data_5E97
# 
_entry.id   5E97 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5E97         
WWPDB D_1000214562 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5E97 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, L.'       1 
'Davies, G.J.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            22 
_citation.language                  ? 
_citation.page_first                1016 
_citation.page_last                 1022 
_citation.title                     'Structural characterization of human heparanase reveals insights into substrate recognition.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nsmb.3136 
_citation.pdbx_database_id_PubMed   26575439 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wu, L.'           1 ? 
primary 'Viola, C.M.'      2 ? 
primary 'Brzozowski, A.M.' 3 ? 
primary 'Davies, G.J.'     4 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   94.91 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5E97 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     45.880 
_cell.length_a_esd                 ? 
_cell.length_b                     70.890 
_cell.length_b_esd                 ? 
_cell.length_c                     78.230 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5E97 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Heparanase 43733.324 1   3.2.1.166 ? 'residues 158-543' ? 
2 polymer     man Heparanase 8542.769  1   3.2.1.166 ? 'residues 36-109'  ? 
3 branched    man 
;2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-beta-D-glucopyranuronic acid-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-beta-D-glucopyranuronic acid
;
776.648   1   ?         ? ?                  ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   4   ?         ? ?                  ? 
5 non-polymer syn 'CHLORIDE ION' 35.453    4   ?         ? ?                  ? 
6 non-polymer syn P-NITROPHENOL 139.109   1   ?         ? ?                  ? 
7 water       nat water 18.015    397 ?         ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 Endo-glucoronidase,Heparanase-1,Hpa1 
2 Endo-glucoronidase,Heparanase-1,Hpa1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DPGKKFKNSTYSRSSVDVLYTFANCSGLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNEPNSFLKKAD
IFINGSQLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYLNGRTATREDFLNPD
VLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFAAGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLV
DENFDPLPDYWLSLLFKKLVGTKVLMASVQGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYPFSNKQ
VDKYLLRPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVAACI
;
;DPGKKFKNSTYSRSSVDVLYTFANCSGLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNEPNSFLKKAD
IFINGSQLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYLNGRTATREDFLNPD
VLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFAAGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLV
DENFDPLPDYWLSLLFKKLVGTKVLMASVQGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYPFSNKQ
VDKYLLRPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVAACI
;
A ? 
2 'polypeptide(L)' no no DPGQDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKE 
DPGQDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKE B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   PRO n 
1 3   GLY n 
1 4   LYS n 
1 5   LYS n 
1 6   PHE n 
1 7   LYS n 
1 8   ASN n 
1 9   SER n 
1 10  THR n 
1 11  TYR n 
1 12  SER n 
1 13  ARG n 
1 14  SER n 
1 15  SER n 
1 16  VAL n 
1 17  ASP n 
1 18  VAL n 
1 19  LEU n 
1 20  TYR n 
1 21  THR n 
1 22  PHE n 
1 23  ALA n 
1 24  ASN n 
1 25  CYS n 
1 26  SER n 
1 27  GLY n 
1 28  LEU n 
1 29  ASP n 
1 30  LEU n 
1 31  ILE n 
1 32  PHE n 
1 33  GLY n 
1 34  LEU n 
1 35  ASN n 
1 36  ALA n 
1 37  LEU n 
1 38  LEU n 
1 39  ARG n 
1 40  THR n 
1 41  ALA n 
1 42  ASP n 
1 43  LEU n 
1 44  GLN n 
1 45  TRP n 
1 46  ASN n 
1 47  SER n 
1 48  SER n 
1 49  ASN n 
1 50  ALA n 
1 51  GLN n 
1 52  LEU n 
1 53  LEU n 
1 54  LEU n 
1 55  ASP n 
1 56  TYR n 
1 57  CYS n 
1 58  SER n 
1 59  SER n 
1 60  LYS n 
1 61  GLY n 
1 62  TYR n 
1 63  ASN n 
1 64  ILE n 
1 65  SER n 
1 66  TRP n 
1 67  GLU n 
1 68  LEU n 
1 69  GLY n 
1 70  ASN n 
1 71  GLU n 
1 72  PRO n 
1 73  ASN n 
1 74  SER n 
1 75  PHE n 
1 76  LEU n 
1 77  LYS n 
1 78  LYS n 
1 79  ALA n 
1 80  ASP n 
1 81  ILE n 
1 82  PHE n 
1 83  ILE n 
1 84  ASN n 
1 85  GLY n 
1 86  SER n 
1 87  GLN n 
1 88  LEU n 
1 89  GLY n 
1 90  GLU n 
1 91  ASP n 
1 92  PHE n 
1 93  ILE n 
1 94  GLN n 
1 95  LEU n 
1 96  HIS n 
1 97  LYS n 
1 98  LEU n 
1 99  LEU n 
1 100 ARG n 
1 101 LYS n 
1 102 SER n 
1 103 THR n 
1 104 PHE n 
1 105 LYS n 
1 106 ASN n 
1 107 ALA n 
1 108 LYS n 
1 109 LEU n 
1 110 TYR n 
1 111 GLY n 
1 112 PRO n 
1 113 ASP n 
1 114 VAL n 
1 115 GLY n 
1 116 GLN n 
1 117 PRO n 
1 118 ARG n 
1 119 ARG n 
1 120 LYS n 
1 121 THR n 
1 122 ALA n 
1 123 LYS n 
1 124 MET n 
1 125 LEU n 
1 126 LYS n 
1 127 SER n 
1 128 PHE n 
1 129 LEU n 
1 130 LYS n 
1 131 ALA n 
1 132 GLY n 
1 133 GLY n 
1 134 GLU n 
1 135 VAL n 
1 136 ILE n 
1 137 ASP n 
1 138 SER n 
1 139 VAL n 
1 140 THR n 
1 141 TRP n 
1 142 HIS n 
1 143 HIS n 
1 144 TYR n 
1 145 TYR n 
1 146 LEU n 
1 147 ASN n 
1 148 GLY n 
1 149 ARG n 
1 150 THR n 
1 151 ALA n 
1 152 THR n 
1 153 ARG n 
1 154 GLU n 
1 155 ASP n 
1 156 PHE n 
1 157 LEU n 
1 158 ASN n 
1 159 PRO n 
1 160 ASP n 
1 161 VAL n 
1 162 LEU n 
1 163 ASP n 
1 164 ILE n 
1 165 PHE n 
1 166 ILE n 
1 167 SER n 
1 168 SER n 
1 169 VAL n 
1 170 GLN n 
1 171 LYS n 
1 172 VAL n 
1 173 PHE n 
1 174 GLN n 
1 175 VAL n 
1 176 VAL n 
1 177 GLU n 
1 178 SER n 
1 179 THR n 
1 180 ARG n 
1 181 PRO n 
1 182 GLY n 
1 183 LYS n 
1 184 LYS n 
1 185 VAL n 
1 186 TRP n 
1 187 LEU n 
1 188 GLY n 
1 189 GLU n 
1 190 THR n 
1 191 SER n 
1 192 SER n 
1 193 ALA n 
1 194 TYR n 
1 195 GLY n 
1 196 GLY n 
1 197 GLY n 
1 198 ALA n 
1 199 PRO n 
1 200 LEU n 
1 201 LEU n 
1 202 SER n 
1 203 ASP n 
1 204 THR n 
1 205 PHE n 
1 206 ALA n 
1 207 ALA n 
1 208 GLY n 
1 209 PHE n 
1 210 MET n 
1 211 TRP n 
1 212 LEU n 
1 213 ASP n 
1 214 LYS n 
1 215 LEU n 
1 216 GLY n 
1 217 LEU n 
1 218 SER n 
1 219 ALA n 
1 220 ARG n 
1 221 MET n 
1 222 GLY n 
1 223 ILE n 
1 224 GLU n 
1 225 VAL n 
1 226 VAL n 
1 227 MET n 
1 228 ARG n 
1 229 GLN n 
1 230 VAL n 
1 231 PHE n 
1 232 PHE n 
1 233 GLY n 
1 234 ALA n 
1 235 GLY n 
1 236 ASN n 
1 237 TYR n 
1 238 HIS n 
1 239 LEU n 
1 240 VAL n 
1 241 ASP n 
1 242 GLU n 
1 243 ASN n 
1 244 PHE n 
1 245 ASP n 
1 246 PRO n 
1 247 LEU n 
1 248 PRO n 
1 249 ASP n 
1 250 TYR n 
1 251 TRP n 
1 252 LEU n 
1 253 SER n 
1 254 LEU n 
1 255 LEU n 
1 256 PHE n 
1 257 LYS n 
1 258 LYS n 
1 259 LEU n 
1 260 VAL n 
1 261 GLY n 
1 262 THR n 
1 263 LYS n 
1 264 VAL n 
1 265 LEU n 
1 266 MET n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 GLN n 
1 271 GLY n 
1 272 SER n 
1 273 LYS n 
1 274 ARG n 
1 275 ARG n 
1 276 LYS n 
1 277 LEU n 
1 278 ARG n 
1 279 VAL n 
1 280 TYR n 
1 281 LEU n 
1 282 HIS n 
1 283 CYS n 
1 284 THR n 
1 285 ASN n 
1 286 THR n 
1 287 ASP n 
1 288 ASN n 
1 289 PRO n 
1 290 ARG n 
1 291 TYR n 
1 292 LYS n 
1 293 GLU n 
1 294 GLY n 
1 295 ASP n 
1 296 LEU n 
1 297 THR n 
1 298 LEU n 
1 299 TYR n 
1 300 ALA n 
1 301 ILE n 
1 302 ASN n 
1 303 LEU n 
1 304 HIS n 
1 305 ASN n 
1 306 VAL n 
1 307 THR n 
1 308 LYS n 
1 309 TYR n 
1 310 LEU n 
1 311 ARG n 
1 312 LEU n 
1 313 PRO n 
1 314 TYR n 
1 315 PRO n 
1 316 PHE n 
1 317 SER n 
1 318 ASN n 
1 319 LYS n 
1 320 GLN n 
1 321 VAL n 
1 322 ASP n 
1 323 LYS n 
1 324 TYR n 
1 325 LEU n 
1 326 LEU n 
1 327 ARG n 
1 328 PRO n 
1 329 LEU n 
1 330 GLY n 
1 331 PRO n 
1 332 HIS n 
1 333 GLY n 
1 334 LEU n 
1 335 LEU n 
1 336 SER n 
1 337 LYS n 
1 338 SER n 
1 339 VAL n 
1 340 GLN n 
1 341 LEU n 
1 342 ASN n 
1 343 GLY n 
1 344 LEU n 
1 345 THR n 
1 346 LEU n 
1 347 LYS n 
1 348 MET n 
1 349 VAL n 
1 350 ASP n 
1 351 ASP n 
1 352 GLN n 
1 353 THR n 
1 354 LEU n 
1 355 PRO n 
1 356 PRO n 
1 357 LEU n 
1 358 MET n 
1 359 GLU n 
1 360 LYS n 
1 361 PRO n 
1 362 LEU n 
1 363 ARG n 
1 364 PRO n 
1 365 GLY n 
1 366 SER n 
1 367 SER n 
1 368 LEU n 
1 369 GLY n 
1 370 LEU n 
1 371 PRO n 
1 372 ALA n 
1 373 PHE n 
1 374 SER n 
1 375 TYR n 
1 376 SER n 
1 377 PHE n 
1 378 PHE n 
1 379 VAL n 
1 380 ILE n 
1 381 ARG n 
1 382 ASN n 
1 383 ALA n 
1 384 LYS n 
1 385 VAL n 
1 386 ALA n 
1 387 ALA n 
1 388 CYS n 
1 389 ILE n 
2 1   ASP n 
2 2   PRO n 
2 3   GLY n 
2 4   GLN n 
2 5   ASP n 
2 6   VAL n 
2 7   VAL n 
2 8   ASP n 
2 9   LEU n 
2 10  ASP n 
2 11  PHE n 
2 12  PHE n 
2 13  THR n 
2 14  GLN n 
2 15  GLU n 
2 16  PRO n 
2 17  LEU n 
2 18  HIS n 
2 19  LEU n 
2 20  VAL n 
2 21  SER n 
2 22  PRO n 
2 23  SER n 
2 24  PHE n 
2 25  LEU n 
2 26  SER n 
2 27  VAL n 
2 28  THR n 
2 29  ILE n 
2 30  ASP n 
2 31  ALA n 
2 32  ASN n 
2 33  LEU n 
2 34  ALA n 
2 35  THR n 
2 36  ASP n 
2 37  PRO n 
2 38  ARG n 
2 39  PHE n 
2 40  LEU n 
2 41  ILE n 
2 42  LEU n 
2 43  LEU n 
2 44  GLY n 
2 45  SER n 
2 46  PRO n 
2 47  LYS n 
2 48  LEU n 
2 49  ARG n 
2 50  THR n 
2 51  LEU n 
2 52  ALA n 
2 53  ARG n 
2 54  GLY n 
2 55  LEU n 
2 56  SER n 
2 57  PRO n 
2 58  ALA n 
2 59  TYR n 
2 60  LEU n 
2 61  ARG n 
2 62  PHE n 
2 63  GLY n 
2 64  GLY n 
2 65  THR n 
2 66  LYS n 
2 67  THR n 
2 68  ASP n 
2 69  PHE n 
2 70  LEU n 
2 71  ILE n 
2 72  PHE n 
2 73  ASP n 
2 74  PRO n 
2 75  LYS n 
2 76  LYS n 
2 77  GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 389 Human ? 'HPSE, HEP, HPA, HPA1, HPR1, HPSE1, HSE1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? 
? ? 'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 77  Human ? 'HPSE, HEP, HPA, HPA1, HPR1, HPSE1, HSE1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? 
? ? 'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP HPSE_HUMAN Q9Y251 ? 1 
;KKFKNSTYSRSSVDVLYTFANCSGLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNEPNSFLKKADIFI
NGSQLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYLNGRTATKEDFLNPDVLD
IFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFAAGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLVDEN
FDPLPDYWLSLLFKKLVGTKVLMASVQGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYPFSNKQVDK
YLLRPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVAACI
;
158 
2 UNP HPSE_HUMAN Q9Y251 ? 2 QDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKE 36  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5E97 A 4 ? 389 ? Q9Y251 158 ? 543 ? 158 543 
2 2 5E97 B 4 ? 77  ? Q9Y251 36  ? 109 ? 36  109 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5E97 ASP A 1   ? UNP Q9Y251 ?   ?   'expression tag' 155 1 
1 5E97 PRO A 2   ? UNP Q9Y251 ?   ?   'expression tag' 156 2 
1 5E97 GLY A 3   ? UNP Q9Y251 ?   ?   'expression tag' 157 3 
1 5E97 ARG A 153 ? UNP Q9Y251 LYS 307 conflict         307 4 
2 5E97 ASP B 1   ? UNP Q9Y251 ?   ?   'expression tag' 33  5 
2 5E97 PRO B 2   ? UNP Q9Y251 ?   ?   'expression tag' 34  6 
2 5E97 GLY B 3   ? UNP Q9Y251 ?   ?   'expression tag' 35  7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                   ?                   'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                  ?                   'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                ?                   'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                           ?                   'C4 H7 N O4'     133.103 
BDP 'D-saccharide, beta linking'  . 'beta-D-glucopyranuronic acid'            'D-GLUCURONIC ACID' 'C6 H10 O7'      194.139 
CL  non-polymer                   . 'CHLORIDE ION'                            ?                   'Cl -1'          35.453  
CYS 'L-peptide linking'           y CYSTEINE                                  ?                   'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                 ?                   'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                           ?                   'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                   ?                   'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                 ?                   'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                     ?                   'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                ?                   'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                   ?                   'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                    ?                   'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                ?                   'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose  ?                   'C8 H15 N O6'    221.208 
NDG 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-glucopyranose ?                   'C8 H15 N O6'    221.208 
NPO non-polymer                   . P-NITROPHENOL                             ?                   'C6 H5 N O3'     139.109 
PHE 'L-peptide linking'           y PHENYLALANINE                             ?                   'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                   ?                   'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                    ?                   'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                 ?                   'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                ?                   'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                  ?                   'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                    ?                   'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5E97 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.32 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.1 M MES [5.5]
0.1 M MgCl2
17% PEG3350
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-08-06 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5E97 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.63 
_reflns.d_resolution_low                 38.42 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       61989 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.Rmerge_I_obs                0.61 
_reflns_shell.d_res_high                  1.64 
_reflns_shell.d_res_low                   1.67 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.percent_possible_obs        ? 
# 
_refine.aniso_B[1][1]                            1.02 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.57 
_refine.aniso_B[2][2]                            -0.28 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -0.82 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               29.499 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.973 
_refine.correlation_coeff_Fo_to_Fc_free          0.961 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5E97 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.63 
_refine.ls_d_res_low                             38.42 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     57972 
_refine.ls_number_reflns_R_free                  3125 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.79 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.16733 
_refine.ls_R_factor_R_free                       0.19677 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.16571 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5e8m 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            'taken from apo structure' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.088 
_refine.pdbx_overall_ESU_R_Free                  0.088 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             2.156 
_refine.overall_SU_ML                            0.070 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        3643 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         122 
_refine_hist.number_atoms_solvent             397 
_refine_hist.number_atoms_total               4162 
_refine_hist.d_res_high                       1.63 
_refine_hist.d_res_low                        38.42 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.014  0.019  3868 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  3707 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.671  2.009  5247 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.974  3.000  8550 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.336  5.000  459  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 37.290 23.500 160  ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 12.524 15.000 649  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.469 15.000 22   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.097  0.200  599  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.008  0.021  4239 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  885  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 2.185  2.600  1839 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.185  2.597  1838 ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 3.328  3.885  2297 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 3.327  3.888  2298 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.905  3.087  2029 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.904  3.090  2030 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.553  4.472  2951 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 6.638  22.540 4619 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 6.637  22.551 4620 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.640 
_refine_ls_shell.d_res_low                        1.683 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             226 
_refine_ls_shell.number_reflns_R_work             4264 
_refine_ls_shell.percent_reflns_obs               99.82 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.338 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.298 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5E97 
_struct.title                        'Glycoside Hydrolase ligand structure 1' 
_struct.pdbx_descriptor              'Heparanase (E.C.3.2.1.166)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5E97 
_struct_keywords.text            'glycoside hydrolase, ligand 1, protein, sugar, hydrolase' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 5 ? 
M N N 7 ? 
N N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 12  ? GLY A 27  ? SER A 166 GLY A 181 1 ? 16 
HELX_P HELX_P2  AA2 SER A 47  ? LYS A 60  ? SER A 201 LYS A 214 1 ? 14 
HELX_P HELX_P3  AA3 GLU A 71  ? ASN A 73  ? GLU A 225 ASN A 227 5 ? 3  
HELX_P HELX_P4  AA4 SER A 74  ? ASP A 80  ? SER A 228 ASP A 234 1 ? 7  
HELX_P HELX_P5  AA5 ASN A 84  ? LYS A 101 ? ASN A 238 LYS A 255 1 ? 18 
HELX_P HELX_P6  AA6 ARG A 118 ? GLY A 133 ? ARG A 272 GLY A 287 1 ? 16 
HELX_P HELX_P7  AA7 GLU A 134 ? ILE A 136 ? GLU A 288 ILE A 290 5 ? 3  
HELX_P HELX_P8  AA8 THR A 152 ? LEU A 157 ? THR A 306 LEU A 311 1 ? 6  
HELX_P HELX_P9  AA9 ASN A 158 ? ASP A 163 ? ASN A 312 ASP A 317 1 ? 6  
HELX_P HELX_P10 AB1 ASP A 163 ? SER A 178 ? ASP A 317 SER A 332 1 ? 16 
HELX_P HELX_P11 AB2 THR A 204 ? ALA A 206 ? THR A 358 ALA A 360 5 ? 3  
HELX_P HELX_P12 AB3 ALA A 207 ? GLY A 222 ? ALA A 361 GLY A 376 1 ? 16 
HELX_P HELX_P13 AB4 LEU A 247 ? LEU A 259 ? LEU A 401 LEU A 413 1 ? 13 
HELX_P HELX_P14 AB5 HIS A 332 ? SER A 336 ? HIS A 486 SER A 490 5 ? 5  
HELX_P HELX_P15 AB6 VAL A 385 ? ILE A 389 ? VAL A 539 ILE A 543 5 ? 5  
HELX_P HELX_P16 AB7 ASN B 32  ? ASP B 36  ? ASN B 64  ASP B 68  5 ? 5  
HELX_P HELX_P17 AB8 ARG B 38  ? SER B 45  ? ARG B 70  SER B 77  1 ? 8  
HELX_P HELX_P18 AB9 SER B 45  ? LEU B 55  ? SER B 77  LEU B 87  1 ? 11 
HELX_P HELX_P19 AC1 GLY B 64  ? ASP B 68  ? GLY B 96  ASP B 100 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 283 SG  ? ? ? 1_555 A CYS 388 SG ? ? A CYS 437 A CYS 542 1_555 ? ? ? ? ? ? ? 2.014 ? ?               
covale1 covale one ? A ASN 8   ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 162 A NAG 601 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale2 covale one ? A ASN 46  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 200 A NAG 602 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale3 covale one ? A ASN 84  ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 238 A NAG 603 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale4 covale one ? A ASN 305 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 459 A NAG 604 1_555 ? ? ? ? ? ? ? 1.471 ? N-Glycosylation 
covale5 covale one ? K NPO .   OH  ? ? ? 1_555 C BDP .   C1 ? ? A NPO 612 C BDP 1   1_555 ? ? ? ? ? ? ? 1.421 ? ?               
covale6 covale one ? C BDP .   O4  ? ? ? 1_555 C NDG .   C1 ? ? C BDP 1   C NDG 2   1_555 ? ? ? ? ? ? ? 1.443 ? ?               
covale7 covale one ? C NDG .   O4  ? ? ? 1_555 C BDP .   C1 ? ? C NDG 2   C BDP 3   1_555 ? ? ? ? ? ? ? 1.418 ? ?               
covale8 covale one ? C BDP .   O4  ? ? ? 1_555 C NDG .   C1 ? ? C BDP 3   C NDG 4   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 111 A . ? GLY 265 A PRO 112 A ? PRO 266 A 1 5.85  
2 GLN 229 A . ? GLN 383 A VAL 230 A ? VAL 384 A 1 -0.76 
3 TYR 314 A . ? TYR 468 A PRO 315 A ? PRO 469 A 1 7.66  
4 GLY 330 A . ? GLY 484 A PRO 331 A ? PRO 485 A 1 10.68 
5 SER 56  B . ? SER 88  B PRO 57  B ? PRO 89  B 1 2.08  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 9 ? 
AA3 ? 4 ? 
AA4 ? 8 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? parallel      
AA2 6 7 ? parallel      
AA2 7 8 ? parallel      
AA2 8 9 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA4 6 7 ? anti-parallel 
AA4 7 8 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? parallel      
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 9   ? TYR A 11  ? SER A 163 TYR A 165 
AA1 2 LEU B 70  ? PHE B 72  ? LEU B 102 PHE B 104 
AA2 1 LEU A 28  ? LEU A 34  ? LEU A 182 LEU A 188 
AA2 2 SER A 65  ? LEU A 68  ? SER A 219 LEU A 222 
AA2 3 LEU A 109 ? VAL A 114 ? LEU A 263 VAL A 268 
AA2 4 SER A 138 ? ASN A 147 ? SER A 292 ASN A 301 
AA2 5 LYS A 184 ? TYR A 194 ? LYS A 338 TYR A 348 
AA2 6 VAL A 225 ? ARG A 228 ? VAL A 379 ARG A 382 
AA2 7 LEU B 25  ? ASP B 30  ? LEU B 57  ASP B 62  
AA2 8 ALA B 58  ? GLY B 63  ? ALA B 90  GLY B 95  
AA2 9 LEU A 28  ? LEU A 34  ? LEU A 182 LEU A 188 
AA3 1 LEU A 344 ? THR A 345 ? LEU A 498 THR A 499 
AA3 2 VAL A 339 ? LEU A 341 ? VAL A 493 LEU A 495 
AA3 3 VAL A 321 ? PRO A 328 ? VAL A 475 PRO A 482 
AA3 4 LYS A 360 ? PRO A 361 ? LYS A 514 PRO A 515 
AA4 1 LEU A 344 ? THR A 345 ? LEU A 498 THR A 499 
AA4 2 VAL A 339 ? LEU A 341 ? VAL A 493 LEU A 495 
AA4 3 VAL A 321 ? PRO A 328 ? VAL A 475 PRO A 482 
AA4 4 SER A 374 ? ILE A 380 ? SER A 528 ILE A 534 
AA4 5 LEU A 296 ? ASN A 302 ? LEU A 450 ASN A 456 
AA4 6 LEU A 277 ? THR A 284 ? LEU A 431 THR A 438 
AA4 7 VAL A 260 ? VAL A 264 ? VAL A 414 VAL A 418 
AA4 8 HIS B 18  ? LEU B 19  ? HIS B 50  LEU B 51  
AA5 1 MET A 266 ? VAL A 269 ? MET A 420 VAL A 423 
AA5 2 VAL B 6   ? PHE B 12  ? VAL B 38  PHE B 44  
AA5 3 LYS A 308 ? ARG A 311 ? LYS A 462 ARG A 465 
AA5 4 LEU A 368 ? LEU A 370 ? LEU A 522 LEU A 524 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 9   ? N SER A 163 O ILE B 71  ? O ILE B 103 
AA2 1 2 N PHE A 32  ? N PHE A 186 O SER A 65  ? O SER A 219 
AA2 2 3 N TRP A 66  ? N TRP A 220 O TYR A 110 ? O TYR A 264 
AA2 3 4 N VAL A 114 ? N VAL A 268 O HIS A 142 ? O HIS A 296 
AA2 4 5 N VAL A 139 ? N VAL A 293 O LYS A 184 ? O LYS A 338 
AA2 5 6 N LEU A 187 ? N LEU A 341 O VAL A 225 ? O VAL A 379 
AA2 6 7 N VAL A 226 ? N VAL A 380 O SER B 26  ? O SER B 58  
AA2 7 8 N ILE B 29  ? N ILE B 61  O ARG B 61  ? O ARG B 93  
AA2 8 9 O PHE B 62  ? O PHE B 94  N ILE A 31  ? N ILE A 185 
AA3 1 2 O LEU A 344 ? O LEU A 498 N LEU A 341 ? N LEU A 495 
AA3 2 3 O GLN A 340 ? O GLN A 494 N ARG A 327 ? N ARG A 481 
AA3 3 4 N LYS A 323 ? N LYS A 477 O LYS A 360 ? O LYS A 514 
AA4 1 2 O LEU A 344 ? O LEU A 498 N LEU A 341 ? N LEU A 495 
AA4 2 3 O GLN A 340 ? O GLN A 494 N ARG A 327 ? N ARG A 481 
AA4 3 4 N TYR A 324 ? N TYR A 478 O PHE A 377 ? O PHE A 531 
AA4 4 5 O SER A 374 ? O SER A 528 N ASN A 302 ? N ASN A 456 
AA4 5 6 O THR A 297 ? O THR A 451 N HIS A 282 ? N HIS A 436 
AA4 6 7 O CYS A 283 ? O CYS A 437 N LYS A 263 ? N LYS A 417 
AA4 7 8 N VAL A 264 ? N VAL A 418 O HIS B 18  ? O HIS B 50  
AA5 1 2 N SER A 268 ? N SER A 422 O ASP B 10  ? O ASP B 42  
AA5 2 3 O VAL B 7   ? O VAL B 39  N TYR A 309 ? N TYR A 463 
AA5 3 4 N LEU A 310 ? N LEU A 464 O LEU A 368 ? O LEU A 522 
# 
_atom_sites.entry_id                    5E97 
_atom_sites.fract_transf_matrix[1][1]   0.021796 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001872 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014106 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012830 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 5   ? -29.388 19.913  50.888 1.00 92.53  ? 159  LYS A N   1 
ATOM   2    C  CA  . LYS A 1 5   ? -28.479 21.099  50.871 1.00 91.94  ? 159  LYS A CA  1 
ATOM   3    C  C   . LYS A 1 5   ? -27.376 21.009  49.809 1.00 86.22  ? 159  LYS A C   1 
ATOM   4    O  O   . LYS A 1 5   ? -27.073 22.007  49.153 1.00 91.83  ? 159  LYS A O   1 
ATOM   5    C  CB  . LYS A 1 5   ? -27.848 21.311  52.254 1.00 95.07  ? 159  LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 5   ? -27.112 22.634  52.386 1.00 95.68  ? 159  LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 5   ? -26.859 23.007  53.833 1.00 96.69  ? 159  LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 5   ? -26.366 24.440  53.926 1.00 98.05  ? 159  LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 5   ? -26.120 24.852  55.333 1.00 102.06 ? 159  LYS A NZ  1 
ATOM   10   N  N   . PHE A 1 6   ? -26.794 19.824  49.630 1.00 79.59  ? 160  PHE A N   1 
ATOM   11   C  CA  . PHE A 1 6   ? -25.547 19.687  48.863 1.00 73.01  ? 160  PHE A CA  1 
ATOM   12   C  C   . PHE A 1 6   ? -25.709 19.632  47.331 1.00 68.36  ? 160  PHE A C   1 
ATOM   13   O  O   . PHE A 1 6   ? -26.388 18.755  46.790 1.00 61.45  ? 160  PHE A O   1 
ATOM   14   C  CB  . PHE A 1 6   ? -24.734 18.507  49.403 1.00 78.06  ? 160  PHE A CB  1 
ATOM   15   C  CG  . PHE A 1 6   ? -24.161 18.769  50.773 1.00 82.04  ? 160  PHE A CG  1 
ATOM   16   C  CD1 . PHE A 1 6   ? -24.915 18.504  51.921 1.00 83.85  ? 160  PHE A CD1 1 
ATOM   17   C  CD2 . PHE A 1 6   ? -22.884 19.335  50.917 1.00 78.84  ? 160  PHE A CD2 1 
ATOM   18   C  CE1 . PHE A 1 6   ? -24.396 18.773  53.185 1.00 86.07  ? 160  PHE A CE1 1 
ATOM   19   C  CE2 . PHE A 1 6   ? -22.363 19.610  52.178 1.00 78.53  ? 160  PHE A CE2 1 
ATOM   20   C  CZ  . PHE A 1 6   ? -23.119 19.327  53.313 1.00 82.76  ? 160  PHE A CZ  1 
ATOM   21   N  N   . LYS A 1 7   ? -25.061 20.583  46.652 1.00 62.33  ? 161  LYS A N   1 
ATOM   22   C  CA  . LYS A 1 7   ? -25.071 20.685  45.189 1.00 59.62  ? 161  LYS A CA  1 
ATOM   23   C  C   . LYS A 1 7   ? -23.708 20.276  44.628 1.00 49.20  ? 161  LYS A C   1 
ATOM   24   O  O   . LYS A 1 7   ? -22.699 20.397  45.320 1.00 42.54  ? 161  LYS A O   1 
ATOM   25   C  CB  . LYS A 1 7   ? -25.428 22.113  44.744 1.00 66.04  ? 161  LYS A CB  1 
ATOM   26   C  CG  . LYS A 1 7   ? -24.463 23.202  45.203 1.00 74.11  ? 161  LYS A CG  1 
ATOM   27   C  CD  . LYS A 1 7   ? -24.703 24.519  44.479 1.00 81.65  ? 161  LYS A CD  1 
ATOM   28   C  CE  . LYS A 1 7   ? -23.581 25.509  44.768 1.00 83.61  ? 161  LYS A CE  1 
ATOM   29   N  NZ  . LYS A 1 7   ? -23.823 26.828  44.120 1.00 87.23  ? 161  LYS A NZ  1 
ATOM   30   N  N   . ASN A 1 8   ? -23.685 19.804  43.385 1.00 42.74  ? 162  ASN A N   1 
ATOM   31   C  CA  . ASN A 1 8   ? -22.438 19.431  42.727 1.00 44.94  ? 162  ASN A CA  1 
ATOM   32   C  C   . ASN A 1 8   ? -21.625 20.638  42.338 1.00 43.48  ? 162  ASN A C   1 
ATOM   33   O  O   . ASN A 1 8   ? -22.185 21.656  41.960 1.00 43.12  ? 162  ASN A O   1 
ATOM   34   C  CB  . ASN A 1 8   ? -22.692 18.604  41.466 1.00 47.41  ? 162  ASN A CB  1 
ATOM   35   C  CG  . ASN A 1 8   ? -23.255 17.228  41.770 1.00 53.49  ? 162  ASN A CG  1 
ATOM   36   O  OD1 . ASN A 1 8   ? -23.017 16.671  42.840 1.00 53.23  ? 162  ASN A OD1 1 
ATOM   37   N  ND2 . ASN A 1 8   ? -24.015 16.678  40.822 1.00 59.42  ? 162  ASN A ND2 1 
ATOM   38   N  N   . SER A 1 9   ? -20.305 20.517  42.449 1.00 38.22  ? 163  SER A N   1 
ATOM   39   C  CA  . SER A 1 9   ? -19.377 21.540  41.998 1.00 40.92  ? 163  SER A CA  1 
ATOM   40   C  C   . SER A 1 9   ? -18.354 20.840  41.146 1.00 37.96  ? 163  SER A C   1 
ATOM   41   O  O   . SER A 1 9   ? -18.178 19.614  41.239 1.00 36.75  ? 163  SER A O   1 
ATOM   42   C  CB  . SER A 1 9   ? -18.650 22.227  43.171 1.00 41.02  ? 163  SER A CB  1 
ATOM   43   O  OG  . SER A 1 9   ? -19.561 22.757  44.111 1.00 47.60  ? 163  SER A OG  1 
ATOM   44   N  N   . THR A 1 10  ? -17.643 21.615  40.337 1.00 36.57  ? 164  THR A N   1 
ATOM   45   C  CA  . THR A 1 10  ? -16.545 21.068  39.565 1.00 34.99  ? 164  THR A CA  1 
ATOM   46   C  C   . THR A 1 10  ? -15.224 21.585  40.091 1.00 34.15  ? 164  THR A C   1 
ATOM   47   O  O   . THR A 1 10  ? -15.165 22.633  40.748 1.00 35.72  ? 164  THR A O   1 
ATOM   48   C  CB  . THR A 1 10  ? -16.662 21.414  38.056 1.00 39.65  ? 164  THR A CB  1 
ATOM   49   O  OG1 . THR A 1 10  ? -16.714 22.833  37.895 1.00 38.12  ? 164  THR A OG1 1 
ATOM   50   C  CG2 . THR A 1 10  ? -17.931 20.786  37.451 1.00 40.52  ? 164  THR A CG2 1 
ATOM   51   N  N   . TYR A 1 11  ? -14.173 20.846  39.795 1.00 35.10  ? 165  TYR A N   1 
ATOM   52   C  CA  . TYR A 1 11  ? -12.816 21.281  40.039 1.00 34.22  ? 165  TYR A CA  1 
ATOM   53   C  C   . TYR A 1 11  ? -11.967 20.991  38.831 1.00 34.82  ? 165  TYR A C   1 
ATOM   54   O  O   . TYR A 1 11  ? -12.240 20.065  38.079 1.00 35.70  ? 165  TYR A O   1 
ATOM   55   C  CB  . TYR A 1 11  ? -12.197 20.587  41.262 1.00 34.25  ? 165  TYR A CB  1 
ATOM   56   C  CG  . TYR A 1 11  ? -12.165 19.069  41.211 1.00 29.11  ? 165  TYR A CG  1 
ATOM   57   C  CD1 . TYR A 1 11  ? -13.285 18.318  41.575 1.00 30.30  ? 165  TYR A CD1 1 
ATOM   58   C  CD2 . TYR A 1 11  ? -11.026 18.388  40.827 1.00 27.04  ? 165  TYR A CD2 1 
ATOM   59   C  CE1 . TYR A 1 11  ? -13.266 16.934  41.531 1.00 26.94  ? 165  TYR A CE1 1 
ATOM   60   C  CE2 . TYR A 1 11  ? -10.990 17.001  40.796 1.00 27.60  ? 165  TYR A CE2 1 
ATOM   61   C  CZ  . TYR A 1 11  ? -12.116 16.275  41.155 1.00 25.62  ? 165  TYR A CZ  1 
ATOM   62   O  OH  . TYR A 1 11  ? -12.128 14.939  41.117 1.00 26.15  ? 165  TYR A OH  1 
ATOM   63   N  N   . SER A 1 12  ? -10.892 21.753  38.713 1.00 35.26  ? 166  SER A N   1 
ATOM   64   C  CA  . SER A 1 12  ? -10.058 21.792  37.514 1.00 38.12  ? 166  SER A CA  1 
ATOM   65   C  C   . SER A 1 12  ? -8.758  21.064  37.715 1.00 38.32  ? 166  SER A C   1 
ATOM   66   O  O   . SER A 1 12  ? -8.419  20.657  38.833 1.00 33.59  ? 166  SER A O   1 
ATOM   67   C  CB  . SER A 1 12  ? -9.741  23.246  37.208 1.00 35.75  ? 166  SER A CB  1 
ATOM   68   O  OG  . SER A 1 12  ? -9.026  23.830  38.290 1.00 35.80  ? 166  SER A OG  1 
ATOM   69   N  N   . ARG A 1 13  ? -8.008  20.930  36.622 1.00 34.64  ? 167  ARG A N   1 
ATOM   70   C  CA  . ARG A 1 13  ? -6.631  20.438  36.653 1.00 33.72  ? 167  ARG A CA  1 
ATOM   71   C  C   . ARG A 1 13  ? -5.762  21.332  37.543 1.00 34.57  ? 167  ARG A C   1 
ATOM   72   O  O   . ARG A 1 13  ? -4.903  20.845  38.290 1.00 31.71  ? 167  ARG A O   1 
ATOM   73   C  CB  . ARG A 1 13  ? -6.039  20.379  35.209 1.00 36.50  ? 167  ARG A CB  1 
ATOM   74   C  CG  . ARG A 1 13  ? -6.560  19.215  34.363 1.00 39.50  ? 167  ARG A CG  1 
ATOM   75   C  CD  . ARG A 1 13  ? -6.246  19.387  32.852 1.00 40.28  ? 167  ARG A CD  1 
ATOM   76   N  NE  . ARG A 1 13  ? -7.048  20.493  32.327 1.00 42.22  ? 167  ARG A NE  1 
ATOM   77   C  CZ  . ARG A 1 13  ? -6.601  21.576  31.679 1.00 49.16  ? 167  ARG A CZ  1 
ATOM   78   N  NH1 . ARG A 1 13  ? -5.314  21.735  31.356 1.00 50.36  ? 167  ARG A NH1 1 
ATOM   79   N  NH2 . ARG A 1 13  ? -7.476  22.512  31.316 1.00 49.98  ? 167  ARG A NH2 1 
ATOM   80   N  N   . SER A 1 14  ? -5.994  22.639  37.465 1.00 36.80  ? 168  SER A N   1 
ATOM   81   C  CA  . SER A 1 14  ? -5.326  23.620  38.318 1.00 37.64  ? 168  SER A CA  1 
ATOM   82   C  C   . SER A 1 14  ? -5.487  23.260  39.810 1.00 36.47  ? 168  SER A C   1 
ATOM   83   O  O   . SER A 1 14  ? -4.521  23.277  40.562 1.00 37.39  ? 168  SER A O   1 
ATOM   84   C  CB  . SER A 1 14  ? -5.903  25.009  38.094 1.00 41.81  ? 168  SER A CB  1 
ATOM   85   O  OG  . SER A 1 14  ? -5.278  25.945  38.969 1.00 47.27  ? 168  SER A OG  1 
ATOM   86   N  N   . SER A 1 15  ? -6.719  22.970  40.197 1.00 34.95  ? 169  SER A N   1 
ATOM   87   C  CA  . SER A 1 15  ? -7.048  22.580  41.585 1.00 34.14  ? 169  SER A CA  1 
ATOM   88   C  C   . SER A 1 15  ? -6.319  21.319  42.024 1.00 33.41  ? 169  SER A C   1 
ATOM   89   O  O   . SER A 1 15  ? -5.714  21.271  43.128 1.00 30.67  ? 169  SER A O   1 
ATOM   90   C  CB  . SER A 1 15  ? -8.554  22.429  41.736 1.00 36.12  ? 169  SER A CB  1 
ATOM   91   O  OG  . SER A 1 15  ? -9.140  23.703  41.564 1.00 39.35  ? 169  SER A OG  1 
ATOM   92   N  N   . VAL A 1 16  ? -6.346  20.321  41.150 1.00 29.08  ? 170  VAL A N   1 
ATOM   93   C  CA  . VAL A 1 16  ? -5.595  19.089  41.355 1.00 29.77  ? 170  VAL A CA  1 
ATOM   94   C  C   . VAL A 1 16  ? -4.122  19.406  41.531 1.00 31.73  ? 170  VAL A C   1 
ATOM   95   O  O   . VAL A 1 16  ? -3.481  18.917  42.462 1.00 29.80  ? 170  VAL A O   1 
ATOM   96   C  CB  . VAL A 1 16  ? -5.813  18.059  40.232 1.00 29.97  ? 170  VAL A CB  1 
ATOM   97   C  CG1 . VAL A 1 16  ? -4.959  16.817  40.463 1.00 29.06  ? 170  VAL A CG1 1 
ATOM   98   C  CG2 . VAL A 1 16  ? -7.282  17.668  40.127 1.00 31.36  ? 170  VAL A CG2 1 
ATOM   99   N  N   . ASP A 1 17  ? -3.581  20.253  40.656 1.00 29.96  ? 171  ASP A N   1 
ATOM   100  C  CA  . ASP A 1 17  ? -2.175  20.659  40.783 1.00 29.68  ? 171  ASP A CA  1 
ATOM   101  C  C   . ASP A 1 17  ? -1.846  21.420  42.073 1.00 28.15  ? 171  ASP A C   1 
ATOM   102  O  O   . ASP A 1 17  ? -0.777  21.246  42.624 1.00 30.36  ? 171  ASP A O   1 
ATOM   103  C  CB  . ASP A 1 17  ? -1.724  21.552  39.579 1.00 31.85  ? 171  ASP A CB  1 
ATOM   104  C  CG  . ASP A 1 17  ? -1.794  20.825  38.208 1.00 34.38  ? 171  ASP A CG  1 
ATOM   105  O  OD1 . ASP A 1 17  ? -1.825  19.576  38.102 1.00 31.99  ? 171  ASP A OD1 1 
ATOM   106  O  OD2 . ASP A 1 17  ? -1.779  21.564  37.194 1.00 37.88  ? 171  ASP A OD2 1 
ATOM   107  N  N   . VAL A 1 18  ? -2.714  22.327  42.467 1.00 30.19  ? 172  VAL A N   1 
ATOM   108  C  CA  . VAL A 1 18  ? -2.560  23.102  43.717 1.00 32.30  ? 172  VAL A CA  1 
ATOM   109  C  C   . VAL A 1 18  ? -2.453  22.111  44.898 1.00 32.69  ? 172  VAL A C   1 
ATOM   110  O  O   . VAL A 1 18  ? -1.539  22.183  45.712 1.00 30.03  ? 172  VAL A O   1 
ATOM   111  C  CB  . VAL A 1 18  ? -3.755  24.062  43.905 1.00 36.69  ? 172  VAL A CB  1 
ATOM   112  C  CG1 . VAL A 1 18  ? -3.895  24.579  45.333 1.00 36.58  ? 172  VAL A CG1 1 
ATOM   113  C  CG2 . VAL A 1 18  ? -3.639  25.236  42.916 1.00 38.97  ? 172  VAL A CG2 1 
ATOM   114  N  N   . LEU A 1 19  ? -3.380  21.171  44.932 1.00 31.79  ? 173  LEU A N   1 
ATOM   115  C  CA  . LEU A 1 19  ? -3.440  20.186  46.021 1.00 29.93  ? 173  LEU A CA  1 
ATOM   116  C  C   . LEU A 1 19  ? -2.202  19.291  46.054 1.00 30.59  ? 173  LEU A C   1 
ATOM   117  O  O   . LEU A 1 19  ? -1.584  19.118  47.119 1.00 28.19  ? 173  LEU A O   1 
ATOM   118  C  CB  . LEU A 1 19  ? -4.702  19.365  45.869 1.00 31.58  ? 173  LEU A CB  1 
ATOM   119  C  CG  . LEU A 1 19  ? -5.006  18.282  46.905 1.00 30.92  ? 173  LEU A CG  1 
ATOM   120  C  CD1 . LEU A 1 19  ? -5.186  18.934  48.273 1.00 31.14  ? 173  LEU A CD1 1 
ATOM   121  C  CD2 . LEU A 1 19  ? -6.219  17.493  46.419 1.00 30.88  ? 173  LEU A CD2 1 
ATOM   122  N  N   . TYR A 1 20  ? -1.830  18.732  44.896 1.00 28.05  ? 174  TYR A N   1 
ATOM   123  C  CA  . TYR A 1 20  ? -0.669  17.886  44.816 1.00 26.90  ? 174  TYR A CA  1 
ATOM   124  C  C   . TYR A 1 20  ? 0.618   18.621  45.162 1.00 27.32  ? 174  TYR A C   1 
ATOM   125  O  O   . TYR A 1 20  ? 1.459   18.068  45.863 1.00 29.23  ? 174  TYR A O   1 
ATOM   126  C  CB  . TYR A 1 20  ? -0.520  17.226  43.431 1.00 26.99  ? 174  TYR A CB  1 
ATOM   127  C  CG  . TYR A 1 20  ? 0.558   16.204  43.445 1.00 29.93  ? 174  TYR A CG  1 
ATOM   128  C  CD1 . TYR A 1 20  ? 0.307   14.919  43.926 1.00 30.86  ? 174  TYR A CD1 1 
ATOM   129  C  CD2 . TYR A 1 20  ? 1.856   16.515  43.024 1.00 31.27  ? 174  TYR A CD2 1 
ATOM   130  C  CE1 . TYR A 1 20  ? 1.296   13.963  43.958 1.00 33.59  ? 174  TYR A CE1 1 
ATOM   131  C  CE2 . TYR A 1 20  ? 2.853   15.572  43.078 1.00 33.56  ? 174  TYR A CE2 1 
ATOM   132  C  CZ  . TYR A 1 20  ? 2.567   14.300  43.536 1.00 35.17  ? 174  TYR A CZ  1 
ATOM   133  O  OH  . TYR A 1 20  ? 3.538   13.347  43.565 1.00 36.65  ? 174  TYR A OH  1 
ATOM   134  N  N   . THR A 1 21  ? 0.805   19.832  44.642 1.00 28.84  ? 175  THR A N   1 
ATOM   135  C  CA  . THR A 1 21  ? 2.056   20.545  44.888 1.00 31.40  ? 175  THR A CA  1 
ATOM   136  C  C   . THR A 1 21  ? 2.169   20.950  46.349 1.00 30.90  ? 175  THR A C   1 
ATOM   137  O  O   . THR A 1 21  ? 3.264   20.963  46.893 1.00 29.44  ? 175  THR A O   1 
ATOM   138  C  CB  . THR A 1 21  ? 2.251   21.776  43.980 1.00 32.97  ? 175  THR A CB  1 
ATOM   139  O  OG1 . THR A 1 21  ? 1.174   22.704  44.128 1.00 36.58  ? 175  THR A OG1 1 
ATOM   140  C  CG2 . THR A 1 21  ? 2.295   21.327  42.538 1.00 34.57  ? 175  THR A CG2 1 
ATOM   141  N  N   . PHE A 1 22  ? 1.031   21.271  46.956 1.00 29.50  ? 176  PHE A N   1 
ATOM   142  C  CA  . PHE A 1 22  ? 0.997   21.536  48.394 1.00 27.67  ? 176  PHE A CA  1 
ATOM   143  C  C   . PHE A 1 22  ? 1.492   20.312  49.153 1.00 26.42  ? 176  PHE A C   1 
ATOM   144  O  O   . PHE A 1 22  ? 2.369   20.418  49.988 1.00 25.95  ? 176  PHE A O   1 
ATOM   145  C  CB  . PHE A 1 22  ? -0.399  21.935  48.848 1.00 26.35  ? 176  PHE A CB  1 
ATOM   146  C  CG  . PHE A 1 22  ? -0.500  22.093  50.346 1.00 26.93  ? 176  PHE A CG  1 
ATOM   147  C  CD1 . PHE A 1 22  ? 0.013   23.208  50.956 1.00 26.49  ? 176  PHE A CD1 1 
ATOM   148  C  CD2 . PHE A 1 22  ? -1.039  21.089  51.131 1.00 27.13  ? 176  PHE A CD2 1 
ATOM   149  C  CE1 . PHE A 1 22  ? -0.021  23.354  52.329 1.00 28.06  ? 176  PHE A CE1 1 
ATOM   150  C  CE2 . PHE A 1 22  ? -1.095  21.241  52.517 1.00 26.68  ? 176  PHE A CE2 1 
ATOM   151  C  CZ  . PHE A 1 22  ? -0.571  22.360  53.099 1.00 27.99  ? 176  PHE A CZ  1 
ATOM   152  N  N   . ALA A 1 23  ? 0.942   19.131  48.849 1.00 28.11  ? 177  ALA A N   1 
ATOM   153  C  CA  . ALA A 1 23  ? 1.360   17.906  49.524 1.00 30.47  ? 177  ALA A CA  1 
ATOM   154  C  C   . ALA A 1 23  ? 2.815   17.562  49.222 1.00 34.35  ? 177  ALA A C   1 
ATOM   155  O  O   . ALA A 1 23  ? 3.636   17.345  50.139 1.00 28.56  ? 177  ALA A O   1 
ATOM   156  C  CB  . ALA A 1 23  ? 0.446   16.762  49.124 1.00 30.99  ? 177  ALA A CB  1 
ATOM   157  N  N   . ASN A 1 24  ? 3.147   17.543  47.932 1.00 34.35  ? 178  ASN A N   1 
ATOM   158  C  CA  . ASN A 1 24  ? 4.501   17.208  47.538 1.00 37.87  ? 178  ASN A CA  1 
ATOM   159  C  C   . ASN A 1 24  ? 5.546   18.172  48.120 1.00 33.52  ? 178  ASN A C   1 
ATOM   160  O  O   . ASN A 1 24  ? 6.525   17.699  48.696 1.00 38.95  ? 178  ASN A O   1 
ATOM   161  C  CB  . ASN A 1 24  ? 4.639   17.052  46.018 1.00 41.99  ? 178  ASN A CB  1 
ATOM   162  C  CG  . ASN A 1 24  ? 5.726   16.039  45.646 1.00 47.95  ? 178  ASN A CG  1 
ATOM   163  O  OD1 . ASN A 1 24  ? 5.613   14.835  45.946 1.00 50.96  ? 178  ASN A OD1 1 
ATOM   164  N  ND2 . ASN A 1 24  ? 6.797   16.522  45.037 1.00 49.63  ? 178  ASN A ND2 1 
ATOM   165  N  N   . CYS A 1 25  ? 5.322   19.489  48.027 1.00 39.10  ? 179  CYS A N   1 
ATOM   166  C  CA  . CYS A 1 25  ? 6.266   20.510  48.595 1.00 41.46  ? 179  CYS A CA  1 
ATOM   167  C  C   . CYS A 1 25  ? 6.372   20.445  50.129 1.00 40.25  ? 179  CYS A C   1 
ATOM   168  O  O   . CYS A 1 25  ? 7.346   20.935  50.732 1.00 36.90  ? 179  CYS A O   1 
ATOM   169  C  CB  . CYS A 1 25  ? 5.882   21.954  48.216 1.00 42.76  ? 179  CYS A CB  1 
ATOM   170  S  SG  . CYS A 1 25  ? 6.132   22.460  46.477 0.83 47.73  ? 179  CYS A SG  1 
ATOM   171  N  N   . SER A 1 26  ? 5.345   19.884  50.759 1.00 35.07  ? 180  SER A N   1 
ATOM   172  C  CA  . SER A 1 26  ? 5.301   19.779  52.224 1.00 34.78  ? 180  SER A CA  1 
ATOM   173  C  C   . SER A 1 26  ? 5.778   18.433  52.763 1.00 30.88  ? 180  SER A C   1 
ATOM   174  O  O   . SER A 1 26  ? 5.809   18.238  53.978 1.00 32.86  ? 180  SER A O   1 
ATOM   175  C  CB  . SER A 1 26  ? 3.889   20.060  52.694 1.00 33.77  ? 180  SER A CB  1 
ATOM   176  O  OG  . SER A 1 26  ? 3.503   21.360  52.281 1.00 36.51  ? 180  SER A OG  1 
ATOM   177  N  N   . GLY A 1 27  ? 6.132   17.499  51.886 1.00 29.92  ? 181  GLY A N   1 
ATOM   178  C  CA  . GLY A 1 27  ? 6.601   16.188  52.273 1.00 26.20  ? 181  GLY A CA  1 
ATOM   179  C  C   . GLY A 1 27  ? 5.454   15.305  52.799 1.00 27.18  ? 181  GLY A C   1 
ATOM   180  O  O   . GLY A 1 27  ? 5.662   14.444  53.645 1.00 26.55  ? 181  GLY A O   1 
ATOM   181  N  N   . LEU A 1 28  ? 4.244   15.589  52.334 1.00 25.52  ? 182  LEU A N   1 
ATOM   182  C  CA  . LEU A 1 28  ? 3.069   14.826  52.736 1.00 26.05  ? 182  LEU A CA  1 
ATOM   183  C  C   . LEU A 1 28  ? 2.609   13.910  51.607 1.00 27.53  ? 182  LEU A C   1 
ATOM   184  O  O   . LEU A 1 28  ? 2.877   14.191  50.431 1.00 28.05  ? 182  LEU A O   1 
ATOM   185  C  CB  . LEU A 1 28  ? 1.976   15.773  53.114 1.00 25.78  ? 182  LEU A CB  1 
ATOM   186  C  CG  . LEU A 1 28  ? 2.365   16.851  54.134 1.00 25.74  ? 182  LEU A CG  1 
ATOM   187  C  CD1 . LEU A 1 28  ? 1.174   17.751  54.373 1.00 27.03  ? 182  LEU A CD1 1 
ATOM   188  C  CD2 . LEU A 1 28  ? 2.878   16.193  55.427 1.00 27.42  ? 182  LEU A CD2 1 
ATOM   189  N  N   . ASP A 1 29  ? 1.912   12.828  51.959 1.00 24.29  ? 183  ASP A N   1 
ATOM   190  C  CA  . ASP A 1 29  ? 1.471   11.823  50.973 1.00 24.32  ? 183  ASP A CA  1 
ATOM   191  C  C   . ASP A 1 29  ? -0.024  11.987  50.755 1.00 25.25  ? 183  ASP A C   1 
ATOM   192  O  O   . ASP A 1 29  ? -0.773  11.834  51.688 1.00 21.27  ? 183  ASP A O   1 
ATOM   193  C  CB  . ASP A 1 29  ? 1.798   10.424  51.466 1.00 23.80  ? 183  ASP A CB  1 
ATOM   194  C  CG  . ASP A 1 29  ? 3.279   10.219  51.659 1.00 29.11  ? 183  ASP A CG  1 
ATOM   195  O  OD1 . ASP A 1 29  ? 4.041   10.322  50.683 1.00 28.41  ? 183  ASP A OD1 1 
ATOM   196  O  OD2 . ASP A 1 29  ? 3.706   9.948   52.770 1.00 28.24  ? 183  ASP A OD2 1 
ATOM   197  N  N   . LEU A 1 30  ? -0.433  12.398  49.549 1.00 22.68  ? 184  LEU A N   1 
ATOM   198  C  CA  . LEU A 1 30  ? -1.810  12.720  49.266 1.00 24.56  ? 184  LEU A CA  1 
ATOM   199  C  C   . LEU A 1 30  ? -2.707  11.510  49.106 1.00 24.04  ? 184  LEU A C   1 
ATOM   200  O  O   . LEU A 1 30  ? -2.374  10.560  48.389 1.00 22.90  ? 184  LEU A O   1 
ATOM   201  C  CB  . LEU A 1 30  ? -1.881  13.509  47.926 1.00 24.73  ? 184  LEU A CB  1 
ATOM   202  C  CG  . LEU A 1 30  ? -3.256  14.066  47.573 1.00 25.73  ? 184  LEU A CG  1 
ATOM   203  C  CD1 . LEU A 1 30  ? -3.824  15.017  48.611 1.00 25.12  ? 184  LEU A CD1 1 
ATOM   204  C  CD2 . LEU A 1 30  ? -3.165  14.824  46.258 1.00 26.22  ? 184  LEU A CD2 1 
ATOM   205  N  N   . ILE A 1 31  ? -3.844  11.541  49.817 1.00 21.64  ? 185  ILE A N   1 
ATOM   206  C  CA  . ILE A 1 31  ? -4.935  10.586  49.654 1.00 21.68  ? 185  ILE A CA  1 
ATOM   207  C  C   . ILE A 1 31  ? -6.094  11.386  49.101 1.00 21.53  ? 185  ILE A C   1 
ATOM   208  O  O   . ILE A 1 31  ? -6.500  12.380  49.694 1.00 21.06  ? 185  ILE A O   1 
ATOM   209  C  CB  . ILE A 1 31  ? -5.349  9.878   50.984 1.00 21.04  ? 185  ILE A CB  1 
ATOM   210  C  CG1 . ILE A 1 31  ? -4.164  9.167   51.611 1.00 20.10  ? 185  ILE A CG1 1 
ATOM   211  C  CG2 . ILE A 1 31  ? -6.539  8.955   50.694 1.00 20.64  ? 185  ILE A CG2 1 
ATOM   212  C  CD1 . ILE A 1 31  ? -4.466  8.632   52.999 1.00 20.22  ? 185  ILE A CD1 1 
ATOM   213  N  N   . PHE A 1 32  ? -6.627  10.974  47.955 1.00 22.09  ? 186  PHE A N   1 
ATOM   214  C  CA  . PHE A 1 32  ? -7.702  11.699  47.285 1.00 22.45  ? 186  PHE A CA  1 
ATOM   215  C  C   . PHE A 1 32  ? -9.007  10.942  47.267 1.00 22.44  ? 186  PHE A C   1 
ATOM   216  O  O   . PHE A 1 32  ? -9.104  9.854   46.715 1.00 22.26  ? 186  PHE A O   1 
ATOM   217  C  CB  . PHE A 1 32  ? -7.242  12.044  45.856 1.00 24.33  ? 186  PHE A CB  1 
ATOM   218  C  CG  . PHE A 1 32  ? -8.119  13.050  45.154 1.00 22.71  ? 186  PHE A CG  1 
ATOM   219  C  CD1 . PHE A 1 32  ? -9.366  12.694  44.668 1.00 23.69  ? 186  PHE A CD1 1 
ATOM   220  C  CD2 . PHE A 1 32  ? -7.683  14.363  44.989 1.00 22.96  ? 186  PHE A CD2 1 
ATOM   221  C  CE1 . PHE A 1 32  ? -10.185 13.626  44.031 1.00 24.16  ? 186  PHE A CE1 1 
ATOM   222  C  CE2 . PHE A 1 32  ? -8.479  15.294  44.342 1.00 24.23  ? 186  PHE A CE2 1 
ATOM   223  C  CZ  . PHE A 1 32  ? -9.739  14.924  43.861 1.00 23.88  ? 186  PHE A CZ  1 
ATOM   224  N  N   . GLY A 1 33  ? -10.044 11.507  47.857 1.00 23.37  ? 187  GLY A N   1 
ATOM   225  C  CA  . GLY A 1 33  ? -11.339 10.853  47.864 1.00 21.73  ? 187  GLY A CA  1 
ATOM   226  C  C   . GLY A 1 33  ? -12.128 11.115  46.580 1.00 23.05  ? 187  GLY A C   1 
ATOM   227  O  O   . GLY A 1 33  ? -12.441 12.273  46.266 1.00 22.11  ? 187  GLY A O   1 
ATOM   228  N  N   . LEU A 1 34  ? -12.491 10.024  45.916 1.00 22.98  ? 188  LEU A N   1 
ATOM   229  C  CA  . LEU A 1 34  ? -13.311 10.077  44.705 1.00 24.39  ? 188  LEU A CA  1 
ATOM   230  C  C   . LEU A 1 34  ? -14.794 10.132  45.021 1.00 25.44  ? 188  LEU A C   1 
ATOM   231  O  O   . LEU A 1 34  ? -15.293 9.603   46.045 1.00 25.58  ? 188  LEU A O   1 
ATOM   232  C  CB  . LEU A 1 34  ? -12.983 8.892   43.798 1.00 24.30  ? 188  LEU A CB  1 
ATOM   233  C  CG  . LEU A 1 34  ? -11.538 8.896   43.269 1.00 26.72  ? 188  LEU A CG  1 
ATOM   234  C  CD1 . LEU A 1 34  ? -11.127 7.533   42.737 1.00 28.22  ? 188  LEU A CD1 1 
ATOM   235  C  CD2 . LEU A 1 34  ? -11.337 10.004  42.226 1.00 27.87  ? 188  LEU A CD2 1 
ATOM   236  N  N   . ASN A 1 35  ? -15.533 10.764  44.119 1.00 24.46  ? 189  ASN A N   1 
ATOM   237  C  CA  . ASN A 1 35  ? -16.997 10.836  44.214 1.00 24.83  ? 189  ASN A CA  1 
ATOM   238  C  C   . ASN A 1 35  ? -17.682 9.489   44.011 1.00 27.47  ? 189  ASN A C   1 
ATOM   239  O  O   . ASN A 1 35  ? -17.696 8.921   42.877 1.00 26.64  ? 189  ASN A O   1 
ATOM   240  C  CB  . ASN A 1 35  ? -17.471 11.860  43.161 1.00 26.29  ? 189  ASN A CB  1 
ATOM   241  C  CG  . ASN A 1 35  ? -18.931 12.190  43.264 1.00 25.39  ? 189  ASN A CG  1 
ATOM   242  O  OD1 . ASN A 1 35  ? -19.748 11.394  43.719 1.00 26.24  ? 189  ASN A OD1 1 
ATOM   243  N  ND2 . ASN A 1 35  ? -19.283 13.394  42.799 1.00 27.69  ? 189  ASN A ND2 1 
ATOM   244  N  N   . ALA A 1 36  ? -18.309 8.976   45.066 1.00 23.61  ? 190  ALA A N   1 
ATOM   245  C  CA  . ALA A 1 36  ? -19.007 7.702   45.010 1.00 26.91  ? 190  ALA A CA  1 
ATOM   246  C  C   . ALA A 1 36  ? -20.483 7.804   44.604 1.00 26.21  ? 190  ALA A C   1 
ATOM   247  O  O   . ALA A 1 36  ? -21.143 6.774   44.473 1.00 27.33  ? 190  ALA A O   1 
ATOM   248  C  CB  . ALA A 1 36  ? -18.878 6.980   46.344 1.00 26.87  ? 190  ALA A CB  1 
ATOM   249  N  N   . LEU A 1 37  ? -20.991 9.023   44.437 1.00 27.11  ? 191  LEU A N   1 
ATOM   250  C  CA  . LEU A 1 37  ? -22.416 9.250   44.136 1.00 28.53  ? 191  LEU A CA  1 
ATOM   251  C  C   . LEU A 1 37  ? -22.697 9.359   42.629 1.00 31.32  ? 191  LEU A C   1 
ATOM   252  O  O   . LEU A 1 37  ? -23.842 9.584   42.244 1.00 35.51  ? 191  LEU A O   1 
ATOM   253  C  CB  . LEU A 1 37  ? -22.974 10.454  44.880 1.00 29.65  ? 191  LEU A CB  1 
ATOM   254  C  CG  . LEU A 1 37  ? -23.290 10.203  46.372 1.00 30.09  ? 191  LEU A CG  1 
ATOM   255  C  CD1 . LEU A 1 37  ? -23.793 11.472  47.005 1.00 31.51  ? 191  LEU A CD1 1 
ATOM   256  C  CD2 . LEU A 1 37  ? -24.299 9.082   46.602 1.00 33.38  ? 191  LEU A CD2 1 
ATOM   257  N  N   . LEU A 1 38  ? -21.674 9.143   41.819 1.00 31.11  ? 192  LEU A N   1 
ATOM   258  C  CA  . LEU A 1 38  ? -21.808 9.049   40.359 1.00 30.58  ? 192  LEU A CA  1 
ATOM   259  C  C   . LEU A 1 38  ? -22.208 7.613   40.084 1.00 32.20  ? 192  LEU A C   1 
ATOM   260  O  O   . LEU A 1 38  ? -21.452 6.681   40.342 1.00 31.25  ? 192  LEU A O   1 
ATOM   261  C  CB  . LEU A 1 38  ? -20.509 9.419   39.684 1.00 30.79  ? 192  LEU A CB  1 
ATOM   262  C  CG  . LEU A 1 38  ? -20.011 10.828  39.997 1.00 30.50  ? 192  LEU A CG  1 
ATOM   263  C  CD1 . LEU A 1 38  ? -18.740 11.146  39.242 1.00 29.54  ? 192  LEU A CD1 1 
ATOM   264  C  CD2 . LEU A 1 38  ? -21.045 11.906  39.728 1.00 33.62  ? 192  LEU A CD2 1 
ATOM   265  N  N   . ARG A 1 39  ? -23.450 7.448   39.626 1.00 32.97  ? 193  ARG A N   1 
ATOM   266  C  CA  . ARG A 1 39  ? -24.118 6.166   39.588 1.00 34.75  ? 193  ARG A CA  1 
ATOM   267  C  C   . ARG A 1 39  ? -24.755 5.883   38.225 1.00 38.93  ? 193  ARG A C   1 
ATOM   268  O  O   . ARG A 1 39  ? -25.314 6.790   37.590 1.00 41.89  ? 193  ARG A O   1 
ATOM   269  C  CB  . ARG A 1 39  ? -25.193 6.125   40.675 1.00 33.63  ? 193  ARG A CB  1 
ATOM   270  C  CG  . ARG A 1 39  ? -24.619 6.084   42.100 1.00 34.13  ? 193  ARG A CG  1 
ATOM   271  C  CD  . ARG A 1 39  ? -24.048 4.704   42.395 1.00 33.29  ? 193  ARG A CD  1 
ATOM   272  N  NE  . ARG A 1 39  ? -22.938 4.728   43.343 1.00 37.34  ? 193  ARG A NE  1 
ATOM   273  C  CZ  . ARG A 1 39  ? -22.360 3.648   43.857 1.00 36.97  ? 193  ARG A CZ  1 
ATOM   274  N  NH1 . ARG A 1 39  ? -22.780 2.420   43.541 1.00 35.42  ? 193  ARG A NH1 1 
ATOM   275  N  NH2 . ARG A 1 39  ? -21.328 3.795   44.701 1.00 37.63  ? 193  ARG A NH2 1 
ATOM   276  N  N   . THR A 1 40  ? -24.688 4.632   37.801 1.00 39.47  ? 194  THR A N   1 
ATOM   277  C  CA  . THR A 1 40  ? -25.420 4.195   36.601 1.00 43.26  ? 194  THR A CA  1 
ATOM   278  C  C   . THR A 1 40  ? -26.897 3.998   36.949 1.00 43.99  ? 194  THR A C   1 
ATOM   279  O  O   . THR A 1 40  ? -27.267 3.966   38.120 1.00 42.18  ? 194  THR A O   1 
ATOM   280  C  CB  . THR A 1 40  ? -24.863 2.880   36.061 1.00 41.84  ? 194  THR A CB  1 
ATOM   281  O  OG1 . THR A 1 40  ? -25.136 1.833   36.993 1.00 45.88  ? 194  THR A OG1 1 
ATOM   282  C  CG2 . THR A 1 40  ? -23.367 2.953   35.821 1.00 44.39  ? 194  THR A CG2 1 
ATOM   283  N  N   . ALA A 1 41  ? -27.743 3.848   35.925 1.00 50.78  ? 195  ALA A N   1 
ATOM   284  C  CA  . ALA A 1 41  ? -29.188 3.585   36.105 1.00 54.41  ? 195  ALA A CA  1 
ATOM   285  C  C   . ALA A 1 41  ? -29.520 2.570   37.214 1.00 56.36  ? 195  ALA A C   1 
ATOM   286  O  O   . ALA A 1 41  ? -30.406 2.813   38.030 1.00 63.48  ? 195  ALA A O   1 
ATOM   287  C  CB  . ALA A 1 41  ? -29.802 3.129   34.783 1.00 56.99  ? 195  ALA A CB  1 
ATOM   288  N  N   . ASP A 1 42  ? -28.775 1.469   37.269 1.00 57.81  ? 196  ASP A N   1 
ATOM   289  C  CA  . ASP A 1 42  ? -28.990 0.406   38.274 1.00 55.61  ? 196  ASP A CA  1 
ATOM   290  C  C   . ASP A 1 42  ? -28.101 0.503   39.545 1.00 54.33  ? 196  ASP A C   1 
ATOM   291  O  O   . ASP A 1 42  ? -27.753 -0.508  40.137 1.00 51.40  ? 196  ASP A O   1 
ATOM   292  C  CB  . ASP A 1 42  ? -28.833 -0.962  37.600 1.00 59.58  ? 196  ASP A CB  1 
ATOM   293  C  CG  . ASP A 1 42  ? -27.467 -1.156  36.977 1.00 60.25  ? 196  ASP A CG  1 
ATOM   294  O  OD1 . ASP A 1 42  ? -26.683 -0.188  36.922 1.00 66.16  ? 196  ASP A OD1 1 
ATOM   295  O  OD2 . ASP A 1 42  ? -27.176 -2.279  36.536 1.00 61.86  ? 196  ASP A OD2 1 
ATOM   296  N  N   . LEU A 1 43  ? -27.759 1.725   39.959 1.00 54.28  ? 197  LEU A N   1 
ATOM   297  C  CA  . LEU A 1 43  ? -26.957 1.986   41.170 1.00 50.01  ? 197  LEU A CA  1 
ATOM   298  C  C   . LEU A 1 43  ? -25.533 1.373   41.233 1.00 47.02  ? 197  LEU A C   1 
ATOM   299  O  O   . LEU A 1 43  ? -24.979 1.230   42.332 1.00 41.24  ? 197  LEU A O   1 
ATOM   300  C  CB  . LEU A 1 43  ? -27.781 1.649   42.438 1.00 52.91  ? 197  LEU A CB  1 
ATOM   301  C  CG  . LEU A 1 43  ? -28.610 2.787   43.069 1.00 57.97  ? 197  LEU A CG  1 
ATOM   302  C  CD1 . LEU A 1 43  ? -29.291 3.676   42.031 1.00 60.31  ? 197  LEU A CD1 1 
ATOM   303  C  CD2 . LEU A 1 43  ? -29.634 2.226   44.055 1.00 56.94  ? 197  LEU A CD2 1 
ATOM   304  N  N   . GLN A 1 44  ? -24.924 1.061   40.083 1.00 39.94  ? 198  GLN A N   1 
ATOM   305  C  CA  . GLN A 1 44  ? -23.490 0.731   40.044 1.00 39.77  ? 198  GLN A CA  1 
ATOM   306  C  C   . GLN A 1 44  ? -22.682 2.016   40.037 1.00 34.47  ? 198  GLN A C   1 
ATOM   307  O  O   . GLN A 1 44  ? -23.138 3.045   39.526 1.00 32.59  ? 198  GLN A O   1 
ATOM   308  C  CB  . GLN A 1 44  ? -23.146 -0.123  38.821 1.00 42.01  ? 198  GLN A CB  1 
ATOM   309  C  CG  . GLN A 1 44  ? -23.697 -1.547  38.898 1.00 47.09  ? 198  GLN A CG  1 
ATOM   310  C  CD  . GLN A 1 44  ? -22.715 -2.540  39.532 1.00 49.28  ? 198  GLN A CD  1 
ATOM   311  O  OE1 . GLN A 1 44  ? -23.058 -3.286  40.438 1.00 47.54  ? 198  GLN A OE1 1 
ATOM   312  N  NE2 . GLN A 1 44  ? -21.487 -2.559  39.032 1.00 55.50  ? 198  GLN A NE2 1 
ATOM   313  N  N   . TRP A 1 45  ? -21.462 1.983   40.571 1.00 30.92  ? 199  TRP A N   1 
ATOM   314  C  CA  . TRP A 1 45  ? -20.631 3.187   40.511 1.00 31.29  ? 199  TRP A CA  1 
ATOM   315  C  C   . TRP A 1 45  ? -20.251 3.422   39.050 1.00 32.30  ? 199  TRP A C   1 
ATOM   316  O  O   . TRP A 1 45  ? -19.830 2.487   38.351 1.00 33.59  ? 199  TRP A O   1 
ATOM   317  C  CB  . TRP A 1 45  ? -19.414 3.101   41.455 1.00 30.21  ? 199  TRP A CB  1 
ATOM   318  C  CG  . TRP A 1 45  ? -18.434 4.280   41.398 1.00 26.94  ? 199  TRP A CG  1 
ATOM   319  C  CD1 . TRP A 1 45  ? -18.695 5.573   41.686 1.00 26.77  ? 199  TRP A CD1 1 
ATOM   320  C  CD2 . TRP A 1 45  ? -17.057 4.212   41.068 1.00 24.94  ? 199  TRP A CD2 1 
ATOM   321  N  NE1 . TRP A 1 45  ? -17.569 6.320   41.539 1.00 25.55  ? 199  TRP A NE1 1 
ATOM   322  C  CE2 . TRP A 1 45  ? -16.543 5.503   41.152 1.00 23.47  ? 199  TRP A CE2 1 
ATOM   323  C  CE3 . TRP A 1 45  ? -16.194 3.167   40.718 1.00 27.02  ? 199  TRP A CE3 1 
ATOM   324  C  CZ2 . TRP A 1 45  ? -15.192 5.800   40.868 1.00 24.86  ? 199  TRP A CZ2 1 
ATOM   325  C  CZ3 . TRP A 1 45  ? -14.870 3.456   40.418 1.00 26.45  ? 199  TRP A CZ3 1 
ATOM   326  C  CH2 . TRP A 1 45  ? -14.371 4.757   40.542 1.00 26.02  ? 199  TRP A CH2 1 
ATOM   327  N  N   . ASN A 1 46  ? -20.463 4.649   38.595 1.00 31.94  ? 200  ASN A N   1 
ATOM   328  C  CA  . ASN A 1 46  ? -19.981 5.098   37.293 1.00 32.43  ? 200  ASN A CA  1 
ATOM   329  C  C   . ASN A 1 46  ? -18.595 5.690   37.446 1.00 29.55  ? 200  ASN A C   1 
ATOM   330  O  O   . ASN A 1 46  ? -18.417 6.801   37.935 1.00 30.55  ? 200  ASN A O   1 
ATOM   331  C  CB  . ASN A 1 46  ? -20.980 6.078   36.667 1.00 35.46  ? 200  ASN A CB  1 
ATOM   332  C  CG  . ASN A 1 46  ? -20.573 6.543   35.276 1.00 35.55  ? 200  ASN A CG  1 
ATOM   333  O  OD1 . ASN A 1 46  ? -19.420 6.378   34.856 1.00 33.46  ? 200  ASN A OD1 1 
ATOM   334  N  ND2 . ASN A 1 46  ? -21.522 7.153   34.568 1.00 40.75  ? 200  ASN A ND2 1 
ATOM   335  N  N   . SER A 1 47  ? -17.609 4.936   36.988 1.00 30.17  ? 201  SER A N   1 
ATOM   336  C  CA  . SER A 1 47  ? -16.191 5.290   37.097 1.00 32.28  ? 201  SER A CA  1 
ATOM   337  C  C   . SER A 1 47  ? -15.619 6.237   36.061 1.00 30.52  ? 201  SER A C   1 
ATOM   338  O  O   . SER A 1 47  ? -14.402 6.492   36.063 1.00 29.70  ? 201  SER A O   1 
ATOM   339  C  CB  . SER A 1 47  ? -15.375 4.007   37.088 1.00 33.64  ? 201  SER A CB  1 
ATOM   340  O  OG  . SER A 1 47  ? -15.455 3.342   35.832 1.00 35.97  ? 201  SER A OG  1 
ATOM   341  N  N   . SER A 1 48  ? -16.449 6.722   35.141 1.00 34.74  ? 202  SER A N   1 
ATOM   342  C  CA  . SER A 1 48  ? -15.944 7.524   34.005 1.00 34.07  ? 202  SER A CA  1 
ATOM   343  C  C   . SER A 1 48  ? -15.243 8.838   34.411 1.00 34.07  ? 202  SER A C   1 
ATOM   344  O  O   . SER A 1 48  ? -14.166 9.184   33.874 1.00 34.46  ? 202  SER A O   1 
ATOM   345  C  CB  . SER A 1 48  ? -17.058 7.786   32.984 1.00 35.74  ? 202  SER A CB  1 
ATOM   346  O  OG  . SER A 1 48  ? -17.982 8.734   33.472 1.00 38.99  ? 202  SER A OG  1 
ATOM   347  N  N   . ASN A 1 49  ? -15.813 9.562   35.375 1.00 31.85  ? 203  ASN A N   1 
ATOM   348  C  CA  . ASN A 1 49  ? -15.160 10.755  35.871 1.00 31.63  ? 203  ASN A CA  1 
ATOM   349  C  C   . ASN A 1 49  ? -13.830 10.407  36.574 1.00 30.47  ? 203  ASN A C   1 
ATOM   350  O  O   . ASN A 1 49  ? -12.792 11.045  36.310 1.00 30.11  ? 203  ASN A O   1 
ATOM   351  C  CB  . ASN A 1 49  ? -16.072 11.553  36.799 1.00 33.22  ? 203  ASN A CB  1 
ATOM   352  C  CG  . ASN A 1 49  ? -15.550 12.975  37.052 1.00 37.25  ? 203  ASN A CG  1 
ATOM   353  O  OD1 . ASN A 1 49  ? -15.142 13.324  38.164 1.00 31.77  ? 203  ASN A OD1 1 
ATOM   354  N  ND2 . ASN A 1 49  ? -15.552 13.806  36.004 1.00 37.65  ? 203  ASN A ND2 1 
ATOM   355  N  N   . ALA A 1 50  ? -13.854 9.423   37.471 1.00 28.87  ? 204  ALA A N   1 
ATOM   356  C  CA  . ALA A 1 50  ? -12.607 8.979   38.119 1.00 29.19  ? 204  ALA A CA  1 
ATOM   357  C  C   . ALA A 1 50  ? -11.534 8.541   37.092 1.00 31.53  ? 204  ALA A C   1 
ATOM   358  O  O   . ALA A 1 50  ? -10.347 8.779   37.264 1.00 29.50  ? 204  ALA A O   1 
ATOM   359  C  CB  . ALA A 1 50  ? -12.886 7.847   39.072 1.00 28.06  ? 204  ALA A CB  1 
ATOM   360  N  N   . GLN A 1 51  ? -11.961 7.896   36.010 1.00 31.88  ? 205  GLN A N   1 
ATOM   361  C  CA  . GLN A 1 51  ? -11.028 7.503   34.949 1.00 34.30  ? 205  GLN A CA  1 
ATOM   362  C  C   . GLN A 1 51  ? -10.375 8.735   34.357 1.00 30.51  ? 205  GLN A C   1 
ATOM   363  O  O   . GLN A 1 51  ? -9.168  8.740   34.114 1.00 32.12  ? 205  GLN A O   1 
ATOM   364  C  CB  . GLN A 1 51  ? -11.742 6.684   33.851 1.00 36.61  ? 205  GLN A CB  1 
ATOM   365  C  CG  . GLN A 1 51  ? -10.806 6.036   32.841 1.00 39.62  ? 205  GLN A CG  1 
ATOM   366  C  CD  . GLN A 1 51  ? -9.961  4.931   33.440 1.00 42.52  ? 205  GLN A CD  1 
ATOM   367  O  OE1 . GLN A 1 51  ? -10.436 3.823   33.608 1.00 52.04  ? 205  GLN A OE1 1 
ATOM   368  N  NE2 . GLN A 1 51  ? -8.703  5.221   33.750 1.00 40.20  ? 205  GLN A NE2 1 
ATOM   369  N  N   . LEU A 1 52  ? -11.147 9.795   34.178 1.00 28.40  ? 206  LEU A N   1 
ATOM   370  C  CA  . LEU A 1 52  ? -10.577 11.038  33.687 1.00 34.40  ? 206  LEU A CA  1 
ATOM   371  C  C   . LEU A 1 52  ? -9.500  11.566  34.626 1.00 35.02  ? 206  LEU A C   1 
ATOM   372  O  O   . LEU A 1 52  ? -8.392  11.950  34.196 1.00 34.93  ? 206  LEU A O   1 
ATOM   373  C  CB  . LEU A 1 52  ? -11.657 12.098  33.482 1.00 38.04  ? 206  LEU A CB  1 
ATOM   374  C  CG  . LEU A 1 52  ? -12.588 11.872  32.294 1.00 42.04  ? 206  LEU A CG  1 
ATOM   375  C  CD1 . LEU A 1 52  ? -13.600 13.006  32.288 1.00 42.14  ? 206  LEU A CD1 1 
ATOM   376  C  CD2 . LEU A 1 52  ? -11.843 11.797  30.957 1.00 41.74  ? 206  LEU A CD2 1 
ATOM   377  N  N   . LEU A 1 53  ? -9.819  11.575  35.922 1.00 33.32  ? 207  LEU A N   1 
ATOM   378  C  CA  . LEU A 1 53  ? -8.863  12.061  36.900 1.00 29.80  ? 207  LEU A CA  1 
ATOM   379  C  C   . LEU A 1 53  ? -7.633  11.179  36.993 1.00 27.37  ? 207  LEU A C   1 
ATOM   380  O  O   . LEU A 1 53  ? -6.501  11.697  37.088 1.00 30.78  ? 207  LEU A O   1 
ATOM   381  C  CB  . LEU A 1 53  ? -9.514  12.157  38.279 1.00 29.97  ? 207  LEU A CB  1 
ATOM   382  C  CG  . LEU A 1 53  ? -8.592  12.734  39.361 1.00 28.77  ? 207  LEU A CG  1 
ATOM   383  C  CD1 . LEU A 1 53  ? -8.160  14.154  39.045 1.00 29.84  ? 207  LEU A CD1 1 
ATOM   384  C  CD2 . LEU A 1 53  ? -9.344  12.682  40.691 1.00 28.61  ? 207  LEU A CD2 1 
ATOM   385  N  N   . LEU A 1 54  ? -7.833  9.861   37.006 1.00 32.00  ? 208  LEU A N   1 
ATOM   386  C  CA  . LEU A 1 54  ? -6.706  8.932   37.100 1.00 33.39  ? 208  LEU A CA  1 
ATOM   387  C  C   . LEU A 1 54  ? -5.718  9.143   35.952 1.00 37.22  ? 208  LEU A C   1 
ATOM   388  O  O   . LEU A 1 54  ? -4.495  9.168   36.150 1.00 36.02  ? 208  LEU A O   1 
ATOM   389  C  CB  . LEU A 1 54  ? -7.177  7.479   37.111 1.00 35.86  ? 208  LEU A CB  1 
ATOM   390  C  CG  . LEU A 1 54  ? -7.915  6.958   38.343 1.00 36.68  ? 208  LEU A CG  1 
ATOM   391  C  CD1 . LEU A 1 54  ? -8.205  5.491   38.138 1.00 38.18  ? 208  LEU A CD1 1 
ATOM   392  C  CD2 . LEU A 1 54  ? -7.109  7.152   39.604 1.00 37.12  ? 208  LEU A CD2 1 
ATOM   393  N  N   . ASP A 1 55  ? -6.272  9.308   34.753 1.00 40.05  ? 209  ASP A N   1 
ATOM   394  C  CA  . ASP A 1 55  ? -5.470  9.490   33.576 1.00 37.50  ? 209  ASP A CA  1 
ATOM   395  C  C   . ASP A 1 55  ? -4.666  10.758  33.685 1.00 39.58  ? 209  ASP A C   1 
ATOM   396  O  O   . ASP A 1 55  ? -3.451  10.711  33.480 1.00 36.78  ? 209  ASP A O   1 
ATOM   397  C  CB  . ASP A 1 55  ? -6.339  9.495   32.312 1.00 40.75  ? 209  ASP A CB  1 
ATOM   398  C  CG  . ASP A 1 55  ? -6.922  8.120   31.992 1.00 42.73  ? 209  ASP A CG  1 
ATOM   399  O  OD1 . ASP A 1 55  ? -6.499  7.110   32.596 1.00 45.97  ? 209  ASP A OD1 1 
ATOM   400  O  OD2 . ASP A 1 55  ? -7.838  8.046   31.152 1.00 43.83  ? 209  ASP A OD2 1 
ATOM   401  N  N   . TYR A 1 56  ? -5.326  11.863  34.045 1.00 37.79  ? 210  TYR A N   1 
ATOM   402  C  CA  . TYR A 1 56  ? -4.654  13.140  34.238 1.00 35.92  ? 210  TYR A CA  1 
ATOM   403  C  C   . TYR A 1 56  ? -3.530  13.064  35.268 1.00 38.57  ? 210  TYR A C   1 
ATOM   404  O  O   . TYR A 1 56  ? -2.423  13.590  35.039 1.00 35.75  ? 210  TYR A O   1 
ATOM   405  C  CB  . TYR A 1 56  ? -5.628  14.245  34.635 1.00 38.02  ? 210  TYR A CB  1 
ATOM   406  C  CG  . TYR A 1 56  ? -4.896  15.552  34.909 1.00 39.66  ? 210  TYR A CG  1 
ATOM   407  C  CD1 . TYR A 1 56  ? -4.304  16.259  33.872 1.00 39.27  ? 210  TYR A CD1 1 
ATOM   408  C  CD2 . TYR A 1 56  ? -4.737  16.053  36.228 1.00 35.87  ? 210  TYR A CD2 1 
ATOM   409  C  CE1 . TYR A 1 56  ? -3.594  17.438  34.113 1.00 41.80  ? 210  TYR A CE1 1 
ATOM   410  C  CE2 . TYR A 1 56  ? -4.043  17.223  36.476 1.00 35.69  ? 210  TYR A CE2 1 
ATOM   411  C  CZ  . TYR A 1 56  ? -3.467  17.924  35.413 1.00 39.80  ? 210  TYR A CZ  1 
ATOM   412  O  OH  . TYR A 1 56  ? -2.774  19.089  35.628 1.00 37.88  ? 210  TYR A OH  1 
ATOM   413  N  N   . CYS A 1 57  ? -3.817  12.458  36.423 1.00 37.04  ? 211  CYS A N   1 
ATOM   414  C  CA  . CYS A 1 57  ? -2.801  12.329  37.471 1.00 35.08  ? 211  CYS A CA  1 
ATOM   415  C  C   . CYS A 1 57  ? -1.642  11.461  37.001 1.00 36.18  ? 211  CYS A C   1 
ATOM   416  O  O   . CYS A 1 57  ? -0.497  11.782  37.274 1.00 38.52  ? 211  CYS A O   1 
ATOM   417  C  CB  . CYS A 1 57  ? -3.409  11.758  38.775 1.00 32.87  ? 211  CYS A CB  1 
ATOM   418  S  SG  . CYS A 1 57  ? -4.521  12.941  39.565 1.00 31.96  ? 211  CYS A SG  1 
ATOM   419  N  N   . SER A 1 58  ? -1.948  10.360  36.314 1.00 40.40  ? 212  SER A N   1 
ATOM   420  C  CA  . SER A 1 58  ? -0.898  9.527   35.663 1.00 46.15  ? 212  SER A CA  1 
ATOM   421  C  C   . SER A 1 58  ? -0.022  10.355  34.742 1.00 44.21  ? 212  SER A C   1 
ATOM   422  O  O   . SER A 1 58  ? 1.211   10.295  34.835 1.00 45.06  ? 212  SER A O   1 
ATOM   423  C  CB  . SER A 1 58  ? -1.489  8.338   34.884 1.00 48.77  ? 212  SER A CB  1 
ATOM   424  O  OG  . SER A 1 58  ? -1.472  7.165   35.690 1.00 54.54  ? 212  SER A OG  1 
ATOM   425  N  N   . SER A 1 59  ? -0.666  11.169  33.909 1.00 45.05  ? 213  SER A N   1 
ATOM   426  C  CA  . SER A 1 59  ? 0.039   12.023  32.949 1.00 44.97  ? 213  SER A CA  1 
ATOM   427  C  C   . SER A 1 59  ? 0.995   13.036  33.579 1.00 48.17  ? 213  SER A C   1 
ATOM   428  O  O   . SER A 1 59  ? 1.911   13.478  32.893 1.00 46.86  ? 213  SER A O   1 
ATOM   429  C  CB  . SER A 1 59  ? -0.940  12.779  32.047 1.00 44.30  ? 213  SER A CB  1 
ATOM   430  O  OG  . SER A 1 59  ? -1.372  14.000  32.645 1.00 43.00  ? 213  SER A OG  1 
ATOM   431  N  N   . LYS A 1 60  ? 0.778   13.436  34.845 1.00 41.98  ? 214  LYS A N   1 
ATOM   432  C  CA  . LYS A 1 60  ? 1.672   14.380  35.523 1.00 39.73  ? 214  LYS A CA  1 
ATOM   433  C  C   . LYS A 1 60  ? 2.698   13.729  36.444 1.00 35.36  ? 214  LYS A C   1 
ATOM   434  O  O   . LYS A 1 60  ? 3.541   14.428  37.015 1.00 37.67  ? 214  LYS A O   1 
ATOM   435  C  CB  . LYS A 1 60  ? 0.877   15.421  36.324 1.00 41.50  ? 214  LYS A CB  1 
ATOM   436  C  CG  . LYS A 1 60  ? -0.217  16.151  35.568 1.00 42.96  ? 214  LYS A CG  1 
ATOM   437  C  CD  . LYS A 1 60  ? 0.305   16.999  34.426 1.00 47.18  ? 214  LYS A CD  1 
ATOM   438  C  CE  . LYS A 1 60  ? 1.242   18.080  34.921 1.00 49.45  ? 214  LYS A CE  1 
ATOM   439  N  NZ  . LYS A 1 60  ? 0.967   19.348  34.210 1.00 53.51  ? 214  LYS A NZ  1 
ATOM   440  N  N   . GLY A 1 61  ? 2.652   12.412  36.568 1.00 35.28  ? 215  GLY A N   1 
ATOM   441  C  CA  . GLY A 1 61  ? 3.577   11.690  37.400 1.00 35.33  ? 215  GLY A CA  1 
ATOM   442  C  C   . GLY A 1 61  ? 3.194   11.774  38.875 1.00 34.29  ? 215  GLY A C   1 
ATOM   443  O  O   . GLY A 1 61  ? 4.049   11.575  39.726 1.00 32.19  ? 215  GLY A O   1 
ATOM   444  N  N   . TYR A 1 62  ? 1.918   12.040  39.167 1.00 31.49  ? 216  TYR A N   1 
ATOM   445  C  CA  . TYR A 1 62  ? 1.470   12.220  40.570 1.00 31.87  ? 216  TYR A CA  1 
ATOM   446  C  C   . TYR A 1 62  ? 1.292   10.893  41.277 1.00 32.10  ? 216  TYR A C   1 
ATOM   447  O  O   . TYR A 1 62  ? 0.486   10.082  40.852 1.00 33.62  ? 216  TYR A O   1 
ATOM   448  C  CB  . TYR A 1 62  ? 0.153   12.988  40.637 1.00 29.34  ? 216  TYR A CB  1 
ATOM   449  C  CG  . TYR A 1 62  ? 0.187   14.428  40.150 1.00 28.95  ? 216  TYR A CG  1 
ATOM   450  C  CD1 . TYR A 1 62  ? 1.398   15.145  39.979 1.00 31.75  ? 216  TYR A CD1 1 
ATOM   451  C  CD2 . TYR A 1 62  ? -1.010  15.115  39.916 1.00 30.01  ? 216  TYR A CD2 1 
ATOM   452  C  CE1 . TYR A 1 62  ? 1.389   16.472  39.586 1.00 31.20  ? 216  TYR A CE1 1 
ATOM   453  C  CE2 . TYR A 1 62  ? -1.011  16.454  39.514 1.00 31.30  ? 216  TYR A CE2 1 
ATOM   454  C  CZ  . TYR A 1 62  ? 0.183   17.105  39.331 1.00 31.69  ? 216  TYR A CZ  1 
ATOM   455  O  OH  . TYR A 1 62  ? 0.167   18.421  38.928 1.00 35.49  ? 216  TYR A OH  1 
ATOM   456  N  N   . ASN A 1 63  ? 2.013   10.681  42.375 1.00 36.69  ? 217  ASN A N   1 
ATOM   457  C  CA  . ASN A 1 63  ? 1.859   9.452   43.152 1.00 41.31  ? 217  ASN A CA  1 
ATOM   458  C  C   . ASN A 1 63  ? 0.807   9.723   44.243 1.00 35.20  ? 217  ASN A C   1 
ATOM   459  O  O   . ASN A 1 63  ? 1.035   10.508  45.168 1.00 37.63  ? 217  ASN A O   1 
ATOM   460  C  CB  . ASN A 1 63  ? 3.187   8.974   43.753 1.00 48.79  ? 217  ASN A CB  1 
ATOM   461  C  CG  . ASN A 1 63  ? 3.119   7.512   44.212 1.00 60.40  ? 217  ASN A CG  1 
ATOM   462  O  OD1 . ASN A 1 63  ? 2.374   6.694   43.638 1.00 68.95  ? 217  ASN A OD1 1 
ATOM   463  N  ND2 . ASN A 1 63  ? 3.898   7.172   45.239 1.00 60.95  ? 217  ASN A ND2 1 
ATOM   464  N  N   . ILE A 1 64  ? -0.377  9.152   44.071 1.00 28.73  ? 218  ILE A N   1 
ATOM   465  C  CA  . ILE A 1 64  ? -1.546  9.527   44.876 1.00 29.70  ? 218  ILE A CA  1 
ATOM   466  C  C   . ILE A 1 64  ? -2.166  8.204   45.334 1.00 28.83  ? 218  ILE A C   1 
ATOM   467  O  O   . ILE A 1 64  ? -2.104  7.226   44.603 1.00 28.92  ? 218  ILE A O   1 
ATOM   468  C  CB  . ILE A 1 64  ? -2.545  10.378  44.026 1.00 28.88  ? 218  ILE A CB  1 
ATOM   469  C  CG1 . ILE A 1 64  ? -1.909  11.708  43.607 1.00 30.76  ? 218  ILE A CG1 1 
ATOM   470  C  CG2 . ILE A 1 64  ? -3.824  10.668  44.800 1.00 32.06  ? 218  ILE A CG2 1 
ATOM   471  C  CD1 . ILE A 1 64  ? -2.804  12.628  42.778 1.00 30.26  ? 218  ILE A CD1 1 
ATOM   472  N  N   . SER A 1 65  ? -2.720  8.184   46.558 1.00 25.11  ? 219  SER A N   1 
ATOM   473  C  CA  . SER A 1 65  ? -3.534  7.107   47.044 1.00 23.09  ? 219  SER A CA  1 
ATOM   474  C  C   . SER A 1 65  ? -4.970  7.529   47.006 1.00 20.70  ? 219  SER A C   1 
ATOM   475  O  O   . SER A 1 65  ? -5.276  8.724   46.965 1.00 24.03  ? 219  SER A O   1 
ATOM   476  C  CB  . SER A 1 65  ? -3.166  6.760   48.491 1.00 24.05  ? 219  SER A CB  1 
ATOM   477  O  OG  . SER A 1 65  ? -1.831  6.329   48.566 1.00 29.91  ? 219  SER A OG  1 
ATOM   478  N  N   . TRP A 1 66  ? -5.861  6.554   46.958 1.00 20.94  ? 220  TRP A N   1 
ATOM   479  C  CA  . TRP A 1 66  ? -7.261  6.822   46.691 1.00 20.93  ? 220  TRP A CA  1 
ATOM   480  C  C   . TRP A 1 66  ? -8.243  6.333   47.761 1.00 20.57  ? 220  TRP A C   1 
ATOM   481  O  O   . TRP A 1 66  ? -7.976  5.373   48.482 1.00 21.04  ? 220  TRP A O   1 
ATOM   482  C  CB  . TRP A 1 66  ? -7.641  6.221   45.327 1.00 21.60  ? 220  TRP A CB  1 
ATOM   483  C  CG  . TRP A 1 66  ? -6.700  6.693   44.263 1.00 24.61  ? 220  TRP A CG  1 
ATOM   484  C  CD1 . TRP A 1 66  ? -5.574  6.073   43.841 1.00 25.80  ? 220  TRP A CD1 1 
ATOM   485  C  CD2 . TRP A 1 66  ? -6.767  7.944   43.562 1.00 23.40  ? 220  TRP A CD2 1 
ATOM   486  N  NE1 . TRP A 1 66  ? -4.924  6.861   42.897 1.00 26.36  ? 220  TRP A NE1 1 
ATOM   487  C  CE2 . TRP A 1 66  ? -5.648  8.000   42.696 1.00 25.25  ? 220  TRP A CE2 1 
ATOM   488  C  CE3 . TRP A 1 66  ? -7.657  9.017   43.577 1.00 24.72  ? 220  TRP A CE3 1 
ATOM   489  C  CZ2 . TRP A 1 66  ? -5.408  9.093   41.844 1.00 25.30  ? 220  TRP A CZ2 1 
ATOM   490  C  CZ3 . TRP A 1 66  ? -7.435  10.101  42.716 1.00 26.32  ? 220  TRP A CZ3 1 
ATOM   491  C  CH2 . TRP A 1 66  ? -6.311  10.121  41.853 1.00 27.76  ? 220  TRP A CH2 1 
ATOM   492  N  N   . GLU A 1 67  ? -9.375  7.033   47.834 1.00 21.06  ? 221  GLU A N   1 
ATOM   493  C  CA  . GLU A 1 67  ? -10.562 6.613   48.547 1.00 20.77  ? 221  GLU A CA  1 
ATOM   494  C  C   . GLU A 1 67  ? -11.739 6.773   47.643 1.00 22.39  ? 221  GLU A C   1 
ATOM   495  O  O   . GLU A 1 67  ? -11.627 7.432   46.591 1.00 22.22  ? 221  GLU A O   1 
ATOM   496  C  CB  . GLU A 1 67  ? -10.756 7.451   49.821 1.00 20.47  ? 221  GLU A CB  1 
ATOM   497  C  CG  . GLU A 1 67  ? -9.730  7.166   50.915 1.00 19.86  ? 221  GLU A CG  1 
ATOM   498  C  CD  . GLU A 1 67  ? -9.719  8.147   52.066 1.00 19.90  ? 221  GLU A CD  1 
ATOM   499  O  OE1 . GLU A 1 67  ? -10.433 9.158   52.021 1.00 20.17  ? 221  GLU A OE1 1 
ATOM   500  O  OE2 . GLU A 1 67  ? -8.953  7.839   53.020 1.00 21.00  ? 221  GLU A OE2 1 
ATOM   501  N  N   . LEU A 1 68  ? -12.877 6.197   48.028 1.00 22.00  ? 222  LEU A N   1 
ATOM   502  C  CA  . LEU A 1 68  ? -14.077 6.344   47.248 1.00 23.72  ? 222  LEU A CA  1 
ATOM   503  C  C   . LEU A 1 68  ? -15.268 6.492   48.179 1.00 23.18  ? 222  LEU A C   1 
ATOM   504  O  O   . LEU A 1 68  ? -15.661 5.525   48.846 1.00 24.53  ? 222  LEU A O   1 
ATOM   505  C  CB  . LEU A 1 68  ? -14.208 5.130   46.308 1.00 23.44  ? 222  LEU A CB  1 
ATOM   506  C  CG  . LEU A 1 68  ? -15.506 4.964   45.516 1.00 26.92  ? 222  LEU A CG  1 
ATOM   507  C  CD1 . LEU A 1 68  ? -15.670 6.161   44.614 1.00 24.46  ? 222  LEU A CD1 1 
ATOM   508  C  CD2 . LEU A 1 68  ? -15.489 3.668   44.722 1.00 27.16  ? 222  LEU A CD2 1 
ATOM   509  N  N   . GLY A 1 69  ? -15.828 7.713   48.235 1.00 22.48  ? 223  GLY A N   1 
ATOM   510  C  CA  . GLY A 1 69  ? -16.969 8.022   49.068 1.00 21.56  ? 223  GLY A CA  1 
ATOM   511  C  C   . GLY A 1 69  ? -16.535 8.476   50.466 1.00 23.76  ? 223  GLY A C   1 
ATOM   512  O  O   . GLY A 1 69  ? -15.482 8.098   50.934 1.00 23.22  ? 223  GLY A O   1 
ATOM   513  N  N   . ASN A 1 70  ? -17.369 9.311   51.065 1.00 21.34  ? 224  ASN A N   1 
ATOM   514  C  CA  . ASN A 1 70  ? -17.215 9.818   52.424 1.00 22.04  ? 224  ASN A CA  1 
ATOM   515  C  C   . ASN A 1 70  ? -18.516 9.574   53.174 1.00 21.84  ? 224  ASN A C   1 
ATOM   516  O  O   . ASN A 1 70  ? -19.586 10.046  52.732 1.00 22.29  ? 224  ASN A O   1 
ATOM   517  C  CB  . ASN A 1 70  ? -16.916 11.289  52.340 1.00 22.03  ? 224  ASN A CB  1 
ATOM   518  C  CG  . ASN A 1 70  ? -16.694 11.922  53.702 1.00 23.32  ? 224  ASN A CG  1 
ATOM   519  O  OD1 . ASN A 1 70  ? -15.608 11.913  54.204 1.00 21.32  ? 224  ASN A OD1 1 
ATOM   520  N  ND2 . ASN A 1 70  ? -17.725 12.505  54.252 1.00 23.27  ? 224  ASN A ND2 1 
ATOM   521  N  N   . GLU A 1 71  ? -18.463 8.893   54.331 1.00 19.44  ? 225  GLU A N   1 
ATOM   522  C  CA  . GLU A 1 71  ? -19.684 8.575   55.078 1.00 21.44  ? 225  GLU A CA  1 
ATOM   523  C  C   . GLU A 1 71  ? -20.801 8.045   54.199 1.00 22.29  ? 225  GLU A C   1 
ATOM   524  O  O   . GLU A 1 71  ? -21.919 8.613   54.141 1.00 22.71  ? 225  GLU A O   1 
ATOM   525  C  CB  . GLU A 1 71  ? -20.150 9.776   55.904 1.00 23.78  ? 225  GLU A CB  1 
ATOM   526  C  CG  . GLU A 1 71  ? -19.136 10.180  56.979 1.00 28.14  ? 225  GLU A CG  1 
ATOM   527  C  CD  . GLU A 1 71  ? -19.601 10.026  58.429 1.00 30.01  ? 225  GLU A CD  1 
ATOM   528  O  OE1 . GLU A 1 71  ? -18.786 10.384  59.327 1.00 32.34  ? 225  GLU A OE1 1 
ATOM   529  O  OE2 . GLU A 1 71  ? -20.747 9.599   58.718 1.00 29.43  ? 225  GLU A OE2 1 
ATOM   530  N  N   . PRO A 1 72  ? -20.538 6.926   53.544 1.00 22.36  ? 226  PRO A N   1 
ATOM   531  C  CA  . PRO A 1 72  ? -21.591 6.346   52.723 1.00 23.02  ? 226  PRO A CA  1 
ATOM   532  C  C   . PRO A 1 72  ? -22.821 5.934   53.537 1.00 23.03  ? 226  PRO A C   1 
ATOM   533  O  O   . PRO A 1 72  ? -23.923 5.831   52.976 1.00 24.86  ? 226  PRO A O   1 
ATOM   534  C  CB  . PRO A 1 72  ? -20.926 5.112   52.123 1.00 23.37  ? 226  PRO A CB  1 
ATOM   535  C  CG  . PRO A 1 72  ? -19.867 4.766   53.081 1.00 21.81  ? 226  PRO A CG  1 
ATOM   536  C  CD  . PRO A 1 72  ? -19.327 6.073   53.558 1.00 21.78  ? 226  PRO A CD  1 
ATOM   537  N  N   . ASN A 1 73  ? -22.638 5.685   54.849 1.00 23.96  ? 227  ASN A N   1 
ATOM   538  C  CA  . ASN A 1 73  ? -23.769 5.457   55.743 1.00 22.85  ? 227  ASN A CA  1 
ATOM   539  C  C   . ASN A 1 73  ? -24.895 6.505   55.691 1.00 24.94  ? 227  ASN A C   1 
ATOM   540  O  O   . ASN A 1 73  ? -26.041 6.205   56.050 1.00 26.44  ? 227  ASN A O   1 
ATOM   541  C  CB  . ASN A 1 73  ? -23.267 5.285   57.186 1.00 24.39  ? 227  ASN A CB  1 
ATOM   542  C  CG  . ASN A 1 73  ? -22.245 6.351   57.571 1.00 23.40  ? 227  ASN A CG  1 
ATOM   543  O  OD1 . ASN A 1 73  ? -21.077 6.255   57.151 1.00 22.96  ? 227  ASN A OD1 1 
ATOM   544  N  ND2 . ASN A 1 73  ? -22.668 7.368   58.334 1.00 24.38  ? 227  ASN A ND2 1 
ATOM   545  N  N   . SER A 1 74  ? -24.575 7.731   55.303 1.00 25.28  ? 228  SER A N   1 
ATOM   546  C  CA  . SER A 1 74  ? -25.578 8.814   55.224 1.00 28.55  ? 228  SER A CA  1 
ATOM   547  C  C   . SER A 1 74  ? -25.842 9.342   53.808 1.00 26.24  ? 228  SER A C   1 
ATOM   548  O  O   . SER A 1 74  ? -26.354 10.449  53.625 1.00 29.63  ? 228  SER A O   1 
ATOM   549  C  CB  . SER A 1 74  ? -25.161 9.930   56.160 1.00 29.95  ? 228  SER A CB  1 
ATOM   550  O  OG  . SER A 1 74  ? -23.948 10.515  55.738 1.00 31.79  ? 228  SER A OG  1 
ATOM   551  N  N   . PHE A 1 75  ? -25.553 8.521   52.808 1.00 25.87  ? 229  PHE A N   1 
ATOM   552  C  CA  . PHE A 1 75  ? -25.905 8.851   51.414 1.00 28.47  ? 229  PHE A CA  1 
ATOM   553  C  C   . PHE A 1 75  ? -27.405 9.037   51.217 1.00 30.24  ? 229  PHE A C   1 
ATOM   554  O  O   . PHE A 1 75  ? -27.819 9.921   50.452 1.00 33.33  ? 229  PHE A O   1 
ATOM   555  C  CB  . PHE A 1 75  ? -25.435 7.769   50.464 1.00 26.14  ? 229  PHE A CB  1 
ATOM   556  C  CG  . PHE A 1 75  ? -23.970 7.807   50.131 1.00 25.43  ? 229  PHE A CG  1 
ATOM   557  C  CD1 . PHE A 1 75  ? -23.155 8.927   50.412 1.00 26.12  ? 229  PHE A CD1 1 
ATOM   558  C  CD2 . PHE A 1 75  ? -23.410 6.751   49.459 1.00 23.31  ? 229  PHE A CD2 1 
ATOM   559  C  CE1 . PHE A 1 75  ? -21.826 8.926   50.050 1.00 25.63  ? 229  PHE A CE1 1 
ATOM   560  C  CE2 . PHE A 1 75  ? -22.080 6.768   49.080 1.00 25.87  ? 229  PHE A CE2 1 
ATOM   561  C  CZ  . PHE A 1 75  ? -21.284 7.848   49.395 1.00 26.34  ? 229  PHE A CZ  1 
ATOM   562  N  N   . LEU A 1 76  ? -28.213 8.238   51.895 1.00 32.35  ? 230  LEU A N   1 
ATOM   563  C  CA  . LEU A 1 76  ? -29.680 8.383   51.738 1.00 38.47  ? 230  LEU A CA  1 
ATOM   564  C  C   . LEU A 1 76  ? -30.127 9.759   52.224 1.00 37.63  ? 230  LEU A C   1 
ATOM   565  O  O   . LEU A 1 76  ? -30.805 10.492  51.505 1.00 37.98  ? 230  LEU A O   1 
ATOM   566  C  CB  . LEU A 1 76  ? -30.399 7.252   52.441 1.00 37.98  ? 230  LEU A CB  1 
ATOM   567  C  CG  . LEU A 1 76  ? -31.905 7.109   52.204 1.00 40.67  ? 230  LEU A CG  1 
ATOM   568  C  CD1 . LEU A 1 76  ? -32.234 6.917   50.727 1.00 39.97  ? 230  LEU A CD1 1 
ATOM   569  C  CD2 . LEU A 1 76  ? -32.401 5.939   53.062 1.00 39.95  ? 230  LEU A CD2 1 
ATOM   570  N  N   . LYS A 1 77  ? -29.681 10.154  53.406 1.00 36.81  ? 231  LYS A N   1 
ATOM   571  C  CA  . LYS A 1 77  ? -29.965 11.513  53.889 1.00 40.85  ? 231  LYS A CA  1 
ATOM   572  C  C   . LYS A 1 77  ? -29.396 12.634  53.004 1.00 38.28  ? 231  LYS A C   1 
ATOM   573  O  O   . LYS A 1 77  ? -30.062 13.628  52.753 1.00 40.75  ? 231  LYS A O   1 
ATOM   574  C  CB  . LYS A 1 77  ? -29.469 11.698  55.323 1.00 44.32  ? 231  LYS A CB  1 
ATOM   575  C  CG  . LYS A 1 77  ? -30.154 12.857  56.040 1.00 52.81  ? 231  LYS A CG  1 
ATOM   576  C  CD  . LYS A 1 77  ? -29.180 13.837  56.668 1.00 56.94  ? 231  LYS A CD  1 
ATOM   577  C  CE  . LYS A 1 77  ? -29.918 15.084  57.160 1.00 63.14  ? 231  LYS A CE  1 
ATOM   578  N  NZ  . LYS A 1 77  ? -29.006 16.039  57.861 1.00 64.58  ? 231  LYS A NZ  1 
ATOM   579  N  N   . LYS A 1 78  ? -28.155 12.490  52.551 1.00 35.64  ? 232  LYS A N   1 
ATOM   580  C  CA  . LYS A 1 78  ? -27.464 13.547  51.804 1.00 34.41  ? 232  LYS A CA  1 
ATOM   581  C  C   . LYS A 1 78  ? -27.936 13.707  50.369 1.00 37.28  ? 232  LYS A C   1 
ATOM   582  O  O   . LYS A 1 78  ? -27.935 14.828  49.832 1.00 37.69  ? 232  LYS A O   1 
ATOM   583  C  CB  . LYS A 1 78  ? -25.941 13.295  51.805 1.00 34.27  ? 232  LYS A CB  1 
ATOM   584  C  CG  . LYS A 1 78  ? -25.326 13.448  53.192 1.00 34.43  ? 232  LYS A CG  1 
ATOM   585  C  CD  . LYS A 1 78  ? -23.813 13.321  53.167 1.00 32.76  ? 232  LYS A CD  1 
ATOM   586  C  CE  . LYS A 1 78  ? -23.382 11.894  52.834 1.00 30.41  ? 232  LYS A CE  1 
ATOM   587  N  NZ  . LYS A 1 78  ? -21.964 11.608  53.172 1.00 27.63  ? 232  LYS A NZ  1 
ATOM   588  N  N   . ALA A 1 79  ? -28.286 12.595  49.731 1.00 37.37  ? 233  ALA A N   1 
ATOM   589  C  CA  . ALA A 1 79  ? -28.615 12.602  48.306 1.00 39.70  ? 233  ALA A CA  1 
ATOM   590  C  C   . ALA A 1 79  ? -29.798 11.709  47.902 1.00 40.20  ? 233  ALA A C   1 
ATOM   591  O  O   . ALA A 1 79  ? -29.997 11.497  46.713 1.00 39.93  ? 233  ALA A O   1 
ATOM   592  C  CB  . ALA A 1 79  ? -27.382 12.184  47.526 1.00 37.74  ? 233  ALA A CB  1 
ATOM   593  N  N   . ASP A 1 80  ? -30.560 11.187  48.865 1.00 44.19  ? 234  ASP A N   1 
ATOM   594  C  CA  . ASP A 1 80  ? -31.683 10.257  48.612 1.00 47.60  ? 234  ASP A CA  1 
ATOM   595  C  C   . ASP A 1 80  ? -31.342 9.021   47.793 1.00 44.72  ? 234  ASP A C   1 
ATOM   596  O  O   . ASP A 1 80  ? -32.177 8.491   47.080 1.00 41.54  ? 234  ASP A O   1 
ATOM   597  C  CB  . ASP A 1 80  ? -32.889 11.012  48.025 1.00 57.04  ? 234  ASP A CB  1 
ATOM   598  C  CG  . ASP A 1 80  ? -33.487 11.995  49.019 1.00 64.01  ? 234  ASP A CG  1 
ATOM   599  O  OD1 . ASP A 1 80  ? -33.672 11.623  50.201 1.00 67.29  ? 234  ASP A OD1 1 
ATOM   600  O  OD2 . ASP A 1 80  ? -33.760 13.148  48.621 1.00 79.04  ? 234  ASP A OD2 1 
ATOM   601  N  N   . ILE A 1 81  ? -30.114 8.539   47.949 1.00 38.30  ? 235  ILE A N   1 
ATOM   602  C  CA  . ILE A 1 81  ? -29.640 7.353   47.279 1.00 38.89  ? 235  ILE A CA  1 
ATOM   603  C  C   . ILE A 1 81  ? -29.159 6.446   48.401 1.00 38.58  ? 235  ILE A C   1 
ATOM   604  O  O   . ILE A 1 81  ? -28.372 6.876   49.246 1.00 35.06  ? 235  ILE A O   1 
ATOM   605  C  CB  . ILE A 1 81  ? -28.488 7.700   46.301 1.00 42.30  ? 235  ILE A CB  1 
ATOM   606  C  CG1 . ILE A 1 81  ? -28.995 8.614   45.171 1.00 47.72  ? 235  ILE A CG1 1 
ATOM   607  C  CG2 . ILE A 1 81  ? -27.926 6.442   45.666 1.00 44.82  ? 235  ILE A CG2 1 
ATOM   608  C  CD1 . ILE A 1 81  ? -27.915 9.370   44.403 1.00 49.41  ? 235  ILE A CD1 1 
ATOM   609  N  N   . PHE A 1 82  ? -29.641 5.218   48.439 1.00 35.06  ? 236  PHE A N   1 
ATOM   610  C  CA  . PHE A 1 82  ? -29.082 4.233   49.352 1.00 34.22  ? 236  PHE A CA  1 
ATOM   611  C  C   . PHE A 1 82  ? -28.176 3.256   48.598 1.00 34.64  ? 236  PHE A C   1 
ATOM   612  O  O   . PHE A 1 82  ? -28.623 2.548   47.718 1.00 33.91  ? 236  PHE A O   1 
ATOM   613  C  CB  . PHE A 1 82  ? -30.160 3.465   50.087 1.00 34.52  ? 236  PHE A CB  1 
ATOM   614  C  CG  . PHE A 1 82  ? -29.594 2.485   51.060 1.00 36.09  ? 236  PHE A CG  1 
ATOM   615  C  CD1 . PHE A 1 82  ? -28.887 2.946   52.153 1.00 34.08  ? 236  PHE A CD1 1 
ATOM   616  C  CD2 . PHE A 1 82  ? -29.667 1.110   50.833 1.00 34.58  ? 236  PHE A CD2 1 
ATOM   617  C  CE1 . PHE A 1 82  ? -28.329 2.061   53.051 1.00 36.75  ? 236  PHE A CE1 1 
ATOM   618  C  CE2 . PHE A 1 82  ? -29.102 0.217   51.731 1.00 36.45  ? 236  PHE A CE2 1 
ATOM   619  C  CZ  . PHE A 1 82  ? -28.424 0.687   52.827 1.00 35.71  ? 236  PHE A CZ  1 
ATOM   620  N  N   . ILE A 1 83  ? -26.896 3.229   48.966 1.00 30.93  ? 237  ILE A N   1 
ATOM   621  C  CA  . ILE A 1 83  ? -25.944 2.274   48.473 1.00 29.74  ? 237  ILE A CA  1 
ATOM   622  C  C   . ILE A 1 83  ? -25.616 1.323   49.618 1.00 30.93  ? 237  ILE A C   1 
ATOM   623  O  O   . ILE A 1 83  ? -25.067 1.763   50.646 1.00 28.22  ? 237  ILE A O   1 
ATOM   624  C  CB  . ILE A 1 83  ? -24.655 2.990   48.019 1.00 30.29  ? 237  ILE A CB  1 
ATOM   625  C  CG1 . ILE A 1 83  ? -24.978 4.110   46.995 1.00 32.34  ? 237  ILE A CG1 1 
ATOM   626  C  CG2 . ILE A 1 83  ? -23.646 2.013   47.438 1.00 28.70  ? 237  ILE A CG2 1 
ATOM   627  C  CD1 . ILE A 1 83  ? -25.699 3.629   45.758 1.00 34.90  ? 237  ILE A CD1 1 
ATOM   628  N  N   . ASN A 1 84  ? -25.941 0.042   49.481 1.00 27.63  ? 238  ASN A N   1 
ATOM   629  C  CA  . ASN A 1 84  ? -25.676 -0.888  50.579 1.00 29.55  ? 238  ASN A CA  1 
ATOM   630  C  C   . ASN A 1 84  ? -24.181 -1.230  50.598 1.00 27.48  ? 238  ASN A C   1 
ATOM   631  O  O   . ASN A 1 84  ? -23.461 -0.939  49.628 1.00 26.52  ? 238  ASN A O   1 
ATOM   632  C  CB  . ASN A 1 84  ? -26.594 -2.129  50.559 1.00 31.04  ? 238  ASN A CB  1 
ATOM   633  C  CG  . ASN A 1 84  ? -26.395 -2.980  49.338 1.00 35.56  ? 238  ASN A CG  1 
ATOM   634  O  OD1 . ASN A 1 84  ? -25.279 -3.220  48.935 1.00 31.30  ? 238  ASN A OD1 1 
ATOM   635  N  ND2 . ASN A 1 84  ? -27.498 -3.448  48.736 1.00 42.85  ? 238  ASN A ND2 1 
ATOM   636  N  N   . GLY A 1 85  ? -23.706 -1.847  51.689 1.00 27.19  ? 239  GLY A N   1 
ATOM   637  C  CA  . GLY A 1 85  ? -22.262 -2.125  51.812 1.00 28.11  ? 239  GLY A CA  1 
ATOM   638  C  C   . GLY A 1 85  ? -21.720 -3.103  50.792 1.00 28.08  ? 239  GLY A C   1 
ATOM   639  O  O   . GLY A 1 85  ? -20.574 -2.991  50.332 1.00 24.47  ? 239  GLY A O   1 
ATOM   640  N  N   . SER A 1 86  ? -22.548 -4.069  50.443 1.00 27.72  ? 240  SER A N   1 
ATOM   641  C  CA  . SER A 1 86  ? -22.204 -5.049  49.382 1.00 30.01  ? 240  SER A CA  1 
ATOM   642  C  C   . SER A 1 86  ? -21.914 -4.378  48.050 1.00 25.53  ? 240  SER A C   1 
ATOM   643  O  O   . SER A 1 86  ? -20.882 -4.646  47.431 1.00 31.21  ? 240  SER A O   1 
ATOM   644  C  CB  . SER A 1 86  ? -23.359 -6.063  49.174 1.00 31.50  ? 240  SER A CB  1 
ATOM   645  O  OG  . SER A 1 86  ? -23.497 -6.869  50.318 1.00 37.96  ? 240  SER A OG  1 
ATOM   646  N  N   . GLN A 1 87  ? -22.817 -3.502  47.625 1.00 27.99  ? 241  GLN A N   1 
ATOM   647  C  CA  . GLN A 1 87  ? -22.628 -2.701  46.403 1.00 27.41  ? 241  GLN A CA  1 
ATOM   648  C  C   . GLN A 1 87  ? -21.386 -1.828  46.476 1.00 26.40  ? 241  GLN A C   1 
ATOM   649  O  O   . GLN A 1 87  ? -20.600 -1.760  45.540 1.00 25.23  ? 241  GLN A O   1 
ATOM   650  C  CB  . GLN A 1 87  ? -23.884 -1.857  46.109 1.00 29.60  ? 241  GLN A CB  1 
ATOM   651  C  CG  . GLN A 1 87  ? -23.816 -1.046  44.836 1.00 30.50  ? 241  GLN A CG  1 
ATOM   652  C  CD  . GLN A 1 87  ? -23.608 -1.946  43.618 1.00 33.08  ? 241  GLN A CD  1 
ATOM   653  O  OE1 . GLN A 1 87  ? -24.441 -2.795  43.361 1.00 32.33  ? 241  GLN A OE1 1 
ATOM   654  N  NE2 . GLN A 1 87  ? -22.495 -1.797  42.909 1.00 29.96  ? 241  GLN A NE2 1 
ATOM   655  N  N   . LEU A 1 88  ? -21.182 -1.164  47.624 1.00 24.44  ? 242  LEU A N   1 
ATOM   656  C  CA  . LEU A 1 88  ? -20.008 -0.317  47.789 1.00 22.89  ? 242  LEU A CA  1 
ATOM   657  C  C   . LEU A 1 88  ? -18.738 -1.120  47.664 1.00 22.49  ? 242  LEU A C   1 
ATOM   658  O  O   . LEU A 1 88  ? -17.785 -0.663  47.076 1.00 24.33  ? 242  LEU A O   1 
ATOM   659  C  CB  . LEU A 1 88  ? -20.101 0.432   49.137 1.00 23.97  ? 242  LEU A CB  1 
ATOM   660  C  CG  . LEU A 1 88  ? -19.085 1.545   49.293 1.00 26.38  ? 242  LEU A CG  1 
ATOM   661  C  CD1 . LEU A 1 88  ? -19.385 2.734   48.406 1.00 26.39  ? 242  LEU A CD1 1 
ATOM   662  C  CD2 . LEU A 1 88  ? -19.083 1.923   50.755 1.00 25.46  ? 242  LEU A CD2 1 
ATOM   663  N  N   . GLY A 1 89  ? -18.708 -2.318  48.237 1.00 24.70  ? 243  GLY A N   1 
ATOM   664  C  CA  . GLY A 1 89  ? -17.561 -3.183  48.096 1.00 27.30  ? 243  GLY A CA  1 
ATOM   665  C  C   . GLY A 1 89  ? -17.267 -3.538  46.636 1.00 28.11  ? 243  GLY A C   1 
ATOM   666  O  O   . GLY A 1 89  ? -16.107 -3.555  46.210 1.00 26.62  ? 243  GLY A O   1 
ATOM   667  N  N   . GLU A 1 90  ? -18.318 -3.798  45.873 1.00 29.02  ? 244  GLU A N   1 
ATOM   668  C  CA  . GLU A 1 90  ? -18.162 -4.045  44.410 1.00 31.58  ? 244  GLU A CA  1 
ATOM   669  C  C   . GLU A 1 90  ? -17.603 -2.811  43.681 1.00 28.19  ? 244  GLU A C   1 
ATOM   670  O  O   . GLU A 1 90  ? -16.723 -2.917  42.819 1.00 30.43  ? 244  GLU A O   1 
ATOM   671  C  CB  . GLU A 1 90  ? -19.521 -4.459  43.799 1.00 37.34  ? 244  GLU A CB  1 
ATOM   672  C  CG  . GLU A 1 90  ? -19.961 -5.880  44.158 1.00 42.93  ? 244  GLU A CG  1 
ATOM   673  C  CD  . GLU A 1 90  ? -18.973 -6.942  43.648 1.00 50.78  ? 244  GLU A CD  1 
ATOM   674  O  OE1 . GLU A 1 90  ? -18.385 -6.744  42.544 1.00 53.58  ? 244  GLU A OE1 1 
ATOM   675  O  OE2 . GLU A 1 90  ? -18.775 -7.962  44.358 1.00 45.24  ? 244  GLU A OE2 1 
ATOM   676  N  N   . ASP A 1 91  ? -18.080 -1.633  44.077 1.00 28.27  ? 245  ASP A N   1 
ATOM   677  C  CA  . ASP A 1 91  ? -17.592 -0.355  43.558 1.00 27.22  ? 245  ASP A CA  1 
ATOM   678  C  C   . ASP A 1 91  ? -16.107 -0.214  43.810 1.00 25.82  ? 245  ASP A C   1 
ATOM   679  O  O   . ASP A 1 91  ? -15.366 0.235   42.943 1.00 26.31  ? 245  ASP A O   1 
ATOM   680  C  CB  . ASP A 1 91  ? -18.349 0.849   44.174 1.00 27.80  ? 245  ASP A CB  1 
ATOM   681  C  CG  . ASP A 1 91  ? -19.831 0.792   43.948 1.00 28.55  ? 245  ASP A CG  1 
ATOM   682  O  OD1 . ASP A 1 91  ? -20.254 0.184   42.926 1.00 28.74  ? 245  ASP A OD1 1 
ATOM   683  O  OD2 . ASP A 1 91  ? -20.613 1.356   44.762 1.00 29.31  ? 245  ASP A OD2 1 
ATOM   684  N  N   . PHE A 1 92  ? -15.654 -0.592  45.019 1.00 24.07  ? 246  PHE A N   1 
ATOM   685  C  CA  . PHE A 1 92  ? -14.223 -0.523  45.338 1.00 24.11  ? 246  PHE A CA  1 
ATOM   686  C  C   . PHE A 1 92  ? -13.413 -1.517  44.502 1.00 25.14  ? 246  PHE A C   1 
ATOM   687  O  O   . PHE A 1 92  ? -12.303 -1.232  44.080 1.00 25.67  ? 246  PHE A O   1 
ATOM   688  C  CB  . PHE A 1 92  ? -13.987 -0.746  46.851 1.00 22.76  ? 246  PHE A CB  1 
ATOM   689  C  CG  . PHE A 1 92  ? -14.003 0.526   47.675 1.00 23.08  ? 246  PHE A CG  1 
ATOM   690  C  CD1 . PHE A 1 92  ? -15.162 1.218   47.919 1.00 22.20  ? 246  PHE A CD1 1 
ATOM   691  C  CD2 . PHE A 1 92  ? -12.809 1.015   48.195 1.00 22.63  ? 246  PHE A CD2 1 
ATOM   692  C  CE1 . PHE A 1 92  ? -15.140 2.374   48.687 1.00 22.96  ? 246  PHE A CE1 1 
ATOM   693  C  CE2 . PHE A 1 92  ? -12.778 2.178   48.935 1.00 22.65  ? 246  PHE A CE2 1 
ATOM   694  C  CZ  . PHE A 1 92  ? -13.946 2.839   49.189 1.00 20.70  ? 246  PHE A CZ  1 
ATOM   695  N  N   . ILE A 1 93  ? -13.979 -2.691  44.272 1.00 28.25  ? 247  ILE A N   1 
ATOM   696  C  CA  . ILE A 1 93  ? -13.355 -3.668  43.379 1.00 27.04  ? 247  ILE A CA  1 
ATOM   697  C  C   . ILE A 1 93  ? -13.171 -3.035  41.999 1.00 24.49  ? 247  ILE A C   1 
ATOM   698  O  O   . ILE A 1 93  ? -12.075 -3.123  41.435 1.00 27.19  ? 247  ILE A O   1 
ATOM   699  C  CB  . ILE A 1 93  ? -14.142 -4.985  43.300 1.00 28.47  ? 247  ILE A CB  1 
ATOM   700  C  CG1 . ILE A 1 93  ? -13.994 -5.767  44.614 1.00 28.95  ? 247  ILE A CG1 1 
ATOM   701  C  CG2 . ILE A 1 93  ? -13.639 -5.847  42.128 1.00 28.58  ? 247  ILE A CG2 1 
ATOM   702  C  CD1 . ILE A 1 93  ? -14.903 -6.969  44.721 1.00 30.65  ? 247  ILE A CD1 1 
ATOM   703  N  N   . GLN A 1 94  ? -14.176 -2.354  41.492 1.00 27.07  ? 248  GLN A N   1 
ATOM   704  C  CA  . GLN A 1 94  ? -14.044 -1.713  40.182 1.00 30.94  ? 248  GLN A CA  1 
ATOM   705  C  C   . GLN A 1 94  ? -13.009 -0.609  40.161 1.00 30.64  ? 248  GLN A C   1 
ATOM   706  O  O   . GLN A 1 94  ? -12.234 -0.490  39.217 1.00 29.46  ? 248  GLN A O   1 
ATOM   707  C  CB  . GLN A 1 94  ? -15.416 -1.253  39.671 1.00 33.89  ? 248  GLN A CB  1 
ATOM   708  C  CG  . GLN A 1 94  ? -16.324 -2.452  39.389 1.00 39.60  ? 248  GLN A CG  1 
ATOM   709  C  CD  . GLN A 1 94  ? -15.688 -3.493  38.429 1.00 44.98  ? 248  GLN A CD  1 
ATOM   710  O  OE1 . GLN A 1 94  ? -15.113 -3.136  37.394 1.00 45.00  ? 248  GLN A OE1 1 
ATOM   711  N  NE2 . GLN A 1 94  ? -15.771 -4.774  38.788 1.00 44.82  ? 248  GLN A NE2 1 
ATOM   712  N  N   . LEU A 1 95  ? -12.919 0.181   41.240 1.00 29.22  ? 249  LEU A N   1 
ATOM   713  C  CA  . LEU A 1 95  ? -11.842 1.176   41.330 1.00 25.89  ? 249  LEU A CA  1 
ATOM   714  C  C   . LEU A 1 95  ? -10.468 0.496   41.366 1.00 25.67  ? 249  LEU A C   1 
ATOM   715  O  O   . LEU A 1 95  ? -9.534  0.977   40.755 1.00 26.86  ? 249  LEU A O   1 
ATOM   716  C  CB  . LEU A 1 95  ? -12.030 2.056   42.583 1.00 26.29  ? 249  LEU A CB  1 
ATOM   717  C  CG  . LEU A 1 95  ? -10.975 3.096   42.894 1.00 26.96  ? 249  LEU A CG  1 
ATOM   718  C  CD1 . LEU A 1 95  ? -10.675 3.957   41.674 1.00 27.56  ? 249  LEU A CD1 1 
ATOM   719  C  CD2 . LEU A 1 95  ? -11.405 3.949   44.094 1.00 27.15  ? 249  LEU A CD2 1 
ATOM   720  N  N   . HIS A 1 96  ? -10.339 -0.584  42.147 1.00 24.13  ? 250  HIS A N   1 
ATOM   721  C  CA  . HIS A 1 96  ? -9.071  -1.276  42.272 1.00 27.09  ? 250  HIS A CA  1 
ATOM   722  C  C   . HIS A 1 96  ? -8.631  -1.780  40.874 1.00 28.69  ? 250  HIS A C   1 
ATOM   723  O  O   . HIS A 1 96  ? -7.464  -1.682  40.567 1.00 27.39  ? 250  HIS A O   1 
ATOM   724  C  CB  . HIS A 1 96  ? -9.176  -2.421  43.276 1.00 30.35  ? 250  HIS A CB  1 
ATOM   725  C  CG  . HIS A 1 96  ? -8.076  -3.426  43.194 1.00 32.02  ? 250  HIS A CG  1 
ATOM   726  N  ND1 . HIS A 1 96  ? -6.836  -3.229  43.756 1.00 34.12  ? 250  HIS A ND1 1 
ATOM   727  C  CD2 . HIS A 1 96  ? -8.053  -4.667  42.648 1.00 36.58  ? 250  HIS A CD2 1 
ATOM   728  C  CE1 . HIS A 1 96  ? -6.088  -4.294  43.552 1.00 35.57  ? 250  HIS A CE1 1 
ATOM   729  N  NE2 . HIS A 1 96  ? -6.804  -5.184  42.887 1.00 37.85  ? 250  HIS A NE2 1 
ATOM   730  N  N   . LYS A 1 97  ? -9.571  -2.255  40.064 1.00 29.26  ? 251  LYS A N   1 
ATOM   731  C  CA  . LYS A 1 97  ? -9.239  -2.683  38.665 1.00 32.48  ? 251  LYS A CA  1 
ATOM   732  C  C   . LYS A 1 97  ? -8.702  -1.522  37.826 1.00 34.06  ? 251  LYS A C   1 
ATOM   733  O  O   . LYS A 1 97  ? -7.704  -1.687  37.140 1.00 34.63  ? 251  LYS A O   1 
ATOM   734  C  CB  . LYS A 1 97  ? -10.439 -3.305  37.973 1.00 34.68  ? 251  LYS A CB  1 
ATOM   735  C  CG  . LYS A 1 97  ? -10.835 -4.656  38.522 1.00 36.56  ? 251  LYS A CG  1 
ATOM   736  C  CD  . LYS A 1 97  ? -12.053 -5.191  37.779 1.00 40.72  ? 251  LYS A CD  1 
ATOM   737  C  CE  . LYS A 1 97  ? -12.720 -6.340  38.487 1.00 45.08  ? 251  LYS A CE  1 
ATOM   738  N  NZ  . LYS A 1 97  ? -11.797 -7.482  38.692 1.00 49.56  ? 251  LYS A NZ  1 
ATOM   739  N  N   . LEU A 1 98  ? -9.311  -0.338  37.941 1.00 32.75  ? 252  LEU A N   1 
ATOM   740  C  CA  . LEU A 1 98  ? -8.795  0.864   37.284 1.00 34.21  ? 252  LEU A CA  1 
ATOM   741  C  C   . LEU A 1 98  ? -7.414  1.224   37.756 1.00 34.69  ? 252  LEU A C   1 
ATOM   742  O  O   . LEU A 1 98  ? -6.572  1.611   36.964 1.00 34.62  ? 252  LEU A O   1 
ATOM   743  C  CB  . LEU A 1 98  ? -9.714  2.077   37.494 1.00 37.33  ? 252  LEU A CB  1 
ATOM   744  C  CG  . LEU A 1 98  ? -11.124 1.932   36.931 1.00 40.21  ? 252  LEU A CG  1 
ATOM   745  C  CD1 . LEU A 1 98  ? -11.852 3.259   36.989 1.00 44.35  ? 252  LEU A CD1 1 
ATOM   746  C  CD2 . LEU A 1 98  ? -11.101 1.382   35.490 1.00 41.53  ? 252  LEU A CD2 1 
ATOM   747  N  N   . LEU A 1 99  ? -7.159  1.119   39.054 1.00 30.69  ? 253  LEU A N   1 
ATOM   748  C  CA  . LEU A 1 99  ? -5.846  1.441   39.536 1.00 28.33  ? 253  LEU A CA  1 
ATOM   749  C  C   . LEU A 1 99  ? -4.795  0.461   39.030 1.00 28.95  ? 253  LEU A C   1 
ATOM   750  O  O   . LEU A 1 99  ? -3.674  0.863   38.715 1.00 32.66  ? 253  LEU A O   1 
ATOM   751  C  CB  . LEU A 1 99  ? -5.828  1.465   41.065 1.00 32.39  ? 253  LEU A CB  1 
ATOM   752  C  CG  . LEU A 1 99  ? -6.743  2.518   41.715 1.00 31.43  ? 253  LEU A CG  1 
ATOM   753  C  CD1 . LEU A 1 99  ? -6.692  2.289   43.228 1.00 32.92  ? 253  LEU A CD1 1 
ATOM   754  C  CD2 . LEU A 1 99  ? -6.352  3.922   41.332 1.00 32.58  ? 253  LEU A CD2 1 
ATOM   755  N  N   . ARG A 1 100 ? -5.136  -0.820  39.003 1.00 30.57  ? 254  ARG A N   1 
ATOM   756  C  CA  . ARG A 1 100 ? -4.188  -1.858  38.559 1.00 31.89  ? 254  ARG A CA  1 
ATOM   757  C  C   . ARG A 1 100 ? -3.805  -1.667  37.073 1.00 32.72  ? 254  ARG A C   1 
ATOM   758  O  O   . ARG A 1 100 ? -2.701  -2.077  36.671 1.00 32.89  ? 254  ARG A O   1 
ATOM   759  C  CB  . ARG A 1 100 ? -4.742  -3.254  38.780 1.00 30.48  ? 254  ARG A CB  1 
ATOM   760  C  CG  . ARG A 1 100 ? -4.833  -3.663  40.266 1.00 34.28  ? 254  ARG A CG  1 
ATOM   761  C  CD  . ARG A 1 100 ? -3.460  -3.887  40.845 1.00 36.18  ? 254  ARG A CD  1 
ATOM   762  N  NE  . ARG A 1 100 ? -2.869  -5.133  40.334 1.00 39.98  ? 254  ARG A NE  1 
ATOM   763  C  CZ  . ARG A 1 100 ? -1.564  -5.421  40.348 1.00 42.17  ? 254  ARG A CZ  1 
ATOM   764  N  NH1 . ARG A 1 100 ? -0.673  -4.555  40.814 1.00 43.74  ? 254  ARG A NH1 1 
ATOM   765  N  NH2 . ARG A 1 100 ? -1.142  -6.596  39.886 1.00 44.53  ? 254  ARG A NH2 1 
ATOM   766  N  N   . LYS A 1 101 ? -4.687  -1.040  36.305 1.00 35.49  ? 255  LYS A N   1 
ATOM   767  C  CA  . LYS A 1 101 ? -4.430  -0.755  34.877 1.00 38.03  ? 255  LYS A CA  1 
ATOM   768  C  C   . LYS A 1 101 ? -3.782  0.575   34.656 1.00 38.69  ? 255  LYS A C   1 
ATOM   769  O  O   . LYS A 1 101 ? -3.539  0.940   33.525 1.00 40.59  ? 255  LYS A O   1 
ATOM   770  C  CB  . LYS A 1 101 ? -5.721  -0.838  34.065 1.00 38.67  ? 255  LYS A CB  1 
ATOM   771  C  CG  . LYS A 1 101 ? -6.207  -2.252  33.917 1.00 44.31  ? 255  LYS A CG  1 
ATOM   772  C  CD  . LYS A 1 101 ? -7.551  -2.305  33.204 1.00 52.12  ? 255  LYS A CD  1 
ATOM   773  C  CE  . LYS A 1 101 ? -8.054  -3.742  33.072 1.00 58.28  ? 255  LYS A CE  1 
ATOM   774  N  NZ  . LYS A 1 101 ? -8.677  -4.021  31.739 1.00 62.60  ? 255  LYS A NZ  1 
ATOM   775  N  N   . SER A 1 102 ? -3.478  1.309   35.720 1.00 38.55  ? 256  SER A N   1 
ATOM   776  C  CA  . SER A 1 102 ? -2.927  2.647   35.595 1.00 35.17  ? 256  SER A CA  1 
ATOM   777  C  C   . SER A 1 102 ? -1.409  2.592   35.698 1.00 36.32  ? 256  SER A C   1 
ATOM   778  O  O   . SER A 1 102 ? -0.823  1.529   35.990 1.00 41.31  ? 256  SER A O   1 
ATOM   779  C  CB  . SER A 1 102 ? -3.489  3.542   36.722 1.00 37.63  ? 256  SER A CB  1 
ATOM   780  O  OG  . SER A 1 102 ? -2.709  3.357   37.878 1.00 35.59  ? 256  SER A OG  1 
ATOM   781  N  N   . THR A 1 103 ? -0.778  3.749   35.495 1.00 35.23  ? 257  THR A N   1 
ATOM   782  C  CA  . THR A 1 103 ? 0.683   3.922   35.630 1.00 42.15  ? 257  THR A CA  1 
ATOM   783  C  C   . THR A 1 103 ? 1.244   3.599   37.004 1.00 45.30  ? 257  THR A C   1 
ATOM   784  O  O   . THR A 1 103 ? 2.384   3.129   37.126 1.00 42.23  ? 257  THR A O   1 
ATOM   785  C  CB  . THR A 1 103 ? 1.082   5.375   35.319 1.00 45.56  ? 257  THR A CB  1 
ATOM   786  O  OG1 . THR A 1 103 ? 0.362   5.825   34.163 1.00 49.77  ? 257  THR A OG1 1 
ATOM   787  C  CG2 . THR A 1 103 ? 2.572   5.488   35.063 1.00 49.62  ? 257  THR A CG2 1 
ATOM   788  N  N   . PHE A 1 104 ? 0.460   3.889   38.040 1.00 46.69  ? 258  PHE A N   1 
ATOM   789  C  CA  . PHE A 1 104 ? 0.791   3.489   39.410 1.00 50.07  ? 258  PHE A CA  1 
ATOM   790  C  C   . PHE A 1 104 ? -0.083  2.270   39.755 1.00 51.11  ? 258  PHE A C   1 
ATOM   791  O  O   . PHE A 1 104 ? -1.165  2.387   40.349 1.00 43.74  ? 258  PHE A O   1 
ATOM   792  C  CB  . PHE A 1 104 ? 0.587   4.673   40.368 1.00 51.71  ? 258  PHE A CB  1 
ATOM   793  C  CG  . PHE A 1 104 ? 1.485   5.848   40.064 1.00 49.69  ? 258  PHE A CG  1 
ATOM   794  C  CD1 . PHE A 1 104 ? 1.089   6.831   39.162 1.00 50.35  ? 258  PHE A CD1 1 
ATOM   795  C  CD2 . PHE A 1 104 ? 2.731   5.951   40.657 1.00 51.63  ? 258  PHE A CD2 1 
ATOM   796  C  CE1 . PHE A 1 104 ? 1.923   7.893   38.848 1.00 52.97  ? 258  PHE A CE1 1 
ATOM   797  C  CE2 . PHE A 1 104 ? 3.569   7.020   40.358 1.00 55.33  ? 258  PHE A CE2 1 
ATOM   798  C  CZ  . PHE A 1 104 ? 3.169   7.991   39.449 1.00 52.80  ? 258  PHE A CZ  1 
ATOM   799  N  N   . LYS A 1 105 ? 0.394   1.098   39.330 1.00 47.90  ? 259  LYS A N   1 
ATOM   800  C  CA  . LYS A 1 105 ? -0.364  -0.146  39.461 1.00 47.56  ? 259  LYS A CA  1 
ATOM   801  C  C   . LYS A 1 105 ? -0.394  -0.634  40.897 1.00 40.69  ? 259  LYS A C   1 
ATOM   802  O  O   . LYS A 1 105 ? -1.183  -1.505  41.239 1.00 36.05  ? 259  LYS A O   1 
ATOM   803  C  CB  . LYS A 1 105 ? 0.215   -1.239  38.555 1.00 51.53  ? 259  LYS A CB  1 
ATOM   804  C  CG  . LYS A 1 105 ? 1.529   -1.844  39.060 1.00 60.78  ? 259  LYS A CG  1 
ATOM   805  C  CD  . LYS A 1 105 ? 2.294   -2.617  37.981 1.00 66.72  ? 259  LYS A CD  1 
ATOM   806  C  CE  . LYS A 1 105 ? 1.656   -3.971  37.696 1.00 72.42  ? 259  LYS A CE  1 
ATOM   807  N  NZ  . LYS A 1 105 ? 2.488   -4.801  36.774 1.00 75.45  ? 259  LYS A NZ  1 
ATOM   808  N  N   . ASN A 1 106 ? 0.494   -0.103  41.723 1.00 39.04  ? 260  ASN A N   1 
ATOM   809  C  CA  . ASN A 1 106 ? 0.537   -0.491  43.116 1.00 35.76  ? 260  ASN A CA  1 
ATOM   810  C  C   . ASN A 1 106 ? -0.024  0.609   43.997 1.00 35.64  ? 260  ASN A C   1 
ATOM   811  O  O   . ASN A 1 106 ? 0.200   0.570   45.211 1.00 37.21  ? 260  ASN A O   1 
ATOM   812  C  CB  . ASN A 1 106 ? 1.964   -0.807  43.526 1.00 39.65  ? 260  ASN A CB  1 
ATOM   813  C  CG  . ASN A 1 106 ? 2.550   -1.993  42.773 1.00 39.34  ? 260  ASN A CG  1 
ATOM   814  O  OD1 . ASN A 1 106 ? 1.897   -2.993  42.571 1.00 39.33  ? 260  ASN A OD1 1 
ATOM   815  N  ND2 . ASN A 1 106 ? 3.804   -1.891  42.421 1.00 45.41  ? 260  ASN A ND2 1 
ATOM   816  N  N   . ALA A 1 107 ? -0.757  1.560   43.419 1.00 30.86  ? 261  ALA A N   1 
ATOM   817  C  CA  . ALA A 1 107 ? -1.340  2.659   44.209 1.00 31.09  ? 261  ALA A CA  1 
ATOM   818  C  C   . ALA A 1 107 ? -2.250  2.055   45.289 1.00 29.94  ? 261  ALA A C   1 
ATOM   819  O  O   . ALA A 1 107 ? -2.942  1.054   45.064 1.00 29.09  ? 261  ALA A O   1 
ATOM   820  C  CB  . ALA A 1 107 ? -2.142  3.596   43.319 1.00 32.77  ? 261  ALA A CB  1 
ATOM   821  N  N   . LYS A 1 108 ? -2.283  2.718   46.445 1.00 28.12  ? 262  LYS A N   1 
ATOM   822  C  CA  . LYS A 1 108 ? -3.054  2.233   47.565 1.00 26.39  ? 262  LYS A CA  1 
ATOM   823  C  C   . LYS A 1 108 ? -4.471  2.775   47.537 1.00 24.39  ? 262  LYS A C   1 
ATOM   824  O  O   . LYS A 1 108 ? -4.739  3.838   47.014 1.00 22.94  ? 262  LYS A O   1 
ATOM   825  C  CB  . LYS A 1 108 ? -2.390  2.623   48.883 1.00 28.32  ? 262  LYS A CB  1 
ATOM   826  C  CG  . LYS A 1 108 ? -0.933  2.265   49.015 1.00 29.94  ? 262  LYS A CG  1 
ATOM   827  C  CD  . LYS A 1 108 ? -0.771  0.758   49.115 1.00 34.70  ? 262  LYS A CD  1 
ATOM   828  C  CE  . LYS A 1 108 ? 0.700   0.431   49.081 1.00 41.74  ? 262  LYS A CE  1 
ATOM   829  N  NZ  . LYS A 1 108 ? 0.875   -0.997  49.470 1.00 48.14  ? 262  LYS A NZ  1 
ATOM   830  N  N   . LEU A 1 109 ? -5.354  2.013   48.150 1.00 23.04  ? 263  LEU A N   1 
ATOM   831  C  CA  . LEU A 1 109 ? -6.771  2.250   48.160 1.00 21.80  ? 263  LEU A CA  1 
ATOM   832  C  C   . LEU A 1 109 ? -7.303  2.021   49.593 1.00 21.87  ? 263  LEU A C   1 
ATOM   833  O  O   . LEU A 1 109 ? -7.113  0.958   50.146 1.00 22.58  ? 263  LEU A O   1 
ATOM   834  C  CB  . LEU A 1 109 ? -7.460  1.253   47.217 1.00 24.72  ? 263  LEU A CB  1 
ATOM   835  C  CG  . LEU A 1 109 ? -8.981  1.246   47.093 1.00 23.12  ? 263  LEU A CG  1 
ATOM   836  C  CD1 . LEU A 1 109 ? -9.534  2.595   46.712 1.00 23.82  ? 263  LEU A CD1 1 
ATOM   837  C  CD2 . LEU A 1 109 ? -9.431  0.170   46.085 1.00 25.58  ? 263  LEU A CD2 1 
ATOM   838  N  N   . TYR A 1 110 ? -8.021  3.013   50.124 1.00 21.52  ? 264  TYR A N   1 
ATOM   839  C  CA  . TYR A 1 110 ? -8.504  2.984   51.499 1.00 21.51  ? 264  TYR A CA  1 
ATOM   840  C  C   . TYR A 1 110 ? -9.990  3.272   51.481 1.00 19.39  ? 264  TYR A C   1 
ATOM   841  O  O   . TYR A 1 110 ? -10.480 4.063   50.684 1.00 19.95  ? 264  TYR A O   1 
ATOM   842  C  CB  . TYR A 1 110 ? -7.776  4.038   52.311 1.00 20.67  ? 264  TYR A CB  1 
ATOM   843  C  CG  . TYR A 1 110 ? -6.273  4.006   52.206 1.00 20.47  ? 264  TYR A CG  1 
ATOM   844  C  CD1 . TYR A 1 110 ? -5.549  2.922   52.683 1.00 21.35  ? 264  TYR A CD1 1 
ATOM   845  C  CD2 . TYR A 1 110 ? -5.585  5.053   51.629 1.00 22.12  ? 264  TYR A CD2 1 
ATOM   846  C  CE1 . TYR A 1 110 ? -4.171  2.898   52.599 1.00 21.91  ? 264  TYR A CE1 1 
ATOM   847  C  CE2 . TYR A 1 110 ? -4.200  5.032   51.538 1.00 22.01  ? 264  TYR A CE2 1 
ATOM   848  C  CZ  . TYR A 1 110 ? -3.514  3.950   52.027 1.00 23.06  ? 264  TYR A CZ  1 
ATOM   849  O  OH  . TYR A 1 110 ? -2.129  3.984   51.937 1.00 26.35  ? 264  TYR A OH  1 
ATOM   850  N  N   . GLY A 1 111 ? -10.720 2.656   52.395 1.00 19.10  ? 265  GLY A N   1 
ATOM   851  C  CA  . GLY A 1 111 ? -12.114 2.972   52.576 1.00 17.72  ? 265  GLY A CA  1 
ATOM   852  C  C   . GLY A 1 111 ? -12.703 2.136   53.703 1.00 18.26  ? 265  GLY A C   1 
ATOM   853  O  O   . GLY A 1 111 ? -11.971 1.381   54.349 1.00 18.82  ? 265  GLY A O   1 
ATOM   854  N  N   . PRO A 1 112 ? -14.011 2.253   53.953 1.00 18.06  ? 266  PRO A N   1 
ATOM   855  C  CA  . PRO A 1 112 ? -14.974 3.033   53.157 1.00 19.81  ? 266  PRO A CA  1 
ATOM   856  C  C   . PRO A 1 112 ? -15.292 4.401   53.746 1.00 19.27  ? 266  PRO A C   1 
ATOM   857  O  O   . PRO A 1 112 ? -16.293 5.030   53.372 1.00 19.80  ? 266  PRO A O   1 
ATOM   858  C  CB  . PRO A 1 112 ? -16.196 2.154   53.245 1.00 20.02  ? 266  PRO A CB  1 
ATOM   859  C  CG  . PRO A 1 112 ? -16.096 1.580   54.624 1.00 19.54  ? 266  PRO A CG  1 
ATOM   860  C  CD  . PRO A 1 112 ? -14.675 1.378   54.928 1.00 18.62  ? 266  PRO A CD  1 
ATOM   861  N  N   . ASP A 1 113 ? -14.513 4.835   54.725 1.00 20.12  ? 267  ASP A N   1 
ATOM   862  C  CA  . ASP A 1 113 ? -14.752 6.156   55.333 1.00 18.36  ? 267  ASP A CA  1 
ATOM   863  C  C   . ASP A 1 113 ? -16.148 6.311   55.903 1.00 17.13  ? 267  ASP A C   1 
ATOM   864  O  O   . ASP A 1 113 ? -16.780 7.372   55.800 1.00 18.82  ? 267  ASP A O   1 
ATOM   865  C  CB  . ASP A 1 113 ? -14.350 7.273   54.337 1.00 18.42  ? 267  ASP A CB  1 
ATOM   866  C  CG  . ASP A 1 113 ? -12.886 7.382   54.222 1.00 20.64  ? 267  ASP A CG  1 
ATOM   867  O  OD1 . ASP A 1 113 ? -12.319 8.088   55.094 1.00 21.07  ? 267  ASP A OD1 1 
ATOM   868  O  OD2 . ASP A 1 113 ? -12.262 6.674   53.379 1.00 20.34  ? 267  ASP A OD2 1 
ATOM   869  N  N   . VAL A 1 114 ? -16.617 5.257   56.576 1.00 19.11  ? 268  VAL A N   1 
ATOM   870  C  CA  . VAL A 1 114 ? -17.842 5.289   57.332 1.00 19.19  ? 268  VAL A CA  1 
ATOM   871  C  C   . VAL A 1 114 ? -17.671 6.119   58.594 1.00 21.68  ? 268  VAL A C   1 
ATOM   872  O  O   . VAL A 1 114 ? -16.568 6.290   59.129 1.00 18.70  ? 268  VAL A O   1 
ATOM   873  C  CB  . VAL A 1 114 ? -18.358 3.905   57.789 1.00 21.78  ? 268  VAL A CB  1 
ATOM   874  C  CG1 . VAL A 1 114 ? -18.949 3.172   56.585 1.00 24.43  ? 268  VAL A CG1 1 
ATOM   875  C  CG2 . VAL A 1 114 ? -17.283 3.087   58.498 1.00 20.41  ? 268  VAL A CG2 1 
ATOM   876  N  N   . GLY A 1 115 ? -18.786 6.570   59.110 1.00 19.99  ? 269  GLY A N   1 
ATOM   877  C  CA  . GLY A 1 115 ? -18.778 7.233   60.379 1.00 20.09  ? 269  GLY A CA  1 
ATOM   878  C  C   . GLY A 1 115 ? -18.645 6.240   61.517 1.00 19.76  ? 269  GLY A C   1 
ATOM   879  O  O   . GLY A 1 115 ? -18.354 5.075   61.355 1.00 18.95  ? 269  GLY A O   1 
ATOM   880  N  N   . GLN A 1 116 ? -18.805 6.752   62.712 1.00 20.09  ? 270  GLN A N   1 
ATOM   881  C  CA  . GLN A 1 116 ? -18.661 5.955   63.914 1.00 21.47  ? 270  GLN A CA  1 
ATOM   882  C  C   . GLN A 1 116 ? -19.704 4.823   63.953 1.00 21.84  ? 270  GLN A C   1 
ATOM   883  O  O   . GLN A 1 116 ? -20.782 4.954   63.354 1.00 24.14  ? 270  GLN A O   1 
ATOM   884  C  CB  . GLN A 1 116 ? -18.665 6.857   65.178 1.00 25.88  ? 270  GLN A CB  1 
ATOM   885  C  CG  . GLN A 1 116 ? -19.693 7.965   65.267 1.00 30.16  ? 270  GLN A CG  1 
ATOM   886  C  CD  . GLN A 1 116 ? -19.091 9.272   65.872 1.00 31.58  ? 270  GLN A CD  1 
ATOM   887  O  OE1 . GLN A 1 116 ? -19.184 9.472   67.096 1.00 34.65  ? 270  GLN A OE1 1 
ATOM   888  N  NE2 . GLN A 1 116 ? -18.522 10.192  65.000 1.00 28.06  ? 270  GLN A NE2 1 
ATOM   889  N  N   . PRO A 1 117 ? -19.350 3.685   64.550 1.00 21.75  ? 271  PRO A N   1 
ATOM   890  C  CA  . PRO A 1 117 ? -20.101 2.419   64.351 1.00 24.13  ? 271  PRO A CA  1 
ATOM   891  C  C   . PRO A 1 117 ? -21.392 2.202   65.143 1.00 26.21  ? 271  PRO A C   1 
ATOM   892  O  O   . PRO A 1 117 ? -21.545 1.181   65.812 1.00 30.83  ? 271  PRO A O   1 
ATOM   893  C  CB  . PRO A 1 117 ? -19.039 1.355   64.686 1.00 25.42  ? 271  PRO A CB  1 
ATOM   894  C  CG  . PRO A 1 117 ? -18.246 2.024   65.743 1.00 23.17  ? 271  PRO A CG  1 
ATOM   895  C  CD  . PRO A 1 117 ? -18.056 3.404   65.215 1.00 23.36  ? 271  PRO A CD  1 
ATOM   896  N  N   . ARG A 1 118 ? -22.339 3.097   64.953 1.00 27.81  ? 272  ARG A N   1 
ATOM   897  C  CA  . ARG A 1 118 ? -23.745 2.852   65.307 1.00 29.65  ? 272  ARG A CA  1 
ATOM   898  C  C   . ARG A 1 118 ? -24.254 1.655   64.501 1.00 28.53  ? 272  ARG A C   1 
ATOM   899  O  O   . ARG A 1 118 ? -23.670 1.284   63.482 1.00 24.70  ? 272  ARG A O   1 
ATOM   900  C  CB  . ARG A 1 118 ? -24.603 4.050   64.914 1.00 35.30  ? 272  ARG A CB  1 
ATOM   901  C  CG  . ARG A 1 118 ? -24.252 5.387   65.567 1.00 42.65  ? 272  ARG A CG  1 
ATOM   902  C  CD  . ARG A 1 118 ? -24.684 6.577   64.706 1.00 50.88  ? 272  ARG A CD  1 
ATOM   903  N  NE  . ARG A 1 118 ? -26.057 6.461   64.191 1.00 59.16  ? 272  ARG A NE  1 
ATOM   904  C  CZ  . ARG A 1 118 ? -26.407 6.075   62.956 1.00 68.74  ? 272  ARG A CZ  1 
ATOM   905  N  NH1 . ARG A 1 118 ? -25.489 5.743   62.047 1.00 70.46  ? 272  ARG A NH1 1 
ATOM   906  N  NH2 . ARG A 1 118 ? -27.701 6.010   62.622 1.00 67.66  ? 272  ARG A NH2 1 
ATOM   907  N  N   . ARG A 1 119 ? -25.380 1.087   64.918 1.00 28.10  ? 273  ARG A N   1 
ATOM   908  C  CA  . ARG A 1 119 ? -25.808 -0.190  64.367 1.00 30.27  ? 273  ARG A CA  1 
ATOM   909  C  C   . ARG A 1 119 ? -25.808 -0.250  62.833 1.00 27.74  ? 273  ARG A C   1 
ATOM   910  O  O   . ARG A 1 119 ? -25.216 -1.160  62.242 1.00 26.66  ? 273  ARG A O   1 
ATOM   911  C  CB  . ARG A 1 119 ? -27.206 -0.556  64.857 1.00 33.96  ? 273  ARG A CB  1 
ATOM   912  C  CG  . ARG A 1 119 ? -27.599 -1.966  64.433 1.00 42.43  ? 273  ARG A CG  1 
ATOM   913  C  CD  . ARG A 1 119 ? -29.020 -2.287  64.872 1.00 47.75  ? 273  ARG A CD  1 
ATOM   914  N  NE  . ARG A 1 119 ? -29.089 -3.655  65.374 1.00 58.87  ? 273  ARG A NE  1 
ATOM   915  C  CZ  . ARG A 1 119 ? -28.556 -4.076  66.526 1.00 66.94  ? 273  ARG A CZ  1 
ATOM   916  N  NH1 . ARG A 1 119 ? -27.886 -3.241  67.331 1.00 73.16  ? 273  ARG A NH1 1 
ATOM   917  N  NH2 . ARG A 1 119 ? -28.678 -5.354  66.872 1.00 71.07  ? 273  ARG A NH2 1 
ATOM   918  N  N   . LYS A 1 120 ? -26.469 0.696   62.220 1.00 26.71  ? 274  LYS A N   1 
ATOM   919  C  CA  . LYS A 1 120 ? -26.597 0.675   60.772 1.00 27.84  ? 274  LYS A CA  1 
ATOM   920  C  C   . LYS A 1 120 ? -25.259 0.886   60.048 1.00 26.50  ? 274  LYS A C   1 
ATOM   921  O  O   . LYS A 1 120 ? -25.034 0.325   58.985 1.00 26.28  ? 274  LYS A O   1 
ATOM   922  C  CB  . LYS A 1 120 ? -27.650 1.682   60.319 1.00 30.99  ? 274  LYS A CB  1 
ATOM   923  C  CG  . LYS A 1 120 ? -29.065 1.151   60.511 1.00 36.11  ? 274  LYS A CG  1 
ATOM   924  C  CD  . LYS A 1 120 ? -30.114 2.126   59.978 1.00 41.31  ? 274  LYS A CD  1 
ATOM   925  C  CE  . LYS A 1 120 ? -31.505 1.511   60.033 1.00 45.89  ? 274  LYS A CE  1 
ATOM   926  N  NZ  . LYS A 1 120 ? -32.545 2.565   59.886 1.00 48.01  ? 274  LYS A NZ  1 
ATOM   927  N  N   . THR A 1 121 ? -24.378 1.690   60.640 1.00 23.43  ? 275  THR A N   1 
ATOM   928  C  CA  . THR A 1 121 ? -23.066 1.901   60.074 1.00 22.57  ? 275  THR A CA  1 
ATOM   929  C  C   . THR A 1 121 ? -22.231 0.650   60.212 1.00 22.26  ? 275  THR A C   1 
ATOM   930  O  O   . THR A 1 121 ? -21.530 0.303   59.279 1.00 20.59  ? 275  THR A O   1 
ATOM   931  C  CB  . THR A 1 121 ? -22.387 3.123   60.708 1.00 22.96  ? 275  THR A CB  1 
ATOM   932  O  OG1 . THR A 1 121 ? -23.200 4.276   60.430 1.00 24.24  ? 275  THR A OG1 1 
ATOM   933  C  CG2 . THR A 1 121 ? -21.012 3.328   60.125 1.00 23.48  ? 275  THR A CG2 1 
ATOM   934  N  N   . ALA A 1 122 ? -22.317 -0.018  61.367 1.00 21.41  ? 276  ALA A N   1 
ATOM   935  C  CA  . ALA A 1 122 ? -21.564 -1.220  61.595 1.00 22.25  ? 276  ALA A CA  1 
ATOM   936  C  C   . ALA A 1 122 ? -21.971 -2.312  60.587 1.00 24.43  ? 276  ALA A C   1 
ATOM   937  O  O   . ALA A 1 122 ? -21.129 -3.033  60.076 1.00 22.27  ? 276  ALA A O   1 
ATOM   938  C  CB  . ALA A 1 122 ? -21.723 -1.721  63.012 1.00 23.26  ? 276  ALA A CB  1 
ATOM   939  N  N   . LYS A 1 123 ? -23.276 -2.403  60.324 1.00 25.23  ? 277  LYS A N   1 
ATOM   940  C  CA  . LYS A 1 123 ? -23.815 -3.332  59.341 1.00 26.92  ? 277  LYS A CA  1 
ATOM   941  C  C   . LYS A 1 123 ? -23.255 -3.057  57.934 1.00 25.78  ? 277  LYS A C   1 
ATOM   942  O  O   . LYS A 1 123 ? -22.835 -3.988  57.239 1.00 28.09  ? 277  LYS A O   1 
ATOM   943  C  CB  . LYS A 1 123 ? -25.345 -3.217  59.371 1.00 28.39  ? 277  LYS A CB  1 
ATOM   944  C  CG  . LYS A 1 123 ? -26.129 -4.032  58.359 1.00 32.83  ? 277  LYS A CG  1 
ATOM   945  C  CD  . LYS A 1 123 ? -27.638 -3.805  58.620 1.00 38.42  ? 277  LYS A CD  1 
ATOM   946  C  CE  . LYS A 1 123 ? -28.536 -4.263  57.476 1.00 41.92  ? 277  LYS A CE  1 
ATOM   947  N  NZ  . LYS A 1 123 ? -28.452 -5.732  57.330 1.00 44.67  ? 277  LYS A NZ  1 
ATOM   948  N  N   . MET A 1 124 ? -23.233 -1.786  57.549 1.00 24.75  ? 278  MET A N   1 
ATOM   949  C  CA  . MET A 1 124 ? -22.688 -1.355  56.249 1.00 24.80  ? 278  MET A CA  1 
ATOM   950  C  C   . MET A 1 124 ? -21.215 -1.626  56.171 1.00 23.56  ? 278  MET A C   1 
ATOM   951  O  O   . MET A 1 124 ? -20.713 -2.126  55.145 1.00 21.66  ? 278  MET A O   1 
ATOM   952  C  CB  . MET A 1 124 ? -22.972 0.110   56.010 1.00 24.33  ? 278  MET A CB  1 
ATOM   953  C  CG  . MET A 1 124 ? -22.367 0.639   54.724 1.00 27.93  ? 278  MET A CG  1 
ATOM   954  S  SD  . MET A 1 124 ? -22.814 2.337   54.344 1.00 27.79  ? 278  MET A SD  1 
ATOM   955  C  CE  . MET A 1 124 ? -24.549 2.177   53.911 1.00 27.86  ? 278  MET A CE  1 
ATOM   956  N  N   . LEU A 1 125 ? -20.499 -1.334  57.261 1.00 20.22  ? 279  LEU A N   1 
ATOM   957  C  CA  . LEU A 1 125 ? -19.080 -1.654  57.283 1.00 21.02  ? 279  LEU A CA  1 
ATOM   958  C  C   . LEU A 1 125 ? -18.803 -3.171  57.113 1.00 21.13  ? 279  LEU A C   1 
ATOM   959  O  O   . LEU A 1 125 ? -17.878 -3.563  56.404 1.00 22.48  ? 279  LEU A O   1 
ATOM   960  C  CB  . LEU A 1 125 ? -18.414 -1.138  58.572 1.00 20.58  ? 279  LEU A CB  1 
ATOM   961  C  CG  . LEU A 1 125 ? -16.940 -1.517  58.677 1.00 20.75  ? 279  LEU A CG  1 
ATOM   962  C  CD1 . LEU A 1 125 ? -16.153 -0.845  57.579 1.00 23.37  ? 279  LEU A CD1 1 
ATOM   963  C  CD2 . LEU A 1 125 ? -16.411 -1.058  60.030 1.00 23.13  ? 279  LEU A CD2 1 
ATOM   964  N  N   . LYS A 1 126 ? -19.578 -4.013  57.787 1.00 21.33  ? 280  LYS A N   1 
ATOM   965  C  CA  . LYS A 1 126 ? -19.383 -5.463  57.743 1.00 24.10  ? 280  LYS A CA  1 
ATOM   966  C  C   . LYS A 1 126 ? -19.596 -6.028  56.333 1.00 24.80  ? 280  LYS A C   1 
ATOM   967  O  O   . LYS A 1 126 ? -18.756 -6.766  55.814 1.00 25.84  ? 280  LYS A O   1 
ATOM   968  C  CB  . LYS A 1 126 ? -20.355 -6.131  58.720 1.00 26.98  ? 280  LYS A CB  1 
ATOM   969  C  CG  . LYS A 1 126 ? -20.073 -7.607  58.875 1.00 30.65  ? 280  LYS A CG  1 
ATOM   970  C  CD  . LYS A 1 126 ? -20.932 -8.248  59.949 1.00 34.79  ? 280  LYS A CD  1 
ATOM   971  C  CE  . LYS A 1 126 ? -20.460 -9.675  60.198 1.00 42.70  ? 280  LYS A CE  1 
ATOM   972  N  NZ  . LYS A 1 126 ? -20.752 -10.093 61.591 1.00 49.64  ? 280  LYS A NZ  1 
ATOM   973  N  N   . SER A 1 127 ? -20.700 -5.625  55.724 1.00 25.68  ? 281  SER A N   1 
ATOM   974  C  CA  . SER A 1 127 ? -21.046 -6.106  54.390 1.00 28.18  ? 281  SER A CA  1 
ATOM   975  C  C   . SER A 1 127 ? -20.071 -5.548  53.354 1.00 25.87  ? 281  SER A C   1 
ATOM   976  O  O   . SER A 1 127 ? -19.659 -6.256  52.442 1.00 27.74  ? 281  SER A O   1 
ATOM   977  C  CB  . SER A 1 127 ? -22.493 -5.809  54.090 1.00 29.42  ? 281  SER A CB  1 
ATOM   978  O  OG  . SER A 1 127 ? -22.764 -4.450  54.130 1.00 37.30  ? 281  SER A OG  1 
ATOM   979  N  N   . PHE A 1 128 ? -19.655 -4.295  53.538 1.00 22.27  ? 282  PHE A N   1 
ATOM   980  C  CA  . PHE A 1 128 ? -18.572 -3.721  52.747 1.00 21.86  ? 282  PHE A CA  1 
ATOM   981  C  C   . PHE A 1 128 ? -17.320 -4.549  52.819 1.00 24.03  ? 282  PHE A C   1 
ATOM   982  O  O   . PHE A 1 128 ? -16.694 -4.847  51.779 1.00 22.95  ? 282  PHE A O   1 
ATOM   983  C  CB  . PHE A 1 128 ? -18.229 -2.270  53.179 1.00 21.83  ? 282  PHE A CB  1 
ATOM   984  C  CG  . PHE A 1 128 ? -17.037 -1.723  52.490 1.00 21.56  ? 282  PHE A CG  1 
ATOM   985  C  CD1 . PHE A 1 128 ? -17.152 -1.277  51.184 1.00 22.62  ? 282  PHE A CD1 1 
ATOM   986  C  CD2 . PHE A 1 128 ? -15.753 -1.729  53.091 1.00 22.33  ? 282  PHE A CD2 1 
ATOM   987  C  CE1 . PHE A 1 128 ? -16.064 -0.797  50.509 1.00 23.51  ? 282  PHE A CE1 1 
ATOM   988  C  CE2 . PHE A 1 128 ? -14.656 -1.245  52.405 1.00 21.93  ? 282  PHE A CE2 1 
ATOM   989  C  CZ  . PHE A 1 128 ? -14.811 -0.788  51.093 1.00 23.43  ? 282  PHE A CZ  1 
ATOM   990  N  N   . LEU A 1 129 ? -16.873 -4.860  54.045 1.00 21.75  ? 283  LEU A N   1 
ATOM   991  C  CA  . LEU A 1 129 ? -15.606 -5.614  54.182 1.00 22.82  ? 283  LEU A CA  1 
ATOM   992  C  C   . LEU A 1 129 ? -15.750 -7.037  53.620 1.00 23.74  ? 283  LEU A C   1 
ATOM   993  O  O   . LEU A 1 129 ? -14.820 -7.535  53.012 1.00 23.01  ? 283  LEU A O   1 
ATOM   994  C  CB  . LEU A 1 129 ? -15.132 -5.651  55.632 1.00 23.96  ? 283  LEU A CB  1 
ATOM   995  C  CG  . LEU A 1 129 ? -14.564 -4.311  56.107 1.00 23.71  ? 283  LEU A CG  1 
ATOM   996  C  CD1 . LEU A 1 129 ? -14.211 -4.433  57.601 1.00 25.92  ? 283  LEU A CD1 1 
ATOM   997  C  CD2 . LEU A 1 129 ? -13.365 -3.808  55.320 1.00 25.20  ? 283  LEU A CD2 1 
ATOM   998  N  N   . LYS A 1 130 ? -16.911 -7.666  53.808 1.00 24.95  ? 284  LYS A N   1 
ATOM   999  C  CA  . LYS A 1 130 ? -17.127 -9.018  53.213 1.00 31.79  ? 284  LYS A CA  1 
ATOM   1000 C  C   . LYS A 1 130 ? -16.943 -8.969  51.695 1.00 30.93  ? 284  LYS A C   1 
ATOM   1001 O  O   . LYS A 1 130 ? -16.192 -9.762  51.145 1.00 29.06  ? 284  LYS A O   1 
ATOM   1002 C  CB  . LYS A 1 130 ? -18.523 -9.543  53.520 1.00 36.66  ? 284  LYS A CB  1 
ATOM   1003 C  CG  . LYS A 1 130 ? -18.682 -10.189 54.870 1.00 44.33  ? 284  LYS A CG  1 
ATOM   1004 C  CD  . LYS A 1 130 ? -19.985 -10.998 54.922 1.00 52.43  ? 284  LYS A CD  1 
ATOM   1005 C  CE  . LYS A 1 130 ? -20.566 -11.065 56.324 1.00 54.93  ? 284  LYS A CE  1 
ATOM   1006 N  NZ  . LYS A 1 130 ? -19.698 -11.827 57.263 1.00 57.86  ? 284  LYS A NZ  1 
ATOM   1007 N  N   . ALA A 1 131 ? -17.587 -7.989  51.065 1.00 31.49  ? 285  ALA A N   1 
ATOM   1008 C  CA  . ALA A 1 131 ? -17.601 -7.808  49.603 1.00 30.70  ? 285  ALA A CA  1 
ATOM   1009 C  C   . ALA A 1 131 ? -16.312 -7.239  48.988 1.00 33.64  ? 285  ALA A C   1 
ATOM   1010 O  O   . ALA A 1 131 ? -15.748 -7.814  48.040 1.00 33.25  ? 285  ALA A O   1 
ATOM   1011 C  CB  . ALA A 1 131 ? -18.780 -6.939  49.215 1.00 31.00  ? 285  ALA A CB  1 
ATOM   1012 N  N   . GLY A 1 132 ? -15.838 -6.131  49.535 1.00 27.58  ? 286  GLY A N   1 
ATOM   1013 C  CA  . GLY A 1 132 ? -14.718 -5.378  48.965 1.00 27.56  ? 286  GLY A CA  1 
ATOM   1014 C  C   . GLY A 1 132 ? -13.414 -5.346  49.746 1.00 26.40  ? 286  GLY A C   1 
ATOM   1015 O  O   . GLY A 1 132 ? -12.458 -4.723  49.328 1.00 25.68  ? 286  GLY A O   1 
ATOM   1016 N  N   . GLY A 1 133 ? -13.390 -6.015  50.896 1.00 27.78  ? 287  GLY A N   1 
ATOM   1017 C  CA  . GLY A 1 133 ? -12.271 -5.945  51.786 1.00 27.03  ? 287  GLY A CA  1 
ATOM   1018 C  C   . GLY A 1 133 ? -10.949 -6.428  51.262 1.00 27.01  ? 287  GLY A C   1 
ATOM   1019 O  O   . GLY A 1 133 ? -9.893  -6.010  51.728 1.00 27.63  ? 287  GLY A O   1 
ATOM   1020 N  N   . GLU A 1 134 ? -10.972 -7.306  50.259 1.00 27.02  ? 288  GLU A N   1 
ATOM   1021 C  CA  . GLU A 1 134 ? -9.730  -7.827  49.724 1.00 30.28  ? 288  GLU A CA  1 
ATOM   1022 C  C   . GLU A 1 134 ? -8.927  -6.754  49.021 1.00 28.65  ? 288  GLU A C   1 
ATOM   1023 O  O   . GLU A 1 134 ? -7.689  -6.835  49.002 1.00 29.99  ? 288  GLU A O   1 
ATOM   1024 C  CB  . GLU A 1 134 ? -10.005 -8.995  48.765 1.00 35.70  ? 288  GLU A CB  1 
ATOM   1025 C  CG  . GLU A 1 134 ? -8.861  -9.975  48.646 1.00 43.65  ? 288  GLU A CG  1 
ATOM   1026 C  CD  . GLU A 1 134 ? -9.134  -11.035 47.580 1.00 55.84  ? 288  GLU A CD  1 
ATOM   1027 O  OE1 . GLU A 1 134 ? -10.328 -11.391 47.356 1.00 56.74  ? 288  GLU A OE1 1 
ATOM   1028 O  OE2 . GLU A 1 134 ? -8.150  -11.499 46.956 1.00 60.78  ? 288  GLU A OE2 1 
ATOM   1029 N  N   . VAL A 1 135 ? -9.594  -5.739  48.459 1.00 24.41  ? 289  VAL A N   1 
ATOM   1030 C  CA  . VAL A 1 135 ? -8.893  -4.729  47.685 1.00 26.25  ? 289  VAL A CA  1 
ATOM   1031 C  C   . VAL A 1 135 ? -8.463  -3.435  48.418 1.00 27.86  ? 289  VAL A C   1 
ATOM   1032 O  O   . VAL A 1 135 ? -7.747  -2.597  47.854 1.00 25.93  ? 289  VAL A O   1 
ATOM   1033 C  CB  . VAL A 1 135 ? -9.652  -4.388  46.398 1.00 27.69  ? 289  VAL A CB  1 
ATOM   1034 C  CG1 . VAL A 1 135 ? -9.971  -5.678  45.618 1.00 30.01  ? 289  VAL A CG1 1 
ATOM   1035 C  CG2 . VAL A 1 135 ? -10.928 -3.581  46.636 1.00 27.71  ? 289  VAL A CG2 1 
ATOM   1036 N  N   . ILE A 1 136 ? -8.830  -3.289  49.685 1.00 27.92  ? 290  ILE A N   1 
ATOM   1037 C  CA  . ILE A 1 136 ? -8.434  -2.080  50.412 1.00 27.12  ? 290  ILE A CA  1 
ATOM   1038 C  C   . ILE A 1 136 ? -7.184  -2.394  51.227 1.00 24.87  ? 290  ILE A C   1 
ATOM   1039 O  O   . ILE A 1 136 ? -6.987  -3.520  51.675 1.00 28.36  ? 290  ILE A O   1 
ATOM   1040 C  CB  . ILE A 1 136 ? -9.558  -1.497  51.281 1.00 28.08  ? 290  ILE A CB  1 
ATOM   1041 C  CG1 . ILE A 1 136 ? -10.065 -2.505  52.297 1.00 29.19  ? 290  ILE A CG1 1 
ATOM   1042 C  CG2 . ILE A 1 136 ? -10.706 -0.960  50.411 1.00 29.25  ? 290  ILE A CG2 1 
ATOM   1043 C  CD1 . ILE A 1 136 ? -10.910 -1.909  53.381 1.00 28.25  ? 290  ILE A CD1 1 
ATOM   1044 N  N   . ASP A 1 137 ? -6.347  -1.394  51.367 1.00 21.50  ? 291  ASP A N   1 
ATOM   1045 C  CA  . ASP A 1 137 ? -5.117  -1.500  52.046 1.00 23.24  ? 291  ASP A CA  1 
ATOM   1046 C  C   . ASP A 1 137 ? -5.275  -1.211  53.545 1.00 22.82  ? 291  ASP A C   1 
ATOM   1047 O  O   . ASP A 1 137 ? -4.526  -1.752  54.349 1.00 22.94  ? 291  ASP A O   1 
ATOM   1048 C  CB  . ASP A 1 137 ? -4.086  -0.613  51.373 1.00 23.98  ? 291  ASP A CB  1 
ATOM   1049 C  CG  . ASP A 1 137 ? -3.762  -1.138  49.952 1.00 26.32  ? 291  ASP A CG  1 
ATOM   1050 O  OD1 . ASP A 1 137 ? -3.202  -2.245  49.898 1.00 29.11  ? 291  ASP A OD1 1 
ATOM   1051 O  OD2 . ASP A 1 137 ? -4.169  -0.497  48.962 1.00 23.17  ? 291  ASP A OD2 1 
ATOM   1052 N  N   . SER A 1 138 ? -6.258  -0.399  53.888 1.00 23.33  ? 292  SER A N   1 
ATOM   1053 C  CA  . SER A 1 138 ? -6.593  -0.091  55.291 1.00 22.38  ? 292  SER A CA  1 
ATOM   1054 C  C   . SER A 1 138 ? -8.065  0.226   55.331 1.00 21.83  ? 292  SER A C   1 
ATOM   1055 O  O   . SER A 1 138 ? -8.621  0.746   54.344 1.00 22.23  ? 292  SER A O   1 
ATOM   1056 C  CB  . SER A 1 138 ? -5.834  1.126   55.795 1.00 24.72  ? 292  SER A CB  1 
ATOM   1057 O  OG  . SER A 1 138 ? -4.422  0.979   55.640 1.00 28.80  ? 292  SER A OG  1 
ATOM   1058 N  N   . VAL A 1 139 ? -8.676  -0.031  56.476 1.00 19.42  ? 293  VAL A N   1 
ATOM   1059 C  CA  . VAL A 1 139 ? -10.076 0.295   56.709 1.00 20.38  ? 293  VAL A CA  1 
ATOM   1060 C  C   . VAL A 1 139 ? -10.124 1.675   57.318 1.00 21.26  ? 293  VAL A C   1 
ATOM   1061 O  O   . VAL A 1 139 ? -9.526  1.878   58.348 1.00 20.80  ? 293  VAL A O   1 
ATOM   1062 C  CB  . VAL A 1 139 ? -10.717 -0.710  57.706 1.00 22.16  ? 293  VAL A CB  1 
ATOM   1063 C  CG1 . VAL A 1 139 ? -12.168 -0.380  57.927 1.00 23.56  ? 293  VAL A CG1 1 
ATOM   1064 C  CG2 . VAL A 1 139 ? -10.518 -2.145  57.200 1.00 25.84  ? 293  VAL A CG2 1 
ATOM   1065 N  N   . THR A 1 140 ? -10.918 2.577   56.755 1.00 19.34  ? 294  THR A N   1 
ATOM   1066 C  CA  . THR A 1 140 ? -11.034 3.952   57.276 1.00 18.78  ? 294  THR A CA  1 
ATOM   1067 C  C   . THR A 1 140 ? -12.424 4.194   57.840 1.00 18.86  ? 294  THR A C   1 
ATOM   1068 O  O   . THR A 1 140 ? -13.456 3.775   57.289 1.00 19.35  ? 294  THR A O   1 
ATOM   1069 C  CB  . THR A 1 140 ? -10.782 5.003   56.189 1.00 18.39  ? 294  THR A CB  1 
ATOM   1070 O  OG1 . THR A 1 140 ? -11.587 4.689   55.055 1.00 20.42  ? 294  THR A OG1 1 
ATOM   1071 C  CG2 . THR A 1 140 ? -9.263  5.057   55.814 1.00 20.01  ? 294  THR A CG2 1 
ATOM   1072 N  N   . TRP A 1 141 ? -12.451 4.842   59.001 1.00 17.24  ? 295  TRP A N   1 
ATOM   1073 C  CA  . TRP A 1 141 ? -13.680 5.284   59.640 1.00 16.53  ? 295  TRP A CA  1 
ATOM   1074 C  C   . TRP A 1 141 ? -13.432 6.617   60.328 1.00 17.94  ? 295  TRP A C   1 
ATOM   1075 O  O   . TRP A 1 141 ? -12.270 7.068   60.468 1.00 16.30  ? 295  TRP A O   1 
ATOM   1076 C  CB  . TRP A 1 141 ? -14.171 4.250   60.669 1.00 17.29  ? 295  TRP A CB  1 
ATOM   1077 C  CG  . TRP A 1 141 ? -13.291 4.049   61.835 1.00 17.02  ? 295  TRP A CG  1 
ATOM   1078 C  CD1 . TRP A 1 141 ? -12.089 3.415   61.857 1.00 16.16  ? 295  TRP A CD1 1 
ATOM   1079 C  CD2 . TRP A 1 141 ? -13.534 4.471   63.194 1.00 17.06  ? 295  TRP A CD2 1 
ATOM   1080 N  NE1 . TRP A 1 141 ? -11.565 3.410   63.144 1.00 18.08  ? 295  TRP A NE1 1 
ATOM   1081 C  CE2 . TRP A 1 141 ? -12.438 4.051   63.974 1.00 17.26  ? 295  TRP A CE2 1 
ATOM   1082 C  CE3 . TRP A 1 141 ? -14.577 5.152   63.817 1.00 18.38  ? 295  TRP A CE3 1 
ATOM   1083 C  CZ2 . TRP A 1 141 ? -12.378 4.288   65.358 1.00 17.17  ? 295  TRP A CZ2 1 
ATOM   1084 C  CZ3 . TRP A 1 141 ? -14.508 5.388   65.177 1.00 17.86  ? 295  TRP A CZ3 1 
ATOM   1085 C  CH2 . TRP A 1 141 ? -13.422 4.974   65.915 1.00 17.77  ? 295  TRP A CH2 1 
ATOM   1086 N  N   . HIS A 1 142 ? -14.514 7.272   60.688 1.00 16.81  ? 296  HIS A N   1 
ATOM   1087 C  CA  . HIS A 1 142 ? -14.456 8.644   61.173 1.00 18.18  ? 296  HIS A CA  1 
ATOM   1088 C  C   . HIS A 1 142 ? -15.008 8.761   62.584 1.00 17.63  ? 296  HIS A C   1 
ATOM   1089 O  O   . HIS A 1 142 ? -15.896 7.999   62.972 1.00 18.15  ? 296  HIS A O   1 
ATOM   1090 C  CB  . HIS A 1 142 ? -15.248 9.565   60.277 1.00 18.62  ? 296  HIS A CB  1 
ATOM   1091 C  CG  . HIS A 1 142 ? -14.798 9.589   58.861 1.00 19.33  ? 296  HIS A CG  1 
ATOM   1092 N  ND1 . HIS A 1 142 ? -15.368 10.441  57.938 1.00 19.75  ? 296  HIS A ND1 1 
ATOM   1093 C  CD2 . HIS A 1 142 ? -13.803 8.942   58.210 1.00 19.57  ? 296  HIS A CD2 1 
ATOM   1094 C  CE1 . HIS A 1 142 ? -14.757 10.296  56.775 1.00 20.86  ? 296  HIS A CE1 1 
ATOM   1095 N  NE2 . HIS A 1 142 ? -13.795 9.410   56.915 1.00 20.01  ? 296  HIS A NE2 1 
ATOM   1096 N  N   . HIS A 1 143 ? -14.533 9.772   63.323 1.00 16.97  ? 297  HIS A N   1 
ATOM   1097 C  CA  . HIS A 1 143 ? -14.992 10.001  64.662 1.00 17.41  ? 297  HIS A CA  1 
ATOM   1098 C  C   . HIS A 1 143 ? -14.982 11.445  65.095 1.00 16.50  ? 297  HIS A C   1 
ATOM   1099 O  O   . HIS A 1 143 ? -13.972 12.154  64.899 1.00 16.34  ? 297  HIS A O   1 
ATOM   1100 C  CB  . HIS A 1 143 ? -14.172 9.186   65.673 1.00 15.60  ? 297  HIS A CB  1 
ATOM   1101 C  CG  . HIS A 1 143 ? -14.669 9.353   67.062 1.00 15.57  ? 297  HIS A CG  1 
ATOM   1102 N  ND1 . HIS A 1 143 ? -14.235 10.353  67.886 1.00 17.34  ? 297  HIS A ND1 1 
ATOM   1103 C  CD2 . HIS A 1 143 ? -15.641 8.701   67.756 1.00 16.00  ? 297  HIS A CD2 1 
ATOM   1104 C  CE1 . HIS A 1 143 ? -14.874 10.314  69.029 1.00 17.98  ? 297  HIS A CE1 1 
ATOM   1105 N  NE2 . HIS A 1 143 ? -15.740 9.320   68.980 1.00 17.13  ? 297  HIS A NE2 1 
ATOM   1106 N  N   . TYR A 1 144 ? -16.089 11.909  65.660 1.00 16.64  ? 298  TYR A N   1 
ATOM   1107 C  CA  . TYR A 1 144 ? -16.122 13.173  66.354 1.00 17.46  ? 298  TYR A CA  1 
ATOM   1108 C  C   . TYR A 1 144 ? -16.848 12.948  67.668 1.00 17.63  ? 298  TYR A C   1 
ATOM   1109 O  O   . TYR A 1 144 ? -17.800 12.145  67.736 1.00 18.73  ? 298  TYR A O   1 
ATOM   1110 C  CB  . TYR A 1 144 ? -16.883 14.192  65.540 1.00 17.90  ? 298  TYR A CB  1 
ATOM   1111 C  CG  . TYR A 1 144 ? -16.283 14.596  64.216 1.00 17.83  ? 298  TYR A CG  1 
ATOM   1112 C  CD1 . TYR A 1 144 ? -16.352 13.780  63.095 1.00 18.45  ? 298  TYR A CD1 1 
ATOM   1113 C  CD2 . TYR A 1 144 ? -15.672 15.844  64.063 1.00 18.88  ? 298  TYR A CD2 1 
ATOM   1114 C  CE1 . TYR A 1 144 ? -15.813 14.181  61.889 1.00 19.48  ? 298  TYR A CE1 1 
ATOM   1115 C  CE2 . TYR A 1 144 ? -15.173 16.251  62.849 1.00 19.43  ? 298  TYR A CE2 1 
ATOM   1116 C  CZ  . TYR A 1 144 ? -15.202 15.403  61.776 1.00 20.12  ? 298  TYR A CZ  1 
ATOM   1117 O  OH  . TYR A 1 144 ? -14.718 15.807  60.554 1.00 20.95  ? 298  TYR A OH  1 
ATOM   1118 N  N   . TYR A 1 145 ? -16.463 13.640  68.736 1.00 16.28  ? 299  TYR A N   1 
ATOM   1119 C  CA  . TYR A 1 145 ? -17.096 13.371  70.003 1.00 18.04  ? 299  TYR A CA  1 
ATOM   1120 C  C   . TYR A 1 145 ? -18.499 13.968  70.138 1.00 18.61  ? 299  TYR A C   1 
ATOM   1121 O  O   . TYR A 1 145 ? -19.398 13.327  70.712 1.00 20.23  ? 299  TYR A O   1 
ATOM   1122 C  CB  . TYR A 1 145 ? -16.253 13.935  71.151 1.00 17.34  ? 299  TYR A CB  1 
ATOM   1123 C  CG  . TYR A 1 145 ? -14.904 13.282  71.335 1.00 16.72  ? 299  TYR A CG  1 
ATOM   1124 C  CD1 . TYR A 1 145 ? -13.787 13.798  70.708 1.00 16.77  ? 299  TYR A CD1 1 
ATOM   1125 C  CD2 . TYR A 1 145 ? -14.732 12.212  72.237 1.00 17.16  ? 299  TYR A CD2 1 
ATOM   1126 C  CE1 . TYR A 1 145 ? -12.551 13.224  70.895 1.00 17.68  ? 299  TYR A CE1 1 
ATOM   1127 C  CE2 . TYR A 1 145 ? -13.479 11.645  72.441 1.00 16.08  ? 299  TYR A CE2 1 
ATOM   1128 C  CZ  . TYR A 1 145 ? -12.375 12.225  71.794 1.00 17.23  ? 299  TYR A CZ  1 
ATOM   1129 O  OH  . TYR A 1 145 ? -11.090 11.690  71.917 1.00 17.84  ? 299  TYR A OH  1 
ATOM   1130 N  N   . LEU A 1 146 ? -18.647 15.185  69.613 1.00 20.33  ? 300  LEU A N   1 
ATOM   1131 C  CA  . LEU A 1 146 ? -19.771 16.084  69.935 1.00 23.00  ? 300  LEU A CA  1 
ATOM   1132 C  C   . LEU A 1 146 ? -20.183 16.883  68.724 1.00 21.29  ? 300  LEU A C   1 
ATOM   1133 O  O   . LEU A 1 146 ? -19.423 17.087  67.836 1.00 21.08  ? 300  LEU A O   1 
ATOM   1134 C  CB  . LEU A 1 146 ? -19.336 17.150  70.980 1.00 27.21  ? 300  LEU A CB  1 
ATOM   1135 C  CG  . LEU A 1 146 ? -18.928 16.691  72.364 1.00 30.50  ? 300  LEU A CG  1 
ATOM   1136 C  CD1 . LEU A 1 146 ? -17.970 17.686  73.018 1.00 36.79  ? 300  LEU A CD1 1 
ATOM   1137 C  CD2 . LEU A 1 146 ? -20.149 16.478  73.215 1.00 37.19  ? 300  LEU A CD2 1 
ATOM   1138 N  N   . ASN A 1 147 ? -21.414 17.375  68.751 1.00 21.86  ? 301  ASN A N   1 
ATOM   1139 C  CA  . ASN A 1 147 ? -21.862 18.439  67.891 1.00 22.88  ? 301  ASN A CA  1 
ATOM   1140 C  C   . ASN A 1 147 ? -21.294 19.763  68.335 1.00 22.79  ? 301  ASN A C   1 
ATOM   1141 O  O   . ASN A 1 147 ? -21.437 20.184  69.499 1.00 23.47  ? 301  ASN A O   1 
ATOM   1142 C  CB  . ASN A 1 147 ? -23.403 18.533  68.010 1.00 24.62  ? 301  ASN A CB  1 
ATOM   1143 C  CG  . ASN A 1 147 ? -24.013 19.562  67.063 1.00 29.74  ? 301  ASN A CG  1 
ATOM   1144 O  OD1 . ASN A 1 147 ? -23.318 20.335  66.426 1.00 31.41  ? 301  ASN A OD1 1 
ATOM   1145 N  ND2 . ASN A 1 147 ? -25.327 19.549  66.953 1.00 28.43  ? 301  ASN A ND2 1 
ATOM   1146 N  N   . GLY A 1 148 ? -20.622 20.444  67.421 1.00 23.36  ? 302  GLY A N   1 
ATOM   1147 C  CA  . GLY A 1 148 ? -19.967 21.722  67.752 1.00 23.06  ? 302  GLY A CA  1 
ATOM   1148 C  C   . GLY A 1 148 ? -20.950 22.784  68.222 1.00 26.66  ? 302  GLY A C   1 
ATOM   1149 O  O   . GLY A 1 148 ? -20.607 23.636  69.020 1.00 24.90  ? 302  GLY A O   1 
ATOM   1150 N  N   . ARG A 1 149 ? -22.181 22.716  67.746 1.00 26.74  ? 303  ARG A N   1 
ATOM   1151 C  CA  . ARG A 1 149 ? -23.152 23.752  68.087 1.00 30.26  ? 303  ARG A CA  1 
ATOM   1152 C  C   . ARG A 1 149 ? -23.533 23.801  69.554 1.00 30.74  ? 303  ARG A C   1 
ATOM   1153 O  O   . ARG A 1 149 ? -23.783 24.897  70.100 1.00 33.00  ? 303  ARG A O   1 
ATOM   1154 C  CB  . ARG A 1 149 ? -24.376 23.596  67.193 1.00 33.75  ? 303  ARG A CB  1 
ATOM   1155 C  CG  . ARG A 1 149 ? -24.044 23.976  65.770 1.00 43.53  ? 303  ARG A CG  1 
ATOM   1156 C  CD  . ARG A 1 149 ? -25.194 23.791  64.792 1.00 51.53  ? 303  ARG A CD  1 
ATOM   1157 N  NE  . ARG A 1 149 ? -24.666 23.701  63.420 1.00 60.42  ? 303  ARG A NE  1 
ATOM   1158 C  CZ  . ARG A 1 149 ? -24.911 22.726  62.538 1.00 66.35  ? 303  ARG A CZ  1 
ATOM   1159 N  NH1 . ARG A 1 149 ? -24.335 22.777  61.332 1.00 71.69  ? 303  ARG A NH1 1 
ATOM   1160 N  NH2 . ARG A 1 149 ? -25.712 21.696  62.831 1.00 70.69  ? 303  ARG A NH2 1 
ATOM   1161 N  N   . THR A 1 150 ? -23.504 22.643  70.215 1.00 28.16  ? 304  THR A N   1 
ATOM   1162 C  CA  . THR A 1 150 ? -23.944 22.517  71.597 1.00 29.55  ? 304  THR A CA  1 
ATOM   1163 C  C   . THR A 1 150 ? -22.868 22.167  72.596 1.00 25.99  ? 304  THR A C   1 
ATOM   1164 O  O   . THR A 1 150 ? -23.082 22.238  73.814 1.00 23.93  ? 304  THR A O   1 
ATOM   1165 C  CB  . THR A 1 150 ? -25.058 21.438  71.687 1.00 29.04  ? 304  THR A CB  1 
ATOM   1166 O  OG1 . THR A 1 150 ? -24.632 20.213  71.080 1.00 28.45  ? 304  THR A OG1 1 
ATOM   1167 C  CG2 . THR A 1 150 ? -26.302 21.926  70.951 1.00 31.92  ? 304  THR A CG2 1 
ATOM   1168 N  N   . ALA A 1 151 ? -21.686 21.789  72.107 1.00 23.63  ? 305  ALA A N   1 
ATOM   1169 C  CA  . ALA A 1 151 ? -20.654 21.340  72.993 1.00 23.61  ? 305  ALA A CA  1 
ATOM   1170 C  C   . ALA A 1 151 ? -20.299 22.432  74.002 1.00 24.19  ? 305  ALA A C   1 
ATOM   1171 O  O   . ALA A 1 151 ? -20.297 23.612  73.675 1.00 27.26  ? 305  ALA A O   1 
ATOM   1172 C  CB  . ALA A 1 151 ? -19.419 20.951  72.193 1.00 24.40  ? 305  ALA A CB  1 
ATOM   1173 N  N   . THR A 1 152 ? -20.013 22.033  75.213 1.00 21.74  ? 306  THR A N   1 
ATOM   1174 C  CA  . THR A 1 152 ? -19.614 22.957  76.278 1.00 22.33  ? 306  THR A CA  1 
ATOM   1175 C  C   . THR A 1 152 ? -18.143 22.854  76.583 1.00 22.45  ? 306  THR A C   1 
ATOM   1176 O  O   . THR A 1 152 ? -17.459 21.867  76.263 1.00 20.33  ? 306  THR A O   1 
ATOM   1177 C  CB  . THR A 1 152 ? -20.392 22.688  77.563 1.00 22.70  ? 306  THR A CB  1 
ATOM   1178 O  OG1 . THR A 1 152 ? -20.028 21.428  78.125 1.00 22.90  ? 306  THR A OG1 1 
ATOM   1179 C  CG2 . THR A 1 152 ? -21.869 22.708  77.305 1.00 24.55  ? 306  THR A CG2 1 
ATOM   1180 N  N   . ARG A 1 153 ? -17.656 23.853  77.295 1.00 22.69  ? 307  ARG A N   1 
ATOM   1181 C  CA  . ARG A 1 153 ? -16.321 23.779  77.868 1.00 22.13  ? 307  ARG A CA  1 
ATOM   1182 C  C   . ARG A 1 153 ? -16.118 22.548  78.716 1.00 20.86  ? 307  ARG A C   1 
ATOM   1183 O  O   . ARG A 1 153 ? -15.057 21.882  78.636 1.00 20.13  ? 307  ARG A O   1 
ATOM   1184 C  CB  . ARG A 1 153 ? -16.089 25.033  78.700 1.00 23.93  ? 307  ARG A CB  1 
ATOM   1185 C  CG  . ARG A 1 153 ? -14.699 25.163  79.266 1.00 26.62  ? 307  ARG A CG  1 
ATOM   1186 C  CD  . ARG A 1 153 ? -14.641 26.497  79.962 1.00 28.46  ? 307  ARG A CD  1 
ATOM   1187 N  NE  . ARG A 1 153 ? -13.362 26.734  80.595 1.00 33.32  ? 307  ARG A NE  1 
ATOM   1188 C  CZ  . ARG A 1 153 ? -12.960 26.183  81.742 1.00 34.67  ? 307  ARG A CZ  1 
ATOM   1189 N  NH1 . ARG A 1 153 ? -13.718 25.319  82.407 1.00 36.04  ? 307  ARG A NH1 1 
ATOM   1190 N  NH2 . ARG A 1 153 ? -11.764 26.513  82.227 1.00 36.49  ? 307  ARG A NH2 1 
ATOM   1191 N  N   . GLU A 1 154 ? -17.122 22.246  79.563 1.00 22.42  ? 308  GLU A N   1 
ATOM   1192 C  CA  . GLU A 1 154 ? -17.056 21.070  80.427 1.00 22.48  ? 308  GLU A CA  1 
ATOM   1193 C  C   . GLU A 1 154 ? -16.879 19.779  79.641 1.00 20.69  ? 308  GLU A C   1 
ATOM   1194 O  O   . GLU A 1 154 ? -16.197 18.875  80.079 1.00 21.79  ? 308  GLU A O   1 
ATOM   1195 C  CB  . GLU A 1 154 ? -18.293 20.948  81.344 1.00 26.56  ? 308  GLU A CB  1 
ATOM   1196 C  CG  . GLU A 1 154 ? -18.247 21.940  82.494 1.00 32.55  ? 308  GLU A CG  1 
ATOM   1197 C  CD  . GLU A 1 154 ? -18.185 23.350  81.982 1.00 36.83  ? 308  GLU A CD  1 
ATOM   1198 O  OE1 . GLU A 1 154 ? -17.216 24.085  82.341 1.00 45.41  ? 308  GLU A OE1 1 
ATOM   1199 O  OE2 . GLU A 1 154 ? -19.074 23.675  81.128 1.00 37.84  ? 308  GLU A OE2 1 
ATOM   1200 N  N   . ASP A 1 155 ? -17.526 19.694  78.498 1.00 19.27  ? 309  ASP A N   1 
ATOM   1201 C  CA  . ASP A 1 155 ? -17.461 18.487  77.650 1.00 19.70  ? 309  ASP A CA  1 
ATOM   1202 C  C   . ASP A 1 155 ? -16.040 18.238  77.209 1.00 19.93  ? 309  ASP A C   1 
ATOM   1203 O  O   . ASP A 1 155 ? -15.597 17.081  77.204 1.00 20.23  ? 309  ASP A O   1 
ATOM   1204 C  CB  . ASP A 1 155 ? -18.294 18.671  76.394 1.00 20.81  ? 309  ASP A CB  1 
ATOM   1205 C  CG  . ASP A 1 155 ? -19.798 18.634  76.645 1.00 21.99  ? 309  ASP A CG  1 
ATOM   1206 O  OD1 . ASP A 1 155 ? -20.261 17.953  77.571 1.00 23.25  ? 309  ASP A OD1 1 
ATOM   1207 O  OD2 . ASP A 1 155 ? -20.489 19.197  75.808 1.00 21.09  ? 309  ASP A OD2 1 
ATOM   1208 N  N   . PHE A 1 156 ? -15.340 19.335  76.852 1.00 19.46  ? 310  PHE A N   1 
ATOM   1209 C  CA  . PHE A 1 156 ? -13.926 19.238  76.410 1.00 20.68  ? 310  PHE A CA  1 
ATOM   1210 C  C   . PHE A 1 156 ? -12.978 18.781  77.542 1.00 20.55  ? 310  PHE A C   1 
ATOM   1211 O  O   . PHE A 1 156 ? -11.883 18.325  77.244 1.00 20.35  ? 310  PHE A O   1 
ATOM   1212 C  CB  . PHE A 1 156 ? -13.435 20.591  75.850 1.00 19.31  ? 310  PHE A CB  1 
ATOM   1213 C  CG  . PHE A 1 156 ? -13.789 20.812  74.416 1.00 20.58  ? 310  PHE A CG  1 
ATOM   1214 C  CD1 . PHE A 1 156 ? -15.111 20.835  73.992 1.00 22.71  ? 310  PHE A CD1 1 
ATOM   1215 C  CD2 . PHE A 1 156 ? -12.797 20.971  73.462 1.00 20.00  ? 310  PHE A CD2 1 
ATOM   1216 C  CE1 . PHE A 1 156 ? -15.445 21.014  72.658 1.00 22.45  ? 310  PHE A CE1 1 
ATOM   1217 C  CE2 . PHE A 1 156 ? -13.123 21.150  72.123 1.00 20.89  ? 310  PHE A CE2 1 
ATOM   1218 C  CZ  . PHE A 1 156 ? -14.445 21.171  71.716 1.00 22.10  ? 310  PHE A CZ  1 
ATOM   1219 N  N   . LEU A 1 157 ? -13.403 18.882  78.805 1.00 18.89  ? 311  LEU A N   1 
ATOM   1220 C  CA  . LEU A 1 157 ? -12.606 18.490  79.951 1.00 19.36  ? 311  LEU A CA  1 
ATOM   1221 C  C   . LEU A 1 157 ? -13.116 17.246  80.667 1.00 19.88  ? 311  LEU A C   1 
ATOM   1222 O  O   . LEU A 1 157 ? -12.582 16.895  81.729 1.00 20.17  ? 311  LEU A O   1 
ATOM   1223 C  CB  . LEU A 1 157 ? -12.544 19.670  80.942 1.00 20.58  ? 311  LEU A CB  1 
ATOM   1224 C  CG  . LEU A 1 157 ? -12.222 21.055  80.343 1.00 22.68  ? 311  LEU A CG  1 
ATOM   1225 C  CD1 . LEU A 1 157 ? -12.358 22.130  81.427 1.00 23.62  ? 311  LEU A CD1 1 
ATOM   1226 C  CD2 . LEU A 1 157 ? -10.846 21.055  79.740 1.00 24.11  ? 311  LEU A CD2 1 
ATOM   1227 N  N   . ASN A 1 158 ? -14.136 16.583  80.105 1.00 18.59  ? 312  ASN A N   1 
ATOM   1228 C  CA  . ASN A 1 158 ? -14.837 15.521  80.797 1.00 19.64  ? 312  ASN A CA  1 
ATOM   1229 C  C   . ASN A 1 158 ? -14.309 14.129  80.409 1.00 17.87  ? 312  ASN A C   1 
ATOM   1230 O  O   . ASN A 1 158 ? -14.528 13.678  79.295 1.00 18.30  ? 312  ASN A O   1 
ATOM   1231 C  CB  . ASN A 1 158 ? -16.302 15.614  80.497 1.00 18.80  ? 312  ASN A CB  1 
ATOM   1232 C  CG  . ASN A 1 158 ? -17.142 14.676  81.337 1.00 21.42  ? 312  ASN A CG  1 
ATOM   1233 O  OD1 . ASN A 1 158 ? -16.659 13.765  82.021 1.00 21.28  ? 312  ASN A OD1 1 
ATOM   1234 N  ND2 . ASN A 1 158 ? -18.413 14.933  81.323 1.00 22.50  ? 312  ASN A ND2 1 
ATOM   1235 N  N   . PRO A 1 159 ? -13.705 13.405  81.363 1.00 20.17  ? 313  PRO A N   1 
ATOM   1236 C  CA  . PRO A 1 159 ? -13.253 12.056  81.046 1.00 20.13  ? 313  PRO A CA  1 
ATOM   1237 C  C   . PRO A 1 159 ? -14.373 11.146  80.554 1.00 21.02  ? 313  PRO A C   1 
ATOM   1238 O  O   . PRO A 1 159 ? -14.083 10.233  79.807 1.00 20.40  ? 313  PRO A O   1 
ATOM   1239 C  CB  . PRO A 1 159 ? -12.666 11.532  82.375 1.00 21.69  ? 313  PRO A CB  1 
ATOM   1240 C  CG  . PRO A 1 159 ? -13.214 12.396  83.418 1.00 22.91  ? 313  PRO A CG  1 
ATOM   1241 C  CD  . PRO A 1 159 ? -13.485 13.728  82.796 1.00 21.44  ? 313  PRO A CD  1 
ATOM   1242 N  N   . ASP A 1 160 ? -15.639 11.391  80.940 1.00 22.33  ? 314  ASP A N   1 
ATOM   1243 C  CA  . ASP A 1 160 ? -16.740 10.565  80.466 1.00 23.46  ? 314  ASP A CA  1 
ATOM   1244 C  C   . ASP A 1 160 ? -17.013 10.776  78.991 1.00 20.81  ? 314  ASP A C   1 
ATOM   1245 O  O   . ASP A 1 160 ? -17.480 9.865   78.308 1.00 23.09  ? 314  ASP A O   1 
ATOM   1246 C  CB  . ASP A 1 160 ? -18.038 10.814  81.267 1.00 25.28  ? 314  ASP A CB  1 
ATOM   1247 C  CG  . ASP A 1 160 ? -17.933 10.389  82.737 1.00 29.77  ? 314  ASP A CG  1 
ATOM   1248 O  OD1 . ASP A 1 160 ? -17.110 9.530   83.083 1.00 30.91  ? 314  ASP A OD1 1 
ATOM   1249 O  OD2 . ASP A 1 160 ? -18.697 10.936  83.548 1.00 33.41  ? 314  ASP A OD2 1 
ATOM   1250 N  N   . VAL A 1 161 ? -16.704 11.962  78.487 1.00 18.45  ? 315  VAL A N   1 
ATOM   1251 C  CA  . VAL A 1 161 ? -16.810 12.259  77.092 1.00 17.67  ? 315  VAL A CA  1 
ATOM   1252 C  C   . VAL A 1 161 ? -15.624 11.628  76.397 1.00 16.51  ? 315  VAL A C   1 
ATOM   1253 O  O   . VAL A 1 161 ? -15.806 10.929  75.402 1.00 16.96  ? 315  VAL A O   1 
ATOM   1254 C  CB  . VAL A 1 161 ? -16.857 13.805  76.807 1.00 17.94  ? 315  VAL A CB  1 
ATOM   1255 C  CG1 . VAL A 1 161 ? -16.766 14.123  75.315 1.00 18.58  ? 315  VAL A CG1 1 
ATOM   1256 C  CG2 . VAL A 1 161 ? -18.196 14.353  77.331 1.00 20.33  ? 315  VAL A CG2 1 
ATOM   1257 N  N   . LEU A 1 162 ? -14.423 11.843  76.916 1.00 16.97  ? 316  LEU A N   1 
ATOM   1258 C  CA  . LEU A 1 162 ? -13.231 11.206  76.307 1.00 17.48  ? 316  LEU A CA  1 
ATOM   1259 C  C   . LEU A 1 162 ? -13.345 9.678   76.151 1.00 17.32  ? 316  LEU A C   1 
ATOM   1260 O  O   . LEU A 1 162 ? -12.982 9.099   75.132 1.00 17.02  ? 316  LEU A O   1 
ATOM   1261 C  CB  . LEU A 1 162 ? -12.001 11.516  77.148 1.00 18.05  ? 316  LEU A CB  1 
ATOM   1262 C  CG  . LEU A 1 162 ? -11.526 12.968  77.227 1.00 20.60  ? 316  LEU A CG  1 
ATOM   1263 C  CD1 . LEU A 1 162 ? -10.201 13.122  77.960 1.00 22.24  ? 316  LEU A CD1 1 
ATOM   1264 C  CD2 . LEU A 1 162 ? -11.435 13.625  75.913 1.00 23.36  ? 316  LEU A CD2 1 
ATOM   1265 N  N   . ASP A 1 163 ? -13.886 9.025   77.182 1.00 18.93  ? 317  ASP A N   1 
ATOM   1266 C  CA  . ASP A 1 163 ? -13.992 7.597   77.199 1.00 18.96  ? 317  ASP A CA  1 
ATOM   1267 C  C   . ASP A 1 163 ? -14.940 7.000   76.165 1.00 18.98  ? 317  ASP A C   1 
ATOM   1268 O  O   . ASP A 1 163 ? -14.792 5.849   75.850 1.00 18.66  ? 317  ASP A O   1 
ATOM   1269 C  CB  . ASP A 1 163 ? -14.422 7.141   78.582 1.00 20.33  ? 317  ASP A CB  1 
ATOM   1270 C  CG  . ASP A 1 163 ? -13.302 7.170   79.608 1.00 23.51  ? 317  ASP A CG  1 
ATOM   1271 O  OD1 . ASP A 1 163 ? -12.124 7.402   79.275 1.00 22.19  ? 317  ASP A OD1 1 
ATOM   1272 O  OD2 . ASP A 1 163 ? -13.691 6.902   80.793 1.00 24.94  ? 317  ASP A OD2 1 
ATOM   1273 N  N   . ILE A 1 164 ? -15.860 7.784   75.611 1.00 18.31  ? 318  ILE A N   1 
ATOM   1274 C  CA  . ILE A 1 164 ? -16.773 7.231   74.584 1.00 20.75  ? 318  ILE A CA  1 
ATOM   1275 C  C   . ILE A 1 164 ? -16.025 6.698   73.365 1.00 19.01  ? 318  ILE A C   1 
ATOM   1276 O  O   . ILE A 1 164 ? -16.468 5.762   72.666 1.00 18.57  ? 318  ILE A O   1 
ATOM   1277 C  CB  . ILE A 1 164 ? -17.919 8.175   74.170 1.00 22.88  ? 318  ILE A CB  1 
ATOM   1278 C  CG1 . ILE A 1 164 ? -17.374 9.365   73.307 1.00 26.60  ? 318  ILE A CG1 1 
ATOM   1279 C  CG2 . ILE A 1 164 ? -18.725 8.584   75.390 1.00 24.11  ? 318  ILE A CG2 1 
ATOM   1280 C  CD1 . ILE A 1 164 ? -18.448 10.281  72.774 1.00 27.92  ? 318  ILE A CD1 1 
ATOM   1281 N  N   . PHE A 1 165 ? -14.885 7.322   73.079 1.00 17.39  ? 319  PHE A N   1 
ATOM   1282 C  CA  . PHE A 1 165 ? -14.067 6.945   71.967 1.00 16.69  ? 319  PHE A CA  1 
ATOM   1283 C  C   . PHE A 1 165 ? -13.637 5.487   72.068 1.00 16.39  ? 319  PHE A C   1 
ATOM   1284 O  O   . PHE A 1 165 ? -13.570 4.788   71.047 1.00 16.81  ? 319  PHE A O   1 
ATOM   1285 C  CB  . PHE A 1 165 ? -12.840 7.873   71.883 1.00 16.25  ? 319  PHE A CB  1 
ATOM   1286 C  CG  . PHE A 1 165 ? -11.924 7.554   70.754 1.00 15.45  ? 319  PHE A CG  1 
ATOM   1287 C  CD1 . PHE A 1 165 ? -12.373 7.639   69.466 1.00 15.60  ? 319  PHE A CD1 1 
ATOM   1288 C  CD2 . PHE A 1 165 ? -10.640 7.083   70.991 1.00 16.36  ? 319  PHE A CD2 1 
ATOM   1289 C  CE1 . PHE A 1 165 ? -11.545 7.312   68.393 1.00 17.83  ? 319  PHE A CE1 1 
ATOM   1290 C  CE2 . PHE A 1 165 ? -9.789  6.769   69.928 1.00 17.08  ? 319  PHE A CE2 1 
ATOM   1291 C  CZ  . PHE A 1 165 ? -10.257 6.894   68.617 1.00 16.87  ? 319  PHE A CZ  1 
ATOM   1292 N  N   . ILE A 1 166 ? -13.425 5.004   73.306 1.00 16.52  ? 320  ILE A N   1 
ATOM   1293 C  CA  . ILE A 1 166 ? -12.957 3.638   73.510 1.00 18.24  ? 320  ILE A CA  1 
ATOM   1294 C  C   . ILE A 1 166 ? -13.966 2.634   72.942 1.00 17.46  ? 320  ILE A C   1 
ATOM   1295 O  O   . ILE A 1 166 ? -13.575 1.698   72.218 1.00 17.11  ? 320  ILE A O   1 
ATOM   1296 C  CB  . ILE A 1 166 ? -12.654 3.362   74.999 1.00 18.37  ? 320  ILE A CB  1 
ATOM   1297 C  CG1 . ILE A 1 166 ? -11.518 4.266   75.452 1.00 18.77  ? 320  ILE A CG1 1 
ATOM   1298 C  CG2 . ILE A 1 166 ? -12.305 1.901   75.235 1.00 18.83  ? 320  ILE A CG2 1 
ATOM   1299 C  CD1 . ILE A 1 166 ? -11.359 4.425   76.956 1.00 21.61  ? 320  ILE A CD1 1 
ATOM   1300 N  N   . SER A 1 167 ? -15.269 2.791   73.245 1.00 17.30  ? 321  SER A N   1 
ATOM   1301 C  CA  . SER A 1 167 ? -16.228 1.811   72.695 1.00 19.48  ? 321  SER A CA  1 
ATOM   1302 C  C   . SER A 1 167 ? -16.384 1.911   71.196 1.00 18.33  ? 321  SER A C   1 
ATOM   1303 O  O   . SER A 1 167 ? -16.588 0.881   70.559 1.00 19.33  ? 321  SER A O   1 
ATOM   1304 C  CB  . SER A 1 167 ? -17.601 1.866   73.340 1.00 24.88  ? 321  SER A CB  1 
ATOM   1305 O  OG  . SER A 1 167 ? -18.109 3.145   73.193 1.00 30.53  ? 321  SER A OG  1 
ATOM   1306 N  N   . SER A 1 168 ? -16.214 3.097   70.613 1.00 17.58  ? 322  SER A N   1 
ATOM   1307 C  CA  . SER A 1 168 ? -16.240 3.180   69.150 1.00 18.77  ? 322  SER A CA  1 
ATOM   1308 C  C   . SER A 1 168 ? -15.115 2.348   68.554 1.00 16.86  ? 322  SER A C   1 
ATOM   1309 O  O   . SER A 1 168 ? -15.299 1.575   67.616 1.00 17.62  ? 322  SER A O   1 
ATOM   1310 C  CB  . SER A 1 168 ? -16.128 4.595   68.642 1.00 20.58  ? 322  SER A CB  1 
ATOM   1311 O  OG  . SER A 1 168 ? -17.222 5.334   69.120 1.00 24.79  ? 322  SER A OG  1 
ATOM   1312 N  N   . VAL A 1 169 ? -13.925 2.540   69.082 1.00 17.08  ? 323  VAL A N   1 
ATOM   1313 C  CA  . VAL A 1 169 ? -12.766 1.786   68.583 1.00 16.10  ? 323  VAL A CA  1 
ATOM   1314 C  C   . VAL A 1 169 ? -13.022 0.267   68.713 1.00 18.16  ? 323  VAL A C   1 
ATOM   1315 O  O   . VAL A 1 169 ? -12.736 -0.477  67.760 1.00 16.79  ? 323  VAL A O   1 
ATOM   1316 C  CB  . VAL A 1 169 ? -11.458 2.193   69.330 1.00 16.97  ? 323  VAL A CB  1 
ATOM   1317 C  CG1 . VAL A 1 169 ? -10.288 1.268   68.936 1.00 16.59  ? 323  VAL A CG1 1 
ATOM   1318 C  CG2 . VAL A 1 169 ? -11.047 3.634   69.055 1.00 17.94  ? 323  VAL A CG2 1 
ATOM   1319 N  N   . GLN A 1 170 ? -13.498 -0.188  69.886 1.00 18.75  ? 324  GLN A N   1 
ATOM   1320 C  CA  . GLN A 1 170 ? -13.747 -1.629  70.105 1.00 19.73  ? 324  GLN A CA  1 
ATOM   1321 C  C   . GLN A 1 170 ? -14.746 -2.161  69.113 1.00 20.47  ? 324  GLN A C   1 
ATOM   1322 O  O   . GLN A 1 170 ? -14.543 -3.221  68.533 1.00 20.57  ? 324  GLN A O   1 
ATOM   1323 C  CB  . GLN A 1 170 ? -14.160 -1.928  71.561 1.00 22.74  ? 324  GLN A CB  1 
ATOM   1324 C  CG  . GLN A 1 170 ? -13.066 -1.549  72.545 1.00 26.78  ? 324  GLN A CG  1 
ATOM   1325 C  CD  . GLN A 1 170 ? -13.026 -2.317  73.883 1.00 29.49  ? 324  GLN A CD  1 
ATOM   1326 O  OE1 . GLN A 1 170 ? -13.381 -1.800  74.986 1.00 21.92  ? 324  GLN A OE1 1 
ATOM   1327 N  NE2 . GLN A 1 170 ? -12.432 -3.500  73.809 1.00 31.27  ? 324  GLN A NE2 1 
ATOM   1328 N  N   . LYS A 1 171 ? -15.774 -1.395  68.829 1.00 20.34  ? 325  LYS A N   1 
ATOM   1329 C  CA  . LYS A 1 171 ? -16.782 -1.832  67.878 1.00 22.58  ? 325  LYS A CA  1 
ATOM   1330 C  C   . LYS A 1 171 ? -16.277 -1.956  66.440 1.00 21.48  ? 325  LYS A C   1 
ATOM   1331 O  O   . LYS A 1 171 ? -16.619 -2.890  65.723 1.00 20.56  ? 325  LYS A O   1 
ATOM   1332 C  CB  . LYS A 1 171 ? -17.991 -0.940  67.924 1.00 24.31  ? 325  LYS A CB  1 
ATOM   1333 C  CG  . LYS A 1 171 ? -18.832 -1.177  69.160 1.00 30.77  ? 325  LYS A CG  1 
ATOM   1334 C  CD  . LYS A 1 171 ? -19.925 -0.139  69.309 1.00 36.15  ? 325  LYS A CD  1 
ATOM   1335 C  CE  . LYS A 1 171 ? -20.448 -0.139  70.747 1.00 41.50  ? 325  LYS A CE  1 
ATOM   1336 N  NZ  . LYS A 1 171 ? -21.214 1.101   70.965 1.00 44.28  ? 325  LYS A NZ  1 
ATOM   1337 N  N   . VAL A 1 172 ? -15.465 -1.003  66.010 1.00 19.74  ? 326  VAL A N   1 
ATOM   1338 C  CA  . VAL A 1 172 ? -14.863 -1.122  64.701 1.00 20.39  ? 326  VAL A CA  1 
ATOM   1339 C  C   . VAL A 1 172 ? -13.991 -2.385  64.615 1.00 19.79  ? 326  VAL A C   1 
ATOM   1340 O  O   . VAL A 1 172 ? -14.101 -3.161  63.647 1.00 20.65  ? 326  VAL A O   1 
ATOM   1341 C  CB  . VAL A 1 172 ? -14.029 0.129   64.336 1.00 21.34  ? 326  VAL A CB  1 
ATOM   1342 C  CG1 . VAL A 1 172 ? -13.260 -0.098  63.048 1.00 23.22  ? 326  VAL A CG1 1 
ATOM   1343 C  CG2 . VAL A 1 172 ? -14.931 1.331   64.211 1.00 23.53  ? 326  VAL A CG2 1 
ATOM   1344 N  N   . PHE A 1 173 ? -13.145 -2.627  65.624 1.00 18.73  ? 327  PHE A N   1 
ATOM   1345 C  CA  . PHE A 1 173 ? -12.322 -3.831  65.598 1.00 20.00  ? 327  PHE A CA  1 
ATOM   1346 C  C   . PHE A 1 173 ? -13.148 -5.106  65.664 1.00 20.98  ? 327  PHE A C   1 
ATOM   1347 O  O   . PHE A 1 173 ? -12.740 -6.096  65.037 1.00 21.29  ? 327  PHE A O   1 
ATOM   1348 C  CB  . PHE A 1 173 ? -11.245 -3.868  66.704 1.00 19.18  ? 327  PHE A CB  1 
ATOM   1349 C  CG  . PHE A 1 173 ? -10.041 -3.047  66.381 1.00 20.35  ? 327  PHE A CG  1 
ATOM   1350 C  CD1 . PHE A 1 173 ? -9.225  -3.408  65.324 1.00 20.46  ? 327  PHE A CD1 1 
ATOM   1351 C  CD2 . PHE A 1 173 ? -9.719  -1.899  67.114 1.00 21.45  ? 327  PHE A CD2 1 
ATOM   1352 C  CE1 . PHE A 1 173 ? -8.127  -2.650  64.982 1.00 21.38  ? 327  PHE A CE1 1 
ATOM   1353 C  CE2 . PHE A 1 173 ? -8.614  -1.150  66.754 1.00 21.06  ? 327  PHE A CE2 1 
ATOM   1354 C  CZ  . PHE A 1 173 ? -7.816  -1.518  65.720 1.00 21.70  ? 327  PHE A CZ  1 
ATOM   1355 N  N   A GLN A 1 174 ? -14.283 -5.099  66.366 0.50 21.70  ? 328  GLN A N   1 
ATOM   1356 N  N   B GLN A 1 174 ? -14.286 -5.090  66.352 0.50 22.52  ? 328  GLN A N   1 
ATOM   1357 C  CA  A GLN A 1 174 ? -15.178 -6.259  66.345 0.50 23.35  ? 328  GLN A CA  1 
ATOM   1358 C  CA  B GLN A 1 174 ? -15.184 -6.243  66.353 0.50 24.73  ? 328  GLN A CA  1 
ATOM   1359 C  C   A GLN A 1 174 ? -15.608 -6.582  64.912 0.50 22.18  ? 328  GLN A C   1 
ATOM   1360 C  C   B GLN A 1 174 ? -15.723 -6.581  64.955 0.50 22.89  ? 328  GLN A C   1 
ATOM   1361 O  O   A GLN A 1 174 ? -15.493 -7.729  64.494 0.50 22.68  ? 328  GLN A O   1 
ATOM   1362 O  O   B GLN A 1 174 ? -15.818 -7.749  64.603 0.50 24.01  ? 328  GLN A O   1 
ATOM   1363 C  CB  A GLN A 1 174 ? -16.407 -6.070  67.215 0.50 24.63  ? 328  GLN A CB  1 
ATOM   1364 C  CB  B GLN A 1 174 ? -16.307 -6.047  67.353 0.50 26.95  ? 328  GLN A CB  1 
ATOM   1365 C  CG  A GLN A 1 174 ? -17.338 -7.281  67.208 0.50 26.14  ? 328  GLN A CG  1 
ATOM   1366 C  CG  B GLN A 1 174 ? -15.823 -6.269  68.772 0.50 31.18  ? 328  GLN A CG  1 
ATOM   1367 C  CD  A GLN A 1 174 ? -18.801 -6.918  66.959 0.50 32.21  ? 328  GLN A CD  1 
ATOM   1368 C  CD  B GLN A 1 174 ? -16.851 -5.996  69.851 0.50 33.90  ? 328  GLN A CD  1 
ATOM   1369 O  OE1 A GLN A 1 174 ? -19.532 -6.563  67.883 0.50 35.39  ? 328  GLN A OE1 1 
ATOM   1370 O  OE1 B GLN A 1 174 ? -18.013 -5.646  69.589 0.50 36.97  ? 328  GLN A OE1 1 
ATOM   1371 N  NE2 A GLN A 1 174 ? -19.232 -7.020  65.698 0.50 32.36  ? 328  GLN A NE2 1 
ATOM   1372 N  NE2 B GLN A 1 174 ? -16.420 -6.160  71.091 0.50 35.20  ? 328  GLN A NE2 1 
ATOM   1373 N  N   . VAL A 1 175 ? -16.015 -5.561  64.150 1.00 20.63  ? 329  VAL A N   1 
ATOM   1374 C  CA  . VAL A 1 175 ? -16.455 -5.766  62.764 1.00 21.72  ? 329  VAL A CA  1 
ATOM   1375 C  C   . VAL A 1 175 ? -15.283 -6.280  61.901 1.00 21.93  ? 329  VAL A C   1 
ATOM   1376 O  O   . VAL A 1 175 ? -15.398 -7.295  61.184 1.00 22.17  ? 329  VAL A O   1 
ATOM   1377 C  CB  . VAL A 1 175 ? -17.102 -4.502  62.176 1.00 22.57  ? 329  VAL A CB  1 
ATOM   1378 C  CG1 . VAL A 1 175 ? -17.357 -4.691  60.678 1.00 23.82  ? 329  VAL A CG1 1 
ATOM   1379 C  CG2 . VAL A 1 175 ? -18.402 -4.187  62.922 1.00 23.70  ? 329  VAL A CG2 1 
ATOM   1380 N  N   . VAL A 1 176 ? -14.146 -5.610  62.003 1.00 20.81  ? 330  VAL A N   1 
ATOM   1381 C  CA  . VAL A 1 176 ? -13.002 -5.964  61.201 1.00 22.51  ? 330  VAL A CA  1 
ATOM   1382 C  C   . VAL A 1 176 ? -12.556 -7.396  61.536 1.00 25.05  ? 330  VAL A C   1 
ATOM   1383 O  O   . VAL A 1 176 ? -12.341 -8.193  60.622 1.00 26.55  ? 330  VAL A O   1 
ATOM   1384 C  CB  . VAL A 1 176 ? -11.873 -4.956  61.338 1.00 23.09  ? 330  VAL A CB  1 
ATOM   1385 C  CG1 . VAL A 1 176 ? -10.634 -5.422  60.585 1.00 25.38  ? 330  VAL A CG1 1 
ATOM   1386 C  CG2 . VAL A 1 176 ? -12.287 -3.575  60.853 1.00 22.89  ? 330  VAL A CG2 1 
ATOM   1387 N  N   . GLU A 1 177 ? -12.473 -7.753  62.814 1.00 25.25  ? 331  GLU A N   1 
ATOM   1388 C  CA  . GLU A 1 177 ? -12.031 -9.123  63.178 1.00 29.37  ? 331  GLU A CA  1 
ATOM   1389 C  C   . GLU A 1 177 ? -13.003 -10.257 62.754 1.00 28.52  ? 331  GLU A C   1 
ATOM   1390 O  O   . GLU A 1 177 ? -12.600 -11.412 62.540 1.00 26.34  ? 331  GLU A O   1 
ATOM   1391 C  CB  . GLU A 1 177 ? -11.656 -9.165  64.661 1.00 33.22  ? 331  GLU A CB  1 
ATOM   1392 C  CG  . GLU A 1 177 ? -10.407 -8.326  64.944 1.00 36.63  ? 331  GLU A CG  1 
ATOM   1393 C  CD  . GLU A 1 177 ? -9.230  -8.594  63.976 1.00 41.58  ? 331  GLU A CD  1 
ATOM   1394 O  OE1 . GLU A 1 177 ? -8.921  -9.770  63.687 1.00 45.74  ? 331  GLU A OE1 1 
ATOM   1395 O  OE2 . GLU A 1 177 ? -8.603  -7.642  63.494 1.00 44.86  ? 331  GLU A OE2 1 
ATOM   1396 N  N   . SER A 1 178 ? -14.253 -9.914  62.549 1.00 26.84  ? 332  SER A N   1 
ATOM   1397 C  CA  . SER A 1 178 ? -15.233 -10.860 62.082 1.00 29.46  ? 332  SER A CA  1 
ATOM   1398 C  C   . SER A 1 178 ? -15.250 -11.013 60.570 1.00 32.11  ? 332  SER A C   1 
ATOM   1399 O  O   . SER A 1 178 ? -16.004 -11.859 60.080 1.00 31.68  ? 332  SER A O   1 
ATOM   1400 C  CB  . SER A 1 178 ? -16.625 -10.461 62.615 1.00 29.89  ? 332  SER A CB  1 
ATOM   1401 O  OG  . SER A 1 178 ? -17.207 -9.415  61.851 1.00 33.93  ? 332  SER A OG  1 
ATOM   1402 N  N   . THR A 1 179 ? -14.484 -10.182 59.831 1.00 30.12  ? 333  THR A N   1 
ATOM   1403 C  CA  . THR A 1 179 ? -14.545 -10.154 58.351 1.00 29.92  ? 333  THR A CA  1 
ATOM   1404 C  C   . THR A 1 179 ? -13.210 -10.152 57.639 1.00 31.34  ? 333  THR A C   1 
ATOM   1405 O  O   . THR A 1 179 ? -13.038 -10.882 56.667 1.00 32.08  ? 333  THR A O   1 
ATOM   1406 C  CB  . THR A 1 179 ? -15.333 -8.949  57.802 1.00 30.99  ? 333  THR A CB  1 
ATOM   1407 O  OG1 . THR A 1 179 ? -14.871 -7.726  58.420 1.00 31.23  ? 333  THR A OG1 1 
ATOM   1408 C  CG2 . THR A 1 179 ? -16.754 -9.129  58.087 1.00 31.61  ? 333  THR A CG2 1 
ATOM   1409 N  N   . ARG A 1 180 ? -12.276 -9.314  58.061 1.00 25.29  ? 334  ARG A N   1 
ATOM   1410 C  CA  . ARG A 1 180 ? -10.957 -9.251  57.456 1.00 27.32  ? 334  ARG A CA  1 
ATOM   1411 C  C   . ARG A 1 180 ? -9.938  -9.171  58.551 1.00 27.26  ? 334  ARG A C   1 
ATOM   1412 O  O   . ARG A 1 180 ? -9.329  -8.137  58.752 1.00 26.96  ? 334  ARG A O   1 
ATOM   1413 C  CB  . ARG A 1 180 ? -10.820 -8.047  56.525 1.00 27.94  ? 334  ARG A CB  1 
ATOM   1414 C  CG  . ARG A 1 180 ? -11.766 -8.033  55.379 1.00 27.52  ? 334  ARG A CG  1 
ATOM   1415 C  CD  . ARG A 1 180 ? -11.288 -8.966  54.265 1.00 28.17  ? 334  ARG A CD  1 
ATOM   1416 N  NE  . ARG A 1 180 ? -12.405 -9.226  53.372 1.00 30.09  ? 334  ARG A NE  1 
ATOM   1417 C  CZ  . ARG A 1 180 ? -12.346 -9.925  52.236 1.00 33.25  ? 334  ARG A CZ  1 
ATOM   1418 N  NH1 . ARG A 1 180 ? -11.205 -10.448 51.810 1.00 32.58  ? 334  ARG A NH1 1 
ATOM   1419 N  NH2 . ARG A 1 180 ? -13.438 -10.070 51.517 1.00 34.46  ? 334  ARG A NH2 1 
ATOM   1420 N  N   . PRO A 1 181 ? -9.742  -10.296 59.277 1.00 29.47  ? 335  PRO A N   1 
ATOM   1421 C  CA  . PRO A 1 181 ? -8.873  -10.252 60.438 1.00 28.53  ? 335  PRO A CA  1 
ATOM   1422 C  C   . PRO A 1 181 ? -7.504  -9.722  60.092 1.00 28.48  ? 335  PRO A C   1 
ATOM   1423 O  O   . PRO A 1 181 ? -6.912  -10.100 59.083 1.00 26.22  ? 335  PRO A O   1 
ATOM   1424 C  CB  . PRO A 1 181 ? -8.787  -11.721 60.873 1.00 29.90  ? 335  PRO A CB  1 
ATOM   1425 C  CG  . PRO A 1 181 ? -9.983  -12.391 60.295 1.00 30.73  ? 335  PRO A CG  1 
ATOM   1426 C  CD  . PRO A 1 181 ? -10.311 -11.646 59.045 1.00 31.04  ? 335  PRO A CD  1 
ATOM   1427 N  N   . GLY A 1 182 ? -6.986  -8.835  60.925 1.00 27.41  ? 336  GLY A N   1 
ATOM   1428 C  CA  . GLY A 1 182 ? -5.665  -8.302  60.692 1.00 27.70  ? 336  GLY A CA  1 
ATOM   1429 C  C   . GLY A 1 182 ? -5.529  -7.118  59.754 1.00 26.61  ? 336  GLY A C   1 
ATOM   1430 O  O   . GLY A 1 182 ? -4.459  -6.540  59.709 1.00 28.64  ? 336  GLY A O   1 
ATOM   1431 N  N   . LYS A 1 183 ? -6.579  -6.744  59.023 1.00 24.11  ? 337  LYS A N   1 
ATOM   1432 C  CA  . LYS A 1 183 ? -6.526  -5.598  58.121 1.00 23.56  ? 337  LYS A CA  1 
ATOM   1433 C  C   . LYS A 1 183 ? -6.284  -4.353  58.993 1.00 22.89  ? 337  LYS A C   1 
ATOM   1434 O  O   . LYS A 1 183 ? -6.887  -4.262  60.091 1.00 21.11  ? 337  LYS A O   1 
ATOM   1435 C  CB  . LYS A 1 183 ? -7.866  -5.457  57.432 1.00 25.36  ? 337  LYS A CB  1 
ATOM   1436 C  CG  . LYS A 1 183 ? -8.007  -4.402  56.372 1.00 28.59  ? 337  LYS A CG  1 
ATOM   1437 C  CD  . LYS A 1 183 ? -7.297  -4.773  55.121 1.00 34.03  ? 337  LYS A CD  1 
ATOM   1438 C  CE  . LYS A 1 183 ? -8.015  -5.803  54.280 1.00 30.92  ? 337  LYS A CE  1 
ATOM   1439 N  NZ  . LYS A 1 183 ? -7.176  -6.040  53.090 1.00 31.04  ? 337  LYS A NZ  1 
ATOM   1440 N  N   . LYS A 1 184 ? -5.425  -3.448  58.524 1.00 20.64  ? 338  LYS A N   1 
ATOM   1441 C  CA  . LYS A 1 184 ? -5.096  -2.264  59.291 1.00 21.64  ? 338  LYS A CA  1 
ATOM   1442 C  C   . LYS A 1 184 ? -6.326  -1.367  59.380 1.00 20.20  ? 338  LYS A C   1 
ATOM   1443 O  O   . LYS A 1 184 ? -7.115  -1.287  58.431 1.00 20.35  ? 338  LYS A O   1 
ATOM   1444 C  CB  . LYS A 1 184 ? -3.909  -1.511  58.709 1.00 22.28  ? 338  LYS A CB  1 
ATOM   1445 C  CG  . LYS A 1 184 ? -2.579  -2.252  58.707 1.00 25.82  ? 338  LYS A CG  1 
ATOM   1446 C  CD  . LYS A 1 184 ? -2.204  -2.684  60.101 1.00 28.43  ? 338  LYS A CD  1 
ATOM   1447 C  CE  . LYS A 1 184 ? -0.855  -3.401  60.196 1.00 32.07  ? 338  LYS A CE  1 
ATOM   1448 N  NZ  . LYS A 1 184 ? -0.768  -3.924  61.596 1.00 34.92  ? 338  LYS A NZ  1 
ATOM   1449 N  N   . VAL A 1 185 ? -6.459  -0.680  60.521 1.00 18.68  ? 339  VAL A N   1 
ATOM   1450 C  CA  . VAL A 1 185 ? -7.583  0.192   60.780 1.00 18.22  ? 339  VAL A CA  1 
ATOM   1451 C  C   . VAL A 1 185 ? -7.047  1.602   61.046 1.00 17.95  ? 339  VAL A C   1 
ATOM   1452 O  O   . VAL A 1 185 ? -6.133  1.795   61.848 1.00 16.57  ? 339  VAL A O   1 
ATOM   1453 C  CB  . VAL A 1 185 ? -8.418  -0.306  61.984 1.00 19.18  ? 339  VAL A CB  1 
ATOM   1454 C  CG1 . VAL A 1 185 ? -9.569  0.646   62.259 1.00 19.51  ? 339  VAL A CG1 1 
ATOM   1455 C  CG2 . VAL A 1 185 ? -8.949  -1.698  61.702 1.00 21.26  ? 339  VAL A CG2 1 
ATOM   1456 N  N   . TRP A 1 186 ? -7.622  2.570   60.310 1.00 17.23  ? 340  TRP A N   1 
ATOM   1457 C  CA  . TRP A 1 186 ? -7.218  3.975   60.296 1.00 17.19  ? 340  TRP A CA  1 
ATOM   1458 C  C   . TRP A 1 186 ? -8.407  4.828   60.654 1.00 17.21  ? 340  TRP A C   1 
ATOM   1459 O  O   . TRP A 1 186 ? -9.518  4.559   60.186 1.00 16.36  ? 340  TRP A O   1 
ATOM   1460 C  CB  . TRP A 1 186 ? -6.779  4.394   58.910 1.00 17.22  ? 340  TRP A CB  1 
ATOM   1461 C  CG  . TRP A 1 186 ? -5.420  3.817   58.482 1.00 18.61  ? 340  TRP A CG  1 
ATOM   1462 C  CD1 . TRP A 1 186 ? -4.657  2.890   59.137 1.00 19.35  ? 340  TRP A CD1 1 
ATOM   1463 C  CD2 . TRP A 1 186 ? -4.679  4.188   57.327 1.00 18.04  ? 340  TRP A CD2 1 
ATOM   1464 N  NE1 . TRP A 1 186 ? -3.475  2.667   58.466 1.00 21.21  ? 340  TRP A NE1 1 
ATOM   1465 C  CE2 . TRP A 1 186 ? -3.462  3.465   57.359 1.00 19.64  ? 340  TRP A CE2 1 
ATOM   1466 C  CE3 . TRP A 1 186 ? -4.922  5.067   56.264 1.00 19.61  ? 340  TRP A CE3 1 
ATOM   1467 C  CZ2 . TRP A 1 186 ? -2.510  3.576   56.358 1.00 21.45  ? 340  TRP A CZ2 1 
ATOM   1468 C  CZ3 . TRP A 1 186 ? -3.945  5.188   55.273 1.00 21.28  ? 340  TRP A CZ3 1 
ATOM   1469 C  CH2 . TRP A 1 186 ? -2.780  4.442   55.330 1.00 19.85  ? 340  TRP A CH2 1 
ATOM   1470 N  N   . LEU A 1 187 ? -8.162  5.874   61.449 1.00 16.02  ? 341  LEU A N   1 
ATOM   1471 C  CA  . LEU A 1 187 ? -9.132  6.921   61.596 1.00 16.53  ? 341  LEU A CA  1 
ATOM   1472 C  C   . LEU A 1 187 ? -8.936  7.891   60.437 1.00 17.43  ? 341  LEU A C   1 
ATOM   1473 O  O   . LEU A 1 187 ? -7.954  8.620   60.409 1.00 18.47  ? 341  LEU A O   1 
ATOM   1474 C  CB  . LEU A 1 187 ? -9.005  7.680   62.940 1.00 19.46  ? 341  LEU A CB  1 
ATOM   1475 C  CG  . LEU A 1 187 ? -9.905  7.324   64.074 1.00 22.26  ? 341  LEU A CG  1 
ATOM   1476 C  CD1 . LEU A 1 187 ? -9.474  8.142   65.314 1.00 21.02  ? 341  LEU A CD1 1 
ATOM   1477 C  CD2 . LEU A 1 187 ? -11.357 7.625   63.720 1.00 21.34  ? 341  LEU A CD2 1 
ATOM   1478 N  N   . GLY A 1 188 ? -9.825  7.821   59.449 1.00 16.62  ? 342  GLY A N   1 
ATOM   1479 C  CA  . GLY A 1 188 ? -9.718  8.589   58.200 1.00 17.63  ? 342  GLY A CA  1 
ATOM   1480 C  C   . GLY A 1 188 ? -10.091 10.046  58.207 1.00 19.73  ? 342  GLY A C   1 
ATOM   1481 O  O   . GLY A 1 188 ? -9.810  10.770  57.264 1.00 19.76  ? 342  GLY A O   1 
ATOM   1482 N  N   . GLU A 1 189 ? -10.729 10.489  59.277 1.00 17.74  ? 343  GLU A N   1 
ATOM   1483 C  CA  . GLU A 1 189 ? -11.140 11.873  59.457 1.00 17.74  ? 343  GLU A CA  1 
ATOM   1484 C  C   . GLU A 1 189 ? -11.635 11.965  60.884 1.00 17.66  ? 343  GLU A C   1 
ATOM   1485 O  O   . GLU A 1 189 ? -12.578 11.245  61.249 1.00 18.30  ? 343  GLU A O   1 
ATOM   1486 C  CB  . GLU A 1 189 ? -12.290 12.248  58.473 1.00 18.69  ? 343  GLU A CB  1 
ATOM   1487 C  CG  . GLU A 1 189 ? -12.780 13.686  58.598 1.00 19.20  ? 343  GLU A CG  1 
ATOM   1488 C  CD  . GLU A 1 189 ? -14.033 13.956  57.810 1.00 21.10  ? 343  GLU A CD  1 
ATOM   1489 O  OE1 . GLU A 1 189 ? -14.115 13.482  56.646 1.00 23.67  ? 343  GLU A OE1 1 
ATOM   1490 O  OE2 . GLU A 1 189 ? -14.934 14.613  58.350 1.00 22.43  ? 343  GLU A OE2 1 
ATOM   1491 N  N   . THR A 1 190 ? -11.054 12.862  61.714 1.00 17.15  ? 344  THR A N   1 
ATOM   1492 C  CA  . THR A 1 190 ? -11.448 12.884  63.107 1.00 17.38  ? 344  THR A CA  1 
ATOM   1493 C  C   . THR A 1 190 ? -11.164 14.214  63.748 1.00 15.79  ? 344  THR A C   1 
ATOM   1494 O  O   . THR A 1 190 ? -10.177 14.885  63.397 1.00 17.28  ? 344  THR A O   1 
ATOM   1495 C  CB  . THR A 1 190 ? -10.766 11.728  63.858 1.00 17.83  ? 344  THR A CB  1 
ATOM   1496 O  OG1 . THR A 1 190 ? -11.393 11.549  65.118 1.00 17.39  ? 344  THR A OG1 1 
ATOM   1497 C  CG2 . THR A 1 190 ? -9.321  11.973  64.094 1.00 16.91  ? 344  THR A CG2 1 
ATOM   1498 N  N   . SER A 1 191 ? -11.999 14.605  64.694 1.00 16.96  ? 345  SER A N   1 
ATOM   1499 C  CA  . SER A 1 191 ? -11.788 15.836  65.443 1.00 17.27  ? 345  SER A CA  1 
ATOM   1500 C  C   . SER A 1 191 ? -12.618 15.893  66.707 1.00 16.13  ? 345  SER A C   1 
ATOM   1501 O  O   . SER A 1 191 ? -13.266 14.879  67.097 1.00 15.89  ? 345  SER A O   1 
ATOM   1502 C  CB  . SER A 1 191 ? -12.090 17.034  64.548 1.00 19.60  ? 345  SER A CB  1 
ATOM   1503 O  OG  . SER A 1 191 ? -11.306 18.112  64.983 1.00 20.21  ? 345  SER A OG  1 
ATOM   1504 N  N   . SER A 1 192 ? -12.599 17.053  67.372 1.00 16.86  ? 346  SER A N   1 
ATOM   1505 C  CA  . SER A 1 192 ? -13.331 17.266  68.586 1.00 17.70  ? 346  SER A CA  1 
ATOM   1506 C  C   . SER A 1 192 ? -14.830 17.241  68.378 1.00 18.24  ? 346  SER A C   1 
ATOM   1507 O  O   . SER A 1 192 ? -15.534 16.496  69.046 1.00 17.17  ? 346  SER A O   1 
ATOM   1508 C  CB  . SER A 1 192 ? -12.940 18.643  69.224 1.00 17.35  ? 346  SER A CB  1 
ATOM   1509 O  OG  . SER A 1 192 ? -12.993 19.656  68.253 1.00 17.32  ? 346  SER A OG  1 
ATOM   1510 N  N   . ALA A 1 193 ? -15.295 18.068  67.463 1.00 16.77  ? 347  ALA A N   1 
ATOM   1511 C  CA  . ALA A 1 193 ? -16.717 18.316  67.298 1.00 18.69  ? 347  ALA A CA  1 
ATOM   1512 C  C   . ALA A 1 193 ? -17.028 18.631  65.853 1.00 19.12  ? 347  ALA A C   1 
ATOM   1513 O  O   . ALA A 1 193 ? -16.219 19.273  65.178 1.00 19.74  ? 347  ALA A O   1 
ATOM   1514 C  CB  . ALA A 1 193 ? -17.212 19.459  68.199 1.00 18.15  ? 347  ALA A CB  1 
ATOM   1515 N  N   . TYR A 1 194 ? -18.169 18.154  65.381 1.00 19.22  ? 348  TYR A N   1 
ATOM   1516 C  CA  . TYR A 1 194 ? -18.626 18.392  63.988 1.00 20.64  ? 348  TYR A CA  1 
ATOM   1517 C  C   . TYR A 1 194 ? -19.436 19.712  63.923 1.00 22.85  ? 348  TYR A C   1 
ATOM   1518 O  O   . TYR A 1 194 ? -19.444 20.481  64.888 1.00 22.90  ? 348  TYR A O   1 
ATOM   1519 C  CB  . TYR A 1 194 ? -19.325 17.168  63.383 1.00 23.63  ? 348  TYR A CB  1 
ATOM   1520 C  CG  . TYR A 1 194 ? -20.581 16.781  64.079 1.00 26.96  ? 348  TYR A CG  1 
ATOM   1521 C  CD1 . TYR A 1 194 ? -21.809 17.374  63.744 1.00 34.02  ? 348  TYR A CD1 1 
ATOM   1522 C  CD2 . TYR A 1 194 ? -20.572 15.820  65.085 1.00 26.73  ? 348  TYR A CD2 1 
ATOM   1523 C  CE1 . TYR A 1 194 ? -22.981 17.014  64.406 1.00 36.90  ? 348  TYR A CE1 1 
ATOM   1524 C  CE2 . TYR A 1 194 ? -21.725 15.444  65.728 1.00 32.56  ? 348  TYR A CE2 1 
ATOM   1525 C  CZ  . TYR A 1 194 ? -22.921 16.057  65.399 1.00 35.39  ? 348  TYR A CZ  1 
ATOM   1526 O  OH  . TYR A 1 194 ? -24.038 15.661  66.082 1.00 43.12  ? 348  TYR A OH  1 
ATOM   1527 N  N   . GLY A 1 195 ? -19.998 20.015  62.751 1.00 23.81  ? 349  GLY A N   1 
ATOM   1528 C  CA  . GLY A 1 195 ? -20.545 21.327  62.430 1.00 27.18  ? 349  GLY A CA  1 
ATOM   1529 C  C   . GLY A 1 195 ? -19.453 22.364  62.321 1.00 26.07  ? 349  GLY A C   1 
ATOM   1530 O  O   . GLY A 1 195 ? -19.655 23.500  62.657 1.00 26.87  ? 349  GLY A O   1 
ATOM   1531 N  N   . GLY A 1 196 ? -18.260 21.942  61.940 1.00 24.23  ? 350  GLY A N   1 
ATOM   1532 C  CA  . GLY A 1 196 ? -17.103 22.821  61.875 1.00 24.92  ? 350  GLY A CA  1 
ATOM   1533 C  C   . GLY A 1 196 ? -16.337 23.044  63.155 1.00 22.73  ? 350  GLY A C   1 
ATOM   1534 O  O   . GLY A 1 196 ? -15.373 23.807  63.139 1.00 27.14  ? 350  GLY A O   1 
ATOM   1535 N  N   . GLY A 1 197 ? -16.728 22.394  64.247 1.00 20.00  ? 351  GLY A N   1 
ATOM   1536 C  CA  . GLY A 1 197 ? -16.065 22.581  65.540 1.00 21.43  ? 351  GLY A CA  1 
ATOM   1537 C  C   . GLY A 1 197 ? -16.902 23.408  66.482 1.00 22.80  ? 351  GLY A C   1 
ATOM   1538 O  O   . GLY A 1 197 ? -17.890 24.026  66.069 1.00 24.86  ? 351  GLY A O   1 
ATOM   1539 N  N   . ALA A 1 198 ? -16.516 23.389  67.734 1.00 19.01  ? 352  ALA A N   1 
ATOM   1540 C  CA  . ALA A 1 198 ? -17.195 24.128  68.770 1.00 21.85  ? 352  ALA A CA  1 
ATOM   1541 C  C   . ALA A 1 198 ? -16.616 25.512  68.847 1.00 23.03  ? 352  ALA A C   1 
ATOM   1542 O  O   . ALA A 1 198 ? -15.461 25.666  69.239 1.00 20.77  ? 352  ALA A O   1 
ATOM   1543 C  CB  . ALA A 1 198 ? -17.024 23.403  70.109 1.00 22.12  ? 352  ALA A CB  1 
ATOM   1544 N  N   . PRO A 1 199 ? -17.417 26.544  68.514 1.00 25.58  ? 353  PRO A N   1 
ATOM   1545 C  CA  . PRO A 1 199 ? -16.907 27.893  68.631 1.00 26.80  ? 353  PRO A CA  1 
ATOM   1546 C  C   . PRO A 1 199 ? -16.234 28.183  69.958 1.00 25.70  ? 353  PRO A C   1 
ATOM   1547 O  O   . PRO A 1 199 ? -16.705 27.792  71.028 1.00 27.95  ? 353  PRO A O   1 
ATOM   1548 C  CB  . PRO A 1 199 ? -18.171 28.767  68.414 1.00 27.20  ? 353  PRO A CB  1 
ATOM   1549 C  CG  . PRO A 1 199 ? -19.005 27.929  67.501 1.00 28.81  ? 353  PRO A CG  1 
ATOM   1550 C  CD  . PRO A 1 199 ? -18.823 26.528  68.061 1.00 27.20  ? 353  PRO A CD  1 
ATOM   1551 N  N   . LEU A 1 200 ? -15.065 28.809  69.872 1.00 26.40  ? 354  LEU A N   1 
ATOM   1552 C  CA  . LEU A 1 200 ? -14.268 29.240  70.998 1.00 27.59  ? 354  LEU A CA  1 
ATOM   1553 C  C   . LEU A 1 200 ? -13.669 28.134  71.827 1.00 25.63  ? 354  LEU A C   1 
ATOM   1554 O  O   . LEU A 1 200 ? -13.090 28.408  72.855 1.00 27.18  ? 354  LEU A O   1 
ATOM   1555 C  CB  . LEU A 1 200 ? -15.045 30.241  71.902 1.00 32.04  ? 354  LEU A CB  1 
ATOM   1556 C  CG  . LEU A 1 200 ? -15.433 31.565  71.219 1.00 39.05  ? 354  LEU A CG  1 
ATOM   1557 C  CD1 . LEU A 1 200 ? -16.299 32.421  72.131 1.00 42.59  ? 354  LEU A CD1 1 
ATOM   1558 C  CD2 . LEU A 1 200 ? -14.183 32.346  70.861 1.00 42.00  ? 354  LEU A CD2 1 
ATOM   1559 N  N   . LEU A 1 201 ? -13.781 26.876  71.341 1.00 23.54  ? 355  LEU A N   1 
ATOM   1560 C  CA  . LEU A 1 201 ? -13.286 25.702  72.044 1.00 21.78  ? 355  LEU A CA  1 
ATOM   1561 C  C   . LEU A 1 201 ? -12.338 24.843  71.196 1.00 20.09  ? 355  LEU A C   1 
ATOM   1562 O  O   . LEU A 1 201 ? -11.267 24.475  71.638 1.00 22.85  ? 355  LEU A O   1 
ATOM   1563 C  CB  . LEU A 1 201 ? -14.468 24.854  72.541 1.00 23.43  ? 355  LEU A CB  1 
ATOM   1564 C  CG  . LEU A 1 201 ? -15.270 25.549  73.655 1.00 24.57  ? 355  LEU A CG  1 
ATOM   1565 C  CD1 . LEU A 1 201 ? -16.549 24.771  73.913 1.00 25.18  ? 355  LEU A CD1 1 
ATOM   1566 C  CD2 . LEU A 1 201 ? -14.480 25.582  74.942 1.00 26.53  ? 355  LEU A CD2 1 
ATOM   1567 N  N   . SER A 1 202 ? -12.748 24.534  69.995 1.00 19.29  ? 356  SER A N   1 
ATOM   1568 C  CA  . SER A 1 202 ? -12.030 23.589  69.138 1.00 18.62  ? 356  SER A CA  1 
ATOM   1569 C  C   . SER A 1 202 ? -10.740 24.149  68.592 1.00 18.57  ? 356  SER A C   1 
ATOM   1570 O  O   . SER A 1 202 ? -9.941  23.382  68.066 1.00 16.78  ? 356  SER A O   1 
ATOM   1571 C  CB  . SER A 1 202 ? -12.911 23.119  67.983 1.00 19.14  ? 356  SER A CB  1 
ATOM   1572 O  OG  . SER A 1 202 ? -13.949 22.231  68.397 1.00 19.70  ? 356  SER A OG  1 
ATOM   1573 N  N   . ASP A 1 203 ? -10.540 25.464  68.739 1.00 18.86  ? 357  ASP A N   1 
ATOM   1574 C  CA  . ASP A 1 203 ? -9.361  26.139  68.274 1.00 18.87  ? 357  ASP A CA  1 
ATOM   1575 C  C   . ASP A 1 203 ? -8.491  26.638  69.436 1.00 18.94  ? 357  ASP A C   1 
ATOM   1576 O  O   . ASP A 1 203 ? -7.676  27.503  69.222 1.00 19.55  ? 357  ASP A O   1 
ATOM   1577 C  CB  . ASP A 1 203 ? -9.717  27.312  67.360 1.00 20.54  ? 357  ASP A CB  1 
ATOM   1578 C  CG  . ASP A 1 203 ? -10.704 28.271  67.956 1.00 24.50  ? 357  ASP A CG  1 
ATOM   1579 O  OD1 . ASP A 1 203 ? -11.182 28.073  69.079 1.00 25.27  ? 357  ASP A OD1 1 
ATOM   1580 O  OD2 . ASP A 1 203 ? -11.063 29.236  67.230 1.00 26.17  ? 357  ASP A OD2 1 
ATOM   1581 N  N   . THR A 1 204 ? -8.634  26.073  70.641 1.00 18.04  ? 358  THR A N   1 
ATOM   1582 C  CA  . THR A 1 204 ? -7.984  26.587  71.850 1.00 18.36  ? 358  THR A CA  1 
ATOM   1583 C  C   . THR A 1 204 ? -7.154  25.530  72.513 1.00 18.23  ? 358  THR A C   1 
ATOM   1584 O  O   . THR A 1 204 ? -7.103  24.413  72.064 1.00 19.24  ? 358  THR A O   1 
ATOM   1585 C  CB  . THR A 1 204 ? -9.033  27.083  72.865 1.00 20.98  ? 358  THR A CB  1 
ATOM   1586 O  OG1 . THR A 1 204 ? -9.815  25.966  73.318 1.00 22.17  ? 358  THR A OG1 1 
ATOM   1587 C  CG2 . THR A 1 204 ? -9.887  28.144  72.244 1.00 21.32  ? 358  THR A CG2 1 
ATOM   1588 N  N   . PHE A 1 205 ? -6.448  25.917  73.567 1.00 16.90  ? 359  PHE A N   1 
ATOM   1589 C  CA  . PHE A 1 205 ? -5.693  25.004  74.398 1.00 16.97  ? 359  PHE A CA  1 
ATOM   1590 C  C   . PHE A 1 205 ? -6.597  23.888  74.912 1.00 16.81  ? 359  PHE A C   1 
ATOM   1591 O  O   . PHE A 1 205 ? -6.146  22.754  75.012 1.00 16.39  ? 359  PHE A O   1 
ATOM   1592 C  CB  . PHE A 1 205 ? -5.049  25.798  75.569 1.00 17.08  ? 359  PHE A CB  1 
ATOM   1593 C  CG  . PHE A 1 205 ? -4.247  24.942  76.480 1.00 16.76  ? 359  PHE A CG  1 
ATOM   1594 C  CD1 . PHE A 1 205 ? -4.842  24.293  77.535 1.00 16.93  ? 359  PHE A CD1 1 
ATOM   1595 C  CD2 . PHE A 1 205 ? -2.917  24.672  76.203 1.00 17.00  ? 359  PHE A CD2 1 
ATOM   1596 C  CE1 . PHE A 1 205 ? -4.097  23.461  78.369 1.00 16.34  ? 359  PHE A CE1 1 
ATOM   1597 C  CE2 . PHE A 1 205 ? -2.167  23.860  77.023 1.00 17.76  ? 359  PHE A CE2 1 
ATOM   1598 C  CZ  . PHE A 1 205 ? -2.761  23.254  78.135 1.00 16.62  ? 359  PHE A CZ  1 
ATOM   1599 N  N   . ALA A 1 206 ? -7.833  24.209  75.187 1.00 16.94  ? 360  ALA A N   1 
ATOM   1600 C  CA  . ALA A 1 206 ? -8.804  23.214  75.719 1.00 17.34  ? 360  ALA A CA  1 
ATOM   1601 C  C   . ALA A 1 206 ? -9.035  22.074  74.729 1.00 16.94  ? 360  ALA A C   1 
ATOM   1602 O  O   . ALA A 1 206 ? -9.426  20.985  75.137 1.00 16.61  ? 360  ALA A O   1 
ATOM   1603 C  CB  . ALA A 1 206 ? -10.142 23.874  76.008 1.00 18.29  ? 360  ALA A CB  1 
ATOM   1604 N  N   . ALA A 1 207 ? -8.891  22.351  73.436 1.00 15.31  ? 361  ALA A N   1 
ATOM   1605 C  CA  . ALA A 1 207 ? -9.048  21.301  72.420 1.00 15.26  ? 361  ALA A CA  1 
ATOM   1606 C  C   . ALA A 1 207 ? -8.009  20.195  72.530 1.00 16.01  ? 361  ALA A C   1 
ATOM   1607 O  O   . ALA A 1 207 ? -8.231  19.103  72.014 1.00 16.08  ? 361  ALA A O   1 
ATOM   1608 C  CB  . ALA A 1 207 ? -8.976  21.884  71.028 1.00 16.66  ? 361  ALA A CB  1 
ATOM   1609 N  N   . GLY A 1 208 ? -6.904  20.477  73.195 1.00 15.19  ? 362  GLY A N   1 
ATOM   1610 C  CA  . GLY A 1 208 ? -5.783  19.567  73.249 1.00 15.09  ? 362  GLY A CA  1 
ATOM   1611 C  C   . GLY A 1 208 ? -6.017  18.325  74.091 1.00 15.32  ? 362  GLY A C   1 
ATOM   1612 O  O   . GLY A 1 208 ? -5.393  17.303  73.800 1.00 14.72  ? 362  GLY A O   1 
ATOM   1613 N  N   . PHE A 1 209 ? -6.936  18.375  75.059 1.00 15.76  ? 363  PHE A N   1 
ATOM   1614 C  CA  . PHE A 1 209 ? -7.244  17.168  75.860 1.00 16.14  ? 363  PHE A CA  1 
ATOM   1615 C  C   . PHE A 1 209 ? -7.847  16.113  74.959 1.00 16.77  ? 363  PHE A C   1 
ATOM   1616 O  O   . PHE A 1 209 ? -7.344  14.972  74.899 1.00 16.63  ? 363  PHE A O   1 
ATOM   1617 C  CB  . PHE A 1 209 ? -8.168  17.482  77.051 1.00 17.98  ? 363  PHE A CB  1 
ATOM   1618 C  CG  . PHE A 1 209 ? -7.632  18.546  77.948 1.00 17.90  ? 363  PHE A CG  1 
ATOM   1619 C  CD1 . PHE A 1 209 ? -6.632  18.272  78.853 1.00 18.44  ? 363  PHE A CD1 1 
ATOM   1620 C  CD2 . PHE A 1 209 ? -8.114  19.820  77.878 1.00 18.49  ? 363  PHE A CD2 1 
ATOM   1621 C  CE1 . PHE A 1 209 ? -6.112  19.250  79.670 1.00 19.56  ? 363  PHE A CE1 1 
ATOM   1622 C  CE2 . PHE A 1 209 ? -7.578  20.806  78.692 1.00 20.11  ? 363  PHE A CE2 1 
ATOM   1623 C  CZ  . PHE A 1 209 ? -6.598  20.513  79.582 1.00 17.85  ? 363  PHE A CZ  1 
ATOM   1624 N  N   . MET A 1 210 ? -8.851  16.493  74.173 1.00 15.58  ? 364  MET A N   1 
ATOM   1625 C  CA  . MET A 1 210 ? -9.434  15.564  73.193 1.00 16.79  ? 364  MET A CA  1 
ATOM   1626 C  C   . MET A 1 210 ? -8.415  15.070  72.170 1.00 17.79  ? 364  MET A C   1 
ATOM   1627 O  O   . MET A 1 210 ? -8.397  13.889  71.800 1.00 18.19  ? 364  MET A O   1 
ATOM   1628 C  CB  . MET A 1 210 ? -10.625 16.179  72.475 1.00 18.29  ? 364  MET A CB  1 
ATOM   1629 C  CG  . MET A 1 210 ? -11.901 15.994  73.280 1.00 19.46  ? 364  MET A CG  1 
ATOM   1630 S  SD  . MET A 1 210 ? -13.209 17.001  72.580 1.00 21.13  ? 364  MET A SD  1 
ATOM   1631 C  CE  . MET A 1 210 ? -14.577 16.346  73.509 1.00 21.88  ? 364  MET A CE  1 
ATOM   1632 N  N   . TRP A 1 211 ? -7.596  15.982  71.642 1.00 15.56  ? 365  TRP A N   1 
ATOM   1633 C  CA  . TRP A 1 211 ? -6.648  15.553  70.595 1.00 15.42  ? 365  TRP A CA  1 
ATOM   1634 C  C   . TRP A 1 211 ? -5.563  14.621  71.121 1.00 13.26  ? 365  TRP A C   1 
ATOM   1635 O  O   . TRP A 1 211 ? -5.379  13.505  70.575 1.00 15.64  ? 365  TRP A O   1 
ATOM   1636 C  CB  . TRP A 1 211 ? -6.069  16.784  69.870 1.00 15.18  ? 365  TRP A CB  1 
ATOM   1637 C  CG  . TRP A 1 211 ? -5.185  16.493  68.765 1.00 16.68  ? 365  TRP A CG  1 
ATOM   1638 C  CD1 . TRP A 1 211 ? -3.987  17.120  68.508 1.00 17.18  ? 365  TRP A CD1 1 
ATOM   1639 C  CD2 . TRP A 1 211 ? -5.363  15.530  67.713 1.00 15.20  ? 365  TRP A CD2 1 
ATOM   1640 N  NE1 . TRP A 1 211 ? -3.426  16.613  67.373 1.00 17.21  ? 365  TRP A NE1 1 
ATOM   1641 C  CE2 . TRP A 1 211 ? -4.240  15.644  66.861 1.00 16.63  ? 365  TRP A CE2 1 
ATOM   1642 C  CE3 . TRP A 1 211 ? -6.351  14.614  67.389 1.00 14.99  ? 365  TRP A CE3 1 
ATOM   1643 C  CZ2 . TRP A 1 211 ? -4.079  14.846  65.717 1.00 17.11  ? 365  TRP A CZ2 1 
ATOM   1644 C  CZ3 . TRP A 1 211 ? -6.182  13.794  66.283 1.00 16.12  ? 365  TRP A CZ3 1 
ATOM   1645 C  CH2 . TRP A 1 211 ? -5.042  13.932  65.455 1.00 16.28  ? 365  TRP A CH2 1 
ATOM   1646 N  N   . LEU A 1 212 ? -4.934  14.981  72.237 1.00 14.61  ? 366  LEU A N   1 
ATOM   1647 C  CA  . LEU A 1 212 ? -3.873  14.133  72.747 1.00 13.75  ? 366  LEU A CA  1 
ATOM   1648 C  C   . LEU A 1 212 ? -4.428  12.808  73.253 1.00 14.03  ? 366  LEU A C   1 
ATOM   1649 O  O   . LEU A 1 212 ? -3.825  11.778  73.054 1.00 13.68  ? 366  LEU A O   1 
ATOM   1650 C  CB  . LEU A 1 212 ? -3.162  14.813  73.895 1.00 13.59  ? 366  LEU A CB  1 
ATOM   1651 C  CG  . LEU A 1 212 ? -1.841  14.117  74.313 1.00 13.63  ? 366  LEU A CG  1 
ATOM   1652 C  CD1 . LEU A 1 212 ? -0.850  13.839  73.188 1.00 14.03  ? 366  LEU A CD1 1 
ATOM   1653 C  CD2 . LEU A 1 212 ? -1.202  14.916  75.431 1.00 14.84  ? 366  LEU A CD2 1 
ATOM   1654 N  N   . ASP A 1 213 ? -5.595  12.842  73.906 1.00 13.26  ? 367  ASP A N   1 
ATOM   1655 C  CA  . ASP A 1 213 ? -6.183  11.595  74.423 1.00 13.82  ? 367  ASP A CA  1 
ATOM   1656 C  C   . ASP A 1 213 ? -6.549  10.639  73.283 1.00 14.36  ? 367  ASP A C   1 
ATOM   1657 O  O   . ASP A 1 213 ? -6.295  9.429   73.383 1.00 15.19  ? 367  ASP A O   1 
ATOM   1658 C  CB  . ASP A 1 213 ? -7.424  11.832  75.216 1.00 14.05  ? 367  ASP A CB  1 
ATOM   1659 C  CG  . ASP A 1 213 ? -7.766  10.674  76.115 1.00 13.95  ? 367  ASP A CG  1 
ATOM   1660 O  OD1 . ASP A 1 213 ? -6.910  10.353  76.973 1.00 15.65  ? 367  ASP A OD1 1 
ATOM   1661 O  OD2 . ASP A 1 213 ? -8.902  10.152  75.978 1.00 15.24  ? 367  ASP A OD2 1 
ATOM   1662 N  N   . LYS A 1 214 ? -7.085  11.211  72.202 1.00 14.00  ? 368  LYS A N   1 
ATOM   1663 C  CA  . LYS A 1 214 ? -7.452  10.408  71.031 1.00 14.40  ? 368  LYS A CA  1 
ATOM   1664 C  C   . LYS A 1 214 ? -6.223  9.743   70.458 1.00 13.39  ? 368  LYS A C   1 
ATOM   1665 O  O   . LYS A 1 214 ? -6.270  8.577   70.055 1.00 14.22  ? 368  LYS A O   1 
ATOM   1666 C  CB  . LYS A 1 214 ? -8.176  11.233  69.975 1.00 14.52  ? 368  LYS A CB  1 
ATOM   1667 C  CG  . LYS A 1 214 ? -8.499  10.479  68.703 1.00 15.02  ? 368  LYS A CG  1 
ATOM   1668 C  CD  . LYS A 1 214 ? -9.493  11.266  67.873 1.00 15.99  ? 368  LYS A CD  1 
ATOM   1669 C  CE  . LYS A 1 214 ? -10.900 11.147  68.395 1.00 15.66  ? 368  LYS A CE  1 
ATOM   1670 N  NZ  . LYS A 1 214 ? -11.689 12.193  67.764 1.00 15.88  ? 368  LYS A NZ  1 
ATOM   1671 N  N   . LEU A 1 215 ? -5.149  10.514  70.318 1.00 12.85  ? 369  LEU A N   1 
ATOM   1672 C  CA  . LEU A 1 215 ? -3.886  9.931   69.849 1.00 13.82  ? 369  LEU A CA  1 
ATOM   1673 C  C   . LEU A 1 215 ? -3.401  8.806   70.739 1.00 13.69  ? 369  LEU A C   1 
ATOM   1674 O  O   . LEU A 1 215 ? -3.024  7.722   70.252 1.00 13.92  ? 369  LEU A O   1 
ATOM   1675 C  CB  . LEU A 1 215 ? -2.824  11.014  69.654 1.00 14.44  ? 369  LEU A CB  1 
ATOM   1676 C  CG  . LEU A 1 215 ? -3.070  12.017  68.502 1.00 14.32  ? 369  LEU A CG  1 
ATOM   1677 C  CD1 . LEU A 1 215 ? -2.130  13.160  68.734 1.00 15.93  ? 369  LEU A CD1 1 
ATOM   1678 C  CD2 . LEU A 1 215 ? -2.916  11.397  67.116 1.00 16.37  ? 369  LEU A CD2 1 
ATOM   1679 N  N   . GLY A 1 216 ? -3.413  9.042   72.024 1.00 12.55  ? 370  GLY A N   1 
ATOM   1680 C  CA  . GLY A 1 216 ? -2.992  8.045   72.992 1.00 14.19  ? 370  GLY A CA  1 
ATOM   1681 C  C   . GLY A 1 216 ? -3.814  6.762   72.949 1.00 14.31  ? 370  GLY A C   1 
ATOM   1682 O  O   . GLY A 1 216 ? -3.274  5.628   72.880 1.00 14.66  ? 370  GLY A O   1 
ATOM   1683 N  N   . LEU A 1 217 ? -5.121  6.909   72.924 1.00 13.32  ? 371  LEU A N   1 
ATOM   1684 C  CA  . LEU A 1 217 ? -5.967  5.752   72.879 1.00 13.50  ? 371  LEU A CA  1 
ATOM   1685 C  C   . LEU A 1 217 ? -5.872  5.029   71.549 1.00 14.06  ? 371  LEU A C   1 
ATOM   1686 O  O   . LEU A 1 217 ? -5.867  3.774   71.477 1.00 14.61  ? 371  LEU A O   1 
ATOM   1687 C  CB  . LEU A 1 217 ? -7.432  6.123   73.184 1.00 14.24  ? 371  LEU A CB  1 
ATOM   1688 C  CG  . LEU A 1 217 ? -7.694  6.586   74.591 1.00 12.93  ? 371  LEU A CG  1 
ATOM   1689 C  CD1 . LEU A 1 217 ? -9.122  7.165   74.635 1.00 14.44  ? 371  LEU A CD1 1 
ATOM   1690 C  CD2 . LEU A 1 217 ? -7.575  5.442   75.591 1.00 14.07  ? 371  LEU A CD2 1 
ATOM   1691 N  N   . SER A 1 218 ? -5.792  5.813   70.476 1.00 12.65  ? 372  SER A N   1 
ATOM   1692 C  CA  . SER A 1 218 ? -5.755  5.219   69.152 1.00 13.70  ? 372  SER A CA  1 
ATOM   1693 C  C   . SER A 1 218 ? -4.511  4.334   69.048 1.00 13.99  ? 372  SER A C   1 
ATOM   1694 O  O   . SER A 1 218 ? -4.581  3.176   68.593 1.00 16.21  ? 372  SER A O   1 
ATOM   1695 C  CB  . SER A 1 218 ? -5.730  6.277   68.050 1.00 13.06  ? 372  SER A CB  1 
ATOM   1696 O  OG  . SER A 1 218 ? -6.988  6.919   67.919 1.00 13.55  ? 372  SER A OG  1 
ATOM   1697 N  N   . ALA A 1 219 ? -3.398  4.911   69.486 1.00 13.66  ? 373  ALA A N   1 
ATOM   1698 C  CA  . ALA A 1 219 ? -2.113  4.163   69.442 1.00 14.05  ? 373  ALA A CA  1 
ATOM   1699 C  C   . ALA A 1 219 ? -2.171  2.937   70.329 1.00 15.73  ? 373  ALA A C   1 
ATOM   1700 O  O   . ALA A 1 219 ? -1.793  1.833   69.910 1.00 16.41  ? 373  ALA A O   1 
ATOM   1701 C  CB  . ALA A 1 219 ? -0.940  5.045   69.792 1.00 15.23  ? 373  ALA A CB  1 
ATOM   1702 N  N   . ARG A 1 220 ? -2.665  3.125   71.550 1.00 15.15  ? 374  ARG A N   1 
ATOM   1703 C  CA  . ARG A 1 220 ? -2.819  2.012   72.505 1.00 14.67  ? 374  ARG A CA  1 
ATOM   1704 C  C   . ARG A 1 220 ? -3.718  0.842   72.051 1.00 15.54  ? 374  ARG A C   1 
ATOM   1705 O  O   . ARG A 1 220 ? -3.390  -0.315  72.377 1.00 15.61  ? 374  ARG A O   1 
ATOM   1706 C  CB  . ARG A 1 220 ? -3.250  2.547   73.852 1.00 14.15  ? 374  ARG A CB  1 
ATOM   1707 C  CG  . ARG A 1 220 ? -3.375  1.487   74.941 1.00 15.17  ? 374  ARG A CG  1 
ATOM   1708 C  CD  . ARG A 1 220 ? -2.042  0.861   75.249 1.00 15.52  ? 374  ARG A CD  1 
ATOM   1709 N  NE  . ARG A 1 220 ? -2.155  -0.290  76.162 1.00 16.02  ? 374  ARG A NE  1 
ATOM   1710 C  CZ  . ARG A 1 220 ? -2.252  -1.548  75.759 1.00 16.68  ? 374  ARG A CZ  1 
ATOM   1711 N  NH1 . ARG A 1 220 ? -2.354  -1.878  74.484 1.00 18.08  ? 374  ARG A NH1 1 
ATOM   1712 N  NH2 . ARG A 1 220 ? -2.249  -2.523  76.686 1.00 18.39  ? 374  ARG A NH2 1 
ATOM   1713 N  N   . MET A 1 221 ? -4.769  1.159   71.278 1.00 15.51  ? 375  MET A N   1 
ATOM   1714 C  CA  . MET A 1 221 ? -5.802  0.220   70.922 1.00 15.80  ? 375  MET A CA  1 
ATOM   1715 C  C   . MET A 1 221 ? -5.578  -0.433  69.562 1.00 16.42  ? 375  MET A C   1 
ATOM   1716 O  O   . MET A 1 221 ? -6.323  -1.360  69.231 1.00 18.09  ? 375  MET A O   1 
ATOM   1717 C  CB  . MET A 1 221 ? -7.177  0.850   71.027 1.00 14.89  ? 375  MET A CB  1 
ATOM   1718 C  CG  . MET A 1 221 ? -7.524  1.226   72.455 1.00 15.45  ? 375  MET A CG  1 
ATOM   1719 S  SD  . MET A 1 221 ? -9.187  1.902   72.626 1.00 17.48  ? 375  MET A SD  1 
ATOM   1720 C  CE  . MET A 1 221 ? -10.200 0.427   72.480 1.00 17.70  ? 375  MET A CE  1 
ATOM   1721 N  N   . GLY A 1 222 ? -4.567  -0.018  68.804 1.00 15.29  ? 376  GLY A N   1 
ATOM   1722 C  CA  . GLY A 1 222 ? -4.270  -0.700  67.517 1.00 17.03  ? 376  GLY A CA  1 
ATOM   1723 C  C   . GLY A 1 222 ? -4.596  0.083   66.255 1.00 17.38  ? 376  GLY A C   1 
ATOM   1724 O  O   . GLY A 1 222 ? -4.455  -0.439  65.136 1.00 19.95  ? 376  GLY A O   1 
ATOM   1725 N  N   . ILE A 1 223 ? -5.099  1.297   66.392 1.00 15.29  ? 377  ILE A N   1 
ATOM   1726 C  CA  . ILE A 1 223 ? -5.269  2.158   65.222 1.00 15.29  ? 377  ILE A CA  1 
ATOM   1727 C  C   . ILE A 1 223 ? -3.899  2.614   64.702 1.00 16.50  ? 377  ILE A C   1 
ATOM   1728 O  O   . ILE A 1 223 ? -3.070  3.129   65.434 1.00 17.18  ? 377  ILE A O   1 
ATOM   1729 C  CB  . ILE A 1 223 ? -6.153  3.387   65.547 1.00 18.67  ? 377  ILE A CB  1 
ATOM   1730 C  CG1 . ILE A 1 223 ? -7.544  3.006   66.007 1.00 21.16  ? 377  ILE A CG1 1 
ATOM   1731 C  CG2 . ILE A 1 223 ? -6.218  4.394   64.391 1.00 17.76  ? 377  ILE A CG2 1 
ATOM   1732 C  CD1 . ILE A 1 223 ? -8.466  2.396   65.010 1.00 25.39  ? 377  ILE A CD1 1 
ATOM   1733 N  N   . GLU A 1 224 ? -3.655  2.451   63.398 1.00 15.98  ? 378  GLU A N   1 
ATOM   1734 C  CA  . GLU A 1 224 ? -2.308  2.651   62.854 1.00 17.73  ? 378  GLU A CA  1 
ATOM   1735 C  C   . GLU A 1 224 ? -2.003  4.082   62.368 1.00 17.42  ? 378  GLU A C   1 
ATOM   1736 O  O   . GLU A 1 224 ? -0.868  4.507   62.366 1.00 17.34  ? 378  GLU A O   1 
ATOM   1737 C  CB  . GLU A 1 224 ? -2.137  1.642   61.685 1.00 19.07  ? 378  GLU A CB  1 
ATOM   1738 C  CG  . GLU A 1 224 ? -0.686  1.464   61.301 1.00 21.12  ? 378  GLU A CG  1 
ATOM   1739 C  CD  . GLU A 1 224 ? -0.479  0.731   59.995 1.00 23.61  ? 378  GLU A CD  1 
ATOM   1740 O  OE1 . GLU A 1 224 ? -1.252  0.981   59.067 1.00 22.29  ? 378  GLU A OE1 1 
ATOM   1741 O  OE2 . GLU A 1 224 ? 0.515   -0.056  59.933 1.00 24.21  ? 378  GLU A OE2 1 
ATOM   1742 N  N   . VAL A 1 225 ? -3.039  4.804   61.907 1.00 16.57  ? 379  VAL A N   1 
ATOM   1743 C  CA  . VAL A 1 225 ? -2.991  6.179   61.402 1.00 15.16  ? 379  VAL A CA  1 
ATOM   1744 C  C   . VAL A 1 225 ? -4.232  6.918   61.869 1.00 16.82  ? 379  VAL A C   1 
ATOM   1745 O  O   . VAL A 1 225 ? -5.342  6.353   61.828 1.00 17.38  ? 379  VAL A O   1 
ATOM   1746 C  CB  . VAL A 1 225 ? -2.900  6.229   59.855 1.00 17.32  ? 379  VAL A CB  1 
ATOM   1747 C  CG1 . VAL A 1 225 ? -3.032  7.657   59.322 1.00 19.31  ? 379  VAL A CG1 1 
ATOM   1748 C  CG2 . VAL A 1 225 ? -1.619  5.581   59.396 1.00 18.92  ? 379  VAL A CG2 1 
ATOM   1749 N  N   . VAL A 1 226 ? -4.043  8.161   62.301 1.00 15.94  ? 380  VAL A N   1 
ATOM   1750 C  CA  . VAL A 1 226 ? -5.146  9.051   62.668 1.00 15.92  ? 380  VAL A CA  1 
ATOM   1751 C  C   . VAL A 1 226 ? -5.020  10.324  61.827 1.00 16.63  ? 380  VAL A C   1 
ATOM   1752 O  O   . VAL A 1 226 ? -4.022  11.041  61.881 1.00 17.33  ? 380  VAL A O   1 
ATOM   1753 C  CB  . VAL A 1 226 ? -5.024  9.407   64.169 1.00 16.47  ? 380  VAL A CB  1 
ATOM   1754 C  CG1 . VAL A 1 226 ? -6.075  10.399  64.602 1.00 17.39  ? 380  VAL A CG1 1 
ATOM   1755 C  CG2 . VAL A 1 226 ? -5.093  8.156   65.023 1.00 17.85  ? 380  VAL A CG2 1 
ATOM   1756 N  N   . MET A 1 227 ? -6.081  10.627  61.102 1.00 17.09  ? 381  MET A N   1 
ATOM   1757 C  CA  . MET A 1 227 ? -6.141  11.798  60.213 1.00 15.88  ? 381  MET A CA  1 
ATOM   1758 C  C   . MET A 1 227 ? -6.981  12.930  60.841 1.00 16.69  ? 381  MET A C   1 
ATOM   1759 O  O   . MET A 1 227 ? -8.191  12.863  60.916 1.00 16.21  ? 381  MET A O   1 
ATOM   1760 C  CB  . MET A 1 227 ? -6.694  11.357  58.864 1.00 16.94  ? 381  MET A CB  1 
ATOM   1761 C  CG  . MET A 1 227 ? -5.845  10.288  58.256 1.00 19.38  ? 381  MET A CG  1 
ATOM   1762 S  SD  . MET A 1 227 ? -6.445  9.849   56.627 1.00 23.32  ? 381  MET A SD  1 
ATOM   1763 C  CE  . MET A 1 227 ? -5.480  8.378   56.352 1.00 24.13  ? 381  MET A CE  1 
ATOM   1764 N  N   . ARG A 1 228 ? -6.308  13.977  61.247 1.00 16.45  ? 382  ARG A N   1 
ATOM   1765 C  CA  . ARG A 1 228 ? -6.948  15.104  61.909 1.00 17.38  ? 382  ARG A CA  1 
ATOM   1766 C  C   . ARG A 1 228 ? -7.684  16.006  60.939 1.00 16.42  ? 382  ARG A C   1 
ATOM   1767 O  O   . ARG A 1 228 ? -7.053  16.633  60.064 1.00 18.27  ? 382  ARG A O   1 
ATOM   1768 C  CB  . ARG A 1 228 ? -5.906  15.919  62.654 1.00 16.50  ? 382  ARG A CB  1 
ATOM   1769 C  CG  . ARG A 1 228 ? -6.343  17.238  63.230 1.00 16.72  ? 382  ARG A CG  1 
ATOM   1770 C  CD  . ARG A 1 228 ? -7.478  17.095  64.242 1.00 16.77  ? 382  ARG A CD  1 
ATOM   1771 N  NE  . ARG A 1 228 ? -7.862  18.389  64.715 1.00 16.82  ? 382  ARG A NE  1 
ATOM   1772 C  CZ  . ARG A 1 228 ? -7.411  19.025  65.798 1.00 16.88  ? 382  ARG A CZ  1 
ATOM   1773 N  NH1 . ARG A 1 228 ? -6.514  18.460  66.621 1.00 17.55  ? 382  ARG A NH1 1 
ATOM   1774 N  NH2 . ARG A 1 228 ? -7.804  20.300  66.010 1.00 17.07  ? 382  ARG A NH2 1 
ATOM   1775 N  N   . GLN A 1 229 ? -8.964  16.168  61.195 1.00 16.81  ? 383  GLN A N   1 
ATOM   1776 C  CA  . GLN A 1 229 ? -9.806  17.218  60.622 1.00 18.97  ? 383  GLN A CA  1 
ATOM   1777 C  C   . GLN A 1 229 ? -9.601  18.477  61.467 1.00 18.27  ? 383  GLN A C   1 
ATOM   1778 O  O   . GLN A 1 229 ? -9.902  18.467  62.661 1.00 17.69  ? 383  GLN A O   1 
ATOM   1779 C  CB  . GLN A 1 229 ? -11.277 16.770  60.605 1.00 17.92  ? 383  GLN A CB  1 
ATOM   1780 C  CG  . GLN A 1 229 ? -12.268 17.815  60.090 1.00 18.58  ? 383  GLN A CG  1 
ATOM   1781 C  CD  . GLN A 1 229 ? -12.401 17.753  58.581 1.00 18.19  ? 383  GLN A CD  1 
ATOM   1782 O  OE1 . GLN A 1 229 ? -11.626 17.078  57.883 1.00 20.03  ? 383  GLN A OE1 1 
ATOM   1783 N  NE2 . GLN A 1 229 ? -13.441 18.422  58.063 1.00 20.92  ? 383  GLN A NE2 1 
ATOM   1784 N  N   . VAL A 1 230 ? -9.012  19.559  60.930 1.00 17.75  ? 384  VAL A N   1 
ATOM   1785 C  CA  . VAL A 1 230 ? -8.478  19.750  59.571 1.00 18.44  ? 384  VAL A CA  1 
ATOM   1786 C  C   . VAL A 1 230 ? -7.152  20.511  59.724 1.00 17.34  ? 384  VAL A C   1 
ATOM   1787 O  O   . VAL A 1 230 ? -6.945  21.181  60.761 1.00 16.97  ? 384  VAL A O   1 
ATOM   1788 C  CB  . VAL A 1 230 ? -9.520  20.538  58.730 1.00 19.16  ? 384  VAL A CB  1 
ATOM   1789 C  CG1 . VAL A 1 230 ? -9.654  21.974  59.187 1.00 19.07  ? 384  VAL A CG1 1 
ATOM   1790 C  CG2 . VAL A 1 230 ? -9.247  20.392  57.245 1.00 20.52  ? 384  VAL A CG2 1 
ATOM   1791 N  N   . PHE A 1 231 ? -6.230  20.371  58.765 1.00 18.58  ? 385  PHE A N   1 
ATOM   1792 C  CA  . PHE A 1 231 ? -4.986  21.139  58.824 1.00 19.95  ? 385  PHE A CA  1 
ATOM   1793 C  C   . PHE A 1 231 ? -5.280  22.644  58.738 1.00 21.12  ? 385  PHE A C   1 
ATOM   1794 O  O   . PHE A 1 231 ? -4.774  23.435  59.528 1.00 20.58  ? 385  PHE A O   1 
ATOM   1795 C  CB  . PHE A 1 231 ? -4.015  20.708  57.740 1.00 20.16  ? 385  PHE A CB  1 
ATOM   1796 C  CG  . PHE A 1 231 ? -2.707  21.409  57.827 1.00 20.79  ? 385  PHE A CG  1 
ATOM   1797 C  CD1 . PHE A 1 231 ? -1.851  21.148  58.890 1.00 22.78  ? 385  PHE A CD1 1 
ATOM   1798 C  CD2 . PHE A 1 231 ? -2.351  22.359  56.879 1.00 24.00  ? 385  PHE A CD2 1 
ATOM   1799 C  CE1 . PHE A 1 231 ? -0.656  21.811  59.005 1.00 23.92  ? 385  PHE A CE1 1 
ATOM   1800 C  CE2 . PHE A 1 231 ? -1.165  23.032  57.006 1.00 21.61  ? 385  PHE A CE2 1 
ATOM   1801 C  CZ  . PHE A 1 231 ? -0.326  22.748  58.042 1.00 23.05  ? 385  PHE A CZ  1 
ATOM   1802 N  N   . PHE A 1 232 ? -6.141  22.983  57.778 1.00 20.73  ? 386  PHE A N   1 
ATOM   1803 C  CA  . PHE A 1 232 ? -6.498  24.319  57.438 1.00 21.90  ? 386  PHE A CA  1 
ATOM   1804 C  C   . PHE A 1 232 ? -7.835  24.307  56.746 1.00 21.73  ? 386  PHE A C   1 
ATOM   1805 O  O   . PHE A 1 232 ? -8.097  23.427  55.930 1.00 21.27  ? 386  PHE A O   1 
ATOM   1806 C  CB  . PHE A 1 232 ? -5.433  24.882  56.489 1.00 23.28  ? 386  PHE A CB  1 
ATOM   1807 C  CG  . PHE A 1 232 ? -5.725  26.288  56.018 1.00 23.20  ? 386  PHE A CG  1 
ATOM   1808 C  CD1 . PHE A 1 232 ? -6.466  26.492  54.879 1.00 24.30  ? 386  PHE A CD1 1 
ATOM   1809 C  CD2 . PHE A 1 232 ? -5.210  27.395  56.703 1.00 24.10  ? 386  PHE A CD2 1 
ATOM   1810 C  CE1 . PHE A 1 232 ? -6.739  27.789  54.434 1.00 28.41  ? 386  PHE A CE1 1 
ATOM   1811 C  CE2 . PHE A 1 232 ? -5.468  28.692  56.270 1.00 27.25  ? 386  PHE A CE2 1 
ATOM   1812 C  CZ  . PHE A 1 232 ? -6.232  28.893  55.134 1.00 26.07  ? 386  PHE A CZ  1 
ATOM   1813 N  N   . GLY A 1 233 ? -8.684  25.279  57.077 1.00 22.14  ? 387  GLY A N   1 
ATOM   1814 C  CA  . GLY A 1 233 ? -9.967  25.464  56.424 1.00 22.81  ? 387  GLY A CA  1 
ATOM   1815 C  C   . GLY A 1 233 ? -11.079 25.999  57.295 1.00 23.38  ? 387  GLY A C   1 
ATOM   1816 O  O   . GLY A 1 233 ? -10.833 26.505  58.414 1.00 23.49  ? 387  GLY A O   1 
ATOM   1817 N  N   . ALA A 1 234 ? -12.299 25.875  56.785 1.00 23.21  ? 388  ALA A N   1 
ATOM   1818 C  CA  . ALA A 1 234 ? -13.524 26.426  57.407 1.00 24.14  ? 388  ALA A CA  1 
ATOM   1819 C  C   . ALA A 1 234 ? -13.795 25.778  58.725 1.00 24.86  ? 388  ALA A C   1 
ATOM   1820 O  O   . ALA A 1 234 ? -13.425 24.608  58.964 1.00 25.84  ? 388  ALA A O   1 
ATOM   1821 C  CB  . ALA A 1 234 ? -14.721 26.232  56.491 1.00 27.29  ? 388  ALA A CB  1 
ATOM   1822 N  N   . GLY A 1 235 ? -14.377 26.536  59.632 1.00 27.17  ? 389  GLY A N   1 
ATOM   1823 C  CA  . GLY A 1 235 ? -14.657 26.053  60.978 1.00 25.66  ? 389  GLY A CA  1 
ATOM   1824 C  C   . GLY A 1 235 ? -13.589 26.546  61.933 1.00 27.22  ? 389  GLY A C   1 
ATOM   1825 O  O   . GLY A 1 235 ? -12.841 27.479  61.634 1.00 28.31  ? 389  GLY A O   1 
ATOM   1826 N  N   . ASN A 1 236 ? -13.498 25.899  63.090 1.00 22.86  ? 390  ASN A N   1 
ATOM   1827 C  CA  . ASN A 1 236 ? -12.428 26.228  63.989 1.00 22.38  ? 390  ASN A CA  1 
ATOM   1828 C  C   . ASN A 1 236 ? -11.749 25.016  64.647 1.00 21.32  ? 390  ASN A C   1 
ATOM   1829 O  O   . ASN A 1 236 ? -11.108 25.171  65.652 1.00 21.08  ? 390  ASN A O   1 
ATOM   1830 C  CB  . ASN A 1 236 ? -12.941 27.201  65.015 1.00 24.36  ? 390  ASN A CB  1 
ATOM   1831 C  CG  . ASN A 1 236 ? -13.779 26.523  66.075 1.00 23.97  ? 390  ASN A CG  1 
ATOM   1832 O  OD1 . ASN A 1 236 ? -14.485 25.574  65.780 1.00 25.17  ? 390  ASN A OD1 1 
ATOM   1833 N  ND2 . ASN A 1 236 ? -13.691 27.019  67.326 1.00 24.72  ? 390  ASN A ND2 1 
ATOM   1834 N  N   . TYR A 1 237 ? -11.901 23.824  64.065 1.00 18.57  ? 391  TYR A N   1 
ATOM   1835 C  CA  . TYR A 1 237 ? -11.094 22.679  64.485 1.00 17.53  ? 391  TYR A CA  1 
ATOM   1836 C  C   . TYR A 1 237 ? -9.831  22.593  63.681 1.00 19.30  ? 391  TYR A C   1 
ATOM   1837 O  O   . TYR A 1 237 ? -9.072  21.649  63.791 1.00 18.19  ? 391  TYR A O   1 
ATOM   1838 C  CB  . TYR A 1 237 ? -11.908 21.366  64.466 1.00 18.96  ? 391  TYR A CB  1 
ATOM   1839 C  CG  . TYR A 1 237 ? -12.750 21.083  63.253 1.00 17.87  ? 391  TYR A CG  1 
ATOM   1840 C  CD1 . TYR A 1 237 ? -12.407 21.522  61.986 1.00 18.90  ? 391  TYR A CD1 1 
ATOM   1841 C  CD2 . TYR A 1 237 ? -13.931 20.352  63.384 1.00 18.82  ? 391  TYR A CD2 1 
ATOM   1842 C  CE1 . TYR A 1 237 ? -13.202 21.204  60.889 1.00 18.98  ? 391  TYR A CE1 1 
ATOM   1843 C  CE2 . TYR A 1 237 ? -14.694 20.015  62.297 1.00 18.34  ? 391  TYR A CE2 1 
ATOM   1844 C  CZ  . TYR A 1 237 ? -14.329 20.475  61.055 1.00 17.93  ? 391  TYR A CZ  1 
ATOM   1845 O  OH  . TYR A 1 237 ? -15.076 20.231  59.960 1.00 19.40  ? 391  TYR A OH  1 
ATOM   1846 N  N   . HIS A 1 238 ? -9.576  23.600  62.827 1.00 17.98  ? 392  HIS A N   1 
ATOM   1847 C  CA  . HIS A 1 238 ? -8.292  23.669  62.163 1.00 18.59  ? 392  HIS A CA  1 
ATOM   1848 C  C   . HIS A 1 238 ? -7.074  23.737  63.079 1.00 16.72  ? 392  HIS A C   1 
ATOM   1849 O  O   . HIS A 1 238 ? -7.129  24.285  64.173 1.00 18.00  ? 392  HIS A O   1 
ATOM   1850 C  CB  . HIS A 1 238 ? -8.273  24.880  61.197 1.00 19.08  ? 392  HIS A CB  1 
ATOM   1851 C  CG  . HIS A 1 238 ? -8.756  26.175  61.788 1.00 20.15  ? 392  HIS A CG  1 
ATOM   1852 N  ND1 . HIS A 1 238 ? -9.222  27.206  60.994 1.00 22.30  ? 392  HIS A ND1 1 
ATOM   1853 C  CD2 . HIS A 1 238 ? -8.922  26.598  63.072 1.00 20.79  ? 392  HIS A CD2 1 
ATOM   1854 C  CE1 . HIS A 1 238 ? -9.546  28.235  61.754 1.00 22.55  ? 392  HIS A CE1 1 
ATOM   1855 N  NE2 . HIS A 1 238 ? -9.429  27.877  63.020 1.00 22.46  ? 392  HIS A NE2 1 
ATOM   1856 N  N   . LEU A 1 239 ? -5.992  23.148  62.624 1.00 17.41  ? 393  LEU A N   1 
ATOM   1857 C  CA  . LEU A 1 239 ? -4.690  23.326  63.265 1.00 18.01  ? 393  LEU A CA  1 
ATOM   1858 C  C   . LEU A 1 239 ? -4.056  24.700  63.022 1.00 19.10  ? 393  LEU A C   1 
ATOM   1859 O  O   . LEU A 1 239 ? -3.311  25.193  63.865 1.00 18.80  ? 393  LEU A O   1 
ATOM   1860 C  CB  . LEU A 1 239 ? -3.707  22.268  62.779 1.00 17.37  ? 393  LEU A CB  1 
ATOM   1861 C  CG  . LEU A 1 239 ? -4.122  20.807  63.098 1.00 18.89  ? 393  LEU A CG  1 
ATOM   1862 C  CD1 . LEU A 1 239 ? -3.045  19.874  62.582 1.00 19.72  ? 393  LEU A CD1 1 
ATOM   1863 C  CD2 . LEU A 1 239 ? -4.284  20.607  64.612 1.00 18.24  ? 393  LEU A CD2 1 
ATOM   1864 N  N   . VAL A 1 240 ? -4.401  25.290  61.887 1.00 19.57  ? 394  VAL A N   1 
ATOM   1865 C  CA  . VAL A 1 240 ? -3.793  26.559  61.413 1.00 22.60  ? 394  VAL A CA  1 
ATOM   1866 C  C   . VAL A 1 240 ? -4.950  27.484  61.018 1.00 23.56  ? 394  VAL A C   1 
ATOM   1867 O  O   . VAL A 1 240 ? -5.864  27.044  60.300 1.00 20.20  ? 394  VAL A O   1 
ATOM   1868 C  CB  . VAL A 1 240 ? -2.901  26.338  60.209 1.00 21.20  ? 394  VAL A CB  1 
ATOM   1869 C  CG1 . VAL A 1 240 ? -2.296  27.653  59.739 1.00 21.99  ? 394  VAL A CG1 1 
ATOM   1870 C  CG2 . VAL A 1 240 ? -1.852  25.301  60.514 1.00 21.86  ? 394  VAL A CG2 1 
ATOM   1871 N  N   . ASP A 1 241 ? -4.929  28.711  61.549 1.00 22.70  ? 395  ASP A N   1 
ATOM   1872 C  CA  . ASP A 1 241 ? -6.022  29.624  61.369 1.00 26.71  ? 395  ASP A CA  1 
ATOM   1873 C  C   . ASP A 1 241 ? -5.936  30.323  60.002 1.00 24.80  ? 395  ASP A C   1 
ATOM   1874 O  O   . ASP A 1 241 ? -5.051  30.064  59.208 1.00 25.87  ? 395  ASP A O   1 
ATOM   1875 C  CB  . ASP A 1 241 ? -6.155  30.635  62.550 1.00 28.57  ? 395  ASP A CB  1 
ATOM   1876 C  CG  . ASP A 1 241 ? -5.060  31.702  62.570 1.00 31.15  ? 395  ASP A CG  1 
ATOM   1877 O  OD1 . ASP A 1 241 ? -4.312  31.854  61.580 1.00 33.02  ? 395  ASP A OD1 1 
ATOM   1878 O  OD2 . ASP A 1 241 ? -4.924  32.352  63.639 1.00 34.03  ? 395  ASP A OD2 1 
ATOM   1879 N  N   . GLU A 1 242 ? -6.965  31.126  59.762 1.00 31.41  ? 396  GLU A N   1 
ATOM   1880 C  CA  . GLU A 1 242 ? -7.184  31.916  58.552 1.00 34.14  ? 396  GLU A CA  1 
ATOM   1881 C  C   . GLU A 1 242 ? -5.997  32.801  58.155 1.00 33.97  ? 396  GLU A C   1 
ATOM   1882 O  O   . GLU A 1 242 ? -5.834  33.074  56.976 1.00 31.54  ? 396  GLU A O   1 
ATOM   1883 C  CB  . GLU A 1 242 ? -8.450  32.791  58.769 1.00 38.99  ? 396  GLU A CB  1 
ATOM   1884 C  CG  . GLU A 1 242 ? -9.736  31.977  59.102 1.00 47.14  ? 396  GLU A CG  1 
ATOM   1885 C  CD  . GLU A 1 242 ? -10.140 31.821  60.618 1.00 49.23  ? 396  GLU A CD  1 
ATOM   1886 O  OE1 . GLU A 1 242 ? -11.383 31.754  60.875 1.00 54.85  ? 396  GLU A OE1 1 
ATOM   1887 O  OE2 . GLU A 1 242 ? -9.278  31.725  61.548 1.00 34.59  ? 396  GLU A OE2 1 
ATOM   1888 N  N   . ASN A 1 243 ? -5.175  33.213  59.127 1.00 33.41  ? 397  ASN A N   1 
ATOM   1889 C  CA  . ASN A 1 243 ? -3.955  34.028  58.908 1.00 34.94  ? 397  ASN A CA  1 
ATOM   1890 C  C   . ASN A 1 243 ? -2.691  33.227  58.788 1.00 32.49  ? 397  ASN A C   1 
ATOM   1891 O  O   . ASN A 1 243 ? -1.575  33.770  58.842 1.00 34.75  ? 397  ASN A O   1 
ATOM   1892 C  CB  . ASN A 1 243 ? -3.853  35.044  60.029 1.00 38.66  ? 397  ASN A CB  1 
ATOM   1893 C  CG  . ASN A 1 243 ? -5.131  35.875  60.154 1.00 46.54  ? 397  ASN A CG  1 
ATOM   1894 O  OD1 . ASN A 1 243 ? -5.470  36.613  59.236 1.00 49.45  ? 397  ASN A OD1 1 
ATOM   1895 N  ND2 . ASN A 1 243 ? -5.875  35.714  61.260 1.00 53.16  ? 397  ASN A ND2 1 
ATOM   1896 N  N   . PHE A 1 244 ? -2.855  31.916  58.585 1.00 28.00  ? 398  PHE A N   1 
ATOM   1897 C  CA  . PHE A 1 244 ? -1.793  30.956  58.513 1.00 27.44  ? 398  PHE A CA  1 
ATOM   1898 C  C   . PHE A 1 244 ? -0.938  30.911  59.789 1.00 28.17  ? 398  PHE A C   1 
ATOM   1899 O  O   . PHE A 1 244 ? 0.244   30.573  59.729 1.00 29.34  ? 398  PHE A O   1 
ATOM   1900 C  CB  . PHE A 1 244 ? -0.918  31.154  57.250 1.00 32.59  ? 398  PHE A CB  1 
ATOM   1901 C  CG  . PHE A 1 244 ? -1.708  31.418  55.996 1.00 31.27  ? 398  PHE A CG  1 
ATOM   1902 C  CD1 . PHE A 1 244 ? -2.421  30.401  55.375 1.00 32.80  ? 398  PHE A CD1 1 
ATOM   1903 C  CD2 . PHE A 1 244 ? -1.709  32.685  55.404 1.00 38.89  ? 398  PHE A CD2 1 
ATOM   1904 C  CE1 . PHE A 1 244 ? -3.144  30.632  54.207 1.00 34.14  ? 398  PHE A CE1 1 
ATOM   1905 C  CE2 . PHE A 1 244 ? -2.419  32.918  54.224 1.00 38.22  ? 398  PHE A CE2 1 
ATOM   1906 C  CZ  . PHE A 1 244 ? -3.151  31.896  53.637 1.00 35.73  ? 398  PHE A CZ  1 
ATOM   1907 N  N   . ASP A 1 245 ? -1.558  31.213  60.919 1.00 28.59  ? 399  ASP A N   1 
ATOM   1908 C  CA  . ASP A 1 245 ? -0.905  31.100  62.214 1.00 29.50  ? 399  ASP A CA  1 
ATOM   1909 C  C   . ASP A 1 245 ? -1.323  29.800  62.948 1.00 24.25  ? 399  ASP A C   1 
ATOM   1910 O  O   . ASP A 1 245 ? -2.532  29.482  63.019 1.00 26.69  ? 399  ASP A O   1 
ATOM   1911 C  CB  . ASP A 1 245 ? -1.242  32.310  63.050 1.00 31.21  ? 399  ASP A CB  1 
ATOM   1912 C  CG  . ASP A 1 245 ? -0.699  33.632  62.430 1.00 33.63  ? 399  ASP A CG  1 
ATOM   1913 O  OD1 . ASP A 1 245 ? 0.373   33.621  61.799 1.00 35.04  ? 399  ASP A OD1 1 
ATOM   1914 O  OD2 . ASP A 1 245 ? -1.392  34.638  62.574 1.00 39.16  ? 399  ASP A OD2 1 
ATOM   1915 N  N   . PRO A 1 246 ? -0.342  29.103  63.511 1.00 23.62  ? 400  PRO A N   1 
ATOM   1916 C  CA  . PRO A 1 246 ? -0.667  27.860  64.232 1.00 21.10  ? 400  PRO A CA  1 
ATOM   1917 C  C   . PRO A 1 246 ? -1.406  28.047  65.547 1.00 22.36  ? 400  PRO A C   1 
ATOM   1918 O  O   . PRO A 1 246 ? -1.109  28.961  66.335 1.00 21.13  ? 400  PRO A O   1 
ATOM   1919 C  CB  . PRO A 1 246 ? 0.703   27.205  64.407 1.00 22.09  ? 400  PRO A CB  1 
ATOM   1920 C  CG  . PRO A 1 246 ? 1.664   28.355  64.512 1.00 23.15  ? 400  PRO A CG  1 
ATOM   1921 C  CD  . PRO A 1 246 ? 1.099   29.394  63.589 1.00 23.05  ? 400  PRO A CD  1 
ATOM   1922 N  N   . LEU A 1 247 ? -2.438  27.213  65.754 1.00 20.28  ? 401  LEU A N   1 
ATOM   1923 C  CA  . LEU A 1 247 ? -3.201  27.151  66.990 1.00 20.96  ? 401  LEU A CA  1 
ATOM   1924 C  C   . LEU A 1 247 ? -2.584  26.151  67.969 1.00 19.34  ? 401  LEU A C   1 
ATOM   1925 O  O   . LEU A 1 247 ? -1.627  25.438  67.616 1.00 17.42  ? 401  LEU A O   1 
ATOM   1926 C  CB  . LEU A 1 247 ? -4.667  26.827  66.690 1.00 20.73  ? 401  LEU A CB  1 
ATOM   1927 C  CG  . LEU A 1 247 ? -5.318  27.975  65.862 1.00 23.44  ? 401  LEU A CG  1 
ATOM   1928 C  CD1 . LEU A 1 247 ? -6.608  27.504  65.252 1.00 23.58  ? 401  LEU A CD1 1 
ATOM   1929 C  CD2 . LEU A 1 247 ? -5.534  29.234  66.740 1.00 24.72  ? 401  LEU A CD2 1 
ATOM   1930 N  N   . PRO A 1 248 ? -3.071  26.128  69.233 1.00 18.87  ? 402  PRO A N   1 
ATOM   1931 C  CA  . PRO A 1 248 ? -2.418  25.278  70.189 1.00 19.70  ? 402  PRO A CA  1 
ATOM   1932 C  C   . PRO A 1 248 ? -2.285  23.777  69.739 1.00 18.74  ? 402  PRO A C   1 
ATOM   1933 O  O   . PRO A 1 248 ? -1.234  23.162  69.963 1.00 16.48  ? 402  PRO A O   1 
ATOM   1934 C  CB  . PRO A 1 248 ? -3.268  25.485  71.470 1.00 18.67  ? 402  PRO A CB  1 
ATOM   1935 C  CG  . PRO A 1 248 ? -3.720  26.913  71.347 1.00 19.66  ? 402  PRO A CG  1 
ATOM   1936 C  CD  . PRO A 1 248 ? -4.047  27.024  69.890 1.00 18.59  ? 402  PRO A CD  1 
ATOM   1937 N  N   . ASP A 1 249 ? -3.332  23.245  69.129 1.00 17.56  ? 403  ASP A N   1 
ATOM   1938 C  CA  . ASP A 1 249 ? -3.295  21.870  68.610 1.00 15.99  ? 403  ASP A CA  1 
ATOM   1939 C  C   . ASP A 1 249 ? -2.200  21.635  67.549 1.00 17.36  ? 403  ASP A C   1 
ATOM   1940 O  O   . ASP A 1 249 ? -1.693  20.511  67.428 1.00 17.62  ? 403  ASP A O   1 
ATOM   1941 C  CB  . ASP A 1 249 ? -4.648  21.436  68.073 1.00 16.33  ? 403  ASP A CB  1 
ATOM   1942 C  CG  . ASP A 1 249 ? -5.584  20.863  69.129 1.00 17.12  ? 403  ASP A CG  1 
ATOM   1943 O  OD1 . ASP A 1 249 ? -5.242  20.858  70.351 1.00 16.78  ? 403  ASP A OD1 1 
ATOM   1944 O  OD2 . ASP A 1 249 ? -6.636  20.342  68.654 1.00 17.93  ? 403  ASP A OD2 1 
ATOM   1945 N  N   . TYR A 1 250 ? -1.817  22.684  66.778 1.00 17.36  ? 404  TYR A N   1 
ATOM   1946 C  CA  . TYR A 1 250 ? -0.688  22.546  65.892 1.00 18.43  ? 404  TYR A CA  1 
ATOM   1947 C  C   . TYR A 1 250 ? 0.588   22.264  66.705 1.00 16.39  ? 404  TYR A C   1 
ATOM   1948 O  O   . TYR A 1 250 ? 1.331   21.330  66.427 1.00 16.10  ? 404  TYR A O   1 
ATOM   1949 C  CB  . TYR A 1 250 ? -0.473  23.802  64.964 1.00 18.64  ? 404  TYR A CB  1 
ATOM   1950 C  CG  . TYR A 1 250 ? 0.753   23.598  64.138 1.00 18.42  ? 404  TYR A CG  1 
ATOM   1951 C  CD1 . TYR A 1 250 ? 2.005   23.932  64.608 1.00 20.86  ? 404  TYR A CD1 1 
ATOM   1952 C  CD2 . TYR A 1 250 ? 0.678   22.939  62.914 1.00 19.63  ? 404  TYR A CD2 1 
ATOM   1953 C  CE1 . TYR A 1 250 ? 3.139   23.694  63.856 1.00 19.74  ? 404  TYR A CE1 1 
ATOM   1954 C  CE2 . TYR A 1 250 ? 1.821   22.662  62.173 1.00 20.16  ? 404  TYR A CE2 1 
ATOM   1955 C  CZ  . TYR A 1 250 ? 3.048   23.066  62.659 1.00 20.34  ? 404  TYR A CZ  1 
ATOM   1956 O  OH  . TYR A 1 250 ? 4.213   22.773  61.964 1.00 21.72  ? 404  TYR A OH  1 
ATOM   1957 N  N   . TRP A 1 251 ? 0.850   23.085  67.709 1.00 16.56  ? 405  TRP A N   1 
ATOM   1958 C  CA  . TRP A 1 251 ? 2.065   22.935  68.482 1.00 17.12  ? 405  TRP A CA  1 
ATOM   1959 C  C   . TRP A 1 251 ? 2.084   21.574  69.244 1.00 16.55  ? 405  TRP A C   1 
ATOM   1960 O  O   . TRP A 1 251 ? 3.103   20.890  69.358 1.00 17.12  ? 405  TRP A O   1 
ATOM   1961 C  CB  . TRP A 1 251 ? 2.212   24.083  69.462 1.00 18.17  ? 405  TRP A CB  1 
ATOM   1962 C  CG  . TRP A 1 251 ? 2.344   25.406  68.762 1.00 17.90  ? 405  TRP A CG  1 
ATOM   1963 C  CD1 . TRP A 1 251 ? 1.474   26.448  68.759 1.00 19.24  ? 405  TRP A CD1 1 
ATOM   1964 C  CD2 . TRP A 1 251 ? 3.461   25.803  67.989 1.00 18.87  ? 405  TRP A CD2 1 
ATOM   1965 N  NE1 . TRP A 1 251 ? 2.002   27.508  67.982 1.00 20.59  ? 405  TRP A NE1 1 
ATOM   1966 C  CE2 . TRP A 1 251 ? 3.206   27.097  67.492 1.00 20.37  ? 405  TRP A CE2 1 
ATOM   1967 C  CE3 . TRP A 1 251 ? 4.659   25.161  67.640 1.00 19.56  ? 405  TRP A CE3 1 
ATOM   1968 C  CZ2 . TRP A 1 251 ? 4.156   27.793  66.693 1.00 19.76  ? 405  TRP A CZ2 1 
ATOM   1969 C  CZ3 . TRP A 1 251 ? 5.571   25.835  66.812 1.00 21.47  ? 405  TRP A CZ3 1 
ATOM   1970 C  CH2 . TRP A 1 251 ? 5.298   27.121  66.359 1.00 20.24  ? 405  TRP A CH2 1 
ATOM   1971 N  N   . LEU A 1 252 ? 0.926   21.202  69.778 1.00 17.32  ? 406  LEU A N   1 
ATOM   1972 C  CA  . LEU A 1 252 ? 0.801   19.867  70.395 1.00 16.05  ? 406  LEU A CA  1 
ATOM   1973 C  C   . LEU A 1 252 ? 1.112   18.742  69.380 1.00 14.58  ? 406  LEU A C   1 
ATOM   1974 O  O   . LEU A 1 252 ? 1.819   17.784  69.680 1.00 16.32  ? 406  LEU A O   1 
ATOM   1975 C  CB  . LEU A 1 252 ? -0.632  19.747  70.944 1.00 16.57  ? 406  LEU A CB  1 
ATOM   1976 C  CG  . LEU A 1 252 ? -1.056  18.399  71.459 1.00 16.72  ? 406  LEU A CG  1 
ATOM   1977 C  CD1 . LEU A 1 252 ? -0.165  17.901  72.581 1.00 16.76  ? 406  LEU A CD1 1 
ATOM   1978 C  CD2 . LEU A 1 252 ? -2.522  18.520  71.849 1.00 16.52  ? 406  LEU A CD2 1 
ATOM   1979 N  N   . SER A 1 253 ? 0.626   18.908  68.155 1.00 15.17  ? 407  SER A N   1 
ATOM   1980 C  CA  . SER A 1 253 ? 0.833   17.959  67.105 1.00 15.81  ? 407  SER A CA  1 
ATOM   1981 C  C   . SER A 1 253 ? 2.316   17.894  66.728 1.00 16.39  ? 407  SER A C   1 
ATOM   1982 O  O   . SER A 1 253 ? 2.861   16.822  66.514 1.00 15.62  ? 407  SER A O   1 
ATOM   1983 C  CB  . SER A 1 253 ? 0.001   18.216  65.882 1.00 17.00  ? 407  SER A CB  1 
ATOM   1984 O  OG  . SER A 1 253 ? -1.393  18.134  66.150 1.00 16.68  ? 407  SER A OG  1 
ATOM   1985 N  N   . LEU A 1 254 ? 2.947   19.077  66.660 1.00 17.78  ? 408  LEU A N   1 
ATOM   1986 C  CA  . LEU A 1 254 ? 4.388   19.106  66.338 1.00 18.43  ? 408  LEU A CA  1 
ATOM   1987 C  C   . LEU A 1 254 ? 5.235   18.412  67.417 1.00 18.68  ? 408  LEU A C   1 
ATOM   1988 O  O   . LEU A 1 254 ? 6.151   17.625  67.093 1.00 18.11  ? 408  LEU A O   1 
ATOM   1989 C  CB  . LEU A 1 254 ? 4.817   20.521  66.097 1.00 19.59  ? 408  LEU A CB  1 
ATOM   1990 C  CG  . LEU A 1 254 ? 6.263   20.744  65.655 1.00 20.55  ? 408  LEU A CG  1 
ATOM   1991 C  CD1 . LEU A 1 254 ? 6.450   20.265  64.199 1.00 21.20  ? 408  LEU A CD1 1 
ATOM   1992 C  CD2 . LEU A 1 254 ? 6.597   22.231  65.833 1.00 20.95  ? 408  LEU A CD2 1 
ATOM   1993 N  N   . LEU A 1 255 ? 4.976   18.715  68.677 1.00 18.86  ? 409  LEU A N   1 
ATOM   1994 C  CA  . LEU A 1 255 ? 5.678   18.066  69.748 1.00 19.06  ? 409  LEU A CA  1 
ATOM   1995 C  C   . LEU A 1 255 ? 5.466   16.538  69.702 1.00 19.06  ? 409  LEU A C   1 
ATOM   1996 O  O   . LEU A 1 255 ? 6.394   15.771  69.867 1.00 18.84  ? 409  LEU A O   1 
ATOM   1997 C  CB  . LEU A 1 255 ? 5.233   18.606  71.097 1.00 20.76  ? 409  LEU A CB  1 
ATOM   1998 C  CG  . LEU A 1 255 ? 5.875   19.919  71.459 1.00 26.22  ? 409  LEU A CG  1 
ATOM   1999 C  CD1 . LEU A 1 255 ? 4.984   20.736  72.378 1.00 28.70  ? 409  LEU A CD1 1 
ATOM   2000 C  CD2 . LEU A 1 255 ? 7.223   19.593  72.093 1.00 24.93  ? 409  LEU A CD2 1 
ATOM   2001 N  N   . PHE A 1 256 ? 4.233   16.106  69.450 1.00 18.04  ? 410  PHE A N   1 
ATOM   2002 C  CA  . PHE A 1 256 ? 3.917   14.688  69.379 1.00 18.00  ? 410  PHE A CA  1 
ATOM   2003 C  C   . PHE A 1 256 ? 4.772   14.041  68.259 1.00 19.13  ? 410  PHE A C   1 
ATOM   2004 O  O   . PHE A 1 256 ? 5.414   12.999  68.436 1.00 19.16  ? 410  PHE A O   1 
ATOM   2005 C  CB  . PHE A 1 256 ? 2.387   14.486  69.129 1.00 16.83  ? 410  PHE A CB  1 
ATOM   2006 C  CG  . PHE A 1 256 ? 1.899   13.077  69.314 1.00 15.35  ? 410  PHE A CG  1 
ATOM   2007 C  CD1 . PHE A 1 256 ? 2.134   12.082  68.358 1.00 15.06  ? 410  PHE A CD1 1 
ATOM   2008 C  CD2 . PHE A 1 256 ? 1.223   12.717  70.491 1.00 15.59  ? 410  PHE A CD2 1 
ATOM   2009 C  CE1 . PHE A 1 256 ? 1.685   10.773  68.587 1.00 16.06  ? 410  PHE A CE1 1 
ATOM   2010 C  CE2 . PHE A 1 256 ? 0.795   11.413  70.722 1.00 16.81  ? 410  PHE A CE2 1 
ATOM   2011 C  CZ  . PHE A 1 256 ? 1.026   10.426  69.773 1.00 16.44  ? 410  PHE A CZ  1 
ATOM   2012 N  N   . LYS A 1 257 ? 4.750   14.689  67.103 1.00 17.68  ? 411  LYS A N   1 
ATOM   2013 C  CA  . LYS A 1 257 ? 5.521   14.243  65.930 1.00 19.96  ? 411  LYS A CA  1 
ATOM   2014 C  C   . LYS A 1 257 ? 7.006   14.086  66.280 1.00 18.79  ? 411  LYS A C   1 
ATOM   2015 O  O   . LYS A 1 257 ? 7.624   13.112  65.872 1.00 19.68  ? 411  LYS A O   1 
ATOM   2016 C  CB  . LYS A 1 257 ? 5.331   15.244  64.782 1.00 21.65  ? 411  LYS A CB  1 
ATOM   2017 C  CG  . LYS A 1 257 ? 5.974   14.882  63.433 1.00 22.04  ? 411  LYS A CG  1 
ATOM   2018 C  CD  . LYS A 1 257 ? 5.329   13.703  62.715 1.00 22.35  ? 411  LYS A CD  1 
ATOM   2019 C  CE  . LYS A 1 257 ? 3.826   13.818  62.579 1.00 23.88  ? 411  LYS A CE  1 
ATOM   2020 N  NZ  . LYS A 1 257 ? 3.431   12.784  61.610 1.00 24.43  ? 411  LYS A NZ  1 
ATOM   2021 N  N   . LYS A 1 258 ? 7.560   15.042  66.982 1.00 21.10  ? 412  LYS A N   1 
ATOM   2022 C  CA  . LYS A 1 258 ? 9.003   15.069  67.298 1.00 22.23  ? 412  LYS A CA  1 
ATOM   2023 C  C   . LYS A 1 258 ? 9.436   14.094  68.387 1.00 23.05  ? 412  LYS A C   1 
ATOM   2024 O  O   . LYS A 1 258 ? 10.542  13.543  68.315 1.00 21.37  ? 412  LYS A O   1 
ATOM   2025 C  CB  . LYS A 1 258 ? 9.486   16.480  67.636 1.00 24.88  ? 412  LYS A CB  1 
ATOM   2026 C  CG  . LYS A 1 258 ? 9.418   17.495  66.492 1.00 29.85  ? 412  LYS A CG  1 
ATOM   2027 C  CD  . LYS A 1 258 ? 9.472   16.884  65.077 1.00 32.93  ? 412  LYS A CD  1 
ATOM   2028 C  CE  . LYS A 1 258 ? 9.232   17.948  64.014 1.00 38.08  ? 412  LYS A CE  1 
ATOM   2029 N  NZ  . LYS A 1 258 ? 9.116   17.371  62.651 1.00 33.42  ? 412  LYS A NZ  1 
ATOM   2030 N  N   . LEU A 1 259 ? 8.545   13.807  69.346 1.00 20.06  ? 413  LEU A N   1 
ATOM   2031 C  CA  . LEU A 1 259 ? 8.922   13.046  70.532 1.00 18.63  ? 413  LEU A CA  1 
ATOM   2032 C  C   . LEU A 1 259 ? 8.407   11.613  70.561 1.00 17.39  ? 413  LEU A C   1 
ATOM   2033 O  O   . LEU A 1 259 ? 9.017   10.746  71.198 1.00 19.79  ? 413  LEU A O   1 
ATOM   2034 C  CB  . LEU A 1 259 ? 8.437   13.802  71.796 1.00 19.70  ? 413  LEU A CB  1 
ATOM   2035 C  CG  . LEU A 1 259 ? 8.946   15.202  72.008 1.00 19.26  ? 413  LEU A CG  1 
ATOM   2036 C  CD1 . LEU A 1 259 ? 8.291   15.830  73.212 1.00 20.37  ? 413  LEU A CD1 1 
ATOM   2037 C  CD2 . LEU A 1 259 ? 10.455  15.127  72.185 1.00 20.86  ? 413  LEU A CD2 1 
ATOM   2038 N  N   . VAL A 1 260 ? 7.244   11.355  69.969 1.00 18.45  ? 414  VAL A N   1 
ATOM   2039 C  CA  . VAL A 1 260 ? 6.582   10.082  70.176 1.00 17.26  ? 414  VAL A CA  1 
ATOM   2040 C  C   . VAL A 1 260 ? 6.889   9.095   69.057 1.00 18.89  ? 414  VAL A C   1 
ATOM   2041 O  O   . VAL A 1 260 ? 6.619   9.390   67.894 1.00 21.22  ? 414  VAL A O   1 
ATOM   2042 C  CB  . VAL A 1 260 ? 5.056   10.277  70.284 1.00 18.43  ? 414  VAL A CB  1 
ATOM   2043 C  CG1 . VAL A 1 260 ? 4.363   8.922   70.506 1.00 18.11  ? 414  VAL A CG1 1 
ATOM   2044 C  CG2 . VAL A 1 260 ? 4.757   11.256  71.393 1.00 18.61  ? 414  VAL A CG2 1 
ATOM   2045 N  N   . GLY A 1 261 ? 7.399   7.930   69.435 1.00 17.93  ? 415  GLY A N   1 
ATOM   2046 C  CA  . GLY A 1 261 ? 7.857   6.906   68.477 1.00 19.77  ? 415  GLY A CA  1 
ATOM   2047 C  C   . GLY A 1 261 ? 6.756   6.019   67.973 1.00 20.64  ? 415  GLY A C   1 
ATOM   2048 O  O   . GLY A 1 261 ? 5.600   6.067   68.443 1.00 18.63  ? 415  GLY A O   1 
ATOM   2049 N  N   . THR A 1 262 ? 7.117   5.140   67.042 1.00 20.18  ? 416  THR A N   1 
ATOM   2050 C  CA  . THR A 1 262 ? 6.169   4.222   66.428 1.00 20.34  ? 416  THR A CA  1 
ATOM   2051 C  C   . THR A 1 262 ? 5.804   3.012   67.319 1.00 18.21  ? 416  THR A C   1 
ATOM   2052 O  O   . THR A 1 262 ? 4.751   2.400   67.178 1.00 18.80  ? 416  THR A O   1 
ATOM   2053 C  CB  . THR A 1 262 ? 6.704   3.686   65.120 1.00 20.91  ? 416  THR A CB  1 
ATOM   2054 O  OG1 . THR A 1 262 ? 8.013   3.177   65.372 1.00 19.58  ? 416  THR A OG1 1 
ATOM   2055 C  CG2 . THR A 1 262 ? 6.722   4.796   64.065 1.00 19.87  ? 416  THR A CG2 1 
ATOM   2056 N  N   . LYS A 1 263 ? 6.670   2.664   68.237 1.00 18.94  ? 417  LYS A N   1 
ATOM   2057 C  CA  . LYS A 1 263 ? 6.449   1.500   69.070 1.00 18.75  ? 417  LYS A CA  1 
ATOM   2058 C  C   . LYS A 1 263 ? 5.659   1.886   70.318 1.00 17.81  ? 417  LYS A C   1 
ATOM   2059 O  O   . LYS A 1 263 ? 6.136   2.660   71.154 1.00 18.17  ? 417  LYS A O   1 
ATOM   2060 C  CB  . LYS A 1 263 ? 7.798   0.901   69.454 1.00 22.56  ? 417  LYS A CB  1 
ATOM   2061 C  CG  . LYS A 1 263 ? 8.457   0.154   68.301 1.00 25.43  ? 417  LYS A CG  1 
ATOM   2062 C  CD  . LYS A 1 263 ? 9.944   -0.073  68.581 1.00 29.64  ? 417  LYS A CD  1 
ATOM   2063 C  CE  . LYS A 1 263 ? 10.566  -0.883  67.472 1.00 34.71  ? 417  LYS A CE  1 
ATOM   2064 N  NZ  . LYS A 1 263 ? 12.045  -0.949  67.676 1.00 38.52  ? 417  LYS A NZ  1 
ATOM   2065 N  N   . VAL A 1 264 ? 4.481   1.298   70.461 1.00 17.46  ? 418  VAL A N   1 
ATOM   2066 C  CA  . VAL A 1 264 ? 3.557   1.682   71.509 1.00 17.32  ? 418  VAL A CA  1 
ATOM   2067 C  C   . VAL A 1 264 ? 3.697   0.750   72.683 1.00 16.84  ? 418  VAL A C   1 
ATOM   2068 O  O   . VAL A 1 264 ? 3.777   -0.480  72.541 1.00 17.30  ? 418  VAL A O   1 
ATOM   2069 C  CB  . VAL A 1 264 ? 2.110   1.622   70.986 1.00 16.22  ? 418  VAL A CB  1 
ATOM   2070 C  CG1 . VAL A 1 264 ? 1.135   2.111   72.042 1.00 17.74  ? 418  VAL A CG1 1 
ATOM   2071 C  CG2 . VAL A 1 264 ? 1.951   2.409   69.700 1.00 17.27  ? 418  VAL A CG2 1 
ATOM   2072 N  N   . LEU A 1 265 ? 3.814   1.335   73.865 1.00 15.95  ? 419  LEU A N   1 
ATOM   2073 C  CA  . LEU A 1 265 ? 3.892   0.610   75.092 1.00 15.91  ? 419  LEU A CA  1 
ATOM   2074 C  C   . LEU A 1 265 ? 2.644   0.946   75.956 1.00 16.75  ? 419  LEU A C   1 
ATOM   2075 O  O   . LEU A 1 265 ? 1.632   1.312   75.413 1.00 14.89  ? 419  LEU A O   1 
ATOM   2076 C  CB  . LEU A 1 265 ? 5.209   0.878   75.776 1.00 17.55  ? 419  LEU A CB  1 
ATOM   2077 C  CG  . LEU A 1 265 ? 6.481   0.668   74.969 1.00 18.25  ? 419  LEU A CG  1 
ATOM   2078 C  CD1 . LEU A 1 265 ? 7.698   1.254   75.660 1.00 19.01  ? 419  LEU A CD1 1 
ATOM   2079 C  CD2 . LEU A 1 265 ? 6.635   -0.835  74.713 1.00 18.93  ? 419  LEU A CD2 1 
ATOM   2080 N  N   . MET A 1 266 ? 2.726   0.785   77.266 1.00 16.31  ? 420  MET A N   1 
ATOM   2081 C  CA  . MET A 1 266 ? 1.598   1.069   78.134 1.00 17.47  ? 420  MET A CA  1 
ATOM   2082 C  C   . MET A 1 266 ? 2.041   1.664   79.448 1.00 17.74  ? 420  MET A C   1 
ATOM   2083 O  O   . MET A 1 266 ? 3.014   1.253   80.050 1.00 16.83  ? 420  MET A O   1 
ATOM   2084 C  CB  . MET A 1 266 ? 0.832   -0.236  78.417 1.00 18.96  ? 420  MET A CB  1 
ATOM   2085 C  CG  . MET A 1 266 ? -0.235  -0.144  79.469 1.00 19.40  ? 420  MET A CG  1 
ATOM   2086 S  SD  . MET A 1 266 ? -1.001  -1.763  79.823 1.00 20.49  ? 420  MET A SD  1 
ATOM   2087 C  CE  . MET A 1 266 ? -2.006  -1.389  81.223 1.00 25.26  ? 420  MET A CE  1 
ATOM   2088 N  N   . ALA A 1 267 ? 1.244   2.617   79.930 1.00 16.23  ? 421  ALA A N   1 
ATOM   2089 C  CA  . ALA A 1 267 ? 1.423   3.178   81.252 1.00 17.29  ? 421  ALA A CA  1 
ATOM   2090 C  C   . ALA A 1 267 ? 0.082   3.161   81.937 1.00 17.85  ? 421  ALA A C   1 
ATOM   2091 O  O   . ALA A 1 267 ? -0.919  3.346   81.285 1.00 17.15  ? 421  ALA A O   1 
ATOM   2092 C  CB  . ALA A 1 267 ? 1.951   4.605   81.187 1.00 19.04  ? 421  ALA A CB  1 
ATOM   2093 N  N   . SER A 1 268 ? 0.085   3.003   83.250 1.00 18.71  ? 422  SER A N   1 
ATOM   2094 C  CA  . SER A 1 268 ? -1.136  3.171   83.992 1.00 20.41  ? 422  SER A CA  1 
ATOM   2095 C  C   . SER A 1 268 ? -0.829  3.661   85.377 1.00 23.77  ? 422  SER A C   1 
ATOM   2096 O  O   . SER A 1 268 ? 0.304   3.562   85.859 1.00 22.53  ? 422  SER A O   1 
ATOM   2097 C  CB  . SER A 1 268 ? -1.901  1.850   84.064 1.00 22.67  ? 422  SER A CB  1 
ATOM   2098 O  OG  . SER A 1 268 ? -1.145  0.826   84.658 1.00 23.85  ? 422  SER A OG  1 
ATOM   2099 N  N   . VAL A 1 269 ? -1.870  4.167   86.023 1.00 26.48  ? 423  VAL A N   1 
ATOM   2100 C  CA  . VAL A 1 269 ? -1.719  4.754   87.360 1.00 31.52  ? 423  VAL A CA  1 
ATOM   2101 C  C   . VAL A 1 269 ? -2.214  3.804   88.428 1.00 36.25  ? 423  VAL A C   1 
ATOM   2102 O  O   . VAL A 1 269 ? -3.334  3.302   88.338 1.00 39.79  ? 423  VAL A O   1 
ATOM   2103 C  CB  . VAL A 1 269 ? -2.400  6.139   87.478 1.00 33.65  ? 423  VAL A CB  1 
ATOM   2104 C  CG1 . VAL A 1 269 ? -1.561  7.178   86.769 1.00 34.44  ? 423  VAL A CG1 1 
ATOM   2105 C  CG2 . VAL A 1 269 ? -3.824  6.152   86.937 1.00 40.74  ? 423  VAL A CG2 1 
ATOM   2106 N  N   . GLN A 1 270 ? -1.340  3.524   89.404 1.00 43.27  ? 424  GLN A N   1 
ATOM   2107 C  CA  . GLN A 1 270 ? -1.678  2.657   90.554 1.00 47.77  ? 424  GLN A CA  1 
ATOM   2108 C  C   . GLN A 1 270 ? -2.785  3.283   91.387 1.00 49.34  ? 424  GLN A C   1 
ATOM   2109 O  O   . GLN A 1 270 ? -2.793  4.507   91.573 1.00 44.99  ? 424  GLN A O   1 
ATOM   2110 C  CB  . GLN A 1 270 ? -0.474  2.478   91.464 1.00 47.41  ? 424  GLN A CB  1 
ATOM   2111 C  CG  . GLN A 1 270 ? 0.606   1.556   90.947 1.00 47.12  ? 424  GLN A CG  1 
ATOM   2112 C  CD  . GLN A 1 270 ? 1.688   1.330   91.991 1.00 49.74  ? 424  GLN A CD  1 
ATOM   2113 O  OE1 . GLN A 1 270 ? 1.474   1.555   93.194 1.00 53.45  ? 424  GLN A OE1 1 
ATOM   2114 N  NE2 . GLN A 1 270 ? 2.862   0.902   91.544 1.00 45.33  ? 424  GLN A NE2 1 
ATOM   2115 N  N   . GLY A 1 271 ? -3.715  2.460   91.883 1.00 55.25  ? 425  GLY A N   1 
ATOM   2116 C  CA  . GLY A 1 271 ? -4.880  2.964   92.638 1.00 61.33  ? 425  GLY A CA  1 
ATOM   2117 C  C   . GLY A 1 271 ? -6.054  3.057   91.693 1.00 72.48  ? 425  GLY A C   1 
ATOM   2118 O  O   . GLY A 1 271 ? -7.215  2.926   92.103 1.00 69.74  ? 425  GLY A O   1 
ATOM   2119 N  N   . SER A 1 272 ? -5.734  3.364   90.432 1.00 82.76  ? 426  SER A N   1 
ATOM   2120 C  CA  . SER A 1 272 ? -6.440  2.839   89.261 1.00 86.03  ? 426  SER A CA  1 
ATOM   2121 C  C   . SER A 1 272 ? -7.827  3.435   89.001 1.00 89.69  ? 426  SER A C   1 
ATOM   2122 O  O   . SER A 1 272 ? -8.622  2.828   88.277 1.00 86.41  ? 426  SER A O   1 
ATOM   2123 C  CB  . SER A 1 272 ? -6.503  1.295   89.335 1.00 89.39  ? 426  SER A CB  1 
ATOM   2124 O  OG  . SER A 1 272 ? -6.516  0.703   88.043 1.00 88.41  ? 426  SER A OG  1 
ATOM   2125 N  N   . LYS A 1 273 ? -8.116  4.616   89.555 1.00 91.13  ? 427  LYS A N   1 
ATOM   2126 C  CA  . LYS A 1 273 ? -9.300  5.371   89.133 1.00 92.48  ? 427  LYS A CA  1 
ATOM   2127 C  C   . LYS A 1 273 ? -9.281  5.487   87.616 1.00 90.12  ? 427  LYS A C   1 
ATOM   2128 O  O   . LYS A 1 273 ? -10.272 5.154   86.973 1.00 99.23  ? 427  LYS A O   1 
ATOM   2129 C  CB  . LYS A 1 273 ? -9.348  6.760   89.760 1.00 95.39  ? 427  LYS A CB  1 
ATOM   2130 C  CG  . LYS A 1 273 ? -9.712  6.739   91.233 1.00 98.09  ? 427  LYS A CG  1 
ATOM   2131 C  CD  . LYS A 1 273 ? -9.386  8.061   91.909 1.00 95.88  ? 427  LYS A CD  1 
ATOM   2132 C  CE  . LYS A 1 273 ? -9.174  7.872   93.397 1.00 93.82  ? 427  LYS A CE  1 
ATOM   2133 N  NZ  . LYS A 1 273 ? -8.480  9.049   93.970 1.00 96.06  ? 427  LYS A NZ  1 
ATOM   2134 N  N   . ARG A 1 274 ? -8.143  5.922   87.059 1.00 77.23  ? 428  ARG A N   1 
ATOM   2135 C  CA  . ARG A 1 274 ? -7.902  5.903   85.599 1.00 71.66  ? 428  ARG A CA  1 
ATOM   2136 C  C   . ARG A 1 274 ? -8.923  6.746   84.822 1.00 59.88  ? 428  ARG A C   1 
ATOM   2137 O  O   . ARG A 1 274 ? -9.431  6.353   83.756 1.00 65.32  ? 428  ARG A O   1 
ATOM   2138 C  CB  . ARG A 1 274 ? -7.877  4.462   85.082 1.00 80.21  ? 428  ARG A CB  1 
ATOM   2139 C  CG  . ARG A 1 274 ? -7.247  4.306   83.698 1.00 86.33  ? 428  ARG A CG  1 
ATOM   2140 C  CD  . ARG A 1 274 ? -6.736  2.889   83.410 1.00 98.09  ? 428  ARG A CD  1 
ATOM   2141 N  NE  . ARG A 1 274 ? -6.037  2.260   84.537 1.00 107.61 ? 428  ARG A NE  1 
ATOM   2142 C  CZ  . ARG A 1 274 ? -5.688  0.973   84.604 1.00 113.17 ? 428  ARG A CZ  1 
ATOM   2143 N  NH1 . ARG A 1 274 ? -5.923  0.137   83.594 1.00 118.98 ? 428  ARG A NH1 1 
ATOM   2144 N  NH2 . ARG A 1 274 ? -5.076  0.520   85.695 1.00 114.02 ? 428  ARG A NH2 1 
ATOM   2145 N  N   . ARG A 1 275 ? -9.245  7.905   85.380 1.00 42.25  ? 429  ARG A N   1 
ATOM   2146 C  CA  . ARG A 1 275 ? -10.257 8.738   84.802 1.00 33.11  ? 429  ARG A CA  1 
ATOM   2147 C  C   . ARG A 1 275 ? -9.603  10.058  84.413 1.00 25.56  ? 429  ARG A C   1 
ATOM   2148 O  O   . ARG A 1 275 ? -9.527  10.355  83.247 1.00 20.42  ? 429  ARG A O   1 
ATOM   2149 C  CB  . ARG A 1 275 ? -11.410 8.931   85.790 1.00 38.59  ? 429  ARG A CB  1 
ATOM   2150 C  CG  . ARG A 1 275 ? -12.731 9.287   85.128 1.00 44.65  ? 429  ARG A CG  1 
ATOM   2151 C  CD  . ARG A 1 275 ? -13.976 8.798   85.878 1.00 45.74  ? 429  ARG A CD  1 
ATOM   2152 N  NE  . ARG A 1 275 ? -15.060 9.795   85.801 1.00 45.86  ? 429  ARG A NE  1 
ATOM   2153 C  CZ  . ARG A 1 275 ? -15.089 10.926  86.513 1.00 47.25  ? 429  ARG A CZ  1 
ATOM   2154 N  NH1 . ARG A 1 275 ? -16.099 11.783  86.374 1.00 48.84  ? 429  ARG A NH1 1 
ATOM   2155 N  NH2 . ARG A 1 275 ? -14.100 11.230  87.349 1.00 45.69  ? 429  ARG A NH2 1 
ATOM   2156 N  N   . LYS A 1 276 ? -9.147  10.838  85.397 1.00 22.64  ? 430  LYS A N   1 
ATOM   2157 C  CA  . LYS A 1 276 ? -8.735  12.214  85.136 1.00 22.16  ? 430  LYS A CA  1 
ATOM   2158 C  C   . LYS A 1 276 ? -7.230  12.372  84.957 1.00 21.30  ? 430  LYS A C   1 
ATOM   2159 O  O   . LYS A 1 276 ? -6.778  13.392  84.415 1.00 23.38  ? 430  LYS A O   1 
ATOM   2160 C  CB  . LYS A 1 276 ? -9.237  13.159  86.234 1.00 22.58  ? 430  LYS A CB  1 
ATOM   2161 C  CG  . LYS A 1 276 ? -10.708 13.519  86.091 1.00 26.04  ? 430  LYS A CG  1 
ATOM   2162 C  CD  . LYS A 1 276 ? -11.143 14.460  87.187 1.00 27.16  ? 430  LYS A CD  1 
ATOM   2163 C  CE  . LYS A 1 276 ? -12.568 14.909  86.881 1.00 34.84  ? 430  LYS A CE  1 
ATOM   2164 N  NZ  . LYS A 1 276 ? -13.028 15.847  87.944 1.00 39.06  ? 430  LYS A NZ  1 
ATOM   2165 N  N   . LEU A 1 277 ? -6.448  11.358  85.291 1.00 19.62  ? 431  LEU A N   1 
ATOM   2166 C  CA  . LEU A 1 277 ? -5.020  11.365  84.992 1.00 19.62  ? 431  LEU A CA  1 
ATOM   2167 C  C   . LEU A 1 277 ? -4.832  10.287  83.962 1.00 21.12  ? 431  LEU A C   1 
ATOM   2168 O  O   . LEU A 1 277 ? -5.093  9.112   84.242 1.00 23.06  ? 431  LEU A O   1 
ATOM   2169 C  CB  . LEU A 1 277 ? -4.229  11.055  86.251 1.00 22.77  ? 431  LEU A CB  1 
ATOM   2170 C  CG  . LEU A 1 277 ? -2.768  11.381  86.321 1.00 29.41  ? 431  LEU A CG  1 
ATOM   2171 C  CD1 . LEU A 1 277 ? -2.512  12.833  85.973 1.00 28.68  ? 431  LEU A CD1 1 
ATOM   2172 C  CD2 . LEU A 1 277 ? -2.329  11.087  87.743 1.00 31.30  ? 431  LEU A CD2 1 
ATOM   2173 N  N   . ARG A 1 278 ? -4.538  10.696  82.734 1.00 17.13  ? 432  ARG A N   1 
ATOM   2174 C  CA  . ARG A 1 278 ? -4.493  9.801   81.587 1.00 18.12  ? 432  ARG A CA  1 
ATOM   2175 C  C   . ARG A 1 278 ? -3.063  9.731   81.070 1.00 17.78  ? 432  ARG A C   1 
ATOM   2176 O  O   . ARG A 1 278 ? -2.471  10.760  80.741 1.00 17.45  ? 432  ARG A O   1 
ATOM   2177 C  CB  . ARG A 1 278 ? -5.515  10.262  80.574 1.00 19.35  ? 432  ARG A CB  1 
ATOM   2178 C  CG  . ARG A 1 278 ? -6.864  10.425  81.281 1.00 19.81  ? 432  ARG A CG  1 
ATOM   2179 C  CD  . ARG A 1 278 ? -7.867  11.060  80.404 1.00 19.52  ? 432  ARG A CD  1 
ATOM   2180 N  NE  . ARG A 1 278 ? -8.368  10.173  79.348 1.00 16.46  ? 432  ARG A NE  1 
ATOM   2181 C  CZ  . ARG A 1 278 ? -9.455  9.416   79.401 1.00 17.54  ? 432  ARG A CZ  1 
ATOM   2182 N  NH1 . ARG A 1 278 ? -9.842  8.757   78.302 1.00 15.57  ? 432  ARG A NH1 1 
ATOM   2183 N  NH2 . ARG A 1 278 ? -10.170 9.299   80.521 1.00 17.88  ? 432  ARG A NH2 1 
ATOM   2184 N  N   . VAL A 1 279 ? -2.522  8.515   80.936 1.00 16.64  ? 433  VAL A N   1 
ATOM   2185 C  CA  . VAL A 1 279 ? -1.113  8.336   80.636 1.00 15.66  ? 433  VAL A CA  1 
ATOM   2186 C  C   . VAL A 1 279 ? -0.887  7.317   79.523 1.00 16.60  ? 433  VAL A C   1 
ATOM   2187 O  O   . VAL A 1 279 ? -1.608  6.318   79.408 1.00 16.07  ? 433  VAL A O   1 
ATOM   2188 C  CB  . VAL A 1 279 ? -0.307  7.892   81.894 1.00 15.45  ? 433  VAL A CB  1 
ATOM   2189 C  CG1 . VAL A 1 279 ? -0.258  9.005   82.925 1.00 17.05  ? 433  VAL A CG1 1 
ATOM   2190 C  CG2 . VAL A 1 279 ? -0.939  6.644   82.546 1.00 16.85  ? 433  VAL A CG2 1 
ATOM   2191 N  N   . TYR A 1 280 ? 0.130   7.613   78.705 1.00 15.22  ? 434  TYR A N   1 
ATOM   2192 C  CA  . TYR A 1 280 ? 0.448   6.879   77.504 1.00 14.49  ? 434  TYR A CA  1 
ATOM   2193 C  C   . TYR A 1 280 ? 1.973   6.815   77.395 1.00 16.56  ? 434  TYR A C   1 
ATOM   2194 O  O   . TYR A 1 280 ? 2.692   7.678   77.882 1.00 17.65  ? 434  TYR A O   1 
ATOM   2195 C  CB  . TYR A 1 280 ? -0.125  7.576   76.273 1.00 14.50  ? 434  TYR A CB  1 
ATOM   2196 C  CG  . TYR A 1 280 ? -1.641  7.726   76.393 1.00 13.89  ? 434  TYR A CG  1 
ATOM   2197 C  CD1 . TYR A 1 280 ? -2.445  6.638   76.205 1.00 14.53  ? 434  TYR A CD1 1 
ATOM   2198 C  CD2 . TYR A 1 280 ? -2.232  8.927   76.792 1.00 14.25  ? 434  TYR A CD2 1 
ATOM   2199 C  CE1 . TYR A 1 280 ? -3.823  6.712   76.387 1.00 13.97  ? 434  TYR A CE1 1 
ATOM   2200 C  CE2 . TYR A 1 280 ? -3.628  9.042   76.886 1.00 14.51  ? 434  TYR A CE2 1 
ATOM   2201 C  CZ  . TYR A 1 280 ? -4.400  7.897   76.733 1.00 14.63  ? 434  TYR A CZ  1 
ATOM   2202 O  OH  . TYR A 1 280 ? -5.771  7.975   76.899 1.00 15.88  ? 434  TYR A OH  1 
ATOM   2203 N  N   . LEU A 1 281 ? 2.458   5.728   76.824 1.00 15.54  ? 435  LEU A N   1 
ATOM   2204 C  CA  . LEU A 1 281 ? 3.909   5.472   76.777 1.00 15.82  ? 435  LEU A CA  1 
ATOM   2205 C  C   . LEU A 1 281 ? 4.273   4.857   75.477 1.00 15.93  ? 435  LEU A C   1 
ATOM   2206 O  O   . LEU A 1 281 ? 3.688   3.856   75.077 1.00 16.99  ? 435  LEU A O   1 
ATOM   2207 C  CB  . LEU A 1 281 ? 4.316   4.540   77.927 1.00 15.59  ? 435  LEU A CB  1 
ATOM   2208 C  CG  . LEU A 1 281 ? 5.815   4.262   78.088 1.00 16.38  ? 435  LEU A CG  1 
ATOM   2209 C  CD1 . LEU A 1 281 ? 6.516   5.517   78.588 1.00 18.06  ? 435  LEU A CD1 1 
ATOM   2210 C  CD2 . LEU A 1 281 ? 5.969   3.113   79.048 1.00 16.92  ? 435  LEU A CD2 1 
ATOM   2211 N  N   . HIS A 1 282 ? 5.234   5.486   74.760 1.00 15.83  ? 436  HIS A N   1 
ATOM   2212 C  CA  . HIS A 1 282 ? 5.786   4.880   73.543 1.00 16.15  ? 436  HIS A CA  1 
ATOM   2213 C  C   . HIS A 1 282 ? 7.316   4.930   73.705 1.00 16.21  ? 436  HIS A C   1 
ATOM   2214 O  O   . HIS A 1 282 ? 7.850   5.609   74.565 1.00 17.45  ? 436  HIS A O   1 
ATOM   2215 C  CB  . HIS A 1 282 ? 5.462   5.705   72.315 1.00 17.01  ? 436  HIS A CB  1 
ATOM   2216 C  CG  . HIS A 1 282 ? 4.010   5.773   71.924 1.00 16.70  ? 436  HIS A CG  1 
ATOM   2217 N  ND1 . HIS A 1 282 ? 3.642   5.886   70.595 1.00 16.56  ? 436  HIS A ND1 1 
ATOM   2218 C  CD2 . HIS A 1 282 ? 2.859   5.904   72.645 1.00 17.01  ? 436  HIS A CD2 1 
ATOM   2219 C  CE1 . HIS A 1 282 ? 2.328   6.063   70.511 1.00 16.71  ? 436  HIS A CE1 1 
ATOM   2220 N  NE2 . HIS A 1 282 ? 1.839   6.086   71.741 1.00 16.07  ? 436  HIS A NE2 1 
ATOM   2221 N  N   . CYS A 1 283 ? 8.006   4.212   72.844 1.00 17.29  ? 437  CYS A N   1 
ATOM   2222 C  CA  . CYS A 1 283 ? 9.435   4.475   72.658 1.00 19.24  ? 437  CYS A CA  1 
ATOM   2223 C  C   . CYS A 1 283 ? 9.556   5.888   72.077 1.00 19.24  ? 437  CYS A C   1 
ATOM   2224 O  O   . CYS A 1 283 ? 8.688   6.362   71.322 1.00 19.18  ? 437  CYS A O   1 
ATOM   2225 C  CB  . CYS A 1 283 ? 10.015  3.445   71.664 1.00 21.04  ? 437  CYS A CB  1 
ATOM   2226 S  SG  . CYS A 1 283 ? 9.909   1.752   72.205 1.00 22.61  ? 437  CYS A SG  1 
ATOM   2227 N  N   . THR A 1 284 ? 10.654  6.559   72.412 1.00 17.80  ? 438  THR A N   1 
ATOM   2228 C  CA  . THR A 1 284 ? 10.967  7.856   71.832 1.00 19.58  ? 438  THR A CA  1 
ATOM   2229 C  C   . THR A 1 284 ? 11.215  7.778   70.353 1.00 21.40  ? 438  THR A C   1 
ATOM   2230 O  O   . THR A 1 284 ? 11.808  6.802   69.898 1.00 24.50  ? 438  THR A O   1 
ATOM   2231 C  CB  . THR A 1 284 ? 12.169  8.444   72.571 1.00 19.98  ? 438  THR A CB  1 
ATOM   2232 O  OG1 . THR A 1 284 ? 11.840  8.535   73.953 1.00 19.49  ? 438  THR A OG1 1 
ATOM   2233 C  CG2 . THR A 1 284 ? 12.480  9.815   72.050 1.00 20.49  ? 438  THR A CG2 1 
ATOM   2234 N  N   . ASN A 1 285 ? 10.744  8.772   69.596 1.00 21.37  ? 439  ASN A N   1 
ATOM   2235 C  CA  . ASN A 1 285 ? 10.992  8.873   68.156 1.00 22.09  ? 439  ASN A CA  1 
ATOM   2236 C  C   . ASN A 1 285 ? 12.521  8.908   67.911 1.00 24.20  ? 439  ASN A C   1 
ATOM   2237 O  O   . ASN A 1 285 ? 13.182  9.792   68.392 1.00 25.37  ? 439  ASN A O   1 
ATOM   2238 C  CB  . ASN A 1 285 ? 10.372  10.146  67.613 1.00 22.41  ? 439  ASN A CB  1 
ATOM   2239 C  CG  . ASN A 1 285 ? 10.489  10.274  66.090 1.00 24.36  ? 439  ASN A CG  1 
ATOM   2240 O  OD1 . ASN A 1 285 ? 11.183  9.508   65.452 1.00 27.66  ? 439  ASN A OD1 1 
ATOM   2241 N  ND2 . ASN A 1 285 ? 9.756   11.202  65.509 1.00 26.12  ? 439  ASN A ND2 1 
ATOM   2242 N  N   . THR A 1 286 ? 13.014  7.938   67.193 1.00 30.09  ? 440  THR A N   1 
ATOM   2243 C  CA  . THR A 1 286 ? 14.452  7.862   66.901 1.00 35.54  ? 440  THR A CA  1 
ATOM   2244 C  C   . THR A 1 286 ? 14.945  8.926   65.922 1.00 36.79  ? 440  THR A C   1 
ATOM   2245 O  O   . THR A 1 286 ? 16.144  9.170   65.851 1.00 41.28  ? 440  THR A O   1 
ATOM   2246 C  CB  . THR A 1 286 ? 14.873  6.462   66.427 1.00 38.62  ? 440  THR A CB  1 
ATOM   2247 O  OG1 . THR A 1 286 ? 13.926  5.939   65.492 1.00 44.67  ? 440  THR A OG1 1 
ATOM   2248 C  CG2 . THR A 1 286 ? 14.989  5.518   67.621 1.00 46.32  ? 440  THR A CG2 1 
ATOM   2249 N  N   . ASP A 1 287 ? 14.049  9.571   65.190 1.00 35.06  ? 441  ASP A N   1 
ATOM   2250 C  CA  . ASP A 1 287 ? 14.423  10.700  64.334 1.00 37.08  ? 441  ASP A CA  1 
ATOM   2251 C  C   . ASP A 1 287 ? 14.791  11.962  65.116 1.00 36.00  ? 441  ASP A C   1 
ATOM   2252 O  O   . ASP A 1 287 ? 15.297  12.910  64.530 1.00 34.56  ? 441  ASP A O   1 
ATOM   2253 C  CB  . ASP A 1 287 ? 13.265  11.085  63.389 1.00 40.10  ? 441  ASP A CB  1 
ATOM   2254 C  CG  . ASP A 1 287 ? 12.852  9.981   62.445 1.00 40.54  ? 441  ASP A CG  1 
ATOM   2255 O  OD1 . ASP A 1 287 ? 13.632  9.049   62.172 1.00 37.21  ? 441  ASP A OD1 1 
ATOM   2256 O  OD2 . ASP A 1 287 ? 11.703  10.063  61.944 1.00 45.06  ? 441  ASP A OD2 1 
ATOM   2257 N  N   . ASN A 1 288 ? 14.524  12.007  66.420 1.00 31.07  ? 442  ASN A N   1 
ATOM   2258 C  CA  . ASN A 1 288 ? 14.779  13.186  67.189 1.00 33.31  ? 442  ASN A CA  1 
ATOM   2259 C  C   . ASN A 1 288 ? 16.273  13.218  67.498 1.00 32.75  ? 442  ASN A C   1 
ATOM   2260 O  O   . ASN A 1 288 ? 16.768  12.257  68.068 1.00 30.66  ? 442  ASN A O   1 
ATOM   2261 C  CB  . ASN A 1 288 ? 13.975  13.149  68.482 1.00 30.84  ? 442  ASN A CB  1 
ATOM   2262 C  CG  . ASN A 1 288 ? 14.034  14.441  69.222 1.00 32.18  ? 442  ASN A CG  1 
ATOM   2263 O  OD1 . ASN A 1 288 ? 15.120  14.979  69.462 1.00 30.85  ? 442  ASN A OD1 1 
ATOM   2264 N  ND2 . ASN A 1 288 ? 12.867  14.996  69.559 1.00 30.76  ? 442  ASN A ND2 1 
ATOM   2265 N  N   . PRO A 1 289 ? 16.975  14.318  67.117 1.00 38.55  ? 443  PRO A N   1 
ATOM   2266 C  CA  . PRO A 1 289 ? 18.439  14.253  67.269 1.00 39.66  ? 443  PRO A CA  1 
ATOM   2267 C  C   . PRO A 1 289 ? 18.898  14.258  68.727 1.00 38.41  ? 443  PRO A C   1 
ATOM   2268 O  O   . PRO A 1 289 ? 20.005  13.831  69.009 1.00 43.35  ? 443  PRO A O   1 
ATOM   2269 C  CB  . PRO A 1 289 ? 18.954  15.512  66.505 1.00 40.02  ? 443  PRO A CB  1 
ATOM   2270 C  CG  . PRO A 1 289 ? 17.750  16.237  65.971 1.00 40.72  ? 443  PRO A CG  1 
ATOM   2271 C  CD  . PRO A 1 289 ? 16.524  15.643  66.622 1.00 37.39  ? 443  PRO A CD  1 
ATOM   2272 N  N   . ARG A 1 290 ? 18.063  14.736  69.647 1.00 34.28  ? 444  ARG A N   1 
ATOM   2273 C  CA  . ARG A 1 290 ? 18.459  14.820  71.024 1.00 31.71  ? 444  ARG A CA  1 
ATOM   2274 C  C   . ARG A 1 290 ? 18.566  13.456  71.710 1.00 31.44  ? 444  ARG A C   1 
ATOM   2275 O  O   . ARG A 1 290 ? 19.360  13.308  72.626 1.00 32.10  ? 444  ARG A O   1 
ATOM   2276 C  CB  . ARG A 1 290 ? 17.547  15.770  71.776 1.00 30.94  ? 444  ARG A CB  1 
ATOM   2277 C  CG  . ARG A 1 290 ? 17.910  15.931  73.235 1.00 33.15  ? 444  ARG A CG  1 
ATOM   2278 C  CD  . ARG A 1 290 ? 17.124  17.040  73.903 1.00 33.95  ? 444  ARG A CD  1 
ATOM   2279 N  NE  . ARG A 1 290 ? 17.581  17.215  75.271 1.00 35.45  ? 444  ARG A NE  1 
ATOM   2280 C  CZ  . ARG A 1 290 ? 18.624  17.963  75.626 1.00 41.52  ? 444  ARG A CZ  1 
ATOM   2281 N  NH1 . ARG A 1 290 ? 19.351  18.615  74.713 1.00 44.97  ? 444  ARG A NH1 1 
ATOM   2282 N  NH2 . ARG A 1 290 ? 18.960  18.047  76.898 1.00 43.33  ? 444  ARG A NH2 1 
ATOM   2283 N  N   . TYR A 1 291 ? 17.824  12.447  71.248 1.00 27.96  ? 445  TYR A N   1 
ATOM   2284 C  CA  . TYR A 1 291 ? 17.643  11.230  72.037 1.00 26.97  ? 445  TYR A CA  1 
ATOM   2285 C  C   . TYR A 1 291 ? 18.263  10.056  71.351 1.00 28.51  ? 445  TYR A C   1 
ATOM   2286 O  O   . TYR A 1 291 ? 18.818  10.207  70.273 1.00 33.56  ? 445  TYR A O   1 
ATOM   2287 C  CB  . TYR A 1 291 ? 16.135  11.020  72.350 1.00 24.72  ? 445  TYR A CB  1 
ATOM   2288 C  CG  . TYR A 1 291 ? 15.581  12.222  73.082 1.00 21.15  ? 445  TYR A CG  1 
ATOM   2289 C  CD1 . TYR A 1 291 ? 16.118  12.587  74.305 1.00 22.09  ? 445  TYR A CD1 1 
ATOM   2290 C  CD2 . TYR A 1 291 ? 14.569  13.048  72.530 1.00 20.18  ? 445  TYR A CD2 1 
ATOM   2291 C  CE1 . TYR A 1 291 ? 15.653  13.672  75.001 1.00 22.59  ? 445  TYR A CE1 1 
ATOM   2292 C  CE2 . TYR A 1 291 ? 14.117  14.158  73.229 1.00 21.77  ? 445  TYR A CE2 1 
ATOM   2293 C  CZ  . TYR A 1 291 ? 14.670  14.462  74.467 1.00 19.92  ? 445  TYR A CZ  1 
ATOM   2294 O  OH  . TYR A 1 291 ? 14.274  15.532  75.215 1.00 24.60  ? 445  TYR A OH  1 
ATOM   2295 N  N   . LYS A 1 292 ? 18.196  8.899   71.999 1.00 29.41  ? 446  LYS A N   1 
ATOM   2296 C  CA  . LYS A 1 292 ? 18.828  7.686   71.502 1.00 31.73  ? 446  LYS A CA  1 
ATOM   2297 C  C   . LYS A 1 292 ? 17.958  6.467   71.664 1.00 30.90  ? 446  LYS A C   1 
ATOM   2298 O  O   . LYS A 1 292 ? 16.993  6.497   72.401 1.00 25.97  ? 446  LYS A O   1 
ATOM   2299 C  CB  . LYS A 1 292 ? 20.142  7.486   72.257 1.00 31.60  ? 446  LYS A CB  1 
ATOM   2300 C  CG  . LYS A 1 292 ? 20.050  7.305   73.751 1.00 31.78  ? 446  LYS A CG  1 
ATOM   2301 C  CD  . LYS A 1 292 ? 21.447  7.157   74.338 1.00 36.84  ? 446  LYS A CD  1 
ATOM   2302 C  CE  . LYS A 1 292 ? 21.403  6.630   75.764 1.00 40.76  ? 446  LYS A CE  1 
ATOM   2303 N  NZ  . LYS A 1 292 ? 22.732  6.715   76.437 1.00 44.73  ? 446  LYS A NZ  1 
ATOM   2304 N  N   . GLU A 1 293 ? 18.338  5.398   70.972 1.00 29.80  ? 447  GLU A N   1 
ATOM   2305 C  CA  . GLU A 1 293 ? 17.628  4.146   70.962 1.00 29.94  ? 447  GLU A CA  1 
ATOM   2306 C  C   . GLU A 1 293 ? 17.553  3.649   72.367 1.00 27.37  ? 447  GLU A C   1 
ATOM   2307 O  O   . GLU A 1 293 ? 18.534  3.651   73.076 1.00 29.22  ? 447  GLU A O   1 
ATOM   2308 C  CB  . GLU A 1 293 ? 18.401  3.085   70.163 1.00 35.30  ? 447  GLU A CB  1 
ATOM   2309 C  CG  . GLU A 1 293 ? 18.446  3.341   68.695 1.00 40.92  ? 447  GLU A CG  1 
ATOM   2310 C  CD  . GLU A 1 293 ? 19.301  2.312   67.945 1.00 40.31  ? 447  GLU A CD  1 
ATOM   2311 O  OE1 . GLU A 1 293 ? 20.307  1.792   68.474 1.00 40.61  ? 447  GLU A OE1 1 
ATOM   2312 O  OE2 . GLU A 1 293 ? 18.915  2.046   66.812 1.00 45.92  ? 447  GLU A OE2 1 
ATOM   2313 N  N   . GLY A 1 294 ? 16.372  3.253   72.800 1.00 23.61  ? 448  GLY A N   1 
ATOM   2314 C  CA  . GLY A 1 294 ? 16.154  2.800   74.179 1.00 23.71  ? 448  GLY A CA  1 
ATOM   2315 C  C   . GLY A 1 294 ? 15.334  3.790   74.999 1.00 22.15  ? 448  GLY A C   1 
ATOM   2316 O  O   . GLY A 1 294 ? 14.775  3.407   76.007 1.00 22.13  ? 448  GLY A O   1 
ATOM   2317 N  N   . ASP A 1 295 ? 15.335  5.046   74.591 1.00 20.20  ? 449  ASP A N   1 
ATOM   2318 C  CA  . ASP A 1 295 ? 14.675  6.138   75.373 1.00 21.32  ? 449  ASP A CA  1 
ATOM   2319 C  C   . ASP A 1 295 ? 13.136  5.955   75.267 1.00 20.92  ? 449  ASP A C   1 
ATOM   2320 O  O   . ASP A 1 295 ? 12.637  5.384   74.276 1.00 21.01  ? 449  ASP A O   1 
ATOM   2321 C  CB  . ASP A 1 295 ? 15.067  7.508   74.875 1.00 21.94  ? 449  ASP A CB  1 
ATOM   2322 C  CG  . ASP A 1 295 ? 16.464  7.936   75.321 1.00 24.45  ? 449  ASP A CG  1 
ATOM   2323 O  OD1 . ASP A 1 295 ? 17.109  7.178   76.030 1.00 26.28  ? 449  ASP A OD1 1 
ATOM   2324 O  OD2 . ASP A 1 295 ? 16.885  9.018   74.908 1.00 24.86  ? 449  ASP A OD2 1 
ATOM   2325 N  N   . LEU A 1 296 ? 12.444  6.439   76.305 1.00 20.25  ? 450  LEU A N   1 
ATOM   2326 C  CA  . LEU A 1 296 ? 10.960  6.386   76.403 1.00 20.02  ? 450  LEU A CA  1 
ATOM   2327 C  C   . LEU A 1 296 ? 10.341  7.760   76.370 1.00 18.64  ? 450  LEU A C   1 
ATOM   2328 O  O   . LEU A 1 296 ? 10.871  8.726   76.936 1.00 17.95  ? 450  LEU A O   1 
ATOM   2329 C  CB  . LEU A 1 296 ? 10.530  5.716   77.722 1.00 19.17  ? 450  LEU A CB  1 
ATOM   2330 C  CG  . LEU A 1 296 ? 10.815  4.231   77.941 1.00 20.39  ? 450  LEU A CG  1 
ATOM   2331 C  CD1 . LEU A 1 296 ? 10.544  3.893   79.391 1.00 19.92  ? 450  LEU A CD1 1 
ATOM   2332 C  CD2 . LEU A 1 296 ? 9.974   3.399   76.980 1.00 21.60  ? 450  LEU A CD2 1 
ATOM   2333 N  N   . THR A 1 297 ? 9.189   7.848   75.733 1.00 18.37  ? 451  THR A N   1 
ATOM   2334 C  CA  . THR A 1 297 ? 8.372   9.037   75.809 1.00 16.97  ? 451  THR A CA  1 
ATOM   2335 C  C   . THR A 1 297 ? 7.035   8.721   76.481 1.00 17.04  ? 451  THR A C   1 
ATOM   2336 O  O   . THR A 1 297 ? 6.200   8.061   75.894 1.00 17.62  ? 451  THR A O   1 
ATOM   2337 C  CB  . THR A 1 297 ? 8.137   9.690   74.456 1.00 16.40  ? 451  THR A CB  1 
ATOM   2338 O  OG1 . THR A 1 297 ? 9.404   10.076  73.891 1.00 18.59  ? 451  THR A OG1 1 
ATOM   2339 C  CG2 . THR A 1 297 ? 7.274   10.923  74.593 1.00 16.60  ? 451  THR A CG2 1 
ATOM   2340 N  N   . LEU A 1 298 ? 6.882   9.273   77.669 1.00 16.98  ? 452  LEU A N   1 
ATOM   2341 C  CA  . LEU A 1 298 ? 5.613   9.315   78.392 1.00 17.44  ? 452  LEU A CA  1 
ATOM   2342 C  C   . LEU A 1 298 ? 4.830   10.596  78.024 1.00 17.05  ? 452  LEU A C   1 
ATOM   2343 O  O   . LEU A 1 298 ? 5.379   11.713  77.877 1.00 17.08  ? 452  LEU A O   1 
ATOM   2344 C  CB  . LEU A 1 298 ? 5.915   9.313   79.871 1.00 17.92  ? 452  LEU A CB  1 
ATOM   2345 C  CG  . LEU A 1 298 ? 4.773   9.540   80.850 1.00 17.53  ? 452  LEU A CG  1 
ATOM   2346 C  CD1 . LEU A 1 298 ? 3.819   8.349   80.936 1.00 19.35  ? 452  LEU A CD1 1 
ATOM   2347 C  CD2 . LEU A 1 298 ? 5.380   9.788   82.214 1.00 18.31  ? 452  LEU A CD2 1 
ATOM   2348 N  N   . TYR A 1 299 ? 3.518   10.484  77.876 1.00 16.75  ? 453  TYR A N   1 
ATOM   2349 C  CA  . TYR A 1 299 ? 2.711   11.705  77.752 1.00 15.36  ? 453  TYR A CA  1 
ATOM   2350 C  C   . TYR A 1 299 ? 1.524   11.554  78.619 1.00 17.63  ? 453  TYR A C   1 
ATOM   2351 O  O   . TYR A 1 299 ? 1.075   10.414  78.896 1.00 17.27  ? 453  TYR A O   1 
ATOM   2352 C  CB  . TYR A 1 299 ? 2.350   12.112  76.343 1.00 15.54  ? 453  TYR A CB  1 
ATOM   2353 C  CG  . TYR A 1 299 ? 1.815   11.118  75.348 1.00 15.26  ? 453  TYR A CG  1 
ATOM   2354 C  CD1 . TYR A 1 299 ? 2.627   10.142  74.740 1.00 15.02  ? 453  TYR A CD1 1 
ATOM   2355 C  CD2 . TYR A 1 299 ? 0.467   11.086  75.014 1.00 15.18  ? 453  TYR A CD2 1 
ATOM   2356 C  CE1 . TYR A 1 299 ? 2.128   9.272   73.794 1.00 15.35  ? 453  TYR A CE1 1 
ATOM   2357 C  CE2 . TYR A 1 299 ? -0.025  10.209  74.055 1.00 14.42  ? 453  TYR A CE2 1 
ATOM   2358 C  CZ  . TYR A 1 299 ? 0.781   9.290   73.459 1.00 14.80  ? 453  TYR A CZ  1 
ATOM   2359 O  OH  . TYR A 1 299 ? 0.265   8.415   72.527 1.00 16.36  ? 453  TYR A OH  1 
ATOM   2360 N  N   . ALA A 1 300 ? 1.061   12.673  79.171 1.00 15.45  ? 454  ALA A N   1 
ATOM   2361 C  CA  . ALA A 1 300 ? 0.119   12.615  80.255 1.00 15.18  ? 454  ALA A CA  1 
ATOM   2362 C  C   . ALA A 1 300 ? -0.791  13.822  80.212 1.00 16.78  ? 454  ALA A C   1 
ATOM   2363 O  O   . ALA A 1 300 ? -0.365  14.919  79.869 1.00 17.19  ? 454  ALA A O   1 
ATOM   2364 C  CB  . ALA A 1 300 ? 0.849   12.587  81.579 1.00 16.12  ? 454  ALA A CB  1 
ATOM   2365 N  N   . ILE A 1 301 ? -2.040  13.582  80.585 1.00 15.34  ? 455  ILE A N   1 
ATOM   2366 C  CA  . ILE A 1 301 ? -3.091  14.585  80.664 1.00 16.66  ? 455  ILE A CA  1 
ATOM   2367 C  C   . ILE A 1 301 ? -3.608  14.629  82.109 1.00 16.97  ? 455  ILE A C   1 
ATOM   2368 O  O   . ILE A 1 301 ? -3.869  13.578  82.734 1.00 15.92  ? 455  ILE A O   1 
ATOM   2369 C  CB  . ILE A 1 301 ? -4.234  14.183  79.745 1.00 16.96  ? 455  ILE A CB  1 
ATOM   2370 C  CG1 . ILE A 1 301 ? -3.779  14.192  78.287 1.00 18.32  ? 455  ILE A CG1 1 
ATOM   2371 C  CG2 . ILE A 1 301 ? -5.432  15.047  79.981 1.00 19.71  ? 455  ILE A CG2 1 
ATOM   2372 C  CD1 . ILE A 1 301 ? -4.753  13.522  77.349 1.00 17.41  ? 455  ILE A CD1 1 
ATOM   2373 N  N   . ASN A 1 302 ? -3.734  15.832  82.660 1.00 17.45  ? 456  ASN A N   1 
ATOM   2374 C  CA  . ASN A 1 302 ? -4.292  15.979  83.991 1.00 16.99  ? 456  ASN A CA  1 
ATOM   2375 C  C   . ASN A 1 302 ? -5.556  16.803  83.906 1.00 18.89  ? 456  ASN A C   1 
ATOM   2376 O  O   . ASN A 1 302 ? -5.507  18.029  83.623 1.00 18.88  ? 456  ASN A O   1 
ATOM   2377 C  CB  . ASN A 1 302 ? -3.311  16.676  84.929 1.00 17.11  ? 456  ASN A CB  1 
ATOM   2378 C  CG  . ASN A 1 302 ? -3.848  16.835  86.325 1.00 18.91  ? 456  ASN A CG  1 
ATOM   2379 O  OD1 . ASN A 1 302 ? -4.921  16.282  86.679 1.00 18.76  ? 456  ASN A OD1 1 
ATOM   2380 N  ND2 . ASN A 1 302 ? -3.115  17.585  87.137 1.00 17.78  ? 456  ASN A ND2 1 
ATOM   2381 N  N   . LEU A 1 303 ? -6.674  16.138  84.128 1.00 16.38  ? 457  LEU A N   1 
ATOM   2382 C  CA  . LEU A 1 303 ? -7.984  16.778  84.066 1.00 17.89  ? 457  LEU A CA  1 
ATOM   2383 C  C   . LEU A 1 303 ? -8.508  17.072  85.500 1.00 19.37  ? 457  LEU A C   1 
ATOM   2384 O  O   . LEU A 1 303 ? -9.656  17.501  85.649 1.00 20.60  ? 457  LEU A O   1 
ATOM   2385 C  CB  . LEU A 1 303 ? -8.969  15.907  83.298 1.00 19.69  ? 457  LEU A CB  1 
ATOM   2386 C  CG  . LEU A 1 303 ? -8.722  15.833  81.786 1.00 24.19  ? 457  LEU A CG  1 
ATOM   2387 C  CD1 . LEU A 1 303 ? -9.586  14.706  81.251 1.00 26.92  ? 457  LEU A CD1 1 
ATOM   2388 C  CD2 . LEU A 1 303 ? -8.991  17.131  81.106 1.00 25.20  ? 457  LEU A CD2 1 
ATOM   2389 N  N   . HIS A 1 304 ? -7.693  16.825  86.507 1.00 18.89  ? 458  HIS A N   1 
ATOM   2390 C  CA  . HIS A 1 304 ? -7.985  17.303  87.872 1.00 18.66  ? 458  HIS A CA  1 
ATOM   2391 C  C   . HIS A 1 304 ? -7.802  18.802  87.934 1.00 20.87  ? 458  HIS A C   1 
ATOM   2392 O  O   . HIS A 1 304 ? -7.056  19.390  87.135 1.00 19.55  ? 458  HIS A O   1 
ATOM   2393 C  CB  . HIS A 1 304 ? -7.071  16.672  88.940 1.00 20.70  ? 458  HIS A CB  1 
ATOM   2394 C  CG  . HIS A 1 304 ? -7.144  15.173  89.024 1.00 21.63  ? 458  HIS A CG  1 
ATOM   2395 N  ND1 . HIS A 1 304 ? -8.153  14.515  89.700 1.00 23.78  ? 458  HIS A ND1 1 
ATOM   2396 C  CD2 . HIS A 1 304 ? -6.356  14.207  88.498 1.00 21.54  ? 458  HIS A CD2 1 
ATOM   2397 C  CE1 . HIS A 1 304 ? -7.966  13.210  89.602 1.00 23.85  ? 458  HIS A CE1 1 
ATOM   2398 N  NE2 . HIS A 1 304 ? -6.870  12.992  88.902 1.00 23.35  ? 458  HIS A NE2 1 
ATOM   2399 N  N   . ASN A 1 305 ? -8.380  19.419  88.974 1.00 19.47  ? 459  ASN A N   1 
ATOM   2400 C  CA  . ASN A 1 305 ? -8.227  20.829  89.196 1.00 21.50  ? 459  ASN A CA  1 
ATOM   2401 C  C   . ASN A 1 305 ? -7.096  21.174  90.150 1.00 21.32  ? 459  ASN A C   1 
ATOM   2402 O  O   . ASN A 1 305 ? -6.985  22.317  90.575 1.00 22.82  ? 459  ASN A O   1 
ATOM   2403 C  CB  . ASN A 1 305 ? -9.582  21.462  89.604 1.00 23.30  ? 459  ASN A CB  1 
ATOM   2404 C  CG  . ASN A 1 305 ? -10.051 21.046  90.974 1.00 27.54  ? 459  ASN A CG  1 
ATOM   2405 O  OD1 . ASN A 1 305 ? -9.421  20.224  91.632 1.00 26.16  ? 459  ASN A OD1 1 
ATOM   2406 N  ND2 . ASN A 1 305 ? -11.163 21.680  91.434 1.00 33.27  ? 459  ASN A ND2 1 
ATOM   2407 N  N   . VAL A 1 306 ? -6.240  20.191  90.454 1.00 21.06  ? 460  VAL A N   1 
ATOM   2408 C  CA  . VAL A 1 306 ? -5.013  20.416  91.202 1.00 20.65  ? 460  VAL A CA  1 
ATOM   2409 C  C   . VAL A 1 306 ? -3.862  19.726  90.508 1.00 19.97  ? 460  VAL A C   1 
ATOM   2410 O  O   . VAL A 1 306 ? -4.048  18.779  89.719 1.00 20.76  ? 460  VAL A O   1 
ATOM   2411 C  CB  . VAL A 1 306 ? -5.095  19.893  92.651 1.00 23.70  ? 460  VAL A CB  1 
ATOM   2412 C  CG1 . VAL A 1 306 ? -6.198  20.622  93.415 1.00 24.88  ? 460  VAL A CG1 1 
ATOM   2413 C  CG2 . VAL A 1 306 ? -5.383  18.404  92.653 1.00 22.83  ? 460  VAL A CG2 1 
ATOM   2414 N  N   . THR A 1 307 ? -2.669  20.208  90.794 1.00 20.97  ? 461  THR A N   1 
ATOM   2415 C  CA  . THR A 1 307 ? -1.469  19.606  90.287 1.00 21.44  ? 461  THR A CA  1 
ATOM   2416 C  C   . THR A 1 307 ? -1.336  18.159  90.810 1.00 22.10  ? 461  THR A C   1 
ATOM   2417 O  O   . THR A 1 307 ? -1.596  17.874  91.982 1.00 22.77  ? 461  THR A O   1 
ATOM   2418 C  CB  . THR A 1 307 ? -0.233  20.406  90.697 1.00 21.56  ? 461  THR A CB  1 
ATOM   2419 O  OG1 . THR A 1 307 ? -0.286  21.726  90.154 1.00 20.39  ? 461  THR A OG1 1 
ATOM   2420 C  CG2 . THR A 1 307 ? 1.077   19.784  90.170 1.00 21.67  ? 461  THR A CG2 1 
ATOM   2421 N  N   . LYS A 1 308 ? -0.897  17.254  89.935 1.00 22.24  ? 462  LYS A N   1 
ATOM   2422 C  CA  . LYS A 1 308 ? -0.546  15.886  90.314 1.00 21.48  ? 462  LYS A CA  1 
ATOM   2423 C  C   . LYS A 1 308 ? 0.945   15.660  90.052 1.00 20.95  ? 462  LYS A C   1 
ATOM   2424 O  O   . LYS A 1 308 ? 1.544   16.286  89.195 1.00 20.68  ? 462  LYS A O   1 
ATOM   2425 C  CB  . LYS A 1 308 ? -1.408  14.850  89.554 1.00 21.60  ? 462  LYS A CB  1 
ATOM   2426 C  CG  . LYS A 1 308 ? -2.889  14.946  89.835 1.00 21.78  ? 462  LYS A CG  1 
ATOM   2427 C  CD  . LYS A 1 308 ? -3.246  14.490  91.238 1.00 25.05  ? 462  LYS A CD  1 
ATOM   2428 C  CE  . LYS A 1 308 ? -4.711  14.646  91.547 1.00 26.90  ? 462  LYS A CE  1 
ATOM   2429 N  NZ  . LYS A 1 308 ? -4.973  14.283  92.974 1.00 29.94  ? 462  LYS A NZ  1 
ATOM   2430 N  N   . TYR A 1 309 ? 1.559   14.809  90.865 1.00 20.41  ? 463  TYR A N   1 
ATOM   2431 C  CA  . TYR A 1 309 ? 2.977   14.564  90.827 1.00 21.68  ? 463  TYR A CA  1 
ATOM   2432 C  C   . TYR A 1 309 ? 3.140   13.083  90.543 1.00 23.96  ? 463  TYR A C   1 
ATOM   2433 O  O   . TYR A 1 309 ? 2.581   12.218  91.284 1.00 26.54  ? 463  TYR A O   1 
ATOM   2434 C  CB  . TYR A 1 309 ? 3.620   14.953  92.180 1.00 23.87  ? 463  TYR A CB  1 
ATOM   2435 C  CG  . TYR A 1 309 ? 3.445   16.433  92.489 1.00 25.75  ? 463  TYR A CG  1 
ATOM   2436 C  CD1 . TYR A 1 309 ? 4.329   17.371  92.002 1.00 27.10  ? 463  TYR A CD1 1 
ATOM   2437 C  CD2 . TYR A 1 309 ? 2.329   16.870  93.195 1.00 27.53  ? 463  TYR A CD2 1 
ATOM   2438 C  CE1 . TYR A 1 309 ? 4.152   18.736  92.258 1.00 27.77  ? 463  TYR A CE1 1 
ATOM   2439 C  CE2 . TYR A 1 309 ? 2.121   18.230  93.465 1.00 28.15  ? 463  TYR A CE2 1 
ATOM   2440 C  CZ  . TYR A 1 309 ? 3.028   19.147  92.985 1.00 30.32  ? 463  TYR A CZ  1 
ATOM   2441 O  OH  . TYR A 1 309 ? 2.772   20.475  93.239 1.00 33.31  ? 463  TYR A OH  1 
ATOM   2442 N  N   . LEU A 1 310 ? 3.799   12.772  89.429 1.00 23.17  ? 464  LEU A N   1 
ATOM   2443 C  CA  . LEU A 1 310 ? 3.907   11.374  88.972 1.00 22.96  ? 464  LEU A CA  1 
ATOM   2444 C  C   . LEU A 1 310 ? 5.285   10.811  89.330 1.00 21.89  ? 464  LEU A C   1 
ATOM   2445 O  O   . LEU A 1 310 ? 6.331   11.453  89.075 1.00 23.14  ? 464  LEU A O   1 
ATOM   2446 C  CB  . LEU A 1 310 ? 3.727   11.286  87.461 1.00 23.73  ? 464  LEU A CB  1 
ATOM   2447 C  CG  . LEU A 1 310 ? 2.595   12.079  86.817 1.00 26.10  ? 464  LEU A CG  1 
ATOM   2448 C  CD1 . LEU A 1 310 ? 2.565   11.771  85.320 1.00 27.35  ? 464  LEU A CD1 1 
ATOM   2449 C  CD2 . LEU A 1 310 ? 1.288   11.726  87.440 1.00 27.74  ? 464  LEU A CD2 1 
ATOM   2450 N  N   . ARG A 1 311 ? 5.303   9.611   89.869 1.00 22.33  ? 465  ARG A N   1 
ATOM   2451 C  CA  . ARG A 1 311 ? 6.574   8.957   90.204 1.00 24.32  ? 465  ARG A CA  1 
ATOM   2452 C  C   . ARG A 1 311 ? 6.815   7.807   89.238 1.00 22.65  ? 465  ARG A C   1 
ATOM   2453 O  O   . ARG A 1 311 ? 5.953   6.942   89.076 1.00 22.05  ? 465  ARG A O   1 
ATOM   2454 C  CB  . ARG A 1 311 ? 6.549   8.389   91.621 1.00 29.02  ? 465  ARG A CB  1 
ATOM   2455 C  CG  . ARG A 1 311 ? 6.548   9.458   92.707 1.00 39.31  ? 465  ARG A CG  1 
ATOM   2456 C  CD  . ARG A 1 311 ? 7.028   8.891   94.047 1.00 45.32  ? 465  ARG A CD  1 
ATOM   2457 N  NE  . ARG A 1 311 ? 6.118   7.875   94.600 1.00 49.62  ? 465  ARG A NE  1 
ATOM   2458 C  CZ  . ARG A 1 311 ? 5.576   7.877   95.828 1.00 51.91  ? 465  ARG A CZ  1 
ATOM   2459 N  NH1 . ARG A 1 311 ? 5.839   8.837   96.729 1.00 51.10  ? 465  ARG A NH1 1 
ATOM   2460 N  NH2 . ARG A 1 311 ? 4.751   6.884   96.170 1.00 51.07  ? 465  ARG A NH2 1 
ATOM   2461 N  N   . LEU A 1 312 ? 7.989   7.806   88.638 1.00 22.24  ? 466  LEU A N   1 
ATOM   2462 C  CA  . LEU A 1 312 ? 8.378   6.796   87.653 1.00 20.88  ? 466  LEU A CA  1 
ATOM   2463 C  C   . LEU A 1 312 ? 8.731   5.524   88.379 1.00 23.06  ? 466  LEU A C   1 
ATOM   2464 O  O   . LEU A 1 312 ? 9.293   5.580   89.478 1.00 24.44  ? 466  LEU A O   1 
ATOM   2465 C  CB  . LEU A 1 312 ? 9.586   7.250   86.848 1.00 20.83  ? 466  LEU A CB  1 
ATOM   2466 C  CG  . LEU A 1 312 ? 9.316   8.459   85.935 1.00 22.24  ? 466  LEU A CG  1 
ATOM   2467 C  CD1 . LEU A 1 312 ? 10.562  8.993   85.309 1.00 23.70  ? 466  LEU A CD1 1 
ATOM   2468 C  CD2 . LEU A 1 312 ? 8.276   8.150   84.883 1.00 21.81  ? 466  LEU A CD2 1 
ATOM   2469 N  N   . PRO A 1 313 ? 8.447   4.381   87.766 1.00 23.12  ? 467  PRO A N   1 
ATOM   2470 C  CA  . PRO A 1 313 ? 8.788   3.132   88.368 1.00 23.26  ? 467  PRO A CA  1 
ATOM   2471 C  C   . PRO A 1 313 ? 10.225  2.754   88.122 1.00 24.91  ? 467  PRO A C   1 
ATOM   2472 O  O   . PRO A 1 313 ? 10.850  3.191   87.155 1.00 25.36  ? 467  PRO A O   1 
ATOM   2473 C  CB  . PRO A 1 313 ? 7.843   2.176   87.680 1.00 23.35  ? 467  PRO A CB  1 
ATOM   2474 C  CG  . PRO A 1 313 ? 7.725   2.716   86.286 1.00 22.32  ? 467  PRO A CG  1 
ATOM   2475 C  CD  . PRO A 1 313 ? 7.756   4.203   86.477 1.00 22.47  ? 467  PRO A CD  1 
ATOM   2476 N  N   . TYR A 1 314 ? 10.731  1.892   89.005 1.00 26.86  ? 468  TYR A N   1 
ATOM   2477 C  CA  . TYR A 1 314 ? 11.984  1.189   88.768 1.00 28.25  ? 468  TYR A CA  1 
ATOM   2478 C  C   . TYR A 1 314 ? 11.858  0.434   87.442 1.00 25.46  ? 468  TYR A C   1 
ATOM   2479 O  O   . TYR A 1 314 ? 10.828  -0.171  87.198 1.00 26.01  ? 468  TYR A O   1 
ATOM   2480 C  CB  . TYR A 1 314 ? 12.239  0.180   89.913 1.00 29.34  ? 468  TYR A CB  1 
ATOM   2481 C  CG  . TYR A 1 314 ? 13.531  -0.598  89.737 1.00 33.49  ? 468  TYR A CG  1 
ATOM   2482 C  CD1 . TYR A 1 314 ? 14.746  -0.048  90.160 1.00 38.05  ? 468  TYR A CD1 1 
ATOM   2483 C  CD2 . TYR A 1 314 ? 13.539  -1.843  89.109 1.00 37.88  ? 468  TYR A CD2 1 
ATOM   2484 C  CE1 . TYR A 1 314 ? 15.949  -0.721  89.971 1.00 42.24  ? 468  TYR A CE1 1 
ATOM   2485 C  CE2 . TYR A 1 314 ? 14.730  -2.539  88.925 1.00 41.72  ? 468  TYR A CE2 1 
ATOM   2486 C  CZ  . TYR A 1 314 ? 15.926  -1.969  89.369 1.00 44.50  ? 468  TYR A CZ  1 
ATOM   2487 O  OH  . TYR A 1 314 ? 17.114  -2.630  89.208 1.00 51.39  ? 468  TYR A OH  1 
ATOM   2488 N  N   . PRO A 1 315 ? 12.879  0.425   86.584 1.00 27.16  ? 469  PRO A N   1 
ATOM   2489 C  CA  . PRO A 1 315 ? 14.224  0.945   86.819 1.00 28.91  ? 469  PRO A CA  1 
ATOM   2490 C  C   . PRO A 1 315 ? 14.488  2.370   86.304 1.00 31.22  ? 469  PRO A C   1 
ATOM   2491 O  O   . PRO A 1 315 ? 15.640  2.711   86.043 1.00 34.45  ? 469  PRO A O   1 
ATOM   2492 C  CB  . PRO A 1 315 ? 15.080  -0.075  86.040 1.00 30.57  ? 469  PRO A CB  1 
ATOM   2493 C  CG  . PRO A 1 315 ? 14.235  -0.384  84.858 1.00 29.35  ? 469  PRO A CG  1 
ATOM   2494 C  CD  . PRO A 1 315 ? 12.856  -0.536  85.462 1.00 29.76  ? 469  PRO A CD  1 
ATOM   2495 N  N   . PHE A 1 316 ? 13.436  3.198   86.186 1.00 26.54  ? 470  PHE A N   1 
ATOM   2496 C  CA  . PHE A 1 316 ? 13.514  4.495   85.551 1.00 26.60  ? 470  PHE A CA  1 
ATOM   2497 C  C   . PHE A 1 316 ? 13.496  5.681   86.532 1.00 27.86  ? 470  PHE A C   1 
ATOM   2498 O  O   . PHE A 1 316 ? 13.586  6.822   86.101 1.00 27.55  ? 470  PHE A O   1 
ATOM   2499 C  CB  . PHE A 1 316 ? 12.339  4.633   84.559 1.00 26.15  ? 470  PHE A CB  1 
ATOM   2500 C  CG  . PHE A 1 316 ? 12.229  3.476   83.616 1.00 24.89  ? 470  PHE A CG  1 
ATOM   2501 C  CD1 . PHE A 1 316 ? 13.249  3.235   82.714 1.00 23.00  ? 470  PHE A CD1 1 
ATOM   2502 C  CD2 . PHE A 1 316 ? 11.151  2.597   83.671 1.00 22.36  ? 470  PHE A CD2 1 
ATOM   2503 C  CE1 . PHE A 1 316 ? 13.193  2.149   81.832 1.00 26.33  ? 470  PHE A CE1 1 
ATOM   2504 C  CE2 . PHE A 1 316 ? 11.097  1.500   82.809 1.00 23.62  ? 470  PHE A CE2 1 
ATOM   2505 C  CZ  . PHE A 1 316 ? 12.114  1.286   81.887 1.00 25.24  ? 470  PHE A CZ  1 
ATOM   2506 N  N   . SER A 1 317 ? 13.392  5.396   87.823 1.00 32.01  ? 471  SER A N   1 
ATOM   2507 C  CA  . SER A 1 317 ? 13.204  6.419   88.858 1.00 33.60  ? 471  SER A CA  1 
ATOM   2508 C  C   . SER A 1 317 ? 14.279  7.487   88.911 1.00 34.82  ? 471  SER A C   1 
ATOM   2509 O  O   . SER A 1 317 ? 13.949  8.628   89.225 1.00 37.46  ? 471  SER A O   1 
ATOM   2510 C  CB  . SER A 1 317 ? 13.157  5.780   90.229 1.00 36.92  ? 471  SER A CB  1 
ATOM   2511 O  OG  . SER A 1 317 ? 12.169  4.791   90.284 1.00 37.01  ? 471  SER A OG  1 
ATOM   2512 N  N   . ASN A 1 318 ? 15.543  7.138   88.628 1.00 34.57  ? 472  ASN A N   1 
ATOM   2513 C  CA  . ASN A 1 318 ? 16.647  8.118   88.688 1.00 37.16  ? 472  ASN A CA  1 
ATOM   2514 C  C   . ASN A 1 318 ? 17.191  8.601   87.359 1.00 35.45  ? 472  ASN A C   1 
ATOM   2515 O  O   . ASN A 1 318 ? 18.231  9.219   87.306 1.00 36.13  ? 472  ASN A O   1 
ATOM   2516 C  CB  . ASN A 1 318 ? 17.760  7.548   89.552 1.00 40.15  ? 472  ASN A CB  1 
ATOM   2517 C  CG  . ASN A 1 318 ? 17.291  7.301   90.958 1.00 42.75  ? 472  ASN A CG  1 
ATOM   2518 O  OD1 . ASN A 1 318 ? 17.276  6.160   91.417 1.00 52.49  ? 472  ASN A OD1 1 
ATOM   2519 N  ND2 . ASN A 1 318 ? 16.834  8.360   91.634 1.00 42.28  ? 472  ASN A ND2 1 
ATOM   2520 N  N   . LYS A 1 319 ? 16.463  8.354   86.278 1.00 30.23  ? 473  LYS A N   1 
ATOM   2521 C  CA  . LYS A 1 319 ? 16.920  8.731   84.966 1.00 28.76  ? 473  LYS A CA  1 
ATOM   2522 C  C   . LYS A 1 319 ? 16.734  10.237  84.773 1.00 27.87  ? 473  LYS A C   1 
ATOM   2523 O  O   . LYS A 1 319 ? 15.888  10.864  85.420 1.00 28.82  ? 473  LYS A O   1 
ATOM   2524 C  CB  . LYS A 1 319 ? 16.123  7.978   83.908 1.00 28.57  ? 473  LYS A CB  1 
ATOM   2525 C  CG  . LYS A 1 319 ? 16.185  6.473   84.040 1.00 29.71  ? 473  LYS A CG  1 
ATOM   2526 C  CD  . LYS A 1 319 ? 17.523  5.920   83.570 1.00 32.06  ? 473  LYS A CD  1 
ATOM   2527 C  CE  . LYS A 1 319 ? 17.556  4.393   83.619 1.00 34.04  ? 473  LYS A CE  1 
ATOM   2528 N  NZ  . LYS A 1 319 ? 18.899  3.941   83.158 1.00 36.21  ? 473  LYS A NZ  1 
ATOM   2529 N  N   . GLN A 1 320 ? 17.546  10.814  83.903 1.00 27.62  ? 474  GLN A N   1 
ATOM   2530 C  CA  . GLN A 1 320 ? 17.329  12.181  83.485 1.00 27.62  ? 474  GLN A CA  1 
ATOM   2531 C  C   . GLN A 1 320 ? 16.057  12.197  82.658 1.00 24.14  ? 474  GLN A C   1 
ATOM   2532 O  O   . GLN A 1 320 ? 15.913  11.433  81.701 1.00 25.66  ? 474  GLN A O   1 
ATOM   2533 C  CB  . GLN A 1 320 ? 18.460  12.694  82.599 1.00 28.24  ? 474  GLN A CB  1 
ATOM   2534 C  CG  . GLN A 1 320 ? 18.255  14.125  82.101 1.00 30.36  ? 474  GLN A CG  1 
ATOM   2535 C  CD  . GLN A 1 320 ? 18.178  15.080  83.267 1.00 34.22  ? 474  GLN A CD  1 
ATOM   2536 O  OE1 . GLN A 1 320 ? 19.131  15.141  84.079 1.00 31.73  ? 474  GLN A OE1 1 
ATOM   2537 N  NE2 . GLN A 1 320 ? 17.061  15.823  83.390 1.00 31.74  ? 474  GLN A NE2 1 
ATOM   2538 N  N   . VAL A 1 321 ? 15.168  13.084  83.022 1.00 22.03  ? 475  VAL A N   1 
ATOM   2539 C  CA  . VAL A 1 321 ? 13.909  13.263  82.290 1.00 23.33  ? 475  VAL A CA  1 
ATOM   2540 C  C   . VAL A 1 321 ? 13.838  14.670  81.716 1.00 21.62  ? 475  VAL A C   1 
ATOM   2541 O  O   . VAL A 1 321 ? 14.135  15.624  82.412 1.00 24.15  ? 475  VAL A O   1 
ATOM   2542 C  CB  . VAL A 1 321 ? 12.698  13.047  83.220 1.00 22.65  ? 475  VAL A CB  1 
ATOM   2543 C  CG1 . VAL A 1 321 ? 11.396  13.301  82.451 1.00 24.63  ? 475  VAL A CG1 1 
ATOM   2544 C  CG2 . VAL A 1 321 ? 12.740  11.650  83.823 1.00 25.51  ? 475  VAL A CG2 1 
ATOM   2545 N  N   . ASP A 1 322 ? 13.416  14.783  80.461 1.00 22.82  ? 476  ASP A N   1 
ATOM   2546 C  CA  . ASP A 1 322 ? 13.173  16.057  79.808 1.00 22.12  ? 476  ASP A CA  1 
ATOM   2547 C  C   . ASP A 1 322 ? 11.689  16.303  79.751 1.00 24.46  ? 476  ASP A C   1 
ATOM   2548 O  O   . ASP A 1 322 ? 10.922  15.476  79.184 1.00 21.35  ? 476  ASP A O   1 
ATOM   2549 C  CB  . ASP A 1 322 ? 13.727  16.067  78.393 1.00 23.99  ? 476  ASP A CB  1 
ATOM   2550 C  CG  . ASP A 1 322 ? 15.264  16.248  78.346 1.00 24.80  ? 476  ASP A CG  1 
ATOM   2551 O  OD1 . ASP A 1 322 ? 15.877  16.451  79.425 1.00 25.55  ? 476  ASP A OD1 1 
ATOM   2552 O  OD2 . ASP A 1 322 ? 15.810  16.131  77.235 1.00 26.47  ? 476  ASP A OD2 1 
ATOM   2553 N  N   . LYS A 1 323 ? 11.271  17.415  80.338 1.00 21.58  ? 477  LYS A N   1 
ATOM   2554 C  CA  . LYS A 1 323 ? 9.879   17.776  80.427 1.00 22.36  ? 477  LYS A CA  1 
ATOM   2555 C  C   . LYS A 1 323 ? 9.506   18.673  79.274 1.00 22.39  ? 477  LYS A C   1 
ATOM   2556 O  O   . LYS A 1 323 ? 10.257  19.562  78.891 1.00 22.07  ? 477  LYS A O   1 
ATOM   2557 C  CB  . LYS A 1 323 ? 9.605   18.482  81.748 1.00 22.76  ? 477  LYS A CB  1 
ATOM   2558 C  CG  . LYS A 1 323 ? 8.157   18.909  82.020 1.00 24.42  ? 477  LYS A CG  1 
ATOM   2559 C  CD  . LYS A 1 323 ? 8.003   19.339  83.467 1.00 26.89  ? 477  LYS A CD  1 
ATOM   2560 C  CE  . LYS A 1 323 ? 6.631   19.831  83.864 1.00 29.44  ? 477  LYS A CE  1 
ATOM   2561 N  NZ  . LYS A 1 323 ? 6.512   20.238  85.322 1.00 30.79  ? 477  LYS A NZ  1 
ATOM   2562 N  N   . TYR A 1 324 ? 8.311   18.446  78.729 1.00 19.38  ? 478  TYR A N   1 
ATOM   2563 C  CA  . TYR A 1 324 ? 7.744   19.269  77.673 1.00 18.39  ? 478  TYR A CA  1 
ATOM   2564 C  C   . TYR A 1 324 ? 6.287   19.552  78.031 1.00 19.53  ? 478  TYR A C   1 
ATOM   2565 O  O   . TYR A 1 324 ? 5.352   18.901  77.503 1.00 17.50  ? 478  TYR A O   1 
ATOM   2566 C  CB  . TYR A 1 324 ? 7.831   18.613  76.337 1.00 17.72  ? 478  TYR A CB  1 
ATOM   2567 C  CG  . TYR A 1 324 ? 9.203   18.314  75.805 1.00 18.74  ? 478  TYR A CG  1 
ATOM   2568 C  CD1 . TYR A 1 324 ? 9.882   17.176  76.188 1.00 19.61  ? 478  TYR A CD1 1 
ATOM   2569 C  CD2 . TYR A 1 324 ? 9.775   19.135  74.854 1.00 20.13  ? 478  TYR A CD2 1 
ATOM   2570 C  CE1 . TYR A 1 324 ? 11.153  16.882  75.640 1.00 20.18  ? 478  TYR A CE1 1 
ATOM   2571 C  CE2 . TYR A 1 324 ? 11.020  18.870  74.346 1.00 21.90  ? 478  TYR A CE2 1 
ATOM   2572 C  CZ  . TYR A 1 324 ? 11.694  17.768  74.710 1.00 22.92  ? 478  TYR A CZ  1 
ATOM   2573 O  OH  . TYR A 1 324 ? 12.916  17.535  74.073 1.00 23.67  ? 478  TYR A OH  1 
ATOM   2574 N  N   . LEU A 1 325 ? 6.126   20.530  78.912 1.00 18.28  ? 479  LEU A N   1 
ATOM   2575 C  CA  . LEU A 1 325 ? 4.818   20.868  79.511 1.00 19.03  ? 479  LEU A CA  1 
ATOM   2576 C  C   . LEU A 1 325 ? 4.180   22.051  78.783 1.00 18.83  ? 479  LEU A C   1 
ATOM   2577 O  O   . LEU A 1 325 ? 4.784   23.144  78.641 1.00 19.00  ? 479  LEU A O   1 
ATOM   2578 C  CB  . LEU A 1 325 ? 4.980   21.175  80.985 1.00 18.34  ? 479  LEU A CB  1 
ATOM   2579 C  CG  . LEU A 1 325 ? 3.846   21.904  81.680 1.00 18.94  ? 479  LEU A CG  1 
ATOM   2580 C  CD1 . LEU A 1 325 ? 2.617   20.997  81.731 1.00 16.74  ? 479  LEU A CD1 1 
ATOM   2581 C  CD2 . LEU A 1 325 ? 4.212   22.298  83.095 1.00 20.16  ? 479  LEU A CD2 1 
ATOM   2582 N  N   . LEU A 1 326 ? 2.952   21.824  78.319 1.00 18.60  ? 480  LEU A N   1 
ATOM   2583 C  CA  . LEU A 1 326 ? 2.160   22.828  77.589 1.00 18.06  ? 480  LEU A CA  1 
ATOM   2584 C  C   . LEU A 1 326 ? 1.124   23.455  78.517 1.00 19.51  ? 480  LEU A C   1 
ATOM   2585 O  O   . LEU A 1 326 ? 0.396   22.731  79.231 1.00 16.47  ? 480  LEU A O   1 
ATOM   2586 C  CB  . LEU A 1 326 ? 1.470   22.220  76.368 1.00 17.31  ? 480  LEU A CB  1 
ATOM   2587 C  CG  . LEU A 1 326 ? 2.449   21.768  75.304 1.00 18.95  ? 480  LEU A CG  1 
ATOM   2588 C  CD1 . LEU A 1 326 ? 1.796   20.828  74.333 1.00 20.46  ? 480  LEU A CD1 1 
ATOM   2589 C  CD2 . LEU A 1 326 ? 3.069   22.946  74.539 1.00 20.05  ? 480  LEU A CD2 1 
ATOM   2590 N  N   . ARG A 1 327 ? 1.125   24.790  78.602 1.00 18.15  ? 481  ARG A N   1 
ATOM   2591 C  CA  . ARG A 1 327 ? 0.114   25.556  79.335 1.00 19.21  ? 481  ARG A CA  1 
ATOM   2592 C  C   . ARG A 1 327 ? -0.351  26.713  78.469 1.00 19.35  ? 481  ARG A C   1 
ATOM   2593 O  O   . ARG A 1 327 ? 0.418   27.225  77.689 1.00 20.03  ? 481  ARG A O   1 
ATOM   2594 C  CB  . ARG A 1 327 ? 0.673   26.197  80.637 1.00 22.57  ? 481  ARG A CB  1 
ATOM   2595 C  CG  . ARG A 1 327 ? 1.422   25.287  81.562 1.00 26.17  ? 481  ARG A CG  1 
ATOM   2596 C  CD  . ARG A 1 327 ? 0.533   24.403  82.397 1.00 27.05  ? 481  ARG A CD  1 
ATOM   2597 N  NE  . ARG A 1 327 ? -0.543  25.012  83.200 1.00 27.33  ? 481  ARG A NE  1 
ATOM   2598 C  CZ  . ARG A 1 327 ? -0.457  25.543  84.427 1.00 30.45  ? 481  ARG A CZ  1 
ATOM   2599 N  NH1 . ARG A 1 327 ? 0.676   25.727  85.068 1.00 33.32  ? 481  ARG A NH1 1 
ATOM   2600 N  NH2 . ARG A 1 327 ? -1.576  25.945  85.016 1.00 32.30  ? 481  ARG A NH2 1 
ATOM   2601 N  N   . PRO A 1 328 ? -1.531  27.223  78.711 1.00 16.60  ? 482  PRO A N   1 
ATOM   2602 C  CA  . PRO A 1 328 ? -2.007  28.329  77.860 1.00 17.20  ? 482  PRO A CA  1 
ATOM   2603 C  C   . PRO A 1 328 ? -1.296  29.665  78.224 1.00 19.12  ? 482  PRO A C   1 
ATOM   2604 O  O   . PRO A 1 328 ? -0.920  29.852  79.392 1.00 21.47  ? 482  PRO A O   1 
ATOM   2605 C  CB  . PRO A 1 328 ? -3.476  28.427  78.222 1.00 17.82  ? 482  PRO A CB  1 
ATOM   2606 C  CG  . PRO A 1 328 ? -3.620  27.762  79.547 1.00 18.30  ? 482  PRO A CG  1 
ATOM   2607 C  CD  . PRO A 1 328 ? -2.593  26.706  79.584 1.00 18.18  ? 482  PRO A CD  1 
ATOM   2608 N  N   . LEU A 1 329 ? -1.140  30.527  77.225 1.00 18.78  ? 483  LEU A N   1 
ATOM   2609 C  CA  . LEU A 1 329 ? -0.745  31.926  77.441 1.00 20.77  ? 483  LEU A CA  1 
ATOM   2610 C  C   . LEU A 1 329 ? -1.984  32.717  77.776 1.00 21.50  ? 483  LEU A C   1 
ATOM   2611 O  O   . LEU A 1 329 ? -3.006  32.601  77.109 1.00 22.84  ? 483  LEU A O   1 
ATOM   2612 C  CB  . LEU A 1 329 ? -0.085  32.466  76.187 1.00 23.52  ? 483  LEU A CB  1 
ATOM   2613 C  CG  . LEU A 1 329 ? 0.322   33.946  76.287 1.00 25.28  ? 483  LEU A CG  1 
ATOM   2614 C  CD1 . LEU A 1 329 ? 1.446   34.173  77.258 1.00 27.57  ? 483  LEU A CD1 1 
ATOM   2615 C  CD2 . LEU A 1 329 ? 0.675   34.421  74.914 1.00 26.26  ? 483  LEU A CD2 1 
ATOM   2616 N  N   . GLY A 1 330 ? -1.919  33.500  78.829 1.00 20.38  ? 484  GLY A N   1 
ATOM   2617 C  CA  . GLY A 1 330 ? -3.087  34.234  79.346 1.00 20.27  ? 484  GLY A CA  1 
ATOM   2618 C  C   . GLY A 1 330 ? -3.438  35.378  78.418 1.00 19.16  ? 484  GLY A C   1 
ATOM   2619 O  O   . GLY A 1 330 ? -2.698  35.674  77.486 1.00 21.83  ? 484  GLY A O   1 
ATOM   2620 N  N   . PRO A 1 331 ? -4.551  36.047  78.661 1.00 17.06  ? 485  PRO A N   1 
ATOM   2621 C  CA  . PRO A 1 331 ? -5.379  35.956  79.840 1.00 16.57  ? 485  PRO A CA  1 
ATOM   2622 C  C   . PRO A 1 331 ? -6.524  34.942  79.758 1.00 15.27  ? 485  PRO A C   1 
ATOM   2623 O  O   . PRO A 1 331 ? -7.202  34.811  80.711 1.00 18.00  ? 485  PRO A O   1 
ATOM   2624 C  CB  . PRO A 1 331 ? -5.985  37.352  79.907 1.00 18.28  ? 485  PRO A CB  1 
ATOM   2625 C  CG  . PRO A 1 331 ? -6.192  37.651  78.491 1.00 18.01  ? 485  PRO A CG  1 
ATOM   2626 C  CD  . PRO A 1 331 ? -4.950  37.194  77.809 1.00 19.52  ? 485  PRO A CD  1 
ATOM   2627 N  N   . HIS A 1 332 ? -6.689  34.236  78.618 1.00 16.13  ? 486  HIS A N   1 
ATOM   2628 C  CA  . HIS A 1 332 ? -7.867  33.421  78.388 1.00 17.38  ? 486  HIS A CA  1 
ATOM   2629 C  C   . HIS A 1 332 ? -7.797  31.972  78.852 1.00 18.40  ? 486  HIS A C   1 
ATOM   2630 O  O   . HIS A 1 332 ? -8.759  31.243  78.668 1.00 19.04  ? 486  HIS A O   1 
ATOM   2631 C  CB  . HIS A 1 332 ? -8.307  33.558  76.942 1.00 17.10  ? 486  HIS A CB  1 
ATOM   2632 C  CG  . HIS A 1 332 ? -8.823  34.929  76.643 1.00 18.82  ? 486  HIS A CG  1 
ATOM   2633 N  ND1 . HIS A 1 332 ? -8.318  35.721  75.635 1.00 21.88  ? 486  HIS A ND1 1 
ATOM   2634 C  CD2 . HIS A 1 332 ? -9.787  35.661  77.250 1.00 16.61  ? 486  HIS A CD2 1 
ATOM   2635 C  CE1 . HIS A 1 332 ? -8.952  36.876  75.625 1.00 18.34  ? 486  HIS A CE1 1 
ATOM   2636 N  NE2 . HIS A 1 332 ? -9.861  36.856  76.587 1.00 21.14  ? 486  HIS A NE2 1 
ATOM   2637 N  N   . GLY A 1 333 ? -6.733  31.600  79.561 1.00 19.34  ? 487  GLY A N   1 
ATOM   2638 C  CA  . GLY A 1 333 ? -6.716  30.274  80.243 1.00 19.92  ? 487  GLY A CA  1 
ATOM   2639 C  C   . GLY A 1 333 ? -6.932  29.178  79.218 1.00 18.57  ? 487  GLY A C   1 
ATOM   2640 O  O   . GLY A 1 333 ? -6.398  29.245  78.110 1.00 18.86  ? 487  GLY A O   1 
ATOM   2641 N  N   . LEU A 1 334 ? -7.811  28.232  79.518 1.00 18.16  ? 488  LEU A N   1 
ATOM   2642 C  CA  . LEU A 1 334 ? -7.940  27.079  78.665 1.00 18.78  ? 488  LEU A CA  1 
ATOM   2643 C  C   . LEU A 1 334 ? -8.552  27.487  77.329 1.00 17.66  ? 488  LEU A C   1 
ATOM   2644 O  O   . LEU A 1 334 ? -8.389  26.779  76.328 1.00 18.85  ? 488  LEU A O   1 
ATOM   2645 C  CB  . LEU A 1 334 ? -8.801  26.005  79.341 1.00 18.47  ? 488  LEU A CB  1 
ATOM   2646 C  CG  . LEU A 1 334 ? -8.233  25.460  80.656 1.00 18.05  ? 488  LEU A CG  1 
ATOM   2647 C  CD1 . LEU A 1 334 ? -9.236  24.370  81.047 1.00 19.60  ? 488  LEU A CD1 1 
ATOM   2648 C  CD2 . LEU A 1 334 ? -6.831  24.897  80.490 1.00 19.51  ? 488  LEU A CD2 1 
ATOM   2649 N  N   . LEU A 1 335 ? -9.199  28.656  77.294 1.00 17.32  ? 489  LEU A N   1 
ATOM   2650 C  CA  . LEU A 1 335 ? -9.765  29.174  76.040 1.00 18.95  ? 489  LEU A CA  1 
ATOM   2651 C  C   . LEU A 1 335 ? -8.796  30.037  75.214 1.00 17.79  ? 489  LEU A C   1 
ATOM   2652 O  O   . LEU A 1 335 ? -9.196  30.643  74.192 1.00 19.74  ? 489  LEU A O   1 
ATOM   2653 C  CB  . LEU A 1 335 ? -11.073 29.914  76.324 1.00 19.88  ? 489  LEU A CB  1 
ATOM   2654 C  CG  . LEU A 1 335 ? -12.136 29.172  77.151 1.00 23.98  ? 489  LEU A CG  1 
ATOM   2655 C  CD1 . LEU A 1 335 ? -13.387 30.025  77.300 1.00 22.42  ? 489  LEU A CD1 1 
ATOM   2656 C  CD2 . LEU A 1 335 ? -12.426 27.838  76.539 1.00 26.15  ? 489  LEU A CD2 1 
ATOM   2657 N  N   . SER A 1 336 ? -7.542  30.031  75.606 1.00 18.29  ? 490  SER A N   1 
ATOM   2658 C  CA  . SER A 1 336 ? -6.500  30.723  74.860 1.00 18.65  ? 490  SER A CA  1 
ATOM   2659 C  C   . SER A 1 336 ? -6.163  30.037  73.521 1.00 18.66  ? 490  SER A C   1 
ATOM   2660 O  O   . SER A 1 336 ? -6.201  28.789  73.389 1.00 17.58  ? 490  SER A O   1 
ATOM   2661 C  CB  . SER A 1 336 ? -5.244  30.814  75.693 1.00 18.99  ? 490  SER A CB  1 
ATOM   2662 O  OG  . SER A 1 336 ? -4.284  31.528  75.005 1.00 19.44  ? 490  SER A OG  1 
ATOM   2663 N  N   . LYS A 1 337 ? -5.785  30.875  72.546 1.00 18.04  ? 491  LYS A N   1 
ATOM   2664 C  CA  . LYS A 1 337 ? -5.282  30.396  71.268 1.00 19.53  ? 491  LYS A CA  1 
ATOM   2665 C  C   . LYS A 1 337 ? -3.774  30.412  71.180 1.00 19.33  ? 491  LYS A C   1 
ATOM   2666 O  O   . LYS A 1 337 ? -3.236  30.209  70.107 1.00 18.58  ? 491  LYS A O   1 
ATOM   2667 C  CB  . LYS A 1 337 ? -5.884  31.183  70.101 1.00 21.94  ? 491  LYS A CB  1 
ATOM   2668 C  CG  . LYS A 1 337 ? -7.379  30.967  69.939 1.00 25.12  ? 491  LYS A CG  1 
ATOM   2669 C  CD  . LYS A 1 337 ? -7.803  31.639  68.645 1.00 30.82  ? 491  LYS A CD  1 
ATOM   2670 C  CE  . LYS A 1 337 ? -9.280  31.649  68.496 1.00 40.60  ? 491  LYS A CE  1 
ATOM   2671 N  NZ  . LYS A 1 337 ? -9.910  32.657  69.390 1.00 45.18  ? 491  LYS A NZ  1 
ATOM   2672 N  N   . SER A 1 338 ? -3.113  30.700  72.295 1.00 17.87  ? 492  SER A N   1 
ATOM   2673 C  CA  . SER A 1 338 ? -1.666  30.694  72.399 1.00 19.48  ? 492  SER A CA  1 
ATOM   2674 C  C   . SER A 1 338 ? -1.208  29.773  73.499 1.00 20.71  ? 492  SER A C   1 
ATOM   2675 O  O   . SER A 1 338 ? -1.855  29.694  74.534 1.00 20.73  ? 492  SER A O   1 
ATOM   2676 C  CB  . SER A 1 338 ? -1.150  32.111  72.706 1.00 22.56  ? 492  SER A CB  1 
ATOM   2677 O  OG  . SER A 1 338 ? -1.413  32.985  71.608 1.00 25.35  ? 492  SER A OG  1 
ATOM   2678 N  N   . VAL A 1 339 ? -0.045  29.160  73.309 1.00 20.20  ? 493  VAL A N   1 
ATOM   2679 C  CA  . VAL A 1 339 ? 0.447   28.134  74.247 1.00 21.72  ? 493  VAL A CA  1 
ATOM   2680 C  C   . VAL A 1 339 ? 1.896   28.361  74.560 1.00 21.27  ? 493  VAL A C   1 
ATOM   2681 O  O   . VAL A 1 339 ? 2.669   28.870  73.693 1.00 22.49  ? 493  VAL A O   1 
ATOM   2682 C  CB  . VAL A 1 339 ? 0.183   26.704  73.678 1.00 21.49  ? 493  VAL A CB  1 
ATOM   2683 C  CG1 . VAL A 1 339 ? 1.027   26.444  72.433 1.00 22.21  ? 493  VAL A CG1 1 
ATOM   2684 C  CG2 . VAL A 1 339 ? 0.424   25.616  74.737 1.00 21.44  ? 493  VAL A CG2 1 
ATOM   2685 N  N   . GLN A 1 340 ? 2.272   28.024  75.788 1.00 21.07  ? 494  GLN A N   1 
ATOM   2686 C  CA  . GLN A 1 340 ? 3.670   28.077  76.200 1.00 22.06  ? 494  GLN A CA  1 
ATOM   2687 C  C   . GLN A 1 340 ? 4.213   26.669  76.419 1.00 22.40  ? 494  GLN A C   1 
ATOM   2688 O  O   . GLN A 1 340 ? 3.502   25.809  76.950 1.00 21.14  ? 494  GLN A O   1 
ATOM   2689 C  CB  . GLN A 1 340 ? 3.807   28.863  77.498 1.00 23.42  ? 494  GLN A CB  1 
ATOM   2690 C  CG  . GLN A 1 340 ? 3.183   30.237  77.457 1.00 26.40  ? 494  GLN A CG  1 
ATOM   2691 C  CD  . GLN A 1 340 ? 3.741   31.107  78.566 1.00 30.35  ? 494  GLN A CD  1 
ATOM   2692 O  OE1 . GLN A 1 340 ? 3.702   30.716  79.729 1.00 33.37  ? 494  GLN A OE1 1 
ATOM   2693 N  NE2 . GLN A 1 340 ? 4.334   32.267  78.200 1.00 31.94  ? 494  GLN A NE2 1 
ATOM   2694 N  N   . LEU A 1 341 ? 5.465   26.446  76.023 1.00 20.44  ? 495  LEU A N   1 
ATOM   2695 C  CA  . LEU A 1 341 ? 6.159   25.205  76.279 1.00 20.66  ? 495  LEU A CA  1 
ATOM   2696 C  C   . LEU A 1 341 ? 7.138   25.471  77.375 1.00 22.10  ? 495  LEU A C   1 
ATOM   2697 O  O   . LEU A 1 341 ? 8.019   26.289  77.189 1.00 22.76  ? 495  LEU A O   1 
ATOM   2698 C  CB  . LEU A 1 341 ? 6.887   24.714  75.028 1.00 20.83  ? 495  LEU A CB  1 
ATOM   2699 C  CG  . LEU A 1 341 ? 7.758   23.473  75.132 1.00 20.68  ? 495  LEU A CG  1 
ATOM   2700 C  CD1 . LEU A 1 341 ? 6.963   22.275  75.710 1.00 22.83  ? 495  LEU A CD1 1 
ATOM   2701 C  CD2 . LEU A 1 341 ? 8.346   23.095  73.787 1.00 22.61  ? 495  LEU A CD2 1 
ATOM   2702 N  N   . ASN A 1 342 ? 6.969   24.839  78.528 1.00 20.04  ? 496  ASN A N   1 
ATOM   2703 C  CA  . ASN A 1 342 ? 7.883   25.074  79.643 1.00 21.62  ? 496  ASN A CA  1 
ATOM   2704 C  C   . ASN A 1 342 ? 8.063   26.598  79.916 1.00 24.63  ? 496  ASN A C   1 
ATOM   2705 O  O   . ASN A 1 342 ? 9.178   27.077  80.107 1.00 24.74  ? 496  ASN A O   1 
ATOM   2706 C  CB  . ASN A 1 342 ? 9.203   24.405  79.308 1.00 21.12  ? 496  ASN A CB  1 
ATOM   2707 C  CG  . ASN A 1 342 ? 9.063   22.934  79.164 1.00 21.98  ? 496  ASN A CG  1 
ATOM   2708 O  OD1 . ASN A 1 342 ? 8.300   22.295  79.951 1.00 21.44  ? 496  ASN A OD1 1 
ATOM   2709 N  ND2 . ASN A 1 342 ? 9.810   22.357  78.268 1.00 21.63  ? 496  ASN A ND2 1 
ATOM   2710 N  N   . GLY A 1 343 ? 6.952   27.343  79.842 1.00 21.68  ? 497  GLY A N   1 
ATOM   2711 C  CA  . GLY A 1 343 ? 6.939   28.793  80.091 1.00 24.65  ? 497  GLY A CA  1 
ATOM   2712 C  C   . GLY A 1 343 ? 7.375   29.732  78.965 1.00 27.38  ? 497  GLY A C   1 
ATOM   2713 O  O   . GLY A 1 343 ? 7.393   30.941  79.175 1.00 30.61  ? 497  GLY A O   1 
ATOM   2714 N  N   . LEU A 1 344 ? 7.654   29.209  77.776 1.00 25.68  ? 498  LEU A N   1 
ATOM   2715 C  CA  . LEU A 1 344 ? 8.074   29.992  76.618 1.00 28.06  ? 498  LEU A CA  1 
ATOM   2716 C  C   . LEU A 1 344 ? 6.971   29.914  75.597 1.00 28.71  ? 498  LEU A C   1 
ATOM   2717 O  O   . LEU A 1 344 ? 6.662   28.822  75.125 1.00 27.99  ? 498  LEU A O   1 
ATOM   2718 C  CB  . LEU A 1 344 ? 9.341   29.372  76.069 1.00 29.94  ? 498  LEU A CB  1 
ATOM   2719 C  CG  . LEU A 1 344 ? 10.163  30.074  75.018 1.00 36.03  ? 498  LEU A CG  1 
ATOM   2720 C  CD1 . LEU A 1 344 ? 10.412  31.541  75.400 1.00 39.72  ? 498  LEU A CD1 1 
ATOM   2721 C  CD2 . LEU A 1 344 ? 11.476  29.318  74.903 1.00 37.89  ? 498  LEU A CD2 1 
ATOM   2722 N  N   . THR A 1 345 ? 6.373   31.048  75.255 1.00 28.58  ? 499  THR A N   1 
ATOM   2723 C  CA  . THR A 1 345 ? 5.342   31.096  74.194 1.00 27.78  ? 499  THR A CA  1 
ATOM   2724 C  C   . THR A 1 345 ? 5.857   30.503  72.858 1.00 25.89  ? 499  THR A C   1 
ATOM   2725 O  O   . THR A 1 345 ? 6.945   30.845  72.369 1.00 26.85  ? 499  THR A O   1 
ATOM   2726 C  CB  . THR A 1 345 ? 4.843   32.531  73.966 1.00 28.74  ? 499  THR A CB  1 
ATOM   2727 O  OG1 . THR A 1 345 ? 4.251   33.023  75.166 1.00 25.29  ? 499  THR A OG1 1 
ATOM   2728 C  CG2 . THR A 1 345 ? 3.846   32.607  72.829 1.00 27.59  ? 499  THR A CG2 1 
ATOM   2729 N  N   . LEU A 1 346 ? 5.092   29.588  72.291 1.00 22.79  ? 500  LEU A N   1 
ATOM   2730 C  CA  . LEU A 1 346 ? 5.426   29.009  71.008 1.00 21.31  ? 500  LEU A CA  1 
ATOM   2731 C  C   . LEU A 1 346 ? 4.934   29.865  69.871 1.00 22.85  ? 500  LEU A C   1 
ATOM   2732 O  O   . LEU A 1 346 ? 3.731   30.158  69.723 1.00 24.35  ? 500  LEU A O   1 
ATOM   2733 C  CB  . LEU A 1 346 ? 4.922   27.558  70.870 1.00 21.35  ? 500  LEU A CB  1 
ATOM   2734 C  CG  . LEU A 1 346 ? 5.599   26.536  71.782 1.00 20.53  ? 500  LEU A CG  1 
ATOM   2735 C  CD1 . LEU A 1 346 ? 5.030   25.120  71.620 1.00 21.48  ? 500  LEU A CD1 1 
ATOM   2736 C  CD2 . LEU A 1 346 ? 7.094   26.420  71.564 1.00 21.79  ? 500  LEU A CD2 1 
ATOM   2737 N  N   . LYS A 1 347 ? 5.876   30.266  69.027 1.00 23.32  ? 501  LYS A N   1 
ATOM   2738 C  CA  . LYS A 1 347 ? 5.559   31.106  67.893 1.00 27.25  ? 501  LYS A CA  1 
ATOM   2739 C  C   . LYS A 1 347 ? 6.633   30.947  66.822 1.00 26.83  ? 501  LYS A C   1 
ATOM   2740 O  O   . LYS A 1 347 ? 7.762   30.563  67.109 1.00 26.62  ? 501  LYS A O   1 
ATOM   2741 C  CB  . LYS A 1 347 ? 5.399   32.558  68.326 1.00 32.73  ? 501  LYS A CB  1 
ATOM   2742 C  CG  . LYS A 1 347 ? 6.672   33.267  68.750 1.00 38.28  ? 501  LYS A CG  1 
ATOM   2743 C  CD  . LYS A 1 347 ? 6.425   34.759  68.993 1.00 48.62  ? 501  LYS A CD  1 
ATOM   2744 C  CE  . LYS A 1 347 ? 5.682   35.000  70.302 1.00 54.59  ? 501  LYS A CE  1 
ATOM   2745 N  NZ  . LYS A 1 347 ? 5.354   36.438  70.540 1.00 60.98  ? 501  LYS A NZ  1 
ATOM   2746 N  N   . MET A 1 348 ? 6.246   31.191  65.591 1.00 26.41  ? 502  MET A N   1 
ATOM   2747 C  CA  . MET A 1 348 ? 7.187   31.040  64.481 1.00 29.66  ? 502  MET A CA  1 
ATOM   2748 C  C   . MET A 1 348 ? 8.317   32.056  64.635 1.00 28.54  ? 502  MET A C   1 
ATOM   2749 O  O   . MET A 1 348 ? 8.075   33.147  65.109 1.00 30.55  ? 502  MET A O   1 
ATOM   2750 C  CB  . MET A 1 348 ? 6.471   31.266  63.160 1.00 28.80  ? 502  MET A CB  1 
ATOM   2751 C  CG  . MET A 1 348 ? 5.404   30.247  62.863 1.00 31.86  ? 502  MET A CG  1 
ATOM   2752 S  SD  . MET A 1 348 ? 6.092   28.617  62.864 1.00 36.14  ? 502  MET A SD  1 
ATOM   2753 C  CE  . MET A 1 348 ? 6.814   28.518  61.212 1.00 37.73  ? 502  MET A CE  1 
ATOM   2754 N  N   . VAL A 1 349 ? 9.518   31.664  64.223 1.00 29.87  ? 503  VAL A N   1 
ATOM   2755 C  CA  . VAL A 1 349 ? 10.676  32.588  64.177 1.00 30.69  ? 503  VAL A CA  1 
ATOM   2756 C  C   . VAL A 1 349 ? 10.401  33.582  63.047 1.00 32.43  ? 503  VAL A C   1 
ATOM   2757 O  O   . VAL A 1 349 ? 10.479  34.795  63.243 1.00 34.08  ? 503  VAL A O   1 
ATOM   2758 C  CB  . VAL A 1 349 ? 11.994  31.798  64.036 1.00 31.93  ? 503  VAL A CB  1 
ATOM   2759 C  CG1 . VAL A 1 349 ? 13.201  32.707  63.743 1.00 34.39  ? 503  VAL A CG1 1 
ATOM   2760 C  CG2 . VAL A 1 349 ? 12.254  30.983  65.321 1.00 28.92  ? 503  VAL A CG2 1 
ATOM   2761 N  N   . ASP A 1 350 ? 10.051  33.044  61.886 1.00 30.51  ? 504  ASP A N   1 
ATOM   2762 C  CA  . ASP A 1 350 ? 9.547   33.808  60.765 1.00 34.13  ? 504  ASP A CA  1 
ATOM   2763 C  C   . ASP A 1 350 ? 8.696   32.844  59.950 1.00 33.11  ? 504  ASP A C   1 
ATOM   2764 O  O   . ASP A 1 350 ? 8.474   31.694  60.374 1.00 33.25  ? 504  ASP A O   1 
ATOM   2765 C  CB  . ASP A 1 350 ? 10.722  34.397  59.928 1.00 33.93  ? 504  ASP A CB  1 
ATOM   2766 C  CG  . ASP A 1 350 ? 11.693  33.332  59.407 1.00 35.85  ? 504  ASP A CG  1 
ATOM   2767 O  OD1 . ASP A 1 350 ? 11.303  32.317  58.792 1.00 37.45  ? 504  ASP A OD1 1 
ATOM   2768 O  OD2 . ASP A 1 350 ? 12.905  33.508  59.598 1.00 41.04  ? 504  ASP A OD2 1 
ATOM   2769 N  N   . ASP A 1 351 ? 8.251   33.269  58.775 1.00 32.80  ? 505  ASP A N   1 
ATOM   2770 C  CA  . ASP A 1 351 ? 7.403   32.449  57.902 1.00 32.46  ? 505  ASP A CA  1 
ATOM   2771 C  C   . ASP A 1 351 ? 8.008   31.165  57.370 1.00 34.30  ? 505  ASP A C   1 
ATOM   2772 O  O   . ASP A 1 351 ? 7.258   30.278  56.943 1.00 34.15  ? 505  ASP A O   1 
ATOM   2773 C  CB  . ASP A 1 351 ? 6.870   33.258  56.705 1.00 33.81  ? 505  ASP A CB  1 
ATOM   2774 C  CG  . ASP A 1 351 ? 5.858   34.311  57.089 1.00 35.83  ? 505  ASP A CG  1 
ATOM   2775 O  OD1 . ASP A 1 351 ? 5.561   34.511  58.276 1.00 38.52  ? 505  ASP A OD1 1 
ATOM   2776 O  OD2 . ASP A 1 351 ? 5.322   34.972  56.171 1.00 42.04  ? 505  ASP A OD2 1 
ATOM   2777 N  N   . GLN A 1 352 ? 9.338   31.039  57.394 1.00 30.90  ? 506  GLN A N   1 
ATOM   2778 C  CA  . GLN A 1 352 ? 9.995   29.836  56.917 1.00 33.05  ? 506  GLN A CA  1 
ATOM   2779 C  C   . GLN A 1 352 ? 10.560  29.014  58.045 1.00 28.81  ? 506  GLN A C   1 
ATOM   2780 O  O   . GLN A 1 352 ? 11.125  27.968  57.790 1.00 32.23  ? 506  GLN A O   1 
ATOM   2781 C  CB  . GLN A 1 352 ? 11.107  30.206  55.916 1.00 38.43  ? 506  GLN A CB  1 
ATOM   2782 C  CG  . GLN A 1 352 ? 10.555  30.838  54.642 1.00 42.01  ? 506  GLN A CG  1 
ATOM   2783 C  CD  . GLN A 1 352 ? 9.720   29.839  53.828 1.00 49.74  ? 506  GLN A CD  1 
ATOM   2784 O  OE1 . GLN A 1 352 ? 10.211  28.767  53.462 1.00 49.71  ? 506  GLN A OE1 1 
ATOM   2785 N  NE2 . GLN A 1 352 ? 8.441   30.172  53.576 1.00 52.65  ? 506  GLN A NE2 1 
ATOM   2786 N  N   . THR A 1 353 ? 10.417  29.463  59.291 1.00 29.22  ? 507  THR A N   1 
ATOM   2787 C  CA  . THR A 1 353 ? 11.204  28.858  60.382 1.00 30.42  ? 507  THR A CA  1 
ATOM   2788 C  C   . THR A 1 353 ? 10.403  28.536  61.640 1.00 29.39  ? 507  THR A C   1 
ATOM   2789 O  O   . THR A 1 353 ? 10.067  29.431  62.411 1.00 27.46  ? 507  THR A O   1 
ATOM   2790 C  CB  . THR A 1 353 ? 12.349  29.818  60.765 1.00 34.56  ? 507  THR A CB  1 
ATOM   2791 O  OG1 . THR A 1 353 ? 12.989  30.261  59.559 1.00 36.49  ? 507  THR A OG1 1 
ATOM   2792 C  CG2 . THR A 1 353 ? 13.372  29.140  61.695 1.00 37.35  ? 507  THR A CG2 1 
ATOM   2793 N  N   . LEU A 1 354 ? 10.162  27.245  61.869 1.00 29.01  ? 508  LEU A N   1 
ATOM   2794 C  CA  . LEU A 1 354 ? 9.682   26.790  63.174 1.00 27.20  ? 508  LEU A CA  1 
ATOM   2795 C  C   . LEU A 1 354 ? 10.661  27.080  64.303 1.00 27.30  ? 508  LEU A C   1 
ATOM   2796 O  O   . LEU A 1 354 ? 11.875  26.999  64.120 1.00 30.26  ? 508  LEU A O   1 
ATOM   2797 C  CB  . LEU A 1 354 ? 9.402   25.279  63.140 1.00 28.09  ? 508  LEU A CB  1 
ATOM   2798 C  CG  . LEU A 1 354 ? 8.187   24.857  62.295 1.00 29.52  ? 508  LEU A CG  1 
ATOM   2799 C  CD1 . LEU A 1 354 ? 8.226   23.385  61.906 1.00 33.86  ? 508  LEU A CD1 1 
ATOM   2800 C  CD2 . LEU A 1 354 ? 6.891   25.185  63.025 1.00 31.38  ? 508  LEU A CD2 1 
ATOM   2801 N  N   . PRO A 1 355 ? 10.152  27.366  65.507 1.00 27.40  ? 509  PRO A N   1 
ATOM   2802 C  CA  . PRO A 1 355 ? 11.062  27.571  66.612 1.00 27.87  ? 509  PRO A CA  1 
ATOM   2803 C  C   . PRO A 1 355 ? 11.602  26.245  67.117 1.00 30.40  ? 509  PRO A C   1 
ATOM   2804 O  O   . PRO A 1 355 ? 11.020  25.180  66.837 1.00 28.27  ? 509  PRO A O   1 
ATOM   2805 C  CB  . PRO A 1 355 ? 10.183  28.209  67.669 1.00 28.81  ? 509  PRO A CB  1 
ATOM   2806 C  CG  . PRO A 1 355 ? 8.843   27.559  67.437 1.00 27.76  ? 509  PRO A CG  1 
ATOM   2807 C  CD  . PRO A 1 355 ? 8.739   27.373  65.950 1.00 27.25  ? 509  PRO A CD  1 
ATOM   2808 N  N   . PRO A 1 356 ? 12.723  26.294  67.862 1.00 32.49  ? 510  PRO A N   1 
ATOM   2809 C  CA  . PRO A 1 356 ? 13.155  25.099  68.551 1.00 31.76  ? 510  PRO A CA  1 
ATOM   2810 C  C   . PRO A 1 356 ? 12.137  24.770  69.679 1.00 27.53  ? 510  PRO A C   1 
ATOM   2811 O  O   . PRO A 1 356 ? 11.448  25.660  70.160 1.00 28.55  ? 510  PRO A O   1 
ATOM   2812 C  CB  . PRO A 1 356 ? 14.522  25.484  69.117 1.00 34.46  ? 510  PRO A CB  1 
ATOM   2813 C  CG  . PRO A 1 356 ? 14.512  26.960  69.255 1.00 35.56  ? 510  PRO A CG  1 
ATOM   2814 C  CD  . PRO A 1 356 ? 13.429  27.501  68.342 1.00 35.38  ? 510  PRO A CD  1 
ATOM   2815 N  N   . LEU A 1 357 ? 12.026  23.498  70.009 1.00 27.35  ? 511  LEU A N   1 
ATOM   2816 C  CA  . LEU A 1 357 ? 11.125  23.020  71.059 1.00 28.04  ? 511  LEU A CA  1 
ATOM   2817 C  C   . LEU A 1 357 ? 11.972  22.691  72.261 1.00 26.06  ? 511  LEU A C   1 
ATOM   2818 O  O   . LEU A 1 357 ? 12.574  21.638  72.343 1.00 29.29  ? 511  LEU A O   1 
ATOM   2819 C  CB  . LEU A 1 357 ? 10.352  21.788  70.572 1.00 27.59  ? 511  LEU A CB  1 
ATOM   2820 C  CG  . LEU A 1 357 ? 9.484   22.093  69.342 1.00 26.84  ? 511  LEU A CG  1 
ATOM   2821 C  CD1 . LEU A 1 357 ? 8.845   20.823  68.832 1.00 28.81  ? 511  LEU A CD1 1 
ATOM   2822 C  CD2 . LEU A 1 357 ? 8.438   23.158  69.610 1.00 27.53  ? 511  LEU A CD2 1 
ATOM   2823 N  N   . MET A 1 358 ? 12.076  23.644  73.164 1.00 26.80  ? 512  MET A N   1 
ATOM   2824 C  CA  . MET A 1 358 ? 13.097  23.541  74.178 1.00 28.62  ? 512  MET A CA  1 
ATOM   2825 C  C   . MET A 1 358 ? 12.561  22.787  75.383 1.00 27.17  ? 512  MET A C   1 
ATOM   2826 O  O   . MET A 1 358 ? 11.578  23.183  76.014 1.00 25.70  ? 512  MET A O   1 
ATOM   2827 C  CB  . MET A 1 358 ? 13.623  24.919  74.551 1.00 31.86  ? 512  MET A CB  1 
ATOM   2828 C  CG  . MET A 1 358 ? 14.352  25.646  73.402 1.00 40.47  ? 512  MET A CG  1 
ATOM   2829 S  SD  . MET A 1 358 ? 16.078  25.248  73.022 0.22 43.11  ? 512  MET A SD  1 
ATOM   2830 C  CE  . MET A 1 358 ? 16.019  23.742  72.039 1.00 43.39  ? 512  MET A CE  1 
ATOM   2831 N  N   . GLU A 1 359 ? 13.221  21.690  75.666 1.00 25.79  ? 513  GLU A N   1 
ATOM   2832 C  CA  . GLU A 1 359 ? 12.943  20.889  76.875 1.00 25.50  ? 513  GLU A CA  1 
ATOM   2833 C  C   . GLU A 1 359 ? 13.297  21.601  78.180 1.00 26.35  ? 513  GLU A C   1 
ATOM   2834 O  O   . GLU A 1 359 ? 14.060  22.569  78.184 1.00 25.90  ? 513  GLU A O   1 
ATOM   2835 C  CB  . GLU A 1 359 ? 13.700  19.592  76.807 1.00 27.32  ? 513  GLU A CB  1 
ATOM   2836 C  CG  . GLU A 1 359 ? 15.180  19.607  77.127 1.00 29.88  ? 513  GLU A CG  1 
ATOM   2837 C  CD  . GLU A 1 359 ? 16.049  20.351  76.122 1.00 35.61  ? 513  GLU A CD  1 
ATOM   2838 O  OE1 . GLU A 1 359 ? 15.653  20.589  74.951 1.00 35.80  ? 513  GLU A OE1 1 
ATOM   2839 O  OE2 . GLU A 1 359 ? 17.154  20.703  76.548 1.00 38.12  ? 513  GLU A OE2 1 
ATOM   2840 N  N   . LYS A 1 360 ? 12.772  21.083  79.274 1.00 26.00  ? 514  LYS A N   1 
ATOM   2841 C  CA  . LYS A 1 360 ? 13.155  21.452  80.622 1.00 25.67  ? 514  LYS A CA  1 
ATOM   2842 C  C   . LYS A 1 360 ? 13.720  20.199  81.298 1.00 26.62  ? 514  LYS A C   1 
ATOM   2843 O  O   . LYS A 1 360 ? 12.966  19.276  81.655 1.00 25.45  ? 514  LYS A O   1 
ATOM   2844 C  CB  . LYS A 1 360 ? 11.953  22.025  81.388 1.00 31.03  ? 514  LYS A CB  1 
ATOM   2845 C  CG  . LYS A 1 360 ? 12.268  22.449  82.831 1.00 35.86  ? 514  LYS A CG  1 
ATOM   2846 C  CD  . LYS A 1 360 ? 11.108  23.249  83.423 1.00 41.74  ? 514  LYS A CD  1 
ATOM   2847 C  CE  . LYS A 1 360 ? 11.338  23.571  84.894 1.00 49.42  ? 514  LYS A CE  1 
ATOM   2848 N  NZ  . LYS A 1 360 ? 12.336  24.650  85.077 1.00 56.30  ? 514  LYS A NZ  1 
ATOM   2849 N  N   . PRO A 1 361 ? 15.055  20.142  81.505 1.00 28.43  ? 515  PRO A N   1 
ATOM   2850 C  CA  . PRO A 1 361 ? 15.611  18.986  82.207 1.00 29.02  ? 515  PRO A CA  1 
ATOM   2851 C  C   . PRO A 1 361 ? 15.237  19.017  83.661 1.00 29.16  ? 515  PRO A C   1 
ATOM   2852 O  O   . PRO A 1 361 ? 15.341  20.054  84.317 1.00 28.32  ? 515  PRO A O   1 
ATOM   2853 C  CB  . PRO A 1 361 ? 17.146  19.107  81.968 1.00 29.51  ? 515  PRO A CB  1 
ATOM   2854 C  CG  . PRO A 1 361 ? 17.290  20.081  80.853 1.00 31.39  ? 515  PRO A CG  1 
ATOM   2855 C  CD  . PRO A 1 361 ? 16.129  21.049  81.057 1.00 29.92  ? 515  PRO A CD  1 
ATOM   2856 N  N   . LEU A 1 362 ? 14.711  17.907  84.162 1.00 26.48  ? 516  LEU A N   1 
ATOM   2857 C  CA  . LEU A 1 362 ? 14.344  17.828  85.569 1.00 27.14  ? 516  LEU A CA  1 
ATOM   2858 C  C   . LEU A 1 362 ? 15.462  17.241  86.402 1.00 29.36  ? 516  LEU A C   1 
ATOM   2859 O  O   . LEU A 1 362 ? 16.354  16.588  85.871 1.00 28.52  ? 516  LEU A O   1 
ATOM   2860 C  CB  . LEU A 1 362 ? 13.129  16.953  85.725 1.00 25.84  ? 516  LEU A CB  1 
ATOM   2861 C  CG  . LEU A 1 362 ? 11.919  17.361  84.890 1.00 24.62  ? 516  LEU A CG  1 
ATOM   2862 C  CD1 . LEU A 1 362 ? 10.807  16.356  85.224 1.00 24.76  ? 516  LEU A CD1 1 
ATOM   2863 C  CD2 . LEU A 1 362 ? 11.493  18.782  85.174 1.00 24.80  ? 516  LEU A CD2 1 
ATOM   2864 N  N   . ARG A 1 363 ? 15.375  17.449  87.716 1.00 31.83  ? 517  ARG A N   1 
ATOM   2865 C  CA  . ARG A 1 363 ? 16.362  16.918  88.634 1.00 38.07  ? 517  ARG A CA  1 
ATOM   2866 C  C   . ARG A 1 363 ? 16.144  15.407  88.643 1.00 36.00  ? 517  ARG A C   1 
ATOM   2867 O  O   . ARG A 1 363 ? 15.008  14.969  88.902 1.00 37.32  ? 517  ARG A O   1 
ATOM   2868 C  CB  . ARG A 1 363 ? 16.163  17.500  90.051 1.00 41.77  ? 517  ARG A CB  1 
ATOM   2869 C  CG  . ARG A 1 363 ? 17.086  16.916  91.130 1.00 49.47  ? 517  ARG A CG  1 
ATOM   2870 C  CD  . ARG A 1 363 ? 16.893  17.549  92.528 1.00 52.74  ? 517  ARG A CD  1 
ATOM   2871 N  NE  . ARG A 1 363 ? 15.495  17.542  93.004 1.00 53.20  ? 517  ARG A NE  1 
ATOM   2872 C  CZ  . ARG A 1 363 ? 14.826  16.480  93.464 1.00 57.33  ? 517  ARG A CZ  1 
ATOM   2873 N  NH1 . ARG A 1 363 ? 15.400  15.273  93.539 1.00 61.23  ? 517  ARG A NH1 1 
ATOM   2874 N  NH2 . ARG A 1 363 ? 13.554  16.622  93.852 1.00 58.21  ? 517  ARG A NH2 1 
ATOM   2875 N  N   . PRO A 1 364 ? 17.193  14.604  88.349 1.00 36.90  ? 518  PRO A N   1 
ATOM   2876 C  CA  . PRO A 1 364 ? 17.022  13.145  88.416 1.00 36.49  ? 518  PRO A CA  1 
ATOM   2877 C  C   . PRO A 1 364 ? 16.480  12.707  89.763 1.00 37.66  ? 518  PRO A C   1 
ATOM   2878 O  O   . PRO A 1 364 ? 16.836  13.294  90.792 1.00 36.46  ? 518  PRO A O   1 
ATOM   2879 C  CB  . PRO A 1 364 ? 18.423  12.614  88.182 1.00 38.02  ? 518  PRO A CB  1 
ATOM   2880 C  CG  . PRO A 1 364 ? 19.059  13.661  87.336 1.00 39.43  ? 518  PRO A CG  1 
ATOM   2881 C  CD  . PRO A 1 364 ? 18.553  14.956  87.884 1.00 38.30  ? 518  PRO A CD  1 
ATOM   2882 N  N   . GLY A 1 365 ? 15.551  11.757  89.738 1.00 36.20  ? 519  GLY A N   1 
ATOM   2883 C  CA  . GLY A 1 365 ? 14.835  11.337  90.945 1.00 36.45  ? 519  GLY A CA  1 
ATOM   2884 C  C   . GLY A 1 365 ? 13.599  12.141  91.279 1.00 33.74  ? 519  GLY A C   1 
ATOM   2885 O  O   . GLY A 1 365 ? 12.814  11.705  92.097 1.00 33.34  ? 519  GLY A O   1 
ATOM   2886 N  N   . SER A 1 366 ? 13.383  13.300  90.652 1.00 31.84  ? 520  SER A N   1 
ATOM   2887 C  CA  . SER A 1 366 ? 12.216  14.086  91.016 1.00 32.81  ? 520  SER A CA  1 
ATOM   2888 C  C   . SER A 1 366 ? 10.927  13.496  90.437 1.00 29.79  ? 520  SER A C   1 
ATOM   2889 O  O   . SER A 1 366 ? 10.942  12.778  89.434 1.00 30.38  ? 520  SER A O   1 
ATOM   2890 C  CB  . SER A 1 366 ? 12.363  15.544  90.597 1.00 34.98  ? 520  SER A CB  1 
ATOM   2891 O  OG  . SER A 1 366 ? 12.433  15.642  89.208 1.00 33.41  ? 520  SER A OG  1 
ATOM   2892 N  N   . SER A 1 367 ? 9.827   13.812  91.099 1.00 30.29  ? 521  SER A N   1 
ATOM   2893 C  CA  . SER A 1 367 ? 8.511   13.461  90.626 1.00 27.24  ? 521  SER A CA  1 
ATOM   2894 C  C   . SER A 1 367 ? 8.184   14.420  89.474 1.00 27.49  ? 521  SER A C   1 
ATOM   2895 O  O   . SER A 1 367 ? 8.773   15.499  89.332 1.00 28.62  ? 521  SER A O   1 
ATOM   2896 C  CB  . SER A 1 367 ? 7.504   13.483  91.770 1.00 31.25  ? 521  SER A CB  1 
ATOM   2897 O  OG  . SER A 1 367 ? 7.274   14.784  92.272 1.00 37.10  ? 521  SER A OG  1 
ATOM   2898 N  N   . LEU A 1 368 ? 7.331   13.954  88.580 1.00 23.17  ? 522  LEU A N   1 
ATOM   2899 C  CA  . LEU A 1 368 ? 6.988   14.688  87.374 1.00 23.74  ? 522  LEU A CA  1 
ATOM   2900 C  C   . LEU A 1 368 ? 5.750   15.484  87.694 1.00 23.15  ? 522  LEU A C   1 
ATOM   2901 O  O   . LEU A 1 368 ? 4.678   14.900  87.874 1.00 25.31  ? 522  LEU A O   1 
ATOM   2902 C  CB  . LEU A 1 368 ? 6.694   13.713  86.274 1.00 23.81  ? 522  LEU A CB  1 
ATOM   2903 C  CG  . LEU A 1 368 ? 7.878   13.107  85.524 1.00 27.93  ? 522  LEU A CG  1 
ATOM   2904 C  CD1 . LEU A 1 368 ? 9.155   12.935  86.292 1.00 28.98  ? 522  LEU A CD1 1 
ATOM   2905 C  CD2 . LEU A 1 368 ? 7.405   11.836  84.812 1.00 26.76  ? 522  LEU A CD2 1 
ATOM   2906 N  N   . GLY A 1 369 ? 5.898   16.801  87.790 1.00 22.38  ? 523  GLY A N   1 
ATOM   2907 C  CA  . GLY A 1 369 ? 4.777   17.715  88.029 1.00 20.70  ? 523  GLY A CA  1 
ATOM   2908 C  C   . GLY A 1 369 ? 3.870   17.991  86.828 1.00 20.22  ? 523  GLY A C   1 
ATOM   2909 O  O   . GLY A 1 369 ? 4.344   18.352  85.768 1.00 21.79  ? 523  GLY A O   1 
ATOM   2910 N  N   . LEU A 1 370 ? 2.563   17.808  87.020 1.00 18.40  ? 524  LEU A N   1 
ATOM   2911 C  CA  . LEU A 1 370 ? 1.602   17.982  85.951 1.00 19.73  ? 524  LEU A CA  1 
ATOM   2912 C  C   . LEU A 1 370 ? 0.515   18.883  86.531 1.00 19.72  ? 524  LEU A C   1 
ATOM   2913 O  O   . LEU A 1 370 ? -0.395  18.432  87.220 1.00 19.03  ? 524  LEU A O   1 
ATOM   2914 C  CB  . LEU A 1 370 ? 1.058   16.630  85.490 1.00 21.73  ? 524  LEU A CB  1 
ATOM   2915 C  CG  . LEU A 1 370 ? 0.258   16.632  84.192 1.00 23.31  ? 524  LEU A CG  1 
ATOM   2916 C  CD1 . LEU A 1 370 ? 1.013   17.218  83.022 1.00 23.83  ? 524  LEU A CD1 1 
ATOM   2917 C  CD2 . LEU A 1 370 ? -0.181  15.205  83.877 1.00 23.88  ? 524  LEU A CD2 1 
ATOM   2918 N  N   . PRO A 1 371 ? 0.581   20.182  86.243 1.00 18.26  ? 525  PRO A N   1 
ATOM   2919 C  CA  . PRO A 1 371 ? -0.470  21.092  86.740 1.00 17.45  ? 525  PRO A CA  1 
ATOM   2920 C  C   . PRO A 1 371 ? -1.910  20.728  86.369 1.00 16.90  ? 525  PRO A C   1 
ATOM   2921 O  O   . PRO A 1 371 ? -2.170  19.977  85.417 1.00 17.19  ? 525  PRO A O   1 
ATOM   2922 C  CB  . PRO A 1 371 ? -0.074  22.443  86.130 1.00 18.49  ? 525  PRO A CB  1 
ATOM   2923 C  CG  . PRO A 1 371 ? 1.376   22.312  85.952 1.00 19.36  ? 525  PRO A CG  1 
ATOM   2924 C  CD  . PRO A 1 371 ? 1.654   20.911  85.547 1.00 19.21  ? 525  PRO A CD  1 
ATOM   2925 N  N   . ALA A 1 372 ? -2.843  21.275  87.111 1.00 17.97  ? 526  ALA A N   1 
ATOM   2926 C  CA  . ALA A 1 372 ? -4.235  21.155  86.765 1.00 18.74  ? 526  ALA A CA  1 
ATOM   2927 C  C   . ALA A 1 372 ? -4.488  21.527  85.302 1.00 18.42  ? 526  ALA A C   1 
ATOM   2928 O  O   . ALA A 1 372 ? -3.919  22.497  84.786 1.00 19.78  ? 526  ALA A O   1 
ATOM   2929 C  CB  . ALA A 1 372 ? -5.065  22.022  87.634 1.00 20.44  ? 526  ALA A CB  1 
ATOM   2930 N  N   . PHE A 1 373 ? -5.412  20.791  84.681 1.00 17.19  ? 527  PHE A N   1 
ATOM   2931 C  CA  . PHE A 1 373 ? -5.837  21.073  83.310 1.00 16.20  ? 527  PHE A CA  1 
ATOM   2932 C  C   . PHE A 1 373 ? -4.652  21.351  82.396 1.00 16.92  ? 527  PHE A C   1 
ATOM   2933 O  O   . PHE A 1 373 ? -4.555  22.415  81.715 1.00 18.25  ? 527  PHE A O   1 
ATOM   2934 C  CB  . PHE A 1 373 ? -6.828  22.230  83.333 1.00 18.64  ? 527  PHE A CB  1 
ATOM   2935 C  CG  . PHE A 1 373 ? -8.047  21.946  84.141 1.00 20.92  ? 527  PHE A CG  1 
ATOM   2936 C  CD1 . PHE A 1 373 ? -8.927  20.934  83.748 1.00 23.60  ? 527  PHE A CD1 1 
ATOM   2937 C  CD2 . PHE A 1 373 ? -8.298  22.657  85.315 1.00 22.80  ? 527  PHE A CD2 1 
ATOM   2938 C  CE1 . PHE A 1 373 ? -10.036 20.649  84.502 1.00 25.29  ? 527  PHE A CE1 1 
ATOM   2939 C  CE2 . PHE A 1 373 ? -9.429  22.399  86.052 1.00 25.77  ? 527  PHE A CE2 1 
ATOM   2940 C  CZ  . PHE A 1 373 ? -10.274 21.384  85.670 1.00 25.90  ? 527  PHE A CZ  1 
ATOM   2941 N  N   . SER A 1 374 ? -3.734  20.386  82.344 1.00 15.96  ? 528  SER A N   1 
ATOM   2942 C  CA  . SER A 1 374 ? -2.549  20.520  81.498 1.00 18.25  ? 528  SER A CA  1 
ATOM   2943 C  C   . SER A 1 374 ? -2.210  19.168  80.860 1.00 17.48  ? 528  SER A C   1 
ATOM   2944 O  O   . SER A 1 374 ? -2.797  18.143  81.226 1.00 17.31  ? 528  SER A O   1 
ATOM   2945 C  CB  . SER A 1 374 ? -1.346  21.112  82.245 1.00 17.94  ? 528  SER A CB  1 
ATOM   2946 O  OG  . SER A 1 374 ? -0.710  20.176  83.032 1.00 18.69  ? 528  SER A OG  1 
ATOM   2947 N  N   . TYR A 1 375 ? -1.295  19.196  79.911 1.00 16.05  ? 529  TYR A N   1 
ATOM   2948 C  CA  . TYR A 1 375 ? -0.735  17.991  79.296 1.00 15.78  ? 529  TYR A CA  1 
ATOM   2949 C  C   . TYR A 1 375 ? 0.736   18.204  79.048 1.00 16.55  ? 529  TYR A C   1 
ATOM   2950 O  O   . TYR A 1 375 ? 1.193   19.351  78.819 1.00 16.30  ? 529  TYR A O   1 
ATOM   2951 C  CB  . TYR A 1 375 ? -1.473  17.555  78.038 1.00 16.35  ? 529  TYR A CB  1 
ATOM   2952 C  CG  . TYR A 1 375 ? -2.056  18.668  77.193 1.00 15.91  ? 529  TYR A CG  1 
ATOM   2953 C  CD1 . TYR A 1 375 ? -1.320  19.284  76.250 1.00 16.09  ? 529  TYR A CD1 1 
ATOM   2954 C  CD2 . TYR A 1 375 ? -3.359  19.139  77.409 1.00 16.83  ? 529  TYR A CD2 1 
ATOM   2955 C  CE1 . TYR A 1 375 ? -1.849  20.289  75.454 1.00 16.59  ? 529  TYR A CE1 1 
ATOM   2956 C  CE2 . TYR A 1 375 ? -3.903  20.144  76.653 1.00 17.28  ? 529  TYR A CE2 1 
ATOM   2957 C  CZ  . TYR A 1 375 ? -3.145  20.737  75.661 1.00 16.65  ? 529  TYR A CZ  1 
ATOM   2958 O  OH  . TYR A 1 375 ? -3.672  21.748  74.890 1.00 18.10  ? 529  TYR A OH  1 
ATOM   2959 N  N   . SER A 1 376 ? 1.459   17.106  79.106 1.00 18.01  ? 530  SER A N   1 
ATOM   2960 C  CA  . SER A 1 376 ? 2.910   17.160  79.032 1.00 16.96  ? 530  SER A CA  1 
ATOM   2961 C  C   . SER A 1 376 ? 3.490   15.901  78.414 1.00 17.29  ? 530  SER A C   1 
ATOM   2962 O  O   . SER A 1 376 ? 2.963   14.818  78.613 1.00 16.52  ? 530  SER A O   1 
ATOM   2963 C  CB  . SER A 1 376 ? 3.516   17.418  80.412 1.00 18.15  ? 530  SER A CB  1 
ATOM   2964 O  OG  . SER A 1 376 ? 4.933   17.629  80.317 1.00 19.17  ? 530  SER A OG  1 
ATOM   2965 N  N   . PHE A 1 377 ? 4.655   16.050  77.788 1.00 16.59  ? 531  PHE A N   1 
ATOM   2966 C  CA  . PHE A 1 377 ? 5.450   14.899  77.364 1.00 18.01  ? 531  PHE A CA  1 
ATOM   2967 C  C   . PHE A 1 377 ? 6.651   14.874  78.305 1.00 18.39  ? 531  PHE A C   1 
ATOM   2968 O  O   . PHE A 1 377 ? 7.063   15.936  78.814 1.00 18.82  ? 531  PHE A O   1 
ATOM   2969 C  CB  . PHE A 1 377 ? 5.943   15.005  75.939 1.00 17.82  ? 531  PHE A CB  1 
ATOM   2970 C  CG  . PHE A 1 377 ? 4.872   15.147  74.911 1.00 17.15  ? 531  PHE A CG  1 
ATOM   2971 C  CD1 . PHE A 1 377 ? 4.305   16.404  74.660 1.00 17.74  ? 531  PHE A CD1 1 
ATOM   2972 C  CD2 . PHE A 1 377 ? 4.485   14.084  74.152 1.00 15.94  ? 531  PHE A CD2 1 
ATOM   2973 C  CE1 . PHE A 1 377 ? 3.275   16.564  73.715 1.00 17.81  ? 531  PHE A CE1 1 
ATOM   2974 C  CE2 . PHE A 1 377 ? 3.460   14.255  73.192 1.00 16.39  ? 531  PHE A CE2 1 
ATOM   2975 C  CZ  . PHE A 1 377 ? 2.868   15.465  72.993 1.00 17.10  ? 531  PHE A CZ  1 
ATOM   2976 N  N   . PHE A 1 378 ? 7.190   13.679  78.549 1.00 17.19  ? 532  PHE A N   1 
ATOM   2977 C  CA  . PHE A 1 378 ? 8.366   13.476  79.394 1.00 17.55  ? 532  PHE A CA  1 
ATOM   2978 C  C   . PHE A 1 378 ? 9.222   12.439  78.652 1.00 19.37  ? 532  PHE A C   1 
ATOM   2979 O  O   . PHE A 1 378 ? 8.738   11.344  78.378 1.00 18.59  ? 532  PHE A O   1 
ATOM   2980 C  CB  . PHE A 1 378 ? 8.029   13.005  80.789 1.00 18.51  ? 532  PHE A CB  1 
ATOM   2981 C  CG  . PHE A 1 378 ? 7.097   13.918  81.565 1.00 18.83  ? 532  PHE A CG  1 
ATOM   2982 C  CD1 . PHE A 1 378 ? 5.706   13.806  81.454 1.00 18.81  ? 532  PHE A CD1 1 
ATOM   2983 C  CD2 . PHE A 1 378 ? 7.578   14.881  82.406 1.00 19.10  ? 532  PHE A CD2 1 
ATOM   2984 C  CE1 . PHE A 1 378 ? 4.881   14.605  82.198 1.00 18.33  ? 532  PHE A CE1 1 
ATOM   2985 C  CE2 . PHE A 1 378 ? 6.730   15.704  83.154 1.00 19.09  ? 532  PHE A CE2 1 
ATOM   2986 C  CZ  . PHE A 1 378 ? 5.382   15.546  83.066 1.00 19.89  ? 532  PHE A CZ  1 
ATOM   2987 N  N   . VAL A 1 379 ? 10.464  12.792  78.276 1.00 18.60  ? 533  VAL A N   1 
ATOM   2988 C  CA  . VAL A 1 379 ? 11.369  11.870  77.650 1.00 19.12  ? 533  VAL A CA  1 
ATOM   2989 C  C   . VAL A 1 379 ? 12.330  11.366  78.716 1.00 21.14  ? 533  VAL A C   1 
ATOM   2990 O  O   . VAL A 1 379 ? 12.976  12.158  79.397 1.00 19.90  ? 533  VAL A O   1 
ATOM   2991 C  CB  . VAL A 1 379 ? 12.148  12.469  76.476 1.00 20.20  ? 533  VAL A CB  1 
ATOM   2992 C  CG1 . VAL A 1 379 ? 13.140  11.444  75.917 1.00 21.22  ? 533  VAL A CG1 1 
ATOM   2993 C  CG2 . VAL A 1 379 ? 11.180  12.908  75.409 1.00 20.46  ? 533  VAL A CG2 1 
ATOM   2994 N  N   . ILE A 1 380 ? 12.378  10.052  78.873 1.00 20.71  ? 534  ILE A N   1 
ATOM   2995 C  CA  . ILE A 1 380 ? 13.182  9.393   79.890 1.00 21.33  ? 534  ILE A CA  1 
ATOM   2996 C  C   . ILE A 1 380 ? 14.461  9.019   79.170 1.00 20.13  ? 534  ILE A C   1 
ATOM   2997 O  O   . ILE A 1 380 ? 14.489  8.086   78.303 1.00 20.08  ? 534  ILE A O   1 
ATOM   2998 C  CB  . ILE A 1 380 ? 12.471  8.151   80.487 1.00 22.36  ? 534  ILE A CB  1 
ATOM   2999 C  CG1 . ILE A 1 380 ? 11.098  8.572   81.021 1.00 23.76  ? 534  ILE A CG1 1 
ATOM   3000 C  CG2 . ILE A 1 380 ? 13.279  7.540   81.607 1.00 22.80  ? 534  ILE A CG2 1 
ATOM   3001 C  CD1 . ILE A 1 380 ? 10.187  7.436   81.393 1.00 24.29  ? 534  ILE A CD1 1 
ATOM   3002 N  N   . ARG A 1 381 ? 15.530  9.751   79.508 1.00 21.36  ? 535  ARG A N   1 
ATOM   3003 C  CA  . ARG A 1 381 ? 16.798  9.570   78.827 1.00 22.87  ? 535  ARG A CA  1 
ATOM   3004 C  C   . ARG A 1 381 ? 17.592  8.415   79.392 1.00 20.85  ? 535  ARG A C   1 
ATOM   3005 O  O   . ARG A 1 381 ? 17.556  8.105   80.586 1.00 23.66  ? 535  ARG A O   1 
ATOM   3006 C  CB  . ARG A 1 381 ? 17.627  10.867  78.906 1.00 24.00  ? 535  ARG A CB  1 
ATOM   3007 C  CG  . ARG A 1 381 ? 16.911  12.076  78.380 1.00 24.36  ? 535  ARG A CG  1 
ATOM   3008 C  CD  . ARG A 1 381 ? 17.895  13.225  78.175 1.00 26.83  ? 535  ARG A CD  1 
ATOM   3009 N  NE  . ARG A 1 381 ? 18.823  12.899  77.094 1.00 28.80  ? 535  ARG A NE  1 
ATOM   3010 C  CZ  . ARG A 1 381 ? 19.812  13.699  76.713 1.00 32.34  ? 535  ARG A CZ  1 
ATOM   3011 N  NH1 . ARG A 1 381 ? 19.974  14.860  77.328 1.00 32.67  ? 535  ARG A NH1 1 
ATOM   3012 N  NH2 . ARG A 1 381 ? 20.621  13.330  75.715 1.00 36.13  ? 535  ARG A NH2 1 
ATOM   3013 N  N   . ASN A 1 382 ? 18.304  7.756   78.500 1.00 23.23  ? 536  ASN A N   1 
ATOM   3014 C  CA  . ASN A 1 382 ? 19.080  6.548   78.842 1.00 25.94  ? 536  ASN A CA  1 
ATOM   3015 C  C   . ASN A 1 382 ? 18.243  5.466   79.499 1.00 25.49  ? 536  ASN A C   1 
ATOM   3016 O  O   . ASN A 1 382 ? 18.648  4.805   80.432 1.00 26.28  ? 536  ASN A O   1 
ATOM   3017 C  CB  . ASN A 1 382 ? 20.291  6.904   79.715 1.00 30.01  ? 536  ASN A CB  1 
ATOM   3018 C  CG  . ASN A 1 382 ? 21.364  5.828   79.667 1.00 31.49  ? 536  ASN A CG  1 
ATOM   3019 O  OD1 . ASN A 1 382 ? 21.722  5.336   78.599 1.00 31.32  ? 536  ASN A OD1 1 
ATOM   3020 N  ND2 . ASN A 1 382 ? 21.832  5.421   80.821 1.00 35.71  ? 536  ASN A ND2 1 
ATOM   3021 N  N   . ALA A 1 383 ? 16.995  5.359   79.060 1.00 26.29  ? 537  ALA A N   1 
ATOM   3022 C  CA  . ALA A 1 383 ? 16.095  4.369   79.605 1.00 24.38  ? 537  ALA A CA  1 
ATOM   3023 C  C   . ALA A 1 383 ? 16.560  2.945   79.279 1.00 24.58  ? 537  ALA A C   1 
ATOM   3024 O  O   . ALA A 1 383 ? 16.267  2.000   80.038 1.00 24.84  ? 537  ALA A O   1 
ATOM   3025 C  CB  . ALA A 1 383 ? 14.679  4.611   79.080 1.00 24.59  ? 537  ALA A CB  1 
ATOM   3026 N  N   . LYS A 1 384 ? 17.264  2.803   78.166 1.00 24.23  ? 538  LYS A N   1 
ATOM   3027 C  CA  . LYS A 1 384 ? 17.824  1.529   77.723 1.00 28.02  ? 538  LYS A CA  1 
ATOM   3028 C  C   . LYS A 1 384 ? 16.790  0.403   77.658 1.00 26.25  ? 538  LYS A C   1 
ATOM   3029 O  O   . LYS A 1 384 ? 17.033  -0.735  78.096 1.00 24.71  ? 538  LYS A O   1 
ATOM   3030 C  CB  . LYS A 1 384 ? 19.002  1.091   78.629 1.00 32.41  ? 538  LYS A CB  1 
ATOM   3031 C  CG  . LYS A 1 384 ? 20.250  1.954   78.532 1.00 36.03  ? 538  LYS A CG  1 
ATOM   3032 C  CD  . LYS A 1 384 ? 21.432  1.183   79.141 1.00 43.71  ? 538  LYS A CD  1 
ATOM   3033 C  CE  . LYS A 1 384 ? 22.459  2.039   79.873 1.00 51.65  ? 538  LYS A CE  1 
ATOM   3034 N  NZ  . LYS A 1 384 ? 23.571  2.519   78.985 1.00 53.69  ? 538  LYS A NZ  1 
ATOM   3035 N  N   . VAL A 1 385 ? 15.630  0.729   77.088 1.00 23.07  ? 539  VAL A N   1 
ATOM   3036 C  CA  . VAL A 1 385 ? 14.573  -0.252  76.961 1.00 23.31  ? 539  VAL A CA  1 
ATOM   3037 C  C   . VAL A 1 385 ? 14.812  -1.081  75.703 1.00 21.30  ? 539  VAL A C   1 
ATOM   3038 O  O   . VAL A 1 385 ? 14.763  -0.569  74.594 1.00 22.83  ? 539  VAL A O   1 
ATOM   3039 C  CB  . VAL A 1 385 ? 13.187  0.421   76.916 1.00 21.60  ? 539  VAL A CB  1 
ATOM   3040 C  CG1 . VAL A 1 385 ? 12.125  -0.616  76.604 1.00 22.28  ? 539  VAL A CG1 1 
ATOM   3041 C  CG2 . VAL A 1 385 ? 12.920  1.109   78.260 1.00 23.54  ? 539  VAL A CG2 1 
ATOM   3042 N  N   . ALA A 1 386 ? 15.081  -2.365  75.904 1.00 24.30  ? 540  ALA A N   1 
ATOM   3043 C  CA  . ALA A 1 386 ? 15.376  -3.300  74.789 1.00 26.81  ? 540  ALA A CA  1 
ATOM   3044 C  C   . ALA A 1 386 ? 14.311  -3.304  73.747 1.00 25.22  ? 540  ALA A C   1 
ATOM   3045 O  O   . ALA A 1 386 ? 14.604  -3.311  72.575 1.00 26.57  ? 540  ALA A O   1 
ATOM   3046 C  CB  . ALA A 1 386 ? 15.611  -4.729  75.295 1.00 28.52  ? 540  ALA A CB  1 
ATOM   3047 N  N   . ALA A 1 387 ? 13.047  -3.187  74.165 1.00 25.19  ? 541  ALA A N   1 
ATOM   3048 C  CA  . ALA A 1 387 ? 11.964  -3.134  73.214 1.00 24.41  ? 541  ALA A CA  1 
ATOM   3049 C  C   . ALA A 1 387 ? 12.045  -1.958  72.253 1.00 25.35  ? 541  ALA A C   1 
ATOM   3050 O  O   . ALA A 1 387 ? 11.449  -1.997  71.194 1.00 26.19  ? 541  ALA A O   1 
ATOM   3051 C  CB  . ALA A 1 387 ? 10.604  -3.136  73.931 1.00 25.60  ? 541  ALA A CB  1 
ATOM   3052 N  N   . CYS A 1 388 ? 12.772  -0.919  72.633 1.00 24.91  ? 542  CYS A N   1 
ATOM   3053 C  CA  . CYS A 1 388 ? 12.869  0.309   71.863 1.00 27.28  ? 542  CYS A CA  1 
ATOM   3054 C  C   . CYS A 1 388 ? 14.192  0.428   71.095 1.00 33.05  ? 542  CYS A C   1 
ATOM   3055 O  O   . CYS A 1 388 ? 14.556  1.524   70.676 1.00 33.44  ? 542  CYS A O   1 
ATOM   3056 C  CB  . CYS A 1 388 ? 12.818  1.481   72.810 1.00 25.22  ? 542  CYS A CB  1 
ATOM   3057 S  SG  . CYS A 1 388 ? 11.256  1.633   73.697 1.00 23.26  ? 542  CYS A SG  1 
ATOM   3058 N  N   . ILE A 1 389 ? 14.955  -0.657  71.025 1.00 37.37  ? 543  ILE A N   1 
ATOM   3059 C  CA  . ILE A 1 389 ? 16.214  -0.660  70.286 1.00 39.35  ? 543  ILE A CA  1 
ATOM   3060 C  C   . ILE A 1 389 ? 15.964  -1.666  69.181 1.00 41.69  ? 543  ILE A C   1 
ATOM   3061 O  O   . ILE A 1 389 ? 15.674  -1.366  68.020 1.00 46.72  ? 543  ILE A O   1 
ATOM   3062 C  CB  . ILE A 1 389 ? 17.395  -1.064  71.194 1.00 41.49  ? 543  ILE A CB  1 
ATOM   3063 C  CG1 . ILE A 1 389 ? 17.578  -0.029  72.315 1.00 39.81  ? 543  ILE A CG1 1 
ATOM   3064 C  CG2 . ILE A 1 389 ? 18.676  -1.172  70.357 1.00 42.12  ? 543  ILE A CG2 1 
ATOM   3065 C  CD1 . ILE A 1 389 ? 18.217  -0.541  73.600 1.00 42.66  ? 543  ILE A CD1 1 
ATOM   3066 O  OXT . ILE A 1 389 ? 15.981  -2.848  69.461 1.00 40.07  ? 543  ILE A OXT 1 
ATOM   3067 N  N   . GLN B 2 4   ? -2.705  13.180  99.625 1.00 75.26  ? 36   GLN B N   1 
ATOM   3068 C  CA  . GLN B 2 4   ? -1.598  13.698  98.766 1.00 68.68  ? 36   GLN B CA  1 
ATOM   3069 C  C   . GLN B 2 4   ? -1.953  13.565  97.288 1.00 62.08  ? 36   GLN B C   1 
ATOM   3070 O  O   . GLN B 2 4   ? -2.904  12.869  96.909 1.00 63.83  ? 36   GLN B O   1 
ATOM   3071 C  CB  . GLN B 2 4   ? -0.260  12.992  99.062 1.00 72.41  ? 36   GLN B CB  1 
ATOM   3072 C  CG  . GLN B 2 4   ? -0.245  11.481  98.810 1.00 75.76  ? 36   GLN B CG  1 
ATOM   3073 C  CD  . GLN B 2 4   ? 1.151   10.867  98.845 1.00 79.59  ? 36   GLN B CD  1 
ATOM   3074 O  OE1 . GLN B 2 4   ? 1.362   9.762   98.334 1.00 73.94  ? 36   GLN B OE1 1 
ATOM   3075 N  NE2 . GLN B 2 4   ? 2.111   11.576  99.440 1.00 81.81  ? 36   GLN B NE2 1 
ATOM   3076 N  N   . ASP B 2 5   ? -1.161  14.237  96.470 1.00 46.42  ? 37   ASP B N   1 
ATOM   3077 C  CA  . ASP B 2 5   ? -1.390  14.320  95.022 1.00 40.41  ? 37   ASP B CA  1 
ATOM   3078 C  C   . ASP B 2 5   ? -0.251  13.640  94.278 1.00 36.03  ? 37   ASP B C   1 
ATOM   3079 O  O   . ASP B 2 5   ? 0.055   14.010  93.156 1.00 29.77  ? 37   ASP B O   1 
ATOM   3080 C  CB  . ASP B 2 5   ? -1.519  15.804  94.615 1.00 38.38  ? 37   ASP B CB  1 
ATOM   3081 C  CG  . ASP B 2 5   ? -2.769  16.450  95.195 1.00 39.37  ? 37   ASP B CG  1 
ATOM   3082 O  OD1 . ASP B 2 5   ? -3.886  15.927  94.995 1.00 31.52  ? 37   ASP B OD1 1 
ATOM   3083 O  OD2 . ASP B 2 5   ? -2.638  17.489  95.869 1.00 44.97  ? 37   ASP B OD2 1 
ATOM   3084 N  N   . VAL B 2 6   ? 0.367   12.640  94.906 1.00 35.10  ? 38   VAL B N   1 
ATOM   3085 C  CA  . VAL B 2 6   ? 1.507   11.912  94.324 1.00 35.25  ? 38   VAL B CA  1 
ATOM   3086 C  C   . VAL B 2 6   ? 0.977   10.576  93.838 1.00 35.59  ? 38   VAL B C   1 
ATOM   3087 O  O   . VAL B 2 6   ? 0.191   9.926   94.527 1.00 37.79  ? 38   VAL B O   1 
ATOM   3088 C  CB  . VAL B 2 6   ? 2.586   11.641  95.350 1.00 36.75  ? 38   VAL B CB  1 
ATOM   3089 C  CG1 . VAL B 2 6   ? 3.741   10.903  94.690 1.00 32.51  ? 38   VAL B CG1 1 
ATOM   3090 C  CG2 . VAL B 2 6   ? 3.050   12.954  95.974 1.00 36.68  ? 38   VAL B CG2 1 
ATOM   3091 N  N   . VAL B 2 7   ? 1.365   10.175  92.638 1.00 30.18  ? 39   VAL B N   1 
ATOM   3092 C  CA  . VAL B 2 7   ? 0.755   9.003   92.010 1.00 29.41  ? 39   VAL B CA  1 
ATOM   3093 C  C   . VAL B 2 7   ? 1.889   8.170   91.426 1.00 29.02  ? 39   VAL B C   1 
ATOM   3094 O  O   . VAL B 2 7   ? 2.819   8.712   90.808 1.00 29.26  ? 39   VAL B O   1 
ATOM   3095 C  CB  . VAL B 2 7   ? -0.196  9.421   90.892 1.00 35.59  ? 39   VAL B CB  1 
ATOM   3096 C  CG1 . VAL B 2 7   ? -0.772  8.196   90.183 1.00 39.85  ? 39   VAL B CG1 1 
ATOM   3097 C  CG2 . VAL B 2 7   ? -1.303  10.274  91.472 1.00 37.53  ? 39   VAL B CG2 1 
ATOM   3098 N  N   . ASP B 2 8   ? 1.790   6.868   91.585 1.00 24.05  ? 40   ASP B N   1 
ATOM   3099 C  CA  . ASP B 2 8   ? 2.836   5.989   91.071 1.00 24.17  ? 40   ASP B CA  1 
ATOM   3100 C  C   . ASP B 2 8   ? 2.408   5.462   89.709 1.00 22.31  ? 40   ASP B C   1 
ATOM   3101 O  O   . ASP B 2 8   ? 1.249   5.032   89.516 1.00 21.94  ? 40   ASP B O   1 
ATOM   3102 C  CB  . ASP B 2 8   ? 3.066   4.827   92.044 1.00 28.37  ? 40   ASP B CB  1 
ATOM   3103 C  CG  . ASP B 2 8   ? 3.790   5.271   93.295 1.00 32.13  ? 40   ASP B CG  1 
ATOM   3104 O  OD1 . ASP B 2 8   ? 4.896   5.827   93.210 1.00 35.37  ? 40   ASP B OD1 1 
ATOM   3105 O  OD2 . ASP B 2 8   ? 3.235   5.070   94.367 1.00 41.51  ? 40   ASP B OD2 1 
ATOM   3106 N  N   . LEU B 2 9   ? 3.346   5.493   88.760 1.00 23.29  ? 41   LEU B N   1 
ATOM   3107 C  CA  . LEU B 2 9   ? 3.074   4.912   87.441 1.00 22.74  ? 41   LEU B CA  1 
ATOM   3108 C  C   . LEU B 2 9   ? 3.619   3.516   87.363 1.00 22.08  ? 41   LEU B C   1 
ATOM   3109 O  O   . LEU B 2 9   ? 4.662   3.229   87.950 1.00 23.97  ? 41   LEU B O   1 
ATOM   3110 C  CB  . LEU B 2 9   ? 3.706   5.723   86.338 1.00 23.38  ? 41   LEU B CB  1 
ATOM   3111 C  CG  . LEU B 2 9   ? 3.291   7.179   86.354 1.00 25.04  ? 41   LEU B CG  1 
ATOM   3112 C  CD1 . LEU B 2 9   ? 4.030   7.918   85.262 1.00 28.29  ? 41   LEU B CD1 1 
ATOM   3113 C  CD2 . LEU B 2 9   ? 1.783   7.281   86.191 1.00 26.70  ? 41   LEU B CD2 1 
ATOM   3114 N  N   . ASP B 2 10  ? 2.893   2.659   86.660 1.00 21.42  ? 42   ASP B N   1 
ATOM   3115 C  CA  . ASP B 2 10  ? 3.404   1.348   86.209 1.00 21.99  ? 42   ASP B CA  1 
ATOM   3116 C  C   . ASP B 2 10  ? 3.585   1.353   84.689 1.00 20.08  ? 42   ASP B C   1 
ATOM   3117 O  O   . ASP B 2 10  ? 2.734   1.892   83.964 1.00 20.31  ? 42   ASP B O   1 
ATOM   3118 C  CB  . ASP B 2 10  ? 2.380   0.289   86.500 1.00 24.59  ? 42   ASP B CB  1 
ATOM   3119 C  CG  . ASP B 2 10  ? 2.174   0.053   88.005 1.00 30.06  ? 42   ASP B CG  1 
ATOM   3120 O  OD1 . ASP B 2 10  ? 3.116   0.155   88.822 1.00 33.82  ? 42   ASP B OD1 1 
ATOM   3121 O  OD2 . ASP B 2 10  ? 1.026   -0.247  88.357 1.00 32.94  ? 42   ASP B OD2 1 
ATOM   3122 N  N   . PHE B 2 11  ? 4.665   0.760   84.218 1.00 18.84  ? 43   PHE B N   1 
ATOM   3123 C  CA  . PHE B 2 11  ? 4.986   0.740   82.808 1.00 19.82  ? 43   PHE B CA  1 
ATOM   3124 C  C   . PHE B 2 11  ? 5.131   -0.704  82.324 1.00 20.51  ? 43   PHE B C   1 
ATOM   3125 O  O   . PHE B 2 11  ? 5.741   -1.519  82.991 1.00 22.15  ? 43   PHE B O   1 
ATOM   3126 C  CB  . PHE B 2 11  ? 6.333   1.360   82.567 1.00 20.34  ? 43   PHE B CB  1 
ATOM   3127 C  CG  . PHE B 2 11  ? 6.414   2.872   82.671 1.00 20.45  ? 43   PHE B CG  1 
ATOM   3128 C  CD1 . PHE B 2 11  ? 5.328   3.703   82.874 1.00 22.09  ? 43   PHE B CD1 1 
ATOM   3129 C  CD2 . PHE B 2 11  ? 7.649   3.460   82.529 1.00 22.44  ? 43   PHE B CD2 1 
ATOM   3130 C  CE1 . PHE B 2 11  ? 5.500   5.091   82.902 1.00 20.59  ? 43   PHE B CE1 1 
ATOM   3131 C  CE2 . PHE B 2 11  ? 7.827   4.828   82.553 1.00 22.08  ? 43   PHE B CE2 1 
ATOM   3132 C  CZ  . PHE B 2 11  ? 6.750   5.644   82.749 1.00 21.70  ? 43   PHE B CZ  1 
ATOM   3133 N  N   . PHE B 2 12  ? 4.556   -0.988  81.165 1.00 19.40  ? 44   PHE B N   1 
ATOM   3134 C  CA  . PHE B 2 12  ? 4.856   -2.230  80.467 1.00 18.98  ? 44   PHE B CA  1 
ATOM   3135 C  C   . PHE B 2 12  ? 5.845   -1.856  79.396 1.00 18.57  ? 44   PHE B C   1 
ATOM   3136 O  O   . PHE B 2 12  ? 5.523   -1.044  78.515 1.00 20.19  ? 44   PHE B O   1 
ATOM   3137 C  CB  . PHE B 2 12  ? 3.591   -2.792  79.861 1.00 20.43  ? 44   PHE B CB  1 
ATOM   3138 C  CG  . PHE B 2 12  ? 3.821   -4.092  79.106 1.00 19.75  ? 44   PHE B CG  1 
ATOM   3139 C  CD1 . PHE B 2 12  ? 4.173   -4.056  77.787 1.00 20.52  ? 44   PHE B CD1 1 
ATOM   3140 C  CD2 . PHE B 2 12  ? 3.677   -5.321  79.742 1.00 20.60  ? 44   PHE B CD2 1 
ATOM   3141 C  CE1 . PHE B 2 12  ? 4.410   -5.239  77.081 1.00 20.61  ? 44   PHE B CE1 1 
ATOM   3142 C  CE2 . PHE B 2 12  ? 3.897   -6.530  79.038 1.00 21.65  ? 44   PHE B CE2 1 
ATOM   3143 C  CZ  . PHE B 2 12  ? 4.253   -6.479  77.713 1.00 22.04  ? 44   PHE B CZ  1 
ATOM   3144 N  N   . THR B 2 13  ? 7.031   -2.471  79.426 1.00 18.85  ? 45   THR B N   1 
ATOM   3145 C  CA  . THR B 2 13  ? 8.078   -2.159  78.487 1.00 20.71  ? 45   THR B CA  1 
ATOM   3146 C  C   . THR B 2 13  ? 8.704   -3.417  77.873 1.00 21.08  ? 45   THR B C   1 
ATOM   3147 O  O   . THR B 2 13  ? 9.683   -3.284  77.168 1.00 20.55  ? 45   THR B O   1 
ATOM   3148 C  CB  . THR B 2 13  ? 9.188   -1.362  79.185 1.00 23.01  ? 45   THR B CB  1 
ATOM   3149 O  OG1 . THR B 2 13  ? 9.711   -2.120  80.278 1.00 22.92  ? 45   THR B OG1 1 
ATOM   3150 C  CG2 . THR B 2 13  ? 8.642   -0.048  79.703 1.00 23.88  ? 45   THR B CG2 1 
ATOM   3151 N  N   . GLN B 2 14  ? 8.115   -4.603  78.094 1.00 20.25  ? 46   GLN B N   1 
ATOM   3152 C  CA  . GLN B 2 14  ? 8.748   -5.894  77.638 1.00 22.92  ? 46   GLN B CA  1 
ATOM   3153 C  C   . GLN B 2 14  ? 8.833   -5.973  76.142 1.00 23.38  ? 46   GLN B C   1 
ATOM   3154 O  O   . GLN B 2 14  ? 9.818   -6.487  75.610 1.00 24.17  ? 46   GLN B O   1 
ATOM   3155 C  CB  . GLN B 2 14  ? 7.999   -7.116  78.229 1.00 28.37  ? 46   GLN B CB  1 
ATOM   3156 C  CG  . GLN B 2 14  ? 8.173   -8.499  77.542 1.00 34.38  ? 46   GLN B CG  1 
ATOM   3157 C  CD  . GLN B 2 14  ? 6.838   -9.270  77.498 1.00 39.88  ? 46   GLN B CD  1 
ATOM   3158 O  OE1 . GLN B 2 14  ? 6.056   -9.330  78.519 1.00 33.16  ? 46   GLN B OE1 1 
ATOM   3159 N  NE2 . GLN B 2 14  ? 6.537   -9.847  76.326 1.00 44.65  ? 46   GLN B NE2 1 
ATOM   3160 N  N   . GLU B 2 15  ? 7.833   -5.465  75.432 1.00 21.86  ? 47   GLU B N   1 
ATOM   3161 C  CA  . GLU B 2 15  ? 7.805   -5.502  73.969 1.00 22.42  ? 47   GLU B CA  1 
ATOM   3162 C  C   . GLU B 2 15  ? 6.812   -4.505  73.455 1.00 22.08  ? 47   GLU B C   1 
ATOM   3163 O  O   . GLU B 2 15  ? 5.891   -4.120  74.195 1.00 23.46  ? 47   GLU B O   1 
ATOM   3164 C  CB  . GLU B 2 15  ? 7.363   -6.883  73.465 1.00 24.39  ? 47   GLU B CB  1 
ATOM   3165 C  CG  . GLU B 2 15  ? 5.924   -7.219  73.796 1.00 25.13  ? 47   GLU B CG  1 
ATOM   3166 C  CD  . GLU B 2 15  ? 5.469   -8.616  73.435 1.00 32.60  ? 47   GLU B CD  1 
ATOM   3167 O  OE1 . GLU B 2 15  ? 6.142   -9.305  72.639 1.00 34.30  ? 47   GLU B OE1 1 
ATOM   3168 O  OE2 . GLU B 2 15  ? 4.415   -9.017  73.987 1.00 33.50  ? 47   GLU B OE2 1 
ATOM   3169 N  N   . PRO B 2 16  ? 6.942   -4.086  72.179 1.00 23.77  ? 48   PRO B N   1 
ATOM   3170 C  CA  . PRO B 2 16  ? 5.899   -3.239  71.659 1.00 23.53  ? 48   PRO B CA  1 
ATOM   3171 C  C   . PRO B 2 16  ? 4.535   -3.926  71.626 1.00 22.35  ? 48   PRO B C   1 
ATOM   3172 O  O   . PRO B 2 16  ? 4.415   -5.015  71.138 1.00 23.52  ? 48   PRO B O   1 
ATOM   3173 C  CB  . PRO B 2 16  ? 6.336   -2.942  70.227 1.00 23.50  ? 48   PRO B CB  1 
ATOM   3174 C  CG  . PRO B 2 16  ? 7.828   -3.145  70.263 1.00 24.00  ? 48   PRO B CG  1 
ATOM   3175 C  CD  . PRO B 2 16  ? 8.025   -4.283  71.192 1.00 25.28  ? 48   PRO B CD  1 
ATOM   3176 N  N   . LEU B 2 17  ? 3.526   -3.231  72.079 1.00 17.82  ? 49   LEU B N   1 
ATOM   3177 C  CA  . LEU B 2 17  ? 2.164   -3.710  72.039 1.00 18.74  ? 49   LEU B CA  1 
ATOM   3178 C  C   . LEU B 2 17  ? 1.498   -3.439  70.718 1.00 19.12  ? 49   LEU B C   1 
ATOM   3179 O  O   . LEU B 2 17  ? 0.618   -4.202  70.305 1.00 22.24  ? 49   LEU B O   1 
ATOM   3180 C  CB  . LEU B 2 17  ? 1.348   -3.101  73.191 1.00 18.89  ? 49   LEU B CB  1 
ATOM   3181 C  CG  . LEU B 2 17  ? 1.866   -3.553  74.548 1.00 20.93  ? 49   LEU B CG  1 
ATOM   3182 C  CD1 . LEU B 2 17  ? 1.230   -2.718  75.662 1.00 20.80  ? 49   LEU B CD1 1 
ATOM   3183 C  CD2 . LEU B 2 17  ? 1.621   -5.015  74.769 1.00 21.79  ? 49   LEU B CD2 1 
ATOM   3184 N  N   . HIS B 2 18  ? 1.887   -2.362  70.054 1.00 18.83  ? 50   HIS B N   1 
ATOM   3185 C  CA  . HIS B 2 18  ? 1.511   -2.101  68.701 1.00 18.98  ? 50   HIS B CA  1 
ATOM   3186 C  C   . HIS B 2 18  ? 2.587   -1.281  68.059 1.00 19.41  ? 50   HIS B C   1 
ATOM   3187 O  O   . HIS B 2 18  ? 3.413   -0.656  68.728 1.00 19.92  ? 50   HIS B O   1 
ATOM   3188 C  CB  . HIS B 2 18  ? 0.189   -1.288  68.575 1.00 19.94  ? 50   HIS B CB  1 
ATOM   3189 C  CG  . HIS B 2 18  ? -1.013  -2.016  69.065 1.00 20.45  ? 50   HIS B CG  1 
ATOM   3190 N  ND1 . HIS B 2 18  ? -1.564  -3.090  68.393 1.00 21.72  ? 50   HIS B ND1 1 
ATOM   3191 C  CD2 . HIS B 2 18  ? -1.798  -1.808  70.142 1.00 22.44  ? 50   HIS B CD2 1 
ATOM   3192 C  CE1 . HIS B 2 18  ? -2.604  -3.539  69.070 1.00 22.03  ? 50   HIS B CE1 1 
ATOM   3193 N  NE2 . HIS B 2 18  ? -2.755  -2.791  70.146 1.00 22.63  ? 50   HIS B NE2 1 
ATOM   3194 N  N   . LEU B 2 19  ? 2.542   -1.248  66.734 1.00 18.31  ? 51   LEU B N   1 
ATOM   3195 C  CA  . LEU B 2 19  ? 3.419   -0.420  65.946 1.00 20.37  ? 51   LEU B CA  1 
ATOM   3196 C  C   . LEU B 2 19  ? 2.502   0.501   65.116 1.00 20.13  ? 51   LEU B C   1 
ATOM   3197 O  O   . LEU B 2 19  ? 1.683   0.021   64.300 1.00 19.93  ? 51   LEU B O   1 
ATOM   3198 C  CB  . LEU B 2 19  ? 4.269   -1.314  65.019 1.00 23.40  ? 51   LEU B CB  1 
ATOM   3199 C  CG  . LEU B 2 19  ? 5.438   -0.817  64.185 1.00 32.71  ? 51   LEU B CG  1 
ATOM   3200 C  CD1 . LEU B 2 19  ? 6.535   -0.062  64.932 1.00 35.84  ? 51   LEU B CD1 1 
ATOM   3201 C  CD2 . LEU B 2 19  ? 6.047   -2.079  63.520 1.00 35.53  ? 51   LEU B CD2 1 
ATOM   3202 N  N   . VAL B 2 20  ? 2.621   1.810   65.317 1.00 18.41  ? 52   VAL B N   1 
ATOM   3203 C  CA  . VAL B 2 20  ? 1.926   2.795   64.500 1.00 18.11  ? 52   VAL B CA  1 
ATOM   3204 C  C   . VAL B 2 20  ? 2.787   3.185   63.317 1.00 19.96  ? 52   VAL B C   1 
ATOM   3205 O  O   . VAL B 2 20  ? 4.000   2.955   63.295 1.00 20.24  ? 52   VAL B O   1 
ATOM   3206 C  CB  . VAL B 2 20  ? 1.426   4.035   65.276 1.00 17.54  ? 52   VAL B CB  1 
ATOM   3207 C  CG1 . VAL B 2 20  ? 0.430   3.624   66.363 1.00 17.80  ? 52   VAL B CG1 1 
ATOM   3208 C  CG2 . VAL B 2 20  ? 2.549   4.814   65.896 1.00 15.99  ? 52   VAL B CG2 1 
ATOM   3209 N  N   . SER B 2 21  ? 2.118   3.707   62.305 1.00 20.59  ? 53   SER B N   1 
ATOM   3210 C  CA  . SER B 2 21  ? 2.818   4.224   61.142 1.00 20.82  ? 53   SER B CA  1 
ATOM   3211 C  C   . SER B 2 21  ? 3.735   5.348   61.549 1.00 22.62  ? 53   SER B C   1 
ATOM   3212 O  O   . SER B 2 21  ? 3.427   6.124   62.442 1.00 19.16  ? 53   SER B O   1 
ATOM   3213 C  CB  . SER B 2 21  ? 1.803   4.721   60.135 1.00 20.53  ? 53   SER B CB  1 
ATOM   3214 O  OG  . SER B 2 21  ? 2.391   5.346   59.002 1.00 20.46  ? 53   SER B OG  1 
ATOM   3215 N  N   . PRO B 2 22  ? 4.872   5.508   60.844 1.00 21.60  ? 54   PRO B N   1 
ATOM   3216 C  CA  . PRO B 2 22  ? 5.556   6.782   61.014 1.00 21.66  ? 54   PRO B CA  1 
ATOM   3217 C  C   . PRO B 2 22  ? 4.691   8.013   60.738 1.00 20.12  ? 54   PRO B C   1 
ATOM   3218 O  O   . PRO B 2 22  ? 4.977   9.074   61.265 1.00 18.63  ? 54   PRO B O   1 
ATOM   3219 C  CB  . PRO B 2 22  ? 6.717   6.694   59.982 1.00 25.10  ? 54   PRO B CB  1 
ATOM   3220 C  CG  . PRO B 2 22  ? 6.892   5.253   59.753 1.00 24.29  ? 54   PRO B CG  1 
ATOM   3221 C  CD  . PRO B 2 22  ? 5.517   4.655   59.823 1.00 23.42  ? 54   PRO B CD  1 
ATOM   3222 N  N   . SER B 2 23  ? 3.666   7.854   59.901 1.00 19.18  ? 55   SER B N   1 
ATOM   3223 C  CA  . SER B 2 23  ? 2.668   8.876   59.613 1.00 18.78  ? 55   SER B CA  1 
ATOM   3224 C  C   . SER B 2 23  ? 1.442   8.768   60.526 1.00 19.36  ? 55   SER B C   1 
ATOM   3225 O  O   . SER B 2 23  ? 0.370   9.273   60.182 1.00 16.73  ? 55   SER B O   1 
ATOM   3226 C  CB  . SER B 2 23  ? 2.198   8.750   58.139 1.00 20.96  ? 55   SER B CB  1 
ATOM   3227 O  OG  . SER B 2 23  ? 3.314   8.996   57.313 1.00 22.97  ? 55   SER B OG  1 
ATOM   3228 N  N   . PHE B 2 24  ? 1.620   8.206   61.726 1.00 17.14  ? 56   PHE B N   1 
ATOM   3229 C  CA  . PHE B 2 24  ? 0.489   8.024   62.639 1.00 19.13  ? 56   PHE B CA  1 
ATOM   3230 C  C   . PHE B 2 24  ? -0.345  9.299   62.830 1.00 18.01  ? 56   PHE B C   1 
ATOM   3231 O  O   . PHE B 2 24  ? -1.569  9.230   62.737 1.00 17.25  ? 56   PHE B O   1 
ATOM   3232 C  CB  . PHE B 2 24  ? 1.024   7.559   63.980 1.00 18.08  ? 56   PHE B CB  1 
ATOM   3233 C  CG  . PHE B 2 24  ? -0.024  7.477   65.077 1.00 17.46  ? 56   PHE B CG  1 
ATOM   3234 C  CD1 . PHE B 2 24  ? -1.075  6.554   65.020 1.00 17.08  ? 56   PHE B CD1 1 
ATOM   3235 C  CD2 . PHE B 2 24  ? 0.062   8.319   66.203 1.00 17.38  ? 56   PHE B CD2 1 
ATOM   3236 C  CE1 . PHE B 2 24  ? -1.985  6.432   66.056 1.00 17.75  ? 56   PHE B CE1 1 
ATOM   3237 C  CE2 . PHE B 2 24  ? -0.908  8.211   67.216 1.00 17.97  ? 56   PHE B CE2 1 
ATOM   3238 C  CZ  . PHE B 2 24  ? -1.918  7.307   67.130 1.00 16.57  ? 56   PHE B CZ  1 
ATOM   3239 N  N   . LEU B 2 25  ? 0.324   10.440  63.058 1.00 16.37  ? 57   LEU B N   1 
ATOM   3240 C  CA  . LEU B 2 25  ? -0.350  11.679  63.168 1.00 15.32  ? 57   LEU B CA  1 
ATOM   3241 C  C   . LEU B 2 25  ? -0.369  12.311  61.785 1.00 17.87  ? 57   LEU B C   1 
ATOM   3242 O  O   . LEU B 2 25  ? 0.648   12.882  61.325 1.00 17.25  ? 57   LEU B O   1 
ATOM   3243 C  CB  . LEU B 2 25  ? 0.264   12.574  64.222 1.00 15.01  ? 57   LEU B CB  1 
ATOM   3244 C  CG  . LEU B 2 25  ? -0.540  13.771  64.697 1.00 15.91  ? 57   LEU B CG  1 
ATOM   3245 C  CD1 . LEU B 2 25  ? 0.116   14.446  65.883 1.00 15.85  ? 57   LEU B CD1 1 
ATOM   3246 C  CD2 . LEU B 2 25  ? -0.748  14.801  63.569 1.00 18.56  ? 57   LEU B CD2 1 
ATOM   3247 N  N   . SER B 2 26  ? -1.534  12.210  61.160 1.00 16.11  ? 58   SER B N   1 
ATOM   3248 C  CA  . SER B 2 26  ? -1.806  12.737  59.828 1.00 17.87  ? 58   SER B CA  1 
ATOM   3249 C  C   . SER B 2 26  ? -2.893  13.821  59.865 1.00 17.61  ? 58   SER B C   1 
ATOM   3250 O  O   . SER B 2 26  ? -3.450  14.130  60.915 1.00 17.97  ? 58   SER B O   1 
ATOM   3251 C  CB  . SER B 2 26  ? -2.152  11.577  58.865 1.00 18.27  ? 58   SER B CB  1 
ATOM   3252 O  OG  . SER B 2 26  ? -0.990  10.843  58.509 1.00 17.19  ? 58   SER B OG  1 
ATOM   3253 N  N   . VAL B 2 27  ? -3.167  14.447  58.717 1.00 17.53  ? 59   VAL B N   1 
ATOM   3254 C  CA  . VAL B 2 27  ? -4.060  15.578  58.662 1.00 17.48  ? 59   VAL B CA  1 
ATOM   3255 C  C   . VAL B 2 27  ? -4.906  15.543  57.394 1.00 17.52  ? 59   VAL B C   1 
ATOM   3256 O  O   . VAL B 2 27  ? -4.638  14.787  56.480 1.00 19.39  ? 59   VAL B O   1 
ATOM   3257 C  CB  . VAL B 2 27  ? -3.264  16.900  58.682 1.00 19.92  ? 59   VAL B CB  1 
ATOM   3258 C  CG1 . VAL B 2 27  ? -2.515  17.041  59.988 1.00 20.00  ? 59   VAL B CG1 1 
ATOM   3259 C  CG2 . VAL B 2 27  ? -2.292  17.004  57.500 1.00 20.55  ? 59   VAL B CG2 1 
ATOM   3260 N  N   . THR B 2 28  ? -5.955  16.330  57.401 1.00 17.95  ? 60   THR B N   1 
ATOM   3261 C  CA  . THR B 2 28  ? -6.824  16.431  56.271 1.00 17.73  ? 60   THR B CA  1 
ATOM   3262 C  C   . THR B 2 28  ? -6.849  17.849  55.735 1.00 17.72  ? 60   THR B C   1 
ATOM   3263 O  O   . THR B 2 28  ? -6.467  18.822  56.393 1.00 19.81  ? 60   THR B O   1 
ATOM   3264 C  CB  . THR B 2 28  ? -8.285  16.042  56.581 1.00 18.05  ? 60   THR B CB  1 
ATOM   3265 O  OG1 . THR B 2 28  ? -8.886  17.091  57.330 1.00 17.79  ? 60   THR B OG1 1 
ATOM   3266 C  CG2 . THR B 2 28  ? -8.450  14.732  57.343 1.00 18.49  ? 60   THR B CG2 1 
ATOM   3267 N  N   . ILE B 2 29  ? -7.351  17.929  54.502 1.00 17.67  ? 61   ILE B N   1 
ATOM   3268 C  CA  . ILE B 2 29  ? -7.887  19.159  53.904 1.00 18.85  ? 61   ILE B CA  1 
ATOM   3269 C  C   . ILE B 2 29  ? -9.266  18.733  53.444 1.00 18.52  ? 61   ILE B C   1 
ATOM   3270 O  O   . ILE B 2 29  ? -9.406  17.731  52.743 1.00 19.52  ? 61   ILE B O   1 
ATOM   3271 C  CB  . ILE B 2 29  ? -7.032  19.663  52.696 1.00 21.40  ? 61   ILE B CB  1 
ATOM   3272 C  CG1 . ILE B 2 29  ? -5.693  20.242  53.179 1.00 22.95  ? 61   ILE B CG1 1 
ATOM   3273 C  CG2 . ILE B 2 29  ? -7.818  20.677  51.858 1.00 20.81  ? 61   ILE B CG2 1 
ATOM   3274 C  CD1 . ILE B 2 29  ? -5.838  21.536  53.957 1.00 24.52  ? 61   ILE B CD1 1 
ATOM   3275 N  N   . ASP B 2 30  ? -10.288 19.446  53.882 1.00 19.46  ? 62   ASP B N   1 
ATOM   3276 C  CA  . ASP B 2 30  ? -11.634 19.085  53.549 1.00 20.31  ? 62   ASP B CA  1 
ATOM   3277 C  C   . ASP B 2 30  ? -11.861 19.384  52.053 1.00 23.32  ? 62   ASP B C   1 
ATOM   3278 O  O   . ASP B 2 30  ? -11.408 20.422  51.552 1.00 23.40  ? 62   ASP B O   1 
ATOM   3279 C  CB  . ASP B 2 30  ? -12.624 19.842  54.365 1.00 20.82  ? 62   ASP B CB  1 
ATOM   3280 C  CG  . ASP B 2 30  ? -13.993 19.200  54.366 1.00 24.20  ? 62   ASP B CG  1 
ATOM   3281 O  OD1 . ASP B 2 30  ? -14.757 19.319  53.363 1.00 23.31  ? 62   ASP B OD1 1 
ATOM   3282 O  OD2 . ASP B 2 30  ? -14.321 18.549  55.382 1.00 22.92  ? 62   ASP B OD2 1 
ATOM   3283 N  N   . ALA B 2 31  ? -12.555 18.479  51.398 1.00 21.29  ? 63   ALA B N   1 
ATOM   3284 C  CA  . ALA B 2 31  ? -13.001 18.661  49.993 1.00 23.68  ? 63   ALA B CA  1 
ATOM   3285 C  C   . ALA B 2 31  ? -13.641 20.030  49.751 1.00 26.43  ? 63   ALA B C   1 
ATOM   3286 O  O   . ALA B 2 31  ? -13.486 20.618  48.668 1.00 27.35  ? 63   ALA B O   1 
ATOM   3287 C  CB  . ALA B 2 31  ? -13.983 17.560  49.636 1.00 24.56  ? 63   ALA B CB  1 
ATOM   3288 N  N   . ASN B 2 32  ? -14.352 20.535  50.748 1.00 24.54  ? 64   ASN B N   1 
ATOM   3289 C  CA  . ASN B 2 32  ? -14.959 21.866  50.734 1.00 27.31  ? 64   ASN B CA  1 
ATOM   3290 C  C   . ASN B 2 32  ? -14.014 22.986  50.317 1.00 27.87  ? 64   ASN B C   1 
ATOM   3291 O  O   . ASN B 2 32  ? -14.438 23.937  49.686 1.00 28.04  ? 64   ASN B O   1 
ATOM   3292 C  CB  . ASN B 2 32  ? -15.563 22.115  52.144 1.00 29.49  ? 64   ASN B CB  1 
ATOM   3293 C  CG  . ASN B 2 32  ? -16.408 23.370  52.255 1.00 35.01  ? 64   ASN B CG  1 
ATOM   3294 O  OD1 . ASN B 2 32  ? -17.135 23.744  51.341 1.00 38.91  ? 64   ASN B OD1 1 
ATOM   3295 N  ND2 . ASN B 2 32  ? -16.358 23.999  53.438 1.00 36.21  ? 64   ASN B ND2 1 
ATOM   3296 N  N   . LEU B 2 33  ? -12.747 22.886  50.692 1.00 25.15  ? 65   LEU B N   1 
ATOM   3297 C  CA  . LEU B 2 33  ? -11.764 23.921  50.439 1.00 25.15  ? 65   LEU B CA  1 
ATOM   3298 C  C   . LEU B 2 33  ? -11.565 24.149  48.947 1.00 25.67  ? 65   LEU B C   1 
ATOM   3299 O  O   . LEU B 2 33  ? -11.300 25.271  48.567 1.00 25.82  ? 65   LEU B O   1 
ATOM   3300 C  CB  . LEU B 2 33  ? -10.432 23.629  51.114 1.00 27.54  ? 65   LEU B CB  1 
ATOM   3301 C  CG  . LEU B 2 33  ? -9.542  24.872  51.279 1.00 26.79  ? 65   LEU B CG  1 
ATOM   3302 C  CD1 . LEU B 2 33  ? -10.132 25.819  52.314 1.00 28.22  ? 65   LEU B CD1 1 
ATOM   3303 C  CD2 . LEU B 2 33  ? -8.128  24.475  51.655 1.00 30.36  ? 65   LEU B CD2 1 
ATOM   3304 N  N   . ALA B 2 34  ? -11.712 23.104  48.135 1.00 24.54  ? 66   ALA B N   1 
ATOM   3305 C  CA  . ALA B 2 34  ? -11.625 23.253  46.664 1.00 27.78  ? 66   ALA B CA  1 
ATOM   3306 C  C   . ALA B 2 34  ? -12.753 24.100  46.077 1.00 31.80  ? 66   ALA B C   1 
ATOM   3307 O  O   . ALA B 2 34  ? -12.642 24.544  44.922 1.00 34.09  ? 66   ALA B O   1 
ATOM   3308 C  CB  . ALA B 2 34  ? -11.574 21.898  46.013 1.00 25.34  ? 66   ALA B CB  1 
ATOM   3309 N  N   . THR B 2 35  ? -13.795 24.360  46.851 1.00 29.85  ? 67   THR B N   1 
ATOM   3310 C  CA  . THR B 2 35  ? -14.864 25.281  46.464 1.00 33.13  ? 67   THR B CA  1 
ATOM   3311 C  C   . THR B 2 35  ? -14.597 26.723  46.863 1.00 34.59  ? 67   THR B C   1 
ATOM   3312 O  O   . THR B 2 35  ? -15.411 27.599  46.566 1.00 36.92  ? 67   THR B O   1 
ATOM   3313 C  CB  . THR B 2 35  ? -16.239 24.845  46.977 1.00 32.58  ? 67   THR B CB  1 
ATOM   3314 O  OG1 . THR B 2 35  ? -16.324 24.960  48.409 1.00 35.73  ? 67   THR B OG1 1 
ATOM   3315 C  CG2 . THR B 2 35  ? -16.559 23.425  46.550 1.00 32.88  ? 67   THR B CG2 1 
ATOM   3316 N  N   . ASP B 2 36  ? -13.453 26.987  47.494 1.00 32.20  ? 68   ASP B N   1 
ATOM   3317 C  CA  . ASP B 2 36  ? -13.118 28.327  47.931 1.00 34.49  ? 68   ASP B CA  1 
ATOM   3318 C  C   . ASP B 2 36  ? -12.428 28.969  46.714 1.00 33.10  ? 68   ASP B C   1 
ATOM   3319 O  O   . ASP B 2 36  ? -11.499 28.376  46.175 1.00 33.47  ? 68   ASP B O   1 
ATOM   3320 C  CB  . ASP B 2 36  ? -12.174 28.286  49.115 1.00 33.67  ? 68   ASP B CB  1 
ATOM   3321 C  CG  . ASP B 2 36  ? -11.968 29.658  49.750 1.00 39.81  ? 68   ASP B CG  1 
ATOM   3322 O  OD1 . ASP B 2 36  ? -11.678 30.643  49.033 1.00 37.51  ? 68   ASP B OD1 1 
ATOM   3323 O  OD2 . ASP B 2 36  ? -12.035 29.732  50.987 1.00 38.40  ? 68   ASP B OD2 1 
ATOM   3324 N  N   . PRO B 2 37  ? -12.878 30.186  46.278 1.00 36.70  ? 69   PRO B N   1 
ATOM   3325 C  CA  . PRO B 2 37  ? -12.248 30.851  45.112 1.00 38.11  ? 69   PRO B CA  1 
ATOM   3326 C  C   . PRO B 2 37  ? -10.769 31.124  45.258 1.00 38.94  ? 69   PRO B C   1 
ATOM   3327 O  O   . PRO B 2 37  ? -10.083 31.256  44.260 1.00 41.09  ? 69   PRO B O   1 
ATOM   3328 C  CB  . PRO B 2 37  ? -13.004 32.188  45.002 1.00 38.88  ? 69   PRO B CB  1 
ATOM   3329 C  CG  . PRO B 2 37  ? -14.312 31.937  45.659 1.00 40.74  ? 69   PRO B CG  1 
ATOM   3330 C  CD  . PRO B 2 37  ? -14.046 30.945  46.769 1.00 38.45  ? 69   PRO B CD  1 
ATOM   3331 N  N   . ARG B 2 38  ? -10.285 31.201  46.495 1.00 37.28  ? 70   ARG B N   1 
ATOM   3332 C  CA  . ARG B 2 38  ? -8.887  31.495  46.790 1.00 38.14  ? 70   ARG B CA  1 
ATOM   3333 C  C   . ARG B 2 38  ? -8.000  30.246  47.081 1.00 34.86  ? 70   ARG B C   1 
ATOM   3334 O  O   . ARG B 2 38  ? -6.894  30.375  47.603 1.00 32.43  ? 70   ARG B O   1 
ATOM   3335 C  CB  . ARG B 2 38  ? -8.858  32.522  47.925 1.00 41.68  ? 70   ARG B CB  1 
ATOM   3336 C  CG  . ARG B 2 38  ? -9.599  33.805  47.523 1.00 47.74  ? 70   ARG B CG  1 
ATOM   3337 C  CD  . ARG B 2 38  ? -9.502  34.935  48.528 1.00 51.90  ? 70   ARG B CD  1 
ATOM   3338 N  NE  . ARG B 2 38  ? -8.150  35.484  48.644 1.00 59.25  ? 70   ARG B NE  1 
ATOM   3339 C  CZ  . ARG B 2 38  ? -7.253  35.167  49.591 1.00 66.79  ? 70   ARG B CZ  1 
ATOM   3340 N  NH1 . ARG B 2 38  ? -7.520  34.266  50.544 1.00 63.61  ? 70   ARG B NH1 1 
ATOM   3341 N  NH2 . ARG B 2 38  ? -6.059  35.763  49.589 1.00 67.14  ? 70   ARG B NH2 1 
ATOM   3342 N  N   . PHE B 2 39  ? -8.485  29.062  46.704 1.00 35.28  ? 71   PHE B N   1 
ATOM   3343 C  CA  . PHE B 2 39  ? -7.822  27.761  46.918 1.00 33.91  ? 71   PHE B CA  1 
ATOM   3344 C  C   . PHE B 2 39  ? -6.340  27.802  46.522 1.00 35.92  ? 71   PHE B C   1 
ATOM   3345 O  O   . PHE B 2 39  ? -5.481  27.358  47.274 1.00 33.01  ? 71   PHE B O   1 
ATOM   3346 C  CB  . PHE B 2 39  ? -8.597  26.679  46.141 1.00 35.36  ? 71   PHE B CB  1 
ATOM   3347 C  CG  . PHE B 2 39  ? -8.174  25.267  46.414 1.00 33.83  ? 71   PHE B CG  1 
ATOM   3348 C  CD1 . PHE B 2 39  ? -8.199  24.747  47.716 1.00 33.02  ? 71   PHE B CD1 1 
ATOM   3349 C  CD2 . PHE B 2 39  ? -7.800  24.430  45.376 1.00 33.75  ? 71   PHE B CD2 1 
ATOM   3350 C  CE1 . PHE B 2 39  ? -7.855  23.422  47.957 1.00 30.27  ? 71   PHE B CE1 1 
ATOM   3351 C  CE2 . PHE B 2 39  ? -7.445  23.118  45.604 1.00 34.51  ? 71   PHE B CE2 1 
ATOM   3352 C  CZ  . PHE B 2 39  ? -7.474  22.605  46.907 1.00 35.31  ? 71   PHE B CZ  1 
ATOM   3353 N  N   . LEU B 2 40  ? -6.030  28.394  45.362 1.00 32.65  ? 72   LEU B N   1 
ATOM   3354 C  CA  . LEU B 2 40  ? -4.651  28.496  44.914 1.00 30.70  ? 72   LEU B CA  1 
ATOM   3355 C  C   . LEU B 2 40  ? -3.791  29.380  45.817 1.00 30.16  ? 72   LEU B C   1 
ATOM   3356 O  O   . LEU B 2 40  ? -2.630  29.056  46.090 1.00 35.13  ? 72   LEU B O   1 
ATOM   3357 C  CB  . LEU B 2 40  ? -4.624  28.978  43.430 1.00 35.65  ? 72   LEU B CB  1 
ATOM   3358 C  CG  . LEU B 2 40  ? -3.251  29.102  42.762 1.00 39.24  ? 72   LEU B CG  1 
ATOM   3359 C  CD1 . LEU B 2 40  ? -3.318  28.816  41.248 1.00 41.37  ? 72   LEU B CD1 1 
ATOM   3360 C  CD2 . LEU B 2 40  ? -2.650  30.475  43.013 1.00 39.90  ? 72   LEU B CD2 1 
ATOM   3361 N  N   . ILE B 2 41  ? -4.330  30.515  46.229 1.00 29.52  ? 73   ILE B N   1 
ATOM   3362 C  CA  . ILE B 2 41  ? -3.605  31.422  47.108 1.00 33.59  ? 73   ILE B CA  1 
ATOM   3363 C  C   . ILE B 2 41  ? -3.371  30.686  48.429 1.00 30.96  ? 73   ILE B C   1 
ATOM   3364 O  O   . ILE B 2 41  ? -2.232  30.600  48.907 1.00 34.45  ? 73   ILE B O   1 
ATOM   3365 C  CB  . ILE B 2 41  ? -4.377  32.738  47.335 1.00 35.86  ? 73   ILE B CB  1 
ATOM   3366 C  CG1 . ILE B 2 41  ? -4.431  33.544  46.030 1.00 38.90  ? 73   ILE B CG1 1 
ATOM   3367 C  CG2 . ILE B 2 41  ? -3.721  33.604  48.412 1.00 38.90  ? 73   ILE B CG2 1 
ATOM   3368 C  CD1 . ILE B 2 41  ? -5.601  34.505  45.976 1.00 38.67  ? 73   ILE B CD1 1 
ATOM   3369 N  N   . LEU B 2 42  ? -4.452  30.102  48.942 1.00 31.15  ? 74   LEU B N   1 
ATOM   3370 C  CA  . LEU B 2 42  ? -4.411  29.420  50.259 1.00 33.58  ? 74   LEU B CA  1 
ATOM   3371 C  C   . LEU B 2 42  ? -3.328  28.346  50.317 1.00 30.32  ? 74   LEU B C   1 
ATOM   3372 O  O   . LEU B 2 42  ? -2.419  28.450  51.115 1.00 34.47  ? 74   LEU B O   1 
ATOM   3373 C  CB  . LEU B 2 42  ? -5.790  28.837  50.607 1.00 32.14  ? 74   LEU B CB  1 
ATOM   3374 C  CG  . LEU B 2 42  ? -6.859  29.914  50.702 1.00 31.74  ? 74   LEU B CG  1 
ATOM   3375 C  CD1 . LEU B 2 42  ? -8.226  29.266  50.843 1.00 30.80  ? 74   LEU B CD1 1 
ATOM   3376 C  CD2 . LEU B 2 42  ? -6.560  30.944  51.773 1.00 35.97  ? 74   LEU B CD2 1 
ATOM   3377 N  N   . LEU B 2 43  ? -3.396  27.355  49.442 1.00 32.63  ? 75   LEU B N   1 
ATOM   3378 C  CA  . LEU B 2 43  ? -2.443  26.232  49.448 1.00 31.82  ? 75   LEU B CA  1 
ATOM   3379 C  C   . LEU B 2 43  ? -1.084  26.556  48.823 1.00 34.35  ? 75   LEU B C   1 
ATOM   3380 O  O   . LEU B 2 43  ? -0.093  25.844  49.049 1.00 31.17  ? 75   LEU B O   1 
ATOM   3381 C  CB  . LEU B 2 43  ? -3.064  24.982  48.821 1.00 32.87  ? 75   LEU B CB  1 
ATOM   3382 C  CG  . LEU B 2 43  ? -4.245  24.349  49.594 1.00 31.79  ? 75   LEU B CG  1 
ATOM   3383 C  CD1 . LEU B 2 43  ? -4.509  22.965  49.051 1.00 31.86  ? 75   LEU B CD1 1 
ATOM   3384 C  CD2 . LEU B 2 43  ? -4.034  24.268  51.108 1.00 33.21  ? 75   LEU B CD2 1 
ATOM   3385 N  N   . GLY B 2 44  ? -0.999  27.662  48.084 1.00 35.85  ? 76   GLY B N   1 
ATOM   3386 C  CA  . GLY B 2 44  ? 0.320   28.178  47.704 1.00 35.00  ? 76   GLY B CA  1 
ATOM   3387 C  C   . GLY B 2 44  ? 1.065   28.947  48.778 1.00 36.69  ? 76   GLY B C   1 
ATOM   3388 O  O   . GLY B 2 44  ? 2.232   29.307  48.567 1.00 36.36  ? 76   GLY B O   1 
ATOM   3389 N  N   . SER B 2 45  ? 0.404   29.227  49.914 1.00 34.61  ? 77   SER B N   1 
ATOM   3390 C  CA  . SER B 2 45  ? 0.982   29.992  51.007 1.00 34.61  ? 77   SER B CA  1 
ATOM   3391 C  C   . SER B 2 45  ? 2.289   29.378  51.489 1.00 35.66  ? 77   SER B C   1 
ATOM   3392 O  O   . SER B 2 45  ? 2.304   28.226  51.965 1.00 32.14  ? 77   SER B O   1 
ATOM   3393 C  CB  . SER B 2 45  ? 0.026   30.048  52.187 1.00 34.40  ? 77   SER B CB  1 
ATOM   3394 O  OG  . SER B 2 45  ? 0.675   30.600  53.316 1.00 36.00  ? 77   SER B OG  1 
ATOM   3395 N  N   . PRO B 2 46  ? 3.396   30.136  51.390 1.00 35.91  ? 78   PRO B N   1 
ATOM   3396 C  CA  . PRO B 2 46  ? 4.653   29.620  51.910 1.00 34.75  ? 78   PRO B CA  1 
ATOM   3397 C  C   . PRO B 2 46  ? 4.622   29.401  53.437 1.00 31.52  ? 78   PRO B C   1 
ATOM   3398 O  O   . PRO B 2 46  ? 5.213   28.440  53.914 1.00 32.87  ? 78   PRO B O   1 
ATOM   3399 C  CB  . PRO B 2 46  ? 5.679   30.706  51.524 1.00 38.74  ? 78   PRO B CB  1 
ATOM   3400 C  CG  . PRO B 2 46  ? 5.020   31.511  50.461 1.00 38.96  ? 78   PRO B CG  1 
ATOM   3401 C  CD  . PRO B 2 46  ? 3.560   31.462  50.758 1.00 39.21  ? 78   PRO B CD  1 
ATOM   3402 N  N   . LYS B 2 47  ? 3.935   30.284  54.158 1.00 32.31  ? 79   LYS B N   1 
ATOM   3403 C  CA  . LYS B 2 47  ? 3.786   30.180  55.605 1.00 33.79  ? 79   LYS B CA  1 
ATOM   3404 C  C   . LYS B 2 47  ? 3.098   28.826  55.933 1.00 32.13  ? 79   LYS B C   1 
ATOM   3405 O  O   . LYS B 2 47  ? 3.567   28.019  56.769 1.00 28.47  ? 79   LYS B O   1 
ATOM   3406 C  CB  . LYS B 2 47  ? 2.990   31.402  56.061 1.00 38.72  ? 79   LYS B CB  1 
ATOM   3407 C  CG  . LYS B 2 47  ? 2.999   31.720  57.532 1.00 42.56  ? 79   LYS B CG  1 
ATOM   3408 C  CD  . LYS B 2 47  ? 2.338   33.075  57.760 1.00 41.75  ? 79   LYS B CD  1 
ATOM   3409 C  CE  . LYS B 2 47  ? 2.249   33.398  59.229 1.00 44.46  ? 79   LYS B CE  1 
ATOM   3410 N  NZ  . LYS B 2 47  ? 1.442   34.635  59.415 1.00 44.90  ? 79   LYS B NZ  1 
ATOM   3411 N  N   . LEU B 2 48  ? 2.030   28.539  55.205 1.00 31.85  ? 80   LEU B N   1 
ATOM   3412 C  CA  . LEU B 2 48  ? 1.243   27.302  55.416 1.00 30.55  ? 80   LEU B CA  1 
ATOM   3413 C  C   . LEU B 2 48  ? 2.058   26.076  55.095 1.00 28.90  ? 80   LEU B C   1 
ATOM   3414 O  O   . LEU B 2 48  ? 1.998   25.050  55.794 1.00 28.42  ? 80   LEU B O   1 
ATOM   3415 C  CB  . LEU B 2 48  ? -0.045  27.332  54.582 1.00 29.25  ? 80   LEU B CB  1 
ATOM   3416 C  CG  . LEU B 2 48  ? -1.075  26.258  54.890 1.00 29.73  ? 80   LEU B CG  1 
ATOM   3417 C  CD1 . LEU B 2 48  ? -1.534  26.472  56.348 1.00 29.08  ? 80   LEU B CD1 1 
ATOM   3418 C  CD2 . LEU B 2 48  ? -2.250  26.348  53.953 1.00 31.99  ? 80   LEU B CD2 1 
ATOM   3419 N  N   . ARG B 2 49  ? 2.875   26.160  54.055 1.00 28.24  ? 81   ARG B N   1 
ATOM   3420 C  CA  . ARG B 2 49  ? 3.675   24.994  53.694 1.00 28.37  ? 81   ARG B CA  1 
ATOM   3421 C  C   . ARG B 2 49  ? 4.778   24.719  54.686 1.00 26.30  ? 81   ARG B C   1 
ATOM   3422 O  O   . ARG B 2 49  ? 5.097   23.553  54.942 1.00 24.80  ? 81   ARG B O   1 
ATOM   3423 C  CB  . ARG B 2 49  ? 4.211   25.115  52.281 1.00 32.32  ? 81   ARG B CB  1 
ATOM   3424 C  CG  . ARG B 2 49  ? 3.100   25.066  51.254 1.00 34.82  ? 81   ARG B CG  1 
ATOM   3425 C  CD  . ARG B 2 49  ? 3.685   25.489  49.937 1.00 38.58  ? 81   ARG B CD  1 
ATOM   3426 N  NE  . ARG B 2 49  ? 2.752   25.379  48.831 1.00 38.81  ? 81   ARG B NE  1 
ATOM   3427 C  CZ  . ARG B 2 49  ? 3.133   25.196  47.572 1.00 45.96  ? 81   ARG B CZ  1 
ATOM   3428 N  NH1 . ARG B 2 49  ? 4.440   25.085  47.246 1.00 48.49  ? 81   ARG B NH1 1 
ATOM   3429 N  NH2 . ARG B 2 49  ? 2.213   25.119  46.629 1.00 48.19  ? 81   ARG B NH2 1 
ATOM   3430 N  N   . THR B 2 50  ? 5.337   25.765  55.293 1.00 25.30  ? 82   THR B N   1 
ATOM   3431 C  CA  . THR B 2 50  ? 6.315   25.582  56.349 1.00 25.57  ? 82   THR B CA  1 
ATOM   3432 C  C   . THR B 2 50  ? 5.674   24.806  57.517 1.00 24.76  ? 82   THR B C   1 
ATOM   3433 O  O   . THR B 2 50  ? 6.274   23.906  58.089 1.00 26.04  ? 82   THR B O   1 
ATOM   3434 C  CB  . THR B 2 50  ? 6.821   26.911  56.877 1.00 26.78  ? 82   THR B CB  1 
ATOM   3435 O  OG1 . THR B 2 50  ? 7.433   27.605  55.782 1.00 28.67  ? 82   THR B OG1 1 
ATOM   3436 C  CG2 . THR B 2 50  ? 7.803   26.739  58.045 1.00 26.81  ? 82   THR B CG2 1 
ATOM   3437 N  N   . LEU B 2 51  ? 4.467   25.199  57.846 1.00 23.11  ? 83   LEU B N   1 
ATOM   3438 C  CA  . LEU B 2 51  ? 3.754   24.521  58.949 1.00 25.14  ? 83   LEU B CA  1 
ATOM   3439 C  C   . LEU B 2 51  ? 3.437   23.066  58.559 1.00 23.87  ? 83   LEU B C   1 
ATOM   3440 O  O   . LEU B 2 51  ? 3.700   22.144  59.347 1.00 23.04  ? 83   LEU B O   1 
ATOM   3441 C  CB  . LEU B 2 51  ? 2.531   25.308  59.327 1.00 23.64  ? 83   LEU B CB  1 
ATOM   3442 C  CG  . LEU B 2 51  ? 2.744   26.683  59.963 1.00 25.48  ? 83   LEU B CG  1 
ATOM   3443 C  CD1 . LEU B 2 51  ? 1.426   27.422  59.966 1.00 27.16  ? 83   LEU B CD1 1 
ATOM   3444 C  CD2 . LEU B 2 51  ? 3.289   26.592  61.377 1.00 28.82  ? 83   LEU B CD2 1 
ATOM   3445 N  N   . ALA B 2 52  ? 2.980   22.824  57.330 1.00 22.45  ? 84   ALA B N   1 
ATOM   3446 C  CA  . ALA B 2 52  ? 2.709   21.457  56.896 1.00 24.96  ? 84   ALA B CA  1 
ATOM   3447 C  C   . ALA B 2 52  ? 3.969   20.574  56.918 1.00 26.83  ? 84   ALA B C   1 
ATOM   3448 O  O   . ALA B 2 52  ? 3.934   19.401  57.377 1.00 24.57  ? 84   ALA B O   1 
ATOM   3449 C  CB  . ALA B 2 52  ? 2.039   21.430  55.523 1.00 26.42  ? 84   ALA B CB  1 
ATOM   3450 N  N   . ARG B 2 53  ? 5.116   21.148  56.512 1.00 26.36  ? 85   ARG B N   1 
ATOM   3451 C  CA  . ARG B 2 53  ? 6.380   20.398  56.560 1.00 27.50  ? 85   ARG B CA  1 
ATOM   3452 C  C   . ARG B 2 53  ? 6.768   19.917  57.941 1.00 24.90  ? 85   ARG B C   1 
ATOM   3453 O  O   . ARG B 2 53  ? 7.392   18.835  58.081 1.00 24.71  ? 85   ARG B O   1 
ATOM   3454 C  CB  . ARG B 2 53  ? 7.582   21.202  55.990 1.00 30.65  ? 85   ARG B CB  1 
ATOM   3455 C  CG  . ARG B 2 53  ? 7.662   21.243  54.491 1.00 36.93  ? 85   ARG B CG  1 
ATOM   3456 C  CD  . ARG B 2 53  ? 9.013   21.744  53.932 1.00 40.15  ? 85   ARG B CD  1 
ATOM   3457 N  NE  . ARG B 2 53  ? 9.280   23.137  54.290 1.00 41.37  ? 85   ARG B NE  1 
ATOM   3458 C  CZ  . ARG B 2 53  ? 8.708   24.212  53.742 1.00 41.86  ? 85   ARG B CZ  1 
ATOM   3459 N  NH1 . ARG B 2 53  ? 7.814   24.107  52.776 1.00 46.82  ? 85   ARG B NH1 1 
ATOM   3460 N  NH2 . ARG B 2 53  ? 9.040   25.420  54.184 1.00 47.24  ? 85   ARG B NH2 1 
ATOM   3461 N  N   . GLY B 2 54  ? 6.433   20.714  58.960 1.00 23.77  ? 86   GLY B N   1 
ATOM   3462 C  CA  . GLY B 2 54  ? 6.667   20.331  60.363 1.00 24.31  ? 86   GLY B CA  1 
ATOM   3463 C  C   . GLY B 2 54  ? 6.065   18.990  60.743 1.00 25.33  ? 86   GLY B C   1 
ATOM   3464 O  O   . GLY B 2 54  ? 6.547   18.316  61.659 1.00 24.57  ? 86   GLY B O   1 
ATOM   3465 N  N   . LEU B 2 55  ? 4.992   18.595  60.050 1.00 22.55  ? 87   LEU B N   1 
ATOM   3466 C  CA  . LEU B 2 55  ? 4.287   17.367  60.442 1.00 21.69  ? 87   LEU B CA  1 
ATOM   3467 C  C   . LEU B 2 55  ? 4.641   16.195  59.549 1.00 24.25  ? 87   LEU B C   1 
ATOM   3468 O  O   . LEU B 2 55  ? 4.209   15.053  59.784 1.00 22.11  ? 87   LEU B O   1 
ATOM   3469 C  CB  . LEU B 2 55  ? 2.786   17.600  60.450 1.00 21.08  ? 87   LEU B CB  1 
ATOM   3470 C  CG  . LEU B 2 55  ? 2.316   18.740  61.335 1.00 21.75  ? 87   LEU B CG  1 
ATOM   3471 C  CD1 . LEU B 2 55  ? 0.787   18.874  61.172 1.00 23.30  ? 87   LEU B CD1 1 
ATOM   3472 C  CD2 . LEU B 2 55  ? 2.713   18.481  62.771 1.00 23.35  ? 87   LEU B CD2 1 
ATOM   3473 N  N   . SER B 2 56  ? 5.524   16.426  58.567 1.00 23.82  ? 88   SER B N   1 
ATOM   3474 C  CA  . SER B 2 56  ? 6.052   15.318  57.791 1.00 23.83  ? 88   SER B CA  1 
ATOM   3475 C  C   . SER B 2 56  ? 6.877   14.339  58.670 1.00 24.18  ? 88   SER B C   1 
ATOM   3476 O  O   . SER B 2 56  ? 7.615   14.782  59.559 1.00 25.97  ? 88   SER B O   1 
ATOM   3477 C  CB  . SER B 2 56  ? 6.915   15.863  56.616 1.00 25.19  ? 88   SER B CB  1 
ATOM   3478 O  OG  . SER B 2 56  ? 7.356   14.777  55.793 1.00 28.15  ? 88   SER B OG  1 
ATOM   3479 N  N   . PRO B 2 57  ? 6.770   13.042  58.475 1.00 23.45  ? 89   PRO B N   1 
ATOM   3480 C  CA  . PRO B 2 57  ? 5.972   12.386  57.470 1.00 23.11  ? 89   PRO B CA  1 
ATOM   3481 C  C   . PRO B 2 57  ? 4.515   12.254  57.929 1.00 23.91  ? 89   PRO B C   1 
ATOM   3482 O  O   . PRO B 2 57  ? 4.220   11.998  59.120 1.00 23.60  ? 89   PRO B O   1 
ATOM   3483 C  CB  . PRO B 2 57  ? 6.589   11.006  57.419 1.00 24.83  ? 89   PRO B CB  1 
ATOM   3484 C  CG  . PRO B 2 57  ? 7.077   10.764  58.805 1.00 24.93  ? 89   PRO B CG  1 
ATOM   3485 C  CD  . PRO B 2 57  ? 7.544   12.081  59.275 1.00 24.32  ? 89   PRO B CD  1 
ATOM   3486 N  N   . ALA B 2 58  ? 3.640   12.365  56.968 1.00 20.87  ? 90   ALA B N   1 
ATOM   3487 C  CA  . ALA B 2 58  ? 2.204   12.284  57.203 1.00 19.80  ? 90   ALA B CA  1 
ATOM   3488 C  C   . ALA B 2 58  ? 1.443   12.136  55.919 1.00 22.17  ? 90   ALA B C   1 
ATOM   3489 O  O   . ALA B 2 58  ? 1.881   12.588  54.855 1.00 22.88  ? 90   ALA B O   1 
ATOM   3490 C  CB  . ALA B 2 58  ? 1.750   13.514  57.969 1.00 19.95  ? 90   ALA B CB  1 
ATOM   3491 N  N   . TYR B 2 59  ? 0.242   11.564  56.037 1.00 20.28  ? 91   TYR B N   1 
ATOM   3492 C  CA  . TYR B 2 59  ? -0.717  11.644  54.985 1.00 20.47  ? 91   TYR B CA  1 
ATOM   3493 C  C   . TYR B 2 59  ? -1.451  12.969  55.023 1.00 20.17  ? 91   TYR B C   1 
ATOM   3494 O  O   . TYR B 2 59  ? -1.676  13.537  56.070 1.00 18.59  ? 91   TYR B O   1 
ATOM   3495 C  CB  . TYR B 2 59  ? -1.737  10.485  55.096 1.00 20.24  ? 91   TYR B CB  1 
ATOM   3496 C  CG  . TYR B 2 59  ? -1.159  9.148   54.882 1.00 20.99  ? 91   TYR B CG  1 
ATOM   3497 C  CD1 . TYR B 2 59  ? -0.901  8.687   53.588 1.00 21.03  ? 91   TYR B CD1 1 
ATOM   3498 C  CD2 . TYR B 2 59  ? -0.841  8.335   55.947 1.00 20.43  ? 91   TYR B CD2 1 
ATOM   3499 C  CE1 . TYR B 2 59  ? -0.330  7.454   53.366 1.00 22.13  ? 91   TYR B CE1 1 
ATOM   3500 C  CE2 . TYR B 2 59  ? -0.311  7.087   55.756 1.00 23.74  ? 91   TYR B CE2 1 
ATOM   3501 C  CZ  . TYR B 2 59  ? -0.068  6.633   54.466 1.00 26.05  ? 91   TYR B CZ  1 
ATOM   3502 O  OH  . TYR B 2 59  ? 0.474   5.397   54.326 1.00 27.83  ? 91   TYR B OH  1 
ATOM   3503 N  N   . LEU B 2 60  ? -1.832  13.464  53.832 1.00 20.09  ? 92   LEU B N   1 
ATOM   3504 C  CA  . LEU B 2 60  ? -2.754  14.552  53.699 1.00 20.59  ? 92   LEU B CA  1 
ATOM   3505 C  C   . LEU B 2 60  ? -3.961  13.973  52.990 1.00 21.60  ? 92   LEU B C   1 
ATOM   3506 O  O   . LEU B 2 60  ? -3.887  13.613  51.813 1.00 20.58  ? 92   LEU B O   1 
ATOM   3507 C  CB  . LEU B 2 60  ? -2.150  15.706  52.860 1.00 23.57  ? 92   LEU B CB  1 
ATOM   3508 C  CG  . LEU B 2 60  ? -3.087  16.884  52.620 1.00 25.56  ? 92   LEU B CG  1 
ATOM   3509 C  CD1 . LEU B 2 60  ? -3.286  17.626  53.921 1.00 29.71  ? 92   LEU B CD1 1 
ATOM   3510 C  CD2 . LEU B 2 60  ? -2.470  17.833  51.624 1.00 28.72  ? 92   LEU B CD2 1 
ATOM   3511 N  N   . ARG B 2 61  ? -5.075  13.804  53.703 1.00 20.39  ? 93   ARG B N   1 
ATOM   3512 C  CA  . ARG B 2 61  ? -6.258  13.243  53.123 1.00 21.36  ? 93   ARG B CA  1 
ATOM   3513 C  C   . ARG B 2 61  ? -7.178  14.351  52.665 1.00 20.21  ? 93   ARG B C   1 
ATOM   3514 O  O   . ARG B 2 61  ? -7.578  15.205  53.437 1.00 19.64  ? 93   ARG B O   1 
ATOM   3515 C  CB  . ARG B 2 61  ? -6.965  12.308  54.112 1.00 20.79  ? 93   ARG B CB  1 
ATOM   3516 C  CG  . ARG B 2 61  ? -8.214  11.665  53.555 1.00 22.91  ? 93   ARG B CG  1 
ATOM   3517 C  CD  . ARG B 2 61  ? -9.478  12.350  54.060 1.00 21.37  ? 93   ARG B CD  1 
ATOM   3518 N  NE  . ARG B 2 61  ? -10.688 11.648  53.627 1.00 22.72  ? 93   ARG B NE  1 
ATOM   3519 C  CZ  . ARG B 2 61  ? -11.912 11.931  54.047 1.00 20.45  ? 93   ARG B CZ  1 
ATOM   3520 N  NH1 . ARG B 2 61  ? -12.112 12.903  54.914 1.00 22.79  ? 93   ARG B NH1 1 
ATOM   3521 N  NH2 . ARG B 2 61  ? -12.935 11.214  53.635 1.00 22.27  ? 93   ARG B NH2 1 
ATOM   3522 N  N   . PHE B 2 62  ? -7.484  14.346  51.373 1.00 19.22  ? 94   PHE B N   1 
ATOM   3523 C  CA  . PHE B 2 62  ? -8.417  15.283  50.802 1.00 20.50  ? 94   PHE B CA  1 
ATOM   3524 C  C   . PHE B 2 62  ? -9.792  14.644  50.665 1.00 19.43  ? 94   PHE B C   1 
ATOM   3525 O  O   . PHE B 2 62  ? -10.037 13.800  49.775 1.00 20.85  ? 94   PHE B O   1 
ATOM   3526 C  CB  . PHE B 2 62  ? -7.891  15.751  49.449 1.00 21.25  ? 94   PHE B CB  1 
ATOM   3527 C  CG  . PHE B 2 62  ? -8.803  16.715  48.732 1.00 22.39  ? 94   PHE B CG  1 
ATOM   3528 C  CD1 . PHE B 2 62  ? -8.928  18.026  49.148 1.00 23.98  ? 94   PHE B CD1 1 
ATOM   3529 C  CD2 . PHE B 2 62  ? -9.524  16.291  47.622 1.00 25.28  ? 94   PHE B CD2 1 
ATOM   3530 C  CE1 . PHE B 2 62  ? -9.752  18.925  48.481 1.00 25.07  ? 94   PHE B CE1 1 
ATOM   3531 C  CE2 . PHE B 2 62  ? -10.362 17.187  46.932 1.00 25.19  ? 94   PHE B CE2 1 
ATOM   3532 C  CZ  . PHE B 2 62  ? -10.482 18.504  47.381 1.00 25.22  ? 94   PHE B CZ  1 
ATOM   3533 N  N   . GLY B 2 63  ? -10.733 15.117  51.487 1.00 20.75  ? 95   GLY B N   1 
ATOM   3534 C  CA  . GLY B 2 63  ? -12.035 14.489  51.556 1.00 20.73  ? 95   GLY B CA  1 
ATOM   3535 C  C   . GLY B 2 63  ? -12.922 15.153  52.569 1.00 21.05  ? 95   GLY B C   1 
ATOM   3536 O  O   . GLY B 2 63  ? -12.500 16.079  53.265 1.00 20.55  ? 95   GLY B O   1 
ATOM   3537 N  N   . GLY B 2 64  ? -14.160 14.671  52.658 1.00 21.94  ? 96   GLY B N   1 
ATOM   3538 C  CA  . GLY B 2 64  ? -15.209 15.280  53.486 1.00 21.17  ? 96   GLY B CA  1 
ATOM   3539 C  C   . GLY B 2 64  ? -16.553 15.074  52.821 1.00 22.81  ? 96   GLY B C   1 
ATOM   3540 O  O   . GLY B 2 64  ? -16.621 14.365  51.815 1.00 21.28  ? 96   GLY B O   1 
ATOM   3541 N  N   . THR B 2 65  ? -17.628 15.687  53.343 1.00 21.39  ? 97   THR B N   1 
ATOM   3542 C  CA  . THR B 2 65  ? -18.948 15.504  52.721 1.00 23.54  ? 97   THR B CA  1 
ATOM   3543 C  C   . THR B 2 65  ? -18.904 15.871  51.235 1.00 22.11  ? 97   THR B C   1 
ATOM   3544 O  O   . THR B 2 65  ? -19.423 15.110  50.378 1.00 22.73  ? 97   THR B O   1 
ATOM   3545 C  CB  . THR B 2 65  ? -20.022 16.362  53.429 1.00 24.77  ? 97   THR B CB  1 
ATOM   3546 O  OG1 . THR B 2 65  ? -20.056 15.970  54.801 1.00 24.94  ? 97   THR B OG1 1 
ATOM   3547 C  CG2 . THR B 2 65  ? -21.414 16.155  52.785 1.00 25.16  ? 97   THR B CG2 1 
ATOM   3548 N  N   . LYS B 2 66  ? -18.192 16.959  50.910 1.00 23.69  ? 98   LYS B N   1 
ATOM   3549 C  CA  . LYS B 2 66  ? -18.129 17.402  49.494 1.00 26.43  ? 98   LYS B CA  1 
ATOM   3550 C  C   . LYS B 2 66  ? -17.397 16.454  48.554 1.00 26.00  ? 98   LYS B C   1 
ATOM   3551 O  O   . LYS B 2 66  ? -17.496 16.614  47.325 1.00 26.77  ? 98   LYS B O   1 
ATOM   3552 C  CB  . LYS B 2 66  ? -17.634 18.836  49.366 1.00 29.01  ? 98   LYS B CB  1 
ATOM   3553 C  CG  . LYS B 2 66  ? -18.727 19.802  49.852 1.00 37.06  ? 98   LYS B CG  1 
ATOM   3554 C  CD  . LYS B 2 66  ? -18.640 21.222  49.327 1.00 41.14  ? 98   LYS B CD  1 
ATOM   3555 C  CE  . LYS B 2 66  ? -19.734 22.097  49.947 1.00 45.15  ? 98   LYS B CE  1 
ATOM   3556 N  NZ  . LYS B 2 66  ? -19.547 23.524  49.555 1.00 48.27  ? 98   LYS B NZ  1 
ATOM   3557 N  N   . THR B 2 67  ? -16.710 15.435  49.077 1.00 22.30  ? 99   THR B N   1 
ATOM   3558 C  CA  . THR B 2 67  ? -16.150 14.382  48.237 1.00 22.21  ? 99   THR B CA  1 
ATOM   3559 C  C   . THR B 2 67  ? -17.151 13.863  47.198 1.00 22.58  ? 99   THR B C   1 
ATOM   3560 O  O   . THR B 2 67  ? -16.794 13.628  46.033 1.00 24.82  ? 99   THR B O   1 
ATOM   3561 C  CB  . THR B 2 67  ? -15.706 13.186  49.138 1.00 25.05  ? 99   THR B CB  1 
ATOM   3562 O  OG1 . THR B 2 67  ? -14.540 13.612  49.870 1.00 26.87  ? 99   THR B OG1 1 
ATOM   3563 C  CG2 . THR B 2 67  ? -15.408 11.892  48.329 1.00 23.95  ? 99   THR B CG2 1 
ATOM   3564 N  N   . ASP B 2 68  ? -18.389 13.657  47.642 1.00 22.00  ? 100  ASP B N   1 
ATOM   3565 C  CA  . ASP B 2 68  ? -19.396 13.035  46.829 1.00 24.04  ? 100  ASP B CA  1 
ATOM   3566 C  C   . ASP B 2 68  ? -20.250 14.060  46.090 1.00 26.14  ? 100  ASP B C   1 
ATOM   3567 O  O   . ASP B 2 68  ? -21.300 13.696  45.565 1.00 26.81  ? 100  ASP B O   1 
ATOM   3568 C  CB  . ASP B 2 68  ? -20.209 12.079  47.669 1.00 24.27  ? 100  ASP B CB  1 
ATOM   3569 C  CG  . ASP B 2 68  ? -19.336 11.009  48.293 1.00 27.53  ? 100  ASP B CG  1 
ATOM   3570 O  OD1 . ASP B 2 68  ? -18.717 10.228  47.521 1.00 23.69  ? 100  ASP B OD1 1 
ATOM   3571 O  OD2 . ASP B 2 68  ? -19.169 11.010  49.532 1.00 25.25  ? 100  ASP B OD2 1 
ATOM   3572 N  N   . PHE B 2 69  ? -19.784 15.311  46.045 1.00 28.39  ? 101  PHE B N   1 
ATOM   3573 C  CA  . PHE B 2 69  ? -20.443 16.400  45.307 1.00 29.77  ? 101  PHE B CA  1 
ATOM   3574 C  C   . PHE B 2 69  ? -19.440 17.191  44.478 1.00 29.81  ? 101  PHE B C   1 
ATOM   3575 O  O   . PHE B 2 69  ? -19.691 18.355  44.140 1.00 31.73  ? 101  PHE B O   1 
ATOM   3576 C  CB  . PHE B 2 69  ? -21.213 17.288  46.297 1.00 30.41  ? 101  PHE B CB  1 
ATOM   3577 C  CG  . PHE B 2 69  ? -22.290 16.541  47.029 1.00 31.14  ? 101  PHE B CG  1 
ATOM   3578 C  CD1 . PHE B 2 69  ? -23.541 16.371  46.459 1.00 31.37  ? 101  PHE B CD1 1 
ATOM   3579 C  CD2 . PHE B 2 69  ? -22.035 15.936  48.269 1.00 27.77  ? 101  PHE B CD2 1 
ATOM   3580 C  CE1 . PHE B 2 69  ? -24.522 15.659  47.093 1.00 30.38  ? 101  PHE B CE1 1 
ATOM   3581 C  CE2 . PHE B 2 69  ? -23.026 15.237  48.913 1.00 30.43  ? 101  PHE B CE2 1 
ATOM   3582 C  CZ  . PHE B 2 69  ? -24.272 15.087  48.324 1.00 35.02  ? 101  PHE B CZ  1 
ATOM   3583 N  N   . LEU B 2 70  ? -18.315 16.560  44.145 1.00 27.60  ? 102  LEU B N   1 
ATOM   3584 C  CA  . LEU B 2 70  ? -17.247 17.175  43.351 1.00 29.65  ? 102  LEU B CA  1 
ATOM   3585 C  C   . LEU B 2 70  ? -17.006 16.355  42.119 1.00 30.07  ? 102  LEU B C   1 
ATOM   3586 O  O   . LEU B 2 70  ? -16.864 15.167  42.204 1.00 25.81  ? 102  LEU B O   1 
ATOM   3587 C  CB  . LEU B 2 70  ? -15.934 17.274  44.137 1.00 30.09  ? 102  LEU B CB  1 
ATOM   3588 C  CG  . LEU B 2 70  ? -15.869 18.355  45.206 1.00 30.92  ? 102  LEU B CG  1 
ATOM   3589 C  CD1 . LEU B 2 70  ? -14.558 18.259  45.968 1.00 29.72  ? 102  LEU B CD1 1 
ATOM   3590 C  CD2 . LEU B 2 70  ? -16.057 19.762  44.647 1.00 32.09  ? 102  LEU B CD2 1 
ATOM   3591 N  N   . ILE B 2 71  ? -16.974 17.017  40.968 1.00 31.83  ? 103  ILE B N   1 
ATOM   3592 C  CA  . ILE B 2 71  ? -16.782 16.364  39.679 1.00 32.28  ? 103  ILE B CA  1 
ATOM   3593 C  C   . ILE B 2 71  ? -15.560 17.003  38.983 1.00 30.75  ? 103  ILE B C   1 
ATOM   3594 O  O   . ILE B 2 71  ? -15.423 18.242  38.944 1.00 29.86  ? 103  ILE B O   1 
ATOM   3595 C  CB  . ILE B 2 71  ? -18.077 16.531  38.859 1.00 36.06  ? 103  ILE B CB  1 
ATOM   3596 C  CG1 . ILE B 2 71  ? -19.235 15.803  39.544 1.00 38.78  ? 103  ILE B CG1 1 
ATOM   3597 C  CG2 . ILE B 2 71  ? -17.900 16.010  37.442 1.00 36.63  ? 103  ILE B CG2 1 
ATOM   3598 C  CD1 . ILE B 2 71  ? -20.593 16.330  39.168 1.00 41.82  ? 103  ILE B CD1 1 
ATOM   3599 N  N   . PHE B 2 72  ? -14.660 16.161  38.464 1.00 30.16  ? 104  PHE B N   1 
ATOM   3600 C  CA  . PHE B 2 72  ? -13.468 16.626  37.772 1.00 30.49  ? 104  PHE B CA  1 
ATOM   3601 C  C   . PHE B 2 72  ? -13.976 17.160  36.443 1.00 31.11  ? 104  PHE B C   1 
ATOM   3602 O  O   . PHE B 2 72  ? -14.792 16.522  35.819 1.00 32.56  ? 104  PHE B O   1 
ATOM   3603 C  CB  . PHE B 2 72  ? -12.479 15.492  37.543 1.00 29.84  ? 104  PHE B CB  1 
ATOM   3604 C  CG  . PHE B 2 72  ? -11.183 15.877  36.814 1.00 32.81  ? 104  PHE B CG  1 
ATOM   3605 C  CD1 . PHE B 2 72  ? -10.446 17.010  37.152 1.00 33.30  ? 104  PHE B CD1 1 
ATOM   3606 C  CD2 . PHE B 2 72  ? -10.663 15.036  35.830 1.00 32.95  ? 104  PHE B CD2 1 
ATOM   3607 C  CE1 . PHE B 2 72  ? -9.236  17.294  36.506 1.00 33.49  ? 104  PHE B CE1 1 
ATOM   3608 C  CE2 . PHE B 2 72  ? -9.454  15.310  35.188 1.00 31.89  ? 104  PHE B CE2 1 
ATOM   3609 C  CZ  . PHE B 2 72  ? -8.742  16.437  35.522 1.00 32.01  ? 104  PHE B CZ  1 
ATOM   3610 N  N   . ASP B 2 73  ? -13.517 18.335  36.081 1.00 34.35  ? 105  ASP B N   1 
ATOM   3611 C  CA  . ASP B 2 73  ? -13.773 18.894  34.740 1.00 38.51  ? 105  ASP B CA  1 
ATOM   3612 C  C   . ASP B 2 73  ? -12.440 19.294  34.121 1.00 38.69  ? 105  ASP B C   1 
ATOM   3613 O  O   . ASP B 2 73  ? -11.912 20.347  34.464 1.00 37.55  ? 105  ASP B O   1 
ATOM   3614 C  CB  . ASP B 2 73  ? -14.683 20.102  34.862 1.00 40.41  ? 105  ASP B CB  1 
ATOM   3615 C  CG  . ASP B 2 73  ? -14.924 20.797  33.520 1.00 44.98  ? 105  ASP B CG  1 
ATOM   3616 O  OD1 . ASP B 2 73  ? -14.282 20.433  32.498 1.00 43.01  ? 105  ASP B OD1 1 
ATOM   3617 O  OD2 . ASP B 2 73  ? -15.756 21.710  33.537 1.00 46.71  ? 105  ASP B OD2 1 
ATOM   3618 N  N   . PRO B 2 74  ? -11.902 18.461  33.199 1.00 38.30  ? 106  PRO B N   1 
ATOM   3619 C  CA  . PRO B 2 74  ? -10.631 18.796  32.529 1.00 44.92  ? 106  PRO B CA  1 
ATOM   3620 C  C   . PRO B 2 74  ? -10.673 20.009  31.558 1.00 45.71  ? 106  PRO B C   1 
ATOM   3621 O  O   . PRO B 2 74  ? -9.589  20.461  31.169 1.00 43.77  ? 106  PRO B O   1 
ATOM   3622 C  CB  . PRO B 2 74  ? -10.261 17.506  31.772 1.00 45.31  ? 106  PRO B CB  1 
ATOM   3623 C  CG  . PRO B 2 74  ? -11.530 16.744  31.627 1.00 43.71  ? 106  PRO B CG  1 
ATOM   3624 C  CD  . PRO B 2 74  ? -12.548 17.289  32.593 1.00 40.92  ? 106  PRO B CD  1 
ATOM   3625 N  N   . LYS B 2 75  ? -11.852 20.573  31.244 1.00 47.08  ? 107  LYS B N   1 
ATOM   3626 C  CA  . LYS B 2 75  ? -11.910 21.835  30.447 1.00 56.51  ? 107  LYS B CA  1 
ATOM   3627 C  C   . LYS B 2 75  ? -11.747 23.093  31.312 1.00 60.02  ? 107  LYS B C   1 
ATOM   3628 O  O   . LYS B 2 75  ? -11.336 24.139  30.806 1.00 62.82  ? 107  LYS B O   1 
ATOM   3629 C  CB  . LYS B 2 75  ? -13.210 22.027  29.621 1.00 58.30  ? 107  LYS B CB  1 
ATOM   3630 C  CG  . LYS B 2 75  ? -14.025 20.812  29.210 1.00 63.74  ? 107  LYS B CG  1 
ATOM   3631 C  CD  . LYS B 2 75  ? -13.249 19.730  28.492 1.00 65.67  ? 107  LYS B CD  1 
ATOM   3632 C  CE  . LYS B 2 75  ? -14.204 18.601  28.128 1.00 69.68  ? 107  LYS B CE  1 
ATOM   3633 N  NZ  . LYS B 2 75  ? -13.472 17.335  27.882 1.00 72.89  ? 107  LYS B NZ  1 
ATOM   3634 N  N   . LYS B 2 76  ? -12.105 23.007  32.595 1.00 58.10  ? 108  LYS B N   1 
ATOM   3635 C  CA  . LYS B 2 76  ? -12.158 24.186  33.473 1.00 58.10  ? 108  LYS B CA  1 
ATOM   3636 C  C   . LYS B 2 76  ? -10.768 24.817  33.656 1.00 55.83  ? 108  LYS B C   1 
ATOM   3637 O  O   . LYS B 2 76  ? -9.756  24.129  33.544 1.00 50.13  ? 108  LYS B O   1 
ATOM   3638 C  CB  . LYS B 2 76  ? -12.765 23.790  34.825 1.00 58.25  ? 108  LYS B CB  1 
ATOM   3639 C  CG  . LYS B 2 76  ? -13.077 24.956  35.743 1.00 63.49  ? 108  LYS B CG  1 
ATOM   3640 C  CD  . LYS B 2 76  ? -13.763 24.490  37.018 1.00 63.33  ? 108  LYS B CD  1 
ATOM   3641 C  CE  . LYS B 2 76  ? -14.232 25.677  37.840 1.00 61.34  ? 108  LYS B CE  1 
ATOM   3642 N  NZ  . LYS B 2 76  ? -14.513 25.269  39.233 1.00 61.91  ? 108  LYS B NZ  1 
ATOM   3643 N  N   . GLU B 2 77  ? -10.735 26.127  33.909 1.00 60.72  ? 109  GLU B N   1 
ATOM   3644 C  CA  . GLU B 2 77  ? -9.478  26.892  34.000 1.00 66.75  ? 109  GLU B CA  1 
ATOM   3645 C  C   . GLU B 2 77  ? -9.210  27.390  35.416 1.00 68.70  ? 109  GLU B C   1 
ATOM   3646 O  O   . GLU B 2 77  ? -10.140 27.656  36.169 1.00 67.86  ? 109  GLU B O   1 
ATOM   3647 C  CB  . GLU B 2 77  ? -9.517  28.095  33.047 1.00 73.80  ? 109  GLU B CB  1 
ATOM   3648 C  CG  . GLU B 2 77  ? -9.730  27.756  31.572 1.00 78.13  ? 109  GLU B CG  1 
ATOM   3649 C  CD  . GLU B 2 77  ? -8.658  26.838  30.994 1.00 82.64  ? 109  GLU B CD  1 
ATOM   3650 O  OE1 . GLU B 2 77  ? -7.457  27.018  31.307 1.00 85.71  ? 109  GLU B OE1 1 
ATOM   3651 O  OE2 . GLU B 2 77  ? -9.019  25.929  30.220 1.00 82.90  ? 109  GLU B OE2 1 
ATOM   3652 O  OXT . GLU B 2 77  ? -8.058  27.556  35.833 1.00 71.12  ? 109  GLU B OXT 1 
HETATM 3653 C  C1  . BDP C 3 .   ? -18.088 15.478  58.594 1.00 24.01  ? 1    BDP C C1  1 
HETATM 3654 C  C2  . BDP C 3 .   ? -17.703 15.748  57.164 1.00 21.99  ? 1    BDP C C2  1 
HETATM 3655 C  C3  . BDP C 3 .   ? -16.899 17.057  57.009 1.00 22.77  ? 1    BDP C C3  1 
HETATM 3656 C  C4  . BDP C 3 .   ? -17.611 18.160  57.774 1.00 23.35  ? 1    BDP C C4  1 
HETATM 3657 C  C5  . BDP C 3 .   ? -17.703 17.714  59.223 1.00 23.16  ? 1    BDP C C5  1 
HETATM 3658 C  C6  . BDP C 3 .   ? -18.234 18.729  60.160 1.00 23.41  ? 1    BDP C C6  1 
HETATM 3659 O  O2  . BDP C 3 .   ? -17.045 14.607  56.658 1.00 21.45  ? 1    BDP C O2  1 
HETATM 3660 O  O3  . BDP C 3 .   ? -16.771 17.387  55.608 1.00 21.60  ? 1    BDP C O3  1 
HETATM 3661 O  O4  . BDP C 3 .   ? -16.977 19.450  57.798 1.00 23.37  ? 1    BDP C O4  1 
HETATM 3662 O  O5  . BDP C 3 .   ? -18.617 16.629  59.249 1.00 25.19  ? 1    BDP C O5  1 
HETATM 3663 O  O6A . BDP C 3 .   ? -19.489 18.823  60.393 1.00 24.73  ? 1    BDP C O6A 1 
HETATM 3664 O  O6B . BDP C 3 .   ? -17.386 19.469  60.714 1.00 22.14  ? 1    BDP C O6B 1 
HETATM 3665 C  C1  . NDG C 3 .   ? -17.255 20.266  56.641 1.00 23.22  ? 2    NDG C C1  1 
HETATM 3666 C  C2  . NDG C 3 .   ? -16.640 21.611  56.876 1.00 23.92  ? 2    NDG C C2  1 
HETATM 3667 C  C3  . NDG C 3 .   ? -17.346 22.370  57.979 1.00 25.72  ? 2    NDG C C3  1 
HETATM 3668 C  C4  . NDG C 3 .   ? -18.858 22.395  57.715 1.00 27.23  ? 2    NDG C C4  1 
HETATM 3669 C  C5  . NDG C 3 .   ? -19.367 20.987  57.532 1.00 25.93  ? 2    NDG C C5  1 
HETATM 3670 C  C6  . NDG C 3 .   ? -20.872 20.928  57.251 1.00 29.11  ? 2    NDG C C6  1 
HETATM 3671 C  C7  . NDG C 3 .   ? -14.279 22.079  56.508 1.00 23.53  ? 2    NDG C C7  1 
HETATM 3672 C  C8  . NDG C 3 .   ? -12.897 22.031  57.081 1.00 21.89  ? 2    NDG C C8  1 
HETATM 3673 O  O5  . NDG C 3 .   ? -18.665 20.380  56.452 1.00 25.59  ? 2    NDG C O5  1 
HETATM 3674 O  O3  . NDG C 3 .   ? -16.796 23.685  58.029 1.00 25.55  ? 2    NDG C O3  1 
HETATM 3675 O  O4  . NDG C 3 .   ? -19.539 22.980  58.816 1.00 30.63  ? 2    NDG C O4  1 
HETATM 3676 O  O6  . NDG C 3 .   ? -21.096 21.612  56.009 1.00 33.84  ? 2    NDG C O6  1 
HETATM 3677 O  O7  . NDG C 3 .   ? -14.504 22.651  55.418 1.00 22.57  ? 2    NDG C O7  1 
HETATM 3678 N  N2  . NDG C 3 .   ? -15.247 21.509  57.225 1.00 23.59  ? 2    NDG C N2  1 
HETATM 3679 C  C1  . BDP C 3 .   ? -19.995 24.303  58.585 1.00 35.38  ? 3    BDP C C1  1 
HETATM 3680 C  C2  . BDP C 3 .   ? -21.241 24.512  59.410 1.00 38.60  ? 3    BDP C C2  1 
HETATM 3681 C  C3  . BDP C 3 .   ? -21.735 25.926  59.282 1.00 41.83  ? 3    BDP C C3  1 
HETATM 3682 C  C4  . BDP C 3 .   ? -20.641 26.947  59.518 1.00 47.93  ? 3    BDP C C4  1 
HETATM 3683 C  C5  . BDP C 3 .   ? -19.350 26.563  58.775 1.00 45.87  ? 3    BDP C C5  1 
HETATM 3684 C  C6  . BDP C 3 .   ? -18.196 27.416  59.172 1.00 45.97  ? 3    BDP C C6  1 
HETATM 3685 O  O2  . BDP C 3 .   ? -22.313 23.705  58.965 1.00 40.51  ? 3    BDP C O2  1 
HETATM 3686 O  O3  . BDP C 3 .   ? -22.717 26.025  60.288 1.00 40.79  ? 3    BDP C O3  1 
HETATM 3687 O  O4  . BDP C 3 .   ? -21.084 28.208  59.020 1.00 62.65  ? 3    BDP C O4  1 
HETATM 3688 O  O5  . BDP C 3 .   ? -18.977 25.210  59.028 1.00 37.52  ? 3    BDP C O5  1 
HETATM 3689 O  O6A . BDP C 3 .   ? -17.684 28.091  58.260 1.00 47.61  ? 3    BDP C O6A 1 
HETATM 3690 O  O6B . BDP C 3 .   ? -17.779 27.404  60.363 1.00 47.12  ? 3    BDP C O6B 1 
HETATM 3691 C  C1  . NDG C 3 .   ? -21.998 28.988  59.815 1.00 71.16  ? 4    NDG C C1  1 
HETATM 3692 C  C2  . NDG C 3 .   ? -22.635 30.103  58.964 1.00 71.59  ? 4    NDG C C2  1 
HETATM 3693 C  C3  . NDG C 3 .   ? -21.511 30.985  58.405 1.00 70.75  ? 4    NDG C C3  1 
HETATM 3694 C  C4  . NDG C 3 .   ? -20.771 31.591  59.590 1.00 72.95  ? 4    NDG C C4  1 
HETATM 3695 C  C5  . NDG C 3 .   ? -20.248 30.500  60.539 1.00 73.65  ? 4    NDG C C5  1 
HETATM 3696 C  C6  . NDG C 3 .   ? -19.662 31.128  61.801 1.00 75.58  ? 4    NDG C C6  1 
HETATM 3697 C  C7  . NDG C 3 .   ? -23.366 28.993  56.799 1.00 80.46  ? 4    NDG C C7  1 
HETATM 3698 C  C8  . NDG C 3 .   ? -24.562 28.672  55.943 1.00 79.98  ? 4    NDG C C8  1 
HETATM 3699 O  O5  . NDG C 3 .   ? -21.283 29.571  60.918 1.00 72.52  ? 4    NDG C O5  1 
HETATM 3700 O  O3  . NDG C 3 .   ? -22.006 32.035  57.580 1.00 71.00  ? 4    NDG C O3  1 
HETATM 3701 O  O4  . NDG C 3 .   ? -19.684 32.399  59.121 1.00 74.30  ? 4    NDG C O4  1 
HETATM 3702 O  O6  . NDG C 3 .   ? -18.246 31.217  61.655 1.00 70.33  ? 4    NDG C O6  1 
HETATM 3703 O  O7  . NDG C 3 .   ? -22.264 28.661  56.389 1.00 79.86  ? 4    NDG C O7  1 
HETATM 3704 N  N2  . NDG C 3 .   ? -23.612 29.638  57.966 1.00 74.99  ? 4    NDG C N2  1 
HETATM 3705 C  C1  . NAG D 4 .   ? -24.668 15.387  40.840 1.00 66.72  ? 601  NAG A C1  1 
HETATM 3706 C  C2  . NAG D 4 .   ? -26.198 15.560  40.911 1.00 71.39  ? 601  NAG A C2  1 
HETATM 3707 C  C3  . NAG D 4 .   ? -26.929 14.257  40.550 1.00 74.57  ? 601  NAG A C3  1 
HETATM 3708 C  C4  . NAG D 4 .   ? -26.436 13.716  39.203 1.00 75.07  ? 601  NAG A C4  1 
HETATM 3709 C  C5  . NAG D 4 .   ? -24.910 13.535  39.209 1.00 74.63  ? 601  NAG A C5  1 
HETATM 3710 C  C6  . NAG D 4 .   ? -24.356 13.134  37.830 1.00 76.17  ? 601  NAG A C6  1 
HETATM 3711 C  C7  . NAG D 4 .   ? -26.962 17.246  42.573 1.00 75.29  ? 601  NAG A C7  1 
HETATM 3712 C  C8  . NAG D 4 .   ? -27.284 17.444  44.026 1.00 70.82  ? 601  NAG A C8  1 
HETATM 3713 N  N2  . NAG D 4 .   ? -26.579 16.002  42.247 1.00 74.07  ? 601  NAG A N2  1 
HETATM 3714 O  O3  . NAG D 4 .   ? -28.349 14.469  40.501 1.00 69.46  ? 601  NAG A O3  1 
HETATM 3715 O  O4  . NAG D 4 .   ? -27.098 12.480  38.899 1.00 79.99  ? 601  NAG A O4  1 
HETATM 3716 O  O5  . NAG D 4 .   ? -24.252 14.742  39.627 1.00 70.59  ? 601  NAG A O5  1 
HETATM 3717 O  O6  . NAG D 4 .   ? -23.659 14.221  37.189 1.00 73.68  ? 601  NAG A O6  1 
HETATM 3718 O  O7  . NAG D 4 .   ? -27.054 18.172  41.778 1.00 75.90  ? 601  NAG A O7  1 
HETATM 3719 C  C1  . NAG E 4 .   ? -21.346 7.699   33.235 1.00 55.49  ? 602  NAG A C1  1 
HETATM 3720 C  C2  . NAG E 4 .   ? -22.298 7.139   32.166 1.00 60.83  ? 602  NAG A C2  1 
HETATM 3721 C  C3  . NAG E 4 .   ? -22.028 7.808   30.811 1.00 62.53  ? 602  NAG A C3  1 
HETATM 3722 C  C4  . NAG E 4 .   ? -22.224 9.316   30.964 1.00 62.31  ? 602  NAG A C4  1 
HETATM 3723 C  C5  . NAG E 4 .   ? -21.373 9.865   32.110 1.00 61.36  ? 602  NAG A C5  1 
HETATM 3724 C  C6  . NAG E 4 .   ? -21.801 11.294  32.424 1.00 61.86  ? 602  NAG A C6  1 
HETATM 3725 C  C7  . NAG E 4 .   ? -23.162 4.820   32.395 1.00 55.54  ? 602  NAG A C7  1 
HETATM 3726 C  C8  . NAG E 4 .   ? -22.804 3.367   32.213 1.00 55.93  ? 602  NAG A C8  1 
HETATM 3727 N  N2  . NAG E 4 .   ? -22.178 5.679   32.073 1.00 59.33  ? 602  NAG A N2  1 
HETATM 3728 O  O3  . NAG E 4 .   ? -22.899 7.274   29.789 1.00 66.82  ? 602  NAG A O3  1 
HETATM 3729 O  O4  . NAG E 4 .   ? -21.891 10.010  29.751 1.00 61.91  ? 602  NAG A O4  1 
HETATM 3730 O  O5  . NAG E 4 .   ? -21.527 9.112   33.326 1.00 56.48  ? 602  NAG A O5  1 
HETATM 3731 O  O6  . NAG E 4 .   ? -20.641 12.091  32.614 1.00 64.48  ? 602  NAG A O6  1 
HETATM 3732 O  O7  . NAG E 4 .   ? -24.271 5.169   32.798 1.00 53.09  ? 602  NAG A O7  1 
HETATM 3733 C  C1  . NAG F 4 .   ? -27.450 -4.240  47.520 1.00 48.57  ? 603  NAG A C1  1 
HETATM 3734 C  C2  . NAG F 4 .   ? -28.454 -5.381  47.452 1.00 55.88  ? 603  NAG A C2  1 
HETATM 3735 C  C3  . NAG F 4 .   ? -28.558 -5.968  46.031 1.00 60.37  ? 603  NAG A C3  1 
HETATM 3736 C  C4  . NAG F 4 .   ? -28.862 -4.842  45.039 1.00 59.73  ? 603  NAG A C4  1 
HETATM 3737 C  C5  . NAG F 4 .   ? -27.729 -3.820  45.131 1.00 56.98  ? 603  NAG A C5  1 
HETATM 3738 C  C6  . NAG F 4 .   ? -27.907 -2.617  44.206 1.00 57.22  ? 603  NAG A C6  1 
HETATM 3739 C  C7  . NAG F 4 .   ? -28.602 -6.582  49.610 1.00 53.53  ? 603  NAG A C7  1 
HETATM 3740 C  C8  . NAG F 4 .   ? -27.927 -7.633  50.455 1.00 55.38  ? 603  NAG A C8  1 
HETATM 3741 N  N2  . NAG F 4 .   ? -28.006 -6.353  48.433 1.00 53.21  ? 603  NAG A N2  1 
HETATM 3742 O  O3  . NAG F 4 .   ? -29.566 -6.990  46.001 1.00 66.91  ? 603  NAG A O3  1 
HETATM 3743 O  O4  . NAG F 4 .   ? -29.011 -5.317  43.695 1.00 68.92  ? 603  NAG A O4  1 
HETATM 3744 O  O5  . NAG F 4 .   ? -27.675 -3.316  46.471 1.00 51.26  ? 603  NAG A O5  1 
HETATM 3745 O  O6  . NAG F 4 .   ? -29.065 -1.848  44.575 1.00 56.96  ? 603  NAG A O6  1 
HETATM 3746 O  O7  . NAG F 4 .   ? -29.614 -5.997  49.981 1.00 50.64  ? 603  NAG A O7  1 
HETATM 3747 C  C1  . NAG G 4 .   ? -11.845 21.503  92.725 1.00 42.30  ? 604  NAG A C1  1 
HETATM 3748 C  C2  . NAG G 4 .   ? -11.680 22.811  93.554 1.00 44.70  ? 604  NAG A C2  1 
HETATM 3749 C  C3  . NAG G 4 .   ? -12.416 22.658  94.905 1.00 50.26  ? 604  NAG A C3  1 
HETATM 3750 C  C4  . NAG G 4 .   ? -13.899 22.389  94.607 1.00 50.90  ? 604  NAG A C4  1 
HETATM 3751 C  C5  . NAG G 4 .   ? -14.067 21.126  93.743 1.00 54.01  ? 604  NAG A C5  1 
HETATM 3752 C  C6  . NAG G 4 .   ? -15.574 20.938  93.505 1.00 53.67  ? 604  NAG A C6  1 
HETATM 3753 C  C7  . NAG G 4 .   ? -9.600  24.108  92.997 1.00 46.92  ? 604  NAG A C7  1 
HETATM 3754 C  C8  . NAG G 4 .   ? -8.108  24.246  93.220 1.00 41.96  ? 604  NAG A C8  1 
HETATM 3755 N  N2  . NAG G 4 .   ? -10.248 23.127  93.687 1.00 43.39  ? 604  NAG A N2  1 
HETATM 3756 O  O3  . NAG G 4 .   ? -12.269 23.811  95.774 1.00 51.66  ? 604  NAG A O3  1 
HETATM 3757 O  O4  . NAG G 4 .   ? -14.673 22.279  95.812 1.00 55.12  ? 604  NAG A O4  1 
HETATM 3758 O  O5  . NAG G 4 .   ? -13.271 21.264  92.529 1.00 49.72  ? 604  NAG A O5  1 
HETATM 3759 O  O6  . NAG G 4 .   ? -15.892 20.156  92.359 1.00 62.70  ? 604  NAG A O6  1 
HETATM 3760 O  O7  . NAG G 4 .   ? -10.152 24.875  92.211 1.00 43.74  ? 604  NAG A O7  1 
HETATM 3761 CL CL  . CL  H 5 .   ? -25.688 -1.729  54.342 1.00 32.48  ? 605  CL  A CL  1 
HETATM 3762 CL CL  . CL  I 5 .   ? -11.459 14.608  91.235 1.00 55.50  ? 606  CL  A CL  1 
HETATM 3763 CL CL  . CL  J 5 .   ? -19.039 10.029  62.461 1.00 53.44  ? 607  CL  A CL  1 
HETATM 3764 C  C1  . NPO K 6 .   ? -20.811 13.001  62.068 1.00 31.25  ? 612  NPO A C1  1 
HETATM 3765 C  C2  . NPO K 6 .   ? -19.711 13.820  62.176 1.00 27.61  ? 612  NPO A C2  1 
HETATM 3766 C  C3  . NPO K 6 .   ? -19.152 14.367  61.028 1.00 25.69  ? 612  NPO A C3  1 
HETATM 3767 C  C4  . NPO K 6 .   ? -19.684 14.072  59.786 1.00 25.51  ? 612  NPO A C4  1 
HETATM 3768 C  C5  . NPO K 6 .   ? -20.819 13.282  59.681 1.00 28.07  ? 612  NPO A C5  1 
HETATM 3769 C  C6  . NPO K 6 .   ? -21.377 12.742  60.810 1.00 30.96  ? 612  NPO A C6  1 
HETATM 3770 O  OH  . NPO K 6 .   ? -19.181 14.570  58.605 1.00 27.45  ? 612  NPO A OH  1 
HETATM 3771 N  N1  . NPO K 6 .   ? -21.367 12.449  63.225 1.00 36.26  ? 612  NPO A N1  1 
HETATM 3772 O  O2  . NPO K 6 .   ? -22.615 11.928  63.091 1.00 42.22  ? 612  NPO A O2  1 
HETATM 3773 O  O3  . NPO K 6 .   ? -20.637 12.383  64.420 1.00 39.39  ? 612  NPO A O3  1 
HETATM 3774 CL CL  . CL  L 5 .   ? 7.092   26.481  49.489 1.00 75.29  ? 201  CL  B CL  1 
HETATM 3775 O  O   . HOH M 7 .   ? -7.285  -1.507  82.866 1.00 18.56  ? 701  HOH A O   1 
HETATM 3776 O  O   . HOH M 7 .   ? -8.700  -11.359 65.355 1.00 34.97  ? 702  HOH A O   1 
HETATM 3777 O  O   . HOH M 7 .   ? -8.170  -0.953  88.038 1.00 53.19  ? 703  HOH A O   1 
HETATM 3778 O  O   . HOH M 7 .   ? -25.898 4.669   59.964 1.00 33.02  ? 704  HOH A O   1 
HETATM 3779 O  O   . HOH M 7 .   ? -16.820 23.370  95.697 1.00 63.35  ? 705  HOH A O   1 
HETATM 3780 O  O   . HOH M 7 .   ? -17.459 -5.082  41.025 1.00 46.87  ? 706  HOH A O   1 
HETATM 3781 O  O   . HOH M 7 .   ? -17.219 12.119  58.616 1.00 28.25  ? 707  HOH A O   1 
HETATM 3782 O  O   . HOH M 7 .   ? -9.723  8.857   55.115 1.00 23.63  ? 708  HOH A O   1 
HETATM 3783 O  O   . HOH M 7 .   ? 6.054   34.585  65.038 1.00 39.26  ? 709  HOH A O   1 
HETATM 3784 O  O   . HOH M 7 .   ? 6.558   10.876  65.667 1.00 36.92  ? 710  HOH A O   1 
HETATM 3785 O  O   . HOH M 7 .   ? 1.777   23.078  90.587 1.00 31.22  ? 711  HOH A O   1 
HETATM 3786 O  O   . HOH M 7 .   ? 18.240  10.277  67.626 1.00 48.72  ? 712  HOH A O   1 
HETATM 3787 O  O   . HOH M 7 .   ? -10.560 34.145  71.307 1.00 39.96  ? 713  HOH A O   1 
HETATM 3788 O  O   . HOH M 7 .   ? 15.168  22.426  85.140 1.00 54.43  ? 714  HOH A O   1 
HETATM 3789 O  O   . HOH M 7 .   ? 5.329   5.130   45.594 1.00 60.10  ? 715  HOH A O   1 
HETATM 3790 O  O   . HOH M 7 .   ? 2.008   -0.923  61.782 1.00 30.93  ? 716  HOH A O   1 
HETATM 3791 O  O   . HOH M 7 .   ? -3.644  34.641  63.734 1.00 42.16  ? 717  HOH A O   1 
HETATM 3792 O  O   . HOH M 7 .   ? -22.837 18.676  75.011 1.00 33.20  ? 718  HOH A O   1 
HETATM 3793 O  O   . HOH M 7 .   ? 3.287   10.283  48.264 1.00 42.08  ? 719  HOH A O   1 
HETATM 3794 O  O   . HOH M 7 .   ? -19.095 27.399  71.794 1.00 34.80  ? 720  HOH A O   1 
HETATM 3795 O  O   . HOH M 7 .   ? -7.112  8.660   86.544 1.00 33.83  ? 721  HOH A O   1 
HETATM 3796 O  O   . HOH M 7 .   ? -22.512 -1.075  66.524 1.00 46.08  ? 722  HOH A O   1 
HETATM 3797 O  O   . HOH M 7 .   ? -12.156 32.563  68.160 1.00 48.39  ? 723  HOH A O   1 
HETATM 3798 O  O   . HOH M 7 .   ? 2.428   9.093   54.835 1.00 24.52  ? 724  HOH A O   1 
HETATM 3799 O  O   . HOH M 7 .   ? -22.779 18.676  72.005 1.00 34.95  ? 725  HOH A O   1 
HETATM 3800 O  O   . HOH M 7 .   ? -16.534 3.945   75.854 1.00 26.51  ? 726  HOH A O   1 
HETATM 3801 O  O   . HOH M 7 .   ? 4.184   35.561  74.683 1.00 32.82  ? 727  HOH A O   1 
HETATM 3802 O  O   . HOH M 7 .   ? -8.759  19.010  69.286 1.00 16.63  ? 728  HOH A O   1 
HETATM 3803 O  O   . HOH M 7 .   ? 7.029   16.591  42.456 1.00 58.28  ? 729  HOH A O   1 
HETATM 3804 O  O   . HOH M 7 .   ? 19.056  10.240  75.670 1.00 27.15  ? 730  HOH A O   1 
HETATM 3805 O  O   . HOH M 7 .   ? 3.260   25.514  84.805 1.00 28.96  ? 731  HOH A O   1 
HETATM 3806 O  O   . HOH M 7 .   ? 18.475  16.478  79.190 1.00 32.47  ? 732  HOH A O   1 
HETATM 3807 O  O   . HOH M 7 .   ? -10.705 10.128  73.976 1.00 18.27  ? 733  HOH A O   1 
HETATM 3808 O  O   . HOH M 7 .   ? -3.009  -5.776  61.753 1.00 39.60  ? 734  HOH A O   1 
HETATM 3809 O  O   . HOH M 7 .   ? -11.329 30.577  70.121 1.00 34.18  ? 735  HOH A O   1 
HETATM 3810 O  O   . HOH M 7 .   ? -0.721  4.988   46.590 1.00 34.90  ? 736  HOH A O   1 
HETATM 3811 O  O   . HOH M 7 .   ? -1.632  2.307   32.310 1.00 49.17  ? 737  HOH A O   1 
HETATM 3812 O  O   . HOH M 7 .   ? -23.443 20.655  63.697 1.00 50.91  ? 738  HOH A O   1 
HETATM 3813 O  O   . HOH M 7 .   ? -11.426 26.245  95.176 1.00 51.22  ? 739  HOH A O   1 
HETATM 3814 O  O   . HOH M 7 .   ? -4.646  -1.372  62.668 1.00 22.83  ? 740  HOH A O   1 
HETATM 3815 O  O   . HOH M 7 .   ? -7.478  -5.445  62.535 1.00 41.50  ? 741  HOH A O   1 
HETATM 3816 O  O   . HOH M 7 .   ? -8.086  12.550  31.633 1.00 41.76  ? 742  HOH A O   1 
HETATM 3817 O  O   . HOH M 7 .   ? -1.708  19.525  94.052 1.00 30.06  ? 743  HOH A O   1 
HETATM 3818 O  O   . HOH M 7 .   ? -18.330 7.435   78.939 1.00 33.31  ? 744  HOH A O   1 
HETATM 3819 O  O   . HOH M 7 .   ? -19.964 3.439   70.916 1.00 38.34  ? 745  HOH A O   1 
HETATM 3820 O  O   . HOH M 7 .   ? -9.852  29.748  64.851 1.00 28.93  ? 746  HOH A O   1 
HETATM 3821 O  O   . HOH M 7 .   ? 19.276  9.123   82.331 1.00 26.99  ? 747  HOH A O   1 
HETATM 3822 O  O   . HOH M 7 .   ? 21.548  14.072  84.327 1.00 39.91  ? 748  HOH A O   1 
HETATM 3823 O  O   . HOH M 7 .   ? -12.133 17.602  84.249 1.00 27.22  ? 749  HOH A O   1 
HETATM 3824 O  O   . HOH M 7 .   ? -13.085 -1.211  36.804 1.00 33.08  ? 750  HOH A O   1 
HETATM 3825 O  O   . HOH M 7 .   ? 19.565  17.412  85.402 1.00 43.58  ? 751  HOH A O   1 
HETATM 3826 O  O   . HOH M 7 .   ? -20.491 25.000  71.409 1.00 29.03  ? 752  HOH A O   1 
HETATM 3827 O  O   . HOH M 7 .   ? -16.606 26.777  64.700 1.00 31.06  ? 753  HOH A O   1 
HETATM 3828 O  O   . HOH M 7 .   ? -1.283  31.618  66.181 1.00 48.81  ? 754  HOH A O   1 
HETATM 3829 O  O   . HOH M 7 .   ? -25.545 4.286   51.368 1.00 24.93  ? 755  HOH A O   1 
HETATM 3830 O  O   . HOH M 7 .   ? -22.087 6.444   61.563 1.00 28.60  ? 756  HOH A O   1 
HETATM 3831 O  O   . HOH M 7 .   ? 5.890   34.033  60.890 1.00 49.47  ? 757  HOH A O   1 
HETATM 3832 O  O   . HOH M 7 .   ? -10.511 20.615  67.916 1.00 17.55  ? 758  HOH A O   1 
HETATM 3833 O  O   . HOH M 7 .   ? -10.572 -12.759 63.667 1.00 31.82  ? 759  HOH A O   1 
HETATM 3834 O  O   . HOH M 7 .   ? 8.246   33.178  72.632 1.00 35.61  ? 760  HOH A O   1 
HETATM 3835 O  O   . HOH M 7 .   ? -3.292  24.749  82.128 1.00 24.57  ? 761  HOH A O   1 
HETATM 3836 O  O   . HOH M 7 .   ? -0.381  0.385   56.596 1.00 32.26  ? 762  HOH A O   1 
HETATM 3837 O  O   . HOH M 7 .   ? 3.772   36.293  59.206 1.00 43.98  ? 763  HOH A O   1 
HETATM 3838 O  O   . HOH M 7 .   ? -4.660  -6.166  54.037 1.00 41.72  ? 764  HOH A O   1 
HETATM 3839 O  O   . HOH M 7 .   ? -13.086 -8.161  48.231 1.00 39.84  ? 765  HOH A O   1 
HETATM 3840 O  O   . HOH M 7 .   ? -10.551 18.569  74.747 1.00 16.97  ? 766  HOH A O   1 
HETATM 3841 O  O   . HOH M 7 .   ? -6.903  33.020  82.703 1.00 25.88  ? 767  HOH A O   1 
HETATM 3842 O  O   . HOH M 7 .   ? -20.484 24.518  65.523 1.00 38.19  ? 768  HOH A O   1 
HETATM 3843 O  O   . HOH M 7 .   ? -12.383 14.201  48.154 1.00 26.76  ? 769  HOH A O   1 
HETATM 3844 O  O   . HOH M 7 .   ? 11.258  -4.107  69.521 1.00 37.78  ? 770  HOH A O   1 
HETATM 3845 O  O   . HOH M 7 .   ? -6.571  3.230   34.800 1.00 36.81  ? 771  HOH A O   1 
HETATM 3846 O  O   . HOH M 7 .   ? -23.020 11.099  58.209 1.00 38.36  ? 772  HOH A O   1 
HETATM 3847 O  O   . HOH M 7 .   ? -15.316 -9.812  66.281 1.00 33.69  ? 773  HOH A O   1 
HETATM 3848 O  O   . HOH M 7 .   ? -3.292  5.174   39.797 1.00 46.51  ? 774  HOH A O   1 
HETATM 3849 O  O   . HOH M 7 .   ? 14.149  10.882  87.497 1.00 34.78  ? 775  HOH A O   1 
HETATM 3850 O  O   . HOH M 7 .   ? -15.373 29.337  58.933 1.00 39.19  ? 776  HOH A O   1 
HETATM 3851 O  O   . HOH M 7 .   ? 16.279  -0.360  81.376 1.00 37.80  ? 777  HOH A O   1 
HETATM 3852 O  O   . HOH M 7 .   ? -7.854  27.656  58.560 1.00 24.74  ? 778  HOH A O   1 
HETATM 3853 O  O   . HOH M 7 .   ? -3.831  22.350  72.126 1.00 21.73  ? 779  HOH A O   1 
HETATM 3854 O  O   . HOH M 7 .   ? -19.624 17.248  80.123 1.00 31.63  ? 780  HOH A O   1 
HETATM 3855 O  O   . HOH M 7 .   ? -19.388 -1.168  40.726 1.00 36.67  ? 781  HOH A O   1 
HETATM 3856 O  O   . HOH M 7 .   ? -1.921  1.324   67.236 1.00 17.26  ? 782  HOH A O   1 
HETATM 3857 O  O   . HOH M 7 .   ? -16.284 8.409   38.484 1.00 30.26  ? 783  HOH A O   1 
HETATM 3858 O  O   . HOH M 7 .   ? -3.582  3.831   81.623 1.00 22.13  ? 784  HOH A O   1 
HETATM 3859 O  O   . HOH M 7 .   ? -12.430 24.116  54.421 1.00 20.41  ? 785  HOH A O   1 
HETATM 3860 O  O   . HOH M 7 .   ? -10.162 22.321  54.532 1.00 20.18  ? 786  HOH A O   1 
HETATM 3861 O  O   . HOH M 7 .   ? -6.459  6.709   79.217 1.00 24.47  ? 787  HOH A O   1 
HETATM 3862 O  O   . HOH M 7 .   ? -21.397 -8.165  51.556 1.00 33.12  ? 788  HOH A O   1 
HETATM 3863 O  O   . HOH M 7 .   ? -17.229 13.705  84.692 1.00 39.26  ? 789  HOH A O   1 
HETATM 3864 O  O   . HOH M 7 .   ? -17.627 7.737   70.371 1.00 30.99  ? 790  HOH A O   1 
HETATM 3865 O  O   . HOH M 7 .   ? 3.529   28.394  81.174 1.00 33.51  ? 791  HOH A O   1 
HETATM 3866 O  O   . HOH M 7 .   ? -4.342  4.413   84.491 1.00 26.01  ? 792  HOH A O   1 
HETATM 3867 O  O   . HOH M 7 .   ? -4.778  25.059  85.245 1.00 30.34  ? 793  HOH A O   1 
HETATM 3868 O  O   . HOH M 7 .   ? -14.606 11.827  40.401 1.00 30.09  ? 794  HOH A O   1 
HETATM 3869 O  O   . HOH M 7 .   ? -4.063  -3.936  55.946 1.00 27.68  ? 795  HOH A O   1 
HETATM 3870 O  O   . HOH M 7 .   ? -11.682 18.187  87.437 1.00 29.31  ? 796  HOH A O   1 
HETATM 3871 O  O   . HOH M 7 .   ? -15.581 -0.162  75.147 1.00 32.71  ? 797  HOH A O   1 
HETATM 3872 O  O   . HOH M 7 .   ? 10.909  29.182  79.750 1.00 37.42  ? 798  HOH A O   1 
HETATM 3873 O  O   . HOH M 7 .   ? -13.790 8.308   31.296 1.00 33.84  ? 799  HOH A O   1 
HETATM 3874 O  O   . HOH M 7 .   ? -7.695  -4.274  36.210 1.00 41.68  ? 800  HOH A O   1 
HETATM 3875 O  O   . HOH M 7 .   ? 5.051   11.830  54.259 1.00 26.39  ? 801  HOH A O   1 
HETATM 3876 O  O   . HOH M 7 .   ? -19.092 -3.907  66.379 1.00 34.46  ? 802  HOH A O   1 
HETATM 3877 O  O   . HOH M 7 .   ? -0.951  1.692   52.911 1.00 39.35  ? 803  HOH A O   1 
HETATM 3878 O  O   . HOH M 7 .   ? -14.383 13.836  42.253 1.00 30.48  ? 804  HOH A O   1 
HETATM 3879 O  O   . HOH M 7 .   ? 5.391   14.093  49.303 1.00 42.47  ? 805  HOH A O   1 
HETATM 3880 O  O   . HOH M 7 .   ? -8.766  32.868  72.620 1.00 28.00  ? 806  HOH A O   1 
HETATM 3881 O  O   . HOH M 7 .   ? -1.293  29.133  82.029 1.00 31.07  ? 807  HOH A O   1 
HETATM 3882 O  O   . HOH M 7 .   ? -18.511 8.963   36.170 1.00 37.58  ? 808  HOH A O   1 
HETATM 3883 O  O   . HOH M 7 .   ? -27.097 -0.660  46.946 1.00 34.16  ? 809  HOH A O   1 
HETATM 3884 O  O   . HOH M 7 .   ? -17.761 2.426   61.867 1.00 40.30  ? 810  HOH A O   1 
HETATM 3885 O  O   . HOH M 7 .   ? -5.300  5.741   34.676 1.00 41.86  ? 811  HOH A O   1 
HETATM 3886 O  O   . HOH M 7 .   ? 9.783   9.769   89.392 1.00 33.23  ? 812  HOH A O   1 
HETATM 3887 O  O   . HOH M 7 .   ? -18.038 0.414   38.715 1.00 38.90  ? 813  HOH A O   1 
HETATM 3888 O  O   . HOH M 7 .   ? -11.437 24.688  60.894 1.00 26.36  ? 814  HOH A O   1 
HETATM 3889 O  O   . HOH M 7 .   ? 6.258   15.023  94.842 1.00 46.11  ? 815  HOH A O   1 
HETATM 3890 O  O   . HOH M 7 .   ? -7.434  23.373  66.877 1.00 18.10  ? 816  HOH A O   1 
HETATM 3891 O  O   . HOH M 7 .   ? 10.677  25.808  76.059 1.00 26.07  ? 817  HOH A O   1 
HETATM 3892 O  O   . HOH M 7 .   ? 10.663  28.021  71.395 1.00 28.83  ? 818  HOH A O   1 
HETATM 3893 O  O   . HOH M 7 .   ? 16.727  4.952   87.376 1.00 39.73  ? 819  HOH A O   1 
HETATM 3894 O  O   . HOH M 7 .   ? -18.497 26.026  62.825 1.00 43.41  ? 820  HOH A O   1 
HETATM 3895 O  O   . HOH M 7 .   ? -10.911 28.630  80.628 1.00 31.47  ? 821  HOH A O   1 
HETATM 3896 O  O   . HOH M 7 .   ? -15.892 18.349  82.804 1.00 25.32  ? 822  HOH A O   1 
HETATM 3897 O  O   . HOH M 7 .   ? 8.643   33.417  78.848 1.00 39.82  ? 823  HOH A O   1 
HETATM 3898 O  O   . HOH M 7 .   ? -21.575 17.349  59.258 1.00 33.35  ? 824  HOH A O   1 
HETATM 3899 O  O   . HOH M 7 .   ? -2.554  25.623  39.508 1.00 43.52  ? 825  HOH A O   1 
HETATM 3900 O  O   . HOH M 7 .   ? -21.746 9.183   61.297 1.00 35.98  ? 826  HOH A O   1 
HETATM 3901 O  O   . HOH M 7 .   ? 10.620  17.732  88.790 1.00 35.71  ? 827  HOH A O   1 
HETATM 3902 O  O   . HOH M 7 .   ? -13.794 30.115  67.746 1.00 41.70  ? 828  HOH A O   1 
HETATM 3903 O  O   . HOH M 7 .   ? -0.429  8.619   49.365 1.00 30.64  ? 829  HOH A O   1 
HETATM 3904 O  O   . HOH M 7 .   ? -9.764  26.491  38.764 1.00 45.40  ? 830  HOH A O   1 
HETATM 3905 O  O   . HOH M 7 .   ? 1.150   29.859  70.776 1.00 20.97  ? 831  HOH A O   1 
HETATM 3906 O  O   . HOH M 7 .   ? -0.840  28.855  69.124 1.00 22.81  ? 832  HOH A O   1 
HETATM 3907 O  O   . HOH M 7 .   ? -2.870  32.097  68.063 1.00 32.41  ? 833  HOH A O   1 
HETATM 3908 O  O   . HOH M 7 .   ? 18.300  4.643   76.210 1.00 24.29  ? 834  HOH A O   1 
HETATM 3909 O  O   . HOH M 7 .   ? 1.402   12.325  47.426 1.00 34.41  ? 835  HOH A O   1 
HETATM 3910 O  O   . HOH M 7 .   ? -9.696  3.429   93.318 1.00 52.52  ? 836  HOH A O   1 
HETATM 3911 O  O   . HOH M 7 .   ? -17.593 5.073   50.833 1.00 25.31  ? 837  HOH A O   1 
HETATM 3912 O  O   . HOH M 7 .   ? 4.408   26.155  79.893 1.00 22.94  ? 838  HOH A O   1 
HETATM 3913 O  O   . HOH M 7 .   ? -19.707 4.444   68.154 1.00 32.75  ? 839  HOH A O   1 
HETATM 3914 O  O   . HOH M 7 .   ? -1.963  8.865   40.195 1.00 34.91  ? 840  HOH A O   1 
HETATM 3915 O  O   . HOH M 7 .   ? 23.509  9.407   76.179 1.00 35.30  ? 841  HOH A O   1 
HETATM 3916 O  O   . HOH M 7 .   ? 13.616  4.644   71.742 1.00 24.81  ? 842  HOH A O   1 
HETATM 3917 O  O   . HOH M 7 .   ? -27.173 4.204   57.679 1.00 43.28  ? 843  HOH A O   1 
HETATM 3918 O  O   . HOH M 7 .   ? -15.592 9.236   41.027 1.00 29.76  ? 844  HOH A O   1 
HETATM 3919 O  O   . HOH M 7 .   ? -2.202  23.439  88.989 1.00 28.41  ? 845  HOH A O   1 
HETATM 3920 O  O   . HOH M 7 .   ? 14.629  27.062  64.733 1.00 38.47  ? 846  HOH A O   1 
HETATM 3921 O  O   . HOH M 7 .   ? 3.086   0.427   37.551 1.00 53.16  ? 847  HOH A O   1 
HETATM 3922 O  O   . HOH M 7 .   ? -13.578 5.772   51.047 1.00 20.29  ? 848  HOH A O   1 
HETATM 3923 O  O   . HOH M 7 .   ? 10.451  25.956  73.183 1.00 31.00  ? 849  HOH A O   1 
HETATM 3924 O  O   . HOH M 7 .   ? -11.692 29.052  59.583 1.00 36.13  ? 850  HOH A O   1 
HETATM 3925 O  O   . HOH M 7 .   ? -14.190 3.995   33.387 1.00 42.76  ? 851  HOH A O   1 
HETATM 3926 O  O   . HOH M 7 .   ? -19.998 11.908  28.845 1.00 58.65  ? 852  HOH A O   1 
HETATM 3927 O  O   . HOH M 7 .   ? 10.005  31.666  68.440 1.00 32.66  ? 853  HOH A O   1 
HETATM 3928 O  O   . HOH M 7 .   ? -1.986  -0.056  54.629 1.00 30.44  ? 854  HOH A O   1 
HETATM 3929 O  O   . HOH M 7 .   ? -2.596  5.580   33.625 1.00 39.64  ? 855  HOH A O   1 
HETATM 3930 O  O   . HOH M 7 .   ? 0.413   3.855   75.712 1.00 16.86  ? 856  HOH A O   1 
HETATM 3931 O  O   . HOH M 7 .   ? 1.930   30.395  67.543 1.00 26.26  ? 857  HOH A O   1 
HETATM 3932 O  O   . HOH M 7 .   ? -23.758 -6.663  57.455 1.00 35.79  ? 858  HOH A O   1 
HETATM 3933 O  O   . HOH M 7 .   ? 3.373   10.525  63.328 1.00 21.39  ? 859  HOH A O   1 
HETATM 3934 O  O   . HOH M 7 .   ? 7.880   17.769  90.789 1.00 46.88  ? 860  HOH A O   1 
HETATM 3935 O  O   . HOH M 7 .   ? -26.762 -0.321  56.824 1.00 32.19  ? 861  HOH A O   1 
HETATM 3936 O  O   . HOH M 7 .   ? -20.296 13.051  82.524 1.00 36.52  ? 862  HOH A O   1 
HETATM 3937 O  O   . HOH M 7 .   ? 1.402   -6.554  34.817 1.00 43.40  ? 863  HOH A O   1 
HETATM 3938 O  O   . HOH M 7 .   ? -13.577 -13.925 61.629 1.00 29.99  ? 864  HOH A O   1 
HETATM 3939 O  O   . HOH M 7 .   ? -25.461 -5.278  51.628 1.00 26.34  ? 865  HOH A O   1 
HETATM 3940 O  O   . HOH M 7 .   ? 15.867  9.500   69.302 1.00 39.28  ? 866  HOH A O   1 
HETATM 3941 O  O   . HOH M 7 .   ? -5.969  24.346  69.184 1.00 17.28  ? 867  HOH A O   1 
HETATM 3942 O  O   . HOH M 7 .   ? 1.014   -1.908  57.811 1.00 43.65  ? 868  HOH A O   1 
HETATM 3943 O  O   . HOH M 7 .   ? 10.955  25.383  59.845 1.00 36.90  ? 869  HOH A O   1 
HETATM 3944 O  O   . HOH M 7 .   ? -3.387  -0.932  43.050 1.00 36.44  ? 870  HOH A O   1 
HETATM 3945 O  O   . HOH M 7 .   ? -12.788 -5.189  69.660 1.00 36.00  ? 871  HOH A O   1 
HETATM 3946 O  O   . HOH M 7 .   ? -11.693 30.932  72.810 1.00 30.39  ? 872  HOH A O   1 
HETATM 3947 O  O   . HOH M 7 .   ? -7.483  24.587  88.891 1.00 47.71  ? 873  HOH A O   1 
HETATM 3948 O  O   . HOH M 7 .   ? 9.135   0.994   91.224 1.00 36.63  ? 874  HOH A O   1 
HETATM 3949 O  O   . HOH M 7 .   ? -24.884 -3.872  63.147 1.00 33.65  ? 875  HOH A O   1 
HETATM 3950 O  O   . HOH M 7 .   ? -5.136  34.242  76.078 1.00 18.08  ? 876  HOH A O   1 
HETATM 3951 O  O   . HOH M 7 .   ? -1.754  6.649   41.800 1.00 42.38  ? 877  HOH A O   1 
HETATM 3952 O  O   . HOH M 7 .   ? 4.165   22.126  91.330 1.00 37.85  ? 878  HOH A O   1 
HETATM 3953 O  O   . HOH M 7 .   ? 15.099  13.991  85.804 1.00 28.66  ? 879  HOH A O   1 
HETATM 3954 O  O   . HOH M 7 .   ? -21.280 12.736  72.821 1.00 33.87  ? 880  HOH A O   1 
HETATM 3955 O  O   . HOH M 7 .   ? -19.234 20.561  53.623 1.00 39.65  ? 881  HOH A O   1 
HETATM 3956 O  O   . HOH M 7 .   ? 13.094  17.497  71.187 1.00 48.47  ? 882  HOH A O   1 
HETATM 3957 O  O   . HOH M 7 .   ? -0.493  5.171   73.528 1.00 15.55  ? 883  HOH A O   1 
HETATM 3958 O  O   . HOH M 7 .   ? 8.884   -0.245  85.055 1.00 27.10  ? 884  HOH A O   1 
HETATM 3959 O  O   . HOH M 7 .   ? 13.231  19.063  88.809 1.00 39.25  ? 885  HOH A O   1 
HETATM 3960 O  O   . HOH M 7 .   ? 9.267   11.465  62.654 1.00 33.38  ? 886  HOH A O   1 
HETATM 3961 O  O   . HOH M 7 .   ? 13.439  21.634  68.296 1.00 33.53  ? 887  HOH A O   1 
HETATM 3962 O  O   . HOH M 7 .   ? -1.052  22.965  72.851 1.00 20.01  ? 888  HOH A O   1 
HETATM 3963 O  O   . HOH M 7 .   ? -25.624 -4.582  54.596 1.00 39.15  ? 889  HOH A O   1 
HETATM 3964 O  O   . HOH M 7 .   ? 12.919  24.869  79.535 1.00 41.36  ? 890  HOH A O   1 
HETATM 3965 O  O   . HOH M 7 .   ? 8.819   29.895  70.361 1.00 26.07  ? 891  HOH A O   1 
HETATM 3966 O  O   . HOH M 7 .   ? -10.496 17.762  90.089 1.00 30.05  ? 892  HOH A O   1 
HETATM 3967 O  O   . HOH M 7 .   ? 14.822  -3.590  78.531 1.00 31.06  ? 893  HOH A O   1 
HETATM 3968 O  O   . HOH M 7 .   ? -19.872 23.679  54.363 1.00 44.47  ? 894  HOH A O   1 
HETATM 3969 O  O   . HOH M 7 .   ? -32.053 4.630   46.907 1.00 46.55  ? 895  HOH A O   1 
HETATM 3970 O  O   . HOH M 7 .   ? -20.795 13.188  55.328 1.00 22.05  ? 896  HOH A O   1 
HETATM 3971 O  O   . HOH M 7 .   ? -7.060  10.099  88.538 1.00 38.83  ? 897  HOH A O   1 
HETATM 3972 O  O   . HOH M 7 .   ? 20.800  11.025  73.747 1.00 32.85  ? 898  HOH A O   1 
HETATM 3973 O  O   . HOH M 7 .   ? -19.769 20.678  46.157 1.00 43.85  ? 899  HOH A O   1 
HETATM 3974 O  O   . HOH M 7 .   ? -4.771  -7.234  39.608 1.00 37.46  ? 900  HOH A O   1 
HETATM 3975 O  O   . HOH M 7 .   ? -0.629  35.900  57.064 1.00 43.26  ? 901  HOH A O   1 
HETATM 3976 O  O   . HOH M 7 .   ? -4.249  6.153   80.670 1.00 27.27  ? 902  HOH A O   1 
HETATM 3977 O  O   . HOH M 7 .   ? 1.020   32.591  70.016 1.00 37.51  ? 903  HOH A O   1 
HETATM 3978 O  O   . HOH M 7 .   ? 2.948   32.486  62.639 1.00 44.97  ? 904  HOH A O   1 
HETATM 3979 O  O   . HOH M 7 .   ? 12.106  14.458  66.003 1.00 39.41  ? 905  HOH A O   1 
HETATM 3980 O  O   . HOH M 7 .   ? 3.374   31.733  65.230 1.00 27.36  ? 906  HOH A O   1 
HETATM 3981 O  O   . HOH M 7 .   ? 7.932   33.473  75.865 1.00 37.29  ? 907  HOH A O   1 
HETATM 3982 O  O   . HOH M 7 .   ? -2.280  -4.681  73.573 1.00 27.94  ? 908  HOH A O   1 
HETATM 3983 O  O   . HOH M 7 .   ? -0.976  3.498   78.200 1.00 16.89  ? 909  HOH A O   1 
HETATM 3984 O  O   . HOH M 7 .   ? -25.759 7.642   33.443 1.00 52.54  ? 910  HOH A O   1 
HETATM 3985 O  O   . HOH M 7 .   ? -25.454 7.474   59.321 1.00 25.79  ? 911  HOH A O   1 
HETATM 3986 O  O   . HOH M 7 .   ? -8.616  -2.407  70.791 1.00 27.48  ? 912  HOH A O   1 
HETATM 3987 O  O   . HOH M 7 .   ? -27.293 5.797   53.305 1.00 30.69  ? 913  HOH A O   1 
HETATM 3988 O  O   . HOH M 7 .   ? 10.197  15.498  93.511 1.00 40.41  ? 914  HOH A O   1 
HETATM 3989 O  O   . HOH M 7 .   ? -12.339 30.422  63.348 1.00 43.08  ? 915  HOH A O   1 
HETATM 3990 O  O   . HOH M 7 .   ? -27.971 2.901   63.523 1.00 28.50  ? 916  HOH A O   1 
HETATM 3991 O  O   . HOH M 7 .   ? -10.056 14.409  68.883 1.00 18.24  ? 917  HOH A O   1 
HETATM 3992 O  O   . HOH M 7 .   ? 2.567   2.024   41.621 1.00 38.00  ? 918  HOH A O   1 
HETATM 3993 O  O   . HOH M 7 .   ? 8.286   18.492  87.252 1.00 23.82  ? 919  HOH A O   1 
HETATM 3994 O  O   . HOH M 7 .   ? -21.025 0.954   73.931 1.00 45.86  ? 920  HOH A O   1 
HETATM 3995 O  O   . HOH M 7 .   ? -29.976 -3.123  50.668 1.00 46.66  ? 921  HOH A O   1 
HETATM 3996 O  O   . HOH M 7 .   ? -1.947  -1.988  63.528 1.00 36.11  ? 922  HOH A O   1 
HETATM 3997 O  O   . HOH M 7 .   ? -17.034 13.170  33.498 1.00 44.05  ? 923  HOH A O   1 
HETATM 3998 O  O   . HOH M 7 .   ? -18.522 2.627   35.338 1.00 40.32  ? 924  HOH A O   1 
HETATM 3999 O  O   . HOH M 7 .   ? 22.121  15.844  75.133 1.00 36.72  ? 925  HOH A O   1 
HETATM 4000 O  O   . HOH M 7 .   ? -28.914 8.341   55.659 1.00 37.57  ? 926  HOH A O   1 
HETATM 4001 O  O   . HOH M 7 .   ? 8.694   36.062  57.794 1.00 41.17  ? 927  HOH A O   1 
HETATM 4002 O  O   . HOH M 7 .   ? -4.018  -3.380  65.503 1.00 38.13  ? 928  HOH A O   1 
HETATM 4003 O  O   . HOH M 7 .   ? -11.795 24.306  84.471 1.00 41.45  ? 929  HOH A O   1 
HETATM 4004 O  O   . HOH M 7 .   ? 2.922   1.523   59.097 1.00 43.25  ? 930  HOH A O   1 
HETATM 4005 O  O   . HOH M 7 .   ? -4.551  11.326  92.637 1.00 51.39  ? 931  HOH A O   1 
HETATM 4006 O  O   . HOH M 7 .   ? -20.695 28.156  63.516 1.00 56.15  ? 932  HOH A O   1 
HETATM 4007 O  O   . HOH M 7 .   ? -10.678 5.029   80.526 1.00 39.44  ? 933  HOH A O   1 
HETATM 4008 O  O   . HOH M 7 .   ? -26.284 17.976  69.785 1.00 31.24  ? 934  HOH A O   1 
HETATM 4009 O  O   . HOH M 7 .   ? -14.346 30.965  60.708 1.00 56.83  ? 935  HOH A O   1 
HETATM 4010 O  O   . HOH M 7 .   ? -23.571 16.336  70.681 1.00 30.66  ? 936  HOH A O   1 
HETATM 4011 O  O   . HOH M 7 .   ? -19.224 4.143   75.887 1.00 36.97  ? 937  HOH A O   1 
HETATM 4012 O  O   . HOH M 7 .   ? -9.614  10.351  88.415 1.00 29.94  ? 938  HOH A O   1 
HETATM 4013 O  O   . HOH M 7 .   ? -4.458  32.309  81.544 1.00 26.37  ? 939  HOH A O   1 
HETATM 4014 O  O   . HOH M 7 .   ? -11.893 -9.221  45.784 1.00 43.01  ? 940  HOH A O   1 
HETATM 4015 O  O   . HOH M 7 .   ? 12.712  13.428  86.967 1.00 33.37  ? 941  HOH A O   1 
HETATM 4016 O  O   . HOH M 7 .   ? -27.215 -7.026  41.824 1.00 58.85  ? 942  HOH A O   1 
HETATM 4017 O  O   . HOH M 7 .   ? -24.844 10.075  38.703 1.00 45.12  ? 943  HOH A O   1 
HETATM 4018 O  O   . HOH M 7 .   ? -7.183  26.405  41.409 1.00 44.27  ? 944  HOH A O   1 
HETATM 4019 O  O   . HOH M 7 .   ? -21.570 15.204  76.800 1.00 43.28  ? 945  HOH A O   1 
HETATM 4020 O  O   . HOH M 7 .   ? -31.037 14.845  49.264 1.00 53.08  ? 946  HOH A O   1 
HETATM 4021 O  O   . HOH M 7 .   ? -3.143  7.221   38.364 1.00 43.40  ? 947  HOH A O   1 
HETATM 4022 O  O   . HOH M 7 .   ? 21.083  7.028   83.435 1.00 34.38  ? 948  HOH A O   1 
HETATM 4023 O  O   . HOH M 7 .   ? -20.367 10.950  77.582 1.00 33.66  ? 949  HOH A O   1 
HETATM 4024 O  O   . HOH M 7 .   ? 7.051   8.472   64.848 1.00 25.70  ? 950  HOH A O   1 
HETATM 4025 O  O   . HOH M 7 .   ? -22.827 9.182   64.742 1.00 57.61  ? 951  HOH A O   1 
HETATM 4026 O  O   . HOH M 7 .   ? 14.831  2.974   89.401 1.00 45.49  ? 952  HOH A O   1 
HETATM 4027 O  O   . HOH M 7 .   ? 9.756   3.636   68.193 1.00 24.22  ? 953  HOH A O   1 
HETATM 4028 O  O   . HOH M 7 .   ? -28.716 -4.070  40.717 1.00 55.25  ? 954  HOH A O   1 
HETATM 4029 O  O   . HOH M 7 .   ? -8.493  15.793  92.665 1.00 45.60  ? 955  HOH A O   1 
HETATM 4030 O  O   . HOH M 7 .   ? 3.733   8.278   66.896 1.00 20.99  ? 956  HOH A O   1 
HETATM 4031 O  O   . HOH M 7 .   ? -14.720 27.307  84.779 1.00 47.46  ? 957  HOH A O   1 
HETATM 4032 O  O   . HOH M 7 .   ? 9.390   18.981  52.383 1.00 49.10  ? 958  HOH A O   1 
HETATM 4033 O  O   . HOH M 7 .   ? -6.512  -4.404  68.013 1.00 35.37  ? 959  HOH A O   1 
HETATM 4034 O  O   . HOH M 7 .   ? 2.672   36.467  72.436 1.00 44.05  ? 960  HOH A O   1 
HETATM 4035 O  O   . HOH M 7 .   ? -23.115 22.513  48.482 1.00 45.13  ? 961  HOH A O   1 
HETATM 4036 O  O   . HOH M 7 .   ? -0.453  25.891  88.173 1.00 29.64  ? 962  HOH A O   1 
HETATM 4037 O  O   . HOH M 7 .   ? -8.429  28.560  82.770 1.00 34.66  ? 963  HOH A O   1 
HETATM 4038 O  O   . HOH M 7 .   ? 20.760  5.965   68.763 1.00 55.63  ? 964  HOH A O   1 
HETATM 4039 O  O   . HOH M 7 .   ? -27.122 6.800   67.334 1.00 54.40  ? 965  HOH A O   1 
HETATM 4040 O  O   . HOH M 7 .   ? -9.232  16.839  67.703 1.00 19.75  ? 966  HOH A O   1 
HETATM 4041 O  O   . HOH M 7 .   ? 2.551   -3.545  61.827 1.00 50.84  ? 967  HOH A O   1 
HETATM 4042 O  O   . HOH M 7 .   ? -8.612  1.094   81.841 1.00 54.51  ? 968  HOH A O   1 
HETATM 4043 O  O   . HOH M 7 .   ? 0.106   37.417  76.856 1.00 39.91  ? 969  HOH A O   1 
HETATM 4044 O  O   . HOH M 7 .   ? -7.822  -9.344  52.946 1.00 38.13  ? 970  HOH A O   1 
HETATM 4045 O  O   . HOH M 7 .   ? -8.658  32.033  64.848 1.00 34.42  ? 971  HOH A O   1 
HETATM 4046 O  O   . HOH M 7 .   ? -9.640  25.937  84.852 1.00 42.11  ? 972  HOH A O   1 
HETATM 4047 O  O   . HOH M 7 .   ? 4.070   10.728  66.023 1.00 27.98  ? 973  HOH A O   1 
HETATM 4048 O  O   . HOH M 7 .   ? -12.412 23.555  88.823 1.00 48.47  ? 974  HOH A O   1 
HETATM 4049 O  O   . HOH M 7 .   ? 4.519   21.370  87.903 1.00 31.55  ? 975  HOH A O   1 
HETATM 4050 O  O   . HOH M 7 .   ? -1.535  28.186  87.648 1.00 40.87  ? 976  HOH A O   1 
HETATM 4051 O  O   . HOH M 7 .   ? -23.064 19.769  60.176 1.00 47.63  ? 977  HOH A O   1 
HETATM 4052 O  O   . HOH M 7 .   ? -17.478 -2.230  71.823 1.00 46.08  ? 978  HOH A O   1 
HETATM 4053 O  O   . HOH M 7 .   ? 10.149  6.115   65.642 1.00 37.77  ? 979  HOH A O   1 
HETATM 4054 O  O   . HOH M 7 .   ? -10.711 -3.432  70.778 1.00 35.46  ? 980  HOH A O   1 
HETATM 4055 O  O   . HOH M 7 .   ? 1.709   8.425   47.959 1.00 44.77  ? 981  HOH A O   1 
HETATM 4056 O  O   . HOH M 7 .   ? -22.541 -8.632  56.334 1.00 40.76  ? 982  HOH A O   1 
HETATM 4057 O  O   . HOH M 7 .   ? 0.470   33.909  65.547 1.00 50.15  ? 983  HOH A O   1 
HETATM 4058 O  O   . HOH M 7 .   ? 9.591   11.129  93.591 1.00 51.82  ? 984  HOH A O   1 
HETATM 4059 O  O   . HOH M 7 .   ? -9.433  29.532  57.046 1.00 42.82  ? 985  HOH A O   1 
HETATM 4060 O  O   . HOH M 7 .   ? 12.090  27.145  77.981 1.00 39.11  ? 986  HOH A O   1 
HETATM 4061 O  O   . HOH M 7 .   ? 5.248   25.415  82.454 1.00 33.29  ? 987  HOH A O   1 
HETATM 4062 O  O   . HOH M 7 .   ? 21.103  9.930   77.548 1.00 29.73  ? 988  HOH A O   1 
HETATM 4063 O  O   . HOH M 7 .   ? 7.792   24.250  83.017 1.00 37.85  ? 989  HOH A O   1 
HETATM 4064 O  O   . HOH M 7 .   ? -2.741  -2.913  44.260 1.00 44.30  ? 990  HOH A O   1 
HETATM 4065 O  O   . HOH M 7 .   ? -4.998  -4.240  63.258 1.00 35.27  ? 991  HOH A O   1 
HETATM 4066 O  O   . HOH M 7 .   ? -11.418 -14.190 57.445 1.00 49.26  ? 992  HOH A O   1 
HETATM 4067 O  O   . HOH M 7 .   ? -7.925  3.951   81.152 1.00 53.67  ? 993  HOH A O   1 
HETATM 4068 O  O   . HOH M 7 .   ? -27.702 8.935   58.200 1.00 40.83  ? 994  HOH A O   1 
HETATM 4069 O  O   . HOH M 7 .   ? 19.378  5.570   86.841 1.00 51.51  ? 995  HOH A O   1 
HETATM 4070 O  O   . HOH M 7 .   ? 9.890   21.676  86.642 1.00 41.49  ? 996  HOH A O   1 
HETATM 4071 O  O   . HOH M 7 .   ? -31.677 8.634   56.398 1.00 40.31  ? 997  HOH A O   1 
HETATM 4072 O  O   . HOH M 7 .   ? 7.720   11.137  53.937 1.00 42.98  ? 998  HOH A O   1 
HETATM 4073 O  O   . HOH M 7 .   ? 15.682  24.738  65.734 1.00 53.10  ? 999  HOH A O   1 
HETATM 4074 O  O   . HOH M 7 .   ? -4.434  -5.276  46.166 1.00 47.01  ? 1000 HOH A O   1 
HETATM 4075 O  O   . HOH M 7 .   ? -2.720  18.727  30.852 1.00 53.28  ? 1001 HOH A O   1 
HETATM 4076 O  O   . HOH M 7 .   ? -4.407  -7.885  55.830 1.00 42.36  ? 1002 HOH A O   1 
HETATM 4077 O  O   . HOH M 7 .   ? -16.768 25.553  43.266 1.00 46.02  ? 1003 HOH A O   1 
HETATM 4078 O  O   . HOH M 7 .   ? 7.085   20.197  89.673 1.00 44.42  ? 1004 HOH A O   1 
HETATM 4079 O  O   . HOH M 7 .   ? -23.012 -9.093  53.681 1.00 39.34  ? 1005 HOH A O   1 
HETATM 4080 O  O   . HOH M 7 .   ? 4.877   23.794  86.563 1.00 39.00  ? 1006 HOH A O   1 
HETATM 4081 O  O   . HOH M 7 .   ? -26.273 25.351  73.336 1.00 46.28  ? 1007 HOH A O   1 
HETATM 4082 O  O   . HOH M 7 .   ? 5.613   4.284   42.862 1.00 55.81  ? 1008 HOH A O   1 
HETATM 4083 O  O   . HOH M 7 .   ? -6.189  16.787  30.630 1.00 55.58  ? 1009 HOH A O   1 
HETATM 4084 O  O   . HOH M 7 .   ? 4.835   36.362  77.599 1.00 42.97  ? 1010 HOH A O   1 
HETATM 4085 O  O   . HOH M 7 .   ? -14.047 19.591  84.554 1.00 34.81  ? 1011 HOH A O   1 
HETATM 4086 O  O   . HOH M 7 .   ? 19.867  -4.793  86.926 1.00 34.61  ? 1012 HOH A O   1 
HETATM 4087 O  O   . HOH M 7 .   ? 20.694  18.896  83.112 1.00 45.36  ? 1013 HOH A O   1 
HETATM 4088 O  O   . HOH M 7 .   ? -8.450  -9.755  67.843 1.00 40.22  ? 1014 HOH A O   1 
HETATM 4089 O  O   . HOH M 7 .   ? -9.016  -7.015  67.622 1.00 37.94  ? 1015 HOH A O   1 
HETATM 4090 O  O   . HOH M 7 .   ? -19.047 15.886  85.410 1.00 43.13  ? 1016 HOH A O   1 
HETATM 4091 O  O   . HOH M 7 .   ? -5.168  27.776  82.824 1.00 45.41  ? 1017 HOH A O   1 
HETATM 4092 O  O   . HOH M 7 .   ? -15.858 1.609   77.294 1.00 30.73  ? 1018 HOH A O   1 
HETATM 4093 O  O   . HOH M 7 .   ? -9.127  31.273  54.749 1.00 47.17  ? 1019 HOH A O   1 
HETATM 4094 O  O   . HOH M 7 .   ? -27.290 11.568  58.369 1.00 45.55  ? 1020 HOH A O   1 
HETATM 4095 O  O   . HOH M 7 .   ? 21.233  10.459  80.960 1.00 45.35  ? 1021 HOH A O   1 
HETATM 4096 O  O   . HOH M 7 .   ? -21.124 11.819  79.778 1.00 43.44  ? 1022 HOH A O   1 
HETATM 4097 O  O   . HOH M 7 .   ? 23.827  9.344   80.506 1.00 42.15  ? 1023 HOH A O   1 
HETATM 4098 O  O   . HOH M 7 .   ? -24.515 -6.988  60.033 1.00 37.42  ? 1024 HOH A O   1 
HETATM 4099 O  O   . HOH M 7 .   ? 12.761  29.731  71.382 1.00 35.84  ? 1025 HOH A O   1 
HETATM 4100 O  O   . HOH M 7 .   ? -29.546 -2.295  61.035 1.00 51.17  ? 1026 HOH A O   1 
HETATM 4101 O  O   . HOH M 7 .   ? 16.030  26.005  75.884 1.00 45.51  ? 1027 HOH A O   1 
HETATM 4102 O  O   . HOH M 7 .   ? -23.454 -3.875  65.503 1.00 51.92  ? 1028 HOH A O   1 
HETATM 4103 O  O   . HOH M 7 .   ? -6.916  -6.152  37.996 1.00 40.12  ? 1029 HOH A O   1 
HETATM 4104 O  O   . HOH M 7 .   ? 25.165  12.605  75.312 1.00 36.61  ? 1030 HOH A O   1 
HETATM 4105 O  O   . HOH M 7 .   ? 23.480  10.363  73.546 1.00 36.67  ? 1031 HOH A O   1 
HETATM 4106 O  O   . HOH M 7 .   ? 11.020  33.210  72.099 1.00 48.43  ? 1032 HOH A O   1 
HETATM 4107 O  O   . HOH M 7 .   ? -28.086 23.646  68.091 1.00 44.14  ? 1033 HOH A O   1 
HETATM 4108 O  O   . HOH M 7 .   ? -7.129  26.219  84.137 1.00 44.11  ? 1034 HOH A O   1 
HETATM 4109 O  O   . HOH M 7 .   ? 4.310   16.785  96.240 1.00 56.90  ? 1035 HOH A O   1 
HETATM 4110 O  O   . HOH N 7 .   ? -17.142 18.920  52.742 1.00 29.67  ? 301  HOH B O   1 
HETATM 4111 O  O   . HOH N 7 .   ? 5.525   -0.552  88.774 1.00 34.83  ? 302  HOH B O   1 
HETATM 4112 O  O   . HOH N 7 .   ? 6.374   -8.693  80.930 1.00 40.08  ? 303  HOH B O   1 
HETATM 4113 O  O   . HOH N 7 .   ? -20.424 12.563  51.112 1.00 23.86  ? 304  HOH B O   1 
HETATM 4114 O  O   . HOH N 7 .   ? -12.196 33.077  49.582 1.00 41.01  ? 305  HOH B O   1 
HETATM 4115 O  O   . HOH N 7 .   ? 10.469  24.417  56.193 1.00 54.29  ? 306  HOH B O   1 
HETATM 4116 O  O   . HOH N 7 .   ? 12.066  -3.065  79.707 1.00 36.05  ? 307  HOH B O   1 
HETATM 4117 O  O   . HOH N 7 .   ? -1.266  0.384   87.293 1.00 42.61  ? 308  HOH B O   1 
HETATM 4118 O  O   . HOH N 7 .   ? -0.354  24.775  46.239 1.00 41.07  ? 309  HOH B O   1 
HETATM 4119 O  O   . HOH N 7 .   ? -21.734 17.203  56.396 1.00 32.13  ? 310  HOH B O   1 
HETATM 4120 O  O   . HOH N 7 .   ? -12.519 28.387  53.205 1.00 37.08  ? 311  HOH B O   1 
HETATM 4121 O  O   . HOH N 7 .   ? 1.887   4.025   56.758 1.00 40.88  ? 312  HOH B O   1 
HETATM 4122 O  O   . HOH N 7 .   ? 9.134   14.313  61.714 1.00 36.33  ? 313  HOH B O   1 
HETATM 4123 O  O   . HOH N 7 .   ? -22.461 14.070  43.178 1.00 41.03  ? 314  HOH B O   1 
HETATM 4124 O  O   . HOH N 7 .   ? -0.200  32.150  48.076 1.00 42.06  ? 315  HOH B O   1 
HETATM 4125 O  O   . HOH N 7 .   ? 5.793   -6.725  69.588 1.00 40.96  ? 316  HOH B O   1 
HETATM 4126 O  O   . HOH N 7 .   ? -11.302 15.558  55.623 1.00 23.26  ? 317  HOH B O   1 
HETATM 4127 O  O   . HOH N 7 .   ? -0.649  -6.130  71.705 1.00 30.53  ? 318  HOH B O   1 
HETATM 4128 O  O   . HOH N 7 .   ? -4.565  -3.864  71.849 1.00 25.57  ? 319  HOH B O   1 
HETATM 4129 O  O   . HOH N 7 .   ? 12.237  -4.126  76.818 1.00 24.59  ? 320  HOH B O   1 
HETATM 4130 O  O   . HOH N 7 .   ? 0.340   -1.875  90.415 1.00 53.08  ? 321  HOH B O   1 
HETATM 4131 O  O   . HOH N 7 .   ? 5.980   1.759   61.878 1.00 27.96  ? 322  HOH B O   1 
HETATM 4132 O  O   . HOH N 7 .   ? -9.389  21.518  34.193 1.00 42.07  ? 323  HOH B O   1 
HETATM 4133 O  O   . HOH N 7 .   ? 8.796   -1.841  82.826 1.00 34.68  ? 324  HOH B O   1 
HETATM 4134 O  O   . HOH N 7 .   ? 12.424  -6.842  76.321 1.00 35.34  ? 325  HOH B O   1 
HETATM 4135 O  O   . HOH N 7 .   ? -1.000  0.011   64.803 1.00 21.14  ? 326  HOH B O   1 
HETATM 4136 O  O   . HOH N 7 .   ? 1.201   33.282  53.240 1.00 40.97  ? 327  HOH B O   1 
HETATM 4137 O  O   . HOH N 7 .   ? -14.290 13.809  44.940 1.00 23.75  ? 328  HOH B O   1 
HETATM 4138 O  O   . HOH N 7 .   ? 7.291   9.964   62.439 1.00 35.26  ? 329  HOH B O   1 
HETATM 4139 O  O   . HOH N 7 .   ? 9.006   17.246  59.652 1.00 37.50  ? 330  HOH B O   1 
HETATM 4140 O  O   . HOH N 7 .   ? 4.818   29.537  58.714 1.00 36.84  ? 331  HOH B O   1 
HETATM 4141 O  O   . HOH N 7 .   ? 5.370   7.266   56.650 1.00 29.25  ? 332  HOH B O   1 
HETATM 4142 O  O   . HOH N 7 .   ? -0.960  27.208  44.855 1.00 35.59  ? 333  HOH B O   1 
HETATM 4143 O  O   . HOH N 7 .   ? 9.002   23.521  58.493 1.00 30.13  ? 334  HOH B O   1 
HETATM 4144 O  O   . HOH N 7 .   ? 4.478   7.794   64.407 1.00 21.40  ? 335  HOH B O   1 
HETATM 4145 O  O   . HOH N 7 .   ? 0.749   -3.124  65.660 1.00 35.93  ? 336  HOH B O   1 
HETATM 4146 O  O   . HOH N 7 .   ? 9.677   13.231  56.206 1.00 49.90  ? 337  HOH B O   1 
HETATM 4147 O  O   . HOH N 7 .   ? 7.458   27.462  52.499 1.00 45.07  ? 338  HOH B O   1 
HETATM 4148 O  O   . HOH N 7 .   ? -13.113 9.734   51.229 1.00 25.06  ? 339  HOH B O   1 
HETATM 4149 O  O   . HOH N 7 .   ? -10.707 31.897  52.297 1.00 49.40  ? 340  HOH B O   1 
HETATM 4150 O  O   . HOH N 7 .   ? 6.088   4.107   90.268 1.00 29.49  ? 341  HOH B O   1 
HETATM 4151 O  O   . HOH N 7 .   ? -0.532  5.906   92.959 1.00 33.44  ? 342  HOH B O   1 
HETATM 4152 O  O   . HOH N 7 .   ? 6.325   -0.649  86.081 1.00 21.43  ? 343  HOH B O   1 
HETATM 4153 O  O   . HOH N 7 .   ? -11.925 24.518  40.408 1.00 45.26  ? 344  HOH B O   1 
HETATM 4154 O  O   . HOH N 7 .   ? 7.298   -4.762  81.253 1.00 23.12  ? 345  HOH B O   1 
HETATM 4155 O  O   . HOH N 7 .   ? -7.220  24.258  35.090 1.00 42.16  ? 346  HOH B O   1 
HETATM 4156 O  O   . HOH N 7 .   ? 0.920   -0.093  82.643 1.00 41.14  ? 347  HOH B O   1 
HETATM 4157 O  O   . HOH N 7 .   ? -5.178  34.515  52.662 1.00 45.29  ? 348  HOH B O   1 
HETATM 4158 O  O   . HOH N 7 .   ? -2.037  -5.729  66.386 1.00 50.06  ? 349  HOH B O   1 
HETATM 4159 O  O   . HOH N 7 .   ? 4.011   -3.030  88.054 1.00 53.11  ? 350  HOH B O   1 
HETATM 4160 O  O   . HOH N 7 .   ? -13.517 25.889  52.681 1.00 30.48  ? 351  HOH B O   1 
HETATM 4161 O  O   . HOH N 7 .   ? 1.816   28.069  44.638 1.00 43.14  ? 352  HOH B O   1 
HETATM 4162 O  O   . HOH N 7 .   ? 10.002  21.224  59.329 1.00 39.23  ? 353  HOH B O   1 
HETATM 4163 O  O   . HOH N 7 .   ? 11.123  -5.796  80.252 1.00 45.26  ? 354  HOH B O   1 
HETATM 4164 O  O   . HOH N 7 .   ? -2.900  -6.824  69.979 1.00 37.62  ? 355  HOH B O   1 
HETATM 4165 O  O   . HOH N 7 .   ? 2.697   -5.409  66.297 1.00 42.50  ? 356  HOH B O   1 
HETATM 4166 O  O   . HOH N 7 .   ? 4.705   -0.109  60.527 1.00 45.15  ? 357  HOH B O   1 
HETATM 4167 O  O   . HOH N 7 .   ? -24.098 15.448  55.905 1.00 48.69  ? 358  HOH B O   1 
HETATM 4168 O  O   . HOH N 7 .   ? 10.634  -6.501  71.400 1.00 42.53  ? 359  HOH B O   1 
HETATM 4169 O  O   . HOH N 7 .   ? -17.083 26.135  34.532 1.00 56.31  ? 360  HOH B O   1 
HETATM 4170 O  O   . HOH N 7 .   ? 7.898   7.572   56.671 1.00 33.46  ? 361  HOH B O   1 
HETATM 4171 O  O   . HOH N 7 .   ? 5.625   3.529   51.415 1.00 55.63  ? 362  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   155 ?   ?   ?   A . n 
A 1 2   PRO 2   156 ?   ?   ?   A . n 
A 1 3   GLY 3   157 ?   ?   ?   A . n 
A 1 4   LYS 4   158 ?   ?   ?   A . n 
A 1 5   LYS 5   159 159 LYS LYS A . n 
A 1 6   PHE 6   160 160 PHE PHE A . n 
A 1 7   LYS 7   161 161 LYS LYS A . n 
A 1 8   ASN 8   162 162 ASN ASN A . n 
A 1 9   SER 9   163 163 SER SER A . n 
A 1 10  THR 10  164 164 THR THR A . n 
A 1 11  TYR 11  165 165 TYR TYR A . n 
A 1 12  SER 12  166 166 SER SER A . n 
A 1 13  ARG 13  167 167 ARG ARG A . n 
A 1 14  SER 14  168 168 SER SER A . n 
A 1 15  SER 15  169 169 SER SER A . n 
A 1 16  VAL 16  170 170 VAL VAL A . n 
A 1 17  ASP 17  171 171 ASP ASP A . n 
A 1 18  VAL 18  172 172 VAL VAL A . n 
A 1 19  LEU 19  173 173 LEU LEU A . n 
A 1 20  TYR 20  174 174 TYR TYR A . n 
A 1 21  THR 21  175 175 THR THR A . n 
A 1 22  PHE 22  176 176 PHE PHE A . n 
A 1 23  ALA 23  177 177 ALA ALA A . n 
A 1 24  ASN 24  178 178 ASN ASN A . n 
A 1 25  CYS 25  179 179 CYS CYS A . n 
A 1 26  SER 26  180 180 SER SER A . n 
A 1 27  GLY 27  181 181 GLY GLY A . n 
A 1 28  LEU 28  182 182 LEU LEU A . n 
A 1 29  ASP 29  183 183 ASP ASP A . n 
A 1 30  LEU 30  184 184 LEU LEU A . n 
A 1 31  ILE 31  185 185 ILE ILE A . n 
A 1 32  PHE 32  186 186 PHE PHE A . n 
A 1 33  GLY 33  187 187 GLY GLY A . n 
A 1 34  LEU 34  188 188 LEU LEU A . n 
A 1 35  ASN 35  189 189 ASN ASN A . n 
A 1 36  ALA 36  190 190 ALA ALA A . n 
A 1 37  LEU 37  191 191 LEU LEU A . n 
A 1 38  LEU 38  192 192 LEU LEU A . n 
A 1 39  ARG 39  193 193 ARG ARG A . n 
A 1 40  THR 40  194 194 THR THR A . n 
A 1 41  ALA 41  195 195 ALA ALA A . n 
A 1 42  ASP 42  196 196 ASP ASP A . n 
A 1 43  LEU 43  197 197 LEU LEU A . n 
A 1 44  GLN 44  198 198 GLN GLN A . n 
A 1 45  TRP 45  199 199 TRP TRP A . n 
A 1 46  ASN 46  200 200 ASN ASN A . n 
A 1 47  SER 47  201 201 SER SER A . n 
A 1 48  SER 48  202 202 SER SER A . n 
A 1 49  ASN 49  203 203 ASN ASN A . n 
A 1 50  ALA 50  204 204 ALA ALA A . n 
A 1 51  GLN 51  205 205 GLN GLN A . n 
A 1 52  LEU 52  206 206 LEU LEU A . n 
A 1 53  LEU 53  207 207 LEU LEU A . n 
A 1 54  LEU 54  208 208 LEU LEU A . n 
A 1 55  ASP 55  209 209 ASP ASP A . n 
A 1 56  TYR 56  210 210 TYR TYR A . n 
A 1 57  CYS 57  211 211 CYS CYS A . n 
A 1 58  SER 58  212 212 SER SER A . n 
A 1 59  SER 59  213 213 SER SER A . n 
A 1 60  LYS 60  214 214 LYS LYS A . n 
A 1 61  GLY 61  215 215 GLY GLY A . n 
A 1 62  TYR 62  216 216 TYR TYR A . n 
A 1 63  ASN 63  217 217 ASN ASN A . n 
A 1 64  ILE 64  218 218 ILE ILE A . n 
A 1 65  SER 65  219 219 SER SER A . n 
A 1 66  TRP 66  220 220 TRP TRP A . n 
A 1 67  GLU 67  221 221 GLU GLU A . n 
A 1 68  LEU 68  222 222 LEU LEU A . n 
A 1 69  GLY 69  223 223 GLY GLY A . n 
A 1 70  ASN 70  224 224 ASN ASN A . n 
A 1 71  GLU 71  225 225 GLU GLU A . n 
A 1 72  PRO 72  226 226 PRO PRO A . n 
A 1 73  ASN 73  227 227 ASN ASN A . n 
A 1 74  SER 74  228 228 SER SER A . n 
A 1 75  PHE 75  229 229 PHE PHE A . n 
A 1 76  LEU 76  230 230 LEU LEU A . n 
A 1 77  LYS 77  231 231 LYS LYS A . n 
A 1 78  LYS 78  232 232 LYS LYS A . n 
A 1 79  ALA 79  233 233 ALA ALA A . n 
A 1 80  ASP 80  234 234 ASP ASP A . n 
A 1 81  ILE 81  235 235 ILE ILE A . n 
A 1 82  PHE 82  236 236 PHE PHE A . n 
A 1 83  ILE 83  237 237 ILE ILE A . n 
A 1 84  ASN 84  238 238 ASN ASN A . n 
A 1 85  GLY 85  239 239 GLY GLY A . n 
A 1 86  SER 86  240 240 SER SER A . n 
A 1 87  GLN 87  241 241 GLN GLN A . n 
A 1 88  LEU 88  242 242 LEU LEU A . n 
A 1 89  GLY 89  243 243 GLY GLY A . n 
A 1 90  GLU 90  244 244 GLU GLU A . n 
A 1 91  ASP 91  245 245 ASP ASP A . n 
A 1 92  PHE 92  246 246 PHE PHE A . n 
A 1 93  ILE 93  247 247 ILE ILE A . n 
A 1 94  GLN 94  248 248 GLN GLN A . n 
A 1 95  LEU 95  249 249 LEU LEU A . n 
A 1 96  HIS 96  250 250 HIS HIS A . n 
A 1 97  LYS 97  251 251 LYS LYS A . n 
A 1 98  LEU 98  252 252 LEU LEU A . n 
A 1 99  LEU 99  253 253 LEU LEU A . n 
A 1 100 ARG 100 254 254 ARG ARG A . n 
A 1 101 LYS 101 255 255 LYS LYS A . n 
A 1 102 SER 102 256 256 SER SER A . n 
A 1 103 THR 103 257 257 THR THR A . n 
A 1 104 PHE 104 258 258 PHE PHE A . n 
A 1 105 LYS 105 259 259 LYS LYS A . n 
A 1 106 ASN 106 260 260 ASN ASN A . n 
A 1 107 ALA 107 261 261 ALA ALA A . n 
A 1 108 LYS 108 262 262 LYS LYS A . n 
A 1 109 LEU 109 263 263 LEU LEU A . n 
A 1 110 TYR 110 264 264 TYR TYR A . n 
A 1 111 GLY 111 265 265 GLY GLY A . n 
A 1 112 PRO 112 266 266 PRO PRO A . n 
A 1 113 ASP 113 267 267 ASP ASP A . n 
A 1 114 VAL 114 268 268 VAL VAL A . n 
A 1 115 GLY 115 269 269 GLY GLY A . n 
A 1 116 GLN 116 270 270 GLN GLN A . n 
A 1 117 PRO 117 271 271 PRO PRO A . n 
A 1 118 ARG 118 272 272 ARG ARG A . n 
A 1 119 ARG 119 273 273 ARG ARG A . n 
A 1 120 LYS 120 274 274 LYS LYS A . n 
A 1 121 THR 121 275 275 THR THR A . n 
A 1 122 ALA 122 276 276 ALA ALA A . n 
A 1 123 LYS 123 277 277 LYS LYS A . n 
A 1 124 MET 124 278 278 MET MET A . n 
A 1 125 LEU 125 279 279 LEU LEU A . n 
A 1 126 LYS 126 280 280 LYS LYS A . n 
A 1 127 SER 127 281 281 SER SER A . n 
A 1 128 PHE 128 282 282 PHE PHE A . n 
A 1 129 LEU 129 283 283 LEU LEU A . n 
A 1 130 LYS 130 284 284 LYS LYS A . n 
A 1 131 ALA 131 285 285 ALA ALA A . n 
A 1 132 GLY 132 286 286 GLY GLY A . n 
A 1 133 GLY 133 287 287 GLY GLY A . n 
A 1 134 GLU 134 288 288 GLU GLU A . n 
A 1 135 VAL 135 289 289 VAL VAL A . n 
A 1 136 ILE 136 290 290 ILE ILE A . n 
A 1 137 ASP 137 291 291 ASP ASP A . n 
A 1 138 SER 138 292 292 SER SER A . n 
A 1 139 VAL 139 293 293 VAL VAL A . n 
A 1 140 THR 140 294 294 THR THR A . n 
A 1 141 TRP 141 295 295 TRP TRP A . n 
A 1 142 HIS 142 296 296 HIS HIS A . n 
A 1 143 HIS 143 297 297 HIS HIS A . n 
A 1 144 TYR 144 298 298 TYR TYR A . n 
A 1 145 TYR 145 299 299 TYR TYR A . n 
A 1 146 LEU 146 300 300 LEU LEU A . n 
A 1 147 ASN 147 301 301 ASN ASN A . n 
A 1 148 GLY 148 302 302 GLY GLY A . n 
A 1 149 ARG 149 303 303 ARG ARG A . n 
A 1 150 THR 150 304 304 THR THR A . n 
A 1 151 ALA 151 305 305 ALA ALA A . n 
A 1 152 THR 152 306 306 THR THR A . n 
A 1 153 ARG 153 307 307 ARG ARG A . n 
A 1 154 GLU 154 308 308 GLU GLU A . n 
A 1 155 ASP 155 309 309 ASP ASP A . n 
A 1 156 PHE 156 310 310 PHE PHE A . n 
A 1 157 LEU 157 311 311 LEU LEU A . n 
A 1 158 ASN 158 312 312 ASN ASN A . n 
A 1 159 PRO 159 313 313 PRO PRO A . n 
A 1 160 ASP 160 314 314 ASP ASP A . n 
A 1 161 VAL 161 315 315 VAL VAL A . n 
A 1 162 LEU 162 316 316 LEU LEU A . n 
A 1 163 ASP 163 317 317 ASP ASP A . n 
A 1 164 ILE 164 318 318 ILE ILE A . n 
A 1 165 PHE 165 319 319 PHE PHE A . n 
A 1 166 ILE 166 320 320 ILE ILE A . n 
A 1 167 SER 167 321 321 SER SER A . n 
A 1 168 SER 168 322 322 SER SER A . n 
A 1 169 VAL 169 323 323 VAL VAL A . n 
A 1 170 GLN 170 324 324 GLN GLN A . n 
A 1 171 LYS 171 325 325 LYS LYS A . n 
A 1 172 VAL 172 326 326 VAL VAL A . n 
A 1 173 PHE 173 327 327 PHE PHE A . n 
A 1 174 GLN 174 328 328 GLN GLN A . n 
A 1 175 VAL 175 329 329 VAL VAL A . n 
A 1 176 VAL 176 330 330 VAL VAL A . n 
A 1 177 GLU 177 331 331 GLU GLU A . n 
A 1 178 SER 178 332 332 SER SER A . n 
A 1 179 THR 179 333 333 THR THR A . n 
A 1 180 ARG 180 334 334 ARG ARG A . n 
A 1 181 PRO 181 335 335 PRO PRO A . n 
A 1 182 GLY 182 336 336 GLY GLY A . n 
A 1 183 LYS 183 337 337 LYS LYS A . n 
A 1 184 LYS 184 338 338 LYS LYS A . n 
A 1 185 VAL 185 339 339 VAL VAL A . n 
A 1 186 TRP 186 340 340 TRP TRP A . n 
A 1 187 LEU 187 341 341 LEU LEU A . n 
A 1 188 GLY 188 342 342 GLY GLY A . n 
A 1 189 GLU 189 343 343 GLU GLU A . n 
A 1 190 THR 190 344 344 THR THR A . n 
A 1 191 SER 191 345 345 SER SER A . n 
A 1 192 SER 192 346 346 SER SER A . n 
A 1 193 ALA 193 347 347 ALA ALA A . n 
A 1 194 TYR 194 348 348 TYR TYR A . n 
A 1 195 GLY 195 349 349 GLY GLY A . n 
A 1 196 GLY 196 350 350 GLY GLY A . n 
A 1 197 GLY 197 351 351 GLY GLY A . n 
A 1 198 ALA 198 352 352 ALA ALA A . n 
A 1 199 PRO 199 353 353 PRO PRO A . n 
A 1 200 LEU 200 354 354 LEU LEU A . n 
A 1 201 LEU 201 355 355 LEU LEU A . n 
A 1 202 SER 202 356 356 SER SER A . n 
A 1 203 ASP 203 357 357 ASP ASP A . n 
A 1 204 THR 204 358 358 THR THR A . n 
A 1 205 PHE 205 359 359 PHE PHE A . n 
A 1 206 ALA 206 360 360 ALA ALA A . n 
A 1 207 ALA 207 361 361 ALA ALA A . n 
A 1 208 GLY 208 362 362 GLY GLY A . n 
A 1 209 PHE 209 363 363 PHE PHE A . n 
A 1 210 MET 210 364 364 MET MET A . n 
A 1 211 TRP 211 365 365 TRP TRP A . n 
A 1 212 LEU 212 366 366 LEU LEU A . n 
A 1 213 ASP 213 367 367 ASP ASP A . n 
A 1 214 LYS 214 368 368 LYS LYS A . n 
A 1 215 LEU 215 369 369 LEU LEU A . n 
A 1 216 GLY 216 370 370 GLY GLY A . n 
A 1 217 LEU 217 371 371 LEU LEU A . n 
A 1 218 SER 218 372 372 SER SER A . n 
A 1 219 ALA 219 373 373 ALA ALA A . n 
A 1 220 ARG 220 374 374 ARG ARG A . n 
A 1 221 MET 221 375 375 MET MET A . n 
A 1 222 GLY 222 376 376 GLY GLY A . n 
A 1 223 ILE 223 377 377 ILE ILE A . n 
A 1 224 GLU 224 378 378 GLU GLU A . n 
A 1 225 VAL 225 379 379 VAL VAL A . n 
A 1 226 VAL 226 380 380 VAL VAL A . n 
A 1 227 MET 227 381 381 MET MET A . n 
A 1 228 ARG 228 382 382 ARG ARG A . n 
A 1 229 GLN 229 383 383 GLN GLN A . n 
A 1 230 VAL 230 384 384 VAL VAL A . n 
A 1 231 PHE 231 385 385 PHE PHE A . n 
A 1 232 PHE 232 386 386 PHE PHE A . n 
A 1 233 GLY 233 387 387 GLY GLY A . n 
A 1 234 ALA 234 388 388 ALA ALA A . n 
A 1 235 GLY 235 389 389 GLY GLY A . n 
A 1 236 ASN 236 390 390 ASN ASN A . n 
A 1 237 TYR 237 391 391 TYR TYR A . n 
A 1 238 HIS 238 392 392 HIS HIS A . n 
A 1 239 LEU 239 393 393 LEU LEU A . n 
A 1 240 VAL 240 394 394 VAL VAL A . n 
A 1 241 ASP 241 395 395 ASP ASP A . n 
A 1 242 GLU 242 396 396 GLU GLU A . n 
A 1 243 ASN 243 397 397 ASN ASN A . n 
A 1 244 PHE 244 398 398 PHE PHE A . n 
A 1 245 ASP 245 399 399 ASP ASP A . n 
A 1 246 PRO 246 400 400 PRO PRO A . n 
A 1 247 LEU 247 401 401 LEU LEU A . n 
A 1 248 PRO 248 402 402 PRO PRO A . n 
A 1 249 ASP 249 403 403 ASP ASP A . n 
A 1 250 TYR 250 404 404 TYR TYR A . n 
A 1 251 TRP 251 405 405 TRP TRP A . n 
A 1 252 LEU 252 406 406 LEU LEU A . n 
A 1 253 SER 253 407 407 SER SER A . n 
A 1 254 LEU 254 408 408 LEU LEU A . n 
A 1 255 LEU 255 409 409 LEU LEU A . n 
A 1 256 PHE 256 410 410 PHE PHE A . n 
A 1 257 LYS 257 411 411 LYS LYS A . n 
A 1 258 LYS 258 412 412 LYS LYS A . n 
A 1 259 LEU 259 413 413 LEU LEU A . n 
A 1 260 VAL 260 414 414 VAL VAL A . n 
A 1 261 GLY 261 415 415 GLY GLY A . n 
A 1 262 THR 262 416 416 THR THR A . n 
A 1 263 LYS 263 417 417 LYS LYS A . n 
A 1 264 VAL 264 418 418 VAL VAL A . n 
A 1 265 LEU 265 419 419 LEU LEU A . n 
A 1 266 MET 266 420 420 MET MET A . n 
A 1 267 ALA 267 421 421 ALA ALA A . n 
A 1 268 SER 268 422 422 SER SER A . n 
A 1 269 VAL 269 423 423 VAL VAL A . n 
A 1 270 GLN 270 424 424 GLN GLN A . n 
A 1 271 GLY 271 425 425 GLY GLY A . n 
A 1 272 SER 272 426 426 SER SER A . n 
A 1 273 LYS 273 427 427 LYS LYS A . n 
A 1 274 ARG 274 428 428 ARG ARG A . n 
A 1 275 ARG 275 429 429 ARG ARG A . n 
A 1 276 LYS 276 430 430 LYS LYS A . n 
A 1 277 LEU 277 431 431 LEU LEU A . n 
A 1 278 ARG 278 432 432 ARG ARG A . n 
A 1 279 VAL 279 433 433 VAL VAL A . n 
A 1 280 TYR 280 434 434 TYR TYR A . n 
A 1 281 LEU 281 435 435 LEU LEU A . n 
A 1 282 HIS 282 436 436 HIS HIS A . n 
A 1 283 CYS 283 437 437 CYS CYS A . n 
A 1 284 THR 284 438 438 THR THR A . n 
A 1 285 ASN 285 439 439 ASN ASN A . n 
A 1 286 THR 286 440 440 THR THR A . n 
A 1 287 ASP 287 441 441 ASP ASP A . n 
A 1 288 ASN 288 442 442 ASN ASN A . n 
A 1 289 PRO 289 443 443 PRO PRO A . n 
A 1 290 ARG 290 444 444 ARG ARG A . n 
A 1 291 TYR 291 445 445 TYR TYR A . n 
A 1 292 LYS 292 446 446 LYS LYS A . n 
A 1 293 GLU 293 447 447 GLU GLU A . n 
A 1 294 GLY 294 448 448 GLY GLY A . n 
A 1 295 ASP 295 449 449 ASP ASP A . n 
A 1 296 LEU 296 450 450 LEU LEU A . n 
A 1 297 THR 297 451 451 THR THR A . n 
A 1 298 LEU 298 452 452 LEU LEU A . n 
A 1 299 TYR 299 453 453 TYR TYR A . n 
A 1 300 ALA 300 454 454 ALA ALA A . n 
A 1 301 ILE 301 455 455 ILE ILE A . n 
A 1 302 ASN 302 456 456 ASN ASN A . n 
A 1 303 LEU 303 457 457 LEU LEU A . n 
A 1 304 HIS 304 458 458 HIS HIS A . n 
A 1 305 ASN 305 459 459 ASN ASN A . n 
A 1 306 VAL 306 460 460 VAL VAL A . n 
A 1 307 THR 307 461 461 THR THR A . n 
A 1 308 LYS 308 462 462 LYS LYS A . n 
A 1 309 TYR 309 463 463 TYR TYR A . n 
A 1 310 LEU 310 464 464 LEU LEU A . n 
A 1 311 ARG 311 465 465 ARG ARG A . n 
A 1 312 LEU 312 466 466 LEU LEU A . n 
A 1 313 PRO 313 467 467 PRO PRO A . n 
A 1 314 TYR 314 468 468 TYR TYR A . n 
A 1 315 PRO 315 469 469 PRO PRO A . n 
A 1 316 PHE 316 470 470 PHE PHE A . n 
A 1 317 SER 317 471 471 SER SER A . n 
A 1 318 ASN 318 472 472 ASN ASN A . n 
A 1 319 LYS 319 473 473 LYS LYS A . n 
A 1 320 GLN 320 474 474 GLN GLN A . n 
A 1 321 VAL 321 475 475 VAL VAL A . n 
A 1 322 ASP 322 476 476 ASP ASP A . n 
A 1 323 LYS 323 477 477 LYS LYS A . n 
A 1 324 TYR 324 478 478 TYR TYR A . n 
A 1 325 LEU 325 479 479 LEU LEU A . n 
A 1 326 LEU 326 480 480 LEU LEU A . n 
A 1 327 ARG 327 481 481 ARG ARG A . n 
A 1 328 PRO 328 482 482 PRO PRO A . n 
A 1 329 LEU 329 483 483 LEU LEU A . n 
A 1 330 GLY 330 484 484 GLY GLY A . n 
A 1 331 PRO 331 485 485 PRO PRO A . n 
A 1 332 HIS 332 486 486 HIS HIS A . n 
A 1 333 GLY 333 487 487 GLY GLY A . n 
A 1 334 LEU 334 488 488 LEU LEU A . n 
A 1 335 LEU 335 489 489 LEU LEU A . n 
A 1 336 SER 336 490 490 SER SER A . n 
A 1 337 LYS 337 491 491 LYS LYS A . n 
A 1 338 SER 338 492 492 SER SER A . n 
A 1 339 VAL 339 493 493 VAL VAL A . n 
A 1 340 GLN 340 494 494 GLN GLN A . n 
A 1 341 LEU 341 495 495 LEU LEU A . n 
A 1 342 ASN 342 496 496 ASN ASN A . n 
A 1 343 GLY 343 497 497 GLY GLY A . n 
A 1 344 LEU 344 498 498 LEU LEU A . n 
A 1 345 THR 345 499 499 THR THR A . n 
A 1 346 LEU 346 500 500 LEU LEU A . n 
A 1 347 LYS 347 501 501 LYS LYS A . n 
A 1 348 MET 348 502 502 MET MET A . n 
A 1 349 VAL 349 503 503 VAL VAL A . n 
A 1 350 ASP 350 504 504 ASP ASP A . n 
A 1 351 ASP 351 505 505 ASP ASP A . n 
A 1 352 GLN 352 506 506 GLN GLN A . n 
A 1 353 THR 353 507 507 THR THR A . n 
A 1 354 LEU 354 508 508 LEU LEU A . n 
A 1 355 PRO 355 509 509 PRO PRO A . n 
A 1 356 PRO 356 510 510 PRO PRO A . n 
A 1 357 LEU 357 511 511 LEU LEU A . n 
A 1 358 MET 358 512 512 MET MET A . n 
A 1 359 GLU 359 513 513 GLU GLU A . n 
A 1 360 LYS 360 514 514 LYS LYS A . n 
A 1 361 PRO 361 515 515 PRO PRO A . n 
A 1 362 LEU 362 516 516 LEU LEU A . n 
A 1 363 ARG 363 517 517 ARG ARG A . n 
A 1 364 PRO 364 518 518 PRO PRO A . n 
A 1 365 GLY 365 519 519 GLY GLY A . n 
A 1 366 SER 366 520 520 SER SER A . n 
A 1 367 SER 367 521 521 SER SER A . n 
A 1 368 LEU 368 522 522 LEU LEU A . n 
A 1 369 GLY 369 523 523 GLY GLY A . n 
A 1 370 LEU 370 524 524 LEU LEU A . n 
A 1 371 PRO 371 525 525 PRO PRO A . n 
A 1 372 ALA 372 526 526 ALA ALA A . n 
A 1 373 PHE 373 527 527 PHE PHE A . n 
A 1 374 SER 374 528 528 SER SER A . n 
A 1 375 TYR 375 529 529 TYR TYR A . n 
A 1 376 SER 376 530 530 SER SER A . n 
A 1 377 PHE 377 531 531 PHE PHE A . n 
A 1 378 PHE 378 532 532 PHE PHE A . n 
A 1 379 VAL 379 533 533 VAL VAL A . n 
A 1 380 ILE 380 534 534 ILE ILE A . n 
A 1 381 ARG 381 535 535 ARG ARG A . n 
A 1 382 ASN 382 536 536 ASN ASN A . n 
A 1 383 ALA 383 537 537 ALA ALA A . n 
A 1 384 LYS 384 538 538 LYS LYS A . n 
A 1 385 VAL 385 539 539 VAL VAL A . n 
A 1 386 ALA 386 540 540 ALA ALA A . n 
A 1 387 ALA 387 541 541 ALA ALA A . n 
A 1 388 CYS 388 542 542 CYS CYS A . n 
A 1 389 ILE 389 543 543 ILE ILE A . n 
B 2 1   ASP 1   33  ?   ?   ?   B . n 
B 2 2   PRO 2   34  ?   ?   ?   B . n 
B 2 3   GLY 3   35  ?   ?   ?   B . n 
B 2 4   GLN 4   36  36  GLN GLN B . n 
B 2 5   ASP 5   37  37  ASP ASP B . n 
B 2 6   VAL 6   38  38  VAL VAL B . n 
B 2 7   VAL 7   39  39  VAL VAL B . n 
B 2 8   ASP 8   40  40  ASP ASP B . n 
B 2 9   LEU 9   41  41  LEU LEU B . n 
B 2 10  ASP 10  42  42  ASP ASP B . n 
B 2 11  PHE 11  43  43  PHE PHE B . n 
B 2 12  PHE 12  44  44  PHE PHE B . n 
B 2 13  THR 13  45  45  THR THR B . n 
B 2 14  GLN 14  46  46  GLN GLN B . n 
B 2 15  GLU 15  47  47  GLU GLU B . n 
B 2 16  PRO 16  48  48  PRO PRO B . n 
B 2 17  LEU 17  49  49  LEU LEU B . n 
B 2 18  HIS 18  50  50  HIS HIS B . n 
B 2 19  LEU 19  51  51  LEU LEU B . n 
B 2 20  VAL 20  52  52  VAL VAL B . n 
B 2 21  SER 21  53  53  SER SER B . n 
B 2 22  PRO 22  54  54  PRO PRO B . n 
B 2 23  SER 23  55  55  SER SER B . n 
B 2 24  PHE 24  56  56  PHE PHE B . n 
B 2 25  LEU 25  57  57  LEU LEU B . n 
B 2 26  SER 26  58  58  SER SER B . n 
B 2 27  VAL 27  59  59  VAL VAL B . n 
B 2 28  THR 28  60  60  THR THR B . n 
B 2 29  ILE 29  61  61  ILE ILE B . n 
B 2 30  ASP 30  62  62  ASP ASP B . n 
B 2 31  ALA 31  63  63  ALA ALA B . n 
B 2 32  ASN 32  64  64  ASN ASN B . n 
B 2 33  LEU 33  65  65  LEU LEU B . n 
B 2 34  ALA 34  66  66  ALA ALA B . n 
B 2 35  THR 35  67  67  THR THR B . n 
B 2 36  ASP 36  68  68  ASP ASP B . n 
B 2 37  PRO 37  69  69  PRO PRO B . n 
B 2 38  ARG 38  70  70  ARG ARG B . n 
B 2 39  PHE 39  71  71  PHE PHE B . n 
B 2 40  LEU 40  72  72  LEU LEU B . n 
B 2 41  ILE 41  73  73  ILE ILE B . n 
B 2 42  LEU 42  74  74  LEU LEU B . n 
B 2 43  LEU 43  75  75  LEU LEU B . n 
B 2 44  GLY 44  76  76  GLY GLY B . n 
B 2 45  SER 45  77  77  SER SER B . n 
B 2 46  PRO 46  78  78  PRO PRO B . n 
B 2 47  LYS 47  79  79  LYS LYS B . n 
B 2 48  LEU 48  80  80  LEU LEU B . n 
B 2 49  ARG 49  81  81  ARG ARG B . n 
B 2 50  THR 50  82  82  THR THR B . n 
B 2 51  LEU 51  83  83  LEU LEU B . n 
B 2 52  ALA 52  84  84  ALA ALA B . n 
B 2 53  ARG 53  85  85  ARG ARG B . n 
B 2 54  GLY 54  86  86  GLY GLY B . n 
B 2 55  LEU 55  87  87  LEU LEU B . n 
B 2 56  SER 56  88  88  SER SER B . n 
B 2 57  PRO 57  89  89  PRO PRO B . n 
B 2 58  ALA 58  90  90  ALA ALA B . n 
B 2 59  TYR 59  91  91  TYR TYR B . n 
B 2 60  LEU 60  92  92  LEU LEU B . n 
B 2 61  ARG 61  93  93  ARG ARG B . n 
B 2 62  PHE 62  94  94  PHE PHE B . n 
B 2 63  GLY 63  95  95  GLY GLY B . n 
B 2 64  GLY 64  96  96  GLY GLY B . n 
B 2 65  THR 65  97  97  THR THR B . n 
B 2 66  LYS 66  98  98  LYS LYS B . n 
B 2 67  THR 67  99  99  THR THR B . n 
B 2 68  ASP 68  100 100 ASP ASP B . n 
B 2 69  PHE 69  101 101 PHE PHE B . n 
B 2 70  LEU 70  102 102 LEU LEU B . n 
B 2 71  ILE 71  103 103 ILE ILE B . n 
B 2 72  PHE 72  104 104 PHE PHE B . n 
B 2 73  ASP 73  105 105 ASP ASP B . n 
B 2 74  PRO 74  106 106 PRO PRO B . n 
B 2 75  LYS 75  107 107 LYS LYS B . n 
B 2 76  LYS 76  108 108 LYS LYS B . n 
B 2 77  GLU 77  109 109 GLU GLU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 NAG 1   601  1   NAG NAG A . 
E 4 NAG 1   602  2   NAG NAG A . 
F 4 NAG 1   603  3   NAG NAG A . 
G 4 NAG 1   604  4   NAG NAG A . 
H 5 CL  1   605  1   CL  CL  A . 
I 5 CL  1   606  3   CL  CL  A . 
J 5 CL  1   607  5   CL  CL  A . 
K 6 NPO 1   612  1   NPO M40 A . 
L 5 CL  1   201  4   CL  CL  B . 
M 7 HOH 1   701  1   HOH HOH A . 
M 7 HOH 2   702  158 HOH HOH A . 
M 7 HOH 3   703  415 HOH HOH A . 
M 7 HOH 4   704  110 HOH HOH A . 
M 7 HOH 5   705  320 HOH HOH A . 
M 7 HOH 6   706  265 HOH HOH A . 
M 7 HOH 7   707  146 HOH HOH A . 
M 7 HOH 8   708  36  HOH HOH A . 
M 7 HOH 9   709  377 HOH HOH A . 
M 7 HOH 10  710  236 HOH HOH A . 
M 7 HOH 11  711  152 HOH HOH A . 
M 7 HOH 12  712  274 HOH HOH A . 
M 7 HOH 13  713  438 HOH HOH A . 
M 7 HOH 14  714  335 HOH HOH A . 
M 7 HOH 15  715  133 HOH HOH A . 
M 7 HOH 16  716  167 HOH HOH A . 
M 7 HOH 17  717  303 HOH HOH A . 
M 7 HOH 18  718  45  HOH HOH A . 
M 7 HOH 19  719  244 HOH HOH A . 
M 7 HOH 20  720  288 HOH HOH A . 
M 7 HOH 21  721  315 HOH HOH A . 
M 7 HOH 22  722  197 HOH HOH A . 
M 7 HOH 23  723  296 HOH HOH A . 
M 7 HOH 24  724  42  HOH HOH A . 
M 7 HOH 25  725  175 HOH HOH A . 
M 7 HOH 26  726  85  HOH HOH A . 
M 7 HOH 27  727  140 HOH HOH A . 
M 7 HOH 28  728  21  HOH HOH A . 
M 7 HOH 29  729  345 HOH HOH A . 
M 7 HOH 30  730  59  HOH HOH A . 
M 7 HOH 31  731  46  HOH HOH A . 
M 7 HOH 32  732  147 HOH HOH A . 
M 7 HOH 33  733  37  HOH HOH A . 
M 7 HOH 34  734  362 HOH HOH A . 
M 7 HOH 35  735  151 HOH HOH A . 
M 7 HOH 36  736  121 HOH HOH A . 
M 7 HOH 37  737  271 HOH HOH A . 
M 7 HOH 38  738  205 HOH HOH A . 
M 7 HOH 39  739  319 HOH HOH A . 
M 7 HOH 40  740  39  HOH HOH A . 
M 7 HOH 41  741  394 HOH HOH A . 
M 7 HOH 42  742  352 HOH HOH A . 
M 7 HOH 43  743  55  HOH HOH A . 
M 7 HOH 44  744  145 HOH HOH A . 
M 7 HOH 45  745  357 HOH HOH A . 
M 7 HOH 46  746  78  HOH HOH A . 
M 7 HOH 47  747  58  HOH HOH A . 
M 7 HOH 48  748  150 HOH HOH A . 
M 7 HOH 49  749  79  HOH HOH A . 
M 7 HOH 50  750  80  HOH HOH A . 
M 7 HOH 51  751  326 HOH HOH A . 
M 7 HOH 52  752  69  HOH HOH A . 
M 7 HOH 53  753  35  HOH HOH A . 
M 7 HOH 54  754  414 HOH HOH A . 
M 7 HOH 55  755  64  HOH HOH A . 
M 7 HOH 56  756  96  HOH HOH A . 
M 7 HOH 57  757  410 HOH HOH A . 
M 7 HOH 58  758  8   HOH HOH A . 
M 7 HOH 59  759  115 HOH HOH A . 
M 7 HOH 60  760  157 HOH HOH A . 
M 7 HOH 61  761  22  HOH HOH A . 
M 7 HOH 62  762  136 HOH HOH A . 
M 7 HOH 63  763  169 HOH HOH A . 
M 7 HOH 64  764  276 HOH HOH A . 
M 7 HOH 65  765  119 HOH HOH A . 
M 7 HOH 66  766  11  HOH HOH A . 
M 7 HOH 67  767  7   HOH HOH A . 
M 7 HOH 68  768  114 HOH HOH A . 
M 7 HOH 69  769  62  HOH HOH A . 
M 7 HOH 70  770  337 HOH HOH A . 
M 7 HOH 71  771  272 HOH HOH A . 
M 7 HOH 72  772  226 HOH HOH A . 
M 7 HOH 73  773  213 HOH HOH A . 
M 7 HOH 74  774  242 HOH HOH A . 
M 7 HOH 75  775  375 HOH HOH A . 
M 7 HOH 76  776  300 HOH HOH A . 
M 7 HOH 77  777  293 HOH HOH A . 
M 7 HOH 78  778  44  HOH HOH A . 
M 7 HOH 79  779  54  HOH HOH A . 
M 7 HOH 80  780  83  HOH HOH A . 
M 7 HOH 81  781  348 HOH HOH A . 
M 7 HOH 82  782  3   HOH HOH A . 
M 7 HOH 83  783  120 HOH HOH A . 
M 7 HOH 84  784  298 HOH HOH A . 
M 7 HOH 85  785  18  HOH HOH A . 
M 7 HOH 86  786  27  HOH HOH A . 
M 7 HOH 87  787  63  HOH HOH A . 
M 7 HOH 88  788  170 HOH HOH A . 
M 7 HOH 89  789  160 HOH HOH A . 
M 7 HOH 90  790  159 HOH HOH A . 
M 7 HOH 91  791  194 HOH HOH A . 
M 7 HOH 92  792  48  HOH HOH A . 
M 7 HOH 93  793  101 HOH HOH A . 
M 7 HOH 94  794  200 HOH HOH A . 
M 7 HOH 95  795  91  HOH HOH A . 
M 7 HOH 96  796  97  HOH HOH A . 
M 7 HOH 97  797  153 HOH HOH A . 
M 7 HOH 98  798  307 HOH HOH A . 
M 7 HOH 99  799  240 HOH HOH A . 
M 7 HOH 100 800  267 HOH HOH A . 
M 7 HOH 101 801  94  HOH HOH A . 
M 7 HOH 102 802  210 HOH HOH A . 
M 7 HOH 103 803  186 HOH HOH A . 
M 7 HOH 104 804  74  HOH HOH A . 
M 7 HOH 105 805  172 HOH HOH A . 
M 7 HOH 106 806  299 HOH HOH A . 
M 7 HOH 107 807  154 HOH HOH A . 
M 7 HOH 108 808  143 HOH HOH A . 
M 7 HOH 109 809  118 HOH HOH A . 
M 7 HOH 110 810  398 HOH HOH A . 
M 7 HOH 111 811  355 HOH HOH A . 
M 7 HOH 112 812  198 HOH HOH A . 
M 7 HOH 113 813  349 HOH HOH A . 
M 7 HOH 114 814  50  HOH HOH A . 
M 7 HOH 115 815  282 HOH HOH A . 
M 7 HOH 116 816  4   HOH HOH A . 
M 7 HOH 117 817  40  HOH HOH A . 
M 7 HOH 118 818  52  HOH HOH A . 
M 7 HOH 119 819  199 HOH HOH A . 
M 7 HOH 120 820  385 HOH HOH A . 
M 7 HOH 121 821  250 HOH HOH A . 
M 7 HOH 122 822  16  HOH HOH A . 
M 7 HOH 123 823  420 HOH HOH A . 
M 7 HOH 124 824  215 HOH HOH A . 
M 7 HOH 125 825  344 HOH HOH A . 
M 7 HOH 126 826  177 HOH HOH A . 
M 7 HOH 127 827  334 HOH HOH A . 
M 7 HOH 128 828  368 HOH HOH A . 
M 7 HOH 129 829  164 HOH HOH A . 
M 7 HOH 130 830  182 HOH HOH A . 
M 7 HOH 131 831  53  HOH HOH A . 
M 7 HOH 132 832  60  HOH HOH A . 
M 7 HOH 133 833  178 HOH HOH A . 
M 7 HOH 134 834  56  HOH HOH A . 
M 7 HOH 135 835  209 HOH HOH A . 
M 7 HOH 136 836  384 HOH HOH A . 
M 7 HOH 137 837  89  HOH HOH A . 
M 7 HOH 138 838  41  HOH HOH A . 
M 7 HOH 139 839  70  HOH HOH A . 
M 7 HOH 140 840  122 HOH HOH A . 
M 7 HOH 141 841  104 HOH HOH A . 
M 7 HOH 142 842  38  HOH HOH A . 
M 7 HOH 143 843  435 HOH HOH A . 
M 7 HOH 144 844  161 HOH HOH A . 
M 7 HOH 145 845  25  HOH HOH A . 
M 7 HOH 146 846  332 HOH HOH A . 
M 7 HOH 147 847  353 HOH HOH A . 
M 7 HOH 148 848  43  HOH HOH A . 
M 7 HOH 149 849  191 HOH HOH A . 
M 7 HOH 150 850  165 HOH HOH A . 
M 7 HOH 151 851  350 HOH HOH A . 
M 7 HOH 152 852  351 HOH HOH A . 
M 7 HOH 153 853  93  HOH HOH A . 
M 7 HOH 154 854  173 HOH HOH A . 
M 7 HOH 155 855  181 HOH HOH A . 
M 7 HOH 156 856  5   HOH HOH A . 
M 7 HOH 157 857  72  HOH HOH A . 
M 7 HOH 158 858  263 HOH HOH A . 
M 7 HOH 159 859  29  HOH HOH A . 
M 7 HOH 160 860  367 HOH HOH A . 
M 7 HOH 161 861  262 HOH HOH A . 
M 7 HOH 162 862  179 HOH HOH A . 
M 7 HOH 163 863  269 HOH HOH A . 
M 7 HOH 164 864  188 HOH HOH A . 
M 7 HOH 165 865  24  HOH HOH A . 
M 7 HOH 166 866  316 HOH HOH A . 
M 7 HOH 167 867  31  HOH HOH A . 
M 7 HOH 168 868  391 HOH HOH A . 
M 7 HOH 169 869  329 HOH HOH A . 
M 7 HOH 170 870  65  HOH HOH A . 
M 7 HOH 171 871  254 HOH HOH A . 
M 7 HOH 172 872  162 HOH HOH A . 
M 7 HOH 173 873  336 HOH HOH A . 
M 7 HOH 174 874  204 HOH HOH A . 
M 7 HOH 175 875  359 HOH HOH A . 
M 7 HOH 176 876  19  HOH HOH A . 
M 7 HOH 177 877  166 HOH HOH A . 
M 7 HOH 178 878  365 HOH HOH A . 
M 7 HOH 179 879  82  HOH HOH A . 
M 7 HOH 180 880  277 HOH HOH A . 
M 7 HOH 181 881  224 HOH HOH A . 
M 7 HOH 182 882  378 HOH HOH A . 
M 7 HOH 183 883  2   HOH HOH A . 
M 7 HOH 184 884  71  HOH HOH A . 
M 7 HOH 185 885  284 HOH HOH A . 
M 7 HOH 186 886  195 HOH HOH A . 
M 7 HOH 187 887  34  HOH HOH A . 
M 7 HOH 188 888  77  HOH HOH A . 
M 7 HOH 189 889  203 HOH HOH A . 
M 7 HOH 190 890  163 HOH HOH A . 
M 7 HOH 191 891  17  HOH HOH A . 
M 7 HOH 192 892  92  HOH HOH A . 
M 7 HOH 193 893  129 HOH HOH A . 
M 7 HOH 194 894  223 HOH HOH A . 
M 7 HOH 195 895  429 HOH HOH A . 
M 7 HOH 196 896  14  HOH HOH A . 
M 7 HOH 197 897  134 HOH HOH A . 
M 7 HOH 198 898  111 HOH HOH A . 
M 7 HOH 199 899  343 HOH HOH A . 
M 7 HOH 200 900  184 HOH HOH A . 
M 7 HOH 201 901  407 HOH HOH A . 
M 7 HOH 202 902  98  HOH HOH A . 
M 7 HOH 203 903  417 HOH HOH A . 
M 7 HOH 204 904  180 HOH HOH A . 
M 7 HOH 205 905  372 HOH HOH A . 
M 7 HOH 206 906  15  HOH HOH A . 
M 7 HOH 207 907  305 HOH HOH A . 
M 7 HOH 208 908  88  HOH HOH A . 
M 7 HOH 209 909  6   HOH HOH A . 
M 7 HOH 210 910  239 HOH HOH A . 
M 7 HOH 211 911  76  HOH HOH A . 
M 7 HOH 212 912  10  HOH HOH A . 
M 7 HOH 213 913  155 HOH HOH A . 
M 7 HOH 214 914  324 HOH HOH A . 
M 7 HOH 215 915  301 HOH HOH A . 
M 7 HOH 216 916  61  HOH HOH A . 
M 7 HOH 217 917  49  HOH HOH A . 
M 7 HOH 218 918  132 HOH HOH A . 
M 7 HOH 219 919  12  HOH HOH A . 
M 7 HOH 220 920  419 HOH HOH A . 
M 7 HOH 221 921  196 HOH HOH A . 
M 7 HOH 222 922  248 HOH HOH A . 
M 7 HOH 223 923  183 HOH HOH A . 
M 7 HOH 224 924  139 HOH HOH A . 
M 7 HOH 225 925  222 HOH HOH A . 
M 7 HOH 226 926  126 HOH HOH A . 
M 7 HOH 227 927  123 HOH HOH A . 
M 7 HOH 228 928  393 HOH HOH A . 
M 7 HOH 229 929  260 HOH HOH A . 
M 7 HOH 230 930  246 HOH HOH A . 
M 7 HOH 231 931  321 HOH HOH A . 
M 7 HOH 232 932  386 HOH HOH A . 
M 7 HOH 233 933  116 HOH HOH A . 
M 7 HOH 234 934  66  HOH HOH A . 
M 7 HOH 235 935  369 HOH HOH A . 
M 7 HOH 236 936  57  HOH HOH A . 
M 7 HOH 237 937  192 HOH HOH A . 
M 7 HOH 238 938  28  HOH HOH A . 
M 7 HOH 239 939  84  HOH HOH A . 
M 7 HOH 240 940  437 HOH HOH A . 
M 7 HOH 241 941  325 HOH HOH A . 
M 7 HOH 242 942  266 HOH HOH A . 
M 7 HOH 243 943  237 HOH HOH A . 
M 7 HOH 244 944  270 HOH HOH A . 
M 7 HOH 245 945  221 HOH HOH A . 
M 7 HOH 246 946  261 HOH HOH A . 
M 7 HOH 247 947  241 HOH HOH A . 
M 7 HOH 248 948  106 HOH HOH A . 
M 7 HOH 249 949  174 HOH HOH A . 
M 7 HOH 250 950  90  HOH HOH A . 
M 7 HOH 251 951  418 HOH HOH A . 
M 7 HOH 252 952  135 HOH HOH A . 
M 7 HOH 253 953  33  HOH HOH A . 
M 7 HOH 254 954  347 HOH HOH A . 
M 7 HOH 255 955  317 HOH HOH A . 
M 7 HOH 256 956  30  HOH HOH A . 
M 7 HOH 257 957  422 HOH HOH A . 
M 7 HOH 258 958  346 HOH HOH A . 
M 7 HOH 259 959  432 HOH HOH A . 
M 7 HOH 260 960  218 HOH HOH A . 
M 7 HOH 261 961  225 HOH HOH A . 
M 7 HOH 262 962  20  HOH HOH A . 
M 7 HOH 263 963  434 HOH HOH A . 
M 7 HOH 264 964  130 HOH HOH A . 
M 7 HOH 265 965  273 HOH HOH A . 
M 7 HOH 266 966  73  HOH HOH A . 
M 7 HOH 267 967  392 HOH HOH A . 
M 7 HOH 268 968  328 HOH HOH A . 
M 7 HOH 269 969  428 HOH HOH A . 
M 7 HOH 270 970  275 HOH HOH A . 
M 7 HOH 271 971  81  HOH HOH A . 
M 7 HOH 272 972  258 HOH HOH A . 
M 7 HOH 273 973  99  HOH HOH A . 
M 7 HOH 274 974  374 HOH HOH A . 
M 7 HOH 275 975  281 HOH HOH A . 
M 7 HOH 276 976  253 HOH HOH A . 
M 7 HOH 277 977  287 HOH HOH A . 
M 7 HOH 278 978  187 HOH HOH A . 
M 7 HOH 279 979  440 HOH HOH A . 
M 7 HOH 280 980  255 HOH HOH A . 
M 7 HOH 281 981  389 HOH HOH A . 
M 7 HOH 282 982  217 HOH HOH A . 
M 7 HOH 283 983  304 HOH HOH A . 
M 7 HOH 284 984  323 HOH HOH A . 
M 7 HOH 285 985  413 HOH HOH A . 
M 7 HOH 286 986  294 HOH HOH A . 
M 7 HOH 287 987  310 HOH HOH A . 
M 7 HOH 288 988  109 HOH HOH A . 
M 7 HOH 289 989  308 HOH HOH A . 
M 7 HOH 290 990  399 HOH HOH A . 
M 7 HOH 291 991  247 HOH HOH A . 
M 7 HOH 292 992  286 HOH HOH A . 
M 7 HOH 293 993  439 HOH HOH A . 
M 7 HOH 294 994  229 HOH HOH A . 
M 7 HOH 295 995  322 HOH HOH A . 
M 7 HOH 296 996  285 HOH HOH A . 
M 7 HOH 297 997  436 HOH HOH A . 
M 7 HOH 298 998  234 HOH HOH A . 
M 7 HOH 299 999  388 HOH HOH A . 
M 7 HOH 300 1000 401 HOH HOH A . 
M 7 HOH 301 1001 404 HOH HOH A . 
M 7 HOH 302 1002 361 HOH HOH A . 
M 7 HOH 303 1003 230 HOH HOH A . 
M 7 HOH 304 1004 283 HOH HOH A . 
M 7 HOH 305 1005 216 HOH HOH A . 
M 7 HOH 306 1006 309 HOH HOH A . 
M 7 HOH 307 1007 425 HOH HOH A . 
M 7 HOH 308 1008 354 HOH HOH A . 
M 7 HOH 309 1009 243 HOH HOH A . 
M 7 HOH 310 1010 306 HOH HOH A . 
M 7 HOH 311 1011 363 HOH HOH A . 
M 7 HOH 312 1012 295 HOH HOH A . 
M 7 HOH 313 1013 327 HOH HOH A . 
M 7 HOH 314 1014 252 HOH HOH A . 
M 7 HOH 315 1015 251 HOH HOH A . 
M 7 HOH 316 1016 202 HOH HOH A . 
M 7 HOH 317 1017 433 HOH HOH A . 
M 7 HOH 318 1018 124 HOH HOH A . 
M 7 HOH 319 1019 370 HOH HOH A . 
M 7 HOH 320 1020 228 HOH HOH A . 
M 7 HOH 321 1021 376 HOH HOH A . 
M 7 HOH 322 1022 427 HOH HOH A . 
M 7 HOH 323 1023 278 HOH HOH A . 
M 7 HOH 324 1024 264 HOH HOH A . 
M 7 HOH 325 1025 431 HOH HOH A . 
M 7 HOH 326 1026 360 HOH HOH A . 
M 7 HOH 327 1027 430 HOH HOH A . 
M 7 HOH 328 1028 358 HOH HOH A . 
M 7 HOH 329 1029 268 HOH HOH A . 
M 7 HOH 330 1030 219 HOH HOH A . 
M 7 HOH 331 1031 280 HOH HOH A . 
M 7 HOH 332 1032 185 HOH HOH A . 
M 7 HOH 333 1033 279 HOH HOH A . 
M 7 HOH 334 1034 259 HOH HOH A . 
M 7 HOH 335 1035 366 HOH HOH A . 
N 7 HOH 1   301  86  HOH HOH B . 
N 7 HOH 2   302  148 HOH HOH B . 
N 7 HOH 3   303  338 HOH HOH B . 
N 7 HOH 4   304  47  HOH HOH B . 
N 7 HOH 5   305  412 HOH HOH B . 
N 7 HOH 6   306  380 HOH HOH B . 
N 7 HOH 7   307  291 HOH HOH B . 
N 7 HOH 8   308  416 HOH HOH B . 
N 7 HOH 9   309  168 HOH HOH B . 
N 7 HOH 10  310  141 HOH HOH B . 
N 7 HOH 11  311  138 HOH HOH B . 
N 7 HOH 12  312  208 HOH HOH B . 
N 7 HOH 13  313  331 HOH HOH B . 
N 7 HOH 14  314  238 HOH HOH B . 
N 7 HOH 15  315  142 HOH HOH B . 
N 7 HOH 16  316  423 HOH HOH B . 
N 7 HOH 17  317  51  HOH HOH B . 
N 7 HOH 18  318  249 HOH HOH B . 
N 7 HOH 19  319  75  HOH HOH B . 
N 7 HOH 20  320  26  HOH HOH B . 
N 7 HOH 21  321  297 HOH HOH B . 
N 7 HOH 22  322  87  HOH HOH B . 
N 7 HOH 23  323  131 HOH HOH B . 
N 7 HOH 24  324  292 HOH HOH B . 
N 7 HOH 25  325  108 HOH HOH B . 
N 7 HOH 26  326  13  HOH HOH B . 
N 7 HOH 27  327  232 HOH HOH B . 
N 7 HOH 28  328  67  HOH HOH B . 
N 7 HOH 29  329  112 HOH HOH B . 
N 7 HOH 30  330  381 HOH HOH B . 
N 7 HOH 31  331  137 HOH HOH B . 
N 7 HOH 32  332  103 HOH HOH B . 
N 7 HOH 33  333  231 HOH HOH B . 
N 7 HOH 34  334  100 HOH HOH B . 
N 7 HOH 35  335  9   HOH HOH B . 
N 7 HOH 36  336  107 HOH HOH B . 
N 7 HOH 37  337  156 HOH HOH B . 
N 7 HOH 38  338  408 HOH HOH B . 
N 7 HOH 39  339  68  HOH HOH B . 
N 7 HOH 40  340  411 HOH HOH B . 
N 7 HOH 41  341  105 HOH HOH B . 
N 7 HOH 42  342  113 HOH HOH B . 
N 7 HOH 43  343  127 HOH HOH B . 
N 7 HOH 44  344  206 HOH HOH B . 
N 7 HOH 45  345  289 HOH HOH B . 
N 7 HOH 46  346  402 HOH HOH B . 
N 7 HOH 47  347  211 HOH HOH B . 
N 7 HOH 48  348  371 HOH HOH B . 
N 7 HOH 49  349  256 HOH HOH B . 
N 7 HOH 50  350  426 HOH HOH B . 
N 7 HOH 51  351  102 HOH HOH B . 
N 7 HOH 52  352  379 HOH HOH B . 
N 7 HOH 53  353  330 HOH HOH B . 
N 7 HOH 54  354  290 HOH HOH B . 
N 7 HOH 55  355  257 HOH HOH B . 
N 7 HOH 56  356  339 HOH HOH B . 
N 7 HOH 57  357  390 HOH HOH B . 
N 7 HOH 58  358  342 HOH HOH B . 
N 7 HOH 59  359  424 HOH HOH B . 
N 7 HOH 60  360  341 HOH HOH B . 
N 7 HOH 61  361  235 HOH HOH B . 
N 7 HOH 62  362  245 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 11650 ? 
1 MORE         -61   ? 
1 'SSA (A^2)'  18760 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-11-18 
2 'Structure model' 1 1 2015-12-02 
3 'Structure model' 1 2 2015-12-16 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Database references'  
3 4 'Structure model' 'Atomic model'         
4 4 'Structure model' 'Data collection'      
5 4 'Structure model' 'Derived calculations' 
6 4 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' pdbx_branch_scheme            
5  4 'Structure model' pdbx_chem_comp_identifier     
6  4 'Structure model' pdbx_entity_branch            
7  4 'Structure model' pdbx_entity_branch_descriptor 
8  4 'Structure model' pdbx_entity_branch_link       
9  4 'Structure model' pdbx_entity_branch_list       
10 4 'Structure model' pdbx_entity_nonpoly           
11 4 'Structure model' pdbx_nonpoly_scheme           
12 4 'Structure model' pdbx_struct_assembly_gen      
13 4 'Structure model' struct_asym                   
14 4 'Structure model' struct_conn                   
15 4 'Structure model' struct_site                   
16 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'              
2  4 'Structure model' '_atom_site.Cartn_x'                     
3  4 'Structure model' '_atom_site.Cartn_y'                     
4  4 'Structure model' '_atom_site.Cartn_z'                     
5  4 'Structure model' '_atom_site.auth_asym_id'                
6  4 'Structure model' '_atom_site.auth_atom_id'                
7  4 'Structure model' '_atom_site.auth_comp_id'                
8  4 'Structure model' '_atom_site.auth_seq_id'                 
9  4 'Structure model' '_atom_site.label_asym_id'               
10 4 'Structure model' '_atom_site.label_atom_id'               
11 4 'Structure model' '_atom_site.label_comp_id'               
12 4 'Structure model' '_atom_site.label_entity_id'             
13 4 'Structure model' '_atom_site.type_symbol'                 
14 4 'Structure model' '_chem_comp.name'                        
15 4 'Structure model' '_chem_comp.type'                        
16 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
17 4 'Structure model' '_struct_conn.pdbx_dist_value'           
18 4 'Structure model' '_struct_conn.pdbx_role'                 
19 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
20 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
21 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
22 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
23 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
24 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
25 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
26 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
27 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
28 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
29 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'       
30 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0131 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              481 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              481 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              481 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.87 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            3.57 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 196 ? ? -95.34  32.18   
2 1 ALA A 233 ? ? -140.21 10.94   
3 1 THR A 333 ? ? -133.79 -47.04  
4 1 GLU A 343 ? ? -171.71 122.72  
5 1 LEU A 419 ? ? -115.69 -156.39 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    425 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   SER 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    426 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            145.27 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      B 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       362 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.20 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 155 ? A ASP 1 
2 1 Y 1 A PRO 156 ? A PRO 2 
3 1 Y 1 A GLY 157 ? A GLY 3 
4 1 Y 1 A LYS 158 ? A LYS 4 
5 1 Y 1 B ASP 33  ? B ASP 1 
6 1 Y 1 B PRO 34  ? B PRO 2 
7 1 Y 1 B GLY 35  ? B GLY 3 
# 
_pdbx_audit_support.funding_organization   'European Research Council' 
_pdbx_audit_support.country                'United Kingdom' 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 3 BDP 1 C BDP 1 F M40 1 n 
C 3 NDG 2 C NDG 2 F M40 1 n 
C 3 BDP 3 C BDP 3 F M40 1 n 
C 3 NDG 4 C NDG 4 F M40 1 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BDP 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpAb                        
BDP 'COMMON NAME'                         GMML     1.0 'b-D-glucopyranuronic acid'    
BDP 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpA                      
BDP 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcA                           
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
NDG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAca                      
NDG 'COMMON NAME'                         GMML     1.0 N-acetyl-a-D-glucopyranosamine 
NDG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-GlcpNAc                    
NDG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   3 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 3 DGlcpNAca1-4DGlcpAb1-4DGlcpNAca1-4DGlcpAb1-ROH                                          'Glycam Condensed Sequence' GMML       
1.0   
2 3 'WURCS=2.0/2,4,3/[a2122A-1b_1-5][a2122h-1a_1-5_2*NCC/3=O]/1-2-1-2/a4-b1_b4-c1_c4-d1'    WURCS                       PDB2Glycan 
1.1.0 
3 3 '[][D-1-deoxy-GlcpA]{[(4+1)][a-D-GlcpNAc]{[(4+1)][b-D-GlcpA]{[(4+1)][a-D-GlcpNAc]{}}}}' LINUCS                      PDB-CARE   
?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 3 2 NDG C1 O1 1 BDP O4 HO4 sing ? 
2 3 3 BDP C1 O1 2 NDG O4 HO4 sing ? 
3 3 4 NDG C1 O1 3 BDP O4 HO4 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
3 BDP 1 n 
3 NDG 2 n 
3 BDP 3 n 
3 NDG 4 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
5 'CHLORIDE ION'                           CL  
6 P-NITROPHENOL                            NPO 
7 water                                    HOH 
#