data_5EK0
# 
_entry.id   5EK0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5EK0         
WWPDB D_1000215048 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5EK0 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ahuja, S.'         1 
'Mukund, S.'        2 
'Starovasnik, M.A.' 3 
'Koth, C.M.'        4 
'Payandeh, J.'      5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            350 
_citation.language                  ? 
_citation.page_first                aac5464 
_citation.page_last                 aac5464 
_citation.title                     'Structural basis of Nav1.7 inhibition by an isoform-selective small-molecule antagonist.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aac5464 
_citation.pdbx_database_id_PubMed   26680203 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ahuja, S.'         1  
primary 'Mukund, S.'        2  
primary 'Deng, L.'          3  
primary 'Khakh, K.'         4  
primary 'Chang, E.'         5  
primary 'Ho, H.'            6  
primary 'Shriver, S.'       7  
primary 'Young, C.'         8  
primary 'Lin, S.'           9  
primary 'Johnson, J.P.'     10 
primary 'Wu, P.'            11 
primary 'Li, J.'            12 
primary 'Coons, M.'         13 
primary 'Tam, C.'           14 
primary 'Brillantes, B.'    15 
primary 'Sampang, H.'       16 
primary 'Mortara, K.'       17 
primary 'Bowman, K.K.'      18 
primary 'Clark, K.R.'       19 
primary 'Estevez, A.'       20 
primary 'Xie, Z.'           21 
primary 'Verschoof, H.'     22 
primary 'Grimwood, M.'      23 
primary 'Dehnhardt, C.'     24 
primary 'Andrez, J.C.'      25 
primary 'Focken, T.'        26 
primary 'Sutherlin, D.P.'   27 
primary 'Safina, B.S.'      28 
primary 'Starovasnik, M.A.' 29 
primary 'Ortwine, D.F.'     30 
primary 'Franke, Y.'        31 
primary 'Cohen, C.J.'       32 
primary 'Hackos, D.H.'      33 
primary 'Koth, C.M.'        34 
primary 'Payandeh, J.'      35 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5EK0 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     169.420 
_cell.length_a_esd                 ? 
_cell.length_b                     188.830 
_cell.length_b_esd                 ? 
_cell.length_c                     171.130 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        32 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5EK0 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Chimera of bacterial Ion transport protein and human Sodium channel protein type 9 subunit alpha' 34618.094 4  
? ? ? ? 
2 non-polymer syn 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE 678.940   21 ? ? ? ? 
3 non-polymer syn 
'3-cyano-4-[2-[2-(1-ethylazetidin-3-yl)pyrazol-3-yl]-4-(trifluoromethyl)phenoxy]-~{N}-(1,2,4-thiadiazol-5-yl)benzenesulfonamide' 
575.586   4  ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;euroendocrine sodium channel,hNE-Na,Peripheral sodium channel 1,PN1,Sodium channel protein type IX subunit alpha,Voltage-gated sodium channel subunit alpha Nav1.7
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDYKDDDDKGSLVPRGSHMYLRITNIVESSFFTKFIIYLIVLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTIEIILR
IYVHRISFFKDPWSLFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRILRLVTAVPQMRKIVSALISVIPGML
SVIALMTLFFYIFAIMATQLFGERFPEWFGTLGESFYTLFQVMTLESWSMGIVRPLMEVYPYAWVFFIPFIFVVTFVMIN
LVVAIIVDAMAILNQKEEQHIIDEVQSHEDNINNEIIKLREEIVELKELIKTSLKN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDYKDDDDKGSLVPRGSHMYLRITNIVESSFFTKFIIYLIVLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTIEIILR
IYVHRISFFKDPWSLFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRILRLVTAVPQMRKIVSALISVIPGML
SVIALMTLFFYIFAIMATQLFGERFPEWFGTLGESFYTLFQVMTLESWSMGIVRPLMEVYPYAWVFFIPFIFVVTFVMIN
LVVAIIVDAMAILNQKEEQHIIDEVQSHEDNINNEIIKLREEIVELKELIKTSLKN
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   TYR n 
1 4   LYS n 
1 5   ASP n 
1 6   ASP n 
1 7   ASP n 
1 8   ASP n 
1 9   LYS n 
1 10  GLY n 
1 11  SER n 
1 12  LEU n 
1 13  VAL n 
1 14  PRO n 
1 15  ARG n 
1 16  GLY n 
1 17  SER n 
1 18  HIS n 
1 19  MET n 
1 20  TYR n 
1 21  LEU n 
1 22  ARG n 
1 23  ILE n 
1 24  THR n 
1 25  ASN n 
1 26  ILE n 
1 27  VAL n 
1 28  GLU n 
1 29  SER n 
1 30  SER n 
1 31  PHE n 
1 32  PHE n 
1 33  THR n 
1 34  LYS n 
1 35  PHE n 
1 36  ILE n 
1 37  ILE n 
1 38  TYR n 
1 39  LEU n 
1 40  ILE n 
1 41  VAL n 
1 42  LEU n 
1 43  ASN n 
1 44  MET n 
1 45  VAL n 
1 46  THR n 
1 47  MET n 
1 48  MET n 
1 49  VAL n 
1 50  GLU n 
1 51  LYS n 
1 52  GLU n 
1 53  GLY n 
1 54  GLN n 
1 55  SER n 
1 56  GLN n 
1 57  HIS n 
1 58  MET n 
1 59  THR n 
1 60  GLU n 
1 61  VAL n 
1 62  LEU n 
1 63  TYR n 
1 64  TRP n 
1 65  ILE n 
1 66  ASN n 
1 67  VAL n 
1 68  VAL n 
1 69  PHE n 
1 70  ILE n 
1 71  ILE n 
1 72  LEU n 
1 73  PHE n 
1 74  THR n 
1 75  ILE n 
1 76  GLU n 
1 77  ILE n 
1 78  ILE n 
1 79  LEU n 
1 80  ARG n 
1 81  ILE n 
1 82  TYR n 
1 83  VAL n 
1 84  HIS n 
1 85  ARG n 
1 86  ILE n 
1 87  SER n 
1 88  PHE n 
1 89  PHE n 
1 90  LYS n 
1 91  ASP n 
1 92  PRO n 
1 93  TRP n 
1 94  SER n 
1 95  LEU n 
1 96  PHE n 
1 97  ASP n 
1 98  PHE n 
1 99  VAL n 
1 100 VAL n 
1 101 VAL n 
1 102 ILE n 
1 103 ILE n 
1 104 SER n 
1 105 ILE n 
1 106 VAL n 
1 107 GLY n 
1 108 MET n 
1 109 PHE n 
1 110 LEU n 
1 111 ALA n 
1 112 ASP n 
1 113 LEU n 
1 114 ILE n 
1 115 GLU n 
1 116 THR n 
1 117 TYR n 
1 118 PHE n 
1 119 VAL n 
1 120 SER n 
1 121 PRO n 
1 122 THR n 
1 123 LEU n 
1 124 PHE n 
1 125 ARG n 
1 126 VAL n 
1 127 ILE n 
1 128 ARG n 
1 129 LEU n 
1 130 ALA n 
1 131 ARG n 
1 132 ILE n 
1 133 GLY n 
1 134 ARG n 
1 135 ILE n 
1 136 LEU n 
1 137 ARG n 
1 138 LEU n 
1 139 VAL n 
1 140 THR n 
1 141 ALA n 
1 142 VAL n 
1 143 PRO n 
1 144 GLN n 
1 145 MET n 
1 146 ARG n 
1 147 LYS n 
1 148 ILE n 
1 149 VAL n 
1 150 SER n 
1 151 ALA n 
1 152 LEU n 
1 153 ILE n 
1 154 SER n 
1 155 VAL n 
1 156 ILE n 
1 157 PRO n 
1 158 GLY n 
1 159 MET n 
1 160 LEU n 
1 161 SER n 
1 162 VAL n 
1 163 ILE n 
1 164 ALA n 
1 165 LEU n 
1 166 MET n 
1 167 THR n 
1 168 LEU n 
1 169 PHE n 
1 170 PHE n 
1 171 TYR n 
1 172 ILE n 
1 173 PHE n 
1 174 ALA n 
1 175 ILE n 
1 176 MET n 
1 177 ALA n 
1 178 THR n 
1 179 GLN n 
1 180 LEU n 
1 181 PHE n 
1 182 GLY n 
1 183 GLU n 
1 184 ARG n 
1 185 PHE n 
1 186 PRO n 
1 187 GLU n 
1 188 TRP n 
1 189 PHE n 
1 190 GLY n 
1 191 THR n 
1 192 LEU n 
1 193 GLY n 
1 194 GLU n 
1 195 SER n 
1 196 PHE n 
1 197 TYR n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLN n 
1 202 VAL n 
1 203 MET n 
1 204 THR n 
1 205 LEU n 
1 206 GLU n 
1 207 SER n 
1 208 TRP n 
1 209 SER n 
1 210 MET n 
1 211 GLY n 
1 212 ILE n 
1 213 VAL n 
1 214 ARG n 
1 215 PRO n 
1 216 LEU n 
1 217 MET n 
1 218 GLU n 
1 219 VAL n 
1 220 TYR n 
1 221 PRO n 
1 222 TYR n 
1 223 ALA n 
1 224 TRP n 
1 225 VAL n 
1 226 PHE n 
1 227 PHE n 
1 228 ILE n 
1 229 PRO n 
1 230 PHE n 
1 231 ILE n 
1 232 PHE n 
1 233 VAL n 
1 234 VAL n 
1 235 THR n 
1 236 PHE n 
1 237 VAL n 
1 238 MET n 
1 239 ILE n 
1 240 ASN n 
1 241 LEU n 
1 242 VAL n 
1 243 VAL n 
1 244 ALA n 
1 245 ILE n 
1 246 ILE n 
1 247 VAL n 
1 248 ASP n 
1 249 ALA n 
1 250 MET n 
1 251 ALA n 
1 252 ILE n 
1 253 LEU n 
1 254 ASN n 
1 255 GLN n 
1 256 LYS n 
1 257 GLU n 
1 258 GLU n 
1 259 GLN n 
1 260 HIS n 
1 261 ILE n 
1 262 ILE n 
1 263 ASP n 
1 264 GLU n 
1 265 VAL n 
1 266 GLN n 
1 267 SER n 
1 268 HIS n 
1 269 GLU n 
1 270 ASP n 
1 271 ASN n 
1 272 ILE n 
1 273 ASN n 
1 274 ASN n 
1 275 GLU n 
1 276 ILE n 
1 277 ILE n 
1 278 LYS n 
1 279 LEU n 
1 280 ARG n 
1 281 GLU n 
1 282 GLU n 
1 283 ILE n 
1 284 VAL n 
1 285 GLU n 
1 286 LEU n 
1 287 LYS n 
1 288 GLU n 
1 289 LEU n 
1 290 ILE n 
1 291 LYS n 
1 292 THR n 
1 293 SER n 
1 294 LEU n 
1 295 LYS n 
1 296 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   41 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Abu_1752, SCN9A, NENA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    RM4018 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arcobacter butzleri, Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     '367737, 9606' 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Trichoplusia ni' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7111 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP A8EVM5_ARCB4 A8EVM5 ? 1 MYLRITNIVESSFFTKFIIYLIV 1    
2 UNP SCN9A_HUMAN  Q15858 ? 1 LNMVTMMVEKEGQSQHMTEVLYWINVVFIILFT 1527 
3 UNP A8EVM5_ARCB4 A8EVM5 ? 1 IEIILRIYVHRISFFKDPWSL 58   
4 UNP SCN9A_HUMAN  Q15858 ? 1 FDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRILR 1581 
5 UNP A8EVM5_ARCB4 A8EVM5 ? 1 
;LVTAVPQMRKIVSALISVIPGMLSVIALMTLFFYIFAIMATQLFGERFPEWFGTLGESFYTLFQVMTLESWSMGIVRPLM
EVYPYAWVFFIPFIFVVTFVMINLVVAIIVDAMAILNQKEEQHIIDEVQSHEDNINNEIIKLREEIVELKELIKTSLKN
;
109  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5EK0 A 19  ? 41  ? A8EVM5 1    ? 23   ? 1493 1515 
2  2 5EK0 A 42  ? 74  ? Q15858 1527 ? 1559 ? 1516 1548 
3  3 5EK0 A 75  ? 95  ? A8EVM5 58   ? 78   ? 1549 1569 
4  4 5EK0 A 96  ? 137 ? Q15858 1581 ? 1622 ? 1570 1611 
5  5 5EK0 A 138 ? 296 ? A8EVM5 109  ? 267  ? 1612 1770 
6  1 5EK0 B 19  ? 41  ? A8EVM5 1    ? 23   ? 1493 1515 
7  2 5EK0 B 42  ? 74  ? Q15858 1527 ? 1559 ? 1516 1548 
8  3 5EK0 B 75  ? 95  ? A8EVM5 58   ? 78   ? 1549 1569 
9  4 5EK0 B 96  ? 137 ? Q15858 1581 ? 1622 ? 1570 1611 
10 5 5EK0 B 138 ? 296 ? A8EVM5 109  ? 267  ? 1612 1770 
11 1 5EK0 C 19  ? 41  ? A8EVM5 1    ? 23   ? 1493 1515 
12 2 5EK0 C 42  ? 74  ? Q15858 1527 ? 1559 ? 1516 1548 
13 3 5EK0 C 75  ? 95  ? A8EVM5 58   ? 78   ? 1549 1569 
14 4 5EK0 C 96  ? 137 ? Q15858 1581 ? 1622 ? 1570 1611 
15 5 5EK0 C 138 ? 296 ? A8EVM5 109  ? 267  ? 1612 1770 
16 1 5EK0 D 19  ? 41  ? A8EVM5 1    ? 23   ? 1493 1515 
17 2 5EK0 D 42  ? 74  ? Q15858 1527 ? 1559 ? 1516 1548 
18 3 5EK0 D 75  ? 95  ? A8EVM5 58   ? 78   ? 1549 1569 
19 4 5EK0 D 96  ? 137 ? Q15858 1581 ? 1622 ? 1570 1611 
20 5 5EK0 D 138 ? 296 ? A8EVM5 109  ? 267  ? 1612 1770 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5EK0 MET A 1  ? UNP A8EVM5 ? ? 'initiating methionine' -17 1  
1  5EK0 ASP A 2  ? UNP A8EVM5 ? ? 'expression tag'        -16 2  
1  5EK0 TYR A 3  ? UNP A8EVM5 ? ? 'expression tag'        -15 3  
1  5EK0 LYS A 4  ? UNP A8EVM5 ? ? 'expression tag'        -14 4  
1  5EK0 ASP A 5  ? UNP A8EVM5 ? ? 'expression tag'        -13 5  
1  5EK0 ASP A 6  ? UNP A8EVM5 ? ? 'expression tag'        -12 6  
1  5EK0 ASP A 7  ? UNP A8EVM5 ? ? 'expression tag'        -11 7  
1  5EK0 ASP A 8  ? UNP A8EVM5 ? ? 'expression tag'        -10 8  
1  5EK0 LYS A 9  ? UNP A8EVM5 ? ? 'expression tag'        -9  9  
1  5EK0 GLY A 10 ? UNP A8EVM5 ? ? 'expression tag'        -8  10 
1  5EK0 SER A 11 ? UNP A8EVM5 ? ? 'expression tag'        -7  11 
1  5EK0 LEU A 12 ? UNP A8EVM5 ? ? 'expression tag'        -6  12 
1  5EK0 VAL A 13 ? UNP A8EVM5 ? ? 'expression tag'        -5  13 
1  5EK0 PRO A 14 ? UNP A8EVM5 ? ? 'expression tag'        -4  14 
1  5EK0 ARG A 15 ? UNP A8EVM5 ? ? 'expression tag'        -3  15 
1  5EK0 GLY A 16 ? UNP A8EVM5 ? ? 'expression tag'        -2  16 
1  5EK0 SER A 17 ? UNP A8EVM5 ? ? 'expression tag'        -1  17 
1  5EK0 HIS A 18 ? UNP A8EVM5 ? ? 'expression tag'        0   18 
6  5EK0 MET B 1  ? UNP A8EVM5 ? ? 'initiating methionine' -17 19 
6  5EK0 ASP B 2  ? UNP A8EVM5 ? ? 'expression tag'        -16 20 
6  5EK0 TYR B 3  ? UNP A8EVM5 ? ? 'expression tag'        -15 21 
6  5EK0 LYS B 4  ? UNP A8EVM5 ? ? 'expression tag'        -14 22 
6  5EK0 ASP B 5  ? UNP A8EVM5 ? ? 'expression tag'        -13 23 
6  5EK0 ASP B 6  ? UNP A8EVM5 ? ? 'expression tag'        -12 24 
6  5EK0 ASP B 7  ? UNP A8EVM5 ? ? 'expression tag'        -11 25 
6  5EK0 ASP B 8  ? UNP A8EVM5 ? ? 'expression tag'        -10 26 
6  5EK0 LYS B 9  ? UNP A8EVM5 ? ? 'expression tag'        -9  27 
6  5EK0 GLY B 10 ? UNP A8EVM5 ? ? 'expression tag'        -8  28 
6  5EK0 SER B 11 ? UNP A8EVM5 ? ? 'expression tag'        -7  29 
6  5EK0 LEU B 12 ? UNP A8EVM5 ? ? 'expression tag'        -6  30 
6  5EK0 VAL B 13 ? UNP A8EVM5 ? ? 'expression tag'        -5  31 
6  5EK0 PRO B 14 ? UNP A8EVM5 ? ? 'expression tag'        -4  32 
6  5EK0 ARG B 15 ? UNP A8EVM5 ? ? 'expression tag'        -3  33 
6  5EK0 GLY B 16 ? UNP A8EVM5 ? ? 'expression tag'        -2  34 
6  5EK0 SER B 17 ? UNP A8EVM5 ? ? 'expression tag'        -1  35 
6  5EK0 HIS B 18 ? UNP A8EVM5 ? ? 'expression tag'        0   36 
11 5EK0 MET C 1  ? UNP A8EVM5 ? ? 'initiating methionine' -17 37 
11 5EK0 ASP C 2  ? UNP A8EVM5 ? ? 'expression tag'        -16 38 
11 5EK0 TYR C 3  ? UNP A8EVM5 ? ? 'expression tag'        -15 39 
11 5EK0 LYS C 4  ? UNP A8EVM5 ? ? 'expression tag'        -14 40 
11 5EK0 ASP C 5  ? UNP A8EVM5 ? ? 'expression tag'        -13 41 
11 5EK0 ASP C 6  ? UNP A8EVM5 ? ? 'expression tag'        -12 42 
11 5EK0 ASP C 7  ? UNP A8EVM5 ? ? 'expression tag'        -11 43 
11 5EK0 ASP C 8  ? UNP A8EVM5 ? ? 'expression tag'        -10 44 
11 5EK0 LYS C 9  ? UNP A8EVM5 ? ? 'expression tag'        -9  45 
11 5EK0 GLY C 10 ? UNP A8EVM5 ? ? 'expression tag'        -8  46 
11 5EK0 SER C 11 ? UNP A8EVM5 ? ? 'expression tag'        -7  47 
11 5EK0 LEU C 12 ? UNP A8EVM5 ? ? 'expression tag'        -6  48 
11 5EK0 VAL C 13 ? UNP A8EVM5 ? ? 'expression tag'        -5  49 
11 5EK0 PRO C 14 ? UNP A8EVM5 ? ? 'expression tag'        -4  50 
11 5EK0 ARG C 15 ? UNP A8EVM5 ? ? 'expression tag'        -3  51 
11 5EK0 GLY C 16 ? UNP A8EVM5 ? ? 'expression tag'        -2  52 
11 5EK0 SER C 17 ? UNP A8EVM5 ? ? 'expression tag'        -1  53 
11 5EK0 HIS C 18 ? UNP A8EVM5 ? ? 'expression tag'        0   54 
16 5EK0 MET D 1  ? UNP A8EVM5 ? ? 'initiating methionine' -17 55 
16 5EK0 ASP D 2  ? UNP A8EVM5 ? ? 'expression tag'        -16 56 
16 5EK0 TYR D 3  ? UNP A8EVM5 ? ? 'expression tag'        -15 57 
16 5EK0 LYS D 4  ? UNP A8EVM5 ? ? 'expression tag'        -14 58 
16 5EK0 ASP D 5  ? UNP A8EVM5 ? ? 'expression tag'        -13 59 
16 5EK0 ASP D 6  ? UNP A8EVM5 ? ? 'expression tag'        -12 60 
16 5EK0 ASP D 7  ? UNP A8EVM5 ? ? 'expression tag'        -11 61 
16 5EK0 ASP D 8  ? UNP A8EVM5 ? ? 'expression tag'        -10 62 
16 5EK0 LYS D 9  ? UNP A8EVM5 ? ? 'expression tag'        -9  63 
16 5EK0 GLY D 10 ? UNP A8EVM5 ? ? 'expression tag'        -8  64 
16 5EK0 SER D 11 ? UNP A8EVM5 ? ? 'expression tag'        -7  65 
16 5EK0 LEU D 12 ? UNP A8EVM5 ? ? 'expression tag'        -6  66 
16 5EK0 VAL D 13 ? UNP A8EVM5 ? ? 'expression tag'        -5  67 
16 5EK0 PRO D 14 ? UNP A8EVM5 ? ? 'expression tag'        -4  68 
16 5EK0 ARG D 15 ? UNP A8EVM5 ? ? 'expression tag'        -3  69 
16 5EK0 GLY D 16 ? UNP A8EVM5 ? ? 'expression tag'        -2  70 
16 5EK0 SER D 17 ? UNP A8EVM5 ? ? 'expression tag'        -1  71 
16 5EK0 HIS D 18 ? UNP A8EVM5 ? ? 'expression tag'        0   72 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5P2 non-polymer         . 
'3-cyano-4-[2-[2-(1-ethylazetidin-3-yl)pyrazol-3-yl]-4-(trifluoromethyl)phenoxy]-~{N}-(1,2,4-thiadiazol-5-yl)benzenesulfonamide' 
GX-936 'C24 H20 F3 N7 O3 S2' 575.586 
ALA 'L-peptide linking' y ALANINE ?      'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE ?      'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE ?      'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?      'C4 H7 N O4'          133.103 
GLN 'L-peptide linking' y GLUTAMINE ?      'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?      'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE ?      'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE ?      'C6 H10 N3 O2 1'      156.162 
ILE 'L-peptide linking' y ISOLEUCINE ?      'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE ?      'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE ?      'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE ?      'C5 H11 N O2 S'       149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?      'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE ?      'C5 H9 N O2'          115.130 
PX4 non-polymer         . 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE ?      'C36 H73 N O8 P 1'    678.940 
SER 'L-peptide linking' y SERINE ?      'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE ?      'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?      'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE ?      'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE ?      'C5 H11 N O2'         117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5EK0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.94 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         75 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.4 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2.2 ammonium sulfate, 100 mM sodium citrate pH 5.4' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           80 
_diffrn.ambient_temp_details   'data from 2 single crystals merged' 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-12-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97625 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97625 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            96.72 
_reflns.entry_id                         5EK0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.53 
_reflns.d_resolution_low                 26.59 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33851 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  9 
_reflns.pdbx_Rmerge_I_obs                0.149 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.53 
_reflns_shell.d_res_low                   3.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.8 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             8.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -42.2998 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            47.9394 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -5.6396 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               106.05 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.8358 
_refine.correlation_coeff_Fo_to_Fc_free          0.8205 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5EK0 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.53 
_refine.ls_d_res_low                             26.59 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     33851 
_refine.ls_number_reflns_R_free                  1714 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.73 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2442 
_refine.ls_R_factor_R_free                       0.2719 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2427 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3RVY 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.466 
_refine.pdbx_overall_SU_R_Blow_DPI               2.842 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5EK0 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.871 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        8082 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         489 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8571 
_refine_hist.d_res_high                       3.53 
_refine_hist.d_res_low                        26.59 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 8780  ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.10  ? 11913 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 3036  ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 120   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 1211  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 8780  ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_nbd                     ?     ?            
'X-RAY DIFFRACTION' ? 2.31  ? ?     ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 22.13 ? ?     ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 1150  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 11147 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.53 
_refine_ls_shell.d_res_low                        3.64 
_refine_ls_shell.number_reflns_all                2845 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             148 
_refine_ls_shell.number_reflns_R_work             2697 
_refine_ls_shell.percent_reflns_obs               99.73 
_refine_ls_shell.percent_reflns_R_free            5.20 
_refine_ls_shell.R_factor_all                     0.2479 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2588 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2473 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   17 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5EK0 
_struct.title                        'Human Nav1.7-VSD4-NavAb in complex with GX-936.' 
_struct.pdbx_descriptor              'Ion transport protein, Sodium channel protein type 9 subunit alpha' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5EK0 
_struct_keywords.text            
'membrane protein, ion channel, voltage-gated sodium channel, small molecule antagonist, METAL TRANSPORT' 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 3 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 HIS A 18  ? ARG A 22  ? HIS A 0    ARG A 1496 5 ? 5  
HELX_P HELX_P2  AA2 ILE A 23  ? GLU A 28  ? ILE A 1497 GLU A 1502 1 ? 6  
HELX_P HELX_P3  AA3 SER A 29  ? VAL A 49  ? SER A 1503 VAL A 1523 1 ? 21 
HELX_P HELX_P4  AA4 SER A 55  ? ARG A 85  ? SER A 1529 ARG A 1559 1 ? 31 
HELX_P HELX_P5  AA5 ARG A 85  ? LYS A 90  ? ARG A 1559 LYS A 1564 1 ? 6  
HELX_P HELX_P6  AA6 ASP A 91  ? TYR A 117 ? ASP A 1565 TYR A 1591 1 ? 27 
HELX_P HELX_P7  AA7 SER A 120 ? ARG A 128 ? SER A 1594 ARG A 1602 1 ? 9  
HELX_P HELX_P8  AA8 ARG A 131 ? ARG A 137 ? ARG A 1605 ARG A 1611 1 ? 7  
HELX_P HELX_P9  AA9 ARG A 137 ? VAL A 142 ? ARG A 1611 VAL A 1616 1 ? 6  
HELX_P HELX_P10 AB1 GLN A 144 ? SER A 154 ? GLN A 1618 SER A 1628 1 ? 11 
HELX_P HELX_P11 AB2 VAL A 155 ? PHE A 181 ? VAL A 1629 PHE A 1655 1 ? 27 
HELX_P HELX_P12 AB3 PHE A 185 ? GLY A 190 ? PHE A 1659 GLY A 1664 1 ? 6  
HELX_P HELX_P13 AB4 THR A 191 ? THR A 204 ? THR A 1665 THR A 1678 1 ? 14 
HELX_P HELX_P14 AB5 ILE A 212 ? TYR A 220 ? ILE A 1686 TYR A 1694 1 ? 9  
HELX_P HELX_P15 AB6 ALA A 223 ? ASP A 263 ? ALA A 1697 ASP A 1737 1 ? 41 
HELX_P HELX_P16 AB7 TYR B 20  ? VAL B 27  ? TYR B 1494 VAL B 1501 1 ? 8  
HELX_P HELX_P17 AB8 SER B 30  ? MET B 48  ? SER B 1504 MET B 1522 1 ? 19 
HELX_P HELX_P18 AB9 SER B 55  ? HIS B 84  ? SER B 1529 HIS B 1558 1 ? 30 
HELX_P HELX_P19 AC1 ILE B 86  ? ASP B 91  ? ILE B 1560 ASP B 1565 1 ? 6  
HELX_P HELX_P20 AC2 ASP B 91  ? TYR B 117 ? ASP B 1565 TYR B 1591 1 ? 27 
HELX_P HELX_P21 AC3 SER B 120 ? ARG B 128 ? SER B 1594 ARG B 1602 1 ? 9  
HELX_P HELX_P22 AC4 LEU B 129 ? THR B 140 ? LEU B 1603 THR B 1614 5 ? 12 
HELX_P HELX_P23 AC5 GLN B 144 ? SER B 154 ? GLN B 1618 SER B 1628 1 ? 11 
HELX_P HELX_P24 AC6 VAL B 155 ? GLY B 158 ? VAL B 1629 GLY B 1632 5 ? 4  
HELX_P HELX_P25 AC7 MET B 159 ? PHE B 181 ? MET B 1633 PHE B 1655 1 ? 23 
HELX_P HELX_P26 AC8 PHE B 185 ? GLY B 190 ? PHE B 1659 GLY B 1664 1 ? 6  
HELX_P HELX_P27 AC9 THR B 191 ? THR B 204 ? THR B 1665 THR B 1678 1 ? 14 
HELX_P HELX_P28 AD1 ILE B 212 ? TYR B 220 ? ILE B 1686 TYR B 1694 1 ? 9  
HELX_P HELX_P29 AD2 ALA B 223 ? ASP B 263 ? ALA B 1697 ASP B 1737 1 ? 41 
HELX_P HELX_P30 AD3 TYR C 20  ? GLU C 28  ? TYR C 1494 GLU C 1502 1 ? 9  
HELX_P HELX_P31 AD4 SER C 29  ? VAL C 49  ? SER C 1503 VAL C 1523 1 ? 21 
HELX_P HELX_P32 AD5 SER C 55  ? ARG C 85  ? SER C 1529 ARG C 1559 1 ? 31 
HELX_P HELX_P33 AD6 ASP C 91  ? TYR C 117 ? ASP C 1565 TYR C 1591 1 ? 27 
HELX_P HELX_P34 AD7 THR C 122 ? ARG C 128 ? THR C 1596 ARG C 1602 1 ? 7  
HELX_P HELX_P35 AD8 ARG C 131 ? ALA C 141 ? ARG C 1605 ALA C 1615 1 ? 11 
HELX_P HELX_P36 AD9 GLN C 144 ? SER C 154 ? GLN C 1618 SER C 1628 1 ? 11 
HELX_P HELX_P37 AE1 VAL C 155 ? PHE C 181 ? VAL C 1629 PHE C 1655 1 ? 27 
HELX_P HELX_P38 AE2 PHE C 185 ? GLY C 190 ? PHE C 1659 GLY C 1664 1 ? 6  
HELX_P HELX_P39 AE3 THR C 191 ? LEU C 205 ? THR C 1665 LEU C 1679 1 ? 15 
HELX_P HELX_P40 AE4 ILE C 212 ? TYR C 220 ? ILE C 1686 TYR C 1694 1 ? 9  
HELX_P HELX_P41 AE5 ALA C 223 ? ASP C 263 ? ALA C 1697 ASP C 1737 1 ? 41 
HELX_P HELX_P42 AE6 ARG D 22  ? GLU D 28  ? ARG D 1496 GLU D 1502 1 ? 7  
HELX_P HELX_P43 AE7 SER D 29  ? VAL D 49  ? SER D 1503 VAL D 1523 1 ? 21 
HELX_P HELX_P44 AE8 SER D 55  ? ARG D 85  ? SER D 1529 ARG D 1559 1 ? 31 
HELX_P HELX_P45 AE9 ILE D 86  ? LYS D 90  ? ILE D 1560 LYS D 1564 5 ? 5  
HELX_P HELX_P46 AF1 ASP D 91  ? TYR D 117 ? ASP D 1565 TYR D 1591 1 ? 27 
HELX_P HELX_P47 AF2 THR D 122 ? LEU D 129 ? THR D 1596 LEU D 1603 1 ? 8  
HELX_P HELX_P48 AF3 ARG D 131 ? VAL D 142 ? ARG D 1605 VAL D 1616 1 ? 12 
HELX_P HELX_P49 AF4 GLN D 144 ? SER D 154 ? GLN D 1618 SER D 1628 1 ? 11 
HELX_P HELX_P50 AF5 VAL D 155 ? GLY D 182 ? VAL D 1629 GLY D 1656 1 ? 28 
HELX_P HELX_P51 AF6 PHE D 185 ? GLY D 190 ? PHE D 1659 GLY D 1664 1 ? 6  
HELX_P HELX_P52 AF7 THR D 191 ? THR D 204 ? THR D 1665 THR D 1678 1 ? 14 
HELX_P HELX_P53 AF8 ILE D 212 ? TYR D 220 ? ILE D 1686 TYR D 1694 1 ? 9  
HELX_P HELX_P54 AF9 ALA D 223 ? ILE D 261 ? ALA D 1697 ILE D 1735 1 ? 39 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 15 A . ? ARG -3   A GLY 16 A ? GLY -2   A 1 3.85  
2 GLY 53 A . ? GLY 1527 A GLN 54 A ? GLN 1528 A 1 4.06  
3 GLY 53 B . ? GLY 1527 B GLN 54 B ? GLN 1528 B 1 0.81  
4 GLY 53 C . ? GLY 1527 C GLN 54 C ? GLN 1528 C 1 -2.04 
5 GLY 53 D . ? GLY 1527 D GLN 54 D ? GLN 1528 D 1 -0.80 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PX4 1801 ? 6  'binding site for residue PX4 A 1801' 
AC2 Software A PX4 1802 ? 7  'binding site for residue PX4 A 1802' 
AC3 Software A PX4 1804 ? 1  'binding site for residue PX4 A 1804' 
AC4 Software A PX4 1807 ? 3  'binding site for residue PX4 A 1807' 
AC5 Software A 5P2 1808 ? 16 'binding site for residue 5P2 A 1808' 
AC6 Software B PX4 1801 ? 6  'binding site for residue PX4 B 1801' 
AC7 Software B PX4 1802 ? 8  'binding site for residue PX4 B 1802' 
AC8 Software B PX4 1803 ? 1  'binding site for residue PX4 B 1803' 
AC9 Software B PX4 1804 ? 1  'binding site for residue PX4 B 1804' 
AD1 Software B PX4 1805 ? 3  'binding site for residue PX4 B 1805' 
AD2 Software B 5P2 1806 ? 15 'binding site for residue 5P2 B 1806' 
AD3 Software C PX4 1801 ? 4  'binding site for residue PX4 C 1801' 
AD4 Software C PX4 1802 ? 7  'binding site for residue PX4 C 1802' 
AD5 Software C PX4 1803 ? 1  'binding site for residue PX4 C 1803' 
AD6 Software C PX4 1804 ? 3  'binding site for residue PX4 C 1804' 
AD7 Software C 5P2 1805 ? 16 'binding site for residue 5P2 C 1805' 
AD8 Software D PX4 1801 ? 6  'binding site for residue PX4 D 1801' 
AD9 Software D PX4 1802 ? 5  'binding site for residue PX4 D 1802' 
AE1 Software D PX4 1805 ? 2  'binding site for residue PX4 D 1805' 
AE2 Software D 5P2 1806 ? 17 'binding site for residue 5P2 D 1806' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  LEU A  180 ? LEU A 1654 . ? 1_555 ? 
2   AC1 6  PHE A  181 ? PHE A 1655 . ? 1_555 ? 
3   AC1 6  TYR A  220 ? TYR A 1694 . ? 1_555 ? 
4   AC1 6  PRO A  221 ? PRO A 1695 . ? 1_555 ? 
5   AC1 6  TYR A  222 ? TYR A 1696 . ? 1_555 ? 
6   AC1 6  ARG D  125 ? ARG D 1599 . ? 1_555 ? 
7   AC2 7  THR A  191 ? THR A 1665 . ? 1_555 ? 
8   AC2 7  GLY A  193 ? GLY A 1667 . ? 1_555 ? 
9   AC2 7  GLU A  194 ? GLU A 1668 . ? 1_555 ? 
10  AC2 7  PHE A  196 ? PHE A 1670 . ? 1_555 ? 
11  AC2 7  TYR A  197 ? TYR A 1671 . ? 1_555 ? 
12  AC2 7  PRO B  221 ? PRO B 1695 . ? 1_555 ? 
13  AC2 7  TRP B  224 ? TRP B 1698 . ? 1_555 ? 
14  AC3 1  GLN A  144 ? GLN A 1618 . ? 1_555 ? 
15  AC4 3  GLN A  56  ? GLN A 1530 . ? 1_555 ? 
16  AC4 3  GLU A  60  ? GLU A 1534 . ? 1_555 ? 
17  AC4 3  5P2 L  .   ? 5P2 A 1808 . ? 1_555 ? 
18  AC5 16 GLU A  60  ? GLU A 1534 . ? 1_555 ? 
19  AC5 16 TYR A  63  ? TYR A 1537 . ? 1_555 ? 
20  AC5 16 TRP A  64  ? TRP A 1538 . ? 1_555 ? 
21  AC5 16 ASN A  66  ? ASN A 1540 . ? 1_555 ? 
22  AC5 16 VAL A  67  ? VAL A 1541 . ? 1_555 ? 
23  AC5 16 GLY A  107 ? GLY A 1581 . ? 1_555 ? 
24  AC5 16 MET A  108 ? MET A 1582 . ? 1_555 ? 
25  AC5 16 PHE A  109 ? PHE A 1583 . ? 1_555 ? 
26  AC5 16 ALA A  111 ? ALA A 1585 . ? 1_555 ? 
27  AC5 16 ASP A  112 ? ASP A 1586 . ? 1_555 ? 
28  AC5 16 PHE A  124 ? PHE A 1598 . ? 1_555 ? 
29  AC5 16 ARG A  128 ? ARG A 1602 . ? 1_555 ? 
30  AC5 16 ALA A  130 ? ALA A 1604 . ? 1_555 ? 
31  AC5 16 ARG A  131 ? ARG A 1605 . ? 1_555 ? 
32  AC5 16 ARG A  134 ? ARG A 1608 . ? 1_555 ? 
33  AC5 16 PX4 K  .   ? PX4 A 1807 . ? 1_555 ? 
34  AC6 6  THR A  122 ? THR A 1596 . ? 1_555 ? 
35  AC6 6  ARG A  125 ? ARG A 1599 . ? 1_555 ? 
36  AC6 6  TYR B  220 ? TYR B 1694 . ? 1_555 ? 
37  AC6 6  PRO B  221 ? PRO B 1695 . ? 1_555 ? 
38  AC6 6  TYR B  222 ? TYR B 1696 . ? 1_555 ? 
39  AC6 6  ALA B  223 ? ALA B 1697 . ? 1_555 ? 
40  AC7 8  THR B  191 ? THR B 1665 . ? 1_555 ? 
41  AC7 8  GLY B  193 ? GLY B 1667 . ? 1_555 ? 
42  AC7 8  GLU B  194 ? GLU B 1668 . ? 1_555 ? 
43  AC7 8  PHE B  196 ? PHE B 1670 . ? 1_555 ? 
44  AC7 8  TYR B  197 ? TYR B 1671 . ? 1_555 ? 
45  AC7 8  MET C  217 ? MET C 1691 . ? 1_555 ? 
46  AC7 8  PRO C  221 ? PRO C 1695 . ? 1_555 ? 
47  AC7 8  TRP C  224 ? TRP C 1698 . ? 1_555 ? 
48  AC8 1  GLN B  144 ? GLN B 1618 . ? 1_555 ? 
49  AC9 1  MET B  203 ? MET B 1677 . ? 1_555 ? 
50  AD1 3  GLU B  60  ? GLU B 1534 . ? 1_555 ? 
51  AD1 3  ASP B  112 ? ASP B 1586 . ? 1_555 ? 
52  AD1 3  5P2 R  .   ? 5P2 B 1806 . ? 1_555 ? 
53  AD2 15 GLU B  60  ? GLU B 1534 . ? 1_555 ? 
54  AD2 15 TYR B  63  ? TYR B 1537 . ? 1_555 ? 
55  AD2 15 TRP B  64  ? TRP B 1538 . ? 1_555 ? 
56  AD2 15 ASN B  66  ? ASN B 1540 . ? 1_555 ? 
57  AD2 15 VAL B  67  ? VAL B 1541 . ? 1_555 ? 
58  AD2 15 GLY B  107 ? GLY B 1581 . ? 1_555 ? 
59  AD2 15 MET B  108 ? MET B 1582 . ? 1_555 ? 
60  AD2 15 PHE B  109 ? PHE B 1583 . ? 1_555 ? 
61  AD2 15 ALA B  111 ? ALA B 1585 . ? 1_555 ? 
62  AD2 15 ASP B  112 ? ASP B 1586 . ? 1_555 ? 
63  AD2 15 PHE B  124 ? PHE B 1598 . ? 1_555 ? 
64  AD2 15 ARG B  128 ? ARG B 1602 . ? 1_555 ? 
65  AD2 15 ARG B  131 ? ARG B 1605 . ? 1_555 ? 
66  AD2 15 ARG B  134 ? ARG B 1608 . ? 1_555 ? 
67  AD2 15 PX4 Q  .   ? PX4 B 1805 . ? 1_555 ? 
68  AD3 4  THR B  122 ? THR B 1596 . ? 1_555 ? 
69  AD3 4  TYR C  220 ? TYR C 1694 . ? 1_555 ? 
70  AD3 4  PRO C  221 ? PRO C 1695 . ? 1_555 ? 
71  AD3 4  TYR C  222 ? TYR C 1696 . ? 1_555 ? 
72  AD4 7  TYR C  171 ? TYR C 1645 . ? 1_555 ? 
73  AD4 7  THR C  191 ? THR C 1665 . ? 1_555 ? 
74  AD4 7  GLY C  193 ? GLY C 1667 . ? 1_555 ? 
75  AD4 7  GLU C  194 ? GLU C 1668 . ? 1_555 ? 
76  AD4 7  PHE C  196 ? PHE C 1670 . ? 1_555 ? 
77  AD4 7  TYR D  222 ? TYR D 1696 . ? 1_555 ? 
78  AD4 7  TRP D  224 ? TRP D 1698 . ? 1_555 ? 
79  AD5 1  GLN C  144 ? GLN C 1618 . ? 1_555 ? 
80  AD6 3  GLU C  60  ? GLU C 1534 . ? 1_555 ? 
81  AD6 3  TRP C  64  ? TRP C 1538 . ? 1_555 ? 
82  AD6 3  5P2 W  .   ? 5P2 C 1805 . ? 1_555 ? 
83  AD7 16 TYR C  63  ? TYR C 1537 . ? 1_555 ? 
84  AD7 16 TRP C  64  ? TRP C 1538 . ? 1_555 ? 
85  AD7 16 ASN C  66  ? ASN C 1540 . ? 1_555 ? 
86  AD7 16 GLY C  107 ? GLY C 1581 . ? 1_555 ? 
87  AD7 16 MET C  108 ? MET C 1582 . ? 1_555 ? 
88  AD7 16 PHE C  109 ? PHE C 1583 . ? 1_555 ? 
89  AD7 16 ALA C  111 ? ALA C 1585 . ? 1_555 ? 
90  AD7 16 ASP C  112 ? ASP C 1586 . ? 1_555 ? 
91  AD7 16 GLU C  115 ? GLU C 1589 . ? 1_555 ? 
92  AD7 16 THR C  116 ? THR C 1590 . ? 1_555 ? 
93  AD7 16 PHE C  124 ? PHE C 1598 . ? 1_555 ? 
94  AD7 16 ARG C  128 ? ARG C 1602 . ? 1_555 ? 
95  AD7 16 ALA C  130 ? ALA C 1604 . ? 1_555 ? 
96  AD7 16 ARG C  131 ? ARG C 1605 . ? 1_555 ? 
97  AD7 16 ARG C  134 ? ARG C 1608 . ? 1_555 ? 
98  AD7 16 PX4 V  .   ? PX4 C 1804 . ? 1_555 ? 
99  AD8 6  MET A  217 ? MET A 1691 . ? 1_555 ? 
100 AD8 6  TRP A  224 ? TRP A 1698 . ? 1_555 ? 
101 AD8 6  PHE D  170 ? PHE D 1644 . ? 1_555 ? 
102 AD8 6  GLY D  193 ? GLY D 1667 . ? 1_555 ? 
103 AD8 6  GLU D  194 ? GLU D 1668 . ? 1_555 ? 
104 AD8 6  PHE D  196 ? PHE D 1670 . ? 1_555 ? 
105 AD9 5  ARG C  125 ? ARG C 1599 . ? 1_555 ? 
106 AD9 5  PHE D  181 ? PHE D 1655 . ? 1_555 ? 
107 AD9 5  TYR D  220 ? TYR D 1694 . ? 1_555 ? 
108 AD9 5  PRO D  221 ? PRO D 1695 . ? 1_555 ? 
109 AD9 5  TYR D  222 ? TYR D 1696 . ? 1_555 ? 
110 AE1 2  GLU D  60  ? GLU D 1534 . ? 1_555 ? 
111 AE1 2  5P2 CA .   ? 5P2 D 1806 . ? 1_555 ? 
112 AE2 17 GLU D  60  ? GLU D 1534 . ? 1_555 ? 
113 AE2 17 TYR D  63  ? TYR D 1537 . ? 1_555 ? 
114 AE2 17 TRP D  64  ? TRP D 1538 . ? 1_555 ? 
115 AE2 17 ASN D  66  ? ASN D 1540 . ? 1_555 ? 
116 AE2 17 VAL D  67  ? VAL D 1541 . ? 1_555 ? 
117 AE2 17 SER D  104 ? SER D 1578 . ? 1_555 ? 
118 AE2 17 GLY D  107 ? GLY D 1581 . ? 1_555 ? 
119 AE2 17 MET D  108 ? MET D 1582 . ? 1_555 ? 
120 AE2 17 PHE D  109 ? PHE D 1583 . ? 1_555 ? 
121 AE2 17 ALA D  111 ? ALA D 1585 . ? 1_555 ? 
122 AE2 17 ASP D  112 ? ASP D 1586 . ? 1_555 ? 
123 AE2 17 PHE D  124 ? PHE D 1598 . ? 1_555 ? 
124 AE2 17 ARG D  128 ? ARG D 1602 . ? 1_555 ? 
125 AE2 17 ALA D  130 ? ALA D 1604 . ? 1_555 ? 
126 AE2 17 ARG D  131 ? ARG D 1605 . ? 1_555 ? 
127 AE2 17 ARG D  134 ? ARG D 1608 . ? 1_555 ? 
128 AE2 17 PX4 BA .   ? PX4 D 1805 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5EK0 
_atom_sites.fract_transf_matrix[1][1]   0.005902 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005296 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005844 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A  1 14  ? -108.081 -52.486 -17.410 1.00 80.59  ?  -4   PRO A N   1 
ATOM   2    C CA  . PRO A  1 14  ? -106.970 -53.256 -17.993 1.00 82.40  ?  -4   PRO A CA  1 
ATOM   3    C C   . PRO A  1 14  ? -105.576 -52.746 -17.600 1.00 91.42  ?  -4   PRO A C   1 
ATOM   4    O O   . PRO A  1 14  ? -105.447 -51.715 -16.922 1.00 101.64 ?  -4   PRO A O   1 
ATOM   5    C CB  . PRO A  1 14  ? -107.209 -53.128 -19.508 1.00 81.01  ?  -4   PRO A CB  1 
ATOM   6    C CG  . PRO A  1 14  ? -107.911 -51.808 -19.673 1.00 81.14  ?  -4   PRO A CG  1 
ATOM   7    C CD  . PRO A  1 14  ? -108.575 -51.450 -18.341 1.00 80.09  ?  -4   PRO A CD  1 
ATOM   8    N N   . ARG A  1 15  ? -104.532 -53.478 -18.044 1.00 97.53  ?  -3   ARG A N   1 
ATOM   9    C CA  . ARG A  1 15  ? -103.119 -53.151 -17.843 1.00 94.36  ?  -3   ARG A CA  1 
ATOM   10   C C   . ARG A  1 15  ? -102.604 -52.494 -19.167 1.00 102.60 ?  -3   ARG A C   1 
ATOM   11   O O   . ARG A  1 15  ? -102.371 -53.208 -20.149 1.00 104.83 ?  -3   ARG A O   1 
ATOM   12   C CB  . ARG A  1 15  ? -102.337 -54.427 -17.442 1.00 80.51  ?  -3   ARG A CB  1 
ATOM   13   C CG  . ARG A  1 15  ? -100.813 -54.276 -17.355 1.00 74.23  ?  -3   ARG A CG  1 
ATOM   14   C CD  . ARG A  1 15  ? -100.069 -54.887 -18.541 1.00 71.37  ?  -3   ARG A CD  1 
ATOM   15   N NE  . ARG A  1 15  ? -100.358 -56.316 -18.742 1.00 73.96  ?  -3   ARG A NE  1 
ATOM   16   C CZ  . ARG A  1 15  ? -101.075 -56.811 -19.756 1.00 77.90  ?  -3   ARG A CZ  1 
ATOM   17   N NH1 . ARG A  1 15  ? -101.596 -55.997 -20.674 1.00 75.32  1  -3   ARG A NH1 1 
ATOM   18   N NH2 . ARG A  1 15  ? -101.270 -58.124 -19.863 1.00 79.00  ?  -3   ARG A NH2 1 
ATOM   19   N N   . GLY A  1 16  ? -102.508 -51.157 -19.222 1.00 108.67 ?  -2   GLY A N   1 
ATOM   20   C CA  . GLY A  1 16  ? -102.766 -50.224 -18.126 1.00 113.48 ?  -2   GLY A CA  1 
ATOM   21   C C   . GLY A  1 16  ? -101.490 -49.721 -17.481 1.00 123.82 ?  -2   GLY A C   1 
ATOM   22   O O   . GLY A  1 16  ? -101.383 -48.537 -17.138 1.00 119.35 ?  -2   GLY A O   1 
ATOM   23   N N   . SER A  1 17  ? -100.508 -50.634 -17.314 1.00 133.47 ?  -1   SER A N   1 
ATOM   24   C CA  . SER A  1 17  ? -99.190  -50.366 -16.730 1.00 139.83 ?  -1   SER A CA  1 
ATOM   25   C C   . SER A  1 17  ? -98.102  -50.246 -17.823 1.00 139.40 ?  -1   SER A C   1 
ATOM   26   O O   . SER A  1 17  ? -96.949  -49.939 -17.504 1.00 144.24 ?  -1   SER A O   1 
ATOM   27   C CB  . SER A  1 17  ? -98.832  -51.464 -15.732 1.00 141.09 ?  -1   SER A CB  1 
ATOM   28   O OG  . SER A  1 17  ? -97.733  -51.098 -14.913 1.00 144.74 ?  -1   SER A OG  1 
ATOM   29   N N   . HIS A  1 18  ? -98.491  -50.465 -19.107 1.00 138.12 ?  0    HIS A N   1 
ATOM   30   C CA  . HIS A  1 18  ? -97.641  -50.431 -20.304 1.00 139.23 ?  0    HIS A CA  1 
ATOM   31   C C   . HIS A  1 18  ? -96.811  -49.150 -20.441 1.00 149.13 ?  0    HIS A C   1 
ATOM   32   O O   . HIS A  1 18  ? -95.619  -49.245 -20.738 1.00 155.18 ?  0    HIS A O   1 
ATOM   33   C CB  . HIS A  1 18  ? -98.477  -50.699 -21.581 1.00 136.56 ?  0    HIS A CB  1 
ATOM   34   C CG  . HIS A  1 18  ? -98.126  -49.823 -22.748 1.00 137.06 ?  0    HIS A CG  1 
ATOM   35   N ND1 . HIS A  1 18  ? -97.008  -50.070 -23.528 1.00 138.73 ?  0    HIS A ND1 1 
ATOM   36   C CD2 . HIS A  1 18  ? -98.736  -48.703 -23.202 1.00 137.32 ?  0    HIS A CD2 1 
ATOM   37   C CE1 . HIS A  1 18  ? -96.978  -49.102 -24.428 1.00 137.39 ?  0    HIS A CE1 1 
ATOM   38   N NE2 . HIS A  1 18  ? -97.999  -48.257 -24.273 1.00 141.96 ?  0    HIS A NE2 1 
ATOM   39   N N   . MET A  1 19  ? -97.442  -47.968 -20.267 1.00 158.31 ?  1493 MET A N   1 
ATOM   40   C CA  . MET A  1 19  ? -96.780  -46.665 -20.393 1.00 162.24 ?  1493 MET A CA  1 
ATOM   41   C C   . MET A  1 19  ? -95.776  -46.406 -19.263 1.00 153.46 ?  1493 MET A C   1 
ATOM   42   O O   . MET A  1 19  ? -94.696  -45.870 -19.518 1.00 126.18 ?  1493 MET A O   1 
ATOM   43   C CB  . MET A  1 19  ? -97.822  -45.529 -20.503 1.00 166.77 ?  1493 MET A CB  1 
ATOM   44   C CG  . MET A  1 19  ? -97.227  -44.135 -20.742 1.00 163.50 ?  1493 MET A CG  1 
ATOM   45   S SD  . MET A  1 19  ? -95.994  -44.043 -22.073 1.00 152.29 ?  1493 MET A SD  1 
ATOM   46   C CE  . MET A  1 19  ? -95.595  -42.315 -22.009 1.00 152.39 ?  1493 MET A CE  1 
ATOM   47   N N   . TYR A  1 20  ? -96.120  -46.837 -18.032 1.00 153.20 ?  1494 TYR A N   1 
ATOM   48   C CA  . TYR A  1 20  ? -95.321  -46.671 -16.809 1.00 142.75 ?  1494 TYR A CA  1 
ATOM   49   C C   . TYR A  1 20  ? -94.158  -47.690 -16.687 1.00 129.65 ?  1494 TYR A C   1 
ATOM   50   O O   . TYR A  1 20  ? -93.453  -47.719 -15.675 1.00 114.16 ?  1494 TYR A O   1 
ATOM   51   C CB  . TYR A  1 20  ? -96.245  -46.672 -15.575 1.00 148.70 ?  1494 TYR A CB  1 
ATOM   52   C CG  . TYR A  1 20  ? -97.357  -45.647 -15.690 1.00 157.76 ?  1494 TYR A CG  1 
ATOM   53   C CD1 . TYR A  1 20  ? -97.103  -44.289 -15.510 1.00 157.12 ?  1494 TYR A CD1 1 
ATOM   54   C CD2 . TYR A  1 20  ? -98.651  -46.028 -16.040 1.00 165.21 ?  1494 TYR A CD2 1 
ATOM   55   C CE1 . TYR A  1 20  ? -98.113  -43.338 -15.653 1.00 167.25 ?  1494 TYR A CE1 1 
ATOM   56   C CE2 . TYR A  1 20  ? -99.670  -45.086 -16.183 1.00 164.08 ?  1494 TYR A CE2 1 
ATOM   57   C CZ  . TYR A  1 20  ? -99.397  -43.741 -15.985 1.00 170.49 ?  1494 TYR A CZ  1 
ATOM   58   O OH  . TYR A  1 20  ? -100.397 -42.805 -16.113 1.00 174.74 ?  1494 TYR A OH  1 
ATOM   59   N N   . LEU A  1 21  ? -93.942  -48.474 -17.755 1.00 134.29 ?  1495 LEU A N   1 
ATOM   60   C CA  . LEU A  1 21  ? -92.868  -49.453 -17.923 1.00 135.03 ?  1495 LEU A CA  1 
ATOM   61   C C   . LEU A  1 21  ? -92.121  -49.170 -19.252 1.00 131.23 ?  1495 LEU A C   1 
ATOM   62   O O   . LEU A  1 21  ? -91.068  -49.755 -19.519 1.00 122.66 ?  1495 LEU A O   1 
ATOM   63   C CB  . LEU A  1 21  ? -93.410  -50.899 -17.852 1.00 134.37 ?  1495 LEU A CB  1 
ATOM   64   C CG  . LEU A  1 21  ? -93.275  -51.610 -16.487 1.00 126.94 ?  1495 LEU A CG  1 
ATOM   65   C CD1 . LEU A  1 21  ? -94.438  -51.279 -15.557 1.00 122.52 ?  1495 LEU A CD1 1 
ATOM   66   C CD2 . LEU A  1 21  ? -93.189  -53.112 -16.659 1.00 121.92 ?  1495 LEU A CD2 1 
ATOM   67   N N   . ARG A  1 22  ? -92.670  -48.240 -20.060 1.00 132.93 ?  1496 ARG A N   1 
ATOM   68   C CA  . ARG A  1 22  ? -92.120  -47.766 -21.332 1.00 134.88 ?  1496 ARG A CA  1 
ATOM   69   C C   . ARG A  1 22  ? -91.346  -46.464 -21.062 1.00 141.59 ?  1496 ARG A C   1 
ATOM   70   O O   . ARG A  1 22  ? -90.286  -46.244 -21.658 1.00 146.25 ?  1496 ARG A O   1 
ATOM   71   C CB  . ARG A  1 22  ? -93.262  -47.511 -22.335 1.00 137.38 ?  1496 ARG A CB  1 
ATOM   72   C CG  . ARG A  1 22  ? -92.797  -47.139 -23.735 1.00 140.89 ?  1496 ARG A CG  1 
ATOM   73   C CD  . ARG A  1 22  ? -93.826  -46.293 -24.453 1.00 142.56 ?  1496 ARG A CD  1 
ATOM   74   N NE  . ARG A  1 22  ? -93.249  -45.625 -25.623 1.00 146.34 ?  1496 ARG A NE  1 
ATOM   75   C CZ  . ARG A  1 22  ? -92.809  -44.370 -25.634 1.00 151.84 ?  1496 ARG A CZ  1 
ATOM   76   N NH1 . ARG A  1 22  ? -92.300  -43.850 -26.744 1.00 146.97 1  1496 ARG A NH1 1 
ATOM   77   N NH2 . ARG A  1 22  ? -92.883  -43.623 -24.539 1.00 160.30 ?  1496 ARG A NH2 1 
ATOM   78   N N   . ILE A  1 23  ? -91.885  -45.614 -20.153 1.00 146.28 ?  1497 ILE A N   1 
ATOM   79   C CA  . ILE A  1 23  ? -91.304  -44.333 -19.734 1.00 147.31 ?  1497 ILE A CA  1 
ATOM   80   C C   . ILE A  1 23  ? -90.032  -44.558 -18.872 1.00 151.37 ?  1497 ILE A C   1 
ATOM   81   O O   . ILE A  1 23  ? -89.124  -43.724 -18.912 1.00 144.53 ?  1497 ILE A O   1 
ATOM   82   C CB  . ILE A  1 23  ? -92.381  -43.407 -19.076 1.00 146.36 ?  1497 ILE A CB  1 
ATOM   83   C CG1 . ILE A  1 23  ? -91.973  -41.915 -19.137 1.00 137.56 ?  1497 ILE A CG1 1 
ATOM   84   C CG2 . ILE A  1 23  ? -92.777  -43.842 -17.651 1.00 149.30 ?  1497 ILE A CG2 1 
ATOM   85   C CD1 . ILE A  1 23  ? -93.167  -40.920 -19.277 1.00 129.47 ?  1497 ILE A CD1 1 
ATOM   86   N N   . THR A  1 24  ? -89.958  -45.707 -18.145 1.00 156.15 ?  1498 THR A N   1 
ATOM   87   C CA  . THR A  1 24  ? -88.808  -46.100 -17.315 1.00 153.96 ?  1498 THR A CA  1 
ATOM   88   C C   . THR A  1 24  ? -87.611  -46.521 -18.198 1.00 160.05 ?  1498 THR A C   1 
ATOM   89   O O   . THR A  1 24  ? -86.468  -46.485 -17.741 1.00 157.61 ?  1498 THR A O   1 
ATOM   90   C CB  . THR A  1 24  ? -89.205  -47.147 -16.240 1.00 146.63 ?  1498 THR A CB  1 
ATOM   91   O OG1 . THR A  1 24  ? -88.188  -47.207 -15.238 1.00 146.84 ?  1498 THR A OG1 1 
ATOM   92   C CG2 . THR A  1 24  ? -89.443  -48.544 -16.808 1.00 140.67 ?  1498 THR A CG2 1 
ATOM   93   N N   . ASN A  1 25  ? -87.884  -46.912 -19.459 1.00 164.23 ?  1499 ASN A N   1 
ATOM   94   C CA  . ASN A  1 25  ? -86.867  -47.296 -20.435 1.00 158.74 ?  1499 ASN A CA  1 
ATOM   95   C C   . ASN A  1 25  ? -86.210  -46.041 -21.020 1.00 151.95 ?  1499 ASN A C   1 
ATOM   96   O O   . ASN A  1 25  ? -85.106  -46.122 -21.565 1.00 148.72 ?  1499 ASN A O   1 
ATOM   97   C CB  . ASN A  1 25  ? -87.478  -48.155 -21.547 1.00 161.08 ?  1499 ASN A CB  1 
ATOM   98   C CG  . ASN A  1 25  ? -86.586  -49.285 -22.010 1.00 161.30 ?  1499 ASN A CG  1 
ATOM   99   O OD1 . ASN A  1 25  ? -85.416  -49.096 -22.378 1.00 162.38 ?  1499 ASN A OD1 1 
ATOM   100  N ND2 . ASN A  1 25  ? -87.133  -50.491 -22.023 1.00 157.61 ?  1499 ASN A ND2 1 
ATOM   101  N N   . ILE A  1 26  ? -86.893  -44.884 -20.903 1.00 147.34 ?  1500 ILE A N   1 
ATOM   102  C CA  . ILE A  1 26  ? -86.399  -43.589 -21.376 1.00 145.26 ?  1500 ILE A CA  1 
ATOM   103  C C   . ILE A  1 26  ? -85.656  -42.881 -20.241 1.00 150.57 ?  1500 ILE A C   1 
ATOM   104  O O   . ILE A  1 26  ? -84.535  -42.426 -20.455 1.00 155.45 ?  1500 ILE A O   1 
ATOM   105  C CB  . ILE A  1 26  ? -87.512  -42.680 -21.979 1.00 137.95 ?  1500 ILE A CB  1 
ATOM   106  C CG1 . ILE A  1 26  ? -88.593  -43.489 -22.741 1.00 140.54 ?  1500 ILE A CG1 1 
ATOM   107  C CG2 . ILE A  1 26  ? -86.893  -41.585 -22.865 1.00 131.41 ?  1500 ILE A CG2 1 
ATOM   108  C CD1 . ILE A  1 26  ? -89.979  -42.807 -22.828 1.00 143.00 ?  1500 ILE A CD1 1 
ATOM   109  N N   . VAL A  1 27  ? -86.278  -42.795 -19.044 1.00 148.34 ?  1501 VAL A N   1 
ATOM   110  C CA  . VAL A  1 27  ? -85.721  -42.118 -17.869 1.00 142.14 ?  1501 VAL A CA  1 
ATOM   111  C C   . VAL A  1 27  ? -84.502  -42.881 -17.271 1.00 132.29 ?  1501 VAL A C   1 
ATOM   112  O O   . VAL A  1 27  ? -83.499  -42.239 -16.953 1.00 137.74 ?  1501 VAL A O   1 
ATOM   113  C CB  . VAL A  1 27  ? -86.822  -41.780 -16.814 1.00 144.76 ?  1501 VAL A CB  1 
ATOM   114  C CG1 . VAL A  1 27  ? -87.162  -42.968 -15.920 1.00 150.65 ?  1501 VAL A CG1 1 
ATOM   115  C CG2 . VAL A  1 27  ? -86.446  -40.561 -15.978 1.00 138.43 ?  1501 VAL A CG2 1 
ATOM   116  N N   . GLU A  1 28  ? -84.577  -44.223 -17.134 1.00 122.51 ?  1502 GLU A N   1 
ATOM   117  C CA  . GLU A  1 28  ? -83.474  -45.019 -16.584 1.00 127.78 ?  1502 GLU A CA  1 
ATOM   118  C C   . GLU A  1 28  ? -82.660  -45.624 -17.744 1.00 124.44 ?  1502 GLU A C   1 
ATOM   119  O O   . GLU A  1 28  ? -82.584  -46.847 -17.893 1.00 129.52 ?  1502 GLU A O   1 
ATOM   120  C CB  . GLU A  1 28  ? -83.997  -46.085 -15.587 1.00 130.64 ?  1502 GLU A CB  1 
ATOM   121  C CG  . GLU A  1 28  ? -82.974  -46.570 -14.562 1.00 134.20 ?  1502 GLU A CG  1 
ATOM   122  C CD  . GLU A  1 28  ? -82.760  -45.735 -13.307 1.00 131.01 ?  1502 GLU A CD  1 
ATOM   123  O OE1 . GLU A  1 28  ? -83.453  -44.704 -13.138 1.00 129.83 ?  1502 GLU A OE1 1 
ATOM   124  O OE2 . GLU A  1 28  ? -81.899  -46.123 -12.483 1.00 117.03 -1 1502 GLU A OE2 1 
ATOM   125  N N   . SER A  1 29  ? -82.078  -44.744 -18.585 1.00 122.61 ?  1503 SER A N   1 
ATOM   126  C CA  . SER A  1 29  ? -81.280  -45.128 -19.756 1.00 122.94 ?  1503 SER A CA  1 
ATOM   127  C C   . SER A  1 29  ? -79.906  -44.427 -19.801 1.00 124.46 ?  1503 SER A C   1 
ATOM   128  O O   . SER A  1 29  ? -79.546  -43.709 -18.862 1.00 111.56 ?  1503 SER A O   1 
ATOM   129  C CB  . SER A  1 29  ? -82.068  -44.883 -21.047 1.00 123.57 ?  1503 SER A CB  1 
ATOM   130  O OG  . SER A  1 29  ? -82.210  -43.507 -21.366 1.00 117.72 ?  1503 SER A OG  1 
ATOM   131  N N   . SER A  1 30  ? -79.136  -44.666 -20.887 1.00 133.33 ?  1504 SER A N   1 
ATOM   132  C CA  . SER A  1 30  ? -77.827  -44.059 -21.121 1.00 137.48 ?  1504 SER A CA  1 
ATOM   133  C C   . SER A  1 30  ? -78.018  -42.667 -21.708 1.00 138.93 ?  1504 SER A C   1 
ATOM   134  O O   . SER A  1 30  ? -77.465  -41.713 -21.161 1.00 155.58 ?  1504 SER A O   1 
ATOM   135  C CB  . SER A  1 30  ? -76.983  -44.921 -22.058 1.00 138.54 ?  1504 SER A CB  1 
ATOM   136  O OG  . SER A  1 30  ? -75.743  -44.301 -22.357 1.00 141.18 ?  1504 SER A OG  1 
ATOM   137  N N   . PHE A  1 31  ? -78.820  -42.549 -22.804 1.00 127.81 ?  1505 PHE A N   1 
ATOM   138  C CA  . PHE A  1 31  ? -79.108  -41.284 -23.497 1.00 125.31 ?  1505 PHE A CA  1 
ATOM   139  C C   . PHE A  1 31  ? -79.552  -40.175 -22.543 1.00 120.12 ?  1505 PHE A C   1 
ATOM   140  O O   . PHE A  1 31  ? -78.907  -39.132 -22.517 1.00 102.98 ?  1505 PHE A O   1 
ATOM   141  C CB  . PHE A  1 31  ? -80.112  -41.469 -24.662 1.00 129.81 ?  1505 PHE A CB  1 
ATOM   142  C CG  . PHE A  1 31  ? -80.701  -40.180 -25.202 1.00 130.13 ?  1505 PHE A CG  1 
ATOM   143  C CD1 . PHE A  1 31  ? -79.981  -39.383 -26.085 1.00 123.17 ?  1505 PHE A CD1 1 
ATOM   144  C CD2 . PHE A  1 31  ? -81.968  -39.756 -24.809 1.00 127.92 ?  1505 PHE A CD2 1 
ATOM   145  C CE1 . PHE A  1 31  ? -80.519  -38.182 -26.566 1.00 125.61 ?  1505 PHE A CE1 1 
ATOM   146  C CE2 . PHE A  1 31  ? -82.500  -38.551 -25.283 1.00 124.22 ?  1505 PHE A CE2 1 
ATOM   147  C CZ  . PHE A  1 31  ? -81.775  -37.774 -26.163 1.00 124.27 ?  1505 PHE A CZ  1 
ATOM   148  N N   . PHE A  1 32  ? -80.637  -40.412 -21.766 1.00 122.81 ?  1506 PHE A N   1 
ATOM   149  C CA  . PHE A  1 32  ? -81.215  -39.479 -20.794 1.00 116.75 ?  1506 PHE A CA  1 
ATOM   150  C C   . PHE A  1 32  ? -80.136  -38.928 -19.862 1.00 115.07 ?  1506 PHE A C   1 
ATOM   151  O O   . PHE A  1 32  ? -79.895  -37.721 -19.866 1.00 116.61 ?  1506 PHE A O   1 
ATOM   152  C CB  . PHE A  1 32  ? -82.320  -40.182 -19.989 1.00 114.79 ?  1506 PHE A CB  1 
ATOM   153  C CG  . PHE A  1 32  ? -83.092  -39.320 -19.018 1.00 105.40 ?  1506 PHE A CG  1 
ATOM   154  C CD1 . PHE A  1 32  ? -84.217  -38.615 -19.431 1.00 97.81  ?  1506 PHE A CD1 1 
ATOM   155  C CD2 . PHE A  1 32  ? -82.727  -39.255 -17.676 1.00 103.47 ?  1506 PHE A CD2 1 
ATOM   156  C CE1 . PHE A  1 32  ? -84.954  -37.843 -18.523 1.00 100.35 ?  1506 PHE A CE1 1 
ATOM   157  C CE2 . PHE A  1 32  ? -83.461  -38.479 -16.768 1.00 105.00 ?  1506 PHE A CE2 1 
ATOM   158  C CZ  . PHE A  1 32  ? -84.567  -37.774 -17.199 1.00 103.49 ?  1506 PHE A CZ  1 
ATOM   159  N N   . THR A  1 33  ? -79.455  -39.830 -19.115 1.00 111.78 ?  1507 THR A N   1 
ATOM   160  C CA  . THR A  1 33  ? -78.381  -39.535 -18.162 1.00 102.08 ?  1507 THR A CA  1 
ATOM   161  C C   . THR A  1 33  ? -77.276  -38.692 -18.801 1.00 94.71  ?  1507 THR A C   1 
ATOM   162  O O   . THR A  1 33  ? -76.970  -37.627 -18.274 1.00 90.18  ?  1507 THR A O   1 
ATOM   163  C CB  . THR A  1 33  ? -77.877  -40.833 -17.519 1.00 105.22 ?  1507 THR A CB  1 
ATOM   164  O OG1 . THR A  1 33  ? -78.979  -41.472 -16.868 1.00 108.23 ?  1507 THR A OG1 1 
ATOM   165  C CG2 . THR A  1 33  ? -76.742  -40.603 -16.524 1.00 107.44 ?  1507 THR A CG2 1 
ATOM   166  N N   . LYS A  1 34  ? -76.728  -39.135 -19.951 1.00 88.67  ?  1508 LYS A N   1 
ATOM   167  C CA  . LYS A  1 34  ? -75.677  -38.410 -20.679 1.00 97.54  ?  1508 LYS A CA  1 
ATOM   168  C C   . LYS A  1 34  ? -76.168  -37.048 -21.227 1.00 102.25 ?  1508 LYS A C   1 
ATOM   169  O O   . LYS A  1 34  ? -75.380  -36.102 -21.326 1.00 103.43 ?  1508 LYS A O   1 
ATOM   170  C CB  . LYS A  1 34  ? -75.056  -39.282 -21.800 1.00 105.17 ?  1508 LYS A CB  1 
ATOM   171  C CG  . LYS A  1 34  ? -74.471  -40.641 -21.357 1.00 115.52 ?  1508 LYS A CG  1 
ATOM   172  C CD  . LYS A  1 34  ? -73.284  -40.546 -20.381 1.00 126.03 ?  1508 LYS A CD  1 
ATOM   173  C CE  . LYS A  1 34  ? -73.067  -41.827 -19.604 1.00 134.75 ?  1508 LYS A CE  1 
ATOM   174  N NZ  . LYS A  1 34  ? -72.026  -41.671 -18.552 1.00 140.57 1  1508 LYS A NZ  1 
ATOM   175  N N   . PHE A  1 35  ? -77.473  -36.950 -21.554 1.00 110.04 ?  1509 PHE A N   1 
ATOM   176  C CA  . PHE A  1 35  ? -78.102  -35.730 -22.064 1.00 104.02 ?  1509 PHE A CA  1 
ATOM   177  C C   . PHE A  1 35  ? -78.310  -34.721 -20.942 1.00 100.82 ?  1509 PHE A C   1 
ATOM   178  O O   . PHE A  1 35  ? -78.092  -33.530 -21.160 1.00 95.95  ?  1509 PHE A O   1 
ATOM   179  C CB  . PHE A  1 35  ? -79.430  -36.045 -22.782 1.00 100.99 ?  1509 PHE A CB  1 
ATOM   180  C CG  . PHE A  1 35  ? -80.147  -34.862 -23.387 1.00 95.03  ?  1509 PHE A CG  1 
ATOM   181  C CD1 . PHE A  1 35  ? -79.673  -34.259 -24.548 1.00 89.45  ?  1509 PHE A CD1 1 
ATOM   182  C CD2 . PHE A  1 35  ? -81.312  -34.366 -22.809 1.00 91.55  ?  1509 PHE A CD2 1 
ATOM   183  C CE1 . PHE A  1 35  ? -80.334  -33.160 -25.105 1.00 86.55  ?  1509 PHE A CE1 1 
ATOM   184  C CE2 . PHE A  1 35  ? -81.983  -33.277 -23.374 1.00 90.31  ?  1509 PHE A CE2 1 
ATOM   185  C CZ  . PHE A  1 35  ? -81.488  -32.678 -24.517 1.00 88.60  ?  1509 PHE A CZ  1 
ATOM   186  N N   . ILE A  1 36  ? -78.725  -35.190 -19.744 1.00 99.76  ?  1510 ILE A N   1 
ATOM   187  C CA  . ILE A  1 36  ? -78.942  -34.329 -18.574 1.00 100.60 ?  1510 ILE A CA  1 
ATOM   188  C C   . ILE A  1 36  ? -77.602  -33.765 -18.092 1.00 100.23 ?  1510 ILE A C   1 
ATOM   189  O O   . ILE A  1 36  ? -77.552  -32.602 -17.692 1.00 103.91 ?  1510 ILE A O   1 
ATOM   190  C CB  . ILE A  1 36  ? -79.800  -35.032 -17.483 1.00 101.22 ?  1510 ILE A CB  1 
ATOM   191  C CG1 . ILE A  1 36  ? -81.288  -34.753 -17.742 1.00 93.88  ?  1510 ILE A CG1 1 
ATOM   192  C CG2 . ILE A  1 36  ? -79.437  -34.598 -16.059 1.00 106.02 ?  1510 ILE A CG2 1 
ATOM   193  C CD1 . ILE A  1 36  ? -81.991  -35.581 -18.811 1.00 102.49 ?  1510 ILE A CD1 1 
ATOM   194  N N   . ILE A  1 37  ? -76.513  -34.553 -18.231 1.00 96.17  ?  1511 ILE A N   1 
ATOM   195  C CA  . ILE A  1 37  ? -75.150  -34.125 -17.926 1.00 95.74  ?  1511 ILE A CA  1 
ATOM   196  C C   . ILE A  1 37  ? -74.729  -33.070 -18.954 1.00 98.34  ?  1511 ILE A C   1 
ATOM   197  O O   . ILE A  1 37  ? -74.047  -32.117 -18.583 1.00 100.64 ?  1511 ILE A O   1 
ATOM   198  C CB  . ILE A  1 37  ? -74.187  -35.338 -17.788 1.00 89.52  ?  1511 ILE A CB  1 
ATOM   199  C CG1 . ILE A  1 37  ? -74.002  -35.712 -16.312 1.00 92.07  ?  1511 ILE A CG1 1 
ATOM   200  C CG2 . ILE A  1 37  ? -72.837  -35.143 -18.477 1.00 83.23  ?  1511 ILE A CG2 1 
ATOM   201  C CD1 . ILE A  1 37  ? -74.851  -36.878 -15.831 1.00 92.25  ?  1511 ILE A CD1 1 
ATOM   202  N N   . TYR A  1 38  ? -75.208  -33.196 -20.217 1.00 107.95 ?  1512 TYR A N   1 
ATOM   203  C CA  . TYR A  1 38  ? -74.952  -32.219 -21.281 1.00 118.52 ?  1512 TYR A CA  1 
ATOM   204  C C   . TYR A  1 38  ? -75.634  -30.865 -20.952 1.00 125.90 ?  1512 TYR A C   1 
ATOM   205  O O   . TYR A  1 38  ? -74.991  -29.815 -21.057 1.00 111.50 ?  1512 TYR A O   1 
ATOM   206  C CB  . TYR A  1 38  ? -75.408  -32.757 -22.661 1.00 120.96 ?  1512 TYR A CB  1 
ATOM   207  C CG  . TYR A  1 38  ? -75.188  -31.781 -23.800 1.00 122.83 ?  1512 TYR A CG  1 
ATOM   208  C CD1 . TYR A  1 38  ? -74.025  -31.823 -24.566 1.00 118.43 ?  1512 TYR A CD1 1 
ATOM   209  C CD2 . TYR A  1 38  ? -76.134  -30.804 -24.102 1.00 126.19 ?  1512 TYR A CD2 1 
ATOM   210  C CE1 . TYR A  1 38  ? -73.803  -30.906 -25.594 1.00 115.32 ?  1512 TYR A CE1 1 
ATOM   211  C CE2 . TYR A  1 38  ? -75.917  -29.875 -25.118 1.00 123.69 ?  1512 TYR A CE2 1 
ATOM   212  C CZ  . TYR A  1 38  ? -74.750  -29.930 -25.864 1.00 114.74 ?  1512 TYR A CZ  1 
ATOM   213  O OH  . TYR A  1 38  ? -74.541  -29.023 -26.877 1.00 96.86  ?  1512 TYR A OH  1 
ATOM   214  N N   . LEU A  1 39  ? -76.933  -30.906 -20.564 1.00 133.33 ?  1513 LEU A N   1 
ATOM   215  C CA  . LEU A  1 39  ? -77.763  -29.740 -20.218 1.00 125.96 ?  1513 LEU A CA  1 
ATOM   216  C C   . LEU A  1 39  ? -77.152  -28.867 -19.126 1.00 118.54 ?  1513 LEU A C   1 
ATOM   217  O O   . LEU A  1 39  ? -77.203  -27.643 -19.234 1.00 117.39 ?  1513 LEU A O   1 
ATOM   218  C CB  . LEU A  1 39  ? -79.181  -30.172 -19.798 1.00 125.69 ?  1513 LEU A CB  1 
ATOM   219  C CG  . LEU A  1 39  ? -80.099  -30.729 -20.882 1.00 133.49 ?  1513 LEU A CG  1 
ATOM   220  C CD1 . LEU A  1 39  ? -81.195  -31.563 -20.264 1.00 140.52 ?  1513 LEU A CD1 1 
ATOM   221  C CD2 . LEU A  1 39  ? -80.689  -29.617 -21.743 1.00 138.98 ?  1513 LEU A CD2 1 
ATOM   222  N N   . ILE A  1 40  ? -76.578  -29.494 -18.083 1.00 108.23 ?  1514 ILE A N   1 
ATOM   223  C CA  . ILE A  1 40  ? -75.936  -28.788 -16.976 1.00 107.27 ?  1514 ILE A CA  1 
ATOM   224  C C   . ILE A  1 40  ? -74.682  -28.072 -17.493 1.00 105.33 ?  1514 ILE A C   1 
ATOM   225  O O   . ILE A  1 40  ? -74.471  -26.903 -17.159 1.00 111.40 ?  1514 ILE A O   1 
ATOM   226  C CB  . ILE A  1 40  ? -75.672  -29.706 -15.744 1.00 110.87 ?  1514 ILE A CB  1 
ATOM   227  C CG1 . ILE A  1 40  ? -76.968  -30.424 -15.292 1.00 107.25 ?  1514 ILE A CG1 1 
ATOM   228  C CG2 . ILE A  1 40  ? -75.102  -28.898 -14.579 1.00 118.95 ?  1514 ILE A CG2 1 
ATOM   229  C CD1 . ILE A  1 40  ? -76.795  -31.634 -14.321 1.00 104.12 ?  1514 ILE A CD1 1 
ATOM   230  N N   . VAL A  1 41  ? -73.896  -28.749 -18.354 1.00 96.61  ?  1515 VAL A N   1 
ATOM   231  C CA  . VAL A  1 41  ? -72.687  -28.187 -18.971 1.00 96.72  ?  1515 VAL A CA  1 
ATOM   232  C C   . VAL A  1 41  ? -73.069  -27.005 -19.879 1.00 103.51 ?  1515 VAL A C   1 
ATOM   233  O O   . VAL A  1 41  ? -72.411  -25.964 -19.843 1.00 102.32 ?  1515 VAL A O   1 
ATOM   234  C CB  . VAL A  1 41  ? -71.850  -29.278 -19.696 1.00 90.11  ?  1515 VAL A CB  1 
ATOM   235  C CG1 . VAL A  1 41  ? -70.758  -28.673 -20.583 1.00 81.89  ?  1515 VAL A CG1 1 
ATOM   236  C CG2 . VAL A  1 41  ? -71.239  -30.253 -18.690 1.00 91.91  ?  1515 VAL A CG2 1 
ATOM   237  N N   . LEU A  1 42  ? -74.164  -27.157 -20.644 1.00 106.88 ?  1516 LEU A N   1 
ATOM   238  C CA  . LEU A  1 42  ? -74.698  -26.129 -21.540 1.00 108.64 ?  1516 LEU A CA  1 
ATOM   239  C C   . LEU A  1 42  ? -75.197  -24.904 -20.742 1.00 95.03  ?  1516 LEU A C   1 
ATOM   240  O O   . LEU A  1 42  ? -74.996  -23.764 -21.176 1.00 79.17  ?  1516 LEU A O   1 
ATOM   241  C CB  . LEU A  1 42  ? -75.825  -26.736 -22.398 1.00 125.40 ?  1516 LEU A CB  1 
ATOM   242  C CG  . LEU A  1 42  ? -76.092  -26.088 -23.757 1.00 128.72 ?  1516 LEU A CG  1 
ATOM   243  C CD1 . LEU A  1 42  ? -74.953  -26.348 -24.738 1.00 130.26 ?  1516 LEU A CD1 1 
ATOM   244  C CD2 . LEU A  1 42  ? -77.381  -26.608 -24.345 1.00 129.08 ?  1516 LEU A CD2 1 
ATOM   245  N N   . ASN A  1 43  ? -75.800  -25.151 -19.554 1.00 89.04  ?  1517 ASN A N   1 
ATOM   246  C CA  . ASN A  1 43  ? -76.294  -24.110 -18.648 1.00 87.92  ?  1517 ASN A CA  1 
ATOM   247  C C   . ASN A  1 43  ? -75.125  -23.418 -17.942 1.00 88.69  ?  1517 ASN A C   1 
ATOM   248  O O   . ASN A  1 43  ? -75.258  -22.268 -17.509 1.00 85.02  ?  1517 ASN A O   1 
ATOM   249  C CB  . ASN A  1 43  ? -77.302  -24.682 -17.636 1.00 89.62  ?  1517 ASN A CB  1 
ATOM   250  C CG  . ASN A  1 43  ? -78.166  -23.677 -16.881 1.00 86.65  ?  1517 ASN A CG  1 
ATOM   251  O OD1 . ASN A  1 43  ? -78.785  -24.020 -15.872 1.00 76.08  ?  1517 ASN A OD1 1 
ATOM   252  N ND2 . ASN A  1 43  ? -78.260  -22.430 -17.340 1.00 84.08  ?  1517 ASN A ND2 1 
ATOM   253  N N   . MET A  1 44  ? -73.972  -24.112 -17.848 1.00 94.82  ?  1518 MET A N   1 
ATOM   254  C CA  . MET A  1 44  ? -72.762  -23.566 -17.241 1.00 101.29 ?  1518 MET A CA  1 
ATOM   255  C C   . MET A  1 44  ? -72.156  -22.493 -18.129 1.00 92.51  ?  1518 MET A C   1 
ATOM   256  O O   . MET A  1 44  ? -71.858  -21.409 -17.630 1.00 88.37  ?  1518 MET A O   1 
ATOM   257  C CB  . MET A  1 44  ? -71.738  -24.669 -16.927 1.00 105.18 ?  1518 MET A CB  1 
ATOM   258  C CG  . MET A  1 44  ? -70.527  -24.164 -16.168 1.00 106.49 ?  1518 MET A CG  1 
ATOM   259  S SD  . MET A  1 44  ? -69.899  -25.321 -14.942 1.00 100.81 ?  1518 MET A SD  1 
ATOM   260  C CE  . MET A  1 44  ? -69.025  -26.478 -16.013 1.00 101.13 ?  1518 MET A CE  1 
ATOM   261  N N   . VAL A  1 45  ? -72.005  -22.783 -19.436 1.00 81.87  ?  1519 VAL A N   1 
ATOM   262  C CA  . VAL A  1 45  ? -71.422  -21.864 -20.415 1.00 77.25  ?  1519 VAL A CA  1 
ATOM   263  C C   . VAL A  1 45  ? -72.209  -20.537 -20.503 1.00 87.52  ?  1519 VAL A C   1 
ATOM   264  O O   . VAL A  1 45  ? -71.573  -19.480 -20.572 1.00 89.20  ?  1519 VAL A O   1 
ATOM   265  C CB  . VAL A  1 45  ? -71.190  -22.511 -21.799 1.00 67.37  ?  1519 VAL A CB  1 
ATOM   266  C CG1 . VAL A  1 45  ? -70.257  -21.654 -22.648 1.00 62.12  ?  1519 VAL A CG1 1 
ATOM   267  C CG2 . VAL A  1 45  ? -70.620  -23.917 -21.656 1.00 66.20  ?  1519 VAL A CG2 1 
ATOM   268  N N   . THR A  1 46  ? -73.566  -20.580 -20.455 1.00 86.60  ?  1520 THR A N   1 
ATOM   269  C CA  . THR A  1 46  ? -74.388  -19.353 -20.472 1.00 82.22  ?  1520 THR A CA  1 
ATOM   270  C C   . THR A  1 46  ? -74.145  -18.534 -19.185 1.00 72.80  ?  1520 THR A C   1 
ATOM   271  O O   . THR A  1 46  ? -73.952  -17.310 -19.255 1.00 60.23  ?  1520 THR A O   1 
ATOM   272  C CB  . THR A  1 46  ? -75.891  -19.623 -20.786 1.00 91.46  ?  1520 THR A CB  1 
ATOM   273  O OG1 . THR A  1 46  ? -76.707  -18.547 -20.299 1.00 101.56 ?  1520 THR A OG1 1 
ATOM   274  C CG2 . THR A  1 46  ? -76.405  -20.926 -20.220 1.00 98.15  ?  1520 THR A CG2 1 
ATOM   275  N N   . MET A  1 47  ? -74.089  -19.227 -18.028 1.00 71.28  ?  1521 MET A N   1 
ATOM   276  C CA  . MET A  1 47  ? -73.799  -18.593 -16.746 1.00 80.05  ?  1521 MET A CA  1 
ATOM   277  C C   . MET A  1 47  ? -72.351  -18.050 -16.721 1.00 86.68  ?  1521 MET A C   1 
ATOM   278  O O   . MET A  1 47  ? -72.087  -17.031 -16.076 1.00 90.46  ?  1521 MET A O   1 
ATOM   279  C CB  . MET A  1 47  ? -74.101  -19.546 -15.574 1.00 83.85  ?  1521 MET A CB  1 
ATOM   280  C CG  . MET A  1 47  ? -75.568  -19.510 -15.145 1.00 80.17  ?  1521 MET A CG  1 
ATOM   281  S SD  . MET A  1 47  ? -75.972  -20.382 -13.596 1.00 71.85  ?  1521 MET A SD  1 
ATOM   282  C CE  . MET A  1 47  ? -76.320  -21.987 -14.224 1.00 71.08  ?  1521 MET A CE  1 
ATOM   283  N N   . MET A  1 48  ? -71.440  -18.692 -17.492 1.00 91.55  ?  1522 MET A N   1 
ATOM   284  C CA  . MET A  1 48  ? -70.028  -18.320 -17.625 1.00 92.09  ?  1522 MET A CA  1 
ATOM   285  C C   . MET A  1 48  ? -69.829  -17.042 -18.420 1.00 93.29  ?  1522 MET A C   1 
ATOM   286  O O   . MET A  1 48  ? -68.909  -16.277 -18.116 1.00 102.34 ?  1522 MET A O   1 
ATOM   287  C CB  . MET A  1 48  ? -69.225  -19.455 -18.276 1.00 88.65  ?  1522 MET A CB  1 
ATOM   288  C CG  . MET A  1 48  ? -68.559  -20.371 -17.272 1.00 92.04  ?  1522 MET A CG  1 
ATOM   289  S SD  . MET A  1 48  ? -68.142  -22.021 -17.900 1.00 93.97  ?  1522 MET A SD  1 
ATOM   290  C CE  . MET A  1 48  ? -66.994  -21.595 -19.268 1.00 86.16  ?  1522 MET A CE  1 
ATOM   291  N N   . VAL A  1 49  ? -70.685  -16.808 -19.433 1.00 91.23  ?  1523 VAL A N   1 
ATOM   292  C CA  . VAL A  1 49  ? -70.555  -15.661 -20.326 1.00 93.64  ?  1523 VAL A CA  1 
ATOM   293  C C   . VAL A  1 49  ? -71.115  -14.343 -19.708 1.00 94.57  ?  1523 VAL A C   1 
ATOM   294  O O   . VAL A  1 49  ? -70.875  -13.272 -20.284 1.00 90.09  ?  1523 VAL A O   1 
ATOM   295  C CB  . VAL A  1 49  ? -71.101  -15.965 -21.749 1.00 91.70  ?  1523 VAL A CB  1 
ATOM   296  C CG1 . VAL A  1 49  ? -72.605  -15.788 -21.845 1.00 92.34  ?  1523 VAL A CG1 1 
ATOM   297  C CG2 . VAL A  1 49  ? -70.375  -15.145 -22.812 1.00 90.69  ?  1523 VAL A CG2 1 
ATOM   298  N N   . GLU A  1 50  ? -71.787  -14.392 -18.530 1.00 100.05 ?  1524 GLU A N   1 
ATOM   299  C CA  . GLU A  1 50  ? -72.222  -13.133 -17.907 1.00 110.13 ?  1524 GLU A CA  1 
ATOM   300  C C   . GLU A  1 50  ? -71.029  -12.489 -17.165 1.00 109.14 ?  1524 GLU A C   1 
ATOM   301  O O   . GLU A  1 50  ? -70.286  -13.196 -16.477 1.00 103.69 ?  1524 GLU A O   1 
ATOM   302  C CB  . GLU A  1 50  ? -73.510  -13.270 -17.057 1.00 116.55 ?  1524 GLU A CB  1 
ATOM   303  C CG  . GLU A  1 50  ? -73.409  -14.073 -15.768 1.00 116.27 ?  1524 GLU A CG  1 
ATOM   304  C CD  . GLU A  1 50  ? -73.391  -13.299 -14.458 1.00 110.04 ?  1524 GLU A CD  1 
ATOM   305  O OE1 . GLU A  1 50  ? -72.715  -13.766 -13.511 1.00 110.48 ?  1524 GLU A OE1 1 
ATOM   306  O OE2 . GLU A  1 50  ? -74.080  -12.257 -14.357 1.00 94.23  -1 1524 GLU A OE2 1 
ATOM   307  N N   . LYS A  1 51  ? -70.786  -11.180 -17.395 1.00 112.50 ?  1525 LYS A N   1 
ATOM   308  C CA  . LYS A  1 51  ? -69.650  -10.477 -16.789 1.00 120.28 ?  1525 LYS A CA  1 
ATOM   309  C C   . LYS A  1 51  ? -69.950  -8.990  -16.435 1.00 118.91 ?  1525 LYS A C   1 
ATOM   310  O O   . LYS A  1 51  ? -71.117  -8.607  -16.322 1.00 112.47 ?  1525 LYS A O   1 
ATOM   311  C CB  . LYS A  1 51  ? -68.374  -10.628 -17.655 1.00 128.86 ?  1525 LYS A CB  1 
ATOM   312  C CG  . LYS A  1 51  ? -68.455  -10.055 -19.066 1.00 133.76 ?  1525 LYS A CG  1 
ATOM   313  C CD  . LYS A  1 51  ? -67.080  -10.031 -19.712 1.00 133.68 ?  1525 LYS A CD  1 
ATOM   314  C CE  . LYS A  1 51  ? -67.079  -9.359  -21.061 1.00 136.47 ?  1525 LYS A CE  1 
ATOM   315  N NZ  . LYS A  1 51  ? -65.713  -9.303  -21.641 1.00 139.19 1  1525 LYS A NZ  1 
ATOM   316  N N   . GLU A  1 52  ? -68.871  -8.190  -16.220 1.00 123.27 ?  1526 GLU A N   1 
ATOM   317  C CA  . GLU A  1 52  ? -68.758  -6.773  -15.826 1.00 121.57 ?  1526 GLU A CA  1 
ATOM   318  C C   . GLU A  1 52  ? -69.988  -5.868  -16.064 1.00 122.88 ?  1526 GLU A C   1 
ATOM   319  O O   . GLU A  1 52  ? -70.310  -5.051  -15.197 1.00 122.65 ?  1526 GLU A O   1 
ATOM   320  C CB  . GLU A  1 52  ? -67.532  -6.144  -16.504 1.00 116.63 ?  1526 GLU A CB  1 
ATOM   321  C CG  . GLU A  1 52  ? -66.782  -5.157  -15.624 1.00 116.83 ?  1526 GLU A CG  1 
ATOM   322  C CD  . GLU A  1 52  ? -65.389  -4.784  -16.103 1.00 121.55 ?  1526 GLU A CD  1 
ATOM   323  O OE1 . GLU A  1 52  ? -65.062  -3.574  -16.079 1.00 113.45 ?  1526 GLU A OE1 1 
ATOM   324  O OE2 . GLU A  1 52  ? -64.605  -5.700  -16.446 1.00 131.45 -1 1526 GLU A OE2 1 
ATOM   325  N N   . GLY A  1 53  ? -70.620  -5.992  -17.231 1.00 120.38 ?  1527 GLY A N   1 
ATOM   326  C CA  . GLY A  1 53  ? -71.782  -5.194  -17.608 1.00 119.00 ?  1527 GLY A CA  1 
ATOM   327  C C   . GLY A  1 53  ? -71.561  -4.483  -18.929 1.00 123.42 ?  1527 GLY A C   1 
ATOM   328  O O   . GLY A  1 53  ? -70.735  -3.570  -18.972 1.00 133.41 ?  1527 GLY A O   1 
ATOM   329  N N   . GLN A  1 54  ? -72.230  -4.881  -20.053 1.00 125.52 ?  1528 GLN A N   1 
ATOM   330  C CA  . GLN A  1 54  ? -73.276  -5.898  -20.307 1.00 117.32 ?  1528 GLN A CA  1 
ATOM   331  C C   . GLN A  1 54  ? -74.682  -5.277  -20.210 1.00 114.62 ?  1528 GLN A C   1 
ATOM   332  O O   . GLN A  1 54  ? -75.211  -5.078  -19.112 1.00 126.78 ?  1528 GLN A O   1 
ATOM   333  C CB  . GLN A  1 54  ? -73.128  -7.189  -19.469 1.00 114.59 ?  1528 GLN A CB  1 
ATOM   334  C CG  . GLN A  1 54  ? -73.847  -8.387  -20.058 1.00 113.50 ?  1528 GLN A CG  1 
ATOM   335  C CD  . GLN A  1 54  ? -73.367  -9.679  -19.458 1.00 115.87 ?  1528 GLN A CD  1 
ATOM   336  O OE1 . GLN A  1 54  ? -73.966  -10.205 -18.519 1.00 108.42 ?  1528 GLN A OE1 1 
ATOM   337  N NE2 . GLN A  1 54  ? -72.291  -10.233 -20.008 1.00 121.39 ?  1528 GLN A NE2 1 
ATOM   338  N N   . SER A  1 55  ? -75.263  -4.957  -21.385 1.00 107.42 ?  1529 SER A N   1 
ATOM   339  C CA  . SER A  1 55  ? -76.576  -4.322  -21.550 1.00 108.97 ?  1529 SER A CA  1 
ATOM   340  C C   . SER A  1 55  ? -77.743  -5.196  -21.088 1.00 118.45 ?  1529 SER A C   1 
ATOM   341  O O   . SER A  1 55  ? -77.593  -6.418  -20.991 1.00 113.22 ?  1529 SER A O   1 
ATOM   342  C CB  . SER A  1 55  ? -76.789  -3.921  -23.010 1.00 111.26 ?  1529 SER A CB  1 
ATOM   343  O OG  . SER A  1 55  ? -77.105  -5.035  -23.832 1.00 99.84  ?  1529 SER A OG  1 
ATOM   344  N N   . GLN A  1 56  ? -78.930  -4.566  -20.876 1.00 130.20 ?  1530 GLN A N   1 
ATOM   345  C CA  . GLN A  1 56  ? -80.179  -5.236  -20.496 1.00 125.49 ?  1530 GLN A CA  1 
ATOM   346  C C   . GLN A  1 56  ? -80.624  -6.199  -21.603 1.00 122.74 ?  1530 GLN A C   1 
ATOM   347  O O   . GLN A  1 56  ? -81.408  -7.104  -21.327 1.00 117.60 ?  1530 GLN A O   1 
ATOM   348  C CB  . GLN A  1 56  ? -81.296  -4.227  -20.168 1.00 124.25 ?  1530 GLN A CB  1 
ATOM   349  C CG  . GLN A  1 56  ? -82.301  -4.750  -19.135 1.00 132.05 ?  1530 GLN A CG  1 
ATOM   350  C CD  . GLN A  1 56  ? -83.738  -4.754  -19.618 1.00 141.68 ?  1530 GLN A CD  1 
ATOM   351  O OE1 . GLN A  1 56  ? -84.364  -3.700  -19.802 1.00 146.07 ?  1530 GLN A OE1 1 
ATOM   352  N NE2 . GLN A  1 56  ? -84.319  -5.942  -19.760 1.00 134.25 ?  1530 GLN A NE2 1 
ATOM   353  N N   . HIS A  1 57  ? -80.109  -6.014  -22.848 1.00 122.45 ?  1531 HIS A N   1 
ATOM   354  C CA  . HIS A  1 57  ? -80.374  -6.901  -23.982 1.00 123.54 ?  1531 HIS A CA  1 
ATOM   355  C C   . HIS A  1 57  ? -79.630  -8.203  -23.704 1.00 120.41 ?  1531 HIS A C   1 
ATOM   356  O O   . HIS A  1 57  ? -80.281  -9.234  -23.534 1.00 109.66 ?  1531 HIS A O   1 
ATOM   357  C CB  . HIS A  1 57  ? -79.935  -6.268  -25.326 1.00 121.99 ?  1531 HIS A CB  1 
ATOM   358  C CG  . HIS A  1 57  ? -80.045  -7.188  -26.516 1.00 115.89 ?  1531 HIS A CG  1 
ATOM   359  N ND1 . HIS A  1 57  ? -78.914  -7.692  -27.151 1.00 111.59 ?  1531 HIS A ND1 1 
ATOM   360  C CD2 . HIS A  1 57  ? -81.146  -7.667  -27.148 1.00 112.79 ?  1531 HIS A CD2 1 
ATOM   361  C CE1 . HIS A  1 57  ? -79.362  -8.451  -28.140 1.00 106.37 ?  1531 HIS A CE1 1 
ATOM   362  N NE2 . HIS A  1 57  ? -80.697  -8.470  -28.178 1.00 112.12 ?  1531 HIS A NE2 1 
ATOM   363  N N   . MET A  1 58  ? -78.280  -8.133  -23.561 1.00 117.84 ?  1532 MET A N   1 
ATOM   364  C CA  . MET A  1 58  ? -77.416  -9.281  -23.261 1.00 122.87 ?  1532 MET A CA  1 
ATOM   365  C C   . MET A  1 58  ? -77.823  -9.948  -21.945 1.00 117.99 ?  1532 MET A C   1 
ATOM   366  O O   . MET A  1 58  ? -77.794  -11.174 -21.850 1.00 118.54 ?  1532 MET A O   1 
ATOM   367  C CB  . MET A  1 58  ? -75.925  -8.876  -23.276 1.00 124.29 ?  1532 MET A CB  1 
ATOM   368  C CG  . MET A  1 58  ? -74.933  -10.044 -23.092 1.00 117.00 ?  1532 MET A CG  1 
ATOM   369  S SD  . MET A  1 58  ? -75.154  -11.524 -24.128 1.00 108.15 ?  1532 MET A SD  1 
ATOM   370  C CE  . MET A  1 58  ? -74.403  -10.973 -25.673 1.00 105.87 ?  1532 MET A CE  1 
ATOM   371  N N   . THR A  1 59  ? -78.267  -9.142  -20.968 1.00 108.42 ?  1533 THR A N   1 
ATOM   372  C CA  . THR A  1 59  ? -78.744  -9.616  -19.675 1.00 105.06 ?  1533 THR A CA  1 
ATOM   373  C C   . THR A  1 59  ? -80.098  -10.329 -19.819 1.00 108.43 ?  1533 THR A C   1 
ATOM   374  O O   . THR A  1 59  ? -80.268  -11.379 -19.206 1.00 106.05 ?  1533 THR A O   1 
ATOM   375  C CB  . THR A  1 59  ? -78.728  -8.485  -18.658 1.00 99.61  ?  1533 THR A CB  1 
ATOM   376  O OG1 . THR A  1 59  ? -77.410  -7.926  -18.652 1.00 101.10 ?  1533 THR A OG1 1 
ATOM   377  C CG2 . THR A  1 59  ? -79.111  -8.945  -17.252 1.00 97.26  ?  1533 THR A CG2 1 
ATOM   378  N N   . GLU A  1 60  ? -81.032  -9.799  -20.651 1.00 110.09 ?  1534 GLU A N   1 
ATOM   379  C CA  . GLU A  1 60  ? -82.339  -10.433 -20.903 1.00 116.30 ?  1534 GLU A CA  1 
ATOM   380  C C   . GLU A  1 60  ? -82.158  -11.729 -21.708 1.00 119.22 ?  1534 GLU A C   1 
ATOM   381  O O   . GLU A  1 60  ? -82.806  -12.733 -21.392 1.00 116.31 ?  1534 GLU A O   1 
ATOM   382  C CB  . GLU A  1 60  ? -83.304  -9.477  -21.628 1.00 125.98 ?  1534 GLU A CB  1 
ATOM   383  C CG  . GLU A  1 60  ? -84.742  -9.977  -21.685 1.00 130.58 ?  1534 GLU A CG  1 
ATOM   384  C CD  . GLU A  1 60  ? -85.782  -9.042  -22.277 1.00 133.32 ?  1534 GLU A CD  1 
ATOM   385  O OE1 . GLU A  1 60  ? -86.960  -9.135  -21.858 1.00 125.03 ?  1534 GLU A OE1 1 
ATOM   386  O OE2 . GLU A  1 60  ? -85.431  -8.235  -23.170 1.00 126.14 -1 1534 GLU A OE2 1 
ATOM   387  N N   . VAL A  1 61  ? -81.267  -11.694 -22.739 1.00 119.32 ?  1535 VAL A N   1 
ATOM   388  C CA  . VAL A  1 61  ? -80.909  -12.821 -23.614 1.00 118.27 ?  1535 VAL A CA  1 
ATOM   389  C C   . VAL A  1 61  ? -80.451  -13.994 -22.738 1.00 119.36 ?  1535 VAL A C   1 
ATOM   390  O O   . VAL A  1 61  ? -81.035  -15.081 -22.811 1.00 106.55 ?  1535 VAL A O   1 
ATOM   391  C CB  . VAL A  1 61  ? -79.831  -12.418 -24.670 1.00 112.04 ?  1535 VAL A CB  1 
ATOM   392  C CG1 . VAL A  1 61  ? -79.183  -13.642 -25.319 1.00 110.76 ?  1535 VAL A CG1 1 
ATOM   393  C CG2 . VAL A  1 61  ? -80.415  -11.500 -25.739 1.00 114.18 ?  1535 VAL A CG2 1 
ATOM   394  N N   . LEU A  1 62  ? -79.444  -13.733 -21.872 1.00 114.57 ?  1536 LEU A N   1 
ATOM   395  C CA  . LEU A  1 62  ? -78.866  -14.697 -20.941 1.00 109.00 ?  1536 LEU A CA  1 
ATOM   396  C C   . LEU A  1 62  ? -79.864  -15.159 -19.909 1.00 110.25 ?  1536 LEU A C   1 
ATOM   397  O O   . LEU A  1 62  ? -79.845  -16.337 -19.548 1.00 113.63 ?  1536 LEU A O   1 
ATOM   398  C CB  . LEU A  1 62  ? -77.601  -14.144 -20.269 1.00 110.55 ?  1536 LEU A CB  1 
ATOM   399  C CG  . LEU A  1 62  ? -76.355  -14.102 -21.152 1.00 114.18 ?  1536 LEU A CG  1 
ATOM   400  C CD1 . LEU A  1 62  ? -75.227  -13.343 -20.483 1.00 113.83 ?  1536 LEU A CD1 1 
ATOM   401  C CD2 . LEU A  1 62  ? -75.919  -15.496 -21.549 1.00 115.36 ?  1536 LEU A CD2 1 
ATOM   402  N N   . TYR A  1 63  ? -80.754  -14.250 -19.459 1.00 113.93 ?  1537 TYR A N   1 
ATOM   403  C CA  . TYR A  1 63  ? -81.802  -14.563 -18.487 1.00 114.35 ?  1537 TYR A CA  1 
ATOM   404  C C   . TYR A  1 63  ? -82.825  -15.528 -19.077 1.00 101.60 ?  1537 TYR A C   1 
ATOM   405  O O   . TYR A  1 63  ? -83.217  -16.476 -18.391 1.00 89.31  ?  1537 TYR A O   1 
ATOM   406  C CB  . TYR A  1 63  ? -82.505  -13.289 -17.987 1.00 116.99 ?  1537 TYR A CB  1 
ATOM   407  C CG  . TYR A  1 63  ? -81.874  -12.573 -16.806 1.00 117.33 ?  1537 TYR A CG  1 
ATOM   408  C CD1 . TYR A  1 63  ? -80.596  -12.904 -16.360 1.00 114.84 ?  1537 TYR A CD1 1 
ATOM   409  C CD2 . TYR A  1 63  ? -82.535  -11.527 -16.168 1.00 116.72 ?  1537 TYR A CD2 1 
ATOM   410  C CE1 . TYR A  1 63  ? -80.004  -12.228 -15.294 1.00 111.98 ?  1537 TYR A CE1 1 
ATOM   411  C CE2 . TYR A  1 63  ? -81.956  -10.850 -15.096 1.00 114.51 ?  1537 TYR A CE2 1 
ATOM   412  C CZ  . TYR A  1 63  ? -80.690  -11.202 -14.664 1.00 116.42 ?  1537 TYR A CZ  1 
ATOM   413  O OH  . TYR A  1 63  ? -80.119  -10.530 -13.611 1.00 129.08 ?  1537 TYR A OH  1 
ATOM   414  N N   . TRP A  1 64  ? -83.225  -15.319 -20.354 1.00 95.55  ?  1538 TRP A N   1 
ATOM   415  C CA  . TRP A  1 64  ? -84.204  -16.186 -21.012 1.00 99.83  ?  1538 TRP A CA  1 
ATOM   416  C C   . TRP A  1 64  ? -83.676  -17.596 -21.282 1.00 99.67  ?  1538 TRP A C   1 
ATOM   417  O O   . TRP A  1 64  ? -84.407  -18.558 -21.022 1.00 91.77  ?  1538 TRP A O   1 
ATOM   418  C CB  . TRP A  1 64  ? -84.808  -15.547 -22.272 1.00 100.50 ?  1538 TRP A CB  1 
ATOM   419  C CG  . TRP A  1 64  ? -85.995  -14.676 -21.963 1.00 104.88 ?  1538 TRP A CG  1 
ATOM   420  C CD1 . TRP A  1 64  ? -86.139  -13.353 -22.262 1.00 106.40 ?  1538 TRP A CD1 1 
ATOM   421  C CD2 . TRP A  1 64  ? -87.174  -15.051 -21.227 1.00 105.54 ?  1538 TRP A CD2 1 
ATOM   422  N NE1 . TRP A  1 64  ? -87.338  -12.882 -21.771 1.00 105.02 ?  1538 TRP A NE1 1 
ATOM   423  C CE2 . TRP A  1 64  ? -87.995  -13.904 -21.136 1.00 104.26 ?  1538 TRP A CE2 1 
ATOM   424  C CE3 . TRP A  1 64  ? -87.623  -16.251 -20.644 1.00 104.71 ?  1538 TRP A CE3 1 
ATOM   425  C CZ2 . TRP A  1 64  ? -89.233  -13.920 -20.481 1.00 105.82 ?  1538 TRP A CZ2 1 
ATOM   426  C CZ3 . TRP A  1 64  ? -88.854  -16.267 -20.007 1.00 101.18 ?  1538 TRP A CZ3 1 
ATOM   427  C CH2 . TRP A  1 64  ? -89.650  -15.115 -19.941 1.00 102.72 ?  1538 TRP A CH2 1 
ATOM   428  N N   . ILE A  1 65  ? -82.399  -17.720 -21.727 1.00 94.44  ?  1539 ILE A N   1 
ATOM   429  C CA  . ILE A  1 65  ? -81.722  -19.010 -21.951 1.00 90.82  ?  1539 ILE A CA  1 
ATOM   430  C C   . ILE A  1 65  ? -81.776  -19.825 -20.636 1.00 92.23  ?  1539 ILE A C   1 
ATOM   431  O O   . ILE A  1 65  ? -82.067  -21.023 -20.663 1.00 83.24  ?  1539 ILE A O   1 
ATOM   432  C CB  . ILE A  1 65  ? -80.262  -18.804 -22.478 1.00 85.91  ?  1539 ILE A CB  1 
ATOM   433  C CG1 . ILE A  1 65  ? -80.252  -18.072 -23.841 1.00 83.68  ?  1539 ILE A CG1 1 
ATOM   434  C CG2 . ILE A  1 65  ? -79.486  -20.128 -22.573 1.00 81.24  ?  1539 ILE A CG2 1 
ATOM   435  C CD1 . ILE A  1 65  ? -78.906  -17.339 -24.209 1.00 88.81  ?  1539 ILE A CD1 1 
ATOM   436  N N   . ASN A  1 66  ? -81.571  -19.142 -19.489 1.00 95.21  ?  1540 ASN A N   1 
ATOM   437  C CA  . ASN A  1 66  ? -81.615  -19.744 -18.156 1.00 100.04 ?  1540 ASN A CA  1 
ATOM   438  C C   . ASN A  1 66  ? -83.020  -20.245 -17.765 1.00 100.75 ?  1540 ASN A C   1 
ATOM   439  O O   . ASN A  1 66  ? -83.111  -21.355 -17.239 1.00 97.14  ?  1540 ASN A O   1 
ATOM   440  C CB  . ASN A  1 66  ? -81.017  -18.811 -17.087 1.00 99.78  ?  1540 ASN A CB  1 
ATOM   441  C CG  . ASN A  1 66  ? -79.503  -18.932 -16.942 1.00 87.75  ?  1540 ASN A CG  1 
ATOM   442  O OD1 . ASN A  1 66  ? -78.974  -19.884 -16.341 1.00 71.34  ?  1540 ASN A OD1 1 
ATOM   443  N ND2 . ASN A  1 66  ? -78.765  -17.983 -17.510 1.00 80.64  ?  1540 ASN A ND2 1 
ATOM   444  N N   . VAL A  1 67  ? -84.103  -19.461 -18.054 1.00 104.06 ?  1541 VAL A N   1 
ATOM   445  C CA  . VAL A  1 67  ? -85.511  -19.834 -17.762 1.00 96.46  ?  1541 VAL A CA  1 
ATOM   446  C C   . VAL A  1 67  ? -85.875  -21.151 -18.478 1.00 90.77  ?  1541 VAL A C   1 
ATOM   447  O O   . VAL A  1 67  ? -86.498  -22.039 -17.877 1.00 88.37  ?  1541 VAL A O   1 
ATOM   448  C CB  . VAL A  1 67  ? -86.531  -18.702 -18.077 1.00 95.69  ?  1541 VAL A CB  1 
ATOM   449  C CG1 . VAL A  1 67  ? -87.950  -19.108 -17.677 1.00 101.21 ?  1541 VAL A CG1 1 
ATOM   450  C CG2 . VAL A  1 67  ? -86.149  -17.397 -17.385 1.00 97.39  ?  1541 VAL A CG2 1 
ATOM   451  N N   . VAL A  1 68  ? -85.444  -21.267 -19.755 1.00 81.82  ?  1542 VAL A N   1 
ATOM   452  C CA  . VAL A  1 68  ? -85.590  -22.446 -20.614 1.00 83.43  ?  1542 VAL A CA  1 
ATOM   453  C C   . VAL A  1 68  ? -84.977  -23.651 -19.861 1.00 90.72  ?  1542 VAL A C   1 
ATOM   454  O O   . VAL A  1 68  ? -85.654  -24.663 -19.659 1.00 76.21  ?  1542 VAL A O   1 
ATOM   455  C CB  . VAL A  1 68  ? -84.899  -22.190 -21.990 1.00 82.31  ?  1542 VAL A CB  1 
ATOM   456  C CG1 . VAL A  1 68  ? -84.822  -23.458 -22.841 1.00 84.16  ?  1542 VAL A CG1 1 
ATOM   457  C CG2 . VAL A  1 68  ? -85.590  -21.066 -22.759 1.00 80.75  ?  1542 VAL A CG2 1 
ATOM   458  N N   . PHE A  1 69  ? -83.717  -23.489 -19.387 1.00 105.20 ?  1543 PHE A N   1 
ATOM   459  C CA  . PHE A  1 69  ? -82.971  -24.489 -18.621 1.00 101.61 ?  1543 PHE A CA  1 
ATOM   460  C C   . PHE A  1 69  ? -83.660  -24.881 -17.303 1.00 99.71  ?  1543 PHE A C   1 
ATOM   461  O O   . PHE A  1 69  ? -83.637  -26.060 -16.941 1.00 90.77  ?  1543 PHE A O   1 
ATOM   462  C CB  . PHE A  1 69  ? -81.522  -24.030 -18.375 1.00 96.44  ?  1543 PHE A CB  1 
ATOM   463  C CG  . PHE A  1 69  ? -80.572  -24.244 -19.531 1.00 88.92  ?  1543 PHE A CG  1 
ATOM   464  C CD1 . PHE A  1 69  ? -80.321  -25.522 -20.023 1.00 87.03  ?  1543 PHE A CD1 1 
ATOM   465  C CD2 . PHE A  1 69  ? -79.874  -23.178 -20.084 1.00 87.14  ?  1543 PHE A CD2 1 
ATOM   466  C CE1 . PHE A  1 69  ? -79.426  -25.721 -21.082 1.00 85.40  ?  1543 PHE A CE1 1 
ATOM   467  C CE2 . PHE A  1 69  ? -78.973  -23.379 -21.136 1.00 89.07  ?  1543 PHE A CE2 1 
ATOM   468  C CZ  . PHE A  1 69  ? -78.759  -24.647 -21.630 1.00 85.98  ?  1543 PHE A CZ  1 
ATOM   469  N N   . ILE A  1 70  ? -84.294  -23.905 -16.612 1.00 102.25 ?  1544 ILE A N   1 
ATOM   470  C CA  . ILE A  1 70  ? -85.007  -24.139 -15.352 1.00 110.26 ?  1544 ILE A CA  1 
ATOM   471  C C   . ILE A  1 70  ? -86.169  -25.125 -15.561 1.00 109.82 ?  1544 ILE A C   1 
ATOM   472  O O   . ILE A  1 70  ? -86.254  -26.108 -14.823 1.00 111.18 ?  1544 ILE A O   1 
ATOM   473  C CB  . ILE A  1 70  ? -85.432  -22.816 -14.635 1.00 113.04 ?  1544 ILE A CB  1 
ATOM   474  C CG1 . ILE A  1 70  ? -84.189  -21.986 -14.246 1.00 111.57 ?  1544 ILE A CG1 1 
ATOM   475  C CG2 . ILE A  1 70  ? -86.278  -23.104 -13.379 1.00 112.13 ?  1544 ILE A CG2 1 
ATOM   476  C CD1 . ILE A  1 70  ? -84.359  -20.450 -14.198 1.00 110.75 ?  1544 ILE A CD1 1 
ATOM   477  N N   . ILE A  1 71  ? -87.019  -24.898 -16.586 1.00 104.17 ?  1545 ILE A N   1 
ATOM   478  C CA  . ILE A  1 71  ? -88.149  -25.796 -16.862 1.00 109.28 ?  1545 ILE A CA  1 
ATOM   479  C C   . ILE A  1 71  ? -87.665  -27.165 -17.368 1.00 105.16 ?  1545 ILE A C   1 
ATOM   480  O O   . ILE A  1 71  ? -88.255  -28.190 -17.010 1.00 106.95 ?  1545 ILE A O   1 
ATOM   481  C CB  . ILE A  1 71  ? -89.255  -25.177 -17.764 1.00 112.99 ?  1545 ILE A CB  1 
ATOM   482  C CG1 . ILE A  1 71  ? -88.706  -24.573 -19.070 1.00 117.51 ?  1545 ILE A CG1 1 
ATOM   483  C CG2 . ILE A  1 71  ? -90.095  -24.162 -16.993 1.00 107.84 ?  1545 ILE A CG2 1 
ATOM   484  C CD1 . ILE A  1 71  ? -88.818  -25.492 -20.280 1.00 121.15 ?  1545 ILE A CD1 1 
ATOM   485  N N   . LEU A  1 72  ? -86.566  -27.175 -18.158 1.00 97.42  ?  1546 LEU A N   1 
ATOM   486  C CA  . LEU A  1 72  ? -85.933  -28.382 -18.704 1.00 96.76  ?  1546 LEU A CA  1 
ATOM   487  C C   . LEU A  1 72  ? -85.532  -29.387 -17.610 1.00 98.48  ?  1546 LEU A C   1 
ATOM   488  O O   . LEU A  1 72  ? -85.590  -30.599 -17.844 1.00 89.81  ?  1546 LEU A O   1 
ATOM   489  C CB  . LEU A  1 72  ? -84.698  -27.998 -19.531 1.00 94.34  ?  1546 LEU A CB  1 
ATOM   490  C CG  . LEU A  1 72  ? -84.936  -27.665 -20.995 1.00 90.15  ?  1546 LEU A CG  1 
ATOM   491  C CD1 . LEU A  1 72  ? -83.849  -26.758 -21.524 1.00 87.47  ?  1546 LEU A CD1 1 
ATOM   492  C CD2 . LEU A  1 72  ? -84.978  -28.923 -21.835 1.00 91.11  ?  1546 LEU A CD2 1 
ATOM   493  N N   . PHE A  1 73  ? -85.106  -28.879 -16.431 1.00 106.82 ?  1547 PHE A N   1 
ATOM   494  C CA  . PHE A  1 73  ? -84.712  -29.705 -15.287 1.00 113.87 ?  1547 PHE A CA  1 
ATOM   495  C C   . PHE A  1 73  ? -85.935  -30.080 -14.439 1.00 110.29 ?  1547 PHE A C   1 
ATOM   496  O O   . PHE A  1 73  ? -85.887  -31.077 -13.711 1.00 106.83 ?  1547 PHE A O   1 
ATOM   497  C CB  . PHE A  1 73  ? -83.613  -29.023 -14.431 1.00 125.08 ?  1547 PHE A CB  1 
ATOM   498  C CG  . PHE A  1 73  ? -82.292  -28.708 -15.112 1.00 121.84 ?  1547 PHE A CG  1 
ATOM   499  C CD1 . PHE A  1 73  ? -81.594  -29.691 -15.809 1.00 119.28 ?  1547 PHE A CD1 1 
ATOM   500  C CD2 . PHE A  1 73  ? -81.706  -27.454 -14.982 1.00 123.20 ?  1547 PHE A CD2 1 
ATOM   501  C CE1 . PHE A  1 73  ? -80.374  -29.400 -16.431 1.00 117.82 ?  1547 PHE A CE1 1 
ATOM   502  C CE2 . PHE A  1 73  ? -80.485  -27.164 -15.605 1.00 127.56 ?  1547 PHE A CE2 1 
ATOM   503  C CZ  . PHE A  1 73  ? -79.826  -28.140 -16.322 1.00 121.69 ?  1547 PHE A CZ  1 
ATOM   504  N N   . THR A  1 74  ? -87.031  -29.286 -14.545 1.00 112.25 ?  1548 THR A N   1 
ATOM   505  C CA  . THR A  1 74  ? -88.291  -29.535 -13.831 1.00 118.67 ?  1548 THR A CA  1 
ATOM   506  C C   . THR A  1 74  ? -89.014  -30.723 -14.491 1.00 122.76 ?  1548 THR A C   1 
ATOM   507  O O   . THR A  1 74  ? -89.581  -31.563 -13.779 1.00 119.54 ?  1548 THR A O   1 
ATOM   508  C CB  . THR A  1 74  ? -89.161  -28.261 -13.742 1.00 113.65 ?  1548 THR A CB  1 
ATOM   509  O OG1 . THR A  1 74  ? -88.338  -27.137 -13.428 1.00 115.81 ?  1548 THR A OG1 1 
ATOM   510  C CG2 . THR A  1 74  ? -90.281  -28.383 -12.702 1.00 106.00 ?  1548 THR A CG2 1 
ATOM   511  N N   . ILE A  1 75  ? -88.972  -30.802 -15.850 1.00 116.62 ?  1549 ILE A N   1 
ATOM   512  C CA  . ILE A  1 75  ? -89.563  -31.921 -16.597 1.00 107.84 ?  1549 ILE A CA  1 
ATOM   513  C C   . ILE A  1 75  ? -88.794  -33.213 -16.244 1.00 113.39 ?  1549 ILE A C   1 
ATOM   514  O O   . ILE A  1 75  ? -89.406  -34.260 -16.022 1.00 113.52 ?  1549 ILE A O   1 
ATOM   515  C CB  . ILE A  1 75  ? -89.733  -31.667 -18.136 1.00 95.18  ?  1549 ILE A CB  1 
ATOM   516  C CG1 . ILE A  1 75  ? -88.400  -31.682 -18.925 1.00 94.71  ?  1549 ILE A CG1 1 
ATOM   517  C CG2 . ILE A  1 75  ? -90.509  -30.387 -18.416 1.00 88.85  ?  1549 ILE A CG2 1 
ATOM   518  C CD1 . ILE A  1 75  ? -88.059  -33.039 -19.651 1.00 91.67  ?  1549 ILE A CD1 1 
ATOM   519  N N   . GLU A  1 76  ? -87.450  -33.090 -16.133 1.00 118.54 ?  1550 GLU A N   1 
ATOM   520  C CA  . GLU A  1 76  ? -86.507  -34.145 -15.780 1.00 118.62 ?  1550 GLU A CA  1 
ATOM   521  C C   . GLU A  1 76  ? -86.839  -34.717 -14.401 1.00 115.83 ?  1550 GLU A C   1 
ATOM   522  O O   . GLU A  1 76  ? -86.842  -35.937 -14.244 1.00 108.03 ?  1550 GLU A O   1 
ATOM   523  C CB  . GLU A  1 76  ? -85.072  -33.591 -15.814 1.00 120.28 ?  1550 GLU A CB  1 
ATOM   524  C CG  . GLU A  1 76  ? -84.003  -34.607 -15.445 1.00 126.78 ?  1550 GLU A CG  1 
ATOM   525  C CD  . GLU A  1 76  ? -82.789  -34.069 -14.711 1.00 128.54 ?  1550 GLU A CD  1 
ATOM   526  O OE1 . GLU A  1 76  ? -82.296  -32.975 -15.074 1.00 129.33 ?  1550 GLU A OE1 1 
ATOM   527  O OE2 . GLU A  1 76  ? -82.284  -34.787 -13.817 1.00 124.08 -1 1550 GLU A OE2 1 
ATOM   528  N N   . ILE A  1 77  ? -87.134  -33.847 -13.416 1.00 118.05 ?  1551 ILE A N   1 
ATOM   529  C CA  . ILE A  1 77  ? -87.470  -34.314 -12.076 1.00 126.61 ?  1551 ILE A CA  1 
ATOM   530  C C   . ILE A  1 77  ? -88.900  -34.870 -12.042 1.00 132.27 ?  1551 ILE A C   1 
ATOM   531  O O   . ILE A  1 77  ? -89.106  -35.862 -11.350 1.00 153.37 ?  1551 ILE A O   1 
ATOM   532  C CB  . ILE A  1 77  ? -87.166  -33.292 -10.927 1.00 130.78 ?  1551 ILE A CB  1 
ATOM   533  C CG1 . ILE A  1 77  ? -87.046  -33.981 -9.533  1.00 129.85 ?  1551 ILE A CG1 1 
ATOM   534  C CG2 . ILE A  1 77  ? -88.155  -32.119 -10.880 1.00 132.91 ?  1551 ILE A CG2 1 
ATOM   535  C CD1 . ILE A  1 77  ? -85.833  -34.959 -9.318  1.00 125.04 ?  1551 ILE A CD1 1 
ATOM   536  N N   . ILE A  1 78  ? -89.861  -34.294 -12.817 1.00 124.37 ?  1552 ILE A N   1 
ATOM   537  C CA  . ILE A  1 78  ? -91.245  -34.800 -12.821 1.00 119.56 ?  1552 ILE A CA  1 
ATOM   538  C C   . ILE A  1 78  ? -91.313  -36.200 -13.497 1.00 111.20 ?  1552 ILE A C   1 
ATOM   539  O O   . ILE A  1 78  ? -92.140  -37.027 -13.090 1.00 106.85 ?  1552 ILE A O   1 
ATOM   540  C CB  . ILE A  1 78  ? -92.314  -33.781 -13.346 1.00 111.94 ?  1552 ILE A CB  1 
ATOM   541  C CG1 . ILE A  1 78  ? -93.731  -34.078 -12.771 1.00 108.38 ?  1552 ILE A CG1 1 
ATOM   542  C CG2 . ILE A  1 78  ? -92.342  -33.638 -14.873 1.00 105.15 ?  1552 ILE A CG2 1 
ATOM   543  C CD1 . ILE A  1 78  ? -93.967  -33.694 -11.271 1.00 103.50 ?  1552 ILE A CD1 1 
ATOM   544  N N   . LEU A  1 79  ? -90.398  -36.474 -14.464 1.00 101.53 ?  1553 LEU A N   1 
ATOM   545  C CA  . LEU A  1 79  ? -90.256  -37.771 -15.135 1.00 100.37 ?  1553 LEU A CA  1 
ATOM   546  C C   . LEU A  1 79  ? -89.797  -38.807 -14.089 1.00 103.47 ?  1553 LEU A C   1 
ATOM   547  O O   . LEU A  1 79  ? -90.360  -39.899 -14.009 1.00 95.38  ?  1553 LEU A O   1 
ATOM   548  C CB  . LEU A  1 79  ? -89.228  -37.668 -16.275 1.00 103.48 ?  1553 LEU A CB  1 
ATOM   549  C CG  . LEU A  1 79  ? -89.792  -37.681 -17.693 1.00 106.10 ?  1553 LEU A CG  1 
ATOM   550  C CD1 . LEU A  1 79  ? -89.182  -36.575 -18.540 1.00 102.32 ?  1553 LEU A CD1 1 
ATOM   551  C CD2 . LEU A  1 79  ? -89.560  -39.023 -18.356 1.00 111.70 ?  1553 LEU A CD2 1 
ATOM   552  N N   . ARG A  1 80  ? -88.819  -38.416 -13.248 1.00 122.07 ?  1554 ARG A N   1 
ATOM   553  C CA  . ARG A  1 80  ? -88.262  -39.220 -12.158 1.00 140.99 ?  1554 ARG A CA  1 
ATOM   554  C C   . ARG A  1 80  ? -89.259  -39.370 -10.996 1.00 148.84 ?  1554 ARG A C   1 
ATOM   555  O O   . ARG A  1 80  ? -89.200  -40.366 -10.273 1.00 148.36 ?  1554 ARG A O   1 
ATOM   556  C CB  . ARG A  1 80  ? -86.952  -38.592 -11.649 1.00 149.34 ?  1554 ARG A CB  1 
ATOM   557  C CG  . ARG A  1 80  ? -85.791  -38.668 -12.639 1.00 152.57 ?  1554 ARG A CG  1 
ATOM   558  C CD  . ARG A  1 80  ? -84.629  -37.796 -12.198 1.00 156.84 ?  1554 ARG A CD  1 
ATOM   559  N NE  . ARG A  1 80  ? -83.413  -38.069 -12.968 1.00 147.46 ?  1554 ARG A NE  1 
ATOM   560  C CZ  . ARG A  1 80  ? -82.185  -37.740 -12.576 1.00 139.70 ?  1554 ARG A CZ  1 
ATOM   561  N NH1 . ARG A  1 80  ? -81.992  -37.120 -11.417 1.00 126.81 1  1554 ARG A NH1 1 
ATOM   562  N NH2 . ARG A  1 80  ? -81.140  -38.031 -13.339 1.00 148.59 ?  1554 ARG A NH2 1 
ATOM   563  N N   . ILE A  1 81  ? -90.157  -38.372 -10.812 1.00 156.20 ?  1555 ILE A N   1 
ATOM   564  C CA  . ILE A  1 81  ? -91.188  -38.336 -9.769  1.00 163.85 ?  1555 ILE A CA  1 
ATOM   565  C C   . ILE A  1 81  ? -92.220  -39.461 -9.988  1.00 175.35 ?  1555 ILE A C   1 
ATOM   566  O O   . ILE A  1 81  ? -92.524  -40.192 -9.043  1.00 206.48 ?  1555 ILE A O   1 
ATOM   567  C CB  . ILE A  1 81  ? -91.811  -36.901 -9.634  1.00 163.37 ?  1555 ILE A CB  1 
ATOM   568  C CG1 . ILE A  1 81  ? -90.969  -36.031 -8.673  1.00 161.45 ?  1555 ILE A CG1 1 
ATOM   569  C CG2 . ILE A  1 81  ? -93.296  -36.908 -9.204  1.00 163.36 ?  1555 ILE A CG2 1 
ATOM   570  C CD1 . ILE A  1 81  ? -91.001  -34.504 -8.945  1.00 161.09 ?  1555 ILE A CD1 1 
ATOM   571  N N   . TYR A  1 82  ? -92.727  -39.616 -11.228 1.00 168.40 ?  1556 TYR A N   1 
ATOM   572  C CA  . TYR A  1 82  ? -93.717  -40.649 -11.548 1.00 160.93 ?  1556 TYR A CA  1 
ATOM   573  C C   . TYR A  1 82  ? -93.124  -42.052 -11.664 1.00 145.56 ?  1556 TYR A C   1 
ATOM   574  O O   . TYR A  1 82  ? -93.820  -43.023 -11.362 1.00 152.47 ?  1556 TYR A O   1 
ATOM   575  C CB  . TYR A  1 82  ? -94.531  -40.287 -12.805 1.00 164.03 ?  1556 TYR A CB  1 
ATOM   576  C CG  . TYR A  1 82  ? -95.737  -39.414 -12.518 1.00 168.19 ?  1556 TYR A CG  1 
ATOM   577  C CD1 . TYR A  1 82  ? -96.912  -39.958 -12.001 1.00 163.82 ?  1556 TYR A CD1 1 
ATOM   578  C CD2 . TYR A  1 82  ? -95.711  -38.045 -12.777 1.00 162.98 ?  1556 TYR A CD2 1 
ATOM   579  C CE1 . TYR A  1 82  ? -98.023  -39.159 -11.730 1.00 157.17 ?  1556 TYR A CE1 1 
ATOM   580  C CE2 . TYR A  1 82  ? -96.818  -37.237 -12.516 1.00 152.41 ?  1556 TYR A CE2 1 
ATOM   581  C CZ  . TYR A  1 82  ? -97.973  -37.798 -11.992 1.00 155.42 ?  1556 TYR A CZ  1 
ATOM   582  O OH  . TYR A  1 82  ? -99.067  -37.007 -11.732 1.00 156.26 ?  1556 TYR A OH  1 
ATOM   583  N N   . VAL A  1 83  ? -91.848  -42.158 -12.085 1.00 130.11 ?  1557 VAL A N   1 
ATOM   584  C CA  . VAL A  1 83  ? -91.172  -43.444 -12.274 1.00 121.54 ?  1557 VAL A CA  1 
ATOM   585  C C   . VAL A  1 83  ? -90.692  -44.055 -10.944 1.00 113.74 ?  1557 VAL A C   1 
ATOM   586  O O   . VAL A  1 83  ? -91.137  -45.150 -10.602 1.00 113.70 ?  1557 VAL A O   1 
ATOM   587  C CB  . VAL A  1 83  ? -90.045  -43.379 -13.344 1.00 119.65 ?  1557 VAL A CB  1 
ATOM   588  C CG1 . VAL A  1 83  ? -89.207  -44.657 -13.357 1.00 117.81 ?  1557 VAL A CG1 1 
ATOM   589  C CG2 . VAL A  1 83  ? -90.631  -43.115 -14.727 1.00 119.50 ?  1557 VAL A CG2 1 
ATOM   590  N N   . HIS A  1 84  ? -89.788  -43.383 -10.213 1.00 111.20 ?  1558 HIS A N   1 
ATOM   591  C CA  . HIS A  1 84  ? -89.248  -43.938 -8.969  1.00 117.67 ?  1558 HIS A CA  1 
ATOM   592  C C   . HIS A  1 84  ? -90.161  -43.743 -7.741  1.00 120.45 ?  1558 HIS A C   1 
ATOM   593  O O   . HIS A  1 84  ? -90.106  -44.580 -6.840  1.00 114.88 ?  1558 HIS A O   1 
ATOM   594  C CB  . HIS A  1 84  ? -87.823  -43.425 -8.705  1.00 126.48 ?  1558 HIS A CB  1 
ATOM   595  C CG  . HIS A  1 84  ? -86.781  -44.075 -9.575  1.00 134.94 ?  1558 HIS A CG  1 
ATOM   596  N ND1 . HIS A  1 84  ? -85.810  -44.911 -9.040  1.00 131.81 ?  1558 HIS A ND1 1 
ATOM   597  C CD2 . HIS A  1 84  ? -86.604  -44.006 -10.917 1.00 136.62 ?  1558 HIS A CD2 1 
ATOM   598  C CE1 . HIS A  1 84  ? -85.073  -45.309 -10.067 1.00 125.34 ?  1558 HIS A CE1 1 
ATOM   599  N NE2 . HIS A  1 84  ? -85.515  -44.796 -11.218 1.00 127.71 ?  1558 HIS A NE2 1 
ATOM   600  N N   . ARG A  1 85  ? -91.016  -42.679 -7.722  1.00 122.98 ?  1559 ARG A N   1 
ATOM   601  C CA  . ARG A  1 85  ? -91.971  -42.356 -6.642  1.00 124.78 ?  1559 ARG A CA  1 
ATOM   602  C C   . ARG A  1 85  ? -91.245  -42.240 -5.258  1.00 125.27 ?  1559 ARG A C   1 
ATOM   603  O O   . ARG A  1 85  ? -90.264  -41.508 -5.182  1.00 127.59 ?  1559 ARG A O   1 
ATOM   604  C CB  . ARG A  1 85  ? -93.177  -43.338 -6.659  1.00 127.45 ?  1559 ARG A CB  1 
ATOM   605  C CG  . ARG A  1 85  ? -94.309  -43.074 -5.655  1.00 127.34 ?  1559 ARG A CG  1 
ATOM   606  C CD  . ARG A  1 85  ? -95.364  -42.087 -6.111  1.00 125.11 ?  1559 ARG A CD  1 
ATOM   607  N NE  . ARG A  1 85  ? -96.578  -42.244 -5.307  1.00 129.97 ?  1559 ARG A NE  1 
ATOM   608  C CZ  . ARG A  1 85  ? -97.663  -41.483 -5.410  1.00 133.25 ?  1559 ARG A CZ  1 
ATOM   609  N NH1 . ARG A  1 85  ? -97.700  -40.480 -6.281  1.00 144.81 1  1559 ARG A NH1 1 
ATOM   610  N NH2 . ARG A  1 85  ? -98.718  -41.713 -4.640  1.00 128.47 ?  1559 ARG A NH2 1 
ATOM   611  N N   . ILE A  1 86  ? -91.684  -42.967 -4.200  1.00 132.77 ?  1560 ILE A N   1 
ATOM   612  C CA  . ILE A  1 86  ? -91.093  -42.910 -2.849  1.00 139.82 ?  1560 ILE A CA  1 
ATOM   613  C C   . ILE A  1 86  ? -89.683  -43.579 -2.833  1.00 147.08 ?  1560 ILE A C   1 
ATOM   614  O O   . ILE A  1 86  ? -88.911  -43.360 -1.894  1.00 149.03 ?  1560 ILE A O   1 
ATOM   615  C CB  . ILE A  1 86  ? -92.094  -43.444 -1.765  1.00 134.53 ?  1560 ILE A CB  1 
ATOM   616  C CG1 . ILE A  1 86  ? -93.437  -42.659 -1.829  1.00 133.63 ?  1560 ILE A CG1 1 
ATOM   617  C CG2 . ILE A  1 86  ? -91.521  -43.357 -0.338  1.00 128.54 ?  1560 ILE A CG2 1 
ATOM   618  C CD1 . ILE A  1 86  ? -94.697  -43.505 -1.875  1.00 128.45 ?  1560 ILE A CD1 1 
ATOM   619  N N   . SER A  1 87  ? -89.327  -44.317 -3.914  1.00 144.39 ?  1561 SER A N   1 
ATOM   620  C CA  . SER A  1 87  ? -87.998  -44.917 -4.080  1.00 134.91 ?  1561 SER A CA  1 
ATOM   621  C C   . SER A  1 87  ? -86.967  -43.829 -4.457  1.00 129.31 ?  1561 SER A C   1 
ATOM   622  O O   . SER A  1 87  ? -85.774  -44.013 -4.198  1.00 118.58 ?  1561 SER A O   1 
ATOM   623  C CB  . SER A  1 87  ? -88.020  -46.054 -5.098  1.00 132.08 ?  1561 SER A CB  1 
ATOM   624  O OG  . SER A  1 87  ? -88.904  -47.087 -4.691  1.00 126.47 ?  1561 SER A OG  1 
ATOM   625  N N   . PHE A  1 88  ? -87.435  -42.683 -5.030  1.00 126.89 ?  1562 PHE A N   1 
ATOM   626  C CA  . PHE A  1 88  ? -86.588  -41.522 -5.335  1.00 127.18 ?  1562 PHE A CA  1 
ATOM   627  C C   . PHE A  1 88  ? -86.297  -40.809 -4.008  1.00 129.87 ?  1562 PHE A C   1 
ATOM   628  O O   . PHE A  1 88  ? -85.158  -40.406 -3.763  1.00 140.35 ?  1562 PHE A O   1 
ATOM   629  C CB  . PHE A  1 88  ? -87.235  -40.568 -6.390  1.00 127.15 ?  1562 PHE A CB  1 
ATOM   630  C CG  . PHE A  1 88  ? -87.847  -39.248 -5.937  1.00 124.34 ?  1562 PHE A CG  1 
ATOM   631  C CD1 . PHE A  1 88  ? -87.044  -38.207 -5.476  1.00 115.16 ?  1562 PHE A CD1 1 
ATOM   632  C CD2 . PHE A  1 88  ? -89.210  -39.012 -6.074  1.00 132.49 ?  1562 PHE A CD2 1 
ATOM   633  C CE1 . PHE A  1 88  ? -87.609  -36.995 -5.062  1.00 114.87 ?  1562 PHE A CE1 1 
ATOM   634  C CE2 . PHE A  1 88  ? -89.773  -37.799 -5.665  1.00 126.44 ?  1562 PHE A CE2 1 
ATOM   635  C CZ  . PHE A  1 88  ? -88.968  -36.795 -5.172  1.00 124.53 ?  1562 PHE A CZ  1 
ATOM   636  N N   . PHE A  1 89  ? -87.344  -40.664 -3.159  1.00 129.17 ?  1563 PHE A N   1 
ATOM   637  C CA  . PHE A  1 89  ? -87.299  -40.026 -1.846  1.00 141.64 ?  1563 PHE A CA  1 
ATOM   638  C C   . PHE A  1 89  ? -86.244  -40.655 -0.939  1.00 145.78 ?  1563 PHE A C   1 
ATOM   639  O O   . PHE A  1 89  ? -85.512  -39.924 -0.271  1.00 134.14 ?  1563 PHE A O   1 
ATOM   640  C CB  . PHE A  1 89  ? -88.683  -40.072 -1.181  1.00 146.11 ?  1563 PHE A CB  1 
ATOM   641  C CG  . PHE A  1 89  ? -89.365  -38.732 -1.066  1.00 150.10 ?  1563 PHE A CG  1 
ATOM   642  C CD1 . PHE A  1 89  ? -90.138  -38.236 -2.109  1.00 151.72 ?  1563 PHE A CD1 1 
ATOM   643  C CD2 . PHE A  1 89  ? -89.253  -37.972 0.094   1.00 151.42 ?  1563 PHE A CD2 1 
ATOM   644  C CE1 . PHE A  1 89  ? -90.773  -36.994 -2.002  1.00 153.49 ?  1563 PHE A CE1 1 
ATOM   645  C CE2 . PHE A  1 89  ? -89.892  -36.732 0.203   1.00 153.48 ?  1563 PHE A CE2 1 
ATOM   646  C CZ  . PHE A  1 89  ? -90.649  -36.251 -0.846  1.00 155.26 ?  1563 PHE A CZ  1 
ATOM   647  N N   . LYS A  1 90  ? -86.132  -42.003 -0.953  1.00 152.61 ?  1564 LYS A N   1 
ATOM   648  C CA  . LYS A  1 90  ? -85.146  -42.740 -0.159  1.00 151.97 ?  1564 LYS A CA  1 
ATOM   649  C C   . LYS A  1 90  ? -83.706  -42.510 -0.659  1.00 144.47 ?  1564 LYS A C   1 
ATOM   650  O O   . LYS A  1 90  ? -82.760  -42.736 0.102   1.00 147.40 ?  1564 LYS A O   1 
ATOM   651  C CB  . LYS A  1 90  ? -85.499  -44.241 -0.082  1.00 159.30 ?  1564 LYS A CB  1 
ATOM   652  C CG  . LYS A  1 90  ? -84.887  -44.985 1.115   1.00 158.44 ?  1564 LYS A CG  1 
ATOM   653  C CD  . LYS A  1 90  ? -85.556  -44.639 2.450   1.00 156.83 ?  1564 LYS A CD  1 
ATOM   654  C CE  . LYS A  1 90  ? -84.757  -45.138 3.628   1.00 158.00 ?  1564 LYS A CE  1 
ATOM   655  N NZ  . LYS A  1 90  ? -85.385  -44.755 4.919   1.00 159.09 1  1564 LYS A NZ  1 
ATOM   656  N N   . ASP A  1 91  ? -83.542  -42.030 -1.915  1.00 139.32 ?  1565 ASP A N   1 
ATOM   657  C CA  . ASP A  1 91  ? -82.227  -41.725 -2.483  1.00 136.73 ?  1565 ASP A CA  1 
ATOM   658  C C   . ASP A  1 91  ? -81.838  -40.259 -2.196  1.00 127.40 ?  1565 ASP A C   1 
ATOM   659  O O   . ASP A  1 91  ? -82.608  -39.355 -2.542  1.00 118.34 ?  1565 ASP A O   1 
ATOM   660  C CB  . ASP A  1 91  ? -82.168  -42.040 -3.991  1.00 134.52 ?  1565 ASP A CB  1 
ATOM   661  C CG  . ASP A  1 91  ? -80.755  -42.136 -4.546  1.00 142.90 ?  1565 ASP A CG  1 
ATOM   662  O OD1 . ASP A  1 91  ? -79.964  -42.955 -4.023  1.00 150.61 -1 1565 ASP A OD1 1 
ATOM   663  O OD2 . ASP A  1 91  ? -80.451  -41.420 -5.525  1.00 141.09 ?  1565 ASP A OD2 1 
ATOM   664  N N   . PRO A  1 92  ? -80.667  -40.009 -1.541  1.00 119.38 ?  1566 PRO A N   1 
ATOM   665  C CA  . PRO A  1 92  ? -80.277  -38.618 -1.233  1.00 113.99 ?  1566 PRO A CA  1 
ATOM   666  C C   . PRO A  1 92  ? -79.913  -37.783 -2.461  1.00 102.54 ?  1566 PRO A C   1 
ATOM   667  O O   . PRO A  1 92  ? -80.278  -36.607 -2.519  1.00 81.98  ?  1566 PRO A O   1 
ATOM   668  C CB  . PRO A  1 92  ? -79.097  -38.782 -0.269  1.00 119.93 ?  1566 PRO A CB  1 
ATOM   669  C CG  . PRO A  1 92  ? -78.522  -40.109 -0.590  1.00 118.10 ?  1566 PRO A CG  1 
ATOM   670  C CD  . PRO A  1 92  ? -79.660  -40.975 -1.047  1.00 117.68 ?  1566 PRO A CD  1 
ATOM   671  N N   . TRP A  1 93  ? -79.221  -38.402 -3.445  1.00 103.04 ?  1567 TRP A N   1 
ATOM   672  C CA  . TRP A  1 93  ? -78.800  -37.784 -4.710  1.00 112.56 ?  1567 TRP A CA  1 
ATOM   673  C C   . TRP A  1 93  ? -80.003  -37.391 -5.587  1.00 116.71 ?  1567 TRP A C   1 
ATOM   674  O O   . TRP A  1 93  ? -79.910  -36.439 -6.367  1.00 113.35 ?  1567 TRP A O   1 
ATOM   675  C CB  . TRP A  1 93  ? -77.856  -38.720 -5.487  1.00 123.28 ?  1567 TRP A CB  1 
ATOM   676  C CG  . TRP A  1 93  ? -76.675  -39.224 -4.702  1.00 134.08 ?  1567 TRP A CG  1 
ATOM   677  C CD1 . TRP A  1 93  ? -75.648  -38.481 -4.196  1.00 124.27 ?  1567 TRP A CD1 1 
ATOM   678  C CD2 . TRP A  1 93  ? -76.365  -40.593 -4.406  1.00 148.41 ?  1567 TRP A CD2 1 
ATOM   679  N NE1 . TRP A  1 93  ? -74.735  -39.299 -3.570  1.00 128.83 ?  1567 TRP A NE1 1 
ATOM   680  C CE2 . TRP A  1 93  ? -75.148  -40.601 -3.687  1.00 145.53 ?  1567 TRP A CE2 1 
ATOM   681  C CE3 . TRP A  1 93  ? -77.005  -41.818 -4.668  1.00 151.83 ?  1567 TRP A CE3 1 
ATOM   682  C CZ2 . TRP A  1 93  ? -74.559  -41.786 -3.225  1.00 154.69 ?  1567 TRP A CZ2 1 
ATOM   683  C CZ3 . TRP A  1 93  ? -76.425  -42.990 -4.204  1.00 152.46 ?  1567 TRP A CZ3 1 
ATOM   684  C CH2 . TRP A  1 93  ? -75.216  -42.968 -3.494  1.00 159.06 ?  1567 TRP A CH2 1 
ATOM   685  N N   . SER A  1 94  ? -81.122  -38.139 -5.456  1.00 124.60 ?  1568 SER A N   1 
ATOM   686  C CA  . SER A  1 94  ? -82.385  -37.915 -6.167  1.00 110.20 ?  1568 SER A CA  1 
ATOM   687  C C   . SER A  1 94  ? -83.192  -36.840 -5.443  1.00 103.26 ?  1568 SER A C   1 
ATOM   688  O O   . SER A  1 94  ? -83.827  -36.014 -6.103  1.00 103.52 ?  1568 SER A O   1 
ATOM   689  C CB  . SER A  1 94  ? -83.204  -39.204 -6.236  1.00 107.33 ?  1568 SER A CB  1 
ATOM   690  O OG  . SER A  1 94  ? -82.521  -40.270 -6.878  1.00 109.39 ?  1568 SER A OG  1 
ATOM   691  N N   . LEU A  1 95  ? -83.177  -36.864 -4.087  1.00 99.56  ?  1569 LEU A N   1 
ATOM   692  C CA  . LEU A  1 95  ? -83.869  -35.904 -3.221  1.00 106.91 ?  1569 LEU A CA  1 
ATOM   693  C C   . LEU A  1 95  ? -83.306  -34.496 -3.453  1.00 108.26 ?  1569 LEU A C   1 
ATOM   694  O O   . LEU A  1 95  ? -84.075  -33.566 -3.695  1.00 98.12  ?  1569 LEU A O   1 
ATOM   695  C CB  . LEU A  1 95  ? -83.712  -36.317 -1.744  1.00 112.71 ?  1569 LEU A CB  1 
ATOM   696  C CG  . LEU A  1 95  ? -84.653  -35.649 -0.737  1.00 120.21 ?  1569 LEU A CG  1 
ATOM   697  C CD1 . LEU A  1 95  ? -85.123  -36.643 0.313   1.00 119.38 ?  1569 LEU A CD1 1 
ATOM   698  C CD2 . LEU A  1 95  ? -83.999  -34.433 -0.082  1.00 120.48 ?  1569 LEU A CD2 1 
ATOM   699  N N   . PHE A  1 96  ? -81.959  -34.369 -3.399  1.00 119.51 ?  1570 PHE A N   1 
ATOM   700  C CA  . PHE A  1 96  ? -81.185  -33.142 -3.615  1.00 121.30 ?  1570 PHE A CA  1 
ATOM   701  C C   . PHE A  1 96  ? -81.487  -32.515 -4.987  1.00 118.82 ?  1570 PHE A C   1 
ATOM   702  O O   . PHE A  1 96  ? -81.621  -31.294 -5.081  1.00 104.30 ?  1570 PHE A O   1 
ATOM   703  C CB  . PHE A  1 96  ? -79.675  -33.435 -3.455  1.00 114.84 ?  1570 PHE A CB  1 
ATOM   704  C CG  . PHE A  1 96  ? -78.757  -32.275 -3.763  1.00 108.85 ?  1570 PHE A CG  1 
ATOM   705  C CD1 . PHE A  1 96  ? -78.465  -31.321 -2.794  1.00 104.66 ?  1570 PHE A CD1 1 
ATOM   706  C CD2 . PHE A  1 96  ? -78.184  -32.137 -5.023  1.00 107.54 ?  1570 PHE A CD2 1 
ATOM   707  C CE1 . PHE A  1 96  ? -77.629  -30.236 -3.086  1.00 105.16 ?  1570 PHE A CE1 1 
ATOM   708  C CE2 . PHE A  1 96  ? -77.349  -31.052 -5.315  1.00 105.00 ?  1570 PHE A CE2 1 
ATOM   709  C CZ  . PHE A  1 96  ? -77.077  -30.110 -4.345  1.00 104.63 ?  1570 PHE A CZ  1 
ATOM   710  N N   . ASP A  1 97  ? -81.585  -33.359 -6.041  1.00 122.76 ?  1571 ASP A N   1 
ATOM   711  C CA  . ASP A  1 97  ? -81.893  -32.977 -7.424  1.00 129.19 ?  1571 ASP A CA  1 
ATOM   712  C C   . ASP A  1 97  ? -83.204  -32.182 -7.462  1.00 134.93 ?  1571 ASP A C   1 
ATOM   713  O O   . ASP A  1 97  ? -83.284  -31.167 -8.154  1.00 139.43 ?  1571 ASP A O   1 
ATOM   714  C CB  . ASP A  1 97  ? -81.996  -34.241 -8.301  1.00 137.83 ?  1571 ASP A CB  1 
ATOM   715  C CG  . ASP A  1 97  ? -81.964  -33.997 -9.798  1.00 148.56 ?  1571 ASP A CG  1 
ATOM   716  O OD1 . ASP A  1 97  ? -82.947  -33.432 -10.332 1.00 149.16 ?  1571 ASP A OD1 1 
ATOM   717  O OD2 . ASP A  1 97  ? -80.985  -34.429 -10.448 1.00 159.86 -1 1571 ASP A OD2 1 
ATOM   718  N N   . PHE A  1 98  ? -84.211  -32.639 -6.684  1.00 133.08 ?  1572 PHE A N   1 
ATOM   719  C CA  . PHE A  1 98  ? -85.526  -32.016 -6.541  1.00 128.13 ?  1572 PHE A CA  1 
ATOM   720  C C   . PHE A  1 98  ? -85.414  -30.705 -5.749  1.00 119.51 ?  1572 PHE A C   1 
ATOM   721  O O   . PHE A  1 98  ? -86.115  -29.739 -6.074  1.00 101.66 ?  1572 PHE A O   1 
ATOM   722  C CB  . PHE A  1 98  ? -86.514  -32.999 -5.874  1.00 136.88 ?  1572 PHE A CB  1 
ATOM   723  C CG  . PHE A  1 98  ? -87.910  -32.472 -5.634  1.00 144.41 ?  1572 PHE A CG  1 
ATOM   724  C CD1 . PHE A  1 98  ? -88.819  -32.358 -6.681  1.00 139.48 ?  1572 PHE A CD1 1 
ATOM   725  C CD2 . PHE A  1 98  ? -88.329  -32.122 -4.355  1.00 142.23 ?  1572 PHE A CD2 1 
ATOM   726  C CE1 . PHE A  1 98  ? -90.112  -31.874 -6.457  1.00 132.68 ?  1572 PHE A CE1 1 
ATOM   727  C CE2 . PHE A  1 98  ? -89.623  -31.638 -4.132  1.00 134.18 ?  1572 PHE A CE2 1 
ATOM   728  C CZ  . PHE A  1 98  ? -90.506  -31.520 -5.183  1.00 130.93 ?  1572 PHE A CZ  1 
ATOM   729  N N   . VAL A  1 99  ? -84.522  -30.671 -4.724  1.00 116.39 ?  1573 VAL A N   1 
ATOM   730  C CA  . VAL A  1 99  ? -84.257  -29.489 -3.884  1.00 110.62 ?  1573 VAL A CA  1 
ATOM   731  C C   . VAL A  1 99  ? -83.692  -28.357 -4.767  1.00 111.18 ?  1573 VAL A C   1 
ATOM   732  O O   . VAL A  1 99  ? -84.095  -27.205 -4.613  1.00 108.24 ?  1573 VAL A O   1 
ATOM   733  C CB  . VAL A  1 99  ? -83.348  -29.800 -2.656  1.00 103.28 ?  1573 VAL A CB  1 
ATOM   734  C CG1 . VAL A  1 99  ? -83.206  -28.582 -1.751  1.00 100.76 ?  1573 VAL A CG1 1 
ATOM   735  C CG2 . VAL A  1 99  ? -83.881  -30.983 -1.853  1.00 103.45 ?  1573 VAL A CG2 1 
ATOM   736  N N   . VAL A  1 100 ? -82.801  -28.712 -5.722  1.00 110.45 ?  1574 VAL A N   1 
ATOM   737  C CA  . VAL A  1 100 ? -82.187  -27.807 -6.702  1.00 111.29 ?  1574 VAL A CA  1 
ATOM   738  C C   . VAL A  1 100 ? -83.288  -27.172 -7.570  1.00 114.11 ?  1574 VAL A C   1 
ATOM   739  O O   . VAL A  1 100 ? -83.300  -25.952 -7.745  1.00 119.59 ?  1574 VAL A O   1 
ATOM   740  C CB  . VAL A  1 100 ? -81.108  -28.560 -7.542  1.00 116.30 ?  1574 VAL A CB  1 
ATOM   741  C CG1 . VAL A  1 100 ? -80.809  -27.868 -8.874  1.00 122.10 ?  1574 VAL A CG1 1 
ATOM   742  C CG2 . VAL A  1 100 ? -79.827  -28.763 -6.741  1.00 114.16 ?  1574 VAL A CG2 1 
ATOM   743  N N   . VAL A  1 101 ? -84.224  -28.007 -8.070  1.00 111.36 ?  1575 VAL A N   1 
ATOM   744  C CA  . VAL A  1 101 ? -85.350  -27.617 -8.928  1.00 106.50 ?  1575 VAL A CA  1 
ATOM   745  C C   . VAL A  1 101 ? -86.248  -26.594 -8.228  1.00 106.51 ?  1575 VAL A C   1 
ATOM   746  O O   . VAL A  1 101 ? -86.537  -25.548 -8.811  1.00 113.97 ?  1575 VAL A O   1 
ATOM   747  C CB  . VAL A  1 101 ? -86.132  -28.853 -9.470  1.00 107.63 ?  1575 VAL A CB  1 
ATOM   748  C CG1 . VAL A  1 101 ? -87.391  -28.440 -10.227 1.00 109.93 ?  1575 VAL A CG1 1 
ATOM   749  C CG2 . VAL A  1 101 ? -85.247  -29.722 -10.361 1.00 106.98 ?  1575 VAL A CG2 1 
ATOM   750  N N   . ILE A  1 102 ? -86.634  -26.873 -6.964  1.00 105.89 ?  1576 ILE A N   1 
ATOM   751  C CA  . ILE A  1 102 ? -87.495  -25.992 -6.171  1.00 109.58 ?  1576 ILE A CA  1 
ATOM   752  C C   . ILE A  1 102 ? -86.781  -24.658 -5.808  1.00 106.31 ?  1576 ILE A C   1 
ATOM   753  O O   . ILE A  1 102 ? -87.456  -23.649 -5.605  1.00 101.50 ?  1576 ILE A O   1 
ATOM   754  C CB  . ILE A  1 102 ? -88.103  -26.746 -4.949  1.00 108.42 ?  1576 ILE A CB  1 
ATOM   755  C CG1 . ILE A  1 102 ? -89.564  -26.313 -4.695  1.00 107.57 ?  1576 ILE A CG1 1 
ATOM   756  C CG2 . ILE A  1 102 ? -87.246  -26.678 -3.676  1.00 98.29  ?  1576 ILE A CG2 1 
ATOM   757  C CD1 . ILE A  1 102 ? -90.629  -27.022 -5.592  1.00 99.68  ?  1576 ILE A CD1 1 
ATOM   758  N N   . ILE A  1 103 ? -85.428  -24.659 -5.782  1.00 109.71 ?  1577 ILE A N   1 
ATOM   759  C CA  . ILE A  1 103 ? -84.585  -23.487 -5.513  1.00 106.76 ?  1577 ILE A CA  1 
ATOM   760  C C   . ILE A  1 103 ? -84.459  -22.645 -6.798  1.00 103.02 ?  1577 ILE A C   1 
ATOM   761  O O   . ILE A  1 103 ? -84.627  -21.421 -6.755  1.00 91.31  ?  1577 ILE A O   1 
ATOM   762  C CB  . ILE A  1 103 ? -83.214  -23.921 -4.895  1.00 103.91 ?  1577 ILE A CB  1 
ATOM   763  C CG1 . ILE A  1 103 ? -83.368  -24.185 -3.379  1.00 98.99  ?  1577 ILE A CG1 1 
ATOM   764  C CG2 . ILE A  1 103 ? -82.084  -22.912 -5.173  1.00 108.02 ?  1577 ILE A CG2 1 
ATOM   765  C CD1 . ILE A  1 103 ? -82.313  -25.094 -2.746  1.00 95.76  ?  1577 ILE A CD1 1 
ATOM   766  N N   . SER A  1 104 ? -84.204  -23.311 -7.940  1.00 107.37 ?  1578 SER A N   1 
ATOM   767  C CA  . SER A  1 104 ? -84.052  -22.667 -9.246  1.00 117.03 ?  1578 SER A CA  1 
ATOM   768  C C   . SER A  1 104 ? -85.346  -22.029 -9.764  1.00 124.64 ?  1578 SER A C   1 
ATOM   769  O O   . SER A  1 104 ? -85.290  -21.206 -10.679 1.00 133.72 ?  1578 SER A O   1 
ATOM   770  C CB  . SER A  1 104 ? -83.465  -23.642 -10.260 1.00 116.44 ?  1578 SER A CB  1 
ATOM   771  O OG  . SER A  1 104 ? -82.181  -24.063 -9.830  1.00 111.25 ?  1578 SER A OG  1 
ATOM   772  N N   . ILE A  1 105 ? -86.500  -22.393 -9.162  1.00 122.43 ?  1579 ILE A N   1 
ATOM   773  C CA  . ILE A  1 105 ? -87.825  -21.859 -9.489  1.00 111.68 ?  1579 ILE A CA  1 
ATOM   774  C C   . ILE A  1 105 ? -88.135  -20.669 -8.566  1.00 104.22 ?  1579 ILE A C   1 
ATOM   775  O O   . ILE A  1 105 ? -88.430  -19.578 -9.065  1.00 98.61  ?  1579 ILE A O   1 
ATOM   776  C CB  . ILE A  1 105 ? -88.906  -22.986 -9.482  1.00 112.83 ?  1579 ILE A CB  1 
ATOM   777  C CG1 . ILE A  1 105 ? -88.806  -23.827 -10.778 1.00 110.18 ?  1579 ILE A CG1 1 
ATOM   778  C CG2 . ILE A  1 105 ? -90.334  -22.426 -9.297  1.00 118.21 ?  1579 ILE A CG2 1 
ATOM   779  C CD1 . ILE A  1 105 ? -89.319  -25.247 -10.687 1.00 111.54 ?  1579 ILE A CD1 1 
ATOM   780  N N   . VAL A  1 106 ? -88.037  -20.880 -7.230  1.00 96.37  ?  1580 VAL A N   1 
ATOM   781  C CA  . VAL A  1 106 ? -88.257  -19.840 -6.219  1.00 97.04  ?  1580 VAL A CA  1 
ATOM   782  C C   . VAL A  1 106 ? -87.332  -18.661 -6.531  1.00 100.78 ?  1580 VAL A C   1 
ATOM   783  O O   . VAL A  1 106 ? -87.827  -17.552 -6.747  1.00 95.93  ?  1580 VAL A O   1 
ATOM   784  C CB  . VAL A  1 106 ? -88.111  -20.361 -4.755  1.00 97.14  ?  1580 VAL A CB  1 
ATOM   785  C CG1 . VAL A  1 106 ? -87.964  -19.211 -3.755  1.00 93.50  ?  1580 VAL A CG1 1 
ATOM   786  C CG2 . VAL A  1 106 ? -89.291  -21.249 -4.370  1.00 100.39 ?  1580 VAL A CG2 1 
ATOM   787  N N   . GLY A  1 107 ? -86.028  -18.945 -6.638  1.00 105.27 ?  1581 GLY A N   1 
ATOM   788  C CA  . GLY A  1 107 ? -84.991  -17.972 -6.963  1.00 100.04 ?  1581 GLY A CA  1 
ATOM   789  C C   . GLY A  1 107 ? -85.315  -17.157 -8.200  1.00 102.76 ?  1581 GLY A C   1 
ATOM   790  O O   . GLY A  1 107 ? -85.215  -15.925 -8.172  1.00 96.48  ?  1581 GLY A O   1 
ATOM   791  N N   . MET A  1 108 ? -85.747  -17.855 -9.284  1.00 102.93 ?  1582 MET A N   1 
ATOM   792  C CA  . MET A  1 108 ? -86.148  -17.289 -10.578 1.00 96.61  ?  1582 MET A CA  1 
ATOM   793  C C   . MET A  1 108 ? -87.218  -16.205 -10.402 1.00 94.89  ?  1582 MET A C   1 
ATOM   794  O O   . MET A  1 108 ? -87.133  -15.139 -11.026 1.00 84.42  ?  1582 MET A O   1 
ATOM   795  C CB  . MET A  1 108 ? -86.635  -18.417 -11.511 1.00 94.21  ?  1582 MET A CB  1 
ATOM   796  C CG  . MET A  1 108 ? -87.463  -17.955 -12.700 1.00 98.08  ?  1582 MET A CG  1 
ATOM   797  S SD  . MET A  1 108 ? -87.882  -19.250 -13.902 1.00 107.70 ?  1582 MET A SD  1 
ATOM   798  C CE  . MET A  1 108 ? -88.875  -20.369 -12.864 1.00 112.34 ?  1582 MET A CE  1 
ATOM   799  N N   . PHE A  1 109 ? -88.202  -16.476 -9.530  1.00 96.88  ?  1583 PHE A N   1 
ATOM   800  C CA  . PHE A  1 109 ? -89.292  -15.548 -9.265  1.00 98.63  ?  1583 PHE A CA  1 
ATOM   801  C C   . PHE A  1 109 ? -88.911  -14.461 -8.274  1.00 91.43  ?  1583 PHE A C   1 
ATOM   802  O O   . PHE A  1 109 ? -89.133  -13.277 -8.560  1.00 80.08  ?  1583 PHE A O   1 
ATOM   803  C CB  . PHE A  1 109 ? -90.563  -16.304 -8.842  1.00 100.36 ?  1583 PHE A CB  1 
ATOM   804  C CG  . PHE A  1 109 ? -91.102  -17.224 -9.920  1.00 103.44 ?  1583 PHE A CG  1 
ATOM   805  C CD1 . PHE A  1 109 ? -91.263  -16.773 -11.233 1.00 98.56  ?  1583 PHE A CD1 1 
ATOM   806  C CD2 . PHE A  1 109 ? -91.466  -18.534 -9.621  1.00 105.62 ?  1583 PHE A CD2 1 
ATOM   807  C CE1 . PHE A  1 109 ? -91.751  -17.626 -12.230 1.00 93.44  ?  1583 PHE A CE1 1 
ATOM   808  C CE2 . PHE A  1 109 ? -91.965  -19.383 -10.618 1.00 104.10 ?  1583 PHE A CE2 1 
ATOM   809  C CZ  . PHE A  1 109 ? -92.107  -18.921 -11.914 1.00 99.07  ?  1583 PHE A CZ  1 
ATOM   810  N N   . LEU A  1 110 ? -88.310  -14.856 -7.129  1.00 90.17  ?  1584 LEU A N   1 
ATOM   811  C CA  . LEU A  1 110 ? -87.879  -13.953 -6.062  1.00 93.18  ?  1584 LEU A CA  1 
ATOM   812  C C   . LEU A  1 110 ? -86.899  -12.875 -6.549  1.00 103.22 ?  1584 LEU A C   1 
ATOM   813  O O   . LEU A  1 110 ? -87.054  -11.709 -6.175  1.00 104.33 ?  1584 LEU A O   1 
ATOM   814  C CB  . LEU A  1 110 ? -87.320  -14.734 -4.860  1.00 86.92  ?  1584 LEU A CB  1 
ATOM   815  C CG  . LEU A  1 110 ? -87.394  -14.008 -3.512  1.00 82.84  ?  1584 LEU A CG  1 
ATOM   816  C CD1 . LEU A  1 110 ? -88.798  -14.062 -2.928  1.00 82.47  ?  1584 LEU A CD1 1 
ATOM   817  C CD2 . LEU A  1 110 ? -86.420  -14.597 -2.525  1.00 83.24  ?  1584 LEU A CD2 1 
ATOM   818  N N   . ALA A  1 111 ? -85.933  -13.251 -7.419  1.00 109.22 ?  1585 ALA A N   1 
ATOM   819  C CA  . ALA A  1 111 ? -84.977  -12.305 -8.001  1.00 105.97 ?  1585 ALA A CA  1 
ATOM   820  C C   . ALA A  1 111 ? -85.703  -11.345 -8.951  1.00 108.32 ?  1585 ALA A C   1 
ATOM   821  O O   . ALA A  1 111 ? -85.465  -10.136 -8.879  1.00 102.05 ?  1585 ALA A O   1 
ATOM   822  C CB  . ALA A  1 111 ? -83.870  -13.045 -8.738  1.00 103.94 ?  1585 ALA A CB  1 
ATOM   823  N N   . ASP A  1 112 ? -86.626  -11.884 -9.799  1.00 109.25 ?  1586 ASP A N   1 
ATOM   824  C CA  . ASP A  1 112 ? -87.443  -11.121 -10.755 1.00 100.97 ?  1586 ASP A CA  1 
ATOM   825  C C   . ASP A  1 112 ? -88.340  -10.121 -10.032 1.00 94.14  ?  1586 ASP A C   1 
ATOM   826  O O   . ASP A  1 112 ? -88.556  -9.022  -10.549 1.00 81.03  ?  1586 ASP A O   1 
ATOM   827  C CB  . ASP A  1 112 ? -88.290  -12.054 -11.639 1.00 97.46  ?  1586 ASP A CB  1 
ATOM   828  C CG  . ASP A  1 112 ? -88.989  -11.355 -12.803 1.00 97.51  ?  1586 ASP A CG  1 
ATOM   829  O OD1 . ASP A  1 112 ? -88.481  -11.446 -13.938 1.00 82.55  ?  1586 ASP A OD1 1 
ATOM   830  O OD2 . ASP A  1 112 ? -90.069  -10.745 -12.578 1.00 105.63 -1 1586 ASP A OD2 1 
ATOM   831  N N   . LEU A  1 113 ? -88.855  -10.507 -8.843  1.00 99.35  ?  1587 LEU A N   1 
ATOM   832  C CA  . LEU A  1 113 ? -89.697  -9.673  -7.988  1.00 109.58 ?  1587 LEU A CA  1 
ATOM   833  C C   . LEU A  1 113 ? -88.915  -8.427  -7.512  1.00 112.80 ?  1587 LEU A C   1 
ATOM   834  O O   . LEU A  1 113 ? -89.437  -7.314  -7.607  1.00 118.65 ?  1587 LEU A O   1 
ATOM   835  C CB  . LEU A  1 113 ? -90.202  -10.503 -6.794  1.00 106.69 ?  1587 LEU A CB  1 
ATOM   836  C CG  . LEU A  1 113 ? -91.271  -9.854  -5.921  1.00 94.71  ?  1587 LEU A CG  1 
ATOM   837  C CD1 . LEU A  1 113 ? -92.656  -10.134 -6.465  1.00 96.80  ?  1587 LEU A CD1 1 
ATOM   838  C CD2 . LEU A  1 113 ? -91.163  -10.334 -4.486  1.00 88.77  ?  1587 LEU A CD2 1 
ATOM   839  N N   . ILE A  1 114 ? -87.651  -8.623  -7.059  1.00 103.32 ?  1588 ILE A N   1 
ATOM   840  C CA  . ILE A  1 114 ? -86.727  -7.577  -6.594  1.00 103.54 ?  1588 ILE A CA  1 
ATOM   841  C C   . ILE A  1 114 ? -86.275  -6.681  -7.778  1.00 108.38 ?  1588 ILE A C   1 
ATOM   842  O O   . ILE A  1 114 ? -85.889  -5.527  -7.572  1.00 104.52 ?  1588 ILE A O   1 
ATOM   843  C CB  . ILE A  1 114 ? -85.550  -8.220  -5.795  1.00 108.09 ?  1588 ILE A CB  1 
ATOM   844  C CG1 . ILE A  1 114 ? -86.081  -8.993  -4.561  1.00 111.45 ?  1588 ILE A CG1 1 
ATOM   845  C CG2 . ILE A  1 114 ? -84.495  -7.188  -5.370  1.00 113.26 ?  1588 ILE A CG2 1 
ATOM   846  C CD1 . ILE A  1 114 ? -85.143  -10.105 -4.004  1.00 120.65 ?  1588 ILE A CD1 1 
ATOM   847  N N   . GLU A  1 115 ? -86.363  -7.210  -9.012  1.00 118.60 ?  1589 GLU A N   1 
ATOM   848  C CA  . GLU A  1 115 ? -86.029  -6.495  -10.243 1.00 132.78 ?  1589 GLU A CA  1 
ATOM   849  C C   . GLU A  1 115 ? -87.218  -5.623  -10.697 1.00 134.45 ?  1589 GLU A C   1 
ATOM   850  O O   . GLU A  1 115 ? -87.002  -4.520  -11.202 1.00 130.64 ?  1589 GLU A O   1 
ATOM   851  C CB  . GLU A  1 115 ? -85.595  -7.489  -11.341 1.00 140.90 ?  1589 GLU A CB  1 
ATOM   852  C CG  . GLU A  1 115 ? -84.980  -6.862  -12.588 1.00 142.81 ?  1589 GLU A CG  1 
ATOM   853  C CD  . GLU A  1 115 ? -83.711  -6.042  -12.425 1.00 139.62 ?  1589 GLU A CD  1 
ATOM   854  O OE1 . GLU A  1 115 ? -83.682  -4.895  -12.927 1.00 126.01 ?  1589 GLU A OE1 1 
ATOM   855  O OE2 . GLU A  1 115 ? -82.736  -6.554  -11.827 1.00 144.74 -1 1589 GLU A OE2 1 
ATOM   856  N N   . THR A  1 116 ? -88.465  -6.114  -10.504 1.00 140.27 ?  1590 THR A N   1 
ATOM   857  C CA  . THR A  1 116 ? -89.709  -5.410  -10.849 1.00 154.75 ?  1590 THR A CA  1 
ATOM   858  C C   . THR A  1 116 ? -89.876  -4.195  -9.924  1.00 155.88 ?  1590 THR A C   1 
ATOM   859  O O   . THR A  1 116 ? -89.917  -3.060  -10.399 1.00 169.41 ?  1590 THR A O   1 
ATOM   860  C CB  . THR A  1 116 ? -90.900  -6.394  -10.824 1.00 162.49 ?  1590 THR A CB  1 
ATOM   861  O OG1 . THR A  1 116 ? -90.679  -7.415  -11.800 1.00 170.38 ?  1590 THR A OG1 1 
ATOM   862  C CG2 . THR A  1 116 ? -92.248  -5.714  -11.084 1.00 165.25 ?  1590 THR A CG2 1 
ATOM   863  N N   . TYR A  1 117 ? -89.960  -4.450  -8.609  1.00 143.41 ?  1591 TYR A N   1 
ATOM   864  C CA  . TYR A  1 117 ? -90.054  -3.434  -7.564  1.00 131.96 ?  1591 TYR A CA  1 
ATOM   865  C C   . TYR A  1 117 ? -88.600  -3.257  -7.125  1.00 127.56 ?  1591 TYR A C   1 
ATOM   866  O O   . TYR A  1 117 ? -88.091  -4.039  -6.317  1.00 129.55 ?  1591 TYR A O   1 
ATOM   867  C CB  . TYR A  1 117 ? -90.966  -3.913  -6.410  1.00 131.38 ?  1591 TYR A CB  1 
ATOM   868  C CG  . TYR A  1 117 ? -92.283  -4.505  -6.871  1.00 138.68 ?  1591 TYR A CG  1 
ATOM   869  C CD1 . TYR A  1 117 ? -93.390  -3.695  -7.108  1.00 141.98 ?  1591 TYR A CD1 1 
ATOM   870  C CD2 . TYR A  1 117 ? -92.426  -5.878  -7.062  1.00 142.33 ?  1591 TYR A CD2 1 
ATOM   871  C CE1 . TYR A  1 117 ? -94.604  -4.234  -7.537  1.00 140.35 ?  1591 TYR A CE1 1 
ATOM   872  C CE2 . TYR A  1 117 ? -93.632  -6.428  -7.495  1.00 144.94 ?  1591 TYR A CE2 1 
ATOM   873  C CZ  . TYR A  1 117 ? -94.720  -5.602  -7.730  1.00 139.35 ?  1591 TYR A CZ  1 
ATOM   874  O OH  . TYR A  1 117 ? -95.915  -6.137  -8.154  1.00 126.43 ?  1591 TYR A OH  1 
ATOM   875  N N   . PHE A  1 118 ? -87.919  -2.271  -7.749  1.00 126.36 ?  1592 PHE A N   1 
ATOM   876  C CA  . PHE A  1 118 ? -86.490  -1.909  -7.667  1.00 131.77 ?  1592 PHE A CA  1 
ATOM   877  C C   . PHE A  1 118 ? -85.906  -1.668  -6.234  1.00 125.03 ?  1592 PHE A C   1 
ATOM   878  O O   . PHE A  1 118 ? -84.790  -1.144  -6.100  1.00 106.76 ?  1592 PHE A O   1 
ATOM   879  C CB  . PHE A  1 118 ? -86.214  -0.686  -8.575  1.00 130.90 ?  1592 PHE A CB  1 
ATOM   880  C CG  . PHE A  1 118 ? -86.485  -0.923  -10.048 1.00 131.34 ?  1592 PHE A CG  1 
ATOM   881  C CD1 . PHE A  1 118 ? -85.500  -1.450  -10.879 1.00 134.99 ?  1592 PHE A CD1 1 
ATOM   882  C CD2 . PHE A  1 118 ? -87.722  -0.613  -10.604 1.00 135.51 ?  1592 PHE A CD2 1 
ATOM   883  C CE1 . PHE A  1 118 ? -85.753  -1.674  -12.238 1.00 132.51 ?  1592 PHE A CE1 1 
ATOM   884  C CE2 . PHE A  1 118 ? -87.976  -0.843  -11.962 1.00 138.34 ?  1592 PHE A CE2 1 
ATOM   885  C CZ  . PHE A  1 118 ? -86.989  -1.371  -12.769 1.00 133.91 ?  1592 PHE A CZ  1 
ATOM   886  N N   . VAL A  1 119 ? -86.628  -2.099  -5.189  1.00 125.58 ?  1593 VAL A N   1 
ATOM   887  C CA  . VAL A  1 119 ? -86.206  -2.006  -3.795  1.00 124.03 ?  1593 VAL A CA  1 
ATOM   888  C C   . VAL A  1 119 ? -85.164  -3.108  -3.540  1.00 121.38 ?  1593 VAL A C   1 
ATOM   889  O O   . VAL A  1 119 ? -85.447  -4.287  -3.782  1.00 97.98  ?  1593 VAL A O   1 
ATOM   890  C CB  . VAL A  1 119 ? -87.420  -2.071  -2.817  1.00 134.17 ?  1593 VAL A CB  1 
ATOM   891  C CG1 . VAL A  1 119 ? -86.969  -2.149  -1.355  1.00 136.01 ?  1593 VAL A CG1 1 
ATOM   892  C CG2 . VAL A  1 119 ? -88.360  -0.882  -3.025  1.00 135.03 ?  1593 VAL A CG2 1 
ATOM   893  N N   . SER A  1 120 ? -83.951  -2.679  -3.083  1.00 138.41 ?  1594 SER A N   1 
ATOM   894  C CA  . SER A  1 120 ? -82.726  -3.417  -2.702  1.00 137.52 ?  1594 SER A CA  1 
ATOM   895  C C   . SER A  1 120 ? -81.925  -4.025  -3.897  1.00 119.70 ?  1594 SER A C   1 
ATOM   896  O O   . SER A  1 120 ? -82.102  -5.198  -4.237  1.00 96.86  ?  1594 SER A O   1 
ATOM   897  C CB  . SER A  1 120 ? -82.994  -4.469  -1.625  1.00 149.47 ?  1594 SER A CB  1 
ATOM   898  O OG  . SER A  1 120 ? -83.741  -5.575  -2.104  1.00 170.26 ?  1594 SER A OG  1 
ATOM   899  N N   . PRO A  1 121 ? -80.987  -3.254  -4.507  1.00 119.48 ?  1595 PRO A N   1 
ATOM   900  C CA  . PRO A  1 121 ? -80.169  -3.828  -5.595  1.00 117.92 ?  1595 PRO A CA  1 
ATOM   901  C C   . PRO A  1 121 ? -79.034  -4.710  -5.063  1.00 117.99 ?  1595 PRO A C   1 
ATOM   902  O O   . PRO A  1 121 ? -78.466  -5.512  -5.811  1.00 106.67 ?  1595 PRO A O   1 
ATOM   903  C CB  . PRO A  1 121 ? -79.639  -2.596  -6.334  1.00 114.64 ?  1595 PRO A CB  1 
ATOM   904  C CG  . PRO A  1 121 ? -79.652  -1.496  -5.328  1.00 115.63 ?  1595 PRO A CG  1 
ATOM   905  C CD  . PRO A  1 121 ? -80.613  -1.850  -4.224  1.00 119.33 ?  1595 PRO A CD  1 
ATOM   906  N N   . THR A  1 122 ? -78.715  -4.552  -3.763  1.00 121.40 ?  1596 THR A N   1 
ATOM   907  C CA  . THR A  1 122 ? -77.685  -5.292  -3.036  1.00 120.68 ?  1596 THR A CA  1 
ATOM   908  C C   . THR A  1 122 ? -78.190  -6.696  -2.653  1.00 107.23 ?  1596 THR A C   1 
ATOM   909  O O   . THR A  1 122 ? -77.414  -7.649  -2.698  1.00 89.62  ?  1596 THR A O   1 
ATOM   910  C CB  . THR A  1 122 ? -77.140  -4.456  -1.852  1.00 135.01 ?  1596 THR A CB  1 
ATOM   911  O OG1 . THR A  1 122 ? -76.175  -5.222  -1.128  1.00 143.09 ?  1596 THR A OG1 1 
ATOM   912  C CG2 . THR A  1 122 ? -78.241  -3.939  -0.907  1.00 138.38 ?  1596 THR A CG2 1 
ATOM   913  N N   . LEU A  1 123 ? -79.489  -6.824  -2.306  1.00 114.63 ?  1597 LEU A N   1 
ATOM   914  C CA  . LEU A  1 123 ? -80.116  -8.102  -1.953  1.00 111.29 ?  1597 LEU A CA  1 
ATOM   915  C C   . LEU A  1 123 ? -80.313  -8.957  -3.205  1.00 109.64 ?  1597 LEU A C   1 
ATOM   916  O O   . LEU A  1 123 ? -80.290  -10.187 -3.107  1.00 93.65  ?  1597 LEU A O   1 
ATOM   917  C CB  . LEU A  1 123 ? -81.457  -7.860  -1.231  1.00 110.23 ?  1597 LEU A CB  1 
ATOM   918  C CG  . LEU A  1 123 ? -82.271  -9.077  -0.755  1.00 104.39 ?  1597 LEU A CG  1 
ATOM   919  C CD1 . LEU A  1 123 ? -81.688  -9.687  0.510   1.00 102.98 ?  1597 LEU A CD1 1 
ATOM   920  C CD2 . LEU A  1 123 ? -83.710  -8.688  -0.498  1.00 99.92  ?  1597 LEU A CD2 1 
ATOM   921  N N   . PHE A  1 124 ? -80.491  -8.298  -4.378  1.00 115.75 ?  1598 PHE A N   1 
ATOM   922  C CA  . PHE A  1 124 ? -80.687  -8.930  -5.681  1.00 113.24 ?  1598 PHE A CA  1 
ATOM   923  C C   . PHE A  1 124 ? -79.551  -9.885  -6.031  1.00 115.67 ?  1598 PHE A C   1 
ATOM   924  O O   . PHE A  1 124 ? -79.829  -11.058 -6.282  1.00 131.42 ?  1598 PHE A O   1 
ATOM   925  C CB  . PHE A  1 124 ? -80.899  -7.882  -6.790  1.00 115.12 ?  1598 PHE A CB  1 
ATOM   926  C CG  . PHE A  1 124 ? -81.080  -8.454  -8.182  1.00 120.17 ?  1598 PHE A CG  1 
ATOM   927  C CD1 . PHE A  1 124 ? -82.322  -8.912  -8.609  1.00 123.81 ?  1598 PHE A CD1 1 
ATOM   928  C CD2 . PHE A  1 124 ? -80.011  -8.520  -9.070  1.00 118.41 ?  1598 PHE A CD2 1 
ATOM   929  C CE1 . PHE A  1 124 ? -82.485  -9.439  -9.894  1.00 119.09 ?  1598 PHE A CE1 1 
ATOM   930  C CE2 . PHE A  1 124 ? -80.177  -9.049  -10.353 1.00 112.68 ?  1598 PHE A CE2 1 
ATOM   931  C CZ  . PHE A  1 124 ? -81.412  -9.503  -10.756 1.00 111.08 ?  1598 PHE A CZ  1 
ATOM   932  N N   . ARG A  1 125 ? -78.280  -9.400  -6.018  1.00 107.64 ?  1599 ARG A N   1 
ATOM   933  C CA  . ARG A  1 125 ? -77.086  -10.210 -6.326  1.00 102.72 ?  1599 ARG A CA  1 
ATOM   934  C C   . ARG A  1 125 ? -76.905  -11.415 -5.374  1.00 91.64  ?  1599 ARG A C   1 
ATOM   935  O O   . ARG A  1 125 ? -76.310  -12.424 -5.762  1.00 78.96  ?  1599 ARG A O   1 
ATOM   936  C CB  . ARG A  1 125 ? -75.803  -9.347  -6.395  1.00 103.41 ?  1599 ARG A CB  1 
ATOM   937  C CG  . ARG A  1 125 ? -75.327  -8.806  -5.049  1.00 109.01 ?  1599 ARG A CG  1 
ATOM   938  C CD  . ARG A  1 125 ? -73.943  -8.190  -5.090  1.00 105.45 ?  1599 ARG A CD  1 
ATOM   939  N NE  . ARG A  1 125 ? -73.701  -7.413  -3.875  1.00 106.03 ?  1599 ARG A NE  1 
ATOM   940  C CZ  . ARG A  1 125 ? -74.017  -6.127  -3.728  1.00 122.81 ?  1599 ARG A CZ  1 
ATOM   941  N NH1 . ARG A  1 125 ? -73.787  -5.507  -2.579  1.00 135.92 1  1599 ARG A NH1 1 
ATOM   942  N NH2 . ARG A  1 125 ? -74.565  -5.451  -4.733  1.00 121.80 ?  1599 ARG A NH2 1 
ATOM   943  N N   . VAL A  1 126 ? -77.427  -11.300 -4.139  1.00 88.12  ?  1600 VAL A N   1 
ATOM   944  C CA  . VAL A  1 126 ? -77.348  -12.354 -3.134  1.00 90.06  ?  1600 VAL A CA  1 
ATOM   945  C C   . VAL A  1 126 ? -78.368  -13.450 -3.457  1.00 91.55  ?  1600 VAL A C   1 
ATOM   946  O O   . VAL A  1 126 ? -77.970  -14.609 -3.545  1.00 97.51  ?  1600 VAL A O   1 
ATOM   947  C CB  . VAL A  1 126 ? -77.453  -11.816 -1.681  1.00 95.19  ?  1600 VAL A CB  1 
ATOM   948  C CG1 . VAL A  1 126 ? -77.279  -12.938 -0.659  1.00 95.92  ?  1600 VAL A CG1 1 
ATOM   949  C CG2 . VAL A  1 126 ? -76.433  -10.707 -1.428  1.00 95.00  ?  1600 VAL A CG2 1 
ATOM   950  N N   . ILE A  1 127 ? -79.664  -13.088 -3.662  1.00 94.67  ?  1601 ILE A N   1 
ATOM   951  C CA  . ILE A  1 127 ? -80.746  -14.041 -3.996  1.00 94.18  ?  1601 ILE A CA  1 
ATOM   952  C C   . ILE A  1 127 ? -80.450  -14.760 -5.325  1.00 90.32  ?  1601 ILE A C   1 
ATOM   953  O O   . ILE A  1 127 ? -80.535  -15.994 -5.386  1.00 78.25  ?  1601 ILE A O   1 
ATOM   954  C CB  . ILE A  1 127 ? -82.166  -13.373 -3.947  1.00 91.25  ?  1601 ILE A CB  1 
ATOM   955  C CG1 . ILE A  1 127 ? -82.598  -13.033 -2.488  1.00 87.85  ?  1601 ILE A CG1 1 
ATOM   956  C CG2 . ILE A  1 127 ? -83.256  -14.182 -4.692  1.00 85.75  ?  1601 ILE A CG2 1 
ATOM   957  C CD1 . ILE A  1 127 ? -82.834  -14.268 -1.486  1.00 84.05  ?  1601 ILE A CD1 1 
ATOM   958  N N   . ARG A  1 128 ? -80.027  -13.979 -6.354  1.00 87.72  ?  1602 ARG A N   1 
ATOM   959  C CA  . ARG A  1 128 ? -79.656  -14.434 -7.702  1.00 89.34  ?  1602 ARG A CA  1 
ATOM   960  C C   . ARG A  1 128 ? -78.581  -15.552 -7.693  1.00 95.83  ?  1602 ARG A C   1 
ATOM   961  O O   . ARG A  1 128 ? -78.405  -16.225 -8.706  1.00 99.70  ?  1602 ARG A O   1 
ATOM   962  C CB  . ARG A  1 128 ? -79.211  -13.232 -8.561  1.00 90.67  ?  1602 ARG A CB  1 
ATOM   963  C CG  . ARG A  1 128 ? -79.328  -13.423 -10.066 1.00 95.80  ?  1602 ARG A CG  1 
ATOM   964  C CD  . ARG A  1 128 ? -78.397  -12.472 -10.785 1.00 104.24 ?  1602 ARG A CD  1 
ATOM   965  N NE  . ARG A  1 128 ? -78.081  -12.939 -12.134 1.00 114.29 ?  1602 ARG A NE  1 
ATOM   966  C CZ  . ARG A  1 128 ? -77.132  -12.419 -12.905 1.00 119.93 ?  1602 ARG A CZ  1 
ATOM   967  N NH1 . ARG A  1 128 ? -76.373  -11.424 -12.458 1.00 126.66 1  1602 ARG A NH1 1 
ATOM   968  N NH2 . ARG A  1 128 ? -76.911  -12.910 -14.117 1.00 116.15 ?  1602 ARG A NH2 1 
ATOM   969  N N   . LEU A  1 129 ? -77.896  -15.771 -6.543  1.00 95.58  ?  1603 LEU A N   1 
ATOM   970  C CA  . LEU A  1 129 ? -76.884  -16.820 -6.369  1.00 91.85  ?  1603 LEU A CA  1 
ATOM   971  C C   . LEU A  1 129 ? -77.514  -18.235 -6.376  1.00 92.65  ?  1603 LEU A C   1 
ATOM   972  O O   . LEU A  1 129 ? -76.782  -19.226 -6.431  1.00 93.44  ?  1603 LEU A O   1 
ATOM   973  C CB  . LEU A  1 129 ? -76.068  -16.572 -5.087  1.00 90.90  ?  1603 LEU A CB  1 
ATOM   974  C CG  . LEU A  1 129 ? -74.634  -17.104 -5.045  1.00 98.02  ?  1603 LEU A CG  1 
ATOM   975  C CD1 . LEU A  1 129 ? -73.707  -16.291 -5.933  1.00 104.54 ?  1603 LEU A CD1 1 
ATOM   976  C CD2 . LEU A  1 129 ? -74.099  -17.060 -3.643  1.00 99.18  ?  1603 LEU A CD2 1 
ATOM   977  N N   . ALA A  1 130 ? -78.870  -18.317 -6.366  1.00 90.25  ?  1604 ALA A N   1 
ATOM   978  C CA  . ALA A  1 130 ? -79.663  -19.553 -6.425  1.00 85.03  ?  1604 ALA A CA  1 
ATOM   979  C C   . ALA A  1 130 ? -79.360  -20.361 -7.704  1.00 79.49  ?  1604 ALA A C   1 
ATOM   980  O O   . ALA A  1 130 ? -79.338  -21.598 -7.670  1.00 69.58  ?  1604 ALA A O   1 
ATOM   981  C CB  . ALA A  1 130 ? -81.146  -19.214 -6.364  1.00 87.98  ?  1604 ALA A CB  1 
ATOM   982  N N   . ARG A  1 131 ? -79.093  -19.641 -8.817  1.00 77.53  ?  1605 ARG A N   1 
ATOM   983  C CA  . ARG A  1 131 ? -78.761  -20.173 -10.144 1.00 78.15  ?  1605 ARG A CA  1 
ATOM   984  C C   . ARG A  1 131 ? -77.596  -21.160 -10.123 1.00 74.23  ?  1605 ARG A C   1 
ATOM   985  O O   . ARG A  1 131 ? -77.452  -21.975 -11.041 1.00 67.74  ?  1605 ARG A O   1 
ATOM   986  C CB  . ARG A  1 131 ? -78.466  -19.029 -11.128 1.00 82.28  ?  1605 ARG A CB  1 
ATOM   987  C CG  . ARG A  1 131 ? -77.256  -18.180 -10.779 1.00 83.03  ?  1605 ARG A CG  1 
ATOM   988  C CD  . ARG A  1 131 ? -77.096  -17.060 -11.772 1.00 92.54  ?  1605 ARG A CD  1 
ATOM   989  N NE  . ARG A  1 131 ? -75.809  -17.163 -12.452 1.00 98.72  ?  1605 ARG A NE  1 
ATOM   990  C CZ  . ARG A  1 131 ? -74.994  -16.139 -12.679 1.00 107.83 ?  1605 ARG A CZ  1 
ATOM   991  N NH1 . ARG A  1 131 ? -75.334  -14.915 -12.301 1.00 101.83 1  1605 ARG A NH1 1 
ATOM   992  N NH2 . ARG A  1 131 ? -73.833  -16.331 -13.287 1.00 117.84 ?  1605 ARG A NH2 1 
ATOM   993  N N   . ILE A  1 132 ? -76.768  -21.078 -9.070  1.00 75.85  ?  1606 ILE A N   1 
ATOM   994  C CA  . ILE A  1 132 ? -75.603  -21.932 -8.869  1.00 78.95  ?  1606 ILE A CA  1 
ATOM   995  C C   . ILE A  1 132 ? -76.031  -23.368 -8.536  1.00 82.89  ?  1606 ILE A C   1 
ATOM   996  O O   . ILE A  1 132 ? -75.332  -24.295 -8.925  1.00 78.71  ?  1606 ILE A O   1 
ATOM   997  C CB  . ILE A  1 132 ? -74.634  -21.280 -7.849  1.00 73.94  ?  1606 ILE A CB  1 
ATOM   998  C CG1 . ILE A  1 132 ? -74.090  -19.944 -8.409  1.00 71.02  ?  1606 ILE A CG1 1 
ATOM   999  C CG2 . ILE A  1 132 ? -73.504  -22.205 -7.390  1.00 78.74  ?  1606 ILE A CG2 1 
ATOM   1000 C CD1 . ILE A  1 132 ? -73.354  -20.016 -9.826  1.00 65.24  ?  1606 ILE A CD1 1 
ATOM   1001 N N   . GLY A  1 133 ? -77.209  -23.534 -7.928  1.00 88.59  ?  1607 GLY A N   1 
ATOM   1002 C CA  . GLY A  1 133 ? -77.778  -24.843 -7.630  1.00 92.60  ?  1607 GLY A CA  1 
ATOM   1003 C C   . GLY A  1 133 ? -77.885  -25.712 -8.870  1.00 91.92  ?  1607 GLY A C   1 
ATOM   1004 O O   . GLY A  1 133 ? -77.576  -26.907 -8.814  1.00 88.60  ?  1607 GLY A O   1 
ATOM   1005 N N   . ARG A  1 134 ? -78.279  -25.091 -10.017 1.00 93.01  ?  1608 ARG A N   1 
ATOM   1006 C CA  . ARG A  1 134 ? -78.420  -25.739 -11.328 1.00 93.83  ?  1608 ARG A CA  1 
ATOM   1007 C C   . ARG A  1 134 ? -77.134  -26.406 -11.802 1.00 92.58  ?  1608 ARG A C   1 
ATOM   1008 O O   . ARG A  1 134 ? -77.192  -27.524 -12.323 1.00 90.85  ?  1608 ARG A O   1 
ATOM   1009 C CB  . ARG A  1 134 ? -78.911  -24.749 -12.399 1.00 89.53  ?  1608 ARG A CB  1 
ATOM   1010 C CG  . ARG A  1 134 ? -80.404  -24.494 -12.341 1.00 87.81  ?  1608 ARG A CG  1 
ATOM   1011 C CD  . ARG A  1 134 ? -81.001  -23.909 -13.615 1.00 81.40  ?  1608 ARG A CD  1 
ATOM   1012 N NE  . ARG A  1 134 ? -80.413  -22.623 -14.020 1.00 72.85  ?  1608 ARG A NE  1 
ATOM   1013 C CZ  . ARG A  1 134 ? -80.672  -21.453 -13.439 1.00 70.54  ?  1608 ARG A CZ  1 
ATOM   1014 N NH1 . ARG A  1 134 ? -81.479  -21.391 -12.386 1.00 74.58  1  1608 ARG A NH1 1 
ATOM   1015 N NH2 . ARG A  1 134 ? -80.103  -20.344 -13.886 1.00 62.51  ?  1608 ARG A NH2 1 
ATOM   1016 N N   . ILE A  1 135 ? -75.979  -25.723 -11.614 1.00 90.94  ?  1609 ILE A N   1 
ATOM   1017 C CA  . ILE A  1 135 ? -74.652  -26.203 -12.025 1.00 85.14  ?  1609 ILE A CA  1 
ATOM   1018 C C   . ILE A  1 135 ? -73.856  -26.818 -10.866 1.00 89.40  ?  1609 ILE A C   1 
ATOM   1019 O O   . ILE A  1 135 ? -72.828  -27.457 -11.108 1.00 82.67  ?  1609 ILE A O   1 
ATOM   1020 C CB  . ILE A  1 135 ? -73.834  -25.134 -12.795 1.00 80.22  ?  1609 ILE A CB  1 
ATOM   1021 C CG1 . ILE A  1 135 ? -73.852  -23.750 -12.095 1.00 82.89  ?  1609 ILE A CG1 1 
ATOM   1022 C CG2 . ILE A  1 135 ? -74.308  -25.047 -14.242 1.00 76.87  ?  1609 ILE A CG2 1 
ATOM   1023 C CD1 . ILE A  1 135 ? -72.630  -23.442 -11.248 1.00 83.21  ?  1609 ILE A CD1 1 
ATOM   1024 N N   . LEU A  1 136 ? -74.358  -26.666 -9.621  1.00 100.48 ?  1610 LEU A N   1 
ATOM   1025 C CA  . LEU A  1 136 ? -73.780  -27.242 -8.406  1.00 104.37 ?  1610 LEU A CA  1 
ATOM   1026 C C   . LEU A  1 136 ? -74.024  -28.733 -8.495  1.00 106.20 ?  1610 LEU A C   1 
ATOM   1027 O O   . LEU A  1 136 ? -73.186  -29.527 -8.073  1.00 97.19  ?  1610 LEU A O   1 
ATOM   1028 C CB  . LEU A  1 136 ? -74.477  -26.665 -7.153  1.00 98.52  ?  1610 LEU A CB  1 
ATOM   1029 C CG  . LEU A  1 136 ? -73.772  -26.781 -5.785  1.00 98.62  ?  1610 LEU A CG  1 
ATOM   1030 C CD1 . LEU A  1 136 ? -74.071  -28.103 -5.082  1.00 94.17  ?  1610 LEU A CD1 1 
ATOM   1031 C CD2 . LEU A  1 136 ? -72.272  -26.471 -5.860  1.00 102.30 ?  1610 LEU A CD2 1 
ATOM   1032 N N   . ARG A  1 137 ? -75.167  -29.093 -9.107  1.00 111.86 ?  1611 ARG A N   1 
ATOM   1033 C CA  . ARG A  1 137 ? -75.643  -30.438 -9.379  1.00 117.41 ?  1611 ARG A CA  1 
ATOM   1034 C C   . ARG A  1 137 ? -74.684  -31.220 -10.312 1.00 111.93 ?  1611 ARG A C   1 
ATOM   1035 O O   . ARG A  1 137 ? -74.780  -32.446 -10.358 1.00 103.10 ?  1611 ARG A O   1 
ATOM   1036 C CB  . ARG A  1 137 ? -77.061  -30.366 -9.973  1.00 122.55 ?  1611 ARG A CB  1 
ATOM   1037 C CG  . ARG A  1 137 ? -77.886  -31.624 -9.763  1.00 132.16 ?  1611 ARG A CG  1 
ATOM   1038 C CD  . ARG A  1 137 ? -78.744  -31.921 -10.972 1.00 137.53 ?  1611 ARG A CD  1 
ATOM   1039 N NE  . ARG A  1 137 ? -80.094  -31.379 -10.821 1.00 147.19 ?  1611 ARG A NE  1 
ATOM   1040 C CZ  . ARG A  1 137 ? -81.022  -31.403 -11.771 1.00 154.70 ?  1611 ARG A CZ  1 
ATOM   1041 N NH1 . ARG A  1 137 ? -80.759  -31.948 -12.953 1.00 158.33 1  1611 ARG A NH1 1 
ATOM   1042 N NH2 . ARG A  1 137 ? -82.227  -30.898 -11.541 1.00 154.10 ?  1611 ARG A NH2 1 
ATOM   1043 N N   . LEU A  1 138 ? -73.750  -30.528 -11.025 1.00 102.04 ?  1612 LEU A N   1 
ATOM   1044 C CA  . LEU A  1 138 ? -72.788  -31.183 -11.925 1.00 97.61  ?  1612 LEU A CA  1 
ATOM   1045 C C   . LEU A  1 138 ? -71.882  -32.198 -11.216 1.00 109.59 ?  1612 LEU A C   1 
ATOM   1046 O O   . LEU A  1 138 ? -71.607  -33.247 -11.790 1.00 118.15 ?  1612 LEU A O   1 
ATOM   1047 C CB  . LEU A  1 138 ? -71.952  -30.174 -12.728 1.00 90.35  ?  1612 LEU A CB  1 
ATOM   1048 C CG  . LEU A  1 138 ? -71.783  -30.470 -14.228 1.00 93.00  ?  1612 LEU A CG  1 
ATOM   1049 C CD1 . LEU A  1 138 ? -71.433  -29.221 -14.987 1.00 97.12  ?  1612 LEU A CD1 1 
ATOM   1050 C CD2 . LEU A  1 138 ? -70.717  -31.520 -14.495 1.00 100.17 ?  1612 LEU A CD2 1 
ATOM   1051 N N   . VAL A  1 139 ? -71.447  -31.911 -9.973  1.00 115.29 ?  1613 VAL A N   1 
ATOM   1052 C CA  . VAL A  1 139 ? -70.597  -32.835 -9.209  1.00 115.91 ?  1613 VAL A CA  1 
ATOM   1053 C C   . VAL A  1 139 ? -71.357  -34.115 -8.810  1.00 113.28 ?  1613 VAL A C   1 
ATOM   1054 O O   . VAL A  1 139 ? -70.739  -35.182 -8.762  1.00 113.86 ?  1613 VAL A O   1 
ATOM   1055 C CB  . VAL A  1 139 ? -69.860  -32.198 -7.996  1.00 124.69 ?  1613 VAL A CB  1 
ATOM   1056 C CG1 . VAL A  1 139 ? -68.876  -31.125 -8.443  1.00 127.39 ?  1613 VAL A CG1 1 
ATOM   1057 C CG2 . VAL A  1 139 ? -70.829  -31.649 -6.951  1.00 132.14 ?  1613 VAL A CG2 1 
ATOM   1058 N N   . THR A  1 140 ? -72.685  -34.012 -8.545  1.00 106.63 ?  1614 THR A N   1 
ATOM   1059 C CA  . THR A  1 140 ? -73.523  -35.155 -8.155  1.00 107.68 ?  1614 THR A CA  1 
ATOM   1060 C C   . THR A  1 140 ? -74.125  -35.895 -9.376  1.00 99.82  ?  1614 THR A C   1 
ATOM   1061 O O   . THR A  1 140 ? -74.387  -37.097 -9.278  1.00 96.64  ?  1614 THR A O   1 
ATOM   1062 C CB  . THR A  1 140 ? -74.591  -34.770 -7.096  1.00 111.00 ?  1614 THR A CB  1 
ATOM   1063 O OG1 . THR A  1 140 ? -75.225  -35.958 -6.614  1.00 114.83 ?  1614 THR A OG1 1 
ATOM   1064 C CG2 . THR A  1 140 ? -75.654  -33.808 -7.617  1.00 112.66 ?  1614 THR A CG2 1 
ATOM   1065 N N   . ALA A  1 141 ? -74.336  -35.194 -10.508 1.00 92.32  ?  1615 ALA A N   1 
ATOM   1066 C CA  . ALA A  1 141 ? -74.903  -35.803 -11.713 1.00 90.07  ?  1615 ALA A CA  1 
ATOM   1067 C C   . ALA A  1 141 ? -73.934  -36.775 -12.390 1.00 88.61  ?  1615 ALA A C   1 
ATOM   1068 O O   . ALA A  1 141 ? -74.215  -37.975 -12.411 1.00 83.10  ?  1615 ALA A O   1 
ATOM   1069 C CB  . ALA A  1 141 ? -75.363  -34.734 -12.690 1.00 92.83  ?  1615 ALA A CB  1 
ATOM   1070 N N   . VAL A  1 142 ? -72.794  -36.270 -12.919 1.00 96.88  ?  1616 VAL A N   1 
ATOM   1071 C CA  . VAL A  1 142 ? -71.784  -37.075 -13.612 1.00 91.46  ?  1616 VAL A CA  1 
ATOM   1072 C C   . VAL A  1 142 ? -71.096  -38.066 -12.634 1.00 90.98  ?  1616 VAL A C   1 
ATOM   1073 O O   . VAL A  1 142 ? -70.627  -37.637 -11.573 1.00 84.21  ?  1616 VAL A O   1 
ATOM   1074 C CB  . VAL A  1 142 ? -70.783  -36.211 -14.449 1.00 77.93  ?  1616 VAL A CB  1 
ATOM   1075 C CG1 . VAL A  1 142 ? -70.052  -35.174 -13.609 1.00 71.23  ?  1616 VAL A CG1 1 
ATOM   1076 C CG2 . VAL A  1 142 ? -69.798  -37.067 -15.238 1.00 78.29  ?  1616 VAL A CG2 1 
ATOM   1077 N N   . PRO A  1 143 ? -71.080  -39.396 -12.950 1.00 96.79  ?  1617 PRO A N   1 
ATOM   1078 C CA  . PRO A  1 143 ? -70.407  -40.360 -12.057 1.00 109.32 ?  1617 PRO A CA  1 
ATOM   1079 C C   . PRO A  1 143 ? -68.882  -40.203 -12.107 1.00 125.65 ?  1617 PRO A C   1 
ATOM   1080 O O   . PRO A  1 143 ? -68.354  -39.561 -13.023 1.00 133.15 ?  1617 PRO A O   1 
ATOM   1081 C CB  . PRO A  1 143 ? -70.871  -41.731 -12.578 1.00 104.93 ?  1617 PRO A CB  1 
ATOM   1082 C CG  . PRO A  1 143 ? -71.890  -41.451 -13.644 1.00 101.93 ?  1617 PRO A CG  1 
ATOM   1083 C CD  . PRO A  1 143 ? -71.604  -40.079 -14.149 1.00 98.30  ?  1617 PRO A CD  1 
ATOM   1084 N N   . GLN A  1 144 ? -68.180  -40.777 -11.103 1.00 133.77 ?  1618 GLN A N   1 
ATOM   1085 C CA  . GLN A  1 144 ? -66.729  -40.685 -10.859 1.00 144.82 ?  1618 GLN A CA  1 
ATOM   1086 C C   . GLN A  1 144 ? -66.448  -39.381 -10.109 1.00 139.86 ?  1618 GLN A C   1 
ATOM   1087 O O   . GLN A  1 144 ? -65.553  -39.345 -9.266  1.00 154.14 ?  1618 GLN A O   1 
ATOM   1088 C CB  . GLN A  1 144 ? -65.853  -40.864 -12.124 1.00 155.45 ?  1618 GLN A CB  1 
ATOM   1089 C CG  . GLN A  1 144 ? -64.423  -41.318 -11.824 1.00 162.89 ?  1618 GLN A CG  1 
ATOM   1090 C CD  . GLN A  1 144 ? -63.829  -42.156 -12.934 1.00 163.90 ?  1618 GLN A CD  1 
ATOM   1091 O OE1 . GLN A  1 144 ? -63.916  -43.390 -12.929 1.00 164.01 ?  1618 GLN A OE1 1 
ATOM   1092 N NE2 . GLN A  1 144 ? -63.184  -41.507 -13.896 1.00 158.76 ?  1618 GLN A NE2 1 
ATOM   1093 N N   . MET A  1 145 ? -67.255  -38.333 -10.387 1.00 127.38 ?  1619 MET A N   1 
ATOM   1094 C CA  . MET A  1 145 ? -67.233  -37.026 -9.727  1.00 118.23 ?  1619 MET A CA  1 
ATOM   1095 C C   . MET A  1 145 ? -68.032  -37.137 -8.448  1.00 113.81 ?  1619 MET A C   1 
ATOM   1096 O O   . MET A  1 145 ? -67.651  -36.533 -7.455  1.00 116.65 ?  1619 MET A O   1 
ATOM   1097 C CB  . MET A  1 145 ? -67.832  -35.934 -10.617 1.00 121.27 ?  1619 MET A CB  1 
ATOM   1098 C CG  . MET A  1 145 ? -66.946  -35.551 -11.769 1.00 126.03 ?  1619 MET A CG  1 
ATOM   1099 S SD  . MET A  1 145 ? -65.539  -34.549 -11.264 1.00 118.90 ?  1619 MET A SD  1 
ATOM   1100 C CE  . MET A  1 145 ? -65.299  -33.597 -12.753 1.00 133.82 ?  1619 MET A CE  1 
ATOM   1101 N N   . ARG A  1 146 ? -69.136  -37.921 -8.469  1.00 113.34 ?  1620 ARG A N   1 
ATOM   1102 C CA  . ARG A  1 146 ? -69.967  -38.198 -7.296  1.00 115.16 ?  1620 ARG A CA  1 
ATOM   1103 C C   . ARG A  1 146 ? -69.207  -39.196 -6.411  1.00 118.92 ?  1620 ARG A C   1 
ATOM   1104 O O   . ARG A  1 146 ? -69.350  -39.164 -5.188  1.00 120.14 ?  1620 ARG A O   1 
ATOM   1105 C CB  . ARG A  1 146 ? -71.330  -38.780 -7.714  1.00 116.18 ?  1620 ARG A CB  1 
ATOM   1106 C CG  . ARG A  1 146 ? -72.368  -38.795 -6.585  1.00 119.22 ?  1620 ARG A CG  1 
ATOM   1107 C CD  . ARG A  1 146 ? -73.454  -39.837 -6.790  1.00 120.22 ?  1620 ARG A CD  1 
ATOM   1108 N NE  . ARG A  1 146 ? -74.480  -39.392 -7.736  1.00 124.76 ?  1620 ARG A NE  1 
ATOM   1109 C CZ  . ARG A  1 146 ? -75.491  -40.140 -8.169  1.00 129.88 ?  1620 ARG A CZ  1 
ATOM   1110 N NH1 . ARG A  1 146 ? -75.631  -41.391 -7.744  1.00 137.54 1  1620 ARG A NH1 1 
ATOM   1111 N NH2 . ARG A  1 146 ? -76.368  -39.647 -9.032  1.00 128.82 ?  1620 ARG A NH2 1 
ATOM   1112 N N   . LYS A  1 147 ? -68.390  -40.069 -7.048  1.00 119.00 ?  1621 LYS A N   1 
ATOM   1113 C CA  . LYS A  1 147 ? -67.549  -41.090 -6.417  1.00 115.50 ?  1621 LYS A CA  1 
ATOM   1114 C C   . LYS A  1 147 ? -66.527  -40.415 -5.497  1.00 109.61 ?  1621 LYS A C   1 
ATOM   1115 O O   . LYS A  1 147 ? -66.516  -40.691 -4.295  1.00 106.28 ?  1621 LYS A O   1 
ATOM   1116 C CB  . LYS A  1 147 ? -66.849  -41.938 -7.504  1.00 112.14 ?  1621 LYS A CB  1 
ATOM   1117 C CG  . LYS A  1 147 ? -66.029  -43.125 -7.002  1.00 106.07 ?  1621 LYS A CG  1 
ATOM   1118 C CD  . LYS A  1 147 ? -65.242  -43.772 -8.139  1.00 105.33 ?  1621 LYS A CD  1 
ATOM   1119 C CE  . LYS A  1 147 ? -64.606  -45.076 -7.718  1.00 110.23 ?  1621 LYS A CE  1 
ATOM   1120 N NZ  . LYS A  1 147 ? -64.016  -45.811 -8.871  1.00 112.49 1  1621 LYS A NZ  1 
ATOM   1121 N N   . ILE A  1 148 ? -65.707  -39.501 -6.063  1.00 102.25 ?  1622 ILE A N   1 
ATOM   1122 C CA  . ILE A  1 148 ? -64.673  -38.750 -5.345  1.00 99.76  ?  1622 ILE A CA  1 
ATOM   1123 C C   . ILE A  1 148 ? -65.291  -37.819 -4.306  1.00 103.40 ?  1622 ILE A C   1 
ATOM   1124 O O   . ILE A  1 148 ? -64.765  -37.740 -3.200  1.00 110.04 ?  1622 ILE A O   1 
ATOM   1125 C CB  . ILE A  1 148 ? -63.672  -38.030 -6.290  1.00 97.66  ?  1622 ILE A CB  1 
ATOM   1126 C CG1 . ILE A  1 148 ? -64.395  -37.054 -7.252  1.00 99.57  ?  1622 ILE A CG1 1 
ATOM   1127 C CG2 . ILE A  1 148 ? -62.785  -39.052 -7.020  1.00 101.48 ?  1622 ILE A CG2 1 
ATOM   1128 C CD1 . ILE A  1 148 ? -63.649  -36.542 -8.393  1.00 104.32 ?  1622 ILE A CD1 1 
ATOM   1129 N N   . VAL A  1 149 ? -66.435  -37.167 -4.640  1.00 99.87  ?  1623 VAL A N   1 
ATOM   1130 C CA  . VAL A  1 149 ? -67.182  -36.278 -3.741  1.00 91.16  ?  1623 VAL A CA  1 
ATOM   1131 C C   . VAL A  1 149 ? -67.558  -37.025 -2.467  1.00 95.62  ?  1623 VAL A C   1 
ATOM   1132 O O   . VAL A  1 149 ? -67.348  -36.489 -1.379  1.00 96.28  ?  1623 VAL A O   1 
ATOM   1133 C CB  . VAL A  1 149 ? -68.389  -35.601 -4.453  1.00 81.46  ?  1623 VAL A CB  1 
ATOM   1134 C CG1 . VAL A  1 149 ? -69.633  -35.501 -3.571  1.00 79.53  ?  1623 VAL A CG1 1 
ATOM   1135 C CG2 . VAL A  1 149 ? -68.004  -34.232 -4.986  1.00 84.80  ?  1623 VAL A CG2 1 
ATOM   1136 N N   . SER A  1 150 ? -68.043  -38.284 -2.613  1.00 96.93  ?  1624 SER A N   1 
ATOM   1137 C CA  . SER A  1 150 ? -68.431  -39.173 -1.517  1.00 102.21 ?  1624 SER A CA  1 
ATOM   1138 C C   . SER A  1 150 ? -67.200  -39.709 -0.793  1.00 104.87 ?  1624 SER A C   1 
ATOM   1139 O O   . SER A  1 150 ? -67.274  -39.979 0.406   1.00 117.92 ?  1624 SER A O   1 
ATOM   1140 C CB  . SER A  1 150 ? -69.269  -40.333 -2.043  1.00 108.41 ?  1624 SER A CB  1 
ATOM   1141 O OG  . SER A  1 150 ? -70.400  -39.877 -2.766  1.00 112.93 ?  1624 SER A OG  1 
ATOM   1142 N N   . ALA A  1 151 ? -66.077  -39.874 -1.523  1.00 97.70  ?  1625 ALA A N   1 
ATOM   1143 C CA  . ALA A  1 151 ? -64.807  -40.356 -0.976  1.00 95.91  ?  1625 ALA A CA  1 
ATOM   1144 C C   . ALA A  1 151 ? -64.170  -39.301 -0.076  1.00 97.57  ?  1625 ALA A C   1 
ATOM   1145 O O   . ALA A  1 151 ? -63.564  -39.647 0.936   1.00 99.88  ?  1625 ALA A O   1 
ATOM   1146 C CB  . ALA A  1 151 ? -63.855  -40.731 -2.100  1.00 94.14  ?  1625 ALA A CB  1 
ATOM   1147 N N   . LEU A  1 152 ? -64.307  -38.015 -0.445  1.00 95.60  ?  1626 LEU A N   1 
ATOM   1148 C CA  . LEU A  1 152 ? -63.799  -36.885 0.334   1.00 98.80  ?  1626 LEU A CA  1 
ATOM   1149 C C   . LEU A  1 152 ? -64.716  -36.659 1.530   1.00 102.16 ?  1626 LEU A C   1 
ATOM   1150 O O   . LEU A  1 152 ? -64.237  -36.439 2.641   1.00 109.50 ?  1626 LEU A O   1 
ATOM   1151 C CB  . LEU A  1 152 ? -63.729  -35.624 -0.534  1.00 94.15  ?  1626 LEU A CB  1 
ATOM   1152 C CG  . LEU A  1 152 ? -62.637  -35.620 -1.583  1.00 96.50  ?  1626 LEU A CG  1 
ATOM   1153 C CD1 . LEU A  1 152 ? -63.140  -35.052 -2.855  1.00 103.45 ?  1626 LEU A CD1 1 
ATOM   1154 C CD2 . LEU A  1 152 ? -61.459  -34.820 -1.136  1.00 96.00  ?  1626 LEU A CD2 1 
ATOM   1155 N N   . ILE A  1 153 ? -66.040  -36.774 1.301   1.00 103.69 ?  1627 ILE A N   1 
ATOM   1156 C CA  . ILE A  1 153 ? -67.096  -36.636 2.300   1.00 106.97 ?  1627 ILE A CA  1 
ATOM   1157 C C   . ILE A  1 153 ? -66.951  -37.703 3.405   1.00 110.03 ?  1627 ILE A C   1 
ATOM   1158 O O   . ILE A  1 153 ? -67.357  -37.465 4.545   1.00 113.10 ?  1627 ILE A O   1 
ATOM   1159 C CB  . ILE A  1 153 ? -68.477  -36.613 1.577   1.00 105.49 ?  1627 ILE A CB  1 
ATOM   1160 C CG1 . ILE A  1 153 ? -69.002  -35.167 1.444   1.00 101.87 ?  1627 ILE A CG1 1 
ATOM   1161 C CG2 . ILE A  1 153 ? -69.527  -37.566 2.175   1.00 111.25 ?  1627 ILE A CG2 1 
ATOM   1162 C CD1 . ILE A  1 153 ? -69.824  -34.860 0.183   1.00 101.33 ?  1627 ILE A CD1 1 
ATOM   1163 N N   . SER A  1 154 ? -66.325  -38.850 3.073   1.00 108.67 ?  1628 SER A N   1 
ATOM   1164 C CA  . SER A  1 154 ? -66.079  -39.943 4.015   1.00 110.94 ?  1628 SER A CA  1 
ATOM   1165 C C   . SER A  1 154 ? -64.782  -39.755 4.821   1.00 112.16 ?  1628 SER A C   1 
ATOM   1166 O O   . SER A  1 154 ? -64.519  -40.537 5.740   1.00 116.81 ?  1628 SER A O   1 
ATOM   1167 C CB  . SER A  1 154 ? -66.096  -41.290 3.298   1.00 115.20 ?  1628 SER A CB  1 
ATOM   1168 O OG  . SER A  1 154 ? -65.070  -41.381 2.324   1.00 118.76 ?  1628 SER A OG  1 
ATOM   1169 N N   . VAL A  1 155 ? -64.003  -38.692 4.517   1.00 110.55 ?  1629 VAL A N   1 
ATOM   1170 C CA  . VAL A  1 155 ? -62.755  -38.365 5.219   1.00 104.43 ?  1629 VAL A CA  1 
ATOM   1171 C C   . VAL A  1 155 ? -63.032  -37.492 6.468   1.00 110.46 ?  1629 VAL A C   1 
ATOM   1172 O O   . VAL A  1 155 ? -62.524  -37.795 7.553   1.00 112.87 ?  1629 VAL A O   1 
ATOM   1173 C CB  . VAL A  1 155 ? -61.702  -37.744 4.258   1.00 94.65  ?  1629 VAL A CB  1 
ATOM   1174 C CG1 . VAL A  1 155 ? -60.476  -37.232 5.009   1.00 96.70  ?  1629 VAL A CG1 1 
ATOM   1175 C CG2 . VAL A  1 155 ? -61.288  -38.738 3.176   1.00 90.17  ?  1629 VAL A CG2 1 
ATOM   1176 N N   . ILE A  1 156 ? -63.897  -36.458 6.310   1.00 111.97 ?  1630 ILE A N   1 
ATOM   1177 C CA  . ILE A  1 156 ? -64.306  -35.471 7.330   1.00 103.21 ?  1630 ILE A CA  1 
ATOM   1178 C C   . ILE A  1 156 ? -64.913  -36.070 8.649   1.00 100.94 ?  1630 ILE A C   1 
ATOM   1179 O O   . ILE A  1 156 ? -64.724  -35.417 9.677   1.00 97.75  ?  1630 ILE A O   1 
ATOM   1180 C CB  . ILE A  1 156 ? -65.228  -34.339 6.776   1.00 95.56  ?  1630 ILE A CB  1 
ATOM   1181 C CG1 . ILE A  1 156 ? -65.920  -34.716 5.450   1.00 103.26 ?  1630 ILE A CG1 1 
ATOM   1182 C CG2 . ILE A  1 156 ? -64.429  -33.049 6.619   1.00 93.66  ?  1630 ILE A CG2 1 
ATOM   1183 C CD1 . ILE A  1 156 ? -67.238  -34.032 5.202   1.00 109.93 ?  1630 ILE A CD1 1 
ATOM   1184 N N   . PRO A  1 157 ? -65.600  -37.247 8.716   1.00 102.39 ?  1631 PRO A N   1 
ATOM   1185 C CA  . PRO A  1 157 ? -66.116  -37.707 10.020  1.00 100.98 ?  1631 PRO A CA  1 
ATOM   1186 C C   . PRO A  1 157 ? -65.043  -38.039 11.058  1.00 99.99  ?  1631 PRO A C   1 
ATOM   1187 O O   . PRO A  1 157 ? -65.254  -37.758 12.236  1.00 109.50 ?  1631 PRO A O   1 
ATOM   1188 C CB  . PRO A  1 157 ? -66.956  -38.941 9.667   1.00 108.00 ?  1631 PRO A CB  1 
ATOM   1189 C CG  . PRO A  1 157 ? -67.203  -38.849 8.209   1.00 108.72 ?  1631 PRO A CG  1 
ATOM   1190 C CD  . PRO A  1 157 ? -65.995  -38.187 7.649   1.00 107.86 ?  1631 PRO A CD  1 
ATOM   1191 N N   . GLY A  1 158 ? -63.926  -38.633 10.626  1.00 96.83  ?  1632 GLY A N   1 
ATOM   1192 C CA  . GLY A  1 158 ? -62.818  -38.982 11.516  1.00 103.78 ?  1632 GLY A CA  1 
ATOM   1193 C C   . GLY A  1 158 ? -62.064  -37.749 11.971  1.00 106.08 ?  1632 GLY A C   1 
ATOM   1194 O O   . GLY A  1 158 ? -61.761  -37.569 13.157  1.00 109.64 ?  1632 GLY A O   1 
ATOM   1195 N N   . MET A  1 159 ? -61.801  -36.882 10.996  1.00 102.77 ?  1633 MET A N   1 
ATOM   1196 C CA  . MET A  1 159 ? -61.153  -35.576 11.048  1.00 102.18 ?  1633 MET A CA  1 
ATOM   1197 C C   . MET A  1 159 ? -61.847  -34.623 12.053  1.00 104.47 ?  1633 MET A C   1 
ATOM   1198 O O   . MET A  1 159 ? -61.183  -33.769 12.636  1.00 115.92 ?  1633 MET A O   1 
ATOM   1199 C CB  . MET A  1 159 ? -61.288  -35.007 9.633   1.00 99.37  ?  1633 MET A CB  1 
ATOM   1200 C CG  . MET A  1 159 ? -60.357  -33.913 9.281   1.00 103.24 ?  1633 MET A CG  1 
ATOM   1201 S SD  . MET A  1 159 ? -60.763  -33.482 7.576   1.00 111.86 ?  1633 MET A SD  1 
ATOM   1202 C CE  . MET A  1 159 ? -60.161  -31.809 7.515   1.00 125.47 ?  1633 MET A CE  1 
ATOM   1203 N N   . LEU A  1 160 ? -63.180  -34.784 12.228  1.00 104.84 ?  1634 LEU A N   1 
ATOM   1204 C CA  . LEU A  1 160 ? -64.119  -34.010 13.052  1.00 101.38 ?  1634 LEU A CA  1 
ATOM   1205 C C   . LEU A  1 160 ? -63.673  -33.662 14.476  1.00 99.00  ?  1634 LEU A C   1 
ATOM   1206 O O   . LEU A  1 160 ? -64.023  -32.580 14.955  1.00 97.24  ?  1634 LEU A O   1 
ATOM   1207 C CB  . LEU A  1 160 ? -65.459  -34.746 13.118  1.00 102.45 ?  1634 LEU A CB  1 
ATOM   1208 C CG  . LEU A  1 160 ? -66.700  -33.881 13.184  1.00 99.03  ?  1634 LEU A CG  1 
ATOM   1209 C CD1 . LEU A  1 160 ? -67.767  -34.417 12.261  1.00 95.43  ?  1634 LEU A CD1 1 
ATOM   1210 C CD2 . LEU A  1 160 ? -67.224  -33.773 14.612  1.00 101.04 ?  1634 LEU A CD2 1 
ATOM   1211 N N   . SER A  1 161 ? -62.980  -34.584 15.172  1.00 97.91  ?  1635 SER A N   1 
ATOM   1212 C CA  . SER A  1 161 ? -62.528  -34.343 16.547  1.00 103.76 ?  1635 SER A CA  1 
ATOM   1213 C C   . SER A  1 161 ? -61.335  -33.385 16.632  1.00 109.97 ?  1635 SER A C   1 
ATOM   1214 O O   . SER A  1 161 ? -61.253  -32.592 17.572  1.00 114.51 ?  1635 SER A O   1 
ATOM   1215 C CB  . SER A  1 161 ? -62.251  -35.654 17.265  1.00 107.18 ?  1635 SER A CB  1 
ATOM   1216 O OG  . SER A  1 161 ? -63.485  -36.261 17.609  1.00 114.79 ?  1635 SER A OG  1 
ATOM   1217 N N   . VAL A  1 162 ? -60.435  -33.438 15.630  1.00 108.63 ?  1636 VAL A N   1 
ATOM   1218 C CA  . VAL A  1 162 ? -59.274  -32.550 15.512  1.00 98.73  ?  1636 VAL A CA  1 
ATOM   1219 C C   . VAL A  1 162 ? -59.802  -31.140 15.221  1.00 94.84  ?  1636 VAL A C   1 
ATOM   1220 O O   . VAL A  1 162 ? -59.387  -30.194 15.890  1.00 89.09  ?  1636 VAL A O   1 
ATOM   1221 C CB  . VAL A  1 162 ? -58.276  -33.021 14.419  1.00 95.98  ?  1636 VAL A CB  1 
ATOM   1222 C CG1 . VAL A  1 162 ? -57.029  -32.142 14.397  1.00 92.94  ?  1636 VAL A CG1 1 
ATOM   1223 C CG2 . VAL A  1 162 ? -57.897  -34.491 14.605  1.00 99.17  ?  1636 VAL A CG2 1 
ATOM   1224 N N   . ILE A  1 163 ? -60.744  -31.021 14.243  1.00 97.35  ?  1637 ILE A N   1 
ATOM   1225 C CA  . ILE A  1 163 ? -61.409  -29.774 13.825  1.00 98.45  ?  1637 ILE A CA  1 
ATOM   1226 C C   . ILE A  1 163 ? -62.074  -29.130 15.037  1.00 97.13  ?  1637 ILE A C   1 
ATOM   1227 O O   . ILE A  1 163 ? -61.863  -27.942 15.273  1.00 103.23 ?  1637 ILE A O   1 
ATOM   1228 C CB  . ILE A  1 163 ? -62.427  -29.988 12.662  1.00 96.34  ?  1637 ILE A CB  1 
ATOM   1229 C CG1 . ILE A  1 163 ? -61.775  -30.666 11.433  1.00 99.75  ?  1637 ILE A CG1 1 
ATOM   1230 C CG2 . ILE A  1 163 ? -63.106  -28.664 12.271  1.00 92.30  ?  1637 ILE A CG2 1 
ATOM   1231 C CD1 . ILE A  1 163 ? -62.761  -31.404 10.492  1.00 96.65  ?  1637 ILE A CD1 1 
ATOM   1232 N N   . ALA A  1 164 ? -62.840  -29.923 15.820  1.00 92.26  ?  1638 ALA A N   1 
ATOM   1233 C CA  . ALA A  1 164 ? -63.517  -29.464 17.033  1.00 86.84  ?  1638 ALA A CA  1 
ATOM   1234 C C   . ALA A  1 164 ? -62.514  -28.876 18.023  1.00 85.06  ?  1638 ALA A C   1 
ATOM   1235 O O   . ALA A  1 164 ? -62.796  -27.835 18.618  1.00 80.23  ?  1638 ALA A O   1 
ATOM   1236 C CB  . ALA A  1 164 ? -64.287  -30.603 17.672  1.00 89.69  ?  1638 ALA A CB  1 
ATOM   1237 N N   . LEU A  1 165 ? -61.322  -29.501 18.150  1.00 84.43  ?  1639 LEU A N   1 
ATOM   1238 C CA  . LEU A  1 165 ? -60.260  -29.002 19.021  1.00 77.41  ?  1639 LEU A CA  1 
ATOM   1239 C C   . LEU A  1 165 ? -59.683  -27.702 18.460  1.00 77.13  ?  1639 LEU A C   1 
ATOM   1240 O O   . LEU A  1 165 ? -59.525  -26.737 19.208  1.00 77.44  ?  1639 LEU A O   1 
ATOM   1241 C CB  . LEU A  1 165 ? -59.158  -30.049 19.215  1.00 74.24  ?  1639 LEU A CB  1 
ATOM   1242 C CG  . LEU A  1 165 ? -58.161  -29.734 20.320  1.00 80.29  ?  1639 LEU A CG  1 
ATOM   1243 C CD1 . LEU A  1 165 ? -58.546  -30.412 21.607  1.00 83.59  ?  1639 LEU A CD1 1 
ATOM   1244 C CD2 . LEU A  1 165 ? -56.761  -30.118 19.915  1.00 87.03  ?  1639 LEU A CD2 1 
ATOM   1245 N N   . MET A  1 166 ? -59.421  -27.673 17.139  1.00 80.60  ?  1640 MET A N   1 
ATOM   1246 C CA  . MET A  1 166 ? -58.893  -26.522 16.408  1.00 84.81  ?  1640 MET A CA  1 
ATOM   1247 C C   . MET A  1 166 ? -59.812  -25.308 16.567  1.00 81.73  ?  1640 MET A C   1 
ATOM   1248 O O   . MET A  1 166 ? -59.323  -24.201 16.782  1.00 80.19  ?  1640 MET A O   1 
ATOM   1249 C CB  . MET A  1 166 ? -58.690  -26.886 14.927  1.00 89.84  ?  1640 MET A CB  1 
ATOM   1250 C CG  . MET A  1 166 ? -57.924  -25.855 14.124  1.00 93.00  ?  1640 MET A CG  1 
ATOM   1251 S SD  . MET A  1 166 ? -56.173  -25.752 14.533  1.00 91.04  ?  1640 MET A SD  1 
ATOM   1252 C CE  . MET A  1 166 ? -56.152  -24.244 15.452  1.00 87.59  ?  1640 MET A CE  1 
ATOM   1253 N N   . THR A  1 167 ? -61.138  -25.532 16.508  1.00 81.72  ?  1641 THR A N   1 
ATOM   1254 C CA  . THR A  1 167 ? -62.175  -24.515 16.692  1.00 81.36  ?  1641 THR A CA  1 
ATOM   1255 C C   . THR A  1 167 ? -62.096  -23.963 18.113  1.00 78.93  ?  1641 THR A C   1 
ATOM   1256 O O   . THR A  1 167 ? -62.148  -22.743 18.294  1.00 77.12  ?  1641 THR A O   1 
ATOM   1257 C CB  . THR A  1 167 ? -63.558  -25.127 16.456  1.00 77.80  ?  1641 THR A CB  1 
ATOM   1258 O OG1 . THR A  1 167 ? -63.552  -25.811 15.212  1.00 81.71  ?  1641 THR A OG1 1 
ATOM   1259 C CG2 . THR A  1 167 ? -64.672  -24.092 16.469  1.00 80.67  ?  1641 THR A CG2 1 
ATOM   1260 N N   . LEU A  1 168 ? -61.980  -24.868 19.118  1.00 78.31  ?  1642 LEU A N   1 
ATOM   1261 C CA  . LEU A  1 168 ? -61.897  -24.500 20.531  1.00 83.93  ?  1642 LEU A CA  1 
ATOM   1262 C C   . LEU A  1 168 ? -60.675  -23.634 20.787  1.00 80.04  ?  1642 LEU A C   1 
ATOM   1263 O O   . LEU A  1 168 ? -60.792  -22.587 21.432  1.00 71.50  ?  1642 LEU A O   1 
ATOM   1264 C CB  . LEU A  1 168 ? -61.905  -25.734 21.440  1.00 89.70  ?  1642 LEU A CB  1 
ATOM   1265 C CG  . LEU A  1 168 ? -62.586  -25.509 22.783  1.00 97.46  ?  1642 LEU A CG  1 
ATOM   1266 C CD1 . LEU A  1 168 ? -63.970  -26.130 22.808  1.00 98.56  ?  1642 LEU A CD1 1 
ATOM   1267 C CD2 . LEU A  1 168 ? -61.733  -26.011 23.914  1.00 104.88 ?  1642 LEU A CD2 1 
ATOM   1268 N N   . PHE A  1 169 ? -59.526  -24.033 20.207  1.00 85.53  ?  1643 PHE A N   1 
ATOM   1269 C CA  . PHE A  1 169 ? -58.274  -23.296 20.297  1.00 85.68  ?  1643 PHE A CA  1 
ATOM   1270 C C   . PHE A  1 169 ? -58.430  -21.906 19.715  1.00 80.31  ?  1643 PHE A C   1 
ATOM   1271 O O   . PHE A  1 169 ? -57.871  -20.951 20.249  1.00 70.54  ?  1643 PHE A O   1 
ATOM   1272 C CB  . PHE A  1 169 ? -57.141  -24.080 19.633  1.00 83.74  ?  1643 PHE A CB  1 
ATOM   1273 C CG  . PHE A  1 169 ? -56.460  -24.981 20.629  1.00 88.13  ?  1643 PHE A CG  1 
ATOM   1274 C CD1 . PHE A  1 169 ? -55.377  -24.527 21.372  1.00 98.78  ?  1643 PHE A CD1 1 
ATOM   1275 C CD2 . PHE A  1 169 ? -56.956  -26.252 20.894  1.00 90.84  ?  1643 PHE A CD2 1 
ATOM   1276 C CE1 . PHE A  1 169 ? -54.769  -25.348 22.324  1.00 106.76 ?  1643 PHE A CE1 1 
ATOM   1277 C CE2 . PHE A  1 169 ? -56.359  -27.066 21.856  1.00 95.92  ?  1643 PHE A CE2 1 
ATOM   1278 C CZ  . PHE A  1 169 ? -55.261  -26.614 22.556  1.00 108.70 ?  1643 PHE A CZ  1 
ATOM   1279 N N   . PHE A  1 170 ? -59.276  -21.782 18.681  1.00 75.79  ?  1644 PHE A N   1 
ATOM   1280 C CA  . PHE A  1 170 ? -59.577  -20.498 18.068  1.00 75.44  ?  1644 PHE A CA  1 
ATOM   1281 C C   . PHE A  1 170 ? -60.430  -19.617 18.971  1.00 83.95  ?  1644 PHE A C   1 
ATOM   1282 O O   . PHE A  1 170 ? -60.212  -18.409 18.986  1.00 83.87  ?  1644 PHE A O   1 
ATOM   1283 C CB  . PHE A  1 170 ? -60.201  -20.668 16.679  1.00 70.32  ?  1644 PHE A CB  1 
ATOM   1284 C CG  . PHE A  1 170 ? -59.226  -20.302 15.597  1.00 63.13  ?  1644 PHE A CG  1 
ATOM   1285 C CD1 . PHE A  1 170 ? -58.263  -21.209 15.171  1.00 68.42  ?  1644 PHE A CD1 1 
ATOM   1286 C CD2 . PHE A  1 170 ? -59.230  -19.032 15.040  1.00 69.96  ?  1644 PHE A CD2 1 
ATOM   1287 C CE1 . PHE A  1 170 ? -57.337  -20.859 14.193  1.00 80.22  ?  1644 PHE A CE1 1 
ATOM   1288 C CE2 . PHE A  1 170 ? -58.308  -18.684 14.056  1.00 80.70  ?  1644 PHE A CE2 1 
ATOM   1289 C CZ  . PHE A  1 170 ? -57.364  -19.597 13.643  1.00 83.58  ?  1644 PHE A CZ  1 
ATOM   1290 N N   . TYR A  1 171 ? -61.363  -20.217 19.750  1.00 84.76  ?  1645 TYR A N   1 
ATOM   1291 C CA  . TYR A  1 171 ? -62.229  -19.490 20.682  1.00 86.33  ?  1645 TYR A CA  1 
ATOM   1292 C C   . TYR A  1 171 ? -61.454  -18.898 21.862  1.00 87.12  ?  1645 TYR A C   1 
ATOM   1293 O O   . TYR A  1 171 ? -61.693  -17.745 22.220  1.00 78.54  ?  1645 TYR A O   1 
ATOM   1294 C CB  . TYR A  1 171 ? -63.373  -20.378 21.175  1.00 92.12  ?  1645 TYR A CB  1 
ATOM   1295 C CG  . TYR A  1 171 ? -64.606  -20.323 20.302  1.00 94.28  ?  1645 TYR A CG  1 
ATOM   1296 C CD1 . TYR A  1 171 ? -65.612  -19.391 20.541  1.00 92.03  ?  1645 TYR A CD1 1 
ATOM   1297 C CD2 . TYR A  1 171 ? -64.794  -21.236 19.269  1.00 97.83  ?  1645 TYR A CD2 1 
ATOM   1298 C CE1 . TYR A  1 171 ? -66.767  -19.355 19.757  1.00 96.48  ?  1645 TYR A CE1 1 
ATOM   1299 C CE2 . TYR A  1 171 ? -65.940  -21.204 18.472  1.00 102.49 ?  1645 TYR A CE2 1 
ATOM   1300 C CZ  . TYR A  1 171 ? -66.928  -20.266 18.723  1.00 101.36 ?  1645 TYR A CZ  1 
ATOM   1301 O OH  . TYR A  1 171 ? -68.062  -20.244 17.941  1.00 107.39 ?  1645 TYR A OH  1 
ATOM   1302 N N   . ILE A  1 172 ? -60.522  -19.678 22.451  1.00 87.55  ?  1646 ILE A N   1 
ATOM   1303 C CA  . ILE A  1 172 ? -59.684  -19.247 23.583  1.00 81.48  ?  1646 ILE A CA  1 
ATOM   1304 C C   . ILE A  1 172 ? -58.659  -18.197 23.118  1.00 71.57  ?  1646 ILE A C   1 
ATOM   1305 O O   . ILE A  1 172 ? -58.446  -17.207 23.818  1.00 62.53  ?  1646 ILE A O   1 
ATOM   1306 C CB  . ILE A  1 172 ? -59.051  -20.449 24.359  1.00 79.73  ?  1646 ILE A CB  1 
ATOM   1307 C CG1 . ILE A  1 172 ? -60.137  -21.428 24.843  1.00 82.53  ?  1646 ILE A CG1 1 
ATOM   1308 C CG2 . ILE A  1 172 ? -58.200  -19.983 25.552  1.00 75.37  ?  1646 ILE A CG2 1 
ATOM   1309 C CD1 . ILE A  1 172 ? -59.821  -22.848 24.638  1.00 88.53  ?  1646 ILE A CD1 1 
ATOM   1310 N N   . PHE A  1 173 ? -58.061  -18.393 21.930  1.00 64.99  ?  1647 PHE A N   1 
ATOM   1311 C CA  . PHE A  1 173 ? -57.118  -17.427 21.383  1.00 73.78  ?  1647 PHE A CA  1 
ATOM   1312 C C   . PHE A  1 173 ? -57.835  -16.150 20.923  1.00 73.57  ?  1647 PHE A C   1 
ATOM   1313 O O   . PHE A  1 173 ? -57.250  -15.066 21.002  1.00 59.46  ?  1647 PHE A O   1 
ATOM   1314 C CB  . PHE A  1 173 ? -56.280  -18.039 20.255  1.00 80.69  ?  1647 PHE A CB  1 
ATOM   1315 C CG  . PHE A  1 173 ? -55.119  -18.875 20.735  1.00 88.49  ?  1647 PHE A CG  1 
ATOM   1316 C CD1 . PHE A  1 173 ? -54.014  -18.281 21.337  1.00 81.42  ?  1647 PHE A CD1 1 
ATOM   1317 C CD2 . PHE A  1 173 ? -55.097  -20.250 20.527  1.00 87.15  ?  1647 PHE A CD2 1 
ATOM   1318 C CE1 . PHE A  1 173 ? -52.937  -19.057 21.774  1.00 80.56  ?  1647 PHE A CE1 1 
ATOM   1319 C CE2 . PHE A  1 173 ? -54.019  -21.025 20.963  1.00 79.52  ?  1647 PHE A CE2 1 
ATOM   1320 C CZ  . PHE A  1 173 ? -52.946  -20.423 21.581  1.00 80.96  ?  1647 PHE A CZ  1 
ATOM   1321 N N   . ALA A  1 174 ? -59.106  -16.276 20.462  1.00 86.30  ?  1648 ALA A N   1 
ATOM   1322 C CA  . ALA A  1 174 ? -59.912  -15.142 20.006  1.00 85.12  ?  1648 ALA A CA  1 
ATOM   1323 C C   . ALA A  1 174 ? -60.409  -14.268 21.149  1.00 80.35  ?  1648 ALA A C   1 
ATOM   1324 O O   . ALA A  1 174 ? -60.490  -13.052 20.969  1.00 69.46  ?  1648 ALA A O   1 
ATOM   1325 C CB  . ALA A  1 174 ? -61.065  -15.608 19.147  1.00 81.73  ?  1648 ALA A CB  1 
ATOM   1326 N N   . ILE A  1 175 ? -60.741  -14.865 22.321  1.00 78.96  ?  1649 ILE A N   1 
ATOM   1327 C CA  . ILE A  1 175 ? -61.167  -14.087 23.498  1.00 86.25  ?  1649 ILE A CA  1 
ATOM   1328 C C   . ILE A  1 175 ? -59.955  -13.353 24.110  1.00 83.47  ?  1649 ILE A C   1 
ATOM   1329 O O   . ILE A  1 175 ? -60.127  -12.324 24.762  1.00 81.36  ?  1649 ILE A O   1 
ATOM   1330 C CB  . ILE A  1 175 ? -62.006  -14.877 24.558  1.00 93.32  ?  1649 ILE A CB  1 
ATOM   1331 C CG1 . ILE A  1 175 ? -61.204  -15.983 25.237  1.00 104.59 ?  1649 ILE A CG1 1 
ATOM   1332 C CG2 . ILE A  1 175 ? -63.322  -15.415 24.020  1.00 91.12  ?  1649 ILE A CG2 1 
ATOM   1333 C CD1 . ILE A  1 175 ? -60.979  -15.706 26.654  1.00 110.03 ?  1649 ILE A CD1 1 
ATOM   1334 N N   . MET A  1 176 ? -58.739  -13.885 23.868  1.00 84.27  ?  1650 MET A N   1 
ATOM   1335 C CA  . MET A  1 176 ? -57.461  -13.350 24.330  1.00 84.09  ?  1650 MET A CA  1 
ATOM   1336 C C   . MET A  1 176 ? -56.976  -12.199 23.483  1.00 77.80  ?  1650 MET A C   1 
ATOM   1337 O O   . MET A  1 176 ? -56.399  -11.258 24.025  1.00 83.27  ?  1650 MET A O   1 
ATOM   1338 C CB  . MET A  1 176 ? -56.396  -14.437 24.305  1.00 81.18  ?  1650 MET A CB  1 
ATOM   1339 C CG  . MET A  1 176 ? -56.343  -15.228 25.548  1.00 81.87  ?  1650 MET A CG  1 
ATOM   1340 S SD  . MET A  1 176 ? -54.834  -16.192 25.691  1.00 79.52  ?  1650 MET A SD  1 
ATOM   1341 C CE  . MET A  1 176 ? -55.294  -17.663 24.776  1.00 78.93  ?  1650 MET A CE  1 
ATOM   1342 N N   . ALA A  1 177 ? -57.146  -12.297 22.151  1.00 70.59  ?  1651 ALA A N   1 
ATOM   1343 C CA  . ALA A  1 177 ? -56.719  -11.281 21.187  1.00 72.85  ?  1651 ALA A CA  1 
ATOM   1344 C C   . ALA A  1 177 ? -57.526  -9.993  21.349  1.00 79.46  ?  1651 ALA A C   1 
ATOM   1345 O O   . ALA A  1 177 ? -56.942  -8.903  21.352  1.00 75.69  ?  1651 ALA A O   1 
ATOM   1346 C CB  . ALA A  1 177 ? -56.856  -11.819 19.772  1.00 70.39  ?  1651 ALA A CB  1 
ATOM   1347 N N   . THR A  1 178 ? -58.865  -10.134 21.518  1.00 89.58  ?  1652 THR A N   1 
ATOM   1348 C CA  . THR A  1 178 ? -59.834  -9.048  21.719  1.00 93.69  ?  1652 THR A CA  1 
ATOM   1349 C C   . THR A  1 178 ? -59.538  -8.331  23.040  1.00 96.38  ?  1652 THR A C   1 
ATOM   1350 O O   . THR A  1 178 ? -59.642  -7.105  23.109  1.00 91.44  ?  1652 THR A O   1 
ATOM   1351 C CB  . THR A  1 178 ? -61.272  -9.610  21.713  1.00 91.82  ?  1652 THR A CB  1 
ATOM   1352 O OG1 . THR A  1 178 ? -61.439  -10.504 20.616  1.00 97.10  ?  1652 THR A OG1 1 
ATOM   1353 C CG2 . THR A  1 178 ? -62.338  -8.522  21.655  1.00 89.77  ?  1652 THR A CG2 1 
ATOM   1354 N N   . GLN A  1 179 ? -59.170  -9.108  24.078  1.00 102.83 ?  1653 GLN A N   1 
ATOM   1355 C CA  . GLN A  1 179 ? -58.860  -8.625  25.418  1.00 106.00 ?  1653 GLN A CA  1 
ATOM   1356 C C   . GLN A  1 179 ? -57.618  -7.744  25.434  1.00 101.43 ?  1653 GLN A C   1 
ATOM   1357 O O   . GLN A  1 179 ? -57.658  -6.656  26.009  1.00 99.66  ?  1653 GLN A O   1 
ATOM   1358 C CB  . GLN A  1 179 ? -58.689  -9.806  26.386  1.00 106.80 ?  1653 GLN A CB  1 
ATOM   1359 C CG  . GLN A  1 179 ? -58.802  -9.410  27.851  1.00 111.42 ?  1653 GLN A CG  1 
ATOM   1360 C CD  . GLN A  1 179 ? -57.998  -10.311 28.750  1.00 114.59 ?  1653 GLN A CD  1 
ATOM   1361 O OE1 . GLN A  1 179 ? -58.310  -11.489 28.938  1.00 107.47 ?  1653 GLN A OE1 1 
ATOM   1362 N NE2 . GLN A  1 179 ? -56.953  -9.762  29.352  1.00 121.92 ?  1653 GLN A NE2 1 
ATOM   1363 N N   . LEU A  1 180 ? -56.522  -8.205  24.812  1.00 103.13 ?  1654 LEU A N   1 
ATOM   1364 C CA  . LEU A  1 180 ? -55.260  -7.470  24.821  1.00 108.41 ?  1654 LEU A CA  1 
ATOM   1365 C C   . LEU A  1 180 ? -55.224  -6.279  23.861  1.00 114.21 ?  1654 LEU A C   1 
ATOM   1366 O O   . LEU A  1 180 ? -55.371  -5.133  24.294  1.00 119.16 ?  1654 LEU A O   1 
ATOM   1367 C CB  . LEU A  1 180 ? -54.060  -8.410  24.581  1.00 99.48  ?  1654 LEU A CB  1 
ATOM   1368 C CG  . LEU A  1 180 ? -53.816  -9.493  25.622  1.00 97.58  ?  1654 LEU A CG  1 
ATOM   1369 C CD1 . LEU A  1 180 ? -53.153  -10.681 25.000  1.00 102.81 ?  1654 LEU A CD1 1 
ATOM   1370 C CD2 . LEU A  1 180 ? -52.988  -8.979  26.777  1.00 96.14  ?  1654 LEU A CD2 1 
ATOM   1371 N N   . PHE A  1 181 ? -55.024  -6.560  22.564  1.00 111.98 ?  1655 PHE A N   1 
ATOM   1372 C CA  . PHE A  1 181 ? -54.882  -5.586  21.481  1.00 109.33 ?  1655 PHE A CA  1 
ATOM   1373 C C   . PHE A  1 181 ? -56.232  -5.211  20.855  1.00 103.69 ?  1655 PHE A C   1 
ATOM   1374 O O   . PHE A  1 181 ? -56.403  -5.291  19.637  1.00 99.94  ?  1655 PHE A O   1 
ATOM   1375 C CB  . PHE A  1 181 ? -53.895  -6.117  20.417  1.00 111.51 ?  1655 PHE A CB  1 
ATOM   1376 C CG  . PHE A  1 181 ? -53.144  -7.383  20.775  1.00 106.48 ?  1655 PHE A CG  1 
ATOM   1377 C CD1 . PHE A  1 181 ? -51.903  -7.322  21.394  1.00 99.52  ?  1655 PHE A CD1 1 
ATOM   1378 C CD2 . PHE A  1 181 ? -53.677  -8.635  20.485  1.00 109.68 ?  1655 PHE A CD2 1 
ATOM   1379 C CE1 . PHE A  1 181 ? -51.202  -8.489  21.705  1.00 101.15 ?  1655 PHE A CE1 1 
ATOM   1380 C CE2 . PHE A  1 181 ? -52.981  -9.802  20.815  1.00 95.75  ?  1655 PHE A CE2 1 
ATOM   1381 C CZ  . PHE A  1 181 ? -51.747  -9.720  21.419  1.00 94.69  ?  1655 PHE A CZ  1 
ATOM   1382 N N   . GLY A  1 182 ? -57.173  -4.799  21.698  1.00 109.55 ?  1656 GLY A N   1 
ATOM   1383 C CA  . GLY A  1 182 ? -58.515  -4.419  21.274  1.00 111.65 ?  1656 GLY A CA  1 
ATOM   1384 C C   . GLY A  1 182 ? -58.763  -2.930  21.317  1.00 110.06 ?  1656 GLY A C   1 
ATOM   1385 O O   . GLY A  1 182 ? -59.476  -2.392  20.467  1.00 100.22 ?  1656 GLY A O   1 
ATOM   1386 N N   . GLU A  1 183 ? -58.174  -2.260  22.312  1.00 114.60 ?  1657 GLU A N   1 
ATOM   1387 C CA  . GLU A  1 183 ? -58.320  -0.823  22.508  1.00 119.11 ?  1657 GLU A CA  1 
ATOM   1388 C C   . GLU A  1 183 ? -57.570  -0.051  21.432  1.00 112.54 ?  1657 GLU A C   1 
ATOM   1389 O O   . GLU A  1 183 ? -58.185  0.758   20.734  1.00 102.17 ?  1657 GLU A O   1 
ATOM   1390 C CB  . GLU A  1 183 ? -57.834  -0.402  23.912  1.00 130.41 ?  1657 GLU A CB  1 
ATOM   1391 C CG  . GLU A  1 183 ? -58.622  -0.996  25.070  1.00 132.05 ?  1657 GLU A CG  1 
ATOM   1392 C CD  . GLU A  1 183 ? -57.825  -1.923  25.970  1.00 134.93 ?  1657 GLU A CD  1 
ATOM   1393 O OE1 . GLU A  1 183 ? -57.521  -1.517  27.115  1.00 124.07 ?  1657 GLU A OE1 1 
ATOM   1394 O OE2 . GLU A  1 183 ? -57.505  -3.053  25.532  1.00 137.52 -1 1657 GLU A OE2 1 
ATOM   1395 N N   . ARG A  1 184 ? -56.252  -0.319  21.287  1.00 103.63 ?  1658 ARG A N   1 
ATOM   1396 C CA  . ARG A  1 184 ? -55.365  0.359   20.338  1.00 102.75 ?  1658 ARG A CA  1 
ATOM   1397 C C   . ARG A  1 184 ? -55.501  -0.142  18.891  1.00 96.81  ?  1658 ARG A C   1 
ATOM   1398 O O   . ARG A  1 184 ? -55.259  0.640   17.966  1.00 99.74  ?  1658 ARG A O   1 
ATOM   1399 C CB  . ARG A  1 184 ? -53.901  0.318   20.812  1.00 113.34 ?  1658 ARG A CB  1 
ATOM   1400 C CG  . ARG A  1 184 ? -53.635  1.117   22.099  1.00 122.82 ?  1658 ARG A CG  1 
ATOM   1401 C CD  . ARG A  1 184 ? -53.366  2.600   21.863  1.00 125.77 ?  1658 ARG A CD  1 
ATOM   1402 N NE  . ARG A  1 184 ? -51.946  2.871   21.628  1.00 130.53 ?  1658 ARG A NE  1 
ATOM   1403 C CZ  . ARG A  1 184 ? -51.084  3.239   22.571  1.00 147.53 ?  1658 ARG A CZ  1 
ATOM   1404 N NH1 . ARG A  1 184 ? -51.488  3.396   23.826  1.00 158.30 1  1658 ARG A NH1 1 
ATOM   1405 N NH2 . ARG A  1 184 ? -49.812  3.457   22.266  1.00 148.32 ?  1658 ARG A NH2 1 
ATOM   1406 N N   . PHE A  1 185 ? -55.897  -1.422  18.691  1.00 90.43  ?  1659 PHE A N   1 
ATOM   1407 C CA  . PHE A  1 185 ? -56.121  -2.000  17.360  1.00 91.28  ?  1659 PHE A CA  1 
ATOM   1408 C C   . PHE A  1 185 ? -57.553  -2.565  17.222  1.00 100.49 ?  1659 PHE A C   1 
ATOM   1409 O O   . PHE A  1 185 ? -57.714  -3.785  17.184  1.00 114.99 ?  1659 PHE A O   1 
ATOM   1410 C CB  . PHE A  1 185 ? -55.078  -3.078  17.034  1.00 91.16  ?  1659 PHE A CB  1 
ATOM   1411 C CG  . PHE A  1 185 ? -53.647  -2.614  17.042  1.00 87.82  ?  1659 PHE A CG  1 
ATOM   1412 C CD1 . PHE A  1 185 ? -53.103  -1.967  15.941  1.00 90.11  ?  1659 PHE A CD1 1 
ATOM   1413 C CD2 . PHE A  1 185 ? -52.826  -2.862  18.134  1.00 85.53  ?  1659 PHE A CD2 1 
ATOM   1414 C CE1 . PHE A  1 185 ? -51.771  -1.551  15.942  1.00 88.44  ?  1659 PHE A CE1 1 
ATOM   1415 C CE2 . PHE A  1 185 ? -51.491  -2.454  18.132  1.00 89.45  ?  1659 PHE A CE2 1 
ATOM   1416 C CZ  . PHE A  1 185 ? -50.974  -1.798  17.036  1.00 91.95  ?  1659 PHE A CZ  1 
ATOM   1417 N N   . PRO A  1 186 ? -58.618  -1.727  17.143  1.00 103.26 ?  1660 PRO A N   1 
ATOM   1418 C CA  . PRO A  1 186 ? -59.971  -2.288  16.999  1.00 102.95 ?  1660 PRO A CA  1 
ATOM   1419 C C   . PRO A  1 186 ? -60.255  -2.792  15.584  1.00 103.56 ?  1660 PRO A C   1 
ATOM   1420 O O   . PRO A  1 186 ? -61.217  -3.536  15.375  1.00 105.74 ?  1660 PRO A O   1 
ATOM   1421 C CB  . PRO A  1 186 ? -60.890  -1.114  17.372  1.00 106.37 ?  1660 PRO A CB  1 
ATOM   1422 C CG  . PRO A  1 186 ? -59.987  0.010   17.805  1.00 107.20 ?  1660 PRO A CG  1 
ATOM   1423 C CD  . PRO A  1 186 ? -58.668  -0.253  17.171  1.00 110.25 ?  1660 PRO A CD  1 
ATOM   1424 N N   . GLU A  1 187 ? -59.411  -2.373  14.614  1.00 104.28 ?  1661 GLU A N   1 
ATOM   1425 C CA  . GLU A  1 187 ? -59.478  -2.699  13.185  1.00 104.37 ?  1661 GLU A CA  1 
ATOM   1426 C C   . GLU A  1 187 ? -59.407  -4.211  12.945  1.00 94.59  ?  1661 GLU A C   1 
ATOM   1427 O O   . GLU A  1 187 ? -60.141  -4.736  12.103  1.00 94.62  ?  1661 GLU A O   1 
ATOM   1428 C CB  . GLU A  1 187 ? -58.335  -2.009  12.403  1.00 120.54 ?  1661 GLU A CB  1 
ATOM   1429 C CG  . GLU A  1 187 ? -58.051  -0.561  12.778  1.00 136.20 ?  1661 GLU A CG  1 
ATOM   1430 C CD  . GLU A  1 187 ? -56.635  -0.260  13.242  1.00 150.63 ?  1661 GLU A CD  1 
ATOM   1431 O OE1 . GLU A  1 187 ? -55.693  -0.955  12.795  1.00 144.50 ?  1661 GLU A OE1 1 
ATOM   1432 O OE2 . GLU A  1 187 ? -56.465  0.700   14.027  1.00 150.01 -1 1661 GLU A OE2 1 
ATOM   1433 N N   . TRP A  1 188 ? -58.511  -4.901  13.675  1.00 88.80  ?  1662 TRP A N   1 
ATOM   1434 C CA  . TRP A  1 188 ? -58.291  -6.330  13.521  1.00 89.57  ?  1662 TRP A CA  1 
ATOM   1435 C C   . TRP A  1 188 ? -58.880  -7.139  14.664  1.00 87.52  ?  1662 TRP A C   1 
ATOM   1436 O O   . TRP A  1 188 ? -59.568  -8.113  14.398  1.00 81.04  ?  1662 TRP A O   1 
ATOM   1437 C CB  . TRP A  1 188 ? -56.790  -6.639  13.329  1.00 91.77  ?  1662 TRP A CB  1 
ATOM   1438 C CG  . TRP A  1 188 ? -56.110  -5.882  12.213  1.00 93.81  ?  1662 TRP A CG  1 
ATOM   1439 C CD1 . TRP A  1 188 ? -56.631  -5.570  10.991  1.00 93.10  ?  1662 TRP A CD1 1 
ATOM   1440 C CD2 . TRP A  1 188 ? -54.755  -5.406  12.203  1.00 89.85  ?  1662 TRP A CD2 1 
ATOM   1441 N NE1 . TRP A  1 188 ? -55.707  -4.878  10.243  1.00 89.10  ?  1662 TRP A NE1 1 
ATOM   1442 C CE2 . TRP A  1 188 ? -54.541  -4.779  10.956  1.00 88.32  ?  1662 TRP A CE2 1 
ATOM   1443 C CE3 . TRP A  1 188 ? -53.703  -5.431  13.136  1.00 90.97  ?  1662 TRP A CE3 1 
ATOM   1444 C CZ2 . TRP A  1 188 ? -53.318  -4.192  10.616  1.00 88.08  ?  1662 TRP A CZ2 1 
ATOM   1445 C CZ3 . TRP A  1 188 ? -52.493  -4.846  12.796  1.00 85.70  ?  1662 TRP A CZ3 1 
ATOM   1446 C CH2 . TRP A  1 188 ? -52.314  -4.224  11.557  1.00 86.31  ?  1662 TRP A CH2 1 
ATOM   1447 N N   . PHE A  1 189 ? -58.628  -6.739  15.925  1.00 87.29  ?  1663 PHE A N   1 
ATOM   1448 C CA  . PHE A  1 189 ? -59.083  -7.449  17.129  1.00 91.59  ?  1663 PHE A CA  1 
ATOM   1449 C C   . PHE A  1 189 ? -60.062  -6.621  17.987  1.00 97.18  ?  1663 PHE A C   1 
ATOM   1450 O O   . PHE A  1 189 ? -59.945  -6.601  19.214  1.00 99.41  ?  1663 PHE A O   1 
ATOM   1451 C CB  . PHE A  1 189 ? -57.874  -7.884  17.985  1.00 99.98  ?  1663 PHE A CB  1 
ATOM   1452 C CG  . PHE A  1 189 ? -56.616  -8.272  17.247  1.00 91.68  ?  1663 PHE A CG  1 
ATOM   1453 C CD1 . PHE A  1 189 ? -55.678  -7.311  16.885  1.00 77.77  ?  1663 PHE A CD1 1 
ATOM   1454 C CD2 . PHE A  1 189 ? -56.346  -9.604  16.954  1.00 92.32  ?  1663 PHE A CD2 1 
ATOM   1455 C CE1 . PHE A  1 189 ? -54.515  -7.669  16.206  1.00 76.41  ?  1663 PHE A CE1 1 
ATOM   1456 C CE2 . PHE A  1 189 ? -55.166  -9.967  16.303  1.00 85.68  ?  1663 PHE A CE2 1 
ATOM   1457 C CZ  . PHE A  1 189 ? -54.260  -8.995  15.928  1.00 84.00  ?  1663 PHE A CZ  1 
ATOM   1458 N N   . GLY A  1 190 ? -61.018  -5.961  17.339  1.00 104.76 ?  1664 GLY A N   1 
ATOM   1459 C CA  . GLY A  1 190 ? -62.012  -5.134  18.019  1.00 100.93 ?  1664 GLY A CA  1 
ATOM   1460 C C   . GLY A  1 190 ? -63.071  -5.932  18.742  1.00 87.41  ?  1664 GLY A C   1 
ATOM   1461 O O   . GLY A  1 190 ? -63.305  -5.723  19.935  1.00 93.20  ?  1664 GLY A O   1 
ATOM   1462 N N   . THR A  1 191 ? -63.732  -6.827  18.007  1.00 76.18  ?  1665 THR A N   1 
ATOM   1463 C CA  . THR A  1 191 ? -64.754  -7.711  18.549  1.00 87.06  ?  1665 THR A CA  1 
ATOM   1464 C C   . THR A  1 191 ? -64.192  -9.116  18.536  1.00 81.66  ?  1665 THR A C   1 
ATOM   1465 O O   . THR A  1 191 ? -63.114  -9.340  17.982  1.00 79.90  ?  1665 THR A O   1 
ATOM   1466 C CB  . THR A  1 191 ? -66.077  -7.615  17.760  1.00 99.28  ?  1665 THR A CB  1 
ATOM   1467 O OG1 . THR A  1 191 ? -65.900  -8.083  16.419  1.00 100.16 ?  1665 THR A OG1 1 
ATOM   1468 C CG2 . THR A  1 191 ? -66.684  -6.217  17.785  1.00 106.85 ?  1665 THR A CG2 1 
ATOM   1469 N N   . LEU A  1 192 ? -64.916  -10.060 19.153  1.00 82.03  ?  1666 LEU A N   1 
ATOM   1470 C CA  . LEU A  1 192 ? -64.536  -11.465 19.199  1.00 77.23  ?  1666 LEU A CA  1 
ATOM   1471 C C   . LEU A  1 192 ? -64.443  -12.014 17.771  1.00 83.64  ?  1666 LEU A C   1 
ATOM   1472 O O   . LEU A  1 192 ? -63.462  -12.683 17.440  1.00 93.70  ?  1666 LEU A O   1 
ATOM   1473 C CB  . LEU A  1 192 ? -65.559  -12.258 20.044  1.00 71.56  ?  1666 LEU A CB  1 
ATOM   1474 C CG  . LEU A  1 192 ? -65.253  -13.726 20.403  1.00 68.59  ?  1666 LEU A CG  1 
ATOM   1475 C CD1 . LEU A  1 192 ? -65.741  -14.703 19.338  1.00 65.91  ?  1666 LEU A CD1 1 
ATOM   1476 C CD2 . LEU A  1 192 ? -63.816  -13.935 20.738  1.00 75.83  ?  1666 LEU A CD2 1 
ATOM   1477 N N   . GLY A  1 193 ? -65.445  -11.697 16.950  1.00 86.72  ?  1667 GLY A N   1 
ATOM   1478 C CA  . GLY A  1 193 ? -65.518  -12.116 15.555  1.00 91.29  ?  1667 GLY A CA  1 
ATOM   1479 C C   . GLY A  1 193 ? -64.399  -11.565 14.695  1.00 93.06  ?  1667 GLY A C   1 
ATOM   1480 O O   . GLY A  1 193 ? -63.953  -12.229 13.754  1.00 99.45  ?  1667 GLY A O   1 
ATOM   1481 N N   . GLU A  1 194 ? -63.942  -10.342 15.021  1.00 97.04  ?  1668 GLU A N   1 
ATOM   1482 C CA  . GLU A  1 194 ? -62.849  -9.661  14.336  1.00 102.68 ?  1668 GLU A CA  1 
ATOM   1483 C C   . GLU A  1 194 ? -61.550  -10.411 14.581  1.00 103.52 ?  1668 GLU A C   1 
ATOM   1484 O O   . GLU A  1 194 ? -60.790  -10.626 13.635  1.00 109.36 ?  1668 GLU A O   1 
ATOM   1485 C CB  . GLU A  1 194 ? -62.740  -8.208  14.815  1.00 109.74 ?  1668 GLU A CB  1 
ATOM   1486 C CG  . GLU A  1 194 ? -63.582  -7.244  14.003  1.00 110.69 ?  1668 GLU A CG  1 
ATOM   1487 C CD  . GLU A  1 194 ? -62.935  -6.691  12.747  1.00 118.79 ?  1668 GLU A CD  1 
ATOM   1488 O OE1 . GLU A  1 194 ? -62.134  -7.408  12.102  1.00 116.11 ?  1668 GLU A OE1 1 
ATOM   1489 O OE2 . GLU A  1 194 ? -63.249  -5.530  12.398  1.00 129.62 -1 1668 GLU A OE2 1 
ATOM   1490 N N   . SER A  1 195 ? -61.318  -10.835 15.848  1.00 94.06  ?  1669 SER A N   1 
ATOM   1491 C CA  . SER A  1 195 ? -60.151  -11.596 16.287  1.00 86.67  ?  1669 SER A CA  1 
ATOM   1492 C C   . SER A  1 195 ? -60.090  -12.926 15.580  1.00 90.30  ?  1669 SER A C   1 
ATOM   1493 O O   . SER A  1 195 ? -59.010  -13.330 15.161  1.00 101.86 ?  1669 SER A O   1 
ATOM   1494 C CB  . SER A  1 195 ? -60.194  -11.823 17.789  1.00 81.41  ?  1669 SER A CB  1 
ATOM   1495 O OG  . SER A  1 195 ? -59.831  -10.636 18.466  1.00 77.22  ?  1669 SER A OG  1 
ATOM   1496 N N   . PHE A  1 196 ? -61.254  -13.590 15.416  1.00 89.84  ?  1670 PHE A N   1 
ATOM   1497 C CA  . PHE A  1 196 ? -61.393  -14.870 14.724  1.00 85.69  ?  1670 PHE A CA  1 
ATOM   1498 C C   . PHE A  1 196 ? -60.826  -14.794 13.301  1.00 80.43  ?  1670 PHE A C   1 
ATOM   1499 O O   . PHE A  1 196 ? -60.060  -15.676 12.902  1.00 72.57  ?  1670 PHE A O   1 
ATOM   1500 C CB  . PHE A  1 196 ? -62.864  -15.299 14.694  1.00 85.71  ?  1670 PHE A CB  1 
ATOM   1501 C CG  . PHE A  1 196 ? -63.168  -16.492 15.559  1.00 80.88  ?  1670 PHE A CG  1 
ATOM   1502 C CD1 . PHE A  1 196 ? -63.615  -16.329 16.861  1.00 78.68  ?  1670 PHE A CD1 1 
ATOM   1503 C CD2 . PHE A  1 196 ? -63.022  -17.785 15.066  1.00 86.58  ?  1670 PHE A CD2 1 
ATOM   1504 C CE1 . PHE A  1 196 ? -63.887  -17.435 17.665  1.00 85.75  ?  1670 PHE A CE1 1 
ATOM   1505 C CE2 . PHE A  1 196 ? -63.303  -18.893 15.866  1.00 86.91  ?  1670 PHE A CE2 1 
ATOM   1506 C CZ  . PHE A  1 196 ? -63.727  -18.710 17.162  1.00 84.62  ?  1670 PHE A CZ  1 
ATOM   1507 N N   . TYR A  1 197 ? -61.164  -13.711 12.566  1.00 80.15  ?  1671 TYR A N   1 
ATOM   1508 C CA  . TYR A  1 197 ? -60.697  -13.462 11.207  1.00 82.36  ?  1671 TYR A CA  1 
ATOM   1509 C C   . TYR A  1 197 ? -59.174  -13.251 11.146  1.00 83.76  ?  1671 TYR A C   1 
ATOM   1510 O O   . TYR A  1 197 ? -58.500  -13.946 10.378  1.00 82.67  ?  1671 TYR A O   1 
ATOM   1511 C CB  . TYR A  1 197 ? -61.458  -12.286 10.574  1.00 81.44  ?  1671 TYR A CB  1 
ATOM   1512 C CG  . TYR A  1 197 ? -61.055  -12.006 9.142   1.00 85.46  ?  1671 TYR A CG  1 
ATOM   1513 C CD1 . TYR A  1 197 ? -61.625  -12.713 8.085   1.00 85.81  ?  1671 TYR A CD1 1 
ATOM   1514 C CD2 . TYR A  1 197 ? -60.096  -11.041 8.841   1.00 78.53  ?  1671 TYR A CD2 1 
ATOM   1515 C CE1 . TYR A  1 197 ? -61.245  -12.472 6.766   1.00 77.29  ?  1671 TYR A CE1 1 
ATOM   1516 C CE2 . TYR A  1 197 ? -59.704  -10.798 7.527   1.00 76.79  ?  1671 TYR A CE2 1 
ATOM   1517 C CZ  . TYR A  1 197 ? -60.275  -11.523 6.496   1.00 76.34  ?  1671 TYR A CZ  1 
ATOM   1518 O OH  . TYR A  1 197 ? -59.917  -11.265 5.202   1.00 84.05  ?  1671 TYR A OH  1 
ATOM   1519 N N   . THR A  1 198 ? -58.642  -12.303 11.954  1.00 82.38  ?  1672 THR A N   1 
ATOM   1520 C CA  . THR A  1 198 ? -57.213  -11.961 12.020  1.00 76.46  ?  1672 THR A CA  1 
ATOM   1521 C C   . THR A  1 198 ? -56.362  -13.154 12.485  1.00 72.73  ?  1672 THR A C   1 
ATOM   1522 O O   . THR A  1 198 ? -55.263  -13.357 11.969  1.00 71.51  ?  1672 THR A O   1 
ATOM   1523 C CB  . THR A  1 198 ? -57.007  -10.694 12.846  1.00 74.91  ?  1672 THR A CB  1 
ATOM   1524 O OG1 . THR A  1 198 ? -57.822  -9.675  12.276  1.00 70.12  ?  1672 THR A OG1 1 
ATOM   1525 C CG2 . THR A  1 198 ? -55.579  -10.217 12.833  1.00 80.68  ?  1672 THR A CG2 1 
ATOM   1526 N N   . LEU A  1 199 ? -56.885  -13.962 13.409  1.00 69.87  ?  1673 LEU A N   1 
ATOM   1527 C CA  . LEU A  1 199 ? -56.166  -15.141 13.854  1.00 70.84  ?  1673 LEU A CA  1 
ATOM   1528 C C   . LEU A  1 199 ? -56.203  -16.229 12.788  1.00 70.32  ?  1673 LEU A C   1 
ATOM   1529 O O   . LEU A  1 199 ? -55.268  -17.023 12.719  1.00 81.64  ?  1673 LEU A O   1 
ATOM   1530 C CB  . LEU A  1 199 ? -56.647  -15.639 15.218  1.00 72.39  ?  1673 LEU A CB  1 
ATOM   1531 C CG  . LEU A  1 199 ? -56.255  -14.770 16.407  1.00 82.91  ?  1673 LEU A CG  1 
ATOM   1532 C CD1 . LEU A  1 199 ? -57.069  -15.116 17.598  1.00 82.65  ?  1673 LEU A CD1 1 
ATOM   1533 C CD2 . LEU A  1 199 ? -54.761  -14.861 16.723  1.00 90.96  ?  1673 LEU A CD2 1 
ATOM   1534 N N   . PHE A  1 200 ? -57.244  -16.246 11.923  1.00 70.07  ?  1674 PHE A N   1 
ATOM   1535 C CA  . PHE A  1 200 ? -57.288  -17.207 10.823  1.00 69.96  ?  1674 PHE A CA  1 
ATOM   1536 C C   . PHE A  1 200 ? -56.278  -16.763 9.763   1.00 78.37  ?  1674 PHE A C   1 
ATOM   1537 O O   . PHE A  1 200 ? -55.568  -17.606 9.213   1.00 88.32  ?  1674 PHE A O   1 
ATOM   1538 C CB  . PHE A  1 200 ? -58.706  -17.379 10.244  1.00 68.15  ?  1674 PHE A CB  1 
ATOM   1539 C CG  . PHE A  1 200 ? -58.781  -18.285 9.027   1.00 67.35  ?  1674 PHE A CG  1 
ATOM   1540 C CD1 . PHE A  1 200 ? -58.755  -19.670 9.165   1.00 70.28  ?  1674 PHE A CD1 1 
ATOM   1541 C CD2 . PHE A  1 200 ? -58.869  -17.750 7.740   1.00 62.32  ?  1674 PHE A CD2 1 
ATOM   1542 C CE1 . PHE A  1 200 ? -58.814  -20.503 8.037   1.00 68.99  ?  1674 PHE A CE1 1 
ATOM   1543 C CE2 . PHE A  1 200 ? -58.942  -18.586 6.615   1.00 60.25  ?  1674 PHE A CE2 1 
ATOM   1544 C CZ  . PHE A  1 200 ? -58.925  -19.955 6.773   1.00 64.55  ?  1674 PHE A CZ  1 
ATOM   1545 N N   . GLN A  1 201 ? -56.185  -15.439 9.515   1.00 80.98  ?  1675 GLN A N   1 
ATOM   1546 C CA  . GLN A  1 201 ? -55.238  -14.850 8.569   1.00 77.94  ?  1675 GLN A CA  1 
ATOM   1547 C C   . GLN A  1 201 ? -53.800  -15.174 8.990   1.00 79.86  ?  1675 GLN A C   1 
ATOM   1548 O O   . GLN A  1 201 ? -52.976  -15.565 8.158   1.00 92.46  ?  1675 GLN A O   1 
ATOM   1549 C CB  . GLN A  1 201 ? -55.433  -13.333 8.496   1.00 70.35  ?  1675 GLN A CB  1 
ATOM   1550 C CG  . GLN A  1 201 ? -54.541  -12.692 7.442   1.00 65.68  ?  1675 GLN A CG  1 
ATOM   1551 C CD  . GLN A  1 201 ? -54.435  -11.191 7.505   1.00 68.99  ?  1675 GLN A CD  1 
ATOM   1552 O OE1 . GLN A  1 201 ? -55.363  -10.472 7.897   1.00 74.00  ?  1675 GLN A OE1 1 
ATOM   1553 N NE2 . GLN A  1 201 ? -53.302  -10.682 7.066   1.00 64.84  ?  1675 GLN A NE2 1 
ATOM   1554 N N   . VAL A  1 202 ? -53.519  -15.005 10.294  1.00 73.89  ?  1676 VAL A N   1 
ATOM   1555 C CA  . VAL A  1 202 ? -52.230  -15.274 10.931  1.00 71.75  ?  1676 VAL A CA  1 
ATOM   1556 C C   . VAL A  1 202 ? -51.916  -16.779 10.836  1.00 71.19  ?  1676 VAL A C   1 
ATOM   1557 O O   . VAL A  1 202 ? -50.766  -17.139 10.593  1.00 84.53  ?  1676 VAL A O   1 
ATOM   1558 C CB  . VAL A  1 202 ? -52.189  -14.681 12.374  1.00 68.62  ?  1676 VAL A CB  1 
ATOM   1559 C CG1 . VAL A  1 202 ? -51.129  -15.335 13.247  1.00 69.95  ?  1676 VAL A CG1 1 
ATOM   1560 C CG2 . VAL A  1 202 ? -51.977  -13.175 12.332  1.00 71.76  ?  1676 VAL A CG2 1 
ATOM   1561 N N   . MET A  1 203 ? -52.954  -17.639 10.950  1.00 70.89  ?  1677 MET A N   1 
ATOM   1562 C CA  . MET A  1 203 ? -52.842  -19.095 10.848  1.00 76.15  ?  1677 MET A CA  1 
ATOM   1563 C C   . MET A  1 203 ? -52.459  -19.491 9.432   1.00 75.97  ?  1677 MET A C   1 
ATOM   1564 O O   . MET A  1 203 ? -51.534  -20.281 9.261   1.00 74.69  ?  1677 MET A O   1 
ATOM   1565 C CB  . MET A  1 203 ? -54.152  -19.775 11.263  1.00 82.13  ?  1677 MET A CB  1 
ATOM   1566 C CG  . MET A  1 203 ? -54.109  -21.272 11.188  1.00 86.28  ?  1677 MET A CG  1 
ATOM   1567 S SD  . MET A  1 203 ? -55.741  -21.898 10.807  1.00 96.69  ?  1677 MET A SD  1 
ATOM   1568 C CE  . MET A  1 203 ? -55.727  -23.337 11.741  1.00 92.63  ?  1677 MET A CE  1 
ATOM   1569 N N   . THR A  1 204 ? -53.150  -18.918 8.421   1.00 78.43  ?  1678 THR A N   1 
ATOM   1570 C CA  . THR A  1 204 ? -52.879  -19.152 6.995   1.00 86.89  ?  1678 THR A CA  1 
ATOM   1571 C C   . THR A  1 204 ? -51.568  -18.471 6.574   1.00 83.21  ?  1678 THR A C   1 
ATOM   1572 O O   . THR A  1 204 ? -51.144  -18.593 5.422   1.00 75.99  ?  1678 THR A O   1 
ATOM   1573 C CB  . THR A  1 204 ? -54.081  -18.766 6.118   1.00 85.40  ?  1678 THR A CB  1 
ATOM   1574 O OG1 . THR A  1 204 ? -54.463  -17.423 6.395   1.00 68.37  ?  1678 THR A OG1 1 
ATOM   1575 C CG2 . THR A  1 204 ? -55.264  -19.681 6.321   1.00 87.11  ?  1678 THR A CG2 1 
ATOM   1576 N N   . LEU A  1 205 ? -50.932  -17.759 7.538   1.00 82.94  ?  1679 LEU A N   1 
ATOM   1577 C CA  . LEU A  1 205 ? -49.649  -17.052 7.465   1.00 85.76  ?  1679 LEU A CA  1 
ATOM   1578 C C   . LEU A  1 205 ? -49.628  -15.886 6.476   1.00 89.65  ?  1679 LEU A C   1 
ATOM   1579 O O   . LEU A  1 205 ? -48.546  -15.380 6.177   1.00 99.67  ?  1679 LEU A O   1 
ATOM   1580 C CB  . LEU A  1 205 ? -48.471  -18.030 7.186   1.00 80.61  ?  1679 LEU A CB  1 
ATOM   1581 C CG  . LEU A  1 205 ? -48.193  -19.158 8.189   1.00 79.28  ?  1679 LEU A CG  1 
ATOM   1582 C CD1 . LEU A  1 205 ? -47.160  -20.092 7.646   1.00 82.80  ?  1679 LEU A CD1 1 
ATOM   1583 C CD2 . LEU A  1 205 ? -47.686  -18.624 9.514   1.00 81.77  ?  1679 LEU A CD2 1 
ATOM   1584 N N   . GLU A  1 206 ? -50.798  -15.444 5.979   1.00 84.91  ?  1680 GLU A N   1 
ATOM   1585 C CA  . GLU A  1 206 ? -50.851  -14.347 5.011   1.00 93.38  ?  1680 GLU A CA  1 
ATOM   1586 C C   . GLU A  1 206 ? -50.547  -13.012 5.687   1.00 88.68  ?  1680 GLU A C   1 
ATOM   1587 O O   . GLU A  1 206 ? -51.319  -12.568 6.538   1.00 87.94  ?  1680 GLU A O   1 
ATOM   1588 C CB  . GLU A  1 206 ? -52.197  -14.315 4.280   1.00 99.97  ?  1680 GLU A CB  1 
ATOM   1589 C CG  . GLU A  1 206 ? -52.176  -13.519 2.988   1.00 107.17 ?  1680 GLU A CG  1 
ATOM   1590 C CD  . GLU A  1 206 ? -52.365  -12.023 3.143   1.00 112.57 ?  1680 GLU A CD  1 
ATOM   1591 O OE1 . GLU A  1 206 ? -51.396  -11.273 2.895   1.00 128.04 ?  1680 GLU A OE1 1 
ATOM   1592 O OE2 . GLU A  1 206 ? -53.488  -11.598 3.492   1.00 99.20  -1 1680 GLU A OE2 1 
ATOM   1593 N N   . SER A  1 207 ? -49.408  -12.385 5.312   1.00 78.53  ?  1681 SER A N   1 
ATOM   1594 C CA  . SER A  1 207 ? -48.906  -11.127 5.873   1.00 73.07  ?  1681 SER A CA  1 
ATOM   1595 C C   . SER A  1 207 ? -49.030  -11.074 7.405   1.00 66.43  ?  1681 SER A C   1 
ATOM   1596 O O   . SER A  1 207 ? -49.362  -10.027 7.949   1.00 56.10  ?  1681 SER A O   1 
ATOM   1597 C CB  . SER A  1 207 ? -49.568  -9.922  5.210   1.00 73.98  ?  1681 SER A CB  1 
ATOM   1598 O OG  . SER A  1 207 ? -49.253  -9.860  3.829   1.00 83.65  ?  1681 SER A OG  1 
ATOM   1599 N N   . TRP A  1 208 ? -48.777  -12.214 8.094   1.00 74.12  ?  1682 TRP A N   1 
ATOM   1600 C CA  . TRP A  1 208 ? -48.892  -12.319 9.546   1.00 80.22  ?  1682 TRP A CA  1 
ATOM   1601 C C   . TRP A  1 208 ? -47.984  -11.344 10.271  1.00 80.50  ?  1682 TRP A C   1 
ATOM   1602 O O   . TRP A  1 208 ? -48.442  -10.714 11.214  1.00 84.78  ?  1682 TRP A O   1 
ATOM   1603 C CB  . TRP A  1 208 ? -48.707  -13.766 10.059  1.00 83.35  ?  1682 TRP A CB  1 
ATOM   1604 C CG  . TRP A  1 208 ? -47.302  -14.297 10.010  1.00 93.28  ?  1682 TRP A CG  1 
ATOM   1605 C CD1 . TRP A  1 208 ? -46.753  -15.054 9.023   1.00 97.33  ?  1682 TRP A CD1 1 
ATOM   1606 C CD2 . TRP A  1 208 ? -46.284  -14.149 11.014  1.00 96.01  ?  1682 TRP A CD2 1 
ATOM   1607 N NE1 . TRP A  1 208 ? -45.437  -15.332 9.313   1.00 96.01  ?  1682 TRP A NE1 1 
ATOM   1608 C CE2 . TRP A  1 208 ? -45.127  -14.802 10.537  1.00 92.31  ?  1682 TRP A CE2 1 
ATOM   1609 C CE3 . TRP A  1 208 ? -46.225  -13.496 12.258  1.00 98.82  ?  1682 TRP A CE3 1 
ATOM   1610 C CZ2 . TRP A  1 208 ? -43.934  -14.846 11.269  1.00 89.38  ?  1682 TRP A CZ2 1 
ATOM   1611 C CZ3 . TRP A  1 208 ? -45.040  -13.531 12.977  1.00 92.62  ?  1682 TRP A CZ3 1 
ATOM   1612 C CH2 . TRP A  1 208 ? -43.913  -14.202 12.484  1.00 89.86  ?  1682 TRP A CH2 1 
ATOM   1613 N N   . SER A  1 209 ? -46.729  -11.185 9.821   1.00 76.42  ?  1683 SER A N   1 
ATOM   1614 C CA  . SER A  1 209 ? -45.768  -10.298 10.468  1.00 78.49  ?  1683 SER A CA  1 
ATOM   1615 C C   . SER A  1 209 ? -45.644  -8.940  9.801   1.00 67.02  ?  1683 SER A C   1 
ATOM   1616 O O   . SER A  1 209 ? -45.838  -7.923  10.472  1.00 54.28  ?  1683 SER A O   1 
ATOM   1617 C CB  . SER A  1 209 ? -44.406  -10.969 10.588  1.00 83.81  ?  1683 SER A CB  1 
ATOM   1618 O OG  . SER A  1 209 ? -43.432  -10.097 11.133  1.00 83.98  ?  1683 SER A OG  1 
ATOM   1619 N N   . MET A  1 210 ? -45.326  -8.905  8.496   1.00 59.80  ?  1684 MET A N   1 
ATOM   1620 C CA  . MET A  1 210 ? -45.149  -7.629  7.799   1.00 68.55  ?  1684 MET A CA  1 
ATOM   1621 C C   . MET A  1 210 ? -46.382  -6.755  7.873   1.00 68.24  ?  1684 MET A C   1 
ATOM   1622 O O   . MET A  1 210 ? -46.250  -5.525  7.904   1.00 58.95  ?  1684 MET A O   1 
ATOM   1623 C CB  . MET A  1 210 ? -44.677  -7.796  6.343   1.00 76.12  ?  1684 MET A CB  1 
ATOM   1624 C CG  . MET A  1 210 ? -43.187  -8.138  6.188   1.00 75.79  ?  1684 MET A CG  1 
ATOM   1625 S SD  . MET A  1 210 ? -41.975  -7.354  7.300   1.00 67.62  ?  1684 MET A SD  1 
ATOM   1626 C CE  . MET A  1 210 ? -41.903  -5.691  6.614   1.00 62.80  ?  1684 MET A CE  1 
ATOM   1627 N N   . GLY A  1 211 ? -47.547  -7.405  7.977   1.00 90.21  ?  1685 GLY A N   1 
ATOM   1628 C CA  . GLY A  1 211 ? -48.853  -6.766  8.046   1.00 82.33  ?  1685 GLY A CA  1 
ATOM   1629 C C   . GLY A  1 211 ? -49.500  -6.625  9.410   1.00 74.25  ?  1685 GLY A C   1 
ATOM   1630 O O   . GLY A  1 211 ? -50.118  -5.586  9.647   1.00 71.04  ?  1685 GLY A O   1 
ATOM   1631 N N   . ILE A  1 212 ? -49.393  -7.643  10.317  1.00 69.34  ?  1686 ILE A N   1 
ATOM   1632 C CA  . ILE A  1 212 ? -50.087  -7.605  11.620  1.00 73.71  ?  1686 ILE A CA  1 
ATOM   1633 C C   . ILE A  1 212 ? -49.172  -7.598  12.864  1.00 76.00  ?  1686 ILE A C   1 
ATOM   1634 O O   . ILE A  1 212 ? -49.314  -6.677  13.667  1.00 87.13  ?  1686 ILE A O   1 
ATOM   1635 C CB  . ILE A  1 212 ? -51.171  -8.732  11.722  1.00 73.53  ?  1686 ILE A CB  1 
ATOM   1636 C CG1 . ILE A  1 212 ? -52.436  -8.317  10.960  1.00 76.43  ?  1686 ILE A CG1 1 
ATOM   1637 C CG2 . ILE A  1 212 ? -51.544  -9.103  13.174  1.00 68.23  ?  1686 ILE A CG2 1 
ATOM   1638 C CD1 . ILE A  1 212 ? -53.159  -9.430  10.329  1.00 80.25  ?  1686 ILE A CD1 1 
ATOM   1639 N N   . VAL A  1 213 ? -48.312  -8.616  13.067  1.00 74.22  ?  1687 VAL A N   1 
ATOM   1640 C CA  . VAL A  1 213 ? -47.513  -8.769  14.294  1.00 68.55  ?  1687 VAL A CA  1 
ATOM   1641 C C   . VAL A  1 213 ? -46.433  -7.659  14.440  1.00 74.74  ?  1687 VAL A C   1 
ATOM   1642 O O   . VAL A  1 213 ? -46.231  -7.205  15.569  1.00 73.80  ?  1687 VAL A O   1 
ATOM   1643 C CB  . VAL A  1 213 ? -46.952  -10.216 14.474  1.00 64.69  ?  1687 VAL A CB  1 
ATOM   1644 C CG1 . VAL A  1 213 ? -46.306  -10.411 15.839  1.00 65.12  ?  1687 VAL A CG1 1 
ATOM   1645 C CG2 . VAL A  1 213 ? -48.055  -11.248 14.314  1.00 70.66  ?  1687 VAL A CG2 1 
ATOM   1646 N N   . ARG A  1 214 ? -45.788  -7.190  13.337  1.00 84.30  ?  1688 ARG A N   1 
ATOM   1647 C CA  . ARG A  1 214 ? -44.785  -6.107  13.406  1.00 95.15  ?  1688 ARG A CA  1 
ATOM   1648 C C   . ARG A  1 214 ? -45.403  -4.737  13.794  1.00 88.83  ?  1688 ARG A C   1 
ATOM   1649 O O   . ARG A  1 214 ? -44.899  -4.131  14.744  1.00 91.09  ?  1688 ARG A O   1 
ATOM   1650 C CB  . ARG A  1 214 ? -43.927  -6.004  12.134  1.00 106.14 ?  1688 ARG A CB  1 
ATOM   1651 C CG  . ARG A  1 214 ? -42.767  -6.981  12.098  1.00 107.84 ?  1688 ARG A CG  1 
ATOM   1652 C CD  . ARG A  1 214 ? -41.682  -6.525  11.142  1.00 104.86 ?  1688 ARG A CD  1 
ATOM   1653 N NE  . ARG A  1 214 ? -40.650  -7.545  10.953  1.00 108.98 ?  1688 ARG A NE  1 
ATOM   1654 C CZ  . ARG A  1 214 ? -39.501  -7.595  11.621  1.00 114.33 ?  1688 ARG A CZ  1 
ATOM   1655 N NH1 . ARG A  1 214 ? -39.214  -6.676  12.533  1.00 111.79 1  1688 ARG A NH1 1 
ATOM   1656 N NH2 . ARG A  1 214 ? -38.629  -8.563  11.378  1.00 109.91 ?  1688 ARG A NH2 1 
ATOM   1657 N N   . PRO A  1 215 ? -46.502  -4.246  13.148  1.00 83.10  ?  1689 PRO A N   1 
ATOM   1658 C CA  . PRO A  1 215 ? -47.107  -2.978  13.596  1.00 85.39  ?  1689 PRO A CA  1 
ATOM   1659 C C   . PRO A  1 215 ? -47.587  -3.034  15.051  1.00 81.19  ?  1689 PRO A C   1 
ATOM   1660 O O   . PRO A  1 215 ? -47.481  -2.036  15.769  1.00 74.89  ?  1689 PRO A O   1 
ATOM   1661 C CB  . PRO A  1 215 ? -48.297  -2.791  12.643  1.00 89.36  ?  1689 PRO A CB  1 
ATOM   1662 C CG  . PRO A  1 215 ? -48.004  -3.623  11.480  1.00 88.28  ?  1689 PRO A CG  1 
ATOM   1663 C CD  . PRO A  1 215 ? -47.253  -4.800  12.002  1.00 90.07  ?  1689 PRO A CD  1 
ATOM   1664 N N   . LEU A  1 216 ? -48.099  -4.206  15.484  1.00 78.51  ?  1690 LEU A N   1 
ATOM   1665 C CA  . LEU A  1 216 ? -48.572  -4.472  16.844  1.00 85.55  ?  1690 LEU A CA  1 
ATOM   1666 C C   . LEU A  1 216 ? -47.454  -4.341  17.873  1.00 95.49  ?  1690 LEU A C   1 
ATOM   1667 O O   . LEU A  1 216 ? -47.732  -4.103  19.049  1.00 95.62  ?  1690 LEU A O   1 
ATOM   1668 C CB  . LEU A  1 216 ? -49.157  -5.883  16.917  1.00 88.12  ?  1690 LEU A CB  1 
ATOM   1669 C CG  . LEU A  1 216 ? -50.621  -5.976  17.268  1.00 87.82  ?  1690 LEU A CG  1 
ATOM   1670 C CD1 . LEU A  1 216 ? -51.475  -5.707  16.071  1.00 88.12  ?  1690 LEU A CD1 1 
ATOM   1671 C CD2 . LEU A  1 216 ? -50.953  -7.335  17.778  1.00 88.00  ?  1690 LEU A CD2 1 
ATOM   1672 N N   . MET A  1 217 ? -46.193  -4.506  17.426  1.00 102.86 ?  1691 MET A N   1 
ATOM   1673 C CA  . MET A  1 217 ? -45.000  -4.441  18.262  1.00 97.61  ?  1691 MET A CA  1 
ATOM   1674 C C   . MET A  1 217 ? -44.448  -3.038  18.441  1.00 95.76  ?  1691 MET A C   1 
ATOM   1675 O O   . MET A  1 217 ? -43.489  -2.850  19.189  1.00 113.00 ?  1691 MET A O   1 
ATOM   1676 C CB  . MET A  1 217 ? -43.933  -5.401  17.753  1.00 95.24  ?  1691 MET A CB  1 
ATOM   1677 C CG  . MET A  1 217 ? -44.033  -6.756  18.391  1.00 97.99  ?  1691 MET A CG  1 
ATOM   1678 S SD  . MET A  1 217 ? -43.436  -8.041  17.300  1.00 106.38 ?  1691 MET A SD  1 
ATOM   1679 C CE  . MET A  1 217 ? -41.728  -7.786  17.407  1.00 121.18 ?  1691 MET A CE  1 
ATOM   1680 N N   . GLU A  1 218 ? -45.065  -2.051  17.790  1.00 86.07  ?  1692 GLU A N   1 
ATOM   1681 C CA  . GLU A  1 218 ? -44.684  -0.652  17.959  1.00 88.70  ?  1692 GLU A CA  1 
ATOM   1682 C C   . GLU A  1 218 ? -45.394  -0.174  19.228  1.00 85.83  ?  1692 GLU A C   1 
ATOM   1683 O O   . GLU A  1 218 ? -44.770  0.446   20.090  1.00 94.10  ?  1692 GLU A O   1 
ATOM   1684 C CB  . GLU A  1 218 ? -45.099  0.200   16.742  1.00 97.57  ?  1692 GLU A CB  1 
ATOM   1685 C CG  . GLU A  1 218 ? -44.477  -0.208  15.413  1.00 104.25 ?  1692 GLU A CG  1 
ATOM   1686 C CD  . GLU A  1 218 ? -42.988  0.026   15.232  1.00 108.02 ?  1692 GLU A CD  1 
ATOM   1687 O OE1 . GLU A  1 218 ? -42.523  1.167   15.458  1.00 105.82 ?  1692 GLU A OE1 1 
ATOM   1688 O OE2 . GLU A  1 218 ? -42.297  -0.925  14.798  1.00 107.94 -1 1692 GLU A OE2 1 
ATOM   1689 N N   . VAL A  1 219 ? -46.688  -0.530  19.360  1.00 82.63  ?  1693 VAL A N   1 
ATOM   1690 C CA  . VAL A  1 219 ? -47.546  -0.210  20.497  1.00 85.20  ?  1693 VAL A CA  1 
ATOM   1691 C C   . VAL A  1 219 ? -47.147  -1.108  21.670  1.00 81.58  ?  1693 VAL A C   1 
ATOM   1692 O O   . VAL A  1 219 ? -46.552  -0.611  22.625  1.00 86.60  ?  1693 VAL A O   1 
ATOM   1693 C CB  . VAL A  1 219 ? -49.053  -0.309  20.125  1.00 93.13  ?  1693 VAL A CB  1 
ATOM   1694 C CG1 . VAL A  1 219 ? -49.952  -0.166  21.349  1.00 93.54  ?  1693 VAL A CG1 1 
ATOM   1695 C CG2 . VAL A  1 219 ? -49.422  0.727   19.075  1.00 94.65  ?  1693 VAL A CG2 1 
ATOM   1696 N N   . TYR A  1 220 ? -47.441  -2.425  21.579  1.00 88.89  ?  1694 TYR A N   1 
ATOM   1697 C CA  . TYR A  1 220 ? -47.122  -3.439  22.593  1.00 102.53 ?  1694 TYR A CA  1 
ATOM   1698 C C   . TYR A  1 220 ? -45.904  -4.250  22.083  1.00 101.63 ?  1694 TYR A C   1 
ATOM   1699 O O   . TYR A  1 220 ? -46.103  -5.158  21.275  1.00 109.55 ?  1694 TYR A O   1 
ATOM   1700 C CB  . TYR A  1 220 ? -48.329  -4.381  22.836  1.00 108.73 ?  1694 TYR A CB  1 
ATOM   1701 C CG  . TYR A  1 220 ? -49.697  -3.730  22.881  1.00 104.62 ?  1694 TYR A CG  1 
ATOM   1702 C CD1 . TYR A  1 220 ? -50.115  -3.014  23.999  1.00 106.73 ?  1694 TYR A CD1 1 
ATOM   1703 C CD2 . TYR A  1 220 ? -50.610  -3.910  21.846  1.00 105.61 ?  1694 TYR A CD2 1 
ATOM   1704 C CE1 . TYR A  1 220 ? -51.387  -2.443  24.060  1.00 113.62 ?  1694 TYR A CE1 1 
ATOM   1705 C CE2 . TYR A  1 220 ? -51.885  -3.347  21.897  1.00 108.77 ?  1694 TYR A CE2 1 
ATOM   1706 C CZ  . TYR A  1 220 ? -52.270  -2.614  23.006  1.00 109.16 ?  1694 TYR A CZ  1 
ATOM   1707 O OH  . TYR A  1 220 ? -53.530  -2.067  23.061  1.00 105.96 ?  1694 TYR A OH  1 
ATOM   1708 N N   . PRO A  1 221 ? -44.648  -3.943  22.498  1.00 92.02  ?  1695 PRO A N   1 
ATOM   1709 C CA  . PRO A  1 221 ? -43.488  -4.652  21.924  1.00 91.08  ?  1695 PRO A CA  1 
ATOM   1710 C C   . PRO A  1 221 ? -43.366  -6.151  22.229  1.00 91.81  ?  1695 PRO A C   1 
ATOM   1711 O O   . PRO A  1 221 ? -42.688  -6.853  21.472  1.00 92.34  ?  1695 PRO A O   1 
ATOM   1712 C CB  . PRO A  1 221 ? -42.289  -3.866  22.447  1.00 91.89  ?  1695 PRO A CB  1 
ATOM   1713 C CG  . PRO A  1 221 ? -42.777  -3.181  23.644  1.00 96.76  ?  1695 PRO A CG  1 
ATOM   1714 C CD  . PRO A  1 221 ? -44.214  -2.869  23.407  1.00 91.16  ?  1695 PRO A CD  1 
ATOM   1715 N N   . TYR A  1 222 ? -44.016  -6.649  23.301  1.00 85.64  ?  1696 TYR A N   1 
ATOM   1716 C CA  . TYR A  1 222 ? -43.985  -8.080  23.626  1.00 96.67  ?  1696 TYR A CA  1 
ATOM   1717 C C   . TYR A  1 222 ? -45.253  -8.776  23.123  1.00 92.13  ?  1696 TYR A C   1 
ATOM   1718 O O   . TYR A  1 222 ? -45.709  -9.724  23.754  1.00 90.28  ?  1696 TYR A O   1 
ATOM   1719 C CB  . TYR A  1 222 ? -43.768  -8.333  25.137  1.00 100.89 ?  1696 TYR A CB  1 
ATOM   1720 C CG  . TYR A  1 222 ? -42.470  -7.789  25.691  1.00 99.53  ?  1696 TYR A CG  1 
ATOM   1721 C CD1 . TYR A  1 222 ? -41.264  -8.446  25.469  1.00 97.73  ?  1696 TYR A CD1 1 
ATOM   1722 C CD2 . TYR A  1 222 ? -42.452  -6.639  26.476  1.00 103.25 ?  1696 TYR A CD2 1 
ATOM   1723 C CE1 . TYR A  1 222 ? -40.065  -7.951  25.981  1.00 109.51 ?  1696 TYR A CE1 1 
ATOM   1724 C CE2 . TYR A  1 222 ? -41.261  -6.138  27.000  1.00 109.96 ?  1696 TYR A CE2 1 
ATOM   1725 C CZ  . TYR A  1 222 ? -40.068  -6.798  26.750  1.00 116.70 ?  1696 TYR A CZ  1 
ATOM   1726 O OH  . TYR A  1 222 ? -38.888  -6.306  27.260  1.00 119.28 ?  1696 TYR A OH  1 
ATOM   1727 N N   . ALA A  1 223 ? -45.827  -8.302  21.993  1.00 95.00  ?  1697 ALA A N   1 
ATOM   1728 C CA  . ALA A  1 223 ? -47.040  -8.866  21.384  1.00 96.54  ?  1697 ALA A CA  1 
ATOM   1729 C C   . ALA A  1 223 ? -46.783  -10.220 20.703  1.00 90.60  ?  1697 ALA A C   1 
ATOM   1730 O O   . ALA A  1 223 ? -47.678  -11.068 20.660  1.00 88.93  ?  1697 ALA A O   1 
ATOM   1731 C CB  . ALA A  1 223 ? -47.638  -7.883  20.393  1.00 98.03  ?  1697 ALA A CB  1 
ATOM   1732 N N   . TRP A  1 224 ? -45.553  -10.420 20.189  1.00 86.04  ?  1698 TRP A N   1 
ATOM   1733 C CA  . TRP A  1 224 ? -45.098  -11.639 19.515  1.00 86.21  ?  1698 TRP A CA  1 
ATOM   1734 C C   . TRP A  1 224 ? -45.162  -12.862 20.431  1.00 76.79  ?  1698 TRP A C   1 
ATOM   1735 O O   . TRP A  1 224 ? -45.257  -13.989 19.938  1.00 69.00  ?  1698 TRP A O   1 
ATOM   1736 C CB  . TRP A  1 224 ? -43.676  -11.452 18.969  1.00 90.62  ?  1698 TRP A CB  1 
ATOM   1737 C CG  . TRP A  1 224 ? -42.675  -11.077 20.020  1.00 86.34  ?  1698 TRP A CG  1 
ATOM   1738 C CD1 . TRP A  1 224 ? -42.302  -9.816  20.387  1.00 92.73  ?  1698 TRP A CD1 1 
ATOM   1739 C CD2 . TRP A  1 224 ? -41.943  -11.974 20.863  1.00 73.94  ?  1698 TRP A CD2 1 
ATOM   1740 N NE1 . TRP A  1 224 ? -41.369  -9.872  21.396  1.00 93.70  ?  1698 TRP A NE1 1 
ATOM   1741 C CE2 . TRP A  1 224 ? -41.138  -11.186 21.715  1.00 81.88  ?  1698 TRP A CE2 1 
ATOM   1742 C CE3 . TRP A  1 224 ? -41.876  -13.376 20.973  1.00 67.95  ?  1698 TRP A CE3 1 
ATOM   1743 C CZ2 . TRP A  1 224 ? -40.279  -11.751 22.665  1.00 75.51  ?  1698 TRP A CZ2 1 
ATOM   1744 C CZ3 . TRP A  1 224 ? -41.032  -13.935 21.921  1.00 67.79  ?  1698 TRP A CZ3 1 
ATOM   1745 C CH2 . TRP A  1 224 ? -40.243  -13.128 22.750  1.00 69.25  ?  1698 TRP A CH2 1 
ATOM   1746 N N   . VAL A  1 225 ? -45.107  -12.647 21.765  1.00 70.09  ?  1699 VAL A N   1 
ATOM   1747 C CA  . VAL A  1 225 ? -45.179  -13.735 22.749  1.00 75.69  ?  1699 VAL A CA  1 
ATOM   1748 C C   . VAL A  1 225 ? -46.557  -14.402 22.704  1.00 84.18  ?  1699 VAL A C   1 
ATOM   1749 O O   . VAL A  1 225 ? -46.718  -15.502 23.229  1.00 87.72  ?  1699 VAL A O   1 
ATOM   1750 C CB  . VAL A  1 225 ? -44.741  -13.348 24.191  1.00 80.01  ?  1699 VAL A CB  1 
ATOM   1751 C CG1 . VAL A  1 225 ? -43.544  -12.408 24.180  1.00 83.21  ?  1699 VAL A CG1 1 
ATOM   1752 C CG2 . VAL A  1 225 ? -45.892  -12.752 24.999  1.00 89.49  ?  1699 VAL A CG2 1 
ATOM   1753 N N   . PHE A  1 226 ? -47.547  -13.720 22.091  1.00 88.49  ?  1700 PHE A N   1 
ATOM   1754 C CA  . PHE A  1 226 ? -48.894  -14.241 21.911  1.00 78.58  ?  1700 PHE A CA  1 
ATOM   1755 C C   . PHE A  1 226 ? -49.015  -14.907 20.543  1.00 76.29  ?  1700 PHE A C   1 
ATOM   1756 O O   . PHE A  1 226 ? -49.732  -15.901 20.416  1.00 76.44  ?  1700 PHE A O   1 
ATOM   1757 C CB  . PHE A  1 226 ? -49.951  -13.125 22.067  1.00 78.79  ?  1700 PHE A CB  1 
ATOM   1758 C CG  . PHE A  1 226 ? -51.361  -13.542 21.698  1.00 87.86  ?  1700 PHE A CG  1 
ATOM   1759 C CD1 . PHE A  1 226 ? -52.166  -14.214 22.608  1.00 85.04  ?  1700 PHE A CD1 1 
ATOM   1760 C CD2 . PHE A  1 226 ? -51.872  -13.286 20.432  1.00 91.21  ?  1700 PHE A CD2 1 
ATOM   1761 C CE1 . PHE A  1 226 ? -53.451  -14.629 22.254  1.00 78.88  ?  1700 PHE A CE1 1 
ATOM   1762 C CE2 . PHE A  1 226 ? -53.156  -13.709 20.079  1.00 84.00  ?  1700 PHE A CE2 1 
ATOM   1763 C CZ  . PHE A  1 226 ? -53.937  -14.374 20.994  1.00 84.35  ?  1700 PHE A CZ  1 
ATOM   1764 N N   . PHE A  1 227 ? -48.342  -14.354 19.522  1.00 75.34  ?  1701 PHE A N   1 
ATOM   1765 C CA  . PHE A  1 227 ? -48.466  -14.841 18.157  1.00 79.97  ?  1701 PHE A CA  1 
ATOM   1766 C C   . PHE A  1 227 ? -47.525  -15.980 17.786  1.00 78.48  ?  1701 PHE A C   1 
ATOM   1767 O O   . PHE A  1 227 ? -47.985  -16.887 17.094  1.00 74.79  ?  1701 PHE A O   1 
ATOM   1768 C CB  . PHE A  1 227 ? -48.368  -13.691 17.160  1.00 82.63  ?  1701 PHE A CB  1 
ATOM   1769 C CG  . PHE A  1 227 ? -49.579  -12.796 17.265  1.00 84.71  ?  1701 PHE A CG  1 
ATOM   1770 C CD1 . PHE A  1 227 ? -50.809  -13.200 16.756  1.00 93.03  ?  1701 PHE A CD1 1 
ATOM   1771 C CD2 . PHE A  1 227 ? -49.507  -11.581 17.929  1.00 90.15  ?  1701 PHE A CD2 1 
ATOM   1772 C CE1 . PHE A  1 227 ? -51.936  -12.388 16.884  1.00 97.64  ?  1701 PHE A CE1 1 
ATOM   1773 C CE2 . PHE A  1 227 ? -50.634  -10.771 18.058  1.00 91.78  ?  1701 PHE A CE2 1 
ATOM   1774 C CZ  . PHE A  1 227 ? -51.838  -11.173 17.523  1.00 96.14  ?  1701 PHE A CZ  1 
ATOM   1775 N N   . ILE A  1 228 ? -46.245  -15.966 18.225  1.00 75.75  ?  1702 ILE A N   1 
ATOM   1776 C CA  . ILE A  1 228 ? -45.316  -17.076 17.930  1.00 82.83  ?  1702 ILE A CA  1 
ATOM   1777 C C   . ILE A  1 228 ? -45.912  -18.395 18.483  1.00 82.12  ?  1702 ILE A C   1 
ATOM   1778 O O   . ILE A  1 228 ? -46.168  -19.282 17.667  1.00 86.58  ?  1702 ILE A O   1 
ATOM   1779 C CB  . ILE A  1 228 ? -43.833  -16.813 18.344  1.00 85.27  ?  1702 ILE A CB  1 
ATOM   1780 C CG1 . ILE A  1 228 ? -43.251  -15.522 17.708  1.00 84.97  ?  1702 ILE A CG1 1 
ATOM   1781 C CG2 . ILE A  1 228 ? -42.937  -18.023 18.069  1.00 85.32  ?  1702 ILE A CG2 1 
ATOM   1782 C CD1 . ILE A  1 228 ? -43.399  -15.364 16.154  1.00 85.30  ?  1702 ILE A CD1 1 
ATOM   1783 N N   . PRO A  1 229 ? -46.284  -18.502 19.794  1.00 84.38  ?  1703 PRO A N   1 
ATOM   1784 C CA  . PRO A  1 229 ? -46.961  -19.720 20.271  1.00 92.91  ?  1703 PRO A CA  1 
ATOM   1785 C C   . PRO A  1 229 ? -48.247  -20.042 19.510  1.00 86.53  ?  1703 PRO A C   1 
ATOM   1786 O O   . PRO A  1 229 ? -48.467  -21.211 19.224  1.00 71.26  ?  1703 PRO A O   1 
ATOM   1787 C CB  . PRO A  1 229 ? -47.255  -19.404 21.738  1.00 94.60  ?  1703 PRO A CB  1 
ATOM   1788 C CG  . PRO A  1 229 ? -46.219  -18.433 22.112  1.00 86.35  ?  1703 PRO A CG  1 
ATOM   1789 C CD  . PRO A  1 229 ? -46.098  -17.555 20.912  1.00 81.55  ?  1703 PRO A CD  1 
ATOM   1790 N N   . PHE A  1 230 ? -49.069  -19.025 19.145  1.00 84.37  ?  1704 PHE A N   1 
ATOM   1791 C CA  . PHE A  1 230 ? -50.289  -19.248 18.364  1.00 85.36  ?  1704 PHE A CA  1 
ATOM   1792 C C   . PHE A  1 230 ? -49.938  -19.911 17.038  1.00 85.26  ?  1704 PHE A C   1 
ATOM   1793 O O   . PHE A  1 230 ? -50.545  -20.924 16.704  1.00 84.40  ?  1704 PHE A O   1 
ATOM   1794 C CB  . PHE A  1 230 ? -51.073  -17.951 18.123  1.00 90.20  ?  1704 PHE A CB  1 
ATOM   1795 C CG  . PHE A  1 230 ? -52.283  -18.123 17.230  1.00 93.02  ?  1704 PHE A CG  1 
ATOM   1796 C CD1 . PHE A  1 230 ? -53.493  -18.572 17.747  1.00 96.77  ?  1704 PHE A CD1 1 
ATOM   1797 C CD2 . PHE A  1 230 ? -52.215  -17.833 15.873  1.00 90.09  ?  1704 PHE A CD2 1 
ATOM   1798 C CE1 . PHE A  1 230 ? -54.615  -18.715 16.925  1.00 92.07  ?  1704 PHE A CE1 1 
ATOM   1799 C CE2 . PHE A  1 230 ? -53.331  -17.997 15.049  1.00 96.39  ?  1704 PHE A CE2 1 
ATOM   1800 C CZ  . PHE A  1 230 ? -54.525  -18.430 15.582  1.00 92.27  ?  1704 PHE A CZ  1 
ATOM   1801 N N   . ILE A  1 231 ? -48.932  -19.365 16.313  1.00 81.72  ?  1705 ILE A N   1 
ATOM   1802 C CA  . ILE A  1 231 ? -48.427  -19.886 15.032  1.00 71.10  ?  1705 ILE A CA  1 
ATOM   1803 C C   . ILE A  1 231 ? -47.851  -21.306 15.207  1.00 68.33  ?  1705 ILE A C   1 
ATOM   1804 O O   . ILE A  1 231 ? -47.917  -22.101 14.270  1.00 63.16  ?  1705 ILE A O   1 
ATOM   1805 C CB  . ILE A  1 231 ? -47.450  -18.888 14.336  1.00 63.81  ?  1705 ILE A CB  1 
ATOM   1806 C CG1 . ILE A  1 231 ? -48.237  -17.687 13.776  1.00 66.28  ?  1705 ILE A CG1 1 
ATOM   1807 C CG2 . ILE A  1 231 ? -46.613  -19.552 13.217  1.00 62.22  ?  1705 ILE A CG2 1 
ATOM   1808 C CD1 . ILE A  1 231 ? -47.507  -16.420 13.751  1.00 72.15  ?  1705 ILE A CD1 1 
ATOM   1809 N N   . PHE A  1 232 ? -47.345  -21.640 16.409  1.00 68.87  ?  1706 PHE A N   1 
ATOM   1810 C CA  . PHE A  1 232 ? -46.839  -22.977 16.691  1.00 73.65  ?  1706 PHE A CA  1 
ATOM   1811 C C   . PHE A  1 232 ? -48.002  -23.925 16.937  1.00 77.60  ?  1706 PHE A C   1 
ATOM   1812 O O   . PHE A  1 232 ? -48.109  -24.925 16.233  1.00 82.77  ?  1706 PHE A O   1 
ATOM   1813 C CB  . PHE A  1 232 ? -45.863  -22.958 17.873  1.00 74.73  ?  1706 PHE A CB  1 
ATOM   1814 C CG  . PHE A  1 232 ? -44.415  -22.735 17.500  1.00 79.32  ?  1706 PHE A CG  1 
ATOM   1815 C CD1 . PHE A  1 232 ? -43.985  -21.506 17.010  1.00 88.02  ?  1706 PHE A CD1 1 
ATOM   1816 C CD2 . PHE A  1 232 ? -43.472  -23.738 17.681  1.00 80.35  ?  1706 PHE A CD2 1 
ATOM   1817 C CE1 . PHE A  1 232 ? -42.644  -21.295 16.686  1.00 89.51  ?  1706 PHE A CE1 1 
ATOM   1818 C CE2 . PHE A  1 232 ? -42.128  -23.522 17.361  1.00 83.86  ?  1706 PHE A CE2 1 
ATOM   1819 C CZ  . PHE A  1 232 ? -41.725  -22.302 16.865  1.00 88.42  ?  1706 PHE A CZ  1 
ATOM   1820 N N   . VAL A  1 233 ? -48.900  -23.576 17.886  1.00 79.48  ?  1707 VAL A N   1 
ATOM   1821 C CA  . VAL A  1 233 ? -50.079  -24.353 18.294  1.00 82.07  ?  1707 VAL A CA  1 
ATOM   1822 C C   . VAL A  1 233 ? -50.991  -24.688 17.109  1.00 83.31  ?  1707 VAL A C   1 
ATOM   1823 O O   . VAL A  1 233 ? -51.347  -25.858 16.934  1.00 80.86  ?  1707 VAL A O   1 
ATOM   1824 C CB  . VAL A  1 233 ? -50.863  -23.694 19.466  1.00 80.28  ?  1707 VAL A CB  1 
ATOM   1825 C CG1 . VAL A  1 233 ? -52.167  -24.433 19.751  1.00 70.12  ?  1707 VAL A CG1 1 
ATOM   1826 C CG2 . VAL A  1 233 ? -50.014  -23.622 20.730  1.00 80.68  ?  1707 VAL A CG2 1 
ATOM   1827 N N   . VAL A  1 234 ? -51.350  -23.674 16.295  1.00 78.76  ?  1708 VAL A N   1 
ATOM   1828 C CA  . VAL A  1 234 ? -52.232  -23.870 15.146  1.00 83.45  ?  1708 VAL A CA  1 
ATOM   1829 C C   . VAL A  1 234 ? -51.609  -24.793 14.116  1.00 86.81  ?  1708 VAL A C   1 
ATOM   1830 O O   . VAL A  1 234 ? -52.279  -25.723 13.672  1.00 100.56 ?  1708 VAL A O   1 
ATOM   1831 C CB  . VAL A  1 234 ? -52.762  -22.565 14.523  1.00 94.82  ?  1708 VAL A CB  1 
ATOM   1832 C CG1 . VAL A  1 234 ? -53.588  -21.792 15.535  1.00 105.12 ?  1708 VAL A CG1 1 
ATOM   1833 C CG2 . VAL A  1 234 ? -51.643  -21.698 13.951  1.00 95.08  ?  1708 VAL A CG2 1 
ATOM   1834 N N   . THR A  1 235 ? -50.311  -24.581 13.798  1.00 88.64  ?  1709 THR A N   1 
ATOM   1835 C CA  . THR A  1 235 ? -49.541  -25.379 12.842  1.00 79.99  ?  1709 THR A CA  1 
ATOM   1836 C C   . THR A  1 235 ? -49.347  -26.809 13.352  1.00 72.80  ?  1709 THR A C   1 
ATOM   1837 O O   . THR A  1 235 ? -49.366  -27.746 12.545  1.00 60.83  ?  1709 THR A O   1 
ATOM   1838 C CB  . THR A  1 235 ? -48.248  -24.660 12.475  1.00 73.13  ?  1709 THR A CB  1 
ATOM   1839 O OG1 . THR A  1 235 ? -48.591  -23.375 11.953  1.00 78.14  ?  1709 THR A OG1 1 
ATOM   1840 C CG2 . THR A  1 235 ? -47.423  -25.410 11.445  1.00 77.06  ?  1709 THR A CG2 1 
ATOM   1841 N N   . PHE A  1 236 ? -49.217  -26.978 14.692  1.00 73.99  ?  1710 PHE A N   1 
ATOM   1842 C CA  . PHE A  1 236 ? -49.095  -28.290 15.313  1.00 80.95  ?  1710 PHE A CA  1 
ATOM   1843 C C   . PHE A  1 236 ? -50.404  -29.041 15.166  1.00 84.38  ?  1710 PHE A C   1 
ATOM   1844 O O   . PHE A  1 236 ? -50.373  -30.199 14.760  1.00 93.36  ?  1710 PHE A O   1 
ATOM   1845 C CB  . PHE A  1 236 ? -48.677  -28.200 16.784  1.00 88.26  ?  1710 PHE A CB  1 
ATOM   1846 C CG  . PHE A  1 236 ? -48.429  -29.557 17.403  1.00 97.13  ?  1710 PHE A CG  1 
ATOM   1847 C CD1 . PHE A  1 236 ? -47.229  -30.226 17.196  1.00 105.95 ?  1710 PHE A CD1 1 
ATOM   1848 C CD2 . PHE A  1 236 ? -49.406  -30.178 18.175  1.00 100.72 ?  1710 PHE A CD2 1 
ATOM   1849 C CE1 . PHE A  1 236 ? -47.007  -31.489 17.756  1.00 109.70 ?  1710 PHE A CE1 1 
ATOM   1850 C CE2 . PHE A  1 236 ? -49.181  -31.439 18.733  1.00 103.96 ?  1710 PHE A CE2 1 
ATOM   1851 C CZ  . PHE A  1 236 ? -47.983  -32.084 18.519  1.00 107.45 ?  1710 PHE A CZ  1 
ATOM   1852 N N   . VAL A  1 237 ? -51.552  -28.390 15.454  1.00 81.22  ?  1711 VAL A N   1 
ATOM   1853 C CA  . VAL A  1 237 ? -52.857  -29.038 15.309  1.00 79.71  ?  1711 VAL A CA  1 
ATOM   1854 C C   . VAL A  1 237 ? -53.140  -29.318 13.833  1.00 79.88  ?  1711 VAL A C   1 
ATOM   1855 O O   . VAL A  1 237 ? -53.688  -30.371 13.510  1.00 78.21  ?  1711 VAL A O   1 
ATOM   1856 C CB  . VAL A  1 237 ? -54.022  -28.287 16.001  1.00 82.82  ?  1711 VAL A CB  1 
ATOM   1857 C CG1 . VAL A  1 237 ? -55.305  -29.120 15.986  1.00 84.32  ?  1711 VAL A CG1 1 
ATOM   1858 C CG2 . VAL A  1 237 ? -53.669  -27.902 17.433  1.00 88.17  ?  1711 VAL A CG2 1 
ATOM   1859 N N   . MET A  1 238 ? -52.722  -28.403 12.940  1.00 84.48  ?  1712 MET A N   1 
ATOM   1860 C CA  . MET A  1 238 ? -52.912  -28.551 11.498  1.00 93.83  ?  1712 MET A CA  1 
ATOM   1861 C C   . MET A  1 238 ? -52.142  -29.716 10.904  1.00 95.73  ?  1712 MET A C   1 
ATOM   1862 O O   . MET A  1 238 ? -52.742  -30.515 10.186  1.00 99.50  ?  1712 MET A O   1 
ATOM   1863 C CB  . MET A  1 238 ? -52.613  -27.250 10.748  1.00 96.96  ?  1712 MET A CB  1 
ATOM   1864 C CG  . MET A  1 238 ? -53.838  -26.424 10.510  1.00 106.44 ?  1712 MET A CG  1 
ATOM   1865 S SD  . MET A  1 238 ? -54.911  -27.194 9.282   1.00 125.24 ?  1712 MET A SD  1 
ATOM   1866 C CE  . MET A  1 238 ? -56.483  -26.506 9.768   1.00 133.01 ?  1712 MET A CE  1 
ATOM   1867 N N   . ILE A  1 239 ? -50.829  -29.829 11.210  1.00 92.49  ?  1713 ILE A N   1 
ATOM   1868 C CA  . ILE A  1 239 ? -49.983  -30.923 10.719  1.00 95.08  ?  1713 ILE A CA  1 
ATOM   1869 C C   . ILE A  1 239 ? -50.600  -32.264 11.107  1.00 91.54  ?  1713 ILE A C   1 
ATOM   1870 O O   . ILE A  1 239 ? -50.824  -33.098 10.232  1.00 86.86  ?  1713 ILE A O   1 
ATOM   1871 C CB  . ILE A  1 239 ? -48.496  -30.765 11.154  1.00 103.16 ?  1713 ILE A CB  1 
ATOM   1872 C CG1 . ILE A  1 239 ? -47.819  -29.635 10.350  1.00 113.35 ?  1713 ILE A CG1 1 
ATOM   1873 C CG2 . ILE A  1 239 ? -47.712  -32.078 10.996  1.00 101.72 ?  1713 ILE A CG2 1 
ATOM   1874 C CD1 . ILE A  1 239 ? -46.563  -29.035 10.990  1.00 115.27 ?  1713 ILE A CD1 1 
ATOM   1875 N N   . ASN A  1 240 ? -50.957  -32.418 12.399  1.00 91.39  ?  1714 ASN A N   1 
ATOM   1876 C CA  . ASN A  1 240 ? -51.588  -33.609 12.967  1.00 94.84  ?  1714 ASN A CA  1 
ATOM   1877 C C   . ASN A  1 240 ? -52.911  -33.960 12.295  1.00 95.32  ?  1714 ASN A C   1 
ATOM   1878 O O   . ASN A  1 240 ? -53.253  -35.138 12.224  1.00 93.18  ?  1714 ASN A O   1 
ATOM   1879 C CB  . ASN A  1 240 ? -51.767  -33.464 14.472  1.00 101.03 ?  1714 ASN A CB  1 
ATOM   1880 C CG  . ASN A  1 240 ? -50.517  -33.749 15.270  1.00 110.42 ?  1714 ASN A CG  1 
ATOM   1881 O OD1 . ASN A  1 240 ? -49.890  -32.848 15.828  1.00 109.56 ?  1714 ASN A OD1 1 
ATOM   1882 N ND2 . ASN A  1 240 ? -50.160  -35.020 15.397  1.00 115.03 ?  1714 ASN A ND2 1 
ATOM   1883 N N   . LEU A  1 241 ? -53.635  -32.950 11.781  1.00 99.08  ?  1715 LEU A N   1 
ATOM   1884 C CA  . LEU A  1 241 ? -54.893  -33.139 11.059  1.00 96.73  ?  1715 LEU A CA  1 
ATOM   1885 C C   . LEU A  1 241 ? -54.600  -33.786 9.699   1.00 98.78  ?  1715 LEU A C   1 
ATOM   1886 O O   . LEU A  1 241 ? -55.283  -34.734 9.319   1.00 106.83 ?  1715 LEU A O   1 
ATOM   1887 C CB  . LEU A  1 241 ? -55.618  -31.790 10.892  1.00 93.60  ?  1715 LEU A CB  1 
ATOM   1888 C CG  . LEU A  1 241 ? -56.872  -31.780 10.025  1.00 95.43  ?  1715 LEU A CG  1 
ATOM   1889 C CD1 . LEU A  1 241 ? -58.061  -31.254 10.795  1.00 94.10  ?  1715 LEU A CD1 1 
ATOM   1890 C CD2 . LEU A  1 241 ? -56.646  -30.970 8.767   1.00 97.91  ?  1715 LEU A CD2 1 
ATOM   1891 N N   . VAL A  1 242 ? -53.575  -33.273 8.989   1.00 92.36  ?  1716 VAL A N   1 
ATOM   1892 C CA  . VAL A  1 242 ? -53.114  -33.746 7.676   1.00 84.71  ?  1716 VAL A CA  1 
ATOM   1893 C C   . VAL A  1 242 ? -52.517  -35.169 7.805   1.00 83.36  ?  1716 VAL A C   1 
ATOM   1894 O O   . VAL A  1 242 ? -52.731  -36.016 6.933   1.00 74.98  ?  1716 VAL A O   1 
ATOM   1895 C CB  . VAL A  1 242 ? -52.134  -32.717 7.044   1.00 77.01  ?  1716 VAL A CB  1 
ATOM   1896 C CG1 . VAL A  1 242 ? -51.579  -33.207 5.711   1.00 73.57  ?  1716 VAL A CG1 1 
ATOM   1897 C CG2 . VAL A  1 242 ? -52.809  -31.363 6.863   1.00 79.04  ?  1716 VAL A CG2 1 
ATOM   1898 N N   . VAL A  1 243 ? -51.800  -35.420 8.917   1.00 86.38  ?  1717 VAL A N   1 
ATOM   1899 C CA  . VAL A  1 243 ? -51.200  -36.709 9.264   1.00 88.81  ?  1717 VAL A CA  1 
ATOM   1900 C C   . VAL A  1 243 ? -52.324  -37.695 9.564   1.00 91.77  ?  1717 VAL A C   1 
ATOM   1901 O O   . VAL A  1 243 ? -52.228  -38.857 9.169   1.00 104.45 ?  1717 VAL A O   1 
ATOM   1902 C CB  . VAL A  1 243 ? -50.185  -36.562 10.429  1.00 92.00  ?  1717 VAL A CB  1 
ATOM   1903 C CG1 . VAL A  1 243 ? -49.865  -37.903 11.094  1.00 83.91  ?  1717 VAL A CG1 1 
ATOM   1904 C CG2 . VAL A  1 243 ? -48.909  -35.870 9.952   1.00 99.21  ?  1717 VAL A CG2 1 
ATOM   1905 N N   . ALA A  1 244 ? -53.410  -37.219 10.204  1.00 92.33  ?  1718 ALA A N   1 
ATOM   1906 C CA  . ALA A  1 244 ? -54.576  -38.047 10.502  1.00 94.59  ?  1718 ALA A CA  1 
ATOM   1907 C C   . ALA A  1 244 ? -55.247  -38.553 9.218   1.00 96.32  ?  1718 ALA A C   1 
ATOM   1908 O O   . ALA A  1 244 ? -55.652  -39.711 9.185   1.00 87.03  ?  1718 ALA A O   1 
ATOM   1909 C CB  . ALA A  1 244 ? -55.573  -37.282 11.356  1.00 94.78  ?  1718 ALA A CB  1 
ATOM   1910 N N   . ILE A  1 245 ? -55.312  -37.707 8.154   1.00 103.18 ?  1719 ILE A N   1 
ATOM   1911 C CA  . ILE A  1 245 ? -55.891  -38.037 6.835   1.00 108.88 ?  1719 ILE A CA  1 
ATOM   1912 C C   . ILE A  1 245 ? -55.144  -39.226 6.235   1.00 109.43 ?  1719 ILE A C   1 
ATOM   1913 O O   . ILE A  1 245 ? -55.772  -40.114 5.655   1.00 111.23 ?  1719 ILE A O   1 
ATOM   1914 C CB  . ILE A  1 245 ? -55.901  -36.815 5.852   1.00 113.04 ?  1719 ILE A CB  1 
ATOM   1915 C CG1 . ILE A  1 245 ? -56.463  -35.519 6.491   1.00 117.44 ?  1719 ILE A CG1 1 
ATOM   1916 C CG2 . ILE A  1 245 ? -56.614  -37.129 4.525   1.00 109.78 ?  1719 ILE A CG2 1 
ATOM   1917 C CD1 . ILE A  1 245 ? -57.840  -35.607 7.181   1.00 120.01 ?  1719 ILE A CD1 1 
ATOM   1918 N N   . ILE A  1 246 ? -53.803  -39.240 6.399   1.00 100.03 ?  1720 ILE A N   1 
ATOM   1919 C CA  . ILE A  1 246 ? -52.912  -40.304 5.933   1.00 91.79  ?  1720 ILE A CA  1 
ATOM   1920 C C   . ILE A  1 246 ? -53.220  -41.614 6.688   1.00 83.29  ?  1720 ILE A C   1 
ATOM   1921 O O   . ILE A  1 246 ? -53.347  -42.660 6.050   1.00 71.36  ?  1720 ILE A O   1 
ATOM   1922 C CB  . ILE A  1 246 ? -51.418  -39.875 6.038   1.00 99.28  ?  1720 ILE A CB  1 
ATOM   1923 C CG1 . ILE A  1 246 ? -51.151  -38.569 5.249   1.00 101.56 ?  1720 ILE A CG1 1 
ATOM   1924 C CG2 . ILE A  1 246 ? -50.475  -41.001 5.585   1.00 105.67 ?  1720 ILE A CG2 1 
ATOM   1925 C CD1 . ILE A  1 246 ? -50.014  -37.699 5.793   1.00 99.53  ?  1720 ILE A CD1 1 
ATOM   1926 N N   . VAL A  1 247 ? -53.393  -41.536 8.026   1.00 83.42  ?  1721 VAL A N   1 
ATOM   1927 C CA  . VAL A  1 247 ? -53.690  -42.677 8.898   1.00 91.61  ?  1721 VAL A CA  1 
ATOM   1928 C C   . VAL A  1 247 ? -55.138  -43.185 8.677   1.00 97.90  ?  1721 VAL A C   1 
ATOM   1929 O O   . VAL A  1 247 ? -55.377  -44.389 8.760   1.00 100.85 ?  1721 VAL A O   1 
ATOM   1930 C CB  . VAL A  1 247 ? -53.337  -42.348 10.374  1.00 95.82  ?  1721 VAL A CB  1 
ATOM   1931 C CG1 . VAL A  1 247 ? -53.902  -43.376 11.351  1.00 102.27 ?  1721 VAL A CG1 1 
ATOM   1932 C CG2 . VAL A  1 247 ? -51.824  -42.223 10.551  1.00 89.39  ?  1721 VAL A CG2 1 
ATOM   1933 N N   . ASP A  1 248 ? -56.069  -42.278 8.325   1.00 108.75 ?  1722 ASP A N   1 
ATOM   1934 C CA  . ASP A  1 248 ? -57.471  -42.567 7.985   1.00 114.34 ?  1722 ASP A CA  1 
ATOM   1935 C C   . ASP A  1 248 ? -57.493  -43.370 6.669   1.00 110.36 ?  1722 ASP A C   1 
ATOM   1936 O O   . ASP A  1 248 ? -58.294  -44.296 6.520   1.00 107.48 ?  1722 ASP A O   1 
ATOM   1937 C CB  . ASP A  1 248 ? -58.249  -41.234 7.818   1.00 119.18 ?  1722 ASP A CB  1 
ATOM   1938 C CG  . ASP A  1 248 ? -59.761  -41.287 7.587   1.00 113.76 ?  1722 ASP A CG  1 
ATOM   1939 O OD1 . ASP A  1 248 ? -60.315  -42.407 7.468   1.00 113.67 ?  1722 ASP A OD1 1 
ATOM   1940 O OD2 . ASP A  1 248 ? -60.391  -40.202 7.530   1.00 102.84 -1 1722 ASP A OD2 1 
ATOM   1941 N N   . ALA A  1 249 ? -56.588  -43.016 5.733   1.00 108.57 ?  1723 ALA A N   1 
ATOM   1942 C CA  . ALA A  1 249 ? -56.423  -43.655 4.428   1.00 104.93 ?  1723 ALA A CA  1 
ATOM   1943 C C   . ALA A  1 249 ? -55.679  -45.003 4.522   1.00 107.84 ?  1723 ALA A C   1 
ATOM   1944 O O   . ALA A  1 249 ? -56.022  -45.943 3.798   1.00 104.28 ?  1723 ALA A O   1 
ATOM   1945 C CB  . ALA A  1 249 ? -55.696  -42.715 3.487   1.00 98.19  ?  1723 ALA A CB  1 
ATOM   1946 N N   . MET A  1 250 ? -54.681  -45.099 5.429   1.00 109.24 ?  1724 MET A N   1 
ATOM   1947 C CA  . MET A  1 250 ? -53.895  -46.319 5.652   1.00 111.70 ?  1724 MET A CA  1 
ATOM   1948 C C   . MET A  1 250 ? -54.666  -47.382 6.451   1.00 119.13 ?  1724 MET A C   1 
ATOM   1949 O O   . MET A  1 250 ? -54.184  -48.509 6.598   1.00 108.33 ?  1724 MET A O   1 
ATOM   1950 C CB  . MET A  1 250 ? -52.533  -46.006 6.292   1.00 112.42 ?  1724 MET A CB  1 
ATOM   1951 C CG  . MET A  1 250 ? -51.624  -45.157 5.423   1.00 114.79 ?  1724 MET A CG  1 
ATOM   1952 S SD  . MET A  1 250 ? -51.158  -45.879 3.832   1.00 113.22 ?  1724 MET A SD  1 
ATOM   1953 C CE  . MET A  1 250 ? -50.311  -44.504 3.106   1.00 121.66 ?  1724 MET A CE  1 
ATOM   1954 N N   . ALA A  1 251 ? -55.872  -47.023 6.944   1.00 130.37 ?  1725 ALA A N   1 
ATOM   1955 C CA  . ALA A  1 251 ? -56.782  -47.920 7.659   1.00 126.28 ?  1725 ALA A CA  1 
ATOM   1956 C C   . ALA A  1 251 ? -57.450  -48.847 6.636   1.00 125.59 ?  1725 ALA A C   1 
ATOM   1957 O O   . ALA A  1 251 ? -57.783  -49.986 6.963   1.00 123.70 ?  1725 ALA A O   1 
ATOM   1958 C CB  . ALA A  1 251 ? -57.838  -47.113 8.401   1.00 119.06 ?  1725 ALA A CB  1 
ATOM   1959 N N   . ILE A  1 252 ? -57.618  -48.353 5.393   1.00 125.84 ?  1726 ILE A N   1 
ATOM   1960 C CA  . ILE A  1 252 ? -58.197  -49.079 4.260   1.00 127.94 ?  1726 ILE A CA  1 
ATOM   1961 C C   . ILE A  1 252 ? -57.180  -50.124 3.742   1.00 133.03 ?  1726 ILE A C   1 
ATOM   1962 O O   . ILE A  1 252 ? -57.534  -51.297 3.597   1.00 134.76 ?  1726 ILE A O   1 
ATOM   1963 C CB  . ILE A  1 252 ? -58.657  -48.077 3.150   1.00 123.08 ?  1726 ILE A CB  1 
ATOM   1964 C CG1 . ILE A  1 252 ? -59.657  -47.029 3.712   1.00 109.35 ?  1726 ILE A CG1 1 
ATOM   1965 C CG2 . ILE A  1 252 ? -59.238  -48.805 1.920   1.00 122.62 ?  1726 ILE A CG2 1 
ATOM   1966 C CD1 . ILE A  1 252 ? -59.488  -45.609 3.159   1.00 101.65 ?  1726 ILE A CD1 1 
ATOM   1967 N N   . LEU A  1 253 ? -55.921  -49.688 3.487   1.00 126.27 ?  1727 LEU A N   1 
ATOM   1968 C CA  . LEU A  1 253 ? -54.822  -50.515 2.977   1.00 119.96 ?  1727 LEU A CA  1 
ATOM   1969 C C   . LEU A  1 253 ? -54.403  -51.668 3.895   1.00 116.38 ?  1727 LEU A C   1 
ATOM   1970 O O   . LEU A  1 253 ? -54.236  -52.786 3.411   1.00 116.02 ?  1727 LEU A O   1 
ATOM   1971 C CB  . LEU A  1 253 ? -53.601  -49.649 2.624   1.00 120.21 ?  1727 LEU A CB  1 
ATOM   1972 C CG  . LEU A  1 253 ? -53.552  -49.095 1.199   1.00 115.26 ?  1727 LEU A CG  1 
ATOM   1973 C CD1 . LEU A  1 253 ? -52.705  -47.846 1.132   1.00 113.33 ?  1727 LEU A CD1 1 
ATOM   1974 C CD2 . LEU A  1 253 ? -53.010  -50.126 0.220   1.00 110.06 ?  1727 LEU A CD2 1 
ATOM   1975 N N   . ASN A  1 254 ? -54.224  -51.405 5.198   1.00 112.98 ?  1728 ASN A N   1 
ATOM   1976 C CA  . ASN A  1 254 ? -53.814  -52.431 6.159   1.00 120.36 ?  1728 ASN A CA  1 
ATOM   1977 C C   . ASN A  1 254 ? -54.900  -53.472 6.471   1.00 128.52 ?  1728 ASN A C   1 
ATOM   1978 O O   . ASN A  1 254 ? -54.563  -54.563 6.931   1.00 125.19 ?  1728 ASN A O   1 
ATOM   1979 C CB  . ASN A  1 254 ? -53.278  -51.800 7.445   1.00 122.39 ?  1728 ASN A CB  1 
ATOM   1980 C CG  . ASN A  1 254 ? -51.856  -51.312 7.329   1.00 123.05 ?  1728 ASN A CG  1 
ATOM   1981 O OD1 . ASN A  1 254 ? -50.908  -52.097 7.198   1.00 125.04 ?  1728 ASN A OD1 1 
ATOM   1982 N ND2 . ASN A  1 254 ? -51.670  -50.000 7.390   1.00 124.76 ?  1728 ASN A ND2 1 
ATOM   1983 N N   . GLN A  1 255 ? -56.190  -53.144 6.217   1.00 144.79 ?  1729 GLN A N   1 
ATOM   1984 C CA  . GLN A  1 255 ? -57.328  -54.037 6.476   1.00 150.92 ?  1729 GLN A CA  1 
ATOM   1985 C C   . GLN A  1 255 ? -57.643  -54.977 5.311   1.00 151.63 ?  1729 GLN A C   1 
ATOM   1986 O O   . GLN A  1 255 ? -58.020  -56.128 5.555   1.00 158.63 ?  1729 GLN A O   1 
ATOM   1987 C CB  . GLN A  1 255 ? -58.577  -53.247 6.894   1.00 150.62 ?  1729 GLN A CB  1 
ATOM   1988 C CG  . GLN A  1 255 ? -59.449  -53.975 7.920   1.00 151.51 ?  1729 GLN A CG  1 
ATOM   1989 C CD  . GLN A  1 255 ? -58.816  -54.111 9.293   1.00 155.18 ?  1729 GLN A CD  1 
ATOM   1990 O OE1 . GLN A  1 255 ? -58.093  -53.229 9.777   1.00 150.30 ?  1729 GLN A OE1 1 
ATOM   1991 N NE2 . GLN A  1 255 ? -59.104  -55.215 9.967   1.00 161.67 ?  1729 GLN A NE2 1 
ATOM   1992 N N   . LYS A  1 256 ? -57.508  -54.487 4.054   1.00 140.66 ?  1730 LYS A N   1 
ATOM   1993 C CA  . LYS A  1 256 ? -57.730  -55.283 2.837   1.00 136.52 ?  1730 LYS A CA  1 
ATOM   1994 C C   . LYS A  1 256 ? -56.617  -56.327 2.689   1.00 135.62 ?  1730 LYS A C   1 
ATOM   1995 O O   . LYS A  1 256 ? -56.885  -57.467 2.311   1.00 136.54 ?  1730 LYS A O   1 
ATOM   1996 C CB  . LYS A  1 256 ? -57.810  -54.386 1.589   1.00 140.53 ?  1730 LYS A CB  1 
ATOM   1997 C CG  . LYS A  1 256 ? -59.165  -53.704 1.410   1.00 148.86 ?  1730 LYS A CG  1 
ATOM   1998 C CD  . LYS A  1 256 ? -59.256  -52.884 0.117   1.00 153.24 ?  1730 LYS A CD  1 
ATOM   1999 C CE  . LYS A  1 256 ? -59.761  -53.668 -1.077  1.00 157.82 ?  1730 LYS A CE  1 
ATOM   2000 N NZ  . LYS A  1 256 ? -61.217  -53.964 -0.987  1.00 159.24 1  1730 LYS A NZ  1 
ATOM   2001 N N   . GLU A  1 257 ? -55.377  -55.932 3.030   1.00 129.59 ?  1731 GLU A N   1 
ATOM   2002 C CA  . GLU A  1 257 ? -54.174  -56.762 3.017   1.00 120.83 ?  1731 GLU A CA  1 
ATOM   2003 C C   . GLU A  1 257 ? -54.257  -57.838 4.124   1.00 124.12 ?  1731 GLU A C   1 
ATOM   2004 O O   . GLU A  1 257 ? -53.827  -58.971 3.901   1.00 123.64 ?  1731 GLU A O   1 
ATOM   2005 C CB  . GLU A  1 257 ? -52.942  -55.864 3.239   1.00 120.18 ?  1731 GLU A CB  1 
ATOM   2006 C CG  . GLU A  1 257 ? -51.623  -56.477 2.798   1.00 125.09 ?  1731 GLU A CG  1 
ATOM   2007 C CD  . GLU A  1 257 ? -50.399  -56.185 3.650   1.00 122.55 ?  1731 GLU A CD  1 
ATOM   2008 O OE1 . GLU A  1 257 ? -49.355  -56.832 3.409   1.00 112.70 ?  1731 GLU A OE1 1 
ATOM   2009 O OE2 . GLU A  1 257 ? -50.477  -55.323 4.557   1.00 128.13 -1 1731 GLU A OE2 1 
ATOM   2010 N N   . GLU A  1 258 ? -54.820  -57.469 5.303   1.00 128.56 ?  1732 GLU A N   1 
ATOM   2011 C CA  . GLU A  1 258 ? -54.992  -58.301 6.500   1.00 134.70 ?  1732 GLU A CA  1 
ATOM   2012 C C   . GLU A  1 258 ? -55.744  -59.611 6.236   1.00 142.55 ?  1732 GLU A C   1 
ATOM   2013 O O   . GLU A  1 258 ? -55.205  -60.681 6.530   1.00 153.65 ?  1732 GLU A O   1 
ATOM   2014 C CB  . GLU A  1 258 ? -55.700  -57.497 7.600   1.00 136.99 ?  1732 GLU A CB  1 
ATOM   2015 C CG  . GLU A  1 258 ? -55.155  -57.736 8.996   1.00 142.27 ?  1732 GLU A CG  1 
ATOM   2016 C CD  . GLU A  1 258 ? -55.822  -56.898 10.071  1.00 145.86 ?  1732 GLU A CD  1 
ATOM   2017 O OE1 . GLU A  1 258 ? -55.135  -56.031 10.661  1.00 149.54 ?  1732 GLU A OE1 1 
ATOM   2018 O OE2 . GLU A  1 258 ? -57.033  -57.100 10.319  1.00 150.29 -1 1732 GLU A OE2 1 
ATOM   2019 N N   . GLN A  1 259 ? -56.979  -59.523 5.680   1.00 138.84 ?  1733 GLN A N   1 
ATOM   2020 C CA  . GLN A  1 259 ? -57.846  -60.672 5.361   1.00 139.17 ?  1733 GLN A CA  1 
ATOM   2021 C C   . GLN A  1 259 ? -57.234  -61.630 4.321   1.00 138.50 ?  1733 GLN A C   1 
ATOM   2022 O O   . GLN A  1 259 ? -57.460  -62.843 4.395   1.00 128.80 ?  1733 GLN A O   1 
ATOM   2023 C CB  . GLN A  1 259 ? -59.263  -60.218 4.944   1.00 139.02 ?  1733 GLN A CB  1 
ATOM   2024 C CG  . GLN A  1 259 ? -59.326  -59.262 3.739   1.00 140.66 ?  1733 GLN A CG  1 
ATOM   2025 C CD  . GLN A  1 259 ? -60.460  -59.553 2.775   1.00 146.66 ?  1733 GLN A CD  1 
ATOM   2026 O OE1 . GLN A  1 259 ? -61.310  -60.430 2.995   1.00 149.57 ?  1733 GLN A OE1 1 
ATOM   2027 N NE2 . GLN A  1 259 ? -60.505  -58.811 1.675   1.00 148.44 ?  1733 GLN A NE2 1 
ATOM   2028 N N   . HIS A  1 260 ? -56.455  -61.072 3.367   1.00 140.18 ?  1734 HIS A N   1 
ATOM   2029 C CA  . HIS A  1 260 ? -55.758  -61.803 2.306   1.00 133.40 ?  1734 HIS A CA  1 
ATOM   2030 C C   . HIS A  1 260 ? -54.710  -62.731 2.909   1.00 120.52 ?  1734 HIS A C   1 
ATOM   2031 O O   . HIS A  1 260 ? -54.568  -63.865 2.455   1.00 112.74 ?  1734 HIS A O   1 
ATOM   2032 C CB  . HIS A  1 260 ? -55.079  -60.825 1.322   1.00 137.14 ?  1734 HIS A CB  1 
ATOM   2033 C CG  . HIS A  1 260 ? -56.013  -59.947 0.538   1.00 143.90 ?  1734 HIS A CG  1 
ATOM   2034 N ND1 . HIS A  1 260 ? -57.393  -60.056 0.648   1.00 141.23 ?  1734 HIS A ND1 1 
ATOM   2035 C CD2 . HIS A  1 260 ? -55.725  -58.967 -0.350  1.00 146.73 ?  1734 HIS A CD2 1 
ATOM   2036 C CE1 . HIS A  1 260 ? -57.892  -59.151 -0.179  1.00 141.25 ?  1734 HIS A CE1 1 
ATOM   2037 N NE2 . HIS A  1 260 ? -56.929  -58.468 -0.797  1.00 144.24 ?  1734 HIS A NE2 1 
ATOM   2038 N N   . ILE A  1 261 ? -53.994  -62.248 3.942   1.00 115.29 ?  1735 ILE A N   1 
ATOM   2039 C CA  . ILE A  1 261 ? -52.940  -62.982 4.643   1.00 121.57 ?  1735 ILE A CA  1 
ATOM   2040 C C   . ILE A  1 261 ? -53.530  -64.087 5.562   1.00 129.71 ?  1735 ILE A C   1 
ATOM   2041 O O   . ILE A  1 261 ? -52.840  -65.079 5.822   1.00 148.65 ?  1735 ILE A O   1 
ATOM   2042 C CB  . ILE A  1 261 ? -51.980  -61.983 5.370   1.00 122.50 ?  1735 ILE A CB  1 
ATOM   2043 C CG1 . ILE A  1 261 ? -51.165  -61.163 4.338   1.00 124.48 ?  1735 ILE A CG1 1 
ATOM   2044 C CG2 . ILE A  1 261 ? -51.033  -62.684 6.355   1.00 121.42 ?  1735 ILE A CG2 1 
ATOM   2045 C CD1 . ILE A  1 261 ? -50.681  -59.785 4.823   1.00 127.03 ?  1735 ILE A CD1 1 
ATOM   2046 N N   . ILE A  1 262 ? -54.807  -63.944 6.001   1.00 128.18 ?  1736 ILE A N   1 
ATOM   2047 C CA  . ILE A  1 262 ? -55.482  -64.912 6.880   1.00 129.41 ?  1736 ILE A CA  1 
ATOM   2048 C C   . ILE A  1 262 ? -55.601  -66.318 6.213   1.00 128.41 ?  1736 ILE A C   1 
ATOM   2049 O O   . ILE A  1 262 ? -55.019  -67.275 6.746   1.00 110.64 ?  1736 ILE A O   1 
ATOM   2050 C CB  . ILE A  1 262 ? -56.835  -64.343 7.418   1.00 128.39 ?  1736 ILE A CB  1 
ATOM   2051 C CG1 . ILE A  1 262 ? -56.560  -63.324 8.551   1.00 124.82 ?  1736 ILE A CG1 1 
ATOM   2052 C CG2 . ILE A  1 262 ? -57.801  -65.448 7.902   1.00 128.40 ?  1736 ILE A CG2 1 
ATOM   2053 C CD1 . ILE A  1 262 ? -57.657  -62.274 8.793   1.00 127.91 ?  1736 ILE A CD1 1 
ATOM   2054 N N   . ASP A  1 263 ? -56.298  -66.422 5.043   1.00 123.24 ?  1737 ASP A N   1 
ATOM   2055 C CA  . ASP A  1 263 ? -56.532  -67.667 4.282   1.00 113.79 ?  1737 ASP A CA  1 
ATOM   2056 C C   . ASP A  1 263 ? -57.302  -68.742 5.088   1.00 117.18 ?  1737 ASP A C   1 
ATOM   2057 O O   . ASP A  1 263 ? -56.723  -69.536 5.839   1.00 123.27 ?  1737 ASP A O   1 
ATOM   2058 C CB  . ASP A  1 263 ? -55.233  -68.243 3.678   1.00 105.43 ?  1737 ASP A CB  1 
ATOM   2059 C CG  . ASP A  1 263 ? -54.707  -67.460 2.498   1.00 102.73 ?  1737 ASP A CG  1 
ATOM   2060 O OD1 . ASP A  1 263 ? -55.179  -67.705 1.363   1.00 104.67 ?  1737 ASP A OD1 1 
ATOM   2061 O OD2 . ASP A  1 263 ? -53.792  -66.638 2.697   1.00 97.78  -1 1737 ASP A OD2 1 
ATOM   2062 N N   . MET B  1 19  ? -22.070  -52.549 -45.897 1.00 126.08 ?  1493 MET B N   1 
ATOM   2063 C CA  . MET B  1 19  ? -22.314  -51.132 -46.162 1.00 127.19 ?  1493 MET B CA  1 
ATOM   2064 C C   . MET B  1 19  ? -22.948  -50.453 -44.940 1.00 134.20 ?  1493 MET B C   1 
ATOM   2065 O O   . MET B  1 19  ? -23.684  -51.112 -44.208 1.00 157.18 ?  1493 MET B O   1 
ATOM   2066 C CB  . MET B  1 19  ? -23.217  -50.969 -47.405 1.00 118.98 ?  1493 MET B CB  1 
ATOM   2067 C CG  . MET B  1 19  ? -23.248  -49.551 -47.978 1.00 120.72 ?  1493 MET B CG  1 
ATOM   2068 S SD  . MET B  1 19  ? -21.704  -49.020 -48.774 1.00 127.00 ?  1493 MET B SD  1 
ATOM   2069 C CE  . MET B  1 19  ? -21.939  -49.714 -50.408 1.00 116.27 ?  1493 MET B CE  1 
ATOM   2070 N N   . TYR B  1 20  ? -22.624  -49.146 -44.715 1.00 131.39 ?  1494 TYR B N   1 
ATOM   2071 C CA  . TYR B  1 20  ? -23.109  -48.222 -43.667 1.00 119.29 ?  1494 TYR B CA  1 
ATOM   2072 C C   . TYR B  1 20  ? -22.985  -48.756 -42.209 1.00 118.32 ?  1494 TYR B C   1 
ATOM   2073 O O   . TYR B  1 20  ? -23.363  -48.037 -41.285 1.00 115.38 ?  1494 TYR B O   1 
ATOM   2074 C CB  . TYR B  1 20  ? -24.562  -47.733 -43.979 1.00 112.39 ?  1494 TYR B CB  1 
ATOM   2075 C CG  . TYR B  1 20  ? -25.703  -48.363 -43.193 1.00 106.56 ?  1494 TYR B CG  1 
ATOM   2076 C CD1 . TYR B  1 20  ? -26.170  -49.639 -43.500 1.00 104.93 ?  1494 TYR B CD1 1 
ATOM   2077 C CD2 . TYR B  1 20  ? -26.387  -47.642 -42.219 1.00 111.04 ?  1494 TYR B CD2 1 
ATOM   2078 C CE1 . TYR B  1 20  ? -27.228  -50.216 -42.794 1.00 103.52 ?  1494 TYR B CE1 1 
ATOM   2079 C CE2 . TYR B  1 20  ? -27.458  -48.202 -41.518 1.00 120.28 ?  1494 TYR B CE2 1 
ATOM   2080 C CZ  . TYR B  1 20  ? -27.873  -49.493 -41.804 1.00 113.32 ?  1494 TYR B CZ  1 
ATOM   2081 O OH  . TYR B  1 20  ? -28.932  -50.050 -41.119 1.00 110.65 ?  1494 TYR B OH  1 
ATOM   2082 N N   . LEU B  1 21  ? -22.410  -49.965 -41.997 1.00 124.64 ?  1495 LEU B N   1 
ATOM   2083 C CA  . LEU B  1 21  ? -22.255  -50.576 -40.665 1.00 128.73 ?  1495 LEU B CA  1 
ATOM   2084 C C   . LEU B  1 21  ? -21.385  -49.744 -39.717 1.00 130.77 ?  1495 LEU B C   1 
ATOM   2085 O O   . LEU B  1 21  ? -21.627  -49.756 -38.511 1.00 136.45 ?  1495 LEU B O   1 
ATOM   2086 C CB  . LEU B  1 21  ? -21.755  -52.032 -40.753 1.00 133.65 ?  1495 LEU B CB  1 
ATOM   2087 C CG  . LEU B  1 21  ? -21.853  -52.876 -39.475 1.00 135.32 ?  1495 LEU B CG  1 
ATOM   2088 C CD1 . LEU B  1 21  ? -23.284  -53.334 -39.208 1.00 130.95 ?  1495 LEU B CD1 1 
ATOM   2089 C CD2 . LEU B  1 21  ? -20.914  -54.049 -39.540 1.00 141.00 ?  1495 LEU B CD2 1 
ATOM   2090 N N   . ARG B  1 22  ? -20.416  -48.989 -40.267 1.00 131.85 ?  1496 ARG B N   1 
ATOM   2091 C CA  . ARG B  1 22  ? -19.531  -48.099 -39.509 1.00 132.00 ?  1496 ARG B CA  1 
ATOM   2092 C C   . ARG B  1 22  ? -20.358  -46.954 -38.874 1.00 126.47 ?  1496 ARG B C   1 
ATOM   2093 O O   . ARG B  1 22  ? -20.106  -46.592 -37.726 1.00 123.90 ?  1496 ARG B O   1 
ATOM   2094 C CB  . ARG B  1 22  ? -18.385  -47.574 -40.400 1.00 132.30 ?  1496 ARG B CB  1 
ATOM   2095 C CG  . ARG B  1 22  ? -17.675  -48.670 -41.223 1.00 131.54 ?  1496 ARG B CG  1 
ATOM   2096 C CD  . ARG B  1 22  ? -16.385  -49.189 -40.598 1.00 128.57 ?  1496 ARG B CD  1 
ATOM   2097 N NE  . ARG B  1 22  ? -15.199  -48.555 -41.185 1.00 123.99 ?  1496 ARG B NE  1 
ATOM   2098 C CZ  . ARG B  1 22  ? -14.436  -49.094 -42.135 1.00 115.20 ?  1496 ARG B CZ  1 
ATOM   2099 N NH1 . ARG B  1 22  ? -14.714  -50.304 -42.612 1.00 107.69 1  1496 ARG B NH1 1 
ATOM   2100 N NH2 . ARG B  1 22  ? -13.388  -48.432 -42.609 1.00 116.26 ?  1496 ARG B NH2 1 
ATOM   2101 N N   . ILE B  1 23  ? -21.391  -46.457 -39.600 1.00 118.17 ?  1497 ILE B N   1 
ATOM   2102 C CA  . ILE B  1 23  ? -22.354  -45.436 -39.159 1.00 107.78 ?  1497 ILE B CA  1 
ATOM   2103 C C   . ILE B  1 23  ? -23.270  -46.067 -38.099 1.00 103.58 ?  1497 ILE B C   1 
ATOM   2104 O O   . ILE B  1 23  ? -23.439  -45.486 -37.033 1.00 89.34  ?  1497 ILE B O   1 
ATOM   2105 C CB  . ILE B  1 23  ? -23.160  -44.858 -40.368 1.00 106.97 ?  1497 ILE B CB  1 
ATOM   2106 C CG1 . ILE B  1 23  ? -22.242  -44.190 -41.435 1.00 103.50 ?  1497 ILE B CG1 1 
ATOM   2107 C CG2 . ILE B  1 23  ? -24.305  -43.929 -39.948 1.00 115.86 ?  1497 ILE B CG2 1 
ATOM   2108 C CD1 . ILE B  1 23  ? -21.283  -43.030 -40.974 1.00 104.96 ?  1497 ILE B CD1 1 
ATOM   2109 N N   . THR B  1 24  ? -23.810  -47.282 -38.376 1.00 113.18 ?  1498 THR B N   1 
ATOM   2110 C CA  . THR B  1 24  ? -24.684  -48.082 -37.491 1.00 120.38 ?  1498 THR B CA  1 
ATOM   2111 C C   . THR B  1 24  ? -24.022  -48.343 -36.124 1.00 113.49 ?  1498 THR B C   1 
ATOM   2112 O O   . THR B  1 24  ? -24.713  -48.672 -35.156 1.00 120.86 ?  1498 THR B O   1 
ATOM   2113 C CB  . THR B  1 24  ? -25.095  -49.410 -38.182 1.00 137.23 ?  1498 THR B CB  1 
ATOM   2114 O OG1 . THR B  1 24  ? -25.182  -49.237 -39.598 1.00 156.20 ?  1498 THR B OG1 1 
ATOM   2115 C CG2 . THR B  1 24  ? -26.413  -49.974 -37.654 1.00 136.42 ?  1498 THR B CG2 1 
ATOM   2116 N N   . ASN B  1 25  ? -22.685  -48.183 -36.058 1.00 110.13 ?  1499 ASN B N   1 
ATOM   2117 C CA  . ASN B  1 25  ? -21.881  -48.344 -34.849 1.00 107.13 ?  1499 ASN B CA  1 
ATOM   2118 C C   . ASN B  1 25  ? -21.653  -47.015 -34.128 1.00 105.46 ?  1499 ASN B C   1 
ATOM   2119 O O   . ASN B  1 25  ? -21.590  -47.012 -32.900 1.00 108.78 ?  1499 ASN B O   1 
ATOM   2120 C CB  . ASN B  1 25  ? -20.567  -49.055 -35.152 1.00 103.92 ?  1499 ASN B CB  1 
ATOM   2121 C CG  . ASN B  1 25  ? -20.745  -50.483 -35.624 1.00 108.36 ?  1499 ASN B CG  1 
ATOM   2122 O OD1 . ASN B  1 25  ? -21.610  -51.236 -35.143 1.00 104.81 ?  1499 ASN B OD1 1 
ATOM   2123 N ND2 . ASN B  1 25  ? -19.931  -50.882 -36.596 1.00 110.74 ?  1499 ASN B ND2 1 
ATOM   2124 N N   . ILE B  1 26  ? -21.552  -45.891 -34.881 1.00 101.94 ?  1500 ILE B N   1 
ATOM   2125 C CA  . ILE B  1 26  ? -21.410  -44.541 -34.310 1.00 103.51 ?  1500 ILE B CA  1 
ATOM   2126 C C   . ILE B  1 26  ? -22.773  -44.199 -33.683 1.00 106.09 ?  1500 ILE B C   1 
ATOM   2127 O O   . ILE B  1 26  ? -22.948  -44.381 -32.478 1.00 92.33  ?  1500 ILE B O   1 
ATOM   2128 C CB  . ILE B  1 26  ? -20.948  -43.467 -35.354 1.00 102.56 ?  1500 ILE B CB  1 
ATOM   2129 C CG1 . ILE B  1 26  ? -19.609  -43.838 -36.013 1.00 99.90  ?  1500 ILE B CG1 1 
ATOM   2130 C CG2 . ILE B  1 26  ? -20.868  -42.064 -34.723 1.00 99.35  ?  1500 ILE B CG2 1 
ATOM   2131 C CD1 . ILE B  1 26  ? -19.467  -43.315 -37.452 1.00 98.49  ?  1500 ILE B CD1 1 
ATOM   2132 N N   . VAL B  1 27  ? -23.748  -43.778 -34.520 1.00 118.37 ?  1501 VAL B N   1 
ATOM   2133 C CA  . VAL B  1 27  ? -25.108  -43.458 -34.089 1.00 127.53 ?  1501 VAL B CA  1 
ATOM   2134 C C   . VAL B  1 27  ? -25.730  -44.712 -33.471 1.00 125.87 ?  1501 VAL B C   1 
ATOM   2135 O O   . VAL B  1 27  ? -25.679  -45.782 -34.080 1.00 134.13 ?  1501 VAL B O   1 
ATOM   2136 C CB  . VAL B  1 27  ? -25.974  -42.756 -35.183 1.00 130.93 ?  1501 VAL B CB  1 
ATOM   2137 C CG1 . VAL B  1 27  ? -25.827  -43.406 -36.550 1.00 128.30 ?  1501 VAL B CG1 1 
ATOM   2138 C CG2 . VAL B  1 27  ? -27.439  -42.661 -34.780 1.00 138.04 ?  1501 VAL B CG2 1 
ATOM   2139 N N   . GLU B  1 28  ? -26.219  -44.582 -32.222 1.00 121.71 ?  1502 GLU B N   1 
ATOM   2140 C CA  . GLU B  1 28  ? -26.776  -45.653 -31.395 1.00 125.44 ?  1502 GLU B CA  1 
ATOM   2141 C C   . GLU B  1 28  ? -25.608  -46.513 -30.873 1.00 117.70 ?  1502 GLU B C   1 
ATOM   2142 O O   . GLU B  1 28  ? -25.311  -47.587 -31.407 1.00 119.04 ?  1502 GLU B O   1 
ATOM   2143 C CB  . GLU B  1 28  ? -27.888  -46.465 -32.122 1.00 131.57 ?  1502 GLU B CB  1 
ATOM   2144 C CG  . GLU B  1 28  ? -28.711  -47.390 -31.231 1.00 139.57 ?  1502 GLU B CG  1 
ATOM   2145 C CD  . GLU B  1 28  ? -29.667  -46.719 -30.260 1.00 140.07 ?  1502 GLU B CD  1 
ATOM   2146 O OE1 . GLU B  1 28  ? -30.569  -45.982 -30.723 1.00 146.93 ?  1502 GLU B OE1 1 
ATOM   2147 O OE2 . GLU B  1 28  ? -29.537  -46.962 -29.037 1.00 122.58 -1 1502 GLU B OE2 1 
ATOM   2148 N N   . SER B  1 29  ? -24.902  -45.965 -29.862 1.00 109.30 ?  1503 SER B N   1 
ATOM   2149 C CA  . SER B  1 29  ? -23.759  -46.569 -29.164 1.00 99.91  ?  1503 SER B CA  1 
ATOM   2150 C C   . SER B  1 29  ? -23.768  -46.091 -27.699 1.00 109.73 ?  1503 SER B C   1 
ATOM   2151 O O   . SER B  1 29  ? -24.832  -46.070 -27.067 1.00 125.88 ?  1503 SER B O   1 
ATOM   2152 C CB  . SER B  1 29  ? -22.439  -46.204 -29.851 1.00 90.53  ?  1503 SER B CB  1 
ATOM   2153 O OG  . SER B  1 29  ? -22.133  -44.819 -29.778 1.00 81.45  ?  1503 SER B OG  1 
ATOM   2154 N N   . SER B  1 30  ? -22.587  -45.716 -27.168 1.00 107.64 ?  1504 SER B N   1 
ATOM   2155 C CA  . SER B  1 30  ? -22.395  -45.194 -25.818 1.00 100.14 ?  1504 SER B CA  1 
ATOM   2156 C C   . SER B  1 30  ? -21.790  -43.791 -25.947 1.00 100.90 ?  1504 SER B C   1 
ATOM   2157 O O   . SER B  1 30  ? -22.328  -42.853 -25.366 1.00 105.07 ?  1504 SER B O   1 
ATOM   2158 C CB  . SER B  1 30  ? -21.487  -46.117 -25.003 1.00 97.97  ?  1504 SER B CB  1 
ATOM   2159 O OG  . SER B  1 30  ? -21.994  -47.442 -24.925 1.00 91.52  ?  1504 SER B OG  1 
ATOM   2160 N N   . PHE B  1 31  ? -20.713  -43.648 -26.760 1.00 106.14 ?  1505 PHE B N   1 
ATOM   2161 C CA  . PHE B  1 31  ? -20.008  -42.390 -27.031 1.00 106.40 ?  1505 PHE B CA  1 
ATOM   2162 C C   . PHE B  1 31  ? -20.927  -41.377 -27.707 1.00 108.74 ?  1505 PHE B C   1 
ATOM   2163 O O   . PHE B  1 31  ? -20.963  -40.227 -27.272 1.00 110.80 ?  1505 PHE B O   1 
ATOM   2164 C CB  . PHE B  1 31  ? -18.749  -42.636 -27.899 1.00 105.44 ?  1505 PHE B CB  1 
ATOM   2165 C CG  . PHE B  1 31  ? -18.039  -41.396 -28.407 1.00 99.35  ?  1505 PHE B CG  1 
ATOM   2166 C CD1 . PHE B  1 31  ? -18.499  -40.719 -29.537 1.00 95.28  ?  1505 PHE B CD1 1 
ATOM   2167 C CD2 . PHE B  1 31  ? -16.890  -40.928 -27.781 1.00 96.18  ?  1505 PHE B CD2 1 
ATOM   2168 C CE1 . PHE B  1 31  ? -17.855  -39.567 -29.996 1.00 93.87  ?  1505 PHE B CE1 1 
ATOM   2169 C CE2 . PHE B  1 31  ? -16.236  -39.783 -28.251 1.00 99.49  ?  1505 PHE B CE2 1 
ATOM   2170 C CZ  . PHE B  1 31  ? -16.720  -39.113 -29.358 1.00 96.93  ?  1505 PHE B CZ  1 
ATOM   2171 N N   . PHE B  1 32  ? -21.613  -41.785 -28.801 1.00 111.00 ?  1506 PHE B N   1 
ATOM   2172 C CA  . PHE B  1 32  ? -22.513  -40.911 -29.558 1.00 113.76 ?  1506 PHE B CA  1 
ATOM   2173 C C   . PHE B  1 32  ? -23.661  -40.436 -28.673 1.00 114.91 ?  1506 PHE B C   1 
ATOM   2174 O O   . PHE B  1 32  ? -23.978  -39.242 -28.683 1.00 114.89 ?  1506 PHE B O   1 
ATOM   2175 C CB  . PHE B  1 32  ? -23.041  -41.614 -30.820 1.00 113.34 ?  1506 PHE B CB  1 
ATOM   2176 C CG  . PHE B  1 32  ? -24.001  -40.791 -31.649 1.00 112.69 ?  1506 PHE B CG  1 
ATOM   2177 C CD1 . PHE B  1 32  ? -23.531  -39.872 -32.578 1.00 113.91 ?  1506 PHE B CD1 1 
ATOM   2178 C CD2 . PHE B  1 32  ? -25.376  -40.941 -31.505 1.00 110.80 ?  1506 PHE B CD2 1 
ATOM   2179 C CE1 . PHE B  1 32  ? -24.421  -39.110 -33.344 1.00 114.18 ?  1506 PHE B CE1 1 
ATOM   2180 C CE2 . PHE B  1 32  ? -26.265  -40.178 -32.271 1.00 111.24 ?  1506 PHE B CE2 1 
ATOM   2181 C CZ  . PHE B  1 32  ? -25.781  -39.272 -33.188 1.00 108.25 ?  1506 PHE B CZ  1 
ATOM   2182 N N   . THR B  1 33  ? -24.254  -41.375 -27.895 1.00 107.61 ?  1507 THR B N   1 
ATOM   2183 C CA  . THR B  1 33  ? -25.341  -41.140 -26.939 1.00 99.89  ?  1507 THR B CA  1 
ATOM   2184 C C   . THR B  1 33  ? -24.939  -40.007 -25.994 1.00 97.83  ?  1507 THR B C   1 
ATOM   2185 O O   . THR B  1 33  ? -25.677  -39.027 -25.887 1.00 96.21  ?  1507 THR B O   1 
ATOM   2186 C CB  . THR B  1 33  ? -25.653  -42.441 -26.182 1.00 100.36 ?  1507 THR B CB  1 
ATOM   2187 O OG1 . THR B  1 33  ? -25.740  -43.517 -27.117 1.00 101.71 ?  1507 THR B OG1 1 
ATOM   2188 C CG2 . THR B  1 33  ? -26.934  -42.353 -25.353 1.00 98.80  ?  1507 THR B CG2 1 
ATOM   2189 N N   . LYS B  1 34  ? -23.727  -40.120 -25.388 1.00 96.60  ?  1508 LYS B N   1 
ATOM   2190 C CA  . LYS B  1 34  ? -23.087  -39.167 -24.471 1.00 91.75  ?  1508 LYS B CA  1 
ATOM   2191 C C   . LYS B  1 34  ? -22.727  -37.833 -25.144 1.00 88.52  ?  1508 LYS B C   1 
ATOM   2192 O O   . LYS B  1 34  ? -22.879  -36.779 -24.523 1.00 81.37  ?  1508 LYS B O   1 
ATOM   2193 C CB  . LYS B  1 34  ? -21.813  -39.781 -23.862 1.00 89.38  ?  1508 LYS B CB  1 
ATOM   2194 C CG  . LYS B  1 34  ? -22.059  -40.840 -22.794 1.00 93.79  ?  1508 LYS B CG  1 
ATOM   2195 C CD  . LYS B  1 34  ? -20.739  -41.382 -22.246 1.00 99.40  ?  1508 LYS B CD  1 
ATOM   2196 C CE  . LYS B  1 34  ? -20.931  -42.293 -21.056 1.00 104.24 ?  1508 LYS B CE  1 
ATOM   2197 N NZ  . LYS B  1 34  ? -19.650  -42.540 -20.345 1.00 108.24 1  1508 LYS B NZ  1 
ATOM   2198 N N   . PHE B  1 35  ? -22.225  -37.880 -26.395 1.00 89.58  ?  1509 PHE B N   1 
ATOM   2199 C CA  . PHE B  1 35  ? -21.824  -36.688 -27.140 1.00 93.35  ?  1509 PHE B CA  1 
ATOM   2200 C C   . PHE B  1 35  ? -22.982  -35.743 -27.448 1.00 103.85 ?  1509 PHE B C   1 
ATOM   2201 O O   . PHE B  1 35  ? -22.779  -34.525 -27.461 1.00 116.62 ?  1509 PHE B O   1 
ATOM   2202 C CB  . PHE B  1 35  ? -21.051  -37.049 -28.420 1.00 91.81  ?  1509 PHE B CB  1 
ATOM   2203 C CG  . PHE B  1 35  ? -20.662  -35.845 -29.249 1.00 89.60  ?  1509 PHE B CG  1 
ATOM   2204 C CD1 . PHE B  1 35  ? -19.734  -34.922 -28.774 1.00 87.83  ?  1509 PHE B CD1 1 
ATOM   2205 C CD2 . PHE B  1 35  ? -21.265  -35.603 -30.478 1.00 90.96  ?  1509 PHE B CD2 1 
ATOM   2206 C CE1 . PHE B  1 35  ? -19.397  -33.792 -29.527 1.00 88.90  ?  1509 PHE B CE1 1 
ATOM   2207 C CE2 . PHE B  1 35  ? -20.917  -34.480 -31.236 1.00 86.11  ?  1509 PHE B CE2 1 
ATOM   2208 C CZ  . PHE B  1 35  ? -19.986  -33.582 -30.756 1.00 86.50  ?  1509 PHE B CZ  1 
ATOM   2209 N N   . ILE B  1 36  ? -24.187  -36.294 -27.700 1.00 102.94 ?  1510 ILE B N   1 
ATOM   2210 C CA  . ILE B  1 36  ? -25.365  -35.472 -27.997 1.00 106.27 ?  1510 ILE B CA  1 
ATOM   2211 C C   . ILE B  1 36  ? -25.794  -34.708 -26.731 1.00 100.01 ?  1510 ILE B C   1 
ATOM   2212 O O   . ILE B  1 36  ? -26.166  -33.537 -26.844 1.00 97.65  ?  1510 ILE B O   1 
ATOM   2213 C CB  . ILE B  1 36  ? -26.507  -36.263 -28.706 1.00 111.93 ?  1510 ILE B CB  1 
ATOM   2214 C CG1 . ILE B  1 36  ? -25.989  -37.023 -29.968 1.00 116.80 ?  1510 ILE B CG1 1 
ATOM   2215 C CG2 . ILE B  1 36  ? -27.705  -35.366 -29.063 1.00 109.61 ?  1510 ILE B CG2 1 
ATOM   2216 C CD1 . ILE B  1 36  ? -25.012  -36.235 -30.990 1.00 107.91 ?  1510 ILE B CD1 1 
ATOM   2217 N N   . ILE B  1 37  ? -25.635  -35.329 -25.531 1.00 95.92  ?  1511 ILE B N   1 
ATOM   2218 C CA  . ILE B  1 37  ? -25.917  -34.694 -24.233 1.00 94.68  ?  1511 ILE B CA  1 
ATOM   2219 C C   . ILE B  1 37  ? -25.008  -33.469 -24.133 1.00 95.46  ?  1511 ILE B C   1 
ATOM   2220 O O   . ILE B  1 37  ? -25.497  -32.362 -23.902 1.00 94.35  ?  1511 ILE B O   1 
ATOM   2221 C CB  . ILE B  1 37  ? -25.695  -35.642 -23.008 1.00 91.56  ?  1511 ILE B CB  1 
ATOM   2222 C CG1 . ILE B  1 37  ? -26.191  -37.100 -23.248 1.00 100.40 ?  1511 ILE B CG1 1 
ATOM   2223 C CG2 . ILE B  1 37  ? -26.283  -35.057 -21.720 1.00 83.25  ?  1511 ILE B CG2 1 
ATOM   2224 C CD1 . ILE B  1 37  ? -27.666  -37.341 -23.685 1.00 104.72 ?  1511 ILE B CD1 1 
ATOM   2225 N N   . TYR B  1 38  ? -23.691  -33.675 -24.383 1.00 99.32  ?  1512 TYR B N   1 
ATOM   2226 C CA  . TYR B  1 38  ? -22.642  -32.653 -24.379 1.00 97.36  ?  1512 TYR B CA  1 
ATOM   2227 C C   . TYR B  1 38  ? -23.015  -31.438 -25.247 1.00 92.04  ?  1512 TYR B C   1 
ATOM   2228 O O   . TYR B  1 38  ? -22.756  -30.304 -24.844 1.00 88.56  ?  1512 TYR B O   1 
ATOM   2229 C CB  . TYR B  1 38  ? -21.296  -33.274 -24.809 1.00 94.71  ?  1512 TYR B CB  1 
ATOM   2230 C CG  . TYR B  1 38  ? -20.215  -32.266 -25.132 1.00 100.45 ?  1512 TYR B CG  1 
ATOM   2231 C CD1 . TYR B  1 38  ? -19.403  -31.741 -24.132 1.00 95.49  ?  1512 TYR B CD1 1 
ATOM   2232 C CD2 . TYR B  1 38  ? -19.998  -31.841 -26.441 1.00 108.66 ?  1512 TYR B CD2 1 
ATOM   2233 C CE1 . TYR B  1 38  ? -18.404  -30.813 -24.424 1.00 97.43  ?  1512 TYR B CE1 1 
ATOM   2234 C CE2 . TYR B  1 38  ? -19.018  -30.897 -26.742 1.00 107.91 ?  1512 TYR B CE2 1 
ATOM   2235 C CZ  . TYR B  1 38  ? -18.213  -30.394 -25.731 1.00 101.43 ?  1512 TYR B CZ  1 
ATOM   2236 O OH  . TYR B  1 38  ? -17.238  -29.467 -26.023 1.00 104.87 ?  1512 TYR B OH  1 
ATOM   2237 N N   . LEU B  1 39  ? -23.614  -31.680 -26.426 1.00 87.52  ?  1513 LEU B N   1 
ATOM   2238 C CA  . LEU B  1 39  ? -24.045  -30.611 -27.319 1.00 91.87  ?  1513 LEU B CA  1 
ATOM   2239 C C   . LEU B  1 39  ? -25.282  -29.902 -26.778 1.00 94.23  ?  1513 LEU B C   1 
ATOM   2240 O O   . LEU B  1 39  ? -25.352  -28.676 -26.868 1.00 103.56 ?  1513 LEU B O   1 
ATOM   2241 C CB  . LEU B  1 39  ? -24.298  -31.129 -28.745 1.00 95.31  ?  1513 LEU B CB  1 
ATOM   2242 C CG  . LEU B  1 39  ? -23.082  -31.384 -29.646 1.00 95.40  ?  1513 LEU B CG  1 
ATOM   2243 C CD1 . LEU B  1 39  ? -23.531  -31.834 -31.018 1.00 93.15  ?  1513 LEU B CD1 1 
ATOM   2244 C CD2 . LEU B  1 39  ? -22.226  -30.130 -29.811 1.00 93.47  ?  1513 LEU B CD2 1 
ATOM   2245 N N   . ILE B  1 40  ? -26.248  -30.665 -26.207 1.00 91.76  ?  1514 ILE B N   1 
ATOM   2246 C CA  . ILE B  1 40  ? -27.487  -30.131 -25.617 1.00 88.12  ?  1514 ILE B CA  1 
ATOM   2247 C C   . ILE B  1 40  ? -27.122  -29.189 -24.463 1.00 87.31  ?  1514 ILE B C   1 
ATOM   2248 O O   . ILE B  1 40  ? -27.638  -28.071 -24.394 1.00 86.30  ?  1514 ILE B O   1 
ATOM   2249 C CB  . ILE B  1 40  ? -28.475  -31.271 -25.204 1.00 89.25  ?  1514 ILE B CB  1 
ATOM   2250 C CG1 . ILE B  1 40  ? -29.049  -31.979 -26.450 1.00 94.38  ?  1514 ILE B CG1 1 
ATOM   2251 C CG2 . ILE B  1 40  ? -29.624  -30.747 -24.330 1.00 85.02  ?  1514 ILE B CG2 1 
ATOM   2252 C CD1 . ILE B  1 40  ? -29.500  -33.426 -26.242 1.00 96.80  ?  1514 ILE B CD1 1 
ATOM   2253 N N   . VAL B  1 41  ? -26.179  -29.631 -23.609 1.00 86.68  ?  1515 VAL B N   1 
ATOM   2254 C CA  . VAL B  1 41  ? -25.634  -28.895 -22.468 1.00 88.44  ?  1515 VAL B CA  1 
ATOM   2255 C C   . VAL B  1 41  ? -24.866  -27.638 -22.939 1.00 88.00  ?  1515 VAL B C   1 
ATOM   2256 O O   . VAL B  1 41  ? -25.034  -26.566 -22.358 1.00 86.71  ?  1515 VAL B O   1 
ATOM   2257 C CB  . VAL B  1 41  ? -24.806  -29.859 -21.569 1.00 89.10  ?  1515 VAL B CB  1 
ATOM   2258 C CG1 . VAL B  1 41  ? -23.632  -29.170 -20.872 1.00 91.69  ?  1515 VAL B CG1 1 
ATOM   2259 C CG2 . VAL B  1 41  ? -25.706  -30.560 -20.559 1.00 90.39  ?  1515 VAL B CG2 1 
ATOM   2260 N N   . LEU B  1 42  ? -24.065  -27.765 -24.009 1.00 86.55  ?  1516 LEU B N   1 
ATOM   2261 C CA  . LEU B  1 42  ? -23.308  -26.645 -24.560 1.00 88.73  ?  1516 LEU B CA  1 
ATOM   2262 C C   . LEU B  1 42  ? -24.210  -25.608 -25.217 1.00 90.77  ?  1516 LEU B C   1 
ATOM   2263 O O   . LEU B  1 42  ? -23.863  -24.427 -25.226 1.00 96.20  ?  1516 LEU B O   1 
ATOM   2264 C CB  . LEU B  1 42  ? -22.241  -27.126 -25.539 1.00 97.01  ?  1516 LEU B CB  1 
ATOM   2265 C CG  . LEU B  1 42  ? -20.888  -26.481 -25.332 1.00 100.46 ?  1516 LEU B CG  1 
ATOM   2266 C CD1 . LEU B  1 42  ? -19.885  -27.487 -24.827 1.00 96.06  ?  1516 LEU B CD1 1 
ATOM   2267 C CD2 . LEU B  1 42  ? -20.413  -25.773 -26.589 1.00 106.80 ?  1516 LEU B CD2 1 
ATOM   2268 N N   . ASN B  1 43  ? -25.370  -26.039 -25.751 1.00 86.70  ?  1517 ASN B N   1 
ATOM   2269 C CA  . ASN B  1 43  ? -26.340  -25.127 -26.349 1.00 80.06  ?  1517 ASN B CA  1 
ATOM   2270 C C   . ASN B  1 43  ? -27.124  -24.397 -25.250 1.00 82.02  ?  1517 ASN B C   1 
ATOM   2271 O O   . ASN B  1 43  ? -27.633  -23.303 -25.490 1.00 86.20  ?  1517 ASN B O   1 
ATOM   2272 C CB  . ASN B  1 43  ? -27.271  -25.839 -27.342 1.00 78.85  ?  1517 ASN B CB  1 
ATOM   2273 C CG  . ASN B  1 43  ? -28.121  -24.925 -28.225 1.00 80.34  ?  1517 ASN B CG  1 
ATOM   2274 O OD1 . ASN B  1 43  ? -29.175  -25.325 -28.741 1.00 76.22  ?  1517 ASN B OD1 1 
ATOM   2275 N ND2 . ASN B  1 43  ? -27.686  -23.690 -28.450 1.00 79.26  ?  1517 ASN B ND2 1 
ATOM   2276 N N   . MET B  1 44  ? -27.208  -24.997 -24.040 1.00 83.54  ?  1518 MET B N   1 
ATOM   2277 C CA  . MET B  1 44  ? -27.893  -24.403 -22.887 1.00 86.39  ?  1518 MET B CA  1 
ATOM   2278 C C   . MET B  1 44  ? -27.081  -23.244 -22.319 1.00 88.59  ?  1518 MET B C   1 
ATOM   2279 O O   . MET B  1 44  ? -27.653  -22.212 -21.960 1.00 90.25  ?  1518 MET B O   1 
ATOM   2280 C CB  . MET B  1 44  ? -28.156  -25.458 -21.806 1.00 84.39  ?  1518 MET B CB  1 
ATOM   2281 C CG  . MET B  1 44  ? -29.204  -25.039 -20.804 1.00 84.68  ?  1518 MET B CG  1 
ATOM   2282 S SD  . MET B  1 44  ? -29.283  -26.168 -19.403 1.00 88.14  ?  1518 MET B SD  1 
ATOM   2283 C CE  . MET B  1 44  ? -30.862  -26.889 -19.675 1.00 87.18  ?  1518 MET B CE  1 
ATOM   2284 N N   . VAL B  1 45  ? -25.748  -23.424 -22.254 1.00 91.84  ?  1519 VAL B N   1 
ATOM   2285 C CA  . VAL B  1 45  ? -24.784  -22.439 -21.762 1.00 91.59  ?  1519 VAL B CA  1 
ATOM   2286 C C   . VAL B  1 45  ? -24.768  -21.195 -22.669 1.00 95.90  ?  1519 VAL B C   1 
ATOM   2287 O O   . VAL B  1 45  ? -24.627  -20.094 -22.144 1.00 97.84  ?  1519 VAL B O   1 
ATOM   2288 C CB  . VAL B  1 45  ? -23.375  -23.054 -21.521 1.00 83.91  ?  1519 VAL B CB  1 
ATOM   2289 C CG1 . VAL B  1 45  ? -22.404  -22.021 -20.954 1.00 80.15  ?  1519 VAL B CG1 1 
ATOM   2290 C CG2 . VAL B  1 45  ? -23.450  -24.270 -20.595 1.00 78.70  ?  1519 VAL B CG2 1 
ATOM   2291 N N   . THR B  1 46  ? -24.960  -21.357 -24.005 1.00 95.74  ?  1520 THR B N   1 
ATOM   2292 C CA  . THR B  1 46  ? -25.027  -20.209 -24.928 1.00 103.19 ?  1520 THR B CA  1 
ATOM   2293 C C   . THR B  1 46  ? -26.415  -19.512 -24.793 1.00 102.74 ?  1520 THR B C   1 
ATOM   2294 O O   . THR B  1 46  ? -26.527  -18.299 -25.008 1.00 95.24  ?  1520 THR B O   1 
ATOM   2295 C CB  . THR B  1 46  ? -24.589  -20.552 -26.385 1.00 106.43 ?  1520 THR B CB  1 
ATOM   2296 O OG1 . THR B  1 46  ? -24.911  -19.476 -27.273 1.00 100.84 ?  1520 THR B OG1 1 
ATOM   2297 C CG2 . THR B  1 46  ? -25.192  -21.814 -26.919 1.00 106.34 ?  1520 THR B CG2 1 
ATOM   2298 N N   . MET B  1 47  ? -27.442  -20.272 -24.367 1.00 110.39 ?  1521 MET B N   1 
ATOM   2299 C CA  . MET B  1 47  ? -28.782  -19.745 -24.105 1.00 112.70 ?  1521 MET B CA  1 
ATOM   2300 C C   . MET B  1 47  ? -28.842  -19.099 -22.704 1.00 114.13 ?  1521 MET B C   1 
ATOM   2301 O O   . MET B  1 47  ? -29.795  -18.379 -22.396 1.00 117.10 ?  1521 MET B O   1 
ATOM   2302 C CB  . MET B  1 47  ? -29.843  -20.837 -24.293 1.00 112.56 ?  1521 MET B CB  1 
ATOM   2303 C CG  . MET B  1 47  ? -30.296  -20.961 -25.736 1.00 116.14 ?  1521 MET B CG  1 
ATOM   2304 S SD  . MET B  1 47  ? -31.204  -22.465 -26.173 1.00 118.28 ?  1521 MET B SD  1 
ATOM   2305 C CE  . MET B  1 47  ? -32.660  -22.285 -25.177 1.00 121.43 ?  1521 MET B CE  1 
ATOM   2306 N N   . MET B  1 48  ? -27.799  -19.348 -21.874 1.00 102.46 ?  1522 MET B N   1 
ATOM   2307 C CA  . MET B  1 48  ? -27.597  -18.789 -20.534 1.00 90.49  ?  1522 MET B CA  1 
ATOM   2308 C C   . MET B  1 48  ? -26.851  -17.440 -20.614 1.00 85.30  ?  1522 MET B C   1 
ATOM   2309 O O   . MET B  1 48  ? -26.704  -16.761 -19.593 1.00 75.69  ?  1522 MET B O   1 
ATOM   2310 C CB  . MET B  1 48  ? -26.825  -19.777 -19.649 1.00 81.69  ?  1522 MET B CB  1 
ATOM   2311 C CG  . MET B  1 48  ? -27.707  -20.724 -18.898 1.00 82.23  ?  1522 MET B CG  1 
ATOM   2312 S SD  . MET B  1 48  ? -26.786  -22.017 -18.013 1.00 84.90  ?  1522 MET B SD  1 
ATOM   2313 C CE  . MET B  1 48  ? -26.008  -21.052 -16.684 1.00 84.50  ?  1522 MET B CE  1 
ATOM   2314 N N   . VAL B  1 49  ? -26.384  -17.055 -21.829 1.00 84.11  ?  1523 VAL B N   1 
ATOM   2315 C CA  . VAL B  1 49  ? -25.684  -15.780 -22.059 1.00 92.46  ?  1523 VAL B CA  1 
ATOM   2316 C C   . VAL B  1 49  ? -26.702  -14.677 -22.450 1.00 97.99  ?  1523 VAL B C   1 
ATOM   2317 O O   . VAL B  1 49  ? -26.330  -13.628 -22.997 1.00 92.43  ?  1523 VAL B O   1 
ATOM   2318 C CB  . VAL B  1 49  ? -24.461  -15.864 -23.030 1.00 96.61  ?  1523 VAL B CB  1 
ATOM   2319 C CG1 . VAL B  1 49  ? -23.468  -14.734 -22.755 1.00 96.41  ?  1523 VAL B CG1 1 
ATOM   2320 C CG2 . VAL B  1 49  ? -23.750  -17.208 -22.937 1.00 89.76  ?  1523 VAL B CG2 1 
ATOM   2321 N N   . GLU B  1 50  ? -27.992  -14.922 -22.139 1.00 109.10 ?  1524 GLU B N   1 
ATOM   2322 C CA  . GLU B  1 50  ? -29.081  -13.982 -22.375 1.00 115.70 ?  1524 GLU B CA  1 
ATOM   2323 C C   . GLU B  1 50  ? -28.987  -12.870 -21.333 1.00 108.81 ?  1524 GLU B C   1 
ATOM   2324 O O   . GLU B  1 50  ? -29.072  -13.128 -20.126 1.00 107.00 ?  1524 GLU B O   1 
ATOM   2325 C CB  . GLU B  1 50  ? -30.447  -14.687 -22.331 1.00 120.57 ?  1524 GLU B CB  1 
ATOM   2326 C CG  . GLU B  1 50  ? -30.779  -15.459 -23.596 1.00 128.26 ?  1524 GLU B CG  1 
ATOM   2327 C CD  . GLU B  1 50  ? -31.173  -14.629 -24.803 1.00 123.14 ?  1524 GLU B CD  1 
ATOM   2328 O OE1 . GLU B  1 50  ? -30.392  -14.592 -25.783 1.00 124.69 ?  1524 GLU B OE1 1 
ATOM   2329 O OE2 . GLU B  1 50  ? -32.275  -14.035 -24.778 1.00 105.00 -1 1524 GLU B OE2 1 
ATOM   2330 N N   . LYS B  1 51  ? -28.730  -11.648 -21.809 1.00 103.00 ?  1525 LYS B N   1 
ATOM   2331 C CA  . LYS B  1 51  ? -28.573  -10.465 -20.971 1.00 102.88 ?  1525 LYS B CA  1 
ATOM   2332 C C   . LYS B  1 51  ? -29.608  -9.402  -21.341 1.00 99.23  ?  1525 LYS B C   1 
ATOM   2333 O O   . LYS B  1 51  ? -30.254  -9.504  -22.388 1.00 93.50  ?  1525 LYS B O   1 
ATOM   2334 C CB  . LYS B  1 51  ? -27.142  -9.908  -21.095 1.00 117.23 ?  1525 LYS B CB  1 
ATOM   2335 C CG  . LYS B  1 51  ? -26.079  -10.762 -20.405 1.00 129.13 ?  1525 LYS B CG  1 
ATOM   2336 C CD  . LYS B  1 51  ? -24.670  -10.489 -20.946 1.00 139.13 ?  1525 LYS B CD  1 
ATOM   2337 C CE  . LYS B  1 51  ? -23.851  -9.536  -20.102 1.00 139.21 ?  1525 LYS B CE  1 
ATOM   2338 N NZ  . LYS B  1 51  ? -24.299  -8.122  -20.237 1.00 143.01 1  1525 LYS B NZ  1 
ATOM   2339 N N   . GLU B  1 52  ? -29.769  -8.391  -20.468 1.00 108.20 ?  1526 GLU B N   1 
ATOM   2340 C CA  . GLU B  1 52  ? -30.693  -7.271  -20.651 1.00 113.89 ?  1526 GLU B CA  1 
ATOM   2341 C C   . GLU B  1 52  ? -30.194  -6.288  -21.729 1.00 111.97 ?  1526 GLU B C   1 
ATOM   2342 O O   . GLU B  1 52  ? -31.020  -5.671  -22.406 1.00 104.14 ?  1526 GLU B O   1 
ATOM   2343 C CB  . GLU B  1 52  ? -30.913  -6.547  -19.311 1.00 118.72 ?  1526 GLU B CB  1 
ATOM   2344 C CG  . GLU B  1 52  ? -32.204  -5.749  -19.251 1.00 126.38 ?  1526 GLU B CG  1 
ATOM   2345 C CD  . GLU B  1 52  ? -32.074  -4.245  -19.420 1.00 129.93 ?  1526 GLU B CD  1 
ATOM   2346 O OE1 . GLU B  1 52  ? -31.387  -3.607  -18.587 1.00 123.81 ?  1526 GLU B OE1 1 
ATOM   2347 O OE2 . GLU B  1 52  ? -32.721  -3.695  -20.342 1.00 130.61 -1 1526 GLU B OE2 1 
ATOM   2348 N N   . GLY B  1 53  ? -28.862  -6.175  -21.864 1.00 115.69 ?  1527 GLY B N   1 
ATOM   2349 C CA  . GLY B  1 53  ? -28.136  -5.297  -22.783 1.00 115.06 ?  1527 GLY B CA  1 
ATOM   2350 C C   . GLY B  1 53  ? -28.705  -5.106  -24.183 1.00 117.04 ?  1527 GLY B C   1 
ATOM   2351 O O   . GLY B  1 53  ? -29.536  -4.218  -24.384 1.00 135.25 ?  1527 GLY B O   1 
ATOM   2352 N N   . GLN B  1 54  ? -28.262  -5.888  -25.186 1.00 104.56 ?  1528 GLN B N   1 
ATOM   2353 C CA  . GLN B  1 54  ? -27.269  -6.955  -25.085 1.00 99.59  ?  1528 GLN B CA  1 
ATOM   2354 C C   . GLN B  1 54  ? -26.077  -6.661  -26.017 1.00 104.68 ?  1528 GLN B C   1 
ATOM   2355 O O   . GLN B  1 54  ? -25.011  -7.260  -25.849 1.00 120.11 ?  1528 GLN B O   1 
ATOM   2356 C CB  . GLN B  1 54  ? -27.926  -8.297  -25.440 1.00 102.52 ?  1528 GLN B CB  1 
ATOM   2357 C CG  . GLN B  1 54  ? -27.192  -9.523  -24.904 1.00 106.25 ?  1528 GLN B CG  1 
ATOM   2358 C CD  . GLN B  1 54  ? -27.770  -10.822 -25.416 1.00 113.59 ?  1528 GLN B CD  1 
ATOM   2359 O OE1 . GLN B  1 54  ? -27.915  -11.791 -24.666 1.00 112.73 ?  1528 GLN B OE1 1 
ATOM   2360 N NE2 . GLN B  1 54  ? -28.095  -10.890 -26.707 1.00 116.86 ?  1528 GLN B NE2 1 
ATOM   2361 N N   . SER B  1 55  ? -26.267  -5.701  -26.964 1.00 110.23 ?  1529 SER B N   1 
ATOM   2362 C CA  . SER B  1 55  ? -25.374  -5.198  -28.031 1.00 118.88 ?  1529 SER B CA  1 
ATOM   2363 C C   . SER B  1 55  ? -25.621  -5.923  -29.346 1.00 122.45 ?  1529 SER B C   1 
ATOM   2364 O O   . SER B  1 55  ? -25.779  -7.143  -29.344 1.00 121.33 ?  1529 SER B O   1 
ATOM   2365 C CB  . SER B  1 55  ? -23.890  -5.200  -27.645 1.00 129.28 ?  1529 SER B CB  1 
ATOM   2366 O OG  . SER B  1 55  ? -23.252  -6.462  -27.773 1.00 125.69 ?  1529 SER B OG  1 
ATOM   2367 N N   . GLN B  1 56  ? -25.671  -5.169  -30.465 1.00 133.78 ?  1530 GLN B N   1 
ATOM   2368 C CA  . GLN B  1 56  ? -25.912  -5.694  -31.816 1.00 146.67 ?  1530 GLN B CA  1 
ATOM   2369 C C   . GLN B  1 56  ? -24.955  -6.840  -32.172 1.00 147.65 ?  1530 GLN B C   1 
ATOM   2370 O O   . GLN B  1 56  ? -25.385  -7.819  -32.790 1.00 151.58 ?  1530 GLN B O   1 
ATOM   2371 C CB  . GLN B  1 56  ? -25.877  -4.556  -32.862 1.00 153.83 ?  1530 GLN B CB  1 
ATOM   2372 C CG  . GLN B  1 56  ? -26.165  -4.969  -34.323 1.00 149.15 ?  1530 GLN B CG  1 
ATOM   2373 C CD  . GLN B  1 56  ? -27.606  -5.311  -34.664 1.00 145.57 ?  1530 GLN B CD  1 
ATOM   2374 O OE1 . GLN B  1 56  ? -28.500  -5.395  -33.805 1.00 135.77 ?  1530 GLN B OE1 1 
ATOM   2375 N NE2 . GLN B  1 56  ? -27.858  -5.528  -35.951 1.00 146.50 ?  1530 GLN B NE2 1 
ATOM   2376 N N   . HIS B  1 57  ? -23.679  -6.732  -31.736 1.00 142.33 ?  1531 HIS B N   1 
ATOM   2377 C CA  . HIS B  1 57  ? -22.640  -7.740  -31.943 1.00 146.46 ?  1531 HIS B CA  1 
ATOM   2378 C C   . HIS B  1 57  ? -23.029  -9.061  -31.257 1.00 142.99 ?  1531 HIS B C   1 
ATOM   2379 O O   . HIS B  1 57  ? -23.244  -10.056 -31.948 1.00 136.06 ?  1531 HIS B O   1 
ATOM   2380 C CB  . HIS B  1 57  ? -21.277  -7.221  -31.439 1.00 146.22 ?  1531 HIS B CB  1 
ATOM   2381 C CG  . HIS B  1 57  ? -20.238  -8.288  -31.290 1.00 147.86 ?  1531 HIS B CG  1 
ATOM   2382 N ND1 . HIS B  1 57  ? -20.025  -8.923  -30.078 1.00 151.68 ?  1531 HIS B ND1 1 
ATOM   2383 C CD2 . HIS B  1 57  ? -19.402  -8.816  -32.214 1.00 141.62 ?  1531 HIS B CD2 1 
ATOM   2384 C CE1 . HIS B  1 57  ? -19.064  -9.805  -30.299 1.00 150.46 ?  1531 HIS B CE1 1 
ATOM   2385 N NE2 . HIS B  1 57  ? -18.654  -9.774  -31.568 1.00 147.52 ?  1531 HIS B NE2 1 
ATOM   2386 N N   . MET B  1 58  ? -23.161  -9.038  -29.911 1.00 134.29 ?  1532 MET B N   1 
ATOM   2387 C CA  . MET B  1 58  ? -23.494  -10.173 -29.043 1.00 121.04 ?  1532 MET B CA  1 
ATOM   2388 C C   . MET B  1 58  ? -24.797  -10.901 -29.410 1.00 117.07 ?  1532 MET B C   1 
ATOM   2389 O O   . MET B  1 58  ? -24.820  -12.129 -29.367 1.00 104.69 ?  1532 MET B O   1 
ATOM   2390 C CB  . MET B  1 58  ? -23.512  -9.722  -27.572 1.00 116.54 ?  1532 MET B CB  1 
ATOM   2391 C CG  . MET B  1 58  ? -23.566  -10.859 -26.561 1.00 119.16 ?  1532 MET B CG  1 
ATOM   2392 S SD  . MET B  1 58  ? -22.161  -11.991 -26.645 1.00 116.13 ?  1532 MET B SD  1 
ATOM   2393 C CE  . MET B  1 58  ? -20.862  -10.971 -25.922 1.00 122.17 ?  1532 MET B CE  1 
ATOM   2394 N N   . THR B  1 59  ? -25.867  -10.162 -29.761 1.00 122.61 ?  1533 THR B N   1 
ATOM   2395 C CA  . THR B  1 59  ? -27.159  -10.751 -30.128 1.00 129.95 ?  1533 THR B CA  1 
ATOM   2396 C C   . THR B  1 59  ? -27.016  -11.601 -31.401 1.00 137.81 ?  1533 THR B C   1 
ATOM   2397 O O   . THR B  1 59  ? -27.451  -12.753 -31.401 1.00 150.37 ?  1533 THR B O   1 
ATOM   2398 C CB  . THR B  1 59  ? -28.256  -9.673  -30.183 1.00 128.14 ?  1533 THR B CB  1 
ATOM   2399 O OG1 . THR B  1 59  ? -28.395  -9.105  -28.879 1.00 130.55 ?  1533 THR B OG1 1 
ATOM   2400 C CG2 . THR B  1 59  ? -29.610  -10.220 -30.618 1.00 127.59 ?  1533 THR B CG2 1 
ATOM   2401 N N   . GLU B  1 60  ? -26.360  -11.058 -32.447 1.00 137.19 ?  1534 GLU B N   1 
ATOM   2402 C CA  . GLU B  1 60  ? -26.112  -11.768 -33.709 1.00 132.26 ?  1534 GLU B CA  1 
ATOM   2403 C C   . GLU B  1 60  ? -25.099  -12.908 -33.540 1.00 114.15 ?  1534 GLU B C   1 
ATOM   2404 O O   . GLU B  1 60  ? -25.245  -13.939 -34.200 1.00 107.33 ?  1534 GLU B O   1 
ATOM   2405 C CB  . GLU B  1 60  ? -25.676  -10.804 -34.824 1.00 139.92 ?  1534 GLU B CB  1 
ATOM   2406 C CG  . GLU B  1 60  ? -26.839  -10.084 -35.493 1.00 141.89 ?  1534 GLU B CG  1 
ATOM   2407 C CD  . GLU B  1 60  ? -26.484  -9.223  -36.692 1.00 138.69 ?  1534 GLU B CD  1 
ATOM   2408 O OE1 . GLU B  1 60  ? -25.637  -9.652  -37.511 1.00 141.89 ?  1534 GLU B OE1 1 
ATOM   2409 O OE2 . GLU B  1 60  ? -27.099  -8.142  -36.843 1.00 128.07 -1 1534 GLU B OE2 1 
ATOM   2410 N N   . VAL B  1 61  ? -24.088  -12.721 -32.652 1.00 102.64 ?  1535 VAL B N   1 
ATOM   2411 C CA  . VAL B  1 61  ? -23.055  -13.719 -32.321 1.00 98.32  ?  1535 VAL B CA  1 
ATOM   2412 C C   . VAL B  1 61  ? -23.738  -14.975 -31.741 1.00 101.59 ?  1535 VAL B C   1 
ATOM   2413 O O   . VAL B  1 61  ? -23.497  -16.087 -32.228 1.00 100.63 ?  1535 VAL B O   1 
ATOM   2414 C CB  . VAL B  1 61  ? -21.945  -13.126 -31.393 1.00 87.94  ?  1535 VAL B CB  1 
ATOM   2415 C CG1 . VAL B  1 61  ? -21.223  -14.202 -30.577 1.00 80.72  ?  1535 VAL B CG1 1 
ATOM   2416 C CG2 . VAL B  1 61  ? -20.945  -12.303 -32.195 1.00 84.49  ?  1535 VAL B CG2 1 
ATOM   2417 N N   . LEU B  1 62  ? -24.636  -14.766 -30.745 1.00 100.10 ?  1536 LEU B N   1 
ATOM   2418 C CA  . LEU B  1 62  ? -25.416  -15.809 -30.079 1.00 102.06 ?  1536 LEU B CA  1 
ATOM   2419 C C   . LEU B  1 62  ? -26.349  -16.498 -31.071 1.00 103.88 ?  1536 LEU B C   1 
ATOM   2420 O O   . LEU B  1 62  ? -26.423  -17.731 -31.075 1.00 100.54 ?  1536 LEU B O   1 
ATOM   2421 C CB  . LEU B  1 62  ? -26.216  -15.234 -28.890 1.00 105.10 ?  1536 LEU B CB  1 
ATOM   2422 C CG  . LEU B  1 62  ? -25.431  -14.840 -27.629 1.00 105.28 ?  1536 LEU B CG  1 
ATOM   2423 C CD1 . LEU B  1 62  ? -26.306  -14.061 -26.669 1.00 110.27 ?  1536 LEU B CD1 1 
ATOM   2424 C CD2 . LEU B  1 62  ? -24.839  -16.054 -26.926 1.00 103.07 ?  1536 LEU B CD2 1 
ATOM   2425 N N   . TYR B  1 63  ? -27.020  -15.705 -31.940 1.00 101.66 ?  1537 TYR B N   1 
ATOM   2426 C CA  . TYR B  1 63  ? -27.921  -16.205 -32.982 1.00 103.93 ?  1537 TYR B CA  1 
ATOM   2427 C C   . TYR B  1 63  ? -27.188  -17.176 -33.916 1.00 107.51 ?  1537 TYR B C   1 
ATOM   2428 O O   . TYR B  1 63  ? -27.718  -18.254 -34.194 1.00 109.39 ?  1537 TYR B O   1 
ATOM   2429 C CB  . TYR B  1 63  ? -28.525  -15.048 -33.798 1.00 105.19 ?  1537 TYR B CB  1 
ATOM   2430 C CG  . TYR B  1 63  ? -29.631  -14.245 -33.142 1.00 116.99 ?  1537 TYR B CG  1 
ATOM   2431 C CD1 . TYR B  1 63  ? -30.154  -14.613 -31.904 1.00 120.26 ?  1537 TYR B CD1 1 
ATOM   2432 C CD2 . TYR B  1 63  ? -30.165  -13.121 -33.766 1.00 124.30 ?  1537 TYR B CD2 1 
ATOM   2433 C CE1 . TYR B  1 63  ? -31.171  -13.873 -31.299 1.00 120.39 ?  1537 TYR B CE1 1 
ATOM   2434 C CE2 . TYR B  1 63  ? -31.188  -12.379 -33.175 1.00 120.88 ?  1537 TYR B CE2 1 
ATOM   2435 C CZ  . TYR B  1 63  ? -31.692  -12.762 -31.942 1.00 120.03 ?  1537 TYR B CZ  1 
ATOM   2436 O OH  . TYR B  1 63  ? -32.688  -12.022 -31.353 1.00 125.64 ?  1537 TYR B OH  1 
ATOM   2437 N N   . TRP B  1 64  ? -25.954  -16.816 -34.349 1.00 103.63 ?  1538 TRP B N   1 
ATOM   2438 C CA  . TRP B  1 64  ? -25.119  -17.645 -35.220 1.00 95.63  ?  1538 TRP B CA  1 
ATOM   2439 C C   . TRP B  1 64  ? -24.623  -18.935 -34.548 1.00 89.57  ?  1538 TRP B C   1 
ATOM   2440 O O   . TRP B  1 64  ? -24.590  -19.977 -35.213 1.00 79.75  ?  1538 TRP B O   1 
ATOM   2441 C CB  . TRP B  1 64  ? -23.953  -16.850 -35.822 1.00 96.87  ?  1538 TRP B CB  1 
ATOM   2442 C CG  . TRP B  1 64  ? -24.329  -16.028 -37.027 1.00 105.36 ?  1538 TRP B CG  1 
ATOM   2443 C CD1 . TRP B  1 64  ? -24.249  -14.669 -37.148 1.00 111.91 ?  1538 TRP B CD1 1 
ATOM   2444 C CD2 . TRP B  1 64  ? -24.819  -16.516 -38.290 1.00 99.98  ?  1538 TRP B CD2 1 
ATOM   2445 N NE1 . TRP B  1 64  ? -24.669  -14.278 -38.403 1.00 110.45 ?  1538 TRP B NE1 1 
ATOM   2446 C CE2 . TRP B  1 64  ? -25.020  -15.391 -39.125 1.00 100.05 ?  1538 TRP B CE2 1 
ATOM   2447 C CE3 . TRP B  1 64  ? -25.113  -17.796 -38.797 1.00 91.74  ?  1538 TRP B CE3 1 
ATOM   2448 C CZ2 . TRP B  1 64  ? -25.507  -15.507 -40.435 1.00 90.07  ?  1538 TRP B CZ2 1 
ATOM   2449 C CZ3 . TRP B  1 64  ? -25.596  -17.907 -40.092 1.00 89.55  ?  1538 TRP B CZ3 1 
ATOM   2450 C CH2 . TRP B  1 64  ? -25.781  -16.774 -40.898 1.00 86.98  ?  1538 TRP B CH2 1 
ATOM   2451 N N   . ILE B  1 65  ? -24.259  -18.879 -33.237 1.00 87.32  ?  1539 ILE B N   1 
ATOM   2452 C CA  . ILE B  1 65  ? -23.817  -20.064 -32.478 1.00 88.86  ?  1539 ILE B CA  1 
ATOM   2453 C C   . ILE B  1 65  ? -24.943  -21.108 -32.467 1.00 93.69  ?  1539 ILE B C   1 
ATOM   2454 O O   . ILE B  1 65  ? -24.687  -22.293 -32.684 1.00 81.99  ?  1539 ILE B O   1 
ATOM   2455 C CB  . ILE B  1 65  ? -23.319  -19.709 -31.046 1.00 85.66  ?  1539 ILE B CB  1 
ATOM   2456 C CG1 . ILE B  1 65  ? -22.044  -18.839 -31.103 1.00 86.10  ?  1539 ILE B CG1 1 
ATOM   2457 C CG2 . ILE B  1 65  ? -23.087  -20.974 -30.186 1.00 80.78  ?  1539 ILE B CG2 1 
ATOM   2458 C CD1 . ILE B  1 65  ? -21.843  -17.872 -29.880 1.00 88.58  ?  1539 ILE B CD1 1 
ATOM   2459 N N   . ASN B  1 66  ? -26.191  -20.651 -32.256 1.00 103.08 ?  1540 ASN B N   1 
ATOM   2460 C CA  . ASN B  1 66  ? -27.371  -21.511 -32.258 1.00 107.55 ?  1540 ASN B CA  1 
ATOM   2461 C C   . ASN B  1 66  ? -27.592  -22.141 -33.634 1.00 108.53 ?  1540 ASN B C   1 
ATOM   2462 O O   . ASN B  1 66  ? -27.885  -23.332 -33.691 1.00 109.59 ?  1540 ASN B O   1 
ATOM   2463 C CB  . ASN B  1 66  ? -28.604  -20.754 -31.783 1.00 102.78 ?  1540 ASN B CB  1 
ATOM   2464 C CG  . ASN B  1 66  ? -28.646  -20.536 -30.283 1.00 99.81  ?  1540 ASN B CG  1 
ATOM   2465 O OD1 . ASN B  1 66  ? -28.958  -21.445 -29.501 1.00 91.01  ?  1540 ASN B OD1 1 
ATOM   2466 N ND2 . ASN B  1 66  ? -28.391  -19.308 -29.852 1.00 100.40 ?  1540 ASN B ND2 1 
ATOM   2467 N N   . VAL B  1 67  ? -27.382  -21.363 -34.734 1.00 102.95 ?  1541 VAL B N   1 
ATOM   2468 C CA  . VAL B  1 67  ? -27.493  -21.810 -36.139 1.00 96.04  ?  1541 VAL B CA  1 
ATOM   2469 C C   . VAL B  1 67  ? -26.637  -23.071 -36.324 1.00 90.94  ?  1541 VAL B C   1 
ATOM   2470 O O   . VAL B  1 67  ? -27.138  -24.089 -36.804 1.00 83.24  ?  1541 VAL B O   1 
ATOM   2471 C CB  . VAL B  1 67  ? -27.114  -20.673 -37.142 1.00 94.24  ?  1541 VAL B CB  1 
ATOM   2472 C CG1 . VAL B  1 67  ? -26.879  -21.201 -38.555 1.00 89.89  ?  1541 VAL B CG1 1 
ATOM   2473 C CG2 . VAL B  1 67  ? -28.162  -19.566 -37.152 1.00 94.96  ?  1541 VAL B CG2 1 
ATOM   2474 N N   . VAL B  1 68  ? -25.374  -23.004 -35.861 1.00 88.13  ?  1542 VAL B N   1 
ATOM   2475 C CA  . VAL B  1 68  ? -24.383  -24.082 -35.871 1.00 85.27  ?  1542 VAL B CA  1 
ATOM   2476 C C   . VAL B  1 68  ? -24.953  -25.344 -35.176 1.00 83.16  ?  1542 VAL B C   1 
ATOM   2477 O O   . VAL B  1 68  ? -24.924  -26.430 -35.765 1.00 65.52  ?  1542 VAL B O   1 
ATOM   2478 C CB  . VAL B  1 68  ? -23.066  -23.580 -35.215 1.00 82.45  ?  1542 VAL B CB  1 
ATOM   2479 C CG1 . VAL B  1 68  ? -22.057  -24.708 -35.015 1.00 81.90  ?  1542 VAL B CG1 1 
ATOM   2480 C CG2 . VAL B  1 68  ? -22.454  -22.432 -36.010 1.00 78.61  ?  1542 VAL B CG2 1 
ATOM   2481 N N   . PHE B  1 69  ? -25.501  -25.171 -33.943 1.00 88.07  ?  1543 PHE B N   1 
ATOM   2482 C CA  . PHE B  1 69  ? -26.122  -26.218 -33.119 1.00 88.73  ?  1543 PHE B CA  1 
ATOM   2483 C C   . PHE B  1 69  ? -27.335  -26.856 -33.808 1.00 92.98  ?  1543 PHE B C   1 
ATOM   2484 O O   . PHE B  1 69  ? -27.429  -28.082 -33.830 1.00 91.44  ?  1543 PHE B O   1 
ATOM   2485 C CB  . PHE B  1 69  ? -26.532  -25.671 -31.740 1.00 84.25  ?  1543 PHE B CB  1 
ATOM   2486 C CG  . PHE B  1 69  ? -25.446  -25.663 -30.695 1.00 79.91  ?  1543 PHE B CG  1 
ATOM   2487 C CD1 . PHE B  1 69  ? -25.008  -26.848 -30.113 1.00 79.86  ?  1543 PHE B CD1 1 
ATOM   2488 C CD2 . PHE B  1 69  ? -24.906  -24.465 -30.241 1.00 79.26  ?  1543 PHE B CD2 1 
ATOM   2489 C CE1 . PHE B  1 69  ? -24.017  -26.839 -29.127 1.00 82.06  ?  1543 PHE B CE1 1 
ATOM   2490 C CE2 . PHE B  1 69  ? -23.918  -24.455 -29.248 1.00 82.58  ?  1543 PHE B CE2 1 
ATOM   2491 C CZ  . PHE B  1 69  ? -23.482  -25.643 -28.698 1.00 81.13  ?  1543 PHE B CZ  1 
ATOM   2492 N N   . ILE B  1 70  ? -28.244  -26.028 -34.382 1.00 89.88  ?  1544 ILE B N   1 
ATOM   2493 C CA  . ILE B  1 70  ? -29.438  -26.467 -35.112 1.00 88.79  ?  1544 ILE B CA  1 
ATOM   2494 C C   . ILE B  1 70  ? -29.016  -27.386 -36.275 1.00 93.81  ?  1544 ILE B C   1 
ATOM   2495 O O   . ILE B  1 70  ? -29.612  -28.453 -36.440 1.00 92.68  ?  1544 ILE B O   1 
ATOM   2496 C CB  . ILE B  1 70  ? -30.322  -25.259 -35.550 1.00 92.03  ?  1544 ILE B CB  1 
ATOM   2497 C CG1 . ILE B  1 70  ? -30.853  -24.491 -34.315 1.00 95.91  ?  1544 ILE B CG1 1 
ATOM   2498 C CG2 . ILE B  1 70  ? -31.495  -25.712 -36.428 1.00 95.97  ?  1544 ILE B CG2 1 
ATOM   2499 C CD1 . ILE B  1 70  ? -31.049  -22.990 -34.488 1.00 99.07  ?  1544 ILE B CD1 1 
ATOM   2500 N N   . ILE B  1 71  ? -27.938  -27.004 -37.018 1.00 96.10  ?  1545 ILE B N   1 
ATOM   2501 C CA  . ILE B  1 71  ? -27.342  -27.783 -38.118 1.00 89.85  ?  1545 ILE B CA  1 
ATOM   2502 C C   . ILE B  1 71  ? -26.867  -29.142 -37.574 1.00 91.75  ?  1545 ILE B C   1 
ATOM   2503 O O   . ILE B  1 71  ? -27.306  -30.179 -38.077 1.00 91.53  ?  1545 ILE B O   1 
ATOM   2504 C CB  . ILE B  1 71  ? -26.211  -26.980 -38.828 1.00 84.60  ?  1545 ILE B CB  1 
ATOM   2505 C CG1 . ILE B  1 71  ? -26.802  -25.810 -39.629 1.00 84.16  ?  1545 ILE B CG1 1 
ATOM   2506 C CG2 . ILE B  1 71  ? -25.340  -27.874 -39.727 1.00 85.72  ?  1545 ILE B CG2 1 
ATOM   2507 C CD1 . ILE B  1 71  ? -25.854  -24.641 -39.836 1.00 86.36  ?  1545 ILE B CD1 1 
ATOM   2508 N N   . LEU B  1 72  ? -26.027  -29.121 -36.510 1.00 91.70  ?  1546 LEU B N   1 
ATOM   2509 C CA  . LEU B  1 72  ? -25.503  -30.305 -35.819 1.00 94.61  ?  1546 LEU B CA  1 
ATOM   2510 C C   . LEU B  1 72  ? -26.629  -31.242 -35.357 1.00 100.37 ?  1546 LEU B C   1 
ATOM   2511 O O   . LEU B  1 72  ? -26.493  -32.454 -35.503 1.00 106.03 ?  1546 LEU B O   1 
ATOM   2512 C CB  . LEU B  1 72  ? -24.643  -29.899 -34.610 1.00 92.19  ?  1546 LEU B CB  1 
ATOM   2513 C CG  . LEU B  1 72  ? -23.250  -29.345 -34.903 1.00 94.17  ?  1546 LEU B CG  1 
ATOM   2514 C CD1 . LEU B  1 72  ? -22.904  -28.232 -33.941 1.00 95.13  ?  1546 LEU B CD1 1 
ATOM   2515 C CD2 . LEU B  1 72  ? -22.198  -30.432 -34.794 1.00 97.55  ?  1546 LEU B CD2 1 
ATOM   2516 N N   . PHE B  1 73  ? -27.736  -30.682 -34.820 1.00 99.90  ?  1547 PHE B N   1 
ATOM   2517 C CA  . PHE B  1 73  ? -28.897  -31.448 -34.354 1.00 94.82  ?  1547 PHE B CA  1 
ATOM   2518 C C   . PHE B  1 73  ? -29.718  -32.046 -35.499 1.00 95.74  ?  1547 PHE B C   1 
ATOM   2519 O O   . PHE B  1 73  ? -30.336  -33.103 -35.318 1.00 95.45  ?  1547 PHE B O   1 
ATOM   2520 C CB  . PHE B  1 73  ? -29.781  -30.625 -33.399 1.00 94.05  ?  1547 PHE B CB  1 
ATOM   2521 C CG  . PHE B  1 73  ? -29.172  -30.396 -32.039 1.00 84.54  ?  1547 PHE B CG  1 
ATOM   2522 C CD1 . PHE B  1 73  ? -28.878  -31.465 -31.202 1.00 83.92  ?  1547 PHE B CD1 1 
ATOM   2523 C CD2 . PHE B  1 73  ? -28.936  -29.110 -31.575 1.00 84.40  ?  1547 PHE B CD2 1 
ATOM   2524 C CE1 . PHE B  1 73  ? -28.310  -31.253 -29.944 1.00 87.89  ?  1547 PHE B CE1 1 
ATOM   2525 C CE2 . PHE B  1 73  ? -28.364  -28.896 -30.319 1.00 86.02  ?  1547 PHE B CE2 1 
ATOM   2526 C CZ  . PHE B  1 73  ? -28.064  -29.969 -29.506 1.00 88.34  ?  1547 PHE B CZ  1 
ATOM   2527 N N   . THR B  1 74  ? -29.733  -31.368 -36.668 1.00 94.62  ?  1548 THR B N   1 
ATOM   2528 C CA  . THR B  1 74  ? -30.424  -31.853 -37.864 1.00 103.09 ?  1548 THR B CA  1 
ATOM   2529 C C   . THR B  1 74  ? -29.595  -33.011 -38.445 1.00 115.93 ?  1548 THR B C   1 
ATOM   2530 O O   . THR B  1 74  ? -30.166  -34.025 -38.849 1.00 127.68 ?  1548 THR B O   1 
ATOM   2531 C CB  . THR B  1 74  ? -30.679  -30.710 -38.854 1.00 99.23  ?  1548 THR B CB  1 
ATOM   2532 O OG1 . THR B  1 74  ? -31.291  -29.623 -38.160 1.00 95.60  ?  1548 THR B OG1 1 
ATOM   2533 C CG2 . THR B  1 74  ? -31.573  -31.133 -40.020 1.00 93.76  ?  1548 THR B CG2 1 
ATOM   2534 N N   . ILE B  1 75  ? -28.243  -32.865 -38.433 1.00 114.40 ?  1549 ILE B N   1 
ATOM   2535 C CA  . ILE B  1 75  ? -27.268  -33.878 -38.856 1.00 103.16 ?  1549 ILE B CA  1 
ATOM   2536 C C   . ILE B  1 75  ? -27.483  -35.112 -37.965 1.00 101.02 ?  1549 ILE B C   1 
ATOM   2537 O O   . ILE B  1 75  ? -27.573  -36.226 -38.476 1.00 91.05  ?  1549 ILE B O   1 
ATOM   2538 C CB  . ILE B  1 75  ? -25.818  -33.306 -38.752 1.00 98.32  ?  1549 ILE B CB  1 
ATOM   2539 C CG1 . ILE B  1 75  ? -25.506  -32.366 -39.935 1.00 95.30  ?  1549 ILE B CG1 1 
ATOM   2540 C CG2 . ILE B  1 75  ? -24.759  -34.412 -38.633 1.00 96.38  ?  1549 ILE B CG2 1 
ATOM   2541 C CD1 . ILE B  1 75  ? -24.260  -31.488 -39.763 1.00 93.76  ?  1549 ILE B CD1 1 
ATOM   2542 N N   . GLU B  1 76  ? -27.622  -34.873 -36.641 1.00 105.35 ?  1550 GLU B N   1 
ATOM   2543 C CA  . GLU B  1 76  ? -27.866  -35.843 -35.575 1.00 103.98 ?  1550 GLU B CA  1 
ATOM   2544 C C   . GLU B  1 76  ? -29.143  -36.662 -35.831 1.00 94.23  ?  1550 GLU B C   1 
ATOM   2545 O O   . GLU B  1 76  ? -29.112  -37.882 -35.664 1.00 83.22  ?  1550 GLU B O   1 
ATOM   2546 C CB  . GLU B  1 76  ? -27.922  -35.106 -34.218 1.00 105.16 ?  1550 GLU B CB  1 
ATOM   2547 C CG  . GLU B  1 76  ? -28.171  -35.966 -32.988 1.00 102.40 ?  1550 GLU B CG  1 
ATOM   2548 C CD  . GLU B  1 76  ? -29.503  -35.776 -32.281 1.00 99.77  ?  1550 GLU B CD  1 
ATOM   2549 O OE1 . GLU B  1 76  ? -30.206  -34.773 -32.555 1.00 104.06 ?  1550 GLU B OE1 1 
ATOM   2550 O OE2 . GLU B  1 76  ? -29.844  -36.645 -31.445 1.00 95.29  -1 1550 GLU B OE2 1 
ATOM   2551 N N   . ILE B  1 77  ? -30.249  -36.011 -36.243 1.00 96.37  ?  1551 ILE B N   1 
ATOM   2552 C CA  . ILE B  1 77  ? -31.490  -36.743 -36.506 1.00 102.71 ?  1551 ILE B CA  1 
ATOM   2553 C C   . ILE B  1 77  ? -31.431  -37.451 -37.883 1.00 101.81 ?  1551 ILE B C   1 
ATOM   2554 O O   . ILE B  1 77  ? -32.051  -38.505 -38.032 1.00 100.89 ?  1551 ILE B O   1 
ATOM   2555 C CB  . ILE B  1 77  ? -32.779  -35.890 -36.282 1.00 99.27  ?  1551 ILE B CB  1 
ATOM   2556 C CG1 . ILE B  1 77  ? -34.006  -36.774 -35.948 1.00 91.95  ?  1551 ILE B CG1 1 
ATOM   2557 C CG2 . ILE B  1 77  ? -33.070  -34.919 -37.427 1.00 100.83 ?  1551 ILE B CG2 1 
ATOM   2558 C CD1 . ILE B  1 77  ? -34.032  -37.329 -34.503 1.00 93.55  ?  1551 ILE B CD1 1 
ATOM   2559 N N   . ILE B  1 78  ? -30.653  -36.905 -38.858 1.00 99.73  ?  1552 ILE B N   1 
ATOM   2560 C CA  . ILE B  1 78  ? -30.461  -37.506 -40.190 1.00 95.40  ?  1552 ILE B CA  1 
ATOM   2561 C C   . ILE B  1 78  ? -29.864  -38.924 -40.043 1.00 98.30  ?  1552 ILE B C   1 
ATOM   2562 O O   . ILE B  1 78  ? -30.456  -39.880 -40.545 1.00 97.82  ?  1552 ILE B O   1 
ATOM   2563 C CB  . ILE B  1 78  ? -29.669  -36.561 -41.156 1.00 86.36  ?  1552 ILE B CB  1 
ATOM   2564 C CG1 . ILE B  1 78  ? -30.619  -35.528 -41.787 1.00 84.25  ?  1552 ILE B CG1 1 
ATOM   2565 C CG2 . ILE B  1 78  ? -28.898  -37.333 -42.251 1.00 82.22  ?  1552 ILE B CG2 1 
ATOM   2566 C CD1 . ILE B  1 78  ? -29.960  -34.248 -42.225 1.00 82.10  ?  1552 ILE B CD1 1 
ATOM   2567 N N   . LEU B  1 79  ? -28.746  -39.052 -39.290 1.00 100.73 ?  1553 LEU B N   1 
ATOM   2568 C CA  . LEU B  1 79  ? -28.070  -40.321 -38.996 1.00 102.36 ?  1553 LEU B CA  1 
ATOM   2569 C C   . LEU B  1 79  ? -29.025  -41.268 -38.257 1.00 102.99 ?  1553 LEU B C   1 
ATOM   2570 O O   . LEU B  1 79  ? -29.157  -42.429 -38.648 1.00 104.98 ?  1553 LEU B O   1 
ATOM   2571 C CB  . LEU B  1 79  ? -26.819  -40.085 -38.124 1.00 102.24 ?  1553 LEU B CB  1 
ATOM   2572 C CG  . LEU B  1 79  ? -25.692  -39.249 -38.718 1.00 102.39 ?  1553 LEU B CG  1 
ATOM   2573 C CD1 . LEU B  1 79  ? -25.114  -38.318 -37.682 1.00 105.18 ?  1553 LEU B CD1 1 
ATOM   2574 C CD2 . LEU B  1 79  ? -24.594  -40.131 -39.255 1.00 100.44 ?  1553 LEU B CD2 1 
ATOM   2575 N N   . ARG B  1 80  ? -29.710  -40.746 -37.212 1.00 101.22 ?  1554 ARG B N   1 
ATOM   2576 C CA  . ARG B  1 80  ? -30.646  -41.464 -36.340 1.00 106.40 ?  1554 ARG B CA  1 
ATOM   2577 C C   . ARG B  1 80  ? -31.812  -42.130 -37.065 1.00 121.53 ?  1554 ARG B C   1 
ATOM   2578 O O   . ARG B  1 80  ? -32.156  -43.269 -36.742 1.00 137.25 ?  1554 ARG B O   1 
ATOM   2579 C CB  . ARG B  1 80  ? -31.165  -40.543 -35.224 1.00 99.38  ?  1554 ARG B CB  1 
ATOM   2580 C CG  . ARG B  1 80  ? -30.255  -40.483 -34.000 1.00 95.22  ?  1554 ARG B CG  1 
ATOM   2581 C CD  . ARG B  1 80  ? -30.867  -39.685 -32.866 1.00 92.63  ?  1554 ARG B CD  1 
ATOM   2582 N NE  . ARG B  1 80  ? -31.943  -40.420 -32.193 1.00 93.21  ?  1554 ARG B NE  1 
ATOM   2583 C CZ  . ARG B  1 80  ? -32.800  -39.876 -31.333 1.00 99.98  ?  1554 ARG B CZ  1 
ATOM   2584 N NH1 . ARG B  1 80  ? -32.717  -38.586 -31.027 1.00 103.73 1  1554 ARG B NH1 1 
ATOM   2585 N NH2 . ARG B  1 80  ? -33.748  -40.617 -30.774 1.00 100.77 ?  1554 ARG B NH2 1 
ATOM   2586 N N   . ILE B  1 81  ? -32.423  -41.426 -38.028 1.00 129.06 ?  1555 ILE B N   1 
ATOM   2587 C CA  . ILE B  1 81  ? -33.566  -41.955 -38.768 1.00 129.30 ?  1555 ILE B CA  1 
ATOM   2588 C C   . ILE B  1 81  ? -33.081  -42.904 -39.883 1.00 136.21 ?  1555 ILE B C   1 
ATOM   2589 O O   . ILE B  1 81  ? -33.797  -43.846 -40.210 1.00 140.54 ?  1555 ILE B O   1 
ATOM   2590 C CB  . ILE B  1 81  ? -34.547  -40.829 -39.246 1.00 126.06 ?  1555 ILE B CB  1 
ATOM   2591 C CG1 . ILE B  1 81  ? -34.939  -39.822 -38.109 1.00 125.11 ?  1555 ILE B CG1 1 
ATOM   2592 C CG2 . ILE B  1 81  ? -35.799  -41.373 -39.936 1.00 125.37 ?  1555 ILE B CG2 1 
ATOM   2593 C CD1 . ILE B  1 81  ? -35.249  -40.363 -36.611 1.00 121.58 ?  1555 ILE B CD1 1 
ATOM   2594 N N   . TYR B  1 82  ? -31.849  -42.709 -40.413 1.00 132.83 ?  1556 TYR B N   1 
ATOM   2595 C CA  . TYR B  1 82  ? -31.299  -43.590 -41.452 1.00 131.82 ?  1556 TYR B CA  1 
ATOM   2596 C C   . TYR B  1 82  ? -30.911  -44.968 -40.921 1.00 125.73 ?  1556 TYR B C   1 
ATOM   2597 O O   . TYR B  1 82  ? -31.204  -45.969 -41.577 1.00 133.12 ?  1556 TYR B O   1 
ATOM   2598 C CB  . TYR B  1 82  ? -30.131  -42.939 -42.223 1.00 135.51 ?  1556 TYR B CB  1 
ATOM   2599 C CG  . TYR B  1 82  ? -30.539  -41.903 -43.257 1.00 149.82 ?  1556 TYR B CG  1 
ATOM   2600 C CD1 . TYR B  1 82  ? -31.808  -41.922 -43.834 1.00 156.28 ?  1556 TYR B CD1 1 
ATOM   2601 C CD2 . TYR B  1 82  ? -29.641  -40.931 -43.691 1.00 152.48 ?  1556 TYR B CD2 1 
ATOM   2602 C CE1 . TYR B  1 82  ? -32.187  -40.972 -44.785 1.00 154.80 ?  1556 TYR B CE1 1 
ATOM   2603 C CE2 . TYR B  1 82  ? -30.006  -39.981 -44.648 1.00 159.07 ?  1556 TYR B CE2 1 
ATOM   2604 C CZ  . TYR B  1 82  ? -31.281  -40.006 -45.192 1.00 158.97 ?  1556 TYR B CZ  1 
ATOM   2605 O OH  . TYR B  1 82  ? -31.646  -39.075 -46.136 1.00 154.84 ?  1556 TYR B OH  1 
ATOM   2606 N N   . VAL B  1 83  ? -30.276  -45.023 -39.736 1.00 120.35 ?  1557 VAL B N   1 
ATOM   2607 C CA  . VAL B  1 83  ? -29.848  -46.271 -39.093 1.00 123.35 ?  1557 VAL B CA  1 
ATOM   2608 C C   . VAL B  1 83  ? -31.076  -47.069 -38.579 1.00 133.07 ?  1557 VAL B C   1 
ATOM   2609 O O   . VAL B  1 83  ? -31.088  -48.299 -38.697 1.00 140.63 ?  1557 VAL B O   1 
ATOM   2610 C CB  . VAL B  1 83  ? -28.743  -46.009 -38.032 1.00 117.12 ?  1557 VAL B CB  1 
ATOM   2611 C CG1 . VAL B  1 83  ? -28.661  -47.110 -36.976 1.00 114.46 ?  1557 VAL B CG1 1 
ATOM   2612 C CG2 . VAL B  1 83  ? -27.394  -45.819 -38.715 1.00 116.96 ?  1557 VAL B CG2 1 
ATOM   2613 N N   . HIS B  1 84  ? -32.120  -46.365 -38.080 1.00 140.42 ?  1558 HIS B N   1 
ATOM   2614 C CA  . HIS B  1 84  ? -33.380  -46.963 -37.611 1.00 141.28 ?  1558 HIS B CA  1 
ATOM   2615 C C   . HIS B  1 84  ? -34.560  -46.424 -38.464 1.00 138.56 ?  1558 HIS B C   1 
ATOM   2616 O O   . HIS B  1 84  ? -35.388  -45.640 -37.983 1.00 140.35 ?  1558 HIS B O   1 
ATOM   2617 C CB  . HIS B  1 84  ? -33.583  -46.726 -36.096 1.00 141.33 ?  1558 HIS B CB  1 
ATOM   2618 C CG  . HIS B  1 84  ? -32.756  -47.616 -35.214 1.00 140.98 ?  1558 HIS B CG  1 
ATOM   2619 N ND1 . HIS B  1 84  ? -31.679  -47.123 -34.494 1.00 136.12 ?  1558 HIS B ND1 1 
ATOM   2620 C CD2 . HIS B  1 84  ? -32.888  -48.939 -34.948 1.00 141.66 ?  1558 HIS B CD2 1 
ATOM   2621 C CE1 . HIS B  1 84  ? -31.188  -48.156 -33.826 1.00 133.50 ?  1558 HIS B CE1 1 
ATOM   2622 N NE2 . HIS B  1 84  ? -31.883  -49.270 -34.065 1.00 134.85 ?  1558 HIS B NE2 1 
ATOM   2623 N N   . ARG B  1 85  ? -34.599  -46.846 -39.750 1.00 126.65 ?  1559 ARG B N   1 
ATOM   2624 C CA  . ARG B  1 85  ? -35.557  -46.448 -40.793 1.00 117.34 ?  1559 ARG B CA  1 
ATOM   2625 C C   . ARG B  1 85  ? -37.048  -46.562 -40.407 1.00 111.10 ?  1559 ARG B C   1 
ATOM   2626 O O   . ARG B  1 85  ? -37.794  -45.601 -40.612 1.00 94.62  ?  1559 ARG B O   1 
ATOM   2627 C CB  . ARG B  1 85  ? -35.279  -47.216 -42.102 1.00 117.49 ?  1559 ARG B CB  1 
ATOM   2628 C CG  . ARG B  1 85  ? -34.154  -46.627 -42.968 1.00 114.71 ?  1559 ARG B CG  1 
ATOM   2629 C CD  . ARG B  1 85  ? -34.644  -45.479 -43.852 1.00 116.66 ?  1559 ARG B CD  1 
ATOM   2630 N NE  . ARG B  1 85  ? -33.649  -45.044 -44.841 1.00 119.12 ?  1559 ARG B NE  1 
ATOM   2631 C CZ  . ARG B  1 85  ? -33.840  -44.064 -45.726 1.00 125.13 ?  1559 ARG B CZ  1 
ATOM   2632 N NH1 . ARG B  1 85  ? -34.989  -43.397 -45.753 1.00 122.28 1  1559 ARG B NH1 1 
ATOM   2633 N NH2 . ARG B  1 85  ? -32.881  -43.742 -46.585 1.00 127.13 ?  1559 ARG B NH2 1 
ATOM   2634 N N   . ILE B  1 86  ? -37.477  -47.723 -39.874 1.00 121.55 ?  1560 ILE B N   1 
ATOM   2635 C CA  . ILE B  1 86  ? -38.875  -47.987 -39.487 1.00 128.95 ?  1560 ILE B CA  1 
ATOM   2636 C C   . ILE B  1 86  ? -39.089  -47.795 -37.973 1.00 126.64 ?  1560 ILE B C   1 
ATOM   2637 O O   . ILE B  1 86  ? -40.184  -47.406 -37.552 1.00 131.81 ?  1560 ILE B O   1 
ATOM   2638 C CB  . ILE B  1 86  ? -39.392  -49.385 -39.984 1.00 131.88 ?  1560 ILE B CB  1 
ATOM   2639 C CG1 . ILE B  1 86  ? -38.767  -49.812 -41.352 1.00 120.39 ?  1560 ILE B CG1 1 
ATOM   2640 C CG2 . ILE B  1 86  ? -40.936  -49.416 -40.039 1.00 132.72 ?  1560 ILE B CG2 1 
ATOM   2641 C CD1 . ILE B  1 86  ? -38.686  -51.369 -41.622 1.00 107.50 ?  1560 ILE B CD1 1 
ATOM   2642 N N   . SER B  1 87  ? -38.037  -48.065 -37.167 1.00 120.22 ?  1561 SER B N   1 
ATOM   2643 C CA  . SER B  1 87  ? -38.029  -47.959 -35.702 1.00 120.95 ?  1561 SER B CA  1 
ATOM   2644 C C   . SER B  1 87  ? -38.222  -46.516 -35.170 1.00 129.26 ?  1561 SER B C   1 
ATOM   2645 O O   . SER B  1 87  ? -38.627  -46.346 -34.015 1.00 134.90 ?  1561 SER B O   1 
ATOM   2646 C CB  . SER B  1 87  ? -36.754  -48.582 -35.137 1.00 118.02 ?  1561 SER B CB  1 
ATOM   2647 O OG  . SER B  1 87  ? -36.781  -48.684 -33.722 1.00 115.09 ?  1561 SER B OG  1 
ATOM   2648 N N   . PHE B  1 88  ? -37.945  -45.493 -36.015 1.00 132.65 ?  1562 PHE B N   1 
ATOM   2649 C CA  . PHE B  1 88  ? -38.077  -44.071 -35.684 1.00 134.94 ?  1562 PHE B CA  1 
ATOM   2650 C C   . PHE B  1 88  ? -39.517  -43.680 -35.326 1.00 146.09 ?  1562 PHE B C   1 
ATOM   2651 O O   . PHE B  1 88  ? -39.722  -43.009 -34.315 1.00 158.61 ?  1562 PHE B O   1 
ATOM   2652 C CB  . PHE B  1 88  ? -37.486  -43.188 -36.809 1.00 132.73 ?  1562 PHE B CB  1 
ATOM   2653 C CG  . PHE B  1 88  ? -38.429  -42.407 -37.705 1.00 132.75 ?  1562 PHE B CG  1 
ATOM   2654 C CD1 . PHE B  1 88  ? -39.102  -43.031 -38.750 1.00 123.70 ?  1562 PHE B CD1 1 
ATOM   2655 C CD2 . PHE B  1 88  ? -38.590  -41.035 -37.547 1.00 133.29 ?  1562 PHE B CD2 1 
ATOM   2656 C CE1 . PHE B  1 88  ? -39.963  -42.305 -39.582 1.00 110.50 ?  1562 PHE B CE1 1 
ATOM   2657 C CE2 . PHE B  1 88  ? -39.430  -40.306 -38.398 1.00 117.82 ?  1562 PHE B CE2 1 
ATOM   2658 C CZ  . PHE B  1 88  ? -40.112  -40.947 -39.407 1.00 105.65 ?  1562 PHE B CZ  1 
ATOM   2659 N N   . PHE B  1 89  ? -40.504  -44.132 -36.130 1.00 150.31 ?  1563 PHE B N   1 
ATOM   2660 C CA  . PHE B  1 89  ? -41.929  -43.844 -35.946 1.00 152.80 ?  1563 PHE B CA  1 
ATOM   2661 C C   . PHE B  1 89  ? -42.520  -44.592 -34.742 1.00 142.60 ?  1563 PHE B C   1 
ATOM   2662 O O   . PHE B  1 89  ? -43.382  -44.038 -34.052 1.00 132.68 ?  1563 PHE B O   1 
ATOM   2663 C CB  . PHE B  1 89  ? -42.716  -44.160 -37.233 1.00 169.53 ?  1563 PHE B CB  1 
ATOM   2664 C CG  . PHE B  1 89  ? -43.737  -43.121 -37.648 1.00 178.29 ?  1563 PHE B CG  1 
ATOM   2665 C CD1 . PHE B  1 89  ? -43.392  -42.086 -38.510 1.00 169.26 ?  1563 PHE B CD1 1 
ATOM   2666 C CD2 . PHE B  1 89  ? -45.056  -43.202 -37.209 1.00 174.45 ?  1563 PHE B CD2 1 
ATOM   2667 C CE1 . PHE B  1 89  ? -44.339  -41.134 -38.905 1.00 156.15 ?  1563 PHE B CE1 1 
ATOM   2668 C CE2 . PHE B  1 89  ? -46.003  -42.248 -37.603 1.00 163.62 ?  1563 PHE B CE2 1 
ATOM   2669 C CZ  . PHE B  1 89  ? -45.638  -41.222 -38.449 1.00 158.83 ?  1563 PHE B CZ  1 
ATOM   2670 N N   . LYS B  1 90  ? -42.055  -45.837 -34.485 1.00 136.15 ?  1564 LYS B N   1 
ATOM   2671 C CA  . LYS B  1 90  ? -42.532  -46.652 -33.363 1.00 136.29 ?  1564 LYS B CA  1 
ATOM   2672 C C   . LYS B  1 90  ? -42.120  -46.068 -32.008 1.00 126.12 ?  1564 LYS B C   1 
ATOM   2673 O O   . LYS B  1 90  ? -42.914  -46.114 -31.065 1.00 123.66 ?  1564 LYS B O   1 
ATOM   2674 C CB  . LYS B  1 90  ? -42.066  -48.115 -33.485 1.00 143.28 ?  1564 LYS B CB  1 
ATOM   2675 C CG  . LYS B  1 90  ? -42.911  -49.092 -32.659 1.00 147.46 ?  1564 LYS B CG  1 
ATOM   2676 C CD  . LYS B  1 90  ? -42.201  -50.417 -32.420 1.00 143.13 ?  1564 LYS B CD  1 
ATOM   2677 C CE  . LYS B  1 90  ? -42.970  -51.306 -31.474 1.00 141.11 ?  1564 LYS B CE  1 
ATOM   2678 N NZ  . LYS B  1 90  ? -42.281  -52.604 -31.244 1.00 145.25 1  1564 LYS B NZ  1 
ATOM   2679 N N   . ASP B  1 91  ? -40.894  -45.519 -31.910 1.00 114.53 ?  1565 ASP B N   1 
ATOM   2680 C CA  . ASP B  1 91  ? -40.401  -44.954 -30.657 1.00 111.61 ?  1565 ASP B CA  1 
ATOM   2681 C C   . ASP B  1 91  ? -40.927  -43.532 -30.379 1.00 112.08 ?  1565 ASP B C   1 
ATOM   2682 O O   . ASP B  1 91  ? -40.737  -42.644 -31.217 1.00 110.87 ?  1565 ASP B O   1 
ATOM   2683 C CB  . ASP B  1 91  ? -38.870  -45.016 -30.578 1.00 108.20 ?  1565 ASP B CB  1 
ATOM   2684 C CG  . ASP B  1 91  ? -38.344  -44.690 -29.196 1.00 104.63 ?  1565 ASP B CG  1 
ATOM   2685 O OD1 . ASP B  1 91  ? -38.621  -45.471 -28.253 1.00 100.71 ?  1565 ASP B OD1 1 
ATOM   2686 O OD2 . ASP B  1 91  ? -37.688  -43.635 -29.046 1.00 93.88  -1 1565 ASP B OD2 1 
ATOM   2687 N N   . PRO B  1 92  ? -41.566  -43.299 -29.198 1.00 111.55 ?  1566 PRO B N   1 
ATOM   2688 C CA  . PRO B  1 92  ? -42.099  -41.953 -28.898 1.00 108.68 ?  1566 PRO B CA  1 
ATOM   2689 C C   . PRO B  1 92  ? -41.046  -40.877 -28.631 1.00 107.19 ?  1566 PRO B C   1 
ATOM   2690 O O   . PRO B  1 92  ? -41.262  -39.725 -29.006 1.00 94.27  ?  1566 PRO B O   1 
ATOM   2691 C CB  . PRO B  1 92  ? -43.002  -42.186 -27.683 1.00 115.98 ?  1566 PRO B CB  1 
ATOM   2692 C CG  . PRO B  1 92  ? -42.436  -43.386 -27.014 1.00 118.55 ?  1566 PRO B CG  1 
ATOM   2693 C CD  . PRO B  1 92  ? -41.870  -44.253 -28.108 1.00 115.77 ?  1566 PRO B CD  1 
ATOM   2694 N N   . TRP B  1 93  ? -39.922  -41.243 -27.973 1.00 117.15 ?  1567 TRP B N   1 
ATOM   2695 C CA  . TRP B  1 93  ? -38.828  -40.318 -27.653 1.00 110.70 ?  1567 TRP B CA  1 
ATOM   2696 C C   . TRP B  1 93  ? -38.050  -39.926 -28.908 1.00 107.93 ?  1567 TRP B C   1 
ATOM   2697 O O   . TRP B  1 93  ? -37.599  -38.784 -29.006 1.00 96.86  ?  1567 TRP B O   1 
ATOM   2698 C CB  . TRP B  1 93  ? -37.883  -40.910 -26.607 1.00 104.19 ?  1567 TRP B CB  1 
ATOM   2699 C CG  . TRP B  1 93  ? -38.576  -41.528 -25.431 1.00 101.70 ?  1567 TRP B CG  1 
ATOM   2700 C CD1 . TRP B  1 93  ? -38.817  -42.854 -25.231 1.00 106.08 ?  1567 TRP B CD1 1 
ATOM   2701 C CD2 . TRP B  1 93  ? -39.110  -40.845 -24.286 1.00 102.02 ?  1567 TRP B CD2 1 
ATOM   2702 N NE1 . TRP B  1 93  ? -39.451  -43.045 -24.025 1.00 107.48 ?  1567 TRP B NE1 1 
ATOM   2703 C CE2 . TRP B  1 93  ? -39.644  -41.828 -23.423 1.00 101.60 ?  1567 TRP B CE2 1 
ATOM   2704 C CE3 . TRP B  1 93  ? -39.184  -39.494 -23.899 1.00 109.72 ?  1567 TRP B CE3 1 
ATOM   2705 C CZ2 . TRP B  1 93  ? -40.241  -41.506 -22.196 1.00 102.98 ?  1567 TRP B CZ2 1 
ATOM   2706 C CZ3 . TRP B  1 93  ? -39.765  -39.176 -22.679 1.00 105.31 ?  1567 TRP B CZ3 1 
ATOM   2707 C CH2 . TRP B  1 93  ? -40.294  -40.174 -21.848 1.00 104.40 ?  1567 TRP B CH2 1 
ATOM   2708 N N   . SER B  1 94  ? -37.915  -40.868 -29.870 1.00 108.95 ?  1568 SER B N   1 
ATOM   2709 C CA  . SER B  1 94  ? -37.232  -40.652 -31.146 1.00 113.95 ?  1568 SER B CA  1 
ATOM   2710 C C   . SER B  1 94  ? -37.980  -39.626 -31.989 1.00 114.83 ?  1568 SER B C   1 
ATOM   2711 O O   . SER B  1 94  ? -37.336  -38.853 -32.701 1.00 128.69 ?  1568 SER B O   1 
ATOM   2712 C CB  . SER B  1 94  ? -37.095  -41.961 -31.918 1.00 120.30 ?  1568 SER B CB  1 
ATOM   2713 O OG  . SER B  1 94  ? -36.269  -42.899 -31.245 1.00 122.74 ?  1568 SER B OG  1 
ATOM   2714 N N   . LEU B  1 95  ? -39.333  -39.606 -31.902 1.00 107.05 ?  1569 LEU B N   1 
ATOM   2715 C CA  . LEU B  1 95  ? -40.150  -38.645 -32.648 1.00 106.22 ?  1569 LEU B CA  1 
ATOM   2716 C C   . LEU B  1 95  ? -40.211  -37.277 -31.954 1.00 96.79  ?  1569 LEU B C   1 
ATOM   2717 O O   . LEU B  1 95  ? -40.431  -36.280 -32.641 1.00 84.13  ?  1569 LEU B O   1 
ATOM   2718 C CB  . LEU B  1 95  ? -41.557  -39.173 -33.024 1.00 117.86 ?  1569 LEU B CB  1 
ATOM   2719 C CG  . LEU B  1 95  ? -42.472  -39.731 -31.930 1.00 134.02 ?  1569 LEU B CG  1 
ATOM   2720 C CD1 . LEU B  1 95  ? -43.428  -38.666 -31.399 1.00 146.77 ?  1569 LEU B CD1 1 
ATOM   2721 C CD2 . LEU B  1 95  ? -43.286  -40.896 -32.453 1.00 134.90 ?  1569 LEU B CD2 1 
ATOM   2722 N N   . PHE B  1 96  ? -39.993  -37.225 -30.608 1.00 93.81  ?  1570 PHE B N   1 
ATOM   2723 C CA  . PHE B  1 96  ? -39.955  -35.977 -29.821 1.00 101.09 ?  1570 PHE B CA  1 
ATOM   2724 C C   . PHE B  1 96  ? -38.765  -35.153 -30.295 1.00 100.79 ?  1570 PHE B C   1 
ATOM   2725 O O   . PHE B  1 96  ? -38.914  -33.966 -30.587 1.00 87.30  ?  1570 PHE B O   1 
ATOM   2726 C CB  . PHE B  1 96  ? -39.852  -36.260 -28.296 1.00 108.37 ?  1570 PHE B CB  1 
ATOM   2727 C CG  . PHE B  1 96  ? -39.316  -35.123 -27.437 1.00 109.16 ?  1570 PHE B CG  1 
ATOM   2728 C CD1 . PHE B  1 96  ? -40.124  -34.039 -27.100 1.00 101.91 ?  1570 PHE B CD1 1 
ATOM   2729 C CD2 . PHE B  1 96  ? -38.009  -35.145 -26.958 1.00 118.30 ?  1570 PHE B CD2 1 
ATOM   2730 C CE1 . PHE B  1 96  ? -39.625  -32.990 -26.317 1.00 102.05 ?  1570 PHE B CE1 1 
ATOM   2731 C CE2 . PHE B  1 96  ? -37.510  -34.089 -26.182 1.00 115.47 ?  1570 PHE B CE2 1 
ATOM   2732 C CZ  . PHE B  1 96  ? -38.324  -33.026 -25.859 1.00 107.20 ?  1570 PHE B CZ  1 
ATOM   2733 N N   . ASP B  1 97  ? -37.593  -35.813 -30.405 1.00 107.16 ?  1571 ASP B N   1 
ATOM   2734 C CA  . ASP B  1 97  ? -36.340  -35.233 -30.875 1.00 104.12 ?  1571 ASP B CA  1 
ATOM   2735 C C   . ASP B  1 97  ? -36.452  -34.833 -32.351 1.00 100.74 ?  1571 ASP B C   1 
ATOM   2736 O O   . ASP B  1 97  ? -35.680  -33.993 -32.805 1.00 99.49  ?  1571 ASP B O   1 
ATOM   2737 C CB  . ASP B  1 97  ? -35.169  -36.208 -30.646 1.00 107.82 ?  1571 ASP B CB  1 
ATOM   2738 C CG  . ASP B  1 97  ? -34.998  -36.692 -29.209 1.00 116.11 ?  1571 ASP B CG  1 
ATOM   2739 O OD1 . ASP B  1 97  ? -34.979  -35.841 -28.290 1.00 126.60 -1 1571 ASP B OD1 1 
ATOM   2740 O OD2 . ASP B  1 97  ? -34.827  -37.917 -29.009 1.00 114.66 ?  1571 ASP B OD2 1 
ATOM   2741 N N   . PHE B  1 98  ? -37.437  -35.410 -33.083 1.00 101.07 ?  1572 PHE B N   1 
ATOM   2742 C CA  . PHE B  1 98  ? -37.731  -35.104 -34.487 1.00 99.31  ?  1572 PHE B CA  1 
ATOM   2743 C C   . PHE B  1 98  ? -38.647  -33.862 -34.592 1.00 98.07  ?  1572 PHE B C   1 
ATOM   2744 O O   . PHE B  1 98  ? -38.365  -32.958 -35.389 1.00 100.79 ?  1572 PHE B O   1 
ATOM   2745 C CB  . PHE B  1 98  ? -38.341  -36.330 -35.212 1.00 94.18  ?  1572 PHE B CB  1 
ATOM   2746 C CG  . PHE B  1 98  ? -38.685  -36.074 -36.663 1.00 87.83  ?  1572 PHE B CG  1 
ATOM   2747 C CD1 . PHE B  1 98  ? -37.715  -36.175 -37.653 1.00 85.50  ?  1572 PHE B CD1 1 
ATOM   2748 C CD2 . PHE B  1 98  ? -39.971  -35.691 -37.034 1.00 85.04  ?  1572 PHE B CD2 1 
ATOM   2749 C CE1 . PHE B  1 98  ? -38.024  -35.894 -38.986 1.00 84.62  ?  1572 PHE B CE1 1 
ATOM   2750 C CE2 . PHE B  1 98  ? -40.278  -35.408 -38.366 1.00 80.31  ?  1572 PHE B CE2 1 
ATOM   2751 C CZ  . PHE B  1 98  ? -39.305  -35.516 -39.334 1.00 82.61  ?  1572 PHE B CZ  1 
ATOM   2752 N N   . VAL B  1 99  ? -39.742  -33.837 -33.792 1.00 90.91  ?  1573 VAL B N   1 
ATOM   2753 C CA  . VAL B  1 99  ? -40.716  -32.738 -33.706 1.00 94.08  ?  1573 VAL B CA  1 
ATOM   2754 C C   . VAL B  1 99  ? -39.992  -31.452 -33.251 1.00 97.68  ?  1573 VAL B C   1 
ATOM   2755 O O   . VAL B  1 99  ? -40.292  -30.366 -33.751 1.00 89.49  ?  1573 VAL B O   1 
ATOM   2756 C CB  . VAL B  1 99  ? -41.943  -33.117 -32.824 1.00 93.24  ?  1573 VAL B CB  1 
ATOM   2757 C CG1 . VAL B  1 99  ? -42.841  -31.915 -32.536 1.00 89.34  ?  1573 VAL B CG1 1 
ATOM   2758 C CG2 . VAL B  1 99  ? -42.757  -34.229 -33.475 1.00 95.19  ?  1573 VAL B CG2 1 
ATOM   2759 N N   . VAL B  1 100 ? -38.999  -31.604 -32.349 1.00 103.36 ?  1574 VAL B N   1 
ATOM   2760 C CA  . VAL B  1 100 ? -38.140  -30.529 -31.847 1.00 102.03 ?  1574 VAL B CA  1 
ATOM   2761 C C   . VAL B  1 100 ? -37.283  -29.999 -33.002 1.00 105.11 ?  1574 VAL B C   1 
ATOM   2762 O O   . VAL B  1 100 ? -37.177  -28.784 -33.152 1.00 109.52 ?  1574 VAL B O   1 
ATOM   2763 C CB  . VAL B  1 100 ? -37.298  -31.003 -30.627 1.00 102.14 ?  1574 VAL B CB  1 
ATOM   2764 C CG1 . VAL B  1 100 ? -36.018  -30.188 -30.450 1.00 107.73 ?  1574 VAL B CG1 1 
ATOM   2765 C CG2 . VAL B  1 100 ? -38.130  -30.976 -29.350 1.00 100.15 ?  1574 VAL B CG2 1 
ATOM   2766 N N   . VAL B  1 101 ? -36.709  -30.909 -33.831 1.00 105.36 ?  1575 VAL B N   1 
ATOM   2767 C CA  . VAL B  1 101 ? -35.878  -30.556 -34.992 1.00 106.29 ?  1575 VAL B CA  1 
ATOM   2768 C C   . VAL B  1 101 ? -36.687  -29.752 -36.008 1.00 103.22 ?  1575 VAL B C   1 
ATOM   2769 O O   . VAL B  1 101 ? -36.226  -28.687 -36.432 1.00 99.06  ?  1575 VAL B O   1 
ATOM   2770 C CB  . VAL B  1 101 ? -35.135  -31.772 -35.624 1.00 108.44 ?  1575 VAL B CB  1 
ATOM   2771 C CG1 . VAL B  1 101 ? -34.624  -31.458 -37.031 1.00 107.99 ?  1575 VAL B CG1 1 
ATOM   2772 C CG2 . VAL B  1 101 ? -33.977  -32.222 -34.740 1.00 112.78 ?  1575 VAL B CG2 1 
ATOM   2773 N N   . ILE B  1 102 ? -37.908  -30.225 -36.348 1.00 99.33  ?  1576 ILE B N   1 
ATOM   2774 C CA  . ILE B  1 102 ? -38.776  -29.530 -37.306 1.00 97.73  ?  1576 ILE B CA  1 
ATOM   2775 C C   . ILE B  1 102 ? -39.281  -28.189 -36.716 1.00 96.67  ?  1576 ILE B C   1 
ATOM   2776 O O   . ILE B  1 102 ? -39.509  -27.254 -37.480 1.00 87.68  ?  1576 ILE B O   1 
ATOM   2777 C CB  . ILE B  1 102 ? -39.903  -30.414 -37.926 1.00 96.94  ?  1576 ILE B CB  1 
ATOM   2778 C CG1 . ILE B  1 102 ? -40.888  -30.963 -36.871 1.00 109.14 ?  1576 ILE B CG1 1 
ATOM   2779 C CG2 . ILE B  1 102 ? -39.295  -31.542 -38.781 1.00 97.33  ?  1576 ILE B CG2 1 
ATOM   2780 C CD1 . ILE B  1 102 ? -42.166  -31.692 -37.421 1.00 119.89 ?  1576 ILE B CD1 1 
ATOM   2781 N N   . ILE B  1 103 ? -39.363  -28.073 -35.369 1.00 101.21 ?  1577 ILE B N   1 
ATOM   2782 C CA  . ILE B  1 103 ? -39.746  -26.836 -34.672 1.00 99.34  ?  1577 ILE B CA  1 
ATOM   2783 C C   . ILE B  1 103 ? -38.581  -25.833 -34.687 1.00 106.43 ?  1577 ILE B C   1 
ATOM   2784 O O   . ILE B  1 103 ? -38.791  -24.653 -34.975 1.00 101.37 ?  1577 ILE B O   1 
ATOM   2785 C CB  . ILE B  1 103 ? -40.284  -27.137 -33.242 1.00 92.49  ?  1577 ILE B CB  1 
ATOM   2786 C CG1 . ILE B  1 103 ? -41.805  -27.379 -33.290 1.00 93.14  ?  1577 ILE B CG1 1 
ATOM   2787 C CG2 . ILE B  1 103 ? -39.915  -26.043 -32.210 1.00 89.35  ?  1577 ILE B CG2 1 
ATOM   2788 C CD1 . ILE B  1 103 ? -42.379  -28.216 -32.136 1.00 97.42  ?  1577 ILE B CD1 1 
ATOM   2789 N N   . SER B  1 104 ? -37.361  -26.314 -34.378 1.00 117.83 ?  1578 SER B N   1 
ATOM   2790 C CA  . SER B  1 104 ? -36.135  -25.524 -34.337 1.00 123.30 ?  1578 SER B CA  1 
ATOM   2791 C C   . SER B  1 104 ? -35.827  -24.940 -35.714 1.00 119.39 ?  1578 SER B C   1 
ATOM   2792 O O   . SER B  1 104 ? -35.404  -23.786 -35.807 1.00 117.88 ?  1578 SER B O   1 
ATOM   2793 C CB  . SER B  1 104 ? -34.972  -26.377 -33.846 1.00 127.94 ?  1578 SER B CB  1 
ATOM   2794 O OG  . SER B  1 104 ? -33.992  -25.564 -33.227 1.00 124.45 ?  1578 SER B OG  1 
ATOM   2795 N N   . ILE B  1 105 ? -36.086  -25.730 -36.777 1.00 108.34 ?  1579 ILE B N   1 
ATOM   2796 C CA  . ILE B  1 105 ? -35.897  -25.345 -38.175 1.00 102.50 ?  1579 ILE B CA  1 
ATOM   2797 C C   . ILE B  1 105 ? -36.926  -24.278 -38.585 1.00 98.23  ?  1579 ILE B C   1 
ATOM   2798 O O   . ILE B  1 105 ? -36.524  -23.230 -39.097 1.00 89.05  ?  1579 ILE B O   1 
ATOM   2799 C CB  . ILE B  1 105 ? -35.890  -26.614 -39.079 1.00 102.33 ?  1579 ILE B CB  1 
ATOM   2800 C CG1 . ILE B  1 105 ? -34.547  -27.387 -38.965 1.00 101.01 ?  1579 ILE B CG1 1 
ATOM   2801 C CG2 . ILE B  1 105 ? -36.273  -26.330 -40.545 1.00 104.20 ?  1579 ILE B CG2 1 
ATOM   2802 C CD1 . ILE B  1 105 ? -33.233  -26.650 -39.483 1.00 104.38 ?  1579 ILE B CD1 1 
ATOM   2803 N N   . VAL B  1 106 ? -38.241  -24.537 -38.331 1.00 94.10  ?  1580 VAL B N   1 
ATOM   2804 C CA  . VAL B  1 106 ? -39.355  -23.623 -38.637 1.00 95.15  ?  1580 VAL B CA  1 
ATOM   2805 C C   . VAL B  1 106 ? -39.155  -22.299 -37.906 1.00 101.27 ?  1580 VAL B C   1 
ATOM   2806 O O   . VAL B  1 106 ? -39.238  -21.245 -38.534 1.00 100.48 ?  1580 VAL B O   1 
ATOM   2807 C CB  . VAL B  1 106 ? -40.756  -24.257 -38.364 1.00 93.07  ?  1580 VAL B CB  1 
ATOM   2808 C CG1 . VAL B  1 106 ? -41.852  -23.199 -38.242 1.00 92.78  ?  1580 VAL B CG1 1 
ATOM   2809 C CG2 . VAL B  1 106 ? -41.124  -25.263 -39.443 1.00 92.63  ?  1580 VAL B CG2 1 
ATOM   2810 N N   . GLY B  1 107 ? -38.847  -22.385 -36.611 1.00 108.73 ?  1581 GLY B N   1 
ATOM   2811 C CA  . GLY B  1 107 ? -38.603  -21.244 -35.738 1.00 110.76 ?  1581 GLY B CA  1 
ATOM   2812 C C   . GLY B  1 107 ? -37.490  -20.344 -36.233 1.00 109.56 ?  1581 GLY B C   1 
ATOM   2813 O O   . GLY B  1 107 ? -37.711  -19.149 -36.439 1.00 104.01 ?  1581 GLY B O   1 
ATOM   2814 N N   . MET B  1 108 ? -36.302  -20.935 -36.466 1.00 110.56 ?  1582 MET B N   1 
ATOM   2815 C CA  . MET B  1 108 ? -35.084  -20.275 -36.949 1.00 118.12 ?  1582 MET B CA  1 
ATOM   2816 C C   . MET B  1 108 ? -35.342  -19.220 -38.039 1.00 114.58 ?  1582 MET B C   1 
ATOM   2817 O O   . MET B  1 108 ? -34.878  -18.086 -37.918 1.00 112.54 ?  1582 MET B O   1 
ATOM   2818 C CB  . MET B  1 108 ? -34.100  -21.340 -37.455 1.00 125.01 ?  1582 MET B CB  1 
ATOM   2819 C CG  . MET B  1 108 ? -32.669  -20.889 -37.492 1.00 128.89 ?  1582 MET B CG  1 
ATOM   2820 S SD  . MET B  1 108 ? -31.614  -22.280 -37.925 1.00 127.92 ?  1582 MET B SD  1 
ATOM   2821 C CE  . MET B  1 108 ? -30.654  -21.573 -39.220 1.00 118.26 ?  1582 MET B CE  1 
ATOM   2822 N N   . PHE B  1 109 ? -36.100  -19.594 -39.081 1.00 113.68 ?  1583 PHE B N   1 
ATOM   2823 C CA  . PHE B  1 109 ? -36.410  -18.725 -40.212 1.00 118.09 ?  1583 PHE B CA  1 
ATOM   2824 C C   . PHE B  1 109 ? -37.671  -17.898 -40.006 1.00 118.83 ?  1583 PHE B C   1 
ATOM   2825 O O   . PHE B  1 109 ? -37.746  -16.797 -40.546 1.00 122.84 ?  1583 PHE B O   1 
ATOM   2826 C CB  . PHE B  1 109 ? -36.467  -19.524 -41.527 1.00 124.17 ?  1583 PHE B CB  1 
ATOM   2827 C CG  . PHE B  1 109 ? -35.246  -20.380 -41.783 1.00 128.66 ?  1583 PHE B CG  1 
ATOM   2828 C CD1 . PHE B  1 109 ? -34.049  -19.809 -42.208 1.00 131.29 ?  1583 PHE B CD1 1 
ATOM   2829 C CD2 . PHE B  1 109 ? -35.288  -21.755 -41.590 1.00 129.07 ?  1583 PHE B CD2 1 
ATOM   2830 C CE1 . PHE B  1 109 ? -32.917  -20.600 -42.429 1.00 128.22 ?  1583 PHE B CE1 1 
ATOM   2831 C CE2 . PHE B  1 109 ? -34.154  -22.544 -41.805 1.00 134.28 ?  1583 PHE B CE2 1 
ATOM   2832 C CZ  . PHE B  1 109 ? -32.977  -21.962 -42.229 1.00 133.06 ?  1583 PHE B CZ  1 
ATOM   2833 N N   . LEU B  1 110 ? -38.655  -18.413 -39.229 1.00 118.09 ?  1584 LEU B N   1 
ATOM   2834 C CA  . LEU B  1 110 ? -39.906  -17.704 -38.929 1.00 113.59 ?  1584 LEU B CA  1 
ATOM   2835 C C   . LEU B  1 110 ? -39.627  -16.479 -38.048 1.00 110.55 ?  1584 LEU B C   1 
ATOM   2836 O O   . LEU B  1 110 ? -40.205  -15.417 -38.286 1.00 98.69  ?  1584 LEU B O   1 
ATOM   2837 C CB  . LEU B  1 110 ? -40.925  -18.642 -38.261 1.00 110.27 ?  1584 LEU B CB  1 
ATOM   2838 C CG  . LEU B  1 110 ? -42.378  -18.183 -38.212 1.00 115.13 ?  1584 LEU B CG  1 
ATOM   2839 C CD1 . LEU B  1 110 ? -43.005  -18.163 -39.603 1.00 116.60 ?  1584 LEU B CD1 1 
ATOM   2840 C CD2 . LEU B  1 110 ? -43.185  -19.086 -37.310 1.00 118.80 ?  1584 LEU B CD2 1 
ATOM   2841 N N   . ALA B  1 111 ? -38.709  -16.626 -37.063 1.00 109.53 ?  1585 ALA B N   1 
ATOM   2842 C CA  . ALA B  1 111 ? -38.262  -15.556 -36.165 1.00 110.82 ?  1585 ALA B CA  1 
ATOM   2843 C C   . ALA B  1 111 ? -37.408  -14.561 -36.952 1.00 109.76 ?  1585 ALA B C   1 
ATOM   2844 O O   . ALA B  1 111 ? -37.541  -13.348 -36.754 1.00 97.62  ?  1585 ALA B O   1 
ATOM   2845 C CB  . ALA B  1 111 ? -37.461  -16.135 -35.007 1.00 111.29 ?  1585 ALA B CB  1 
ATOM   2846 N N   . ASP B  1 112 ? -36.558  -15.084 -37.868 1.00 117.03 ?  1586 ASP B N   1 
ATOM   2847 C CA  . ASP B  1 112 ? -35.699  -14.295 -38.748 1.00 121.05 ?  1586 ASP B CA  1 
ATOM   2848 C C   . ASP B  1 112 ? -36.537  -13.456 -39.721 1.00 119.63 ?  1586 ASP B C   1 
ATOM   2849 O O   . ASP B  1 112 ? -36.165  -12.316 -40.006 1.00 117.35 ?  1586 ASP B O   1 
ATOM   2850 C CB  . ASP B  1 112 ? -34.715  -15.203 -39.504 1.00 123.09 ?  1586 ASP B CB  1 
ATOM   2851 C CG  . ASP B  1 112 ? -33.879  -14.508 -40.567 1.00 124.99 ?  1586 ASP B CG  1 
ATOM   2852 O OD1 . ASP B  1 112 ? -33.399  -13.375 -40.307 1.00 114.03 ?  1586 ASP B OD1 1 
ATOM   2853 O OD2 . ASP B  1 112 ? -33.708  -15.091 -41.662 1.00 127.87 -1 1586 ASP B OD2 1 
ATOM   2854 N N   . LEU B  1 113 ? -37.671  -14.014 -40.201 1.00 114.75 ?  1587 LEU B N   1 
ATOM   2855 C CA  . LEU B  1 113 ? -38.613  -13.358 -41.112 1.00 109.67 ?  1587 LEU B CA  1 
ATOM   2856 C C   . LEU B  1 113 ? -39.236  -12.106 -40.463 1.00 106.29 ?  1587 LEU B C   1 
ATOM   2857 O O   . LEU B  1 113 ? -39.380  -11.086 -41.142 1.00 105.92 ?  1587 LEU B O   1 
ATOM   2858 C CB  . LEU B  1 113 ? -39.714  -14.347 -41.525 1.00 113.97 ?  1587 LEU B CB  1 
ATOM   2859 C CG  . LEU B  1 113 ? -40.567  -13.948 -42.719 1.00 115.05 ?  1587 LEU B CG  1 
ATOM   2860 C CD1 . LEU B  1 113 ? -40.337  -14.890 -43.877 1.00 115.45 ?  1587 LEU B CD1 1 
ATOM   2861 C CD2 . LEU B  1 113 ? -42.042  -13.898 -42.344 1.00 114.72 ?  1587 LEU B CD2 1 
ATOM   2862 N N   . ILE B  1 114 ? -39.591  -12.192 -39.152 1.00 100.61 ?  1588 ILE B N   1 
ATOM   2863 C CA  . ILE B  1 114 ? -40.198  -11.100 -38.367 1.00 99.58  ?  1588 ILE B CA  1 
ATOM   2864 C C   . ILE B  1 114 ? -39.135  -10.059 -37.952 1.00 103.60 ?  1588 ILE B C   1 
ATOM   2865 O O   . ILE B  1 114 ? -39.459  -8.867  -37.817 1.00 97.07  ?  1588 ILE B O   1 
ATOM   2866 C CB  . ILE B  1 114 ? -41.048  -11.633 -37.161 1.00 97.73  ?  1588 ILE B CB  1 
ATOM   2867 C CG1 . ILE B  1 114 ? -41.965  -12.813 -37.588 1.00 97.48  ?  1588 ILE B CG1 1 
ATOM   2868 C CG2 . ILE B  1 114 ? -41.885  -10.499 -36.515 1.00 98.60  ?  1588 ILE B CG2 1 
ATOM   2869 C CD1 . ILE B  1 114 ? -42.416  -13.754 -36.466 1.00 98.34  ?  1588 ILE B CD1 1 
ATOM   2870 N N   . GLU B  1 115 ? -37.871  -10.523 -37.759 1.00 110.78 ?  1589 GLU B N   1 
ATOM   2871 C CA  . GLU B  1 115 ? -36.710  -9.695  -37.403 1.00 113.63 ?  1589 GLU B CA  1 
ATOM   2872 C C   . GLU B  1 115 ? -36.294  -8.824  -38.604 1.00 111.51 ?  1589 GLU B C   1 
ATOM   2873 O O   . GLU B  1 115 ? -35.992  -7.640  -38.422 1.00 104.52 ?  1589 GLU B O   1 
ATOM   2874 C CB  . GLU B  1 115 ? -35.541  -10.573 -36.901 1.00 115.90 ?  1589 GLU B CB  1 
ATOM   2875 C CG  . GLU B  1 115 ? -34.332  -9.809  -36.367 1.00 122.71 ?  1589 GLU B CG  1 
ATOM   2876 C CD  . GLU B  1 115 ? -34.402  -9.265  -34.950 1.00 126.90 ?  1589 GLU B CD  1 
ATOM   2877 O OE1 . GLU B  1 115 ? -35.177  -8.309  -34.715 1.00 126.64 ?  1589 GLU B OE1 1 
ATOM   2878 O OE2 . GLU B  1 115 ? -33.615  -9.737  -34.096 1.00 128.72 -1 1589 GLU B OE2 1 
ATOM   2879 N N   . THR B  1 116 ? -36.306  -9.409  -39.826 1.00 117.33 ?  1590 THR B N   1 
ATOM   2880 C CA  . THR B  1 116 ? -35.982  -8.721  -41.083 1.00 123.29 ?  1590 THR B CA  1 
ATOM   2881 C C   . THR B  1 116 ? -37.098  -7.727  -41.432 1.00 122.06 ?  1590 THR B C   1 
ATOM   2882 O O   . THR B  1 116 ? -36.819  -6.550  -41.658 1.00 117.41 ?  1590 THR B O   1 
ATOM   2883 C CB  . THR B  1 116 ? -35.694  -9.749  -42.198 1.00 126.95 ?  1590 THR B CB  1 
ATOM   2884 O OG1 . THR B  1 116 ? -34.628  -10.605 -41.774 1.00 132.43 ?  1590 THR B OG1 1 
ATOM   2885 C CG2 . THR B  1 116 ? -35.337  -9.092  -43.541 1.00 124.36 ?  1590 THR B CG2 1 
ATOM   2886 N N   . TYR B  1 117 ? -38.354  -8.206  -41.452 1.00 128.38 ?  1591 TYR B N   1 
ATOM   2887 C CA  . TYR B  1 117 ? -39.536  -7.395  -41.732 1.00 135.54 ?  1591 TYR B CA  1 
ATOM   2888 C C   . TYR B  1 117 ? -40.083  -6.865  -40.406 1.00 136.79 ?  1591 TYR B C   1 
ATOM   2889 O O   . TYR B  1 117 ? -40.957  -7.483  -39.790 1.00 120.57 ?  1591 TYR B O   1 
ATOM   2890 C CB  . TYR B  1 117 ? -40.571  -8.196  -42.548 1.00 131.60 ?  1591 TYR B CB  1 
ATOM   2891 C CG  . TYR B  1 117 ? -40.066  -8.567  -43.925 1.00 126.49 ?  1591 TYR B CG  1 
ATOM   2892 C CD1 . TYR B  1 117 ? -39.338  -9.735  -44.132 1.00 120.45 ?  1591 TYR B CD1 1 
ATOM   2893 C CD2 . TYR B  1 117 ? -40.287  -7.734  -45.017 1.00 126.36 ?  1591 TYR B CD2 1 
ATOM   2894 C CE1 . TYR B  1 117 ? -38.841  -10.065 -45.392 1.00 115.83 ?  1591 TYR B CE1 1 
ATOM   2895 C CE2 . TYR B  1 117 ? -39.800  -8.055  -46.283 1.00 119.59 ?  1591 TYR B CE2 1 
ATOM   2896 C CZ  . TYR B  1 117 ? -39.080  -9.224  -46.468 1.00 115.02 ?  1591 TYR B CZ  1 
ATOM   2897 O OH  . TYR B  1 117 ? -38.602  -9.545  -47.717 1.00 116.13 ?  1591 TYR B OH  1 
ATOM   2898 N N   . PHE B  1 118 ? -39.491  -5.727  -39.962 1.00 141.43 ?  1592 PHE B N   1 
ATOM   2899 C CA  . PHE B  1 118 ? -39.707  -4.982  -38.714 1.00 138.06 ?  1592 PHE B CA  1 
ATOM   2900 C C   . PHE B  1 118 ? -41.176  -4.884  -38.303 1.00 118.80 ?  1592 PHE B C   1 
ATOM   2901 O O   . PHE B  1 118 ? -41.894  -3.924  -38.607 1.00 112.99 ?  1592 PHE B O   1 
ATOM   2902 C CB  . PHE B  1 118 ? -39.028  -3.605  -38.772 1.00 147.86 ?  1592 PHE B CB  1 
ATOM   2903 C CG  . PHE B  1 118 ? -37.522  -3.698  -38.713 1.00 150.80 ?  1592 PHE B CG  1 
ATOM   2904 C CD1 . PHE B  1 118 ? -36.858  -3.742  -37.491 1.00 149.14 ?  1592 PHE B CD1 1 
ATOM   2905 C CD2 . PHE B  1 118 ? -36.767  -3.753  -39.879 1.00 145.23 ?  1592 PHE B CD2 1 
ATOM   2906 C CE1 . PHE B  1 118 ? -35.465  -3.836  -37.437 1.00 147.43 ?  1592 PHE B CE1 1 
ATOM   2907 C CE2 . PHE B  1 118 ? -35.375  -3.852  -39.823 1.00 146.48 ?  1592 PHE B CE2 1 
ATOM   2908 C CZ  . PHE B  1 118 ? -34.733  -3.888  -38.603 1.00 145.26 ?  1592 PHE B CZ  1 
ATOM   2909 N N   . VAL B  1 119 ? -41.593  -5.934  -37.588 1.00 30.00  ?  1593 VAL B N   1 
ATOM   2910 C CA  . VAL B  1 119 ? -42.956  -6.201  -37.069 1.00 30.00  ?  1593 VAL B CA  1 
ATOM   2911 C C   . VAL B  1 119 ? -42.866  -6.612  -35.528 1.00 30.00  ?  1593 VAL B C   1 
ATOM   2912 O O   . VAL B  1 119 ? -42.044  -7.489  -35.131 1.00 30.00  ?  1593 VAL B O   1 
ATOM   2913 C CB  . VAL B  1 119 ? -43.736  -7.265  -38.001 1.00 20.00  ?  1593 VAL B CB  1 
ATOM   2914 C CG1 . VAL B  1 119 ? -44.785  -8.121  -37.232 1.00 20.00  ?  1593 VAL B CG1 1 
ATOM   2915 C CG2 . VAL B  1 119 ? -44.360  -6.582  -39.243 1.00 20.00  ?  1593 VAL B CG2 1 
ATOM   2916 N N   . SER B  1 120 ? -43.733  -5.952  -34.714 1.00 126.71 ?  1594 SER B N   1 
ATOM   2917 C CA  . SER B  1 120 ? -43.982  -6.125  -33.279 1.00 119.32 ?  1594 SER B CA  1 
ATOM   2918 C C   . SER B  1 120 ? -42.959  -6.989  -32.518 1.00 121.52 ?  1594 SER B C   1 
ATOM   2919 O O   . SER B  1 120 ? -42.926  -8.215  -32.724 1.00 115.29 ?  1594 SER B O   1 
ATOM   2920 C CB  . SER B  1 120 ? -45.390  -6.675  -33.061 1.00 116.24 ?  1594 SER B CB  1 
ATOM   2921 O OG  . SER B  1 120 ? -45.618  -7.828  -33.858 1.00 113.79 ?  1594 SER B OG  1 
ATOM   2922 N N   . PRO B  1 121 ? -42.147  -6.383  -31.605 1.00 124.68 ?  1595 PRO B N   1 
ATOM   2923 C CA  . PRO B  1 121 ? -41.196  -7.191  -30.812 1.00 122.94 ?  1595 PRO B CA  1 
ATOM   2924 C C   . PRO B  1 121 ? -41.920  -8.244  -29.972 1.00 123.55 ?  1595 PRO B C   1 
ATOM   2925 O O   . PRO B  1 121 ? -41.312  -9.226  -29.558 1.00 111.00 ?  1595 PRO B O   1 
ATOM   2926 C CB  . PRO B  1 121 ? -40.488  -6.153  -29.932 1.00 120.81 ?  1595 PRO B CB  1 
ATOM   2927 C CG  . PRO B  1 121 ? -41.430  -4.996  -29.868 1.00 125.31 ?  1595 PRO B CG  1 
ATOM   2928 C CD  . PRO B  1 121 ? -42.090  -4.958  -31.214 1.00 124.57 ?  1595 PRO B CD  1 
ATOM   2929 N N   . THR B  1 122 ? -43.242  -8.035  -29.775 1.00 131.78 ?  1596 THR B N   1 
ATOM   2930 C CA  . THR B  1 122 ? -44.195  -8.889  -29.069 1.00 127.24 ?  1596 THR B CA  1 
ATOM   2931 C C   . THR B  1 122 ? -44.412  -10.202 -29.839 1.00 118.01 ?  1596 THR B C   1 
ATOM   2932 O O   . THR B  1 122 ? -44.598  -11.241 -29.209 1.00 116.52 ?  1596 THR B O   1 
ATOM   2933 C CB  . THR B  1 122 ? -45.511  -8.127  -28.825 1.00 130.35 ?  1596 THR B CB  1 
ATOM   2934 O OG1 . THR B  1 122 ? -45.228  -6.757  -28.528 1.00 125.52 ?  1596 THR B OG1 1 
ATOM   2935 C CG2 . THR B  1 122 ? -46.322  -8.717  -27.695 1.00 131.87 ?  1596 THR B CG2 1 
ATOM   2936 N N   . LEU B  1 123 ? -44.388  -10.159 -31.190 1.00 109.44 ?  1597 LEU B N   1 
ATOM   2937 C CA  . LEU B  1 123 ? -44.532  -11.360 -32.023 1.00 106.09 ?  1597 LEU B CA  1 
ATOM   2938 C C   . LEU B  1 123 ? -43.217  -12.141 -32.017 1.00 107.31 ?  1597 LEU B C   1 
ATOM   2939 O O   . LEU B  1 123 ? -43.235  -13.370 -31.993 1.00 95.65  ?  1597 LEU B O   1 
ATOM   2940 C CB  . LEU B  1 123 ? -44.894  -10.989 -33.473 1.00 106.65 ?  1597 LEU B CB  1 
ATOM   2941 C CG  . LEU B  1 123 ? -46.020  -11.789 -34.145 1.00 106.49 ?  1597 LEU B CG  1 
ATOM   2942 C CD1 . LEU B  1 123 ? -46.429  -11.138 -35.455 1.00 107.75 ?  1597 LEU B CD1 1 
ATOM   2943 C CD2 . LEU B  1 123 ? -45.631  -13.255 -34.380 1.00 104.50 ?  1597 LEU B CD2 1 
ATOM   2944 N N   . PHE B  1 124 ? -42.084  -11.413 -32.052 1.00 111.69 ?  1598 PHE B N   1 
ATOM   2945 C CA  . PHE B  1 124 ? -40.732  -11.955 -32.067 1.00 114.19 ?  1598 PHE B CA  1 
ATOM   2946 C C   . PHE B  1 124 ? -40.357  -12.648 -30.751 1.00 122.28 ?  1598 PHE B C   1 
ATOM   2947 O O   . PHE B  1 124 ? -39.882  -13.785 -30.800 1.00 123.52 ?  1598 PHE B O   1 
ATOM   2948 C CB  . PHE B  1 124 ? -39.721  -10.849 -32.430 1.00 115.84 ?  1598 PHE B CB  1 
ATOM   2949 C CG  . PHE B  1 124 ? -38.278  -11.290 -32.526 1.00 121.58 ?  1598 PHE B CG  1 
ATOM   2950 C CD1 . PHE B  1 124 ? -37.792  -11.887 -33.682 1.00 124.62 ?  1598 PHE B CD1 1 
ATOM   2951 C CD2 . PHE B  1 124 ? -37.397  -11.077 -31.471 1.00 121.01 ?  1598 PHE B CD2 1 
ATOM   2952 C CE1 . PHE B  1 124 ? -36.456  -12.291 -33.771 1.00 125.38 ?  1598 PHE B CE1 1 
ATOM   2953 C CE2 . PHE B  1 124 ? -36.062  -11.481 -31.561 1.00 118.74 ?  1598 PHE B CE2 1 
ATOM   2954 C CZ  . PHE B  1 124 ? -35.599  -12.079 -32.713 1.00 123.16 ?  1598 PHE B CZ  1 
ATOM   2955 N N   . ARG B  1 125 ? -40.557  -11.970 -29.585 1.00 125.08 ?  1599 ARG B N   1 
ATOM   2956 C CA  . ARG B  1 125 ? -40.213  -12.504 -28.251 1.00 118.81 ?  1599 ARG B CA  1 
ATOM   2957 C C   . ARG B  1 125 ? -40.943  -13.807 -27.933 1.00 99.89  ?  1599 ARG B C   1 
ATOM   2958 O O   . ARG B  1 125 ? -40.356  -14.699 -27.319 1.00 97.46  ?  1599 ARG B O   1 
ATOM   2959 C CB  . ARG B  1 125 ? -40.386  -11.458 -27.115 1.00 128.52 ?  1599 ARG B CB  1 
ATOM   2960 C CG  . ARG B  1 125 ? -41.811  -10.935 -26.857 1.00 134.23 ?  1599 ARG B CG  1 
ATOM   2961 C CD  . ARG B  1 125 ? -41.886  -10.040 -25.630 1.00 134.73 ?  1599 ARG B CD  1 
ATOM   2962 N NE  . ARG B  1 125 ? -42.913  -9.000  -25.757 1.00 137.36 ?  1599 ARG B NE  1 
ATOM   2963 C CZ  . ARG B  1 125 ? -42.667  -7.731  -26.077 1.00 141.98 ?  1599 ARG B CZ  1 
ATOM   2964 N NH1 . ARG B  1 125 ? -41.425  -7.328  -26.318 1.00 143.50 1  1599 ARG B NH1 1 
ATOM   2965 N NH2 . ARG B  1 125 ? -43.661  -6.857  -26.165 1.00 143.18 ?  1599 ARG B NH2 1 
ATOM   2966 N N   . VAL B  1 126 ? -42.200  -13.920 -28.387 1.00 88.92  ?  1600 VAL B N   1 
ATOM   2967 C CA  . VAL B  1 126 ? -43.050  -15.092 -28.198 1.00 90.16  ?  1600 VAL B CA  1 
ATOM   2968 C C   . VAL B  1 126 ? -42.622  -16.209 -29.174 1.00 90.63  ?  1600 VAL B C   1 
ATOM   2969 O O   . VAL B  1 126 ? -42.446  -17.348 -28.745 1.00 84.47  ?  1600 VAL B O   1 
ATOM   2970 C CB  . VAL B  1 126 ? -44.564  -14.721 -28.300 1.00 91.17  ?  1600 VAL B CB  1 
ATOM   2971 C CG1 . VAL B  1 126 ? -45.463  -15.954 -28.279 1.00 91.68  ?  1600 VAL B CG1 1 
ATOM   2972 C CG2 . VAL B  1 126 ? -44.974  -13.764 -27.191 1.00 91.29  ?  1600 VAL B CG2 1 
ATOM   2973 N N   . ILE B  1 127 ? -42.434  -15.876 -30.473 1.00 97.41  ?  1601 ILE B N   1 
ATOM   2974 C CA  . ILE B  1 127 ? -42.063  -16.846 -31.514 1.00 101.35 ?  1601 ILE B CA  1 
ATOM   2975 C C   . ILE B  1 127 ? -40.665  -17.457 -31.274 1.00 97.02  ?  1601 ILE B C   1 
ATOM   2976 O O   . ILE B  1 127 ? -40.493  -18.649 -31.529 1.00 90.52  ?  1601 ILE B O   1 
ATOM   2977 C CB  . ILE B  1 127 ? -42.242  -16.260 -32.949 1.00 106.90 ?  1601 ILE B CB  1 
ATOM   2978 C CG1 . ILE B  1 127 ? -42.759  -17.319 -33.931 1.00 108.85 ?  1601 ILE B CG1 1 
ATOM   2979 C CG2 . ILE B  1 127 ? -41.009  -15.533 -33.489 1.00 111.76 ?  1601 ILE B CG2 1 
ATOM   2980 C CD1 . ILE B  1 127 ? -44.256  -17.228 -34.167 1.00 117.36 ?  1601 ILE B CD1 1 
ATOM   2981 N N   . ARG B  1 128 ? -39.703  -16.666 -30.735 1.00 96.91  ?  1602 ARG B N   1 
ATOM   2982 C CA  . ARG B  1 128 ? -38.340  -17.117 -30.446 1.00 101.25 ?  1602 ARG B CA  1 
ATOM   2983 C C   . ARG B  1 128 ? -38.286  -18.195 -29.340 1.00 101.38 ?  1602 ARG B C   1 
ATOM   2984 O O   . ARG B  1 128 ? -37.257  -18.852 -29.178 1.00 104.99 ?  1602 ARG B O   1 
ATOM   2985 C CB  . ARG B  1 128 ? -37.421  -15.925 -30.132 1.00 103.24 ?  1602 ARG B CB  1 
ATOM   2986 C CG  . ARG B  1 128 ? -35.971  -16.174 -30.529 1.00 105.08 ?  1602 ARG B CG  1 
ATOM   2987 C CD  . ARG B  1 128 ? -35.109  -14.925 -30.540 1.00 104.67 ?  1602 ARG B CD  1 
ATOM   2988 N NE  . ARG B  1 128 ? -34.755  -14.474 -29.193 1.00 106.79 ?  1602 ARG B NE  1 
ATOM   2989 C CZ  . ARG B  1 128 ? -33.689  -14.888 -28.508 1.00 109.43 ?  1602 ARG B CZ  1 
ATOM   2990 N NH1 . ARG B  1 128 ? -32.858  -15.781 -29.033 1.00 112.99 1  1602 ARG B NH1 1 
ATOM   2991 N NH2 . ARG B  1 128 ? -33.454  -14.419 -27.290 1.00 107.21 ?  1602 ARG B NH2 1 
ATOM   2992 N N   . LEU B  1 129 ? -39.422  -18.427 -28.642 1.00 96.50  ?  1603 LEU B N   1 
ATOM   2993 C CA  . LEU B  1 129 ? -39.590  -19.419 -27.573 1.00 90.21  ?  1603 LEU B CA  1 
ATOM   2994 C C   . LEU B  1 129 ? -39.476  -20.889 -28.071 1.00 92.25  ?  1603 LEU B C   1 
ATOM   2995 O O   . LEU B  1 129 ? -39.583  -21.820 -27.272 1.00 102.74 ?  1603 LEU B O   1 
ATOM   2996 C CB  . LEU B  1 129 ? -40.942  -19.160 -26.873 1.00 87.15  ?  1603 LEU B CB  1 
ATOM   2997 C CG  . LEU B  1 129 ? -41.074  -19.413 -25.372 1.00 85.89  ?  1603 LEU B CG  1 
ATOM   2998 C CD1 . LEU B  1 129 ? -40.024  -18.671 -24.585 1.00 94.78  ?  1603 LEU B CD1 1 
ATOM   2999 C CD2 . LEU B  1 129 ? -42.434  -18.980 -24.886 1.00 83.75  ?  1603 LEU B CD2 1 
ATOM   3000 N N   . ALA B  1 130 ? -39.234  -21.086 -29.380 1.00 90.68  ?  1604 ALA B N   1 
ATOM   3001 C CA  . ALA B  1 130 ? -39.057  -22.395 -30.012 1.00 96.27  ?  1604 ALA B CA  1 
ATOM   3002 C C   . ALA B  1 130 ? -37.643  -22.950 -29.771 1.00 102.09 ?  1604 ALA B C   1 
ATOM   3003 O O   . ALA B  1 130 ? -37.434  -24.164 -29.889 1.00 98.83  ?  1604 ALA B O   1 
ATOM   3004 C CB  . ALA B  1 130 ? -39.331  -22.293 -31.505 1.00 101.51 ?  1604 ALA B CB  1 
ATOM   3005 N N   . ARG B  1 131 ? -36.679  -22.054 -29.423 1.00 102.72 ?  1605 ARG B N   1 
ATOM   3006 C CA  . ARG B  1 131 ? -35.274  -22.372 -29.122 1.00 96.56  ?  1605 ARG B CA  1 
ATOM   3007 C C   . ARG B  1 131 ? -35.164  -23.306 -27.902 1.00 97.78  ?  1605 ARG B C   1 
ATOM   3008 O O   . ARG B  1 131 ? -34.195  -24.059 -27.782 1.00 102.43 ?  1605 ARG B O   1 
ATOM   3009 C CB  . ARG B  1 131 ? -34.449  -21.076 -28.905 1.00 89.95  ?  1605 ARG B CB  1 
ATOM   3010 C CG  . ARG B  1 131 ? -34.724  -20.335 -27.591 1.00 89.73  ?  1605 ARG B CG  1 
ATOM   3011 C CD  . ARG B  1 131 ? -34.420  -18.855 -27.655 1.00 91.35  ?  1605 ARG B CD  1 
ATOM   3012 N NE  . ARG B  1 131 ? -33.019  -18.536 -27.374 1.00 95.73  ?  1605 ARG B NE  1 
ATOM   3013 C CZ  . ARG B  1 131 ? -32.564  -18.074 -26.211 1.00 99.29  ?  1605 ARG B CZ  1 
ATOM   3014 N NH1 . ARG B  1 131 ? -33.391  -17.896 -25.188 1.00 93.40  1  1605 ARG B NH1 1 
ATOM   3015 N NH2 . ARG B  1 131 ? -31.278  -17.791 -26.062 1.00 111.05 ?  1605 ARG B NH2 1 
ATOM   3016 N N   . ILE B  1 132 ? -36.186  -23.245 -27.016 1.00 92.77  ?  1606 ILE B N   1 
ATOM   3017 C CA  . ILE B  1 132 ? -36.368  -23.970 -25.754 1.00 85.51  ?  1606 ILE B CA  1 
ATOM   3018 C C   . ILE B  1 132 ? -36.440  -25.489 -25.949 1.00 86.66  ?  1606 ILE B C   1 
ATOM   3019 O O   . ILE B  1 132 ? -35.986  -26.235 -25.072 1.00 77.68  ?  1606 ILE B O   1 
ATOM   3020 C CB  . ILE B  1 132 ? -37.612  -23.379 -25.028 1.00 83.33  ?  1606 ILE B CB  1 
ATOM   3021 C CG1 . ILE B  1 132 ? -37.463  -21.846 -24.752 1.00 84.63  ?  1606 ILE B CG1 1 
ATOM   3022 C CG2 . ILE B  1 132 ? -38.011  -24.143 -23.768 1.00 83.42  ?  1606 ILE B CG2 1 
ATOM   3023 C CD1 . ILE B  1 132 ? -36.122  -21.321 -24.074 1.00 92.54  ?  1606 ILE B CD1 1 
ATOM   3024 N N   . GLY B  1 133 ? -36.984  -25.911 -27.099 1.00 91.81  ?  1607 GLY B N   1 
ATOM   3025 C CA  . GLY B  1 133 ? -37.112  -27.309 -27.504 1.00 89.96  ?  1607 GLY B CA  1 
ATOM   3026 C C   . GLY B  1 133 ? -35.786  -28.043 -27.504 1.00 92.13  ?  1607 GLY B C   1 
ATOM   3027 O O   . GLY B  1 133 ? -35.705  -29.169 -27.004 1.00 92.61  ?  1607 GLY B O   1 
ATOM   3028 N N   . ARG B  1 134 ? -34.725  -27.370 -28.021 1.00 98.94  ?  1608 ARG B N   1 
ATOM   3029 C CA  . ARG B  1 134 ? -33.335  -27.849 -28.102 1.00 97.44  ?  1608 ARG B CA  1 
ATOM   3030 C C   . ARG B  1 134 ? -32.734  -28.095 -26.724 1.00 95.08  ?  1608 ARG B C   1 
ATOM   3031 O O   . ARG B  1 134 ? -31.766  -28.850 -26.591 1.00 97.19  ?  1608 ARG B O   1 
ATOM   3032 C CB  . ARG B  1 134 ? -32.446  -26.793 -28.781 1.00 98.69  ?  1608 ARG B CB  1 
ATOM   3033 C CG  . ARG B  1 134 ? -32.749  -26.526 -30.239 1.00 97.48  ?  1608 ARG B CG  1 
ATOM   3034 C CD  . ARG B  1 134 ? -31.563  -25.896 -30.951 1.00 94.23  ?  1608 ARG B CD  1 
ATOM   3035 N NE  . ARG B  1 134 ? -31.239  -24.551 -30.463 1.00 89.43  ?  1608 ARG B NE  1 
ATOM   3036 C CZ  . ARG B  1 134 ? -31.881  -23.439 -30.816 1.00 91.77  ?  1608 ARG B CZ  1 
ATOM   3037 N NH1 . ARG B  1 134 ? -32.917  -23.494 -31.644 1.00 88.78  1  1608 ARG B NH1 1 
ATOM   3038 N NH2 . ARG B  1 134 ? -31.506  -22.267 -30.324 1.00 97.64  ?  1608 ARG B NH2 1 
ATOM   3039 N N   . ILE B  1 135 ? -33.272  -27.400 -25.715 1.00 96.82  ?  1609 ILE B N   1 
ATOM   3040 C CA  . ILE B  1 135 ? -32.773  -27.412 -24.355 1.00 102.03 ?  1609 ILE B CA  1 
ATOM   3041 C C   . ILE B  1 135 ? -33.568  -28.362 -23.463 1.00 107.98 ?  1609 ILE B C   1 
ATOM   3042 O O   . ILE B  1 135 ? -32.941  -29.102 -22.701 1.00 112.98 ?  1609 ILE B O   1 
ATOM   3043 C CB  . ILE B  1 135 ? -32.688  -25.933 -23.862 1.00 105.84 ?  1609 ILE B CB  1 
ATOM   3044 C CG1 . ILE B  1 135 ? -31.235  -25.446 -23.873 1.00 107.56 ?  1609 ILE B CG1 1 
ATOM   3045 C CG2 . ILE B  1 135 ? -33.346  -25.654 -22.513 1.00 105.00 ?  1609 ILE B CG2 1 
ATOM   3046 C CD1 . ILE B  1 135 ? -30.458  -25.664 -25.189 1.00 109.98 ?  1609 ILE B CD1 1 
ATOM   3047 N N   . LEU B  1 136 ? -34.915  -28.412 -23.595 1.00 111.73 ?  1610 LEU B N   1 
ATOM   3048 C CA  . LEU B  1 136 ? -35.717  -29.322 -22.770 1.00 116.34 ?  1610 LEU B CA  1 
ATOM   3049 C C   . LEU B  1 136 ? -35.530  -30.793 -23.200 1.00 121.97 ?  1610 LEU B C   1 
ATOM   3050 O O   . LEU B  1 136 ? -36.226  -31.680 -22.706 1.00 135.12 ?  1610 LEU B O   1 
ATOM   3051 C CB  . LEU B  1 136 ? -37.198  -28.898 -22.676 1.00 109.66 ?  1610 LEU B CB  1 
ATOM   3052 C CG  . LEU B  1 136 ? -38.081  -29.081 -23.896 1.00 102.72 ?  1610 LEU B CG  1 
ATOM   3053 C CD1 . LEU B  1 136 ? -39.095  -30.160 -23.651 1.00 97.04  ?  1610 LEU B CD1 1 
ATOM   3054 C CD2 . LEU B  1 136 ? -38.819  -27.819 -24.201 1.00 101.33 ?  1610 LEU B CD2 1 
ATOM   3055 N N   . ARG B  1 137 ? -34.536  -31.045 -24.078 1.00 122.24 ?  1611 ARG B N   1 
ATOM   3056 C CA  . ARG B  1 137 ? -34.146  -32.376 -24.537 1.00 120.67 ?  1611 ARG B CA  1 
ATOM   3057 C C   . ARG B  1 137 ? -33.403  -33.105 -23.410 1.00 124.19 ?  1611 ARG B C   1 
ATOM   3058 O O   . ARG B  1 137 ? -33.343  -34.327 -23.429 1.00 132.69 ?  1611 ARG B O   1 
ATOM   3059 C CB  . ARG B  1 137 ? -33.263  -32.283 -25.792 1.00 115.81 ?  1611 ARG B CB  1 
ATOM   3060 C CG  . ARG B  1 137 ? -34.032  -32.440 -27.103 1.00 111.41 ?  1611 ARG B CG  1 
ATOM   3061 C CD  . ARG B  1 137 ? -33.112  -32.596 -28.311 1.00 103.43 ?  1611 ARG B CD  1 
ATOM   3062 N NE  . ARG B  1 137 ? -32.360  -33.857 -28.281 1.00 103.93 ?  1611 ARG B NE  1 
ATOM   3063 C CZ  . ARG B  1 137 ? -31.873  -34.478 -29.353 1.00 107.76 ?  1611 ARG B CZ  1 
ATOM   3064 N NH1 . ARG B  1 137 ? -32.065  -33.975 -30.568 1.00 114.09 1  1611 ARG B NH1 1 
ATOM   3065 N NH2 . ARG B  1 137 ? -31.205  -35.615 -29.220 1.00 109.58 ?  1611 ARG B NH2 1 
ATOM   3066 N N   . LEU B  1 138 ? -32.861  -32.351 -22.421 1.00 119.52 ?  1612 LEU B N   1 
ATOM   3067 C CA  . LEU B  1 138 ? -32.148  -32.874 -21.249 1.00 113.15 ?  1612 LEU B CA  1 
ATOM   3068 C C   . LEU B  1 138 ? -33.057  -33.679 -20.303 1.00 107.17 ?  1612 LEU B C   1 
ATOM   3069 O O   . LEU B  1 138 ? -32.552  -34.514 -19.560 1.00 103.48 ?  1612 LEU B O   1 
ATOM   3070 C CB  . LEU B  1 138 ? -31.441  -31.740 -20.486 1.00 112.00 ?  1612 LEU B CB  1 
ATOM   3071 C CG  . LEU B  1 138 ? -29.923  -31.636 -20.651 1.00 113.87 ?  1612 LEU B CG  1 
ATOM   3072 C CD1 . LEU B  1 138 ? -29.477  -30.191 -20.652 1.00 111.75 ?  1612 LEU B CD1 1 
ATOM   3073 C CD2 . LEU B  1 138 ? -29.192  -32.386 -19.552 1.00 124.03 ?  1612 LEU B CD2 1 
ATOM   3074 N N   . VAL B  1 139 ? -34.390  -33.445 -20.332 1.00 103.97 ?  1613 VAL B N   1 
ATOM   3075 C CA  . VAL B  1 139 ? -35.336  -34.214 -19.505 1.00 109.47 ?  1613 VAL B CA  1 
ATOM   3076 C C   . VAL B  1 139 ? -35.615  -35.557 -20.188 1.00 108.84 ?  1613 VAL B C   1 
ATOM   3077 O O   . VAL B  1 139 ? -36.214  -36.447 -19.584 1.00 117.51 ?  1613 VAL B O   1 
ATOM   3078 C CB  . VAL B  1 139 ? -36.653  -33.463 -19.126 1.00 114.87 ?  1613 VAL B CB  1 
ATOM   3079 C CG1 . VAL B  1 139 ? -36.376  -32.075 -18.553 1.00 119.24 ?  1613 VAL B CG1 1 
ATOM   3080 C CG2 . VAL B  1 139 ? -37.632  -33.392 -20.296 1.00 123.80 ?  1613 VAL B CG2 1 
ATOM   3081 N N   . THR B  1 140 ? -35.178  -35.681 -21.456 1.00 106.40 ?  1614 THR B N   1 
ATOM   3082 C CA  . THR B  1 140 ? -35.348  -36.843 -22.320 1.00 107.83 ?  1614 THR B CA  1 
ATOM   3083 C C   . THR B  1 140 ? -34.004  -37.568 -22.509 1.00 112.30 ?  1614 THR B C   1 
ATOM   3084 O O   . THR B  1 140 ? -33.729  -38.541 -21.807 1.00 107.82 ?  1614 THR B O   1 
ATOM   3085 C CB  . THR B  1 140 ? -35.988  -36.377 -23.651 1.00 104.47 ?  1614 THR B CB  1 
ATOM   3086 O OG1 . THR B  1 140 ? -37.126  -35.558 -23.372 1.00 94.03  ?  1614 THR B OG1 1 
ATOM   3087 C CG2 . THR B  1 140 ? -36.367  -37.528 -24.577 1.00 102.94 ?  1614 THR B CG2 1 
ATOM   3088 N N   . ALA B  1 141 ? -33.178  -37.057 -23.447 1.00 118.95 ?  1615 ALA B N   1 
ATOM   3089 C CA  . ALA B  1 141 ? -31.877  -37.542 -23.914 1.00 121.81 ?  1615 ALA B CA  1 
ATOM   3090 C C   . ALA B  1 141 ? -30.968  -38.164 -22.848 1.00 122.46 ?  1615 ALA B C   1 
ATOM   3091 O O   . ALA B  1 141 ? -30.461  -39.264 -23.082 1.00 130.50 ?  1615 ALA B O   1 
ATOM   3092 C CB  . ALA B  1 141 ? -31.139  -36.435 -24.648 1.00 124.93 ?  1615 ALA B CB  1 
ATOM   3093 N N   . VAL B  1 142 ? -30.737  -37.483 -21.708 1.00 118.28 ?  1616 VAL B N   1 
ATOM   3094 C CA  . VAL B  1 142 ? -29.878  -38.058 -20.671 1.00 113.67 ?  1616 VAL B CA  1 
ATOM   3095 C C   . VAL B  1 142 ? -30.711  -39.033 -19.800 1.00 117.78 ?  1616 VAL B C   1 
ATOM   3096 O O   . VAL B  1 142 ? -31.785  -38.652 -19.321 1.00 122.70 ?  1616 VAL B O   1 
ATOM   3097 C CB  . VAL B  1 142 ? -29.037  -37.017 -19.869 1.00 109.68 ?  1616 VAL B CB  1 
ATOM   3098 C CG1 . VAL B  1 142 ? -29.901  -36.033 -19.101 1.00 112.04 ?  1616 VAL B CG1 1 
ATOM   3099 C CG2 . VAL B  1 142 ? -28.026  -37.687 -18.945 1.00 116.00 ?  1616 VAL B CG2 1 
ATOM   3100 N N   . PRO B  1 143 ? -30.263  -40.314 -19.651 1.00 121.77 ?  1617 PRO B N   1 
ATOM   3101 C CA  . PRO B  1 143 ? -31.038  -41.284 -18.855 1.00 127.58 ?  1617 PRO B CA  1 
ATOM   3102 C C   . PRO B  1 143 ? -31.190  -40.883 -17.393 1.00 132.86 ?  1617 PRO B C   1 
ATOM   3103 O O   . PRO B  1 143 ? -30.550  -39.927 -16.947 1.00 123.10 ?  1617 PRO B O   1 
ATOM   3104 C CB  . PRO B  1 143 ? -30.251  -42.590 -19.016 1.00 127.13 ?  1617 PRO B CB  1 
ATOM   3105 C CG  . PRO B  1 143 ? -29.405  -42.389 -20.230 1.00 124.50 ?  1617 PRO B CG  1 
ATOM   3106 C CD  . PRO B  1 143 ? -29.042  -40.944 -20.191 1.00 122.71 ?  1617 PRO B CD  1 
ATOM   3107 N N   . GLN B  1 144 ? -32.073  -41.601 -16.665 1.00 139.31 ?  1618 GLN B N   1 
ATOM   3108 C CA  . GLN B  1 144 ? -32.485  -41.385 -15.269 1.00 143.22 ?  1618 GLN B CA  1 
ATOM   3109 C C   . GLN B  1 144 ? -33.331  -40.100 -15.167 1.00 136.74 ?  1618 GLN B C   1 
ATOM   3110 O O   . GLN B  1 144 ? -34.242  -40.049 -14.345 1.00 136.93 ?  1618 GLN B O   1 
ATOM   3111 C CB  . GLN B  1 144 ? -31.333  -41.481 -14.232 1.00 144.65 ?  1618 GLN B CB  1 
ATOM   3112 C CG  . GLN B  1 144 ? -30.608  -40.183 -13.853 1.00 148.91 ?  1618 GLN B CG  1 
ATOM   3113 C CD  . GLN B  1 144 ? -29.103  -40.309 -13.953 1.00 155.64 ?  1618 GLN B CD  1 
ATOM   3114 O OE1 . GLN B  1 144 ? -28.508  -41.357 -13.662 1.00 141.55 ?  1618 GLN B OE1 1 
ATOM   3115 N NE2 . GLN B  1 144 ? -28.449  -39.227 -14.350 1.00 165.57 ?  1618 GLN B NE2 1 
ATOM   3116 N N   . MET B  1 145 ? -33.074  -39.103 -16.049 1.00 125.97 ?  1619 MET B N   1 
ATOM   3117 C CA  . MET B  1 145 ? -33.854  -37.869 -16.162 1.00 115.93 ?  1619 MET B CA  1 
ATOM   3118 C C   . MET B  1 145 ? -35.142  -38.227 -16.888 1.00 118.64 ?  1619 MET B C   1 
ATOM   3119 O O   . MET B  1 145 ? -36.202  -37.693 -16.556 1.00 133.34 ?  1619 MET B O   1 
ATOM   3120 C CB  . MET B  1 145 ? -33.088  -36.784 -16.931 1.00 115.21 ?  1619 MET B CB  1 
ATOM   3121 C CG  . MET B  1 145 ? -32.010  -36.112 -16.112 1.00 122.34 ?  1619 MET B CG  1 
ATOM   3122 S SD  . MET B  1 145 ? -32.638  -35.038 -14.801 1.00 121.82 ?  1619 MET B SD  1 
ATOM   3123 C CE  . MET B  1 145 ? -31.168  -34.162 -14.396 1.00 118.88 ?  1619 MET B CE  1 
ATOM   3124 N N   . ARG B  1 146 ? -35.047  -39.172 -17.855 1.00 116.34 ?  1620 ARG B N   1 
ATOM   3125 C CA  . ARG B  1 146 ? -36.184  -39.716 -18.592 1.00 117.21 ?  1620 ARG B CA  1 
ATOM   3126 C C   . ARG B  1 146 ? -36.987  -40.588 -17.623 1.00 108.46 ?  1620 ARG B C   1 
ATOM   3127 O O   . ARG B  1 146 ? -38.214  -40.573 -17.682 1.00 104.89 ?  1620 ARG B O   1 
ATOM   3128 C CB  . ARG B  1 146 ? -35.709  -40.536 -19.806 1.00 124.16 ?  1620 ARG B CB  1 
ATOM   3129 C CG  . ARG B  1 146 ? -36.835  -40.984 -20.749 1.00 120.77 ?  1620 ARG B CG  1 
ATOM   3130 C CD  . ARG B  1 146 ? -36.325  -41.801 -21.927 1.00 118.19 ?  1620 ARG B CD  1 
ATOM   3131 N NE  . ARG B  1 146 ? -35.661  -40.962 -22.929 1.00 116.69 ?  1620 ARG B NE  1 
ATOM   3132 C CZ  . ARG B  1 146 ? -35.275  -41.381 -24.131 1.00 111.57 ?  1620 ARG B CZ  1 
ATOM   3133 N NH1 . ARG B  1 146 ? -35.484  -42.639 -24.503 1.00 113.27 1  1620 ARG B NH1 1 
ATOM   3134 N NH2 . ARG B  1 146 ? -34.686  -40.543 -24.976 1.00 110.14 ?  1620 ARG B NH2 1 
ATOM   3135 N N   . LYS B  1 147 ? -36.287  -41.317 -16.712 1.00 106.28 ?  1621 LYS B N   1 
ATOM   3136 C CA  . LYS B  1 147 ? -36.890  -42.181 -15.692 1.00 102.36 ?  1621 LYS B CA  1 
ATOM   3137 C C   . LYS B  1 147 ? -37.739  -41.371 -14.727 1.00 98.58  ?  1621 LYS B C   1 
ATOM   3138 O O   . LYS B  1 147 ? -38.923  -41.673 -14.587 1.00 91.90  ?  1621 LYS B O   1 
ATOM   3139 C CB  . LYS B  1 147 ? -35.829  -42.982 -14.910 1.00 107.77 ?  1621 LYS B CB  1 
ATOM   3140 C CG  . LYS B  1 147 ? -35.291  -44.209 -15.641 1.00 116.22 ?  1621 LYS B CG  1 
ATOM   3141 C CD  . LYS B  1 147 ? -34.365  -45.055 -14.754 1.00 114.12 ?  1621 LYS B CD  1 
ATOM   3142 C CE  . LYS B  1 147 ? -35.054  -46.234 -14.095 1.00 113.13 ?  1621 LYS B CE  1 
ATOM   3143 N NZ  . LYS B  1 147 ? -35.296  -47.356 -15.044 1.00 114.89 1  1621 LYS B NZ  1 
ATOM   3144 N N   . ILE B  1 148 ? -37.146  -40.325 -14.092 1.00 108.44 ?  1622 ILE B N   1 
ATOM   3145 C CA  . ILE B  1 148 ? -37.821  -39.461 -13.115 1.00 109.91 ?  1622 ILE B CA  1 
ATOM   3146 C C   . ILE B  1 148 ? -39.051  -38.809 -13.737 1.00 106.27 ?  1622 ILE B C   1 
ATOM   3147 O O   . ILE B  1 148 ? -40.148  -39.027 -13.227 1.00 110.33 ?  1622 ILE B O   1 
ATOM   3148 C CB  . ILE B  1 148 ? -36.871  -38.436 -12.401 1.00 100.97 ?  1622 ILE B CB  1 
ATOM   3149 C CG1 . ILE B  1 148 ? -35.697  -39.120 -11.649 1.00 95.51  ?  1622 ILE B CG1 1 
ATOM   3150 C CG2 . ILE B  1 148 ? -37.633  -37.494 -11.463 1.00 98.51  ?  1622 ILE B CG2 1 
ATOM   3151 C CD1 . ILE B  1 148 ? -36.048  -40.265 -10.604 1.00 95.79  ?  1622 ILE B CD1 1 
ATOM   3152 N N   . VAL B  1 149 ? -38.889  -38.090 -14.870 1.00 102.23 ?  1623 VAL B N   1 
ATOM   3153 C CA  . VAL B  1 149 ? -39.994  -37.409 -15.550 1.00 102.06 ?  1623 VAL B CA  1 
ATOM   3154 C C   . VAL B  1 149 ? -41.139  -38.404 -15.913 1.00 96.90  ?  1623 VAL B C   1 
ATOM   3155 O O   . VAL B  1 149 ? -42.302  -38.033 -15.771 1.00 92.23  ?  1623 VAL B O   1 
ATOM   3156 C CB  . VAL B  1 149 ? -39.525  -36.521 -16.739 1.00 104.58 ?  1623 VAL B CB  1 
ATOM   3157 C CG1 . VAL B  1 149 ? -39.144  -37.340 -17.965 1.00 112.13 ?  1623 VAL B CG1 1 
ATOM   3158 C CG2 . VAL B  1 149 ? -40.571  -35.474 -17.095 1.00 109.24 ?  1623 VAL B CG2 1 
ATOM   3159 N N   . SER B  1 150 ? -40.809  -39.674 -16.271 1.00 92.88  ?  1624 SER B N   1 
ATOM   3160 C CA  . SER B  1 150 ? -41.794  -40.721 -16.592 1.00 87.97  ?  1624 SER B CA  1 
ATOM   3161 C C   . SER B  1 150 ? -42.472  -41.283 -15.342 1.00 89.84  ?  1624 SER B C   1 
ATOM   3162 O O   . SER B  1 150 ? -43.672  -41.569 -15.375 1.00 97.86  ?  1624 SER B O   1 
ATOM   3163 C CB  . SER B  1 150 ? -41.152  -41.849 -17.389 1.00 84.34  ?  1624 SER B CB  1 
ATOM   3164 O OG  . SER B  1 150 ? -40.705  -41.371 -18.647 1.00 82.10  ?  1624 SER B OG  1 
ATOM   3165 N N   . ALA B  1 151 ? -41.710  -41.429 -14.239 1.00 92.47  ?  1625 ALA B N   1 
ATOM   3166 C CA  . ALA B  1 151 ? -42.226  -41.903 -12.954 1.00 93.19  ?  1625 ALA B CA  1 
ATOM   3167 C C   . ALA B  1 151 ? -43.117  -40.833 -12.338 1.00 93.21  ?  1625 ALA B C   1 
ATOM   3168 O O   . ALA B  1 151 ? -43.985  -41.162 -11.530 1.00 99.17  ?  1625 ALA B O   1 
ATOM   3169 C CB  . ALA B  1 151 ? -41.082  -42.230 -12.010 1.00 94.27  ?  1625 ALA B CB  1 
ATOM   3170 N N   . LEU B  1 152 ? -42.899  -39.550 -12.720 1.00 95.04  ?  1626 LEU B N   1 
ATOM   3171 C CA  . LEU B  1 152 ? -43.708  -38.418 -12.269 1.00 102.42 ?  1626 LEU B CA  1 
ATOM   3172 C C   . LEU B  1 152 ? -44.999  -38.355 -13.095 1.00 107.85 ?  1626 LEU B C   1 
ATOM   3173 O O   . LEU B  1 152 ? -46.079  -38.231 -12.520 1.00 106.52 ?  1626 LEU B O   1 
ATOM   3174 C CB  . LEU B  1 152 ? -42.940  -37.076 -12.358 1.00 101.26 ?  1626 LEU B CB  1 
ATOM   3175 C CG  . LEU B  1 152 ? -41.711  -36.849 -11.451 1.00 100.57 ?  1626 LEU B CG  1 
ATOM   3176 C CD1 . LEU B  1 152 ? -41.179  -35.443 -11.608 1.00 97.58  ?  1626 LEU B CD1 1 
ATOM   3177 C CD2 . LEU B  1 152 ? -42.012  -37.118 -9.988  1.00 95.44  ?  1626 LEU B CD2 1 
ATOM   3178 N N   . ILE B  1 153 ? -44.888  -38.486 -14.437 1.00 103.66 ?  1627 ILE B N   1 
ATOM   3179 C CA  . ILE B  1 153 ? -46.026  -38.463 -15.362 1.00 99.23  ?  1627 ILE B CA  1 
ATOM   3180 C C   . ILE B  1 153 ? -47.015  -39.608 -15.055 1.00 103.92 ?  1627 ILE B C   1 
ATOM   3181 O O   . ILE B  1 153 ? -48.225  -39.395 -15.130 1.00 120.22 ?  1627 ILE B O   1 
ATOM   3182 C CB  . ILE B  1 153 ? -45.540  -38.410 -16.840 1.00 95.31  ?  1627 ILE B CB  1 
ATOM   3183 C CG1 . ILE B  1 153 ? -45.091  -36.970 -17.202 1.00 96.27  ?  1627 ILE B CG1 1 
ATOM   3184 C CG2 . ILE B  1 153 ? -46.609  -38.901 -17.829 1.00 97.01  ?  1627 ILE B CG2 1 
ATOM   3185 C CD1 . ILE B  1 153 ? -44.017  -36.848 -18.340 1.00 98.66  ?  1627 ILE B CD1 1 
ATOM   3186 N N   . SER B  1 154 ? -46.500  -40.777 -14.624 1.00 104.15 ?  1628 SER B N   1 
ATOM   3187 C CA  . SER B  1 154 ? -47.293  -41.958 -14.245 1.00 107.47 ?  1628 SER B CA  1 
ATOM   3188 C C   . SER B  1 154 ? -48.256  -41.697 -13.058 1.00 112.76 ?  1628 SER B C   1 
ATOM   3189 O O   . SER B  1 154 ? -49.247  -42.420 -12.886 1.00 110.05 ?  1628 SER B O   1 
ATOM   3190 C CB  . SER B  1 154 ? -46.372  -43.135 -13.935 1.00 106.60 ?  1628 SER B CB  1 
ATOM   3191 O OG  . SER B  1 154 ? -45.592  -42.906 -12.773 1.00 99.72  ?  1628 SER B OG  1 
ATOM   3192 N N   . VAL B  1 155 ? -47.956  -40.660 -12.258 1.00 109.74 ?  1629 VAL B N   1 
ATOM   3193 C CA  . VAL B  1 155 ? -48.736  -40.242 -11.092 1.00 114.20 ?  1629 VAL B CA  1 
ATOM   3194 C C   . VAL B  1 155 ? -49.993  -39.471 -11.529 1.00 114.24 ?  1629 VAL B C   1 
ATOM   3195 O O   . VAL B  1 155 ? -51.079  -39.737 -11.008 1.00 105.12 ?  1629 VAL B O   1 
ATOM   3196 C CB  . VAL B  1 155 ? -47.850  -39.428 -10.110 1.00 112.90 ?  1629 VAL B CB  1 
ATOM   3197 C CG1 . VAL B  1 155 ? -48.652  -38.890 -8.929  1.00 120.42 ?  1629 VAL B CG1 1 
ATOM   3198 C CG2 . VAL B  1 155 ? -46.666  -40.259 -9.623  1.00 110.68 ?  1629 VAL B CG2 1 
ATOM   3199 N N   . ILE B  1 156 ? -49.837  -38.549 -12.508 1.00 114.68 ?  1630 ILE B N   1 
ATOM   3200 C CA  . ILE B  1 156 ? -50.868  -37.663 -13.075 1.00 108.86 ?  1630 ILE B CA  1 
ATOM   3201 C C   . ILE B  1 156 ? -52.254  -38.373 -13.267 1.00 114.71 ?  1630 ILE B C   1 
ATOM   3202 O O   . ILE B  1 156 ? -53.242  -37.797 -12.800 1.00 131.52 ?  1630 ILE B O   1 
ATOM   3203 C CB  . ILE B  1 156 ? -50.342  -36.952 -14.364 1.00 102.46 ?  1630 ILE B CB  1 
ATOM   3204 C CG1 . ILE B  1 156 ? -49.164  -36.005 -14.007 1.00 102.17 ?  1630 ILE B CG1 1 
ATOM   3205 C CG2 . ILE B  1 156 ? -51.451  -36.195 -15.112 1.00 102.01 ?  1630 ILE B CG2 1 
ATOM   3206 C CD1 . ILE B  1 156 ? -48.289  -35.537 -15.150 1.00 105.51 ?  1630 ILE B CD1 1 
ATOM   3207 N N   . PRO B  1 157 ? -52.381  -39.602 -13.844 1.00 108.00 ?  1631 PRO B N   1 
ATOM   3208 C CA  . PRO B  1 157 ? -53.722  -40.212 -13.961 1.00 106.41 ?  1631 PRO B CA  1 
ATOM   3209 C C   . PRO B  1 157 ? -54.341  -40.680 -12.638 1.00 105.44 ?  1631 PRO B C   1 
ATOM   3210 O O   . PRO B  1 157 ? -55.547  -40.509 -12.439 1.00 98.62  ?  1631 PRO B O   1 
ATOM   3211 C CB  . PRO B  1 157 ? -53.509  -41.377 -14.937 1.00 107.42 ?  1631 PRO B CB  1 
ATOM   3212 C CG  . PRO B  1 157 ? -52.141  -41.169 -15.524 1.00 108.64 ?  1631 PRO B CG  1 
ATOM   3213 C CD  . PRO B  1 157 ? -51.365  -40.470 -14.471 1.00 104.28 ?  1631 PRO B CD  1 
ATOM   3214 N N   . GLY B  1 158 ? -53.517  -41.230 -11.741 1.00 109.98 ?  1632 GLY B N   1 
ATOM   3215 C CA  . GLY B  1 158 ? -53.954  -41.712 -10.432 1.00 111.93 ?  1632 GLY B CA  1 
ATOM   3216 C C   . GLY B  1 158 ? -54.357  -40.626 -9.447  1.00 112.34 ?  1632 GLY B C   1 
ATOM   3217 O O   . GLY B  1 158 ? -54.324  -40.844 -8.232  1.00 110.26 ?  1632 GLY B O   1 
ATOM   3218 N N   . MET B  1 159 ? -54.741  -39.443 -9.969  1.00 117.47 ?  1633 MET B N   1 
ATOM   3219 C CA  . MET B  1 159 ? -55.168  -38.251 -9.227  1.00 122.16 ?  1633 MET B CA  1 
ATOM   3220 C C   . MET B  1 159 ? -55.977  -37.318 -10.154 1.00 112.85 ?  1633 MET B C   1 
ATOM   3221 O O   . MET B  1 159 ? -56.395  -36.234 -9.727  1.00 100.33 ?  1633 MET B O   1 
ATOM   3222 C CB  . MET B  1 159 ? -53.949  -37.509 -8.615  1.00 133.61 ?  1633 MET B CB  1 
ATOM   3223 C CG  . MET B  1 159 ? -52.974  -36.956 -9.650  1.00 135.84 ?  1633 MET B CG  1 
ATOM   3224 S SD  . MET B  1 159 ? -51.614  -35.998 -8.952  1.00 129.85 ?  1633 MET B SD  1 
ATOM   3225 C CE  . MET B  1 159 ? -51.141  -35.066 -10.352 1.00 125.77 ?  1633 MET B CE  1 
ATOM   3226 N N   . LEU B  1 160 ? -56.194  -37.757 -11.419 1.00 111.66 ?  1634 LEU B N   1 
ATOM   3227 C CA  . LEU B  1 160 ? -56.897  -37.010 -12.468 1.00 111.56 ?  1634 LEU B CA  1 
ATOM   3228 C C   . LEU B  1 160 ? -58.352  -36.678 -12.149 1.00 108.02 ?  1634 LEU B C   1 
ATOM   3229 O O   . LEU B  1 160 ? -58.855  -35.672 -12.652 1.00 93.53  ?  1634 LEU B O   1 
ATOM   3230 C CB  . LEU B  1 160 ? -56.794  -37.711 -13.821 1.00 109.71 ?  1634 LEU B CB  1 
ATOM   3231 C CG  . LEU B  1 160 ? -56.572  -36.772 -14.992 1.00 107.83 ?  1634 LEU B CG  1 
ATOM   3232 C CD1 . LEU B  1 160 ? -55.109  -36.727 -15.383 1.00 106.88 ?  1634 LEU B CD1 1 
ATOM   3233 C CD2 . LEU B  1 160 ? -57.427  -37.170 -16.172 1.00 105.89 ?  1634 LEU B CD2 1 
ATOM   3234 N N   . SER B  1 161 ? -59.022  -37.505 -11.321 1.00 108.78 ?  1635 SER B N   1 
ATOM   3235 C CA  . SER B  1 161 ? -60.401  -37.261 -10.898 1.00 101.69 ?  1635 SER B CA  1 
ATOM   3236 C C   . SER B  1 161 ? -60.425  -36.084 -9.924  1.00 98.98  ?  1635 SER B C   1 
ATOM   3237 O O   . SER B  1 161 ? -61.291  -35.215 -10.040 1.00 101.66 ?  1635 SER B O   1 
ATOM   3238 C CB  . SER B  1 161 ? -60.998  -38.510 -10.263 1.00 102.36 ?  1635 SER B CB  1 
ATOM   3239 O OG  . SER B  1 161 ? -61.306  -39.473 -11.257 1.00 114.61 ?  1635 SER B OG  1 
ATOM   3240 N N   . VAL B  1 162 ? -59.428  -36.026 -9.015  1.00 98.11  ?  1636 VAL B N   1 
ATOM   3241 C CA  . VAL B  1 162 ? -59.240  -34.960 -8.024  1.00 92.25  ?  1636 VAL B CA  1 
ATOM   3242 C C   . VAL B  1 162 ? -58.891  -33.638 -8.727  1.00 86.95  ?  1636 VAL B C   1 
ATOM   3243 O O   . VAL B  1 162 ? -59.357  -32.582 -8.293  1.00 81.78  ?  1636 VAL B O   1 
ATOM   3244 C CB  . VAL B  1 162 ? -58.190  -35.335 -6.955  1.00 88.88  ?  1636 VAL B CB  1 
ATOM   3245 C CG1 . VAL B  1 162 ? -58.279  -34.402 -5.752  1.00 85.95  ?  1636 VAL B CG1 1 
ATOM   3246 C CG2 . VAL B  1 162 ? -58.341  -36.787 -6.510  1.00 94.45  ?  1636 VAL B CG2 1 
ATOM   3247 N N   . ILE B  1 163 ? -58.094  -33.703 -9.820  1.00 87.19  ?  1637 ILE B N   1 
ATOM   3248 C CA  . ILE B  1 163 ? -57.728  -32.536 -10.642 1.00 89.89  ?  1637 ILE B CA  1 
ATOM   3249 C C   . ILE B  1 163 ? -58.990  -32.034 -11.362 1.00 89.20  ?  1637 ILE B C   1 
ATOM   3250 O O   . ILE B  1 163 ? -59.229  -30.829 -11.405 1.00 89.32  ?  1637 ILE B O   1 
ATOM   3251 C CB  . ILE B  1 163 ? -56.582  -32.846 -11.657 1.00 95.81  ?  1637 ILE B CB  1 
ATOM   3252 C CG1 . ILE B  1 163 ? -55.350  -33.485 -10.972 1.00 98.16  ?  1637 ILE B CG1 1 
ATOM   3253 C CG2 . ILE B  1 163 ? -56.184  -31.583 -12.445 1.00 95.42  ?  1637 ILE B CG2 1 
ATOM   3254 C CD1 . ILE B  1 163 ? -54.480  -34.342 -11.885 1.00 95.83  ?  1637 ILE B CD1 1 
ATOM   3255 N N   . ALA B  1 164 ? -59.795  -32.975 -11.902 1.00 93.10  ?  1638 ALA B N   1 
ATOM   3256 C CA  . ALA B  1 164 ? -61.049  -32.713 -12.606 1.00 96.85  ?  1638 ALA B CA  1 
ATOM   3257 C C   . ALA B  1 164 ? -62.075  -32.070 -11.681 1.00 93.44  ?  1638 ALA B C   1 
ATOM   3258 O O   . ALA B  1 164 ? -62.715  -31.094 -12.081 1.00 98.10  ?  1638 ALA B O   1 
ATOM   3259 C CB  . ALA B  1 164 ? -61.605  -34.005 -13.185 1.00 98.42  ?  1638 ALA B CB  1 
ATOM   3260 N N   . LEU B  1 165 ? -62.208  -32.597 -10.439 1.00 83.83  ?  1639 LEU B N   1 
ATOM   3261 C CA  . LEU B  1 165 ? -63.132  -32.086 -9.424  1.00 79.99  ?  1639 LEU B CA  1 
ATOM   3262 C C   . LEU B  1 165 ? -62.778  -30.652 -9.048  1.00 82.10  ?  1639 LEU B C   1 
ATOM   3263 O O   . LEU B  1 165 ? -63.671  -29.814 -8.893  1.00 79.08  ?  1639 LEU B O   1 
ATOM   3264 C CB  . LEU B  1 165 ? -63.107  -32.977 -8.177  1.00 75.64  ?  1639 LEU B CB  1 
ATOM   3265 C CG  . LEU B  1 165 ? -64.030  -32.560 -7.034  1.00 76.23  ?  1639 LEU B CG  1 
ATOM   3266 C CD1 . LEU B  1 165 ? -65.419  -33.098 -7.223  1.00 76.45  ?  1639 LEU B CD1 1 
ATOM   3267 C CD2 . LEU B  1 165 ? -63.491  -33.018 -5.731  1.00 74.53  ?  1639 LEU B CD2 1 
ATOM   3268 N N   . MET B  1 166 ? -61.470  -30.383 -8.913  1.00 84.86  ?  1640 MET B N   1 
ATOM   3269 C CA  . MET B  1 166 ? -60.928  -29.081 -8.571  1.00 88.31  ?  1640 MET B CA  1 
ATOM   3270 C C   . MET B  1 166 ? -61.323  -28.021 -9.599  1.00 87.42  ?  1640 MET B C   1 
ATOM   3271 O O   . MET B  1 166 ? -61.793  -26.954 -9.203  1.00 83.87  ?  1640 MET B O   1 
ATOM   3272 C CB  . MET B  1 166 ? -59.404  -29.167 -8.423  1.00 92.32  ?  1640 MET B CB  1 
ATOM   3273 C CG  . MET B  1 166 ? -58.803  -27.971 -7.739  1.00 95.31  ?  1640 MET B CG  1 
ATOM   3274 S SD  . MET B  1 166 ? -59.498  -27.719 -6.096  1.00 94.77  ?  1640 MET B SD  1 
ATOM   3275 C CE  . MET B  1 166 ? -58.054  -27.823 -5.154  1.00 108.78 ?  1640 MET B CE  1 
ATOM   3276 N N   . THR B  1 167 ? -61.172  -28.326 -10.907 1.00 86.02  ?  1641 THR B N   1 
ATOM   3277 C CA  . THR B  1 167 ? -61.514  -27.407 -11.997 1.00 86.18  ?  1641 THR B CA  1 
ATOM   3278 C C   . THR B  1 167 ? -62.997  -27.078 -11.981 1.00 97.11  ?  1641 THR B C   1 
ATOM   3279 O O   . THR B  1 167 ? -63.356  -25.913 -12.153 1.00 93.82  ?  1641 THR B O   1 
ATOM   3280 C CB  . THR B  1 167 ? -61.087  -27.956 -13.357 1.00 84.52  ?  1641 THR B CB  1 
ATOM   3281 O OG1 . THR B  1 167 ? -59.885  -28.713 -13.226 1.00 90.88  ?  1641 THR B OG1 1 
ATOM   3282 C CG2 . THR B  1 167 ? -60.898  -26.854 -14.385 1.00 85.45  ?  1641 THR B CG2 1 
ATOM   3283 N N   . LEU B  1 168 ? -63.849  -28.103 -11.754 1.00 108.55 ?  1642 LEU B N   1 
ATOM   3284 C CA  . LEU B  1 168 ? -65.304  -27.971 -11.673 1.00 107.73 ?  1642 LEU B CA  1 
ATOM   3285 C C   . LEU B  1 168 ? -65.683  -27.097 -10.479 1.00 106.47 ?  1642 LEU B C   1 
ATOM   3286 O O   . LEU B  1 168 ? -66.532  -26.216 -10.618 1.00 99.52  ?  1642 LEU B O   1 
ATOM   3287 C CB  . LEU B  1 168 ? -65.964  -29.364 -11.592 1.00 111.51 ?  1642 LEU B CB  1 
ATOM   3288 C CG  . LEU B  1 168 ? -67.501  -29.474 -11.638 1.00 131.50 ?  1642 LEU B CG  1 
ATOM   3289 C CD1 . LEU B  1 168 ? -68.114  -28.611 -12.737 1.00 141.20 ?  1642 LEU B CD1 1 
ATOM   3290 C CD2 . LEU B  1 168 ? -67.917  -30.906 -11.868 1.00 138.08 ?  1642 LEU B CD2 1 
ATOM   3291 N N   . PHE B  1 169 ? -65.000  -27.302 -9.334  1.00 102.97 ?  1643 PHE B N   1 
ATOM   3292 C CA  . PHE B  1 169 ? -65.173  -26.539 -8.099  1.00 93.43  ?  1643 PHE B CA  1 
ATOM   3293 C C   . PHE B  1 169 ? -64.780  -25.082 -8.327  1.00 91.36  ?  1643 PHE B C   1 
ATOM   3294 O O   . PHE B  1 169 ? -65.444  -24.179 -7.820  1.00 91.00  ?  1643 PHE B O   1 
ATOM   3295 C CB  . PHE B  1 169 ? -64.332  -27.169 -6.976  1.00 87.00  ?  1643 PHE B CB  1 
ATOM   3296 C CG  . PHE B  1 169 ? -65.016  -28.236 -6.152  1.00 88.83  ?  1643 PHE B CG  1 
ATOM   3297 C CD1 . PHE B  1 169 ? -65.953  -29.092 -6.723  1.00 93.86  ?  1643 PHE B CD1 1 
ATOM   3298 C CD2 . PHE B  1 169 ? -64.700  -28.408 -4.811  1.00 93.77  ?  1643 PHE B CD2 1 
ATOM   3299 C CE1 . PHE B  1 169 ? -66.591  -30.067 -5.954  1.00 98.45  ?  1643 PHE B CE1 1 
ATOM   3300 C CE2 . PHE B  1 169 ? -65.333  -29.391 -4.044  1.00 97.08  ?  1643 PHE B CE2 1 
ATOM   3301 C CZ  . PHE B  1 169 ? -66.269  -30.218 -4.623  1.00 102.21 ?  1643 PHE B CZ  1 
ATOM   3302 N N   . PHE B  1 170 ? -63.726  -24.867 -9.136  1.00 89.72  ?  1644 PHE B N   1 
ATOM   3303 C CA  . PHE B  1 170 ? -63.224  -23.551 -9.511  1.00 89.47  ?  1644 PHE B CA  1 
ATOM   3304 C C   . PHE B  1 170 ? -64.228  -22.803 -10.369 1.00 91.31  ?  1644 PHE B C   1 
ATOM   3305 O O   . PHE B  1 170 ? -64.419  -21.606 -10.152 1.00 88.73  ?  1644 PHE B O   1 
ATOM   3306 C CB  . PHE B  1 170 ? -61.873  -23.665 -10.223 1.00 84.38  ?  1644 PHE B CB  1 
ATOM   3307 C CG  . PHE B  1 170 ? -60.735  -23.125 -9.398  1.00 82.58  ?  1644 PHE B CG  1 
ATOM   3308 C CD1 . PHE B  1 170 ? -60.205  -23.865 -8.347  1.00 82.89  ?  1644 PHE B CD1 1 
ATOM   3309 C CD2 . PHE B  1 170 ? -60.200  -21.871 -9.661  1.00 84.72  ?  1644 PHE B CD2 1 
ATOM   3310 C CE1 . PHE B  1 170 ? -59.159  -23.362 -7.575  1.00 82.30  ?  1644 PHE B CE1 1 
ATOM   3311 C CE2 . PHE B  1 170 ? -59.150  -21.367 -8.888  1.00 88.60  ?  1644 PHE B CE2 1 
ATOM   3312 C CZ  . PHE B  1 170 ? -58.636  -22.117 -7.850  1.00 85.06  ?  1644 PHE B CZ  1 
ATOM   3313 N N   . TYR B  1 171 ? -64.895  -23.512 -11.315 1.00 90.06  ?  1645 TYR B N   1 
ATOM   3314 C CA  . TYR B  1 171 ? -65.922  -22.943 -12.195 1.00 87.21  ?  1645 TYR B CA  1 
ATOM   3315 C C   . TYR B  1 171 ? -67.057  -22.370 -11.384 1.00 88.45  ?  1645 TYR B C   1 
ATOM   3316 O O   . TYR B  1 171 ? -67.241  -21.157 -11.398 1.00 95.45  ?  1645 TYR B O   1 
ATOM   3317 C CB  . TYR B  1 171 ? -66.451  -23.975 -13.210 1.00 80.15  ?  1645 TYR B CB  1 
ATOM   3318 C CG  . TYR B  1 171 ? -65.658  -23.974 -14.491 1.00 70.84  ?  1645 TYR B CG  1 
ATOM   3319 C CD1 . TYR B  1 171 ? -65.735  -22.905 -15.379 1.00 69.73  ?  1645 TYR B CD1 1 
ATOM   3320 C CD2 . TYR B  1 171 ? -64.796  -25.020 -14.800 1.00 66.66  ?  1645 TYR B CD2 1 
ATOM   3321 C CE1 . TYR B  1 171 ? -64.952  -22.865 -16.529 1.00 66.84  ?  1645 TYR B CE1 1 
ATOM   3322 C CE2 . TYR B  1 171 ? -64.016  -24.999 -15.954 1.00 65.01  ?  1645 TYR B CE2 1 
ATOM   3323 C CZ  . TYR B  1 171 ? -64.101  -23.920 -16.818 1.00 64.40  ?  1645 TYR B CZ  1 
ATOM   3324 O OH  . TYR B  1 171 ? -63.343  -23.899 -17.960 1.00 68.02  ?  1645 TYR B OH  1 
ATOM   3325 N N   . ILE B  1 172 ? -67.758  -23.233 -10.613 1.00 77.90  ?  1646 ILE B N   1 
ATOM   3326 C CA  . ILE B  1 172 ? -68.885  -22.890 -9.743  1.00 76.33  ?  1646 ILE B CA  1 
ATOM   3327 C C   . ILE B  1 172 ? -68.557  -21.631 -8.911  1.00 80.59  ?  1646 ILE B C   1 
ATOM   3328 O O   . ILE B  1 172 ? -69.348  -20.680 -8.913  1.00 69.99  ?  1646 ILE B O   1 
ATOM   3329 C CB  . ILE B  1 172 ? -69.320  -24.120 -8.878  1.00 80.00  ?  1646 ILE B CB  1 
ATOM   3330 C CG1 . ILE B  1 172 ? -69.649  -25.356 -9.751  1.00 83.20  ?  1646 ILE B CG1 1 
ATOM   3331 C CG2 . ILE B  1 172 ? -70.506  -23.783 -7.975  1.00 79.47  ?  1646 ILE B CG2 1 
ATOM   3332 C CD1 . ILE B  1 172 ? -69.531  -26.724 -9.035  1.00 83.47  ?  1646 ILE B CD1 1 
ATOM   3333 N N   . PHE B  1 173 ? -67.351  -21.602 -8.284  1.00 91.05  ?  1647 PHE B N   1 
ATOM   3334 C CA  . PHE B  1 173 ? -66.857  -20.482 -7.475  1.00 87.61  ?  1647 PHE B CA  1 
ATOM   3335 C C   . PHE B  1 173 ? -66.517  -19.231 -8.285  1.00 83.86  ?  1647 PHE B C   1 
ATOM   3336 O O   . PHE B  1 173 ? -66.663  -18.131 -7.751  1.00 79.42  ?  1647 PHE B O   1 
ATOM   3337 C CB  . PHE B  1 173 ? -65.670  -20.901 -6.598  1.00 82.07  ?  1647 PHE B CB  1 
ATOM   3338 C CG  . PHE B  1 173 ? -66.046  -21.507 -5.262  1.00 74.98  ?  1647 PHE B CG  1 
ATOM   3339 C CD1 . PHE B  1 173 ? -66.718  -20.755 -4.301  1.00 69.32  ?  1647 PHE B CD1 1 
ATOM   3340 C CD2 . PHE B  1 173 ? -65.670  -22.808 -4.939  1.00 68.51  ?  1647 PHE B CD2 1 
ATOM   3341 C CE1 . PHE B  1 173 ? -67.048  -21.310 -3.057  1.00 69.93  ?  1647 PHE B CE1 1 
ATOM   3342 C CE2 . PHE B  1 173 ? -65.989  -23.359 -3.690  1.00 66.92  ?  1647 PHE B CE2 1 
ATOM   3343 C CZ  . PHE B  1 173 ? -66.679  -22.607 -2.760  1.00 67.30  ?  1647 PHE B CZ  1 
ATOM   3344 N N   . ALA B  1 174 ? -66.048  -19.390 -9.552  1.00 80.06  ?  1648 ALA B N   1 
ATOM   3345 C CA  . ALA B  1 174 ? -65.720  -18.273 -10.454 1.00 80.91  ?  1648 ALA B CA  1 
ATOM   3346 C C   . ALA B  1 174 ? -66.973  -17.646 -11.040 1.00 89.22  ?  1648 ALA B C   1 
ATOM   3347 O O   . ALA B  1 174 ? -66.984  -16.441 -11.288 1.00 88.47  ?  1648 ALA B O   1 
ATOM   3348 C CB  . ALA B  1 174 ? -64.802  -18.732 -11.569 1.00 81.74  ?  1648 ALA B CB  1 
ATOM   3349 N N   . ILE B  1 175 ? -68.031  -18.465 -11.254 1.00 90.72  ?  1649 ILE B N   1 
ATOM   3350 C CA  . ILE B  1 175 ? -69.338  -18.036 -11.768 1.00 91.20  ?  1649 ILE B CA  1 
ATOM   3351 C C   . ILE B  1 175 ? -70.021  -17.195 -10.678 1.00 81.80  ?  1649 ILE B C   1 
ATOM   3352 O O   . ILE B  1 175 ? -70.770  -16.267 -10.994 1.00 87.55  ?  1649 ILE B O   1 
ATOM   3353 C CB  . ILE B  1 175 ? -70.213  -19.245 -12.257 1.00 104.45 ?  1649 ILE B CB  1 
ATOM   3354 C CG1 . ILE B  1 175 ? -69.495  -20.059 -13.362 1.00 117.09 ?  1649 ILE B CG1 1 
ATOM   3355 C CG2 . ILE B  1 175 ? -71.582  -18.785 -12.779 1.00 100.31 ?  1649 ILE B CG2 1 
ATOM   3356 C CD1 . ILE B  1 175 ? -69.945  -21.521 -13.505 1.00 127.72 ?  1649 ILE B CD1 1 
ATOM   3357 N N   . MET B  1 176 ? -69.705  -17.492 -9.403  1.00 69.65  ?  1650 MET B N   1 
ATOM   3358 C CA  . MET B  1 176 ? -70.224  -16.800 -8.222  1.00 77.75  ?  1650 MET B CA  1 
ATOM   3359 C C   . MET B  1 176 ? -69.524  -15.474 -7.933  1.00 82.19  ?  1650 MET B C   1 
ATOM   3360 O O   . MET B  1 176 ? -70.192  -14.490 -7.609  1.00 78.30  ?  1650 MET B O   1 
ATOM   3361 C CB  . MET B  1 176 ? -70.098  -17.699 -6.993  1.00 77.79  ?  1650 MET B CB  1 
ATOM   3362 C CG  . MET B  1 176 ? -71.131  -18.766 -6.926  1.00 76.04  ?  1650 MET B CG  1 
ATOM   3363 S SD  . MET B  1 176 ? -71.131  -19.552 -5.311  1.00 77.29  ?  1650 MET B SD  1 
ATOM   3364 C CE  . MET B  1 176 ? -70.145  -20.960 -5.654  1.00 69.93  ?  1650 MET B CE  1 
ATOM   3365 N N   . ALA B  1 177 ? -68.181  -15.472 -7.989  1.00 88.98  ?  1651 ALA B N   1 
ATOM   3366 C CA  . ALA B  1 177 ? -67.342  -14.311 -7.710  1.00 90.00  ?  1651 ALA B CA  1 
ATOM   3367 C C   . ALA B  1 177 ? -67.602  -13.161 -8.680  1.00 79.86  ?  1651 ALA B C   1 
ATOM   3368 O O   . ALA B  1 177 ? -67.703  -12.010 -8.245  1.00 73.31  ?  1651 ALA B O   1 
ATOM   3369 C CB  . ALA B  1 177 ? -65.877  -14.711 -7.725  1.00 96.61  ?  1651 ALA B CB  1 
ATOM   3370 N N   . THR B  1 178 ? -67.756  -13.475 -9.982  1.00 75.32  ?  1652 THR B N   1 
ATOM   3371 C CA  . THR B  1 178 ? -68.046  -12.490 -11.029 1.00 85.77  ?  1652 THR B CA  1 
ATOM   3372 C C   . THR B  1 178 ? -69.408  -11.840 -10.775 1.00 89.71  ?  1652 THR B C   1 
ATOM   3373 O O   . THR B  1 178 ? -69.557  -10.634 -10.957 1.00 87.46  ?  1652 THR B O   1 
ATOM   3374 C CB  . THR B  1 178 ? -67.950  -13.139 -12.417 1.00 85.30  ?  1652 THR B CB  1 
ATOM   3375 O OG1 . THR B  1 178 ? -66.727  -13.859 -12.499 1.00 93.97  ?  1652 THR B OG1 1 
ATOM   3376 C CG2 . THR B  1 178 ? -68.008  -12.126 -13.555 1.00 81.24  ?  1652 THR B CG2 1 
ATOM   3377 N N   . GLN B  1 179 ? -70.382  -12.645 -10.324 1.00 91.87  ?  1653 GLN B N   1 
ATOM   3378 C CA  . GLN B  1 179 ? -71.739  -12.218 -10.011 1.00 89.20  ?  1653 GLN B CA  1 
ATOM   3379 C C   . GLN B  1 179 ? -71.737  -11.211 -8.852  1.00 82.45  ?  1653 GLN B C   1 
ATOM   3380 O O   . GLN B  1 179 ? -72.124  -10.058 -9.049  1.00 84.72  ?  1653 GLN B O   1 
ATOM   3381 C CB  . GLN B  1 179 ? -72.608  -13.449 -9.680  1.00 96.53  ?  1653 GLN B CB  1 
ATOM   3382 C CG  . GLN B  1 179 ? -74.106  -13.172 -9.557  1.00 97.13  ?  1653 GLN B CG  1 
ATOM   3383 C CD  . GLN B  1 179 ? -74.862  -14.289 -8.867  1.00 93.95  ?  1653 GLN B CD  1 
ATOM   3384 O OE1 . GLN B  1 179 ? -74.638  -15.494 -9.088  1.00 79.14  ?  1653 GLN B OE1 1 
ATOM   3385 N NE2 . GLN B  1 179 ? -75.818  -13.902 -8.047  1.00 97.54  ?  1653 GLN B NE2 1 
ATOM   3386 N N   . LEU B  1 180 ? -71.264  -11.634 -7.670  1.00 79.08  ?  1654 LEU B N   1 
ATOM   3387 C CA  . LEU B  1 180 ? -71.254  -10.815 -6.458  1.00 91.15  ?  1654 LEU B CA  1 
ATOM   3388 C C   . LEU B  1 180 ? -70.320  -9.586  -6.513  1.00 98.59  ?  1654 LEU B C   1 
ATOM   3389 O O   . LEU B  1 180 ? -70.797  -8.445  -6.581  1.00 96.92  ?  1654 LEU B O   1 
ATOM   3390 C CB  . LEU B  1 180 ? -70.937  -11.687 -5.223  1.00 96.45  ?  1654 LEU B CB  1 
ATOM   3391 C CG  . LEU B  1 180 ? -71.841  -12.892 -4.986  1.00 99.21  ?  1654 LEU B CG  1 
ATOM   3392 C CD1 . LEU B  1 180 ? -71.080  -14.016 -4.336  1.00 102.86 ?  1654 LEU B CD1 1 
ATOM   3393 C CD2 . LEU B  1 180 ? -73.055  -12.519 -4.166  1.00 98.71  ?  1654 LEU B CD2 1 
ATOM   3394 N N   . PHE B  1 181 ? -68.999  -9.837  -6.500  1.00 96.00  ?  1655 PHE B N   1 
ATOM   3395 C CA  . PHE B  1 181 ? -67.933  -8.840  -6.418  1.00 85.81  ?  1655 PHE B CA  1 
ATOM   3396 C C   . PHE B  1 181 ? -67.571  -8.129  -7.715  1.00 82.51  ?  1655 PHE B C   1 
ATOM   3397 O O   . PHE B  1 181 ? -67.038  -7.023  -7.644  1.00 81.17  ?  1655 PHE B O   1 
ATOM   3398 C CB  . PHE B  1 181 ? -66.677  -9.469  -5.803  1.00 81.92  ?  1655 PHE B CB  1 
ATOM   3399 C CG  . PHE B  1 181 ? -66.985  -10.444 -4.692  1.00 83.34  ?  1655 PHE B CG  1 
ATOM   3400 C CD1 . PHE B  1 181 ? -67.476  -9.998  -3.469  1.00 84.31  ?  1655 PHE B CD1 1 
ATOM   3401 C CD2 . PHE B  1 181 ? -66.823  -11.809 -4.880  1.00 86.75  ?  1655 PHE B CD2 1 
ATOM   3402 C CE1 . PHE B  1 181 ? -67.789  -10.901 -2.452  1.00 90.46  ?  1655 PHE B CE1 1 
ATOM   3403 C CE2 . PHE B  1 181 ? -67.142  -12.712 -3.864  1.00 93.82  ?  1655 PHE B CE2 1 
ATOM   3404 C CZ  . PHE B  1 181 ? -67.621  -12.252 -2.655  1.00 92.36  ?  1655 PHE B CZ  1 
ATOM   3405 N N   . GLY B  1 182 ? -67.867  -8.742  -8.863  1.00 82.53  ?  1656 GLY B N   1 
ATOM   3406 C CA  . GLY B  1 182 ? -67.561  -8.210  -10.193 1.00 85.85  ?  1656 GLY B CA  1 
ATOM   3407 C C   . GLY B  1 182 ? -68.000  -6.794  -10.544 1.00 86.06  ?  1656 GLY B C   1 
ATOM   3408 O O   . GLY B  1 182 ? -67.374  -6.153  -11.401 1.00 74.91  ?  1656 GLY B O   1 
ATOM   3409 N N   . GLU B  1 183 ? -69.081  -6.294  -9.902  1.00 93.15  ?  1657 GLU B N   1 
ATOM   3410 C CA  . GLU B  1 183 ? -69.609  -4.952  -10.154 1.00 100.40 ?  1657 GLU B CA  1 
ATOM   3411 C C   . GLU B  1 183 ? -68.674  -3.855  -9.640  1.00 90.25  ?  1657 GLU B C   1 
ATOM   3412 O O   . GLU B  1 183 ? -68.217  -3.031  -10.433 1.00 68.38  ?  1657 GLU B O   1 
ATOM   3413 C CB  . GLU B  1 183 ? -71.032  -4.797  -9.585  1.00 118.10 ?  1657 GLU B CB  1 
ATOM   3414 C CG  . GLU B  1 183 ? -72.107  -5.522  -10.386 1.00 119.88 ?  1657 GLU B CG  1 
ATOM   3415 C CD  . GLU B  1 183 ? -72.612  -4.814  -11.632 1.00 130.92 ?  1657 GLU B CD  1 
ATOM   3416 O OE1 . GLU B  1 183 ? -72.380  -5.337  -12.746 1.00 131.77 ?  1657 GLU B OE1 1 
ATOM   3417 O OE2 . GLU B  1 183 ? -73.281  -3.762  -11.494 1.00 134.82 -1 1657 GLU B OE2 1 
ATOM   3418 N N   . ARG B  1 184 ? -68.367  -3.864  -8.326  1.00 99.57  ?  1658 ARG B N   1 
ATOM   3419 C CA  . ARG B  1 184 ? -67.499  -2.868  -7.689  1.00 111.04 ?  1658 ARG B CA  1 
ATOM   3420 C C   . ARG B  1 184 ? -66.027  -3.230  -7.758  1.00 116.37 ?  1658 ARG B C   1 
ATOM   3421 O O   . ARG B  1 184 ? -65.179  -2.345  -7.608  1.00 123.40 ?  1658 ARG B O   1 
ATOM   3422 C CB  . ARG B  1 184 ? -67.929  -2.587  -6.240  1.00 113.13 ?  1658 ARG B CB  1 
ATOM   3423 C CG  . ARG B  1 184 ? -69.349  -2.056  -6.119  1.00 120.76 ?  1658 ARG B CG  1 
ATOM   3424 C CD  . ARG B  1 184 ? -69.437  -0.552  -6.302  1.00 125.79 ?  1658 ARG B CD  1 
ATOM   3425 N NE  . ARG B  1 184 ? -69.194  0.165   -5.051  1.00 118.36 ?  1658 ARG B NE  1 
ATOM   3426 C CZ  . ARG B  1 184 ? -70.112  0.368   -4.109  1.00 115.58 ?  1658 ARG B CZ  1 
ATOM   3427 N NH1 . ARG B  1 184 ? -71.345  -0.106  -4.258  1.00 108.76 1  1658 ARG B NH1 1 
ATOM   3428 N NH2 . ARG B  1 184 ? -69.802  1.031   -3.005  1.00 125.08 ?  1658 ARG B NH2 1 
ATOM   3429 N N   . PHE B  1 185 ? -65.720  -4.522  -7.994  1.00 109.18 ?  1659 PHE B N   1 
ATOM   3430 C CA  . PHE B  1 185 ? -64.350  -5.019  -8.121  1.00 96.40  ?  1659 PHE B CA  1 
ATOM   3431 C C   . PHE B  1 185 ? -64.133  -5.670  -9.490  1.00 86.25  ?  1659 PHE B C   1 
ATOM   3432 O O   . PHE B  1 185 ? -64.099  -6.896  -9.606  1.00 83.21  ?  1659 PHE B O   1 
ATOM   3433 C CB  . PHE B  1 185 ? -63.966  -5.948  -6.959  1.00 94.43  ?  1659 PHE B CB  1 
ATOM   3434 C CG  . PHE B  1 185 ? -64.017  -5.271  -5.614  1.00 90.27  ?  1659 PHE B CG  1 
ATOM   3435 C CD1 . PHE B  1 185 ? -62.917  -4.583  -5.125  1.00 85.58  ?  1659 PHE B CD1 1 
ATOM   3436 C CD2 . PHE B  1 185 ? -65.175  -5.308  -4.841  1.00 93.87  ?  1659 PHE B CD2 1 
ATOM   3437 C CE1 . PHE B  1 185 ? -62.970  -3.946  -3.884  1.00 90.75  ?  1659 PHE B CE1 1 
ATOM   3438 C CE2 . PHE B  1 185 ? -65.228  -4.669  -3.602  1.00 97.69  ?  1659 PHE B CE2 1 
ATOM   3439 C CZ  . PHE B  1 185 ? -64.123  -3.997  -3.130  1.00 100.02 ?  1659 PHE B CZ  1 
ATOM   3440 N N   . PRO B  1 186 ? -64.025  -4.864  -10.560 1.00 75.65  ?  1660 PRO B N   1 
ATOM   3441 C CA  . PRO B  1 186 ? -63.841  -5.459  -11.885 1.00 83.68  ?  1660 PRO B CA  1 
ATOM   3442 C C   . PRO B  1 186 ? -62.409  -5.911  -12.158 1.00 88.89  ?  1660 PRO B C   1 
ATOM   3443 O O   . PRO B  1 186 ? -62.195  -6.907  -12.856 1.00 92.54  ?  1660 PRO B O   1 
ATOM   3444 C CB  . PRO B  1 186 ? -64.301  -4.355  -12.830 1.00 90.25  ?  1660 PRO B CB  1 
ATOM   3445 C CG  . PRO B  1 186 ? -64.064  -3.086  -12.094 1.00 87.44  ?  1660 PRO B CG  1 
ATOM   3446 C CD  . PRO B  1 186 ? -64.050  -3.386  -10.627 1.00 79.07  ?  1660 PRO B CD  1 
ATOM   3447 N N   . GLU B  1 187 ? -61.431  -5.187  -11.585 1.00 87.65  ?  1661 GLU B N   1 
ATOM   3448 C CA  . GLU B  1 187 ? -60.000  -5.447  -11.720 1.00 88.31  ?  1661 GLU B CA  1 
ATOM   3449 C C   . GLU B  1 187 ? -59.608  -6.844  -11.258 1.00 81.28  ?  1661 GLU B C   1 
ATOM   3450 O O   . GLU B  1 187 ? -58.626  -7.375  -11.763 1.00 74.58  ?  1661 GLU B O   1 
ATOM   3451 C CB  . GLU B  1 187 ? -59.150  -4.353  -11.034 1.00 97.84  ?  1661 GLU B CB  1 
ATOM   3452 C CG  . GLU B  1 187 ? -59.322  -4.210  -9.526  1.00 101.76 ?  1661 GLU B CG  1 
ATOM   3453 C CD  . GLU B  1 187 ? -60.635  -3.614  -9.058  1.00 96.97  ?  1661 GLU B CD  1 
ATOM   3454 O OE1 . GLU B  1 187 ? -60.955  -2.474  -9.466  1.00 95.95  ?  1661 GLU B OE1 1 
ATOM   3455 O OE2 . GLU B  1 187 ? -61.349  -4.294  -8.287  1.00 90.67  -1 1661 GLU B OE2 1 
ATOM   3456 N N   . TRP B  1 188 ? -60.383  -7.443  -10.332 1.00 82.17  ?  1662 TRP B N   1 
ATOM   3457 C CA  . TRP B  1 188 ? -60.143  -8.788  -9.815  1.00 85.86  ?  1662 TRP B CA  1 
ATOM   3458 C C   . TRP B  1 188 ? -61.229  -9.776  -10.205 1.00 93.38  ?  1662 TRP B C   1 
ATOM   3459 O O   . TRP B  1 188 ? -60.911  -10.936 -10.431 1.00 95.88  ?  1662 TRP B O   1 
ATOM   3460 C CB  . TRP B  1 188 ? -60.047  -8.787  -8.285  1.00 88.72  ?  1662 TRP B CB  1 
ATOM   3461 C CG  . TRP B  1 188 ? -58.967  -7.945  -7.689  1.00 90.07  ?  1662 TRP B CG  1 
ATOM   3462 C CD1 . TRP B  1 188 ? -57.689  -7.799  -8.142  1.00 89.12  ?  1662 TRP B CD1 1 
ATOM   3463 C CD2 . TRP B  1 188 ? -59.033  -7.253  -6.440  1.00 93.55  ?  1662 TRP B CD2 1 
ATOM   3464 N NE1 . TRP B  1 188 ? -56.978  -6.986  -7.293  1.00 90.02  ?  1662 TRP B NE1 1 
ATOM   3465 C CE2 . TRP B  1 188 ? -57.774  -6.648  -6.229  1.00 92.53  ?  1662 TRP B CE2 1 
ATOM   3466 C CE3 . TRP B  1 188 ? -60.052  -7.046  -5.491  1.00 99.12  ?  1662 TRP B CE3 1 
ATOM   3467 C CZ2 . TRP B  1 188 ? -57.501  -5.860  -5.102  1.00 99.31  ?  1662 TRP B CZ2 1 
ATOM   3468 C CZ3 . TRP B  1 188 ? -59.781  -6.265  -4.377  1.00 102.63 ?  1662 TRP B CZ3 1 
ATOM   3469 C CH2 . TRP B  1 188 ? -58.523  -5.678  -4.193  1.00 97.16  ?  1662 TRP B CH2 1 
ATOM   3470 N N   . PHE B  1 189 ? -62.509  -9.346  -10.222 1.00 96.47  ?  1663 PHE B N   1 
ATOM   3471 C CA  . PHE B  1 189 ? -63.635  -10.248 -10.479 1.00 93.28  ?  1663 PHE B CA  1 
ATOM   3472 C C   . PHE B  1 189 ? -64.614  -9.841  -11.612 1.00 98.86  ?  1663 PHE B C   1 
ATOM   3473 O O   . PHE B  1 189 ? -65.680  -10.450 -11.732 1.00 88.23  ?  1663 PHE B O   1 
ATOM   3474 C CB  . PHE B  1 189 ? -64.428  -10.465 -9.176  1.00 83.92  ?  1663 PHE B CB  1 
ATOM   3475 C CG  . PHE B  1 189 ? -63.634  -10.902 -7.968  1.00 72.96  ?  1663 PHE B CG  1 
ATOM   3476 C CD1 . PHE B  1 189 ? -63.312  -12.241 -7.774  1.00 70.15  ?  1663 PHE B CD1 1 
ATOM   3477 C CD2 . PHE B  1 189 ? -63.266  -9.987  -6.990  1.00 74.03  ?  1663 PHE B CD2 1 
ATOM   3478 C CE1 . PHE B  1 189 ? -62.611  -12.653 -6.633  1.00 75.09  ?  1663 PHE B CE1 1 
ATOM   3479 C CE2 . PHE B  1 189 ? -62.562  -10.398 -5.849  1.00 71.89  ?  1663 PHE B CE2 1 
ATOM   3480 C CZ  . PHE B  1 189 ? -62.243  -11.727 -5.678  1.00 72.34  ?  1663 PHE B CZ  1 
ATOM   3481 N N   . GLY B  1 190 ? -64.247  -8.863  -12.437 1.00 97.87  ?  1664 GLY B N   1 
ATOM   3482 C CA  . GLY B  1 190 ? -65.093  -8.381  -13.528 1.00 98.72  ?  1664 GLY B CA  1 
ATOM   3483 C C   . GLY B  1 190 ? -65.429  -9.382  -14.613 1.00 93.74  ?  1664 GLY B C   1 
ATOM   3484 O O   . GLY B  1 190 ? -66.520  -9.329  -15.181 1.00 106.96 ?  1664 GLY B O   1 
ATOM   3485 N N   . THR B  1 191 ? -64.497  -10.294 -14.908 1.00 86.39  ?  1665 THR B N   1 
ATOM   3486 C CA  . THR B  1 191 ? -64.624  -11.333 -15.937 1.00 86.59  ?  1665 THR B CA  1 
ATOM   3487 C C   . THR B  1 191 ? -64.502  -12.711 -15.267 1.00 87.06  ?  1665 THR B C   1 
ATOM   3488 O O   . THR B  1 191 ? -64.012  -12.787 -14.134 1.00 81.61  ?  1665 THR B O   1 
ATOM   3489 C CB  . THR B  1 191 ? -63.476  -11.145 -16.953 1.00 92.39  ?  1665 THR B CB  1 
ATOM   3490 O OG1 . THR B  1 191 ? -63.274  -9.752  -17.195 1.00 98.80  ?  1665 THR B OG1 1 
ATOM   3491 C CG2 . THR B  1 191 ? -63.698  -11.891 -18.265 1.00 96.81  ?  1665 THR B CG2 1 
ATOM   3492 N N   . LEU B  1 192 ? -64.906  -13.801 -15.967 1.00 93.31  ?  1666 LEU B N   1 
ATOM   3493 C CA  . LEU B  1 192 ? -64.740  -15.159 -15.438 1.00 102.43 ?  1666 LEU B CA  1 
ATOM   3494 C C   . LEU B  1 192 ? -63.256  -15.527 -15.476 1.00 101.11 ?  1666 LEU B C   1 
ATOM   3495 O O   . LEU B  1 192 ? -62.802  -16.336 -14.673 1.00 100.55 ?  1666 LEU B O   1 
ATOM   3496 C CB  . LEU B  1 192 ? -65.578  -16.193 -16.197 1.00 106.67 ?  1666 LEU B CB  1 
ATOM   3497 C CG  . LEU B  1 192 ? -65.621  -17.569 -15.545 1.00 107.78 ?  1666 LEU B CG  1 
ATOM   3498 C CD1 . LEU B  1 192 ? -66.964  -17.841 -14.931 1.00 111.61 ?  1666 LEU B CD1 1 
ATOM   3499 C CD2 . LEU B  1 192 ? -65.206  -18.642 -16.516 1.00 105.53 ?  1666 LEU B CD2 1 
ATOM   3500 N N   . GLY B  1 193 ? -62.523  -14.900 -16.392 1.00 104.22 ?  1667 GLY B N   1 
ATOM   3501 C CA  . GLY B  1 193 ? -61.084  -15.069 -16.524 1.00 110.60 ?  1667 GLY B CA  1 
ATOM   3502 C C   . GLY B  1 193 ? -60.346  -14.347 -15.418 1.00 106.45 ?  1667 GLY B C   1 
ATOM   3503 O O   . GLY B  1 193 ? -59.272  -14.787 -14.996 1.00 103.33 ?  1667 GLY B O   1 
ATOM   3504 N N   . GLU B  1 194 ? -60.925  -13.222 -14.953 1.00 103.61 ?  1668 GLU B N   1 
ATOM   3505 C CA  . GLU B  1 194 ? -60.404  -12.406 -13.859 1.00 106.22 ?  1668 GLU B CA  1 
ATOM   3506 C C   . GLU B  1 194 ? -60.653  -13.151 -12.564 1.00 101.30 ?  1668 GLU B C   1 
ATOM   3507 O O   . GLU B  1 194 ? -59.748  -13.260 -11.733 1.00 106.92 ?  1668 GLU B O   1 
ATOM   3508 C CB  . GLU B  1 194 ? -61.098  -11.031 -13.816 1.00 108.18 ?  1668 GLU B CB  1 
ATOM   3509 C CG  . GLU B  1 194 ? -60.529  -10.020 -14.795 1.00 114.47 ?  1668 GLU B CG  1 
ATOM   3510 C CD  . GLU B  1 194 ? -59.285  -9.268  -14.355 1.00 116.16 ?  1668 GLU B CD  1 
ATOM   3511 O OE1 . GLU B  1 194 ? -59.201  -8.056  -14.659 1.00 112.29 ?  1668 GLU B OE1 1 
ATOM   3512 O OE2 . GLU B  1 194 ? -58.382  -9.887  -13.741 1.00 114.78 -1 1668 GLU B OE2 1 
ATOM   3513 N N   . SER B  1 195 ? -61.884  -13.681 -12.409 1.00 87.40  ?  1669 SER B N   1 
ATOM   3514 C CA  . SER B  1 195 ? -62.314  -14.443 -11.247 1.00 88.25  ?  1669 SER B CA  1 
ATOM   3515 C C   . SER B  1 195 ? -61.608  -15.788 -11.142 1.00 86.28  ?  1669 SER B C   1 
ATOM   3516 O O   . SER B  1 195 ? -61.429  -16.272 -10.033 1.00 75.00  ?  1669 SER B O   1 
ATOM   3517 C CB  . SER B  1 195 ? -63.824  -14.622 -11.250 1.00 98.04  ?  1669 SER B CB  1 
ATOM   3518 O OG  . SER B  1 195 ? -64.467  -13.365 -11.125 1.00 93.11  ?  1669 SER B OG  1 
ATOM   3519 N N   . PHE B  1 196 ? -61.180  -16.383 -12.272 1.00 92.82  ?  1670 PHE B N   1 
ATOM   3520 C CA  . PHE B  1 196 ? -60.434  -17.646 -12.252 1.00 92.10  ?  1670 PHE B CA  1 
ATOM   3521 C C   . PHE B  1 196 ? -59.022  -17.400 -11.723 1.00 90.40  ?  1670 PHE B C   1 
ATOM   3522 O O   . PHE B  1 196 ? -58.449  -18.270 -11.063 1.00 89.91  ?  1670 PHE B O   1 
ATOM   3523 C CB  . PHE B  1 196 ? -60.380  -18.293 -13.645 1.00 95.10  ?  1670 PHE B CB  1 
ATOM   3524 C CG  . PHE B  1 196 ? -61.147  -19.589 -13.742 1.00 94.30  ?  1670 PHE B CG  1 
ATOM   3525 C CD1 . PHE B  1 196 ? -62.465  -19.603 -14.174 1.00 102.67 ?  1670 PHE B CD1 1 
ATOM   3526 C CD2 . PHE B  1 196 ? -60.552  -20.798 -13.393 1.00 98.55  ?  1670 PHE B CD2 1 
ATOM   3527 C CE1 . PHE B  1 196 ? -63.181  -20.800 -14.241 1.00 113.21 ?  1670 PHE B CE1 1 
ATOM   3528 C CE2 . PHE B  1 196 ? -61.266  -21.997 -13.470 1.00 102.45 ?  1670 PHE B CE2 1 
ATOM   3529 C CZ  . PHE B  1 196 ? -62.574  -21.990 -13.895 1.00 107.60 ?  1670 PHE B CZ  1 
ATOM   3530 N N   . TYR B  1 197 ? -58.486  -16.196 -11.986 1.00 85.27  ?  1671 TYR B N   1 
ATOM   3531 C CA  . TYR B  1 197 ? -57.166  -15.780 -11.539 1.00 92.58  ?  1671 TYR B CA  1 
ATOM   3532 C C   . TYR B  1 197 ? -57.146  -15.480 -10.039 1.00 93.15  ?  1671 TYR B C   1 
ATOM   3533 O O   . TYR B  1 197 ? -56.305  -16.027 -9.320  1.00 95.32  ?  1671 TYR B O   1 
ATOM   3534 C CB  . TYR B  1 197 ? -56.671  -14.566 -12.345 1.00 100.37 ?  1671 TYR B CB  1 
ATOM   3535 C CG  . TYR B  1 197 ? -55.238  -14.203 -12.029 1.00 96.59  ?  1671 TYR B CG  1 
ATOM   3536 C CD1 . TYR B  1 197 ? -54.184  -14.785 -12.722 1.00 86.91  ?  1671 TYR B CD1 1 
ATOM   3537 C CD2 . TYR B  1 197 ? -54.934  -13.308 -11.008 1.00 98.38  ?  1671 TYR B CD2 1 
ATOM   3538 C CE1 . TYR B  1 197 ? -52.862  -14.485 -12.410 1.00 88.15  ?  1671 TYR B CE1 1 
ATOM   3539 C CE2 . TYR B  1 197 ? -53.617  -13.005 -10.683 1.00 101.52 ?  1671 TYR B CE2 1 
ATOM   3540 C CZ  . TYR B  1 197 ? -52.585  -13.595 -11.388 1.00 90.54  ?  1671 TYR B CZ  1 
ATOM   3541 O OH  . TYR B  1 197 ? -51.287  -13.288 -11.085 1.00 77.07  ?  1671 TYR B OH  1 
ATOM   3542 N N   . THR B  1 198 ? -58.039  -14.582 -9.578  1.00 86.72  ?  1672 THR B N   1 
ATOM   3543 C CA  . THR B  1 198 ? -58.114  -14.178 -8.172  1.00 84.01  ?  1672 THR B CA  1 
ATOM   3544 C C   . THR B  1 198 ? -58.355  -15.397 -7.276  1.00 80.42  ?  1672 THR B C   1 
ATOM   3545 O O   . THR B  1 198 ? -57.608  -15.597 -6.319  1.00 81.89  ?  1672 THR B O   1 
ATOM   3546 C CB  . THR B  1 198 ? -59.113  -13.024 -7.964  1.00 78.76  ?  1672 THR B CB  1 
ATOM   3547 O OG1 . THR B  1 198 ? -58.914  -12.043 -8.988  1.00 74.28  ?  1672 THR B OG1 1 
ATOM   3548 C CG2 . THR B  1 198 ? -58.954  -12.364 -6.607  1.00 75.99  ?  1672 THR B CG2 1 
ATOM   3549 N N   . LEU B  1 199 ? -59.319  -16.257 -7.644  1.00 83.58  ?  1673 LEU B N   1 
ATOM   3550 C CA  . LEU B  1 199 ? -59.600  -17.468 -6.887  1.00 90.17  ?  1673 LEU B CA  1 
ATOM   3551 C C   . LEU B  1 199 ? -58.418  -18.409 -6.888  1.00 84.49  ?  1673 LEU B C   1 
ATOM   3552 O O   . LEU B  1 199 ? -58.278  -19.177 -5.937  1.00 98.16  ?  1673 LEU B O   1 
ATOM   3553 C CB  . LEU B  1 199 ? -60.870  -18.173 -7.356  1.00 93.97  ?  1673 LEU B CB  1 
ATOM   3554 C CG  . LEU B  1 199 ? -62.194  -17.442 -7.140  1.00 86.80  ?  1673 LEU B CG  1 
ATOM   3555 C CD1 . LEU B  1 199 ? -63.280  -18.162 -7.833  1.00 88.27  ?  1673 LEU B CD1 1 
ATOM   3556 C CD2 . LEU B  1 199 ? -62.552  -17.305 -5.666  1.00 83.92  ?  1673 LEU B CD2 1 
ATOM   3557 N N   . PHE B  1 200 ? -57.536  -18.329 -7.907  1.00 80.22  ?  1674 PHE B N   1 
ATOM   3558 C CA  . PHE B  1 200 ? -56.327  -19.145 -7.893  1.00 86.34  ?  1674 PHE B CA  1 
ATOM   3559 C C   . PHE B  1 200 ? -55.308  -18.529 -6.924  1.00 82.78  ?  1674 PHE B C   1 
ATOM   3560 O O   . PHE B  1 200 ? -54.669  -19.271 -6.170  1.00 72.36  ?  1674 PHE B O   1 
ATOM   3561 C CB  . PHE B  1 200 ? -55.724  -19.369 -9.290  1.00 81.64  ?  1674 PHE B CB  1 
ATOM   3562 C CG  . PHE B  1 200 ? -54.391  -20.086 -9.246  1.00 75.00  ?  1674 PHE B CG  1 
ATOM   3563 C CD1 . PHE B  1 200 ? -54.307  -21.413 -8.838  1.00 80.26  ?  1674 PHE B CD1 1 
ATOM   3564 C CD2 . PHE B  1 200 ? -53.214  -19.420 -9.556  1.00 81.51  ?  1674 PHE B CD2 1 
ATOM   3565 C CE1 . PHE B  1 200 ? -53.070  -22.067 -8.771  1.00 85.33  ?  1674 PHE B CE1 1 
ATOM   3566 C CE2 . PHE B  1 200 ? -51.976  -20.077 -9.484  1.00 91.07  ?  1674 PHE B CE2 1 
ATOM   3567 C CZ  . PHE B  1 200 ? -51.913  -21.395 -9.095  1.00 88.85  ?  1674 PHE B CZ  1 
ATOM   3568 N N   . GLN B  1 201 ? -55.188  -17.174 -6.920  1.00 80.86  ?  1675 GLN B N   1 
ATOM   3569 C CA  . GLN B  1 201 ? -54.283  -16.444 -6.026  1.00 81.92  ?  1675 GLN B CA  1 
ATOM   3570 C C   . GLN B  1 201 ? -54.663  -16.674 -4.562  1.00 86.89  ?  1675 GLN B C   1 
ATOM   3571 O O   . GLN B  1 201 ? -53.778  -16.872 -3.726  1.00 93.83  ?  1675 GLN B O   1 
ATOM   3572 C CB  . GLN B  1 201 ? -54.272  -14.947 -6.345  1.00 75.14  ?  1675 GLN B CB  1 
ATOM   3573 C CG  . GLN B  1 201 ? -53.177  -14.195 -5.587  1.00 68.90  ?  1675 GLN B CG  1 
ATOM   3574 C CD  . GLN B  1 201 ? -53.358  -12.702 -5.541  1.00 69.38  ?  1675 GLN B CD  1 
ATOM   3575 O OE1 . GLN B  1 201 ? -53.716  -12.042 -6.529  1.00 67.66  ?  1675 GLN B OE1 1 
ATOM   3576 N NE2 . GLN B  1 201 ? -53.038  -12.131 -4.403  1.00 72.53  ?  1675 GLN B NE2 1 
ATOM   3577 N N   . VAL B  1 202 ? -55.983  -16.664 -4.269  1.00 92.33  ?  1676 VAL B N   1 
ATOM   3578 C CA  . VAL B  1 202 ? -56.569  -16.923 -2.949  1.00 92.86  ?  1676 VAL B CA  1 
ATOM   3579 C C   . VAL B  1 202 ? -56.229  -18.374 -2.524  1.00 89.56  ?  1676 VAL B C   1 
ATOM   3580 O O   . VAL B  1 202 ? -55.884  -18.588 -1.361  1.00 90.15  ?  1676 VAL B O   1 
ATOM   3581 C CB  . VAL B  1 202 ? -58.100  -16.609 -2.933  1.00 87.64  ?  1676 VAL B CB  1 
ATOM   3582 C CG1 . VAL B  1 202 ? -58.780  -17.103 -1.660  1.00 87.62  ?  1676 VAL B CG1 1 
ATOM   3583 C CG2 . VAL B  1 202 ? -58.354  -15.120 -3.117  1.00 84.69  ?  1676 VAL B CG2 1 
ATOM   3584 N N   . MET B  1 203 ? -56.263  -19.342 -3.482  1.00 80.63  ?  1677 MET B N   1 
ATOM   3585 C CA  . MET B  1 203 ? -55.942  -20.753 -3.248  1.00 78.11  ?  1677 MET B CA  1 
ATOM   3586 C C   . MET B  1 203 ? -54.488  -20.946 -2.806  1.00 87.13  ?  1677 MET B C   1 
ATOM   3587 O O   . MET B  1 203 ? -54.241  -21.707 -1.868  1.00 98.78  ?  1677 MET B O   1 
ATOM   3588 C CB  . MET B  1 203 ? -56.276  -21.626 -4.467  1.00 71.97  ?  1677 MET B CB  1 
ATOM   3589 C CG  . MET B  1 203 ? -56.153  -23.126 -4.189  1.00 73.44  ?  1677 MET B CG  1 
ATOM   3590 S SD  . MET B  1 203 ? -56.300  -24.186 -5.649  1.00 81.12  ?  1677 MET B SD  1 
ATOM   3591 C CE  . MET B  1 203 ? -54.640  -24.117 -6.275  1.00 82.48  ?  1677 MET B CE  1 
ATOM   3592 N N   . THR B  1 204 ? -53.534  -20.241 -3.449  1.00 86.25  ?  1678 THR B N   1 
ATOM   3593 C CA  . THR B  1 204 ? -52.110  -20.301 -3.076  1.00 74.84  ?  1678 THR B CA  1 
ATOM   3594 C C   . THR B  1 204 ? -51.855  -19.509 -1.772  1.00 77.56  ?  1678 THR B C   1 
ATOM   3595 O O   . THR B  1 204 ? -50.716  -19.458 -1.288  1.00 95.12  ?  1678 THR B O   1 
ATOM   3596 C CB  . THR B  1 204 ? -51.208  -19.807 -4.216  1.00 67.89  ?  1678 THR B CB  1 
ATOM   3597 O OG1 . THR B  1 204 ? -51.533  -18.452 -4.528  1.00 56.86  ?  1678 THR B OG1 1 
ATOM   3598 C CG2 . THR B  1 204 ? -51.289  -20.678 -5.447  1.00 69.84  ?  1678 THR B CG2 1 
ATOM   3599 N N   . LEU B  1 205 ? -52.926  -18.882 -1.224  1.00 73.33  ?  1679 LEU B N   1 
ATOM   3600 C CA  . LEU B  1 205 ? -52.951  -18.066 -0.009  1.00 71.35  ?  1679 LEU B CA  1 
ATOM   3601 C C   . LEU B  1 205 ? -52.074  -16.788 -0.109  1.00 65.20  ?  1679 LEU B C   1 
ATOM   3602 O O   . LEU B  1 205 ? -51.830  -16.126 0.908   1.00 59.23  ?  1679 LEU B O   1 
ATOM   3603 C CB  . LEU B  1 205 ? -52.618  -18.903 1.246   1.00 72.27  ?  1679 LEU B CB  1 
ATOM   3604 C CG  . LEU B  1 205 ? -53.595  -20.028 1.597   1.00 80.48  ?  1679 LEU B CG  1 
ATOM   3605 C CD1 . LEU B  1 205 ? -52.942  -21.034 2.500   1.00 92.93  ?  1679 LEU B CD1 1 
ATOM   3606 C CD2 . LEU B  1 205 ? -54.863  -19.496 2.256   1.00 79.49  ?  1679 LEU B CD2 1 
ATOM   3607 N N   . GLU B  1 206 ? -51.646  -16.413 -1.341  1.00 67.39  ?  1680 GLU B N   1 
ATOM   3608 C CA  . GLU B  1 206 ? -50.830  -15.221 -1.575  1.00 70.21  ?  1680 GLU B CA  1 
ATOM   3609 C C   . GLU B  1 206 ? -51.715  -13.989 -1.500  1.00 68.65  ?  1680 GLU B C   1 
ATOM   3610 O O   . GLU B  1 206 ? -52.655  -13.858 -2.284  1.00 72.96  ?  1680 GLU B O   1 
ATOM   3611 C CB  . GLU B  1 206 ? -50.109  -15.298 -2.926  1.00 73.31  ?  1680 GLU B CB  1 
ATOM   3612 C CG  . GLU B  1 206 ? -48.945  -14.331 -3.048  1.00 71.69  ?  1680 GLU B CG  1 
ATOM   3613 C CD  . GLU B  1 206 ? -49.277  -12.937 -3.553  1.00 73.02  ?  1680 GLU B CD  1 
ATOM   3614 O OE1 . GLU B  1 206 ? -49.289  -12.746 -4.789  1.00 67.56  ?  1680 GLU B OE1 1 
ATOM   3615 O OE2 . GLU B  1 206 ? -49.405  -12.012 -2.717  1.00 60.42  -1 1680 GLU B OE2 1 
ATOM   3616 N N   . SER B  1 207 ? -51.439  -13.115 -0.513  1.00 68.49  ?  1681 SER B N   1 
ATOM   3617 C CA  . SER B  1 207 ? -52.147  -11.859 -0.245  1.00 70.38  ?  1681 SER B CA  1 
ATOM   3618 C C   . SER B  1 207 ? -53.684  -12.015 -0.135  1.00 70.59  ?  1681 SER B C   1 
ATOM   3619 O O   . SER B  1 207 ? -54.396  -11.016 -0.208  1.00 67.93  ?  1681 SER B O   1 
ATOM   3620 C CB  . SER B  1 207 ? -51.761  -10.800 -1.275  1.00 68.24  ?  1681 SER B CB  1 
ATOM   3621 O OG  . SER B  1 207 ? -51.935  -9.477  -0.800  1.00 71.89  ?  1681 SER B OG  1 
ATOM   3622 N N   . TRP B  1 208 ? -54.184  -13.254 0.078   1.00 70.15  ?  1682 TRP B N   1 
ATOM   3623 C CA  . TRP B  1 208 ? -55.611  -13.571 0.129   1.00 74.82  ?  1682 TRP B CA  1 
ATOM   3624 C C   . TRP B  1 208 ? -56.458  -12.587 0.972   1.00 75.94  ?  1682 TRP B C   1 
ATOM   3625 O O   . TRP B  1 208 ? -57.469  -12.104 0.473   1.00 71.53  ?  1682 TRP B O   1 
ATOM   3626 C CB  . TRP B  1 208 ? -55.862  -15.038 0.549   1.00 75.24  ?  1682 TRP B CB  1 
ATOM   3627 C CG  . TRP B  1 208 ? -55.798  -15.348 2.021   1.00 73.49  ?  1682 TRP B CG  1 
ATOM   3628 C CD1 . TRP B  1 208 ? -54.747  -15.890 2.691   1.00 78.68  ?  1682 TRP B CD1 1 
ATOM   3629 C CD2 . TRP B  1 208 ? -56.867  -15.241 2.976   1.00 71.61  ?  1682 TRP B CD2 1 
ATOM   3630 N NE1 . TRP B  1 208 ? -55.067  -16.068 4.017   1.00 72.36  ?  1682 TRP B NE1 1 
ATOM   3631 C CE2 . TRP B  1 208 ? -56.362  -15.678 4.220   1.00 72.34  ?  1682 TRP B CE2 1 
ATOM   3632 C CE3 . TRP B  1 208 ? -58.187  -14.771 2.914   1.00 71.87  ?  1682 TRP B CE3 1 
ATOM   3633 C CZ2 . TRP B  1 208 ? -57.136  -15.684 5.383   1.00 75.59  ?  1682 TRP B CZ2 1 
ATOM   3634 C CZ3 . TRP B  1 208 ? -58.952  -14.775 4.067   1.00 80.78  ?  1682 TRP B CZ3 1 
ATOM   3635 C CH2 . TRP B  1 208 ? -58.424  -15.220 5.286   1.00 76.99  ?  1682 TRP B CH2 1 
ATOM   3636 N N   . SER B  1 209 ? -56.035  -12.269 2.208   1.00 76.50  ?  1683 SER B N   1 
ATOM   3637 C CA  . SER B  1 209 ? -56.786  -11.385 3.092   1.00 76.83  ?  1683 SER B CA  1 
ATOM   3638 C C   . SER B  1 209 ? -56.463  -9.924  2.877   1.00 75.03  ?  1683 SER B C   1 
ATOM   3639 O O   . SER B  1 209 ? -57.320  -9.199  2.398   1.00 88.44  ?  1683 SER B O   1 
ATOM   3640 C CB  . SER B  1 209 ? -56.610  -11.794 4.550   1.00 79.06  ?  1683 SER B CB  1 
ATOM   3641 O OG  . SER B  1 209 ? -57.217  -10.877 5.444   1.00 69.95  ?  1683 SER B OG  1 
ATOM   3642 N N   . MET B  1 210 ? -55.239  -9.488  3.199   1.00 76.19  ?  1684 MET B N   1 
ATOM   3643 C CA  . MET B  1 210 ? -54.801  -8.098  3.038   1.00 77.41  ?  1684 MET B CA  1 
ATOM   3644 C C   . MET B  1 210 ? -55.087  -7.544  1.632   1.00 68.57  ?  1684 MET B C   1 
ATOM   3645 O O   . MET B  1 210 ? -55.720  -6.502  1.507   1.00 63.85  ?  1684 MET B O   1 
ATOM   3646 C CB  . MET B  1 210 ? -53.298  -7.941  3.371   1.00 85.05  ?  1684 MET B CB  1 
ATOM   3647 C CG  . MET B  1 210 ? -52.919  -8.313  4.792   1.00 87.22  ?  1684 MET B CG  1 
ATOM   3648 S SD  . MET B  1 210 ? -53.726  -7.351  6.094   1.00 83.01  ?  1684 MET B SD  1 
ATOM   3649 C CE  . MET B  1 210 ? -52.457  -7.309  7.268   1.00 87.18  ?  1684 MET B CE  1 
ATOM   3650 N N   . GLY B  1 211 ? -54.648  -8.268  0.608   1.00 66.86  ?  1685 GLY B N   1 
ATOM   3651 C CA  . GLY B  1 211 ? -54.785  -7.872  -0.782  1.00 70.44  ?  1685 GLY B CA  1 
ATOM   3652 C C   . GLY B  1 211 ? -56.167  -7.959  -1.382  1.00 78.47  ?  1685 GLY B C   1 
ATOM   3653 O O   . GLY B  1 211 ? -56.518  -7.077  -2.167  1.00 84.89  ?  1685 GLY B O   1 
ATOM   3654 N N   . ILE B  1 212 ? -56.957  -9.019  -1.067  1.00 89.04  ?  1686 ILE B N   1 
ATOM   3655 C CA  . ILE B  1 212 ? -58.279  -9.201  -1.691  1.00 84.91  ?  1686 ILE B CA  1 
ATOM   3656 C C   . ILE B  1 212 ? -59.484  -9.221  -0.724  1.00 78.25  ?  1686 ILE B C   1 
ATOM   3657 O O   . ILE B  1 212 ? -60.377  -8.395  -0.892  1.00 81.94  ?  1686 ILE B O   1 
ATOM   3658 C CB  . ILE B  1 212 ? -58.316  -10.451 -2.615  1.00 84.33  ?  1686 ILE B CB  1 
ATOM   3659 C CG1 . ILE B  1 212 ? -57.241  -10.386 -3.710  1.00 88.63  ?  1686 ILE B CG1 1 
ATOM   3660 C CG2 . ILE B  1 212 ? -59.705  -10.658 -3.237  1.00 83.35  ?  1686 ILE B CG2 1 
ATOM   3661 C CD1 . ILE B  1 212 ? -56.267  -11.462 -3.610  1.00 91.64  ?  1686 ILE B CD1 1 
ATOM   3662 N N   . VAL B  1 213 ? -59.556  -10.191 0.212   1.00 79.14  ?  1687 VAL B N   1 
ATOM   3663 C CA  . VAL B  1 213 ? -60.713  -10.388 1.103   1.00 80.30  ?  1687 VAL B CA  1 
ATOM   3664 C C   . VAL B  1 213 ? -60.965  -9.211  2.078   1.00 77.64  ?  1687 VAL B C   1 
ATOM   3665 O O   . VAL B  1 213 ? -62.129  -8.953  2.379   1.00 79.79  ?  1687 VAL B O   1 
ATOM   3666 C CB  . VAL B  1 213 ? -60.674  -11.748 1.840   1.00 77.91  ?  1687 VAL B CB  1 
ATOM   3667 C CG1 . VAL B  1 213 ? -61.990  -12.021 2.560   1.00 69.82  ?  1687 VAL B CG1 1 
ATOM   3668 C CG2 . VAL B  1 213 ? -60.381  -12.881 0.862   1.00 82.88  ?  1687 VAL B CG2 1 
ATOM   3669 N N   . ARG B  1 214 ? -59.920  -8.496  2.543   1.00 74.03  ?  1688 ARG B N   1 
ATOM   3670 C CA  . ARG B  1 214 ? -60.076  -7.334  3.432   1.00 74.96  ?  1688 ARG B CA  1 
ATOM   3671 C C   . ARG B  1 214 ? -60.591  -6.091  2.683   1.00 73.60  ?  1688 ARG B C   1 
ATOM   3672 O O   . ARG B  1 214 ? -61.577  -5.518  3.154   1.00 89.40  ?  1688 ARG B O   1 
ATOM   3673 C CB  . ARG B  1 214 ? -58.808  -7.018  4.244   1.00 77.61  ?  1688 ARG B CB  1 
ATOM   3674 C CG  . ARG B  1 214 ? -58.660  -7.821  5.526   1.00 78.27  ?  1688 ARG B CG  1 
ATOM   3675 C CD  . ARG B  1 214 ? -57.505  -7.286  6.346   1.00 82.92  ?  1688 ARG B CD  1 
ATOM   3676 N NE  . ARG B  1 214 ? -57.138  -8.154  7.466   1.00 91.76  ?  1688 ARG B NE  1 
ATOM   3677 C CZ  . ARG B  1 214 ? -57.621  -8.036  8.699   1.00 91.32  ?  1688 ARG B CZ  1 
ATOM   3678 N NH1 . ARG B  1 214 ? -58.527  -7.107  8.979   1.00 101.94 1  1688 ARG B NH1 1 
ATOM   3679 N NH2 . ARG B  1 214 ? -57.219  -8.860  9.655   1.00 90.12  ?  1688 ARG B NH2 1 
ATOM   3680 N N   . PRO B  1 215 ? -60.014  -5.666  1.516   1.00 72.66  ?  1689 PRO B N   1 
ATOM   3681 C CA  . PRO B  1 215 ? -60.561  -4.484  0.823   1.00 81.64  ?  1689 PRO B CA  1 
ATOM   3682 C C   . PRO B  1 215 ? -61.954  -4.724  0.245   1.00 82.01  ?  1689 PRO B C   1 
ATOM   3683 O O   . PRO B  1 215 ? -62.671  -3.767  -0.064  1.00 81.08  ?  1689 PRO B O   1 
ATOM   3684 C CB  . PRO B  1 215 ? -59.530  -4.210  -0.274  1.00 84.86  ?  1689 PRO B CB  1 
ATOM   3685 C CG  . PRO B  1 215 ? -58.910  -5.507  -0.533  1.00 77.24  ?  1689 PRO B CG  1 
ATOM   3686 C CD  . PRO B  1 215 ? -58.838  -6.189  0.792   1.00 75.38  ?  1689 PRO B CD  1 
ATOM   3687 N N   . LEU B  1 216 ? -62.330  -6.005  0.108   1.00 77.83  ?  1690 LEU B N   1 
ATOM   3688 C CA  . LEU B  1 216 ? -63.639  -6.416  -0.369  1.00 76.62  ?  1690 LEU B CA  1 
ATOM   3689 C C   . LEU B  1 216 ? -64.658  -6.208  0.726   1.00 84.80  ?  1690 LEU B C   1 
ATOM   3690 O O   . LEU B  1 216 ? -65.820  -5.929  0.437   1.00 108.26 ?  1690 LEU B O   1 
ATOM   3691 C CB  . LEU B  1 216 ? -63.609  -7.887  -0.764  1.00 72.37  ?  1690 LEU B CB  1 
ATOM   3692 C CG  . LEU B  1 216 ? -63.897  -8.192  -2.212  1.00 72.22  ?  1690 LEU B CG  1 
ATOM   3693 C CD1 . LEU B  1 216 ? -62.844  -7.608  -3.107  1.00 71.17  ?  1690 LEU B CD1 1 
ATOM   3694 C CD2 . LEU B  1 216 ? -63.923  -9.666  -2.440  1.00 70.49  ?  1690 LEU B CD2 1 
ATOM   3695 N N   . MET B  1 217 ? -64.217  -6.335  1.988   1.00 84.93  ?  1691 MET B N   1 
ATOM   3696 C CA  . MET B  1 217 ? -65.071  -6.186  3.160   1.00 86.80  ?  1691 MET B CA  1 
ATOM   3697 C C   . MET B  1 217 ? -65.345  -4.728  3.507   1.00 88.39  ?  1691 MET B C   1 
ATOM   3698 O O   . MET B  1 217 ? -66.215  -4.448  4.332   1.00 90.72  ?  1691 MET B O   1 
ATOM   3699 C CB  . MET B  1 217 ? -64.527  -6.982  4.348   1.00 83.88  ?  1691 MET B CB  1 
ATOM   3700 C CG  . MET B  1 217 ? -64.758  -8.474  4.197   1.00 85.35  ?  1691 MET B CG  1 
ATOM   3701 S SD  . MET B  1 217 ? -64.324  -9.465  5.635   1.00 89.60  ?  1691 MET B SD  1 
ATOM   3702 C CE  . MET B  1 217 ? -62.602  -9.192  5.700   1.00 102.25 ?  1691 MET B CE  1 
ATOM   3703 N N   . GLU B  1 218 ? -64.640  -3.799  2.845   1.00 87.89  ?  1692 GLU B N   1 
ATOM   3704 C CA  . GLU B  1 218 ? -64.860  -2.366  2.997   1.00 92.70  ?  1692 GLU B CA  1 
ATOM   3705 C C   . GLU B  1 218 ? -66.186  -2.064  2.300   1.00 93.20  ?  1692 GLU B C   1 
ATOM   3706 O O   . GLU B  1 218 ? -67.028  -1.370  2.865   1.00 111.01 ?  1692 GLU B O   1 
ATOM   3707 C CB  . GLU B  1 218 ? -63.722  -1.559  2.344   1.00 111.23 ?  1692 GLU B CB  1 
ATOM   3708 C CG  . GLU B  1 218 ? -62.368  -1.704  3.020   1.00 111.04 ?  1692 GLU B CG  1 
ATOM   3709 C CD  . GLU B  1 218 ? -62.240  -1.129  4.417   1.00 114.42 ?  1692 GLU B CD  1 
ATOM   3710 O OE1 . GLU B  1 218 ? -61.451  -1.692  5.209   1.00 119.68 ?  1692 GLU B OE1 1 
ATOM   3711 O OE2 . GLU B  1 218 ? -62.918  -0.121  4.724   1.00 115.92 -1 1692 GLU B OE2 1 
ATOM   3712 N N   . VAL B  1 219 ? -66.390  -2.651  1.104   1.00 85.96  ?  1693 VAL B N   1 
ATOM   3713 C CA  . VAL B  1 219 ? -67.604  -2.486  0.313   1.00 84.14  ?  1693 VAL B CA  1 
ATOM   3714 C C   . VAL B  1 219 ? -68.663  -3.487  0.766   1.00 81.19  ?  1693 VAL B C   1 
ATOM   3715 O O   . VAL B  1 219 ? -69.761  -3.076  1.126   1.00 82.21  ?  1693 VAL B O   1 
ATOM   3716 C CB  . VAL B  1 219 ? -67.337  -2.563  -1.207  1.00 84.36  ?  1693 VAL B CB  1 
ATOM   3717 C CG1 . VAL B  1 219 ? -68.586  -2.199  -2.000  1.00 89.91  ?  1693 VAL B CG1 1 
ATOM   3718 C CG2 . VAL B  1 219 ? -66.182  -1.657  -1.598  1.00 84.38  ?  1693 VAL B CG2 1 
ATOM   3719 N N   . TYR B  1 220 ? -68.346  -4.789  0.735   1.00 83.27  ?  1694 TYR B N   1 
ATOM   3720 C CA  . TYR B  1 220 ? -69.270  -5.844  1.143   1.00 85.23  ?  1694 TYR B CA  1 
ATOM   3721 C C   . TYR B  1 220 ? -68.746  -6.494  2.441   1.00 84.87  ?  1694 TYR B C   1 
ATOM   3722 O O   . TYR B  1 220 ? -67.976  -7.449  2.341   1.00 89.35  ?  1694 TYR B O   1 
ATOM   3723 C CB  . TYR B  1 220 ? -69.401  -6.916  0.046   1.00 90.96  ?  1694 TYR B CB  1 
ATOM   3724 C CG  . TYR B  1 220 ? -69.424  -6.439  -1.391  1.00 93.81  ?  1694 TYR B CG  1 
ATOM   3725 C CD1 . TYR B  1 220 ? -70.544  -5.801  -1.916  1.00 89.91  ?  1694 TYR B CD1 1 
ATOM   3726 C CD2 . TYR B  1 220 ? -68.386  -6.755  -2.266  1.00 101.29 ?  1694 TYR B CD2 1 
ATOM   3727 C CE1 . TYR B  1 220 ? -70.601  -5.423  -3.259  1.00 89.79  ?  1694 TYR B CE1 1 
ATOM   3728 C CE2 . TYR B  1 220 ? -68.434  -6.388  -3.612  1.00 104.18 ?  1694 TYR B CE2 1 
ATOM   3729 C CZ  . TYR B  1 220 ? -69.546  -5.724  -4.107  1.00 91.96  ?  1694 TYR B CZ  1 
ATOM   3730 O OH  . TYR B  1 220 ? -69.610  -5.358  -5.437  1.00 77.66  ?  1694 TYR B OH  1 
ATOM   3731 N N   . PRO B  1 221 ? -69.144  -6.031  3.657   1.00 81.50  ?  1695 PRO B N   1 
ATOM   3732 C CA  . PRO B  1 221 ? -68.570  -6.601  4.898   1.00 81.79  ?  1695 PRO B CA  1 
ATOM   3733 C C   . PRO B  1 221 ? -68.776  -8.102  5.154   1.00 81.19  ?  1695 PRO B C   1 
ATOM   3734 O O   . PRO B  1 221 ? -68.044  -8.675  5.967   1.00 76.19  ?  1695 PRO B O   1 
ATOM   3735 C CB  . PRO B  1 221 ? -69.197  -5.756  6.011   1.00 85.51  ?  1695 PRO B CB  1 
ATOM   3736 C CG  . PRO B  1 221 ? -70.374  -5.102  5.395   1.00 86.03  ?  1695 PRO B CG  1 
ATOM   3737 C CD  . PRO B  1 221 ? -70.011  -4.878  3.965   1.00 82.55  ?  1695 PRO B CD  1 
ATOM   3738 N N   . TYR B  1 222 ? -69.720  -8.745  4.463   1.00 83.66  ?  1696 TYR B N   1 
ATOM   3739 C CA  . TYR B  1 222 ? -69.934  -10.176 4.657   1.00 91.76  ?  1696 TYR B CA  1 
ATOM   3740 C C   . TYR B  1 222 ? -69.264  -11.002 3.552   1.00 93.58  ?  1696 TYR B C   1 
ATOM   3741 O O   . TYR B  1 222 ? -69.720  -12.098 3.252   1.00 81.05  ?  1696 TYR B O   1 
ATOM   3742 C CB  . TYR B  1 222 ? -71.435  -10.494 4.824   1.00 99.81  ?  1696 TYR B CB  1 
ATOM   3743 C CG  . TYR B  1 222 ? -72.003  -10.022 6.144   1.00 96.24  ?  1696 TYR B CG  1 
ATOM   3744 C CD1 . TYR B  1 222 ? -72.462  -8.718  6.303   1.00 103.83 ?  1696 TYR B CD1 1 
ATOM   3745 C CD2 . TYR B  1 222 ? -72.069  -10.874 7.241   1.00 95.24  ?  1696 TYR B CD2 1 
ATOM   3746 C CE1 . TYR B  1 222 ? -72.958  -8.268  7.526   1.00 101.68 ?  1696 TYR B CE1 1 
ATOM   3747 C CE2 . TYR B  1 222 ? -72.575  -10.439 8.466   1.00 104.25 ?  1696 TYR B CE2 1 
ATOM   3748 C CZ  . TYR B  1 222 ? -73.019  -9.135  8.604   1.00 104.85 ?  1696 TYR B CZ  1 
ATOM   3749 O OH  . TYR B  1 222 ? -73.515  -8.700  9.809   1.00 126.17 ?  1696 TYR B OH  1 
ATOM   3750 N N   . ALA B  1 223 ? -68.175  -10.473 2.956   1.00 100.61 ?  1697 ALA B N   1 
ATOM   3751 C CA  . ALA B  1 223 ? -67.416  -11.133 1.889   1.00 95.98  ?  1697 ALA B CA  1 
ATOM   3752 C C   . ALA B  1 223 ? -66.678  -12.387 2.369   1.00 92.52  ?  1697 ALA B C   1 
ATOM   3753 O O   . ALA B  1 223 ? -66.520  -13.331 1.592   1.00 89.44  ?  1697 ALA B O   1 
ATOM   3754 C CB  . ALA B  1 223 ? -66.431  -10.162 1.263   1.00 91.51  ?  1697 ALA B CB  1 
ATOM   3755 N N   . TRP B  1 224 ? -66.238  -12.399 3.648   1.00 84.71  ?  1698 TRP B N   1 
ATOM   3756 C CA  . TRP B  1 224 ? -65.511  -13.504 4.288   1.00 84.29  ?  1698 TRP B CA  1 
ATOM   3757 C C   . TRP B  1 224 ? -66.316  -14.805 4.265   1.00 80.42  ?  1698 TRP B C   1 
ATOM   3758 O O   . TRP B  1 224 ? -65.743  -15.885 4.143   1.00 87.50  ?  1698 TRP B O   1 
ATOM   3759 C CB  . TRP B  1 224 ? -65.112  -13.125 5.728   1.00 85.57  ?  1698 TRP B CB  1 
ATOM   3760 C CG  . TRP B  1 224 ? -66.279  -12.785 6.608   1.00 93.27  ?  1698 TRP B CG  1 
ATOM   3761 C CD1 . TRP B  1 224 ? -66.846  -11.557 6.781   1.00 104.75 ?  1698 TRP B CD1 1 
ATOM   3762 C CD2 . TRP B  1 224 ? -67.059  -13.702 7.388   1.00 96.28  ?  1698 TRP B CD2 1 
ATOM   3763 N NE1 . TRP B  1 224 ? -67.924  -11.647 7.632   1.00 110.94 ?  1698 TRP B NE1 1 
ATOM   3764 C CE2 . TRP B  1 224 ? -68.084  -12.956 8.012   1.00 111.11 ?  1698 TRP B CE2 1 
ATOM   3765 C CE3 . TRP B  1 224 ? -66.996  -15.090 7.614   1.00 84.37  ?  1698 TRP B CE3 1 
ATOM   3766 C CZ2 . TRP B  1 224 ? -69.041  -13.550 8.845   1.00 109.27 ?  1698 TRP B CZ2 1 
ATOM   3767 C CZ3 . TRP B  1 224 ? -67.946  -15.677 8.434   1.00 88.72  ?  1698 TRP B CZ3 1 
ATOM   3768 C CH2 . TRP B  1 224 ? -68.948  -14.911 9.046   1.00 97.12  ?  1698 TRP B CH2 1 
ATOM   3769 N N   . VAL B  1 225 ? -67.655  -14.685 4.336   1.00 83.71  ?  1699 VAL B N   1 
ATOM   3770 C CA  . VAL B  1 225 ? -68.604  -15.796 4.333   1.00 83.04  ?  1699 VAL B CA  1 
ATOM   3771 C C   . VAL B  1 225 ? -68.512  -16.617 3.027   1.00 79.50  ?  1699 VAL B C   1 
ATOM   3772 O O   . VAL B  1 225 ? -69.031  -17.729 2.966   1.00 70.02  ?  1699 VAL B O   1 
ATOM   3773 C CB  . VAL B  1 225 ? -70.034  -15.294 4.673   1.00 79.31  ?  1699 VAL B CB  1 
ATOM   3774 C CG1 . VAL B  1 225 ? -70.932  -15.184 3.445   1.00 83.06  ?  1699 VAL B CG1 1 
ATOM   3775 C CG2 . VAL B  1 225 ? -70.679  -16.163 5.737   1.00 76.38  ?  1699 VAL B CG2 1 
ATOM   3776 N N   . PHE B  1 226 ? -67.813  -16.075 2.012   1.00 82.11  ?  1700 PHE B N   1 
ATOM   3777 C CA  . PHE B  1 226 ? -67.588  -16.703 0.718   1.00 87.13  ?  1700 PHE B CA  1 
ATOM   3778 C C   . PHE B  1 226 ? -66.163  -17.220 0.637   1.00 88.28  ?  1700 PHE B C   1 
ATOM   3779 O O   . PHE B  1 226 ? -65.950  -18.358 0.221   1.00 84.68  ?  1700 PHE B O   1 
ATOM   3780 C CB  . PHE B  1 226 ? -67.846  -15.691 -0.423  1.00 89.96  ?  1700 PHE B CB  1 
ATOM   3781 C CG  . PHE B  1 226 ? -67.549  -16.195 -1.820  1.00 92.32  ?  1700 PHE B CG  1 
ATOM   3782 C CD1 . PHE B  1 226 ? -68.540  -16.799 -2.586  1.00 101.39 ?  1700 PHE B CD1 1 
ATOM   3783 C CD2 . PHE B  1 226 ? -66.283  -16.052 -2.377  1.00 98.98  ?  1700 PHE B CD2 1 
ATOM   3784 C CE1 . PHE B  1 226 ? -68.264  -17.275 -3.872  1.00 101.53 ?  1700 PHE B CE1 1 
ATOM   3785 C CE2 . PHE B  1 226 ? -66.006  -16.536 -3.661  1.00 110.23 ?  1700 PHE B CE2 1 
ATOM   3786 C CZ  . PHE B  1 226 ? -67.002  -17.137 -4.403  1.00 101.07 ?  1700 PHE B CZ  1 
ATOM   3787 N N   . PHE B  1 227 ? -65.190  -16.371 1.008   1.00 86.03  ?  1701 PHE B N   1 
ATOM   3788 C CA  . PHE B  1 227 ? -63.766  -16.658 0.884   1.00 83.05  ?  1701 PHE B CA  1 
ATOM   3789 C C   . PHE B  1 227 ? -63.203  -17.605 1.916   1.00 76.31  ?  1701 PHE B C   1 
ATOM   3790 O O   . PHE B  1 227 ? -62.349  -18.408 1.537   1.00 72.08  ?  1701 PHE B O   1 
ATOM   3791 C CB  . PHE B  1 227 ? -62.949  -15.375 0.824   1.00 82.28  ?  1701 PHE B CB  1 
ATOM   3792 C CG  . PHE B  1 227 ? -63.205  -14.652 -0.472  1.00 79.51  ?  1701 PHE B CG  1 
ATOM   3793 C CD1 . PHE B  1 227 ? -62.621  -15.087 -1.656  1.00 73.32  ?  1701 PHE B CD1 1 
ATOM   3794 C CD2 . PHE B  1 227 ? -64.079  -13.577 -0.523  1.00 81.18  ?  1701 PHE B CD2 1 
ATOM   3795 C CE1 . PHE B  1 227 ? -62.901  -14.451 -2.861  1.00 78.58  ?  1701 PHE B CE1 1 
ATOM   3796 C CE2 . PHE B  1 227 ? -64.352  -12.940 -1.726  1.00 84.38  ?  1701 PHE B CE2 1 
ATOM   3797 C CZ  . PHE B  1 227 ? -63.756  -13.373 -2.886  1.00 86.84  ?  1701 PHE B CZ  1 
ATOM   3798 N N   . ILE B  1 228 ? -63.645  -17.526 3.200   1.00 71.15  ?  1702 ILE B N   1 
ATOM   3799 C CA  . ILE B  1 228 ? -63.207  -18.471 4.251   1.00 69.59  ?  1702 ILE B CA  1 
ATOM   3800 C C   . ILE B  1 228 ? -63.690  -19.899 3.833   1.00 76.13  ?  1702 ILE B C   1 
ATOM   3801 O O   . ILE B  1 228 ? -62.828  -20.768 3.692   1.00 73.97  ?  1702 ILE B O   1 
ATOM   3802 C CB  . ILE B  1 228 ? -63.573  -18.070 5.726   1.00 67.49  ?  1702 ILE B CB  1 
ATOM   3803 C CG1 . ILE B  1 228 ? -63.285  -16.578 6.057   1.00 68.57  ?  1702 ILE B CG1 1 
ATOM   3804 C CG2 . ILE B  1 228 ? -62.900  -18.993 6.738   1.00 67.99  ?  1702 ILE B CG2 1 
ATOM   3805 C CD1 . ILE B  1 228 ? -61.792  -16.125 6.216   1.00 72.95  ?  1702 ILE B CD1 1 
ATOM   3806 N N   . PRO B  1 229 ? -64.993  -20.132 3.476   1.00 85.33  ?  1703 PRO B N   1 
ATOM   3807 C CA  . PRO B  1 229 ? -65.392  -21.456 2.976   1.00 80.28  ?  1703 PRO B CA  1 
ATOM   3808 C C   . PRO B  1 229 ? -64.713  -21.831 1.660   1.00 76.25  ?  1703 PRO B C   1 
ATOM   3809 O O   . PRO B  1 229 ? -64.410  -23.003 1.485   1.00 73.47  ?  1703 PRO B O   1 
ATOM   3810 C CB  . PRO B  1 229 ? -66.907  -21.319 2.799   1.00 84.72  ?  1703 PRO B CB  1 
ATOM   3811 C CG  . PRO B  1 229 ? -67.290  -20.230 3.716   1.00 84.03  ?  1703 PRO B CG  1 
ATOM   3812 C CD  . PRO B  1 229 ? -66.175  -19.253 3.551   1.00 85.98  ?  1703 PRO B CD  1 
ATOM   3813 N N   . PHE B  1 230 ? -64.444  -20.862 0.756   1.00 80.63  ?  1704 PHE B N   1 
ATOM   3814 C CA  . PHE B  1 230 ? -63.735  -21.169 -0.487  1.00 90.75  ?  1704 PHE B CA  1 
ATOM   3815 C C   . PHE B  1 230 ? -62.374  -21.783 -0.166  1.00 85.30  ?  1704 PHE B C   1 
ATOM   3816 O O   . PHE B  1 230 ? -62.075  -22.858 -0.674  1.00 76.63  ?  1704 PHE B O   1 
ATOM   3817 C CB  . PHE B  1 230 ? -63.574  -19.945 -1.414  1.00 94.32  ?  1704 PHE B CB  1 
ATOM   3818 C CG  . PHE B  1 230 ? -62.589  -20.195 -2.538  1.00 88.72  ?  1704 PHE B CG  1 
ATOM   3819 C CD1 . PHE B  1 230 ? -62.930  -21.002 -3.617  1.00 84.56  ?  1704 PHE B CD1 1 
ATOM   3820 C CD2 . PHE B  1 230 ? -61.298  -19.683 -2.481  1.00 97.41  ?  1704 PHE B CD2 1 
ATOM   3821 C CE1 . PHE B  1 230 ? -62.007  -21.273 -4.626  1.00 92.28  ?  1704 PHE B CE1 1 
ATOM   3822 C CE2 . PHE B  1 230 ? -60.373  -19.957 -3.492  1.00 98.69  ?  1704 PHE B CE2 1 
ATOM   3823 C CZ  . PHE B  1 230 ? -60.736  -20.747 -4.558  1.00 99.58  ?  1704 PHE B CZ  1 
ATOM   3824 N N   . ILE B  1 231 ? -61.570  -21.109 0.693   1.00 83.71  ?  1705 ILE B N   1 
ATOM   3825 C CA  . ILE B  1 231 ? -60.243  -21.560 1.146   1.00 89.59  ?  1705 ILE B CA  1 
ATOM   3826 C C   . ILE B  1 231 ? -60.331  -22.980 1.709   1.00 94.88  ?  1705 ILE B C   1 
ATOM   3827 O O   . ILE B  1 231 ? -59.528  -23.824 1.323   1.00 96.24  ?  1705 ILE B O   1 
ATOM   3828 C CB  . ILE B  1 231 ? -59.553  -20.538 2.116   1.00 83.59  ?  1705 ILE B CB  1 
ATOM   3829 C CG1 . ILE B  1 231 ? -59.086  -19.299 1.341   1.00 85.37  ?  1705 ILE B CG1 1 
ATOM   3830 C CG2 . ILE B  1 231 ? -58.370  -21.154 2.880   1.00 76.46  ?  1705 ILE B CG2 1 
ATOM   3831 C CD1 . ILE B  1 231 ? -58.871  -18.112 2.141   1.00 84.41  ?  1705 ILE B CD1 1 
ATOM   3832 N N   . PHE B  1 232 ? -61.344  -23.247 2.564   1.00 86.02  ?  1706 PHE B N   1 
ATOM   3833 C CA  . PHE B  1 232 ? -61.589  -24.551 3.174   1.00 80.21  ?  1706 PHE B CA  1 
ATOM   3834 C C   . PHE B  1 232 ? -61.905  -25.631 2.138   1.00 83.51  ?  1706 PHE B C   1 
ATOM   3835 O O   . PHE B  1 232 ? -61.190  -26.632 2.070   1.00 87.43  ?  1706 PHE B O   1 
ATOM   3836 C CB  . PHE B  1 232 ? -62.680  -24.455 4.247   1.00 75.39  ?  1706 PHE B CB  1 
ATOM   3837 C CG  . PHE B  1 232 ? -62.153  -24.015 5.591   1.00 78.49  ?  1706 PHE B CG  1 
ATOM   3838 C CD1 . PHE B  1 232 ? -62.302  -22.704 6.018   1.00 79.73  ?  1706 PHE B CD1 1 
ATOM   3839 C CD2 . PHE B  1 232 ? -61.496  -24.910 6.425   1.00 86.43  ?  1706 PHE B CD2 1 
ATOM   3840 C CE1 . PHE B  1 232 ? -61.813  -22.299 7.260   1.00 84.94  ?  1706 PHE B CE1 1 
ATOM   3841 C CE2 . PHE B  1 232 ? -61.005  -24.501 7.667   1.00 92.40  ?  1706 PHE B CE2 1 
ATOM   3842 C CZ  . PHE B  1 232 ? -61.170  -23.199 8.076   1.00 91.55  ?  1706 PHE B CZ  1 
ATOM   3843 N N   . VAL B  1 233 ? -62.943  -25.404 1.303   1.00 83.92  ?  1707 VAL B N   1 
ATOM   3844 C CA  . VAL B  1 233 ? -63.386  -26.315 0.239   1.00 84.26  ?  1707 VAL B CA  1 
ATOM   3845 C C   . VAL B  1 233 ? -62.225  -26.628 -0.710  1.00 79.27  ?  1707 VAL B C   1 
ATOM   3846 O O   . VAL B  1 233 ? -62.030  -27.786 -1.062  1.00 69.29  ?  1707 VAL B O   1 
ATOM   3847 C CB  . VAL B  1 233 ? -64.644  -25.751 -0.490  1.00 97.19  ?  1707 VAL B CB  1 
ATOM   3848 C CG1 . VAL B  1 233 ? -64.865  -26.391 -1.854  1.00 102.35 ?  1707 VAL B CG1 1 
ATOM   3849 C CG2 . VAL B  1 233 ? -65.893  -25.897 0.373   1.00 99.05  ?  1707 VAL B CG2 1 
ATOM   3850 N N   . VAL B  1 234 ? -61.420  -25.607 -1.048  1.00 86.77  ?  1708 VAL B N   1 
ATOM   3851 C CA  . VAL B  1 234 ? -60.284  -25.715 -1.956  1.00 89.44  ?  1708 VAL B CA  1 
ATOM   3852 C C   . VAL B  1 234 ? -59.016  -26.293 -1.285  1.00 86.65  ?  1708 VAL B C   1 
ATOM   3853 O O   . VAL B  1 234 ? -58.183  -26.850 -1.998  1.00 90.31  ?  1708 VAL B O   1 
ATOM   3854 C CB  . VAL B  1 234 ? -60.026  -24.368 -2.671  1.00 90.44  ?  1708 VAL B CB  1 
ATOM   3855 C CG1 . VAL B  1 234 ? -59.005  -23.498 -1.943  1.00 94.39  ?  1708 VAL B CG1 1 
ATOM   3856 C CG2 . VAL B  1 234 ? -59.637  -24.583 -4.118  1.00 87.14  ?  1708 VAL B CG2 1 
ATOM   3857 N N   . THR B  1 235 ? -58.862  -26.176 0.055   1.00 80.09  ?  1709 THR B N   1 
ATOM   3858 C CA  . THR B  1 235 ? -57.676  -26.739 0.710   1.00 89.59  ?  1709 THR B CA  1 
ATOM   3859 C C   . THR B  1 235 ? -57.860  -28.244 0.920   1.00 87.26  ?  1709 THR B C   1 
ATOM   3860 O O   . THR B  1 235 ? -56.913  -28.987 0.673   1.00 82.29  ?  1709 THR B O   1 
ATOM   3861 C CB  . THR B  1 235 ? -57.208  -25.969 1.979   1.00 98.86  ?  1709 THR B CB  1 
ATOM   3862 O OG1 . THR B  1 235 ? -55.874  -26.374 2.298   1.00 100.57 ?  1709 THR B OG1 1 
ATOM   3863 C CG2 . THR B  1 235 ? -58.113  -26.168 3.203   1.00 98.57  ?  1709 THR B CG2 1 
ATOM   3864 N N   . PHE B  1 236 ? -59.077  -28.693 1.324   1.00 94.47  ?  1710 PHE B N   1 
ATOM   3865 C CA  . PHE B  1 236 ? -59.394  -30.102 1.560   1.00 95.19  ?  1710 PHE B CA  1 
ATOM   3866 C C   . PHE B  1 236 ? -59.123  -30.943 0.327   1.00 97.57  ?  1710 PHE B C   1 
ATOM   3867 O O   . PHE B  1 236 ? -58.441  -31.960 0.436   1.00 97.65  ?  1710 PHE B O   1 
ATOM   3868 C CB  . PHE B  1 236 ? -60.840  -30.274 2.036   1.00 89.08  ?  1710 PHE B CB  1 
ATOM   3869 C CG  . PHE B  1 236 ? -61.178  -31.678 2.481   1.00 82.12  ?  1710 PHE B CG  1 
ATOM   3870 C CD1 . PHE B  1 236 ? -60.611  -32.219 3.634   1.00 82.12  ?  1710 PHE B CD1 1 
ATOM   3871 C CD2 . PHE B  1 236 ? -62.078  -32.456 1.763   1.00 81.75  ?  1710 PHE B CD2 1 
ATOM   3872 C CE1 . PHE B  1 236 ? -60.926  -33.519 4.046   1.00 84.40  ?  1710 PHE B CE1 1 
ATOM   3873 C CE2 . PHE B  1 236 ? -62.403  -33.750 2.187   1.00 84.86  ?  1710 PHE B CE2 1 
ATOM   3874 C CZ  . PHE B  1 236 ? -61.822  -34.272 3.322   1.00 85.22  ?  1710 PHE B CZ  1 
ATOM   3875 N N   . VAL B  1 237 ? -59.596  -30.479 -0.849  1.00 96.92  ?  1711 VAL B N   1 
ATOM   3876 C CA  . VAL B  1 237 ? -59.391  -31.130 -2.145  1.00 100.13 ?  1711 VAL B CA  1 
ATOM   3877 C C   . VAL B  1 237 ? -57.885  -31.240 -2.429  1.00 100.87 ?  1711 VAL B C   1 
ATOM   3878 O O   . VAL B  1 237 ? -57.420  -32.302 -2.845  1.00 96.30  ?  1711 VAL B O   1 
ATOM   3879 C CB  . VAL B  1 237 ? -60.172  -30.422 -3.288  1.00 103.50 ?  1711 VAL B CB  1 
ATOM   3880 C CG1 . VAL B  1 237 ? -59.933  -31.099 -4.635  1.00 101.51 ?  1711 VAL B CG1 1 
ATOM   3881 C CG2 . VAL B  1 237 ? -61.667  -30.375 -2.986  1.00 106.84 ?  1711 VAL B CG2 1 
ATOM   3882 N N   . MET B  1 238 ? -57.125  -30.169 -2.136  1.00 98.88  ?  1712 MET B N   1 
ATOM   3883 C CA  . MET B  1 238 ? -55.672  -30.127 -2.312  1.00 94.78  ?  1712 MET B CA  1 
ATOM   3884 C C   . MET B  1 238 ? -54.916  -31.143 -1.436  1.00 83.66  ?  1712 MET B C   1 
ATOM   3885 O O   . MET B  1 238 ? -54.046  -31.848 -1.953  1.00 78.21  ?  1712 MET B O   1 
ATOM   3886 C CB  . MET B  1 238 ? -55.127  -28.705 -2.085  1.00 97.71  ?  1712 MET B CB  1 
ATOM   3887 C CG  . MET B  1 238 ? -54.976  -27.912 -3.347  1.00 104.14 ?  1712 MET B CG  1 
ATOM   3888 S SD  . MET B  1 238 ? -53.833  -28.688 -4.505  1.00 118.12 ?  1712 MET B SD  1 
ATOM   3889 C CE  . MET B  1 238 ? -54.307  -27.873 -6.013  1.00 130.10 ?  1712 MET B CE  1 
ATOM   3890 N N   . ILE B  1 239 ? -55.247  -31.210 -0.122  1.00 75.73  ?  1713 ILE B N   1 
ATOM   3891 C CA  . ILE B  1 239 ? -54.616  -32.106 0.858   1.00 71.82  ?  1713 ILE B CA  1 
ATOM   3892 C C   . ILE B  1 239 ? -54.798  -33.555 0.406   1.00 78.38  ?  1713 ILE B C   1 
ATOM   3893 O O   . ILE B  1 239 ? -53.830  -34.320 0.366   1.00 73.81  ?  1713 ILE B O   1 
ATOM   3894 C CB  . ILE B  1 239 ? -55.164  -31.875 2.311   1.00 67.09  ?  1713 ILE B CB  1 
ATOM   3895 C CG1 . ILE B  1 239 ? -54.953  -30.430 2.789   1.00 69.75  ?  1713 ILE B CG1 1 
ATOM   3896 C CG2 . ILE B  1 239 ? -54.558  -32.861 3.333   1.00 64.23  ?  1713 ILE B CG2 1 
ATOM   3897 C CD1 . ILE B  1 239 ? -56.041  -29.923 3.784   1.00 74.91  ?  1713 ILE B CD1 1 
ATOM   3898 N N   . ASN B  1 240 ? -56.037  -33.908 0.036   1.00 85.31  ?  1714 ASN B N   1 
ATOM   3899 C CA  . ASN B  1 240 ? -56.417  -35.247 -0.391  1.00 83.15  ?  1714 ASN B CA  1 
ATOM   3900 C C   . ASN B  1 240 ? -55.744  -35.664 -1.686  1.00 86.66  ?  1714 ASN B C   1 
ATOM   3901 O O   . ASN B  1 240 ? -55.465  -36.844 -1.843  1.00 91.28  ?  1714 ASN B O   1 
ATOM   3902 C CB  . ASN B  1 240 ? -57.935  -35.387 -0.457  1.00 78.65  ?  1714 ASN B CB  1 
ATOM   3903 C CG  . ASN B  1 240 ? -58.622  -35.476 0.905   1.00 76.40  ?  1714 ASN B CG  1 
ATOM   3904 O OD1 . ASN B  1 240 ? -59.451  -36.358 1.149   1.00 80.15  ?  1714 ASN B OD1 1 
ATOM   3905 N ND2 . ASN B  1 240 ? -58.353  -34.543 1.813   1.00 73.28  ?  1714 ASN B ND2 1 
ATOM   3906 N N   . LEU B  1 241 ? -55.413  -34.708 -2.576  1.00 87.94  ?  1715 LEU B N   1 
ATOM   3907 C CA  . LEU B  1 241 ? -54.702  -34.993 -3.825  1.00 92.10  ?  1715 LEU B CA  1 
ATOM   3908 C C   . LEU B  1 241 ? -53.289  -35.520 -3.528  1.00 97.70  ?  1715 LEU B C   1 
ATOM   3909 O O   . LEU B  1 241 ? -52.814  -36.415 -4.223  1.00 108.41 ?  1715 LEU B O   1 
ATOM   3910 C CB  . LEU B  1 241 ? -54.635  -33.742 -4.717  1.00 91.82  ?  1715 LEU B CB  1 
ATOM   3911 C CG  . LEU B  1 241 ? -54.080  -33.953 -6.129  1.00 88.99  ?  1715 LEU B CG  1 
ATOM   3912 C CD1 . LEU B  1 241 ? -54.954  -33.297 -7.165  1.00 84.68  ?  1715 LEU B CD1 1 
ATOM   3913 C CD2 . LEU B  1 241 ? -52.652  -33.456 -6.240  1.00 97.52  ?  1715 LEU B CD2 1 
ATOM   3914 N N   . VAL B  1 242 ? -52.631  -34.960 -2.502  1.00 96.30  ?  1716 VAL B N   1 
ATOM   3915 C CA  . VAL B  1 242 ? -51.283  -35.338 -2.060  1.00 87.87  ?  1716 VAL B CA  1 
ATOM   3916 C C   . VAL B  1 242 ? -51.325  -36.674 -1.298  1.00 84.34  ?  1716 VAL B C   1 
ATOM   3917 O O   . VAL B  1 242 ? -50.403  -37.480 -1.435  1.00 86.90  ?  1716 VAL B O   1 
ATOM   3918 C CB  . VAL B  1 242 ? -50.624  -34.196 -1.247  1.00 81.81  ?  1716 VAL B CB  1 
ATOM   3919 C CG1 . VAL B  1 242 ? -49.248  -34.594 -0.721  1.00 82.54  ?  1716 VAL B CG1 1 
ATOM   3920 C CG2 . VAL B  1 242 ? -50.527  -32.923 -2.084  1.00 80.25  ?  1716 VAL B CG2 1 
ATOM   3921 N N   . VAL B  1 243 ? -52.402  -36.906 -0.514  1.00 74.77  ?  1717 VAL B N   1 
ATOM   3922 C CA  . VAL B  1 243 ? -52.635  -38.147 0.238   1.00 71.69  ?  1717 VAL B CA  1 
ATOM   3923 C C   . VAL B  1 243 ? -52.827  -39.303 -0.770  1.00 71.95  ?  1717 VAL B C   1 
ATOM   3924 O O   . VAL B  1 243 ? -52.326  -40.409 -0.542  1.00 64.44  ?  1717 VAL B O   1 
ATOM   3925 C CB  . VAL B  1 243 ? -53.824  -37.999 1.229   1.00 69.36  ?  1717 VAL B CB  1 
ATOM   3926 C CG1 . VAL B  1 243 ? -54.210  -39.337 1.855   1.00 69.73  ?  1717 VAL B CG1 1 
ATOM   3927 C CG2 . VAL B  1 243 ? -53.501  -36.982 2.316   1.00 70.27  ?  1717 VAL B CG2 1 
ATOM   3928 N N   . ALA B  1 244 ? -53.504  -39.007 -1.907  1.00 78.43  ?  1718 ALA B N   1 
ATOM   3929 C CA  . ALA B  1 244 ? -53.762  -39.925 -3.018  1.00 86.04  ?  1718 ALA B CA  1 
ATOM   3930 C C   . ALA B  1 244 ? -52.460  -40.379 -3.657  1.00 89.50  ?  1718 ALA B C   1 
ATOM   3931 O O   . ALA B  1 244 ? -52.338  -41.552 -3.976  1.00 96.91  ?  1718 ALA B O   1 
ATOM   3932 C CB  . ALA B  1 244 ? -54.651  -39.265 -4.059  1.00 89.80  ?  1718 ALA B CB  1 
ATOM   3933 N N   . ILE B  1 245 ? -51.479  -39.469 -3.813  1.00 96.23  ?  1719 ILE B N   1 
ATOM   3934 C CA  . ILE B  1 245 ? -50.157  -39.788 -4.372  1.00 98.74  ?  1719 ILE B CA  1 
ATOM   3935 C C   . ILE B  1 245 ? -49.441  -40.755 -3.411  1.00 97.44  ?  1719 ILE B C   1 
ATOM   3936 O O   . ILE B  1 245 ? -48.818  -41.710 -3.878  1.00 101.75 ?  1719 ILE B O   1 
ATOM   3937 C CB  . ILE B  1 245 ? -49.326  -38.500 -4.708  1.00 95.49  ?  1719 ILE B CB  1 
ATOM   3938 C CG1 . ILE B  1 245 ? -50.061  -37.620 -5.749  1.00 96.04  ?  1719 ILE B CG1 1 
ATOM   3939 C CG2 . ILE B  1 245 ? -47.895  -38.833 -5.193  1.00 91.37  ?  1719 ILE B CG2 1 
ATOM   3940 C CD1 . ILE B  1 245 ? -49.736  -36.147 -5.711  1.00 94.01  ?  1719 ILE B CD1 1 
ATOM   3941 N N   . ILE B  1 246 ? -49.600  -40.544 -2.076  1.00 84.91  ?  1720 ILE B N   1 
ATOM   3942 C CA  . ILE B  1 246 ? -49.001  -41.380 -1.023  1.00 77.74  ?  1720 ILE B CA  1 
ATOM   3943 C C   . ILE B  1 246 ? -49.619  -42.781 -0.984  1.00 85.87  ?  1720 ILE B C   1 
ATOM   3944 O O   . ILE B  1 246 ? -48.875  -43.761 -1.063  1.00 82.66  ?  1720 ILE B O   1 
ATOM   3945 C CB  . ILE B  1 246 ? -48.992  -40.709 0.386   1.00 70.21  ?  1720 ILE B CB  1 
ATOM   3946 C CG1 . ILE B  1 246 ? -48.237  -39.361 0.375   1.00 70.53  ?  1720 ILE B CG1 1 
ATOM   3947 C CG2 . ILE B  1 246 ? -48.390  -41.658 1.437   1.00 66.85  ?  1720 ILE B CG2 1 
ATOM   3948 C CD1 . ILE B  1 246 ? -48.675  -38.357 1.433   1.00 75.20  ?  1720 ILE B CD1 1 
ATOM   3949 N N   . VAL B  1 247 ? -50.962  -42.873 -0.865  1.00 94.84  ?  1721 VAL B N   1 
ATOM   3950 C CA  . VAL B  1 247 ? -51.681  -44.150 -0.779  1.00 103.97 ?  1721 VAL B CA  1 
ATOM   3951 C C   . VAL B  1 247 ? -51.545  -45.001 -2.055  1.00 107.92 ?  1721 VAL B C   1 
ATOM   3952 O O   . VAL B  1 247 ? -51.549  -46.221 -1.942  1.00 101.72 ?  1721 VAL B O   1 
ATOM   3953 C CB  . VAL B  1 247 ? -53.156  -44.029 -0.326  1.00 104.14 ?  1721 VAL B CB  1 
ATOM   3954 C CG1 . VAL B  1 247 ? -53.254  -43.317 1.015   1.00 102.23 ?  1721 VAL B CG1 1 
ATOM   3955 C CG2 . VAL B  1 247 ? -54.032  -43.349 -1.376  1.00 110.62 ?  1721 VAL B CG2 1 
ATOM   3956 N N   . ASP B  1 248 ? -51.411  -44.382 -3.243  1.00 118.24 ?  1722 ASP B N   1 
ATOM   3957 C CA  . ASP B  1 248 ? -51.228  -45.134 -4.487  1.00 122.03 ?  1722 ASP B CA  1 
ATOM   3958 C C   . ASP B  1 248 ? -49.811  -45.672 -4.557  1.00 118.03 ?  1722 ASP B C   1 
ATOM   3959 O O   . ASP B  1 248 ? -49.608  -46.775 -5.057  1.00 108.67 ?  1722 ASP B O   1 
ATOM   3960 C CB  . ASP B  1 248 ? -51.560  -44.286 -5.723  1.00 137.50 ?  1722 ASP B CB  1 
ATOM   3961 C CG  . ASP B  1 248 ? -53.027  -43.906 -5.862  1.00 151.63 ?  1722 ASP B CG  1 
ATOM   3962 O OD1 . ASP B  1 248 ? -53.896  -44.682 -5.389  1.00 159.90 ?  1722 ASP B OD1 1 
ATOM   3963 O OD2 . ASP B  1 248 ? -53.309  -42.843 -6.454  1.00 146.57 -1 1722 ASP B OD2 1 
ATOM   3964 N N   . ALA B  1 249 ? -48.839  -44.910 -4.021  1.00 118.78 ?  1723 ALA B N   1 
ATOM   3965 C CA  . ALA B  1 249 ? -47.436  -45.313 -3.953  1.00 122.12 ?  1723 ALA B CA  1 
ATOM   3966 C C   . ALA B  1 249 ? -47.284  -46.430 -2.919  1.00 125.16 ?  1723 ALA B C   1 
ATOM   3967 O O   . ALA B  1 249 ? -46.592  -47.415 -3.179  1.00 143.14 ?  1723 ALA B O   1 
ATOM   3968 C CB  . ALA B  1 249 ? -46.570  -44.125 -3.580  1.00 117.86 ?  1723 ALA B CB  1 
ATOM   3969 N N   . MET B  1 250 ? -47.990  -46.297 -1.774  1.00 113.59 ?  1724 MET B N   1 
ATOM   3970 C CA  . MET B  1 250 ? -48.021  -47.271 -0.679  1.00 108.65 ?  1724 MET B CA  1 
ATOM   3971 C C   . MET B  1 250 ? -48.915  -48.482 -0.971  1.00 102.24 ?  1724 MET B C   1 
ATOM   3972 O O   . MET B  1 250 ? -49.014  -49.370 -0.126  1.00 86.92  ?  1724 MET B O   1 
ATOM   3973 C CB  . MET B  1 250 ? -48.430  -46.604 0.644   1.00 113.59 ?  1724 MET B CB  1 
ATOM   3974 C CG  . MET B  1 250 ? -47.254  -46.230 1.514   1.00 126.43 ?  1724 MET B CG  1 
ATOM   3975 S SD  . MET B  1 250 ? -46.263  -47.654 2.035   1.00 145.14 ?  1724 MET B SD  1 
ATOM   3976 C CE  . MET B  1 250 ? -47.337  -48.365 3.284   1.00 146.40 ?  1724 MET B CE  1 
ATOM   3977 N N   . ALA B  1 251 ? -49.582  -48.503 -2.150  1.00 103.52 ?  1725 ALA B N   1 
ATOM   3978 C CA  . ALA B  1 251 ? -50.431  -49.609 -2.594  1.00 105.76 ?  1725 ALA B CA  1 
ATOM   3979 C C   . ALA B  1 251 ? -49.553  -50.622 -3.304  1.00 104.83 ?  1725 ALA B C   1 
ATOM   3980 O O   . ALA B  1 251 ? -49.702  -51.822 -3.071  1.00 99.76  ?  1725 ALA B O   1 
ATOM   3981 C CB  . ALA B  1 251 ? -51.523  -49.113 -3.531  1.00 105.76 ?  1725 ALA B CB  1 
ATOM   3982 N N   . ILE B  1 252 ? -48.609  -50.135 -4.142  1.00 105.71 ?  1726 ILE B N   1 
ATOM   3983 C CA  . ILE B  1 252 ? -47.657  -50.972 -4.880  1.00 105.99 ?  1726 ILE B CA  1 
ATOM   3984 C C   . ILE B  1 252 ? -46.763  -51.716 -3.870  1.00 105.27 ?  1726 ILE B C   1 
ATOM   3985 O O   . ILE B  1 252 ? -46.486  -52.901 -4.053  1.00 100.07 ?  1726 ILE B O   1 
ATOM   3986 C CB  . ILE B  1 252 ? -46.836  -50.159 -5.925  1.00 106.63 ?  1726 ILE B CB  1 
ATOM   3987 C CG1 . ILE B  1 252 ? -47.696  -49.085 -6.636  1.00 104.95 ?  1726 ILE B CG1 1 
ATOM   3988 C CG2 . ILE B  1 252 ? -46.178  -51.093 -6.948  1.00 107.89 ?  1726 ILE B CG2 1 
ATOM   3989 C CD1 . ILE B  1 252 ? -46.965  -47.751 -6.905  1.00 107.11 ?  1726 ILE B CD1 1 
ATOM   3990 N N   . LEU B  1 253 ? -46.381  -51.028 -2.776  1.00 102.53 ?  1727 LEU B N   1 
ATOM   3991 C CA  . LEU B  1 253 ? -45.575  -51.568 -1.681  1.00 100.39 ?  1727 LEU B CA  1 
ATOM   3992 C C   . LEU B  1 253 ? -46.359  -52.592 -0.836  1.00 101.91 ?  1727 LEU B C   1 
ATOM   3993 O O   . LEU B  1 253 ? -45.831  -53.662 -0.543  1.00 86.93  ?  1727 LEU B O   1 
ATOM   3994 C CB  . LEU B  1 253 ? -45.095  -50.415 -0.785  1.00 100.13 ?  1727 LEU B CB  1 
ATOM   3995 C CG  . LEU B  1 253 ? -43.719  -49.817 -1.064  1.00 110.50 ?  1727 LEU B CG  1 
ATOM   3996 C CD1 . LEU B  1 253 ? -43.726  -48.944 -2.314  1.00 112.63 ?  1727 LEU B CD1 1 
ATOM   3997 C CD2 . LEU B  1 253 ? -43.259  -48.992 0.116   1.00 117.47 ?  1727 LEU B CD2 1 
ATOM   3998 N N   . ASN B  1 254 ? -47.612  -52.251 -0.451  1.00 114.91 ?  1728 ASN B N   1 
ATOM   3999 C CA  . ASN B  1 254 ? -48.516  -53.059 0.381   1.00 117.74 ?  1728 ASN B CA  1 
ATOM   4000 C C   . ASN B  1 254 ? -49.063  -54.301 -0.319  1.00 125.71 ?  1728 ASN B C   1 
ATOM   4001 O O   . ASN B  1 254 ? -49.236  -55.328 0.339   1.00 125.46 ?  1728 ASN B O   1 
ATOM   4002 C CB  . ASN B  1 254 ? -49.693  -52.205 0.870   1.00 116.30 ?  1728 ASN B CB  1 
ATOM   4003 C CG  . ASN B  1 254 ? -49.897  -52.170 2.368   1.00 117.96 ?  1728 ASN B CG  1 
ATOM   4004 O OD1 . ASN B  1 254 ? -50.820  -52.795 2.906   1.00 117.78 ?  1728 ASN B OD1 1 
ATOM   4005 N ND2 . ASN B  1 254 ? -49.091  -51.383 3.070   1.00 116.15 ?  1728 ASN B ND2 1 
ATOM   4006 N N   . GLN B  1 255 ? -49.381  -54.202 -1.627  1.00 133.66 ?  1729 GLN B N   1 
ATOM   4007 C CA  . GLN B  1 255 ? -49.953  -55.316 -2.390  1.00 134.06 ?  1729 GLN B CA  1 
ATOM   4008 C C   . GLN B  1 255 ? -48.890  -56.296 -2.919  1.00 133.75 ?  1729 GLN B C   1 
ATOM   4009 O O   . GLN B  1 255 ? -49.242  -57.351 -3.459  1.00 137.14 ?  1729 GLN B O   1 
ATOM   4010 C CB  . GLN B  1 255 ? -50.899  -54.821 -3.496  1.00 133.29 ?  1729 GLN B CB  1 
ATOM   4011 C CG  . GLN B  1 255 ? -52.374  -54.741 -3.051  1.00 135.55 ?  1729 GLN B CG  1 
ATOM   4012 C CD  . GLN B  1 255 ? -52.643  -53.814 -1.870  1.00 140.28 ?  1729 GLN B CD  1 
ATOM   4013 O OE1 . GLN B  1 255 ? -52.365  -52.610 -1.906  1.00 138.51 ?  1729 GLN B OE1 1 
ATOM   4014 N NE2 . GLN B  1 255 ? -53.218  -54.354 -0.800  1.00 138.09 ?  1729 GLN B NE2 1 
ATOM   4015 N N   . LYS B  1 256 ? -47.598  -55.976 -2.712  1.00 123.68 ?  1730 LYS B N   1 
ATOM   4016 C CA  . LYS B  1 256 ? -46.491  -56.868 -3.053  1.00 119.28 ?  1730 LYS B CA  1 
ATOM   4017 C C   . LYS B  1 256 ? -45.966  -57.505 -1.776  1.00 118.74 ?  1730 LYS B C   1 
ATOM   4018 O O   . LYS B  1 256 ? -45.499  -58.642 -1.812  1.00 118.93 ?  1730 LYS B O   1 
ATOM   4019 C CB  . LYS B  1 256 ? -45.384  -56.167 -3.860  1.00 121.27 ?  1730 LYS B CB  1 
ATOM   4020 C CG  . LYS B  1 256 ? -45.778  -55.836 -5.308  1.00 127.56 ?  1730 LYS B CG  1 
ATOM   4021 C CD  . LYS B  1 256 ? -46.298  -57.040 -6.122  1.00 127.98 ?  1730 LYS B CD  1 
ATOM   4022 C CE  . LYS B  1 256 ? -47.217  -56.629 -7.254  1.00 128.26 ?  1730 LYS B CE  1 
ATOM   4023 N NZ  . LYS B  1 256 ? -48.532  -56.119 -6.769  1.00 131.40 1  1730 LYS B NZ  1 
ATOM   4024 N N   . GLU B  1 257 ? -46.110  -56.786 -0.638  1.00 114.53 ?  1731 GLU B N   1 
ATOM   4025 C CA  . GLU B  1 257 ? -45.763  -57.224 0.720   1.00 116.10 ?  1731 GLU B CA  1 
ATOM   4026 C C   . GLU B  1 257 ? -46.558  -58.491 1.057   1.00 118.22 ?  1731 GLU B C   1 
ATOM   4027 O O   . GLU B  1 257 ? -45.985  -59.435 1.603   1.00 114.85 ?  1731 GLU B O   1 
ATOM   4028 C CB  . GLU B  1 257 ? -46.094  -56.108 1.738   1.00 118.78 ?  1731 GLU B CB  1 
ATOM   4029 C CG  . GLU B  1 257 ? -45.744  -56.415 3.190   1.00 115.75 ?  1731 GLU B CG  1 
ATOM   4030 C CD  . GLU B  1 257 ? -46.489  -55.602 4.235   1.00 111.51 ?  1731 GLU B CD  1 
ATOM   4031 O OE1 . GLU B  1 257 ? -47.034  -56.223 5.177   1.00 99.85  ?  1731 GLU B OE1 1 
ATOM   4032 O OE2 . GLU B  1 257 ? -46.530  -54.353 4.120   1.00 106.95 -1 1731 GLU B OE2 1 
ATOM   4033 N N   . GLU B  1 258 ? -47.868  -58.508 0.708   1.00 121.80 ?  1732 GLU B N   1 
ATOM   4034 C CA  . GLU B  1 258 ? -48.778  -59.636 0.929   1.00 120.43 ?  1732 GLU B CA  1 
ATOM   4035 C C   . GLU B  1 258 ? -48.373  -60.880 0.127   1.00 127.11 ?  1732 GLU B C   1 
ATOM   4036 O O   . GLU B  1 258 ? -48.369  -61.976 0.686   1.00 128.39 ?  1732 GLU B O   1 
ATOM   4037 C CB  . GLU B  1 258 ? -50.251  -59.248 0.670   1.00 116.96 ?  1732 GLU B CB  1 
ATOM   4038 C CG  . GLU B  1 258 ? -50.526  -58.634 -0.695  1.00 117.07 ?  1732 GLU B CG  1 
ATOM   4039 C CD  . GLU B  1 258 ? -51.967  -58.286 -1.020  1.00 117.87 ?  1732 GLU B CD  1 
ATOM   4040 O OE1 . GLU B  1 258 ? -52.391  -58.549 -2.170  1.00 114.11 ?  1732 GLU B OE1 1 
ATOM   4041 O OE2 . GLU B  1 258 ? -52.661  -57.720 -0.144  1.00 120.58 -1 1732 GLU B OE2 1 
ATOM   4042 N N   . GLN B  1 259 ? -47.996  -60.695 -1.161  1.00 131.86 ?  1733 GLN B N   1 
ATOM   4043 C CA  . GLN B  1 259 ? -47.579  -61.750 -2.090  1.00 132.63 ?  1733 GLN B CA  1 
ATOM   4044 C C   . GLN B  1 259 ? -46.430  -62.596 -1.523  1.00 132.18 ?  1733 GLN B C   1 
ATOM   4045 O O   . GLN B  1 259 ? -46.489  -63.827 -1.596  1.00 134.37 ?  1733 GLN B O   1 
ATOM   4046 C CB  . GLN B  1 259 ? -47.194  -61.133 -3.447  1.00 128.21 ?  1733 GLN B CB  1 
ATOM   4047 C CG  . GLN B  1 259 ? -47.054  -62.143 -4.586  1.00 126.14 ?  1733 GLN B CG  1 
ATOM   4048 C CD  . GLN B  1 259 ? -46.172  -61.634 -5.707  1.00 131.46 ?  1733 GLN B CD  1 
ATOM   4049 O OE1 . GLN B  1 259 ? -45.068  -61.110 -5.487  1.00 130.77 ?  1733 GLN B OE1 1 
ATOM   4050 N NE2 . GLN B  1 259 ? -46.615  -61.826 -6.945  1.00 140.50 ?  1733 GLN B NE2 1 
ATOM   4051 N N   . HIS B  1 260 ? -45.407  -61.933 -0.939  1.00 128.66 ?  1734 HIS B N   1 
ATOM   4052 C CA  . HIS B  1 260 ? -44.241  -62.588 -0.340  1.00 129.69 ?  1734 HIS B CA  1 
ATOM   4053 C C   . HIS B  1 260 ? -44.627  -63.388 0.904   1.00 121.92 ?  1734 HIS B C   1 
ATOM   4054 O O   . HIS B  1 260 ? -44.177  -64.528 1.060   1.00 120.03 ?  1734 HIS B O   1 
ATOM   4055 C CB  . HIS B  1 260 ? -43.145  -61.566 0.019   1.00 133.68 ?  1734 HIS B CB  1 
ATOM   4056 C CG  . HIS B  1 260 ? -42.716  -60.680 -1.110  1.00 135.39 ?  1734 HIS B CG  1 
ATOM   4057 N ND1 . HIS B  1 260 ? -42.738  -59.300 -0.989  1.00 135.30 ?  1734 HIS B ND1 1 
ATOM   4058 C CD2 . HIS B  1 260 ? -42.259  -61.003 -2.343  1.00 138.72 ?  1734 HIS B CD2 1 
ATOM   4059 C CE1 . HIS B  1 260 ? -42.297  -58.831 -2.145  1.00 137.54 ?  1734 HIS B CE1 1 
ATOM   4060 N NE2 . HIS B  1 260 ? -42.001  -59.818 -2.993  1.00 140.56 ?  1734 HIS B NE2 1 
ATOM   4061 N N   . ILE B  1 261 ? -45.468  -62.787 1.778   1.00 114.33 ?  1735 ILE B N   1 
ATOM   4062 C CA  . ILE B  1 261 ? -45.964  -63.359 3.037   1.00 118.47 ?  1735 ILE B CA  1 
ATOM   4063 C C   . ILE B  1 261 ? -46.722  -64.696 2.800   1.00 122.69 ?  1735 ILE B C   1 
ATOM   4064 O O   . ILE B  1 261 ? -46.592  -65.610 3.620   1.00 136.43 ?  1735 ILE B O   1 
ATOM   4065 C CB  . ILE B  1 261 ? -46.785  -62.280 3.825   1.00 122.38 ?  1735 ILE B CB  1 
ATOM   4066 C CG1 . ILE B  1 261 ? -45.832  -61.264 4.507   1.00 126.54 ?  1735 ILE B CG1 1 
ATOM   4067 C CG2 . ILE B  1 261 ? -47.755  -62.887 4.851   1.00 116.45 ?  1735 ILE B CG2 1 
ATOM   4068 C CD1 . ILE B  1 261 ? -46.459  -59.896 4.908   1.00 127.46 ?  1735 ILE B CD1 1 
ATOM   4069 N N   . ILE B  1 262 ? -47.446  -64.821 1.662   1.00 121.22 ?  1736 ILE B N   1 
ATOM   4070 C CA  . ILE B  1 262 ? -48.217  -66.020 1.292   1.00 114.50 ?  1736 ILE B CA  1 
ATOM   4071 C C   . ILE B  1 262 ? -47.299  -67.241 1.015   1.00 122.50 ?  1736 ILE B C   1 
ATOM   4072 O O   . ILE B  1 262 ? -47.614  -68.353 1.467   1.00 133.04 ?  1736 ILE B O   1 
ATOM   4073 C CB  . ILE B  1 262 ? -49.218  -65.728 0.117   1.00 99.18  ?  1736 ILE B CB  1 
ATOM   4074 C CG1 . ILE B  1 262 ? -50.167  -64.529 0.410   1.00 88.67  ?  1736 ILE B CG1 1 
ATOM   4075 C CG2 . ILE B  1 262 ? -50.022  -66.970 -0.314  1.00 96.71  ?  1736 ILE B CG2 1 
ATOM   4076 C CD1 . ILE B  1 262 ? -50.902  -64.465 1.816   1.00 86.89  ?  1736 ILE B CD1 1 
ATOM   4077 N N   . ASP B  1 263 ? -46.157  -67.014 0.315   1.00 109.29 ?  1737 ASP B N   1 
ATOM   4078 C CA  . ASP B  1 263 ? -45.148  -68.013 -0.096  1.00 103.93 ?  1737 ASP B CA  1 
ATOM   4079 C C   . ASP B  1 263 ? -45.667  -68.869 -1.265  1.00 105.22 ?  1737 ASP B C   1 
ATOM   4080 O O   . ASP B  1 263 ? -46.577  -69.690 -1.102  1.00 105.96 ?  1737 ASP B O   1 
ATOM   4081 C CB  . ASP B  1 263 ? -44.635  -68.917 1.064   1.00 100.82 ?  1737 ASP B CB  1 
ATOM   4082 C CG  . ASP B  1 263 ? -44.339  -68.240 2.393   1.00 99.78  ?  1737 ASP B CG  1 
ATOM   4083 O OD1 . ASP B  1 263 ? -43.390  -67.409 2.444   1.00 98.81  -1 1737 ASP B OD1 1 
ATOM   4084 O OD2 . ASP B  1 263 ? -44.997  -68.602 3.403   1.00 99.99  ?  1737 ASP B OD2 1 
ATOM   4085 N N   . MET C  1 19  ? 2.308    -41.588 33.475  1.00 119.82 ?  1493 MET C N   1 
ATOM   4086 C CA  . MET C  1 19  ? 2.274    -40.171 33.109  1.00 124.48 ?  1493 MET C CA  1 
ATOM   4087 C C   . MET C  1 19  ? 1.283    -39.920 31.950  1.00 125.79 ?  1493 MET C C   1 
ATOM   4088 O O   . MET C  1 19  ? 0.263    -39.251 32.162  1.00 130.12 ?  1493 MET C O   1 
ATOM   4089 C CB  . MET C  1 19  ? 3.713    -39.632 32.844  1.00 128.40 ?  1493 MET C CB  1 
ATOM   4090 C CG  . MET C  1 19  ? 3.830    -38.469 31.837  1.00 132.80 ?  1493 MET C CG  1 
ATOM   4091 S SD  . MET C  1 19  ? 3.024    -36.907 32.288  1.00 140.54 ?  1493 MET C SD  1 
ATOM   4092 C CE  . MET C  1 19  ? 3.283    -35.972 30.781  1.00 127.47 ?  1493 MET C CE  1 
ATOM   4093 N N   . TYR C  1 20  ? 1.576    -40.469 30.748  1.00 125.06 ?  1494 TYR C N   1 
ATOM   4094 C CA  . TYR C  1 20  ? 0.757    -40.324 29.544  1.00 117.25 ?  1494 TYR C CA  1 
ATOM   4095 C C   . TYR C  1 20  ? -0.610   -41.006 29.682  1.00 124.98 ?  1494 TYR C C   1 
ATOM   4096 O O   . TYR C  1 20  ? -1.577   -40.548 29.077  1.00 119.04 ?  1494 TYR C O   1 
ATOM   4097 C CB  . TYR C  1 20  ? 1.524    -40.815 28.301  1.00 109.62 ?  1494 TYR C CB  1 
ATOM   4098 C CG  . TYR C  1 20  ? 0.672    -40.983 27.061  1.00 97.65  ?  1494 TYR C CG  1 
ATOM   4099 C CD1 . TYR C  1 20  ? 0.401    -39.903 26.226  1.00 97.05  ?  1494 TYR C CD1 1 
ATOM   4100 C CD2 . TYR C  1 20  ? 0.130    -42.221 26.724  1.00 96.29  ?  1494 TYR C CD2 1 
ATOM   4101 C CE1 . TYR C  1 20  ? -0.387   -40.049 25.084  1.00 103.35 ?  1494 TYR C CE1 1 
ATOM   4102 C CE2 . TYR C  1 20  ? -0.667   -42.378 25.591  1.00 99.81  ?  1494 TYR C CE2 1 
ATOM   4103 C CZ  . TYR C  1 20  ? -0.916   -41.291 24.769  1.00 102.33 ?  1494 TYR C CZ  1 
ATOM   4104 O OH  . TYR C  1 20  ? -1.687   -41.450 23.643  1.00 96.71  ?  1494 TYR C OH  1 
ATOM   4105 N N   . LEU C  1 21  ? -0.691   -42.098 30.469  1.00 142.40 ?  1495 LEU C N   1 
ATOM   4106 C CA  . LEU C  1 21  ? -1.952   -42.808 30.691  1.00 143.08 ?  1495 LEU C CA  1 
ATOM   4107 C C   . LEU C  1 21  ? -2.933   -42.010 31.572  1.00 142.72 ?  1495 LEU C C   1 
ATOM   4108 O O   . LEU C  1 21  ? -4.126   -42.311 31.550  1.00 153.62 ?  1495 LEU C O   1 
ATOM   4109 C CB  . LEU C  1 21  ? -1.736   -44.235 31.210  1.00 140.68 ?  1495 LEU C CB  1 
ATOM   4110 C CG  . LEU C  1 21  ? -1.753   -45.306 30.122  1.00 134.29 ?  1495 LEU C CG  1 
ATOM   4111 C CD1 . LEU C  1 21  ? -0.509   -46.168 30.180  1.00 126.76 ?  1495 LEU C CD1 1 
ATOM   4112 C CD2 . LEU C  1 21  ? -3.014   -46.149 30.197  1.00 137.72 ?  1495 LEU C CD2 1 
ATOM   4113 N N   . ARG C  1 22  ? -2.437   -40.975 32.301  1.00 134.12 ?  1496 ARG C N   1 
ATOM   4114 C CA  . ARG C  1 22  ? -3.249   -40.068 33.120  1.00 129.27 ?  1496 ARG C CA  1 
ATOM   4115 C C   . ARG C  1 22  ? -3.741   -38.907 32.247  1.00 128.90 ?  1496 ARG C C   1 
ATOM   4116 O O   . ARG C  1 22  ? -4.859   -38.430 32.452  1.00 131.86 ?  1496 ARG C O   1 
ATOM   4117 C CB  . ARG C  1 22  ? -2.467   -39.542 34.336  1.00 131.50 ?  1496 ARG C CB  1 
ATOM   4118 C CG  . ARG C  1 22  ? -3.372   -38.900 35.392  1.00 135.11 ?  1496 ARG C CG  1 
ATOM   4119 C CD  . ARG C  1 22  ? -2.599   -38.158 36.464  1.00 134.71 ?  1496 ARG C CD  1 
ATOM   4120 N NE  . ARG C  1 22  ? -3.482   -37.312 37.272  1.00 126.97 ?  1496 ARG C NE  1 
ATOM   4121 C CZ  . ARG C  1 22  ? -3.316   -37.069 38.570  1.00 124.11 ?  1496 ARG C CZ  1 
ATOM   4122 N NH1 . ARG C  1 22  ? -4.172   -36.287 39.218  1.00 115.83 1  1496 ARG C NH1 1 
ATOM   4123 N NH2 . ARG C  1 22  ? -2.297   -37.609 39.232  1.00 131.86 ?  1496 ARG C NH2 1 
ATOM   4124 N N   . ILE C  1 23  ? -2.906   -38.457 31.277  1.00 128.26 ?  1497 ILE C N   1 
ATOM   4125 C CA  . ILE C  1 23  ? -3.268   -37.396 30.328  1.00 129.96 ?  1497 ILE C CA  1 
ATOM   4126 C C   . ILE C  1 23  ? -4.296   -37.937 29.313  1.00 131.30 ?  1497 ILE C C   1 
ATOM   4127 O O   . ILE C  1 23  ? -5.212   -37.209 28.934  1.00 124.57 ?  1497 ILE C O   1 
ATOM   4128 C CB  . ILE C  1 23  ? -2.037   -36.685 29.670  1.00 123.82 ?  1497 ILE C CB  1 
ATOM   4129 C CG1 . ILE C  1 23  ? -2.401   -35.261 29.180  1.00 112.55 ?  1497 ILE C CG1 1 
ATOM   4130 C CG2 . ILE C  1 23  ? -1.390   -37.521 28.560  1.00 128.72 ?  1497 ILE C CG2 1 
ATOM   4131 C CD1 . ILE C  1 23  ? -1.212   -34.374 28.689  1.00 106.12 ?  1497 ILE C CD1 1 
ATOM   4132 N N   . THR C  1 24  ? -4.157   -39.223 28.912  1.00 132.03 ?  1498 THR C N   1 
ATOM   4133 C CA  . THR C  1 24  ? -5.076   -39.890 27.992  1.00 127.48 ?  1498 THR C CA  1 
ATOM   4134 C C   . THR C  1 24  ? -6.377   -40.238 28.736  1.00 133.30 ?  1498 THR C C   1 
ATOM   4135 O O   . THR C  1 24  ? -7.451   -40.210 28.132  1.00 129.67 ?  1498 THR C O   1 
ATOM   4136 C CB  . THR C  1 24  ? -4.383   -41.067 27.256  1.00 119.80 ?  1498 THR C CB  1 
ATOM   4137 O OG1 . THR C  1 24  ? -4.961   -41.220 25.962  1.00 115.15 ?  1498 THR C OG1 1 
ATOM   4138 C CG2 . THR C  1 24  ? -4.437   -42.399 28.023  1.00 115.76 ?  1498 THR C CG2 1 
ATOM   4139 N N   . ASN C  1 25  ? -6.268   -40.527 30.056  1.00 135.75 ?  1499 ASN C N   1 
ATOM   4140 C CA  . ASN C  1 25  ? -7.381   -40.839 30.954  1.00 143.68 ?  1499 ASN C CA  1 
ATOM   4141 C C   . ASN C  1 25  ? -8.278   -39.610 31.085  1.00 141.80 ?  1499 ASN C C   1 
ATOM   4142 O O   . ASN C  1 25  ? -9.498   -39.746 31.114  1.00 143.34 ?  1499 ASN C O   1 
ATOM   4143 C CB  . ASN C  1 25  ? -6.844   -41.230 32.331  1.00 153.65 ?  1499 ASN C CB  1 
ATOM   4144 C CG  . ASN C  1 25  ? -7.823   -41.970 33.200  1.00 164.21 ?  1499 ASN C CG  1 
ATOM   4145 O OD1 . ASN C  1 25  ? -8.768   -41.392 33.750  1.00 182.54 ?  1499 ASN C OD1 1 
ATOM   4146 N ND2 . ASN C  1 25  ? -7.581   -43.260 33.390  1.00 163.51 ?  1499 ASN C ND2 1 
ATOM   4147 N N   . ILE C  1 26  ? -7.659   -38.414 31.148  1.00 137.42 ?  1500 ILE C N   1 
ATOM   4148 C CA  . ILE C  1 26  ? -8.321   -37.118 31.263  1.00 132.70 ?  1500 ILE C CA  1 
ATOM   4149 C C   . ILE C  1 26  ? -8.869   -36.658 29.896  1.00 135.34 ?  1500 ILE C C   1 
ATOM   4150 O O   . ILE C  1 26  ? -9.968   -36.115 29.866  1.00 143.36 ?  1500 ILE C O   1 
ATOM   4151 C CB  . ILE C  1 26  ? -7.376   -36.087 31.977  1.00 125.98 ?  1500 ILE C CB  1 
ATOM   4152 C CG1 . ILE C  1 26  ? -7.335   -36.314 33.520  1.00 127.86 ?  1500 ILE C CG1 1 
ATOM   4153 C CG2 . ILE C  1 26  ? -7.653   -34.612 31.631  1.00 121.23 ?  1500 ILE C CG2 1 
ATOM   4154 C CD1 . ILE C  1 26  ? -8.705   -36.156 34.356  1.00 124.71 ?  1500 ILE C CD1 1 
ATOM   4155 N N   . VAL C  1 27  ? -8.132   -36.886 28.781  1.00 131.51 ?  1501 VAL C N   1 
ATOM   4156 C CA  . VAL C  1 27  ? -8.570   -36.490 27.428  1.00 130.16 ?  1501 VAL C CA  1 
ATOM   4157 C C   . VAL C  1 27  ? -9.736   -37.389 26.959  1.00 134.43 ?  1501 VAL C C   1 
ATOM   4158 O O   . VAL C  1 27  ? -10.812  -36.870 26.652  1.00 132.94 ?  1501 VAL C O   1 
ATOM   4159 C CB  . VAL C  1 27  ? -7.397   -36.379 26.403  1.00 116.21 ?  1501 VAL C CB  1 
ATOM   4160 C CG1 . VAL C  1 27  ? -7.892   -36.388 24.956  1.00 107.63 ?  1501 VAL C CG1 1 
ATOM   4161 C CG2 . VAL C  1 27  ? -6.563   -35.128 26.668  1.00 112.69 ?  1501 VAL C CG2 1 
ATOM   4162 N N   . GLU C  1 28  ? -9.549   -38.723 26.963  1.00 131.00 ?  1502 GLU C N   1 
ATOM   4163 C CA  . GLU C  1 28  ? -10.605  -39.672 26.584  1.00 124.59 ?  1502 GLU C CA  1 
ATOM   4164 C C   . GLU C  1 28  ? -11.509  -39.921 27.821  1.00 119.73 ?  1502 GLU C C   1 
ATOM   4165 O O   . GLU C  1 28  ? -11.725  -41.069 28.230  1.00 129.56 ?  1502 GLU C O   1 
ATOM   4166 C CB  . GLU C  1 28  ? -10.000  -40.985 26.032  1.00 123.18 ?  1502 GLU C CB  1 
ATOM   4167 C CG  . GLU C  1 28  ? -9.008   -40.813 24.888  1.00 117.46 ?  1502 GLU C CG  1 
ATOM   4168 C CD  . GLU C  1 28  ? -9.596   -40.661 23.497  1.00 117.30 ?  1502 GLU C CD  1 
ATOM   4169 O OE1 . GLU C  1 28  ? -10.166  -41.650 22.979  1.00 126.99 ?  1502 GLU C OE1 1 
ATOM   4170 O OE2 . GLU C  1 28  ? -9.437   -39.570 22.901  1.00 108.45 -1 1502 GLU C OE2 1 
ATOM   4171 N N   . SER C  1 29  ? -12.024  -38.814 28.414  1.00 111.81 ?  1503 SER C N   1 
ATOM   4172 C CA  . SER C  1 29  ? -12.848  -38.797 29.626  1.00 116.56 ?  1503 SER C CA  1 
ATOM   4173 C C   . SER C  1 29  ? -14.271  -38.289 29.411  1.00 127.92 ?  1503 SER C C   1 
ATOM   4174 O O   . SER C  1 29  ? -14.521  -37.479 28.511  1.00 144.86 ?  1503 SER C O   1 
ATOM   4175 C CB  . SER C  1 29  ? -12.174  -37.949 30.704  1.00 112.52 ?  1503 SER C CB  1 
ATOM   4176 O OG  . SER C  1 29  ? -12.947  -37.807 31.885  1.00 112.25 ?  1503 SER C OG  1 
ATOM   4177 N N   . SER C  1 30  ? -15.188  -38.736 30.306  1.00 125.55 ?  1504 SER C N   1 
ATOM   4178 C CA  . SER C  1 30  ? -16.595  -38.333 30.375  1.00 119.04 ?  1504 SER C CA  1 
ATOM   4179 C C   . SER C  1 30  ? -16.679  -36.845 30.751  1.00 116.61 ?  1504 SER C C   1 
ATOM   4180 O O   . SER C  1 30  ? -17.557  -36.138 30.255  1.00 122.96 ?  1504 SER C O   1 
ATOM   4181 C CB  . SER C  1 30  ? -17.345  -39.185 31.398  1.00 116.56 ?  1504 SER C CB  1 
ATOM   4182 O OG  . SER C  1 30  ? -16.718  -39.173 32.671  1.00 115.20 ?  1504 SER C OG  1 
ATOM   4183 N N   . PHE C  1 31  ? -15.735  -36.375 31.599  1.00 109.75 ?  1505 PHE C N   1 
ATOM   4184 C CA  . PHE C  1 31  ? -15.622  -34.983 32.023  1.00 110.76 ?  1505 PHE C CA  1 
ATOM   4185 C C   . PHE C  1 31  ? -15.181  -34.102 30.847  1.00 112.02 ?  1505 PHE C C   1 
ATOM   4186 O O   . PHE C  1 31  ? -15.879  -33.136 30.534  1.00 127.37 ?  1505 PHE C O   1 
ATOM   4187 C CB  . PHE C  1 31  ? -14.646  -34.850 33.220  1.00 115.96 ?  1505 PHE C CB  1 
ATOM   4188 C CG  . PHE C  1 31  ? -14.063  -33.468 33.449  1.00 122.28 ?  1505 PHE C CG  1 
ATOM   4189 C CD1 . PHE C  1 31  ? -14.729  -32.534 34.235  1.00 120.49 ?  1505 PHE C CD1 1 
ATOM   4190 C CD2 . PHE C  1 31  ? -12.838  -33.107 32.891  1.00 129.01 ?  1505 PHE C CD2 1 
ATOM   4191 C CE1 . PHE C  1 31  ? -14.194  -31.256 34.436  1.00 125.81 ?  1505 PHE C CE1 1 
ATOM   4192 C CE2 . PHE C  1 31  ? -12.312  -31.825 33.080  1.00 130.53 ?  1505 PHE C CE2 1 
ATOM   4193 C CZ  . PHE C  1 31  ? -12.989  -30.911 33.858  1.00 128.87 ?  1505 PHE C CZ  1 
ATOM   4194 N N   . PHE C  1 32  ? -14.016  -34.431 30.217  1.00 110.86 ?  1506 PHE C N   1 
ATOM   4195 C CA  . PHE C  1 32  ? -13.388  -33.675 29.122  1.00 107.77 ?  1506 PHE C CA  1 
ATOM   4196 C C   . PHE C  1 32  ? -14.331  -33.313 27.995  1.00 108.85 ?  1506 PHE C C   1 
ATOM   4197 O O   . PHE C  1 32  ? -14.296  -32.166 27.549  1.00 121.27 ?  1506 PHE C O   1 
ATOM   4198 C CB  . PHE C  1 32  ? -12.150  -34.388 28.567  1.00 104.44 ?  1506 PHE C CB  1 
ATOM   4199 C CG  . PHE C  1 32  ? -11.282  -33.552 27.649  1.00 99.24  ?  1506 PHE C CG  1 
ATOM   4200 C CD1 . PHE C  1 32  ? -10.341  -32.670 28.166  1.00 99.34  ?  1506 PHE C CD1 1 
ATOM   4201 C CD2 . PHE C  1 32  ? -11.375  -33.683 26.267  1.00 97.96  ?  1506 PHE C CD2 1 
ATOM   4202 C CE1 . PHE C  1 32  ? -9.522   -31.914 27.317  1.00 100.48 ?  1506 PHE C CE1 1 
ATOM   4203 C CE2 . PHE C  1 32  ? -10.558  -32.923 25.417  1.00 100.79 ?  1506 PHE C CE2 1 
ATOM   4204 C CZ  . PHE C  1 32  ? -9.638   -32.042 25.947  1.00 100.95 ?  1506 PHE C CZ  1 
ATOM   4205 N N   . THR C  1 33  ? -15.169  -34.274 27.538  1.00 105.75 ?  1507 THR C N   1 
ATOM   4206 C CA  . THR C  1 33  ? -16.153  -34.042 26.473  1.00 110.71 ?  1507 THR C CA  1 
ATOM   4207 C C   . THR C  1 33  ? -17.153  -32.975 26.948  1.00 109.46 ?  1507 THR C C   1 
ATOM   4208 O O   . THR C  1 33  ? -17.265  -31.926 26.303  1.00 95.73  ?  1507 THR C O   1 
ATOM   4209 C CB  . THR C  1 33  ? -16.837  -35.352 26.041  1.00 113.15 ?  1507 THR C CB  1 
ATOM   4210 O OG1 . THR C  1 33  ? -15.982  -36.464 26.323  1.00 119.24 ?  1507 THR C OG1 1 
ATOM   4211 C CG2 . THR C  1 33  ? -17.232  -35.345 24.564  1.00 111.70 ?  1507 THR C CG2 1 
ATOM   4212 N N   . LYS C  1 34  ? -17.783  -33.207 28.137  1.00 109.15 ?  1508 LYS C N   1 
ATOM   4213 C CA  . LYS C  1 34  ? -18.745  -32.313 28.799  1.00 106.72 ?  1508 LYS C CA  1 
ATOM   4214 C C   . LYS C  1 34  ? -18.192  -30.902 29.038  1.00 101.93 ?  1508 LYS C C   1 
ATOM   4215 O O   . LYS C  1 34  ? -18.939  -29.932 28.921  1.00 100.43 ?  1508 LYS C O   1 
ATOM   4216 C CB  . LYS C  1 34  ? -19.279  -32.936 30.108  1.00 108.23 ?  1508 LYS C CB  1 
ATOM   4217 C CG  . LYS C  1 34  ? -20.304  -34.068 29.907  1.00 117.35 ?  1508 LYS C CG  1 
ATOM   4218 C CD  . LYS C  1 34  ? -21.714  -33.566 29.503  1.00 133.07 ?  1508 LYS C CD  1 
ATOM   4219 C CE  . LYS C  1 34  ? -22.634  -34.668 29.020  1.00 142.88 ?  1508 LYS C CE  1 
ATOM   4220 N NZ  . LYS C  1 34  ? -23.916  -34.131 28.485  1.00 146.52 1  1508 LYS C NZ  1 
ATOM   4221 N N   . PHE C  1 35  ? -16.885  -30.793 29.336  1.00 103.80 ?  1509 PHE C N   1 
ATOM   4222 C CA  . PHE C  1 35  ? -16.197  -29.522 29.533  1.00 108.76 ?  1509 PHE C CA  1 
ATOM   4223 C C   . PHE C  1 35  ? -16.007  -28.780 28.196  1.00 113.45 ?  1509 PHE C C   1 
ATOM   4224 O O   . PHE C  1 35  ? -16.161  -27.556 28.169  1.00 124.56 ?  1509 PHE C O   1 
ATOM   4225 C CB  . PHE C  1 35  ? -14.858  -29.728 30.263  1.00 106.64 ?  1509 PHE C CB  1 
ATOM   4226 C CG  . PHE C  1 35  ? -14.014  -28.481 30.402  1.00 106.87 ?  1509 PHE C CG  1 
ATOM   4227 C CD1 . PHE C  1 35  ? -14.381  -27.464 31.280  1.00 108.04 ?  1509 PHE C CD1 1 
ATOM   4228 C CD2 . PHE C  1 35  ? -12.852  -28.320 29.654  1.00 107.76 ?  1509 PHE C CD2 1 
ATOM   4229 C CE1 . PHE C  1 35  ? -13.605  -26.304 31.399  1.00 111.01 ?  1509 PHE C CE1 1 
ATOM   4230 C CE2 . PHE C  1 35  ? -12.074  -27.162 29.779  1.00 109.62 ?  1509 PHE C CE2 1 
ATOM   4231 C CZ  . PHE C  1 35  ? -12.449  -26.169 30.661  1.00 108.76 ?  1509 PHE C CZ  1 
ATOM   4232 N N   . ILE C  1 36  ? -15.677  -29.512 27.097  1.00 109.42 ?  1510 ILE C N   1 
ATOM   4233 C CA  . ILE C  1 36  ? -15.502  -28.912 25.762  1.00 107.28 ?  1510 ILE C CA  1 
ATOM   4234 C C   . ILE C  1 36  ? -16.869  -28.444 25.231  1.00 110.49 ?  1510 ILE C C   1 
ATOM   4235 O O   . ILE C  1 36  ? -16.947  -27.339 24.690  1.00 116.37 ?  1510 ILE C O   1 
ATOM   4236 C CB  . ILE C  1 36  ? -14.685  -29.794 24.748  1.00 107.10 ?  1510 ILE C CB  1 
ATOM   4237 C CG1 . ILE C  1 36  ? -13.267  -30.167 25.273  1.00 106.63 ?  1510 ILE C CG1 1 
ATOM   4238 C CG2 . ILE C  1 36  ? -14.583  -29.163 23.349  1.00 106.29 ?  1510 ILE C CG2 1 
ATOM   4239 C CD1 . ILE C  1 36  ? -12.363  -29.026 25.878  1.00 106.52 ?  1510 ILE C CD1 1 
ATOM   4240 N N   . ILE C  1 37  ? -17.948  -29.244 25.457  1.00 103.19 ?  1511 ILE C N   1 
ATOM   4241 C CA  . ILE C  1 37  ? -19.323  -28.887 25.072  1.00 92.49  ?  1511 ILE C CA  1 
ATOM   4242 C C   . ILE C  1 37  ? -19.657  -27.552 25.755  1.00 95.77  ?  1511 ILE C C   1 
ATOM   4243 O O   . ILE C  1 37  ? -20.008  -26.592 25.069  1.00 97.63  ?  1511 ILE C O   1 
ATOM   4244 C CB  . ILE C  1 37  ? -20.365  -29.994 25.451  1.00 88.74  ?  1511 ILE C CB  1 
ATOM   4245 C CG1 . ILE C  1 37  ? -20.026  -31.403 24.860  1.00 91.74  ?  1511 ILE C CG1 1 
ATOM   4246 C CG2 . ILE C  1 37  ? -21.803  -29.577 25.103  1.00 89.52  ?  1511 ILE C CG2 1 
ATOM   4247 C CD1 . ILE C  1 37  ? -19.832  -31.566 23.304  1.00 95.15  ?  1511 ILE C CD1 1 
ATOM   4248 N N   . TYR C  1 38  ? -19.473  -27.495 27.101  1.00 98.25  ?  1512 TYR C N   1 
ATOM   4249 C CA  . TYR C  1 38  ? -19.687  -26.340 27.984  1.00 98.87  ?  1512 TYR C CA  1 
ATOM   4250 C C   . TYR C  1 38  ? -18.952  -25.092 27.496  1.00 96.14  ?  1512 TYR C C   1 
ATOM   4251 O O   . TYR C  1 38  ? -19.529  -24.003 27.488  1.00 95.96  ?  1512 TYR C O   1 
ATOM   4252 C CB  . TYR C  1 38  ? -19.238  -26.697 29.415  1.00 104.22 ?  1512 TYR C CB  1 
ATOM   4253 C CG  . TYR C  1 38  ? -19.104  -25.523 30.363  1.00 111.49 ?  1512 TYR C CG  1 
ATOM   4254 C CD1 . TYR C  1 38  ? -20.213  -25.011 31.032  1.00 120.97 ?  1512 TYR C CD1 1 
ATOM   4255 C CD2 . TYR C  1 38  ? -17.860  -24.956 30.630  1.00 109.32 ?  1512 TYR C CD2 1 
ATOM   4256 C CE1 . TYR C  1 38  ? -20.094  -23.938 31.917  1.00 123.05 ?  1512 TYR C CE1 1 
ATOM   4257 C CE2 . TYR C  1 38  ? -17.728  -23.888 31.518  1.00 113.49 ?  1512 TYR C CE2 1 
ATOM   4258 C CZ  . TYR C  1 38  ? -18.847  -23.389 32.167  1.00 119.07 ?  1512 TYR C CZ  1 
ATOM   4259 O OH  . TYR C  1 38  ? -18.727  -22.332 33.040  1.00 127.84 ?  1512 TYR C OH  1 
ATOM   4260 N N   . LEU C  1 39  ? -17.670  -25.262 27.129  1.00 95.92  ?  1513 LEU C N   1 
ATOM   4261 C CA  . LEU C  1 39  ? -16.782  -24.219 26.628  1.00 101.55 ?  1513 LEU C CA  1 
ATOM   4262 C C   . LEU C  1 39  ? -17.326  -23.568 25.348  1.00 101.83 ?  1513 LEU C C   1 
ATOM   4263 O O   . LEU C  1 39  ? -17.289  -22.342 25.232  1.00 104.31 ?  1513 LEU C O   1 
ATOM   4264 C CB  . LEU C  1 39  ? -15.388  -24.825 26.388  1.00 109.39 ?  1513 LEU C CB  1 
ATOM   4265 C CG  . LEU C  1 39  ? -14.196  -24.063 26.967  1.00 115.97 ?  1513 LEU C CG  1 
ATOM   4266 C CD1 . LEU C  1 39  ? -14.222  -24.053 28.491  1.00 111.59 ?  1513 LEU C CD1 1 
ATOM   4267 C CD2 . LEU C  1 39  ? -12.888  -24.654 26.478  1.00 117.31 ?  1513 LEU C CD2 1 
ATOM   4268 N N   . ILE C  1 40  ? -17.854  -24.394 24.407  1.00 98.94  ?  1514 ILE C N   1 
ATOM   4269 C CA  . ILE C  1 40  ? -18.447  -23.968 23.125  1.00 93.04  ?  1514 ILE C CA  1 
ATOM   4270 C C   . ILE C  1 40  ? -19.752  -23.199 23.381  1.00 95.64  ?  1514 ILE C C   1 
ATOM   4271 O O   . ILE C  1 40  ? -19.994  -22.166 22.746  1.00 90.99  ?  1514 ILE C O   1 
ATOM   4272 C CB  . ILE C  1 40  ? -18.644  -25.179 22.157  1.00 84.81  ?  1514 ILE C CB  1 
ATOM   4273 C CG1 . ILE C  1 40  ? -17.291  -25.814 21.763  1.00 90.19  ?  1514 ILE C CG1 1 
ATOM   4274 C CG2 . ILE C  1 40  ? -19.421  -24.775 20.905  1.00 79.99  ?  1514 ILE C CG2 1 
ATOM   4275 C CD1 . ILE C  1 40  ? -17.343  -27.314 21.377  1.00 95.88  ?  1514 ILE C CD1 1 
ATOM   4276 N N   . VAL C  1 41  ? -20.573  -23.714 24.326  1.00 98.39  ?  1515 VAL C N   1 
ATOM   4277 C CA  . VAL C  1 41  ? -21.847  -23.147 24.773  1.00 97.36  ?  1515 VAL C CA  1 
ATOM   4278 C C   . VAL C  1 41  ? -21.631  -21.715 25.297  1.00 93.79  ?  1515 VAL C C   1 
ATOM   4279 O O   . VAL C  1 41  ? -22.394  -20.817 24.934  1.00 89.26  ?  1515 VAL C O   1 
ATOM   4280 C CB  . VAL C  1 41  ? -22.519  -24.081 25.814  1.00 96.00  ?  1515 VAL C CB  1 
ATOM   4281 C CG1 . VAL C  1 41  ? -23.615  -23.367 26.604  1.00 96.91  ?  1515 VAL C CG1 1 
ATOM   4282 C CG2 . VAL C  1 41  ? -23.072  -25.333 25.143  1.00 92.61  ?  1515 VAL C CG2 1 
ATOM   4283 N N   . LEU C  1 42  ? -20.568  -21.509 26.113  1.00 87.54  ?  1516 LEU C N   1 
ATOM   4284 C CA  . LEU C  1 42  ? -20.191  -20.205 26.679  1.00 86.27  ?  1516 LEU C CA  1 
ATOM   4285 C C   . LEU C  1 42  ? -19.646  -19.254 25.621  1.00 83.43  ?  1516 LEU C C   1 
ATOM   4286 O O   . LEU C  1 42  ? -19.798  -18.038 25.757  1.00 81.69  ?  1516 LEU C O   1 
ATOM   4287 C CB  . LEU C  1 42  ? -19.170  -20.345 27.819  1.00 88.29  ?  1516 LEU C CB  1 
ATOM   4288 C CG  . LEU C  1 42  ? -19.585  -21.037 29.126  1.00 91.35  ?  1516 LEU C CG  1 
ATOM   4289 C CD1 . LEU C  1 42  ? -18.622  -20.673 30.206  1.00 91.95  ?  1516 LEU C CD1 1 
ATOM   4290 C CD2 . LEU C  1 42  ? -20.988  -20.636 29.581  1.00 95.26  ?  1516 LEU C CD2 1 
ATOM   4291 N N   . ASN C  1 43  ? -18.996  -19.800 24.584  1.00 76.62  ?  1517 ASN C N   1 
ATOM   4292 C CA  . ASN C  1 43  ? -18.493  -18.989 23.486  1.00 74.18  ?  1517 ASN C CA  1 
ATOM   4293 C C   . ASN C  1 43  ? -19.689  -18.451 22.692  1.00 81.84  ?  1517 ASN C C   1 
ATOM   4294 O O   . ASN C  1 43  ? -19.684  -17.286 22.294  1.00 76.79  ?  1517 ASN C O   1 
ATOM   4295 C CB  . ASN C  1 43  ? -17.541  -19.786 22.596  1.00 64.90  ?  1517 ASN C CB  1 
ATOM   4296 C CG  . ASN C  1 43  ? -16.714  -18.926 21.652  1.00 58.18  ?  1517 ASN C CG  1 
ATOM   4297 O OD1 . ASN C  1 43  ? -16.573  -17.689 21.819  1.00 47.61  ?  1517 ASN C OD1 1 
ATOM   4298 N ND2 . ASN C  1 43  ? -16.132  -19.577 20.639  1.00 53.83  ?  1517 ASN C ND2 1 
ATOM   4299 N N   . MET C  1 44  ? -20.742  -19.289 22.535  1.00 90.25  ?  1518 MET C N   1 
ATOM   4300 C CA  . MET C  1 44  ? -21.999  -18.944 21.868  1.00 96.59  ?  1518 MET C CA  1 
ATOM   4301 C C   . MET C  1 44  ? -22.712  -17.815 22.620  1.00 93.53  ?  1518 MET C C   1 
ATOM   4302 O O   . MET C  1 44  ? -23.219  -16.899 21.973  1.00 94.73  ?  1518 MET C O   1 
ATOM   4303 C CB  . MET C  1 44  ? -22.903  -20.178 21.753  1.00 97.05  ?  1518 MET C CB  1 
ATOM   4304 C CG  . MET C  1 44  ? -23.928  -20.064 20.666  1.00 96.60  ?  1518 MET C CG  1 
ATOM   4305 S SD  . MET C  1 44  ? -25.016  -21.496 20.634  1.00 98.41  ?  1518 MET C SD  1 
ATOM   4306 C CE  . MET C  1 44  ? -24.884  -21.949 18.894  1.00 94.20  ?  1518 MET C CE  1 
ATOM   4307 N N   . VAL C  1 45  ? -22.715  -17.868 23.974  1.00 82.79  ?  1519 VAL C N   1 
ATOM   4308 C CA  . VAL C  1 45  ? -23.316  -16.853 24.845  1.00 77.83  ?  1519 VAL C CA  1 
ATOM   4309 C C   . VAL C  1 45  ? -22.569  -15.514 24.698  1.00 86.32  ?  1519 VAL C C   1 
ATOM   4310 O O   . VAL C  1 45  ? -23.230  -14.476 24.609  1.00 95.67  ?  1519 VAL C O   1 
ATOM   4311 C CB  . VAL C  1 45  ? -23.433  -17.321 26.322  1.00 71.84  ?  1519 VAL C CB  1 
ATOM   4312 C CG1 . VAL C  1 45  ? -24.011  -16.229 27.219  1.00 69.42  ?  1519 VAL C CG1 1 
ATOM   4313 C CG2 . VAL C  1 45  ? -24.269  -18.590 26.436  1.00 71.12  ?  1519 VAL C CG2 1 
ATOM   4314 N N   . THR C  1 46  ? -21.208  -15.540 24.618  1.00 89.14  ?  1520 THR C N   1 
ATOM   4315 C CA  . THR C  1 46  ? -20.375  -14.329 24.438  1.00 93.57  ?  1520 THR C CA  1 
ATOM   4316 C C   . THR C  1 46  ? -20.540  -13.697 23.024  1.00 94.13  ?  1520 THR C C   1 
ATOM   4317 O O   . THR C  1 46  ? -20.147  -12.547 22.801  1.00 93.57  ?  1520 THR C O   1 
ATOM   4318 C CB  . THR C  1 46  ? -18.894  -14.585 24.803  1.00 90.87  ?  1520 THR C CB  1 
ATOM   4319 O OG1 . THR C  1 46  ? -18.357  -15.619 23.980  1.00 90.81  ?  1520 THR C OG1 1 
ATOM   4320 C CG2 . THR C  1 46  ? -18.697  -14.915 26.277  1.00 91.22  ?  1520 THR C CG2 1 
ATOM   4321 N N   . MET C  1 47  ? -21.133  -14.458 22.090  1.00 92.50  ?  1521 MET C N   1 
ATOM   4322 C CA  . MET C  1 47  ? -21.418  -14.053 20.717  1.00 98.53  ?  1521 MET C CA  1 
ATOM   4323 C C   . MET C  1 47  ? -22.875  -13.588 20.619  1.00 97.25  ?  1521 MET C C   1 
ATOM   4324 O O   . MET C  1 47  ? -23.173  -12.664 19.858  1.00 96.10  ?  1521 MET C O   1 
ATOM   4325 C CB  . MET C  1 47  ? -21.158  -15.226 19.765  1.00 100.71 ?  1521 MET C CB  1 
ATOM   4326 C CG  . MET C  1 47  ? -19.692  -15.562 19.606  1.00 92.05  ?  1521 MET C CG  1 
ATOM   4327 S SD  . MET C  1 47  ? -19.474  -17.226 18.933  1.00 83.16  ?  1521 MET C SD  1 
ATOM   4328 C CE  . MET C  1 47  ? -17.839  -17.094 18.270  1.00 87.00  ?  1521 MET C CE  1 
ATOM   4329 N N   . MET C  1 48  ? -23.774  -14.227 21.408  1.00 91.88  ?  1522 MET C N   1 
ATOM   4330 C CA  . MET C  1 48  ? -25.204  -13.923 21.510  1.00 95.58  ?  1522 MET C CA  1 
ATOM   4331 C C   . MET C  1 48  ? -25.438  -12.528 22.088  1.00 103.50 ?  1522 MET C C   1 
ATOM   4332 O O   . MET C  1 48  ? -26.451  -11.899 21.777  1.00 114.31 ?  1522 MET C O   1 
ATOM   4333 C CB  . MET C  1 48  ? -25.901  -14.939 22.414  1.00 90.21  ?  1522 MET C CB  1 
ATOM   4334 C CG  . MET C  1 48  ? -26.406  -16.140 21.688  1.00 93.05  ?  1522 MET C CG  1 
ATOM   4335 S SD  . MET C  1 48  ? -27.674  -16.981 22.664  1.00 87.34  ?  1522 MET C SD  1 
ATOM   4336 C CE  . MET C  1 48  ? -26.686  -18.055 23.650  1.00 83.93  ?  1522 MET C CE  1 
ATOM   4337 N N   . VAL C  1 49  ? -24.502  -12.050 22.934  1.00 106.26 ?  1523 VAL C N   1 
ATOM   4338 C CA  . VAL C  1 49  ? -24.573  -10.736 23.582  1.00 104.16 ?  1523 VAL C CA  1 
ATOM   4339 C C   . VAL C  1 49  ? -23.876  -9.638  22.717  1.00 100.19 ?  1523 VAL C C   1 
ATOM   4340 O O   . VAL C  1 49  ? -23.158  -8.770  23.232  1.00 95.20  ?  1523 VAL C O   1 
ATOM   4341 C CB  . VAL C  1 49  ? -24.099  -10.767 25.067  1.00 104.64 ?  1523 VAL C CB  1 
ATOM   4342 C CG1 . VAL C  1 49  ? -25.045  -11.609 25.922  1.00 103.75 ?  1523 VAL C CG1 1 
ATOM   4343 C CG2 . VAL C  1 49  ? -22.655  -11.260 25.204  1.00 104.02 ?  1523 VAL C CG2 1 
ATOM   4344 N N   . GLU C  1 50  ? -24.134  -9.682  21.394  1.00 100.57 ?  1524 GLU C N   1 
ATOM   4345 C CA  . GLU C  1 50  ? -23.620  -8.713  20.435  1.00 108.73 ?  1524 GLU C CA  1 
ATOM   4346 C C   . GLU C  1 50  ? -24.798  -8.015  19.759  1.00 111.70 ?  1524 GLU C C   1 
ATOM   4347 O O   . GLU C  1 50  ? -25.732  -8.683  19.303  1.00 105.19 ?  1524 GLU C O   1 
ATOM   4348 C CB  . GLU C  1 50  ? -22.690  -9.382  19.410  1.00 115.89 ?  1524 GLU C CB  1 
ATOM   4349 C CG  . GLU C  1 50  ? -21.803  -8.393  18.670  1.00 114.61 ?  1524 GLU C CG  1 
ATOM   4350 C CD  . GLU C  1 50  ? -20.752  -9.004  17.763  1.00 110.70 ?  1524 GLU C CD  1 
ATOM   4351 O OE1 . GLU C  1 50  ? -19.717  -9.479  18.286  1.00 115.60 ?  1524 GLU C OE1 1 
ATOM   4352 O OE2 . GLU C  1 50  ? -20.940  -8.960  16.525  1.00 97.28  -1 1524 GLU C OE2 1 
ATOM   4353 N N   . LYS C  1 51  ? -24.767  -6.668  19.744  1.00 122.87 ?  1525 LYS C N   1 
ATOM   4354 C CA  . LYS C  1 51  ? -25.796  -5.802  19.154  1.00 131.65 ?  1525 LYS C CA  1 
ATOM   4355 C C   . LYS C  1 51  ? -25.185  -4.873  18.093  1.00 123.46 ?  1525 LYS C C   1 
ATOM   4356 O O   . LYS C  1 51  ? -24.021  -5.054  17.718  1.00 125.16 ?  1525 LYS C O   1 
ATOM   4357 C CB  . LYS C  1 51  ? -26.524  -4.992  20.252  1.00 140.60 ?  1525 LYS C CB  1 
ATOM   4358 C CG  . LYS C  1 51  ? -27.787  -5.668  20.785  1.00 142.86 ?  1525 LYS C CG  1 
ATOM   4359 C CD  . LYS C  1 51  ? -28.411  -4.913  21.972  1.00 142.72 ?  1525 LYS C CD  1 
ATOM   4360 C CE  . LYS C  1 51  ? -29.642  -4.110  21.602  1.00 140.96 ?  1525 LYS C CE  1 
ATOM   4361 N NZ  . LYS C  1 51  ? -30.396  -3.658  22.805  1.00 123.39 1  1525 LYS C NZ  1 
ATOM   4362 N N   . GLU C  1 52  ? -25.973  -3.896  17.597  1.00 111.52 ?  1526 GLU C N   1 
ATOM   4363 C CA  . GLU C  1 52  ? -25.508  -2.932  16.599  1.00 106.83 ?  1526 GLU C CA  1 
ATOM   4364 C C   . GLU C  1 52  ? -24.999  -1.633  17.235  1.00 105.83 ?  1526 GLU C C   1 
ATOM   4365 O O   . GLU C  1 52  ? -24.289  -0.876  16.564  1.00 115.07 ?  1526 GLU C O   1 
ATOM   4366 C CB  . GLU C  1 52  ? -26.588  -2.660  15.525  1.00 108.25 ?  1526 GLU C CB  1 
ATOM   4367 C CG  . GLU C  1 52  ? -27.701  -1.687  15.910  1.00 108.23 ?  1526 GLU C CG  1 
ATOM   4368 C CD  . GLU C  1 52  ? -27.540  -0.250  15.436  1.00 104.18 ?  1526 GLU C CD  1 
ATOM   4369 O OE1 . GLU C  1 52  ? -27.201  -0.037  14.248  1.00 97.29  ?  1526 GLU C OE1 1 
ATOM   4370 O OE2 . GLU C  1 52  ? -27.783  0.669   16.252  1.00 101.16 -1 1526 GLU C OE2 1 
ATOM   4371 N N   . GLY C  1 53  ? -25.389  -1.399  18.500  1.00 104.56 ?  1527 GLY C N   1 
ATOM   4372 C CA  . GLY C  1 53  ? -25.073  -0.217  19.306  1.00 109.68 ?  1527 GLY C CA  1 
ATOM   4373 C C   . GLY C  1 53  ? -23.676  0.363   19.145  1.00 106.84 ?  1527 GLY C C   1 
ATOM   4374 O O   . GLY C  1 53  ? -23.490  1.311   18.379  1.00 112.75 ?  1527 GLY C O   1 
ATOM   4375 N N   . GLN C  1 54  ? -22.669  -0.188  19.833  1.00 98.33  ?  1528 GLN C N   1 
ATOM   4376 C CA  . GLN C  1 54  ? -22.784  -1.294  20.780  1.00 105.33 ?  1528 GLN C CA  1 
ATOM   4377 C C   . GLN C  1 54  ? -22.239  -0.793  22.116  1.00 111.18 ?  1528 GLN C C   1 
ATOM   4378 O O   . GLN C  1 54  ? -22.913  -0.887  23.147  1.00 110.07 ?  1528 GLN C O   1 
ATOM   4379 C CB  . GLN C  1 54  ? -21.985  -2.505  20.257  1.00 107.10 ?  1528 GLN C CB  1 
ATOM   4380 C CG  . GLN C  1 54  ? -21.928  -3.691  21.221  1.00 111.44 ?  1528 GLN C CG  1 
ATOM   4381 C CD  . GLN C  1 54  ? -21.201  -4.901  20.680  1.00 115.19 ?  1528 GLN C CD  1 
ATOM   4382 O OE1 . GLN C  1 54  ? -21.580  -6.038  20.965  1.00 114.68 ?  1528 GLN C OE1 1 
ATOM   4383 N NE2 . GLN C  1 54  ? -20.126  -4.697  19.921  1.00 115.54 ?  1528 GLN C NE2 1 
ATOM   4384 N N   . SER C  1 55  ? -21.017  -0.223  22.041  1.00 114.46 ?  1529 SER C N   1 
ATOM   4385 C CA  . SER C  1 55  ? -20.105  0.382   23.018  1.00 110.06 ?  1529 SER C CA  1 
ATOM   4386 C C   . SER C  1 55  ? -18.729  0.057   22.454  1.00 109.44 ?  1529 SER C C   1 
ATOM   4387 O O   . SER C  1 55  ? -18.427  -1.121  22.230  1.00 99.94  ?  1529 SER C O   1 
ATOM   4388 C CB  . SER C  1 55  ? -20.231  -0.219  24.422  1.00 108.44 ?  1529 SER C CB  1 
ATOM   4389 O OG  . SER C  1 55  ? -21.399  0.172   25.125  1.00 109.05 ?  1529 SER C OG  1 
ATOM   4390 N N   . GLN C  1 56  ? -17.910  1.095   22.190  1.00 114.35 ?  1530 GLN C N   1 
ATOM   4391 C CA  . GLN C  1 56  ? -16.532  0.970   21.676  1.00 112.76 ?  1530 GLN C CA  1 
ATOM   4392 C C   . GLN C  1 56  ? -15.709  0.107   22.659  1.00 107.13 ?  1530 GLN C C   1 
ATOM   4393 O O   . GLN C  1 56  ? -14.773  -0.593  22.257  1.00 94.53  ?  1530 GLN C O   1 
ATOM   4394 C CB  . GLN C  1 56  ? -15.879  2.362   21.517  1.00 114.93 ?  1530 GLN C CB  1 
ATOM   4395 C CG  . GLN C  1 56  ? -16.708  3.394   20.727  1.00 113.58 ?  1530 GLN C CG  1 
ATOM   4396 C CD  . GLN C  1 56  ? -17.377  4.473   21.570  1.00 106.69 ?  1530 GLN C CD  1 
ATOM   4397 O OE1 . GLN C  1 56  ? -17.422  4.427   22.813  1.00 106.43 ?  1530 GLN C OE1 1 
ATOM   4398 N NE2 . GLN C  1 56  ? -17.932  5.473   20.895  1.00 98.68  ?  1530 GLN C NE2 1 
ATOM   4399 N N   . HIS C  1 57  ? -16.103  0.166   23.951  1.00 108.25 ?  1531 HIS C N   1 
ATOM   4400 C CA  . HIS C  1 57  ? -15.561  -0.574  25.078  1.00 114.85 ?  1531 HIS C CA  1 
ATOM   4401 C C   . HIS C  1 57  ? -16.017  -2.026  24.956  1.00 117.19 ?  1531 HIS C C   1 
ATOM   4402 O O   . HIS C  1 57  ? -15.170  -2.914  24.978  1.00 123.80 ?  1531 HIS C O   1 
ATOM   4403 C CB  . HIS C  1 57  ? -16.066  0.052   26.394  1.00 119.34 ?  1531 HIS C CB  1 
ATOM   4404 C CG  . HIS C  1 57  ? -15.431  -0.493  27.641  1.00 119.67 ?  1531 HIS C CG  1 
ATOM   4405 N ND1 . HIS C  1 57  ? -16.081  -1.426  28.437  1.00 117.28 ?  1531 HIS C ND1 1 
ATOM   4406 C CD2 . HIS C  1 57  ? -14.247  -0.179  28.218  1.00 113.46 ?  1531 HIS C CD2 1 
ATOM   4407 C CE1 . HIS C  1 57  ? -15.268  -1.659  29.456  1.00 112.85 ?  1531 HIS C CE1 1 
ATOM   4408 N NE2 . HIS C  1 57  ? -14.151  -0.936  29.366  1.00 110.81 ?  1531 HIS C NE2 1 
ATOM   4409 N N   . MET C  1 58  ? -17.346  -2.263  24.777  1.00 117.53 ?  1532 MET C N   1 
ATOM   4410 C CA  . MET C  1 58  ? -17.955  -3.598  24.649  1.00 115.07 ?  1532 MET C CA  1 
ATOM   4411 C C   . MET C  1 58  ? -17.297  -4.443  23.572  1.00 118.46 ?  1532 MET C C   1 
ATOM   4412 O O   . MET C  1 58  ? -17.080  -5.633  23.790  1.00 115.88 ?  1532 MET C O   1 
ATOM   4413 C CB  . MET C  1 58  ? -19.469  -3.501  24.399  1.00 109.67 ?  1532 MET C CB  1 
ATOM   4414 C CG  . MET C  1 58  ? -20.227  -4.783  24.659  1.00 104.98 ?  1532 MET C CG  1 
ATOM   4415 S SD  . MET C  1 58  ? -19.992  -5.374  26.345  1.00 99.18  ?  1532 MET C SD  1 
ATOM   4416 C CE  . MET C  1 58  ? -21.626  -5.990  26.705  1.00 102.18 ?  1532 MET C CE  1 
ATOM   4417 N N   . THR C  1 59  ? -16.979  -3.821  22.420  1.00 120.46 ?  1533 THR C N   1 
ATOM   4418 C CA  . THR C  1 59  ? -16.302  -4.449  21.287  1.00 120.51 ?  1533 THR C CA  1 
ATOM   4419 C C   . THR C  1 59  ? -14.918  -4.938  21.739  1.00 119.41 ?  1533 THR C C   1 
ATOM   4420 O O   . THR C  1 59  ? -14.594  -6.098  21.505  1.00 116.67 ?  1533 THR C O   1 
ATOM   4421 C CB  . THR C  1 59  ? -16.309  -3.497  20.081  1.00 122.01 ?  1533 THR C CB  1 
ATOM   4422 O OG1 . THR C  1 59  ? -17.666  -3.235  19.721  1.00 119.50 ?  1533 THR C OG1 1 
ATOM   4423 C CG2 . THR C  1 59  ? -15.571  -4.057  18.876  1.00 121.69 ?  1533 THR C CG2 1 
ATOM   4424 N N   . GLU C  1 60  ? -14.148  -4.082  22.457  1.00 121.19 ?  1534 GLU C N   1 
ATOM   4425 C CA  . GLU C  1 60  ? -12.829  -4.424  23.012  1.00 118.34 ?  1534 GLU C CA  1 
ATOM   4426 C C   . GLU C  1 60  ? -12.960  -5.543  24.063  1.00 110.57 ?  1534 GLU C C   1 
ATOM   4427 O O   . GLU C  1 60  ? -12.123  -6.447  24.090  1.00 100.47 ?  1534 GLU C O   1 
ATOM   4428 C CB  . GLU C  1 60  ? -12.147  -3.186  23.633  1.00 120.03 ?  1534 GLU C CB  1 
ATOM   4429 C CG  . GLU C  1 60  ? -11.515  -2.232  22.628  1.00 122.99 ?  1534 GLU C CG  1 
ATOM   4430 C CD  . GLU C  1 60  ? -10.131  -2.589  22.108  1.00 126.09 ?  1534 GLU C CD  1 
ATOM   4431 O OE1 . GLU C  1 60  ? -9.344   -3.207  22.863  1.00 136.13 ?  1534 GLU C OE1 1 
ATOM   4432 O OE2 . GLU C  1 60  ? -9.813   -2.199  20.960  1.00 123.69 -1 1534 GLU C OE2 1 
ATOM   4433 N N   . VAL C  1 61  ? -14.036  -5.490  24.892  1.00 113.32 ?  1535 VAL C N   1 
ATOM   4434 C CA  . VAL C  1 61  ? -14.356  -6.464  25.948  1.00 113.68 ?  1535 VAL C CA  1 
ATOM   4435 C C   . VAL C  1 61  ? -14.647  -7.854  25.344  1.00 120.68 ?  1535 VAL C C   1 
ATOM   4436 O O   . VAL C  1 61  ? -13.903  -8.798  25.612  1.00 117.62 ?  1535 VAL C O   1 
ATOM   4437 C CB  . VAL C  1 61  ? -15.508  -5.968  26.883  1.00 109.17 ?  1535 VAL C CB  1 
ATOM   4438 C CG1 . VAL C  1 61  ? -15.937  -7.046  27.878  1.00 106.24 ?  1535 VAL C CG1 1 
ATOM   4439 C CG2 . VAL C  1 61  ? -15.109  -4.700  27.625  1.00 108.43 ?  1535 VAL C CG2 1 
ATOM   4440 N N   . LEU C  1 62  ? -15.713  -7.955  24.520  1.00 123.63 ?  1536 LEU C N   1 
ATOM   4441 C CA  . LEU C  1 62  ? -16.174  -9.185  23.875  1.00 125.40 ?  1536 LEU C CA  1 
ATOM   4442 C C   . LEU C  1 62  ? -15.106  -9.905  23.059  1.00 123.55 ?  1536 LEU C C   1 
ATOM   4443 O O   . LEU C  1 62  ? -15.001  -11.131 23.160  1.00 121.10 ?  1536 LEU C O   1 
ATOM   4444 C CB  . LEU C  1 62  ? -17.426  -8.930  23.012  1.00 132.30 ?  1536 LEU C CB  1 
ATOM   4445 C CG  . LEU C  1 62  ? -18.736  -8.605  23.743  1.00 140.96 ?  1536 LEU C CG  1 
ATOM   4446 C CD1 . LEU C  1 62  ? -19.797  -8.166  22.769  1.00 144.59 ?  1536 LEU C CD1 1 
ATOM   4447 C CD2 . LEU C  1 62  ? -19.248  -9.791  24.539  1.00 140.64 ?  1536 LEU C CD2 1 
ATOM   4448 N N   . TYR C  1 63  ? -14.315  -9.147  22.264  1.00 117.60 ?  1537 TYR C N   1 
ATOM   4449 C CA  . TYR C  1 63  ? -13.252  -9.677  21.397  1.00 115.80 ?  1537 TYR C CA  1 
ATOM   4450 C C   . TYR C  1 63  ? -12.170  -10.430 22.175  1.00 121.21 ?  1537 TYR C C   1 
ATOM   4451 O O   . TYR C  1 63  ? -11.721  -11.480 21.708  1.00 129.17 ?  1537 TYR C O   1 
ATOM   4452 C CB  . TYR C  1 63  ? -12.624  -8.566  20.534  1.00 109.71 ?  1537 TYR C CB  1 
ATOM   4453 C CG  . TYR C  1 63  ? -13.426  -8.091  19.333  1.00 106.08 ?  1537 TYR C CG  1 
ATOM   4454 C CD1 . TYR C  1 63  ? -14.814  -8.224  19.292  1.00 113.15 ?  1537 TYR C CD1 1 
ATOM   4455 C CD2 . TYR C  1 63  ? -12.808  -7.424  18.281  1.00 106.61 ?  1537 TYR C CD2 1 
ATOM   4456 C CE1 . TYR C  1 63  ? -15.558  -7.730  18.220  1.00 119.00 ?  1537 TYR C CE1 1 
ATOM   4457 C CE2 . TYR C  1 63  ? -13.539  -6.941  17.197  1.00 107.65 ?  1537 TYR C CE2 1 
ATOM   4458 C CZ  . TYR C  1 63  ? -14.913  -7.102  17.166  1.00 115.94 ?  1537 TYR C CZ  1 
ATOM   4459 O OH  . TYR C  1 63  ? -15.627  -6.605  16.100  1.00 120.95 ?  1537 TYR C OH  1 
ATOM   4460 N N   . TRP C  1 64  ? -11.772  -9.910  23.364  1.00 114.46 ?  1538 TRP C N   1 
ATOM   4461 C CA  . TRP C  1 64  ? -10.766  -10.545 24.225  1.00 105.24 ?  1538 TRP C CA  1 
ATOM   4462 C C   . TRP C  1 64  ? -11.254  -11.852 24.833  1.00 98.10  ?  1538 TRP C C   1 
ATOM   4463 O O   . TRP C  1 64  ? -10.483  -12.816 24.874  1.00 88.99  ?  1538 TRP C O   1 
ATOM   4464 C CB  . TRP C  1 64  ? -10.234  -9.601  25.319  1.00 101.21 ?  1538 TRP C CB  1 
ATOM   4465 C CG  . TRP C  1 64  ? -9.187   -8.633  24.851  1.00 102.35 ?  1538 TRP C CG  1 
ATOM   4466 C CD1 . TRP C  1 64  ? -9.183   -7.283  25.044  1.00 105.11 ?  1538 TRP C CD1 1 
ATOM   4467 C CD2 . TRP C  1 64  ? -7.995   -8.936  24.106  1.00 109.97 ?  1538 TRP C CD2 1 
ATOM   4468 N NE1 . TRP C  1 64  ? -8.070   -6.721  24.459  1.00 105.61 ?  1538 TRP C NE1 1 
ATOM   4469 C CE2 . TRP C  1 64  ? -7.320   -7.712  23.880  1.00 109.04 ?  1538 TRP C CE2 1 
ATOM   4470 C CE3 . TRP C  1 64  ? -7.434   -10.123 23.595  1.00 116.74 ?  1538 TRP C CE3 1 
ATOM   4471 C CZ2 . TRP C  1 64  ? -6.118   -7.640  23.166  1.00 110.30 ?  1538 TRP C CZ2 1 
ATOM   4472 C CZ3 . TRP C  1 64  ? -6.245   -10.049 22.887  1.00 113.50 ?  1538 TRP C CZ3 1 
ATOM   4473 C CH2 . TRP C  1 64  ? -5.590   -8.822  22.696  1.00 112.50 ?  1538 TRP C CH2 1 
ATOM   4474 N N   . ILE C  1 65  ? -12.537  -11.895 25.283  1.00 90.05  ?  1539 ILE C N   1 
ATOM   4475 C CA  . ILE C  1 65  ? -13.141  -13.107 25.858  1.00 83.12  ?  1539 ILE C CA  1 
ATOM   4476 C C   . ILE C  1 65  ? -13.207  -14.204 24.784  1.00 80.17  ?  1539 ILE C C   1 
ATOM   4477 O O   . ILE C  1 65  ? -13.131  -15.384 25.112  1.00 74.46  ?  1539 ILE C O   1 
ATOM   4478 C CB  . ILE C  1 65  ? -14.499  -12.878 26.586  1.00 81.65  ?  1539 ILE C CB  1 
ATOM   4479 C CG1 . ILE C  1 65  ? -14.543  -11.506 27.311  1.00 84.72  ?  1539 ILE C CG1 1 
ATOM   4480 C CG2 . ILE C  1 65  ? -14.790  -14.036 27.565  1.00 76.25  ?  1539 ILE C CG2 1 
ATOM   4481 C CD1 . ILE C  1 65  ? -15.918  -10.812 27.311  1.00 88.50  ?  1539 ILE C CD1 1 
ATOM   4482 N N   . ASN C  1 66  ? -13.268  -13.807 23.500  1.00 81.66  ?  1540 ASN C N   1 
ATOM   4483 C CA  . ASN C  1 66  ? -13.233  -14.758 22.396  1.00 85.84  ?  1540 ASN C CA  1 
ATOM   4484 C C   . ASN C  1 66  ? -11.823  -15.307 22.221  1.00 86.23  ?  1540 ASN C C   1 
ATOM   4485 O O   . ASN C  1 66  ? -11.691  -16.505 22.010  1.00 83.00  ?  1540 ASN C O   1 
ATOM   4486 C CB  . ASN C  1 66  ? -13.785  -14.156 21.108  1.00 85.02  ?  1540 ASN C CB  1 
ATOM   4487 C CG  . ASN C  1 66  ? -15.251  -14.494 20.886  1.00 79.89  ?  1540 ASN C CG  1 
ATOM   4488 O OD1 . ASN C  1 66  ? -15.602  -15.577 20.372  1.00 63.76  ?  1540 ASN C OD1 1 
ATOM   4489 N ND2 . ASN C  1 66  ? -16.142  -13.578 21.286  1.00 78.29  ?  1540 ASN C ND2 1 
ATOM   4490 N N   . VAL C  1 67  ? -10.773  -14.451 22.386  1.00 94.19  ?  1541 VAL C N   1 
ATOM   4491 C CA  . VAL C  1 67  ? -9.346   -14.847 22.330  1.00 96.36  ?  1541 VAL C CA  1 
ATOM   4492 C C   . VAL C  1 67  ? -9.021   -15.794 23.530  1.00 91.20  ?  1541 VAL C C   1 
ATOM   4493 O O   . VAL C  1 67  ? -8.208   -16.710 23.381  1.00 95.31  ?  1541 VAL C O   1 
ATOM   4494 C CB  . VAL C  1 67  ? -8.355   -13.643 22.179  1.00 91.67  ?  1541 VAL C CB  1 
ATOM   4495 C CG1 . VAL C  1 67  ? -6.904   -14.111 22.028  1.00 90.91  ?  1541 VAL C CG1 1 
ATOM   4496 C CG2 . VAL C  1 67  ? -8.738   -12.759 20.994  1.00 89.57  ?  1541 VAL C CG2 1 
ATOM   4497 N N   . VAL C  1 68  ? -9.726   -15.614 24.678  1.00 80.52  ?  1542 VAL C N   1 
ATOM   4498 C CA  . VAL C  1 68  ? -9.647   -16.482 25.865  1.00 79.25  ?  1542 VAL C CA  1 
ATOM   4499 C C   . VAL C  1 68  ? -10.145  -17.895 25.440  1.00 81.70  ?  1542 VAL C C   1 
ATOM   4500 O O   . VAL C  1 68  ? -9.588   -18.911 25.864  1.00 76.27  ?  1542 VAL C O   1 
ATOM   4501 C CB  . VAL C  1 68  ? -10.494  -15.900 27.041  1.00 83.46  ?  1542 VAL C CB  1 
ATOM   4502 C CG1 . VAL C  1 68  ? -10.615  -16.884 28.211  1.00 82.29  ?  1542 VAL C CG1 1 
ATOM   4503 C CG2 . VAL C  1 68  ? -9.951   -14.556 27.514  1.00 82.55  ?  1542 VAL C CG2 1 
ATOM   4504 N N   . PHE C  1 69  ? -11.192  -17.935 24.583  1.00 92.31  ?  1543 PHE C N   1 
ATOM   4505 C CA  . PHE C  1 69  ? -11.755  -19.173 24.049  1.00 91.86  ?  1543 PHE C CA  1 
ATOM   4506 C C   . PHE C  1 69  ? -10.816  -19.777 23.011  1.00 89.48  ?  1543 PHE C C   1 
ATOM   4507 O O   . PHE C  1 69  ? -10.391  -20.911 23.203  1.00 78.33  ?  1543 PHE C O   1 
ATOM   4508 C CB  . PHE C  1 69  ? -13.158  -18.948 23.457  1.00 86.17  ?  1543 PHE C CB  1 
ATOM   4509 C CG  . PHE C  1 69  ? -14.252  -18.807 24.483  1.00 82.12  ?  1543 PHE C CG  1 
ATOM   4510 C CD1 . PHE C  1 69  ? -14.725  -19.915 25.178  1.00 86.39  ?  1543 PHE C CD1 1 
ATOM   4511 C CD2 . PHE C  1 69  ? -14.852  -17.579 24.714  1.00 79.64  ?  1543 PHE C CD2 1 
ATOM   4512 C CE1 . PHE C  1 69  ? -15.745  -19.783 26.125  1.00 86.33  ?  1543 PHE C CE1 1 
ATOM   4513 C CE2 . PHE C  1 69  ? -15.864  -17.444 25.667  1.00 84.70  ?  1543 PHE C CE2 1 
ATOM   4514 C CZ  . PHE C  1 69  ? -16.307  -18.548 26.363  1.00 85.45  ?  1543 PHE C CZ  1 
ATOM   4515 N N   . ILE C  1 70  ? -10.450  -19.008 21.949  1.00 93.57  ?  1544 ILE C N   1 
ATOM   4516 C CA  . ILE C  1 70  ? -9.551   -19.427 20.859  1.00 103.49 ?  1544 ILE C CA  1 
ATOM   4517 C C   . ILE C  1 70  ? -8.278   -20.085 21.409  1.00 108.60 ?  1544 ILE C C   1 
ATOM   4518 O O   . ILE C  1 70  ? -7.856   -21.108 20.865  1.00 116.28 ?  1544 ILE C O   1 
ATOM   4519 C CB  . ILE C  1 70  ? -9.251   -18.286 19.834  1.00 109.59 ?  1544 ILE C CB  1 
ATOM   4520 C CG1 . ILE C  1 70  ? -10.552  -17.743 19.218  1.00 122.21 ?  1544 ILE C CG1 1 
ATOM   4521 C CG2 . ILE C  1 70  ? -8.316   -18.760 18.710  1.00 106.82 ?  1544 ILE C CG2 1 
ATOM   4522 C CD1 . ILE C  1 70  ? -10.550  -16.267 18.889  1.00 124.44 ?  1544 ILE C CD1 1 
ATOM   4523 N N   . ILE C  1 71  ? -7.715   -19.554 22.520  1.00 111.29 ?  1545 ILE C N   1 
ATOM   4524 C CA  . ILE C  1 71  ? -6.523   -20.149 23.135  1.00 101.10 ?  1545 ILE C CA  1 
ATOM   4525 C C   . ILE C  1 71  ? -6.880   -21.479 23.840  1.00 101.38 ?  1545 ILE C C   1 
ATOM   4526 O O   . ILE C  1 71  ? -6.157   -22.453 23.651  1.00 106.75 ?  1545 ILE C O   1 
ATOM   4527 C CB  . ILE C  1 71  ? -5.685   -19.179 24.021  1.00 90.39  ?  1545 ILE C CB  1 
ATOM   4528 C CG1 . ILE C  1 71  ? -6.458   -18.649 25.242  1.00 91.59  ?  1545 ILE C CG1 1 
ATOM   4529 C CG2 . ILE C  1 71  ? -5.105   -18.033 23.191  1.00 83.24  ?  1545 ILE C CG2 1 
ATOM   4530 C CD1 . ILE C  1 71  ? -6.164   -19.375 26.557  1.00 93.52  ?  1545 ILE C CD1 1 
ATOM   4531 N N   . LEU C  1 72  ? -8.015   -21.533 24.576  1.00 101.75 ?  1546 LEU C N   1 
ATOM   4532 C CA  . LEU C  1 72  ? -8.485   -22.742 25.263  1.00 102.17 ?  1546 LEU C CA  1 
ATOM   4533 C C   . LEU C  1 72  ? -8.864   -23.860 24.284  1.00 102.21 ?  1546 LEU C C   1 
ATOM   4534 O O   . LEU C  1 72  ? -8.658   -25.038 24.588  1.00 91.71  ?  1546 LEU C O   1 
ATOM   4535 C CB  . LEU C  1 72  ? -9.683   -22.424 26.163  1.00 103.48 ?  1546 LEU C CB  1 
ATOM   4536 C CG  . LEU C  1 72  ? -9.369   -21.954 27.571  1.00 104.64 ?  1546 LEU C CG  1 
ATOM   4537 C CD1 . LEU C  1 72  ? -10.553  -21.228 28.161  1.00 110.33 ?  1546 LEU C CD1 1 
ATOM   4538 C CD2 . LEU C  1 72  ? -8.971   -23.117 28.472  1.00 107.23 ?  1546 LEU C CD2 1 
ATOM   4539 N N   . PHE C  1 73  ? -9.421   -23.485 23.116  1.00 104.80 ?  1547 PHE C N   1 
ATOM   4540 C CA  . PHE C  1 73  ? -9.829   -24.417 22.066  1.00 107.92 ?  1547 PHE C CA  1 
ATOM   4541 C C   . PHE C  1 73  ? -8.636   -24.939 21.270  1.00 96.83  ?  1547 PHE C C   1 
ATOM   4542 O O   . PHE C  1 73  ? -8.753   -25.963 20.593  1.00 89.44  ?  1547 PHE C O   1 
ATOM   4543 C CB  . PHE C  1 73  ? -10.922  -23.816 21.160  1.00 124.10 ?  1547 PHE C CB  1 
ATOM   4544 C CG  . PHE C  1 73  ? -12.270  -23.636 21.828  1.00 123.90 ?  1547 PHE C CG  1 
ATOM   4545 C CD1 . PHE C  1 73  ? -12.954  -24.725 22.360  1.00 118.85 ?  1547 PHE C CD1 1 
ATOM   4546 C CD2 . PHE C  1 73  ? -12.878  -22.386 21.883  1.00 118.39 ?  1547 PHE C CD2 1 
ATOM   4547 C CE1 . PHE C  1 73  ? -14.193  -24.557 22.976  1.00 111.10 ?  1547 PHE C CE1 1 
ATOM   4548 C CE2 . PHE C  1 73  ? -14.124  -22.223 22.493  1.00 114.49 ?  1547 PHE C CE2 1 
ATOM   4549 C CZ  . PHE C  1 73  ? -14.771  -23.308 23.035  1.00 112.46 ?  1547 PHE C CZ  1 
ATOM   4550 N N   . THR C  1 74  ? -7.482   -24.255 21.383  1.00 90.58  ?  1548 THR C N   1 
ATOM   4551 C CA  . THR C  1 74  ? -6.228   -24.673 20.758  1.00 87.11  ?  1548 THR C CA  1 
ATOM   4552 C C   . THR C  1 74  ? -5.481   -25.592 21.766  1.00 88.69  ?  1548 THR C C   1 
ATOM   4553 O O   . THR C  1 74  ? -4.760   -26.506 21.353  1.00 75.20  ?  1548 THR C O   1 
ATOM   4554 C CB  . THR C  1 74  ? -5.484   -23.463 20.193  1.00 85.19  ?  1548 THR C CB  1 
ATOM   4555 O OG1 . THR C  1 74  ? -6.384   -22.801 19.303  1.00 74.59  ?  1548 THR C OG1 1 
ATOM   4556 C CG2 . THR C  1 74  ? -4.231   -23.846 19.415  1.00 94.98  ?  1548 THR C CG2 1 
ATOM   4557 N N   . ILE C  1 75  ? -5.754   -25.404 23.081  1.00 96.33  ?  1549 ILE C N   1 
ATOM   4558 C CA  . ILE C  1 75  ? -5.267   -26.260 24.171  1.00 104.64 ?  1549 ILE C CA  1 
ATOM   4559 C C   . ILE C  1 75  ? -6.070   -27.577 24.072  1.00 105.99 ?  1549 ILE C C   1 
ATOM   4560 O O   . ILE C  1 75  ? -5.506   -28.656 24.266  1.00 103.36 ?  1549 ILE C O   1 
ATOM   4561 C CB  . ILE C  1 75  ? -5.416   -25.564 25.572  1.00 109.34 ?  1549 ILE C CB  1 
ATOM   4562 C CG1 . ILE C  1 75  ? -4.513   -24.297 25.717  1.00 110.94 ?  1549 ILE C CG1 1 
ATOM   4563 C CG2 . ILE C  1 75  ? -5.217   -26.527 26.764  1.00 109.77 ?  1549 ILE C CG2 1 
ATOM   4564 C CD1 . ILE C  1 75  ? -2.973   -24.427 25.407  1.00 112.16 ?  1549 ILE C CD1 1 
ATOM   4565 N N   . GLU C  1 76  ? -7.377   -27.467 23.723  1.00 107.29 ?  1550 GLU C N   1 
ATOM   4566 C CA  . GLU C  1 76  ? -8.325   -28.571 23.530  1.00 106.95 ?  1550 GLU C CA  1 
ATOM   4567 C C   . GLU C  1 76  ? -7.843   -29.547 22.442  1.00 99.31  ?  1550 GLU C C   1 
ATOM   4568 O O   . GLU C  1 76  ? -7.830   -30.761 22.686  1.00 86.55  ?  1550 GLU C O   1 
ATOM   4569 C CB  . GLU C  1 76  ? -9.741   -28.014 23.230  1.00 115.74 ?  1550 GLU C CB  1 
ATOM   4570 C CG  . GLU C  1 76  ? -10.753  -29.003 22.659  1.00 120.42 ?  1550 GLU C CG  1 
ATOM   4571 C CD  . GLU C  1 76  ? -10.880  -29.034 21.145  1.00 125.00 ?  1550 GLU C CD  1 
ATOM   4572 O OE1 . GLU C  1 76  ? -10.978  -30.149 20.581  1.00 129.07 ?  1550 GLU C OE1 1 
ATOM   4573 O OE2 . GLU C  1 76  ? -10.899  -27.947 20.520  1.00 123.15 -1 1550 GLU C OE2 1 
ATOM   4574 N N   . ILE C  1 77  ? -7.454   -29.021 21.252  1.00 97.37  ?  1551 ILE C N   1 
ATOM   4575 C CA  . ILE C  1 77  ? -6.972   -29.851 20.141  1.00 100.96 ?  1551 ILE C CA  1 
ATOM   4576 C C   . ILE C  1 77  ? -5.543   -30.317 20.353  1.00 101.50 ?  1551 ILE C C   1 
ATOM   4577 O O   . ILE C  1 77  ? -5.202   -31.387 19.855  1.00 104.18 ?  1551 ILE C O   1 
ATOM   4578 C CB  . ILE C  1 77  ? -7.156   -29.240 18.728  1.00 104.16 ?  1551 ILE C CB  1 
ATOM   4579 C CG1 . ILE C  1 77  ? -6.502   -27.847 18.608  1.00 102.82 ?  1551 ILE C CG1 1 
ATOM   4580 C CG2 . ILE C  1 77  ? -8.620   -29.239 18.296  1.00 106.89 ?  1551 ILE C CG2 1 
ATOM   4581 C CD1 . ILE C  1 77  ? -5.076   -27.855 18.013  1.00 102.87 ?  1551 ILE C CD1 1 
ATOM   4582 N N   . ILE C  1 78  ? -4.695   -29.514 21.046  1.00 99.03  ?  1552 ILE C N   1 
ATOM   4583 C CA  . ILE C  1 78  ? -3.302   -29.897 21.314  1.00 95.40  ?  1552 ILE C CA  1 
ATOM   4584 C C   . ILE C  1 78  ? -3.247   -31.108 22.282  1.00 91.48  ?  1552 ILE C C   1 
ATOM   4585 O O   . ILE C  1 78  ? -2.424   -32.005 22.081  1.00 91.15  ?  1552 ILE C O   1 
ATOM   4586 C CB  . ILE C  1 78  ? -2.402   -28.699 21.734  1.00 89.43  ?  1552 ILE C CB  1 
ATOM   4587 C CG1 . ILE C  1 78  ? -1.049   -28.754 21.013  1.00 81.48  ?  1552 ILE C CG1 1 
ATOM   4588 C CG2 . ILE C  1 78  ? -2.248   -28.521 23.255  1.00 87.18  ?  1552 ILE C CG2 1 
ATOM   4589 C CD1 . ILE C  1 78  ? -1.062   -28.114 19.633  1.00 78.76  ?  1552 ILE C CD1 1 
ATOM   4590 N N   . LEU C  1 79  ? -4.169   -31.153 23.274  1.00 87.37  ?  1553 LEU C N   1 
ATOM   4591 C CA  . LEU C  1 79  ? -4.330   -32.255 24.227  1.00 88.95  ?  1553 LEU C CA  1 
ATOM   4592 C C   . LEU C  1 79  ? -4.837   -33.502 23.486  1.00 88.18  ?  1553 LEU C C   1 
ATOM   4593 O O   . LEU C  1 79  ? -4.412   -34.622 23.794  1.00 81.57  ?  1553 LEU C O   1 
ATOM   4594 C CB  . LEU C  1 79  ? -5.367   -31.867 25.299  1.00 96.08  ?  1553 LEU C CB  1 
ATOM   4595 C CG  . LEU C  1 79  ? -4.865   -31.136 26.538  1.00 104.90 ?  1553 LEU C CG  1 
ATOM   4596 C CD1 . LEU C  1 79  ? -5.968   -30.269 27.131  1.00 115.04 ?  1553 LEU C CD1 1 
ATOM   4597 C CD2 . LEU C  1 79  ? -4.339   -32.119 27.593  1.00 101.93 ?  1553 LEU C CD2 1 
ATOM   4598 N N   . ARG C  1 80  ? -5.761   -33.288 22.517  1.00 92.49  ?  1554 ARG C N   1 
ATOM   4599 C CA  . ARG C  1 80  ? -6.396   -34.325 21.703  1.00 95.35  ?  1554 ARG C CA  1 
ATOM   4600 C C   . ARG C  1 80  ? -5.518   -34.830 20.554  1.00 95.04  ?  1554 ARG C C   1 
ATOM   4601 O O   . ARG C  1 80  ? -5.734   -35.947 20.085  1.00 93.60  ?  1554 ARG C O   1 
ATOM   4602 C CB  . ARG C  1 80  ? -7.764   -33.860 21.199  1.00 100.80 ?  1554 ARG C CB  1 
ATOM   4603 C CG  . ARG C  1 80  ? -8.858   -33.897 22.275  1.00 102.25 ?  1554 ARG C CG  1 
ATOM   4604 C CD  . ARG C  1 80  ? -10.159  -34.540 21.802  1.00 95.69  ?  1554 ARG C CD  1 
ATOM   4605 N NE  . ARG C  1 80  ? -10.734  -33.866 20.631  1.00 95.20  ?  1554 ARG C NE  1 
ATOM   4606 C CZ  . ARG C  1 80  ? -10.673  -34.333 19.384  1.00 94.62  ?  1554 ARG C CZ  1 
ATOM   4607 N NH1 . ARG C  1 80  ? -10.075  -35.494 19.131  1.00 91.84  1  1554 ARG C NH1 1 
ATOM   4608 N NH2 . ARG C  1 80  ? -11.211  -33.647 18.385  1.00 93.96  ?  1554 ARG C NH2 1 
ATOM   4609 N N   . ILE C  1 81  ? -4.531   -34.034 20.112  1.00 99.22  ?  1555 ILE C N   1 
ATOM   4610 C CA  . ILE C  1 81  ? -3.607   -34.474 19.072  1.00 99.70  ?  1555 ILE C CA  1 
ATOM   4611 C C   . ILE C  1 81  ? -2.438   -35.212 19.730  1.00 101.98 ?  1555 ILE C C   1 
ATOM   4612 O O   . ILE C  1 81  ? -1.843   -36.079 19.101  1.00 105.06 ?  1555 ILE C O   1 
ATOM   4613 C CB  . ILE C  1 81  ? -3.187   -33.369 18.057  1.00 98.02  ?  1555 ILE C CB  1 
ATOM   4614 C CG1 . ILE C  1 81  ? -2.704   -33.996 16.720  1.00 94.04  ?  1555 ILE C CG1 1 
ATOM   4615 C CG2 . ILE C  1 81  ? -2.167   -32.372 18.652  1.00 98.20  ?  1555 ILE C CG2 1 
ATOM   4616 C CD1 . ILE C  1 81  ? -3.067   -33.254 15.463  1.00 91.87  ?  1555 ILE C CD1 1 
ATOM   4617 N N   . TYR C  1 82  ? -2.144   -34.895 21.012  1.00 110.15 ?  1556 TYR C N   1 
ATOM   4618 C CA  . TYR C  1 82  ? -1.092   -35.539 21.818  1.00 131.40 ?  1556 TYR C CA  1 
ATOM   4619 C C   . TYR C  1 82  ? -1.419   -37.038 22.016  1.00 138.43 ?  1556 TYR C C   1 
ATOM   4620 O O   . TYR C  1 82  ? -0.532   -37.892 21.906  1.00 156.66 ?  1556 TYR C O   1 
ATOM   4621 C CB  . TYR C  1 82  ? -0.939   -34.804 23.176  1.00 137.80 ?  1556 TYR C CB  1 
ATOM   4622 C CG  . TYR C  1 82  ? 0.110    -35.357 24.122  1.00 140.76 ?  1556 TYR C CG  1 
ATOM   4623 C CD1 . TYR C  1 82  ? 1.468    -35.129 23.903  1.00 144.97 ?  1556 TYR C CD1 1 
ATOM   4624 C CD2 . TYR C  1 82  ? -0.257   -36.029 25.285  1.00 144.34 ?  1556 TYR C CD2 1 
ATOM   4625 C CE1 . TYR C  1 82  ? 2.437    -35.614 24.785  1.00 150.75 ?  1556 TYR C CE1 1 
ATOM   4626 C CE2 . TYR C  1 82  ? 0.702    -36.505 26.180  1.00 152.05 ?  1556 TYR C CE2 1 
ATOM   4627 C CZ  . TYR C  1 82  ? 2.047    -36.305 25.923  1.00 151.93 ?  1556 TYR C CZ  1 
ATOM   4628 O OH  . TYR C  1 82  ? 2.981    -36.787 26.811  1.00 155.06 ?  1556 TYR C OH  1 
ATOM   4629 N N   . VAL C  1 83  ? -2.710   -37.337 22.245  1.00 135.31 ?  1557 VAL C N   1 
ATOM   4630 C CA  . VAL C  1 83  ? -3.256   -38.675 22.461  1.00 137.24 ?  1557 VAL C CA  1 
ATOM   4631 C C   . VAL C  1 83  ? -3.290   -39.510 21.160  1.00 135.17 ?  1557 VAL C C   1 
ATOM   4632 O O   . VAL C  1 83  ? -2.844   -40.660 21.170  1.00 143.23 ?  1557 VAL C O   1 
ATOM   4633 C CB  . VAL C  1 83  ? -4.644   -38.577 23.167  1.00 139.64 ?  1557 VAL C CB  1 
ATOM   4634 C CG1 . VAL C  1 83  ? -5.454   -39.870 23.055  1.00 141.61 ?  1557 VAL C CG1 1 
ATOM   4635 C CG2 . VAL C  1 83  ? -4.486   -38.160 24.624  1.00 134.72 ?  1557 VAL C CG2 1 
ATOM   4636 N N   . HIS C  1 84  ? -3.810   -38.938 20.057  1.00 126.02 ?  1558 HIS C N   1 
ATOM   4637 C CA  . HIS C  1 84  ? -3.980   -39.660 18.793  1.00 124.26 ?  1558 HIS C CA  1 
ATOM   4638 C C   . HIS C  1 84  ? -2.787   -39.555 17.825  1.00 129.53 ?  1558 HIS C C   1 
ATOM   4639 O O   . HIS C  1 84  ? -2.732   -40.324 16.867  1.00 145.98 ?  1558 HIS C O   1 
ATOM   4640 C CB  . HIS C  1 84  ? -5.298   -39.247 18.112  1.00 123.57 ?  1558 HIS C CB  1 
ATOM   4641 C CG  . HIS C  1 84  ? -6.482   -39.303 19.036  1.00 129.88 ?  1558 HIS C CG  1 
ATOM   4642 N ND1 . HIS C  1 84  ? -7.266   -38.185 19.276  1.00 138.35 ?  1558 HIS C ND1 1 
ATOM   4643 C CD2 . HIS C  1 84  ? -6.938   -40.326 19.800  1.00 126.01 ?  1558 HIS C CD2 1 
ATOM   4644 C CE1 . HIS C  1 84  ? -8.184   -38.570 20.149  1.00 131.89 ?  1558 HIS C CE1 1 
ATOM   4645 N NE2 . HIS C  1 84  ? -8.024   -39.849 20.497  1.00 127.21 ?  1558 HIS C NE2 1 
ATOM   4646 N N   . ARG C  1 85  ? -1.812   -38.665 18.111  1.00 124.65 ?  1559 ARG C N   1 
ATOM   4647 C CA  . ARG C  1 85  ? -0.588   -38.421 17.327  1.00 117.17 ?  1559 ARG C CA  1 
ATOM   4648 C C   . ARG C  1 85  ? -0.883   -38.152 15.822  1.00 109.22 ?  1559 ARG C C   1 
ATOM   4649 O O   . ARG C  1 85  ? -1.011   -36.984 15.449  1.00 103.36 ?  1559 ARG C O   1 
ATOM   4650 C CB  . ARG C  1 85  ? 0.472    -39.532 17.545  1.00 115.77 ?  1559 ARG C CB  1 
ATOM   4651 C CG  . ARG C  1 85  ? 1.839    -39.286 16.876  1.00 117.05 ?  1559 ARG C CG  1 
ATOM   4652 C CD  . ARG C  1 85  ? 2.624    -38.122 17.467  1.00 115.68 ?  1559 ARG C CD  1 
ATOM   4653 N NE  . ARG C  1 85  ? 3.352    -37.387 16.427  1.00 117.27 ?  1559 ARG C NE  1 
ATOM   4654 C CZ  . ARG C  1 85  ? 2.913    -36.277 15.835  1.00 117.35 ?  1559 ARG C CZ  1 
ATOM   4655 N NH1 . ARG C  1 85  ? 1.744    -35.748 16.178  1.00 115.07 1  1559 ARG C NH1 1 
ATOM   4656 N NH2 . ARG C  1 85  ? 3.644    -35.686 14.897  1.00 118.80 ?  1559 ARG C NH2 1 
ATOM   4657 N N   . ILE C  1 86  ? -0.982   -39.204 14.974  1.00 107.48 ?  1560 ILE C N   1 
ATOM   4658 C CA  . ILE C  1 86  ? -1.262   -39.059 13.531  1.00 110.18 ?  1560 ILE C CA  1 
ATOM   4659 C C   . ILE C  1 86  ? -2.632   -39.728 13.194  1.00 111.16 ?  1560 ILE C C   1 
ATOM   4660 O O   . ILE C  1 86  ? -3.231   -39.426 12.154  1.00 98.90  ?  1560 ILE C O   1 
ATOM   4661 C CB  . ILE C  1 86  ? -0.049   -39.519 12.627  1.00 109.95 ?  1560 ILE C CB  1 
ATOM   4662 C CG1 . ILE C  1 86  ? 1.294    -38.795 13.000  1.00 113.83 ?  1560 ILE C CG1 1 
ATOM   4663 C CG2 . ILE C  1 86  ? -0.328   -39.417 11.106  1.00 99.52  ?  1560 ILE C CG2 1 
ATOM   4664 C CD1 . ILE C  1 86  ? 1.462    -37.245 12.597  1.00 114.17 ?  1560 ILE C CD1 1 
ATOM   4665 N N   . SER C  1 87  ? -3.161   -40.563 14.126  1.00 116.23 ?  1561 SER C N   1 
ATOM   4666 C CA  . SER C  1 87  ? -4.468   -41.228 14.009  1.00 114.50 ?  1561 SER C CA  1 
ATOM   4667 C C   . SER C  1 87  ? -5.631   -40.211 14.126  1.00 119.12 ?  1561 SER C C   1 
ATOM   4668 O O   . SER C  1 87  ? -6.780   -40.541 13.813  1.00 122.03 ?  1561 SER C O   1 
ATOM   4669 C CB  . SER C  1 87  ? -4.605   -42.337 15.051  1.00 111.02 ?  1561 SER C CB  1 
ATOM   4670 O OG  . SER C  1 87  ? -5.583   -43.291 14.670  1.00 107.53 ?  1561 SER C OG  1 
ATOM   4671 N N   . PHE C  1 88  ? -5.303   -38.968 14.558  1.00 117.92 ?  1562 PHE C N   1 
ATOM   4672 C CA  . PHE C  1 88  ? -6.192   -37.811 14.682  1.00 114.90 ?  1562 PHE C CA  1 
ATOM   4673 C C   . PHE C  1 88  ? -6.712   -37.413 13.290  1.00 118.30 ?  1562 PHE C C   1 
ATOM   4674 O O   . PHE C  1 88  ? -7.888   -37.074 13.159  1.00 126.64 ?  1562 PHE C O   1 
ATOM   4675 C CB  . PHE C  1 88  ? -5.415   -36.641 15.312  1.00 113.23 ?  1562 PHE C CB  1 
ATOM   4676 C CG  . PHE C  1 88  ? -6.236   -35.462 15.778  1.00 112.33 ?  1562 PHE C CG  1 
ATOM   4677 C CD1 . PHE C  1 88  ? -6.732   -35.409 17.075  1.00 106.88 ?  1562 PHE C CD1 1 
ATOM   4678 C CD2 . PHE C  1 88  ? -6.465   -34.378 14.938  1.00 122.27 ?  1562 PHE C CD2 1 
ATOM   4679 C CE1 . PHE C  1 88  ? -7.459   -34.301 17.517  1.00 108.19 ?  1562 PHE C CE1 1 
ATOM   4680 C CE2 . PHE C  1 88  ? -7.188   -33.269 15.383  1.00 122.39 ?  1562 PHE C CE2 1 
ATOM   4681 C CZ  . PHE C  1 88  ? -7.691   -33.243 16.665  1.00 113.98 ?  1562 PHE C CZ  1 
ATOM   4682 N N   . PHE C  1 89  ? -5.837   -37.476 12.257  1.00 124.98 ?  1563 PHE C N   1 
ATOM   4683 C CA  . PHE C  1 89  ? -6.169   -37.166 10.862  1.00 132.19 ?  1563 PHE C CA  1 
ATOM   4684 C C   . PHE C  1 89  ? -7.156   -38.184 10.266  1.00 143.42 ?  1563 PHE C C   1 
ATOM   4685 O O   . PHE C  1 89  ? -7.961   -37.809 9.408   1.00 170.79 ?  1563 PHE C O   1 
ATOM   4686 C CB  . PHE C  1 89  ? -4.890   -37.059 10.003  1.00 138.18 ?  1563 PHE C CB  1 
ATOM   4687 C CG  . PHE C  1 89  ? -5.092   -36.861 8.514   1.00 141.48 ?  1563 PHE C CG  1 
ATOM   4688 C CD1 . PHE C  1 89  ? -5.397   -35.607 7.996   1.00 141.59 ?  1563 PHE C CD1 1 
ATOM   4689 C CD2 . PHE C  1 89  ? -4.940   -37.922 7.627   1.00 139.52 ?  1563 PHE C CD2 1 
ATOM   4690 C CE1 . PHE C  1 89  ? -5.584   -35.426 6.620   1.00 141.39 ?  1563 PHE C CE1 1 
ATOM   4691 C CE2 . PHE C  1 89  ? -5.123   -37.740 6.251   1.00 134.88 ?  1563 PHE C CE2 1 
ATOM   4692 C CZ  . PHE C  1 89  ? -5.441   -36.493 5.756   1.00 136.22 ?  1563 PHE C CZ  1 
ATOM   4693 N N   . LYS C  1 90  ? -7.097   -39.459 10.720  1.00 141.74 ?  1564 LYS C N   1 
ATOM   4694 C CA  . LYS C  1 90  ? -7.970   -40.536 10.240  1.00 144.00 ?  1564 LYS C CA  1 
ATOM   4695 C C   . LYS C  1 90  ? -9.454   -40.246 10.513  1.00 146.14 ?  1564 LYS C C   1 
ATOM   4696 O O   . LYS C  1 90  ? -10.242  -40.224 9.564   1.00 148.54 ?  1564 LYS C O   1 
ATOM   4697 C CB  . LYS C  1 90  ? -7.550   -41.905 10.811  1.00 147.64 ?  1564 LYS C CB  1 
ATOM   4698 C CG  . LYS C  1 90  ? -7.952   -43.080 9.919   1.00 148.99 ?  1564 LYS C CG  1 
ATOM   4699 C CD  . LYS C  1 90  ? -8.453   -44.277 10.718  1.00 148.32 ?  1564 LYS C CD  1 
ATOM   4700 C CE  . LYS C  1 90  ? -9.066   -45.325 9.818   1.00 145.92 ?  1564 LYS C CE  1 
ATOM   4701 N NZ  . LYS C  1 90  ? -9.719   -46.415 10.593  1.00 139.77 1  1564 LYS C NZ  1 
ATOM   4702 N N   . ASP C  1 91  ? -9.820   -39.993 11.793  1.00 147.14 ?  1565 ASP C N   1 
ATOM   4703 C CA  . ASP C  1 91  ? -11.195  -39.689 12.200  1.00 144.62 ?  1565 ASP C CA  1 
ATOM   4704 C C   . ASP C  1 91  ? -11.591  -38.266 11.755  1.00 132.40 ?  1565 ASP C C   1 
ATOM   4705 O O   . ASP C  1 91  ? -10.997  -37.296 12.241  1.00 132.80 ?  1565 ASP C O   1 
ATOM   4706 C CB  . ASP C  1 91  ? -11.383  -39.890 13.721  1.00 150.45 ?  1565 ASP C CB  1 
ATOM   4707 C CG  . ASP C  1 91  ? -12.823  -39.843 14.216  1.00 154.70 ?  1565 ASP C CG  1 
ATOM   4708 O OD1 . ASP C  1 91  ? -13.700  -40.456 13.565  1.00 156.54 ?  1565 ASP C OD1 1 
ATOM   4709 O OD2 . ASP C  1 91  ? -13.062  -39.248 15.288  1.00 159.60 -1 1565 ASP C OD2 1 
ATOM   4710 N N   . PRO C  1 92  ? -12.574  -38.120 10.820  1.00 117.44 ?  1566 PRO C N   1 
ATOM   4711 C CA  . PRO C  1 92  ? -12.953  -36.773 10.352  1.00 111.22 ?  1566 PRO C CA  1 
ATOM   4712 C C   . PRO C  1 92  ? -13.527  -35.844 11.425  1.00 106.09 ?  1566 PRO C C   1 
ATOM   4713 O O   . PRO C  1 92  ? -13.519  -34.635 11.208  1.00 92.63  ?  1566 PRO C O   1 
ATOM   4714 C CB  . PRO C  1 92  ? -13.947  -37.044 9.218   1.00 114.59 ?  1566 PRO C CB  1 
ATOM   4715 C CG  . PRO C  1 92  ? -14.465  -38.397 9.473   1.00 120.95 ?  1566 PRO C CG  1 
ATOM   4716 C CD  . PRO C  1 92  ? -13.356  -39.164 10.125  1.00 116.43 ?  1566 PRO C CD  1 
ATOM   4717 N N   . TRP C  1 93  ? -14.001  -36.392 12.579  1.00 111.37 ?  1567 TRP C N   1 
ATOM   4718 C CA  . TRP C  1 93  ? -14.520  -35.595 13.700  1.00 115.36 ?  1567 TRP C CA  1 
ATOM   4719 C C   . TRP C  1 93  ? -13.361  -34.798 14.280  1.00 108.26 ?  1567 TRP C C   1 
ATOM   4720 O O   . TRP C  1 93  ? -13.416  -33.568 14.282  1.00 106.54 ?  1567 TRP C O   1 
ATOM   4721 C CB  . TRP C  1 93  ? -15.169  -36.473 14.793  1.00 121.95 ?  1567 TRP C CB  1 
ATOM   4722 C CG  . TRP C  1 93  ? -16.301  -37.340 14.327  1.00 125.23 ?  1567 TRP C CG  1 
ATOM   4723 C CD1 . TRP C  1 93  ? -16.362  -38.702 14.380  1.00 129.01 ?  1567 TRP C CD1 1 
ATOM   4724 C CD2 . TRP C  1 93  ? -17.530  -36.906 13.726  1.00 120.19 ?  1567 TRP C CD2 1 
ATOM   4725 N NE1 . TRP C  1 93  ? -17.571  -39.142 13.894  1.00 125.79 ?  1567 TRP C NE1 1 
ATOM   4726 C CE2 . TRP C  1 93  ? -18.296  -38.062 13.457  1.00 120.93 ?  1567 TRP C CE2 1 
ATOM   4727 C CE3 . TRP C  1 93  ? -18.058  -35.649 13.380  1.00 114.84 ?  1567 TRP C CE3 1 
ATOM   4728 C CZ2 . TRP C  1 93  ? -19.561  -37.998 12.858  1.00 118.66 ?  1567 TRP C CZ2 1 
ATOM   4729 C CZ3 . TRP C  1 93  ? -19.312  -35.587 12.793  1.00 113.64 ?  1567 TRP C CZ3 1 
ATOM   4730 C CH2 . TRP C  1 93  ? -20.048  -36.750 12.535  1.00 115.55 ?  1567 TRP C CH2 1 
ATOM   4731 N N   . SER C  1 94  ? -12.278  -35.503 14.691  1.00 105.17 ?  1568 SER C N   1 
ATOM   4732 C CA  . SER C  1 94  ? -11.040  -34.917 15.210  1.00 106.62 ?  1568 SER C CA  1 
ATOM   4733 C C   . SER C  1 94  ? -10.472  -33.951 14.163  1.00 101.27 ?  1568 SER C C   1 
ATOM   4734 O O   . SER C  1 94  ? -10.097  -32.825 14.500  1.00 104.97 ?  1568 SER C O   1 
ATOM   4735 C CB  . SER C  1 94  ? -10.017  -36.010 15.520  1.00 105.72 ?  1568 SER C CB  1 
ATOM   4736 O OG  . SER C  1 94  ? -10.352  -36.779 16.664  1.00 94.77  ?  1568 SER C OG  1 
ATOM   4737 N N   . LEU C  1 95  ? -10.497  -34.379 12.883  1.00 91.12  ?  1569 LEU C N   1 
ATOM   4738 C CA  . LEU C  1 95  ? -10.034  -33.631 11.720  1.00 91.75  ?  1569 LEU C CA  1 
ATOM   4739 C C   . LEU C  1 95  ? -10.811  -32.312 11.503  1.00 98.44  ?  1569 LEU C C   1 
ATOM   4740 O O   . LEU C  1 95  ? -10.187  -31.297 11.179  1.00 91.40  ?  1569 LEU C O   1 
ATOM   4741 C CB  . LEU C  1 95  ? -10.084  -34.548 10.488  1.00 90.58  ?  1569 LEU C CB  1 
ATOM   4742 C CG  . LEU C  1 95  ? -9.631   -34.006 9.135   1.00 92.10  ?  1569 LEU C CG  1 
ATOM   4743 C CD1 . LEU C  1 95  ? -8.171   -33.545 9.162   1.00 94.49  ?  1569 LEU C CD1 1 
ATOM   4744 C CD2 . LEU C  1 95  ? -9.840   -35.052 8.054   1.00 91.21  ?  1569 LEU C CD2 1 
ATOM   4745 N N   . PHE C  1 96  ? -12.148  -32.321 11.723  1.00 106.52 ?  1570 PHE C N   1 
ATOM   4746 C CA  . PHE C  1 96  ? -13.027  -31.148 11.598  1.00 104.92 ?  1570 PHE C CA  1 
ATOM   4747 C C   . PHE C  1 96  ? -12.684  -30.109 12.663  1.00 106.75 ?  1570 PHE C C   1 
ATOM   4748 O O   . PHE C  1 96  ? -12.526  -28.932 12.333  1.00 106.97 ?  1570 PHE C O   1 
ATOM   4749 C CB  . PHE C  1 96  ? -14.508  -31.561 11.703  1.00 100.82 ?  1570 PHE C CB  1 
ATOM   4750 C CG  . PHE C  1 96  ? -15.513  -30.432 11.804  1.00 98.91  ?  1570 PHE C CG  1 
ATOM   4751 C CD1 . PHE C  1 96  ? -15.944  -29.756 10.666  1.00 99.63  ?  1570 PHE C CD1 1 
ATOM   4752 C CD2 . PHE C  1 96  ? -16.061  -30.074 13.033  1.00 96.99  ?  1570 PHE C CD2 1 
ATOM   4753 C CE1 . PHE C  1 96  ? -16.892  -28.730 10.758  1.00 99.63  ?  1570 PHE C CE1 1 
ATOM   4754 C CE2 . PHE C  1 96  ? -17.012  -29.051 13.124  1.00 98.36  ?  1570 PHE C CE2 1 
ATOM   4755 C CZ  . PHE C  1 96  ? -17.419  -28.383 11.987  1.00 99.41  ?  1570 PHE C CZ  1 
ATOM   4756 N N   . ASP C  1 97  ? -12.568  -30.558 13.935  1.00 106.14 ?  1571 ASP C N   1 
ATOM   4757 C CA  . ASP C  1 97  ? -12.218  -29.746 15.101  1.00 111.33 ?  1571 ASP C CA  1 
ATOM   4758 C C   . ASP C  1 97  ? -10.901  -29.007 14.884  1.00 122.06 ?  1571 ASP C C   1 
ATOM   4759 O O   . ASP C  1 97  ? -10.749  -27.883 15.362  1.00 135.34 ?  1571 ASP C O   1 
ATOM   4760 C CB  . ASP C  1 97  ? -12.140  -30.619 16.363  1.00 112.33 ?  1571 ASP C CB  1 
ATOM   4761 C CG  . ASP C  1 97  ? -13.491  -31.006 16.935  1.00 111.05 ?  1571 ASP C CG  1 
ATOM   4762 O OD1 . ASP C  1 97  ? -14.350  -31.485 16.161  1.00 117.25 ?  1571 ASP C OD1 1 
ATOM   4763 O OD2 . ASP C  1 97  ? -13.683  -30.851 18.164  1.00 112.99 -1 1571 ASP C OD2 1 
ATOM   4764 N N   . PHE C  1 98  ? -9.968   -29.635 14.136  1.00 121.56 ?  1572 PHE C N   1 
ATOM   4765 C CA  . PHE C  1 98  ? -8.673   -29.065 13.772  1.00 124.74 ?  1572 PHE C CA  1 
ATOM   4766 C C   . PHE C  1 98  ? -8.847   -27.948 12.710  1.00 123.26 ?  1572 PHE C C   1 
ATOM   4767 O O   . PHE C  1 98  ? -8.246   -26.876 12.856  1.00 128.32 ?  1572 PHE C O   1 
ATOM   4768 C CB  . PHE C  1 98  ? -7.700   -30.171 13.298  1.00 121.59 ?  1572 PHE C CB  1 
ATOM   4769 C CG  . PHE C  1 98  ? -6.443   -29.652 12.640  1.00 114.17 ?  1572 PHE C CG  1 
ATOM   4770 C CD1 . PHE C  1 98  ? -5.383   -29.178 13.405  1.00 111.14 ?  1572 PHE C CD1 1 
ATOM   4771 C CD2 . PHE C  1 98  ? -6.337   -29.597 11.253  1.00 108.78 ?  1572 PHE C CD2 1 
ATOM   4772 C CE1 . PHE C  1 98  ? -4.238   -28.657 12.794  1.00 107.52 ?  1572 PHE C CE1 1 
ATOM   4773 C CE2 . PHE C  1 98  ? -5.195   -29.072 10.643  1.00 110.98 ?  1572 PHE C CE2 1 
ATOM   4774 C CZ  . PHE C  1 98  ? -4.148   -28.616 11.417  1.00 111.38 ?  1572 PHE C CZ  1 
ATOM   4775 N N   . VAL C  1 99  ? -9.665   -28.203 11.653  1.00 106.13 ?  1573 VAL C N   1 
ATOM   4776 C CA  . VAL C  1 99  ? -9.951   -27.236 10.574  1.00 98.50  ?  1573 VAL C CA  1 
ATOM   4777 C C   . VAL C  1 99  ? -10.669  -25.995 11.150  1.00 101.58 ?  1573 VAL C C   1 
ATOM   4778 O O   . VAL C  1 99  ? -10.405  -24.871 10.721  1.00 91.45  ?  1573 VAL C O   1 
ATOM   4779 C CB  . VAL C  1 99  ? -10.700  -27.866 9.359   1.00 94.27  ?  1573 VAL C CB  1 
ATOM   4780 C CG1 . VAL C  1 99  ? -10.870  -26.859 8.220   1.00 90.31  ?  1573 VAL C CG1 1 
ATOM   4781 C CG2 . VAL C  1 99  ? -9.980   -29.111 8.851   1.00 94.27  ?  1573 VAL C CG2 1 
ATOM   4782 N N   . VAL C  1 100 ? -11.546  -26.214 12.148  1.00 110.50 ?  1574 VAL C N   1 
ATOM   4783 C CA  . VAL C  1 100 ? -12.272  -25.169 12.868  1.00 117.17 ?  1574 VAL C CA  1 
ATOM   4784 C C   . VAL C  1 100 ? -11.257  -24.302 13.629  1.00 116.08 ?  1574 VAL C C   1 
ATOM   4785 O O   . VAL C  1 100 ? -11.287  -23.078 13.482  1.00 116.80 ?  1574 VAL C O   1 
ATOM   4786 C CB  . VAL C  1 100 ? -13.370  -25.789 13.788  1.00 128.02 ?  1574 VAL C CB  1 
ATOM   4787 C CG1 . VAL C  1 100 ? -13.638  -24.948 15.038  1.00 135.79 ?  1574 VAL C CG1 1 
ATOM   4788 C CG2 . VAL C  1 100 ? -14.658  -26.036 13.012  1.00 122.77 ?  1574 VAL C CG2 1 
ATOM   4789 N N   . VAL C  1 101 ? -10.334  -24.951 14.388  1.00 112.35 ?  1575 VAL C N   1 
ATOM   4790 C CA  . VAL C  1 101 ? -9.299   -24.310 15.208  1.00 104.94 ?  1575 VAL C CA  1 
ATOM   4791 C C   . VAL C  1 101 ? -8.323   -23.498 14.341  1.00 96.23  ?  1575 VAL C C   1 
ATOM   4792 O O   . VAL C  1 101 ? -8.023   -22.355 14.705  1.00 92.91  ?  1575 VAL C O   1 
ATOM   4793 C CB  . VAL C  1 101 ? -8.595   -25.310 16.174  1.00 101.19 ?  1575 VAL C CB  1 
ATOM   4794 C CG1 . VAL C  1 101 ? -7.271   -24.761 16.709  1.00 98.82  ?  1575 VAL C CG1 1 
ATOM   4795 C CG2 . VAL C  1 101 ? -9.519   -25.672 17.335  1.00 106.97 ?  1575 VAL C CG2 1 
ATOM   4796 N N   . ILE C  1 102 ? -7.880   -24.045 13.186  1.00 88.11  ?  1576 ILE C N   1 
ATOM   4797 C CA  . ILE C  1 102 ? -6.967   -23.314 12.293  1.00 95.63  ?  1576 ILE C CA  1 
ATOM   4798 C C   . ILE C  1 102 ? -7.662   -22.064 11.687  1.00 92.83  ?  1576 ILE C C   1 
ATOM   4799 O O   . ILE C  1 102 ? -7.040   -21.005 11.625  1.00 78.30  ?  1576 ILE C O   1 
ATOM   4800 C CB  . ILE C  1 102 ? -6.249   -24.199 11.225  1.00 102.05 ?  1576 ILE C CB  1 
ATOM   4801 C CG1 . ILE C  1 102 ? -7.215   -24.899 10.247  1.00 114.13 ?  1576 ILE C CG1 1 
ATOM   4802 C CG2 . ILE C  1 102 ? -5.315   -25.210 11.885  1.00 98.25  ?  1576 ILE C CG2 1 
ATOM   4803 C CD1 . ILE C  1 102 ? -7.337   -24.243 8.878   1.00 117.77 ?  1576 ILE C CD1 1 
ATOM   4804 N N   . ILE C  1 103 ? -8.966   -22.186 11.326  1.00 102.31 ?  1577 ILE C N   1 
ATOM   4805 C CA  . ILE C  1 103 ? -9.803   -21.123 10.750  1.00 103.61 ?  1577 ILE C CA  1 
ATOM   4806 C C   . ILE C  1 103 ? -10.062  -19.990 11.762  1.00 101.18 ?  1577 ILE C C   1 
ATOM   4807 O O   . ILE C  1 103 ? -10.021  -18.815 11.383  1.00 88.46  ?  1577 ILE C O   1 
ATOM   4808 C CB  . ILE C  1 103 ? -11.099  -21.724 10.118  1.00 98.87  ?  1577 ILE C CB  1 
ATOM   4809 C CG1 . ILE C  1 103 ? -10.865  -22.137 8.638   1.00 97.06  ?  1577 ILE C CG1 1 
ATOM   4810 C CG2 . ILE C  1 103 ? -12.357  -20.857 10.277  1.00 98.71  ?  1577 ILE C CG2 1 
ATOM   4811 C CD1 . ILE C  1 103 ? -10.325  -21.024 7.630   1.00 97.32  ?  1577 ILE C CD1 1 
ATOM   4812 N N   . SER C  1 104 ? -10.304  -20.341 13.038  1.00 105.88 ?  1578 SER C N   1 
ATOM   4813 C CA  . SER C  1 104 ? -10.525  -19.374 14.115  1.00 111.53 ?  1578 SER C CA  1 
ATOM   4814 C C   . SER C  1 104 ? -9.278   -18.509 14.255  1.00 108.34 ?  1578 SER C C   1 
ATOM   4815 O O   . SER C  1 104 ? -9.383   -17.283 14.241  1.00 104.04 ?  1578 SER C O   1 
ATOM   4816 C CB  . SER C  1 104 ? -10.806  -20.093 15.430  1.00 119.18 ?  1578 SER C CB  1 
ATOM   4817 O OG  . SER C  1 104 ? -11.814  -21.075 15.262  1.00 119.81 ?  1578 SER C OG  1 
ATOM   4818 N N   . ILE C  1 105 ? -8.096   -19.161 14.301  1.00 100.65 ?  1579 ILE C N   1 
ATOM   4819 C CA  . ILE C  1 105 ? -6.790   -18.521 14.428  1.00 95.76  ?  1579 ILE C CA  1 
ATOM   4820 C C   . ILE C  1 105 ? -6.438   -17.699 13.177  1.00 86.12  ?  1579 ILE C C   1 
ATOM   4821 O O   . ILE C  1 105 ? -6.240   -16.484 13.307  1.00 78.24  ?  1579 ILE C O   1 
ATOM   4822 C CB  . ILE C  1 105 ? -5.695   -19.549 14.821  1.00 94.02  ?  1579 ILE C CB  1 
ATOM   4823 C CG1 . ILE C  1 105 ? -5.988   -20.155 16.215  1.00 93.33  ?  1579 ILE C CG1 1 
ATOM   4824 C CG2 . ILE C  1 105 ? -4.294   -18.917 14.771  1.00 92.32  ?  1579 ILE C CG2 1 
ATOM   4825 C CD1 . ILE C  1 105 ? -5.354   -21.522 16.484  1.00 87.22  ?  1579 ILE C CD1 1 
ATOM   4826 N N   . VAL C  1 106 ? -6.397   -18.342 11.975  1.00 77.20  ?  1580 VAL C N   1 
ATOM   4827 C CA  . VAL C  1 106 ? -6.062   -17.664 10.704  1.00 78.99  ?  1580 VAL C CA  1 
ATOM   4828 C C   . VAL C  1 106 ? -6.970   -16.431 10.464  1.00 84.03  ?  1580 VAL C C   1 
ATOM   4829 O O   . VAL C  1 106 ? -6.485   -15.392 9.999   1.00 71.66  ?  1580 VAL C O   1 
ATOM   4830 C CB  . VAL C  1 106 ? -5.971   -18.585 9.433   1.00 77.03  ?  1580 VAL C CB  1 
ATOM   4831 C CG1 . VAL C  1 106 ? -4.943   -19.702 9.604   1.00 77.39  ?  1580 VAL C CG1 1 
ATOM   4832 C CG2 . VAL C  1 106 ? -7.322   -19.148 8.999   1.00 80.13  ?  1580 VAL C CG2 1 
ATOM   4833 N N   . GLY C  1 107 ? -8.245   -16.570 10.855  1.00 96.89  ?  1581 GLY C N   1 
ATOM   4834 C CA  . GLY C  1 107 ? -9.299   -15.575 10.719  1.00 96.79  ?  1581 GLY C CA  1 
ATOM   4835 C C   . GLY C  1 107 ? -9.296   -14.463 11.745  1.00 101.02 ?  1581 GLY C C   1 
ATOM   4836 O O   . GLY C  1 107 ? -9.581   -13.319 11.380  1.00 99.51  ?  1581 GLY C O   1 
ATOM   4837 N N   . MET C  1 108 ? -8.997   -14.770 13.037  1.00 99.88  ?  1582 MET C N   1 
ATOM   4838 C CA  . MET C  1 108 ? -8.990   -13.719 14.066  1.00 103.81 ?  1582 MET C CA  1 
ATOM   4839 C C   . MET C  1 108 ? -7.849   -12.734 13.839  1.00 105.33 ?  1582 MET C C   1 
ATOM   4840 O O   . MET C  1 108 ? -8.027   -11.537 14.077  1.00 99.51  ?  1582 MET C O   1 
ATOM   4841 C CB  . MET C  1 108 ? -9.038   -14.259 15.510  1.00 109.82 ?  1582 MET C CB  1 
ATOM   4842 C CG  . MET C  1 108 ? -7.742   -14.835 16.037  1.00 117.56 ?  1582 MET C CG  1 
ATOM   4843 S SD  . MET C  1 108 ? -7.602   -14.490 17.809  1.00 128.57 ?  1582 MET C SD  1 
ATOM   4844 C CE  . MET C  1 108 ? -6.267   -15.551 18.235  1.00 138.26 ?  1582 MET C CE  1 
ATOM   4845 N N   . PHE C  1 109 ? -6.714   -13.230 13.313  1.00 107.50 ?  1583 PHE C N   1 
ATOM   4846 C CA  . PHE C  1 109 ? -5.563   -12.401 12.978  1.00 105.89 ?  1583 PHE C CA  1 
ATOM   4847 C C   . PHE C  1 109 ? -5.825   -11.633 11.680  1.00 103.23 ?  1583 PHE C C   1 
ATOM   4848 O O   . PHE C  1 109 ? -5.437   -10.466 11.575  1.00 99.75  ?  1583 PHE C O   1 
ATOM   4849 C CB  . PHE C  1 109 ? -4.267   -13.231 12.929  1.00 103.13 ?  1583 PHE C CB  1 
ATOM   4850 C CG  . PHE C  1 109 ? -3.817   -13.748 14.282  1.00 104.68 ?  1583 PHE C CG  1 
ATOM   4851 C CD1 . PHE C  1 109 ? -3.551   -12.869 15.332  1.00 102.12 ?  1583 PHE C CD1 1 
ATOM   4852 C CD2 . PHE C  1 109 ? -3.625   -15.109 14.498  1.00 106.02 ?  1583 PHE C CD2 1 
ATOM   4853 C CE1 . PHE C  1 109 ? -3.138   -13.349 16.586  1.00 99.61  ?  1583 PHE C CE1 1 
ATOM   4854 C CE2 . PHE C  1 109 ? -3.206   -15.587 15.750  1.00 102.65 ?  1583 PHE C CE2 1 
ATOM   4855 C CZ  . PHE C  1 109 ? -2.962   -14.704 16.785  1.00 97.75  ?  1583 PHE C CZ  1 
ATOM   4856 N N   . LEU C  1 110 ? -6.540   -12.264 10.723  1.00 100.02 ?  1584 LEU C N   1 
ATOM   4857 C CA  . LEU C  1 110 ? -6.936   -11.653 9.449   1.00 107.69 ?  1584 LEU C CA  1 
ATOM   4858 C C   . LEU C  1 110 ? -7.897   -10.483 9.702   1.00 118.94 ?  1584 LEU C C   1 
ATOM   4859 O O   . LEU C  1 110 ? -7.750   -9.425  9.091   1.00 121.68 ?  1584 LEU C O   1 
ATOM   4860 C CB  . LEU C  1 110 ? -7.622   -12.694 8.557   1.00 103.84 ?  1584 LEU C CB  1 
ATOM   4861 C CG  . LEU C  1 110 ? -7.099   -12.789 7.142   1.00 101.81 ?  1584 LEU C CG  1 
ATOM   4862 C CD1 . LEU C  1 110 ? -6.600   -14.185 6.852   1.00 96.37  ?  1584 LEU C CD1 1 
ATOM   4863 C CD2 . LEU C  1 110 ? -8.160   -12.384 6.142   1.00 102.20 ?  1584 LEU C CD2 1 
ATOM   4864 N N   . ALA C  1 111 ? -8.860   -10.682 10.630  1.00 122.78 ?  1585 ALA C N   1 
ATOM   4865 C CA  . ALA C  1 111 ? -9.869   -9.699  11.025  1.00 123.38 ?  1585 ALA C CA  1 
ATOM   4866 C C   . ALA C  1 111 ? -9.248   -8.506  11.747  1.00 118.35 ?  1585 ALA C C   1 
ATOM   4867 O O   . ALA C  1 111 ? -9.645   -7.372  11.478  1.00 119.17 ?  1585 ALA C O   1 
ATOM   4868 C CB  . ALA C  1 111 ? -10.930  -10.352 11.897  1.00 130.47 ?  1585 ALA C CB  1 
ATOM   4869 N N   . ASP C  1 112 ? -8.287   -8.758  12.665  1.00 113.38 ?  1586 ASP C N   1 
ATOM   4870 C CA  . ASP C  1 112 ? -7.573   -7.714  13.405  1.00 111.97 ?  1586 ASP C CA  1 
ATOM   4871 C C   . ASP C  1 112 ? -6.799   -6.852  12.409  1.00 109.97 ?  1586 ASP C C   1 
ATOM   4872 O O   . ASP C  1 112 ? -6.858   -5.623  12.490  1.00 102.88 ?  1586 ASP C O   1 
ATOM   4873 C CB  . ASP C  1 112 ? -6.601   -8.348  14.417  1.00 107.99 ?  1586 ASP C CB  1 
ATOM   4874 C CG  . ASP C  1 112 ? -5.958   -7.404  15.432  1.00 101.74 ?  1586 ASP C CG  1 
ATOM   4875 O OD1 . ASP C  1 112 ? -5.661   -6.231  15.068  1.00 94.83  -1 1586 ASP C OD1 1 
ATOM   4876 O OD2 . ASP C  1 112 ? -5.673   -7.859  16.566  1.00 91.96  ?  1586 ASP C OD2 1 
ATOM   4877 N N   . LEU C  1 113 ? -6.106   -7.512  11.453  1.00 107.12 ?  1587 LEU C N   1 
ATOM   4878 C CA  . LEU C  1 113 ? -5.310   -6.898  10.393  1.00 103.40 ?  1587 LEU C CA  1 
ATOM   4879 C C   . LEU C  1 113 ? -6.148   -5.953  9.516   1.00 105.94 ?  1587 LEU C C   1 
ATOM   4880 O O   . LEU C  1 113 ? -5.755   -4.800  9.332   1.00 108.31 ?  1587 LEU C O   1 
ATOM   4881 C CB  . LEU C  1 113 ? -4.667   -7.999  9.531   1.00 97.69  ?  1587 LEU C CB  1 
ATOM   4882 C CG  . LEU C  1 113 ? -3.408   -7.630  8.754   1.00 94.88  ?  1587 LEU C CG  1 
ATOM   4883 C CD1 . LEU C  1 113 ? -2.432   -8.788  8.749   1.00 97.10  ?  1587 LEU C CD1 1 
ATOM   4884 C CD2 . LEU C  1 113 ? -3.736   -7.193  7.318   1.00 89.90  ?  1587 LEU C CD2 1 
ATOM   4885 N N   . ILE C  1 114 ? -7.292   -6.443  8.981   1.00 100.51 ?  1588 ILE C N   1 
ATOM   4886 C CA  . ILE C  1 114 ? -8.188   -5.679  8.101   1.00 94.85  ?  1588 ILE C CA  1 
ATOM   4887 C C   . ILE C  1 114 ? -8.718   -4.405  8.803   1.00 95.72  ?  1588 ILE C C   1 
ATOM   4888 O O   . ILE C  1 114 ? -8.604   -3.311  8.236   1.00 92.07  ?  1588 ILE C O   1 
ATOM   4889 C CB  . ILE C  1 114 ? -9.323   -6.582  7.496   1.00 94.30  ?  1588 ILE C CB  1 
ATOM   4890 C CG1 . ILE C  1 114 ? -8.732   -7.664  6.543   1.00 92.92  ?  1588 ILE C CG1 1 
ATOM   4891 C CG2 . ILE C  1 114 ? -10.412  -5.745  6.766   1.00 98.55  ?  1588 ILE C CG2 1 
ATOM   4892 C CD1 . ILE C  1 114 ? -9.593   -8.924  6.324   1.00 89.89  ?  1588 ILE C CD1 1 
ATOM   4893 N N   . GLU C  1 115 ? -9.252   -4.550  10.040  1.00 103.46 ?  1589 GLU C N   1 
ATOM   4894 C CA  . GLU C  1 115 ? -9.819   -3.454  10.841  1.00 111.97 ?  1589 GLU C CA  1 
ATOM   4895 C C   . GLU C  1 115 ? -8.840   -2.303  11.077  1.00 111.56 ?  1589 GLU C C   1 
ATOM   4896 O O   . GLU C  1 115 ? -9.251   -1.141  11.051  1.00 91.03  ?  1589 GLU C O   1 
ATOM   4897 C CB  . GLU C  1 115 ? -10.373  -3.968  12.176  1.00 117.28 ?  1589 GLU C CB  1 
ATOM   4898 C CG  . GLU C  1 115 ? -11.479  -3.087  12.728  1.00 119.97 ?  1589 GLU C CG  1 
ATOM   4899 C CD  . GLU C  1 115 ? -11.714  -3.222  14.218  1.00 129.05 ?  1589 GLU C CD  1 
ATOM   4900 O OE1 . GLU C  1 115 ? -10.792  -2.885  14.996  1.00 124.76 ?  1589 GLU C OE1 1 
ATOM   4901 O OE2 . GLU C  1 115 ? -12.833  -3.626  14.610  1.00 146.38 -1 1589 GLU C OE2 1 
ATOM   4902 N N   . THR C  1 116 ? -7.549   -2.636  11.286  1.00 126.11 ?  1590 THR C N   1 
ATOM   4903 C CA  . THR C  1 116 ? -6.449   -1.699  11.527  1.00 123.69 ?  1590 THR C CA  1 
ATOM   4904 C C   . THR C  1 116 ? -6.231   -0.745  10.322  1.00 128.91 ?  1590 THR C C   1 
ATOM   4905 O O   . THR C  1 116 ? -5.929   0.433   10.537  1.00 122.31 ?  1590 THR C O   1 
ATOM   4906 C CB  . THR C  1 116 ? -5.183   -2.486  11.950  1.00 110.33 ?  1590 THR C CB  1 
ATOM   4907 O OG1 . THR C  1 116 ? -5.504   -3.324  13.063  1.00 96.25  ?  1590 THR C OG1 1 
ATOM   4908 C CG2 . THR C  1 116 ? -4.013   -1.585  12.333  1.00 111.16 ?  1590 THR C CG2 1 
ATOM   4909 N N   . TYR C  1 117 ? -6.425   -1.235  9.076   1.00 127.95 ?  1591 TYR C N   1 
ATOM   4910 C CA  . TYR C  1 117 ? -6.216   -0.425  7.870   1.00 121.50 ?  1591 TYR C CA  1 
ATOM   4911 C C   . TYR C  1 117 ? -7.484   -0.272  7.022   1.00 117.43 ?  1591 TYR C C   1 
ATOM   4912 O O   . TYR C  1 117 ? -7.896   -1.195  6.319   1.00 114.50 ?  1591 TYR C O   1 
ATOM   4913 C CB  . TYR C  1 117 ? -5.027   -0.960  7.038   1.00 120.16 ?  1591 TYR C CB  1 
ATOM   4914 C CG  . TYR C  1 117 ? -3.843   -1.389  7.880   1.00 120.38 ?  1591 TYR C CG  1 
ATOM   4915 C CD1 . TYR C  1 117 ? -2.883   -0.468  8.290   1.00 122.13 ?  1591 TYR C CD1 1 
ATOM   4916 C CD2 . TYR C  1 117 ? -3.695   -2.712  8.289   1.00 118.06 ?  1591 TYR C CD2 1 
ATOM   4917 C CE1 . TYR C  1 117 ? -1.807   -0.852  9.091   1.00 119.62 ?  1591 TYR C CE1 1 
ATOM   4918 C CE2 . TYR C  1 117 ? -2.634   -3.105  9.102   1.00 116.71 ?  1591 TYR C CE2 1 
ATOM   4919 C CZ  . TYR C  1 117 ? -1.687   -2.173  9.496   1.00 114.78 ?  1591 TYR C CZ  1 
ATOM   4920 O OH  . TYR C  1 117 ? -0.634   -2.561  10.290  1.00 102.36 ?  1591 TYR C OH  1 
ATOM   4921 N N   . PRO C  1 121 ? -13.218  -3.225  5.242   1.00 98.37  ?  1595 PRO C N   1 
ATOM   4922 C CA  . PRO C  1 121 ? -14.413  -2.362  5.271   1.00 104.66 ?  1595 PRO C CA  1 
ATOM   4923 C C   . PRO C  1 121 ? -15.701  -3.198  5.297   1.00 105.52 ?  1595 PRO C C   1 
ATOM   4924 O O   . PRO C  1 121 ? -16.308  -3.397  6.358   1.00 88.14  ?  1595 PRO C O   1 
ATOM   4925 C CB  . PRO C  1 121 ? -14.261  -1.507  3.999   1.00 96.80  ?  1595 PRO C CB  1 
ATOM   4926 C CG  . PRO C  1 121 ? -13.314  -2.309  3.082   1.00 92.10  ?  1595 PRO C CG  1 
ATOM   4927 C CD  . PRO C  1 121 ? -12.737  -3.464  3.867   1.00 89.06  ?  1595 PRO C CD  1 
ATOM   4928 N N   . THR C  1 122 ? -16.094  -3.697  4.109   1.00 114.09 ?  1596 THR C N   1 
ATOM   4929 C CA  . THR C  1 122 ? -17.198  -4.609  3.832   1.00 104.40 ?  1596 THR C CA  1 
ATOM   4930 C C   . THR C  1 122 ? -16.613  -5.987  4.186   1.00 99.84  ?  1596 THR C C   1 
ATOM   4931 O O   . THR C  1 122 ? -17.285  -6.818  4.794   1.00 83.43  ?  1596 THR C O   1 
ATOM   4932 C CB  . THR C  1 122 ? -17.568  -4.481  2.331   1.00 104.26 ?  1596 THR C CB  1 
ATOM   4933 O OG1 . THR C  1 122 ? -17.921  -3.123  2.030   1.00 89.31  ?  1596 THR C OG1 1 
ATOM   4934 C CG2 . THR C  1 122 ? -18.686  -5.414  1.910   1.00 113.19 ?  1596 THR C CG2 1 
ATOM   4935 N N   . LEU C  1 123 ? -15.320  -6.177  3.848   1.00 112.46 ?  1597 LEU C N   1 
ATOM   4936 C CA  . LEU C  1 123 ? -14.532  -7.379  4.101   1.00 115.31 ?  1597 LEU C CA  1 
ATOM   4937 C C   . LEU C  1 123 ? -14.478  -7.723  5.581   1.00 107.66 ?  1597 LEU C C   1 
ATOM   4938 O O   . LEU C  1 123 ? -14.636  -8.892  5.918   1.00 96.14  ?  1597 LEU C O   1 
ATOM   4939 C CB  . LEU C  1 123 ? -13.108  -7.209  3.548   1.00 122.98 ?  1597 LEU C CB  1 
ATOM   4940 C CG  . LEU C  1 123 ? -12.941  -7.413  2.046   1.00 126.94 ?  1597 LEU C CG  1 
ATOM   4941 C CD1 . LEU C  1 123 ? -13.090  -6.100  1.286   1.00 119.30 ?  1597 LEU C CD1 1 
ATOM   4942 C CD2 . LEU C  1 123 ? -11.599  -8.042  1.737   1.00 129.65 ?  1597 LEU C CD2 1 
ATOM   4943 N N   . PHE C  1 124 ? -14.296  -6.706  6.461   1.00 107.13 ?  1598 PHE C N   1 
ATOM   4944 C CA  . PHE C  1 124 ? -14.207  -6.891  7.909   1.00 107.51 ?  1598 PHE C CA  1 
ATOM   4945 C C   . PHE C  1 124 ? -15.381  -7.672  8.496   1.00 104.00 ?  1598 PHE C C   1 
ATOM   4946 O O   . PHE C  1 124 ? -15.128  -8.618  9.238   1.00 96.11  ?  1598 PHE C O   1 
ATOM   4947 C CB  . PHE C  1 124 ? -13.989  -5.565  8.667   1.00 115.27 ?  1598 PHE C CB  1 
ATOM   4948 C CG  . PHE C  1 124 ? -14.073  -5.707  10.174  1.00 129.79 ?  1598 PHE C CG  1 
ATOM   4949 C CD1 . PHE C  1 124 ? -13.121  -6.441  10.878  1.00 132.02 ?  1598 PHE C CD1 1 
ATOM   4950 C CD2 . PHE C  1 124 ? -15.125  -5.139  10.886  1.00 141.26 ?  1598 PHE C CD2 1 
ATOM   4951 C CE1 . PHE C  1 124 ? -13.220  -6.603  12.267  1.00 133.82 ?  1598 PHE C CE1 1 
ATOM   4952 C CE2 . PHE C  1 124 ? -15.218  -5.295  12.277  1.00 148.03 ?  1598 PHE C CE2 1 
ATOM   4953 C CZ  . PHE C  1 124 ? -14.265  -6.026  12.957  1.00 144.21 ?  1598 PHE C CZ  1 
ATOM   4954 N N   . ARG C  1 125 ? -16.642  -7.295  8.174   1.00 108.44 ?  1599 ARG C N   1 
ATOM   4955 C CA  . ARG C  1 125 ? -17.827  -7.989  8.708   1.00 108.58 ?  1599 ARG C CA  1 
ATOM   4956 C C   . ARG C  1 125 ? -17.984  -9.414  8.145   1.00 98.32  ?  1599 ARG C C   1 
ATOM   4957 O O   . ARG C  1 125 ? -18.374  -10.319 8.891   1.00 91.73  ?  1599 ARG C O   1 
ATOM   4958 C CB  . ARG C  1 125 ? -19.127  -7.159  8.552   1.00 108.37 ?  1599 ARG C CB  1 
ATOM   4959 C CG  . ARG C  1 125 ? -19.507  -6.812  7.116   1.00 106.87 ?  1599 ARG C CG  1 
ATOM   4960 C CD  . ARG C  1 125 ? -20.962  -6.411  6.923   1.00 103.80 ?  1599 ARG C CD  1 
ATOM   4961 N NE  . ARG C  1 125 ? -21.387  -6.648  5.539   1.00 96.38  ?  1599 ARG C NE  1 
ATOM   4962 C CZ  . ARG C  1 125 ? -21.208  -5.798  4.525   1.00 92.40  ?  1599 ARG C CZ  1 
ATOM   4963 N NH1 . ARG C  1 125 ? -20.648  -4.608  4.733   1.00 81.82  1  1599 ARG C NH1 1 
ATOM   4964 N NH2 . ARG C  1 125 ? -21.600  -6.125  3.300   1.00 86.31  ?  1599 ARG C NH2 1 
ATOM   4965 N N   . VAL C  1 126 ? -17.640  -9.610  6.848   1.00 89.34  ?  1600 VAL C N   1 
ATOM   4966 C CA  . VAL C  1 126 ? -17.714  -10.901 6.152   1.00 86.51  ?  1600 VAL C CA  1 
ATOM   4967 C C   . VAL C  1 126 ? -16.651  -11.859 6.694   1.00 88.45  ?  1600 VAL C C   1 
ATOM   4968 O O   . VAL C  1 126 ? -17.015  -12.948 7.127   1.00 80.32  ?  1600 VAL C O   1 
ATOM   4969 C CB  . VAL C  1 126 ? -17.664  -10.767 4.605   1.00 85.34  ?  1600 VAL C CB  1 
ATOM   4970 C CG1 . VAL C  1 126 ? -17.786  -12.130 3.926   1.00 80.89  ?  1600 VAL C CG1 1 
ATOM   4971 C CG2 . VAL C  1 126 ? -18.749  -9.822  4.092   1.00 91.22  ?  1600 VAL C CG2 1 
ATOM   4972 N N   . ILE C  1 127 ? -15.352  -11.443 6.702   1.00 94.18  ?  1601 ILE C N   1 
ATOM   4973 C CA  . ILE C  1 127 ? -14.200  -12.216 7.218   1.00 92.43  ?  1601 ILE C CA  1 
ATOM   4974 C C   . ILE C  1 127 ? -14.434  -12.638 8.691   1.00 90.73  ?  1601 ILE C C   1 
ATOM   4975 O O   . ILE C  1 127 ? -14.120  -13.775 9.060   1.00 99.50  ?  1601 ILE C O   1 
ATOM   4976 C CB  . ILE C  1 127 ? -12.833  -11.472 6.988   1.00 96.91  ?  1601 ILE C CB  1 
ATOM   4977 C CG1 . ILE C  1 127 ? -12.542  -11.202 5.483   1.00 104.07 ?  1601 ILE C CG1 1 
ATOM   4978 C CG2 . ILE C  1 127 ? -11.637  -12.168 7.666   1.00 94.86  ?  1601 ILE C CG2 1 
ATOM   4979 C CD1 . ILE C  1 127 ? -12.296  -12.449 4.540   1.00 111.44 ?  1601 ILE C CD1 1 
ATOM   4980 N N   . ARG C  1 128 ? -15.065  -11.743 9.490   1.00 84.33  ?  1602 ARG C N   1 
ATOM   4981 C CA  . ARG C  1 128 ? -15.436  -11.948 10.893  1.00 80.54  ?  1602 ARG C CA  1 
ATOM   4982 C C   . ARG C  1 128 ? -16.351  -13.170 11.109  1.00 73.57  ?  1602 ARG C C   1 
ATOM   4983 O O   . ARG C  1 128 ? -16.593  -13.552 12.260  1.00 55.31  ?  1602 ARG C O   1 
ATOM   4984 C CB  . ARG C  1 128 ? -16.110  -10.688 11.450  1.00 86.03  ?  1602 ARG C CB  1 
ATOM   4985 C CG  . ARG C  1 128 ? -15.451  -10.157 12.714  1.00 98.05  ?  1602 ARG C CG  1 
ATOM   4986 C CD  . ARG C  1 128 ? -16.292  -9.090  13.380  1.00 109.54 ?  1602 ARG C CD  1 
ATOM   4987 N NE  . ARG C  1 128 ? -17.507  -9.646  13.980  1.00 120.79 ?  1602 ARG C NE  1 
ATOM   4988 C CZ  . ARG C  1 128 ? -17.621  -10.018 15.251  1.00 123.98 ?  1602 ARG C CZ  1 
ATOM   4989 N NH1 . ARG C  1 128 ? -16.596  -9.886  16.082  1.00 128.13 1  1602 ARG C NH1 1 
ATOM   4990 N NH2 . ARG C  1 128 ? -18.762  -10.509 15.705  1.00 125.52 ?  1602 ARG C NH2 1 
ATOM   4991 N N   . LEU C  1 129 ? -16.840  -13.786 10.006  1.00 75.99  ?  1603 LEU C N   1 
ATOM   4992 C CA  . LEU C  1 129 ? -17.705  -14.969 10.028  1.00 84.64  ?  1603 LEU C CA  1 
ATOM   4993 C C   . LEU C  1 129 ? -17.007  -16.222 10.533  1.00 85.82  ?  1603 LEU C C   1 
ATOM   4994 O O   . LEU C  1 129 ? -17.656  -17.025 11.193  1.00 87.18  ?  1603 LEU C O   1 
ATOM   4995 C CB  . LEU C  1 129 ? -18.323  -15.243 8.651   1.00 89.37  ?  1603 LEU C CB  1 
ATOM   4996 C CG  . LEU C  1 129 ? -19.808  -14.945 8.514   1.00 89.57  ?  1603 LEU C CG  1 
ATOM   4997 C CD1 . LEU C  1 129 ? -20.129  -14.439 7.135   1.00 89.31  ?  1603 LEU C CD1 1 
ATOM   4998 C CD2 . LEU C  1 129 ? -20.638  -16.161 8.843   1.00 87.14  ?  1603 LEU C CD2 1 
ATOM   4999 N N   . ALA C  1 130 ? -15.693  -16.381 10.241  1.00 83.76  ?  1604 ALA C N   1 
ATOM   5000 C CA  . ALA C  1 130 ? -14.839  -17.522 10.625  1.00 80.86  ?  1604 ALA C CA  1 
ATOM   5001 C C   . ALA C  1 130 ? -15.040  -18.052 12.067  1.00 77.81  ?  1604 ALA C C   1 
ATOM   5002 O O   . ALA C  1 130 ? -14.799  -19.234 12.328  1.00 65.71  ?  1604 ALA C O   1 
ATOM   5003 C CB  . ALA C  1 130 ? -13.379  -17.178 10.390  1.00 87.08  ?  1604 ALA C CB  1 
ATOM   5004 N N   . ARG C  1 131 ? -15.517  -17.192 12.980  1.00 80.02  ?  1605 ARG C N   1 
ATOM   5005 C CA  . ARG C  1 131 ? -15.805  -17.536 14.372  1.00 86.82  ?  1605 ARG C CA  1 
ATOM   5006 C C   . ARG C  1 131 ? -16.951  -18.554 14.525  1.00 89.67  ?  1605 ARG C C   1 
ATOM   5007 O O   . ARG C  1 131 ? -17.057  -19.181 15.580  1.00 92.89  ?  1605 ARG C O   1 
ATOM   5008 C CB  . ARG C  1 131 ? -16.111  -16.260 15.182  1.00 91.82  ?  1605 ARG C CB  1 
ATOM   5009 C CG  . ARG C  1 131 ? -17.382  -15.531 14.763  1.00 93.17  ?  1605 ARG C CG  1 
ATOM   5010 C CD  . ARG C  1 131 ? -17.524  -14.179 15.423  1.00 98.74  ?  1605 ARG C CD  1 
ATOM   5011 N NE  . ARG C  1 131 ? -18.750  -13.501 14.995  1.00 103.26 ?  1605 ARG C NE  1 
ATOM   5012 C CZ  . ARG C  1 131 ? -19.909  -13.572 15.644  1.00 108.73 ?  1605 ARG C CZ  1 
ATOM   5013 N NH1 . ARG C  1 131 ? -20.010  -14.280 16.759  1.00 107.02 1  1605 ARG C NH1 1 
ATOM   5014 N NH2 . ARG C  1 131 ? -20.973  -12.927 15.187  1.00 108.83 ?  1605 ARG C NH2 1 
ATOM   5015 N N   . ILE C  1 132 ? -17.812  -18.697 13.484  1.00 94.42  ?  1606 ILE C N   1 
ATOM   5016 C CA  . ILE C  1 132 ? -18.988  -19.584 13.473  1.00 95.84  ?  1606 ILE C CA  1 
ATOM   5017 C C   . ILE C  1 132 ? -18.616  -21.068 13.642  1.00 101.85 ?  1606 ILE C C   1 
ATOM   5018 O O   . ILE C  1 132 ? -19.384  -21.808 14.249  1.00 98.89  ?  1606 ILE C O   1 
ATOM   5019 C CB  . ILE C  1 132 ? -19.942  -19.363 12.254  1.00 93.94  ?  1606 ILE C CB  1 
ATOM   5020 C CG1 . ILE C  1 132 ? -19.268  -19.699 10.891  1.00 104.86 ?  1606 ILE C CG1 1 
ATOM   5021 C CG2 . ILE C  1 132 ? -20.545  -17.952 12.264  1.00 89.75  ?  1606 ILE C CG2 1 
ATOM   5022 C CD1 . ILE C  1 132 ? -20.178  -20.386 9.853   1.00 115.34 ?  1606 ILE C CD1 1 
ATOM   5023 N N   . GLY C  1 133 ? -17.448  -21.467 13.133  1.00 109.43 ?  1607 GLY C N   1 
ATOM   5024 C CA  . GLY C  1 133 ? -16.946  -22.835 13.218  1.00 109.30 ?  1607 GLY C CA  1 
ATOM   5025 C C   . GLY C  1 133 ? -16.773  -23.318 14.641  1.00 111.73 ?  1607 GLY C C   1 
ATOM   5026 O O   . GLY C  1 133 ? -17.005  -24.496 14.928  1.00 105.48 ?  1607 GLY C O   1 
ATOM   5027 N N   . ARG C  1 134 ? -16.382  -22.391 15.545  1.00 119.21 ?  1608 ARG C N   1 
ATOM   5028 C CA  . ARG C  1 134 ? -16.165  -22.628 16.977  1.00 119.07 ?  1608 ARG C CA  1 
ATOM   5029 C C   . ARG C  1 134 ? -17.447  -23.033 17.676  1.00 113.67 ?  1608 ARG C C   1 
ATOM   5030 O O   . ARG C  1 134 ? -17.393  -23.840 18.603  1.00 122.95 ?  1608 ARG C O   1 
ATOM   5031 C CB  . ARG C  1 134 ? -15.611  -21.376 17.675  1.00 116.24 ?  1608 ARG C CB  1 
ATOM   5032 C CG  . ARG C  1 134 ? -14.354  -20.815 17.054  1.00 118.22 ?  1608 ARG C CG  1 
ATOM   5033 C CD  . ARG C  1 134 ? -13.506  -20.079 18.068  1.00 115.62 ?  1608 ARG C CD  1 
ATOM   5034 N NE  . ARG C  1 134 ? -14.044  -18.759 18.395  1.00 111.26 ?  1608 ARG C NE  1 
ATOM   5035 C CZ  . ARG C  1 134 ? -13.754  -17.644 17.732  1.00 105.39 ?  1608 ARG C CZ  1 
ATOM   5036 N NH1 . ARG C  1 134 ? -12.925  -17.676 16.694  1.00 95.47  1  1608 ARG C NH1 1 
ATOM   5037 N NH2 . ARG C  1 134 ? -14.283  -16.489 18.107  1.00 105.97 ?  1608 ARG C NH2 1 
ATOM   5038 N N   . ILE C  1 135 ? -18.589  -22.444 17.259  1.00 97.36  ?  1609 ILE C N   1 
ATOM   5039 C CA  . ILE C  1 135 ? -19.905  -22.695 17.853  1.00 85.22  ?  1609 ILE C CA  1 
ATOM   5040 C C   . ILE C  1 135 ? -20.722  -23.684 17.029  1.00 79.45  ?  1609 ILE C C   1 
ATOM   5041 O O   . ILE C  1 135 ? -21.684  -24.264 17.549  1.00 84.96  ?  1609 ILE C O   1 
ATOM   5042 C CB  . ILE C  1 135 ? -20.693  -21.394 18.183  1.00 84.92  ?  1609 ILE C CB  1 
ATOM   5043 C CG1 . ILE C  1 135 ? -20.866  -20.463 16.960  1.00 96.49  ?  1609 ILE C CG1 1 
ATOM   5044 C CG2 . ILE C  1 135 ? -20.055  -20.664 19.363  1.00 78.25  ?  1609 ILE C CG2 1 
ATOM   5045 C CD1 . ILE C  1 135 ? -22.313  -20.037 16.707  1.00 102.22 ?  1609 ILE C CD1 1 
ATOM   5046 N N   . LEU C  1 136 ? -20.319  -23.896 15.757  1.00 77.02  ?  1610 LEU C N   1 
ATOM   5047 C CA  . LEU C  1 136 ? -20.944  -24.846 14.836  1.00 83.03  ?  1610 LEU C CA  1 
ATOM   5048 C C   . LEU C  1 136 ? -20.700  -26.280 15.344  1.00 89.39  ?  1610 LEU C C   1 
ATOM   5049 O O   . LEU C  1 136 ? -21.543  -27.151 15.139  1.00 83.30  ?  1610 LEU C O   1 
ATOM   5050 C CB  . LEU C  1 136 ? -20.421  -24.618 13.399  1.00 81.26  ?  1610 LEU C CB  1 
ATOM   5051 C CG  . LEU C  1 136 ? -20.548  -25.734 12.353  1.00 83.06  ?  1610 LEU C CG  1 
ATOM   5052 C CD1 . LEU C  1 136 ? -21.999  -25.978 11.944  1.00 86.30  ?  1610 LEU C CD1 1 
ATOM   5053 C CD2 . LEU C  1 136 ? -19.726  -25.400 11.139  1.00 82.79  ?  1610 LEU C CD2 1 
ATOM   5054 N N   . ARG C  1 137 ? -19.596  -26.485 16.096  1.00 102.44 ?  1611 ARG C N   1 
ATOM   5055 C CA  . ARG C  1 137 ? -19.221  -27.752 16.725  1.00 109.43 ?  1611 ARG C CA  1 
ATOM   5056 C C   . ARG C  1 137 ? -20.300  -28.279 17.685  1.00 103.88 ?  1611 ARG C C   1 
ATOM   5057 O O   . ARG C  1 137 ? -20.176  -29.396 18.187  1.00 88.11  ?  1611 ARG C O   1 
ATOM   5058 C CB  . ARG C  1 137 ? -17.870  -27.613 17.438  1.00 122.05 ?  1611 ARG C CB  1 
ATOM   5059 C CG  . ARG C  1 137 ? -16.717  -28.231 16.658  1.00 136.78 ?  1611 ARG C CG  1 
ATOM   5060 C CD  . ARG C  1 137 ? -15.365  -27.658 17.043  1.00 135.46 ?  1611 ARG C CD  1 
ATOM   5061 N NE  . ARG C  1 137 ? -15.019  -27.926 18.439  1.00 130.51 ?  1611 ARG C NE  1 
ATOM   5062 C CZ  . ARG C  1 137 ? -13.919  -27.484 19.039  1.00 148.48 ?  1611 ARG C CZ  1 
ATOM   5063 N NH1 . ARG C  1 137 ? -13.032  -26.756 18.366  1.00 156.43 1  1611 ARG C NH1 1 
ATOM   5064 N NH2 . ARG C  1 137 ? -13.695  -27.764 20.314  1.00 160.32 ?  1611 ARG C NH2 1 
ATOM   5065 N N   . LEU C  1 138 ? -21.377  -27.493 17.898  1.00 100.71 ?  1612 LEU C N   1 
ATOM   5066 C CA  . LEU C  1 138 ? -22.524  -27.861 18.725  1.00 91.32  ?  1612 LEU C CA  1 
ATOM   5067 C C   . LEU C  1 138 ? -23.495  -28.835 18.019  1.00 94.98  ?  1612 LEU C C   1 
ATOM   5068 O O   . LEU C  1 138 ? -24.463  -29.288 18.633  1.00 94.44  ?  1612 LEU C O   1 
ATOM   5069 C CB  . LEU C  1 138 ? -23.248  -26.612 19.240  1.00 81.53  ?  1612 LEU C CB  1 
ATOM   5070 C CG  . LEU C  1 138 ? -22.844  -26.135 20.628  1.00 79.85  ?  1612 LEU C CG  1 
ATOM   5071 C CD1 . LEU C  1 138 ? -23.201  -24.682 20.823  1.00 78.18  ?  1612 LEU C CD1 1 
ATOM   5072 C CD2 . LEU C  1 138 ? -23.472  -26.997 21.725  1.00 80.31  ?  1612 LEU C CD2 1 
ATOM   5073 N N   . VAL C  1 139 ? -23.238  -29.150 16.733  1.00 99.66  ?  1613 VAL C N   1 
ATOM   5074 C CA  . VAL C  1 139 ? -23.993  -30.146 15.962  1.00 107.06 ?  1613 VAL C CA  1 
ATOM   5075 C C   . VAL C  1 139 ? -23.088  -31.365 15.792  1.00 105.70 ?  1613 VAL C C   1 
ATOM   5076 O O   . VAL C  1 139 ? -23.580  -32.484 15.665  1.00 115.46 ?  1613 VAL C O   1 
ATOM   5077 C CB  . VAL C  1 139 ? -24.571  -29.649 14.598  1.00 114.88 ?  1613 VAL C CB  1 
ATOM   5078 C CG1 . VAL C  1 139 ? -25.588  -28.533 14.789  1.00 124.91 ?  1613 VAL C CG1 1 
ATOM   5079 C CG2 . VAL C  1 139 ? -23.480  -29.236 13.609  1.00 113.01 ?  1613 VAL C CG2 1 
ATOM   5080 N N   . THR C  1 140 ? -21.757  -31.122 15.824  1.00 107.65 ?  1614 THR C N   1 
ATOM   5081 C CA  . THR C  1 140 ? -20.661  -32.075 15.639  1.00 112.37 ?  1614 THR C CA  1 
ATOM   5082 C C   . THR C  1 140 ? -20.252  -32.794 16.934  1.00 111.28 ?  1614 THR C C   1 
ATOM   5083 O O   . THR C  1 140 ? -20.559  -33.976 17.097  1.00 107.90 ?  1614 THR C O   1 
ATOM   5084 C CB  . THR C  1 140 ? -19.462  -31.358 14.963  1.00 114.26 ?  1614 THR C CB  1 
ATOM   5085 O OG1 . THR C  1 140 ? -19.905  -30.681 13.788  1.00 107.28 ?  1614 THR C OG1 1 
ATOM   5086 C CG2 . THR C  1 140 ? -18.322  -32.303 14.615  1.00 114.78 ?  1614 THR C CG2 1 
ATOM   5087 N N   . ALA C  1 141 ? -19.531  -32.084 17.828  1.00 105.09 ?  1615 ALA C N   1 
ATOM   5088 C CA  . ALA C  1 141 ? -18.971  -32.592 19.084  1.00 109.92 ?  1615 ALA C CA  1 
ATOM   5089 C C   . ALA C  1 141 ? -19.979  -33.221 20.054  1.00 102.74 ?  1615 ALA C C   1 
ATOM   5090 O O   . ALA C  1 141 ? -19.589  -34.084 20.849  1.00 101.19 ?  1615 ALA C O   1 
ATOM   5091 C CB  . ALA C  1 141 ? -18.183  -31.496 19.788  1.00 121.48 ?  1615 ALA C CB  1 
ATOM   5092 N N   . VAL C  1 142 ? -21.255  -32.806 19.998  1.00 101.00 ?  1616 VAL C N   1 
ATOM   5093 C CA  . VAL C  1 142 ? -22.263  -33.348 20.905  1.00 91.50  ?  1616 VAL C CA  1 
ATOM   5094 C C   . VAL C  1 142 ? -23.072  -34.498 20.244  1.00 96.89  ?  1616 VAL C C   1 
ATOM   5095 O O   . VAL C  1 142 ? -23.683  -34.302 19.186  1.00 84.91  ?  1616 VAL C O   1 
ATOM   5096 C CB  . VAL C  1 142 ? -23.156  -32.244 21.542  1.00 78.49  ?  1616 VAL C CB  1 
ATOM   5097 C CG1 . VAL C  1 142 ? -23.848  -31.388 20.497  1.00 70.46  ?  1616 VAL C CG1 1 
ATOM   5098 C CG2 . VAL C  1 142 ? -24.159  -32.819 22.539  1.00 78.46  ?  1616 VAL C CG2 1 
ATOM   5099 N N   . PRO C  1 143 ? -23.089  -35.706 20.874  1.00 110.60 ?  1617 PRO C N   1 
ATOM   5100 C CA  . PRO C  1 143 ? -23.902  -36.807 20.332  1.00 114.21 ?  1617 PRO C CA  1 
ATOM   5101 C C   . PRO C  1 143 ? -25.378  -36.481 20.542  1.00 122.58 ?  1617 PRO C C   1 
ATOM   5102 O O   . PRO C  1 143 ? -25.688  -35.451 21.148  1.00 121.17 ?  1617 PRO C O   1 
ATOM   5103 C CB  . PRO C  1 143 ? -23.465  -38.023 21.162  1.00 115.67 ?  1617 PRO C CB  1 
ATOM   5104 C CG  . PRO C  1 143 ? -22.283  -37.572 21.973  1.00 116.36 ?  1617 PRO C CG  1 
ATOM   5105 C CD  . PRO C  1 143 ? -22.449  -36.105 22.142  1.00 116.28 ?  1617 PRO C CD  1 
ATOM   5106 N N   . GLN C  1 144 ? -26.292  -37.340 20.044  1.00 131.51 ?  1618 GLN C N   1 
ATOM   5107 C CA  . GLN C  1 144 ? -27.751  -37.135 20.068  1.00 131.77 ?  1618 GLN C CA  1 
ATOM   5108 C C   . GLN C  1 144 ? -28.031  -36.141 18.939  1.00 119.35 ?  1618 GLN C C   1 
ATOM   5109 O O   . GLN C  1 144 ? -28.814  -36.454 18.048  1.00 124.25 ?  1618 GLN C O   1 
ATOM   5110 C CB  . GLN C  1 144 ? -28.280  -36.643 21.442  1.00 134.52 ?  1618 GLN C CB  1 
ATOM   5111 C CG  . GLN C  1 144 ? -29.801  -36.730 21.623  1.00 135.63 ?  1618 GLN C CG  1 
ATOM   5112 C CD  . GLN C  1 144 ? -30.349  -35.757 22.653  1.00 136.52 ?  1618 GLN C CD  1 
ATOM   5113 O OE1 . GLN C  1 144 ? -31.365  -35.085 22.429  1.00 134.20 ?  1618 GLN C OE1 1 
ATOM   5114 N NE2 . GLN C  1 144 ? -29.702  -35.657 23.811  1.00 130.88 ?  1618 GLN C NE2 1 
ATOM   5115 N N   . MET C  1 145 ? -27.318  -34.989 18.932  1.00 109.61 ?  1619 MET C N   1 
ATOM   5116 C CA  . MET C  1 145 ? -27.371  -33.974 17.882  1.00 110.51 ?  1619 MET C CA  1 
ATOM   5117 C C   . MET C  1 145 ? -26.687  -34.563 16.657  1.00 104.90 ?  1619 MET C C   1 
ATOM   5118 O O   . MET C  1 145 ? -27.301  -34.625 15.593  1.00 98.69  ?  1619 MET C O   1 
ATOM   5119 C CB  . MET C  1 145 ? -26.656  -32.682 18.321  1.00 115.62 ?  1619 MET C CB  1 
ATOM   5120 C CG  . MET C  1 145 ? -27.467  -31.833 19.273  1.00 119.06 ?  1619 MET C CG  1 
ATOM   5121 S SD  . MET C  1 145 ? -28.776  -30.880 18.467  1.00 126.10 ?  1619 MET C SD  1 
ATOM   5122 C CE  . MET C  1 145 ? -27.825  -29.484 17.841  1.00 119.55 ?  1619 MET C CE  1 
ATOM   5123 N N   . ARG C  1 146 ? -25.448  -35.076 16.842  1.00 101.69 ?  1620 ARG C N   1 
ATOM   5124 C CA  . ARG C  1 146 ? -24.616  -35.717 15.821  1.00 105.78 ?  1620 ARG C CA  1 
ATOM   5125 C C   . ARG C  1 146 ? -25.434  -36.752 15.042  1.00 101.07 ?  1620 ARG C C   1 
ATOM   5126 O O   . ARG C  1 146 ? -25.397  -36.768 13.808  1.00 90.96  ?  1620 ARG C O   1 
ATOM   5127 C CB  . ARG C  1 146 ? -23.397  -36.380 16.491  1.00 110.30 ?  1620 ARG C CB  1 
ATOM   5128 C CG  . ARG C  1 146 ? -22.189  -36.557 15.570  1.00 109.38 ?  1620 ARG C CG  1 
ATOM   5129 C CD  . ARG C  1 146 ? -21.126  -37.470 16.171  1.00 110.46 ?  1620 ARG C CD  1 
ATOM   5130 N NE  . ARG C  1 146 ? -20.359  -36.812 17.233  1.00 119.41 ?  1620 ARG C NE  1 
ATOM   5131 C CZ  . ARG C  1 146 ? -20.342  -37.205 18.503  1.00 121.56 ?  1620 ARG C CZ  1 
ATOM   5132 N NH1 . ARG C  1 146 ? -21.038  -38.266 18.885  1.00 117.14 1  1620 ARG C NH1 1 
ATOM   5133 N NH2 . ARG C  1 146 ? -19.623  -36.544 19.399  1.00 125.55 ?  1620 ARG C NH2 1 
ATOM   5134 N N   . LYS C  1 147 ? -26.215  -37.568 15.787  1.00 101.48 ?  1621 LYS C N   1 
ATOM   5135 C CA  . LYS C  1 147 ? -27.111  -38.624 15.317  1.00 95.58  ?  1621 LYS C CA  1 
ATOM   5136 C C   . LYS C  1 147 ? -28.167  -38.054 14.364  1.00 96.72  ?  1621 LYS C C   1 
ATOM   5137 O O   . LYS C  1 147 ? -28.272  -38.527 13.231  1.00 105.16 ?  1621 LYS C O   1 
ATOM   5138 C CB  . LYS C  1 147 ? -27.782  -39.290 16.536  1.00 95.55  ?  1621 LYS C CB  1 
ATOM   5139 C CG  . LYS C  1 147 ? -28.437  -40.634 16.264  1.00 101.82 ?  1621 LYS C CG  1 
ATOM   5140 C CD  . LYS C  1 147 ? -28.965  -41.254 17.562  1.00 106.95 ?  1621 LYS C CD  1 
ATOM   5141 C CE  . LYS C  1 147 ? -29.318  -42.715 17.413  1.00 110.88 ?  1621 LYS C CE  1 
ATOM   5142 N NZ  . LYS C  1 147 ? -29.900  -43.268 18.662  1.00 110.22 1  1621 LYS C NZ  1 
ATOM   5143 N N   . ILE C  1 148 ? -28.905  -37.010 14.816  1.00 96.39  ?  1622 ILE C N   1 
ATOM   5144 C CA  . ILE C  1 148 ? -29.993  -36.342 14.086  1.00 97.89  ?  1622 ILE C CA  1 
ATOM   5145 C C   . ILE C  1 148 ? -29.475  -35.620 12.838  1.00 93.55  ?  1622 ILE C C   1 
ATOM   5146 O O   . ILE C  1 148 ? -30.157  -35.653 11.817  1.00 104.82 ?  1622 ILE C O   1 
ATOM   5147 C CB  . ILE C  1 148 ? -30.854  -35.432 15.023  1.00 99.65  ?  1622 ILE C CB  1 
ATOM   5148 C CG1 . ILE C  1 148 ? -31.371  -36.199 16.275  1.00 105.92 ?  1622 ILE C CG1 1 
ATOM   5149 C CG2 . ILE C  1 148 ? -32.015  -34.749 14.297  1.00 96.46  ?  1622 ILE C CG2 1 
ATOM   5150 C CD1 . ILE C  1 148 ? -32.048  -37.658 16.076  1.00 104.23 ?  1622 ILE C CD1 1 
ATOM   5151 N N   . VAL C  1 149 ? -28.266  -35.026 12.897  1.00 87.07  ?  1623 VAL C N   1 
ATOM   5152 C CA  . VAL C  1 149 ? -27.648  -34.345 11.749  1.00 85.38  ?  1623 VAL C CA  1 
ATOM   5153 C C   . VAL C  1 149 ? -27.355  -35.379 10.658  1.00 87.37  ?  1623 VAL C C   1 
ATOM   5154 O O   . VAL C  1 149 ? -27.661  -35.133 9.492   1.00 87.06  ?  1623 VAL C O   1 
ATOM   5155 C CB  . VAL C  1 149 ? -26.369  -33.540 12.129  1.00 89.19  ?  1623 VAL C CB  1 
ATOM   5156 C CG1 . VAL C  1 149 ? -25.782  -32.819 10.917  1.00 87.71  ?  1623 VAL C CG1 1 
ATOM   5157 C CG2 . VAL C  1 149 ? -26.644  -32.543 13.249  1.00 94.02  ?  1623 VAL C CG2 1 
ATOM   5158 N N   . SER C  1 150 ? -26.791  -36.544 11.055  1.00 94.00  ?  1624 SER C N   1 
ATOM   5159 C CA  . SER C  1 150 ? -26.430  -37.655 10.165  1.00 100.15 ?  1624 SER C CA  1 
ATOM   5160 C C   . SER C  1 150 ? -27.651  -38.343 9.553   1.00 105.27 ?  1624 SER C C   1 
ATOM   5161 O O   . SER C  1 150 ? -27.738  -38.448 8.325   1.00 115.08 ?  1624 SER C O   1 
ATOM   5162 C CB  . SER C  1 150 ? -25.544  -38.666 10.890  1.00 102.68 ?  1624 SER C CB  1 
ATOM   5163 O OG  . SER C  1 150 ? -24.205  -38.615 10.419  1.00 112.70 ?  1624 SER C OG  1 
ATOM   5164 N N   . ALA C  1 151 ? -28.607  -38.770 10.407  1.00 102.89 ?  1625 ALA C N   1 
ATOM   5165 C CA  . ALA C  1 151 ? -29.852  -39.428 10.001  1.00 97.65  ?  1625 ALA C CA  1 
ATOM   5166 C C   . ALA C  1 151 ? -30.701  -38.552 9.080   1.00 96.76  ?  1625 ALA C C   1 
ATOM   5167 O O   . ALA C  1 151 ? -31.509  -39.079 8.315   1.00 105.45 ?  1625 ALA C O   1 
ATOM   5168 C CB  . ALA C  1 151 ? -30.656  -39.825 11.226  1.00 101.98 ?  1625 ALA C CB  1 
ATOM   5169 N N   . LEU C  1 152 ? -30.521  -37.224 9.155   1.00 92.63  ?  1626 LEU C N   1 
ATOM   5170 C CA  . LEU C  1 152 ? -31.232  -36.271 8.310   1.00 92.40  ?  1626 LEU C CA  1 
ATOM   5171 C C   . LEU C  1 152 ? -30.501  -36.103 6.987   1.00 95.29  ?  1626 LEU C C   1 
ATOM   5172 O O   . LEU C  1 152 ? -31.154  -36.050 5.950   1.00 96.41  ?  1626 LEU C O   1 
ATOM   5173 C CB  . LEU C  1 152 ? -31.369  -34.921 9.014   1.00 93.22  ?  1626 LEU C CB  1 
ATOM   5174 C CG  . LEU C  1 152 ? -32.702  -34.224 8.852   1.00 94.37  ?  1626 LEU C CG  1 
ATOM   5175 C CD1 . LEU C  1 152 ? -33.692  -34.678 9.914   1.00 96.02  ?  1626 LEU C CD1 1 
ATOM   5176 C CD2 . LEU C  1 152 ? -32.522  -32.744 8.939   1.00 96.62  ?  1626 LEU C CD2 1 
ATOM   5177 N N   . ILE C  1 153 ? -29.150  -36.051 7.017   1.00 96.49  ?  1627 ILE C N   1 
ATOM   5178 C CA  . ILE C  1 153 ? -28.301  -35.901 5.831   1.00 96.41  ?  1627 ILE C CA  1 
ATOM   5179 C C   . ILE C  1 153 ? -28.463  -37.102 4.885   1.00 100.67 ?  1627 ILE C C   1 
ATOM   5180 O O   . ILE C  1 153 ? -28.450  -36.913 3.667   1.00 114.62 ?  1627 ILE C O   1 
ATOM   5181 C CB  . ILE C  1 153 ? -26.829  -35.594 6.241   1.00 97.44  ?  1627 ILE C CB  1 
ATOM   5182 C CG1 . ILE C  1 153 ? -26.610  -34.066 6.302   1.00 100.37 ?  1627 ILE C CG1 1 
ATOM   5183 C CG2 . ILE C  1 153 ? -25.788  -36.262 5.326   1.00 100.30 ?  1627 ILE C CG2 1 
ATOM   5184 C CD1 . ILE C  1 153 ? -25.475  -33.577 7.232   1.00 106.45 ?  1627 ILE C CD1 1 
ATOM   5185 N N   . SER C  1 154 ? -28.697  -38.308 5.448   1.00 100.10 ?  1628 SER C N   1 
ATOM   5186 C CA  . SER C  1 154 ? -28.901  -39.566 4.718   1.00 106.59 ?  1628 SER C CA  1 
ATOM   5187 C C   . SER C  1 154 ? -30.089  -39.572 3.721   1.00 98.26  ?  1628 SER C C   1 
ATOM   5188 O O   . SER C  1 154 ? -30.141  -40.436 2.844   1.00 96.20  ?  1628 SER C O   1 
ATOM   5189 C CB  . SER C  1 154 ? -29.045  -40.718 5.704   1.00 116.91 ?  1628 SER C CB  1 
ATOM   5190 O OG  . SER C  1 154 ? -30.232  -40.572 6.465   1.00 125.43 ?  1628 SER C OG  1 
ATOM   5191 N N   . VAL C  1 155 ? -31.032  -38.626 3.860   1.00 93.41  ?  1629 VAL C N   1 
ATOM   5192 C CA  . VAL C  1 155 ? -32.212  -38.500 2.994   1.00 97.83  ?  1629 VAL C CA  1 
ATOM   5193 C C   . VAL C  1 155 ? -31.824  -37.971 1.599   1.00 94.06  ?  1629 VAL C C   1 
ATOM   5194 O O   . VAL C  1 155 ? -32.272  -38.534 0.598   1.00 91.03  ?  1629 VAL C O   1 
ATOM   5195 C CB  . VAL C  1 155 ? -33.344  -37.660 3.653   1.00 95.63  ?  1629 VAL C CB  1 
ATOM   5196 C CG1 . VAL C  1 155 ? -34.607  -37.673 2.807   1.00 89.79  ?  1629 VAL C CG1 1 
ATOM   5197 C CG2 . VAL C  1 155 ? -33.656  -38.153 5.064   1.00 98.20  ?  1629 VAL C CG2 1 
ATOM   5198 N N   . ILE C  1 156 ? -30.966  -36.913 1.553   1.00 88.97  ?  1630 ILE C N   1 
ATOM   5199 C CA  . ILE C  1 156 ? -30.436  -36.193 0.369   1.00 88.91  ?  1630 ILE C CA  1 
ATOM   5200 C C   . ILE C  1 156 ? -30.094  -37.113 -0.852  1.00 101.96 ?  1630 ILE C C   1 
ATOM   5201 O O   . ILE C  1 156 ? -30.541  -36.767 -1.948  1.00 122.96 ?  1630 ILE C O   1 
ATOM   5202 C CB  . ILE C  1 156 ? -29.216  -35.270 0.735   1.00 78.58  ?  1630 ILE C CB  1 
ATOM   5203 C CG1 . ILE C  1 156 ? -29.541  -34.282 1.907   1.00 75.94  ?  1630 ILE C CG1 1 
ATOM   5204 C CG2 . ILE C  1 156 ? -28.628  -34.532 -0.494  1.00 69.63  ?  1630 ILE C CG2 1 
ATOM   5205 C CD1 . ILE C  1 156 ? -30.450  -33.040 1.594   1.00 81.80  ?  1630 ILE C CD1 1 
ATOM   5206 N N   . PRO C  1 157 ? -29.328  -38.240 -0.731  1.00 100.15 ?  1631 PRO C N   1 
ATOM   5207 C CA  . PRO C  1 157 ? -29.006  -39.042 -1.928  1.00 92.77  ?  1631 PRO C CA  1 
ATOM   5208 C C   . PRO C  1 157 ? -30.195  -39.624 -2.691  1.00 91.88  ?  1631 PRO C C   1 
ATOM   5209 O O   . PRO C  1 157 ? -30.145  -39.688 -3.923  1.00 78.71  ?  1631 PRO C O   1 
ATOM   5210 C CB  . PRO C  1 157 ? -28.091  -40.134 -1.382  1.00 94.98  ?  1631 PRO C CB  1 
ATOM   5211 C CG  . PRO C  1 157 ? -27.526  -39.558 -0.131  1.00 97.12  ?  1631 PRO C CG  1 
ATOM   5212 C CD  . PRO C  1 157 ? -28.663  -38.809 0.457   1.00 98.65  ?  1631 PRO C CD  1 
ATOM   5213 N N   . GLY C  1 158 ? -31.244  -40.020 -1.961  1.00 95.42  ?  1632 GLY C N   1 
ATOM   5214 C CA  . GLY C  1 158 ? -32.483  -40.546 -2.536  1.00 101.41 ?  1632 GLY C CA  1 
ATOM   5215 C C   . GLY C  1 158 ? -33.258  -39.476 -3.286  1.00 102.63 ?  1632 GLY C C   1 
ATOM   5216 O O   . GLY C  1 158 ? -33.964  -39.763 -4.260  1.00 97.75  ?  1632 GLY C O   1 
ATOM   5217 N N   . MET C  1 159 ? -33.100  -38.223 -2.832  1.00 107.37 ?  1633 MET C N   1 
ATOM   5218 C CA  . MET C  1 159 ? -33.705  -37.027 -3.407  1.00 107.23 ?  1633 MET C CA  1 
ATOM   5219 C C   . MET C  1 159 ? -32.883  -36.501 -4.580  1.00 111.57 ?  1633 MET C C   1 
ATOM   5220 O O   . MET C  1 159 ? -33.463  -35.873 -5.456  1.00 103.35 ?  1633 MET C O   1 
ATOM   5221 C CB  . MET C  1 159 ? -33.785  -35.910 -2.358  1.00 100.75 ?  1633 MET C CB  1 
ATOM   5222 C CG  . MET C  1 159 ? -34.715  -36.189 -1.212  1.00 100.32 ?  1633 MET C CG  1 
ATOM   5223 S SD  . MET C  1 159 ? -34.201  -35.236 0.234   1.00 93.65  ?  1633 MET C SD  1 
ATOM   5224 C CE  . MET C  1 159 ? -34.710  -33.573 -0.247  1.00 94.74  ?  1633 MET C CE  1 
ATOM   5225 N N   . LEU C  1 160 ? -31.537  -36.716 -4.579  1.00 120.04 ?  1634 LEU C N   1 
ATOM   5226 C CA  . LEU C  1 160 ? -30.569  -36.218 -5.577  1.00 116.54 ?  1634 LEU C CA  1 
ATOM   5227 C C   . LEU C  1 160 ? -31.049  -36.246 -7.035  1.00 116.36 ?  1634 LEU C C   1 
ATOM   5228 O O   . LEU C  1 160 ? -30.609  -35.409 -7.824  1.00 102.45 ?  1634 LEU C O   1 
ATOM   5229 C CB  . LEU C  1 160 ? -29.205  -36.926 -5.465  1.00 113.88 ?  1634 LEU C CB  1 
ATOM   5230 C CG  . LEU C  1 160 ? -28.188  -36.349 -4.456  1.00 116.96 ?  1634 LEU C CG  1 
ATOM   5231 C CD1 . LEU C  1 160 ? -26.964  -37.237 -4.359  1.00 118.09 ?  1634 LEU C CD1 1 
ATOM   5232 C CD2 . LEU C  1 160 ? -27.731  -34.944 -4.843  1.00 112.06 ?  1634 LEU C CD2 1 
ATOM   5233 N N   . SER C  1 161 ? -31.949  -37.191 -7.378  1.00 120.43 ?  1635 SER C N   1 
ATOM   5234 C CA  . SER C  1 161 ? -32.541  -37.357 -8.710  1.00 118.20 ?  1635 SER C CA  1 
ATOM   5235 C C   . SER C  1 161 ? -33.669  -36.333 -8.931  1.00 113.74 ?  1635 SER C C   1 
ATOM   5236 O O   . SER C  1 161 ? -33.695  -35.652 -9.960  1.00 106.73 ?  1635 SER C O   1 
ATOM   5237 C CB  . SER C  1 161 ? -33.060  -38.783 -8.875  1.00 116.31 ?  1635 SER C CB  1 
ATOM   5238 O OG  . SER C  1 161 ? -32.093  -39.738 -8.460  1.00 111.79 ?  1635 SER C OG  1 
ATOM   5239 N N   . VAL C  1 162 ? -34.576  -36.217 -7.939  1.00 108.16 ?  1636 VAL C N   1 
ATOM   5240 C CA  . VAL C  1 162 ? -35.708  -35.281 -7.888  1.00 102.90 ?  1636 VAL C CA  1 
ATOM   5241 C C   . VAL C  1 162 ? -35.164  -33.836 -7.836  1.00 91.84  ?  1636 VAL C C   1 
ATOM   5242 O O   . VAL C  1 162 ? -35.696  -32.965 -8.525  1.00 74.41  ?  1636 VAL C O   1 
ATOM   5243 C CB  . VAL C  1 162 ? -36.653  -35.588 -6.685  1.00 108.97 ?  1636 VAL C CB  1 
ATOM   5244 C CG1 . VAL C  1 162 ? -38.008  -34.907 -6.853  1.00 107.78 ?  1636 VAL C CG1 1 
ATOM   5245 C CG2 . VAL C  1 162 ? -36.837  -37.094 -6.476  1.00 112.18 ?  1636 VAL C CG2 1 
ATOM   5246 N N   . ILE C  1 163 ? -34.087  -33.606 -7.032  1.00 91.95  ?  1637 ILE C N   1 
ATOM   5247 C CA  . ILE C  1 163 ? -33.371  -32.328 -6.858  1.00 89.16  ?  1637 ILE C CA  1 
ATOM   5248 C C   . ILE C  1 163 ? -32.808  -31.893 -8.216  1.00 84.63  ?  1637 ILE C C   1 
ATOM   5249 O O   . ILE C  1 163 ? -33.013  -30.746 -8.619  1.00 77.44  ?  1637 ILE C O   1 
ATOM   5250 C CB  . ILE C  1 163 ? -32.227  -32.434 -5.791  1.00 90.63  ?  1637 ILE C CB  1 
ATOM   5251 C CG1 . ILE C  1 163 ? -32.747  -32.867 -4.378  1.00 99.74  ?  1637 ILE C CG1 1 
ATOM   5252 C CG2 . ILE C  1 163 ? -31.369  -31.158 -5.716  1.00 81.63  ?  1637 ILE C CG2 1 
ATOM   5253 C CD1 . ILE C  1 163 ? -33.492  -31.835 -3.475  1.00 101.59 ?  1637 ILE C CD1 1 
ATOM   5254 N N   . ALA C  1 164 ? -32.113  -32.825 -8.916  1.00 89.46  ?  1638 ALA C N   1 
ATOM   5255 C CA  . ALA C  1 164 ? -31.498  -32.613 -10.227 1.00 93.49  ?  1638 ALA C CA  1 
ATOM   5256 C C   . ALA C  1 164 ? -32.510  -32.175 -11.284 1.00 90.83  ?  1638 ALA C C   1 
ATOM   5257 O O   . ALA C  1 164 ? -32.206  -31.245 -12.034 1.00 80.27  ?  1638 ALA C O   1 
ATOM   5258 C CB  . ALA C  1 164 ? -30.768  -33.865 -10.679 1.00 98.81  ?  1638 ALA C CB  1 
ATOM   5259 N N   . LEU C  1 165 ? -33.715  -32.808 -11.327 1.00 91.95  ?  1639 LEU C N   1 
ATOM   5260 C CA  . LEU C  1 165 ? -34.761  -32.428 -12.286 1.00 87.93  ?  1639 LEU C CA  1 
ATOM   5261 C C   . LEU C  1 165 ? -35.365  -31.055 -11.965 1.00 82.90  ?  1639 LEU C C   1 
ATOM   5262 O O   . LEU C  1 165 ? -35.743  -30.331 -12.888 1.00 81.85  ?  1639 LEU C O   1 
ATOM   5263 C CB  . LEU C  1 165 ? -35.858  -33.504 -12.436 1.00 85.82  ?  1639 LEU C CB  1 
ATOM   5264 C CG  . LEU C  1 165 ? -36.966  -33.234 -13.489 1.00 88.82  ?  1639 LEU C CG  1 
ATOM   5265 C CD1 . LEU C  1 165 ? -36.396  -33.048 -14.885 1.00 90.34  ?  1639 LEU C CD1 1 
ATOM   5266 C CD2 . LEU C  1 165 ? -38.012  -34.321 -13.493 1.00 94.30  ?  1639 LEU C CD2 1 
ATOM   5267 N N   . MET C  1 166 ? -35.436  -30.695 -10.667 1.00 78.52  ?  1640 MET C N   1 
ATOM   5268 C CA  . MET C  1 166 ? -35.950  -29.403 -10.207 1.00 78.74  ?  1640 MET C CA  1 
ATOM   5269 C C   . MET C  1 166 ? -34.996  -28.268 -10.642 1.00 75.25  ?  1640 MET C C   1 
ATOM   5270 O O   . MET C  1 166 ? -35.458  -27.208 -11.083 1.00 62.42  ?  1640 MET C O   1 
ATOM   5271 C CB  . MET C  1 166 ? -36.170  -29.432 -8.683  1.00 85.14  ?  1640 MET C CB  1 
ATOM   5272 C CG  . MET C  1 166 ? -36.913  -28.223 -8.123  1.00 91.60  ?  1640 MET C CG  1 
ATOM   5273 S SD  . MET C  1 166 ? -38.671  -28.114 -8.543  1.00 88.43  ?  1640 MET C SD  1 
ATOM   5274 C CE  . MET C  1 166 ? -38.601  -26.863 -9.786  1.00 94.56  ?  1640 MET C CE  1 
ATOM   5275 N N   . THR C  1 167 ? -33.669  -28.528 -10.568 1.00 81.87  ?  1641 THR C N   1 
ATOM   5276 C CA  . THR C  1 167 ? -32.621  -27.597 -10.994 1.00 82.30  ?  1641 THR C CA  1 
ATOM   5277 C C   . THR C  1 167 ? -32.699  -27.473 -12.502 1.00 80.47  ?  1641 THR C C   1 
ATOM   5278 O O   . THR C  1 167 ? -32.706  -26.358 -13.020 1.00 68.44  ?  1641 THR C O   1 
ATOM   5279 C CB  . THR C  1 167 ? -31.223  -28.102 -10.611 1.00 80.85  ?  1641 THR C CB  1 
ATOM   5280 O OG1 . THR C  1 167 ? -31.277  -28.841 -9.399  1.00 85.34  ?  1641 THR C OG1 1 
ATOM   5281 C CG2 . THR C  1 167 ? -30.203  -26.980 -10.510 1.00 78.99  ?  1641 THR C CG2 1 
ATOM   5282 N N   . LEU C  1 168 ? -32.771  -28.628 -13.202 1.00 84.78  ?  1642 LEU C N   1 
ATOM   5283 C CA  . LEU C  1 168 ? -32.852  -28.706 -14.660 1.00 94.48  ?  1642 LEU C CA  1 
ATOM   5284 C C   . LEU C  1 168 ? -34.071  -27.966 -15.193 1.00 98.84  ?  1642 LEU C C   1 
ATOM   5285 O O   . LEU C  1 168 ? -33.931  -27.233 -16.169 1.00 93.19  ?  1642 LEU C O   1 
ATOM   5286 C CB  . LEU C  1 168 ? -32.820  -30.166 -15.144 1.00 96.88  ?  1642 LEU C CB  1 
ATOM   5287 C CG  . LEU C  1 168 ? -32.621  -30.399 -16.646 1.00 110.63 ?  1642 LEU C CG  1 
ATOM   5288 C CD1 . LEU C  1 168 ? -31.226  -29.972 -17.107 1.00 113.51 ?  1642 LEU C CD1 1 
ATOM   5289 C CD2 . LEU C  1 168 ? -32.860  -31.852 -16.989 1.00 126.52 ?  1642 LEU C CD2 1 
ATOM   5290 N N   . PHE C  1 169 ? -35.236  -28.106 -14.517 1.00 99.65  ?  1643 PHE C N   1 
ATOM   5291 C CA  . PHE C  1 169 ? -36.473  -27.419 -14.879 1.00 95.10  ?  1643 PHE C CA  1 
ATOM   5292 C C   . PHE C  1 169 ? -36.329  -25.919 -14.694 1.00 90.93  ?  1643 PHE C C   1 
ATOM   5293 O O   . PHE C  1 169 ? -36.819  -25.156 -15.523 1.00 84.00  ?  1643 PHE C O   1 
ATOM   5294 C CB  . PHE C  1 169 ? -37.675  -27.949 -14.081 1.00 100.28 ?  1643 PHE C CB  1 
ATOM   5295 C CG  . PHE C  1 169 ? -38.403  -29.118 -14.702 1.00 109.30 ?  1643 PHE C CG  1 
ATOM   5296 C CD1 . PHE C  1 169 ? -38.449  -29.280 -16.084 1.00 113.25 ?  1643 PHE C CD1 1 
ATOM   5297 C CD2 . PHE C  1 169 ? -39.091  -30.027 -13.910 1.00 107.27 ?  1643 PHE C CD2 1 
ATOM   5298 C CE1 . PHE C  1 169 ? -39.131  -30.355 -16.657 1.00 113.19 ?  1643 PHE C CE1 1 
ATOM   5299 C CE2 . PHE C  1 169 ? -39.785  -31.096 -14.485 1.00 102.91 ?  1643 PHE C CE2 1 
ATOM   5300 C CZ  . PHE C  1 169 ? -39.799  -31.255 -15.854 1.00 104.99 ?  1643 PHE C CZ  1 
ATOM   5301 N N   . PHE C  1 170 ? -35.619  -25.497 -13.636 1.00 95.44  ?  1644 PHE C N   1 
ATOM   5302 C CA  . PHE C  1 170 ? -35.382  -24.082 -13.353 1.00 93.89  ?  1644 PHE C CA  1 
ATOM   5303 C C   . PHE C  1 170 ? -34.608  -23.386 -14.453 1.00 91.18  ?  1644 PHE C C   1 
ATOM   5304 O O   . PHE C  1 170 ? -34.918  -22.241 -14.754 1.00 79.23  ?  1644 PHE C O   1 
ATOM   5305 C CB  . PHE C  1 170 ? -34.653  -23.898 -12.023 1.00 20.00  ?  1644 PHE C CB  1 
ATOM   5306 C CG  . PHE C  1 170 ? -35.505  -23.363 -10.896 1.00 20.00  ?  1644 PHE C CG  1 
ATOM   5307 C CD1 . PHE C  1 170 ? -35.785  -21.995 -10.798 1.00 20.00  ?  1644 PHE C CD1 1 
ATOM   5308 C CD2 . PHE C  1 170 ? -36.011  -24.223 -9.914  1.00 20.00  ?  1644 PHE C CD2 1 
ATOM   5309 C CE1 . PHE C  1 170 ? -36.554  -21.492 -9.729  1.00 20.00  ?  1644 PHE C CE1 1 
ATOM   5310 C CE2 . PHE C  1 170 ? -36.794  -23.724 -8.854  1.00 20.00  ?  1644 PHE C CE2 1 
ATOM   5311 C CZ  . PHE C  1 170 ? -37.062  -22.362 -8.767  1.00 20.00  ?  1644 PHE C CZ  1 
ATOM   5312 N N   . TYR C  1 171 ? -33.610  -24.068 -15.047 1.00 93.62  ?  1645 TYR C N   1 
ATOM   5313 C CA  . TYR C  1 171 ? -32.788  -23.522 -16.124 1.00 103.20 ?  1645 TYR C CA  1 
ATOM   5314 C C   . TYR C  1 171 ? -33.596  -23.177 -17.367 1.00 103.74 ?  1645 TYR C C   1 
ATOM   5315 O O   . TYR C  1 171 ? -33.391  -22.106 -17.940 1.00 96.00  ?  1645 TYR C O   1 
ATOM   5316 C CB  . TYR C  1 171 ? -31.622  -24.460 -16.464 1.00 105.20 ?  1645 TYR C CB  1 
ATOM   5317 C CG  . TYR C  1 171 ? -30.445  -24.298 -15.532 1.00 104.64 ?  1645 TYR C CG  1 
ATOM   5318 C CD1 . TYR C  1 171 ? -29.550  -23.241 -15.684 1.00 100.15 ?  1645 TYR C CD1 1 
ATOM   5319 C CD2 . TYR C  1 171 ? -30.223  -25.197 -14.494 1.00 102.02 ?  1645 TYR C CD2 1 
ATOM   5320 C CE1 . TYR C  1 171 ? -28.473  -23.074 -14.815 1.00 102.05 ?  1645 TYR C CE1 1 
ATOM   5321 C CE2 . TYR C  1 171 ? -29.147  -25.044 -13.621 1.00 101.10 ?  1645 TYR C CE2 1 
ATOM   5322 C CZ  . TYR C  1 171 ? -28.271  -23.983 -13.788 1.00 104.09 ?  1645 TYR C CZ  1 
ATOM   5323 O OH  . TYR C  1 171 ? -27.207  -23.823 -12.934 1.00 103.75 ?  1645 TYR C OH  1 
ATOM   5324 N N   . ILE C  1 172 ? -34.538  -24.065 -17.755 1.00 99.78  ?  1646 ILE C N   1 
ATOM   5325 C CA  . ILE C  1 172 ? -35.421  -23.896 -18.919 1.00 100.39 ?  1646 ILE C CA  1 
ATOM   5326 C C   . ILE C  1 172 ? -36.273  -22.636 -18.729 1.00 101.65 ?  1646 ILE C C   1 
ATOM   5327 O O   . ILE C  1 172 ? -36.316  -21.786 -19.619 1.00 106.45 ?  1646 ILE C O   1 
ATOM   5328 C CB  . ILE C  1 172 ? -36.323  -25.141 -19.202 1.00 98.84  ?  1646 ILE C CB  1 
ATOM   5329 C CG1 . ILE C  1 172 ? -35.761  -26.471 -18.621 1.00 99.98  ?  1646 ILE C CG1 1 
ATOM   5330 C CG2 . ILE C  1 172 ? -36.640  -25.273 -20.682 1.00 98.66  ?  1646 ILE C CG2 1 
ATOM   5331 C CD1 . ILE C  1 172 ? -34.551  -27.145 -19.311 1.00 100.41 ?  1646 ILE C CD1 1 
ATOM   5332 N N   . PHE C  1 173 ? -36.910  -22.512 -17.548 1.00 94.14  ?  1647 PHE C N   1 
ATOM   5333 C CA  . PHE C  1 173 ? -37.747  -21.382 -17.174 1.00 93.28  ?  1647 PHE C CA  1 
ATOM   5334 C C   . PHE C  1 173 ? -36.941  -20.095 -17.012 1.00 90.27  ?  1647 PHE C C   1 
ATOM   5335 O O   . PHE C  1 173 ? -37.424  -19.040 -17.410 1.00 81.68  ?  1647 PHE C O   1 
ATOM   5336 C CB  . PHE C  1 173 ? -38.524  -21.690 -15.893 1.00 92.48  ?  1647 PHE C CB  1 
ATOM   5337 C CG  . PHE C  1 173 ? -39.648  -22.686 -16.036 1.00 88.68  ?  1647 PHE C CG  1 
ATOM   5338 C CD1 . PHE C  1 173 ? -40.836  -22.333 -16.663 1.00 81.62  ?  1647 PHE C CD1 1 
ATOM   5339 C CD2 . PHE C  1 173 ? -39.556  -23.946 -15.460 1.00 84.38  ?  1647 PHE C CD2 1 
ATOM   5340 C CE1 . PHE C  1 173 ? -41.890  -23.242 -16.758 1.00 81.56  ?  1647 PHE C CE1 1 
ATOM   5341 C CE2 . PHE C  1 173 ? -40.611  -24.857 -15.554 1.00 77.78  ?  1647 PHE C CE2 1 
ATOM   5342 C CZ  . PHE C  1 173 ? -41.772  -24.498 -16.199 1.00 79.95  ?  1647 PHE C CZ  1 
ATOM   5343 N N   . ALA C  1 174 ? -35.718  -20.180 -16.441 1.00 89.49  ?  1648 ALA C N   1 
ATOM   5344 C CA  . ALA C  1 174 ? -34.819  -19.038 -16.239 1.00 85.25  ?  1648 ALA C CA  1 
ATOM   5345 C C   . ALA C  1 174 ? -34.342  -18.442 -17.557 1.00 84.52  ?  1648 ALA C C   1 
ATOM   5346 O O   . ALA C  1 174 ? -34.155  -17.224 -17.628 1.00 77.80  ?  1648 ALA C O   1 
ATOM   5347 C CB  . ALA C  1 174 ? -33.631  -19.436 -15.391 1.00 81.98  ?  1648 ALA C CB  1 
ATOM   5348 N N   . ILE C  1 175 ? -34.145  -19.297 -18.597 1.00 82.75  ?  1649 ILE C N   1 
ATOM   5349 C CA  . ILE C  1 175 ? -33.746  -18.885 -19.951 1.00 92.18  ?  1649 ILE C CA  1 
ATOM   5350 C C   . ILE C  1 175 ? -34.955  -18.218 -20.638 1.00 96.52  ?  1649 ILE C C   1 
ATOM   5351 O O   . ILE C  1 175 ? -34.793  -17.232 -21.362 1.00 92.81  ?  1649 ILE C O   1 
ATOM   5352 C CB  . ILE C  1 175 ? -33.143  -20.082 -20.756 1.00 96.93  ?  1649 ILE C CB  1 
ATOM   5353 C CG1 . ILE C  1 175 ? -31.735  -20.442 -20.225 1.00 105.65 ?  1649 ILE C CG1 1 
ATOM   5354 C CG2 . ILE C  1 175 ? -33.077  -19.781 -22.267 1.00 98.68  ?  1649 ILE C CG2 1 
ATOM   5355 C CD1 . ILE C  1 175 ? -31.215  -21.846 -20.531 1.00 115.14 ?  1649 ILE C CD1 1 
ATOM   5356 N N   . MET C  1 176 ? -36.163  -18.745 -20.367 1.00 99.58  ?  1650 MET C N   1 
ATOM   5357 C CA  . MET C  1 176 ? -37.428  -18.255 -20.903 1.00 93.54  ?  1650 MET C CA  1 
ATOM   5358 C C   . MET C  1 176 ? -37.818  -16.902 -20.328 1.00 85.51  ?  1650 MET C C   1 
ATOM   5359 O O   . MET C  1 176 ? -38.192  -16.017 -21.097 1.00 90.29  ?  1650 MET C O   1 
ATOM   5360 C CB  . MET C  1 176 ? -38.548  -19.264 -20.642 1.00 94.33  ?  1650 MET C CB  1 
ATOM   5361 C CG  . MET C  1 176 ? -38.546  -20.426 -21.584 1.00 91.47  ?  1650 MET C CG  1 
ATOM   5362 S SD  . MET C  1 176 ? -39.692  -21.725 -21.101 1.00 96.97  ?  1650 MET C SD  1 
ATOM   5363 C CE  . MET C  1 176 ? -41.196  -21.120 -21.855 1.00 90.85  ?  1650 MET C CE  1 
ATOM   5364 N N   . ALA C  1 177 ? -37.745  -16.739 -18.985 1.00 76.67  ?  1651 ALA C N   1 
ATOM   5365 C CA  . ALA C  1 177 ? -38.106  -15.507 -18.278 1.00 82.86  ?  1651 ALA C CA  1 
ATOM   5366 C C   . ALA C  1 177 ? -37.352  -14.286 -18.801 1.00 86.62  ?  1651 ALA C C   1 
ATOM   5367 O O   . ALA C  1 177 ? -37.999  -13.337 -19.240 1.00 89.37  ?  1651 ALA C O   1 
ATOM   5368 C CB  . ALA C  1 177 ? -37.895  -15.673 -16.785 1.00 90.24  ?  1651 ALA C CB  1 
ATOM   5369 N N   . THR C  1 178 ? -35.997  -14.339 -18.813 1.00 95.38  ?  1652 THR C N   1 
ATOM   5370 C CA  . THR C  1 178 ? -35.099  -13.280 -19.315 1.00 97.04  ?  1652 THR C CA  1 
ATOM   5371 C C   . THR C  1 178 ? -35.473  -12.880 -20.737 1.00 100.40 ?  1652 THR C C   1 
ATOM   5372 O O   . THR C  1 178 ? -35.549  -11.693 -21.051 1.00 100.22 ?  1652 THR C O   1 
ATOM   5373 C CB  . THR C  1 178 ? -33.645  -13.771 -19.345 1.00 92.12  ?  1652 THR C CB  1 
ATOM   5374 O OG1 . THR C  1 178 ? -33.615  -15.137 -19.753 1.00 91.41  ?  1652 THR C OG1 1 
ATOM   5375 C CG2 . THR C  1 178 ? -32.945  -13.611 -18.037 1.00 88.76  ?  1652 THR C CG2 1 
ATOM   5376 N N   . GLN C  1 179 ? -35.697  -13.894 -21.588 1.00 105.20 ?  1653 GLN C N   1 
ATOM   5377 C CA  . GLN C  1 179 ? -36.072  -13.792 -22.991 1.00 99.27  ?  1653 GLN C CA  1 
ATOM   5378 C C   . GLN C  1 179 ? -37.378  -13.002 -23.108 1.00 93.91  ?  1653 GLN C C   1 
ATOM   5379 O O   . GLN C  1 179 ? -37.370  -11.899 -23.650 1.00 90.22  ?  1653 GLN C O   1 
ATOM   5380 C CB  . GLN C  1 179 ? -36.230  -15.222 -23.561 1.00 95.96  ?  1653 GLN C CB  1 
ATOM   5381 C CG  . GLN C  1 179 ? -36.300  -15.352 -25.081 1.00 94.31  ?  1653 GLN C CG  1 
ATOM   5382 C CD  . GLN C  1 179 ? -36.925  -16.665 -25.519 1.00 95.56  ?  1653 GLN C CD  1 
ATOM   5383 O OE1 . GLN C  1 179 ? -37.864  -16.686 -26.323 1.00 100.64 ?  1653 GLN C OE1 1 
ATOM   5384 N NE2 . GLN C  1 179 ? -36.430  -17.793 -25.008 1.00 92.64  ?  1653 GLN C NE2 1 
ATOM   5385 N N   . LEU C  1 180 ? -38.463  -13.529 -22.515 1.00 95.02  ?  1654 LEU C N   1 
ATOM   5386 C CA  . LEU C  1 180 ? -39.810  -12.975 -22.585 1.00 100.80 ?  1654 LEU C CA  1 
ATOM   5387 C C   . LEU C  1 180 ? -40.040  -11.635 -21.876 1.00 110.54 ?  1654 LEU C C   1 
ATOM   5388 O O   . LEU C  1 180 ? -40.534  -10.703 -22.514 1.00 124.08 ?  1654 LEU C O   1 
ATOM   5389 C CB  . LEU C  1 180 ? -40.835  -13.996 -22.072 1.00 94.50  ?  1654 LEU C CB  1 
ATOM   5390 C CG  . LEU C  1 180 ? -40.905  -15.338 -22.779 1.00 92.78  ?  1654 LEU C CG  1 
ATOM   5391 C CD1 . LEU C  1 180 ? -41.365  -16.417 -21.824 1.00 91.97  ?  1654 LEU C CD1 1 
ATOM   5392 C CD2 . LEU C  1 180 ? -41.805  -15.275 -23.997 1.00 95.19  ?  1654 LEU C CD2 1 
ATOM   5393 N N   . PHE C  1 181 ? -39.741  -11.550 -20.563 1.00 103.34 ?  1655 PHE C N   1 
ATOM   5394 C CA  . PHE C  1 181 ? -40.053  -10.380 -19.733 1.00 97.28  ?  1655 PHE C CA  1 
ATOM   5395 C C   . PHE C  1 181 ? -38.912  -9.408  -19.476 1.00 104.01 ?  1655 PHE C C   1 
ATOM   5396 O O   . PHE C  1 181 ? -39.169  -8.211  -19.387 1.00 118.93 ?  1655 PHE C O   1 
ATOM   5397 C CB  . PHE C  1 181 ? -40.649  -10.830 -18.386 1.00 92.71  ?  1655 PHE C CB  1 
ATOM   5398 C CG  . PHE C  1 181 ? -41.611  -11.992 -18.481 1.00 94.81  ?  1655 PHE C CG  1 
ATOM   5399 C CD1 . PHE C  1 181 ? -42.884  -11.823 -19.016 1.00 103.82 ?  1655 PHE C CD1 1 
ATOM   5400 C CD2 . PHE C  1 181 ? -41.235  -13.261 -18.062 1.00 99.87  ?  1655 PHE C CD2 1 
ATOM   5401 C CE1 . PHE C  1 181 ? -43.769  -12.901 -19.115 1.00 107.74 ?  1655 PHE C CE1 1 
ATOM   5402 C CE2 . PHE C  1 181 ? -42.119  -14.338 -18.165 1.00 109.50 ?  1655 PHE C CE2 1 
ATOM   5403 C CZ  . PHE C  1 181 ? -43.382  -14.150 -18.686 1.00 110.58 ?  1655 PHE C CZ  1 
ATOM   5404 N N   . GLY C  1 182 ? -37.695  -9.931  -19.330 1.00 99.53  ?  1656 GLY C N   1 
ATOM   5405 C CA  . GLY C  1 182 ? -36.463  -9.203  -19.025 1.00 97.61  ?  1656 GLY C CA  1 
ATOM   5406 C C   . GLY C  1 182 ? -36.212  -7.824  -19.612 1.00 101.69 ?  1656 GLY C C   1 
ATOM   5407 O O   . GLY C  1 182 ? -35.414  -7.066  -19.052 1.00 104.86 ?  1656 GLY C O   1 
ATOM   5408 N N   . GLU C  1 183 ? -36.865  -7.486  -20.745 1.00 102.66 ?  1657 GLU C N   1 
ATOM   5409 C CA  . GLU C  1 183 ? -36.732  -6.182  -21.412 1.00 104.47 ?  1657 GLU C CA  1 
ATOM   5410 C C   . GLU C  1 183 ? -37.366  -5.081  -20.543 1.00 100.20 ?  1657 GLU C C   1 
ATOM   5411 O O   . GLU C  1 183 ? -36.660  -4.198  -20.050 1.00 90.28  ?  1657 GLU C O   1 
ATOM   5412 C CB  . GLU C  1 183 ? -37.391  -6.201  -22.813 1.00 114.17 ?  1657 GLU C CB  1 
ATOM   5413 C CG  . GLU C  1 183 ? -36.934  -7.326  -23.734 1.00 124.29 ?  1657 GLU C CG  1 
ATOM   5414 C CD  . GLU C  1 183 ? -38.043  -8.046  -24.484 1.00 130.08 ?  1657 GLU C CD  1 
ATOM   5415 O OE1 . GLU C  1 183 ? -39.012  -8.497  -23.830 1.00 126.77 ?  1657 GLU C OE1 1 
ATOM   5416 O OE2 . GLU C  1 183 ? -37.922  -8.194  -25.722 1.00 124.75 -1 1657 GLU C OE2 1 
ATOM   5417 N N   . ARG C  1 184 ? -38.692  -5.170  -20.328 1.00 103.51 ?  1658 ARG C N   1 
ATOM   5418 C CA  . ARG C  1 184 ? -39.478  -4.217  -19.544 1.00 105.89 ?  1658 ARG C CA  1 
ATOM   5419 C C   . ARG C  1 184 ? -39.344  -4.430  -18.033 1.00 105.02 ?  1658 ARG C C   1 
ATOM   5420 O O   . ARG C  1 184 ? -39.624  -3.502  -17.270 1.00 116.17 ?  1658 ARG C O   1 
ATOM   5421 C CB  . ARG C  1 184 ? -40.963  -4.253  -19.960 1.00 107.61 ?  1658 ARG C CB  1 
ATOM   5422 C CG  . ARG C  1 184 ? -41.217  -3.991  -21.443 1.00 107.96 ?  1658 ARG C CG  1 
ATOM   5423 C CD  . ARG C  1 184 ? -41.609  -2.555  -21.745 1.00 107.26 ?  1658 ARG C CD  1 
ATOM   5424 N NE  . ARG C  1 184 ? -42.352  -2.460  -23.005 1.00 117.81 ?  1658 ARG C NE  1 
ATOM   5425 C CZ  . ARG C  1 184 ? -41.793  -2.393  -24.211 1.00 129.20 ?  1658 ARG C CZ  1 
ATOM   5426 N NH1 . ARG C  1 184 ? -40.471  -2.408  -24.341 1.00 140.89 1  1658 ARG C NH1 1 
ATOM   5427 N NH2 . ARG C  1 184 ? -42.550  -2.316  -25.297 1.00 129.54 ?  1658 ARG C NH2 1 
ATOM   5428 N N   . PHE C  1 185 ? -38.914  -5.633  -17.592 1.00 97.89  ?  1659 PHE C N   1 
ATOM   5429 C CA  . PHE C  1 185 ? -38.767  -5.941  -16.160 1.00 97.27  ?  1659 PHE C CA  1 
ATOM   5430 C C   . PHE C  1 185 ? -37.340  -6.399  -15.778 1.00 98.84  ?  1659 PHE C C   1 
ATOM   5431 O O   . PHE C  1 185 ? -37.187  -7.504  -15.248 1.00 100.06 ?  1659 PHE C O   1 
ATOM   5432 C CB  . PHE C  1 185 ? -39.837  -6.955  -15.713 1.00 96.21  ?  1659 PHE C CB  1 
ATOM   5433 C CG  . PHE C  1 185 ? -41.257  -6.473  -15.894 1.00 87.48  ?  1659 PHE C CG  1 
ATOM   5434 C CD1 . PHE C  1 185 ? -41.884  -6.550  -17.133 1.00 80.63  ?  1659 PHE C CD1 1 
ATOM   5435 C CD2 . PHE C  1 185 ? -41.968  -5.946  -14.827 1.00 83.01  ?  1659 PHE C CD2 1 
ATOM   5436 C CE1 . PHE C  1 185 ? -43.190  -6.096  -17.299 1.00 81.41  ?  1659 PHE C CE1 1 
ATOM   5437 C CE2 . PHE C  1 185 ? -43.282  -5.506  -14.991 1.00 83.69  ?  1659 PHE C CE2 1 
ATOM   5438 C CZ  . PHE C  1 185 ? -43.880  -5.577  -16.227 1.00 85.14  ?  1659 PHE C CZ  1 
ATOM   5439 N N   . PRO C  1 186 ? -36.286  -5.560  -16.007 1.00 97.83  ?  1660 PRO C N   1 
ATOM   5440 C CA  . PRO C  1 186 ? -34.917  -5.983  -15.659 1.00 91.62  ?  1660 PRO C CA  1 
ATOM   5441 C C   . PRO C  1 186 ? -34.665  -6.126  -14.161 1.00 88.12  ?  1660 PRO C C   1 
ATOM   5442 O O   . PRO C  1 186 ? -33.796  -6.902  -13.767 1.00 79.32  ?  1660 PRO C O   1 
ATOM   5443 C CB  . PRO C  1 186 ? -34.039  -4.881  -16.262 1.00 91.67  ?  1660 PRO C CB  1 
ATOM   5444 C CG  . PRO C  1 186 ? -34.922  -4.130  -17.203 1.00 93.89  ?  1660 PRO C CG  1 
ATOM   5445 C CD  . PRO C  1 186 ? -36.270  -4.207  -16.601 1.00 95.30  ?  1660 PRO C CD  1 
ATOM   5446 N N   . GLU C  1 187 ? -35.432  -5.384  -13.332 1.00 92.69  ?  1661 GLU C N   1 
ATOM   5447 C CA  . GLU C  1 187 ? -35.353  -5.406  -11.868 1.00 103.24 ?  1661 GLU C CA  1 
ATOM   5448 C C   . GLU C  1 187 ? -35.639  -6.806  -11.292 1.00 96.04  ?  1661 GLU C C   1 
ATOM   5449 O O   . GLU C  1 187 ? -35.193  -7.119  -10.183 1.00 89.23  ?  1661 GLU C O   1 
ATOM   5450 C CB  . GLU C  1 187 ? -36.265  -4.323  -11.238 1.00 115.02 ?  1661 GLU C CB  1 
ATOM   5451 C CG  . GLU C  1 187 ? -37.769  -4.540  -11.388 1.00 120.89 ?  1661 GLU C CG  1 
ATOM   5452 C CD  . GLU C  1 187 ? -38.467  -3.893  -12.572 1.00 120.05 ?  1661 GLU C CD  1 
ATOM   5453 O OE1 . GLU C  1 187 ? -37.802  -3.617  -13.597 1.00 104.32 ?  1661 GLU C OE1 1 
ATOM   5454 O OE2 . GLU C  1 187 ? -39.698  -3.685  -12.480 1.00 127.41 -1 1661 GLU C OE2 1 
ATOM   5455 N N   . TRP C  1 188 ? -36.371  -7.638  -12.063 1.00 98.01  ?  1662 TRP C N   1 
ATOM   5456 C CA  . TRP C  1 188 ? -36.725  -8.999  -11.684 1.00 102.98 ?  1662 TRP C CA  1 
ATOM   5457 C C   . TRP C  1 188 ? -36.124  -10.044 -12.618 1.00 103.73 ?  1662 TRP C C   1 
ATOM   5458 O O   . TRP C  1 188 ? -35.770  -11.113 -12.137 1.00 96.44  ?  1662 TRP C O   1 
ATOM   5459 C CB  . TRP C  1 188 ? -38.258  -9.191  -11.627 1.00 109.88 ?  1662 TRP C CB  1 
ATOM   5460 C CG  . TRP C  1 188 ? -39.008  -8.305  -10.670 1.00 101.58 ?  1662 TRP C CG  1 
ATOM   5461 C CD1 . TRP C  1 188 ? -38.605  -7.900  -9.431  1.00 101.24 ?  1662 TRP C CD1 1 
ATOM   5462 C CD2 . TRP C  1 188 ? -40.341  -7.807  -10.839 1.00 94.88  ?  1662 TRP C CD2 1 
ATOM   5463 N NE1 . TRP C  1 188 ? -39.578  -7.127  -8.846  1.00 97.52  ?  1662 TRP C NE1 1 
ATOM   5464 C CE2 . TRP C  1 188 ? -40.659  -7.059  -9.686  1.00 96.27  ?  1662 TRP C CE2 1 
ATOM   5465 C CE3 . TRP C  1 188 ? -41.292  -7.895  -11.871 1.00 100.06 ?  1662 TRP C CE3 1 
ATOM   5466 C CZ2 . TRP C  1 188 ? -41.883  -6.395  -9.538  1.00 97.77  ?  1662 TRP C CZ2 1 
ATOM   5467 C CZ3 . TRP C  1 188 ? -42.516  -7.261  -11.710 1.00 100.09 ?  1662 TRP C CZ3 1 
ATOM   5468 C CH2 . TRP C  1 188 ? -42.796  -6.509  -10.563 1.00 96.83  ?  1662 TRP C CH2 1 
ATOM   5469 N N   . PHE C  1 189 ? -36.056  -9.771  -13.945 1.00 105.20 ?  1663 PHE C N   1 
ATOM   5470 C CA  . PHE C  1 189 ? -35.596  -10.750 -14.945 1.00 106.82 ?  1663 PHE C CA  1 
ATOM   5471 C C   . PHE C  1 189 ? -34.513  -10.274 -15.931 1.00 114.16 ?  1663 PHE C C   1 
ATOM   5472 O O   . PHE C  1 189 ? -34.485  -10.757 -17.065 1.00 131.03 ?  1663 PHE C O   1 
ATOM   5473 C CB  . PHE C  1 189 ? -36.801  -11.288 -15.749 1.00 105.34 ?  1663 PHE C CB  1 
ATOM   5474 C CG  . PHE C  1 189 ? -38.005  -11.705 -14.941 1.00 96.94  ?  1663 PHE C CG  1 
ATOM   5475 C CD1 . PHE C  1 189 ? -38.021  -12.917 -14.259 1.00 92.68  ?  1663 PHE C CD1 1 
ATOM   5476 C CD2 . PHE C  1 189 ? -39.133  -10.896 -14.881 1.00 83.25  ?  1663 PHE C CD2 1 
ATOM   5477 C CE1 . PHE C  1 189 ? -39.140  -13.307 -13.522 1.00 80.63  ?  1663 PHE C CE1 1 
ATOM   5478 C CE2 . PHE C  1 189 ? -40.246  -11.279 -14.131 1.00 80.63  ?  1663 PHE C CE2 1 
ATOM   5479 C CZ  . PHE C  1 189 ? -40.242  -12.481 -13.455 1.00 81.34  ?  1663 PHE C CZ  1 
ATOM   5480 N N   . GLY C  1 190 ? -33.623  -9.380  -15.497 1.00 114.57 ?  1664 GLY C N   1 
ATOM   5481 C CA  . GLY C  1 190 ? -32.535  -8.864  -16.331 1.00 114.31 ?  1664 GLY C CA  1 
ATOM   5482 C C   . GLY C  1 190 ? -31.610  -9.962  -16.818 1.00 103.17 ?  1664 GLY C C   1 
ATOM   5483 O O   . GLY C  1 190 ? -31.685  -10.376 -17.979 1.00 103.72 ?  1664 GLY C O   1 
ATOM   5484 N N   . THR C  1 191 ? -30.755  -10.455 -15.922 1.00 96.18  ?  1665 THR C N   1 
ATOM   5485 C CA  . THR C  1 191 ? -29.852  -11.569 -16.190 1.00 97.60  ?  1665 THR C CA  1 
ATOM   5486 C C   . THR C  1 191 ? -30.546  -12.859 -15.741 1.00 91.99  ?  1665 THR C C   1 
ATOM   5487 O O   . THR C  1 191 ? -31.605  -12.795 -15.105 1.00 90.50  ?  1665 THR C O   1 
ATOM   5488 C CB  . THR C  1 191 ? -28.466  -11.351 -15.514 1.00 109.03 ?  1665 THR C CB  1 
ATOM   5489 O OG1 . THR C  1 191 ? -27.682  -12.547 -15.608 1.00 117.92 ?  1665 THR C OG1 1 
ATOM   5490 C CG2 . THR C  1 191 ? -28.559  -10.934 -14.046 1.00 112.05 ?  1665 THR C CG2 1 
ATOM   5491 N N   . LEU C  1 192 ? -29.953  -14.025 -16.076 1.00 87.01  ?  1666 LEU C N   1 
ATOM   5492 C CA  . LEU C  1 192 ? -30.430  -15.347 -15.668 1.00 81.42  ?  1666 LEU C CA  1 
ATOM   5493 C C   . LEU C  1 192 ? -30.331  -15.480 -14.143 1.00 91.22  ?  1666 LEU C C   1 
ATOM   5494 O O   . LEU C  1 192 ? -31.016  -16.309 -13.539 1.00 102.97 ?  1666 LEU C O   1 
ATOM   5495 C CB  . LEU C  1 192 ? -29.588  -16.423 -16.334 1.00 70.77  ?  1666 LEU C CB  1 
ATOM   5496 C CG  . LEU C  1 192 ? -30.255  -17.768 -16.431 1.00 67.54  ?  1666 LEU C CG  1 
ATOM   5497 C CD1 . LEU C  1 192 ? -30.364  -18.188 -17.858 1.00 71.47  ?  1666 LEU C CD1 1 
ATOM   5498 C CD2 . LEU C  1 192 ? -29.526  -18.797 -15.589 1.00 65.57  ?  1666 LEU C CD2 1 
ATOM   5499 N N   . GLY C  1 193 ? -29.476  -14.651 -13.551 1.00 98.35  ?  1667 GLY C N   1 
ATOM   5500 C CA  . GLY C  1 193 ? -29.300  -14.560 -12.113 1.00 108.26 ?  1667 GLY C CA  1 
ATOM   5501 C C   . GLY C  1 193 ? -30.548  -14.024 -11.445 1.00 105.75 ?  1667 GLY C C   1 
ATOM   5502 O O   . GLY C  1 193 ? -31.071  -14.641 -10.510 1.00 104.75 ?  1667 GLY C O   1 
ATOM   5503 N N   . GLU C  1 194 ? -31.052  -12.881 -11.965 1.00 100.19 ?  1668 GLU C N   1 
ATOM   5504 C CA  . GLU C  1 194 ? -32.277  -12.218 -11.506 1.00 100.19 ?  1668 GLU C CA  1 
ATOM   5505 C C   . GLU C  1 194 ? -33.458  -13.147 -11.765 1.00 99.17  ?  1668 GLU C C   1 
ATOM   5506 O O   . GLU C  1 194 ? -34.304  -13.324 -10.884 1.00 95.51  ?  1668 GLU C O   1 
ATOM   5507 C CB  . GLU C  1 194 ? -32.496  -10.872 -12.229 1.00 95.97  ?  1668 GLU C CB  1 
ATOM   5508 C CG  . GLU C  1 194 ? -31.317  -9.922  -12.150 1.00 100.95 ?  1668 GLU C CG  1 
ATOM   5509 C CD  . GLU C  1 194 ? -31.603  -8.519  -11.656 1.00 109.19 ?  1668 GLU C CD  1 
ATOM   5510 O OE1 . GLU C  1 194 ? -31.263  -7.558  -12.386 1.00 102.38 ?  1668 GLU C OE1 1 
ATOM   5511 O OE2 . GLU C  1 194 ? -32.113  -8.377  -10.520 1.00 116.53 -1 1668 GLU C OE2 1 
ATOM   5512 N N   . SER C  1 195 ? -33.482  -13.768 -12.964 1.00 85.57  ?  1669 SER C N   1 
ATOM   5513 C CA  . SER C  1 195 ? -34.510  -14.697 -13.408 1.00 79.81  ?  1669 SER C CA  1 
ATOM   5514 C C   . SER C  1 195 ? -34.648  -15.896 -12.490 1.00 80.73  ?  1669 SER C C   1 
ATOM   5515 O O   . SER C  1 195 ? -35.771  -16.241 -12.145 1.00 85.79  ?  1669 SER C O   1 
ATOM   5516 C CB  . SER C  1 195 ? -34.230  -15.159 -14.830 1.00 77.03  ?  1669 SER C CB  1 
ATOM   5517 O OG  . SER C  1 195 ? -34.933  -14.346 -15.746 1.00 74.52  ?  1669 SER C OG  1 
ATOM   5518 N N   . PHE C  1 196 ? -33.519  -16.520 -12.081 1.00 83.40  ?  1670 PHE C N   1 
ATOM   5519 C CA  . PHE C  1 196 ? -33.496  -17.700 -11.204 1.00 81.50  ?  1670 PHE C CA  1 
ATOM   5520 C C   . PHE C  1 196 ? -34.106  -17.416 -9.829  1.00 82.43  ?  1670 PHE C C   1 
ATOM   5521 O O   . PHE C  1 196 ? -34.868  -18.234 -9.299  1.00 70.95  ?  1670 PHE C O   1 
ATOM   5522 C CB  . PHE C  1 196 ? -32.062  -18.227 -11.053 1.00 74.94  ?  1670 PHE C CB  1 
ATOM   5523 C CG  . PHE C  1 196 ? -31.886  -19.662 -11.490 1.00 70.58  ?  1670 PHE C CG  1 
ATOM   5524 C CD1 . PHE C  1 196 ? -32.188  -20.712 -10.629 1.00 73.37  ?  1670 PHE C CD1 1 
ATOM   5525 C CD2 . PHE C  1 196 ? -31.395  -19.965 -12.750 1.00 68.98  ?  1670 PHE C CD2 1 
ATOM   5526 C CE1 . PHE C  1 196 ? -32.010  -22.040 -11.028 1.00 73.08  ?  1670 PHE C CE1 1 
ATOM   5527 C CE2 . PHE C  1 196 ? -31.235  -21.294 -13.156 1.00 75.45  ?  1670 PHE C CE2 1 
ATOM   5528 C CZ  . PHE C  1 196 ? -31.541  -22.322 -12.290 1.00 72.89  ?  1670 PHE C CZ  1 
ATOM   5529 N N   . TYR C  1 197 ? -33.788  -16.228 -9.287  1.00 93.31  ?  1671 TYR C N   1 
ATOM   5530 C CA  . TYR C  1 197 ? -34.230  -15.723 -7.992  1.00 99.36  ?  1671 TYR C CA  1 
ATOM   5531 C C   . TYR C  1 197 ? -35.744  -15.482 -7.926  1.00 96.37  ?  1671 TYR C C   1 
ATOM   5532 O O   . TYR C  1 197 ? -36.392  -16.005 -7.018  1.00 98.82  ?  1671 TYR C O   1 
ATOM   5533 C CB  . TYR C  1 197 ? -33.420  -14.463 -7.621  1.00 103.34 ?  1671 TYR C CB  1 
ATOM   5534 C CG  . TYR C  1 197 ? -33.776  -13.854 -6.282  1.00 91.07  ?  1671 TYR C CG  1 
ATOM   5535 C CD1 . TYR C  1 197 ? -33.267  -14.378 -5.097  1.00 85.09  ?  1671 TYR C CD1 1 
ATOM   5536 C CD2 . TYR C  1 197 ? -34.597  -12.735 -6.201  1.00 82.01  ?  1671 TYR C CD2 1 
ATOM   5537 C CE1 . TYR C  1 197 ? -33.598  -13.827 -3.863  1.00 76.54  ?  1671 TYR C CE1 1 
ATOM   5538 C CE2 . TYR C  1 197 ? -34.928  -12.172 -4.973  1.00 76.59  ?  1671 TYR C CE2 1 
ATOM   5539 C CZ  . TYR C  1 197 ? -34.435  -12.728 -3.808  1.00 75.02  ?  1671 TYR C CZ  1 
ATOM   5540 O OH  . TYR C  1 197 ? -34.755  -12.155 -2.607  1.00 72.35  ?  1671 TYR C OH  1 
ATOM   5541 N N   . THR C  1 198 ? -36.300  -14.699 -8.880  1.00 91.61  ?  1672 THR C N   1 
ATOM   5542 C CA  . THR C  1 198 ? -37.732  -14.372 -8.953  1.00 87.01  ?  1672 THR C CA  1 
ATOM   5543 C C   . THR C  1 198 ? -38.583  -15.630 -9.101  1.00 82.05  ?  1672 THR C C   1 
ATOM   5544 O O   . THR C  1 198 ? -39.644  -15.726 -8.488  1.00 82.13  ?  1672 THR C O   1 
ATOM   5545 C CB  . THR C  1 198 ? -38.003  -13.349 -10.059 1.00 82.37  ?  1672 THR C CB  1 
ATOM   5546 O OG1 . THR C  1 198 ? -37.023  -12.316 -9.988  1.00 85.08  ?  1672 THR C OG1 1 
ATOM   5547 C CG2 . THR C  1 198 ? -39.383  -12.730 -9.958  1.00 74.74  ?  1672 THR C CG2 1 
ATOM   5548 N N   . LEU C  1 199 ? -38.100  -16.599 -9.893  1.00 82.78  ?  1673 LEU C N   1 
ATOM   5549 C CA  . LEU C  1 199 ? -38.770  -17.875 -10.119 1.00 81.23  ?  1673 LEU C CA  1 
ATOM   5550 C C   . LEU C  1 199 ? -38.808  -18.677 -8.836  1.00 81.42  ?  1673 LEU C C   1 
ATOM   5551 O O   . LEU C  1 199 ? -39.881  -19.152 -8.480  1.00 86.06  ?  1673 LEU C O   1 
ATOM   5552 C CB  . LEU C  1 199 ? -38.120  -18.658 -11.264 1.00 80.05  ?  1673 LEU C CB  1 
ATOM   5553 C CG  . LEU C  1 199 ? -38.440  -18.159 -12.667 1.00 82.17  ?  1673 LEU C CG  1 
ATOM   5554 C CD1 . LEU C  1 199 ? -37.453  -18.695 -13.662 1.00 79.51  ?  1673 LEU C CD1 1 
ATOM   5555 C CD2 . LEU C  1 199 ? -39.867  -18.492 -13.077 1.00 84.89  ?  1673 LEU C CD2 1 
ATOM   5556 N N   . PHE C  1 200 ? -37.678  -18.744 -8.088  1.00 79.95  ?  1674 PHE C N   1 
ATOM   5557 C CA  . PHE C  1 200 ? -37.621  -19.419 -6.790  1.00 77.45  ?  1674 PHE C CA  1 
ATOM   5558 C C   . PHE C  1 200 ? -38.644  -18.788 -5.835  1.00 83.24  ?  1674 PHE C C   1 
ATOM   5559 O O   . PHE C  1 200 ? -39.296  -19.501 -5.073  1.00 80.93  ?  1674 PHE C O   1 
ATOM   5560 C CB  . PHE C  1 200 ? -36.204  -19.352 -6.184  1.00 71.82  ?  1674 PHE C CB  1 
ATOM   5561 C CG  . PHE C  1 200 ? -36.137  -19.847 -4.754  1.00 67.34  ?  1674 PHE C CG  1 
ATOM   5562 C CD1 . PHE C  1 200 ? -36.048  -21.207 -4.474  1.00 70.78  ?  1674 PHE C CD1 1 
ATOM   5563 C CD2 . PHE C  1 200 ? -36.211  -18.958 -3.686  1.00 63.23  ?  1674 PHE C CD2 1 
ATOM   5564 C CE1 . PHE C  1 200 ? -36.024  -21.668 -3.150  1.00 71.59  ?  1674 PHE C CE1 1 
ATOM   5565 C CE2 . PHE C  1 200 ? -36.198  -19.422 -2.363  1.00 64.36  ?  1674 PHE C CE2 1 
ATOM   5566 C CZ  . PHE C  1 200 ? -36.097  -20.772 -2.105  1.00 68.62  ?  1674 PHE C CZ  1 
ATOM   5567 N N   . GLN C  1 201 ? -38.766  -17.449 -5.874  1.00 84.26  ?  1675 GLN C N   1 
ATOM   5568 C CA  . GLN C  1 201 ? -39.707  -16.701 -5.047  1.00 82.13  ?  1675 GLN C CA  1 
ATOM   5569 C C   . GLN C  1 201 ? -41.145  -17.042 -5.447  1.00 88.32  ?  1675 GLN C C   1 
ATOM   5570 O O   . GLN C  1 201 ? -41.978  -17.292 -4.572  1.00 97.95  ?  1675 GLN C O   1 
ATOM   5571 C CB  . GLN C  1 201 ? -39.439  -15.199 -5.146  1.00 74.76  ?  1675 GLN C CB  1 
ATOM   5572 C CG  . GLN C  1 201 ? -40.279  -14.393 -4.177  1.00 70.24  ?  1675 GLN C CG  1 
ATOM   5573 C CD  . GLN C  1 201 ? -40.617  -13.020 -4.671  1.00 68.31  ?  1675 GLN C CD  1 
ATOM   5574 O OE1 . GLN C  1 201 ? -39.972  -12.462 -5.550  1.00 73.11  ?  1675 GLN C OE1 1 
ATOM   5575 N NE2 . GLN C  1 201 ? -41.613  -12.419 -4.072  1.00 63.25  ?  1675 GLN C NE2 1 
ATOM   5576 N N   . VAL C  1 202 ? -41.415  -17.086 -6.774  1.00 81.31  ?  1676 VAL C N   1 
ATOM   5577 C CA  . VAL C  1 202 ? -42.713  -17.445 -7.350  1.00 69.56  ?  1676 VAL C CA  1 
ATOM   5578 C C   . VAL C  1 202 ? -43.047  -18.873 -6.887  1.00 69.38  ?  1676 VAL C C   1 
ATOM   5579 O O   . VAL C  1 202 ? -44.186  -19.141 -6.504  1.00 74.67  ?  1676 VAL C O   1 
ATOM   5580 C CB  . VAL C  1 202 ? -42.730  -17.240 -8.899  1.00 61.35  ?  1676 VAL C CB  1 
ATOM   5581 C CG1 . VAL C  1 202 ? -43.831  -18.047 -9.586  1.00 59.30  ?  1676 VAL C CG1 1 
ATOM   5582 C CG2 . VAL C  1 202 ? -42.859  -15.759 -9.252  1.00 58.69  ?  1676 VAL C CG2 1 
ATOM   5583 N N   . MET C  1 203 ? -42.013  -19.741 -6.824  1.00 72.49  ?  1677 MET C N   1 
ATOM   5584 C CA  . MET C  1 203 ? -42.069  -21.132 -6.364  1.00 79.59  ?  1677 MET C CA  1 
ATOM   5585 C C   . MET C  1 203 ? -42.443  -21.206 -4.874  1.00 84.45  ?  1677 MET C C   1 
ATOM   5586 O O   . MET C  1 203 ? -43.336  -21.974 -4.516  1.00 87.90  ?  1677 MET C O   1 
ATOM   5587 C CB  . MET C  1 203 ? -40.746  -21.867 -6.683  1.00 75.38  ?  1677 MET C CB  1 
ATOM   5588 C CG  . MET C  1 203 ? -40.333  -22.879 -5.647  1.00 76.24  ?  1677 MET C CG  1 
ATOM   5589 S SD  . MET C  1 203 ? -39.139  -24.041 -6.283  1.00 89.37  ?  1677 MET C SD  1 
ATOM   5590 C CE  . MET C  1 203 ? -39.022  -25.130 -4.918  1.00 86.90  ?  1677 MET C CE  1 
ATOM   5591 N N   . THR C  1 204 ? -41.790  -20.385 -4.021  1.00 82.46  ?  1678 THR C N   1 
ATOM   5592 C CA  . THR C  1 204 ? -42.069  -20.320 -2.579  1.00 85.75  ?  1678 THR C CA  1 
ATOM   5593 C C   . THR C  1 204 ? -43.428  -19.653 -2.314  1.00 86.06  ?  1678 THR C C   1 
ATOM   5594 O O   . THR C  1 204 ? -43.901  -19.639 -1.172  1.00 72.12  ?  1678 THR C O   1 
ATOM   5595 C CB  . THR C  1 204 ? -40.930  -19.620 -1.841  1.00 78.21  ?  1678 THR C CB  1 
ATOM   5596 O OG1 . THR C  1 204 ? -40.552  -18.449 -2.558  1.00 66.04  ?  1678 THR C OG1 1 
ATOM   5597 C CG2 . THR C  1 204 ? -39.732  -20.503 -1.673  1.00 76.34  ?  1678 THR C CG2 1 
ATOM   5598 N N   . LEU C  1 205 ? -44.042  -19.101 -3.394  1.00 85.68  ?  1679 LEU C N   1 
ATOM   5599 C CA  . LEU C  1 205 ? -45.336  -18.416 -3.475  1.00 90.34  ?  1679 LEU C CA  1 
ATOM   5600 C C   . LEU C  1 205 ? -45.341  -17.045 -2.780  1.00 95.17  ?  1679 LEU C C   1 
ATOM   5601 O O   . LEU C  1 205 ? -46.411  -16.454 -2.605  1.00 111.05 ?  1679 LEU C O   1 
ATOM   5602 C CB  . LEU C  1 205 ? -46.501  -19.312 -2.994  1.00 82.95  ?  1679 LEU C CB  1 
ATOM   5603 C CG  . LEU C  1 205 ? -46.753  -20.592 -3.795  1.00 75.34  ?  1679 LEU C CG  1 
ATOM   5604 C CD1 . LEU C  1 205 ? -47.602  -21.553 -3.010  1.00 76.45  ?  1679 LEU C CD1 1 
ATOM   5605 C CD2 . LEU C  1 205 ? -47.406  -20.295 -5.143  1.00 72.50  ?  1679 LEU C CD2 1 
ATOM   5606 N N   . GLU C  1 206 ? -44.142  -16.518 -2.434  1.00 88.02  ?  1680 GLU C N   1 
ATOM   5607 C CA  . GLU C  1 206 ? -43.980  -15.208 -1.792  1.00 87.82  ?  1680 GLU C CA  1 
ATOM   5608 C C   . GLU C  1 206 ? -44.354  -14.131 -2.814  1.00 78.28  ?  1680 GLU C C   1 
ATOM   5609 O O   . GLU C  1 206 ? -43.722  -14.051 -3.866  1.00 79.93  ?  1680 GLU C O   1 
ATOM   5610 C CB  . GLU C  1 206 ? -42.531  -15.009 -1.291  1.00 81.66  ?  1680 GLU C CB  1 
ATOM   5611 C CG  . GLU C  1 206 ? -42.358  -13.971 -0.191  1.00 80.57  ?  1680 GLU C CG  1 
ATOM   5612 C CD  . GLU C  1 206 ? -42.696  -12.528 -0.520  1.00 82.20  ?  1680 GLU C CD  1 
ATOM   5613 O OE1 . GLU C  1 206 ? -43.885  -12.164 -0.385  1.00 101.09 ?  1680 GLU C OE1 1 
ATOM   5614 O OE2 . GLU C  1 206 ? -41.767  -11.734 -0.787  1.00 67.82  -1 1680 GLU C OE2 1 
ATOM   5615 N N   . SER C  1 207 ? -45.424  -13.360 -2.529  1.00 68.84  ?  1681 SER C N   1 
ATOM   5616 C CA  . SER C  1 207 ? -45.955  -12.298 -3.388  1.00 72.40  ?  1681 SER C CA  1 
ATOM   5617 C C   . SER C  1 207 ? -45.834  -12.589 -4.897  1.00 70.80  ?  1681 SER C C   1 
ATOM   5618 O O   . SER C  1 207 ? -45.488  -11.693 -5.661  1.00 61.89  ?  1681 SER C O   1 
ATOM   5619 C CB  . SER C  1 207 ? -45.328  -10.952 -3.032  1.00 76.46  ?  1681 SER C CB  1 
ATOM   5620 O OG  . SER C  1 207 ? -45.639  -10.575 -1.701  1.00 83.86  ?  1681 SER C OG  1 
ATOM   5621 N N   . TRP C  1 208 ? -46.107  -13.838 -5.327  1.00 76.26  ?  1682 TRP C N   1 
ATOM   5622 C CA  . TRP C  1 208 ? -45.958  -14.217 -6.733  1.00 80.99  ?  1682 TRP C CA  1 
ATOM   5623 C C   . TRP C  1 208 ? -46.864  -13.406 -7.658  1.00 78.12  ?  1682 TRP C C   1 
ATOM   5624 O O   . TRP C  1 208 ? -46.404  -12.976 -8.706  1.00 58.93  ?  1682 TRP C O   1 
ATOM   5625 C CB  . TRP C  1 208 ? -46.110  -15.741 -6.958  1.00 86.12  ?  1682 TRP C CB  1 
ATOM   5626 C CG  . TRP C  1 208 ? -47.482  -16.282 -6.700  1.00 88.14  ?  1682 TRP C CG  1 
ATOM   5627 C CD1 . TRP C  1 208 ? -47.949  -16.797 -5.531  1.00 92.13  ?  1682 TRP C CD1 1 
ATOM   5628 C CD2 . TRP C  1 208 ? -48.572  -16.340 -7.630  1.00 90.63  ?  1682 TRP C CD2 1 
ATOM   5629 N NE1 . TRP C  1 208 ? -49.265  -17.170 -5.671  1.00 96.43  ?  1682 TRP C NE1 1 
ATOM   5630 C CE2 . TRP C  1 208 ? -49.679  -16.881 -6.945  1.00 93.08  ?  1682 TRP C CE2 1 
ATOM   5631 C CE3 . TRP C  1 208 ? -48.729  -15.961 -8.973  1.00 92.09  ?  1682 TRP C CE3 1 
ATOM   5632 C CZ2 . TRP C  1 208 ? -50.924  -17.057 -7.557  1.00 91.18  ?  1682 TRP C CZ2 1 
ATOM   5633 C CZ3 . TRP C  1 208 ? -49.965  -16.127 -9.574  1.00 87.58  ?  1682 TRP C CZ3 1 
ATOM   5634 C CH2 . TRP C  1 208 ? -51.045  -16.666 -8.869  1.00 86.54  ?  1682 TRP C CH2 1 
ATOM   5635 N N   . SER C  1 209 ? -48.116  -13.154 -7.242  1.00 89.90  ?  1683 SER C N   1 
ATOM   5636 C CA  . SER C  1 209 ? -49.108  -12.432 -8.029  1.00 101.85 ?  1683 SER C CA  1 
ATOM   5637 C C   . SER C  1 209 ? -49.089  -10.935 -7.809  1.00 100.03 ?  1683 SER C C   1 
ATOM   5638 O O   . SER C  1 209 ? -48.776  -10.199 -8.739  1.00 104.23 ?  1683 SER C O   1 
ATOM   5639 C CB  . SER C  1 209 ? -50.499  -13.000 -7.778  1.00 94.49  ?  1683 SER C CB  1 
ATOM   5640 O OG  . SER C  1 209 ? -51.524  -12.103 -8.165  1.00 91.29  ?  1683 SER C OG  1 
ATOM   5641 N N   . MET C  1 210 ? -49.441  -10.477 -6.594  1.00 89.31  ?  1684 MET C N   1 
ATOM   5642 C CA  . MET C  1 210 ? -49.507  -9.052  -6.245  1.00 88.44  ?  1684 MET C CA  1 
ATOM   5643 C C   . MET C  1 210 ? -48.211  -8.331  -6.552  1.00 86.20  ?  1684 MET C C   1 
ATOM   5644 O O   . MET C  1 210 ? -48.234  -7.285  -7.195  1.00 82.04  ?  1684 MET C O   1 
ATOM   5645 C CB  . MET C  1 210 ? -49.898  -8.852  -4.768  1.00 92.27  ?  1684 MET C CB  1 
ATOM   5646 C CG  . MET C  1 210 ? -51.327  -9.237  -4.442  1.00 94.09  ?  1684 MET C CG  1 
ATOM   5647 S SD  . MET C  1 210 ? -52.587  -8.521  -5.518  1.00 77.99  ?  1684 MET C SD  1 
ATOM   5648 C CE  . MET C  1 210 ? -53.970  -8.675  -4.514  1.00 80.02  ?  1684 MET C CE  1 
ATOM   5649 N N   . GLY C  1 211 ? -47.103  -8.939  -6.137  1.00 93.68  ?  1685 GLY C N   1 
ATOM   5650 C CA  . GLY C  1 211 ? -45.761  -8.413  -6.303  1.00 94.85  ?  1685 GLY C CA  1 
ATOM   5651 C C   . GLY C  1 211 ? -45.085  -8.619  -7.643  1.00 97.10  ?  1685 GLY C C   1 
ATOM   5652 O O   . GLY C  1 211 ? -44.328  -7.740  -8.048  1.00 95.24  ?  1685 GLY C O   1 
ATOM   5653 N N   . ILE C  1 212 ? -45.310  -9.765  -8.339  1.00 94.43  ?  1686 ILE C N   1 
ATOM   5654 C CA  . ILE C  1 212 ? -44.602  -10.045 -9.602  1.00 87.57  ?  1686 ILE C CA  1 
ATOM   5655 C C   . ILE C  1 212 ? -45.521  -10.227 -10.832 1.00 85.79  ?  1686 ILE C C   1 
ATOM   5656 O O   . ILE C  1 212 ? -45.342  -9.478  -11.791 1.00 96.39  ?  1686 ILE C O   1 
ATOM   5657 C CB  . ILE C  1 212 ? -43.600  -11.240 -9.453  1.00 84.52  ?  1686 ILE C CB  1 
ATOM   5658 C CG1 . ILE C  1 212 ? -42.416  -10.866 -8.550  1.00 96.12  ?  1686 ILE C CG1 1 
ATOM   5659 C CG2 . ILE C  1 212 ? -43.063  -11.740 -10.799 1.00 73.97  ?  1686 ILE C CG2 1 
ATOM   5660 C CD1 . ILE C  1 212 ? -42.534  -11.313 -7.183  1.00 104.43 ?  1686 ILE C CD1 1 
ATOM   5661 N N   . VAL C  1 213 ? -46.455  -11.209 -10.829 1.00 71.37  ?  1687 VAL C N   1 
ATOM   5662 C CA  . VAL C  1 213 ? -47.299  -11.552 -11.988 1.00 68.75  ?  1687 VAL C CA  1 
ATOM   5663 C C   . VAL C  1 213 ? -48.308  -10.436 -12.376 1.00 80.06  ?  1687 VAL C C   1 
ATOM   5664 O O   . VAL C  1 213 ? -48.367  -10.096 -13.557 1.00 82.48  ?  1687 VAL C O   1 
ATOM   5665 C CB  . VAL C  1 213 ? -47.991  -12.939 -11.863 1.00 63.02  ?  1687 VAL C CB  1 
ATOM   5666 C CG1 . VAL C  1 213 ? -48.678  -13.338 -13.165 1.00 63.60  ?  1687 VAL C CG1 1 
ATOM   5667 C CG2 . VAL C  1 213 ? -46.994  -14.017 -11.485 1.00 65.10  ?  1687 VAL C CG2 1 
ATOM   5668 N N   . ARG C  1 214 ? -49.094  -9.885  -11.426 1.00 92.55  ?  1688 ARG C N   1 
ATOM   5669 C CA  . ARG C  1 214 ? -50.065  -8.812  -11.716 1.00 89.59  ?  1688 ARG C CA  1 
ATOM   5670 C C   . ARG C  1 214 ? -49.393  -7.548  -12.337 1.00 85.98  ?  1688 ARG C C   1 
ATOM   5671 O O   . ARG C  1 214 ? -49.900  -7.099  -13.366 1.00 85.67  ?  1688 ARG C O   1 
ATOM   5672 C CB  . ARG C  1 214 ? -50.943  -8.468  -10.503 1.00 88.58  ?  1688 ARG C CB  1 
ATOM   5673 C CG  . ARG C  1 214 ? -51.873  -9.589  -10.073 1.00 91.71  ?  1688 ARG C CG  1 
ATOM   5674 C CD  . ARG C  1 214 ? -53.338  -9.197  -10.115 1.00 88.21  ?  1688 ARG C CD  1 
ATOM   5675 N NE  . ARG C  1 214 ? -54.108  -9.902  -9.088  1.00 81.46  ?  1688 ARG C NE  1 
ATOM   5676 C CZ  . ARG C  1 214 ? -55.400  -10.201 -9.180  1.00 85.37  ?  1688 ARG C CZ  1 
ATOM   5677 N NH1 . ARG C  1 214 ? -56.091  -9.869  -10.264 1.00 82.92  1  1688 ARG C NH1 1 
ATOM   5678 N NH2 . ARG C  1 214 ? -56.009  -10.844 -8.195  1.00 102.48 ?  1688 ARG C NH2 1 
ATOM   5679 N N   . PRO C  1 215 ? -48.229  -7.026  -11.836 1.00 84.25  ?  1689 PRO C N   1 
ATOM   5680 C CA  . PRO C  1 215 ? -47.578  -5.884  -12.509 1.00 84.60  ?  1689 PRO C CA  1 
ATOM   5681 C C   . PRO C  1 215 ? -47.015  -6.237  -13.887 1.00 82.24  ?  1689 PRO C C   1 
ATOM   5682 O O   . PRO C  1 215 ? -46.814  -5.335  -14.709 1.00 78.17  ?  1689 PRO C O   1 
ATOM   5683 C CB  . PRO C  1 215 ? -46.435  -5.514  -11.555 1.00 83.15  ?  1689 PRO C CB  1 
ATOM   5684 C CG  . PRO C  1 215 ? -46.804  -6.110  -10.255 1.00 88.54  ?  1689 PRO C CG  1 
ATOM   5685 C CD  . PRO C  1 215 ? -47.469  -7.394  -10.628 1.00 89.14  ?  1689 PRO C CD  1 
ATOM   5686 N N   . LEU C  1 216 ? -46.743  -7.544  -14.128 1.00 81.07  ?  1690 LEU C N   1 
ATOM   5687 C CA  . LEU C  1 216 ? -46.270  -8.073  -15.410 1.00 88.40  ?  1690 LEU C CA  1 
ATOM   5688 C C   . LEU C  1 216 ? -47.415  -8.057  -16.412 1.00 92.44  ?  1690 LEU C C   1 
ATOM   5689 O O   . LEU C  1 216 ? -47.193  -7.793  -17.593 1.00 101.45 ?  1690 LEU C O   1 
ATOM   5690 C CB  . LEU C  1 216 ? -45.751  -9.513  -15.261 1.00 90.87  ?  1690 LEU C CB  1 
ATOM   5691 C CG  . LEU C  1 216 ? -44.266  -9.698  -15.003 1.00 87.66  ?  1690 LEU C CG  1 
ATOM   5692 C CD1 . LEU C  1 216 ? -43.993  -11.050 -14.391 1.00 79.09  ?  1690 LEU C CD1 1 
ATOM   5693 C CD2 . LEU C  1 216 ? -43.483  -9.570  -16.270 1.00 87.61  ?  1690 LEU C CD2 1 
ATOM   5694 N N   . MET C  1 217 ? -48.645  -8.317  -15.930 1.00 98.49  ?  1691 MET C N   1 
ATOM   5695 C CA  . MET C  1 217 ? -49.861  -8.366  -16.741 1.00 96.61  ?  1691 MET C CA  1 
ATOM   5696 C C   . MET C  1 217 ? -50.370  -6.997  -17.179 1.00 99.05  ?  1691 MET C C   1 
ATOM   5697 O O   . MET C  1 217 ? -51.364  -6.914  -17.905 1.00 109.71 ?  1691 MET C O   1 
ATOM   5698 C CB  . MET C  1 217 ? -50.956  -9.176  -16.050 1.00 94.06  ?  1691 MET C CB  1 
ATOM   5699 C CG  . MET C  1 217 ? -50.683  -10.661 -16.065 1.00 96.13  ?  1691 MET C CG  1 
ATOM   5700 S SD  . MET C  1 217 ? -52.116  -11.627 -15.592 1.00 97.06  ?  1691 MET C SD  1 
ATOM   5701 C CE  . MET C  1 217 ? -52.234  -11.213 -13.896 1.00 94.57  ?  1691 MET C CE  1 
ATOM   5702 N N   . GLU C  1 218 ? -49.675  -5.930  -16.769 1.00 97.02  ?  1692 GLU C N   1 
ATOM   5703 C CA  . GLU C  1 218 ? -49.989  -4.572  -17.185 1.00 99.80  ?  1692 GLU C CA  1 
ATOM   5704 C C   . GLU C  1 218 ? -49.326  -4.362  -18.545 1.00 95.10  ?  1692 GLU C C   1 
ATOM   5705 O O   . GLU C  1 218 ? -49.988  -3.950  -19.502 1.00 85.41  ?  1692 GLU C O   1 
ATOM   5706 C CB  . GLU C  1 218 ? -49.507  -3.543  -16.143 1.00 105.11 ?  1692 GLU C CB  1 
ATOM   5707 C CG  . GLU C  1 218 ? -50.470  -3.342  -14.985 1.00 108.46 ?  1692 GLU C CG  1 
ATOM   5708 C CD  . GLU C  1 218 ? -51.877  -2.928  -15.376 1.00 116.15 ?  1692 GLU C CD  1 
ATOM   5709 O OE1 . GLU C  1 218 ? -52.083  -1.744  -15.724 1.00 111.47 ?  1692 GLU C OE1 1 
ATOM   5710 O OE2 . GLU C  1 218 ? -52.771  -3.803  -15.364 1.00 123.68 -1 1692 GLU C OE2 1 
ATOM   5711 N N   . VAL C  1 219 ? -48.032  -4.723  -18.634 1.00 93.44  ?  1693 VAL C N   1 
ATOM   5712 C CA  . VAL C  1 219 ? -47.222  -4.646  -19.848 1.00 94.89  ?  1693 VAL C CA  1 
ATOM   5713 C C   . VAL C  1 219 ? -47.629  -5.793  -20.795 1.00 91.49  ?  1693 VAL C C   1 
ATOM   5714 O O   . VAL C  1 219 ? -47.938  -5.540  -21.961 1.00 97.52  ?  1693 VAL C O   1 
ATOM   5715 C CB  . VAL C  1 219 ? -45.701  -4.662  -19.519 1.00 93.97  ?  1693 VAL C CB  1 
ATOM   5716 C CG1 . VAL C  1 219 ? -44.852  -4.670  -20.785 1.00 95.59  ?  1693 VAL C CG1 1 
ATOM   5717 C CG2 . VAL C  1 219 ? -45.319  -3.483  -18.641 1.00 89.96  ?  1693 VAL C CG2 1 
ATOM   5718 N N   . TYR C  1 220 ? -47.633  -7.041  -20.283 1.00 87.26  ?  1694 TYR C N   1 
ATOM   5719 C CA  . TYR C  1 220 ? -47.959  -8.246  -21.040 1.00 90.03  ?  1694 TYR C CA  1 
ATOM   5720 C C   . TYR C  1 220 ? -49.213  -8.912  -20.450 1.00 90.47  ?  1694 TYR C C   1 
ATOM   5721 O O   . TYR C  1 220 ? -49.073  -9.623  -19.463 1.00 91.64  ?  1694 TYR C O   1 
ATOM   5722 C CB  . TYR C  1 220 ? -46.777  -9.232  -20.974 1.00 97.16  ?  1694 TYR C CB  1 
ATOM   5723 C CG  . TYR C  1 220 ? -45.399  -8.644  -21.193 1.00 94.39  ?  1694 TYR C CG  1 
ATOM   5724 C CD1 . TYR C  1 220 ? -45.020  -8.151  -22.438 1.00 102.97 ?  1694 TYR C CD1 1 
ATOM   5725 C CD2 . TYR C  1 220 ? -44.431  -8.701  -20.195 1.00 90.16  ?  1694 TYR C CD2 1 
ATOM   5726 C CE1 . TYR C  1 220 ? -43.732  -7.666  -22.664 1.00 108.99 ?  1694 TYR C CE1 1 
ATOM   5727 C CE2 . TYR C  1 220 ? -43.138  -8.227  -20.411 1.00 100.69 ?  1694 TYR C CE2 1 
ATOM   5728 C CZ  . TYR C  1 220 ? -42.793  -7.705  -21.647 1.00 106.32 ?  1694 TYR C CZ  1 
ATOM   5729 O OH  . TYR C  1 220 ? -41.518  -7.243  -21.872 1.00 96.23  ?  1694 TYR C OH  1 
ATOM   5730 N N   . PRO C  1 221 ? -50.427  -8.741  -21.024 1.00 101.85 ?  1695 PRO C N   1 
ATOM   5731 C CA  . PRO C  1 221 ? -51.629  -9.353  -20.416 1.00 108.99 ?  1695 PRO C CA  1 
ATOM   5732 C C   . PRO C  1 221 ? -51.649  -10.878 -20.312 1.00 108.36 ?  1695 PRO C C   1 
ATOM   5733 O O   . PRO C  1 221 ? -52.273  -11.405 -19.389 1.00 112.54 ?  1695 PRO C O   1 
ATOM   5734 C CB  . PRO C  1 221 ? -52.776  -8.846  -21.288 1.00 109.63 ?  1695 PRO C CB  1 
ATOM   5735 C CG  . PRO C  1 221 ? -52.139  -8.443  -22.562 1.00 113.53 ?  1695 PRO C CG  1 
ATOM   5736 C CD  . PRO C  1 221 ? -50.788  -7.920  -22.192 1.00 113.88 ?  1695 PRO C CD  1 
ATOM   5737 N N   . TYR C  1 222 ? -50.989  -11.583 -21.243 1.00 101.11 ?  1696 TYR C N   1 
ATOM   5738 C CA  . TYR C  1 222 ? -50.933  -13.047 -21.229 1.00 105.09 ?  1696 TYR C CA  1 
ATOM   5739 C C   . TYR C  1 222 ? -49.597  -13.531 -20.645 1.00 103.80 ?  1696 TYR C C   1 
ATOM   5740 O O   . TYR C  1 222 ? -48.882  -14.309 -21.275 1.00 107.31 ?  1696 TYR C O   1 
ATOM   5741 C CB  . TYR C  1 222 ? -51.203  -13.620 -22.634 1.00 111.76 ?  1696 TYR C CB  1 
ATOM   5742 C CG  . TYR C  1 222 ? -52.608  -13.374 -23.141 1.00 120.72 ?  1696 TYR C CG  1 
ATOM   5743 C CD1 . TYR C  1 222 ? -53.668  -14.183 -22.740 1.00 132.56 ?  1696 TYR C CD1 1 
ATOM   5744 C CD2 . TYR C  1 222 ? -52.876  -12.347 -24.043 1.00 120.34 ?  1696 TYR C CD2 1 
ATOM   5745 C CE1 . TYR C  1 222 ? -54.964  -13.964 -23.206 1.00 135.68 ?  1696 TYR C CE1 1 
ATOM   5746 C CE2 . TYR C  1 222 ? -54.168  -12.118 -24.517 1.00 123.66 ?  1696 TYR C CE2 1 
ATOM   5747 C CZ  . TYR C  1 222 ? -55.210  -12.930 -24.095 1.00 134.83 ?  1696 TYR C CZ  1 
ATOM   5748 O OH  . TYR C  1 222 ? -56.490  -12.713 -24.550 1.00 142.53 ?  1696 TYR C OH  1 
ATOM   5749 N N   . ALA C  1 223 ? -49.260  -13.041 -19.439 1.00 100.13 ?  1697 ALA C N   1 
ATOM   5750 C CA  . ALA C  1 223 ? -48.023  -13.377 -18.736 1.00 90.99  ?  1697 ALA C CA  1 
ATOM   5751 C C   . ALA C  1 223 ? -48.198  -14.610 -17.869 1.00 88.27  ?  1697 ALA C C   1 
ATOM   5752 O O   . ALA C  1 223 ? -47.260  -15.402 -17.751 1.00 86.33  ?  1697 ALA C O   1 
ATOM   5753 C CB  . ALA C  1 223 ? -47.568  -12.205 -17.887 1.00 94.34  ?  1697 ALA C CB  1 
ATOM   5754 N N   . TRP C  1 224 ? -49.406  -14.781 -17.281 1.00 92.01  ?  1698 TRP C N   1 
ATOM   5755 C CA  . TRP C  1 224 ? -49.807  -15.902 -16.417 1.00 92.89  ?  1698 TRP C CA  1 
ATOM   5756 C C   . TRP C  1 224 ? -49.564  -17.278 -17.061 1.00 88.99  ?  1698 TRP C C   1 
ATOM   5757 O O   . TRP C  1 224 ? -49.326  -18.259 -16.357 1.00 79.79  ?  1698 TRP C O   1 
ATOM   5758 C CB  . TRP C  1 224 ? -51.279  -15.757 -15.992 1.00 91.23  ?  1698 TRP C CB  1 
ATOM   5759 C CG  . TRP C  1 224 ? -52.245  -15.635 -17.134 1.00 87.94  ?  1698 TRP C CG  1 
ATOM   5760 C CD1 . TRP C  1 224 ? -52.703  -14.481 -17.698 1.00 99.47  ?  1698 TRP C CD1 1 
ATOM   5761 C CD2 . TRP C  1 224 ? -52.858  -16.709 -17.859 1.00 88.33  ?  1698 TRP C CD2 1 
ATOM   5762 N NE1 . TRP C  1 224 ? -53.568  -14.766 -18.730 1.00 104.71 ?  1698 TRP C NE1 1 
ATOM   5763 C CE2 . TRP C  1 224 ? -53.682  -16.127 -18.852 1.00 99.70  ?  1698 TRP C CE2 1 
ATOM   5764 C CE3 . TRP C  1 224 ? -52.780  -18.113 -17.781 1.00 91.15  ?  1698 TRP C CE3 1 
ATOM   5765 C CZ2 . TRP C  1 224 ? -54.435  -16.900 -19.749 1.00 95.68  ?  1698 TRP C CZ2 1 
ATOM   5766 C CZ3 . TRP C  1 224 ? -53.515  -18.877 -18.678 1.00 90.84  ?  1698 TRP C CZ3 1 
ATOM   5767 C CH2 . TRP C  1 224 ? -54.340  -18.273 -19.640 1.00 91.98  ?  1698 TRP C CH2 1 
ATOM   5768 N N   . VAL C  1 225 ? -49.603  -17.332 -18.407 1.00 83.11  ?  1699 VAL C N   1 
ATOM   5769 C CA  . VAL C  1 225 ? -49.389  -18.527 -19.234 1.00 80.23  ?  1699 VAL C CA  1 
ATOM   5770 C C   . VAL C  1 225 ? -47.994  -19.127 -18.975 1.00 81.31  ?  1699 VAL C C   1 
ATOM   5771 O O   . VAL C  1 225 ? -47.768  -20.295 -19.280 1.00 82.04  ?  1699 VAL C O   1 
ATOM   5772 C CB  . VAL C  1 225 ? -49.629  -18.236 -20.744 1.00 81.63  ?  1699 VAL C CB  1 
ATOM   5773 C CG1 . VAL C  1 225 ? -49.948  -19.511 -21.507 1.00 78.25  ?  1699 VAL C CG1 1 
ATOM   5774 C CG2 . VAL C  1 225 ? -50.741  -17.213 -20.950 1.00 84.13  ?  1699 VAL C CG2 1 
ATOM   5775 N N   . PHE C  1 226 ? -47.069  -18.330 -18.408 1.00 88.53  ?  1700 PHE C N   1 
ATOM   5776 C CA  . PHE C  1 226 ? -45.724  -18.777 -18.064 1.00 87.08  ?  1700 PHE C CA  1 
ATOM   5777 C C   . PHE C  1 226 ? -45.613  -19.104 -16.574 1.00 82.58  ?  1700 PHE C C   1 
ATOM   5778 O O   . PHE C  1 226 ? -44.888  -20.034 -16.208 1.00 80.46  ?  1700 PHE C O   1 
ATOM   5779 C CB  . PHE C  1 226 ? -44.669  -17.723 -18.459 1.00 93.53  ?  1700 PHE C CB  1 
ATOM   5780 C CG  . PHE C  1 226 ? -43.265  -18.044 -17.986 1.00 102.06 ?  1700 PHE C CG  1 
ATOM   5781 C CD1 . PHE C  1 226 ? -42.430  -18.856 -18.740 1.00 100.34 ?  1700 PHE C CD1 1 
ATOM   5782 C CD2 . PHE C  1 226 ? -42.794  -17.561 -16.770 1.00 105.63 ?  1700 PHE C CD2 1 
ATOM   5783 C CE1 . PHE C  1 226 ? -41.149  -19.175 -18.288 1.00 99.71  ?  1700 PHE C CE1 1 
ATOM   5784 C CE2 . PHE C  1 226 ? -41.512  -17.884 -16.320 1.00 99.65  ?  1700 PHE C CE2 1 
ATOM   5785 C CZ  . PHE C  1 226 ? -40.697  -18.684 -17.085 1.00 100.98 ?  1700 PHE C CZ  1 
ATOM   5786 N N   . PHE C  1 227 ? -46.284  -18.311 -15.717 1.00 83.99  ?  1701 PHE C N   1 
ATOM   5787 C CA  . PHE C  1 227 ? -46.190  -18.450 -14.269 1.00 90.73  ?  1701 PHE C CA  1 
ATOM   5788 C C   . PHE C  1 227 ? -47.130  -19.481 -13.673 1.00 91.82  ?  1701 PHE C C   1 
ATOM   5789 O O   . PHE C  1 227 ? -46.654  -20.280 -12.870 1.00 89.39  ?  1701 PHE C O   1 
ATOM   5790 C CB  . PHE C  1 227 ? -46.328  -17.096 -13.577 1.00 90.13  ?  1701 PHE C CB  1 
ATOM   5791 C CG  . PHE C  1 227 ? -45.115  -16.245 -13.843 1.00 81.67  ?  1701 PHE C CG  1 
ATOM   5792 C CD1 . PHE C  1 227 ? -43.918  -16.486 -13.181 1.00 77.71  ?  1701 PHE C CD1 1 
ATOM   5793 C CD2 . PHE C  1 227 ? -45.147  -15.248 -14.803 1.00 79.54  ?  1701 PHE C CD2 1 
ATOM   5794 C CE1 . PHE C  1 227 ? -42.784  -15.731 -13.461 1.00 84.18  ?  1701 PHE C CE1 1 
ATOM   5795 C CE2 . PHE C  1 227 ? -44.015  -14.493 -15.079 1.00 82.24  ?  1701 PHE C CE2 1 
ATOM   5796 C CZ  . PHE C  1 227 ? -42.842  -14.737 -14.404 1.00 86.12  ?  1701 PHE C CZ  1 
ATOM   5797 N N   . ILE C  1 228 ? -48.434  -19.485 -14.044 1.00 87.40  ?  1702 ILE C N   1 
ATOM   5798 C CA  . ILE C  1 228 ? -49.394  -20.487 -13.547 1.00 85.57  ?  1702 ILE C CA  1 
ATOM   5799 C C   . ILE C  1 228 ? -48.833  -21.919 -13.819 1.00 83.95  ?  1702 ILE C C   1 
ATOM   5800 O O   . ILE C  1 228 ? -48.671  -22.664 -12.847 1.00 84.81  ?  1702 ILE C O   1 
ATOM   5801 C CB  . ILE C  1 228 ? -50.865  -20.270 -14.026 1.00 85.82  ?  1702 ILE C CB  1 
ATOM   5802 C CG1 . ILE C  1 228 ? -51.349  -18.810 -13.872 1.00 87.41  ?  1702 ILE C CG1 1 
ATOM   5803 C CG2 . ILE C  1 228 ? -51.830  -21.244 -13.353 1.00 88.50  ?  1702 ILE C CG2 1 
ATOM   5804 C CD1 . ILE C  1 228 ? -51.364  -18.184 -12.475 1.00 89.82  ?  1702 ILE C CD1 1 
ATOM   5805 N N   . PRO C  1 229 ? -48.387  -22.275 -15.062 1.00 83.96  ?  1703 PRO C N   1 
ATOM   5806 C CA  . PRO C  1 229 ? -47.769  -23.596 -15.266 1.00 86.30  ?  1703 PRO C CA  1 
ATOM   5807 C C   . PRO C  1 229 ? -46.468  -23.785 -14.482 1.00 86.72  ?  1703 PRO C C   1 
ATOM   5808 O O   . PRO C  1 229 ? -46.242  -24.887 -13.984 1.00 81.43  ?  1703 PRO C O   1 
ATOM   5809 C CB  . PRO C  1 229 ? -47.539  -23.647 -16.781 1.00 79.64  ?  1703 PRO C CB  1 
ATOM   5810 C CG  . PRO C  1 229 ? -48.510  -22.674 -17.337 1.00 81.47  ?  1703 PRO C CG  1 
ATOM   5811 C CD  . PRO C  1 229 ? -48.471  -21.556 -16.349 1.00 81.38  ?  1703 PRO C CD  1 
ATOM   5812 N N   . PHE C  1 230 ? -45.638  -22.722 -14.326 1.00 88.00  ?  1704 PHE C N   1 
ATOM   5813 C CA  . PHE C  1 230 ? -44.401  -22.816 -13.540 1.00 89.38  ?  1704 PHE C CA  1 
ATOM   5814 C C   . PHE C  1 230 ? -44.746  -23.220 -12.119 1.00 90.16  ?  1704 PHE C C   1 
ATOM   5815 O O   . PHE C  1 230 ? -44.065  -24.072 -11.565 1.00 98.69  ?  1704 PHE C O   1 
ATOM   5816 C CB  . PHE C  1 230 ? -43.591  -21.506 -13.545 1.00 88.53  ?  1704 PHE C CB  1 
ATOM   5817 C CG  . PHE C  1 230 ? -42.417  -21.505 -12.587 1.00 84.94  ?  1704 PHE C CG  1 
ATOM   5818 C CD1 . PHE C  1 230 ? -41.189  -22.037 -12.964 1.00 92.32  ?  1704 PHE C CD1 1 
ATOM   5819 C CD2 . PHE C  1 230 ? -42.544  -20.988 -11.305 1.00 85.25  ?  1704 PHE C CD2 1 
ATOM   5820 C CE1 . PHE C  1 230 ? -40.108  -22.054 -12.071 1.00 95.74  ?  1704 PHE C CE1 1 
ATOM   5821 C CE2 . PHE C  1 230 ? -41.470  -21.014 -10.412 1.00 93.28  ?  1704 PHE C CE2 1 
ATOM   5822 C CZ  . PHE C  1 230 ? -40.255  -21.535 -10.804 1.00 96.21  ?  1704 PHE C CZ  1 
ATOM   5823 N N   . ILE C  1 231 ? -45.812  -22.615 -11.543 1.00 82.08  ?  1705 ILE C N   1 
ATOM   5824 C CA  . ILE C  1 231 ? -46.317  -22.905 -10.192 1.00 75.71  ?  1705 ILE C CA  1 
ATOM   5825 C C   . ILE C  1 231 ? -46.723  -24.389 -10.130 1.00 74.94  ?  1705 ILE C C   1 
ATOM   5826 O O   . ILE C  1 231 ? -46.254  -25.090 -9.237  1.00 69.70  ?  1705 ILE C O   1 
ATOM   5827 C CB  . ILE C  1 231 ? -47.454  -21.909 -9.732  1.00 75.86  ?  1705 ILE C CB  1 
ATOM   5828 C CG1 . ILE C  1 231 ? -46.905  -20.485 -9.537  1.00 79.26  ?  1705 ILE C CG1 1 
ATOM   5829 C CG2 . ILE C  1 231 ? -48.171  -22.370 -8.447  1.00 77.92  ?  1705 ILE C CG2 1 
ATOM   5830 C CD1 . ILE C  1 231 ? -47.899  -19.422 -9.763  1.00 84.07  ?  1705 ILE C CD1 1 
ATOM   5831 N N   . PHE C  1 232 ? -47.521  -24.870 -11.114 1.00 76.95  ?  1706 PHE C N   1 
ATOM   5832 C CA  . PHE C  1 232 ? -47.986  -26.253 -11.187 1.00 81.60  ?  1706 PHE C CA  1 
ATOM   5833 C C   . PHE C  1 232 ? -46.839  -27.253 -11.291 1.00 76.48  ?  1706 PHE C C   1 
ATOM   5834 O O   . PHE C  1 232 ? -46.778  -28.171 -10.478 1.00 71.73  ?  1706 PHE C O   1 
ATOM   5835 C CB  . PHE C  1 232 ? -48.985  -26.435 -12.330 1.00 86.93  ?  1706 PHE C CB  1 
ATOM   5836 C CG  . PHE C  1 232 ? -50.414  -26.095 -11.989 1.00 90.86  ?  1706 PHE C CG  1 
ATOM   5837 C CD1 . PHE C  1 232 ? -50.881  -24.791 -12.096 1.00 103.04 ?  1706 PHE C CD1 1 
ATOM   5838 C CD2 . PHE C  1 232 ? -51.312  -27.087 -11.620 1.00 105.73 ?  1706 PHE C CD2 1 
ATOM   5839 C CE1 . PHE C  1 232 ? -52.215  -24.480 -11.806 1.00 114.37 ?  1706 PHE C CE1 1 
ATOM   5840 C CE2 . PHE C  1 232 ? -52.648  -26.777 -11.338 1.00 118.83 ?  1706 PHE C CE2 1 
ATOM   5841 C CZ  . PHE C  1 232 ? -53.090  -25.475 -11.432 1.00 117.45 ?  1706 PHE C CZ  1 
ATOM   5842 N N   . VAL C  1 233 ? -45.916  -27.058 -12.254 1.00 72.18  ?  1707 VAL C N   1 
ATOM   5843 C CA  . VAL C  1 233 ? -44.746  -27.923 -12.478 1.00 72.72  ?  1707 VAL C CA  1 
ATOM   5844 C C   . VAL C  1 233 ? -43.868  -28.010 -11.220 1.00 73.14  ?  1707 VAL C C   1 
ATOM   5845 O O   . VAL C  1 233 ? -43.501  -29.111 -10.811 1.00 67.74  ?  1707 VAL C O   1 
ATOM   5846 C CB  . VAL C  1 233 ? -43.940  -27.493 -13.731 1.00 72.58  ?  1707 VAL C CB  1 
ATOM   5847 C CG1 . VAL C  1 233 ? -42.586  -28.200 -13.807 1.00 73.75  ?  1707 VAL C CG1 1 
ATOM   5848 C CG2 . VAL C  1 233 ? -44.742  -27.723 -15.005 1.00 70.84  ?  1707 VAL C CG2 1 
ATOM   5849 N N   . VAL C  1 234 ? -43.565  -26.846 -10.610 1.00 70.67  ?  1708 VAL C N   1 
ATOM   5850 C CA  . VAL C  1 234 ? -42.768  -26.687 -9.395  1.00 71.45  ?  1708 VAL C CA  1 
ATOM   5851 C C   . VAL C  1 234 ? -43.390  -27.433 -8.218  1.00 74.93  ?  1708 VAL C C   1 
ATOM   5852 O O   . VAL C  1 234 ? -42.695  -28.206 -7.563  1.00 69.07  ?  1708 VAL C O   1 
ATOM   5853 C CB  . VAL C  1 234 ? -42.557  -25.174 -9.104  1.00 83.25  ?  1708 VAL C CB  1 
ATOM   5854 C CG1 . VAL C  1 234 ? -42.584  -24.840 -7.614  1.00 89.44  ?  1708 VAL C CG1 1 
ATOM   5855 C CG2 . VAL C  1 234 ? -41.284  -24.667 -9.753  1.00 95.19  ?  1708 VAL C CG2 1 
ATOM   5856 N N   . THR C  1 235 ? -44.695  -27.192 -7.959  1.00 86.52  ?  1709 THR C N   1 
ATOM   5857 C CA  . THR C  1 235 ? -45.451  -27.772 -6.852  1.00 87.64  ?  1709 THR C CA  1 
ATOM   5858 C C   . THR C  1 235 ? -45.557  -29.279 -7.023  1.00 82.58  ?  1709 THR C C   1 
ATOM   5859 O O   . THR C  1 235 ? -45.402  -30.003 -6.039  1.00 73.62  ?  1709 THR C O   1 
ATOM   5860 C CB  . THR C  1 235 ? -46.804  -27.046 -6.655  1.00 90.49  ?  1709 THR C CB  1 
ATOM   5861 O OG1 . THR C  1 235 ? -46.590  -25.632 -6.608  1.00 101.95 ?  1709 THR C OG1 1 
ATOM   5862 C CG2 . THR C  1 235 ? -47.521  -27.463 -5.382  1.00 94.16  ?  1709 THR C CG2 1 
ATOM   5863 N N   . PHE C  1 236 ? -45.759  -29.755 -8.270  1.00 83.50  ?  1710 PHE C N   1 
ATOM   5864 C CA  . PHE C  1 236 ? -45.852  -31.186 -8.552  1.00 89.89  ?  1710 PHE C CA  1 
ATOM   5865 C C   . PHE C  1 236 ? -44.567  -31.913 -8.158  1.00 89.31  ?  1710 PHE C C   1 
ATOM   5866 O O   . PHE C  1 236 ? -44.634  -32.843 -7.354  1.00 93.55  ?  1710 PHE C O   1 
ATOM   5867 C CB  . PHE C  1 236 ? -46.243  -31.455 -10.016 1.00 93.53  ?  1710 PHE C CB  1 
ATOM   5868 C CG  . PHE C  1 236 ? -46.428  -32.917 -10.358 1.00 87.98  ?  1710 PHE C CG  1 
ATOM   5869 C CD1 . PHE C  1 236 ? -47.417  -33.676 -9.737  1.00 90.49  ?  1710 PHE C CD1 1 
ATOM   5870 C CD2 . PHE C  1 236 ? -45.621  -33.533 -11.306 1.00 88.06  ?  1710 PHE C CD2 1 
ATOM   5871 C CE1 . PHE C  1 236 ? -47.582  -35.026 -10.046 1.00 95.64  ?  1710 PHE C CE1 1 
ATOM   5872 C CE2 . PHE C  1 236 ? -45.798  -34.880 -11.624 1.00 91.92  ?  1710 PHE C CE2 1 
ATOM   5873 C CZ  . PHE C  1 236 ? -46.781  -35.614 -10.996 1.00 95.09  ?  1710 PHE C CZ  1 
ATOM   5874 N N   . VAL C  1 237 ? -43.404  -31.434 -8.661  1.00 82.93  ?  1711 VAL C N   1 
ATOM   5875 C CA  . VAL C  1 237 ? -42.070  -31.969 -8.365  1.00 82.03  ?  1711 VAL C CA  1 
ATOM   5876 C C   . VAL C  1 237 ? -41.818  -31.924 -6.859  1.00 80.18  ?  1711 VAL C C   1 
ATOM   5877 O O   . VAL C  1 237 ? -41.346  -32.911 -6.295  1.00 78.78  ?  1711 VAL C O   1 
ATOM   5878 C CB  . VAL C  1 237 ? -40.960  -31.254 -9.179  1.00 82.13  ?  1711 VAL C CB  1 
ATOM   5879 C CG1 . VAL C  1 237 ? -39.564  -31.695 -8.751  1.00 76.25  ?  1711 VAL C CG1 1 
ATOM   5880 C CG2 . VAL C  1 237 ? -41.150  -31.488 -10.671 1.00 89.53  ?  1711 VAL C CG2 1 
ATOM   5881 N N   . MET C  1 238 ? -42.194  -30.807 -6.207  1.00 80.00  ?  1712 MET C N   1 
ATOM   5882 C CA  . MET C  1 238 ? -42.058  -30.612 -4.764  1.00 87.33  ?  1712 MET C CA  1 
ATOM   5883 C C   . MET C  1 238 ? -42.853  -31.632 -3.961  1.00 87.92  ?  1712 MET C C   1 
ATOM   5884 O O   . MET C  1 238 ? -42.298  -32.231 -3.040  1.00 84.79  ?  1712 MET C O   1 
ATOM   5885 C CB  . MET C  1 238 ? -42.435  -29.178 -4.357  1.00 95.54  ?  1712 MET C CB  1 
ATOM   5886 C CG  . MET C  1 238 ? -41.290  -28.200 -4.488  1.00 103.00 ?  1712 MET C CG  1 
ATOM   5887 S SD  . MET C  1 238 ? -39.945  -28.553 -3.320  1.00 95.17  ?  1712 MET C SD  1 
ATOM   5888 C CE  . MET C  1 238 ? -38.611  -28.923 -4.461  1.00 106.13 ?  1712 MET C CE  1 
ATOM   5889 N N   . ILE C  1 239 ? -44.139  -31.846 -4.327  1.00 93.83  ?  1713 ILE C N   1 
ATOM   5890 C CA  . ILE C  1 239 ? -45.035  -32.802 -3.667  1.00 96.45  ?  1713 ILE C CA  1 
ATOM   5891 C C   . ILE C  1 239 ? -44.443  -34.213 -3.715  1.00 99.19  ?  1713 ILE C C   1 
ATOM   5892 O O   . ILE C  1 239 ? -44.349  -34.865 -2.676  1.00 92.53  ?  1713 ILE C O   1 
ATOM   5893 C CB  . ILE C  1 239 ? -46.484  -32.721 -4.235  1.00 94.65  ?  1713 ILE C CB  1 
ATOM   5894 C CG1 . ILE C  1 239 ? -47.208  -31.473 -3.695  1.00 97.51  ?  1713 ILE C CG1 1 
ATOM   5895 C CG2 . ILE C  1 239 ? -47.293  -33.992 -3.916  1.00 99.15  ?  1713 ILE C CG2 1 
ATOM   5896 C CD1 . ILE C  1 239 ? -48.361  -30.982 -4.548  1.00 102.82 ?  1713 ILE C CD1 1 
ATOM   5897 N N   . ASN C  1 240 ? -43.995  -34.644 -4.911  1.00 98.40  ?  1714 ASN C N   1 
ATOM   5898 C CA  . ASN C  1 240 ? -43.401  -35.955 -5.161  1.00 98.26  ?  1714 ASN C CA  1 
ATOM   5899 C C   . ASN C  1 240 ? -42.126  -36.199 -4.389  1.00 102.71 ?  1714 ASN C C   1 
ATOM   5900 O O   . ASN C  1 240 ? -41.877  -37.332 -3.994  1.00 115.83 ?  1714 ASN C O   1 
ATOM   5901 C CB  . ASN C  1 240 ? -43.188  -36.170 -6.644  1.00 99.76  ?  1714 ASN C CB  1 
ATOM   5902 C CG  . ASN C  1 240 ? -44.476  -36.192 -7.426  1.00 101.23 ?  1714 ASN C CG  1 
ATOM   5903 O OD1 . ASN C  1 240 ? -45.445  -36.882 -7.079  1.00 101.32 ?  1714 ASN C OD1 1 
ATOM   5904 N ND2 . ASN C  1 240 ? -44.524  -35.413 -8.487  1.00 108.51 ?  1714 ASN C ND2 1 
ATOM   5905 N N   . LEU C  1 241 ? -41.339  -35.146 -4.151  1.00 102.25 ?  1715 LEU C N   1 
ATOM   5906 C CA  . LEU C  1 241 ? -40.096  -35.202 -3.383  1.00 102.83 ?  1715 LEU C CA  1 
ATOM   5907 C C   . LEU C  1 241 ? -40.373  -35.626 -1.921  1.00 96.69  ?  1715 LEU C C   1 
ATOM   5908 O O   . LEU C  1 241 ? -39.739  -36.557 -1.423  1.00 94.14  ?  1715 LEU C O   1 
ATOM   5909 C CB  . LEU C  1 241 ? -39.398  -33.833 -3.444  1.00 106.76 ?  1715 LEU C CB  1 
ATOM   5910 C CG  . LEU C  1 241 ? -38.080  -33.703 -2.706  1.00 104.31 ?  1715 LEU C CG  1 
ATOM   5911 C CD1 . LEU C  1 241 ? -37.011  -33.160 -3.618  1.00 106.31 ?  1715 LEU C CD1 1 
ATOM   5912 C CD2 . LEU C  1 241 ? -38.240  -32.848 -1.459  1.00 110.02 ?  1715 LEU C CD2 1 
ATOM   5913 N N   . VAL C  1 242 ? -41.327  -34.942 -1.257  1.00 89.90  ?  1716 VAL C N   1 
ATOM   5914 C CA  . VAL C  1 242 ? -41.751  -35.180 0.130   1.00 78.43  ?  1716 VAL C CA  1 
ATOM   5915 C C   . VAL C  1 242 ? -42.393  -36.564 0.272   1.00 71.72  ?  1716 VAL C C   1 
ATOM   5916 O O   . VAL C  1 242 ? -42.095  -37.268 1.237   1.00 60.96  ?  1716 VAL C O   1 
ATOM   5917 C CB  . VAL C  1 242 ? -42.679  -34.038 0.629   1.00 75.24  ?  1716 VAL C CB  1 
ATOM   5918 C CG1 . VAL C  1 242 ? -43.191  -34.301 2.044   1.00 72.12  ?  1716 VAL C CG1 1 
ATOM   5919 C CG2 . VAL C  1 242 ? -41.974  -32.683 0.556   1.00 77.90  ?  1716 VAL C CG2 1 
ATOM   5920 N N   . VAL C  1 243 ? -43.254  -36.948 -0.703  1.00 76.86  ?  1717 VAL C N   1 
ATOM   5921 C CA  . VAL C  1 243 ? -43.958  -38.239 -0.793  1.00 74.61  ?  1717 VAL C CA  1 
ATOM   5922 C C   . VAL C  1 243 ? -42.939  -39.379 -0.914  1.00 75.62  ?  1717 VAL C C   1 
ATOM   5923 O O   . VAL C  1 243 ? -43.118  -40.427 -0.292  1.00 74.84  ?  1717 VAL C O   1 
ATOM   5924 C CB  . VAL C  1 243 ? -44.997  -38.247 -1.950  1.00 71.04  ?  1717 VAL C CB  1 
ATOM   5925 C CG1 . VAL C  1 243 ? -45.514  -39.653 -2.248  1.00 67.40  ?  1717 VAL C CG1 1 
ATOM   5926 C CG2 . VAL C  1 243 ? -46.156  -37.301 -1.654  1.00 74.10  ?  1717 VAL C CG2 1 
ATOM   5927 N N   . ALA C  1 244 ? -41.859  -39.151 -1.687  1.00 74.73  ?  1718 ALA C N   1 
ATOM   5928 C CA  . ALA C  1 244 ? -40.781  -40.116 -1.871  1.00 72.20  ?  1718 ALA C CA  1 
ATOM   5929 C C   . ALA C  1 244 ? -40.082  -40.405 -0.545  1.00 76.60  ?  1718 ALA C C   1 
ATOM   5930 O O   . ALA C  1 244 ? -39.753  -41.559 -0.297  1.00 75.03  ?  1718 ALA C O   1 
ATOM   5931 C CB  . ALA C  1 244 ? -39.783  -39.607 -2.894  1.00 73.25  ?  1718 ALA C CB  1 
ATOM   5932 N N   . ILE C  1 245 ? -39.888  -39.372 0.317   1.00 79.88  ?  1719 ILE C N   1 
ATOM   5933 C CA  . ILE C  1 245 ? -39.267  -39.496 1.651   1.00 82.14  ?  1719 ILE C CA  1 
ATOM   5934 C C   . ILE C  1 245 ? -40.197  -40.322 2.561   1.00 96.70  ?  1719 ILE C C   1 
ATOM   5935 O O   . ILE C  1 245 ? -39.716  -41.197 3.288   1.00 97.79  ?  1719 ILE C O   1 
ATOM   5936 C CB  . ILE C  1 245 ? -38.888  -38.106 2.268   1.00 76.54  ?  1719 ILE C CB  1 
ATOM   5937 C CG1 . ILE C  1 245 ? -37.959  -37.293 1.326   1.00 78.50  ?  1719 ILE C CG1 1 
ATOM   5938 C CG2 . ILE C  1 245 ? -38.265  -38.250 3.674   1.00 72.79  ?  1719 ILE C CG2 1 
ATOM   5939 C CD1 . ILE C  1 245 ? -37.871  -35.768 1.627   1.00 80.20  ?  1719 ILE C CD1 1 
ATOM   5940 N N   . ILE C  1 246 ? -41.527  -40.051 2.483   1.00 107.90 ?  1720 ILE C N   1 
ATOM   5941 C CA  . ILE C  1 246 ? -42.595  -40.740 3.221   1.00 102.56 ?  1720 ILE C CA  1 
ATOM   5942 C C   . ILE C  1 246 ? -42.585  -42.232 2.847   1.00 98.01  ?  1720 ILE C C   1 
ATOM   5943 O O   . ILE C  1 246 ? -42.532  -43.092 3.730   1.00 94.41  ?  1720 ILE C O   1 
ATOM   5944 C CB  . ILE C  1 246 ? -43.986  -40.071 2.946   1.00 108.96 ?  1720 ILE C CB  1 
ATOM   5945 C CG1 . ILE C  1 246 ? -44.096  -38.688 3.618   1.00 110.11 ?  1720 ILE C CG1 1 
ATOM   5946 C CG2 . ILE C  1 246 ? -45.157  -40.978 3.361   1.00 116.96 ?  1720 ILE C CG2 1 
ATOM   5947 C CD1 . ILE C  1 246 ? -45.239  -37.798 3.107   1.00 104.05 ?  1720 ILE C CD1 1 
ATOM   5948 N N   . VAL C  1 247 ? -42.603  -42.516 1.529   1.00 95.35  ?  1721 VAL C N   1 
ATOM   5949 C CA  . VAL C  1 247 ? -42.628  -43.854 0.955   1.00 92.77  ?  1721 VAL C CA  1 
ATOM   5950 C C   . VAL C  1 247 ? -41.275  -44.581 1.162   1.00 94.74  ?  1721 VAL C C   1 
ATOM   5951 O O   . VAL C  1 247 ? -41.299  -45.778 1.431   1.00 101.51 ?  1721 VAL C O   1 
ATOM   5952 C CB  . VAL C  1 247 ? -43.139  -43.806 -0.512  1.00 88.72  ?  1721 VAL C CB  1 
ATOM   5953 C CG1 . VAL C  1 247 ? -42.239  -44.551 -1.494  1.00 93.37  ?  1721 VAL C CG1 1 
ATOM   5954 C CG2 . VAL C  1 247 ? -44.579  -44.294 -0.596  1.00 81.60  ?  1721 VAL C CG2 1 
ATOM   5955 N N   . ASP C  1 248 ? -40.130  -43.871 1.125   1.00 92.49  ?  1722 ASP C N   1 
ATOM   5956 C CA  . ASP C  1 248 ? -38.815  -44.479 1.373   1.00 105.76 ?  1722 ASP C CA  1 
ATOM   5957 C C   . ASP C  1 248 ? -38.690  -44.909 2.844   1.00 103.81 ?  1722 ASP C C   1 
ATOM   5958 O O   . ASP C  1 248 ? -38.074  -45.937 3.134   1.00 100.20 ?  1722 ASP C O   1 
ATOM   5959 C CB  . ASP C  1 248 ? -37.666  -43.533 0.981   1.00 118.17 ?  1722 ASP C CB  1 
ATOM   5960 C CG  . ASP C  1 248 ? -36.281  -44.153 1.084   1.00 126.10 ?  1722 ASP C CG  1 
ATOM   5961 O OD1 . ASP C  1 248 ? -35.919  -44.957 0.191   1.00 126.19 ?  1722 ASP C OD1 1 
ATOM   5962 O OD2 . ASP C  1 248 ? -35.559  -43.834 2.058   1.00 129.13 -1 1722 ASP C OD2 1 
ATOM   5963 N N   . ALA C  1 249 ? -39.290  -44.128 3.762   1.00 98.13  ?  1723 ALA C N   1 
ATOM   5964 C CA  . ALA C  1 249 ? -39.319  -44.428 5.194   1.00 96.34  ?  1723 ALA C CA  1 
ATOM   5965 C C   . ALA C  1 249 ? -40.223  -45.643 5.444   1.00 103.64 ?  1723 ALA C C   1 
ATOM   5966 O O   . ALA C  1 249 ? -39.903  -46.492 6.275   1.00 105.11 ?  1723 ALA C O   1 
ATOM   5967 C CB  . ALA C  1 249 ? -39.838  -43.226 5.962   1.00 90.60  ?  1723 ALA C CB  1 
ATOM   5968 N N   . MET C  1 250 ? -41.335  -45.730 4.694   1.00 112.11 ?  1724 MET C N   1 
ATOM   5969 C CA  . MET C  1 250 ? -42.306  -46.813 4.775   1.00 117.03 ?  1724 MET C CA  1 
ATOM   5970 C C   . MET C  1 250 ? -41.844  -48.095 4.094   1.00 114.20 ?  1724 MET C C   1 
ATOM   5971 O O   . MET C  1 250 ? -42.331  -49.169 4.445   1.00 110.47 ?  1724 MET C O   1 
ATOM   5972 C CB  . MET C  1 250 ? -43.668  -46.360 4.241   1.00 133.09 ?  1724 MET C CB  1 
ATOM   5973 C CG  . MET C  1 250 ? -44.465  -45.549 5.242   1.00 147.24 ?  1724 MET C CG  1 
ATOM   5974 S SD  . MET C  1 250 ? -44.486  -46.287 6.898   1.00 165.15 ?  1724 MET C SD  1 
ATOM   5975 C CE  . MET C  1 250 ? -45.617  -47.664 6.643   1.00 166.58 ?  1724 MET C CE  1 
ATOM   5976 N N   . ALA C  1 251 ? -40.908  -47.985 3.127   1.00 118.30 ?  1725 ALA C N   1 
ATOM   5977 C CA  . ALA C  1 251 ? -40.331  -49.122 2.404   1.00 127.37 ?  1725 ALA C CA  1 
ATOM   5978 C C   . ALA C  1 251 ? -39.406  -49.916 3.327   1.00 125.72 ?  1725 ALA C C   1 
ATOM   5979 O O   . ALA C  1 251 ? -39.510  -51.143 3.376   1.00 113.88 ?  1725 ALA C O   1 
ATOM   5980 C CB  . ALA C  1 251 ? -39.567  -48.641 1.176   1.00 135.35 ?  1725 ALA C CB  1 
ATOM   5981 N N   . ILE C  1 252 ? -38.529  -49.211 4.078   1.00 119.77 ?  1726 ILE C N   1 
ATOM   5982 C CA  . ILE C  1 252 ? -37.595  -49.812 5.032   1.00 118.41 ?  1726 ILE C CA  1 
ATOM   5983 C C   . ILE C  1 252 ? -38.349  -50.303 6.299   1.00 119.19 ?  1726 ILE C C   1 
ATOM   5984 O O   . ILE C  1 252 ? -37.940  -51.304 6.895   1.00 134.01 ?  1726 ILE C O   1 
ATOM   5985 C CB  . ILE C  1 252 ? -36.377  -48.872 5.323   1.00 121.03 ?  1726 ILE C CB  1 
ATOM   5986 C CG1 . ILE C  1 252 ? -35.216  -49.633 6.011   1.00 119.51 ?  1726 ILE C CG1 1 
ATOM   5987 C CG2 . ILE C  1 252 ? -36.764  -47.589 6.088   1.00 121.94 ?  1726 ILE C CG2 1 
ATOM   5988 C CD1 . ILE C  1 252 ? -33.811  -49.226 5.560   1.00 117.29 ?  1726 ILE C CD1 1 
ATOM   5989 N N   . LEU C  1 253 ? -39.466  -49.628 6.672   1.00 113.86 ?  1727 LEU C N   1 
ATOM   5990 C CA  . LEU C  1 253 ? -40.293  -49.996 7.828   1.00 112.86 ?  1727 LEU C CA  1 
ATOM   5991 C C   . LEU C  1 253 ? -41.056  -51.303 7.571   1.00 115.07 ?  1727 LEU C C   1 
ATOM   5992 O O   . LEU C  1 253 ? -41.092  -52.163 8.452   1.00 114.44 ?  1727 LEU C O   1 
ATOM   5993 C CB  . LEU C  1 253 ? -41.261  -48.857 8.202   1.00 118.68 ?  1727 LEU C CB  1 
ATOM   5994 C CG  . LEU C  1 253 ? -41.700  -48.780 9.669   1.00 123.43 ?  1727 LEU C CG  1 
ATOM   5995 C CD1 . LEU C  1 253 ? -40.626  -48.136 10.532  1.00 131.72 ?  1727 LEU C CD1 1 
ATOM   5996 C CD2 . LEU C  1 253 ? -42.973  -47.972 9.815   1.00 118.51 ?  1727 LEU C CD2 1 
ATOM   5997 N N   . ASN C  1 254 ? -41.642  -51.459 6.362   1.00 120.26 ?  1728 ASN C N   1 
ATOM   5998 C CA  . ASN C  1 254 ? -42.376  -52.666 5.964   1.00 127.51 ?  1728 ASN C CA  1 
ATOM   5999 C C   . ASN C  1 254 ? -41.446  -53.853 5.732   1.00 134.91 ?  1728 ASN C C   1 
ATOM   6000 O O   . ASN C  1 254 ? -41.881  -54.986 5.908   1.00 132.41 ?  1728 ASN C O   1 
ATOM   6001 C CB  . ASN C  1 254 ? -43.239  -52.418 4.719   1.00 127.48 ?  1728 ASN C CB  1 
ATOM   6002 C CG  . ASN C  1 254 ? -44.627  -51.858 4.978   1.00 126.20 ?  1728 ASN C CG  1 
ATOM   6003 O OD1 . ASN C  1 254 ? -45.265  -51.289 4.082   1.00 120.31 ?  1728 ASN C OD1 1 
ATOM   6004 N ND2 . ASN C  1 254 ? -45.154  -52.036 6.183   1.00 128.37 ?  1728 ASN C ND2 1 
ATOM   6005 N N   . GLN C  1 255 ? -40.175  -53.588 5.335   1.00 143.19 ?  1729 GLN C N   1 
ATOM   6006 C CA  . GLN C  1 255 ? -39.118  -54.579 5.073   1.00 139.96 ?  1729 GLN C CA  1 
ATOM   6007 C C   . GLN C  1 255 ? -38.821  -55.432 6.309   1.00 140.06 ?  1729 GLN C C   1 
ATOM   6008 O O   . GLN C  1 255 ? -38.714  -56.655 6.188   1.00 149.79 ?  1729 GLN C O   1 
ATOM   6009 C CB  . GLN C  1 255 ? -37.830  -53.886 4.592   1.00 134.16 ?  1729 GLN C CB  1 
ATOM   6010 C CG  . GLN C  1 255 ? -37.642  -53.871 3.075   1.00 132.78 ?  1729 GLN C CG  1 
ATOM   6011 C CD  . GLN C  1 255 ? -36.788  -52.704 2.614   1.00 137.20 ?  1729 GLN C CD  1 
ATOM   6012 O OE1 . GLN C  1 255 ? -35.651  -52.499 3.065   1.00 141.73 ?  1729 GLN C OE1 1 
ATOM   6013 N NE2 . GLN C  1 255 ? -37.316  -51.917 1.686   1.00 136.89 ?  1729 GLN C NE2 1 
ATOM   6014 N N   . LYS C  1 256 ? -38.686  -54.785 7.491   1.00 133.44 ?  1730 LYS C N   1 
ATOM   6015 C CA  . LYS C  1 256 ? -38.438  -55.477 8.759   1.00 130.06 ?  1730 LYS C CA  1 
ATOM   6016 C C   . LYS C  1 256 ? -39.710  -56.167 9.257   1.00 132.11 ?  1730 LYS C C   1 
ATOM   6017 O O   . LYS C  1 256 ? -39.632  -57.284 9.771   1.00 137.50 ?  1730 LYS C O   1 
ATOM   6018 C CB  . LYS C  1 256 ? -37.810  -54.553 9.829   1.00 123.38 ?  1730 LYS C CB  1 
ATOM   6019 C CG  . LYS C  1 256 ? -38.652  -53.354 10.263  1.00 120.78 ?  1730 LYS C CG  1 
ATOM   6020 C CD  . LYS C  1 256 ? -38.039  -52.645 11.454  1.00 119.48 ?  1730 LYS C CD  1 
ATOM   6021 C CE  . LYS C  1 256 ? -38.873  -51.471 11.904  1.00 124.57 ?  1730 LYS C CE  1 
ATOM   6022 N NZ  . LYS C  1 256 ? -38.232  -50.733 13.028  1.00 128.08 1  1730 LYS C NZ  1 
ATOM   6023 N N   . GLU C  1 257 ? -40.877  -55.513 9.055   1.00 130.55 ?  1731 GLU C N   1 
ATOM   6024 C CA  . GLU C  1 257 ? -42.209  -55.994 9.418   1.00 136.29 ?  1731 GLU C CA  1 
ATOM   6025 C C   . GLU C  1 257 ? -42.556  -57.297 8.661   1.00 148.32 ?  1731 GLU C C   1 
ATOM   6026 O O   . GLU C  1 257 ? -43.078  -58.232 9.272   1.00 155.72 ?  1731 GLU C O   1 
ATOM   6027 C CB  . GLU C  1 257 ? -43.240  -54.884 9.133   1.00 132.69 ?  1731 GLU C CB  1 
ATOM   6028 C CG  . GLU C  1 257 ? -44.696  -55.268 9.357   1.00 136.94 ?  1731 GLU C CG  1 
ATOM   6029 C CD  . GLU C  1 257 ? -45.642  -55.020 8.194   1.00 141.76 ?  1731 GLU C CD  1 
ATOM   6030 O OE1 . GLU C  1 257 ? -45.160  -54.849 7.050   1.00 151.51 ?  1731 GLU C OE1 1 
ATOM   6031 O OE2 . GLU C  1 257 ? -46.873  -55.015 8.428   1.00 134.74 -1 1731 GLU C OE2 1 
ATOM   6032 N N   . GLU C  1 258 ? -42.226  -57.352 7.345   1.00 151.35 ?  1732 GLU C N   1 
ATOM   6033 C CA  . GLU C  1 258 ? -42.461  -58.467 6.413   1.00 145.03 ?  1732 GLU C CA  1 
ATOM   6034 C C   . GLU C  1 258 ? -41.772  -59.771 6.838   1.00 143.65 ?  1732 GLU C C   1 
ATOM   6035 O O   . GLU C  1 258 ? -42.437  -60.809 6.883   1.00 145.82 ?  1732 GLU C O   1 
ATOM   6036 C CB  . GLU C  1 258 ? -42.023  -58.074 4.989   1.00 139.83 ?  1732 GLU C CB  1 
ATOM   6037 C CG  . GLU C  1 258 ? -42.804  -58.741 3.872   1.00 136.40 ?  1732 GLU C CG  1 
ATOM   6038 C CD  . GLU C  1 258 ? -42.377  -58.305 2.483   1.00 134.96 ?  1732 GLU C CD  1 
ATOM   6039 O OE1 . GLU C  1 258 ? -42.709  -57.164 2.087   1.00 131.43 ?  1732 GLU C OE1 1 
ATOM   6040 O OE2 . GLU C  1 258 ? -41.690  -59.095 1.796   1.00 134.88 -1 1732 GLU C OE2 1 
ATOM   6041 N N   . GLN C  1 259 ? -40.448  -59.719 7.133   1.00 136.65 ?  1733 GLN C N   1 
ATOM   6042 C CA  . GLN C  1 259 ? -39.654  -60.882 7.548   1.00 132.27 ?  1733 GLN C CA  1 
ATOM   6043 C C   . GLN C  1 259 ? -40.042  -61.411 8.940   1.00 139.40 ?  1733 GLN C C   1 
ATOM   6044 O O   . GLN C  1 259 ? -39.961  -62.625 9.162   1.00 155.52 ?  1733 GLN C O   1 
ATOM   6045 C CB  . GLN C  1 259 ? -38.144  -60.612 7.438   1.00 126.89 ?  1733 GLN C CB  1 
ATOM   6046 C CG  . GLN C  1 259 ? -37.606  -60.784 6.007   1.00 126.05 ?  1733 GLN C CG  1 
ATOM   6047 C CD  . GLN C  1 259 ? -36.109  -61.039 5.898   1.00 125.34 ?  1733 GLN C CD  1 
ATOM   6048 O OE1 . GLN C  1 259 ? -35.342  -60.939 6.869   1.00 120.91 ?  1733 GLN C OE1 1 
ATOM   6049 N NE2 . GLN C  1 259 ? -35.654  -61.374 4.695   1.00 120.78 ?  1733 GLN C NE2 1 
ATOM   6050 N N   . HIS C  1 260 ? -40.493  -60.513 9.856   1.00 133.85 ?  1734 HIS C N   1 
ATOM   6051 C CA  . HIS C  1 260 ? -40.949  -60.870 11.209  1.00 126.52 ?  1734 HIS C CA  1 
ATOM   6052 C C   . HIS C  1 260 ? -42.155  -61.817 11.137  1.00 118.59 ?  1734 HIS C C   1 
ATOM   6053 O O   . HIS C  1 260 ? -42.179  -62.833 11.833  1.00 115.37 ?  1734 HIS C O   1 
ATOM   6054 C CB  . HIS C  1 260 ? -41.328  -59.616 12.029  1.00 128.35 ?  1734 HIS C CB  1 
ATOM   6055 C CG  . HIS C  1 260 ? -40.170  -58.798 12.524  1.00 137.64 ?  1734 HIS C CG  1 
ATOM   6056 N ND1 . HIS C  1 260 ? -40.215  -57.413 12.521  1.00 144.91 ?  1734 HIS C ND1 1 
ATOM   6057 C CD2 . HIS C  1 260 ? -38.985  -59.191 13.049  1.00 143.44 ?  1734 HIS C CD2 1 
ATOM   6058 C CE1 . HIS C  1 260 ? -39.059  -57.011 13.024  1.00 145.93 ?  1734 HIS C CE1 1 
ATOM   6059 N NE2 . HIS C  1 260 ? -38.284  -58.044 13.355  1.00 148.01 ?  1734 HIS C NE2 1 
ATOM   6060 N N   . ILE C  1 261 ? -43.129  -61.485 10.261  1.00 106.72 ?  1735 ILE C N   1 
ATOM   6061 C CA  . ILE C  1 261 ? -44.377  -62.221 10.017  1.00 102.20 ?  1735 ILE C CA  1 
ATOM   6062 C C   . ILE C  1 261 ? -44.143  -63.682 9.578   1.00 97.03  ?  1735 ILE C C   1 
ATOM   6063 O O   . ILE C  1 261 ? -44.837  -64.567 10.084  1.00 104.27 ?  1735 ILE C O   1 
ATOM   6064 C CB  . ILE C  1 261 ? -45.284  -61.431 9.008   1.00 108.26 ?  1735 ILE C CB  1 
ATOM   6065 C CG1 . ILE C  1 261 ? -45.830  -60.125 9.651   1.00 113.76 ?  1735 ILE C CG1 1 
ATOM   6066 C CG2 . ILE C  1 261 ? -46.440  -62.292 8.433   1.00 107.83 ?  1735 ILE C CG2 1 
ATOM   6067 C CD1 . ILE C  1 261 ? -46.280  -58.999 8.655   1.00 112.31 ?  1735 ILE C CD1 1 
ATOM   6068 N N   . ILE C  1 262 ? -43.173  -63.922 8.664   1.00 111.53 ?  1736 ILE C N   1 
ATOM   6069 C CA  . ILE C  1 262 ? -42.843  -65.211 8.021   1.00 114.74 ?  1736 ILE C CA  1 
ATOM   6070 C C   . ILE C  1 262 ? -42.832  -66.457 8.978   1.00 118.21 ?  1736 ILE C C   1 
ATOM   6071 O O   . ILE C  1 262 ? -43.677  -67.352 8.797   1.00 116.78 ?  1736 ILE C O   1 
ATOM   6072 C CB  . ILE C  1 262 ? -41.519  -65.108 7.193   1.00 111.44 ?  1736 ILE C CB  1 
ATOM   6073 C CG1 . ILE C  1 262 ? -41.525  -63.896 6.200   1.00 106.06 ?  1736 ILE C CG1 1 
ATOM   6074 C CG2 . ILE C  1 262 ? -41.163  -66.433 6.474   1.00 110.23 ?  1736 ILE C CG2 1 
ATOM   6075 C CD1 . ILE C  1 262 ? -42.745  -63.764 5.143   1.00 100.13 ?  1736 ILE C CD1 1 
ATOM   6076 N N   . ASP C  1 263 ? -41.880  -66.520 9.951   1.00 113.34 ?  1737 ASP C N   1 
ATOM   6077 C CA  . ASP C  1 263 ? -41.681  -67.642 10.895  1.00 111.07 ?  1737 ASP C CA  1 
ATOM   6078 C C   . ASP C  1 263 ? -41.126  -68.910 10.197  1.00 107.91 ?  1737 ASP C C   1 
ATOM   6079 O O   . ASP C  1 263 ? -41.865  -69.707 9.607   1.00 100.84 ?  1737 ASP C O   1 
ATOM   6080 C CB  . ASP C  1 263 ? -42.942  -67.972 11.737  1.00 112.00 ?  1737 ASP C CB  1 
ATOM   6081 C CG  . ASP C  1 263 ? -43.664  -66.785 12.340  1.00 111.66 ?  1737 ASP C CG  1 
ATOM   6082 O OD1 . ASP C  1 263 ? -42.977  -65.880 12.878  1.00 108.03 -1 1737 ASP C OD1 1 
ATOM   6083 O OD2 . ASP C  1 263 ? -44.920  -66.781 12.317  1.00 115.49 ?  1737 ASP C OD2 1 
ATOM   6084 N N   . MET D  1 19  ? -73.434  -35.348 55.359  1.00 154.23 ?  1493 MET D N   1 
ATOM   6085 C CA  . MET D  1 19  ? -72.894  -34.345 54.439  1.00 153.01 ?  1493 MET D CA  1 
ATOM   6086 C C   . MET D  1 19  ? -71.506  -34.756 53.866  1.00 162.21 ?  1493 MET D C   1 
ATOM   6087 O O   . MET D  1 19  ? -70.665  -33.904 53.560  1.00 177.96 ?  1493 MET D O   1 
ATOM   6088 C CB  . MET D  1 19  ? -72.895  -32.930 55.076  1.00 145.40 ?  1493 MET D CB  1 
ATOM   6089 C CG  . MET D  1 19  ? -72.062  -32.799 56.350  1.00 141.45 ?  1493 MET D CG  1 
ATOM   6090 S SD  . MET D  1 19  ? -72.172  -31.150 57.090  1.00 139.30 ?  1493 MET D SD  1 
ATOM   6091 C CE  . MET D  1 19  ? -73.517  -31.408 58.242  1.00 129.05 ?  1493 MET D CE  1 
ATOM   6092 N N   . TYR D  1 20  ? -71.300  -36.077 53.702  1.00 156.32 ?  1494 TYR D N   1 
ATOM   6093 C CA  . TYR D  1 20  ? -70.093  -36.715 53.157  1.00 150.21 ?  1494 TYR D CA  1 
ATOM   6094 C C   . TYR D  1 20  ? -70.476  -38.089 52.605  1.00 135.61 ?  1494 TYR D C   1 
ATOM   6095 O O   . TYR D  1 20  ? -69.754  -38.656 51.789  1.00 124.72 ?  1494 TYR D O   1 
ATOM   6096 C CB  . TYR D  1 20  ? -69.007  -36.854 54.242  1.00 157.22 ?  1494 TYR D CB  1 
ATOM   6097 C CG  . TYR D  1 20  ? -67.611  -37.124 53.713  1.00 158.63 ?  1494 TYR D CG  1 
ATOM   6098 C CD1 . TYR D  1 20  ? -67.160  -38.426 53.504  1.00 153.20 ?  1494 TYR D CD1 1 
ATOM   6099 C CD2 . TYR D  1 20  ? -66.714  -36.082 53.498  1.00 162.86 ?  1494 TYR D CD2 1 
ATOM   6100 C CE1 . TYR D  1 20  ? -65.871  -38.681 53.037  1.00 152.27 ?  1494 TYR D CE1 1 
ATOM   6101 C CE2 . TYR D  1 20  ? -65.415  -36.325 53.047  1.00 164.30 ?  1494 TYR D CE2 1 
ATOM   6102 C CZ  . TYR D  1 20  ? -64.997  -37.626 52.819  1.00 159.64 ?  1494 TYR D CZ  1 
ATOM   6103 O OH  . TYR D  1 20  ? -63.717  -37.864 52.374  1.00 163.14 ?  1494 TYR D OH  1 
ATOM   6104 N N   . LEU D  1 21  ? -71.615  -38.620 53.068  1.00 125.29 ?  1495 LEU D N   1 
ATOM   6105 C CA  . LEU D  1 21  ? -72.146  -39.918 52.658  1.00 123.52 ?  1495 LEU D CA  1 
ATOM   6106 C C   . LEU D  1 21  ? -72.933  -39.772 51.334  1.00 124.65 ?  1495 LEU D C   1 
ATOM   6107 O O   . LEU D  1 21  ? -72.746  -40.580 50.415  1.00 113.99 ?  1495 LEU D O   1 
ATOM   6108 C CB  . LEU D  1 21  ? -73.038  -40.525 53.778  1.00 121.91 ?  1495 LEU D CB  1 
ATOM   6109 C CG  . LEU D  1 21  ? -72.386  -40.766 55.164  1.00 118.61 ?  1495 LEU D CG  1 
ATOM   6110 C CD1 . LEU D  1 21  ? -72.768  -39.667 56.161  1.00 116.70 ?  1495 LEU D CD1 1 
ATOM   6111 C CD2 . LEU D  1 21  ? -72.789  -42.113 55.733  1.00 112.18 ?  1495 LEU D CD2 1 
ATOM   6112 N N   . ARG D  1 22  ? -73.786  -38.720 51.238  1.00 129.50 ?  1496 ARG D N   1 
ATOM   6113 C CA  . ARG D  1 22  ? -74.638  -38.417 50.076  1.00 122.39 ?  1496 ARG D CA  1 
ATOM   6114 C C   . ARG D  1 22  ? -73.919  -37.610 48.986  1.00 113.74 ?  1496 ARG D C   1 
ATOM   6115 O O   . ARG D  1 22  ? -74.214  -37.785 47.801  1.00 104.37 ?  1496 ARG D O   1 
ATOM   6116 C CB  . ARG D  1 22  ? -75.903  -37.655 50.518  1.00 127.29 ?  1496 ARG D CB  1 
ATOM   6117 C CG  . ARG D  1 22  ? -76.838  -38.431 51.441  1.00 134.99 ?  1496 ARG D CG  1 
ATOM   6118 C CD  . ARG D  1 22  ? -77.994  -37.557 51.900  1.00 142.39 ?  1496 ARG D CD  1 
ATOM   6119 N NE  . ARG D  1 22  ? -78.827  -38.226 52.903  1.00 145.98 ?  1496 ARG D NE  1 
ATOM   6120 C CZ  . ARG D  1 22  ? -79.885  -37.676 53.495  1.00 146.63 ?  1496 ARG D CZ  1 
ATOM   6121 N NH1 . ARG D  1 22  ? -80.258  -36.438 53.192  1.00 145.25 1  1496 ARG D NH1 1 
ATOM   6122 N NH2 . ARG D  1 22  ? -80.578  -38.362 54.395  1.00 145.30 ?  1496 ARG D NH2 1 
ATOM   6123 N N   . ILE D  1 23  ? -73.009  -36.701 49.390  1.00 116.16 ?  1497 ILE D N   1 
ATOM   6124 C CA  . ILE D  1 23  ? -72.279  -35.846 48.451  1.00 119.94 ?  1497 ILE D CA  1 
ATOM   6125 C C   . ILE D  1 23  ? -71.224  -36.652 47.651  1.00 121.83 ?  1497 ILE D C   1 
ATOM   6126 O O   . ILE D  1 23  ? -71.015  -36.347 46.476  1.00 111.33 ?  1497 ILE D O   1 
ATOM   6127 C CB  . ILE D  1 23  ? -71.708  -34.533 49.083  1.00 113.00 ?  1497 ILE D CB  1 
ATOM   6128 C CG1 . ILE D  1 23  ? -70.627  -34.795 50.162  1.00 108.61 ?  1497 ILE D CG1 1 
ATOM   6129 C CG2 . ILE D  1 23  ? -72.845  -33.651 49.621  1.00 108.46 ?  1497 ILE D CG2 1 
ATOM   6130 C CD1 . ILE D  1 23  ? -69.652  -33.615 50.436  1.00 101.73 ?  1497 ILE D CD1 1 
ATOM   6131 N N   . THR D  1 24  ? -70.616  -37.703 48.259  1.00 132.04 ?  1498 THR D N   1 
ATOM   6132 C CA  . THR D  1 24  ? -69.616  -38.568 47.606  1.00 128.82 ?  1498 THR D CA  1 
ATOM   6133 C C   . THR D  1 24  ? -70.129  -39.202 46.310  1.00 125.71 ?  1498 THR D C   1 
ATOM   6134 O O   . THR D  1 24  ? -69.338  -39.415 45.394  1.00 115.69 ?  1498 THR D O   1 
ATOM   6135 C CB  . THR D  1 24  ? -69.036  -39.639 48.564  1.00 130.96 ?  1498 THR D CB  1 
ATOM   6136 O OG1 . THR D  1 24  ? -70.026  -40.075 49.500  1.00 129.24 ?  1498 THR D OG1 1 
ATOM   6137 C CG2 . THR D  1 24  ? -67.773  -39.174 49.288  1.00 130.14 ?  1498 THR D CG2 1 
ATOM   6138 N N   . ASN D  1 25  ? -71.445  -39.486 46.228  1.00 131.57 ?  1499 ASN D N   1 
ATOM   6139 C CA  . ASN D  1 25  ? -72.059  -40.099 45.049  1.00 134.77 ?  1499 ASN D CA  1 
ATOM   6140 C C   . ASN D  1 25  ? -72.615  -39.076 44.043  1.00 133.25 ?  1499 ASN D C   1 
ATOM   6141 O O   . ASN D  1 25  ? -72.654  -39.385 42.850  1.00 129.87 ?  1499 ASN D O   1 
ATOM   6142 C CB  . ASN D  1 25  ? -73.120  -41.155 45.429  1.00 133.58 ?  1499 ASN D CB  1 
ATOM   6143 C CG  . ASN D  1 25  ? -74.095  -40.750 46.515  1.00 135.28 ?  1499 ASN D CG  1 
ATOM   6144 O OD1 . ASN D  1 25  ? -75.126  -40.115 46.256  1.00 143.06 ?  1499 ASN D OD1 1 
ATOM   6145 N ND2 . ASN D  1 25  ? -73.817  -41.156 47.751  1.00 131.14 ?  1499 ASN D ND2 1 
ATOM   6146 N N   . ILE D  1 26  ? -73.017  -37.865 44.506  1.00 133.99 ?  1500 ILE D N   1 
ATOM   6147 C CA  . ILE D  1 26  ? -73.566  -36.823 43.617  1.00 133.03 ?  1500 ILE D CA  1 
ATOM   6148 C C   . ILE D  1 26  ? -72.459  -36.151 42.771  1.00 124.68 ?  1500 ILE D C   1 
ATOM   6149 O O   . ILE D  1 26  ? -72.721  -35.786 41.625  1.00 112.72 ?  1500 ILE D O   1 
ATOM   6150 C CB  . ILE D  1 26  ? -74.496  -35.777 44.325  1.00 136.70 ?  1500 ILE D CB  1 
ATOM   6151 C CG1 . ILE D  1 26  ? -73.733  -34.811 45.263  1.00 137.86 ?  1500 ILE D CG1 1 
ATOM   6152 C CG2 . ILE D  1 26  ? -75.665  -36.451 45.057  1.00 137.08 ?  1500 ILE D CG2 1 
ATOM   6153 C CD1 . ILE D  1 26  ? -73.536  -33.413 44.716  1.00 133.92 ?  1500 ILE D CD1 1 
ATOM   6154 N N   . VAL D  1 27  ? -71.245  -35.981 43.346  1.00 127.12 ?  1501 VAL D N   1 
ATOM   6155 C CA  . VAL D  1 27  ? -70.079  -35.380 42.684  1.00 130.11 ?  1501 VAL D CA  1 
ATOM   6156 C C   . VAL D  1 27  ? -69.586  -36.323 41.562  1.00 127.64 ?  1501 VAL D C   1 
ATOM   6157 O O   . VAL D  1 27  ? -69.347  -35.863 40.440  1.00 125.32 ?  1501 VAL D O   1 
ATOM   6158 C CB  . VAL D  1 27  ? -68.964  -34.982 43.704  1.00 130.29 ?  1501 VAL D CB  1 
ATOM   6159 C CG1 . VAL D  1 27  ? -67.708  -34.461 43.003  1.00 128.43 ?  1501 VAL D CG1 1 
ATOM   6160 C CG2 . VAL D  1 27  ? -69.476  -33.948 44.705  1.00 128.29 ?  1501 VAL D CG2 1 
ATOM   6161 N N   . GLU D  1 28  ? -69.500  -37.647 41.855  1.00 123.00 ?  1502 GLU D N   1 
ATOM   6162 C CA  . GLU D  1 28  ? -69.083  -38.682 40.895  1.00 119.55 ?  1502 GLU D CA  1 
ATOM   6163 C C   . GLU D  1 28  ? -70.306  -39.170 40.106  1.00 113.68 ?  1502 GLU D C   1 
ATOM   6164 O O   . GLU D  1 28  ? -70.561  -40.376 40.020  1.00 119.92 ?  1502 GLU D O   1 
ATOM   6165 C CB  . GLU D  1 28  ? -68.378  -39.874 41.587  1.00 121.99 ?  1502 GLU D CB  1 
ATOM   6166 C CG  . GLU D  1 28  ? -67.540  -39.560 42.816  1.00 118.54 ?  1502 GLU D CG  1 
ATOM   6167 C CD  . GLU D  1 28  ? -66.282  -38.737 42.622  1.00 119.69 ?  1502 GLU D CD  1 
ATOM   6168 O OE1 . GLU D  1 28  ? -65.442  -39.113 41.773  1.00 109.31 ?  1502 GLU D OE1 1 
ATOM   6169 O OE2 . GLU D  1 28  ? -66.105  -37.753 43.377  1.00 130.96 -1 1502 GLU D OE2 1 
ATOM   6170 N N   . SER D  1 29  ? -71.067  -38.219 39.539  1.00 113.78 ?  1503 SER D N   1 
ATOM   6171 C CA  . SER D  1 29  ? -72.280  -38.480 38.765  1.00 117.58 ?  1503 SER D CA  1 
ATOM   6172 C C   . SER D  1 29  ? -72.207  -37.822 37.385  1.00 113.38 ?  1503 SER D C   1 
ATOM   6173 O O   . SER D  1 29  ? -71.390  -36.917 37.169  1.00 114.85 ?  1503 SER D O   1 
ATOM   6174 C CB  . SER D  1 29  ? -73.507  -37.979 39.530  1.00 116.86 ?  1503 SER D CB  1 
ATOM   6175 O OG  . SER D  1 29  ? -74.723  -38.157 38.822  1.00 112.31 ?  1503 SER D OG  1 
ATOM   6176 N N   . SER D  1 30  ? -73.071  -38.284 36.455  1.00 103.18 ?  1504 SER D N   1 
ATOM   6177 C CA  . SER D  1 30  ? -73.191  -37.720 35.112  1.00 99.34  ?  1504 SER D CA  1 
ATOM   6178 C C   . SER D  1 30  ? -73.722  -36.288 35.253  1.00 98.13  ?  1504 SER D C   1 
ATOM   6179 O O   . SER D  1 30  ? -73.142  -35.381 34.661  1.00 108.59 ?  1504 SER D O   1 
ATOM   6180 C CB  . SER D  1 30  ? -74.121  -38.563 34.244  1.00 96.92  ?  1504 SER D CB  1 
ATOM   6181 O OG  . SER D  1 30  ? -74.050  -38.172 32.882  1.00 92.23  ?  1504 SER D OG  1 
ATOM   6182 N N   . PHE D  1 31  ? -74.757  -36.077 36.112  1.00 92.98  ?  1505 PHE D N   1 
ATOM   6183 C CA  . PHE D  1 31  ? -75.343  -34.764 36.401  1.00 97.84  ?  1505 PHE D CA  1 
ATOM   6184 C C   . PHE D  1 31  ? -74.268  -33.738 36.747  1.00 93.13  ?  1505 PHE D C   1 
ATOM   6185 O O   . PHE D  1 31  ? -74.244  -32.691 36.109  1.00 85.94  ?  1505 PHE D O   1 
ATOM   6186 C CB  . PHE D  1 31  ? -76.399  -34.843 37.530  1.00 110.20 ?  1505 PHE D CB  1 
ATOM   6187 C CG  . PHE D  1 31  ? -76.856  -33.513 38.109  1.00 113.35 ?  1505 PHE D CG  1 
ATOM   6188 C CD1 . PHE D  1 31  ? -76.190  -32.935 39.188  1.00 112.44 ?  1505 PHE D CD1 1 
ATOM   6189 C CD2 . PHE D  1 31  ? -77.972  -32.859 37.599  1.00 112.68 ?  1505 PHE D CD2 1 
ATOM   6190 C CE1 . PHE D  1 31  ? -76.608  -31.708 39.717  1.00 110.37 ?  1505 PHE D CE1 1 
ATOM   6191 C CE2 . PHE D  1 31  ? -78.398  -31.639 38.142  1.00 116.64 ?  1505 PHE D CE2 1 
ATOM   6192 C CZ  . PHE D  1 31  ? -77.712  -31.073 39.196  1.00 113.49 ?  1505 PHE D CZ  1 
ATOM   6193 N N   . PHE D  1 32  ? -73.389  -34.032 37.738  1.00 101.59 ?  1506 PHE D N   1 
ATOM   6194 C CA  . PHE D  1 32  ? -72.345  -33.100 38.189  1.00 104.56 ?  1506 PHE D CA  1 
ATOM   6195 C C   . PHE D  1 32  ? -71.276  -32.791 37.152  1.00 101.55 ?  1506 PHE D C   1 
ATOM   6196 O O   . PHE D  1 32  ? -70.832  -31.642 37.093  1.00 92.32  ?  1506 PHE D O   1 
ATOM   6197 C CB  . PHE D  1 32  ? -71.687  -33.558 39.496  1.00 104.33 ?  1506 PHE D CB  1 
ATOM   6198 C CG  . PHE D  1 32  ? -70.809  -32.515 40.152  1.00 101.18 ?  1506 PHE D CG  1 
ATOM   6199 C CD1 . PHE D  1 32  ? -71.362  -31.507 40.932  1.00 105.72 ?  1506 PHE D CD1 1 
ATOM   6200 C CD2 . PHE D  1 32  ? -69.427  -32.552 40.005  1.00 103.89 ?  1506 PHE D CD2 1 
ATOM   6201 C CE1 . PHE D  1 32  ? -70.549  -30.550 41.550  1.00 111.78 ?  1506 PHE D CE1 1 
ATOM   6202 C CE2 . PHE D  1 32  ? -68.614  -31.590 40.619  1.00 112.19 ?  1506 PHE D CE2 1 
ATOM   6203 C CZ  . PHE D  1 32  ? -69.179  -30.598 41.389  1.00 111.85 ?  1506 PHE D CZ  1 
ATOM   6204 N N   . THR D  1 33  ? -70.836  -33.797 36.364  1.00 103.46 ?  1507 THR D N   1 
ATOM   6205 C CA  . THR D  1 33  ? -69.799  -33.557 35.354  1.00 112.66 ?  1507 THR D CA  1 
ATOM   6206 C C   . THR D  1 33  ? -70.373  -32.767 34.155  1.00 110.00 ?  1507 THR D C   1 
ATOM   6207 O O   . THR D  1 33  ? -69.725  -31.815 33.713  1.00 111.34 ?  1507 THR D O   1 
ATOM   6208 C CB  . THR D  1 33  ? -69.026  -34.842 34.974  1.00 122.59 ?  1507 THR D CB  1 
ATOM   6209 O OG1 . THR D  1 33  ? -67.924  -34.493 34.128  1.00 138.46 ?  1507 THR D OG1 1 
ATOM   6210 C CG2 . THR D  1 33  ? -69.897  -35.920 34.318  1.00 118.43 ?  1507 THR D CG2 1 
ATOM   6211 N N   . LYS D  1 34  ? -71.596  -33.120 33.681  1.00 104.80 ?  1508 LYS D N   1 
ATOM   6212 C CA  . LYS D  1 34  ? -72.274  -32.439 32.567  1.00 98.12  ?  1508 LYS D CA  1 
ATOM   6213 C C   . LYS D  1 34  ? -72.645  -30.994 32.949  1.00 88.50  ?  1508 LYS D C   1 
ATOM   6214 O O   . LYS D  1 34  ? -72.427  -30.074 32.157  1.00 75.52  ?  1508 LYS D O   1 
ATOM   6215 C CB  . LYS D  1 34  ? -73.518  -33.222 32.092  1.00 98.86  ?  1508 LYS D CB  1 
ATOM   6216 C CG  . LYS D  1 34  ? -73.251  -34.660 31.626  1.00 108.86 ?  1508 LYS D CG  1 
ATOM   6217 C CD  . LYS D  1 34  ? -72.962  -34.805 30.133  1.00 125.05 ?  1508 LYS D CD  1 
ATOM   6218 C CE  . LYS D  1 34  ? -72.720  -36.252 29.763  1.00 134.48 ?  1508 LYS D CE  1 
ATOM   6219 N NZ  . LYS D  1 34  ? -72.456  -36.426 28.308  1.00 139.52 1  1508 LYS D NZ  1 
ATOM   6220 N N   . PHE D  1 35  ? -73.172  -30.800 34.175  1.00 90.94  ?  1509 PHE D N   1 
ATOM   6221 C CA  . PHE D  1 35  ? -73.556  -29.491 34.703  1.00 94.80  ?  1509 PHE D CA  1 
ATOM   6222 C C   . PHE D  1 35  ? -72.346  -28.576 34.879  1.00 93.65  ?  1509 PHE D C   1 
ATOM   6223 O O   . PHE D  1 35  ? -72.458  -27.376 34.621  1.00 92.90  ?  1509 PHE D O   1 
ATOM   6224 C CB  . PHE D  1 35  ? -74.346  -29.638 36.020  1.00 102.76 ?  1509 PHE D CB  1 
ATOM   6225 C CG  . PHE D  1 35  ? -74.503  -28.374 36.826  1.00 103.33 ?  1509 PHE D CG  1 
ATOM   6226 C CD1 . PHE D  1 35  ? -75.492  -27.447 36.512  1.00 107.13 ?  1509 PHE D CD1 1 
ATOM   6227 C CD2 . PHE D  1 35  ? -73.653  -28.100 37.892  1.00 97.49  ?  1509 PHE D CD2 1 
ATOM   6228 C CE1 . PHE D  1 35  ? -75.622  -26.265 37.245  1.00 109.19 ?  1509 PHE D CE1 1 
ATOM   6229 C CE2 . PHE D  1 35  ? -73.792  -26.925 38.633  1.00 99.50  ?  1509 PHE D CE2 1 
ATOM   6230 C CZ  . PHE D  1 35  ? -74.770  -26.011 38.300  1.00 108.19 ?  1509 PHE D CZ  1 
ATOM   6231 N N   . ILE D  1 36  ? -71.200  -29.128 35.327  1.00 102.06 ?  1510 ILE D N   1 
ATOM   6232 C CA  . ILE D  1 36  ? -69.997  -28.320 35.526  1.00 102.71 ?  1510 ILE D CA  1 
ATOM   6233 C C   . ILE D  1 36  ? -69.380  -27.931 34.161  1.00 95.39  ?  1510 ILE D C   1 
ATOM   6234 O O   . ILE D  1 36  ? -68.822  -26.838 34.052  1.00 92.71  ?  1510 ILE D O   1 
ATOM   6235 C CB  . ILE D  1 36  ? -69.000  -28.950 36.545  1.00 105.04 ?  1510 ILE D CB  1 
ATOM   6236 C CG1 . ILE D  1 36  ? -68.594  -27.930 37.616  1.00 101.43 ?  1510 ILE D CG1 1 
ATOM   6237 C CG2 . ILE D  1 36  ? -67.787  -29.637 35.912  1.00 113.17 ?  1510 ILE D CG2 1 
ATOM   6238 C CD1 . ILE D  1 36  ? -69.605  -27.795 38.751  1.00 99.73  ?  1510 ILE D CD1 1 
ATOM   6239 N N   . ILE D  1 37  ? -69.558  -28.785 33.118  1.00 93.35  ?  1511 ILE D N   1 
ATOM   6240 C CA  . ILE D  1 37  ? -69.110  -28.503 31.749  1.00 100.53 ?  1511 ILE D CA  1 
ATOM   6241 C C   . ILE D  1 37  ? -70.003  -27.385 31.167  1.00 102.01 ?  1511 ILE D C   1 
ATOM   6242 O O   . ILE D  1 37  ? -69.500  -26.497 30.472  1.00 107.05 ?  1511 ILE D O   1 
ATOM   6243 C CB  . ILE D  1 37  ? -69.009  -29.800 30.880  1.00 97.06  ?  1511 ILE D CB  1 
ATOM   6244 C CG1 . ILE D  1 37  ? -67.692  -30.550 31.196  1.00 103.50 ?  1511 ILE D CG1 1 
ATOM   6245 C CG2 . ILE D  1 37  ? -69.129  -29.521 29.367  1.00 91.00  ?  1511 ILE D CG2 1 
ATOM   6246 C CD1 . ILE D  1 37  ? -67.719  -32.080 30.984  1.00 110.64 ?  1511 ILE D CD1 1 
ATOM   6247 N N   . TYR D  1 38  ? -71.309  -27.394 31.534  1.00 95.90  ?  1512 TYR D N   1 
ATOM   6248 C CA  . TYR D  1 38  ? -72.301  -26.384 31.149  1.00 93.84  ?  1512 TYR D CA  1 
ATOM   6249 C C   . TYR D  1 38  ? -71.886  -25.016 31.710  1.00 80.81  ?  1512 TYR D C   1 
ATOM   6250 O O   . TYR D  1 38  ? -71.937  -24.019 30.986  1.00 74.61  ?  1512 TYR D O   1 
ATOM   6251 C CB  . TYR D  1 38  ? -73.708  -26.792 31.649  1.00 103.47 ?  1512 TYR D CB  1 
ATOM   6252 C CG  . TYR D  1 38  ? -74.810  -25.799 31.337  1.00 107.87 ?  1512 TYR D CG  1 
ATOM   6253 C CD1 . TYR D  1 38  ? -75.465  -25.817 30.107  1.00 106.48 ?  1512 TYR D CD1 1 
ATOM   6254 C CD2 . TYR D  1 38  ? -75.222  -24.863 32.282  1.00 108.85 ?  1512 TYR D CD2 1 
ATOM   6255 C CE1 . TYR D  1 38  ? -76.480  -24.905 29.813  1.00 111.24 ?  1512 TYR D CE1 1 
ATOM   6256 C CE2 . TYR D  1 38  ? -76.240  -23.950 32.002  1.00 117.57 ?  1512 TYR D CE2 1 
ATOM   6257 C CZ  . TYR D  1 38  ? -76.873  -23.981 30.768  1.00 119.86 ?  1512 TYR D CZ  1 
ATOM   6258 O OH  . TYR D  1 38  ? -77.875  -23.083 30.483  1.00 132.10 ?  1512 TYR D OH  1 
ATOM   6259 N N   . LEU D  1 39  ? -71.443  -24.985 32.985  1.00 75.15  ?  1513 LEU D N   1 
ATOM   6260 C CA  . LEU D  1 39  ? -70.993  -23.772 33.662  1.00 80.65  ?  1513 LEU D CA  1 
ATOM   6261 C C   . LEU D  1 39  ? -69.806  -23.113 32.960  1.00 86.86  ?  1513 LEU D C   1 
ATOM   6262 O O   . LEU D  1 39  ? -69.736  -21.881 32.932  1.00 93.45  ?  1513 LEU D O   1 
ATOM   6263 C CB  . LEU D  1 39  ? -70.654  -24.049 35.135  1.00 82.42  ?  1513 LEU D CB  1 
ATOM   6264 C CG  . LEU D  1 39  ? -71.815  -24.088 36.137  1.00 83.63  ?  1513 LEU D CG  1 
ATOM   6265 C CD1 . LEU D  1 39  ? -71.347  -24.631 37.453  1.00 87.61  ?  1513 LEU D CD1 1 
ATOM   6266 C CD2 . LEU D  1 39  ? -72.392  -22.700 36.387  1.00 81.54  ?  1513 LEU D CD2 1 
ATOM   6267 N N   . ILE D  1 40  ? -68.886  -23.927 32.384  1.00 90.61  ?  1514 ILE D N   1 
ATOM   6268 C CA  . ILE D  1 40  ? -67.714  -23.434 31.644  1.00 88.69  ?  1514 ILE D CA  1 
ATOM   6269 C C   . ILE D  1 40  ? -68.165  -22.778 30.320  1.00 90.42  ?  1514 ILE D C   1 
ATOM   6270 O O   . ILE D  1 40  ? -67.736  -21.659 30.015  1.00 84.77  ?  1514 ILE D O   1 
ATOM   6271 C CB  . ILE D  1 40  ? -66.615  -24.515 31.427  1.00 92.33  ?  1514 ILE D CB  1 
ATOM   6272 C CG1 . ILE D  1 40  ? -66.387  -25.366 32.689  1.00 94.28  ?  1514 ILE D CG1 1 
ATOM   6273 C CG2 . ILE D  1 40  ? -65.307  -23.856 30.986  1.00 102.15 ?  1514 ILE D CG2 1 
ATOM   6274 C CD1 . ILE D  1 40  ? -65.798  -26.774 32.444  1.00 97.83  ?  1514 ILE D CD1 1 
ATOM   6275 N N   . VAL D  1 41  ? -69.056  -23.467 29.565  1.00 94.07  ?  1515 VAL D N   1 
ATOM   6276 C CA  . VAL D  1 41  ? -69.630  -22.999 28.297  1.00 94.32  ?  1515 VAL D CA  1 
ATOM   6277 C C   . VAL D  1 41  ? -70.261  -21.628 28.511  1.00 94.30  ?  1515 VAL D C   1 
ATOM   6278 O O   . VAL D  1 41  ? -69.978  -20.703 27.753  1.00 94.03  ?  1515 VAL D O   1 
ATOM   6279 C CB  . VAL D  1 41  ? -70.646  -24.016 27.720  1.00 91.60  ?  1515 VAL D CB  1 
ATOM   6280 C CG1 . VAL D  1 41  ? -71.341  -23.465 26.481  1.00 87.64  ?  1515 VAL D CG1 1 
ATOM   6281 C CG2 . VAL D  1 41  ? -69.973  -25.347 27.404  1.00 102.47 ?  1515 VAL D CG2 1 
ATOM   6282 N N   . LEU D  1 42  ? -71.064  -21.491 29.582  1.00 95.51  ?  1516 LEU D N   1 
ATOM   6283 C CA  . LEU D  1 42  ? -71.724  -20.241 29.963  1.00 96.36  ?  1516 LEU D CA  1 
ATOM   6284 C C   . LEU D  1 42  ? -70.741  -19.151 30.378  1.00 99.22  ?  1516 LEU D C   1 
ATOM   6285 O O   . LEU D  1 42  ? -71.020  -17.975 30.150  1.00 101.37 ?  1516 LEU D O   1 
ATOM   6286 C CB  . LEU D  1 42  ? -72.784  -20.487 31.042  1.00 94.95  ?  1516 LEU D CB  1 
ATOM   6287 C CG  . LEU D  1 42  ? -74.235  -20.446 30.562  1.00 96.99  ?  1516 LEU D CG  1 
ATOM   6288 C CD1 . LEU D  1 42  ? -74.559  -21.612 29.630  1.00 95.98  ?  1516 LEU D CD1 1 
ATOM   6289 C CD2 . LEU D  1 42  ? -75.184  -20.454 31.731  1.00 104.15 ?  1516 LEU D CD2 1 
ATOM   6290 N N   . ASN D  1 43  ? -69.577  -19.537 30.932  1.00 98.46  ?  1517 ASN D N   1 
ATOM   6291 C CA  . ASN D  1 43  ? -68.531  -18.586 31.298  1.00 101.61 ?  1517 ASN D CA  1 
ATOM   6292 C C   . ASN D  1 43  ? -67.718  -18.160 30.057  1.00 99.00  ?  1517 ASN D C   1 
ATOM   6293 O O   . ASN D  1 43  ? -67.099  -17.094 30.086  1.00 93.00  ?  1517 ASN D O   1 
ATOM   6294 C CB  . ASN D  1 43  ? -67.630  -19.141 32.411  1.00 104.95 ?  1517 ASN D CB  1 
ATOM   6295 C CG  . ASN D  1 43  ? -66.951  -18.096 33.287  1.00 100.64 ?  1517 ASN D CG  1 
ATOM   6296 O OD1 . ASN D  1 43  ? -66.204  -18.433 34.218  1.00 101.50 ?  1517 ASN D OD1 1 
ATOM   6297 N ND2 . ASN D  1 43  ? -67.192  -16.807 33.034  1.00 93.72  ?  1517 ASN D ND2 1 
ATOM   6298 N N   . MET D  1 44  ? -67.745  -18.973 28.964  1.00 95.98  ?  1518 MET D N   1 
ATOM   6299 C CA  . MET D  1 44  ? -67.060  -18.658 27.702  1.00 101.78 ?  1518 MET D CA  1 
ATOM   6300 C C   . MET D  1 44  ? -67.863  -17.620 26.951  1.00 104.70 ?  1518 MET D C   1 
ATOM   6301 O O   . MET D  1 44  ? -67.290  -16.641 26.479  1.00 115.07 ?  1518 MET D O   1 
ATOM   6302 C CB  . MET D  1 44  ? -66.843  -19.909 26.832  1.00 103.57 ?  1518 MET D CB  1 
ATOM   6303 C CG  . MET D  1 44  ? -65.848  -19.688 25.705  1.00 103.80 ?  1518 MET D CG  1 
ATOM   6304 S SD  . MET D  1 44  ? -65.554  -21.147 24.676  1.00 104.06 ?  1518 MET D SD  1 
ATOM   6305 C CE  . MET D  1 44  ? -63.803  -21.270 24.814  1.00 97.29  ?  1518 MET D CE  1 
ATOM   6306 N N   . VAL D  1 45  ? -69.192  -17.838 26.854  1.00 96.27  ?  1519 VAL D N   1 
ATOM   6307 C CA  . VAL D  1 45  ? -70.166  -16.960 26.203  1.00 85.34  ?  1519 VAL D CA  1 
ATOM   6308 C C   . VAL D  1 45  ? -70.115  -15.551 26.845  1.00 82.31  ?  1519 VAL D C   1 
ATOM   6309 O O   . VAL D  1 45  ? -70.012  -14.550 26.125  1.00 73.10  ?  1519 VAL D O   1 
ATOM   6310 C CB  . VAL D  1 45  ? -71.578  -17.611 26.227  1.00 85.76  ?  1519 VAL D CB  1 
ATOM   6311 C CG1 . VAL D  1 45  ? -72.661  -16.652 25.740  1.00 87.79  ?  1519 VAL D CG1 1 
ATOM   6312 C CG2 . VAL D  1 45  ? -71.598  -18.892 25.404  1.00 86.81  ?  1519 VAL D CG2 1 
ATOM   6313 N N   . THR D  1 46  ? -70.107  -15.485 28.190  1.00 80.09  ?  1520 THR D N   1 
ATOM   6314 C CA  . THR D  1 46  ? -70.013  -14.213 28.912  1.00 89.75  ?  1520 THR D CA  1 
ATOM   6315 C C   . THR D  1 46  ? -68.649  -13.530 28.674  1.00 94.81  ?  1520 THR D C   1 
ATOM   6316 O O   . THR D  1 46  ? -68.584  -12.301 28.633  1.00 92.53  ?  1520 THR D O   1 
ATOM   6317 C CB  . THR D  1 46  ? -70.374  -14.370 30.400  1.00 95.56  ?  1520 THR D CB  1 
ATOM   6318 O OG1 . THR D  1 46  ? -69.489  -15.302 31.021  1.00 103.03 ?  1520 THR D OG1 1 
ATOM   6319 C CG2 . THR D  1 46  ? -71.829  -14.788 30.611  1.00 101.63 ?  1520 THR D CG2 1 
ATOM   6320 N N   . MET D  1 47  ? -67.580  -14.323 28.474  1.00 104.02 ?  1521 MET D N   1 
ATOM   6321 C CA  . MET D  1 47  ? -66.249  -13.796 28.186  1.00 103.89 ?  1521 MET D CA  1 
ATOM   6322 C C   . MET D  1 47  ? -66.150  -13.336 26.721  1.00 111.05 ?  1521 MET D C   1 
ATOM   6323 O O   . MET D  1 47  ? -65.377  -12.424 26.419  1.00 116.89 ?  1521 MET D O   1 
ATOM   6324 C CB  . MET D  1 47  ? -65.165  -14.824 28.548  1.00 105.92 ?  1521 MET D CB  1 
ATOM   6325 C CG  . MET D  1 47  ? -64.646  -14.657 29.976  1.00 114.93 ?  1521 MET D CG  1 
ATOM   6326 S SD  . MET D  1 47  ? -63.998  -16.136 30.811  1.00 112.79 ?  1521 MET D SD  1 
ATOM   6327 C CE  . MET D  1 47  ? -62.458  -16.331 29.994  1.00 107.48 ?  1521 MET D CE  1 
ATOM   6328 N N   . MET D  1 48  ? -66.968  -13.937 25.826  1.00 111.89 ?  1522 MET D N   1 
ATOM   6329 C CA  . MET D  1 48  ? -67.037  -13.643 24.387  1.00 109.21 ?  1522 MET D CA  1 
ATOM   6330 C C   . MET D  1 48  ? -67.762  -12.336 24.090  1.00 105.80 ?  1522 MET D C   1 
ATOM   6331 O O   . MET D  1 48  ? -67.336  -11.582 23.206  1.00 98.13  ?  1522 MET D O   1 
ATOM   6332 C CB  . MET D  1 48  ? -67.788  -14.762 23.658  1.00 107.67 ?  1522 MET D CB  1 
ATOM   6333 C CG  . MET D  1 48  ? -66.918  -15.863 23.151  1.00 108.76 ?  1522 MET D CG  1 
ATOM   6334 S SD  . MET D  1 48  ? -67.872  -17.377 22.931  1.00 113.58 ?  1522 MET D SD  1 
ATOM   6335 C CE  . MET D  1 48  ? -68.959  -16.909 21.578  1.00 113.63 ?  1522 MET D CE  1 
ATOM   6336 N N   . VAL D  1 49  ? -68.881  -12.086 24.808  1.00 101.79 ?  1523 VAL D N   1 
ATOM   6337 C CA  . VAL D  1 49  ? -69.754  -10.923 24.623  1.00 102.75 ?  1523 VAL D CA  1 
ATOM   6338 C C   . VAL D  1 49  ? -69.078  -9.601  25.153  1.00 101.19 ?  1523 VAL D C   1 
ATOM   6339 O O   . VAL D  1 49  ? -69.746  -8.607  25.450  1.00 99.25  ?  1523 VAL D O   1 
ATOM   6340 C CB  . VAL D  1 49  ? -71.180  -11.224 25.182  1.00 102.03 ?  1523 VAL D CB  1 
ATOM   6341 C CG1 . VAL D  1 49  ? -71.229  -11.241 26.706  1.00 102.50 ?  1523 VAL D CG1 1 
ATOM   6342 C CG2 . VAL D  1 49  ? -72.241  -10.303 24.585  1.00 106.42 ?  1523 VAL D CG2 1 
ATOM   6343 N N   . GLU D  1 50  ? -67.732  -9.598  25.170  1.00 98.66  ?  1524 GLU D N   1 
ATOM   6344 C CA  . GLU D  1 50  ? -66.877  -8.468  25.512  1.00 91.49  ?  1524 GLU D CA  1 
ATOM   6345 C C   . GLU D  1 50  ? -66.376  -7.858  24.176  1.00 88.47  ?  1524 GLU D C   1 
ATOM   6346 O O   . GLU D  1 50  ? -66.154  -8.592  23.200  1.00 87.22  ?  1524 GLU D O   1 
ATOM   6347 C CB  . GLU D  1 50  ? -65.700  -8.936  26.383  1.00 92.91  ?  1524 GLU D CB  1 
ATOM   6348 C CG  . GLU D  1 50  ? -64.863  -7.798  26.944  1.00 93.68  ?  1524 GLU D CG  1 
ATOM   6349 C CD  . GLU D  1 50  ? -63.704  -8.172  27.847  1.00 101.07 ?  1524 GLU D CD  1 
ATOM   6350 O OE1 . GLU D  1 50  ? -62.581  -7.674  27.598  1.00 109.03 ?  1524 GLU D OE1 1 
ATOM   6351 O OE2 . GLU D  1 50  ? -63.927  -8.909  28.838  1.00 94.66  -1 1524 GLU D OE2 1 
ATOM   6352 N N   . LYS D  1 51  ? -66.240  -6.518  24.126  1.00 85.19  ?  1525 LYS D N   1 
ATOM   6353 C CA  . LYS D  1 51  ? -65.797  -5.790  22.933  1.00 91.41  ?  1525 LYS D CA  1 
ATOM   6354 C C   . LYS D  1 51  ? -64.955  -4.562  23.281  1.00 90.06  ?  1525 LYS D C   1 
ATOM   6355 O O   . LYS D  1 51  ? -64.785  -4.256  24.463  1.00 93.03  ?  1525 LYS D O   1 
ATOM   6356 C CB  . LYS D  1 51  ? -66.994  -5.423  22.023  1.00 111.65 ?  1525 LYS D CB  1 
ATOM   6357 C CG  . LYS D  1 51  ? -68.068  -4.541  22.668  1.00 128.32 ?  1525 LYS D CG  1 
ATOM   6358 C CD  . LYS D  1 51  ? -69.227  -4.278  21.713  1.00 132.32 ?  1525 LYS D CD  1 
ATOM   6359 C CE  . LYS D  1 51  ? -70.362  -3.538  22.378  1.00 139.77 ?  1525 LYS D CE  1 
ATOM   6360 N NZ  . LYS D  1 51  ? -71.545  -3.416  21.483  1.00 147.21 1  1525 LYS D NZ  1 
ATOM   6361 N N   . GLU D  1 52  ? -64.426  -3.867  22.254  1.00 84.70  ?  1526 GLU D N   1 
ATOM   6362 C CA  . GLU D  1 52  ? -63.619  -2.660  22.439  1.00 89.24  ?  1526 GLU D CA  1 
ATOM   6363 C C   . GLU D  1 52  ? -64.480  -1.455  22.872  1.00 94.92  ?  1526 GLU D C   1 
ATOM   6364 O O   . GLU D  1 52  ? -63.962  -0.544  23.528  1.00 93.40  ?  1526 GLU D O   1 
ATOM   6365 C CB  . GLU D  1 52  ? -62.754  -2.364  21.187  1.00 89.51  ?  1526 GLU D CB  1 
ATOM   6366 C CG  . GLU D  1 52  ? -63.383  -1.491  20.100  1.00 84.57  ?  1526 GLU D CG  1 
ATOM   6367 C CD  . GLU D  1 52  ? -63.082  0.004   20.126  1.00 81.28  ?  1526 GLU D CD  1 
ATOM   6368 O OE1 . GLU D  1 52  ? -63.572  0.711   19.213  1.00 73.90  ?  1526 GLU D OE1 1 
ATOM   6369 O OE2 . GLU D  1 52  ? -62.372  0.473   21.048  1.00 78.85  -1 1526 GLU D OE2 1 
ATOM   6370 N N   . GLY D  1 53  ? -65.768  -1.494  22.492  1.00 101.29 ?  1527 GLY D N   1 
ATOM   6371 C CA  . GLY D  1 53  ? -66.812  -0.501  22.740  1.00 98.64  ?  1527 GLY D CA  1 
ATOM   6372 C C   . GLY D  1 53  ? -66.544  0.524   23.826  1.00 99.91  ?  1527 GLY D C   1 
ATOM   6373 O O   . GLY D  1 53  ? -66.018  1.596   23.523  1.00 103.70 ?  1527 GLY D O   1 
ATOM   6374 N N   . GLN D  1 54  ? -66.881  0.233   25.098  1.00 98.51  ?  1528 GLN D N   1 
ATOM   6375 C CA  . GLN D  1 54  ? -67.515  -1.001  25.566  1.00 108.54 ?  1528 GLN D CA  1 
ATOM   6376 C C   . GLN D  1 54  ? -68.858  -0.697  26.241  1.00 118.57 ?  1528 GLN D C   1 
ATOM   6377 O O   . GLN D  1 54  ? -69.859  -1.351  25.933  1.00 116.68 ?  1528 GLN D O   1 
ATOM   6378 C CB  . GLN D  1 54  ? -66.553  -1.755  26.519  1.00 112.51 ?  1528 GLN D CB  1 
ATOM   6379 C CG  . GLN D  1 54  ? -67.192  -2.766  27.483  1.00 121.48 ?  1528 GLN D CG  1 
ATOM   6380 C CD  . GLN D  1 54  ? -67.551  -4.083  26.842  1.00 123.59 ?  1528 GLN D CD  1 
ATOM   6381 O OE1 . GLN D  1 54  ? -68.588  -4.230  26.183  1.00 124.14 ?  1528 GLN D OE1 1 
ATOM   6382 N NE2 . GLN D  1 54  ? -66.723  -5.082  27.070  1.00 121.38 ?  1528 GLN D NE2 1 
ATOM   6383 N N   . SER D  1 55  ? -68.854  0.325   27.139  1.00 122.67 ?  1529 SER D N   1 
ATOM   6384 C CA  . SER D  1 55  ? -69.892  0.855   28.046  1.00 122.64 ?  1529 SER D CA  1 
ATOM   6385 C C   . SER D  1 55  ? -69.437  0.470   29.451  1.00 115.83 ?  1529 SER D C   1 
ATOM   6386 O O   . SER D  1 55  ? -69.161  -0.706  29.690  1.00 118.47 ?  1529 SER D O   1 
ATOM   6387 C CB  . SER D  1 55  ? -71.288  0.305   27.741  1.00 125.06 ?  1529 SER D CB  1 
ATOM   6388 O OG  . SER D  1 55  ? -72.207  0.490   28.805  1.00 123.81 ?  1529 SER D OG  1 
ATOM   6389 N N   . GLN D  1 56  ? -69.292  1.450   30.362  1.00 110.73 ?  1530 GLN D N   1 
ATOM   6390 C CA  . GLN D  1 56  ? -68.828  1.182   31.728  1.00 112.50 ?  1530 GLN D CA  1 
ATOM   6391 C C   . GLN D  1 56  ? -69.775  0.269   32.504  1.00 108.60 ?  1530 GLN D C   1 
ATOM   6392 O O   . GLN D  1 56  ? -69.309  -0.531  33.309  1.00 97.46  ?  1530 GLN D O   1 
ATOM   6393 C CB  . GLN D  1 56  ? -68.532  2.479   32.493  1.00 118.55 ?  1530 GLN D CB  1 
ATOM   6394 C CG  . GLN D  1 56  ? -67.530  2.315   33.649  1.00 125.07 ?  1530 GLN D CG  1 
ATOM   6395 C CD  . GLN D  1 56  ? -66.164  1.820   33.214  1.00 133.81 ?  1530 GLN D CD  1 
ATOM   6396 O OE1 . GLN D  1 56  ? -65.708  0.752   33.634  1.00 133.98 ?  1530 GLN D OE1 1 
ATOM   6397 N NE2 . GLN D  1 56  ? -65.477  2.583   32.368  1.00 137.89 ?  1530 GLN D NE2 1 
ATOM   6398 N N   . HIS D  1 57  ? -71.092  0.367   32.225  1.00 114.36 ?  1531 HIS D N   1 
ATOM   6399 C CA  . HIS D  1 57  ? -72.151  -0.458  32.811  1.00 119.25 ?  1531 HIS D CA  1 
ATOM   6400 C C   . HIS D  1 57  ? -71.967  -1.913  32.356  1.00 114.20 ?  1531 HIS D C   1 
ATOM   6401 O O   . HIS D  1 57  ? -72.082  -2.826  33.172  1.00 114.51 ?  1531 HIS D O   1 
ATOM   6402 C CB  . HIS D  1 57  ? -73.530  0.094   32.399  1.00 120.71 ?  1531 HIS D CB  1 
ATOM   6403 C CG  . HIS D  1 57  ? -74.679  -0.829  32.656  1.00 128.16 ?  1531 HIS D CG  1 
ATOM   6404 N ND1 . HIS D  1 57  ? -75.231  -0.961  33.918  1.00 143.90 ?  1531 HIS D ND1 1 
ATOM   6405 C CD2 . HIS D  1 57  ? -75.362  -1.618  31.794  1.00 120.28 ?  1531 HIS D CD2 1 
ATOM   6406 C CE1 . HIS D  1 57  ? -76.221  -1.829  33.786  1.00 138.98 ?  1531 HIS D CE1 1 
ATOM   6407 N NE2 . HIS D  1 57  ? -76.338  -2.252  32.526  1.00 127.36 ?  1531 HIS D NE2 1 
ATOM   6408 N N   . MET D  1 58  ? -71.641  -2.108  31.061  1.00 109.80 ?  1532 MET D N   1 
ATOM   6409 C CA  . MET D  1 58  ? -71.381  -3.406  30.436  1.00 113.09 ?  1532 MET D CA  1 
ATOM   6410 C C   . MET D  1 58  ? -70.156  -4.068  31.049  1.00 114.29 ?  1532 MET D C   1 
ATOM   6411 O O   . MET D  1 58  ? -70.138  -5.286  31.183  1.00 107.18 ?  1532 MET D O   1 
ATOM   6412 C CB  . MET D  1 58  ? -71.159  -3.230  28.927  1.00 115.46 ?  1532 MET D CB  1 
ATOM   6413 C CG  . MET D  1 58  ? -71.347  -4.495  28.129  1.00 111.45 ?  1532 MET D CG  1 
ATOM   6414 S SD  . MET D  1 58  ? -73.034  -5.117  28.245  1.00 106.67 ?  1532 MET D SD  1 
ATOM   6415 C CE  . MET D  1 58  ? -73.947  -3.779  27.401  1.00 121.75 ?  1532 MET D CE  1 
ATOM   6416 N N   . THR D  1 59  ? -69.130  -3.266  31.399  1.00 110.94 ?  1533 THR D N   1 
ATOM   6417 C CA  . THR D  1 59  ? -67.898  -3.746  32.019  1.00 106.40 ?  1533 THR D CA  1 
ATOM   6418 C C   . THR D  1 59  ? -68.207  -4.218  33.435  1.00 105.72 ?  1533 THR D C   1 
ATOM   6419 O O   . THR D  1 59  ? -67.775  -5.302  33.807  1.00 105.11 ?  1533 THR D O   1 
ATOM   6420 C CB  . THR D  1 59  ? -66.790  -2.685  31.973  1.00 110.04 ?  1533 THR D CB  1 
ATOM   6421 O OG1 . THR D  1 59  ? -66.949  -1.861  30.820  1.00 117.05 ?  1533 THR D OG1 1 
ATOM   6422 C CG2 . THR D  1 59  ? -65.411  -3.297  31.956  1.00 110.07 ?  1533 THR D CG2 1 
ATOM   6423 N N   . GLU D  1 60  ? -69.014  -3.439  34.193  1.00 110.46 ?  1534 GLU D N   1 
ATOM   6424 C CA  . GLU D  1 60  ? -69.442  -3.755  35.567  1.00 114.24 ?  1534 GLU D CA  1 
ATOM   6425 C C   . GLU D  1 60  ? -70.367  -4.989  35.609  1.00 96.07  ?  1534 GLU D C   1 
ATOM   6426 O O   . GLU D  1 60  ? -70.218  -5.821  36.505  1.00 85.43  ?  1534 GLU D O   1 
ATOM   6427 C CB  . GLU D  1 60  ? -70.132  -2.545  36.246  1.00 126.61 ?  1534 GLU D CB  1 
ATOM   6428 C CG  . GLU D  1 60  ? -69.262  -1.308  36.439  1.00 132.03 ?  1534 GLU D CG  1 
ATOM   6429 C CD  . GLU D  1 60  ? -68.246  -1.342  37.564  1.00 131.33 ?  1534 GLU D CD  1 
ATOM   6430 O OE1 . GLU D  1 60  ? -67.032  -1.417  37.266  1.00 116.21 ?  1534 GLU D OE1 1 
ATOM   6431 O OE2 . GLU D  1 60  ? -68.660  -1.242  38.742  1.00 129.72 -1 1534 GLU D OE2 1 
ATOM   6432 N N   . VAL D  1 61  ? -71.309  -5.104  34.643  1.00 89.64  ?  1535 VAL D N   1 
ATOM   6433 C CA  . VAL D  1 61  ? -72.241  -6.233  34.546  1.00 93.60  ?  1535 VAL D CA  1 
ATOM   6434 C C   . VAL D  1 61  ? -71.483  -7.522  34.224  1.00 99.52  ?  1535 VAL D C   1 
ATOM   6435 O O   . VAL D  1 61  ? -71.615  -8.493  34.965  1.00 100.35 ?  1535 VAL D O   1 
ATOM   6436 C CB  . VAL D  1 61  ? -73.432  -5.954  33.584  1.00 92.30  ?  1535 VAL D CB  1 
ATOM   6437 C CG1 . VAL D  1 61  ? -74.169  -7.233  33.189  1.00 90.00  ?  1535 VAL D CG1 1 
ATOM   6438 C CG2 . VAL D  1 61  ? -74.404  -4.963  34.205  1.00 94.08  ?  1535 VAL D CG2 1 
ATOM   6439 N N   . LEU D  1 62  ? -70.656  -7.508  33.164  1.00 102.41 ?  1536 LEU D N   1 
ATOM   6440 C CA  . LEU D  1 62  ? -69.863  -8.664  32.753  1.00 96.98  ?  1536 LEU D CA  1 
ATOM   6441 C C   . LEU D  1 62  ? -68.870  -9.118  33.813  1.00 99.88  ?  1536 LEU D C   1 
ATOM   6442 O O   . LEU D  1 62  ? -68.773  -10.322 34.058  1.00 102.69 ?  1536 LEU D O   1 
ATOM   6443 C CB  . LEU D  1 62  ? -69.166  -8.432  31.406  1.00 92.28  ?  1536 LEU D CB  1 
ATOM   6444 C CG  . LEU D  1 62  ? -70.056  -8.468  30.160  1.00 93.98  ?  1536 LEU D CG  1 
ATOM   6445 C CD1 . LEU D  1 62  ? -69.296  -7.971  28.941  1.00 90.77  ?  1536 LEU D CD1 1 
ATOM   6446 C CD2 . LEU D  1 62  ? -70.620  -9.857  29.911  1.00 93.77  ?  1536 LEU D CD2 1 
ATOM   6447 N N   . TYR D  1 63  ? -68.169  -8.166  34.472  1.00 99.89  ?  1537 TYR D N   1 
ATOM   6448 C CA  . TYR D  1 63  ? -67.208  -8.472  35.539  1.00 100.85 ?  1537 TYR D CA  1 
ATOM   6449 C C   . TYR D  1 63  ? -67.901  -9.200  36.696  1.00 103.60 ?  1537 TYR D C   1 
ATOM   6450 O O   . TYR D  1 63  ? -67.318  -10.133 37.248  1.00 104.28 ?  1537 TYR D O   1 
ATOM   6451 C CB  . TYR D  1 63  ? -66.517  -7.198  36.062  1.00 96.61  ?  1537 TYR D CB  1 
ATOM   6452 C CG  . TYR D  1 63  ? -65.378  -6.630  35.231  1.00 92.70  ?  1537 TYR D CG  1 
ATOM   6453 C CD1 . TYR D  1 63  ? -65.140  -7.076  33.933  1.00 92.60  ?  1537 TYR D CD1 1 
ATOM   6454 C CD2 . TYR D  1 63  ? -64.577  -5.604  35.723  1.00 90.22  ?  1537 TYR D CD2 1 
ATOM   6455 C CE1 . TYR D  1 63  ? -64.112  -6.535  33.157  1.00 92.25  ?  1537 TYR D CE1 1 
ATOM   6456 C CE2 . TYR D  1 63  ? -63.544  -5.059  34.960  1.00 87.42  ?  1537 TYR D CE2 1 
ATOM   6457 C CZ  . TYR D  1 63  ? -63.308  -5.533  33.680  1.00 91.49  ?  1537 TYR D CZ  1 
ATOM   6458 O OH  . TYR D  1 63  ? -62.290  -4.992  32.924  1.00 95.07  ?  1537 TYR D OH  1 
ATOM   6459 N N   . TRP D  1 64  ? -69.154  -8.801  37.029  1.00 98.31  ?  1538 TRP D N   1 
ATOM   6460 C CA  . TRP D  1 64  ? -69.957  -9.414  38.093  1.00 91.35  ?  1538 TRP D CA  1 
ATOM   6461 C C   . TRP D  1 64  ? -70.468  -10.809 37.737  1.00 84.42  ?  1538 TRP D C   1 
ATOM   6462 O O   . TRP D  1 64  ? -70.467  -11.683 38.614  1.00 75.85  ?  1538 TRP D O   1 
ATOM   6463 C CB  . TRP D  1 64  ? -71.103  -8.499  38.568  1.00 92.82  ?  1538 TRP D CB  1 
ATOM   6464 C CG  . TRP D  1 64  ? -70.672  -7.548  39.647  1.00 96.25  ?  1538 TRP D CG  1 
ATOM   6465 C CD1 . TRP D  1 64  ? -70.582  -6.191  39.552  1.00 103.05 ?  1538 TRP D CD1 1 
ATOM   6466 C CD2 . TRP D  1 64  ? -70.187  -7.894  40.956  1.00 98.94  ?  1538 TRP D CD2 1 
ATOM   6467 N NE1 . TRP D  1 64  ? -70.074  -5.665  40.721  1.00 111.21 ?  1538 TRP D NE1 1 
ATOM   6468 C CE2 . TRP D  1 64  ? -69.823  -6.689  41.600  1.00 104.10 ?  1538 TRP D CE2 1 
ATOM   6469 C CE3 . TRP D  1 64  ? -70.030  -9.108  41.653  1.00 96.67  ?  1538 TRP D CE3 1 
ATOM   6470 C CZ2 . TRP D  1 64  ? -69.319  -6.660  42.907  1.00 99.83  ?  1538 TRP D CZ2 1 
ATOM   6471 C CZ3 . TRP D  1 64  ? -69.526  -9.078  42.945  1.00 95.55  ?  1538 TRP D CZ3 1 
ATOM   6472 C CH2 . TRP D  1 64  ? -69.181  -7.865  43.560  1.00 98.56  ?  1538 TRP D CH2 1 
ATOM   6473 N N   . ILE D  1 65  ? -70.874  -11.032 36.457  1.00 80.89  ?  1539 ILE D N   1 
ATOM   6474 C CA  . ILE D  1 65  ? -71.324  -12.349 35.972  1.00 82.31  ?  1539 ILE D CA  1 
ATOM   6475 C C   . ILE D  1 65  ? -70.163  -13.340 36.174  1.00 95.12  ?  1539 ILE D C   1 
ATOM   6476 O O   . ILE D  1 65  ? -70.387  -14.477 36.588  1.00 101.30 ?  1539 ILE D O   1 
ATOM   6477 C CB  . ILE D  1 65  ? -71.814  -12.336 34.490  1.00 76.55  ?  1539 ILE D CB  1 
ATOM   6478 C CG1 . ILE D  1 65  ? -72.824  -11.206 34.217  1.00 77.41  ?  1539 ILE D CG1 1 
ATOM   6479 C CG2 . ILE D  1 65  ? -72.407  -13.703 34.095  1.00 70.90  ?  1539 ILE D CG2 1 
ATOM   6480 C CD1 . ILE D  1 65  ? -72.930  -10.768 32.742  1.00 79.55  ?  1539 ILE D CD1 1 
ATOM   6481 N N   . ASN D  1 66  ? -68.923  -12.870 35.933  1.00 100.50 ?  1540 ASN D N   1 
ATOM   6482 C CA  . ASN D  1 66  ? -67.703  -13.647 36.109  1.00 98.23  ?  1540 ASN D CA  1 
ATOM   6483 C C   . ASN D  1 66  ? -67.484  -14.042 37.554  1.00 101.86 ?  1540 ASN D C   1 
ATOM   6484 O O   . ASN D  1 66  ? -67.254  -15.224 37.803  1.00 108.17 ?  1540 ASN D O   1 
ATOM   6485 C CB  . ASN D  1 66  ? -66.496  -12.911 35.551  1.00 91.63  ?  1540 ASN D CB  1 
ATOM   6486 C CG  . ASN D  1 66  ? -66.333  -13.118 34.066  1.00 92.67  ?  1540 ASN D CG  1 
ATOM   6487 O OD1 . ASN D  1 66  ? -66.185  -14.253 33.581  1.00 87.31  ?  1540 ASN D OD1 1 
ATOM   6488 N ND2 . ASN D  1 66  ? -66.352  -12.024 33.307  1.00 96.16  ?  1540 ASN D ND2 1 
ATOM   6489 N N   . VAL D  1 67  ? -67.612  -13.078 38.507  1.00 99.69  ?  1541 VAL D N   1 
ATOM   6490 C CA  . VAL D  1 67  ? -67.457  -13.306 39.957  1.00 95.42  ?  1541 VAL D CA  1 
ATOM   6491 C C   . VAL D  1 67  ? -68.361  -14.469 40.402  1.00 90.60  ?  1541 VAL D C   1 
ATOM   6492 O O   . VAL D  1 67  ? -67.876  -15.356 41.096  1.00 86.46  ?  1541 VAL D O   1 
ATOM   6493 C CB  . VAL D  1 67  ? -67.614  -12.015 40.827  1.00 92.48  ?  1541 VAL D CB  1 
ATOM   6494 C CG1 . VAL D  1 67  ? -67.497  -12.320 42.318  1.00 88.75  ?  1541 VAL D CG1 1 
ATOM   6495 C CG2 . VAL D  1 67  ? -66.584  -10.959 40.436  1.00 94.27  ?  1541 VAL D CG2 1 
ATOM   6496 N N   . VAL D  1 68  ? -69.622  -14.515 39.910  1.00 86.84  ?  1542 VAL D N   1 
ATOM   6497 C CA  . VAL D  1 68  ? -70.600  -15.584 40.173  1.00 86.16  ?  1542 VAL D CA  1 
ATOM   6498 C C   . VAL D  1 68  ? -70.018  -16.966 39.781  1.00 93.22  ?  1542 VAL D C   1 
ATOM   6499 O O   . VAL D  1 68  ? -70.080  -17.902 40.583  1.00 92.02  ?  1542 VAL D O   1 
ATOM   6500 C CB  . VAL D  1 68  ? -71.958  -15.288 39.476  1.00 79.73  ?  1542 VAL D CB  1 
ATOM   6501 C CG1 . VAL D  1 68  ? -72.949  -16.443 39.627  1.00 74.76  ?  1542 VAL D CG1 1 
ATOM   6502 C CG2 . VAL D  1 68  ? -72.565  -13.990 39.994  1.00 81.42  ?  1542 VAL D CG2 1 
ATOM   6503 N N   . PHE D  1 69  ? -69.417  -17.065 38.571  1.00 95.37  ?  1543 PHE D N   1 
ATOM   6504 C CA  . PHE D  1 69  ? -68.772  -18.280 38.061  1.00 97.86  ?  1543 PHE D CA  1 
ATOM   6505 C C   . PHE D  1 69  ? -67.473  -18.598 38.823  1.00 101.92 ?  1543 PHE D C   1 
ATOM   6506 O O   . PHE D  1 69  ? -67.194  -19.772 39.075  1.00 106.11 ?  1543 PHE D O   1 
ATOM   6507 C CB  . PHE D  1 69  ? -68.499  -18.170 36.557  1.00 98.56  ?  1543 PHE D CB  1 
ATOM   6508 C CG  . PHE D  1 69  ? -69.709  -18.279 35.660  1.00 100.49 ?  1543 PHE D CG  1 
ATOM   6509 C CD1 . PHE D  1 69  ? -70.327  -19.506 35.440  1.00 103.40 ?  1543 PHE D CD1 1 
ATOM   6510 C CD2 . PHE D  1 69  ? -70.186  -17.170 34.972  1.00 103.65 ?  1543 PHE D CD2 1 
ATOM   6511 C CE1 . PHE D  1 69  ? -71.434  -19.610 34.587  1.00 104.08 ?  1543 PHE D CE1 1 
ATOM   6512 C CE2 . PHE D  1 69  ? -71.291  -17.275 34.118  1.00 104.78 ?  1543 PHE D CE2 1 
ATOM   6513 C CZ  . PHE D  1 69  ? -71.906  -18.494 33.931  1.00 101.25 ?  1543 PHE D CZ  1 
ATOM   6514 N N   . ILE D  1 70  ? -66.690  -17.554 39.198  1.00 96.00  ?  1544 ILE D N   1 
ATOM   6515 C CA  . ILE D  1 70  ? -65.454  -17.698 39.977  1.00 91.51  ?  1544 ILE D CA  1 
ATOM   6516 C C   . ILE D  1 70  ? -65.820  -18.305 41.339  1.00 94.04  ?  1544 ILE D C   1 
ATOM   6517 O O   . ILE D  1 70  ? -65.143  -19.231 41.781  1.00 91.16  ?  1544 ILE D O   1 
ATOM   6518 C CB  . ILE D  1 70  ? -64.630  -16.373 40.062  1.00 92.02  ?  1544 ILE D CB  1 
ATOM   6519 C CG1 . ILE D  1 70  ? -64.167  -15.946 38.653  1.00 96.90  ?  1544 ILE D CG1 1 
ATOM   6520 C CG2 . ILE D  1 70  ? -63.403  -16.534 40.980  1.00 91.56  ?  1544 ILE D CG2 1 
ATOM   6521 C CD1 . ILE D  1 70  ? -63.937  -14.470 38.404  1.00 98.14  ?  1544 ILE D CD1 1 
ATOM   6522 N N   . ILE D  1 71  ? -66.951  -17.846 41.940  1.00 96.86  ?  1545 ILE D N   1 
ATOM   6523 C CA  . ILE D  1 71  ? -67.525  -18.345 43.197  1.00 95.19  ?  1545 ILE D CA  1 
ATOM   6524 C C   . ILE D  1 71  ? -67.992  -19.796 42.981  1.00 90.27  ?  1545 ILE D C   1 
ATOM   6525 O O   . ILE D  1 71  ? -67.555  -20.673 43.718  1.00 89.57  ?  1545 ILE D O   1 
ATOM   6526 C CB  . ILE D  1 71  ? -68.671  -17.417 43.729  1.00 95.46  ?  1545 ILE D CB  1 
ATOM   6527 C CG1 . ILE D  1 71  ? -68.160  -16.000 44.183  1.00 94.54  ?  1545 ILE D CG1 1 
ATOM   6528 C CG2 . ILE D  1 71  ? -69.517  -18.086 44.826  1.00 95.28  ?  1545 ILE D CG2 1 
ATOM   6529 C CD1 . ILE D  1 71  ? -67.025  -15.871 45.306  1.00 86.31  ?  1545 ILE D CD1 1 
ATOM   6530 N N   . LEU D  1 72  ? -68.830  -20.044 41.944  1.00 86.52  ?  1546 LEU D N   1 
ATOM   6531 C CA  . LEU D  1 72  ? -69.360  -21.367 41.577  1.00 88.35  ?  1546 LEU D CA  1 
ATOM   6532 C C   . LEU D  1 72  ? -68.273  -22.436 41.349  1.00 93.06  ?  1546 LEU D C   1 
ATOM   6533 O O   . LEU D  1 72  ? -68.480  -23.595 41.718  1.00 93.16  ?  1546 LEU D O   1 
ATOM   6534 C CB  . LEU D  1 72  ? -70.237  -21.267 40.317  1.00 90.94  ?  1546 LEU D CB  1 
ATOM   6535 C CG  . LEU D  1 72  ? -71.716  -20.945 40.499  1.00 90.67  ?  1546 LEU D CG  1 
ATOM   6536 C CD1 . LEU D  1 72  ? -72.237  -20.155 39.321  1.00 92.72  ?  1546 LEU D CD1 1 
ATOM   6537 C CD2 . LEU D  1 72  ? -72.540  -22.211 40.653  1.00 88.02  ?  1546 LEU D CD2 1 
ATOM   6538 N N   . PHE D  1 73  ? -67.139  -22.057 40.711  1.00 99.76  ?  1547 PHE D N   1 
ATOM   6539 C CA  . PHE D  1 73  ? -66.034  -22.983 40.434  1.00 100.69 ?  1547 PHE D CA  1 
ATOM   6540 C C   . PHE D  1 73  ? -65.199  -23.275 41.685  1.00 98.87  ?  1547 PHE D C   1 
ATOM   6541 O O   . PHE D  1 73  ? -64.556  -24.325 41.743  1.00 94.92  ?  1547 PHE D O   1 
ATOM   6542 C CB  . PHE D  1 73  ? -65.169  -22.531 39.234  1.00 102.03 ?  1547 PHE D CB  1 
ATOM   6543 C CG  . PHE D  1 73  ? -65.816  -22.693 37.868  1.00 95.87  ?  1547 PHE D CG  1 
ATOM   6544 C CD1 . PHE D  1 73  ? -66.571  -23.825 37.563  1.00 86.70  ?  1547 PHE D CD1 1 
ATOM   6545 C CD2 . PHE D  1 73  ? -65.640  -21.734 36.877  1.00 97.56  ?  1547 PHE D CD2 1 
ATOM   6546 C CE1 . PHE D  1 73  ? -67.174  -23.969 36.307  1.00 85.94  ?  1547 PHE D CE1 1 
ATOM   6547 C CE2 . PHE D  1 73  ? -66.240  -21.883 35.618  1.00 90.87  ?  1547 PHE D CE2 1 
ATOM   6548 C CZ  . PHE D  1 73  ? -67.005  -22.997 35.344  1.00 84.56  ?  1547 PHE D CZ  1 
ATOM   6549 N N   . THR D  1 74  ? -65.243  -22.372 42.696  1.00 93.08  ?  1548 THR D N   1 
ATOM   6550 C CA  . THR D  1 74  ? -64.585  -22.563 43.992  1.00 97.18  ?  1548 THR D CA  1 
ATOM   6551 C C   . THR D  1 74  ? -65.429  -23.569 44.759  1.00 100.74 ?  1548 THR D C   1 
ATOM   6552 O O   . THR D  1 74  ? -64.879  -24.515 45.321  1.00 100.52 ?  1548 THR D O   1 
ATOM   6553 C CB  . THR D  1 74  ? -64.437  -21.240 44.759  1.00 98.38  ?  1548 THR D CB  1 
ATOM   6554 O OG1 . THR D  1 74  ? -63.893  -20.245 43.897  1.00 95.92  ?  1548 THR D OG1 1 
ATOM   6555 C CG2 . THR D  1 74  ? -63.561  -21.376 46.003  1.00 99.49  ?  1548 THR D CG2 1 
ATOM   6556 N N   . ILE D  1 75  ? -66.774  -23.381 44.725  1.00 103.16 ?  1549 ILE D N   1 
ATOM   6557 C CA  . ILE D  1 75  ? -67.801  -24.249 45.319  1.00 98.25  ?  1549 ILE D CA  1 
ATOM   6558 C C   . ILE D  1 75  ? -67.592  -25.676 44.783  1.00 98.81  ?  1549 ILE D C   1 
ATOM   6559 O O   . ILE D  1 75  ? -67.621  -26.629 45.561  1.00 100.50 ?  1549 ILE D O   1 
ATOM   6560 C CB  . ILE D  1 75  ? -69.242  -23.704 45.004  1.00 93.97  ?  1549 ILE D CB  1 
ATOM   6561 C CG1 . ILE D  1 75  ? -69.504  -22.266 45.569  1.00 90.75  ?  1549 ILE D CG1 1 
ATOM   6562 C CG2 . ILE D  1 75  ? -70.361  -24.665 45.422  1.00 91.53  ?  1549 ILE D CG2 1 
ATOM   6563 C CD1 . ILE D  1 75  ? -69.117  -21.925 47.051  1.00 88.67  ?  1549 ILE D CD1 1 
ATOM   6564 N N   . GLU D  1 76  ? -67.328  -25.797 43.464  1.00 100.61 ?  1550 GLU D N   1 
ATOM   6565 C CA  . GLU D  1 76  ? -67.074  -27.056 42.768  1.00 102.21 ?  1550 GLU D CA  1 
ATOM   6566 C C   . GLU D  1 76  ? -65.868  -27.800 43.335  1.00 93.93  ?  1550 GLU D C   1 
ATOM   6567 O O   . GLU D  1 76  ? -65.978  -28.997 43.600  1.00 82.68  ?  1550 GLU D O   1 
ATOM   6568 C CB  . GLU D  1 76  ? -66.874  -26.809 41.256  1.00 114.80 ?  1550 GLU D CB  1 
ATOM   6569 C CG  . GLU D  1 76  ? -66.366  -28.031 40.491  1.00 121.15 ?  1550 GLU D CG  1 
ATOM   6570 C CD  . GLU D  1 76  ? -65.322  -27.811 39.409  1.00 123.42 ?  1550 GLU D CD  1 
ATOM   6571 O OE1 . GLU D  1 76  ? -64.689  -26.729 39.382  1.00 123.60 ?  1550 GLU D OE1 1 
ATOM   6572 O OE2 . GLU D  1 76  ? -65.109  -28.753 38.610  1.00 116.76 -1 1550 GLU D OE2 1 
ATOM   6573 N N   . ILE D  1 77  ? -64.716  -27.106 43.473  1.00 100.64 ?  1551 ILE D N   1 
ATOM   6574 C CA  . ILE D  1 77  ? -63.461  -27.708 43.928  1.00 109.76 ?  1551 ILE D CA  1 
ATOM   6575 C C   . ILE D  1 77  ? -63.488  -28.066 45.425  1.00 109.43 ?  1551 ILE D C   1 
ATOM   6576 O O   . ILE D  1 77  ? -62.846  -29.045 45.804  1.00 114.02 ?  1551 ILE D O   1 
ATOM   6577 C CB  . ILE D  1 77  ? -62.209  -26.871 43.521  1.00 110.76 ?  1551 ILE D CB  1 
ATOM   6578 C CG1 . ILE D  1 77  ? -61.011  -27.788 43.168  1.00 107.15 ?  1551 ILE D CG1 1 
ATOM   6579 C CG2 . ILE D  1 77  ? -61.833  -25.782 44.545  1.00 110.45 ?  1551 ILE D CG2 1 
ATOM   6580 C CD1 . ILE D  1 77  ? -61.196  -28.644 41.869  1.00 103.56 ?  1551 ILE D CD1 1 
ATOM   6581 N N   . ILE D  1 78  ? -64.231  -27.299 46.259  1.00 104.21 ?  1552 ILE D N   1 
ATOM   6582 C CA  . ILE D  1 78  ? -64.390  -27.582 47.689  1.00 98.33  ?  1552 ILE D CA  1 
ATOM   6583 C C   . ILE D  1 78  ? -65.101  -28.942 47.797  1.00 96.32  ?  1552 ILE D C   1 
ATOM   6584 O O   . ILE D  1 78  ? -64.582  -29.838 48.463  1.00 95.21  ?  1552 ILE D O   1 
ATOM   6585 C CB  . ILE D  1 78  ? -65.136  -26.427 48.422  1.00 100.16 ?  1552 ILE D CB  1 
ATOM   6586 C CG1 . ILE D  1 78  ? -64.244  -25.165 48.528  1.00 97.95  ?  1552 ILE D CG1 1 
ATOM   6587 C CG2 . ILE D  1 78  ? -65.639  -26.861 49.810  1.00 107.49 ?  1552 ILE D CG2 1 
ATOM   6588 C CD1 . ILE D  1 78  ? -65.031  -23.815 48.601  1.00 100.76 ?  1552 ILE D CD1 1 
ATOM   6589 N N   . LEU D  1 79  ? -66.228  -29.113 47.058  1.00 96.32  ?  1553 LEU D N   1 
ATOM   6590 C CA  . LEU D  1 79  ? -66.996  -30.361 46.981  1.00 98.29  ?  1553 LEU D CA  1 
ATOM   6591 C C   . LEU D  1 79  ? -66.115  -31.507 46.508  1.00 101.99 ?  1553 LEU D C   1 
ATOM   6592 O O   . LEU D  1 79  ? -66.239  -32.602 47.035  1.00 103.77 ?  1553 LEU D O   1 
ATOM   6593 C CB  . LEU D  1 79  ? -68.195  -30.240 46.020  1.00 101.81 ?  1553 LEU D CB  1 
ATOM   6594 C CG  . LEU D  1 79  ? -69.383  -29.375 46.440  1.00 105.19 ?  1553 LEU D CG  1 
ATOM   6595 C CD1 . LEU D  1 79  ? -70.285  -29.112 45.252  1.00 108.36 ?  1553 LEU D CD1 1 
ATOM   6596 C CD2 . LEU D  1 79  ? -70.191  -30.023 47.565  1.00 108.25 ?  1553 LEU D CD2 1 
ATOM   6597 N N   . ARG D  1 80  ? -65.225  -31.244 45.522  1.00 110.52 ?  1554 ARG D N   1 
ATOM   6598 C CA  . ARG D  1 80  ? -64.283  -32.204 44.931  1.00 115.91 ?  1554 ARG D CA  1 
ATOM   6599 C C   . ARG D  1 80  ? -63.144  -32.578 45.874  1.00 118.28 ?  1554 ARG D C   1 
ATOM   6600 O O   . ARG D  1 80  ? -62.656  -33.710 45.816  1.00 117.89 ?  1554 ARG D O   1 
ATOM   6601 C CB  . ARG D  1 80  ? -63.724  -31.672 43.608  1.00 116.70 ?  1554 ARG D CB  1 
ATOM   6602 C CG  . ARG D  1 80  ? -64.670  -31.875 42.432  1.00 118.09 ?  1554 ARG D CG  1 
ATOM   6603 C CD  . ARG D  1 80  ? -64.184  -31.151 41.192  1.00 117.29 ?  1554 ARG D CD  1 
ATOM   6604 N NE  . ARG D  1 80  ? -62.986  -31.776 40.626  1.00 114.55 ?  1554 ARG D NE  1 
ATOM   6605 C CZ  . ARG D  1 80  ? -62.320  -31.304 39.577  1.00 115.97 ?  1554 ARG D CZ  1 
ATOM   6606 N NH1 . ARG D  1 80  ? -62.726  -30.196 38.967  1.00 116.09 1  1554 ARG D NH1 1 
ATOM   6607 N NH2 . ARG D  1 80  ? -61.248  -31.938 39.125  1.00 118.39 ?  1554 ARG D NH2 1 
ATOM   6608 N N   . ILE D  1 81  ? -62.712  -31.633 46.729  1.00 117.77 ?  1555 ILE D N   1 
ATOM   6609 C CA  . ILE D  1 81  ? -61.665  -31.872 47.719  1.00 118.56 ?  1555 ILE D CA  1 
ATOM   6610 C C   . ILE D  1 81  ? -62.263  -32.717 48.852  1.00 118.62 ?  1555 ILE D C   1 
ATOM   6611 O O   . ILE D  1 81  ? -61.710  -33.768 49.173  1.00 121.43 ?  1555 ILE D O   1 
ATOM   6612 C CB  . ILE D  1 81  ? -60.996  -30.544 48.201  1.00 127.91 ?  1555 ILE D CB  1 
ATOM   6613 C CG1 . ILE D  1 81  ? -59.986  -30.030 47.146  1.00 130.75 ?  1555 ILE D CG1 1 
ATOM   6614 C CG2 . ILE D  1 81  ? -60.306  -30.706 49.570  1.00 128.07 ?  1555 ILE D CG2 1 
ATOM   6615 C CD1 . ILE D  1 81  ? -59.709  -28.500 47.143  1.00 131.23 ?  1555 ILE D CD1 1 
ATOM   6616 N N   . TYR D  1 82  ? -63.419  -32.293 49.402  1.00 122.78 ?  1556 TYR D N   1 
ATOM   6617 C CA  . TYR D  1 82  ? -64.066  -32.993 50.505  1.00 132.10 ?  1556 TYR D CA  1 
ATOM   6618 C C   . TYR D  1 82  ? -65.115  -34.039 50.048  1.00 124.18 ?  1556 TYR D C   1 
ATOM   6619 O O   . TYR D  1 82  ? -66.295  -33.953 50.396  1.00 117.66 ?  1556 TYR D O   1 
ATOM   6620 C CB  . TYR D  1 82  ? -64.628  -31.998 51.538  1.00 145.12 ?  1556 TYR D CB  1 
ATOM   6621 C CG  . TYR D  1 82  ? -63.572  -31.493 52.505  1.00 159.10 ?  1556 TYR D CG  1 
ATOM   6622 C CD1 . TYR D  1 82  ? -63.263  -32.201 53.665  1.00 161.22 ?  1556 TYR D CD1 1 
ATOM   6623 C CD2 . TYR D  1 82  ? -62.873  -30.314 52.255  1.00 160.80 ?  1556 TYR D CD2 1 
ATOM   6624 C CE1 . TYR D  1 82  ? -62.283  -31.751 54.550  1.00 157.28 ?  1556 TYR D CE1 1 
ATOM   6625 C CE2 . TYR D  1 82  ? -61.895  -29.850 53.137  1.00 154.67 ?  1556 TYR D CE2 1 
ATOM   6626 C CZ  . TYR D  1 82  ? -61.603  -30.573 54.283  1.00 155.06 ?  1556 TYR D CZ  1 
ATOM   6627 O OH  . TYR D  1 82  ? -60.642  -30.128 55.158  1.00 149.85 ?  1556 TYR D OH  1 
ATOM   6628 N N   . VAL D  1 83  ? -64.629  -35.036 49.268  1.00 122.30 ?  1557 VAL D N   1 
ATOM   6629 C CA  . VAL D  1 83  ? -65.254  -36.280 48.760  1.00 122.26 ?  1557 VAL D CA  1 
ATOM   6630 C C   . VAL D  1 83  ? -64.118  -37.269 48.468  1.00 124.08 ?  1557 VAL D C   1 
ATOM   6631 O O   . VAL D  1 83  ? -64.225  -38.455 48.799  1.00 123.93 ?  1557 VAL D O   1 
ATOM   6632 C CB  . VAL D  1 83  ? -66.268  -36.203 47.575  1.00 122.05 ?  1557 VAL D CB  1 
ATOM   6633 C CG1 . VAL D  1 83  ? -67.582  -35.553 47.978  1.00 126.40 ?  1557 VAL D CG1 1 
ATOM   6634 C CG2 . VAL D  1 83  ? -65.679  -35.563 46.321  1.00 125.80 ?  1557 VAL D CG2 1 
ATOM   6635 N N   . HIS D  1 84  ? -63.025  -36.748 47.860  1.00 121.96 ?  1558 HIS D N   1 
ATOM   6636 C CA  . HIS D  1 84  ? -61.796  -37.455 47.507  1.00 117.52 ?  1558 HIS D CA  1 
ATOM   6637 C C   . HIS D  1 84  ? -60.748  -37.307 48.627  1.00 115.36 ?  1558 HIS D C   1 
ATOM   6638 O O   . HIS D  1 84  ? -59.679  -37.919 48.552  1.00 109.45 ?  1558 HIS D O   1 
ATOM   6639 C CB  . HIS D  1 84  ? -61.238  -36.910 46.188  1.00 116.44 ?  1558 HIS D CB  1 
ATOM   6640 C CG  . HIS D  1 84  ? -61.972  -37.354 44.960  1.00 115.86 ?  1558 HIS D CG  1 
ATOM   6641 N ND1 . HIS D  1 84  ? -61.523  -38.418 44.198  1.00 114.51 ?  1558 HIS D ND1 1 
ATOM   6642 C CD2 . HIS D  1 84  ? -63.068  -36.828 44.368  1.00 115.80 ?  1558 HIS D CD2 1 
ATOM   6643 C CE1 . HIS D  1 84  ? -62.374  -38.525 43.191  1.00 109.09 ?  1558 HIS D CE1 1 
ATOM   6644 N NE2 . HIS D  1 84  ? -63.317  -37.588 43.248  1.00 115.47 ?  1558 HIS D NE2 1 
ATOM   6645 N N   . ARG D  1 85  ? -61.079  -36.494 49.667  1.00 117.91 ?  1559 ARG D N   1 
ATOM   6646 C CA  . ARG D  1 85  ? -60.290  -36.189 50.871  1.00 120.60 ?  1559 ARG D CA  1 
ATOM   6647 C C   . ARG D  1 85  ? -58.870  -35.683 50.534  1.00 121.82 ?  1559 ARG D C   1 
ATOM   6648 O O   . ARG D  1 85  ? -58.667  -34.474 50.427  1.00 126.25 ?  1559 ARG D O   1 
ATOM   6649 C CB  . ARG D  1 85  ? -60.280  -37.383 51.854  1.00 126.42 ?  1559 ARG D CB  1 
ATOM   6650 C CG  . ARG D  1 85  ? -59.902  -37.027 53.293  1.00 131.20 ?  1559 ARG D CG  1 
ATOM   6651 C CD  . ARG D  1 85  ? -59.657  -38.281 54.116  1.00 130.35 ?  1559 ARG D CD  1 
ATOM   6652 N NE  . ARG D  1 85  ? -59.490  -37.998 55.545  1.00 129.38 ?  1559 ARG D NE  1 
ATOM   6653 C CZ  . ARG D  1 85  ? -60.481  -37.993 56.436  1.00 133.59 ?  1559 ARG D CZ  1 
ATOM   6654 N NH1 . ARG D  1 85  ? -61.729  -38.240 56.053  1.00 138.97 1  1559 ARG D NH1 1 
ATOM   6655 N NH2 . ARG D  1 85  ? -60.232  -37.738 57.713  1.00 132.97 ?  1559 ARG D NH2 1 
ATOM   6656 N N   . ILE D  1 86  ? -57.910  -36.604 50.357  1.00 123.04 ?  1560 ILE D N   1 
ATOM   6657 C CA  . ILE D  1 86  ? -56.510  -36.304 50.038  1.00 124.44 ?  1560 ILE D CA  1 
ATOM   6658 C C   . ILE D  1 86  ? -56.084  -36.963 48.724  1.00 124.32 ?  1560 ILE D C   1 
ATOM   6659 O O   . ILE D  1 86  ? -55.126  -36.512 48.089  1.00 124.29 ?  1560 ILE D O   1 
ATOM   6660 C CB  . ILE D  1 86  ? -55.546  -36.630 51.218  1.00 122.14 ?  1560 ILE D CB  1 
ATOM   6661 C CG1 . ILE D  1 86  ? -55.799  -38.045 51.812  1.00 121.62 ?  1560 ILE D CG1 1 
ATOM   6662 C CG2 . ILE D  1 86  ? -55.629  -35.546 52.297  1.00 120.66 ?  1560 ILE D CG2 1 
ATOM   6663 C CD1 . ILE D  1 86  ? -54.541  -38.876 52.102  1.00 119.86 ?  1560 ILE D CD1 1 
ATOM   6664 N N   . SER D  1 87  ? -56.826  -38.014 48.307  1.00 123.34 ?  1561 SER D N   1 
ATOM   6665 C CA  . SER D  1 87  ? -56.607  -38.770 47.071  1.00 123.07 ?  1561 SER D CA  1 
ATOM   6666 C C   . SER D  1 87  ? -56.908  -37.925 45.823  1.00 129.82 ?  1561 SER D C   1 
ATOM   6667 O O   . SER D  1 87  ? -56.545  -38.316 44.710  1.00 130.60 ?  1561 SER D O   1 
ATOM   6668 C CB  . SER D  1 87  ? -57.427  -40.056 47.081  1.00 115.85 ?  1561 SER D CB  1 
ATOM   6669 O OG  . SER D  1 87  ? -56.924  -40.953 48.059  1.00 106.12 ?  1561 SER D OG  1 
ATOM   6670 N N   . PHE D  1 88  ? -57.552  -36.754 46.030  1.00 133.56 ?  1562 PHE D N   1 
ATOM   6671 C CA  . PHE D  1 88  ? -57.886  -35.735 45.033  1.00 138.18 ?  1562 PHE D CA  1 
ATOM   6672 C C   . PHE D  1 88  ? -56.593  -35.200 44.404  1.00 139.57 ?  1562 PHE D C   1 
ATOM   6673 O O   . PHE D  1 88  ? -56.510  -35.032 43.185  1.00 136.29 ?  1562 PHE D O   1 
ATOM   6674 C CB  . PHE D  1 88  ? -58.643  -34.580 45.739  1.00 142.65 ?  1562 PHE D CB  1 
ATOM   6675 C CG  . PHE D  1 88  ? -58.717  -33.264 44.999  1.00 141.01 ?  1562 PHE D CG  1 
ATOM   6676 C CD1 . PHE D  1 88  ? -59.766  -32.996 44.128  1.00 136.72 ?  1562 PHE D CD1 1 
ATOM   6677 C CD2 . PHE D  1 88  ? -57.749  -32.284 45.191  1.00 138.86 ?  1562 PHE D CD2 1 
ATOM   6678 C CE1 . PHE D  1 88  ? -59.836  -31.777 43.447  1.00 136.45 ?  1562 PHE D CE1 1 
ATOM   6679 C CE2 . PHE D  1 88  ? -57.804  -31.077 44.493  1.00 137.27 ?  1562 PHE D CE2 1 
ATOM   6680 C CZ  . PHE D  1 88  ? -58.853  -30.826 43.634  1.00 141.20 ?  1562 PHE D CZ  1 
ATOM   6681 N N   . PHE D  1 89  ? -55.598  -34.930 45.269  1.00 139.88 ?  1563 PHE D N   1 
ATOM   6682 C CA  . PHE D  1 89  ? -54.294  -34.352 44.963  1.00 135.16 ?  1563 PHE D CA  1 
ATOM   6683 C C   . PHE D  1 89  ? -53.349  -35.311 44.218  1.00 139.03 ?  1563 PHE D C   1 
ATOM   6684 O O   . PHE D  1 89  ? -52.333  -34.858 43.682  1.00 147.45 ?  1563 PHE D O   1 
ATOM   6685 C CB  . PHE D  1 89  ? -53.663  -33.792 46.249  1.00 131.19 ?  1563 PHE D CB  1 
ATOM   6686 C CG  . PHE D  1 89  ? -54.544  -32.766 46.932  1.00 123.39 ?  1563 PHE D CG  1 
ATOM   6687 C CD1 . PHE D  1 89  ? -54.453  -31.418 46.603  1.00 121.98 ?  1563 PHE D CD1 1 
ATOM   6688 C CD2 . PHE D  1 89  ? -55.487  -33.153 47.878  1.00 120.72 ?  1563 PHE D CD2 1 
ATOM   6689 C CE1 . PHE D  1 89  ? -55.286  -30.473 47.214  1.00 120.47 ?  1563 PHE D CE1 1 
ATOM   6690 C CE2 . PHE D  1 89  ? -56.323  -32.210 48.484  1.00 120.32 ?  1563 PHE D CE2 1 
ATOM   6691 C CZ  . PHE D  1 89  ? -56.215  -30.875 48.150  1.00 119.36 ?  1563 PHE D CZ  1 
ATOM   6692 N N   . LYS D  1 90  ? -53.700  -36.614 44.145  1.00 132.15 ?  1564 LYS D N   1 
ATOM   6693 C CA  . LYS D  1 90  ? -52.938  -37.621 43.399  1.00 129.51 ?  1564 LYS D CA  1 
ATOM   6694 C C   . LYS D  1 90  ? -53.143  -37.371 41.891  1.00 118.88 ?  1564 LYS D C   1 
ATOM   6695 O O   . LYS D  1 90  ? -52.175  -37.392 41.128  1.00 110.18 ?  1564 LYS D O   1 
ATOM   6696 C CB  . LYS D  1 90  ? -53.379  -39.052 43.797  1.00 138.30 ?  1564 LYS D CB  1 
ATOM   6697 C CG  . LYS D  1 90  ? -52.664  -40.188 43.046  1.00 143.79 ?  1564 LYS D CG  1 
ATOM   6698 C CD  . LYS D  1 90  ? -53.569  -40.857 41.997  1.00 138.57 ?  1564 LYS D CD  1 
ATOM   6699 C CE  . LYS D  1 90  ? -52.796  -41.714 41.020  1.00 130.59 ?  1564 LYS D CE  1 
ATOM   6700 N NZ  . LYS D  1 90  ? -53.696  -42.377 40.040  1.00 127.91 1  1564 LYS D NZ  1 
ATOM   6701 N N   . ASP D  1 91  ? -54.410  -37.130 41.486  1.00 118.99 ?  1565 ASP D N   1 
ATOM   6702 C CA  . ASP D  1 91  ? -54.841  -36.873 40.111  1.00 127.38 ?  1565 ASP D CA  1 
ATOM   6703 C C   . ASP D  1 91  ? -54.232  -35.564 39.590  1.00 117.97 ?  1565 ASP D C   1 
ATOM   6704 O O   . ASP D  1 91  ? -54.450  -34.523 40.210  1.00 127.55 ?  1565 ASP D O   1 
ATOM   6705 C CB  . ASP D  1 91  ? -56.389  -36.828 40.048  1.00 139.09 ?  1565 ASP D CB  1 
ATOM   6706 C CG  . ASP D  1 91  ? -57.021  -36.557 38.688  1.00 142.84 ?  1565 ASP D CG  1 
ATOM   6707 O OD1 . ASP D  1 91  ? -56.371  -36.843 37.659  1.00 153.22 -1 1565 ASP D OD1 1 
ATOM   6708 O OD2 . ASP D  1 91  ? -58.195  -36.125 38.655  1.00 128.10 ?  1565 ASP D OD2 1 
ATOM   6709 N N   . PRO D  1 92  ? -53.469  -35.582 38.469  1.00 111.74 ?  1566 PRO D N   1 
ATOM   6710 C CA  . PRO D  1 92  ? -52.901  -34.323 37.952  1.00 119.49 ?  1566 PRO D CA  1 
ATOM   6711 C C   . PRO D  1 92  ? -53.958  -33.428 37.295  1.00 120.88 ?  1566 PRO D C   1 
ATOM   6712 O O   . PRO D  1 92  ? -53.779  -32.209 37.230  1.00 118.15 ?  1566 PRO D O   1 
ATOM   6713 C CB  . PRO D  1 92  ? -51.833  -34.787 36.949  1.00 120.47 ?  1566 PRO D CB  1 
ATOM   6714 C CG  . PRO D  1 92  ? -51.786  -36.284 37.053  1.00 115.89 ?  1566 PRO D CG  1 
ATOM   6715 C CD  . PRO D  1 92  ? -53.097  -36.719 37.608  1.00 113.07 ?  1566 PRO D CD  1 
ATOM   6716 N N   . TRP D  1 93  ? -55.064  -34.040 36.818  1.00 117.06 ?  1567 TRP D N   1 
ATOM   6717 C CA  . TRP D  1 93  ? -56.186  -33.350 36.185  1.00 114.57 ?  1567 TRP D CA  1 
ATOM   6718 C C   . TRP D  1 93  ? -56.933  -32.516 37.224  1.00 117.57 ?  1567 TRP D C   1 
ATOM   6719 O O   . TRP D  1 93  ? -57.141  -31.325 36.995  1.00 124.66 ?  1567 TRP D O   1 
ATOM   6720 C CB  . TRP D  1 93  ? -57.119  -34.349 35.484  1.00 110.24 ?  1567 TRP D CB  1 
ATOM   6721 C CG  . TRP D  1 93  ? -56.432  -35.164 34.429  1.00 106.09 ?  1567 TRP D CG  1 
ATOM   6722 C CD1 . TRP D  1 93  ? -55.815  -36.370 34.596  1.00 110.62 ?  1567 TRP D CD1 1 
ATOM   6723 C CD2 . TRP D  1 93  ? -56.257  -34.812 33.050  1.00 99.85  ?  1567 TRP D CD2 1 
ATOM   6724 N NE1 . TRP D  1 93  ? -55.285  -36.801 33.404  1.00 107.49 ?  1567 TRP D NE1 1 
ATOM   6725 C CE2 . TRP D  1 93  ? -55.543  -35.865 32.435  1.00 96.95  ?  1567 TRP D CE2 1 
ATOM   6726 C CE3 . TRP D  1 93  ? -56.648  -33.713 32.266  1.00 105.92 ?  1567 TRP D CE3 1 
ATOM   6727 C CZ2 . TRP D  1 93  ? -55.216  -35.853 31.070  1.00 96.92  ?  1567 TRP D CZ2 1 
ATOM   6728 C CZ3 . TRP D  1 93  ? -56.303  -33.692 30.922  1.00 105.17 ?  1567 TRP D CZ3 1 
ATOM   6729 C CH2 . TRP D  1 93  ? -55.603  -34.756 30.335  1.00 100.29 ?  1567 TRP D CH2 1 
ATOM   6730 N N   . SER D  1 94  ? -57.277  -33.123 38.388  1.00 114.13 ?  1568 SER D N   1 
ATOM   6731 C CA  . SER D  1 94  ? -57.946  -32.444 39.507  1.00 108.39 ?  1568 SER D CA  1 
ATOM   6732 C C   . SER D  1 94  ? -57.033  -31.399 40.133  1.00 109.17 ?  1568 SER D C   1 
ATOM   6733 O O   . SER D  1 94  ? -57.514  -30.387 40.644  1.00 109.72 ?  1568 SER D O   1 
ATOM   6734 C CB  . SER D  1 94  ? -58.394  -33.446 40.564  1.00 102.76 ?  1568 SER D CB  1 
ATOM   6735 O OG  . SER D  1 94  ? -59.673  -33.977 40.259  1.00 97.49  ?  1568 SER D OG  1 
ATOM   6736 N N   . LEU D  1 95  ? -55.713  -31.648 40.073  1.00 107.33 ?  1569 LEU D N   1 
ATOM   6737 C CA  . LEU D  1 95  ? -54.667  -30.755 40.553  1.00 111.42 ?  1569 LEU D CA  1 
ATOM   6738 C C   . LEU D  1 95  ? -54.692  -29.477 39.705  1.00 114.98 ?  1569 LEU D C   1 
ATOM   6739 O O   . LEU D  1 95  ? -54.663  -28.386 40.270  1.00 117.29 ?  1569 LEU D O   1 
ATOM   6740 C CB  . LEU D  1 95  ? -53.307  -31.459 40.432  1.00 115.33 ?  1569 LEU D CB  1 
ATOM   6741 C CG  . LEU D  1 95  ? -52.108  -30.765 41.045  1.00 117.75 ?  1569 LEU D CG  1 
ATOM   6742 C CD1 . LEU D  1 95  ? -51.796  -31.336 42.416  1.00 119.62 ?  1569 LEU D CD1 1 
ATOM   6743 C CD2 . LEU D  1 95  ? -50.900  -30.881 40.127  1.00 119.45 ?  1569 LEU D CD2 1 
ATOM   6744 N N   . PHE D  1 96  ? -54.789  -29.621 38.355  1.00 114.77 ?  1570 PHE D N   1 
ATOM   6745 C CA  . PHE D  1 96  ? -54.860  -28.512 37.397  1.00 107.65 ?  1570 PHE D CA  1 
ATOM   6746 C C   . PHE D  1 96  ? -56.104  -27.677 37.649  1.00 105.10 ?  1570 PHE D C   1 
ATOM   6747 O O   . PHE D  1 96  ? -55.987  -26.471 37.841  1.00 101.63 ?  1570 PHE D O   1 
ATOM   6748 C CB  . PHE D  1 96  ? -54.834  -29.031 35.943  1.00 104.63 ?  1570 PHE D CB  1 
ATOM   6749 C CG  . PHE D  1 96  ? -55.320  -28.060 34.886  1.00 100.36 ?  1570 PHE D CG  1 
ATOM   6750 C CD1 . PHE D  1 96  ? -54.510  -27.018 34.448  1.00 98.29  ?  1570 PHE D CD1 1 
ATOM   6751 C CD2 . PHE D  1 96  ? -56.578  -28.207 34.309  1.00 103.70 ?  1570 PHE D CD2 1 
ATOM   6752 C CE1 . PHE D  1 96  ? -54.958  -26.128 33.466  1.00 99.27  ?  1570 PHE D CE1 1 
ATOM   6753 C CE2 . PHE D  1 96  ? -57.026  -27.314 33.332  1.00 103.67 ?  1570 PHE D CE2 1 
ATOM   6754 C CZ  . PHE D  1 96  ? -56.211  -26.287 32.910  1.00 99.74  ?  1570 PHE D CZ  1 
ATOM   6755 N N   . ASP D  1 97  ? -57.287  -28.333 37.684  1.00 107.36 ?  1571 ASP D N   1 
ATOM   6756 C CA  . ASP D  1 97  ? -58.592  -27.718 37.935  1.00 111.35 ?  1571 ASP D CA  1 
ATOM   6757 C C   . ASP D  1 97  ? -58.591  -26.908 39.233  1.00 113.46 ?  1571 ASP D C   1 
ATOM   6758 O O   . ASP D  1 97  ? -59.372  -25.961 39.365  1.00 119.41 ?  1571 ASP D O   1 
ATOM   6759 C CB  . ASP D  1 97  ? -59.697  -28.787 37.958  1.00 109.43 ?  1571 ASP D CB  1 
ATOM   6760 C CG  . ASP D  1 97  ? -60.095  -29.334 36.593  1.00 108.37 ?  1571 ASP D CG  1 
ATOM   6761 O OD1 . ASP D  1 97  ? -59.191  -29.566 35.751  1.00 103.73 -1 1571 ASP D OD1 1 
ATOM   6762 O OD2 . ASP D  1 97  ? -61.305  -29.573 36.381  1.00 105.96 ?  1571 ASP D OD2 1 
ATOM   6763 N N   . PHE D  1 98  ? -57.682  -27.269 40.169  1.00 109.38 ?  1572 PHE D N   1 
ATOM   6764 C CA  . PHE D  1 98  ? -57.467  -26.608 41.456  1.00 113.52 ?  1572 PHE D CA  1 
ATOM   6765 C C   . PHE D  1 98  ? -56.571  -25.362 41.278  1.00 109.60 ?  1572 PHE D C   1 
ATOM   6766 O O   . PHE D  1 98  ? -56.833  -24.329 41.901  1.00 118.20 ?  1572 PHE D O   1 
ATOM   6767 C CB  . PHE D  1 98  ? -56.882  -27.609 42.478  1.00 115.36 ?  1572 PHE D CB  1 
ATOM   6768 C CG  . PHE D  1 98  ? -56.417  -27.028 43.794  1.00 118.81 ?  1572 PHE D CG  1 
ATOM   6769 C CD1 . PHE D  1 98  ? -57.324  -26.758 44.814  1.00 120.93 ?  1572 PHE D CD1 1 
ATOM   6770 C CD2 . PHE D  1 98  ? -55.067  -26.775 44.024  1.00 111.25 ?  1572 PHE D CD2 1 
ATOM   6771 C CE1 . PHE D  1 98  ? -56.892  -26.217 46.029  1.00 118.54 ?  1572 PHE D CE1 1 
ATOM   6772 C CE2 . PHE D  1 98  ? -54.637  -26.234 45.239  1.00 106.85 ?  1572 PHE D CE2 1 
ATOM   6773 C CZ  . PHE D  1 98  ? -55.551  -25.962 46.234  1.00 113.26 ?  1572 PHE D CZ  1 
ATOM   6774 N N   . VAL D  1 99  ? -55.531  -25.454 40.421  1.00 99.22  ?  1573 VAL D N   1 
ATOM   6775 C CA  . VAL D  1 99  ? -54.633  -24.327 40.130  1.00 93.79  ?  1573 VAL D CA  1 
ATOM   6776 C C   . VAL D  1 99  ? -55.434  -23.254 39.379  1.00 98.92  ?  1573 VAL D C   1 
ATOM   6777 O O   . VAL D  1 99  ? -55.180  -22.062 39.553  1.00 85.09  ?  1573 VAL D O   1 
ATOM   6778 C CB  . VAL D  1 99  ? -53.369  -24.743 39.333  1.00 91.34  ?  1573 VAL D CB  1 
ATOM   6779 C CG1 . VAL D  1 99  ? -52.352  -23.602 39.281  1.00 97.94  ?  1573 VAL D CG1 1 
ATOM   6780 C CG2 . VAL D  1 99  ? -52.726  -25.997 39.913  1.00 87.93  ?  1573 VAL D CG2 1 
ATOM   6781 N N   . VAL D  1 100 ? -56.407  -23.701 38.554  1.00 112.08 ?  1574 VAL D N   1 
ATOM   6782 C CA  . VAL D  1 100 ? -57.327  -22.886 37.758  1.00 119.65 ?  1574 VAL D CA  1 
ATOM   6783 C C   . VAL D  1 100 ? -58.139  -21.954 38.665  1.00 135.19 ?  1574 VAL D C   1 
ATOM   6784 O O   . VAL D  1 100 ? -58.242  -20.764 38.369  1.00 160.69 ?  1574 VAL D O   1 
ATOM   6785 C CB  . VAL D  1 100 ? -58.227  -23.796 36.865  1.00 116.73 ?  1574 VAL D CB  1 
ATOM   6786 C CG1 . VAL D  1 100 ? -59.556  -23.136 36.506  1.00 128.56 ?  1574 VAL D CG1 1 
ATOM   6787 C CG2 . VAL D  1 100 ? -57.489  -24.229 35.608  1.00 108.29 ?  1574 VAL D CG2 1 
ATOM   6788 N N   . VAL D  1 101 ? -58.686  -22.489 39.774  1.00 130.70 ?  1575 VAL D N   1 
ATOM   6789 C CA  . VAL D  1 101 ? -59.512  -21.709 40.687  1.00 124.84 ?  1575 VAL D CA  1 
ATOM   6790 C C   . VAL D  1 101 ? -58.668  -20.755 41.551  1.00 106.91 ?  1575 VAL D C   1 
ATOM   6791 O O   . VAL D  1 101 ? -59.089  -19.619 41.749  1.00 113.25 ?  1575 VAL D O   1 
ATOM   6792 C CB  . VAL D  1 101 ? -60.493  -22.588 41.509  1.00 134.02 ?  1575 VAL D CB  1 
ATOM   6793 C CG1 . VAL D  1 101 ? -59.842  -23.205 42.742  1.00 133.42 ?  1575 VAL D CG1 1 
ATOM   6794 C CG2 . VAL D  1 101 ? -61.739  -21.803 41.884  1.00 146.31 ?  1575 VAL D CG2 1 
ATOM   6795 N N   . ILE D  1 102 ? -57.480  -21.185 42.014  1.00 94.18  ?  1576 ILE D N   1 
ATOM   6796 C CA  . ILE D  1 102 ? -56.627  -20.327 42.845  1.00 99.28  ?  1576 ILE D CA  1 
ATOM   6797 C C   . ILE D  1 102 ? -56.065  -19.146 42.021  1.00 103.03 ?  1576 ILE D C   1 
ATOM   6798 O O   . ILE D  1 102 ? -56.066  -18.020 42.520  1.00 96.00  ?  1576 ILE D O   1 
ATOM   6799 C CB  . ILE D  1 102 ? -55.534  -21.095 43.661  1.00 101.60 ?  1576 ILE D CB  1 
ATOM   6800 C CG1 . ILE D  1 102 ? -54.455  -21.762 42.777  1.00 106.33 ?  1576 ILE D CG1 1 
ATOM   6801 C CG2 . ILE D  1 102 ? -56.163  -22.113 44.617  1.00 103.73 ?  1576 ILE D CG2 1 
ATOM   6802 C CD1 . ILE D  1 102 ? -53.121  -21.001 42.715  1.00 103.94 ?  1576 ILE D CD1 1 
ATOM   6803 N N   . ILE D  1 103 ? -55.652  -19.404 40.749  1.00 107.00 ?  1577 ILE D N   1 
ATOM   6804 C CA  . ILE D  1 103 ? -55.116  -18.398 39.819  1.00 107.11 ?  1577 ILE D CA  1 
ATOM   6805 C C   . ILE D  1 103 ? -56.218  -17.396 39.434  1.00 103.95 ?  1577 ILE D C   1 
ATOM   6806 O O   . ILE D  1 103 ? -55.947  -16.200 39.289  1.00 95.90  ?  1577 ILE D O   1 
ATOM   6807 C CB  . ILE D  1 103 ? -54.380  -19.059 38.603  1.00 106.70 ?  1577 ILE D CB  1 
ATOM   6808 C CG1 . ILE D  1 103 ? -53.198  -18.203 38.113  1.00 110.83 ?  1577 ILE D CG1 1 
ATOM   6809 C CG2 . ILE D  1 103 ? -55.312  -19.447 37.453  1.00 108.43 ?  1577 ILE D CG2 1 
ATOM   6810 C CD1 . ILE D  1 103 ? -51.903  -19.008 37.792  1.00 108.92 ?  1577 ILE D CD1 1 
ATOM   6811 N N   . SER D  1 104 ? -57.467  -17.897 39.338  1.00 111.02 ?  1578 SER D N   1 
ATOM   6812 C CA  . SER D  1 104 ? -58.666  -17.133 39.032  1.00 110.71 ?  1578 SER D CA  1 
ATOM   6813 C C   . SER D  1 104 ? -58.985  -16.191 40.196  1.00 108.70 ?  1578 SER D C   1 
ATOM   6814 O O   . SER D  1 104 ? -59.156  -14.994 39.966  1.00 98.54  ?  1578 SER D O   1 
ATOM   6815 C CB  . SER D  1 104 ? -59.833  -18.078 38.757  1.00 106.26 ?  1578 SER D CB  1 
ATOM   6816 O OG  . SER D  1 104 ? -61.059  -17.384 38.619  1.00 109.57 ?  1578 SER D OG  1 
ATOM   6817 N N   . ILE D  1 105 ? -59.017  -16.721 41.442  1.00 109.43 ?  1579 ILE D N   1 
ATOM   6818 C CA  . ILE D  1 105 ? -59.304  -15.946 42.656  1.00 107.24 ?  1579 ILE D CA  1 
ATOM   6819 C C   . ILE D  1 105 ? -58.193  -14.910 42.920  1.00 105.47 ?  1579 ILE D C   1 
ATOM   6820 O O   . ILE D  1 105 ? -58.511  -13.739 43.143  1.00 96.12  ?  1579 ILE D O   1 
ATOM   6821 C CB  . ILE D  1 105 ? -59.622  -16.853 43.891  1.00 100.45 ?  1579 ILE D CB  1 
ATOM   6822 C CG1 . ILE D  1 105 ? -60.879  -17.718 43.640  1.00 94.19  ?  1579 ILE D CG1 1 
ATOM   6823 C CG2 . ILE D  1 105 ? -59.808  -16.023 45.174  1.00 100.57 ?  1579 ILE D CG2 1 
ATOM   6824 C CD1 . ILE D  1 105 ? -60.921  -19.008 44.434  1.00 90.51  ?  1579 ILE D CD1 1 
ATOM   6825 N N   . VAL D  1 106 ? -56.906  -15.330 42.857  1.00 101.16 ?  1580 VAL D N   1 
ATOM   6826 C CA  . VAL D  1 106 ? -55.750  -14.437 43.063  1.00 96.69  ?  1580 VAL D CA  1 
ATOM   6827 C C   . VAL D  1 106 ? -55.744  -13.312 42.009  1.00 96.65  ?  1580 VAL D C   1 
ATOM   6828 O O   . VAL D  1 106 ? -55.589  -12.136 42.362  1.00 91.97  ?  1580 VAL D O   1 
ATOM   6829 C CB  . VAL D  1 106 ? -54.397  -15.210 43.158  1.00 93.72  ?  1580 VAL D CB  1 
ATOM   6830 C CG1 . VAL D  1 106 ? -53.191  -14.272 43.104  1.00 91.93  ?  1580 VAL D CG1 1 
ATOM   6831 C CG2 . VAL D  1 106 ? -54.342  -16.054 44.425  1.00 94.94  ?  1580 VAL D CG2 1 
ATOM   6832 N N   . GLY D  1 107 ? -55.971  -13.693 40.748  1.00 99.79  ?  1581 GLY D N   1 
ATOM   6833 C CA  . GLY D  1 107 ? -56.033  -12.777 39.613  1.00 105.32 ?  1581 GLY D CA  1 
ATOM   6834 C C   . GLY D  1 107 ? -57.146  -11.757 39.733  1.00 102.77 ?  1581 GLY D C   1 
ATOM   6835 O O   . GLY D  1 107 ? -56.917  -10.569 39.490  1.00 101.86 ?  1581 GLY D O   1 
ATOM   6836 N N   . MET D  1 108 ? -58.350  -12.220 40.142  1.00 99.15  ?  1582 MET D N   1 
ATOM   6837 C CA  . MET D  1 108 ? -59.564  -11.422 40.350  1.00 102.74 ?  1582 MET D CA  1 
ATOM   6838 C C   . MET D  1 108 ? -59.283  -10.172 41.204  1.00 102.68 ?  1582 MET D C   1 
ATOM   6839 O O   . MET D  1 108 ? -59.622  -9.056  40.796  1.00 95.37  ?  1582 MET D O   1 
ATOM   6840 C CB  . MET D  1 108 ? -60.637  -12.298 41.015  1.00 109.69 ?  1582 MET D CB  1 
ATOM   6841 C CG  . MET D  1 108 ? -62.051  -11.835 40.771  1.00 113.80 ?  1582 MET D CG  1 
ATOM   6842 S SD  . MET D  1 108 ? -63.295  -12.950 41.480  1.00 107.83 ?  1582 MET D SD  1 
ATOM   6843 C CE  . MET D  1 108 ? -63.123  -12.587 43.213  1.00 109.45 ?  1582 MET D CE  1 
ATOM   6844 N N   . PHE D  1 109 ? -58.627  -10.368 42.365  1.00 103.35 ?  1583 PHE D N   1 
ATOM   6845 C CA  . PHE D  1 109 ? -58.265  -9.299  43.296  1.00 103.10 ?  1583 PHE D CA  1 
ATOM   6846 C C   . PHE D  1 109 ? -57.012  -8.549  42.861  1.00 99.73  ?  1583 PHE D C   1 
ATOM   6847 O O   . PHE D  1 109 ? -56.940  -7.336  43.062  1.00 93.46  ?  1583 PHE D O   1 
ATOM   6848 C CB  . PHE D  1 109 ? -58.111  -9.839  44.727  1.00 104.44 ?  1583 PHE D CB  1 
ATOM   6849 C CG  . PHE D  1 109 ? -59.388  -10.378 45.330  1.00 106.12 ?  1583 PHE D CG  1 
ATOM   6850 C CD1 . PHE D  1 109 ? -60.359  -9.517  45.831  1.00 103.32 ?  1583 PHE D CD1 1 
ATOM   6851 C CD2 . PHE D  1 109 ? -59.610  -11.747 45.417  1.00 110.25 ?  1583 PHE D CD2 1 
ATOM   6852 C CE1 . PHE D  1 109 ? -61.540  -10.017 46.392  1.00 99.28  ?  1583 PHE D CE1 1 
ATOM   6853 C CE2 . PHE D  1 109 ? -60.787  -12.247 45.986  1.00 106.51 ?  1583 PHE D CE2 1 
ATOM   6854 C CZ  . PHE D  1 109 ? -61.746  -11.378 46.465  1.00 99.00  ?  1583 PHE D CZ  1 
ATOM   6855 N N   . LEU D  1 110 ? -56.029  -9.260  42.270  1.00 101.56 ?  1584 LEU D N   1 
ATOM   6856 C CA  . LEU D  1 110 ? -54.782  -8.659  41.786  1.00 113.41 ?  1584 LEU D CA  1 
ATOM   6857 C C   . LEU D  1 110 ? -55.075  -7.595  40.711  1.00 113.22 ?  1584 LEU D C   1 
ATOM   6858 O O   . LEU D  1 110 ? -54.516  -6.495  40.767  1.00 110.60 ?  1584 LEU D O   1 
ATOM   6859 C CB  . LEU D  1 110 ? -53.835  -9.743  41.238  1.00 123.72 ?  1584 LEU D CB  1 
ATOM   6860 C CG  . LEU D  1 110 ? -52.342  -9.481  41.410  1.00 122.01 ?  1584 LEU D CG  1 
ATOM   6861 C CD1 . LEU D  1 110 ? -51.830  -10.063 42.719  1.00 118.32 ?  1584 LEU D CD1 1 
ATOM   6862 C CD2 . LEU D  1 110 ? -51.558  -10.069 40.258  1.00 121.58 ?  1584 LEU D CD2 1 
ATOM   6863 N N   . ALA D  1 111 ? -55.994  -7.915  39.775  1.00 115.47 ?  1585 ALA D N   1 
ATOM   6864 C CA  . ALA D  1 111 ? -56.429  -7.030  38.694  1.00 115.02 ?  1585 ALA D CA  1 
ATOM   6865 C C   . ALA D  1 111 ? -57.230  -5.848  39.239  1.00 114.29 ?  1585 ALA D C   1 
ATOM   6866 O O   . ALA D  1 111 ? -56.998  -4.712  38.814  1.00 112.56 ?  1585 ALA D O   1 
ATOM   6867 C CB  . ALA D  1 111 ? -57.268  -7.808  37.692  1.00 117.40 ?  1585 ALA D CB  1 
ATOM   6868 N N   . ASP D  1 112 ? -58.158  -6.121  40.190  1.00 111.09 ?  1586 ASP D N   1 
ATOM   6869 C CA  . ASP D  1 112 ? -59.022  -5.125  40.835  1.00 112.61 ?  1586 ASP D CA  1 
ATOM   6870 C C   . ASP D  1 112 ? -58.213  -4.072  41.601  1.00 110.66 ?  1586 ASP D C   1 
ATOM   6871 O O   . ASP D  1 112 ? -58.511  -2.881  41.480  1.00 104.20 ?  1586 ASP D O   1 
ATOM   6872 C CB  . ASP D  1 112 ? -60.059  -5.815  41.745  1.00 114.66 ?  1586 ASP D CB  1 
ATOM   6873 C CG  . ASP D  1 112 ? -61.286  -4.995  42.133  1.00 110.16 ?  1586 ASP D CG  1 
ATOM   6874 O OD1 . ASP D  1 112 ? -61.283  -3.757  41.911  1.00 101.22 ?  1586 ASP D OD1 1 
ATOM   6875 O OD2 . ASP D  1 112 ? -62.234  -5.581  42.688  1.00 109.71 -1 1586 ASP D OD2 1 
ATOM   6876 N N   . LEU D  1 113 ? -57.172  -4.506  42.347  1.00 107.05 ?  1587 LEU D N   1 
ATOM   6877 C CA  . LEU D  1 113 ? -56.289  -3.623  43.111  1.00 104.08 ?  1587 LEU D CA  1 
ATOM   6878 C C   . LEU D  1 113 ? -55.593  -2.611  42.184  1.00 109.71 ?  1587 LEU D C   1 
ATOM   6879 O O   . LEU D  1 113 ? -55.503  -1.434  42.540  1.00 112.55 ?  1587 LEU D O   1 
ATOM   6880 C CB  . LEU D  1 113 ? -55.259  -4.443  43.903  1.00 102.14 ?  1587 LEU D CB  1 
ATOM   6881 C CG  . LEU D  1 113 ? -54.622  -3.730  45.100  1.00 102.58 ?  1587 LEU D CG  1 
ATOM   6882 C CD1 . LEU D  1 113 ? -54.678  -4.592  46.338  1.00 101.23 ?  1587 LEU D CD1 1 
ATOM   6883 C CD2 . LEU D  1 113 ? -53.182  -3.320  44.805  1.00 107.58 ?  1587 LEU D CD2 1 
ATOM   6884 N N   . ILE D  1 114 ? -55.145  -3.065  40.986  1.00 112.58 ?  1588 ILE D N   1 
ATOM   6885 C CA  . ILE D  1 114 ? -54.489  -2.227  39.970  1.00 115.21 ?  1588 ILE D CA  1 
ATOM   6886 C C   . ILE D  1 114 ? -55.488  -1.228  39.353  1.00 122.84 ?  1588 ILE D C   1 
ATOM   6887 O O   . ILE D  1 114 ? -55.159  -0.046  39.233  1.00 126.07 ?  1588 ILE D O   1 
ATOM   6888 C CB  . ILE D  1 114 ? -53.744  -3.083  38.902  1.00 108.79 ?  1588 ILE D CB  1 
ATOM   6889 C CG1 . ILE D  1 114 ? -52.626  -3.923  39.549  1.00 100.68 ?  1588 ILE D CG1 1 
ATOM   6890 C CG2 . ILE D  1 114 ? -53.179  -2.209  37.771  1.00 113.15 ?  1588 ILE D CG2 1 
ATOM   6891 C CD1 . ILE D  1 114 ? -52.148  -5.113  38.718  1.00 99.82  ?  1588 ILE D CD1 1 
ATOM   6892 N N   . GLU D  1 115 ? -56.698  -1.705  38.978  1.00 123.85 ?  1589 GLU D N   1 
ATOM   6893 C CA  . GLU D  1 115 ? -57.768  -0.900  38.373  1.00 124.41 ?  1589 GLU D CA  1 
ATOM   6894 C C   . GLU D  1 115 ? -58.175  0.287   39.249  1.00 124.08 ?  1589 GLU D C   1 
ATOM   6895 O O   . GLU D  1 115 ? -58.278  1.407   38.743  1.00 122.84 ?  1589 GLU D O   1 
ATOM   6896 C CB  . GLU D  1 115 ? -58.992  -1.780  38.032  1.00 127.21 ?  1589 GLU D CB  1 
ATOM   6897 C CG  . GLU D  1 115 ? -60.153  -1.054  37.361  1.00 125.94 ?  1589 GLU D CG  1 
ATOM   6898 C CD  . GLU D  1 115 ? -60.020  -0.772  35.875  1.00 130.37 ?  1589 GLU D CD  1 
ATOM   6899 O OE1 . GLU D  1 115 ? -60.821  -1.336  35.095  1.00 130.26 ?  1589 GLU D OE1 1 
ATOM   6900 O OE2 . GLU D  1 115 ? -59.148  0.042   35.492  1.00 141.10 -1 1589 GLU D OE2 1 
ATOM   6901 N N   . THR D  1 116 ? -58.393  0.039   40.553  1.00 125.71 ?  1590 THR D N   1 
ATOM   6902 C CA  . THR D  1 116 ? -58.808  1.047   41.534  1.00 123.85 ?  1590 THR D CA  1 
ATOM   6903 C C   . THR D  1 116 ? -57.727  2.107   41.800  1.00 125.87 ?  1590 THR D C   1 
ATOM   6904 O O   . THR D  1 116 ? -58.049  3.294   41.845  1.00 133.27 ?  1590 THR D O   1 
ATOM   6905 C CB  . THR D  1 116 ? -59.295  0.379   42.831  1.00 112.83 ?  1590 THR D CB  1 
ATOM   6906 O OG1 . THR D  1 116 ? -58.262  -0.468  43.333  1.00 117.07 ?  1590 THR D OG1 1 
ATOM   6907 C CG2 . THR D  1 116 ? -60.585  -0.422  42.638  1.00 105.07 ?  1590 THR D CG2 1 
ATOM   6908 N N   . TYR D  1 117 ? -56.456  1.684   41.957  1.00 114.68 ?  1591 TYR D N   1 
ATOM   6909 C CA  . TYR D  1 117 ? -55.336  2.586   42.247  1.00 104.27 ?  1591 TYR D CA  1 
ATOM   6910 C C   . TYR D  1 117 ? -54.675  3.159   40.979  1.00 101.28 ?  1591 TYR D C   1 
ATOM   6911 O O   . TYR D  1 117 ? -54.066  2.437   40.188  1.00 106.27 ?  1591 TYR D O   1 
ATOM   6912 C CB  . TYR D  1 117 ? -54.306  1.910   43.182  1.00 102.23 ?  1591 TYR D CB  1 
ATOM   6913 C CG  . TYR D  1 117 ? -54.804  1.711   44.600  1.00 107.64 ?  1591 TYR D CG  1 
ATOM   6914 C CD1 . TYR D  1 117 ? -54.544  2.655   45.591  1.00 115.54 ?  1591 TYR D CD1 1 
ATOM   6915 C CD2 . TYR D  1 117 ? -55.536  0.579   44.953  1.00 107.23 ?  1591 TYR D CD2 1 
ATOM   6916 C CE1 . TYR D  1 117 ? -55.011  2.484   46.896  1.00 113.00 ?  1591 TYR D CE1 1 
ATOM   6917 C CE2 . TYR D  1 117 ? -56.013  0.399   46.252  1.00 106.18 ?  1591 TYR D CE2 1 
ATOM   6918 C CZ  . TYR D  1 117 ? -55.747  1.354   47.222  1.00 107.70 ?  1591 TYR D CZ  1 
ATOM   6919 O OH  . TYR D  1 117 ? -56.212  1.174   48.506  1.00 98.58  ?  1591 TYR D OH  1 
ATOM   6920 N N   . PRO D  1 121 ? -52.847  0.220   33.921  1.00 111.03 ?  1595 PRO D N   1 
ATOM   6921 C CA  . PRO D  1 121 ? -53.279  0.600   32.566  1.00 108.73 ?  1595 PRO D CA  1 
ATOM   6922 C C   . PRO D  1 121 ? -53.027  -0.508  31.538  1.00 114.09 ?  1595 PRO D C   1 
ATOM   6923 O O   . PRO D  1 121 ? -53.984  -1.097  31.028  1.00 112.50 ?  1595 PRO D O   1 
ATOM   6924 C CB  . PRO D  1 121 ? -52.485  1.883   32.280  1.00 101.88 ?  1595 PRO D CB  1 
ATOM   6925 C CG  . PRO D  1 121 ? -51.318  1.863   33.252  1.00 109.32 ?  1595 PRO D CG  1 
ATOM   6926 C CD  . PRO D  1 121 ? -51.505  0.741   34.244  1.00 109.91 ?  1595 PRO D CD  1 
ATOM   6927 N N   . THR D  1 122 ? -51.741  -0.798  31.251  1.00 125.94 ?  1596 THR D N   1 
ATOM   6928 C CA  . THR D  1 122 ? -51.306  -1.840  30.327  1.00 121.03 ?  1596 THR D CA  1 
ATOM   6929 C C   . THR D  1 122 ? -51.056  -3.135  31.099  1.00 110.67 ?  1596 THR D C   1 
ATOM   6930 O O   . THR D  1 122 ? -51.216  -4.212  30.533  1.00 100.38 ?  1596 THR D O   1 
ATOM   6931 C CB  . THR D  1 122 ? -50.135  -1.351  29.454  1.00 119.89 ?  1596 THR D CB  1 
ATOM   6932 O OG1 . THR D  1 122 ? -50.144  -2.050  28.208  1.00 106.63 ?  1596 THR D OG1 1 
ATOM   6933 C CG2 . THR D  1 122 ? -48.769  -1.451  30.147  1.00 119.17 ?  1596 THR D CG2 1 
ATOM   6934 N N   . LEU D  1 123 ? -50.695  -3.026  32.398  1.00 109.61 ?  1597 LEU D N   1 
ATOM   6935 C CA  . LEU D  1 123 ? -50.473  -4.164  33.291  1.00 107.26 ?  1597 LEU D CA  1 
ATOM   6936 C C   . LEU D  1 123 ? -51.816  -4.823  33.617  1.00 116.23 ?  1597 LEU D C   1 
ATOM   6937 O O   . LEU D  1 123 ? -51.874  -6.042  33.780  1.00 123.66 ?  1597 LEU D O   1 
ATOM   6938 C CB  . LEU D  1 123 ? -49.750  -3.716  34.582  1.00 95.87  ?  1597 LEU D CB  1 
ATOM   6939 C CG  . LEU D  1 123 ? -49.526  -4.768  35.685  1.00 89.04  ?  1597 LEU D CG  1 
ATOM   6940 C CD1 . LEU D  1 123 ? -48.686  -5.940  35.190  1.00 86.26  ?  1597 LEU D CD1 1 
ATOM   6941 C CD2 . LEU D  1 123 ? -48.889  -4.146  36.905  1.00 88.30  ?  1597 LEU D CD2 1 
ATOM   6942 N N   . PHE D  1 124 ? -52.893  -4.014  33.676  1.00 113.99 ?  1598 PHE D N   1 
ATOM   6943 C CA  . PHE D  1 124 ? -54.253  -4.473  33.944  1.00 111.60 ?  1598 PHE D CA  1 
ATOM   6944 C C   . PHE D  1 124 ? -54.728  -5.485  32.900  1.00 104.64 ?  1598 PHE D C   1 
ATOM   6945 O O   . PHE D  1 124 ? -55.406  -6.441  33.270  1.00 102.56 ?  1598 PHE D O   1 
ATOM   6946 C CB  . PHE D  1 124 ? -55.226  -3.285  34.063  1.00 118.82 ?  1598 PHE D CB  1 
ATOM   6947 C CG  . PHE D  1 124 ? -56.673  -3.668  34.284  1.00 121.06 ?  1598 PHE D CG  1 
ATOM   6948 C CD1 . PHE D  1 124 ? -57.086  -4.228  35.488  1.00 121.40 ?  1598 PHE D CD1 1 
ATOM   6949 C CD2 . PHE D  1 124 ? -57.624  -3.460  33.292  1.00 125.22 ?  1598 PHE D CD2 1 
ATOM   6950 C CE1 . PHE D  1 124 ? -58.422  -4.594  35.686  1.00 118.37 ?  1598 PHE D CE1 1 
ATOM   6951 C CE2 . PHE D  1 124 ? -58.963  -3.819  33.495  1.00 127.61 ?  1598 PHE D CE2 1 
ATOM   6952 C CZ  . PHE D  1 124 ? -59.352  -4.383  34.690  1.00 120.92 ?  1598 PHE D CZ  1 
ATOM   6953 N N   . ARG D  1 125 ? -54.350  -5.298  31.612  1.00 99.63  ?  1599 ARG D N   1 
ATOM   6954 C CA  . ARG D  1 125 ? -54.720  -6.219  30.523  1.00 94.14  ?  1599 ARG D CA  1 
ATOM   6955 C C   . ARG D  1 125 ? -53.928  -7.516  30.646  1.00 85.76  ?  1599 ARG D C   1 
ATOM   6956 O O   . ARG D  1 125 ? -54.499  -8.598  30.502  1.00 82.07  ?  1599 ARG D O   1 
ATOM   6957 C CB  . ARG D  1 125 ? -54.446  -5.631  29.120  1.00 93.91  ?  1599 ARG D CB  1 
ATOM   6958 C CG  . ARG D  1 125 ? -54.663  -4.139  28.910  1.00 101.63 ?  1599 ARG D CG  1 
ATOM   6959 C CD  . ARG D  1 125 ? -54.095  -3.697  27.567  1.00 106.64 ?  1599 ARG D CD  1 
ATOM   6960 N NE  . ARG D  1 125 ? -52.635  -3.827  27.499  1.00 107.54 ?  1599 ARG D NE  1 
ATOM   6961 C CZ  . ARG D  1 125 ? -51.991  -4.716  26.748  1.00 104.60 ?  1599 ARG D CZ  1 
ATOM   6962 N NH1 . ARG D  1 125 ? -52.667  -5.558  25.979  1.00 109.29 1  1599 ARG D NH1 1 
ATOM   6963 N NH2 . ARG D  1 125 ? -50.666  -4.767  26.759  1.00 97.92  ?  1599 ARG D NH2 1 
ATOM   6964 N N   . VAL D  1 126 ? -52.603  -7.392  30.879  1.00 87.05  ?  1600 VAL D N   1 
ATOM   6965 C CA  . VAL D  1 126 ? -51.649  -8.493  31.013  1.00 92.46  ?  1600 VAL D CA  1 
ATOM   6966 C C   . VAL D  1 126 ? -52.024  -9.402  32.201  1.00 99.78  ?  1600 VAL D C   1 
ATOM   6967 O O   . VAL D  1 126 ? -51.909  -10.617 32.077  1.00 101.19 ?  1600 VAL D O   1 
ATOM   6968 C CB  . VAL D  1 126 ? -50.173  -7.991  31.049  1.00 90.93  ?  1600 VAL D CB  1 
ATOM   6969 C CG1 . VAL D  1 126 ? -49.186  -9.143  31.178  1.00 95.34  ?  1600 VAL D CG1 1 
ATOM   6970 C CG2 . VAL D  1 126 ? -49.838  -7.166  29.812  1.00 87.83  ?  1600 VAL D CG2 1 
ATOM   6971 N N   . ILE D  1 127 ? -52.511  -8.829  33.323  1.00 103.92 ?  1601 ILE D N   1 
ATOM   6972 C CA  . ILE D  1 127 ? -52.924  -9.627  34.485  1.00 99.95  ?  1601 ILE D CA  1 
ATOM   6973 C C   . ILE D  1 127 ? -54.247  -10.342 34.194  1.00 93.30  ?  1601 ILE D C   1 
ATOM   6974 O O   . ILE D  1 127 ? -54.311  -11.561 34.340  1.00 89.92  ?  1601 ILE D O   1 
ATOM   6975 C CB  . ILE D  1 127 ? -52.928  -8.824  35.831  1.00 102.55 ?  1601 ILE D CB  1 
ATOM   6976 C CG1 . ILE D  1 127 ? -51.519  -8.261  36.197  1.00 106.77 ?  1601 ILE D CG1 1 
ATOM   6977 C CG2 . ILE D  1 127 ? -53.539  -9.618  37.003  1.00 97.67  ?  1601 ILE D CG2 1 
ATOM   6978 C CD1 . ILE D  1 127 ? -50.300  -9.258  36.282  1.00 100.51 ?  1601 ILE D CD1 1 
ATOM   6979 N N   . ARG D  1 128 ? -55.265  -9.595  33.712  1.00 103.64 ?  1602 ARG D N   1 
ATOM   6980 C CA  . ARG D  1 128 ? -56.623  -10.072 33.404  1.00 104.07 ?  1602 ARG D CA  1 
ATOM   6981 C C   . ARG D  1 128 ? -56.706  -11.368 32.587  1.00 106.07 ?  1602 ARG D C   1 
ATOM   6982 O O   . ARG D  1 128 ? -57.755  -12.008 32.645  1.00 116.02 ?  1602 ARG D O   1 
ATOM   6983 C CB  . ARG D  1 128 ? -57.472  -8.980  32.727  1.00 99.86  ?  1602 ARG D CB  1 
ATOM   6984 C CG  . ARG D  1 128 ? -58.518  -8.361  33.652  1.00 103.15 ?  1602 ARG D CG  1 
ATOM   6985 C CD  . ARG D  1 128 ? -59.598  -7.626  32.882  1.00 105.59 ?  1602 ARG D CD  1 
ATOM   6986 N NE  . ARG D  1 128 ? -60.712  -8.509  32.525  1.00 98.57  ?  1602 ARG D NE  1 
ATOM   6987 C CZ  . ARG D  1 128 ? -61.516  -8.333  31.477  1.00 90.10  ?  1602 ARG D CZ  1 
ATOM   6988 N NH1 . ARG D  1 128 ? -61.330  -7.309  30.650  1.00 87.97  1  1602 ARG D NH1 1 
ATOM   6989 N NH2 . ARG D  1 128 ? -62.504  -9.187  31.242  1.00 86.44  ?  1602 ARG D NH2 1 
ATOM   6990 N N   . LEU D  1 129 ? -55.620  -11.794 31.876  1.00 101.37 ?  1603 LEU D N   1 
ATOM   6991 C CA  . LEU D  1 129 ? -55.666  -13.044 31.097  1.00 100.44 ?  1603 LEU D CA  1 
ATOM   6992 C C   . LEU D  1 129 ? -55.666  -14.316 31.990  1.00 94.97  ?  1603 LEU D C   1 
ATOM   6993 O O   . LEU D  1 129 ? -55.667  -15.430 31.465  1.00 91.43  ?  1603 LEU D O   1 
ATOM   6994 C CB  . LEU D  1 129 ? -54.622  -13.145 29.954  1.00 99.67  ?  1603 LEU D CB  1 
ATOM   6995 C CG  . LEU D  1 129 ? -53.179  -12.713 30.180  1.00 104.39 ?  1603 LEU D CG  1 
ATOM   6996 C CD1 . LEU D  1 129 ? -52.403  -13.718 31.019  1.00 114.44 ?  1603 LEU D CD1 1 
ATOM   6997 C CD2 . LEU D  1 129 ? -52.469  -12.546 28.859  1.00 99.96  ?  1603 LEU D CD2 1 
ATOM   6998 N N   . ALA D  1 130 ? -55.753  -14.143 33.325  1.00 92.11  ?  1604 ALA D N   1 
ATOM   6999 C CA  . ALA D  1 130 ? -55.873  -15.231 34.296  1.00 101.61 ?  1604 ALA D CA  1 
ATOM   7000 C C   . ALA D  1 130 ? -57.294  -15.823 34.213  1.00 96.63  ?  1604 ALA D C   1 
ATOM   7001 O O   . ALA D  1 130 ? -57.518  -16.955 34.656  1.00 94.55  ?  1604 ALA D O   1 
ATOM   7002 C CB  . ALA D  1 130 ? -55.605  -14.706 35.698  1.00 110.81 ?  1604 ALA D CB  1 
ATOM   7003 N N   . ARG D  1 131 ? -58.244  -15.048 33.623  1.00 90.90  ?  1605 ARG D N   1 
ATOM   7004 C CA  . ARG D  1 131 ? -59.640  -15.437 33.400  1.00 93.01  ?  1605 ARG D CA  1 
ATOM   7005 C C   . ARG D  1 131 ? -59.721  -16.634 32.453  1.00 90.24  ?  1605 ARG D C   1 
ATOM   7006 O O   . ARG D  1 131 ? -60.634  -17.454 32.578  1.00 108.28 ?  1605 ARG D O   1 
ATOM   7007 C CB  . ARG D  1 131 ? -60.493  -14.246 32.891  1.00 95.13  ?  1605 ARG D CB  1 
ATOM   7008 C CG  . ARG D  1 131 ? -60.206  -13.770 31.463  1.00 98.45  ?  1605 ARG D CG  1 
ATOM   7009 C CD  . ARG D  1 131 ? -60.659  -12.342 31.215  1.00 100.81 ?  1605 ARG D CD  1 
ATOM   7010 N NE  . ARG D  1 131 ? -61.943  -12.258 30.512  1.00 100.12 ?  1605 ARG D NE  1 
ATOM   7011 C CZ  . ARG D  1 131 ? -62.076  -12.057 29.202  1.00 106.34 ?  1605 ARG D CZ  1 
ATOM   7012 N NH1 . ARG D  1 131 ? -61.006  -11.935 28.428  1.00 105.17 1  1605 ARG D NH1 1 
ATOM   7013 N NH2 . ARG D  1 131 ? -63.282  -11.972 28.658  1.00 116.88 ?  1605 ARG D NH2 1 
ATOM   7014 N N   . ILE D  1 132 ? -58.731  -16.745 31.538  1.00 79.85  ?  1606 ILE D N   1 
ATOM   7015 C CA  . ILE D  1 132 ? -58.579  -17.808 30.539  1.00 85.66  ?  1606 ILE D CA  1 
ATOM   7016 C C   . ILE D  1 132 ? -58.395  -19.189 31.201  1.00 91.61  ?  1606 ILE D C   1 
ATOM   7017 O O   . ILE D  1 132 ? -58.796  -20.187 30.609  1.00 85.65  ?  1606 ILE D O   1 
ATOM   7018 C CB  . ILE D  1 132 ? -57.451  -17.427 29.531  1.00 91.06  ?  1606 ILE D CB  1 
ATOM   7019 C CG1 . ILE D  1 132 ? -57.977  -16.440 28.492  1.00 89.67  ?  1606 ILE D CG1 1 
ATOM   7020 C CG2 . ILE D  1 132 ? -56.791  -18.624 28.837  1.00 101.70 ?  1606 ILE D CG2 1 
ATOM   7021 C CD1 . ILE D  1 132 ? -57.811  -14.984 28.835  1.00 96.29  ?  1606 ILE D CD1 1 
ATOM   7022 N N   . GLY D  1 133 ? -57.845  -19.223 32.421  1.00 98.98  ?  1607 GLY D N   1 
ATOM   7023 C CA  . GLY D  1 133 ? -57.661  -20.452 33.189  1.00 99.92  ?  1607 GLY D CA  1 
ATOM   7024 C C   . GLY D  1 133 ? -58.945  -21.249 33.334  1.00 98.00  ?  1607 GLY D C   1 
ATOM   7025 O O   . GLY D  1 133 ? -58.962  -22.455 33.075  1.00 90.58  ?  1607 GLY D O   1 
ATOM   7026 N N   . ARG D  1 134 ? -60.045  -20.553 33.681  1.00 105.34 ?  1608 ARG D N   1 
ATOM   7027 C CA  . ARG D  1 134 ? -61.384  -21.127 33.845  1.00 113.30 ?  1608 ARG D CA  1 
ATOM   7028 C C   . ARG D  1 134 ? -61.935  -21.652 32.527  1.00 104.34 ?  1608 ARG D C   1 
ATOM   7029 O O   . ARG D  1 134 ? -62.774  -22.548 32.533  1.00 107.67 ?  1608 ARG D O   1 
ATOM   7030 C CB  . ARG D  1 134 ? -62.368  -20.074 34.385  1.00 119.29 ?  1608 ARG D CB  1 
ATOM   7031 C CG  . ARG D  1 134 ? -62.022  -19.468 35.741  1.00 119.51 ?  1608 ARG D CG  1 
ATOM   7032 C CD  . ARG D  1 134 ? -63.185  -18.669 36.310  1.00 116.17 ?  1608 ARG D CD  1 
ATOM   7033 N NE  . ARG D  1 134 ? -63.749  -17.697 35.363  1.00 111.22 ?  1608 ARG D NE  1 
ATOM   7034 C CZ  . ARG D  1 134 ? -63.272  -16.473 35.152  1.00 112.30 ?  1608 ARG D CZ  1 
ATOM   7035 N NH1 . ARG D  1 134 ? -62.196  -16.049 35.804  1.00 105.03 1  1608 ARG D NH1 1 
ATOM   7036 N NH2 . ARG D  1 134 ? -63.859  -15.667 34.278  1.00 118.68 ?  1608 ARG D NH2 1 
ATOM   7037 N N   . ILE D  1 135 ? -61.488  -21.065 31.407  1.00 100.75 ?  1609 ILE D N   1 
ATOM   7038 C CA  . ILE D  1 135 ? -61.960  -21.387 30.066  1.00 99.98  ?  1609 ILE D CA  1 
ATOM   7039 C C   . ILE D  1 135 ? -61.104  -22.475 29.402  1.00 98.87  ?  1609 ILE D C   1 
ATOM   7040 O O   . ILE D  1 135 ? -61.634  -23.275 28.629  1.00 92.28  ?  1609 ILE D O   1 
ATOM   7041 C CB  . ILE D  1 135 ? -62.114  -20.063 29.242  1.00 100.29 ?  1609 ILE D CB  1 
ATOM   7042 C CG1 . ILE D  1 135 ? -63.532  -19.954 28.667  1.00 103.08 ?  1609 ILE D CG1 1 
ATOM   7043 C CG2 . ILE D  1 135 ? -61.032  -19.798 28.180  1.00 95.96  ?  1609 ILE D CG2 1 
ATOM   7044 C CD1 . ILE D  1 135 ? -64.638  -20.153 29.748  1.00 107.49 ?  1609 ILE D CD1 1 
ATOM   7045 N N   . LEU D  1 136 ? -59.808  -22.536 29.766  1.00 100.26 ?  1610 LEU D N   1 
ATOM   7046 C CA  . LEU D  1 136 ? -58.810  -23.497 29.306  1.00 97.66  ?  1610 LEU D CA  1 
ATOM   7047 C C   . LEU D  1 136 ? -59.200  -24.902 29.763  1.00 100.60 ?  1610 LEU D C   1 
ATOM   7048 O O   . LEU D  1 136 ? -58.912  -25.880 29.074  1.00 97.86  ?  1610 LEU D O   1 
ATOM   7049 C CB  . LEU D  1 136 ? -57.435  -23.089 29.857  1.00 90.01  ?  1610 LEU D CB  1 
ATOM   7050 C CG  . LEU D  1 136 ? -56.222  -23.957 29.538  1.00 82.16  ?  1610 LEU D CG  1 
ATOM   7051 C CD1 . LEU D  1 136 ? -56.124  -24.297 28.045  1.00 79.09  ?  1610 LEU D CD1 1 
ATOM   7052 C CD2 . LEU D  1 136 ? -54.952  -23.278 29.996  1.00 86.31  ?  1610 LEU D CD2 1 
ATOM   7053 N N   . ARG D  1 137 ? -59.923  -24.980 30.894  1.00 104.64 ?  1611 ARG D N   1 
ATOM   7054 C CA  . ARG D  1 137 ? -60.459  -26.201 31.482  1.00 104.24 ?  1611 ARG D CA  1 
ATOM   7055 C C   . ARG D  1 137 ? -61.402  -26.952 30.529  1.00 110.43 ?  1611 ARG D C   1 
ATOM   7056 O O   . ARG D  1 137 ? -61.713  -28.099 30.804  1.00 109.90 ?  1611 ARG D O   1 
ATOM   7057 C CB  . ARG D  1 137 ? -61.185  -25.880 32.793  1.00 100.33 ?  1611 ARG D CB  1 
ATOM   7058 C CG  . ARG D  1 137 ? -60.476  -26.399 34.030  1.00 108.19 ?  1611 ARG D CG  1 
ATOM   7059 C CD  . ARG D  1 137 ? -61.306  -26.177 35.282  1.00 117.55 ?  1611 ARG D CD  1 
ATOM   7060 N NE  . ARG D  1 137 ? -62.512  -27.010 35.315  1.00 118.70 ?  1611 ARG D NE  1 
ATOM   7061 C CZ  . ARG D  1 137 ? -63.536  -26.816 36.140  1.00 119.02 ?  1611 ARG D CZ  1 
ATOM   7062 N NH1 . ARG D  1 137 ? -63.520  -25.807 37.004  1.00 122.56 1  1611 ARG D NH1 1 
ATOM   7063 N NH2 . ARG D  1 137 ? -64.591  -27.618 36.097  1.00 111.28 ?  1611 ARG D NH2 1 
ATOM   7064 N N   . LEU D  1 138 ? -61.839  -26.329 29.411  1.00 116.38 ?  1612 LEU D N   1 
ATOM   7065 C CA  . LEU D  1 138 ? -62.728  -26.971 28.439  1.00 116.66 ?  1612 LEU D CA  1 
ATOM   7066 C C   . LEU D  1 138 ? -62.107  -28.198 27.786  1.00 116.87 ?  1612 LEU D C   1 
ATOM   7067 O O   . LEU D  1 138 ? -62.812  -29.182 27.572  1.00 137.69 ?  1612 LEU D O   1 
ATOM   7068 C CB  . LEU D  1 138 ? -63.217  -25.982 27.375  1.00 116.95 ?  1612 LEU D CB  1 
ATOM   7069 C CG  . LEU D  1 138 ? -64.623  -25.427 27.586  1.00 122.40 ?  1612 LEU D CG  1 
ATOM   7070 C CD1 . LEU D  1 138 ? -64.678  -23.964 27.246  1.00 130.64 ?  1612 LEU D CD1 1 
ATOM   7071 C CD2 . LEU D  1 138 ? -65.655  -26.200 26.782  1.00 125.31 ?  1612 LEU D CD2 1 
ATOM   7072 N N   . VAL D  1 139 ? -60.794  -28.157 27.488  1.00 108.17 ?  1613 VAL D N   1 
ATOM   7073 C CA  . VAL D  1 139 ? -60.107  -29.308 26.887  1.00 106.35 ?  1613 VAL D CA  1 
ATOM   7074 C C   . VAL D  1 139 ? -59.959  -30.450 27.899  1.00 103.35 ?  1613 VAL D C   1 
ATOM   7075 O O   . VAL D  1 139 ? -60.264  -31.597 27.568  1.00 102.49 ?  1613 VAL D O   1 
ATOM   7076 C CB  . VAL D  1 139 ? -58.762  -28.991 26.162  1.00 109.36 ?  1613 VAL D CB  1 
ATOM   7077 C CG1 . VAL D  1 139 ? -59.000  -28.339 24.807  1.00 108.50 ?  1613 VAL D CG1 1 
ATOM   7078 C CG2 . VAL D  1 139 ? -57.810  -28.153 27.018  1.00 114.50 ?  1613 VAL D CG2 1 
ATOM   7079 N N   . THR D  1 140 ? -59.538  -30.122 29.135  1.00 94.58  ?  1614 THR D N   1 
ATOM   7080 C CA  . THR D  1 140 ? -59.307  -31.094 30.201  1.00 92.36  ?  1614 THR D CA  1 
ATOM   7081 C C   . THR D  1 140 ? -60.612  -31.660 30.785  1.00 92.57  ?  1614 THR D C   1 
ATOM   7082 O O   . THR D  1 140 ? -60.667  -32.856 31.078  1.00 92.97  ?  1614 THR D O   1 
ATOM   7083 C CB  . THR D  1 140 ? -58.374  -30.522 31.287  1.00 91.22  ?  1614 THR D CB  1 
ATOM   7084 O OG1 . THR D  1 140 ? -59.056  -29.520 32.036  1.00 103.05 ?  1614 THR D OG1 1 
ATOM   7085 C CG2 . THR D  1 140 ? -57.064  -29.973 30.722  1.00 90.92  ?  1614 THR D CG2 1 
ATOM   7086 N N   . ALA D  1 141 ? -61.647  -30.816 30.954  1.00 93.34  ?  1615 ALA D N   1 
ATOM   7087 C CA  . ALA D  1 141 ? -62.935  -31.219 31.523  1.00 92.13  ?  1615 ALA D CA  1 
ATOM   7088 C C   . ALA D  1 141 ? -63.786  -32.069 30.601  1.00 86.91  ?  1615 ALA D C   1 
ATOM   7089 O O   . ALA D  1 141 ? -64.430  -32.996 31.084  1.00 86.88  ?  1615 ALA D O   1 
ATOM   7090 C CB  . ALA D  1 141 ? -63.727  -30.008 31.988  1.00 98.88  ?  1615 ALA D CB  1 
ATOM   7091 N N   . VAL D  1 142 ? -63.830  -31.747 29.297  1.00 87.15  ?  1616 VAL D N   1 
ATOM   7092 C CA  . VAL D  1 142 ? -64.646  -32.510 28.353  1.00 92.48  ?  1616 VAL D CA  1 
ATOM   7093 C C   . VAL D  1 142 ? -63.985  -33.868 28.110  1.00 91.60  ?  1616 VAL D C   1 
ATOM   7094 O O   . VAL D  1 142 ? -62.851  -33.910 27.624  1.00 98.75  ?  1616 VAL D O   1 
ATOM   7095 C CB  . VAL D  1 142 ? -65.001  -31.738 27.055  1.00 99.95  ?  1616 VAL D CB  1 
ATOM   7096 C CG1 . VAL D  1 142 ? -65.833  -32.601 26.114  1.00 104.45 ?  1616 VAL D CG1 1 
ATOM   7097 C CG2 . VAL D  1 142 ? -65.753  -30.450 27.379  1.00 107.46 ?  1616 VAL D CG2 1 
ATOM   7098 N N   . PRO D  1 143 ? -64.645  -34.983 28.511  1.00 94.10  ?  1617 PRO D N   1 
ATOM   7099 C CA  . PRO D  1 143 ? -64.014  -36.299 28.357  1.00 97.37  ?  1617 PRO D CA  1 
ATOM   7100 C C   . PRO D  1 143 ? -64.158  -36.870 26.946  1.00 97.81  ?  1617 PRO D C   1 
ATOM   7101 O O   . PRO D  1 143 ? -65.009  -37.719 26.676  1.00 94.17  ?  1617 PRO D O   1 
ATOM   7102 C CB  . PRO D  1 143 ? -64.670  -37.148 29.462  1.00 101.04 ?  1617 PRO D CB  1 
ATOM   7103 C CG  . PRO D  1 143 ? -65.772  -36.273 30.072  1.00 102.61 ?  1617 PRO D CG  1 
ATOM   7104 C CD  . PRO D  1 143 ? -65.974  -35.117 29.135  1.00 101.08 ?  1617 PRO D CD  1 
ATOM   7105 N N   . GLN D  1 144 ? -63.324  -36.335 26.038  1.00 107.98 ?  1618 GLN D N   1 
ATOM   7106 C CA  . GLN D  1 144 ? -63.125  -36.636 24.609  1.00 115.41 ?  1618 GLN D CA  1 
ATOM   7107 C C   . GLN D  1 144 ? -62.132  -35.624 24.066  1.00 110.80 ?  1618 GLN D C   1 
ATOM   7108 O O   . GLN D  1 144 ? -61.272  -35.986 23.269  1.00 103.08 ?  1618 GLN D O   1 
ATOM   7109 C CB  . GLN D  1 144 ? -64.419  -36.718 23.756  1.00 120.13 ?  1618 GLN D CB  1 
ATOM   7110 C CG  . GLN D  1 144 ? -65.409  -35.567 23.893  1.00 125.49 ?  1618 GLN D CG  1 
ATOM   7111 C CD  . GLN D  1 144 ? -66.811  -36.065 24.160  1.00 133.84 ?  1618 GLN D CD  1 
ATOM   7112 O OE1 . GLN D  1 144 ? -67.291  -36.060 25.300  1.00 123.72 ?  1618 GLN D OE1 1 
ATOM   7113 N NE2 . GLN D  1 144 ? -67.505  -36.496 23.114  1.00 146.55 ?  1618 GLN D NE2 1 
ATOM   7114 N N   . MET D  1 145 ? -62.210  -34.369 24.571  1.00 112.08 ?  1619 MET D N   1 
ATOM   7115 C CA  . MET D  1 145 ? -61.294  -33.262 24.268  1.00 108.60 ?  1619 MET D CA  1 
ATOM   7116 C C   . MET D  1 145 ? -59.995  -33.533 25.015  1.00 105.37 ?  1619 MET D C   1 
ATOM   7117 O O   . MET D  1 145 ? -58.922  -33.074 24.614  1.00 102.20 ?  1619 MET D O   1 
ATOM   7118 C CB  . MET D  1 145 ? -61.895  -31.916 24.719  1.00 105.59 ?  1619 MET D CB  1 
ATOM   7119 C CG  . MET D  1 145 ? -63.038  -31.445 23.852  1.00 101.92 ?  1619 MET D CG  1 
ATOM   7120 S SD  . MET D  1 145 ? -62.555  -31.126 22.140  1.00 101.45 ?  1619 MET D SD  1 
ATOM   7121 C CE  . MET D  1 145 ? -62.069  -29.444 22.282  1.00 114.14 ?  1619 MET D CE  1 
ATOM   7122 N N   . ARG D  1 146 ? -60.126  -34.292 26.115  1.00 103.76 ?  1620 ARG D N   1 
ATOM   7123 C CA  . ARG D  1 146 ? -59.076  -34.773 26.995  1.00 106.16 ?  1620 ARG D CA  1 
ATOM   7124 C C   . ARG D  1 146 ? -58.178  -35.699 26.176  1.00 95.69  ?  1620 ARG D C   1 
ATOM   7125 O O   . ARG D  1 146 ? -56.957  -35.542 26.191  1.00 85.08  ?  1620 ARG D O   1 
ATOM   7126 C CB  . ARG D  1 146 ? -59.738  -35.564 28.137  1.00 117.53 ?  1620 ARG D CB  1 
ATOM   7127 C CG  . ARG D  1 146 ? -59.058  -35.433 29.489  1.00 124.73 ?  1620 ARG D CG  1 
ATOM   7128 C CD  . ARG D  1 146 ? -59.738  -36.280 30.546  1.00 125.17 ?  1620 ARG D CD  1 
ATOM   7129 N NE  . ARG D  1 146 ? -61.025  -35.721 30.964  1.00 130.34 ?  1620 ARG D NE  1 
ATOM   7130 C CZ  . ARG D  1 146 ? -61.865  -36.315 31.808  1.00 161.81 ?  1620 ARG D CZ  1 
ATOM   7131 N NH1 . ARG D  1 146 ? -61.566  -37.499 32.330  1.00 170.71 1  1620 ARG D NH1 1 
ATOM   7132 N NH2 . ARG D  1 146 ? -63.007  -35.728 32.140  1.00 173.51 ?  1620 ARG D NH2 1 
ATOM   7133 N N   . LYS D  1 147 ? -58.811  -36.626 25.420  1.00 95.24  ?  1621 LYS D N   1 
ATOM   7134 C CA  . LYS D  1 147 ? -58.194  -37.640 24.563  1.00 101.06 ?  1621 LYS D CA  1 
ATOM   7135 C C   . LYS D  1 147 ? -57.390  -37.045 23.404  1.00 104.54 ?  1621 LYS D C   1 
ATOM   7136 O O   . LYS D  1 147 ? -56.210  -37.378 23.267  1.00 114.11 ?  1621 LYS D O   1 
ATOM   7137 C CB  . LYS D  1 147 ? -59.275  -38.609 24.038  1.00 105.37 ?  1621 LYS D CB  1 
ATOM   7138 C CG  . LYS D  1 147 ? -58.733  -39.865 23.347  1.00 106.94 ?  1621 LYS D CG  1 
ATOM   7139 C CD  . LYS D  1 147 ? -59.784  -40.564 22.472  1.00 105.93 ?  1621 LYS D CD  1 
ATOM   7140 C CE  . LYS D  1 147 ? -60.684  -41.526 23.220  1.00 104.82 ?  1621 LYS D CE  1 
ATOM   7141 N NZ  . LYS D  1 147 ? -61.648  -42.199 22.308  1.00 107.85 1  1621 LYS D NZ  1 
ATOM   7142 N N   . ILE D  1 148 ? -58.031  -36.179 22.569  1.00 107.60 ?  1622 ILE D N   1 
ATOM   7143 C CA  . ILE D  1 148 ? -57.420  -35.550 21.384  1.00 104.12 ?  1622 ILE D CA  1 
ATOM   7144 C C   . ILE D  1 148 ? -56.195  -34.720 21.765  1.00 98.64  ?  1622 ILE D C   1 
ATOM   7145 O O   . ILE D  1 148 ? -55.246  -34.683 20.985  1.00 101.98 ?  1622 ILE D O   1 
ATOM   7146 C CB  . ILE D  1 148 ? -58.403  -34.752 20.465  1.00 106.72 ?  1622 ILE D CB  1 
ATOM   7147 C CG1 . ILE D  1 148 ? -59.838  -35.311 20.496  1.00 109.27 ?  1622 ILE D CG1 1 
ATOM   7148 C CG2 . ILE D  1 148 ? -57.888  -34.702 19.017  1.00 102.15 ?  1622 ILE D CG2 1 
ATOM   7149 C CD1 . ILE D  1 148 ? -60.917  -34.245 20.525  1.00 111.83 ?  1622 ILE D CD1 1 
ATOM   7150 N N   . VAL D  1 149 ? -56.200  -34.097 22.970  1.00 91.05  ?  1623 VAL D N   1 
ATOM   7151 C CA  . VAL D  1 149 ? -55.085  -33.296 23.500  1.00 86.78  ?  1623 VAL D CA  1 
ATOM   7152 C C   . VAL D  1 149 ? -53.844  -34.172 23.774  1.00 88.21  ?  1623 VAL D C   1 
ATOM   7153 O O   . VAL D  1 149 ? -52.763  -33.869 23.261  1.00 96.09  ?  1623 VAL D O   1 
ATOM   7154 C CB  . VAL D  1 149 ? -55.518  -32.436 24.725  1.00 78.38  ?  1623 VAL D CB  1 
ATOM   7155 C CG1 . VAL D  1 149 ? -54.364  -32.176 25.693  1.00 80.59  ?  1623 VAL D CG1 1 
ATOM   7156 C CG2 . VAL D  1 149 ? -56.127  -31.119 24.270  1.00 80.16  ?  1623 VAL D CG2 1 
ATOM   7157 N N   . SER D  1 150 ? -54.018  -35.268 24.545  1.00 86.50  ?  1624 SER D N   1 
ATOM   7158 C CA  . SER D  1 150 ? -52.942  -36.191 24.907  1.00 88.99  ?  1624 SER D CA  1 
ATOM   7159 C C   . SER D  1 150 ? -52.434  -37.017 23.726  1.00 93.51  ?  1624 SER D C   1 
ATOM   7160 O O   . SER D  1 150 ? -51.262  -37.406 23.718  1.00 109.53 ?  1624 SER D O   1 
ATOM   7161 C CB  . SER D  1 150 ? -53.357  -37.071 26.079  1.00 92.40  ?  1624 SER D CB  1 
ATOM   7162 O OG  . SER D  1 150 ? -53.505  -36.281 27.250  1.00 97.08  ?  1624 SER D OG  1 
ATOM   7163 N N   . ALA D  1 151 ? -53.296  -37.239 22.710  1.00 94.65  ?  1625 ALA D N   1 
ATOM   7164 C CA  . ALA D  1 151 ? -52.935  -37.931 21.469  1.00 99.14  ?  1625 ALA D CA  1 
ATOM   7165 C C   . ALA D  1 151 ? -51.968  -37.047 20.651  1.00 100.10 ?  1625 ALA D C   1 
ATOM   7166 O O   . ALA D  1 151 ? -51.164  -37.571 19.872  1.00 100.84 ?  1625 ALA D O   1 
ATOM   7167 C CB  . ALA D  1 151 ? -54.182  -38.241 20.655  1.00 98.99  ?  1625 ALA D CB  1 
ATOM   7168 N N   . LEU D  1 152 ? -52.049  -35.710 20.847  1.00 96.83  ?  1626 LEU D N   1 
ATOM   7169 C CA  . LEU D  1 152 ? -51.174  -34.729 20.212  1.00 95.54  ?  1626 LEU D CA  1 
ATOM   7170 C C   . LEU D  1 152 ? -49.925  -34.547 21.057  1.00 98.00  ?  1626 LEU D C   1 
ATOM   7171 O O   . LEU D  1 152 ? -48.860  -34.302 20.502  1.00 110.42 ?  1626 LEU D O   1 
ATOM   7172 C CB  . LEU D  1 152 ? -51.868  -33.366 20.043  1.00 95.61  ?  1626 LEU D CB  1 
ATOM   7173 C CG  . LEU D  1 152 ? -53.121  -33.250 19.163  1.00 91.68  ?  1626 LEU D CG  1 
ATOM   7174 C CD1 . LEU D  1 152 ? -53.457  -31.798 18.911  1.00 91.36  ?  1626 LEU D CD1 1 
ATOM   7175 C CD2 . LEU D  1 152 ? -52.972  -33.975 17.843  1.00 89.82  ?  1626 LEU D CD2 1 
ATOM   7176 N N   . ILE D  1 153 ? -50.053  -34.655 22.393  1.00 97.76  ?  1627 ILE D N   1 
ATOM   7177 C CA  . ILE D  1 153 ? -48.938  -34.517 23.335  1.00 99.16  ?  1627 ILE D CA  1 
ATOM   7178 C C   . ILE D  1 153 ? -47.881  -35.619 23.127  1.00 103.64 ?  1627 ILE D C   1 
ATOM   7179 O O   . ILE D  1 153 ? -46.695  -35.303 23.003  1.00 104.79 ?  1627 ILE D O   1 
ATOM   7180 C CB  . ILE D  1 153 ? -49.443  -34.418 24.811  1.00 96.75  ?  1627 ILE D CB  1 
ATOM   7181 C CG1 . ILE D  1 153 ? -50.238  -33.104 25.078  1.00 86.34  ?  1627 ILE D CG1 1 
ATOM   7182 C CG2 . ILE D  1 153 ? -48.323  -34.625 25.854  1.00 98.17  ?  1627 ILE D CG2 1 
ATOM   7183 C CD1 . ILE D  1 153 ? -49.572  -31.758 24.676  1.00 84.95  ?  1627 ILE D CD1 1 
ATOM   7184 N N   . SER D  1 154 ? -48.323  -36.893 23.039  1.00 100.69 ?  1628 SER D N   1 
ATOM   7185 C CA  . SER D  1 154 ? -47.477  -38.080 22.842  1.00 111.71 ?  1628 SER D CA  1 
ATOM   7186 C C   . SER D  1 154 ? -46.554  -38.027 21.600  1.00 110.20 ?  1628 SER D C   1 
ATOM   7187 O O   . SER D  1 154 ? -45.570  -38.771 21.539  1.00 114.05 ?  1628 SER D O   1 
ATOM   7188 C CB  . SER D  1 154 ? -48.336  -39.343 22.815  1.00 119.08 ?  1628 SER D CB  1 
ATOM   7189 O OG  . SER D  1 154 ? -49.320  -39.310 21.794  1.00 118.62 ?  1628 SER D OG  1 
ATOM   7190 N N   . VAL D  1 155 ? -46.869  -37.142 20.633  1.00 107.30 ?  1629 VAL D N   1 
ATOM   7191 C CA  . VAL D  1 155 ? -46.127  -36.943 19.385  1.00 108.28 ?  1629 VAL D CA  1 
ATOM   7192 C C   . VAL D  1 155 ? -44.796  -36.232 19.660  1.00 114.00 ?  1629 VAL D C   1 
ATOM   7193 O O   . VAL D  1 155 ? -43.752  -36.705 19.204  1.00 115.72 ?  1629 VAL D O   1 
ATOM   7194 C CB  . VAL D  1 155 ? -46.979  -36.166 18.337  1.00 110.09 ?  1629 VAL D CB  1 
ATOM   7195 C CG1 . VAL D  1 155 ? -46.258  -36.065 16.996  1.00 109.61 ?  1629 VAL D CG1 1 
ATOM   7196 C CG2 . VAL D  1 155 ? -48.364  -36.787 18.160  1.00 116.97 ?  1629 VAL D CG2 1 
ATOM   7197 N N   . ILE D  1 156 ? -44.854  -35.105 20.420  1.00 114.08 ?  1630 ILE D N   1 
ATOM   7198 C CA  . ILE D  1 156 ? -43.754  -34.193 20.793  1.00 116.59 ?  1630 ILE D CA  1 
ATOM   7199 C C   . ILE D  1 156 ? -42.447  -34.925 21.262  1.00 121.22 ?  1630 ILE D C   1 
ATOM   7200 O O   . ILE D  1 156 ? -41.396  -34.533 20.748  1.00 131.54 ?  1630 ILE D O   1 
ATOM   7201 C CB  . ILE D  1 156 ? -44.206  -33.098 21.812  1.00 106.08 ?  1630 ILE D CB  1 
ATOM   7202 C CG1 . ILE D  1 156 ? -45.528  -32.424 21.362  1.00 101.37 ?  1630 ILE D CG1 1 
ATOM   7203 C CG2 . ILE D  1 156 ? -43.098  -32.044 22.036  1.00 96.39  ?  1630 ILE D CG2 1 
ATOM   7204 C CD1 . ILE D  1 156 ? -46.395  -31.854 22.492  1.00 102.53 ?  1630 ILE D CD1 1 
ATOM   7205 N N   . PRO D  1 157 ? -42.438  -35.962 22.159  1.00 116.91 ?  1631 PRO D N   1 
ATOM   7206 C CA  . PRO D  1 157 ? -41.153  -36.604 22.530  1.00 113.82 ?  1631 PRO D CA  1 
ATOM   7207 C C   . PRO D  1 157 ? -40.246  -37.027 21.359  1.00 119.31 ?  1631 PRO D C   1 
ATOM   7208 O O   . PRO D  1 157 ? -39.031  -36.800 21.420  1.00 117.70 ?  1631 PRO D O   1 
ATOM   7209 C CB  . PRO D  1 157 ? -41.591  -37.802 23.376  1.00 112.35 ?  1631 PRO D CB  1 
ATOM   7210 C CG  . PRO D  1 157 ? -42.880  -37.386 23.962  1.00 117.75 ?  1631 PRO D CG  1 
ATOM   7211 C CD  . PRO D  1 157 ? -43.560  -36.568 22.910  1.00 119.55 ?  1631 PRO D CD  1 
ATOM   7212 N N   . GLY D  1 158 ? -40.844  -37.594 20.303  1.00 121.82 ?  1632 GLY D N   1 
ATOM   7213 C CA  . GLY D  1 158 ? -40.136  -38.013 19.094  1.00 117.41 ?  1632 GLY D CA  1 
ATOM   7214 C C   . GLY D  1 158 ? -39.564  -36.847 18.309  1.00 113.03 ?  1632 GLY D C   1 
ATOM   7215 O O   . GLY D  1 158 ? -38.461  -36.938 17.756  1.00 110.70 ?  1632 GLY D O   1 
ATOM   7216 N N   . MET D  1 159 ? -40.319  -35.731 18.288  1.00 115.06 ?  1633 MET D N   1 
ATOM   7217 C CA  . MET D  1 159 ? -39.999  -34.465 17.622  1.00 117.59 ?  1633 MET D CA  1 
ATOM   7218 C C   . MET D  1 159 ? -38.849  -33.708 18.294  1.00 112.79 ?  1633 MET D C   1 
ATOM   7219 O O   . MET D  1 159 ? -38.103  -33.016 17.598  1.00 101.63 ?  1633 MET D O   1 
ATOM   7220 C CB  . MET D  1 159 ? -41.236  -33.559 17.637  1.00 116.16 ?  1633 MET D CB  1 
ATOM   7221 C CG  . MET D  1 159 ? -42.054  -33.605 16.382  1.00 114.53 ?  1633 MET D CG  1 
ATOM   7222 S SD  . MET D  1 159 ? -43.662  -32.802 16.593  1.00 110.48 ?  1633 MET D SD  1 
ATOM   7223 C CE  . MET D  1 159 ? -43.174  -31.110 16.853  1.00 107.98 ?  1633 MET D CE  1 
ATOM   7224 N N   . LEU D  1 160 ? -38.734  -33.813 19.644  1.00 108.40 ?  1634 LEU D N   1 
ATOM   7225 C CA  . LEU D  1 160 ? -37.757  -33.117 20.500  1.00 105.25 ?  1634 LEU D CA  1 
ATOM   7226 C C   . LEU D  1 160 ? -36.322  -33.105 19.981  1.00 106.38 ?  1634 LEU D C   1 
ATOM   7227 O O   . LEU D  1 160 ? -35.609  -32.122 20.195  1.00 99.67  ?  1634 LEU D O   1 
ATOM   7228 C CB  . LEU D  1 160 ? -37.786  -33.657 21.938  1.00 103.53 ?  1634 LEU D CB  1 
ATOM   7229 C CG  . LEU D  1 160 ? -38.988  -33.255 22.813  1.00 100.39 ?  1634 LEU D CG  1 
ATOM   7230 C CD1 . LEU D  1 160 ? -38.927  -33.948 24.159  1.00 101.65 ?  1634 LEU D CD1 1 
ATOM   7231 C CD2 . LEU D  1 160 ? -39.057  -31.741 23.033  1.00 100.48 ?  1634 LEU D CD2 1 
ATOM   7232 N N   . SER D  1 161 ? -35.908  -34.181 19.301  1.00 100.80 ?  1635 SER D N   1 
ATOM   7233 C CA  . SER D  1 161 ? -34.577  -34.307 18.714  1.00 96.57  ?  1635 SER D CA  1 
ATOM   7234 C C   . SER D  1 161 ? -34.427  -33.298 17.568  1.00 95.92  ?  1635 SER D C   1 
ATOM   7235 O O   . SER D  1 161 ? -33.516  -32.464 17.590  1.00 89.92  ?  1635 SER D O   1 
ATOM   7236 C CB  . SER D  1 161 ? -34.370  -35.726 18.195  1.00 94.78  ?  1635 SER D CB  1 
ATOM   7237 O OG  . SER D  1 161 ? -34.794  -36.707 19.127  1.00 97.54  ?  1635 SER D OG  1 
ATOM   7238 N N   . VAL D  1 162 ? -35.370  -33.354 16.602  1.00 95.44  ?  1636 VAL D N   1 
ATOM   7239 C CA  . VAL D  1 162 ? -35.452  -32.500 15.408  1.00 95.53  ?  1636 VAL D CA  1 
ATOM   7240 C C   . VAL D  1 162 ? -35.580  -31.014 15.787  1.00 95.84  ?  1636 VAL D C   1 
ATOM   7241 O O   . VAL D  1 162 ? -34.930  -30.173 15.158  1.00 90.11  ?  1636 VAL D O   1 
ATOM   7242 C CB  . VAL D  1 162 ? -36.580  -32.941 14.428  1.00 92.35  ?  1636 VAL D CB  1 
ATOM   7243 C CG1 . VAL D  1 162 ? -36.201  -32.633 12.981  1.00 86.63  ?  1636 VAL D CG1 1 
ATOM   7244 C CG2 . VAL D  1 162 ? -36.937  -34.423 14.593  1.00 91.31  ?  1636 VAL D CG2 1 
ATOM   7245 N N   . ILE D  1 163 ? -36.399  -30.706 16.825  1.00 98.73  ?  1637 ILE D N   1 
ATOM   7246 C CA  . ILE D  1 163 ? -36.626  -29.344 17.331  1.00 99.18  ?  1637 ILE D CA  1 
ATOM   7247 C C   . ILE D  1 163 ? -35.312  -28.744 17.850  1.00 96.43  ?  1637 ILE D C   1 
ATOM   7248 O O   . ILE D  1 163 ? -34.923  -27.670 17.393  1.00 84.91  ?  1637 ILE D O   1 
ATOM   7249 C CB  . ILE D  1 163 ? -37.766  -29.274 18.396  1.00 96.10  ?  1637 ILE D CB  1 
ATOM   7250 C CG1 . ILE D  1 163 ? -39.087  -29.855 17.860  1.00 90.88  ?  1637 ILE D CG1 1 
ATOM   7251 C CG2 . ILE D  1 163 ? -37.963  -27.833 18.912  1.00 95.12  ?  1637 ILE D CG2 1 
ATOM   7252 C CD1 . ILE D  1 163 ? -40.066  -30.270 18.927  1.00 90.33  ?  1637 ILE D CD1 1 
ATOM   7253 N N   . ALA D  1 164 ? -34.627  -29.459 18.778  1.00 97.46  ?  1638 ALA D N   1 
ATOM   7254 C CA  . ALA D  1 164 ? -33.356  -29.061 19.391  1.00 95.75  ?  1638 ALA D CA  1 
ATOM   7255 C C   . ALA D  1 164 ? -32.311  -28.660 18.347  1.00 95.54  ?  1638 ALA D C   1 
ATOM   7256 O O   . ALA D  1 164 ? -31.616  -27.658 18.540  1.00 85.33  ?  1638 ALA D O   1 
ATOM   7257 C CB  . ALA D  1 164 ? -32.824  -30.183 20.265  1.00 93.41  ?  1638 ALA D CB  1 
ATOM   7258 N N   . LEU D  1 165 ? -32.235  -29.427 17.229  1.00 96.53  ?  1639 LEU D N   1 
ATOM   7259 C CA  . LEU D  1 165 ? -31.333  -29.185 16.102  1.00 86.62  ?  1639 LEU D CA  1 
ATOM   7260 C C   . LEU D  1 165 ? -31.745  -27.928 15.336  1.00 89.07  ?  1639 LEU D C   1 
ATOM   7261 O O   . LEU D  1 165 ? -30.878  -27.126 14.980  1.00 82.31  ?  1639 LEU D O   1 
ATOM   7262 C CB  . LEU D  1 165 ? -31.296  -30.408 15.164  1.00 81.50  ?  1639 LEU D CB  1 
ATOM   7263 C CG  . LEU D  1 165 ? -30.480  -30.261 13.873  1.00 84.46  ?  1639 LEU D CG  1 
ATOM   7264 C CD1 . LEU D  1 165 ? -29.033  -29.942 14.162  1.00 84.48  ?  1639 LEU D CD1 1 
ATOM   7265 C CD2 . LEU D  1 165 ? -30.574  -31.502 13.026  1.00 94.21  ?  1639 LEU D CD2 1 
ATOM   7266 N N   . MET D  1 166 ? -33.066  -27.774 15.082  1.00 93.68  ?  1640 MET D N   1 
ATOM   7267 C CA  . MET D  1 166 ? -33.687  -26.644 14.382  1.00 91.71  ?  1640 MET D CA  1 
ATOM   7268 C C   . MET D  1 166 ? -33.497  -25.338 15.185  1.00 87.11  ?  1640 MET D C   1 
ATOM   7269 O O   . MET D  1 166 ? -33.310  -24.273 14.595  1.00 80.27  ?  1640 MET D O   1 
ATOM   7270 C CB  . MET D  1 166 ? -35.177  -26.956 14.136  1.00 95.58  ?  1640 MET D CB  1 
ATOM   7271 C CG  . MET D  1 166 ? -35.937  -25.897 13.360  1.00 102.43 ?  1640 MET D CG  1 
ATOM   7272 S SD  . MET D  1 166 ? -35.493  -25.760 11.620  1.00 104.37 ?  1640 MET D SD  1 
ATOM   7273 C CE  . MET D  1 166 ? -37.079  -25.427 10.939  1.00 105.10 ?  1640 MET D CE  1 
ATOM   7274 N N   . THR D  1 167 ? -33.521  -25.442 16.525  1.00 86.92  ?  1641 THR D N   1 
ATOM   7275 C CA  . THR D  1 167 ? -33.322  -24.344 17.471  1.00 86.31  ?  1641 THR D CA  1 
ATOM   7276 C C   . THR D  1 167 ? -31.885  -23.851 17.367  1.00 90.13  ?  1641 THR D C   1 
ATOM   7277 O O   . THR D  1 167 ? -31.656  -22.651 17.244  1.00 89.37  ?  1641 THR D O   1 
ATOM   7278 C CB  . THR D  1 167 ? -33.611  -24.841 18.894  1.00 84.11  ?  1641 THR D CB  1 
ATOM   7279 O OG1 . THR D  1 167 ? -34.906  -25.435 18.926  1.00 86.40  ?  1641 THR D OG1 1 
ATOM   7280 C CG2 . THR D  1 167 ? -33.505  -23.742 19.940  1.00 79.73  ?  1641 THR D CG2 1 
ATOM   7281 N N   . LEU D  1 168 ? -30.925  -24.786 17.423  1.00 86.59  ?  1642 LEU D N   1 
ATOM   7282 C CA  . LEU D  1 168 ? -29.503  -24.492 17.348  1.00 85.69  ?  1642 LEU D CA  1 
ATOM   7283 C C   . LEU D  1 168 ? -29.124  -23.892 16.005  1.00 88.67  ?  1642 LEU D C   1 
ATOM   7284 O O   . LEU D  1 168 ? -28.326  -22.954 15.986  1.00 87.99  ?  1642 LEU D O   1 
ATOM   7285 C CB  . LEU D  1 168 ? -28.678  -25.739 17.644  1.00 87.80  ?  1642 LEU D CB  1 
ATOM   7286 C CG  . LEU D  1 168 ? -27.309  -25.451 18.212  1.00 85.22  ?  1642 LEU D CG  1 
ATOM   7287 C CD1 . LEU D  1 168 ? -27.167  -26.036 19.595  1.00 84.49  ?  1642 LEU D CD1 1 
ATOM   7288 C CD2 . LEU D  1 168 ? -26.238  -25.943 17.290  1.00 81.15  ?  1642 LEU D CD2 1 
ATOM   7289 N N   . PHE D  1 169 ? -29.713  -24.401 14.889  1.00 88.93  ?  1643 PHE D N   1 
ATOM   7290 C CA  . PHE D  1 169 ? -29.476  -23.871 13.542  1.00 91.60  ?  1643 PHE D CA  1 
ATOM   7291 C C   . PHE D  1 169 ? -29.906  -22.412 13.507  1.00 89.41  ?  1643 PHE D C   1 
ATOM   7292 O O   . PHE D  1 169 ? -29.166  -21.569 12.996  1.00 90.01  ?  1643 PHE D O   1 
ATOM   7293 C CB  . PHE D  1 169 ? -30.210  -24.690 12.465  1.00 96.60  ?  1643 PHE D CB  1 
ATOM   7294 C CG  . PHE D  1 169 ? -29.374  -25.783 11.842  1.00 101.91 ?  1643 PHE D CG  1 
ATOM   7295 C CD1 . PHE D  1 169 ? -28.188  -25.485 11.178  1.00 109.74 ?  1643 PHE D CD1 1 
ATOM   7296 C CD2 . PHE D  1 169 ? -29.785  -27.109 11.892  1.00 100.98 ?  1643 PHE D CD2 1 
ATOM   7297 C CE1 . PHE D  1 169 ? -27.411  -26.498 10.609  1.00 113.25 ?  1643 PHE D CE1 1 
ATOM   7298 C CE2 . PHE D  1 169 ? -29.017  -28.117 11.304  1.00 94.06  ?  1643 PHE D CE2 1 
ATOM   7299 C CZ  . PHE D  1 169 ? -27.830  -27.808 10.681  1.00 108.65 ?  1643 PHE D CZ  1 
ATOM   7300 N N   . PHE D  1 170 ? -31.055  -22.111 14.158  1.00 82.82  ?  1644 PHE D N   1 
ATOM   7301 C CA  . PHE D  1 170 ? -31.604  -20.768 14.306  1.00 79.16  ?  1644 PHE D CA  1 
ATOM   7302 C C   . PHE D  1 170 ? -30.610  -19.867 15.006  1.00 80.79  ?  1644 PHE D C   1 
ATOM   7303 O O   . PHE D  1 170 ? -30.389  -18.770 14.506  1.00 71.89  ?  1644 PHE D O   1 
ATOM   7304 C CB  . PHE D  1 170 ? -32.938  -20.784 15.062  1.00 84.21  ?  1644 PHE D CB  1 
ATOM   7305 C CG  . PHE D  1 170 ? -34.143  -20.514 14.200  1.00 78.59  ?  1644 PHE D CG  1 
ATOM   7306 C CD1 . PHE D  1 170 ? -34.847  -21.559 13.614  1.00 75.11  ?  1644 PHE D CD1 1 
ATOM   7307 C CD2 . PHE D  1 170 ? -34.588  -19.215 13.985  1.00 75.62  ?  1644 PHE D CD2 1 
ATOM   7308 C CE1 . PHE D  1 170 ? -35.963  -21.308 12.820  1.00 74.63  ?  1644 PHE D CE1 1 
ATOM   7309 C CE2 . PHE D  1 170 ? -35.708  -18.965 13.192  1.00 77.27  ?  1644 PHE D CE2 1 
ATOM   7310 C CZ  . PHE D  1 170 ? -36.388  -20.013 12.617  1.00 78.58  ?  1644 PHE D CZ  1 
ATOM   7311 N N   . TYR D  1 171 ? -29.968  -20.339 16.117  1.00 87.12  ?  1645 TYR D N   1 
ATOM   7312 C CA  . TYR D  1 171 ? -28.959  -19.569 16.863  1.00 82.05  ?  1645 TYR D CA  1 
ATOM   7313 C C   . TYR D  1 171 ? -27.786  -19.159 15.987  1.00 79.25  ?  1645 TYR D C   1 
ATOM   7314 O O   . TYR D  1 171 ? -27.468  -17.968 15.948  1.00 71.02  ?  1645 TYR D O   1 
ATOM   7315 C CB  . TYR D  1 171 ? -28.456  -20.308 18.110  1.00 74.91  ?  1645 TYR D CB  1 
ATOM   7316 C CG  . TYR D  1 171 ? -29.374  -20.183 19.302  1.00 83.64  ?  1645 TYR D CG  1 
ATOM   7317 C CD1 . TYR D  1 171 ? -29.316  -19.073 20.137  1.00 89.18  ?  1645 TYR D CD1 1 
ATOM   7318 C CD2 . TYR D  1 171 ? -30.285  -21.186 19.611  1.00 89.76  ?  1645 TYR D CD2 1 
ATOM   7319 C CE1 . TYR D  1 171 ? -30.172  -18.948 21.233  1.00 91.93  ?  1645 TYR D CE1 1 
ATOM   7320 C CE2 . TYR D  1 171 ? -31.137  -21.080 20.710  1.00 89.89  ?  1645 TYR D CE2 1 
ATOM   7321 C CZ  . TYR D  1 171 ? -31.076  -19.960 21.522  1.00 90.27  ?  1645 TYR D CZ  1 
ATOM   7322 O OH  . TYR D  1 171 ? -31.912  -19.869 22.612  1.00 86.31  ?  1645 TYR D OH  1 
ATOM   7323 N N   . ILE D  1 172 ? -27.178  -20.131 15.253  1.00 73.41  ?  1646 ILE D N   1 
ATOM   7324 C CA  . ILE D  1 172 ? -26.048  -19.897 14.341  1.00 75.49  ?  1646 ILE D CA  1 
ATOM   7325 C C   . ILE D  1 172 ? -26.427  -18.854 13.297  1.00 72.44  ?  1646 ILE D C   1 
ATOM   7326 O O   . ILE D  1 172 ? -25.725  -17.847 13.164  1.00 71.07  ?  1646 ILE D O   1 
ATOM   7327 C CB  . ILE D  1 172 ? -25.503  -21.212 13.718  1.00 80.69  ?  1646 ILE D CB  1 
ATOM   7328 C CG1 . ILE D  1 172 ? -24.921  -22.130 14.812  1.00 87.78  ?  1646 ILE D CG1 1 
ATOM   7329 C CG2 . ILE D  1 172 ? -24.450  -20.931 12.623  1.00 82.28  ?  1646 ILE D CG2 1 
ATOM   7330 C CD1 . ILE D  1 172 ? -25.211  -23.596 14.614  1.00 93.15  ?  1646 ILE D CD1 1 
ATOM   7331 N N   . PHE D  1 173 ? -27.578  -19.060 12.626  1.00 72.29  ?  1647 PHE D N   1 
ATOM   7332 C CA  . PHE D  1 173 ? -28.102  -18.139 11.623  1.00 74.19  ?  1647 PHE D CA  1 
ATOM   7333 C C   . PHE D  1 173 ? -28.437  -16.769 12.219  1.00 69.35  ?  1647 PHE D C   1 
ATOM   7334 O O   . PHE D  1 173 ? -28.267  -15.763 11.527  1.00 55.10  ?  1647 PHE D O   1 
ATOM   7335 C CB  . PHE D  1 173 ? -29.319  -18.739 10.907  1.00 80.94  ?  1647 PHE D CB  1 
ATOM   7336 C CG  . PHE D  1 173 ? -29.012  -19.825 9.901   1.00 83.06  ?  1647 PHE D CG  1 
ATOM   7337 C CD1 . PHE D  1 173 ? -28.360  -19.528 8.709   1.00 82.41  ?  1647 PHE D CD1 1 
ATOM   7338 C CD2 . PHE D  1 173 ? -29.443  -21.130 10.109  1.00 80.57  ?  1647 PHE D CD2 1 
ATOM   7339 C CE1 . PHE D  1 173 ? -28.097  -20.527 7.771   1.00 81.22  ?  1647 PHE D CE1 1 
ATOM   7340 C CE2 . PHE D  1 173 ? -29.185  -22.128 9.169   1.00 81.10  ?  1647 PHE D CE2 1 
ATOM   7341 C CZ  . PHE D  1 173 ? -28.514  -21.820 8.006   1.00 81.72  ?  1647 PHE D CZ  1 
ATOM   7342 N N   . ALA D  1 174 ? -28.873  -16.732 13.509  1.00 71.98  ?  1648 ALA D N   1 
ATOM   7343 C CA  . ALA D  1 174 ? -29.223  -15.512 14.255  1.00 80.91  ?  1648 ALA D CA  1 
ATOM   7344 C C   . ALA D  1 174 ? -27.998  -14.683 14.625  1.00 91.89  ?  1648 ALA D C   1 
ATOM   7345 O O   . ALA D  1 174 ? -28.027  -13.455 14.461  1.00 90.83  ?  1648 ALA D O   1 
ATOM   7346 C CB  . ALA D  1 174 ? -30.022  -15.854 15.500  1.00 82.74  ?  1648 ALA D CB  1 
ATOM   7347 N N   . ILE D  1 175 ? -26.922  -15.356 15.116  1.00 83.16  ?  1649 ILE D N   1 
ATOM   7348 C CA  . ILE D  1 175 ? -25.648  -14.728 15.481  1.00 78.70  ?  1649 ILE D CA  1 
ATOM   7349 C C   . ILE D  1 175 ? -25.003  -14.147 14.206  1.00 71.76  ?  1649 ILE D C   1 
ATOM   7350 O O   . ILE D  1 175 ? -24.402  -13.065 14.247  1.00 71.46  ?  1649 ILE D O   1 
ATOM   7351 C CB  . ILE D  1 175 ? -24.710  -15.703 16.261  1.00 80.12  ?  1649 ILE D CB  1 
ATOM   7352 C CG1 . ILE D  1 175 ? -25.390  -16.209 17.558  1.00 91.37  ?  1649 ILE D CG1 1 
ATOM   7353 C CG2 . ILE D  1 175 ? -23.376  -15.020 16.611  1.00 84.51  ?  1649 ILE D CG2 1 
ATOM   7354 C CD1 . ILE D  1 175 ? -24.860  -17.540 18.140  1.00 96.17  ?  1649 ILE D CD1 1 
ATOM   7355 N N   . MET D  1 176 ? -25.187  -14.843 13.075  1.00 64.19  ?  1650 MET D N   1 
ATOM   7356 C CA  . MET D  1 176 ? -24.668  -14.427 11.780  1.00 68.66  ?  1650 MET D CA  1 
ATOM   7357 C C   . MET D  1 176 ? -25.375  -13.194 11.241  1.00 70.57  ?  1650 MET D C   1 
ATOM   7358 O O   . MET D  1 176 ? -24.708  -12.268 10.782  1.00 64.53  ?  1650 MET D O   1 
ATOM   7359 C CB  . MET D  1 176 ? -24.786  -15.570 10.779  1.00 73.16  ?  1650 MET D CB  1 
ATOM   7360 C CG  . MET D  1 176 ? -23.694  -16.577 10.892  1.00 79.88  ?  1650 MET D CG  1 
ATOM   7361 S SD  . MET D  1 176 ? -24.208  -18.120 10.131  1.00 96.40  ?  1650 MET D SD  1 
ATOM   7362 C CE  . MET D  1 176 ? -23.878  -17.763 8.401   1.00 98.44  ?  1650 MET D CE  1 
ATOM   7363 N N   . ALA D  1 177 ? -26.719  -13.193 11.291  1.00 80.44  ?  1651 ALA D N   1 
ATOM   7364 C CA  . ALA D  1 177 ? -27.576  -12.115 10.802  1.00 82.85  ?  1651 ALA D CA  1 
ATOM   7365 C C   . ALA D  1 177 ? -27.258  -10.748 11.427  1.00 82.55  ?  1651 ALA D C   1 
ATOM   7366 O O   . ALA D  1 177 ? -27.212  -9.743  10.709  1.00 64.69  ?  1651 ALA D O   1 
ATOM   7367 C CB  . ALA D  1 177 ? -29.030  -12.477 11.020  1.00 88.38  ?  1651 ALA D CB  1 
ATOM   7368 N N   . THR D  1 178 ? -27.008  -10.725 12.758  1.00 90.24  ?  1652 THR D N   1 
ATOM   7369 C CA  . THR D  1 178 ? -26.643  -9.524  13.522  1.00 99.85  ?  1652 THR D CA  1 
ATOM   7370 C C   . THR D  1 178 ? -25.282  -9.015  13.040  1.00 101.21 ?  1652 THR D C   1 
ATOM   7371 O O   . THR D  1 178 ? -25.118  -7.830  12.765  1.00 108.80 ?  1652 THR D O   1 
ATOM   7372 C CB  . THR D  1 178 ? -26.565  -9.825  15.047  1.00 106.49 ?  1652 THR D CB  1 
ATOM   7373 O OG1 . THR D  1 178 ? -25.526  -10.772 15.313  1.00 113.69 ?  1652 THR D OG1 1 
ATOM   7374 C CG2 . THR D  1 178 ? -27.862  -10.321 15.630  1.00 105.27 ?  1652 THR D CG2 1 
ATOM   7375 N N   . GLN D  1 179 ? -24.310  -9.935  12.951  1.00 95.99  ?  1653 GLN D N   1 
ATOM   7376 C CA  . GLN D  1 179 ? -22.932  -9.697  12.552  1.00 99.14  ?  1653 GLN D CA  1 
ATOM   7377 C C   . GLN D  1 179 ? -22.827  -9.163  11.124  1.00 102.64 ?  1653 GLN D C   1 
ATOM   7378 O O   . GLN D  1 179 ? -22.023  -8.262  10.870  1.00 114.78 ?  1653 GLN D O   1 
ATOM   7379 C CB  . GLN D  1 179 ? -22.158  -11.004 12.693  1.00 96.25  ?  1653 GLN D CB  1 
ATOM   7380 C CG  . GLN D  1 179 ? -20.670  -10.886 12.457  1.00 88.63  ?  1653 GLN D CG  1 
ATOM   7381 C CD  . GLN D  1 179 ? -20.169  -12.149 11.822  1.00 85.62  ?  1653 GLN D CD  1 
ATOM   7382 O OE1 . GLN D  1 179 ? -20.164  -13.232 12.439  1.00 67.21  ?  1653 GLN D OE1 1 
ATOM   7383 N NE2 . GLN D  1 179 ? -19.778  -12.043 10.556  1.00 85.57  ?  1653 GLN D NE2 1 
ATOM   7384 N N   . LEU D  1 180 ? -23.638  -9.718  10.205  1.00 92.88  ?  1654 LEU D N   1 
ATOM   7385 C CA  . LEU D  1 180 ? -23.660  -9.350  8.790   1.00 91.06  ?  1654 LEU D CA  1 
ATOM   7386 C C   . LEU D  1 180 ? -24.512  -8.114  8.491   1.00 97.16  ?  1654 LEU D C   1 
ATOM   7387 O O   . LEU D  1 180 ? -24.005  -7.130  7.938   1.00 97.89  ?  1654 LEU D O   1 
ATOM   7388 C CB  . LEU D  1 180 ? -24.160  -10.539 7.948   1.00 88.51  ?  1654 LEU D CB  1 
ATOM   7389 C CG  . LEU D  1 180 ? -23.197  -11.694 7.743   1.00 90.05  ?  1654 LEU D CG  1 
ATOM   7390 C CD1 . LEU D  1 180 ? -23.945  -12.994 7.582   1.00 92.25  ?  1654 LEU D CD1 1 
ATOM   7391 C CD2 . LEU D  1 180 ? -22.302  -11.444 6.547   1.00 90.95  ?  1654 LEU D CD2 1 
ATOM   7392 N N   . PHE D  1 181 ? -25.813  -8.181  8.842   1.00 89.73  ?  1655 PHE D N   1 
ATOM   7393 C CA  . PHE D  1 181 ? -26.792  -7.138  8.540   1.00 83.69  ?  1655 PHE D CA  1 
ATOM   7394 C C   . PHE D  1 181 ? -27.442  -6.471  9.750   1.00 77.85  ?  1655 PHE D C   1 
ATOM   7395 O O   . PHE D  1 181 ? -28.423  -5.750  9.575   1.00 84.14  ?  1655 PHE D O   1 
ATOM   7396 C CB  . PHE D  1 181 ? -27.888  -7.678  7.598   1.00 87.97  ?  1655 PHE D CB  1 
ATOM   7397 C CG  . PHE D  1 181 ? -27.735  -9.097  7.100   1.00 94.20  ?  1655 PHE D CG  1 
ATOM   7398 C CD1 . PHE D  1 181 ? -27.053  -9.367  5.920   1.00 94.23  ?  1655 PHE D CD1 1 
ATOM   7399 C CD2 . PHE D  1 181 ? -28.314  -10.157 7.785   1.00 100.81 ?  1655 PHE D CD2 1 
ATOM   7400 C CE1 . PHE D  1 181 ? -26.934  -10.675 5.448   1.00 96.27  ?  1655 PHE D CE1 1 
ATOM   7401 C CE2 . PHE D  1 181 ? -28.182  -11.465 7.321   1.00 104.59 ?  1655 PHE D CE2 1 
ATOM   7402 C CZ  . PHE D  1 181 ? -27.498  -11.716 6.153   1.00 101.73 ?  1655 PHE D CZ  1 
ATOM   7403 N N   . GLY D  1 182 ? -26.910  -6.692  10.946  1.00 76.22  ?  1656 GLY D N   1 
ATOM   7404 C CA  . GLY D  1 182 ? -27.459  -6.075  12.150  1.00 85.42  ?  1656 GLY D CA  1 
ATOM   7405 C C   . GLY D  1 182 ? -27.163  -4.593  12.280  1.00 87.46  ?  1656 GLY D C   1 
ATOM   7406 O O   . GLY D  1 182 ? -27.919  -3.856  12.924  1.00 80.02  ?  1656 GLY D O   1 
ATOM   7407 N N   . GLU D  1 183 ? -26.060  -4.153  11.640  1.00 94.72  ?  1657 GLU D N   1 
ATOM   7408 C CA  . GLU D  1 183 ? -25.566  -2.778  11.659  1.00 108.17 ?  1657 GLU D CA  1 
ATOM   7409 C C   . GLU D  1 183 ? -26.441  -1.844  10.828  1.00 96.59  ?  1657 GLU D C   1 
ATOM   7410 O O   . GLU D  1 183 ? -27.166  -1.041  11.407  1.00 88.41  ?  1657 GLU D O   1 
ATOM   7411 C CB  . GLU D  1 183 ? -24.083  -2.711  11.221  1.00 130.59 ?  1657 GLU D CB  1 
ATOM   7412 C CG  . GLU D  1 183 ? -23.129  -3.550  12.067  1.00 137.67 ?  1657 GLU D CG  1 
ATOM   7413 C CD  . GLU D  1 183 ? -22.351  -4.633  11.335  1.00 140.57 ?  1657 GLU D CD  1 
ATOM   7414 O OE1 . GLU D  1 183 ? -22.944  -5.330  10.479  1.00 138.89 ?  1657 GLU D OE1 1 
ATOM   7415 O OE2 . GLU D  1 183 ? -21.153  -4.811  11.654  1.00 145.73 -1 1657 GLU D OE2 1 
ATOM   7416 N N   . ARG D  1 184 ? -26.391  -1.968  9.485   1.00 101.68 ?  1658 ARG D N   1 
ATOM   7417 C CA  . ARG D  1 184 ? -27.127  -1.133  8.526   1.00 113.56 ?  1658 ARG D CA  1 
ATOM   7418 C C   . ARG D  1 184 ? -28.644  -1.355  8.538   1.00 117.86 ?  1658 ARG D C   1 
ATOM   7419 O O   . ARG D  1 184 ? -29.391  -0.438  8.188   1.00 124.92 ?  1658 ARG D O   1 
ATOM   7420 C CB  . ARG D  1 184 ? -26.561  -1.293  7.104   1.00 121.07 ?  1658 ARG D CB  1 
ATOM   7421 C CG  . ARG D  1 184 ? -25.064  -0.979  6.981   1.00 132.26 ?  1658 ARG D CG  1 
ATOM   7422 C CD  . ARG D  1 184 ? -24.775  0.488   6.716   1.00 136.34 ?  1658 ARG D CD  1 
ATOM   7423 N NE  . ARG D  1 184 ? -24.520  0.756   5.298   1.00 133.99 ?  1658 ARG D NE  1 
ATOM   7424 C CZ  . ARG D  1 184 ? -25.459  1.060   4.408   1.00 132.92 ?  1658 ARG D CZ  1 
ATOM   7425 N NH1 . ARG D  1 184 ? -26.733  1.131   4.774   1.00 124.31 1  1658 ARG D NH1 1 
ATOM   7426 N NH2 . ARG D  1 184 ? -25.132  1.291   3.144   1.00 137.06 ?  1658 ARG D NH2 1 
ATOM   7427 N N   . PHE D  1 185 ? -29.096  -2.556  8.947   1.00 113.11 ?  1659 PHE D N   1 
ATOM   7428 C CA  . PHE D  1 185 ? -30.515  -2.904  9.060   1.00 98.02  ?  1659 PHE D CA  1 
ATOM   7429 C C   . PHE D  1 185 ? -30.852  -3.313  10.517  1.00 90.47  ?  1659 PHE D C   1 
ATOM   7430 O O   . PHE D  1 185 ? -31.032  -4.510  10.790  1.00 82.05  ?  1659 PHE D O   1 
ATOM   7431 C CB  . PHE D  1 185 ? -30.885  -4.028  8.077   1.00 101.59 ?  1659 PHE D CB  1 
ATOM   7432 C CG  . PHE D  1 185 ? -30.969  -3.648  6.621   1.00 103.76 ?  1659 PHE D CG  1 
ATOM   7433 C CD1 . PHE D  1 185 ? -32.144  -3.132  6.088   1.00 108.11 ?  1659 PHE D CD1 1 
ATOM   7434 C CD2 . PHE D  1 185 ? -29.901  -3.874  5.766   1.00 103.26 ?  1659 PHE D CD2 1 
ATOM   7435 C CE1 . PHE D  1 185 ? -32.235  -2.813  4.731   1.00 110.82 ?  1659 PHE D CE1 1 
ATOM   7436 C CE2 . PHE D  1 185 ? -29.995  -3.564  4.410   1.00 107.46 ?  1659 PHE D CE2 1 
ATOM   7437 C CZ  . PHE D  1 185 ? -31.160  -3.029  3.902   1.00 104.64 ?  1659 PHE D CZ  1 
ATOM   7438 N N   . PRO D  1 186 ? -30.918  -2.360  11.482  1.00 84.41  ?  1660 PRO D N   1 
ATOM   7439 C CA  . PRO D  1 186 ? -31.204  -2.756  12.872  1.00 93.00  ?  1660 PRO D CA  1 
ATOM   7440 C C   . PRO D  1 186 ? -32.671  -3.043  13.164  1.00 93.01  ?  1660 PRO D C   1 
ATOM   7441 O O   . PRO D  1 186 ? -32.977  -3.685  14.176  1.00 80.21  ?  1660 PRO D O   1 
ATOM   7442 C CB  . PRO D  1 186 ? -30.675  -1.586  13.708  1.00 98.16  ?  1660 PRO D CB  1 
ATOM   7443 C CG  . PRO D  1 186 ? -30.235  -0.538  12.731  1.00 98.65  ?  1660 PRO D CG  1 
ATOM   7444 C CD  . PRO D  1 186 ? -30.736  -0.901  11.380  1.00 88.30  ?  1660 PRO D CD  1 
ATOM   7445 N N   . GLU D  1 187 ? -33.572  -2.578  12.269  1.00 98.65  ?  1661 GLU D N   1 
ATOM   7446 C CA  . GLU D  1 187 ? -35.029  -2.735  12.365  1.00 102.01 ?  1661 GLU D CA  1 
ATOM   7447 C C   . GLU D  1 187 ? -35.446  -4.204  12.364  1.00 96.42  ?  1661 GLU D C   1 
ATOM   7448 O O   . GLU D  1 187 ? -36.461  -4.556  12.966  1.00 103.37 ?  1661 GLU D O   1 
ATOM   7449 C CB  . GLU D  1 187 ? -35.765  -1.986  11.229  1.00 110.21 ?  1661 GLU D CB  1 
ATOM   7450 C CG  . GLU D  1 187 ? -34.997  -0.858  10.554  1.00 113.91 ?  1661 GLU D CG  1 
ATOM   7451 C CD  . GLU D  1 187 ? -34.325  -1.221  9.242   1.00 125.96 ?  1661 GLU D CD  1 
ATOM   7452 O OE1 . GLU D  1 187 ? -34.996  -1.813  8.365   1.00 130.34 ?  1661 GLU D OE1 1 
ATOM   7453 O OE2 . GLU D  1 187 ? -33.146  -0.840  9.060   1.00 130.40 -1 1661 GLU D OE2 1 
ATOM   7454 N N   . TRP D  1 188 ? -34.659  -5.049  11.672  1.00 92.50  ?  1662 TRP D N   1 
ATOM   7455 C CA  . TRP D  1 188 ? -34.885  -6.484  11.531  1.00 92.38  ?  1662 TRP D CA  1 
ATOM   7456 C C   . TRP D  1 188 ? -33.757  -7.326  12.134  1.00 93.02  ?  1662 TRP D C   1 
ATOM   7457 O O   . TRP D  1 188 ? -34.003  -8.480  12.478  1.00 81.37  ?  1662 TRP D O   1 
ATOM   7458 C CB  . TRP D  1 188 ? -35.014  -6.861  10.040  1.00 88.50  ?  1662 TRP D CB  1 
ATOM   7459 C CG  . TRP D  1 188 ? -36.037  -6.105  9.241   1.00 86.65  ?  1662 TRP D CG  1 
ATOM   7460 C CD1 . TRP D  1 188 ? -37.325  -5.827  9.600   1.00 77.48  ?  1662 TRP D CD1 1 
ATOM   7461 C CD2 . TRP D  1 188 ? -35.895  -5.666  7.885   1.00 85.26  ?  1662 TRP D CD2 1 
ATOM   7462 N NE1 . TRP D  1 188 ? -37.975  -5.186  8.571   1.00 71.79  ?  1662 TRP D NE1 1 
ATOM   7463 C CE2 . TRP D  1 188 ? -37.124  -5.084  7.501   1.00 75.20  ?  1662 TRP D CE2 1 
ATOM   7464 C CE3 . TRP D  1 188 ? -34.839  -5.691  6.958   1.00 92.55  ?  1662 TRP D CE3 1 
ATOM   7465 C CZ2 . TRP D  1 188 ? -37.326  -4.532  6.230   1.00 80.49  ?  1662 TRP D CZ2 1 
ATOM   7466 C CZ3 . TRP D  1 188 ? -35.040  -5.143  5.701   1.00 99.18  ?  1662 TRP D CZ3 1 
ATOM   7467 C CH2 . TRP D  1 188 ? -36.268  -4.564  5.350   1.00 92.49  ?  1662 TRP D CH2 1 
ATOM   7468 N N   . PHE D  1 189 ? -32.519  -6.782  12.237  1.00 99.52  ?  1663 PHE D N   1 
ATOM   7469 C CA  . PHE D  1 189 ? -31.392  -7.595  12.697  1.00 88.74  ?  1663 PHE D CA  1 
ATOM   7470 C C   . PHE D  1 189 ? -30.450  -6.993  13.778  1.00 84.09  ?  1663 PHE D C   1 
ATOM   7471 O O   . PHE D  1 189 ? -29.461  -7.643  14.115  1.00 85.52  ?  1663 PHE D O   1 
ATOM   7472 C CB  . PHE D  1 189 ? -30.550  -8.028  11.475  1.00 84.01  ?  1663 PHE D CB  1 
ATOM   7473 C CG  . PHE D  1 189 ? -31.265  -8.883  10.446  1.00 77.21  ?  1663 PHE D CG  1 
ATOM   7474 C CD1 . PHE D  1 189 ? -31.647  -10.186 10.743  1.00 73.14  ?  1663 PHE D CD1 1 
ATOM   7475 C CD2 . PHE D  1 189 ? -31.529  -8.393  9.174   1.00 80.39  ?  1663 PHE D CD2 1 
ATOM   7476 C CE1 . PHE D  1 189 ? -32.292  -10.976 9.792   1.00 80.23  ?  1663 PHE D CE1 1 
ATOM   7477 C CE2 . PHE D  1 189 ? -32.181  -9.185  8.226   1.00 81.61  ?  1663 PHE D CE2 1 
ATOM   7478 C CZ  . PHE D  1 189 ? -32.556  -10.471 8.541   1.00 82.19  ?  1663 PHE D CZ  1 
ATOM   7479 N N   . GLY D  1 190 ? -30.771  -5.825  14.331  1.00 79.49  ?  1664 GLY D N   1 
ATOM   7480 C CA  . GLY D  1 190 ? -29.961  -5.148  15.349  1.00 79.71  ?  1664 GLY D CA  1 
ATOM   7481 C C   . GLY D  1 190 ? -29.559  -5.963  16.569  1.00 81.55  ?  1664 GLY D C   1 
ATOM   7482 O O   . GLY D  1 190 ? -28.382  -5.978  16.940  1.00 86.24  ?  1664 GLY D O   1 
ATOM   7483 N N   . THR D  1 191 ? -30.539  -6.632  17.205  1.00 80.89  ?  1665 THR D N   1 
ATOM   7484 C CA  . THR D  1 191 ? -30.378  -7.497  18.389  1.00 81.00  ?  1665 THR D CA  1 
ATOM   7485 C C   . THR D  1 191 ? -30.340  -8.958  17.909  1.00 80.99  ?  1665 THR D C   1 
ATOM   7486 O O   . THR D  1 191 ? -30.661  -9.222  16.748  1.00 87.94  ?  1665 THR D O   1 
ATOM   7487 C CB  . THR D  1 191 ? -31.606  -7.317  19.331  1.00 87.58  ?  1665 THR D CB  1 
ATOM   7488 O OG1 . THR D  1 191 ? -32.021  -5.949  19.368  1.00 97.36  ?  1665 THR D OG1 1 
ATOM   7489 C CG2 . THR D  1 191 ? -31.380  -7.860  20.743  1.00 85.66  ?  1665 THR D CG2 1 
ATOM   7490 N N   . LEU D  1 192 ? -29.983  -9.908  18.803  1.00 85.85  ?  1666 LEU D N   1 
ATOM   7491 C CA  . LEU D  1 192 ? -30.009  -11.340 18.495  1.00 93.94  ?  1666 LEU D CA  1 
ATOM   7492 C C   . LEU D  1 192 ? -31.473  -11.760 18.349  1.00 100.00 ?  1666 LEU D C   1 
ATOM   7493 O O   . LEU D  1 192 ? -31.816  -12.393 17.356  1.00 101.50 ?  1666 LEU D O   1 
ATOM   7494 C CB  . LEU D  1 192 ? -29.301  -12.180 19.582  1.00 99.40  ?  1666 LEU D CB  1 
ATOM   7495 C CG  . LEU D  1 192 ? -29.485  -13.709 19.504  1.00 102.07 ?  1666 LEU D CG  1 
ATOM   7496 C CD1 . LEU D  1 192 ? -28.397  -14.363 18.679  1.00 107.70 ?  1666 LEU D CD1 1 
ATOM   7497 C CD2 . LEU D  1 192 ? -29.554  -14.318 20.881  1.00 102.33 ?  1666 LEU D CD2 1 
ATOM   7498 N N   . GLY D  1 193 ? -32.310  -11.370 19.315  1.00 98.36  ?  1667 GLY D N   1 
ATOM   7499 C CA  . GLY D  1 193 ? -33.739  -11.662 19.305  1.00 97.32  ?  1667 GLY D CA  1 
ATOM   7500 C C   . GLY D  1 193 ? -34.472  -11.002 18.152  1.00 102.09 ?  1667 GLY D C   1 
ATOM   7501 O O   . GLY D  1 193 ? -35.428  -11.573 17.616  1.00 108.86 ?  1667 GLY D O   1 
ATOM   7502 N N   . GLU D  1 194 ? -34.018  -9.782  17.769  1.00 102.45 ?  1668 GLU D N   1 
ATOM   7503 C CA  . GLU D  1 194 ? -34.525  -8.985  16.644  1.00 102.89 ?  1668 GLU D CA  1 
ATOM   7504 C C   . GLU D  1 194 ? -34.259  -9.766  15.344  1.00 94.23  ?  1668 GLU D C   1 
ATOM   7505 O O   . GLU D  1 194 ? -35.132  -9.814  14.472  1.00 89.25  ?  1668 GLU D O   1 
ATOM   7506 C CB  . GLU D  1 194 ? -33.835  -7.606  16.627  1.00 108.44 ?  1668 GLU D CB  1 
ATOM   7507 C CG  . GLU D  1 194 ? -34.205  -6.686  15.480  1.00 117.83 ?  1668 GLU D CG  1 
ATOM   7508 C CD  . GLU D  1 194 ? -35.429  -5.828  15.712  1.00 130.96 ?  1668 GLU D CD  1 
ATOM   7509 O OE1 . GLU D  1 194 ? -35.279  -4.731  16.295  1.00 123.26 ?  1668 GLU D OE1 1 
ATOM   7510 O OE2 . GLU D  1 194 ? -36.537  -6.248  15.307  1.00 141.65 -1 1668 GLU D OE2 1 
ATOM   7511 N N   . SER D  1 195 ? -33.063  -10.404 15.251  1.00 86.33  ?  1669 SER D N   1 
ATOM   7512 C CA  . SER D  1 195 ? -32.639  -11.256 14.144  1.00 80.64  ?  1669 SER D CA  1 
ATOM   7513 C C   . SER D  1 195 ? -33.414  -12.557 14.182  1.00 78.52  ?  1669 SER D C   1 
ATOM   7514 O O   . SER D  1 195 ? -33.878  -12.993 13.140  1.00 74.48  ?  1669 SER D O   1 
ATOM   7515 C CB  . SER D  1 195 ? -31.149  -11.556 14.229  1.00 85.80  ?  1669 SER D CB  1 
ATOM   7516 O OG  . SER D  1 195 ? -30.387  -10.443 13.804  1.00 84.08  ?  1669 SER D OG  1 
ATOM   7517 N N   . PHE D  1 196 ? -33.584  -13.164 15.378  1.00 81.53  ?  1670 PHE D N   1 
ATOM   7518 C CA  . PHE D  1 196 ? -34.334  -14.407 15.594  1.00 88.71  ?  1670 PHE D CA  1 
ATOM   7519 C C   . PHE D  1 196 ? -35.752  -14.298 15.028  1.00 90.07  ?  1670 PHE D C   1 
ATOM   7520 O O   . PHE D  1 196 ? -36.216  -15.224 14.358  1.00 84.40  ?  1670 PHE D O   1 
ATOM   7521 C CB  . PHE D  1 196 ? -34.389  -14.753 17.092  1.00 91.45  ?  1670 PHE D CB  1 
ATOM   7522 C CG  . PHE D  1 196 ? -33.778  -16.084 17.457  1.00 92.17  ?  1670 PHE D CG  1 
ATOM   7523 C CD1 . PHE D  1 196 ? -32.470  -16.163 17.916  1.00 91.74  ?  1670 PHE D CD1 1 
ATOM   7524 C CD2 . PHE D  1 196 ? -34.520  -17.257 17.370  1.00 89.24  ?  1670 PHE D CD2 1 
ATOM   7525 C CE1 . PHE D  1 196 ? -31.903  -17.396 18.252  1.00 90.12  ?  1670 PHE D CE1 1 
ATOM   7526 C CE2 . PHE D  1 196 ? -33.956  -18.490 17.714  1.00 90.24  ?  1670 PHE D CE2 1 
ATOM   7527 C CZ  . PHE D  1 196 ? -32.650  -18.552 18.150  1.00 89.45  ?  1670 PHE D CZ  1 
ATOM   7528 N N   . TYR D  1 197 ? -36.407  -13.137 15.252  1.00 94.93  ?  1671 TYR D N   1 
ATOM   7529 C CA  . TYR D  1 197 ? -37.754  -12.829 14.773  1.00 104.47 ?  1671 TYR D CA  1 
ATOM   7530 C C   . TYR D  1 197 ? -37.846  -12.843 13.245  1.00 101.22 ?  1671 TYR D C   1 
ATOM   7531 O O   . TYR D  1 197 ? -38.736  -13.504 12.702  1.00 106.32 ?  1671 TYR D O   1 
ATOM   7532 C CB  . TYR D  1 197 ? -38.256  -11.487 15.342  1.00 105.78 ?  1671 TYR D CB  1 
ATOM   7533 C CG  . TYR D  1 197 ? -39.680  -11.171 14.941  1.00 98.75  ?  1671 TYR D CG  1 
ATOM   7534 C CD1 . TYR D  1 197 ? -40.757  -11.694 15.650  1.00 89.14  ?  1671 TYR D CD1 1 
ATOM   7535 C CD2 . TYR D  1 197 ? -39.953  -10.372 13.836  1.00 94.27  ?  1671 TYR D CD2 1 
ATOM   7536 C CE1 . TYR D  1 197 ? -42.071  -11.423 15.274  1.00 89.51  ?  1671 TYR D CE1 1 
ATOM   7537 C CE2 . TYR D  1 197 ? -41.262  -10.102 13.444  1.00 101.79 ?  1671 TYR D CE2 1 
ATOM   7538 C CZ  . TYR D  1 197 ? -42.319  -10.628 14.168  1.00 96.89  ?  1671 TYR D CZ  1 
ATOM   7539 O OH  . TYR D  1 197 ? -43.612  -10.368 13.789  1.00 93.54  ?  1671 TYR D OH  1 
ATOM   7540 N N   . THR D  1 198 ? -36.947  -12.108 12.560  1.00 87.42  ?  1672 THR D N   1 
ATOM   7541 C CA  . THR D  1 198 ? -36.913  -12.024 11.098  1.00 85.96  ?  1672 THR D CA  1 
ATOM   7542 C C   . THR D  1 198 ? -36.613  -13.387 10.480  1.00 81.24  ?  1672 THR D C   1 
ATOM   7543 O O   . THR D  1 198 ? -37.169  -13.705 9.431   1.00 84.11  ?  1672 THR D O   1 
ATOM   7544 C CB  . THR D  1 198 ? -35.952  -10.933 10.631  1.00 86.68  ?  1672 THR D CB  1 
ATOM   7545 O OG1 . THR D  1 198 ? -36.107  -9.798  11.478  1.00 94.77  ?  1672 THR D OG1 1 
ATOM   7546 C CG2 . THR D  1 198 ? -36.191  -10.524 9.192   1.00 83.99  ?  1672 THR D CG2 1 
ATOM   7547 N N   . LEU D  1 199 ? -35.782  -14.209 11.146  1.00 82.97  ?  1673 LEU D N   1 
ATOM   7548 C CA  . LEU D  1 199 ? -35.456  -15.546 10.656  1.00 87.82  ?  1673 LEU D CA  1 
ATOM   7549 C C   . LEU D  1 199 ? -36.667  -16.443 10.738  1.00 79.40  ?  1673 LEU D C   1 
ATOM   7550 O O   . LEU D  1 199 ? -36.828  -17.304 9.875   1.00 82.00  ?  1673 LEU D O   1 
ATOM   7551 C CB  . LEU D  1 199 ? -34.266  -16.169 11.386  1.00 92.86  ?  1673 LEU D CB  1 
ATOM   7552 C CG  . LEU D  1 199 ? -32.924  -15.499 11.179  1.00 81.05  ?  1673 LEU D CG  1 
ATOM   7553 C CD1 . LEU D  1 199 ? -32.035  -15.796 12.311  1.00 84.23  ?  1673 LEU D CD1 1 
ATOM   7554 C CD2 . LEU D  1 199 ? -32.278  -15.898 9.866   1.00 77.10  ?  1673 LEU D CD2 1 
ATOM   7555 N N   . PHE D  1 200 ? -37.539  -16.223 11.745  1.00 74.04  ?  1674 PHE D N   1 
ATOM   7556 C CA  . PHE D  1 200 ? -38.783  -16.972 11.862  1.00 76.55  ?  1674 PHE D CA  1 
ATOM   7557 C C   . PHE D  1 200 ? -39.752  -16.498 10.777  1.00 72.34  ?  1674 PHE D C   1 
ATOM   7558 O O   . PHE D  1 200 ? -40.418  -17.324 10.159  1.00 64.97  ?  1674 PHE D O   1 
ATOM   7559 C CB  . PHE D  1 200 ? -39.411  -16.843 13.255  1.00 74.99  ?  1674 PHE D CB  1 
ATOM   7560 C CG  . PHE D  1 200 ? -40.674  -17.661 13.408  1.00 80.88  ?  1674 PHE D CG  1 
ATOM   7561 C CD1 . PHE D  1 200 ? -40.613  -19.031 13.637  1.00 87.88  ?  1674 PHE D CD1 1 
ATOM   7562 C CD2 . PHE D  1 200 ? -41.928  -17.066 13.296  1.00 93.59  ?  1674 PHE D CD2 1 
ATOM   7563 C CE1 . PHE D  1 200 ? -41.783  -19.791 13.752  1.00 102.32 ?  1674 PHE D CE1 1 
ATOM   7564 C CE2 . PHE D  1 200 ? -43.098  -17.826 13.424  1.00 101.80 ?  1674 PHE D CE2 1 
ATOM   7565 C CZ  . PHE D  1 200 ? -43.017  -19.181 13.658  1.00 109.58 ?  1674 PHE D CZ  1 
ATOM   7566 N N   . GLN D  1 201 ? -39.804  -15.182 10.528  1.00 70.15  ?  1675 GLN D N   1 
ATOM   7567 C CA  . GLN D  1 201 ? -40.645  -14.592 9.492   1.00 67.59  ?  1675 GLN D CA  1 
ATOM   7568 C C   . GLN D  1 201 ? -40.249  -15.107 8.103   1.00 68.11  ?  1675 GLN D C   1 
ATOM   7569 O O   . GLN D  1 201 ? -41.127  -15.414 7.300   1.00 76.01  ?  1675 GLN D O   1 
ATOM   7570 C CB  . GLN D  1 201 ? -40.555  -13.070 9.546   1.00 63.36  ?  1675 GLN D CB  1 
ATOM   7571 C CG  . GLN D  1 201 ? -41.673  -12.383 8.782   1.00 60.87  ?  1675 GLN D CG  1 
ATOM   7572 C CD  . GLN D  1 201 ? -41.336  -10.961 8.465   1.00 62.88  ?  1675 GLN D CD  1 
ATOM   7573 O OE1 . GLN D  1 201 ? -41.191  -10.593 7.298   1.00 65.71  ?  1675 GLN D OE1 1 
ATOM   7574 N NE2 . GLN D  1 201 ? -41.178  -10.136 9.490   1.00 60.02  ?  1675 GLN D NE2 1 
ATOM   7575 N N   . VAL D  1 202 ? -38.933  -15.214 7.837   1.00 72.00  ?  1676 VAL D N   1 
ATOM   7576 C CA  . VAL D  1 202 ? -38.362  -15.745 6.593   1.00 78.26  ?  1676 VAL D CA  1 
ATOM   7577 C C   . VAL D  1 202 ? -38.653  -17.273 6.496   1.00 80.37  ?  1676 VAL D C   1 
ATOM   7578 O O   . VAL D  1 202 ? -38.911  -17.770 5.396   1.00 81.31  ?  1676 VAL D O   1 
ATOM   7579 C CB  . VAL D  1 202 ? -36.852  -15.375 6.472   1.00 78.71  ?  1676 VAL D CB  1 
ATOM   7580 C CG1 . VAL D  1 202 ? -36.113  -16.263 5.483   1.00 76.75  ?  1676 VAL D CG1 1 
ATOM   7581 C CG2 . VAL D  1 202 ? -36.680  -13.913 6.090   1.00 84.46  ?  1676 VAL D CG2 1 
ATOM   7582 N N   . MET D  1 203 ? -38.653  -17.995 7.653   1.00 82.55  ?  1677 MET D N   1 
ATOM   7583 C CA  . MET D  1 203 ? -38.949  -19.431 7.731   1.00 81.38  ?  1677 MET D CA  1 
ATOM   7584 C C   . MET D  1 203 ? -40.396  -19.707 7.337   1.00 79.62  ?  1677 MET D C   1 
ATOM   7585 O O   . MET D  1 203 ? -40.623  -20.562 6.486   1.00 83.74  ?  1677 MET D O   1 
ATOM   7586 C CB  . MET D  1 203 ? -38.587  -20.025 9.107   1.00 80.35  ?  1677 MET D CB  1 
ATOM   7587 C CG  . MET D  1 203 ? -39.328  -21.308 9.440   1.00 79.16  ?  1677 MET D CG  1 
ATOM   7588 S SD  . MET D  1 203 ? -38.701  -22.134 10.907  1.00 87.64  ?  1677 MET D SD  1 
ATOM   7589 C CE  . MET D  1 203 ? -40.147  -22.963 11.453  1.00 95.15  ?  1677 MET D CE  1 
ATOM   7590 N N   . THR D  1 204 ? -41.362  -18.955 7.899   1.00 85.37  ?  1678 THR D N   1 
ATOM   7591 C CA  . THR D  1 204 ? -42.783  -19.103 7.552   1.00 85.93  ?  1678 THR D CA  1 
ATOM   7592 C C   . THR D  1 204 ? -43.032  -18.621 6.111   1.00 84.41  ?  1678 THR D C   1 
ATOM   7593 O O   . THR D  1 204 ? -44.167  -18.684 5.629   1.00 80.72  ?  1678 THR D O   1 
ATOM   7594 C CB  . THR D  1 204 ? -43.687  -18.385 8.561   1.00 87.13  ?  1678 THR D CB  1 
ATOM   7595 O OG1 . THR D  1 204 ? -43.311  -17.010 8.621   1.00 79.88  ?  1678 THR D OG1 1 
ATOM   7596 C CG2 . THR D  1 204 ? -43.658  -19.020 9.944   1.00 92.75  ?  1678 THR D CG2 1 
ATOM   7597 N N   . LEU D  1 205 ? -41.949  -18.148 5.432   1.00 84.55  ?  1679 LEU D N   1 
ATOM   7598 C CA  . LEU D  1 205 ? -41.870  -17.651 4.049   1.00 74.84  ?  1679 LEU D CA  1 
ATOM   7599 C C   . LEU D  1 205 ? -42.669  -16.358 3.820   1.00 73.58  ?  1679 LEU D C   1 
ATOM   7600 O O   . LEU D  1 205 ? -42.819  -15.898 2.683   1.00 73.82  ?  1679 LEU D O   1 
ATOM   7601 C CB  . LEU D  1 205 ? -42.250  -18.749 3.044   1.00 68.57  ?  1679 LEU D CB  1 
ATOM   7602 C CG  . LEU D  1 205 ? -41.321  -19.932 3.040   1.00 63.14  ?  1679 LEU D CG  1 
ATOM   7603 C CD1 . LEU D  1 205 ? -42.089  -21.223 3.037   1.00 66.85  ?  1679 LEU D CD1 1 
ATOM   7604 C CD2 . LEU D  1 205 ? -40.352  -19.845 1.909   1.00 61.63  ?  1679 LEU D CD2 1 
ATOM   7605 N N   . GLU D  1 206 ? -43.126  -15.748 4.918   1.00 74.98  ?  1680 GLU D N   1 
ATOM   7606 C CA  . GLU D  1 206 ? -43.925  -14.535 4.916   1.00 84.44  ?  1680 GLU D CA  1 
ATOM   7607 C C   . GLU D  1 206 ? -43.103  -13.299 4.517   1.00 89.72  ?  1680 GLU D C   1 
ATOM   7608 O O   . GLU D  1 206 ? -42.232  -12.856 5.272   1.00 91.74  ?  1680 GLU D O   1 
ATOM   7609 C CB  . GLU D  1 206 ? -44.604  -14.365 6.279   1.00 84.46  ?  1680 GLU D CB  1 
ATOM   7610 C CG  . GLU D  1 206 ? -45.837  -13.492 6.223   1.00 83.75  ?  1680 GLU D CG  1 
ATOM   7611 C CD  . GLU D  1 206 ? -45.542  -12.013 6.327   1.00 78.63  ?  1680 GLU D CD  1 
ATOM   7612 O OE1 . GLU D  1 206 ? -45.323  -11.530 7.461   1.00 60.79  ?  1680 GLU D OE1 1 
ATOM   7613 O OE2 . GLU D  1 206 ? -45.541  -11.334 5.276   1.00 71.17  -1 1680 GLU D OE2 1 
ATOM   7614 N N   . SER D  1 207 ? -43.390  -12.759 3.311   1.00 92.21  ?  1681 SER D N   1 
ATOM   7615 C CA  . SER D  1 207 ? -42.740  -11.590 2.700   1.00 94.12  ?  1681 SER D CA  1 
ATOM   7616 C C   . SER D  1 207 ? -41.201  -11.628 2.752   1.00 86.50  ?  1681 SER D C   1 
ATOM   7617 O O   . SER D  1 207 ? -40.569  -10.569 2.771   1.00 72.46  ?  1681 SER D O   1 
ATOM   7618 C CB  . SER D  1 207 ? -43.280  -10.289 3.287   1.00 92.84  ?  1681 SER D CB  1 
ATOM   7619 O OG  . SER D  1 207 ? -44.670  -10.144 3.043   1.00 79.78  ?  1681 SER D OG  1 
ATOM   7620 N N   . TRP D  1 208 ? -40.606  -12.845 2.747   1.00 82.57  ?  1682 TRP D N   1 
ATOM   7621 C CA  . TRP D  1 208 ? -39.160  -13.035 2.834   1.00 84.15  ?  1682 TRP D CA  1 
ATOM   7622 C C   . TRP D  1 208 ? -38.380  -12.320 1.726   1.00 81.02  ?  1682 TRP D C   1 
ATOM   7623 O O   . TRP D  1 208 ? -37.301  -11.823 2.010   1.00 92.21  ?  1682 TRP D O   1 
ATOM   7624 C CB  . TRP D  1 208 ? -38.758  -14.531 2.928   1.00 83.52  ?  1682 TRP D CB  1 
ATOM   7625 C CG  . TRP D  1 208 ? -38.899  -15.310 1.649   1.00 79.66  ?  1682 TRP D CG  1 
ATOM   7626 C CD1 . TRP D  1 208 ? -39.951  -16.093 1.286   1.00 82.30  ?  1682 TRP D CD1 1 
ATOM   7627 C CD2 . TRP D  1 208 ? -37.956  -15.377 0.567   1.00 78.32  ?  1682 TRP D CD2 1 
ATOM   7628 N NE1 . TRP D  1 208 ? -39.746  -16.607 0.028   1.00 85.00  ?  1682 TRP D NE1 1 
ATOM   7629 C CE2 . TRP D  1 208 ? -38.532  -16.179 -0.440  1.00 85.11  ?  1682 TRP D CE2 1 
ATOM   7630 C CE3 . TRP D  1 208 ? -36.691  -14.812 0.336   1.00 81.64  ?  1682 TRP D CE3 1 
ATOM   7631 C CZ2 . TRP D  1 208 ? -37.887  -16.432 -1.656  1.00 87.45  ?  1682 TRP D CZ2 1 
ATOM   7632 C CZ3 . TRP D  1 208 ? -36.061  -15.050 -0.875  1.00 85.74  ?  1682 TRP D CZ3 1 
ATOM   7633 C CH2 . TRP D  1 208 ? -36.651  -15.860 -1.850  1.00 83.76  ?  1682 TRP D CH2 1 
ATOM   7634 N N   . SER D  1 209 ? -38.908  -12.256 0.486   1.00 69.76  ?  1683 SER D N   1 
ATOM   7635 C CA  . SER D  1 209 ? -38.186  -11.653 -0.634  1.00 61.71  ?  1683 SER D CA  1 
ATOM   7636 C C   . SER D  1 209 ? -38.518  -10.204 -0.893  1.00 63.82  ?  1683 SER D C   1 
ATOM   7637 O O   . SER D  1 209 ? -37.619  -9.383  -0.842  1.00 74.54  ?  1683 SER D O   1 
ATOM   7638 C CB  . SER D  1 209 ? -38.369  -12.473 -1.900  1.00 56.06  ?  1683 SER D CB  1 
ATOM   7639 O OG  . SER D  1 209 ? -37.637  -11.930 -2.985  1.00 48.61  ?  1683 SER D OG  1 
ATOM   7640 N N   . MET D  1 210 ? -39.782  -9.881  -1.180  1.00 68.53  ?  1684 MET D N   1 
ATOM   7641 C CA  . MET D  1 210 ? -40.224  -8.513  -1.478  1.00 73.43  ?  1684 MET D CA  1 
ATOM   7642 C C   . MET D  1 210 ? -39.998  -7.518  -0.314  1.00 66.90  ?  1684 MET D C   1 
ATOM   7643 O O   . MET D  1 210 ? -39.585  -6.369  -0.542  1.00 61.09  ?  1684 MET D O   1 
ATOM   7644 C CB  . MET D  1 210 ? -41.705  -8.503  -1.911  1.00 79.32  ?  1684 MET D CB  1 
ATOM   7645 C CG  . MET D  1 210 ? -41.998  -9.308  -3.161  1.00 82.58  ?  1684 MET D CG  1 
ATOM   7646 S SD  . MET D  1 210 ? -41.136  -8.783  -4.664  1.00 93.77  ?  1684 MET D SD  1 
ATOM   7647 C CE  . MET D  1 210 ? -42.188  -7.456  -5.192  1.00 96.74  ?  1684 MET D CE  1 
ATOM   7648 N N   . GLY D  1 211 ? -40.277  -7.991  0.905   1.00 61.29  ?  1685 GLY D N   1 
ATOM   7649 C CA  . GLY D  1 211 ? -40.191  -7.219  2.134   1.00 63.77  ?  1685 GLY D CA  1 
ATOM   7650 C C   . GLY D  1 211 ? -38.905  -7.311  2.926   1.00 76.04  ?  1685 GLY D C   1 
ATOM   7651 O O   . GLY D  1 211 ? -38.650  -6.405  3.721   1.00 78.52  ?  1685 GLY D O   1 
ATOM   7652 N N   . ILE D  1 212 ? -38.088  -8.388  2.755   1.00 84.95  ?  1686 ILE D N   1 
ATOM   7653 C CA  . ILE D  1 212 ? -36.848  -8.538  3.540   1.00 78.46  ?  1686 ILE D CA  1 
ATOM   7654 C C   . ILE D  1 212 ? -35.575  -8.717  2.686   1.00 70.92  ?  1686 ILE D C   1 
ATOM   7655 O O   . ILE D  1 212 ? -34.695  -7.871  2.800   1.00 73.08  ?  1686 ILE D O   1 
ATOM   7656 C CB  . ILE D  1 212 ? -36.920  -9.644  4.647   1.00 76.29  ?  1686 ILE D CB  1 
ATOM   7657 C CG1 . ILE D  1 212 ? -38.196  -9.531  5.549   1.00 73.46  ?  1686 ILE D CG1 1 
ATOM   7658 C CG2 . ILE D  1 212 ? -35.629  -9.706  5.491   1.00 76.98  ?  1686 ILE D CG2 1 
ATOM   7659 C CD1 . ILE D  1 212 ? -38.336  -8.356  6.512   1.00 69.32  ?  1686 ILE D CD1 1 
ATOM   7660 N N   . VAL D  1 213 ? -35.448  -9.810  1.889   1.00 74.18  ?  1687 VAL D N   1 
ATOM   7661 C CA  . VAL D  1 213 ? -34.224  -10.149 1.128   1.00 82.41  ?  1687 VAL D CA  1 
ATOM   7662 C C   . VAL D  1 213 ? -33.952  -9.185  -0.053  1.00 82.60  ?  1687 VAL D C   1 
ATOM   7663 O O   . VAL D  1 213 ? -32.822  -8.710  -0.146  1.00 92.22  ?  1687 VAL D O   1 
ATOM   7664 C CB  . VAL D  1 213 ? -34.129  -11.639 0.693   1.00 84.66  ?  1687 VAL D CB  1 
ATOM   7665 C CG1 . VAL D  1 213 ? -32.752  -11.961 0.119   1.00 90.96  ?  1687 VAL D CG1 1 
ATOM   7666 C CG2 . VAL D  1 213 ? -34.416  -12.567 1.862   1.00 88.51  ?  1687 VAL D CG2 1 
ATOM   7667 N N   . ARG D  1 214 ? -34.938  -8.900  -0.939  1.00 79.40  ?  1688 ARG D N   1 
ATOM   7668 C CA  . ARG D  1 214 ? -34.754  -7.946  -2.051  1.00 81.31  ?  1688 ARG D CA  1 
ATOM   7669 C C   . ARG D  1 214 ? -34.319  -6.546  -1.543  1.00 79.03  ?  1688 ARG D C   1 
ATOM   7670 O O   . ARG D  1 214 ? -33.323  -6.039  -2.068  1.00 82.56  ?  1688 ARG D O   1 
ATOM   7671 C CB  . ARG D  1 214 ? -35.982  -7.854  -2.978  1.00 91.20  ?  1688 ARG D CB  1 
ATOM   7672 C CG  . ARG D  1 214 ? -36.225  -9.087  -3.827  1.00 95.32  ?  1688 ARG D CG  1 
ATOM   7673 C CD  . ARG D  1 214 ? -37.402  -8.915  -4.767  1.00 95.34  ?  1688 ARG D CD  1 
ATOM   7674 N NE  . ARG D  1 214 ? -36.999  -9.063  -6.169  1.00 104.36 ?  1688 ARG D NE  1 
ATOM   7675 C CZ  . ARG D  1 214 ? -37.135  -10.177 -6.884  1.00 118.83 ?  1688 ARG D CZ  1 
ATOM   7676 N NH1 . ARG D  1 214 ? -37.680  -11.258 -6.346  1.00 115.07 1  1688 ARG D NH1 1 
ATOM   7677 N NH2 . ARG D  1 214 ? -36.724  -10.217 -8.143  1.00 132.75 ?  1688 ARG D NH2 1 
ATOM   7678 N N   . PRO D  1 215 ? -34.954  -5.938  -0.491  1.00 78.46  ?  1689 PRO D N   1 
ATOM   7679 C CA  . PRO D  1 215 ? -34.469  -4.632  -0.006  1.00 84.89  ?  1689 PRO D CA  1 
ATOM   7680 C C   . PRO D  1 215 ? -33.098  -4.696  0.673   1.00 81.75  ?  1689 PRO D C   1 
ATOM   7681 O O   . PRO D  1 215 ? -32.389  -3.688  0.697   1.00 81.97  ?  1689 PRO D O   1 
ATOM   7682 C CB  . PRO D  1 215 ? -35.558  -4.187  0.973   1.00 83.38  ?  1689 PRO D CB  1 
ATOM   7683 C CG  . PRO D  1 215 ? -36.178  -5.422  1.435   1.00 77.18  ?  1689 PRO D CG  1 
ATOM   7684 C CD  . PRO D  1 215 ? -36.155  -6.355  0.268   1.00 75.50  ?  1689 PRO D CD  1 
ATOM   7685 N N   . LEU D  1 216 ? -32.727  -5.878  1.215   1.00 80.42  ?  1690 LEU D N   1 
ATOM   7686 C CA  . LEU D  1 216 ? -31.429  -6.140  1.850   1.00 80.44  ?  1690 LEU D CA  1 
ATOM   7687 C C   . LEU D  1 216 ? -30.316  -6.152  0.793   1.00 86.80  ?  1690 LEU D C   1 
ATOM   7688 O O   . LEU D  1 216 ? -29.154  -5.876  1.102   1.00 89.03  ?  1690 LEU D O   1 
ATOM   7689 C CB  . LEU D  1 216 ? -31.465  -7.505  2.549   1.00 75.56  ?  1690 LEU D CB  1 
ATOM   7690 C CG  . LEU D  1 216 ? -31.275  -7.505  4.047   1.00 79.58  ?  1690 LEU D CG  1 
ATOM   7691 C CD1 . LEU D  1 216 ? -32.055  -8.621  4.687   1.00 85.21  ?  1690 LEU D CD1 1 
ATOM   7692 C CD2 . LEU D  1 216 ? -29.826  -7.630  4.393   1.00 80.74  ?  1690 LEU D CD2 1 
ATOM   7693 N N   . MET D  1 217 ? -30.694  -6.478  -0.455  1.00 89.48  ?  1691 MET D N   1 
ATOM   7694 C CA  . MET D  1 217 ? -29.803  -6.581  -1.605  1.00 89.55  ?  1691 MET D CA  1 
ATOM   7695 C C   . MET D  1 217 ? -29.564  -5.253  -2.296  1.00 94.52  ?  1691 MET D C   1 
ATOM   7696 O O   . MET D  1 217 ? -28.766  -5.182  -3.233  1.00 104.53 ?  1691 MET D O   1 
ATOM   7697 C CB  . MET D  1 217 ? -30.274  -7.663  -2.576  1.00 79.08  ?  1691 MET D CB  1 
ATOM   7698 C CG  . MET D  1 217 ? -30.150  -9.042  -1.979  1.00 77.41  ?  1691 MET D CG  1 
ATOM   7699 S SD  . MET D  1 217 ? -30.394  -10.371 -3.143  1.00 80.33  ?  1691 MET D SD  1 
ATOM   7700 C CE  . MET D  1 217 ? -32.091  -10.157 -3.544  1.00 97.18  ?  1691 MET D CE  1 
ATOM   7701 N N   . GLU D  1 218 ? -30.214  -4.193  -1.812  1.00 94.42  ?  1692 GLU D N   1 
ATOM   7702 C CA  . GLU D  1 218 ? -29.972  -2.848  -2.307  1.00 101.97 ?  1692 GLU D CA  1 
ATOM   7703 C C   . GLU D  1 218 ? -28.642  -2.445  -1.672  1.00 99.51  ?  1692 GLU D C   1 
ATOM   7704 O O   . GLU D  1 218 ? -27.732  -2.002  -2.365  1.00 101.17 ?  1692 GLU D O   1 
ATOM   7705 C CB  . GLU D  1 218 ? -31.106  -1.888  -1.893  1.00 107.08 ?  1692 GLU D CB  1 
ATOM   7706 C CG  . GLU D  1 218 ? -32.420  -2.117  -2.624  1.00 107.38 ?  1692 GLU D CG  1 
ATOM   7707 C CD  . GLU D  1 218 ? -32.324  -2.263  -4.132  1.00 107.10 ?  1692 GLU D CD  1 
ATOM   7708 O OE1 . GLU D  1 218 ? -31.838  -1.322  -4.803  1.00 107.60 ?  1692 GLU D OE1 1 
ATOM   7709 O OE2 . GLU D  1 218 ? -32.718  -3.336  -4.641  1.00 97.71  -1 1692 GLU D OE2 1 
ATOM   7710 N N   . VAL D  1 219 ? -28.508  -2.721  -0.368  1.00 94.01  ?  1693 VAL D N   1 
ATOM   7711 C CA  . VAL D  1 219 ? -27.320  -2.450  0.429   1.00 92.31  ?  1693 VAL D CA  1 
ATOM   7712 C C   . VAL D  1 219 ? -26.278  -3.550  0.191   1.00 92.17  ?  1693 VAL D C   1 
ATOM   7713 O O   . VAL D  1 219 ? -25.138  -3.232  -0.154  1.00 102.70 ?  1693 VAL D O   1 
ATOM   7714 C CB  . VAL D  1 219 ? -27.707  -2.289  1.919   1.00 94.56  ?  1693 VAL D CB  1 
ATOM   7715 C CG1 . VAL D  1 219 ? -26.486  -2.038  2.794   1.00 96.71  ?  1693 VAL D CG1 1 
ATOM   7716 C CG2 . VAL D  1 219 ? -28.722  -1.166  2.092   1.00 99.78  ?  1693 VAL D CG2 1 
ATOM   7717 N N   . TYR D  1 220 ? -26.673  -4.833  0.356   1.00 87.79  ?  1694 TYR D N   1 
ATOM   7718 C CA  . TYR D  1 220 ? -25.779  -5.979  0.161   1.00 86.99  ?  1694 TYR D CA  1 
ATOM   7719 C C   . TYR D  1 220 ? -26.230  -6.821  -1.047  1.00 82.32  ?  1694 TYR D C   1 
ATOM   7720 O O   . TYR D  1 220 ? -27.082  -7.694  -0.879  1.00 75.47  ?  1694 TYR D O   1 
ATOM   7721 C CB  . TYR D  1 220 ? -25.698  -6.853  1.428   1.00 86.10  ?  1694 TYR D CB  1 
ATOM   7722 C CG  . TYR D  1 220 ? -25.584  -6.119  2.749   1.00 79.52  ?  1694 TYR D CG  1 
ATOM   7723 C CD1 . TYR D  1 220 ? -24.571  -5.192  2.970   1.00 80.20  ?  1694 TYR D CD1 1 
ATOM   7724 C CD2 . TYR D  1 220 ? -26.420  -6.433  3.815   1.00 85.07  ?  1694 TYR D CD2 1 
ATOM   7725 C CE1 . TYR D  1 220 ? -24.429  -4.553  4.204   1.00 87.60  ?  1694 TYR D CE1 1 
ATOM   7726 C CE2 . TYR D  1 220 ? -26.295  -5.794  5.049   1.00 82.73  ?  1694 TYR D CE2 1 
ATOM   7727 C CZ  . TYR D  1 220 ? -25.294  -4.858  5.242   1.00 81.62  ?  1694 TYR D CZ  1 
ATOM   7728 O OH  . TYR D  1 220 ? -25.150  -4.254  6.469   1.00 82.22  ?  1694 TYR D OH  1 
ATOM   7729 N N   . PRO D  1 221 ? -25.657  -6.598  -2.262  1.00 82.17  ?  1695 PRO D N   1 
ATOM   7730 C CA  . PRO D  1 221 ? -26.111  -7.348  -3.460  1.00 82.58  ?  1695 PRO D CA  1 
ATOM   7731 C C   . PRO D  1 221 ? -26.067  -8.885  -3.410  1.00 76.32  ?  1695 PRO D C   1 
ATOM   7732 O O   . PRO D  1 221 ? -26.817  -9.527  -4.150  1.00 63.35  ?  1695 PRO D O   1 
ATOM   7733 C CB  . PRO D  1 221 ? -25.201  -6.819  -4.580  1.00 91.64  ?  1695 PRO D CB  1 
ATOM   7734 C CG  . PRO D  1 221 ? -24.057  -6.133  -3.884  1.00 91.26  ?  1695 PRO D CG  1 
ATOM   7735 C CD  . PRO D  1 221 ? -24.649  -5.580  -2.627  1.00 87.43  ?  1695 PRO D CD  1 
ATOM   7736 N N   . TYR D  1 222 ? -25.192  -9.468  -2.571  1.00 81.15  ?  1696 TYR D N   1 
ATOM   7737 C CA  . TYR D  1 222 ? -25.029  -10.914 -2.444  1.00 88.06  ?  1696 TYR D CA  1 
ATOM   7738 C C   . TYR D  1 222 ? -25.531  -11.412 -1.098  1.00 87.11  ?  1696 TYR D C   1 
ATOM   7739 O O   . TYR D  1 222 ? -24.918  -12.277 -0.487  1.00 93.00  ?  1696 TYR D O   1 
ATOM   7740 C CB  . TYR D  1 222 ? -23.573  -11.344 -2.755  1.00 91.90  ?  1696 TYR D CB  1 
ATOM   7741 C CG  . TYR D  1 222 ? -23.183  -11.089 -4.199  1.00 89.94  ?  1696 TYR D CG  1 
ATOM   7742 C CD1 . TYR D  1 222 ? -23.510  -12.000 -5.203  1.00 85.08  ?  1696 TYR D CD1 1 
ATOM   7743 C CD2 . TYR D  1 222 ? -22.549  -9.906  -4.574  1.00 87.96  ?  1696 TYR D CD2 1 
ATOM   7744 C CE1 . TYR D  1 222 ? -23.213  -11.741 -6.542  1.00 86.33  ?  1696 TYR D CE1 1 
ATOM   7745 C CE2 . TYR D  1 222 ? -22.245  -9.637  -5.910  1.00 87.11  ?  1696 TYR D CE2 1 
ATOM   7746 C CZ  . TYR D  1 222 ? -22.576  -10.560 -6.892  1.00 90.21  ?  1696 TYR D CZ  1 
ATOM   7747 O OH  . TYR D  1 222 ? -22.276  -10.303 -8.211  1.00 103.72 ?  1696 TYR D OH  1 
ATOM   7748 N N   . ALA D  1 223 ? -26.669  -10.864 -0.646  1.00 91.18  ?  1697 ALA D N   1 
ATOM   7749 C CA  . ALA D  1 223 ? -27.314  -11.235 0.614   1.00 87.89  ?  1697 ALA D CA  1 
ATOM   7750 C C   . ALA D  1 223 ? -28.124  -12.520 0.468   1.00 86.29  ?  1697 ALA D C   1 
ATOM   7751 O O   . ALA D  1 223 ? -28.306  -13.237 1.455   1.00 75.39  ?  1697 ALA D O   1 
ATOM   7752 C CB  . ALA D  1 223 ? -28.211  -10.108 1.096   1.00 87.13  ?  1697 ALA D CB  1 
ATOM   7753 N N   . TRP D  1 224 ? -28.601  -12.810 -0.768  1.00 94.09  ?  1698 TRP D N   1 
ATOM   7754 C CA  . TRP D  1 224 ? -29.398  -13.989 -1.144  1.00 98.58  ?  1698 TRP D CA  1 
ATOM   7755 C C   . TRP D  1 224 ? -28.685  -15.305 -0.837  1.00 103.41 ?  1698 TRP D C   1 
ATOM   7756 O O   . TRP D  1 224 ? -29.344  -16.326 -0.617  1.00 93.23  ?  1698 TRP D O   1 
ATOM   7757 C CB  . TRP D  1 224 ? -29.770  -13.929 -2.633  1.00 97.75  ?  1698 TRP D CB  1 
ATOM   7758 C CG  . TRP D  1 224 ? -28.586  -13.976 -3.554  1.00 110.66 ?  1698 TRP D CG  1 
ATOM   7759 C CD1 . TRP D  1 224 ? -27.872  -12.916 -4.030  1.00 115.94 ?  1698 TRP D CD1 1 
ATOM   7760 C CD2 . TRP D  1 224 ? -27.943  -15.153 -4.058  1.00 104.40 ?  1698 TRP D CD2 1 
ATOM   7761 N NE1 . TRP D  1 224 ? -26.843  -13.358 -4.829  1.00 107.07 ?  1698 TRP D NE1 1 
ATOM   7762 C CE2 . TRP D  1 224 ? -26.858  -14.729 -4.856  1.00 101.03 ?  1698 TRP D CE2 1 
ATOM   7763 C CE3 . TRP D  1 224 ? -28.179  -16.535 -3.914  1.00 94.08  ?  1698 TRP D CE3 1 
ATOM   7764 C CZ2 . TRP D  1 224 ? -26.015  -15.633 -5.510  1.00 88.29  ?  1698 TRP D CZ2 1 
ATOM   7765 C CZ3 . TRP D  1 224 ? -27.348  -17.429 -4.565  1.00 86.57  ?  1698 TRP D CZ3 1 
ATOM   7766 C CH2 . TRP D  1 224 ? -26.282  -16.979 -5.353  1.00 85.47  ?  1698 TRP D CH2 1 
ATOM   7767 N N   . VAL D  1 225 ? -27.332  -15.278 -0.850  1.00 97.11  ?  1699 VAL D N   1 
ATOM   7768 C CA  . VAL D  1 225 ? -26.473  -16.425 -0.572  1.00 86.55  ?  1699 VAL D CA  1 
ATOM   7769 C C   . VAL D  1 225 ? -26.454  -16.747 0.960   1.00 81.55  ?  1699 VAL D C   1 
ATOM   7770 O O   . VAL D  1 225 ? -25.739  -17.658 1.390   1.00 66.04  ?  1699 VAL D O   1 
ATOM   7771 C CB  . VAL D  1 225 ? -25.073  -16.268 -1.227  1.00 83.34  ?  1699 VAL D CB  1 
ATOM   7772 C CG1 . VAL D  1 225 ? -24.100  -15.493 -0.348  1.00 86.55  ?  1699 VAL D CG1 1 
ATOM   7773 C CG2 . VAL D  1 225 ? -24.498  -17.618 -1.618  1.00 85.72  ?  1699 VAL D CG2 1 
ATOM   7774 N N   . PHE D  1 226 ? -27.276  -16.019 1.766   1.00 78.62  ?  1700 PHE D N   1 
ATOM   7775 C CA  . PHE D  1 226 ? -27.481  -16.276 3.192   1.00 77.31  ?  1700 PHE D CA  1 
ATOM   7776 C C   . PHE D  1 226 ? -28.901  -16.800 3.381   1.00 80.08  ?  1700 PHE D C   1 
ATOM   7777 O O   . PHE D  1 226 ? -29.101  -17.789 4.089   1.00 80.99  ?  1700 PHE D O   1 
ATOM   7778 C CB  . PHE D  1 226 ? -27.268  -15.024 4.079   1.00 74.11  ?  1700 PHE D CB  1 
ATOM   7779 C CG  . PHE D  1 226 ? -27.504  -15.274 5.564   1.00 75.21  ?  1700 PHE D CG  1 
ATOM   7780 C CD1 . PHE D  1 226 ? -28.794  -15.272 6.096   1.00 83.52  ?  1700 PHE D CD1 1 
ATOM   7781 C CD2 . PHE D  1 226 ? -26.442  -15.522 6.425   1.00 76.71  ?  1700 PHE D CD2 1 
ATOM   7782 C CE1 . PHE D  1 226 ? -29.013  -15.540 7.452   1.00 89.10  ?  1700 PHE D CE1 1 
ATOM   7783 C CE2 . PHE D  1 226 ? -26.664  -15.769 7.783   1.00 78.62  ?  1700 PHE D CE2 1 
ATOM   7784 C CZ  . PHE D  1 226 ? -27.945  -15.780 8.286   1.00 83.26  ?  1700 PHE D CZ  1 
ATOM   7785 N N   . PHE D  1 227 ? -29.885  -16.119 2.774   1.00 85.54  ?  1701 PHE D N   1 
ATOM   7786 C CA  . PHE D  1 227 ? -31.289  -16.429 2.970   1.00 93.20  ?  1701 PHE D CA  1 
ATOM   7787 C C   . PHE D  1 227 ? -31.785  -17.639 2.189   1.00 97.20  ?  1701 PHE D C   1 
ATOM   7788 O O   . PHE D  1 227 ? -32.484  -18.444 2.798   1.00 83.96  ?  1701 PHE D O   1 
ATOM   7789 C CB  . PHE D  1 227 ? -32.154  -15.196 2.737   1.00 86.93  ?  1701 PHE D CB  1 
ATOM   7790 C CG  . PHE D  1 227 ? -31.843  -14.137 3.768   1.00 84.85  ?  1701 PHE D CG  1 
ATOM   7791 C CD1 . PHE D  1 227 ? -32.233  -14.297 5.096   1.00 80.61  ?  1701 PHE D CD1 1 
ATOM   7792 C CD2 . PHE D  1 227 ? -31.092  -13.017 3.432   1.00 86.69  ?  1701 PHE D CD2 1 
ATOM   7793 C CE1 . PHE D  1 227 ? -31.899  -13.345 6.060   1.00 87.40  ?  1701 PHE D CE1 1 
ATOM   7794 C CE2 . PHE D  1 227 ? -30.765  -12.061 4.397   1.00 89.00  ?  1701 PHE D CE2 1 
ATOM   7795 C CZ  . PHE D  1 227 ? -31.178  -12.227 5.701   1.00 92.17  ?  1701 PHE D CZ  1 
ATOM   7796 N N   . ILE D  1 228 ? -31.431  -17.806 0.887   1.00 96.55  ?  1702 ILE D N   1 
ATOM   7797 C CA  . ILE D  1 228 ? -31.851  -19.003 0.121   1.00 88.67  ?  1702 ILE D CA  1 
ATOM   7798 C C   . ILE D  1 228 ? -31.228  -20.273 0.779   1.00 98.99  ?  1702 ILE D C   1 
ATOM   7799 O O   . ILE D  1 228 ? -32.009  -21.170 1.119   1.00 106.42 ?  1702 ILE D O   1 
ATOM   7800 C CB  . ILE D  1 228 ? -31.650  -18.905 -1.418  1.00 78.12  ?  1702 ILE D CB  1 
ATOM   7801 C CG1 . ILE D  1 228 ? -32.274  -17.612 -1.960  1.00 76.91  ?  1702 ILE D CG1 1 
ATOM   7802 C CG2 . ILE D  1 228 ? -32.260  -20.115 -2.123  1.00 72.97  ?  1702 ILE D CG2 1 
ATOM   7803 C CD1 . ILE D  1 228 ? -31.668  -17.101 -3.180  1.00 79.62  ?  1702 ILE D CD1 1 
ATOM   7804 N N   . PRO D  1 229 ? -29.895  -20.319 1.117   1.00 91.41  ?  1703 PRO D N   1 
ATOM   7805 C CA  . PRO D  1 229 ? -29.364  -21.476 1.861   1.00 82.29  ?  1703 PRO D CA  1 
ATOM   7806 C C   . PRO D  1 229 ? -30.017  -21.649 3.234   1.00 81.17  ?  1703 PRO D C   1 
ATOM   7807 O O   . PRO D  1 229 ? -30.103  -22.784 3.685   1.00 75.24  ?  1703 PRO D O   1 
ATOM   7808 C CB  . PRO D  1 229 ? -27.876  -21.156 1.992   1.00 90.15  ?  1703 PRO D CB  1 
ATOM   7809 C CG  . PRO D  1 229 ? -27.600  -20.235 0.875   1.00 95.10  ?  1703 PRO D CG  1 
ATOM   7810 C CD  . PRO D  1 229 ? -28.807  -19.366 0.827   1.00 88.46  ?  1703 PRO D CD  1 
ATOM   7811 N N   . PHE D  1 230 ? -30.506  -20.552 3.878   1.00 92.15  ?  1704 PHE D N   1 
ATOM   7812 C CA  . PHE D  1 230 ? -31.235  -20.635 5.150   1.00 96.91  ?  1704 PHE D CA  1 
ATOM   7813 C C   . PHE D  1 230 ? -32.600  -21.282 4.909   1.00 90.63  ?  1704 PHE D C   1 
ATOM   7814 O O   . PHE D  1 230 ? -33.022  -22.103 5.725   1.00 91.00  ?  1704 PHE D O   1 
ATOM   7815 C CB  . PHE D  1 230 ? -31.408  -19.262 5.841   1.00 98.87  ?  1704 PHE D CB  1 
ATOM   7816 C CG  . PHE D  1 230 ? -32.390  -19.272 6.998   1.00 96.24  ?  1704 PHE D CG  1 
ATOM   7817 C CD1 . PHE D  1 230 ? -32.050  -19.843 8.218   1.00 96.60  ?  1704 PHE D CD1 1 
ATOM   7818 C CD2 . PHE D  1 230 ? -33.669  -18.748 6.851   1.00 99.04  ?  1704 PHE D CD2 1 
ATOM   7819 C CE1 . PHE D  1 230 ? -32.962  -19.870 9.279   1.00 95.92  ?  1704 PHE D CE1 1 
ATOM   7820 C CE2 . PHE D  1 230 ? -34.587  -18.790 7.909   1.00 104.87 ?  1704 PHE D CE2 1 
ATOM   7821 C CZ  . PHE D  1 230 ? -34.226  -19.351 9.114   1.00 103.00 ?  1704 PHE D CZ  1 
ATOM   7822 N N   . ILE D  1 231 ? -33.289  -20.898 3.799   1.00 85.66  ?  1705 ILE D N   1 
ATOM   7823 C CA  . ILE D  1 231 ? -34.601  -21.427 3.393   1.00 93.09  ?  1705 ILE D CA  1 
ATOM   7824 C C   . ILE D  1 231 ? -34.509  -22.962 3.332   1.00 95.99  ?  1705 ILE D C   1 
ATOM   7825 O O   . ILE D  1 231 ? -35.145  -23.624 4.150   1.00 95.30  ?  1705 ILE D O   1 
ATOM   7826 C CB  . ILE D  1 231 ? -35.144  -20.781 2.062   1.00 91.51  ?  1705 ILE D CB  1 
ATOM   7827 C CG1 . ILE D  1 231 ? -35.487  -19.275 2.213   1.00 95.31  ?  1705 ILE D CG1 1 
ATOM   7828 C CG2 . ILE D  1 231 ? -36.330  -21.557 1.464   1.00 82.53  ?  1705 ILE D CG2 1 
ATOM   7829 C CD1 . ILE D  1 231 ? -36.789  -18.908 2.963   1.00 93.92  ?  1705 ILE D CD1 1 
ATOM   7830 N N   . PHE D  1 232 ? -33.638  -23.506 2.441   1.00 87.69  ?  1706 PHE D N   1 
ATOM   7831 C CA  . PHE D  1 232 ? -33.411  -24.941 2.241   1.00 84.01  ?  1706 PHE D CA  1 
ATOM   7832 C C   . PHE D  1 232 ? -33.104  -25.727 3.514   1.00 87.08  ?  1706 PHE D C   1 
ATOM   7833 O O   . PHE D  1 232 ? -33.756  -26.746 3.748   1.00 93.58  ?  1706 PHE D O   1 
ATOM   7834 C CB  . PHE D  1 232 ? -32.314  -25.180 1.198   1.00 76.32  ?  1706 PHE D CB  1 
ATOM   7835 C CG  . PHE D  1 232 ? -32.606  -24.683 -0.196  1.00 73.60  ?  1706 PHE D CG  1 
ATOM   7836 C CD1 . PHE D  1 232 ? -33.832  -24.931 -0.799  1.00 77.86  ?  1706 PHE D CD1 1 
ATOM   7837 C CD2 . PHE D  1 232 ? -31.624  -24.043 -0.941  1.00 79.24  ?  1706 PHE D CD2 1 
ATOM   7838 C CE1 . PHE D  1 232 ? -34.093  -24.482 -2.094  1.00 90.15  ?  1706 PHE D CE1 1 
ATOM   7839 C CE2 . PHE D  1 232 ? -31.878  -23.616 -2.247  1.00 79.26  ?  1706 PHE D CE2 1 
ATOM   7840 C CZ  . PHE D  1 232 ? -33.115  -23.823 -2.808  1.00 85.51  ?  1706 PHE D CZ  1 
ATOM   7841 N N   . VAL D  1 233 ? -32.121  -25.255 4.330   1.00 80.03  ?  1707 VAL D N   1 
ATOM   7842 C CA  . VAL D  1 233 ? -31.706  -25.875 5.598   1.00 76.95  ?  1707 VAL D CA  1 
ATOM   7843 C C   . VAL D  1 233 ? -32.921  -26.069 6.524   1.00 77.07  ?  1707 VAL D C   1 
ATOM   7844 O O   . VAL D  1 233 ? -33.173  -27.183 6.977   1.00 69.97  ?  1707 VAL D O   1 
ATOM   7845 C CB  . VAL D  1 233 ? -30.550  -25.099 6.304   1.00 79.27  ?  1707 VAL D CB  1 
ATOM   7846 C CG1 . VAL D  1 233 ? -30.237  -25.685 7.681   1.00 78.86  ?  1707 VAL D CG1 1 
ATOM   7847 C CG2 . VAL D  1 233 ? -29.289  -25.070 5.450   1.00 77.10  ?  1707 VAL D CG2 1 
ATOM   7848 N N   . VAL D  1 234 ? -33.688  -24.991 6.748   1.00 78.34  ?  1708 VAL D N   1 
ATOM   7849 C CA  . VAL D  1 234 ? -34.859  -24.941 7.617   1.00 80.50  ?  1708 VAL D CA  1 
ATOM   7850 C C   . VAL D  1 234 ? -36.067  -25.722 7.040   1.00 81.90  ?  1708 VAL D C   1 
ATOM   7851 O O   . VAL D  1 234 ? -36.773  -26.373 7.809   1.00 83.41  ?  1708 VAL D O   1 
ATOM   7852 C CB  . VAL D  1 234 ? -35.157  -23.456 7.950   1.00 82.88  ?  1708 VAL D CB  1 
ATOM   7853 C CG1 . VAL D  1 234 ? -36.639  -23.110 7.896   1.00 85.02  ?  1708 VAL D CG1 1 
ATOM   7854 C CG2 . VAL D  1 234 ? -34.547  -23.067 9.288   1.00 87.02  ?  1708 VAL D CG2 1 
ATOM   7855 N N   . THR D  1 235 ? -36.284  -25.675 5.707   1.00 83.08  ?  1709 THR D N   1 
ATOM   7856 C CA  . THR D  1 235 ? -37.390  -26.377 5.036   1.00 87.93  ?  1709 THR D CA  1 
ATOM   7857 C C   . THR D  1 235 ? -37.153  -27.887 5.015   1.00 87.64  ?  1709 THR D C   1 
ATOM   7858 O O   . THR D  1 235 ? -38.104  -28.654 5.186   1.00 93.82  ?  1709 THR D O   1 
ATOM   7859 C CB  . THR D  1 235 ? -37.640  -25.811 3.630   1.00 93.29  ?  1709 THR D CB  1 
ATOM   7860 O OG1 . THR D  1 235 ? -37.634  -24.388 3.694   1.00 103.35 ?  1709 THR D OG1 1 
ATOM   7861 C CG2 . THR D  1 235 ? -38.971  -26.265 3.042   1.00 96.05  ?  1709 THR D CG2 1 
ATOM   7862 N N   . PHE D  1 236 ? -35.892  -28.313 4.801   1.00 87.39  ?  1710 PHE D N   1 
ATOM   7863 C CA  . PHE D  1 236 ? -35.534  -29.726 4.797   1.00 89.98  ?  1710 PHE D CA  1 
ATOM   7864 C C   . PHE D  1 236 ? -35.864  -30.339 6.165   1.00 91.49  ?  1710 PHE D C   1 
ATOM   7865 O O   . PHE D  1 236 ? -36.582  -31.340 6.219   1.00 85.33  ?  1710 PHE D O   1 
ATOM   7866 C CB  . PHE D  1 236 ? -34.052  -29.918 4.421   1.00 94.51  ?  1710 PHE D CB  1 
ATOM   7867 C CG  . PHE D  1 236 ? -33.600  -31.359 4.358   1.00 86.31  ?  1710 PHE D CG  1 
ATOM   7868 C CD1 . PHE D  1 236 ? -34.020  -32.195 3.326   1.00 83.37  ?  1710 PHE D CD1 1 
ATOM   7869 C CD2 . PHE D  1 236 ? -32.755  -31.883 5.329   1.00 76.92  ?  1710 PHE D CD2 1 
ATOM   7870 C CE1 . PHE D  1 236 ? -33.617  -33.531 3.280   1.00 82.66  ?  1710 PHE D CE1 1 
ATOM   7871 C CE2 . PHE D  1 236 ? -32.344  -33.218 5.274   1.00 76.30  ?  1710 PHE D CE2 1 
ATOM   7872 C CZ  . PHE D  1 236 ? -32.779  -34.032 4.250   1.00 82.42  ?  1710 PHE D CZ  1 
ATOM   7873 N N   . VAL D  1 237 ? -35.417  -29.676 7.262   1.00 90.17  ?  1711 VAL D N   1 
ATOM   7874 C CA  . VAL D  1 237 ? -35.658  -30.067 8.657   1.00 94.78  ?  1711 VAL D CA  1 
ATOM   7875 C C   . VAL D  1 237 ? -37.165  -30.098 8.934   1.00 96.78  ?  1711 VAL D C   1 
ATOM   7876 O O   . VAL D  1 237 ? -37.651  -31.023 9.587   1.00 102.63 ?  1711 VAL D O   1 
ATOM   7877 C CB  . VAL D  1 237 ? -34.890  -29.150 9.642   1.00 93.91  ?  1711 VAL D CB  1 
ATOM   7878 C CG1 . VAL D  1 237 ? -35.168  -29.522 11.095  1.00 91.50  ?  1711 VAL D CG1 1 
ATOM   7879 C CG2 . VAL D  1 237 ? -33.395  -29.193 9.373   1.00 93.40  ?  1711 VAL D CG2 1 
ATOM   7880 N N   . MET D  1 238 ? -37.898  -29.114 8.389   1.00 95.17  ?  1712 MET D N   1 
ATOM   7881 C CA  . MET D  1 238 ? -39.348  -29.009 8.502   1.00 95.51  ?  1712 MET D CA  1 
ATOM   7882 C C   . MET D  1 238 ? -40.049  -30.233 7.918   1.00 91.22  ?  1712 MET D C   1 
ATOM   7883 O O   . MET D  1 238 ? -40.774  -30.904 8.653   1.00 90.94  ?  1712 MET D O   1 
ATOM   7884 C CB  . MET D  1 238 ? -39.858  -27.716 7.849   1.00 97.00  ?  1712 MET D CB  1 
ATOM   7885 C CG  . MET D  1 238 ? -39.972  -26.573 8.809   1.00 99.80  ?  1712 MET D CG  1 
ATOM   7886 S SD  . MET D  1 238 ? -40.828  -27.045 10.329  1.00 106.63 ?  1712 MET D SD  1 
ATOM   7887 C CE  . MET D  1 238 ? -42.521  -27.211 9.727   1.00 127.73 ?  1712 MET D CE  1 
ATOM   7888 N N   . ILE D  1 239 ? -39.787  -30.545 6.616   1.00 80.80  ?  1713 ILE D N   1 
ATOM   7889 C CA  . ILE D  1 239 ? -40.331  -31.700 5.878   1.00 70.62  ?  1713 ILE D CA  1 
ATOM   7890 C C   . ILE D  1 239 ? -40.144  -32.985 6.697   1.00 74.35  ?  1713 ILE D C   1 
ATOM   7891 O O   . ILE D  1 239 ? -41.114  -33.704 6.929   1.00 71.93  ?  1713 ILE D O   1 
ATOM   7892 C CB  . ILE D  1 239 ? -39.690  -31.841 4.456   1.00 62.58  ?  1713 ILE D CB  1 
ATOM   7893 C CG1 . ILE D  1 239 ? -40.070  -30.669 3.532   1.00 60.09  ?  1713 ILE D CG1 1 
ATOM   7894 C CG2 . ILE D  1 239 ? -40.019  -33.217 3.805   1.00 60.79  ?  1713 ILE D CG2 1 
ATOM   7895 C CD1 . ILE D  1 239 ? -39.215  -30.556 2.232   1.00 62.24  ?  1713 ILE D CD1 1 
ATOM   7896 N N   . ASN D  1 240 ? -38.894  -33.237 7.150   1.00 83.07  ?  1714 ASN D N   1 
ATOM   7897 C CA  . ASN D  1 240 ? -38.499  -34.405 7.926   1.00 90.73  ?  1714 ASN D CA  1 
ATOM   7898 C C   . ASN D  1 240 ? -39.259  -34.544 9.224   1.00 87.49  ?  1714 ASN D C   1 
ATOM   7899 O O   . ASN D  1 240 ? -39.608  -35.663 9.579   1.00 85.89  ?  1714 ASN D O   1 
ATOM   7900 C CB  . ASN D  1 240 ? -36.998  -34.425 8.153   1.00 91.33  ?  1714 ASN D CB  1 
ATOM   7901 C CG  . ASN D  1 240 ? -36.216  -34.732 6.897   1.00 90.76  ?  1714 ASN D CG  1 
ATOM   7902 O OD1 . ASN D  1 240 ? -36.365  -35.796 6.265   1.00 79.29  ?  1714 ASN D OD1 1 
ATOM   7903 N ND2 . ASN D  1 240 ? -35.355  -33.810 6.512   1.00 89.08  ?  1714 ASN D ND2 1 
ATOM   7904 N N   . LEU D  1 241 ? -39.561  -33.423 9.903   1.00 88.05  ?  1715 LEU D N   1 
ATOM   7905 C CA  . LEU D  1 241 ? -40.340  -33.429 11.144  1.00 92.00  ?  1715 LEU D CA  1 
ATOM   7906 C C   . LEU D  1 241 ? -41.772  -33.903 10.854  1.00 99.67  ?  1715 LEU D C   1 
ATOM   7907 O O   . LEU D  1 241 ? -42.269  -34.789 11.549  1.00 105.99 ?  1715 LEU D O   1 
ATOM   7908 C CB  . LEU D  1 241 ? -40.343  -32.036 11.794  1.00 91.49  ?  1715 LEU D CB  1 
ATOM   7909 C CG  . LEU D  1 241 ? -40.960  -31.949 13.189  1.00 88.05  ?  1715 LEU D CG  1 
ATOM   7910 C CD1 . LEU D  1 241 ? -40.003  -31.306 14.169  1.00 84.37  ?  1715 LEU D CD1 1 
ATOM   7911 C CD2 . LEU D  1 241 ? -42.272  -31.198 13.157  1.00 92.65  ?  1715 LEU D CD2 1 
ATOM   7912 N N   . VAL D  1 242 ? -42.405  -33.328 9.803   1.00 98.94  ?  1716 VAL D N   1 
ATOM   7913 C CA  . VAL D  1 242 ? -43.759  -33.657 9.328   1.00 87.48  ?  1716 VAL D CA  1 
ATOM   7914 C C   . VAL D  1 242 ? -43.817  -35.144 8.903   1.00 85.61  ?  1716 VAL D C   1 
ATOM   7915 O O   . VAL D  1 242 ? -44.756  -35.858 9.272   1.00 78.22  ?  1716 VAL D O   1 
ATOM   7916 C CB  . VAL D  1 242 ? -44.200  -32.706 8.179   1.00 80.30  ?  1716 VAL D CB  1 
ATOM   7917 C CG1 . VAL D  1 242 ? -45.672  -32.911 7.824   1.00 85.19  ?  1716 VAL D CG1 1 
ATOM   7918 C CG2 . VAL D  1 242 ? -43.943  -31.245 8.537   1.00 79.87  ?  1716 VAL D CG2 1 
ATOM   7919 N N   . VAL D  1 243 ? -42.782  -35.591 8.146   1.00 85.61  ?  1717 VAL D N   1 
ATOM   7920 C CA  . VAL D  1 243 ? -42.576  -36.961 7.661   1.00 76.58  ?  1717 VAL D CA  1 
ATOM   7921 C C   . VAL D  1 243 ? -42.447  -37.905 8.871   1.00 76.75  ?  1717 VAL D C   1 
ATOM   7922 O O   . VAL D  1 243 ? -43.061  -38.971 8.864   1.00 73.25  ?  1717 VAL D O   1 
ATOM   7923 C CB  . VAL D  1 243 ? -41.369  -37.053 6.672   1.00 70.50  ?  1717 VAL D CB  1 
ATOM   7924 C CG1 . VAL D  1 243 ? -40.924  -38.492 6.439   1.00 74.58  ?  1717 VAL D CG1 1 
ATOM   7925 C CG2 . VAL D  1 243 ? -41.693  -36.381 5.342   1.00 67.26  ?  1717 VAL D CG2 1 
ATOM   7926 N N   . ALA D  1 244 ? -41.705  -37.479 9.924   1.00 81.07  ?  1718 ALA D N   1 
ATOM   7927 C CA  . ALA D  1 244 ? -41.498  -38.247 11.157  1.00 87.13  ?  1718 ALA D CA  1 
ATOM   7928 C C   . ALA D  1 244 ? -42.804  -38.506 11.896  1.00 91.80  ?  1718 ALA D C   1 
ATOM   7929 O O   . ALA D  1 244 ? -43.005  -39.620 12.375  1.00 93.88  ?  1718 ALA D O   1 
ATOM   7930 C CB  . ALA D  1 244 ? -40.512  -37.538 12.071  1.00 93.64  ?  1718 ALA D CB  1 
ATOM   7931 N N   . ILE D  1 245 ? -43.700  -37.491 11.957  1.00 96.46  ?  1719 ILE D N   1 
ATOM   7932 C CA  . ILE D  1 245 ? -45.016  -37.585 12.604  1.00 102.78 ?  1719 ILE D CA  1 
ATOM   7933 C C   . ILE D  1 245 ? -45.862  -38.674 11.923  1.00 100.19 ?  1719 ILE D C   1 
ATOM   7934 O O   . ILE D  1 245 ? -46.582  -39.397 12.614  1.00 103.03 ?  1719 ILE D O   1 
ATOM   7935 C CB  . ILE D  1 245 ? -45.724  -36.196 12.700  1.00 107.06 ?  1719 ILE D CB  1 
ATOM   7936 C CG1 . ILE D  1 245 ? -44.878  -35.209 13.524  1.00 112.46 ?  1719 ILE D CG1 1 
ATOM   7937 C CG2 . ILE D  1 245 ? -47.135  -36.303 13.304  1.00 108.27 ?  1719 ILE D CG2 1 
ATOM   7938 C CD1 . ILE D  1 245 ? -45.045  -33.767 13.141  1.00 116.99 ?  1719 ILE D CD1 1 
ATOM   7939 N N   . ILE D  1 246 ? -45.714  -38.828 10.583  1.00 95.70  ?  1720 ILE D N   1 
ATOM   7940 C CA  . ILE D  1 246 ? -46.400  -39.849 9.775   1.00 90.04  ?  1720 ILE D CA  1 
ATOM   7941 C C   . ILE D  1 246 ? -45.883  -41.254 10.138  1.00 93.39  ?  1720 ILE D C   1 
ATOM   7942 O O   . ILE D  1 246 ? -46.669  -42.088 10.587  1.00 88.36  ?  1720 ILE D O   1 
ATOM   7943 C CB  . ILE D  1 246 ? -46.321  -39.568 8.244   1.00 84.32  ?  1720 ILE D CB  1 
ATOM   7944 C CG1 . ILE D  1 246 ? -46.837  -38.163 7.902   1.00 85.64  ?  1720 ILE D CG1 1 
ATOM   7945 C CG2 . ILE D  1 246 ? -47.092  -40.634 7.460   1.00 85.64  ?  1720 ILE D CG2 1 
ATOM   7946 C CD1 . ILE D  1 246 ? -46.265  -37.561 6.672   1.00 86.40  ?  1720 ILE D CD1 1 
ATOM   7947 N N   . VAL D  1 247 ? -44.566  -41.491 9.970   1.00 93.76  ?  1721 VAL D N   1 
ATOM   7948 C CA  . VAL D  1 247 ? -43.885  -42.752 10.274  1.00 90.19  ?  1721 VAL D CA  1 
ATOM   7949 C C   . VAL D  1 247 ? -44.159  -43.190 11.720  1.00 90.36  ?  1721 VAL D C   1 
ATOM   7950 O O   . VAL D  1 247 ? -44.504  -44.348 11.933  1.00 90.88  ?  1721 VAL D O   1 
ATOM   7951 C CB  . VAL D  1 247 ? -42.373  -42.698 9.943   1.00 94.39  ?  1721 VAL D CB  1 
ATOM   7952 C CG1 . VAL D  1 247 ? -41.746  -44.086 10.008  1.00 99.05  ?  1721 VAL D CG1 1 
ATOM   7953 C CG2 . VAL D  1 247 ? -42.137  -42.084 8.569   1.00 92.80  ?  1721 VAL D CG2 1 
ATOM   7954 N N   . ASP D  1 248 ? -44.073  -42.256 12.693  1.00 101.09 ?  1722 ASP D N   1 
ATOM   7955 C CA  . ASP D  1 248 ? -44.361  -42.500 14.118  1.00 119.35 ?  1722 ASP D CA  1 
ATOM   7956 C C   . ASP D  1 248 ? -45.792  -43.050 14.295  1.00 118.61 ?  1722 ASP D C   1 
ATOM   7957 O O   . ASP D  1 248 ? -46.006  -43.952 15.106  1.00 116.96 ?  1722 ASP D O   1 
ATOM   7958 C CB  . ASP D  1 248 ? -44.184  -41.198 14.929  1.00 134.16 ?  1722 ASP D CB  1 
ATOM   7959 C CG  . ASP D  1 248 ? -44.059  -41.378 16.429  1.00 140.85 ?  1722 ASP D CG  1 
ATOM   7960 O OD1 . ASP D  1 248 ? -42.941  -41.689 16.900  1.00 147.94 ?  1722 ASP D OD1 1 
ATOM   7961 O OD2 . ASP D  1 248 ? -45.058  -41.134 17.141  1.00 134.93 -1 1722 ASP D OD2 1 
ATOM   7962 N N   . ALA D  1 249 ? -46.750  -42.522 13.506  1.00 117.50 ?  1723 ALA D N   1 
ATOM   7963 C CA  . ALA D  1 249 ? -48.154  -42.933 13.508  1.00 114.77 ?  1723 ALA D CA  1 
ATOM   7964 C C   . ALA D  1 249 ? -48.402  -44.166 12.618  1.00 115.44 ?  1723 ALA D C   1 
ATOM   7965 O O   . ALA D  1 249 ? -49.459  -44.792 12.733  1.00 122.11 ?  1723 ALA D O   1 
ATOM   7966 C CB  . ALA D  1 249 ? -49.035  -41.775 13.071  1.00 114.36 ?  1723 ALA D CB  1 
ATOM   7967 N N   . MET D  1 250 ? -47.432  -44.512 11.738  1.00 115.87 ?  1724 MET D N   1 
ATOM   7968 C CA  . MET D  1 250 ? -47.502  -45.686 10.850  1.00 112.76 ?  1724 MET D CA  1 
ATOM   7969 C C   . MET D  1 250 ? -47.049  -46.933 11.599  1.00 107.81 ?  1724 MET D C   1 
ATOM   7970 O O   . MET D  1 250 ? -47.444  -48.042 11.247  1.00 99.41  ?  1724 MET D O   1 
ATOM   7971 C CB  . MET D  1 250 ? -46.653  -45.494 9.591   1.00 117.12 ?  1724 MET D CB  1 
ATOM   7972 C CG  . MET D  1 250 ? -47.174  -44.429 8.656   1.00 121.90 ?  1724 MET D CG  1 
ATOM   7973 S SD  . MET D  1 250 ? -48.619  -44.890 7.679   1.00 120.11 ?  1724 MET D SD  1 
ATOM   7974 C CE  . MET D  1 250 ? -48.219  -44.025 6.146   1.00 113.26 ?  1724 MET D CE  1 
ATOM   7975 N N   . ALA D  1 251 ? -46.235  -46.740 12.650  1.00 115.06 ?  1725 ALA D N   1 
ATOM   7976 C CA  . ALA D  1 251 ? -45.768  -47.794 13.543  1.00 121.76 ?  1725 ALA D CA  1 
ATOM   7977 C C   . ALA D  1 251 ? -46.944  -48.234 14.431  1.00 125.56 ?  1725 ALA D C   1 
ATOM   7978 O O   . ALA D  1 251 ? -46.878  -49.294 15.049  1.00 126.92 ?  1725 ALA D O   1 
ATOM   7979 C CB  . ALA D  1 251 ? -44.625  -47.276 14.402  1.00 122.62 ?  1725 ALA D CB  1 
ATOM   7980 N N   . ILE D  1 252 ? -48.017  -47.410 14.477  1.00 129.15 ?  1726 ILE D N   1 
ATOM   7981 C CA  . ILE D  1 252 ? -49.260  -47.639 15.223  1.00 138.32 ?  1726 ILE D CA  1 
ATOM   7982 C C   . ILE D  1 252 ? -50.237  -48.507 14.391  1.00 148.91 ?  1726 ILE D C   1 
ATOM   7983 O O   . ILE D  1 252 ? -50.806  -49.453 14.935  1.00 173.76 ?  1726 ILE D O   1 
ATOM   7984 C CB  . ILE D  1 252 ? -49.853  -46.284 15.731  1.00 134.11 ?  1726 ILE D CB  1 
ATOM   7985 C CG1 . ILE D  1 252 ? -49.079  -45.795 16.978  1.00 129.26 ?  1726 ILE D CG1 1 
ATOM   7986 C CG2 . ILE D  1 252 ? -51.367  -46.351 16.015  1.00 137.29 ?  1726 ILE D CG2 1 
ATOM   7987 C CD1 . ILE D  1 252 ? -48.829  -44.313 17.042  1.00 130.40 ?  1726 ILE D CD1 1 
ATOM   7988 N N   . LEU D  1 253 ? -50.392  -48.206 13.079  1.00 145.36 ?  1727 LEU D N   1 
ATOM   7989 C CA  . LEU D  1 253 ? -51.247  -48.949 12.137  1.00 139.00 ?  1727 LEU D CA  1 
ATOM   7990 C C   . LEU D  1 253 ? -50.725  -50.371 11.898  1.00 136.06 ?  1727 LEU D C   1 
ATOM   7991 O O   . LEU D  1 253 ? -51.497  -51.329 11.957  1.00 145.23 ?  1727 LEU D O   1 
ATOM   7992 C CB  . LEU D  1 253 ? -51.301  -48.231 10.778  1.00 141.10 ?  1727 LEU D CB  1 
ATOM   7993 C CG  . LEU D  1 253 ? -52.198  -47.025 10.655  1.00 149.62 ?  1727 LEU D CG  1 
ATOM   7994 C CD1 . LEU D  1 253 ? -51.488  -45.926 9.906   1.00 154.22 ?  1727 LEU D CD1 1 
ATOM   7995 C CD2 . LEU D  1 253 ? -53.494  -47.385 9.951   1.00 148.75 ?  1727 LEU D CD2 1 
ATOM   7996 N N   . ASN D  1 254 ? -49.419  -50.488 11.591  1.00 130.53 ?  1728 ASN D N   1 
ATOM   7997 C CA  . ASN D  1 254 ? -48.737  -51.739 11.278  1.00 134.08 ?  1728 ASN D CA  1 
ATOM   7998 C C   . ASN D  1 254 ? -48.534  -52.670 12.467  1.00 143.36 ?  1728 ASN D C   1 
ATOM   7999 O O   . ASN D  1 254 ? -48.508  -53.883 12.258  1.00 148.85 ?  1728 ASN D O   1 
ATOM   8000 C CB  . ASN D  1 254 ? -47.409  -51.463 10.582  1.00 134.07 ?  1728 ASN D CB  1 
ATOM   8001 C CG  . ASN D  1 254 ? -47.574  -51.091 9.131   1.00 135.90 ?  1728 ASN D CG  1 
ATOM   8002 O OD1 . ASN D  1 254 ? -47.435  -51.932 8.239   1.00 139.76 ?  1728 ASN D OD1 1 
ATOM   8003 N ND2 . ASN D  1 254 ? -47.894  -49.828 8.858   1.00 140.85 ?  1728 ASN D ND2 1 
ATOM   8004 N N   . GLN D  1 255 ? -48.378  -52.126 13.699  1.00 148.00 ?  1729 GLN D N   1 
ATOM   8005 C CA  . GLN D  1 255 ? -48.170  -52.950 14.899  1.00 152.22 ?  1729 GLN D CA  1 
ATOM   8006 C C   . GLN D  1 255 ? -49.441  -53.660 15.356  1.00 160.80 ?  1729 GLN D C   1 
ATOM   8007 O O   . GLN D  1 255 ? -49.367  -54.830 15.740  1.00 170.68 ?  1729 GLN D O   1 
ATOM   8008 C CB  . GLN D  1 255 ? -47.521  -52.164 16.049  1.00 149.93 ?  1729 GLN D CB  1 
ATOM   8009 C CG  . GLN D  1 255 ? -46.549  -52.994 16.900  1.00 147.46 ?  1729 GLN D CG  1 
ATOM   8010 C CD  . GLN D  1 255 ? -45.384  -53.572 16.116  1.00 144.28 ?  1729 GLN D CD  1 
ATOM   8011 O OE1 . GLN D  1 255 ? -44.614  -52.855 15.459  1.00 145.97 ?  1729 GLN D OE1 1 
ATOM   8012 N NE2 . GLN D  1 255 ? -45.232  -54.889 16.177  1.00 140.86 ?  1729 GLN D NE2 1 
ATOM   8013 N N   . LYS D  1 256 ? -50.605  -52.971 15.294  1.00 159.48 ?  1730 LYS D N   1 
ATOM   8014 C CA  . LYS D  1 256 ? -51.898  -53.576 15.639  1.00 150.49 ?  1730 LYS D CA  1 
ATOM   8015 C C   . LYS D  1 256 ? -52.347  -54.568 14.546  1.00 152.86 ?  1730 LYS D C   1 
ATOM   8016 O O   . LYS D  1 256 ? -53.185  -55.434 14.809  1.00 169.04 ?  1730 LYS D O   1 
ATOM   8017 C CB  . LYS D  1 256 ? -52.978  -52.527 15.996  1.00 141.31 ?  1730 LYS D CB  1 
ATOM   8018 C CG  . LYS D  1 256 ? -53.325  -51.508 14.910  1.00 140.35 ?  1730 LYS D CG  1 
ATOM   8019 C CD  . LYS D  1 256 ? -54.083  -50.319 15.508  1.00 141.12 ?  1730 LYS D CD  1 
ATOM   8020 C CE  . LYS D  1 256 ? -54.215  -49.155 14.554  1.00 143.19 ?  1730 LYS D CE  1 
ATOM   8021 N NZ  . LYS D  1 256 ? -54.926  -48.011 15.181  1.00 139.28 1  1730 LYS D NZ  1 
ATOM   8022 N N   . GLU D  1 257 ? -51.742  -54.453 13.339  1.00 141.65 ?  1731 GLU D N   1 
ATOM   8023 C CA  . GLU D  1 257 ? -51.949  -55.322 12.179  1.00 132.76 ?  1731 GLU D CA  1 
ATOM   8024 C C   . GLU D  1 257 ? -51.004  -56.536 12.275  1.00 129.57 ?  1731 GLU D C   1 
ATOM   8025 O O   . GLU D  1 257 ? -51.403  -57.640 11.899  1.00 135.81 ?  1731 GLU D O   1 
ATOM   8026 C CB  . GLU D  1 257 ? -51.697  -54.540 10.879  1.00 124.71 ?  1731 GLU D CB  1 
ATOM   8027 C CG  . GLU D  1 257 ? -52.023  -55.312 9.611   1.00 120.84 ?  1731 GLU D CG  1 
ATOM   8028 C CD  . GLU D  1 257 ? -51.076  -55.091 8.448   1.00 116.79 ?  1731 GLU D CD  1 
ATOM   8029 O OE1 . GLU D  1 257 ? -51.571  -54.987 7.303   1.00 118.90 ?  1731 GLU D OE1 1 
ATOM   8030 O OE2 . GLU D  1 257 ? -49.844  -55.035 8.672   1.00 113.84 -1 1731 GLU D OE2 1 
ATOM   8031 N N   . GLU D  1 258 ? -49.761  -56.325 12.782  1.00 122.06 ?  1732 GLU D N   1 
ATOM   8032 C CA  . GLU D  1 258 ? -48.741  -57.365 12.969  1.00 119.06 ?  1732 GLU D CA  1 
ATOM   8033 C C   . GLU D  1 258 ? -49.204  -58.404 14.000  1.00 121.51 ?  1732 GLU D C   1 
ATOM   8034 O O   . GLU D  1 258 ? -49.127  -59.603 13.717  1.00 116.01 ?  1732 GLU D O   1 
ATOM   8035 C CB  . GLU D  1 258 ? -47.392  -56.750 13.383  1.00 117.68 ?  1732 GLU D CB  1 
ATOM   8036 C CG  . GLU D  1 258 ? -46.199  -57.326 12.637  1.00 117.16 ?  1732 GLU D CG  1 
ATOM   8037 C CD  . GLU D  1 258 ? -44.859  -56.695 12.972  1.00 117.48 ?  1732 GLU D CD  1 
ATOM   8038 O OE1 . GLU D  1 258 ? -44.659  -55.504 12.639  1.00 120.87 ?  1732 GLU D OE1 1 
ATOM   8039 O OE2 . GLU D  1 258 ? -43.996  -57.400 13.544  1.00 112.46 -1 1732 GLU D OE2 1 
ATOM   8040 N N   . GLN D  1 259 ? -49.718  -57.944 15.174  1.00 128.60 ?  1733 GLN D N   1 
ATOM   8041 C CA  . GLN D  1 259 ? -50.238  -58.822 16.234  1.00 136.20 ?  1733 GLN D CA  1 
ATOM   8042 C C   . GLN D  1 259 ? -51.512  -59.553 15.790  1.00 136.05 ?  1733 GLN D C   1 
ATOM   8043 O O   . GLN D  1 259 ? -51.711  -60.712 16.165  1.00 138.18 ?  1733 GLN D O   1 
ATOM   8044 C CB  . GLN D  1 259 ? -50.419  -58.091 17.590  1.00 137.56 ?  1733 GLN D CB  1 
ATOM   8045 C CG  . GLN D  1 259 ? -51.570  -57.064 17.665  1.00 136.97 ?  1733 GLN D CG  1 
ATOM   8046 C CD  . GLN D  1 259 ? -52.135  -56.849 19.062  1.00 131.82 ?  1733 GLN D CD  1 
ATOM   8047 O OE1 . GLN D  1 259 ? -52.013  -57.690 19.966  1.00 125.61 ?  1733 GLN D OE1 1 
ATOM   8048 N NE2 . GLN D  1 259 ? -52.818  -55.726 19.254  1.00 126.57 ?  1733 GLN D NE2 1 
ATOM   8049 N N   . HIS D  1 260 ? -52.353  -58.874 14.966  1.00 131.14 ?  1734 HIS D N   1 
ATOM   8050 C CA  . HIS D  1 260 ? -53.588  -59.413 14.398  1.00 132.21 ?  1734 HIS D CA  1 
ATOM   8051 C C   . HIS D  1 260 ? -53.237  -60.546 13.422  1.00 132.79 ?  1734 HIS D C   1 
ATOM   8052 O O   . HIS D  1 260 ? -53.927  -61.571 13.403  1.00 148.18 ?  1734 HIS D O   1 
ATOM   8053 C CB  . HIS D  1 260 ? -54.380  -58.305 13.687  1.00 132.21 ?  1734 HIS D CB  1 
ATOM   8054 C CG  . HIS D  1 260 ? -55.848  -58.579 13.579  1.00 142.08 ?  1734 HIS D CG  1 
ATOM   8055 N ND1 . HIS D  1 260 ? -56.371  -59.325 12.534  1.00 151.89 ?  1734 HIS D ND1 1 
ATOM   8056 C CD2 . HIS D  1 260 ? -56.864  -58.181 14.381  1.00 144.23 ?  1734 HIS D CD2 1 
ATOM   8057 C CE1 . HIS D  1 260 ? -57.678  -59.363 12.739  1.00 152.17 ?  1734 HIS D CE1 1 
ATOM   8058 N NE2 . HIS D  1 260 ? -58.022  -58.690 13.838  1.00 151.69 ?  1734 HIS D NE2 1 
ATOM   8059 N N   . ILE D  1 261 ? -52.130  -60.374 12.652  1.00 124.55 ?  1735 ILE D N   1 
ATOM   8060 C CA  . ILE D  1 261 ? -51.605  -61.367 11.707  1.00 113.79 ?  1735 ILE D CA  1 
ATOM   8061 C C   . ILE D  1 261 ? -50.783  -62.416 12.519  1.00 109.49 ?  1735 ILE D C   1 
ATOM   8062 O O   . ILE D  1 261 ? -49.546  -62.387 12.572  1.00 97.69  ?  1735 ILE D O   1 
ATOM   8063 C CB  . ILE D  1 261 ? -50.886  -60.695 10.473  1.00 107.82 ?  1735 ILE D CB  1 
ATOM   8064 C CG1 . ILE D  1 261 ? -51.948  -60.084 9.514   1.00 105.80 ?  1735 ILE D CG1 1 
ATOM   8065 C CG2 . ILE D  1 261 ? -49.963  -61.665 9.701   1.00 103.47 ?  1735 ILE D CG2 1 
ATOM   8066 C CD1 . ILE D  1 261 ? -51.463  -58.971 8.543   1.00 104.57 ?  1735 ILE D CD1 1 
ATOM   8067 N N   . ILE D  1 262 ? -51.531  -63.300 13.209  1.00 110.46 ?  1736 ILE D N   1 
ATOM   8068 C CA  . ILE D  1 262 ? -51.040  -64.394 14.048  1.00 115.87 ?  1736 ILE D CA  1 
ATOM   8069 C C   . ILE D  1 262 ? -52.086  -65.542 14.018  1.00 117.28 ?  1736 ILE D C   1 
ATOM   8070 O O   . ILE D  1 262 ? -51.791  -66.615 13.474  1.00 113.73 ?  1736 ILE D O   1 
ATOM   8071 C CB  . ILE D  1 262 ? -50.596  -63.887 15.476  1.00 113.47 ?  1736 ILE D CB  1 
ATOM   8072 C CG1 . ILE D  1 262 ? -49.074  -63.645 15.516  1.00 111.74 ?  1736 ILE D CG1 1 
ATOM   8073 C CG2 . ILE D  1 262 ? -51.006  -64.812 16.636  1.00 111.54 ?  1736 ILE D CG2 1 
ATOM   8074 C CD1 . ILE D  1 262 ? -48.669  -62.249 15.742  1.00 113.85 ?  1736 ILE D CD1 1 
ATOM   8075 N N   . ASP D  1 263 ? -53.320  -65.263 14.525  1.00 114.38 ?  1737 ASP D N   1 
ATOM   8076 C CA  . ASP D  1 263 ? -54.485  -66.159 14.622  1.00 109.89 ?  1737 ASP D CA  1 
ATOM   8077 C C   . ASP D  1 263 ? -54.160  -67.564 15.218  1.00 106.48 ?  1737 ASP D C   1 
ATOM   8078 O O   . ASP D  1 263 ? -53.658  -68.478 14.551  1.00 95.87  ?  1737 ASP D O   1 
ATOM   8079 C CB  . ASP D  1 263 ? -55.231  -66.263 13.277  1.00 108.09 ?  1737 ASP D CB  1 
ATOM   8080 C CG  . ASP D  1 263 ? -56.032  -65.015 12.946  1.00 108.99 ?  1737 ASP D CG  1 
ATOM   8081 O OD1 . ASP D  1 263 ? -57.125  -64.830 13.542  1.00 114.19 ?  1737 ASP D OD1 1 
ATOM   8082 O OD2 . ASP D  1 263 ? -55.568  -64.220 12.093  1.00 106.09 -1 1737 ASP D OD2 1 
HETATM 8083 O O1  . PX4 E  2 .   ? -47.112  -3.607  26.333  1.00 117.03 ?  1801 PX4 A O1  1 
HETATM 8084 O O2  . PX4 E  2 .   ? -45.365  -5.346  25.544  1.00 141.28 ?  1801 PX4 A O2  1 
HETATM 8085 P P1  . PX4 E  2 .   ? -46.648  -5.039  26.280  1.00 134.30 ?  1801 PX4 A P1  1 
HETATM 8086 O O3  . PX4 E  2 .   ? -46.563  -5.604  27.790  1.00 120.87 ?  1801 PX4 A O3  1 
HETATM 8087 C C1  . PX4 E  2 .   ? -45.452  -5.360  28.655  1.00 128.80 ?  1801 PX4 A C1  1 
HETATM 8088 C C2  . PX4 E  2 .   ? -45.738  -5.970  30.036  1.00 142.97 ?  1801 PX4 A C2  1 
HETATM 8089 N N1  . PX4 E  2 .   ? -44.698  -5.802  31.084  1.00 165.82 ?  1801 PX4 A N1  1 
HETATM 8090 C C3  . PX4 E  2 .   ? -44.643  -4.426  31.615  1.00 149.41 ?  1801 PX4 A C3  1 
HETATM 8091 C C4  . PX4 E  2 .   ? -45.074  -6.685  32.194  1.00 175.33 ?  1801 PX4 A C4  1 
HETATM 8092 C C5  . PX4 E  2 .   ? -43.355  -6.214  30.642  1.00 168.87 ?  1801 PX4 A C5  1 
HETATM 8093 O O4  . PX4 E  2 .   ? -47.861  -5.913  25.673  1.00 121.66 ?  1801 PX4 A O4  1 
HETATM 8094 C C6  . PX4 E  2 .   ? -47.657  -7.192  25.074  1.00 103.53 ?  1801 PX4 A C6  1 
HETATM 8095 C C7  . PX4 E  2 .   ? -48.645  -8.192  25.646  1.00 106.54 ?  1801 PX4 A C7  1 
HETATM 8096 C C8  . PX4 E  2 .   ? -49.970  -8.033  24.925  1.00 108.33 ?  1801 PX4 A C8  1 
HETATM 8097 O O7  . PX4 E  2 .   ? -48.151  -9.514  25.454  1.00 114.32 ?  1801 PX4 A O7  1 
HETATM 8098 O O1  . PX4 F  2 .   ? -68.140  -9.157  13.852  1.00 146.66 ?  1802 PX4 A O1  1 
HETATM 8099 O O2  . PX4 F  2 .   ? -69.822  -10.666 12.555  1.00 146.24 ?  1802 PX4 A O2  1 
HETATM 8100 P P1  . PX4 F  2 .   ? -68.422  -10.118 12.714  1.00 168.80 ?  1802 PX4 A P1  1 
HETATM 8101 O O3  . PX4 F  2 .   ? -68.004  -9.421  11.319  1.00 192.63 ?  1802 PX4 A O3  1 
HETATM 8102 C C1  . PX4 F  2 .   ? -66.692  -8.902  11.100  1.00 199.80 ?  1802 PX4 A C1  1 
HETATM 8103 C C2  . PX4 F  2 .   ? -66.555  -8.495  9.629   1.00 212.12 ?  1802 PX4 A C2  1 
HETATM 8104 N N1  . PX4 F  2 .   ? -65.555  -7.442  9.335   1.00 211.14 ?  1802 PX4 A N1  1 
HETATM 8105 C C3  . PX4 F  2 .   ? -65.803  -6.979  7.967   1.00 213.39 ?  1802 PX4 A C3  1 
HETATM 8106 C C4  . PX4 F  2 .   ? -65.672  -6.257  10.204  1.00 199.94 ?  1802 PX4 A C4  1 
HETATM 8107 C C5  . PX4 F  2 .   ? -64.185  -7.982  9.392   1.00 197.30 ?  1802 PX4 A C5  1 
HETATM 8108 O O4  . PX4 F  2 .   ? -67.399  -11.366 12.811  1.00 146.92 ?  1802 PX4 A O4  1 
HETATM 8109 C C6  . PX4 F  2 .   ? -67.366  -12.396 11.821  1.00 134.75 ?  1802 PX4 A C6  1 
HETATM 8110 C C7  . PX4 F  2 .   ? -66.889  -13.715 12.414  1.00 137.21 ?  1802 PX4 A C7  1 
HETATM 8111 C C8  . PX4 F  2 .   ? -68.051  -14.371 13.164  1.00 132.28 ?  1802 PX4 A C8  1 
HETATM 8112 O O5  . PX4 F  2 .   ? -67.900  -14.190 14.575  1.00 120.29 ?  1802 PX4 A O5  1 
HETATM 8113 C C9  . PX4 F  2 .   ? -68.181  -15.254 15.531  1.00 121.90 ?  1802 PX4 A C9  1 
HETATM 8114 O O6  . PX4 F  2 .   ? -67.628  -16.345 15.437  1.00 103.88 ?  1802 PX4 A O6  1 
HETATM 8115 C C10 . PX4 F  2 .   ? -69.157  -14.979 16.649  1.00 117.67 ?  1802 PX4 A C10 1 
HETATM 8116 O O7  . PX4 F  2 .   ? -66.458  -14.552 11.333  1.00 140.10 ?  1802 PX4 A O7  1 
HETATM 8117 C C23 . PX4 F  2 .   ? -65.298  -15.400 11.601  1.00 133.40 ?  1802 PX4 A C23 1 
HETATM 8118 O O8  . PX4 F  2 .   ? -65.373  -16.283 12.446  1.00 153.07 ?  1802 PX4 A O8  1 
HETATM 8119 C C24 . PX4 F  2 .   ? -64.023  -15.206 10.810  1.00 119.88 ?  1802 PX4 A C24 1 
HETATM 8120 C C25 . PX4 F  2 .   ? -63.682  -16.472 10.020  1.00 122.99 ?  1802 PX4 A C25 1 
HETATM 8121 C C26 . PX4 F  2 .   ? -62.511  -17.238 10.633  1.00 127.14 ?  1802 PX4 A C26 1 
HETATM 8122 C C27 . PX4 F  2 .   ? -62.704  -18.747 10.547  1.00 125.87 ?  1802 PX4 A C27 1 
HETATM 8123 C C28 . PX4 F  2 .   ? -61.738  -19.488 11.465  1.00 118.66 ?  1802 PX4 A C28 1 
HETATM 8124 C C29 . PX4 F  2 .   ? -62.329  -20.825 11.906  1.00 115.60 ?  1802 PX4 A C29 1 
HETATM 8125 C C30 . PX4 F  2 .   ? -61.337  -21.676 12.695  1.00 124.61 ?  1802 PX4 A C30 1 
HETATM 8126 C C31 . PX4 F  2 .   ? -60.697  -22.762 11.831  1.00 123.82 ?  1802 PX4 A C31 1 
HETATM 8127 C C32 . PX4 F  2 .   ? -60.883  -24.157 12.419  1.00 117.66 ?  1802 PX4 A C32 1 
HETATM 8128 C C33 . PX4 F  2 .   ? -60.454  -25.233 11.426  1.00 101.77 ?  1802 PX4 A C33 1 
HETATM 8129 C C23 . PX4 G  2 .   ? -67.460  -28.265 23.005  1.00 92.07  ?  1803 PX4 A C23 1 
HETATM 8130 C C24 . PX4 G  2 .   ? -67.574  -27.121 22.006  1.00 99.53  ?  1803 PX4 A C24 1 
HETATM 8131 C C25 . PX4 G  2 .   ? -68.470  -26.025 22.568  1.00 105.77 ?  1803 PX4 A C25 1 
HETATM 8132 C C26 . PX4 G  2 .   ? -68.216  -24.690 21.875  1.00 112.20 ?  1803 PX4 A C26 1 
HETATM 8133 C C27 . PX4 G  2 .   ? -68.645  -23.521 22.760  1.00 113.05 ?  1803 PX4 A C27 1 
HETATM 8134 C C28 . PX4 G  2 .   ? -69.472  -22.503 21.984  1.00 103.30 ?  1803 PX4 A C28 1 
HETATM 8135 C C12 . PX4 H  2 .   ? -62.662  -38.608 -15.294 1.00 116.42 ?  1804 PX4 A C12 1 
HETATM 8136 C C13 . PX4 H  2 .   ? -63.906  -37.767 -15.137 1.00 130.62 ?  1804 PX4 A C13 1 
HETATM 8137 C C14 . PX4 H  2 .   ? -63.914  -36.660 -16.185 1.00 127.95 ?  1804 PX4 A C14 1 
HETATM 8138 C C15 . PX4 H  2 .   ? -65.175  -35.813 -16.066 1.00 124.69 ?  1804 PX4 A C15 1 
HETATM 8139 C C16 . PX4 H  2 .   ? -65.289  -34.814 -17.214 1.00 125.20 ?  1804 PX4 A C16 1 
HETATM 8140 C C17 . PX4 H  2 .   ? -65.110  -33.378 -16.728 1.00 125.39 ?  1804 PX4 A C17 1 
HETATM 8141 C C18 . PX4 H  2 .   ? -66.436  -32.628 -16.685 1.00 121.91 ?  1804 PX4 A C18 1 
HETATM 8142 C C19 . PX4 H  2 .   ? -66.224  -31.129 -16.856 1.00 110.35 ?  1804 PX4 A C19 1 
HETATM 8143 C C20 . PX4 H  2 .   ? -66.970  -30.619 -18.083 1.00 98.29  ?  1804 PX4 A C20 1 
HETATM 8144 C C21 . PX4 H  2 .   ? -67.128  -29.104 -18.037 1.00 94.20  ?  1804 PX4 A C21 1 
HETATM 8145 C C22 . PX4 H  2 .   ? -66.680  -28.449 -19.339 1.00 86.94  ?  1804 PX4 A C22 1 
HETATM 8146 C C23 . PX4 I  2 .   ? -75.719  -16.877 -26.658 1.00 101.89 ?  1805 PX4 A C23 1 
HETATM 8147 C C24 . PX4 I  2 .   ? -74.911  -18.167 -26.571 1.00 106.26 ?  1805 PX4 A C24 1 
HETATM 8148 C C25 . PX4 I  2 .   ? -75.750  -19.321 -26.028 1.00 107.68 ?  1805 PX4 A C25 1 
HETATM 8149 C C26 . PX4 I  2 .   ? -75.087  -20.670 -26.306 1.00 111.16 ?  1805 PX4 A C26 1 
HETATM 8150 C C27 . PX4 I  2 .   ? -75.947  -21.829 -25.810 1.00 110.92 ?  1805 PX4 A C27 1 
HETATM 8151 C C28 . PX4 I  2 .   ? -75.737  -23.089 -26.639 1.00 98.64  ?  1805 PX4 A C28 1 
HETATM 8152 C C11 . PX4 J  2 .   ? -50.183  -23.459 6.102   1.00 148.76 ?  1806 PX4 A C11 1 
HETATM 8153 C C12 . PX4 J  2 .   ? -51.465  -23.590 6.894   1.00 140.80 ?  1806 PX4 A C12 1 
HETATM 8154 C C13 . PX4 J  2 .   ? -52.683  -23.524 5.982   1.00 130.43 ?  1806 PX4 A C13 1 
HETATM 8155 C C14 . PX4 J  2 .   ? -53.955  -23.273 6.783   1.00 138.21 ?  1806 PX4 A C14 1 
HETATM 8156 C C15 . PX4 J  2 .   ? -55.205  -23.552 5.956   1.00 141.01 ?  1806 PX4 A C15 1 
HETATM 8157 C C16 . PX4 J  2 .   ? -56.471  -23.337 6.777   1.00 135.13 ?  1806 PX4 A C16 1 
HETATM 8158 C C17 . PX4 J  2 .   ? -57.478  -24.454 6.544   1.00 117.91 ?  1806 PX4 A C17 1 
HETATM 8159 O O1  . PX4 K  2 .   ? -89.212  -8.879  -19.881 1.00 231.59 ?  1807 PX4 A O1  1 
HETATM 8160 O O2  . PX4 K  2 .   ? -91.135  -7.131  -20.068 1.00 258.79 -1 1807 PX4 A O2  1 
HETATM 8161 P P1  . PX4 K  2 .   ? -89.994  -7.735  -19.283 1.00 259.76 ?  1807 PX4 A P1  1 
HETATM 8162 O O3  . PX4 K  2 .   ? -88.940  -6.572  -18.902 1.00 236.48 ?  1807 PX4 A O3  1 
HETATM 8163 C C1  . PX4 K  2 .   ? -89.364  -5.269  -18.498 1.00 202.84 ?  1807 PX4 A C1  1 
HETATM 8164 C C2  . PX4 K  2 .   ? -88.168  -4.305  -18.489 1.00 191.00 ?  1807 PX4 A C2  1 
HETATM 8165 N N1  . PX4 K  2 .   ? -88.392  -2.943  -19.040 1.00 169.54 ?  1807 PX4 A N1  1 
HETATM 8166 C C3  . PX4 K  2 .   ? -88.527  -2.974  -20.505 1.00 165.26 ?  1807 PX4 A C3  1 
HETATM 8167 C C4  . PX4 K  2 .   ? -87.201  -2.143  -18.728 1.00 177.43 ?  1807 PX4 A C4  1 
HETATM 8168 C C5  . PX4 K  2 .   ? -89.554  -2.250  -18.453 1.00 154.80 ?  1807 PX4 A C5  1 
HETATM 8169 O O4  . PX4 K  2 .   ? -90.566  -8.214  -17.852 1.00 238.12 ?  1807 PX4 A O4  1 
HETATM 8170 C C6  . PX4 K  2 .   ? -91.544  -9.253  -17.767 1.00 191.82 ?  1807 PX4 A C6  1 
HETATM 8171 C C7  . PX4 K  2 .   ? -91.573  -9.839  -16.359 1.00 180.07 ?  1807 PX4 A C7  1 
HETATM 8172 O O7  . PX4 K  2 .   ? -91.892  -11.227 -16.428 1.00 177.46 ?  1807 PX4 A O7  1 
HETATM 8173 C C23 . PX4 K  2 .   ? -92.594  -11.682 -15.240 1.00 167.14 ?  1807 PX4 A C23 1 
HETATM 8174 C C4  . 5P2 L  3 .   ? -86.101  -9.791  -15.578 1.00 152.05 ?  1808 5P2 A C4  1 
HETATM 8175 C C14 . 5P2 L  3 .   ? -89.298  -15.135 -15.770 1.00 177.21 ?  1808 5P2 A C14 1 
HETATM 8176 C C5  . 5P2 L  3 .   ? -87.108  -10.471 -16.526 1.00 151.20 ?  1808 5P2 A C5  1 
HETATM 8177 C C6  . 5P2 L  3 .   ? -87.320  -9.037  -17.047 1.00 160.70 ?  1808 5P2 A C6  1 
HETATM 8178 C C8  . 5P2 L  3 .   ? -86.746  -12.853 -17.382 1.00 155.31 ?  1808 5P2 A C8  1 
HETATM 8179 C C9  . 5P2 L  3 .   ? -86.080  -13.390 -18.445 1.00 161.79 ?  1808 5P2 A C9  1 
HETATM 8180 C C10 . 5P2 L  3 .   ? -85.526  -12.346 -19.180 1.00 174.58 ?  1808 5P2 A C10 1 
HETATM 8181 C C12 . 5P2 L  3 .   ? -87.462  -13.665 -16.363 1.00 157.58 ?  1808 5P2 A C12 1 
HETATM 8182 C C13 . 5P2 L  3 .   ? -88.642  -14.344 -16.708 1.00 174.01 ?  1808 5P2 A C13 1 
HETATM 8183 N N3  . 5P2 L  3 .   ? -86.783  -8.493  -15.777 1.00 143.15 ?  1808 5P2 A N3  1 
HETATM 8184 C C1  . 5P2 L  3 .   ? -88.155  -6.719  -14.699 1.00 132.89 ?  1808 5P2 A C1  1 
HETATM 8185 C C2  . 5P2 L  3 .   ? -87.813  -8.211  -14.749 1.00 140.45 ?  1808 5P2 A C2  1 
HETATM 8186 N N7  . 5P2 L  3 .   ? -86.581  -11.486 -17.455 1.00 158.99 ?  1808 5P2 A N7  1 
HETATM 8187 N N11 . 5P2 L  3 .   ? -85.816  -11.215 -18.600 1.00 167.39 ?  1808 5P2 A N11 1 
HETATM 8188 C C15 . 5P2 L  3 .   ? -88.792  -15.241 -14.478 1.00 174.02 ?  1808 5P2 A C15 1 
HETATM 8189 C C16 . 5P2 L  3 .   ? -87.618  -14.600 -14.126 1.00 160.33 ?  1808 5P2 A C16 1 
HETATM 8190 C C17 . 5P2 L  3 .   ? -86.936  -13.826 -15.063 1.00 165.59 ?  1808 5P2 A C17 1 
HETATM 8191 O O18 . 5P2 L  3 .   ? -85.793  -13.180 -14.701 1.00 186.33 ?  1808 5P2 A O18 1 
HETATM 8192 C C19 . 5P2 L  3 .   ? -84.645  -13.872 -14.452 1.00 174.46 ?  1808 5P2 A C19 1 
HETATM 8193 C C20 . 5P2 L  3 .   ? -84.314  -15.002 -15.207 1.00 168.35 ?  1808 5P2 A C20 1 
HETATM 8194 C C21 . 5P2 L  3 .   ? -83.149  -15.701 -14.941 1.00 162.42 ?  1808 5P2 A C21 1 
HETATM 8195 C C22 . 5P2 L  3 .   ? -82.271  -15.255 -13.958 1.00 157.06 ?  1808 5P2 A C22 1 
HETATM 8196 C C23 . 5P2 L  3 .   ? -82.577  -14.138 -13.192 1.00 158.10 ?  1808 5P2 A C23 1 
HETATM 8197 C C24 . 5P2 L  3 .   ? -83.764  -13.429 -13.439 1.00 164.72 ?  1808 5P2 A C24 1 
HETATM 8198 C C25 . 5P2 L  3 .   ? -84.064  -12.259 -12.668 1.00 160.77 ?  1808 5P2 A C25 1 
HETATM 8199 N N26 . 5P2 L  3 .   ? -84.301  -11.332 -12.060 1.00 132.91 ?  1808 5P2 A N26 1 
HETATM 8200 S S27 . 5P2 L  3 .   ? -80.819  -16.204 -13.653 1.00 156.62 ?  1808 5P2 A S27 1 
HETATM 8201 O O28 . 5P2 L  3 .   ? -80.267  -16.512 -14.923 1.00 143.83 ?  1808 5P2 A O28 1 
HETATM 8202 O O29 . 5P2 L  3 .   ? -80.052  -15.550 -12.648 1.00 139.45 ?  1808 5P2 A O29 1 
HETATM 8203 N N30 . 5P2 L  3 .   ? -81.411  -17.628 -13.032 1.00 136.46 ?  1808 5P2 A N30 1 
HETATM 8204 C C31 . 5P2 L  3 .   ? -81.793  -17.796 -11.704 1.00 132.07 ?  1808 5P2 A C31 1 
HETATM 8205 N N32 . 5P2 L  3 .   ? -81.927  -18.942 -11.070 1.00 128.92 ?  1808 5P2 A N32 1 
HETATM 8206 C C33 . 5P2 L  3 .   ? -82.280  -18.910 -9.809  1.00 123.17 ?  1808 5P2 A C33 1 
HETATM 8207 N N34 . 5P2 L  3 .   ? -82.468  -17.745 -9.275  1.00 125.54 ?  1808 5P2 A N34 1 
HETATM 8208 S S35 . 5P2 L  3 .   ? -82.193  -16.614 -10.514 1.00 135.97 ?  1808 5P2 A S35 1 
HETATM 8209 C C36 . 5P2 L  3 .   ? -90.584  -15.848 -16.129 1.00 159.47 ?  1808 5P2 A C36 1 
HETATM 8210 F F37 . 5P2 L  3 .   ? -91.578  -14.893 -16.372 1.00 162.87 ?  1808 5P2 A F37 1 
HETATM 8211 F F38 . 5P2 L  3 .   ? -90.986  -16.701 -15.092 1.00 135.61 ?  1808 5P2 A F38 1 
HETATM 8212 F F39 . 5P2 L  3 .   ? -90.406  -16.624 -17.277 1.00 136.14 ?  1808 5P2 A F39 1 
HETATM 8213 O O1  . PX4 M  2 .   ? -71.894  -7.318  2.637   1.00 135.59 ?  1801 PX4 B O1  1 
HETATM 8214 O O2  . PX4 M  2 .   ? -73.598  -6.704  0.768   1.00 139.39 ?  1801 PX4 B O2  1 
HETATM 8215 P P1  . PX4 M  2 .   ? -72.978  -7.738  1.677   1.00 137.85 ?  1801 PX4 B P1  1 
HETATM 8216 O O3  . PX4 M  2 .   ? -74.128  -8.444  2.557   1.00 143.25 ?  1801 PX4 B O3  1 
HETATM 8217 C C1  . PX4 M  2 .   ? -75.449  -8.672  2.070   1.00 158.26 ?  1801 PX4 B C1  1 
HETATM 8218 C C2  . PX4 M  2 .   ? -76.458  -8.266  3.152   1.00 167.55 ?  1801 PX4 B C2  1 
HETATM 8219 N N1  . PX4 M  2 .   ? -77.520  -9.245  3.494   1.00 171.45 ?  1801 PX4 B N1  1 
HETATM 8220 C C3  . PX4 M  2 .   ? -76.979  -10.412 4.210   1.00 165.59 ?  1801 PX4 B C3  1 
HETATM 8221 C C4  . PX4 M  2 .   ? -78.464  -8.568  4.395   1.00 159.90 ?  1801 PX4 B C4  1 
HETATM 8222 C C5  . PX4 M  2 .   ? -78.278  -9.701  2.316   1.00 175.53 ?  1801 PX4 B C5  1 
HETATM 8223 O O4  . PX4 M  2 .   ? -72.431  -8.938  0.756   1.00 100.66 ?  1801 PX4 B O4  1 
HETATM 8224 C C6  . PX4 M  2 .   ? -71.343  -9.733  1.207   1.00 79.63  ?  1801 PX4 B C6  1 
HETATM 8225 C C7  . PX4 M  2 .   ? -71.050  -10.902 0.293   1.00 77.65  ?  1801 PX4 B C7  1 
HETATM 8226 C C8  . PX4 M  2 .   ? -71.979  -12.053 0.651   1.00 79.09  ?  1801 PX4 B C8  1 
HETATM 8227 O O7  . PX4 M  2 .   ? -71.247  -10.500 -1.054  1.00 88.38  ?  1801 PX4 B O7  1 
HETATM 8228 O O1  . PX4 N  2 .   ? -58.637  -13.246 -20.847 1.00 201.66 ?  1802 PX4 B O1  1 
HETATM 8229 O O2  . PX4 N  2 .   ? -60.494  -12.785 -19.090 1.00 186.04 ?  1802 PX4 B O2  1 
HETATM 8230 P P1  . PX4 N  2 .   ? -59.251  -13.539 -19.498 1.00 200.81 ?  1802 PX4 B P1  1 
HETATM 8231 O O3  . PX4 N  2 .   ? -58.147  -13.346 -18.333 1.00 193.45 ?  1802 PX4 B O3  1 
HETATM 8232 C C1  . PX4 N  2 .   ? -56.806  -12.916 -18.584 1.00 178.05 ?  1802 PX4 B C1  1 
HETATM 8233 C C2  . PX4 N  2 .   ? -56.137  -12.549 -17.253 1.00 169.77 ?  1802 PX4 B C2  1 
HETATM 8234 N N1  . PX4 N  2 .   ? -56.021  -11.104 -16.932 1.00 160.26 ?  1802 PX4 B N1  1 
HETATM 8235 C C3  . PX4 N  2 .   ? -54.937  -10.465 -17.693 1.00 155.23 ?  1802 PX4 B C3  1 
HETATM 8236 C C4  . PX4 N  2 .   ? -57.260  -10.339 -17.145 1.00 158.18 ?  1802 PX4 B C4  1 
HETATM 8237 C C5  . PX4 N  2 .   ? -55.703  -11.001 -15.504 1.00 156.26 ?  1802 PX4 B C5  1 
HETATM 8238 O O4  . PX4 N  2 .   ? -59.591  -15.119 -19.446 1.00 179.17 ?  1802 PX4 B O4  1 
HETATM 8239 C C6  . PX4 N  2 .   ? -58.596  -16.122 -19.204 1.00 164.98 ?  1802 PX4 B C6  1 
HETATM 8240 C C7  . PX4 N  2 .   ? -59.193  -17.471 -18.781 1.00 163.21 ?  1802 PX4 B C7  1 
HETATM 8241 C C8  . PX4 N  2 .   ? -58.706  -17.991 -17.422 1.00 155.99 ?  1802 PX4 B C8  1 
HETATM 8242 O O5  . PX4 N  2 .   ? -57.868  -17.104 -16.678 1.00 133.50 ?  1802 PX4 B O5  1 
HETATM 8243 C C9  . PX4 N  2 .   ? -56.698  -17.651 -16.013 1.00 123.22 ?  1802 PX4 B C9  1 
HETATM 8244 O O6  . PX4 N  2 .   ? -55.676  -17.731 -16.658 1.00 124.58 ?  1802 PX4 B O6  1 
HETATM 8245 C C10 . PX4 N  2 .   ? -56.734  -18.106 -14.570 1.00 109.54 ?  1802 PX4 B C10 1 
HETATM 8246 C C11 . PX4 N  2 .   ? -56.474  -19.605 -14.466 1.00 97.66  ?  1802 PX4 B C11 1 
HETATM 8247 C C12 . PX4 N  2 .   ? -56.272  -20.024 -13.014 1.00 100.01 ?  1802 PX4 B C12 1 
HETATM 8248 C C13 . PX4 N  2 .   ? -55.951  -21.510 -12.886 1.00 106.24 ?  1802 PX4 B C13 1 
HETATM 8249 C C14 . PX4 N  2 .   ? -57.057  -22.260 -12.156 1.00 103.53 ?  1802 PX4 B C14 1 
HETATM 8250 C C15 . PX4 N  2 .   ? -56.621  -23.687 -11.868 1.00 101.45 ?  1802 PX4 B C15 1 
HETATM 8251 C C16 . PX4 N  2 .   ? -57.817  -24.604 -11.636 1.00 97.01  ?  1802 PX4 B C16 1 
HETATM 8252 C C17 . PX4 N  2 .   ? -57.605  -25.503 -10.422 1.00 102.70 ?  1802 PX4 B C17 1 
HETATM 8253 C C18 . PX4 N  2 .   ? -56.995  -26.853 -10.788 1.00 96.46  ?  1802 PX4 B C18 1 
HETATM 8254 O O7  . PX4 N  2 .   ? -60.626  -17.487 -18.800 1.00 160.24 ?  1802 PX4 B O7  1 
HETATM 8255 C C23 . PX4 N  2 .   ? -61.230  -18.540 -19.616 1.00 151.82 ?  1802 PX4 B C23 1 
HETATM 8256 O O8  . PX4 N  2 .   ? -61.762  -18.223 -20.668 1.00 152.45 ?  1802 PX4 B O8  1 
HETATM 8257 C C24 . PX4 N  2 .   ? -61.238  -19.993 -19.181 1.00 150.74 ?  1802 PX4 B C24 1 
HETATM 8258 C C25 . PX4 N  2 .   ? -61.836  -20.126 -17.785 1.00 152.41 ?  1802 PX4 B C25 1 
HETATM 8259 O O1  . PX4 O  2 .   ? -28.898  -42.436 -6.103  1.00 166.99 ?  1803 PX4 B O1  1 
HETATM 8260 O O2  . PX4 O  2 .   ? -26.848  -41.023 -5.307  1.00 138.72 ?  1803 PX4 B O2  1 
HETATM 8261 P P1  . PX4 O  2 .   ? -27.461  -41.995 -6.290  1.00 153.26 ?  1803 PX4 B P1  1 
HETATM 8262 O O3  . PX4 O  2 .   ? -26.501  -43.297 -6.308  1.00 164.78 ?  1803 PX4 B O3  1 
HETATM 8263 C C1  . PX4 O  2 .   ? -26.767  -44.446 -7.119  1.00 146.79 ?  1803 PX4 B C1  1 
HETATM 8264 C C2  . PX4 O  2 .   ? -25.758  -44.545 -8.275  1.00 150.14 ?  1803 PX4 B C2  1 
HETATM 8265 N N1  . PX4 O  2 .   ? -24.524  -45.341 -8.046  1.00 157.62 ?  1803 PX4 B N1  1 
HETATM 8266 C C3  . PX4 O  2 .   ? -23.504  -44.540 -7.347  1.00 160.22 ?  1803 PX4 B C3  1 
HETATM 8267 C C4  . PX4 O  2 .   ? -24.742  -46.603 -7.314  1.00 157.31 ?  1803 PX4 B C4  1 
HETATM 8268 C C5  . PX4 O  2 .   ? -23.980  -45.687 -9.365  1.00 154.29 ?  1803 PX4 B C5  1 
HETATM 8269 O O4  . PX4 O  2 .   ? -27.282  -41.391 -7.781  1.00 144.85 ?  1803 PX4 B O4  1 
HETATM 8270 C C6  . PX4 O  2 .   ? -28.087  -40.325 -8.303  1.00 140.85 ?  1803 PX4 B C6  1 
HETATM 8271 C C7  . PX4 O  2 .   ? -27.322  -39.576 -9.399  1.00 139.06 ?  1803 PX4 B C7  1 
HETATM 8272 C C8  . PX4 O  2 .   ? -27.205  -40.478 -10.635 1.00 134.11 ?  1803 PX4 B C8  1 
HETATM 8273 O O5  . PX4 O  2 .   ? -26.049  -41.310 -10.521 1.00 119.40 ?  1803 PX4 B O5  1 
HETATM 8274 O O7  . PX4 O  2 .   ? -27.904  -38.266 -9.605  1.00 125.59 ?  1803 PX4 B O7  1 
HETATM 8275 C C23 . PX4 O  2 .   ? -28.251  -37.786 -10.950 1.00 106.40 ?  1803 PX4 B C23 1 
HETATM 8276 O O8  . PX4 O  2 .   ? -29.345  -38.087 -11.411 1.00 109.58 ?  1803 PX4 B O8  1 
HETATM 8277 C C24 . PX4 O  2 .   ? -27.279  -36.915 -11.728 1.00 109.56 ?  1803 PX4 B C24 1 
HETATM 8278 C C25 . PX4 O  2 .   ? -27.968  -36.079 -12.806 1.00 109.08 ?  1803 PX4 B C25 1 
HETATM 8279 C C26 . PX4 O  2 .   ? -27.041  -35.833 -13.992 1.00 101.48 ?  1803 PX4 B C26 1 
HETATM 8280 C C27 . PX4 O  2 .   ? -27.451  -34.600 -14.794 1.00 95.70  ?  1803 PX4 B C27 1 
HETATM 8281 C C28 . PX4 O  2 .   ? -26.500  -33.427 -14.568 1.00 101.62 ?  1803 PX4 B C28 1 
HETATM 8282 C C29 . PX4 O  2 .   ? -27.064  -32.129 -15.135 1.00 115.08 ?  1803 PX4 B C29 1 
HETATM 8283 C C30 . PX4 O  2 .   ? -26.016  -31.027 -15.126 1.00 114.54 ?  1803 PX4 B C30 1 
HETATM 8284 C C31 . PX4 O  2 .   ? -26.102  -30.202 -16.402 1.00 109.79 ?  1803 PX4 B C31 1 
HETATM 8285 C C32 . PX4 O  2 .   ? -24.907  -29.263 -16.522 1.00 100.57 ?  1803 PX4 B C32 1 
HETATM 8286 C C33 . PX4 O  2 .   ? -25.313  -27.797 -16.379 1.00 85.19  ?  1803 PX4 B C33 1 
HETATM 8287 C C11 . PX4 P  2 .   ? -51.181  -25.651 -6.199  1.00 89.94  ?  1804 PX4 B C11 1 
HETATM 8288 C C12 . PX4 P  2 .   ? -50.919  -24.583 -5.146  1.00 106.43 ?  1804 PX4 B C12 1 
HETATM 8289 C C13 . PX4 P  2 .   ? -51.718  -24.818 -3.870  1.00 109.27 ?  1804 PX4 B C13 1 
HETATM 8290 C C14 . PX4 P  2 .   ? -50.941  -24.333 -2.650  1.00 110.77 ?  1804 PX4 B C14 1 
HETATM 8291 C C15 . PX4 P  2 .   ? -51.804  -24.303 -1.392  1.00 100.85 ?  1804 PX4 B C15 1 
HETATM 8292 C C16 . PX4 P  2 .   ? -51.005  -23.899 -0.170  1.00 89.26  ?  1804 PX4 B C16 1 
HETATM 8293 O O1  . PX4 Q  2 .   ? -27.902  -9.679  -39.555 1.00 171.34 -1 1805 PX4 B O1  1 
HETATM 8294 O O2  . PX4 Q  2 .   ? -25.917  -11.226 -40.203 1.00 163.36 ?  1805 PX4 B O2  1 
HETATM 8295 P P1  . PX4 Q  2 .   ? -27.002  -10.258 -40.623 1.00 195.16 ?  1805 PX4 B P1  1 
HETATM 8296 O O3  . PX4 Q  2 .   ? -26.340  -9.035  -41.448 1.00 188.03 ?  1805 PX4 B O3  1 
HETATM 8297 C C1  . PX4 Q  2 .   ? -26.331  -7.688  -40.963 1.00 185.12 ?  1805 PX4 B C1  1 
HETATM 8298 C C2  . PX4 Q  2 .   ? -27.478  -6.890  -41.602 1.00 177.28 ?  1805 PX4 B C2  1 
HETATM 8299 N N1  . PX4 Q  2 .   ? -27.679  -5.495  -41.136 1.00 181.19 ?  1805 PX4 B N1  1 
HETATM 8300 C C3  . PX4 Q  2 .   ? -28.770  -4.921  -41.936 1.00 188.97 ?  1805 PX4 B C3  1 
HETATM 8301 C C4  . PX4 Q  2 .   ? -28.078  -5.430  -39.719 1.00 181.50 ?  1805 PX4 B C4  1 
HETATM 8302 C C5  . PX4 Q  2 .   ? -26.493  -4.649  -41.354 1.00 177.85 ?  1805 PX4 B C5  1 
HETATM 8303 O O4  . PX4 Q  2 .   ? -27.945  -10.956 -41.736 1.00 165.02 ?  1805 PX4 B O4  1 
HETATM 8304 C C6  . PX4 Q  2 .   ? -27.478  -11.933 -42.670 1.00 144.87 ?  1805 PX4 B C6  1 
HETATM 8305 C C7  . PX4 Q  2 .   ? -28.107  -13.286 -42.350 1.00 139.51 ?  1805 PX4 B C7  1 
HETATM 8306 C C8  . PX4 Q  2 .   ? -29.441  -13.431 -43.074 1.00 123.60 ?  1805 PX4 B C8  1 
HETATM 8307 O O5  . PX4 Q  2 .   ? -29.761  -14.816 -43.224 1.00 127.71 ?  1805 PX4 B O5  1 
HETATM 8308 C C9  . PX4 Q  2 .   ? -30.589  -15.282 -44.333 1.00 121.93 ?  1805 PX4 B C9  1 
HETATM 8309 O O6  . PX4 Q  2 .   ? -31.782  -15.010 -44.339 1.00 149.68 ?  1805 PX4 B O6  1 
HETATM 8310 C C10 . PX4 Q  2 .   ? -29.973  -16.083 -45.462 1.00 104.41 ?  1805 PX4 B C10 1 
HETATM 8311 C C11 . PX4 Q  2 .   ? -30.576  -17.487 -45.555 1.00 101.75 ?  1805 PX4 B C11 1 
HETATM 8312 C C12 . PX4 Q  2 .   ? -29.785  -18.372 -46.518 1.00 110.73 ?  1805 PX4 B C12 1 
HETATM 8313 C C13 . PX4 Q  2 .   ? -30.436  -19.738 -46.700 1.00 120.62 ?  1805 PX4 B C13 1 
HETATM 8314 C C14 . PX4 Q  2 .   ? -29.385  -20.796 -47.014 1.00 114.40 ?  1805 PX4 B C14 1 
HETATM 8315 C C15 . PX4 Q  2 .   ? -30.034  -22.153 -47.267 1.00 116.59 ?  1805 PX4 B C15 1 
HETATM 8316 C C4  . 5P2 R  3 .   ? -31.436  -12.243 -37.753 1.00 147.25 ?  1806 5P2 B C4  1 
HETATM 8317 C C14 . 5P2 R  3 .   ? -29.928  -17.966 -40.520 1.00 164.45 ?  1806 5P2 B C14 1 
HETATM 8318 C C5  . 5P2 R  3 .   ? -30.650  -13.237 -38.625 1.00 143.93 ?  1806 5P2 B C5  1 
HETATM 8319 C C6  . 5P2 R  3 .   ? -30.387  -12.007 -39.504 1.00 160.35 ?  1806 5P2 B C6  1 
HETATM 8320 C C8  . 5P2 R  3 .   ? -29.144  -15.209 -38.070 1.00 148.59 ?  1806 5P2 B C8  1 
HETATM 8321 C C9  . 5P2 R  3 .   ? -27.974  -15.362 -37.380 1.00 154.10 ?  1806 5P2 B C9  1 
HETATM 8322 C C10 . 5P2 R  3 .   ? -27.585  -14.110 -36.908 1.00 167.52 ?  1806 5P2 B C10 1 
HETATM 8323 C C12 . 5P2 R  3 .   ? -29.883  -16.296 -38.763 1.00 149.98 ?  1806 5P2 B C12 1 
HETATM 8324 C C13 . 5P2 R  3 .   ? -29.260  -16.957 -39.834 1.00 153.31 ?  1806 5P2 B C13 1 
HETATM 8325 N N3  . 5P2 R  3 .   ? -30.627  -11.148 -38.327 1.00 156.17 ?  1806 5P2 B N3  1 
HETATM 8326 C C1  . 5P2 R  3 .   ? -30.784  -8.706  -38.155 1.00 165.77 ?  1806 5P2 B C1  1 
HETATM 8327 C C2  . 5P2 R  3 .   ? -31.443  -9.978  -38.692 1.00 171.63 ?  1806 5P2 B C2  1 
HETATM 8328 N N7  . 5P2 R  3 .   ? -29.470  -13.876 -38.020 1.00 152.47 ?  1806 5P2 B N7  1 
HETATM 8329 N N11 . 5P2 R  3 .   ? -28.473  -13.226 -37.274 1.00 164.69 ?  1806 5P2 B N11 1 
HETATM 8330 C C15 . 5P2 R  3 .   ? -31.220  -18.323 -40.140 1.00 168.32 ?  1806 5P2 B C15 1 
HETATM 8331 C C16 . 5P2 R  3 .   ? -31.853  -17.682 -39.086 1.00 167.13 ?  1806 5P2 B C16 1 
HETATM 8332 C C17 . 5P2 R  3 .   ? -31.190  -16.679 -38.378 1.00 166.67 ?  1806 5P2 B C17 1 
HETATM 8333 O O18 . 5P2 R  3 .   ? -31.820  -16.066 -37.331 1.00 184.50 ?  1806 5P2 B O18 1 
HETATM 8334 C C19 . 5P2 R  3 .   ? -31.876  -16.626 -36.076 1.00 175.05 ?  1806 5P2 B C19 1 
HETATM 8335 C C20 . 5P2 R  3 .   ? -31.084  -17.729 -35.708 1.00 173.84 ?  1806 5P2 B C20 1 
HETATM 8336 C C21 . 5P2 R  3 .   ? -31.169  -18.279 -34.432 1.00 161.04 ?  1806 5P2 B C21 1 
HETATM 8337 C C22 . 5P2 R  3 .   ? -32.030  -17.729 -33.481 1.00 147.59 ?  1806 5P2 B C22 1 
HETATM 8338 C C23 . 5P2 R  3 .   ? -32.812  -16.630 -33.818 1.00 148.47 ?  1806 5P2 B C23 1 
HETATM 8339 C C24 . 5P2 R  3 .   ? -32.747  -16.067 -35.108 1.00 156.90 ?  1806 5P2 B C24 1 
HETATM 8340 C C25 . 5P2 R  3 .   ? -33.571  -14.934 -35.423 1.00 141.29 ?  1806 5P2 B C25 1 
HETATM 8341 N N26 . 5P2 R  3 .   ? -34.222  -14.038 -35.666 1.00 129.56 ?  1806 5P2 B N26 1 
HETATM 8342 S S27 . 5P2 R  3 .   ? -32.117  -18.446 -31.867 1.00 138.96 ?  1806 5P2 B S27 1 
HETATM 8343 O O28 . 5P2 R  3 .   ? -30.781  -18.609 -31.441 1.00 153.52 ?  1806 5P2 B O28 1 
HETATM 8344 O O29 . 5P2 R  3 .   ? -33.030  -17.692 -31.088 1.00 144.72 ?  1806 5P2 B O29 1 
HETATM 8345 N N30 . 5P2 R  3 .   ? -32.764  -19.962 -32.044 1.00 126.53 ?  1806 5P2 B N30 1 
HETATM 8346 C C31 . 5P2 R  3 .   ? -34.080  -20.190 -32.428 1.00 142.30 ?  1806 5P2 B C31 1 
HETATM 8347 N N32 . 5P2 R  3 .   ? -34.638  -21.364 -32.633 1.00 154.59 ?  1806 5P2 B N32 1 
HETATM 8348 C C33 . 5P2 R  3 .   ? -35.902  -21.379 -32.994 1.00 147.11 ?  1806 5P2 B C33 1 
HETATM 8349 N N34 . 5P2 R  3 .   ? -36.517  -20.241 -33.116 1.00 141.17 ?  1806 5P2 B N34 1 
HETATM 8350 S S35 . 5P2 R  3 .   ? -35.353  -19.065 -32.744 1.00 147.17 ?  1806 5P2 B S35 1 
HETATM 8351 C C36 . 5P2 R  3 .   ? -29.245  -18.698 -41.654 1.00 159.45 ?  1806 5P2 B C36 1 
HETATM 8352 F F37 . 5P2 R  3 .   ? -30.177  -19.209 -42.560 1.00 172.69 ?  1806 5P2 B F37 1 
HETATM 8353 F F38 . 5P2 R  3 .   ? -28.523  -19.768 -41.119 1.00 144.46 ?  1806 5P2 B F38 1 
HETATM 8354 F F39 . 5P2 R  3 .   ? -28.379  -17.841 -42.343 1.00 148.31 ?  1806 5P2 B F39 1 
HETATM 8355 O O1  . PX4 S  2 .   ? -49.198  -10.725 -23.220 1.00 136.94 ?  1801 PX4 C O1  1 
HETATM 8356 O O2  . PX4 S  2 .   ? -47.514  -9.441  -24.736 1.00 123.26 ?  1801 PX4 C O2  1 
HETATM 8357 P P1  . PX4 S  2 .   ? -48.245  -10.716 -24.386 1.00 136.80 ?  1801 PX4 C P1  1 
HETATM 8358 O O3  . PX4 S  2 .   ? -49.101  -11.183 -25.672 1.00 130.40 ?  1801 PX4 C O3  1 
HETATM 8359 C C1  . PX4 S  2 .   ? -48.512  -11.683 -26.874 1.00 140.16 ?  1801 PX4 C C1  1 
HETATM 8360 C C2  . PX4 S  2 .   ? -49.585  -12.372 -27.731 1.00 147.13 ?  1801 PX4 C C2  1 
HETATM 8361 N N1  . PX4 S  2 .   ? -49.793  -11.855 -29.109 1.00 164.13 ?  1801 PX4 C N1  1 
HETATM 8362 C C3  . PX4 S  2 .   ? -50.220  -10.444 -29.145 1.00 158.92 ?  1801 PX4 C C3  1 
HETATM 8363 C C4  . PX4 S  2 .   ? -50.878  -12.636 -29.716 1.00 161.85 ?  1801 PX4 C C4  1 
HETATM 8364 C C5  . PX4 S  2 .   ? -48.595  -12.024 -29.948 1.00 164.39 ?  1801 PX4 C C5  1 
HETATM 8365 O O4  . PX4 S  2 .   ? -47.179  -11.899 -24.119 1.00 127.71 ?  1801 PX4 C O4  1 
HETATM 8366 C C6  . PX4 S  2 .   ? -45.854  -11.643 -23.654 1.00 124.02 ?  1801 PX4 C C6  1 
HETATM 8367 C C7  . PX4 S  2 .   ? -45.255  -12.889 -23.013 1.00 117.56 ?  1801 PX4 C C7  1 
HETATM 8368 O O7  . PX4 S  2 .   ? -46.176  -13.460 -22.091 1.00 100.17 ?  1801 PX4 C O7  1 
HETATM 8369 O O1  . PX4 T  2 .   ? -27.058  -12.142 -11.443 1.00 142.58 ?  1802 PX4 C O1  1 
HETATM 8370 O O2  . PX4 T  2 .   ? -25.187  -11.738 -9.700  1.00 192.39 ?  1802 PX4 C O2  1 
HETATM 8371 P P1  . PX4 T  2 .   ? -26.452  -12.464 -10.100 1.00 169.93 ?  1802 PX4 C P1  1 
HETATM 8372 O O3  . PX4 T  2 .   ? -27.595  -12.232 -8.979  1.00 170.30 ?  1802 PX4 C O3  1 
HETATM 8373 C C1  . PX4 T  2 .   ? -27.332  -11.619 -7.715  1.00 173.65 ?  1802 PX4 C C1  1 
HETATM 8374 C C2  . PX4 T  2 .   ? -28.165  -10.343 -7.559  1.00 176.84 ?  1802 PX4 C C2  1 
HETATM 8375 N N1  . PX4 T  2 .   ? -29.628  -10.499 -7.370  1.00 171.23 ?  1802 PX4 C N1  1 
HETATM 8376 C C3  . PX4 T  2 .   ? -30.030  -11.681 -6.589  1.00 167.94 ?  1802 PX4 C C3  1 
HETATM 8377 C C4  . PX4 T  2 .   ? -30.094  -9.294  -6.677  1.00 165.58 ?  1802 PX4 C C4  1 
HETATM 8378 C C5  . PX4 T  2 .   ? -30.330  -10.537 -8.657  1.00 166.15 ?  1802 PX4 C C5  1 
HETATM 8379 O O4  . PX4 T  2 .   ? -26.139  -14.053 -10.061 1.00 162.25 ?  1802 PX4 C O4  1 
HETATM 8380 C C6  . PX4 T  2 .   ? -26.591  -14.954 -9.040  1.00 153.04 ?  1802 PX4 C C6  1 
HETATM 8381 C C7  . PX4 T  2 .   ? -27.513  -15.981 -9.680  1.00 150.19 ?  1802 PX4 C C7  1 
HETATM 8382 C C8  . PX4 T  2 .   ? -26.892  -17.377 -9.622  1.00 147.01 ?  1802 PX4 C C8  1 
HETATM 8383 O O5  . PX4 T  2 .   ? -27.723  -18.247 -10.397 1.00 149.12 ?  1802 PX4 C O5  1 
HETATM 8384 C C9  . PX4 T  2 .   ? -27.367  -18.708 -11.738 1.00 141.06 ?  1802 PX4 C C9  1 
HETATM 8385 O O6  . PX4 T  2 .   ? -27.034  -17.894 -12.592 1.00 139.88 ?  1802 PX4 C O6  1 
HETATM 8386 C C10 . PX4 T  2 .   ? -27.450  -20.184 -12.081 1.00 124.74 ?  1802 PX4 C C10 1 
HETATM 8387 C C11 . PX4 T  2 .   ? -26.985  -21.063 -10.921 1.00 121.60 ?  1802 PX4 C C11 1 
HETATM 8388 C C12 . PX4 T  2 .   ? -28.167  -21.721 -10.217 1.00 118.04 ?  1802 PX4 C C12 1 
HETATM 8389 C C13 . PX4 T  2 .   ? -27.733  -22.467 -8.959  1.00 117.80 ?  1802 PX4 C C13 1 
HETATM 8390 C C14 . PX4 T  2 .   ? -28.422  -23.824 -8.832  1.00 118.87 ?  1802 PX4 C C14 1 
HETATM 8391 C C15 . PX4 T  2 .   ? -27.993  -24.544 -7.557  1.00 118.87 ?  1802 PX4 C C15 1 
HETATM 8392 C C16 . PX4 T  2 .   ? -28.895  -25.728 -7.233  1.00 116.50 ?  1802 PX4 C C16 1 
HETATM 8393 C C17 . PX4 T  2 .   ? -28.630  -26.266 -5.834  1.00 116.88 ?  1802 PX4 C C17 1 
HETATM 8394 C C18 . PX4 T  2 .   ? -29.936  -26.453 -5.075  1.00 126.71 ?  1802 PX4 C C18 1 
HETATM 8395 C C19 . PX4 T  2 .   ? -29.913  -27.733 -4.250  1.00 132.66 ?  1802 PX4 C C19 1 
HETATM 8396 O O7  . PX4 T  2 .   ? -28.881  -15.928 -9.222  1.00 147.56 ?  1802 PX4 C O7  1 
HETATM 8397 C C23 . PX4 T  2 .   ? -29.310  -16.517 -7.957  1.00 134.57 ?  1802 PX4 C C23 1 
HETATM 8398 O O8  . PX4 T  2 .   ? -29.081  -15.901 -6.935  1.00 126.03 ?  1802 PX4 C O8  1 
HETATM 8399 C C24 . PX4 T  2 .   ? -30.079  -17.827 -7.961  1.00 123.93 ?  1802 PX4 C C24 1 
HETATM 8400 C C25 . PX4 T  2 .   ? -30.634  -18.241 -6.603  1.00 122.04 ?  1802 PX4 C C25 1 
HETATM 8401 C C26 . PX4 T  2 .   ? -32.095  -18.657 -6.722  1.00 128.69 ?  1802 PX4 C C26 1 
HETATM 8402 C C27 . PX4 T  2 .   ? -32.389  -19.896 -5.891  1.00 143.41 ?  1802 PX4 C C27 1 
HETATM 8403 C C11 . PX4 U  2 .   ? -30.976  -32.151 23.885  1.00 89.48  ?  1803 PX4 C C11 1 
HETATM 8404 C C12 . PX4 U  2 .   ? -30.809  -30.636 23.849  1.00 99.43  ?  1803 PX4 C C12 1 
HETATM 8405 C C13 . PX4 U  2 .   ? -29.393  -30.225 23.465  1.00 100.05 ?  1803 PX4 C C13 1 
HETATM 8406 C C14 . PX4 U  2 .   ? -29.008  -28.926 24.159  1.00 103.36 ?  1803 PX4 C C14 1 
HETATM 8407 C C15 . PX4 U  2 .   ? -28.164  -28.049 23.245  1.00 106.19 ?  1803 PX4 C C15 1 
HETATM 8408 C C16 . PX4 U  2 .   ? -27.761  -26.757 23.942  1.00 99.35  ?  1803 PX4 C C16 1 
HETATM 8409 C C17 . PX4 U  2 .   ? -28.420  -25.557 23.275  1.00 96.28  ?  1803 PX4 C C17 1 
HETATM 8410 C C18 . PX4 U  2 .   ? -28.395  -24.338 24.188  1.00 86.10  ?  1803 PX4 C C18 1 
HETATM 8411 O O1  . PX4 V  2 .   ? -4.353   -2.332  20.858  1.00 147.49 ?  1804 PX4 C O1  1 
HETATM 8412 O O2  . PX4 V  2 .   ? -6.692   -3.227  20.691  1.00 183.33 ?  1804 PX4 C O2  1 
HETATM 8413 P P1  . PX4 V  2 .   ? -5.189   -3.554  21.167  1.00 174.42 ?  1804 PX4 C P1  1 
HETATM 8414 O O3  . PX4 V  2 .   ? -5.269   -4.096  22.577  1.00 179.45 ?  1804 PX4 C O3  1 
HETATM 8415 O O4  . PX4 V  2 .   ? -4.719   -4.750  20.186  1.00 173.17 ?  1804 PX4 C O4  1 
HETATM 8416 C C6  . PX4 V  2 .   ? -3.468   -5.421  20.360  1.00 154.25 ?  1804 PX4 C C6  1 
HETATM 8417 C C7  . PX4 V  2 .   ? -3.302   -6.488  19.281  1.00 148.51 ?  1804 PX4 C C7  1 
HETATM 8418 C C8  . PX4 V  2 .   ? -2.223   -6.068  18.287  1.00 150.22 ?  1804 PX4 C C8  1 
HETATM 8419 O O5  . PX4 V  2 .   ? -2.770   -5.173  17.318  1.00 155.54 ?  1804 PX4 C O5  1 
HETATM 8420 C C4  . 5P2 W  3 .   ? -9.128   -4.783  17.289  1.00 151.55 ?  1805 5P2 C C4  1 
HETATM 8421 C C14 . 5P2 W  3 .   ? -5.713   -10.346 18.741  1.00 189.53 ?  1805 5P2 C C14 1 
HETATM 8422 C C5  . 5P2 W  3 .   ? -8.233   -5.912  17.830  1.00 150.92 ?  1805 5P2 C C5  1 
HETATM 8423 C C6  . 5P2 W  3 .   ? -7.100   -4.875  17.808  1.00 143.09 ?  1805 5P2 C C6  1 
HETATM 8424 C C8  . 5P2 W  3 .   ? -8.335   -7.749  19.590  1.00 182.64 ?  1805 5P2 C C8  1 
HETATM 8425 C C9  . 5P2 W  3 .   ? -8.867   -7.838  20.847  1.00 178.16 ?  1805 5P2 C C9  1 
HETATM 8426 C C10 . 5P2 W  3 .   ? -9.453   -6.615  21.170  1.00 171.93 ?  1805 5P2 C C10 1 
HETATM 8427 C C12 . 5P2 W  3 .   ? -7.621   -8.856  18.892  1.00 191.71 ?  1805 5P2 C C12 1 
HETATM 8428 C C13 . 5P2 W  3 .   ? -6.383   -9.305  19.377  1.00 186.74 ?  1805 5P2 C C13 1 
HETATM 8429 N N3  . 5P2 W  3 .   ? -7.968   -3.882  17.139  1.00 151.05 ?  1805 5P2 C N3  1 
HETATM 8430 C C1  . 5P2 W  3 .   ? -7.567   -2.156  15.421  1.00 124.57 ?  1805 5P2 C C1  1 
HETATM 8431 C C2  . 5P2 W  3 .   ? -7.600   -3.654  15.726  1.00 147.93 ?  1805 5P2 C C2  1 
HETATM 8432 N N7  . 5P2 W  3 .   ? -8.592   -6.474  19.141  1.00 167.61 ?  1805 5P2 C N7  1 
HETATM 8433 N N11 . 5P2 W  3 .   ? -9.295   -5.804  20.157  1.00 166.09 ?  1805 5P2 C N11 1 
HETATM 8434 C C15 . 5P2 W  3 .   ? -6.261   -10.955 17.617  1.00 201.46 ?  1805 5P2 C C15 1 
HETATM 8435 C C16 . 5P2 W  3 .   ? -7.483   -10.530 17.124  1.00 201.39 ?  1805 5P2 C C16 1 
HETATM 8436 C C17 . 5P2 W  3 .   ? -8.174   -9.494  17.760  1.00 198.88 ?  1805 5P2 C C17 1 
HETATM 8437 O O18 . 5P2 W  3 .   ? -9.371   -9.072  17.276  1.00 193.77 ?  1805 5P2 C O18 1 
HETATM 8438 C C19 . 5P2 W  3 .   ? -10.452  -9.897  17.244  1.00 183.92 ?  1805 5P2 C C19 1 
HETATM 8439 C C20 . 5P2 W  3 .   ? -10.681  -10.853 18.243  1.00 179.38 ?  1805 5P2 C C20 1 
HETATM 8440 C C21 . 5P2 W  3 .   ? -11.789  -11.681 18.170  1.00 183.00 ?  1805 5P2 C C21 1 
HETATM 8441 C C22 . 5P2 W  3 .   ? -12.710  -11.527 17.136  1.00 165.77 ?  1805 5P2 C C22 1 
HETATM 8442 C C23 . 5P2 W  3 .   ? -12.509  -10.572 16.147  1.00 162.20 ?  1805 5P2 C C23 1 
HETATM 8443 C C24 . 5P2 W  3 .   ? -11.369  -9.756  16.183  1.00 176.00 ?  1805 5P2 C C24 1 
HETATM 8444 C C25 . 5P2 W  3 .   ? -11.158  -8.755  15.178  1.00 174.67 ?  1805 5P2 C C25 1 
HETATM 8445 N N26 . 5P2 W  3 .   ? -10.979  -7.957  14.391  1.00 159.15 ?  1805 5P2 C N26 1 
HETATM 8446 S S27 . 5P2 W  3 .   ? -14.102  -12.605 17.074  1.00 150.41 ?  1805 5P2 C S27 1 
HETATM 8447 O O28 . 5P2 W  3 .   ? -14.524  -12.812 18.408  1.00 130.62 ?  1805 5P2 C O28 1 
HETATM 8448 O O29 . 5P2 W  3 .   ? -14.989  -12.122 16.079  1.00 156.13 ?  1805 5P2 C O29 1 
HETATM 8449 N N30 . 5P2 W  3 .   ? -13.485  -14.040 16.529  1.00 114.04 ?  1805 5P2 C N30 1 
HETATM 8450 C C31 . 5P2 W  3 .   ? -13.166  -14.264 15.196  1.00 107.63 ?  1805 5P2 C C31 1 
HETATM 8451 N N32 . 5P2 W  3 .   ? -12.951  -15.434 14.636  1.00 108.23 ?  1805 5P2 C N32 1 
HETATM 8452 C C33 . 5P2 W  3 .   ? -12.672  -15.444 13.352  1.00 115.07 ?  1805 5P2 C C33 1 
HETATM 8453 N N34 . 5P2 W  3 .   ? -12.619  -14.307 12.722  1.00 115.44 ?  1805 5P2 C N34 1 
HETATM 8454 S S35 . 5P2 W  3 .   ? -12.959  -13.135 13.904  1.00 121.08 ?  1805 5P2 C S35 1 
HETATM 8455 C C36 . 5P2 W  3 .   ? -4.377   -10.828 19.244  1.00 181.24 ?  1805 5P2 C C36 1 
HETATM 8456 F F37 . 5P2 W  3 .   ? -3.423   -10.645 18.239  1.00 173.22 ?  1805 5P2 C F37 1 
HETATM 8457 F F38 . 5P2 W  3 .   ? -4.468   -12.183 19.582  1.00 181.98 ?  1805 5P2 C F38 1 
HETATM 8458 F F39 . 5P2 W  3 .   ? -3.979   -10.101 20.365  1.00 169.11 ?  1805 5P2 C F39 1 
HETATM 8459 O O1  . PX4 X  2 .   ? -35.262  -8.925  20.467  1.00 166.99 ?  1801 PX4 D O1  1 
HETATM 8460 O O2  . PX4 X  2 .   ? -35.295  -7.407  22.545  1.00 138.72 ?  1801 PX4 D O2  1 
HETATM 8461 P P1  . PX4 X  2 .   ? -35.874  -8.586  21.803  1.00 153.26 ?  1801 PX4 D P1  1 
HETATM 8462 O O3  . PX4 X  2 .   ? -37.470  -8.324  21.655  1.00 164.78 ?  1801 PX4 D O3  1 
HETATM 8463 C C1  . PX4 X  2 .   ? -38.246  -8.640  20.494  1.00 146.79 ?  1801 PX4 D C1  1 
HETATM 8464 C C2  . PX4 X  2 .   ? -38.787  -7.367  19.829  1.00 150.14 ?  1801 PX4 D C2  1 
HETATM 8465 N N1  . PX4 X  2 .   ? -38.077  -6.924  18.603  1.00 157.62 ?  1801 PX4 D N1  1 
HETATM 8466 C C3  . PX4 X  2 .   ? -36.719  -6.439  18.893  1.00 160.22 ?  1801 PX4 D C3  1 
HETATM 8467 C C4  . PX4 X  2 .   ? -38.036  -7.985  17.582  1.00 157.31 ?  1801 PX4 D C4  1 
HETATM 8468 C C5  . PX4 X  2 .   ? -38.783  -5.769  18.037  1.00 154.29 ?  1801 PX4 D C5  1 
HETATM 8469 O O4  . PX4 X  2 .   ? -35.733  -9.887  22.759  1.00 144.85 ?  1801 PX4 D O4  1 
HETATM 8470 C C6  . PX4 X  2 .   ? -36.652  -10.989 22.776  1.00 140.85 ?  1801 PX4 D C6  1 
HETATM 8471 C C7  . PX4 X  2 .   ? -36.136  -12.161 21.938  1.00 139.06 ?  1801 PX4 D C7  1 
HETATM 8472 C C8  . PX4 X  2 .   ? -35.114  -12.960 22.745  1.00 134.11 ?  1801 PX4 D C8  1 
HETATM 8473 O O5  . PX4 X  2 .   ? -33.834  -12.332 22.675  1.00 119.40 ?  1801 PX4 D O5  1 
HETATM 8474 O O7  . PX4 X  2 .   ? -37.218  -13.018 21.540  1.00 125.59 ?  1801 PX4 D O7  1 
HETATM 8475 C C23 . PX4 X  2 .   ? -37.695  -12.838 20.170  1.00 106.40 ?  1801 PX4 D C23 1 
HETATM 8476 O O8  . PX4 X  2 .   ? -38.285  -11.817 19.863  1.00 109.58 ?  1801 PX4 D O8  1 
HETATM 8477 C C24 . PX4 X  2 .   ? -37.482  -13.911 19.127  1.00 109.56 ?  1801 PX4 D C24 1 
HETATM 8478 C C25 . PX4 X  2 .   ? -38.751  -14.740 18.926  1.00 109.08 ?  1801 PX4 D C25 1 
HETATM 8479 C C26 . PX4 X  2 .   ? -38.732  -15.513 17.609  1.00 101.48 ?  1801 PX4 D C26 1 
HETATM 8480 C C27 . PX4 X  2 .   ? -38.153  -16.910 17.793  1.00 95.70  ?  1801 PX4 D C27 1 
HETATM 8481 C C28 . PX4 X  2 .   ? -38.737  -17.906 16.803  1.00 101.62 ?  1801 PX4 D C28 1 
HETATM 8482 C C29 . PX4 X  2 .   ? -37.658  -18.852 16.293  1.00 115.08 ?  1801 PX4 D C29 1 
HETATM 8483 C C30 . PX4 X  2 .   ? -37.764  -20.241 16.919  1.00 114.54 ?  1801 PX4 D C30 1 
HETATM 8484 C C31 . PX4 X  2 .   ? -37.992  -21.307 15.853  1.00 109.79 ?  1801 PX4 D C31 1 
HETATM 8485 C C32 . PX4 X  2 .   ? -37.387  -22.650 16.241  1.00 100.57 ?  1801 PX4 D C32 1 
HETATM 8486 C C33 . PX4 X  2 .   ? -38.134  -23.774 15.537  1.00 85.19  ?  1801 PX4 D C33 1 
HETATM 8487 O O1  . PX4 Y  2 .   ? -21.853  -6.410  0.226   1.00 147.21 ?  1802 PX4 D O1  1 
HETATM 8488 O O2  . PX4 Y  2 .   ? -23.195  -8.145  -1.178  1.00 141.35 ?  1802 PX4 D O2  1 
HETATM 8489 P P1  . PX4 Y  2 .   ? -22.209  -7.846  -0.082  1.00 152.75 ?  1802 PX4 D P1  1 
HETATM 8490 O O3  . PX4 Y  2 .   ? -20.867  -8.672  -0.418  1.00 153.71 ?  1802 PX4 D O3  1 
HETATM 8491 C C1  . PX4 Y  2 .   ? -19.760  -8.767  0.479   1.00 160.11 ?  1802 PX4 D C1  1 
HETATM 8492 C C2  . PX4 Y  2 .   ? -18.465  -8.520  -0.308  1.00 162.06 ?  1802 PX4 D C2  1 
HETATM 8493 N N1  . PX4 Y  2 .   ? -17.622  -9.695  -0.643  1.00 155.11 ?  1802 PX4 D N1  1 
HETATM 8494 C C3  . PX4 Y  2 .   ? -16.475  -9.202  -1.416  1.00 155.65 ?  1802 PX4 D C3  1 
HETATM 8495 C C4  . PX4 Y  2 .   ? -17.099  -10.368 0.558   1.00 140.84 ?  1802 PX4 D C4  1 
HETATM 8496 C C5  . PX4 Y  2 .   ? -18.317  -10.673 -1.498  1.00 164.56 ?  1802 PX4 D C5  1 
HETATM 8497 O O4  . PX4 Y  2 .   ? -22.738  -8.549  1.261   1.00 125.39 ?  1802 PX4 D O4  1 
HETATM 8498 C C6  . PX4 Y  2 .   ? -23.353  -9.833  1.229   1.00 102.68 ?  1802 PX4 D C6  1 
HETATM 8499 C C7  . PX4 Y  2 .   ? -23.175  -10.509 2.579   1.00 109.43 ?  1802 PX4 D C7  1 
HETATM 8500 C C8  . PX4 Y  2 .   ? -23.917  -9.726  3.656   1.00 116.03 ?  1802 PX4 D C8  1 
HETATM 8501 O O7  . PX4 Y  2 .   ? -23.695  -11.833 2.502   1.00 111.03 ?  1802 PX4 D O7  1 
HETATM 8502 C C11 . PX4 Z  2 .   ? -44.216  -23.341 10.851  1.00 93.01  ?  1803 PX4 D C11 1 
HETATM 8503 C C12 . PX4 Z  2 .   ? -43.474  -22.946 9.580   1.00 102.75 ?  1803 PX4 D C12 1 
HETATM 8504 C C13 . PX4 Z  2 .   ? -44.282  -23.273 8.328   1.00 108.71 ?  1803 PX4 D C13 1 
HETATM 8505 C C14 . PX4 Z  2 .   ? -43.445  -23.095 7.065   1.00 103.67 ?  1803 PX4 D C14 1 
HETATM 8506 C C15 . PX4 Z  2 .   ? -44.308  -23.084 5.822   1.00 84.83  ?  1803 PX4 D C15 1 
HETATM 8507 C C23 . PX4 AA 2 .   ? -75.406  -11.454 29.886  1.00 101.89 ?  1804 PX4 D C23 1 
HETATM 8508 C C24 . PX4 AA 2 .   ? -75.398  -12.746 29.079  1.00 106.26 ?  1804 PX4 D C24 1 
HETATM 8509 C C25 . PX4 AA 2 .   ? -75.492  -13.956 30.003  1.00 107.68 ?  1804 PX4 D C25 1 
HETATM 8510 C C26 . PX4 AA 2 .   ? -75.401  -15.272 29.235  1.00 111.16 ?  1804 PX4 D C26 1 
HETATM 8511 C C27 . PX4 AA 2 .   ? -75.406  -16.458 30.194  1.00 110.92 ?  1804 PX4 D C27 1 
HETATM 8512 C C28 . PX4 AA 2 .   ? -76.681  -17.282 30.051  1.00 98.64  ?  1804 PX4 D C28 1 
HETATM 8513 O O1  . PX4 BA 2 .   ? -69.104  -0.285  41.585  1.00 208.87 -1 1805 PX4 D O1  1 
HETATM 8514 O O2  . PX4 BA 2 .   ? -66.646  0.004   40.777  1.00 252.82 ?  1805 PX4 D O2  1 
HETATM 8515 P P1  . PX4 BA 2 .   ? -67.722  0.288   41.799  1.00 227.34 ?  1805 PX4 D P1  1 
HETATM 8516 O O3  . PX4 BA 2 .   ? -67.874  1.887   41.991  1.00 210.12 ?  1805 PX4 D O3  1 
HETATM 8517 C C1  . PX4 BA 2 .   ? -66.958  2.834   41.437  1.00 193.51 ?  1805 PX4 D C1  1 
HETATM 8518 C C2  . PX4 BA 2 .   ? -66.545  3.841   42.519  1.00 188.13 ?  1805 PX4 D C2  1 
HETATM 8519 N N1  . PX4 BA 2 .   ? -65.823  5.059   42.073  1.00 186.68 ?  1805 PX4 D N1  1 
HETATM 8520 C C3  . PX4 BA 2 .   ? -66.631  5.893   41.167  1.00 195.52 ?  1805 PX4 D C3  1 
HETATM 8521 C C4  . PX4 BA 2 .   ? -65.538  5.864   43.267  1.00 181.03 ?  1805 PX4 D C4  1 
HETATM 8522 C C5  . PX4 BA 2 .   ? -64.530  4.741   41.447  1.00 175.45 ?  1805 PX4 D C5  1 
HETATM 8523 O O4  . PX4 BA 2 .   ? -67.200  -0.202  43.245  1.00 206.42 ?  1805 PX4 D O4  1 
HETATM 8524 C C6  . PX4 BA 2 .   ? -67.145  -1.586  43.594  1.00 193.77 ?  1805 PX4 D C6  1 
HETATM 8525 C C7  . PX4 BA 2 .   ? -65.888  -1.852  44.414  1.00 187.70 ?  1805 PX4 D C7  1 
HETATM 8526 C C8  . PX4 BA 2 .   ? -65.832  -3.316  44.833  1.00 177.69 ?  1805 PX4 D C8  1 
HETATM 8527 O O5  . PX4 BA 2 .   ? -65.498  -3.388  46.219  1.00 156.64 ?  1805 PX4 D O5  1 
HETATM 8528 C C9  . PX4 BA 2 .   ? -65.201  -4.657  46.870  1.00 140.34 ?  1805 PX4 D C9  1 
HETATM 8529 O O6  . PX4 BA 2 .   ? -64.041  -5.048  46.873  1.00 177.85 ?  1805 PX4 D O6  1 
HETATM 8530 C C10 . PX4 BA 2 .   ? -66.325  -5.457  47.511  1.00 115.33 ?  1805 PX4 D C10 1 
HETATM 8531 C C11 . PX4 BA 2 .   ? -65.989  -5.961  48.914  1.00 104.42 ?  1805 PX4 D C11 1 
HETATM 8532 C C12 . PX4 BA 2 .   ? -66.618  -7.326  49.175  1.00 113.55 ?  1805 PX4 D C12 1 
HETATM 8533 C C4  . 5P2 CA 3 .   ? -63.489  -3.680  39.518  1.00 158.65 ?  1806 5P2 D C4  1 
HETATM 8534 C C14 . 5P2 CA 3 .   ? -64.692  -8.536  43.279  1.00 164.29 ?  1806 5P2 D C14 1 
HETATM 8535 C C5  . 5P2 CA 3 .   ? -64.437  -4.184  40.618  1.00 165.51 ?  1806 5P2 D C5  1 
HETATM 8536 C C6  . 5P2 CA 3 .   ? -64.684  -2.687  40.857  1.00 168.29 ?  1806 5P2 D C6  1 
HETATM 8537 C C8  . 5P2 CA 3 .   ? -65.791  -6.329  40.409  1.00 173.76 ?  1806 5P2 D C8  1 
HETATM 8538 C C9  . 5P2 CA 3 .   ? -66.929  -6.686  39.742  1.00 162.14 ?  1806 5P2 D C9  1 
HETATM 8539 C C10 . 5P2 CA 3 .   ? -67.392  -5.564  39.059  1.00 159.63 ?  1806 5P2 D C10 1 
HETATM 8540 C C12 . 5P2 CA 3 .   ? -64.972  -7.237  41.254  1.00 180.00 ?  1806 5P2 D C12 1 
HETATM 8541 C C13 . 5P2 CA 3 .   ? -65.464  -7.685  42.492  1.00 175.70 ?  1806 5P2 D C13 1 
HETATM 8542 N N3  . 5P2 CA 3 .   ? -64.273  -2.433  39.463  1.00 155.26 ?  1806 5P2 D N3  1 
HETATM 8543 C C1  . 5P2 CA 3 .   ? -63.907  -0.378  38.201  1.00 179.27 ?  1806 5P2 D C1  1 
HETATM 8544 C C2  . 5P2 CA 3 .   ? -63.406  -1.251  39.353  1.00 170.68 ?  1806 5P2 D C2  1 
HETATM 8545 N N7  . 5P2 CA 3 .   ? -65.563  -5.002  40.140  1.00 175.57 ?  1806 5P2 D N7  1 
HETATM 8546 N N11 . 5P2 CA 3 .   ? -66.590  -4.563  39.293  1.00 169.43 ?  1806 5P2 D N11 1 
HETATM 8547 C C15 . 5P2 CA 3 .   ? -63.424  -8.926  42.850  1.00 174.77 ?  1806 5P2 D C15 1 
HETATM 8548 C C16 . 5P2 CA 3 .   ? -62.921  -8.489  41.633  1.00 175.84 ?  1806 5P2 D C16 1 
HETATM 8549 C C17 . 5P2 CA 3 .   ? -63.693  -7.655  40.826  1.00 177.41 ?  1806 5P2 D C17 1 
HETATM 8550 O O18 . 5P2 CA 3 .   ? -63.211  -7.229  39.629  1.00 169.11 ?  1806 5P2 D O18 1 
HETATM 8551 C C19 . 5P2 CA 3 .   ? -63.123  -8.093  38.580  1.00 169.13 ?  1806 5P2 D C19 1 
HETATM 8552 C C20 . 5P2 CA 3 .   ? -64.070  -9.105  38.375  1.00 173.71 ?  1806 5P2 D C20 1 
HETATM 8553 C C21 . 5P2 CA 3 .   ? -63.935  -9.979  37.305  1.00 180.43 ?  1806 5P2 D C21 1 
HETATM 8554 C C22 . 5P2 CA 3 .   ? -62.877  -9.835  36.408  1.00 163.72 ?  1806 5P2 D C22 1 
HETATM 8555 C C23 . 5P2 CA 3 .   ? -61.940  -8.830  36.584  1.00 157.79 ?  1806 5P2 D C23 1 
HETATM 8556 C C24 . 5P2 CA 3 .   ? -62.053  -7.954  37.672  1.00 162.14 ?  1806 5P2 D C24 1 
HETATM 8557 C C25 . 5P2 CA 3 .   ? -61.081  -6.921  37.839  1.00 153.98 ?  1806 5P2 D C25 1 
HETATM 8558 N N26 . 5P2 CA 3 .   ? -60.311  -6.104  37.961  1.00 146.53 ?  1806 5P2 D N26 1 
HETATM 8559 S S27 . 5P2 CA 3 .   ? -62.720  -10.951 35.053  1.00 149.48 ?  1806 5P2 D S27 1 
HETATM 8560 O O28 . 5P2 CA 3 .   ? -64.022  -11.123 34.534  1.00 157.96 ?  1806 5P2 D O28 1 
HETATM 8561 O O29 . 5P2 CA 3 .   ? -61.662  -10.482 34.229  1.00 137.94 ?  1806 5P2 D O29 1 
HETATM 8562 N N30 . 5P2 CA 3 .   ? -62.253  -12.409 35.700  1.00 131.70 ?  1806 5P2 D N30 1 
HETATM 8563 C C31 . 5P2 CA 3 .   ? -60.953  -12.666 36.127  1.00 139.60 ?  1806 5P2 D C31 1 
HETATM 8564 N N32 . 5P2 CA 3 .   ? -60.457  -13.842 36.447  1.00 144.22 ?  1806 5P2 D N32 1 
HETATM 8565 C C33 . 5P2 CA 3 .   ? -59.199  -13.882 36.822  1.00 152.83 ?  1806 5P2 D C33 1 
HETATM 8566 N N34 . 5P2 CA 3 .   ? -58.531  -12.768 36.853  1.00 147.59 ?  1806 5P2 D N34 1 
HETATM 8567 S S35 . 5P2 CA 3 .   ? -59.631  -11.575 36.357  1.00 148.03 ?  1806 5P2 D S35 1 
HETATM 8568 C C36 . 5P2 CA 3 .   ? -65.220  -9.021  44.611  1.00 146.92 ?  1806 5P2 D C36 1 
HETATM 8569 F F37 . 5P2 CA 3 .   ? -65.196  -7.969  45.525  1.00 139.13 ?  1806 5P2 D F37 1 
HETATM 8570 F F38 . 5P2 CA 3 .   ? -64.441  -10.070 45.109  1.00 136.57 ?  1806 5P2 D F38 1 
HETATM 8571 F F39 . 5P2 CA 3 .   ? -66.535  -9.471  44.472  1.00 142.05 ?  1806 5P2 D F39 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -17  ?    ?   ?   A . n 
A 1 2   ASP 2   -16  ?    ?   ?   A . n 
A 1 3   TYR 3   -15  ?    ?   ?   A . n 
A 1 4   LYS 4   -14  ?    ?   ?   A . n 
A 1 5   ASP 5   -13  ?    ?   ?   A . n 
A 1 6   ASP 6   -12  ?    ?   ?   A . n 
A 1 7   ASP 7   -11  ?    ?   ?   A . n 
A 1 8   ASP 8   -10  ?    ?   ?   A . n 
A 1 9   LYS 9   -9   ?    ?   ?   A . n 
A 1 10  GLY 10  -8   ?    ?   ?   A . n 
A 1 11  SER 11  -7   ?    ?   ?   A . n 
A 1 12  LEU 12  -6   ?    ?   ?   A . n 
A 1 13  VAL 13  -5   ?    ?   ?   A . n 
A 1 14  PRO 14  -4   -4   PRO PRO A . n 
A 1 15  ARG 15  -3   -3   ARG ARG A . n 
A 1 16  GLY 16  -2   -2   GLY GLY A . n 
A 1 17  SER 17  -1   -1   SER SER A . n 
A 1 18  HIS 18  0    0    HIS HIS A . n 
A 1 19  MET 19  1493 1493 MET MET A . n 
A 1 20  TYR 20  1494 1494 TYR TYR A . n 
A 1 21  LEU 21  1495 1495 LEU LEU A . n 
A 1 22  ARG 22  1496 1496 ARG ARG A . n 
A 1 23  ILE 23  1497 1497 ILE ILE A . n 
A 1 24  THR 24  1498 1498 THR THR A . n 
A 1 25  ASN 25  1499 1499 ASN ASN A . n 
A 1 26  ILE 26  1500 1500 ILE ILE A . n 
A 1 27  VAL 27  1501 1501 VAL VAL A . n 
A 1 28  GLU 28  1502 1502 GLU GLU A . n 
A 1 29  SER 29  1503 1503 SER SER A . n 
A 1 30  SER 30  1504 1504 SER SER A . n 
A 1 31  PHE 31  1505 1505 PHE PHE A . n 
A 1 32  PHE 32  1506 1506 PHE PHE A . n 
A 1 33  THR 33  1507 1507 THR THR A . n 
A 1 34  LYS 34  1508 1508 LYS LYS A . n 
A 1 35  PHE 35  1509 1509 PHE PHE A . n 
A 1 36  ILE 36  1510 1510 ILE ILE A . n 
A 1 37  ILE 37  1511 1511 ILE ILE A . n 
A 1 38  TYR 38  1512 1512 TYR TYR A . n 
A 1 39  LEU 39  1513 1513 LEU LEU A . n 
A 1 40  ILE 40  1514 1514 ILE ILE A . n 
A 1 41  VAL 41  1515 1515 VAL VAL A . n 
A 1 42  LEU 42  1516 1516 LEU LEU A . n 
A 1 43  ASN 43  1517 1517 ASN ASN A . n 
A 1 44  MET 44  1518 1518 MET MET A . n 
A 1 45  VAL 45  1519 1519 VAL VAL A . n 
A 1 46  THR 46  1520 1520 THR THR A . n 
A 1 47  MET 47  1521 1521 MET MET A . n 
A 1 48  MET 48  1522 1522 MET MET A . n 
A 1 49  VAL 49  1523 1523 VAL VAL A . n 
A 1 50  GLU 50  1524 1524 GLU GLU A . n 
A 1 51  LYS 51  1525 1525 LYS LYS A . n 
A 1 52  GLU 52  1526 1526 GLU GLU A . n 
A 1 53  GLY 53  1527 1527 GLY GLY A . n 
A 1 54  GLN 54  1528 1528 GLN GLN A . n 
A 1 55  SER 55  1529 1529 SER SER A . n 
A 1 56  GLN 56  1530 1530 GLN GLN A . n 
A 1 57  HIS 57  1531 1531 HIS HIS A . n 
A 1 58  MET 58  1532 1532 MET MET A . n 
A 1 59  THR 59  1533 1533 THR THR A . n 
A 1 60  GLU 60  1534 1534 GLU GLU A . n 
A 1 61  VAL 61  1535 1535 VAL VAL A . n 
A 1 62  LEU 62  1536 1536 LEU LEU A . n 
A 1 63  TYR 63  1537 1537 TYR TYR A . n 
A 1 64  TRP 64  1538 1538 TRP TRP A . n 
A 1 65  ILE 65  1539 1539 ILE ILE A . n 
A 1 66  ASN 66  1540 1540 ASN ASN A . n 
A 1 67  VAL 67  1541 1541 VAL VAL A . n 
A 1 68  VAL 68  1542 1542 VAL VAL A . n 
A 1 69  PHE 69  1543 1543 PHE PHE A . n 
A 1 70  ILE 70  1544 1544 ILE ILE A . n 
A 1 71  ILE 71  1545 1545 ILE ILE A . n 
A 1 72  LEU 72  1546 1546 LEU LEU A . n 
A 1 73  PHE 73  1547 1547 PHE PHE A . n 
A 1 74  THR 74  1548 1548 THR THR A . n 
A 1 75  ILE 75  1549 1549 ILE ILE A . n 
A 1 76  GLU 76  1550 1550 GLU GLU A . n 
A 1 77  ILE 77  1551 1551 ILE ILE A . n 
A 1 78  ILE 78  1552 1552 ILE ILE A . n 
A 1 79  LEU 79  1553 1553 LEU LEU A . n 
A 1 80  ARG 80  1554 1554 ARG ARG A . n 
A 1 81  ILE 81  1555 1555 ILE ILE A . n 
A 1 82  TYR 82  1556 1556 TYR TYR A . n 
A 1 83  VAL 83  1557 1557 VAL VAL A . n 
A 1 84  HIS 84  1558 1558 HIS HIS A . n 
A 1 85  ARG 85  1559 1559 ARG ARG A . n 
A 1 86  ILE 86  1560 1560 ILE ILE A . n 
A 1 87  SER 87  1561 1561 SER SER A . n 
A 1 88  PHE 88  1562 1562 PHE PHE A . n 
A 1 89  PHE 89  1563 1563 PHE PHE A . n 
A 1 90  LYS 90  1564 1564 LYS LYS A . n 
A 1 91  ASP 91  1565 1565 ASP ASP A . n 
A 1 92  PRO 92  1566 1566 PRO PRO A . n 
A 1 93  TRP 93  1567 1567 TRP TRP A . n 
A 1 94  SER 94  1568 1568 SER SER A . n 
A 1 95  LEU 95  1569 1569 LEU LEU A . n 
A 1 96  PHE 96  1570 1570 PHE PHE A . n 
A 1 97  ASP 97  1571 1571 ASP ASP A . n 
A 1 98  PHE 98  1572 1572 PHE PHE A . n 
A 1 99  VAL 99  1573 1573 VAL VAL A . n 
A 1 100 VAL 100 1574 1574 VAL VAL A . n 
A 1 101 VAL 101 1575 1575 VAL VAL A . n 
A 1 102 ILE 102 1576 1576 ILE ILE A . n 
A 1 103 ILE 103 1577 1577 ILE ILE A . n 
A 1 104 SER 104 1578 1578 SER SER A . n 
A 1 105 ILE 105 1579 1579 ILE ILE A . n 
A 1 106 VAL 106 1580 1580 VAL VAL A . n 
A 1 107 GLY 107 1581 1581 GLY GLY A . n 
A 1 108 MET 108 1582 1582 MET MET A . n 
A 1 109 PHE 109 1583 1583 PHE PHE A . n 
A 1 110 LEU 110 1584 1584 LEU LEU A . n 
A 1 111 ALA 111 1585 1585 ALA ALA A . n 
A 1 112 ASP 112 1586 1586 ASP ASP A . n 
A 1 113 LEU 113 1587 1587 LEU LEU A . n 
A 1 114 ILE 114 1588 1588 ILE ILE A . n 
A 1 115 GLU 115 1589 1589 GLU GLU A . n 
A 1 116 THR 116 1590 1590 THR THR A . n 
A 1 117 TYR 117 1591 1591 TYR TYR A . n 
A 1 118 PHE 118 1592 1592 PHE PHE A . n 
A 1 119 VAL 119 1593 1593 VAL VAL A . n 
A 1 120 SER 120 1594 1594 SER SER A . n 
A 1 121 PRO 121 1595 1595 PRO PRO A . n 
A 1 122 THR 122 1596 1596 THR THR A . n 
A 1 123 LEU 123 1597 1597 LEU LEU A . n 
A 1 124 PHE 124 1598 1598 PHE PHE A . n 
A 1 125 ARG 125 1599 1599 ARG ARG A . n 
A 1 126 VAL 126 1600 1600 VAL VAL A . n 
A 1 127 ILE 127 1601 1601 ILE ILE A . n 
A 1 128 ARG 128 1602 1602 ARG ARG A . n 
A 1 129 LEU 129 1603 1603 LEU LEU A . n 
A 1 130 ALA 130 1604 1604 ALA ALA A . n 
A 1 131 ARG 131 1605 1605 ARG ARG A . n 
A 1 132 ILE 132 1606 1606 ILE ILE A . n 
A 1 133 GLY 133 1607 1607 GLY GLY A . n 
A 1 134 ARG 134 1608 1608 ARG ARG A . n 
A 1 135 ILE 135 1609 1609 ILE ILE A . n 
A 1 136 LEU 136 1610 1610 LEU LEU A . n 
A 1 137 ARG 137 1611 1611 ARG ARG A . n 
A 1 138 LEU 138 1612 1612 LEU LEU A . n 
A 1 139 VAL 139 1613 1613 VAL VAL A . n 
A 1 140 THR 140 1614 1614 THR THR A . n 
A 1 141 ALA 141 1615 1615 ALA ALA A . n 
A 1 142 VAL 142 1616 1616 VAL VAL A . n 
A 1 143 PRO 143 1617 1617 PRO PRO A . n 
A 1 144 GLN 144 1618 1618 GLN GLN A . n 
A 1 145 MET 145 1619 1619 MET MET A . n 
A 1 146 ARG 146 1620 1620 ARG ARG A . n 
A 1 147 LYS 147 1621 1621 LYS LYS A . n 
A 1 148 ILE 148 1622 1622 ILE ILE A . n 
A 1 149 VAL 149 1623 1623 VAL VAL A . n 
A 1 150 SER 150 1624 1624 SER SER A . n 
A 1 151 ALA 151 1625 1625 ALA ALA A . n 
A 1 152 LEU 152 1626 1626 LEU LEU A . n 
A 1 153 ILE 153 1627 1627 ILE ILE A . n 
A 1 154 SER 154 1628 1628 SER SER A . n 
A 1 155 VAL 155 1629 1629 VAL VAL A . n 
A 1 156 ILE 156 1630 1630 ILE ILE A . n 
A 1 157 PRO 157 1631 1631 PRO PRO A . n 
A 1 158 GLY 158 1632 1632 GLY GLY A . n 
A 1 159 MET 159 1633 1633 MET MET A . n 
A 1 160 LEU 160 1634 1634 LEU LEU A . n 
A 1 161 SER 161 1635 1635 SER SER A . n 
A 1 162 VAL 162 1636 1636 VAL VAL A . n 
A 1 163 ILE 163 1637 1637 ILE ILE A . n 
A 1 164 ALA 164 1638 1638 ALA ALA A . n 
A 1 165 LEU 165 1639 1639 LEU LEU A . n 
A 1 166 MET 166 1640 1640 MET MET A . n 
A 1 167 THR 167 1641 1641 THR THR A . n 
A 1 168 LEU 168 1642 1642 LEU LEU A . n 
A 1 169 PHE 169 1643 1643 PHE PHE A . n 
A 1 170 PHE 170 1644 1644 PHE PHE A . n 
A 1 171 TYR 171 1645 1645 TYR TYR A . n 
A 1 172 ILE 172 1646 1646 ILE ILE A . n 
A 1 173 PHE 173 1647 1647 PHE PHE A . n 
A 1 174 ALA 174 1648 1648 ALA ALA A . n 
A 1 175 ILE 175 1649 1649 ILE ILE A . n 
A 1 176 MET 176 1650 1650 MET MET A . n 
A 1 177 ALA 177 1651 1651 ALA ALA A . n 
A 1 178 THR 178 1652 1652 THR THR A . n 
A 1 179 GLN 179 1653 1653 GLN GLN A . n 
A 1 180 LEU 180 1654 1654 LEU LEU A . n 
A 1 181 PHE 181 1655 1655 PHE PHE A . n 
A 1 182 GLY 182 1656 1656 GLY GLY A . n 
A 1 183 GLU 183 1657 1657 GLU GLU A . n 
A 1 184 ARG 184 1658 1658 ARG ARG A . n 
A 1 185 PHE 185 1659 1659 PHE PHE A . n 
A 1 186 PRO 186 1660 1660 PRO PRO A . n 
A 1 187 GLU 187 1661 1661 GLU GLU A . n 
A 1 188 TRP 188 1662 1662 TRP TRP A . n 
A 1 189 PHE 189 1663 1663 PHE PHE A . n 
A 1 190 GLY 190 1664 1664 GLY GLY A . n 
A 1 191 THR 191 1665 1665 THR THR A . n 
A 1 192 LEU 192 1666 1666 LEU LEU A . n 
A 1 193 GLY 193 1667 1667 GLY GLY A . n 
A 1 194 GLU 194 1668 1668 GLU GLU A . n 
A 1 195 SER 195 1669 1669 SER SER A . n 
A 1 196 PHE 196 1670 1670 PHE PHE A . n 
A 1 197 TYR 197 1671 1671 TYR TYR A . n 
A 1 198 THR 198 1672 1672 THR THR A . n 
A 1 199 LEU 199 1673 1673 LEU LEU A . n 
A 1 200 PHE 200 1674 1674 PHE PHE A . n 
A 1 201 GLN 201 1675 1675 GLN GLN A . n 
A 1 202 VAL 202 1676 1676 VAL VAL A . n 
A 1 203 MET 203 1677 1677 MET MET A . n 
A 1 204 THR 204 1678 1678 THR THR A . n 
A 1 205 LEU 205 1679 1679 LEU LEU A . n 
A 1 206 GLU 206 1680 1680 GLU GLU A . n 
A 1 207 SER 207 1681 1681 SER SER A . n 
A 1 208 TRP 208 1682 1682 TRP TRP A . n 
A 1 209 SER 209 1683 1683 SER SER A . n 
A 1 210 MET 210 1684 1684 MET MET A . n 
A 1 211 GLY 211 1685 1685 GLY GLY A . n 
A 1 212 ILE 212 1686 1686 ILE ILE A . n 
A 1 213 VAL 213 1687 1687 VAL VAL A . n 
A 1 214 ARG 214 1688 1688 ARG ARG A . n 
A 1 215 PRO 215 1689 1689 PRO PRO A . n 
A 1 216 LEU 216 1690 1690 LEU LEU A . n 
A 1 217 MET 217 1691 1691 MET MET A . n 
A 1 218 GLU 218 1692 1692 GLU GLU A . n 
A 1 219 VAL 219 1693 1693 VAL VAL A . n 
A 1 220 TYR 220 1694 1694 TYR TYR A . n 
A 1 221 PRO 221 1695 1695 PRO PRO A . n 
A 1 222 TYR 222 1696 1696 TYR TYR A . n 
A 1 223 ALA 223 1697 1697 ALA ALA A . n 
A 1 224 TRP 224 1698 1698 TRP TRP A . n 
A 1 225 VAL 225 1699 1699 VAL VAL A . n 
A 1 226 PHE 226 1700 1700 PHE PHE A . n 
A 1 227 PHE 227 1701 1701 PHE PHE A . n 
A 1 228 ILE 228 1702 1702 ILE ILE A . n 
A 1 229 PRO 229 1703 1703 PRO PRO A . n 
A 1 230 PHE 230 1704 1704 PHE PHE A . n 
A 1 231 ILE 231 1705 1705 ILE ILE A . n 
A 1 232 PHE 232 1706 1706 PHE PHE A . n 
A 1 233 VAL 233 1707 1707 VAL VAL A . n 
A 1 234 VAL 234 1708 1708 VAL VAL A . n 
A 1 235 THR 235 1709 1709 THR THR A . n 
A 1 236 PHE 236 1710 1710 PHE PHE A . n 
A 1 237 VAL 237 1711 1711 VAL VAL A . n 
A 1 238 MET 238 1712 1712 MET MET A . n 
A 1 239 ILE 239 1713 1713 ILE ILE A . n 
A 1 240 ASN 240 1714 1714 ASN ASN A . n 
A 1 241 LEU 241 1715 1715 LEU LEU A . n 
A 1 242 VAL 242 1716 1716 VAL VAL A . n 
A 1 243 VAL 243 1717 1717 VAL VAL A . n 
A 1 244 ALA 244 1718 1718 ALA ALA A . n 
A 1 245 ILE 245 1719 1719 ILE ILE A . n 
A 1 246 ILE 246 1720 1720 ILE ILE A . n 
A 1 247 VAL 247 1721 1721 VAL VAL A . n 
A 1 248 ASP 248 1722 1722 ASP ASP A . n 
A 1 249 ALA 249 1723 1723 ALA ALA A . n 
A 1 250 MET 250 1724 1724 MET MET A . n 
A 1 251 ALA 251 1725 1725 ALA ALA A . n 
A 1 252 ILE 252 1726 1726 ILE ILE A . n 
A 1 253 LEU 253 1727 1727 LEU LEU A . n 
A 1 254 ASN 254 1728 1728 ASN ASN A . n 
A 1 255 GLN 255 1729 1729 GLN GLN A . n 
A 1 256 LYS 256 1730 1730 LYS LYS A . n 
A 1 257 GLU 257 1731 1731 GLU GLU A . n 
A 1 258 GLU 258 1732 1732 GLU GLU A . n 
A 1 259 GLN 259 1733 1733 GLN GLN A . n 
A 1 260 HIS 260 1734 1734 HIS HIS A . n 
A 1 261 ILE 261 1735 1735 ILE ILE A . n 
A 1 262 ILE 262 1736 1736 ILE ILE A . n 
A 1 263 ASP 263 1737 1737 ASP ASP A . n 
A 1 264 GLU 264 1738 ?    ?   ?   A . n 
A 1 265 VAL 265 1739 ?    ?   ?   A . n 
A 1 266 GLN 266 1740 ?    ?   ?   A . n 
A 1 267 SER 267 1741 ?    ?   ?   A . n 
A 1 268 HIS 268 1742 ?    ?   ?   A . n 
A 1 269 GLU 269 1743 ?    ?   ?   A . n 
A 1 270 ASP 270 1744 ?    ?   ?   A . n 
A 1 271 ASN 271 1745 ?    ?   ?   A . n 
A 1 272 ILE 272 1746 ?    ?   ?   A . n 
A 1 273 ASN 273 1747 ?    ?   ?   A . n 
A 1 274 ASN 274 1748 ?    ?   ?   A . n 
A 1 275 GLU 275 1749 ?    ?   ?   A . n 
A 1 276 ILE 276 1750 ?    ?   ?   A . n 
A 1 277 ILE 277 1751 ?    ?   ?   A . n 
A 1 278 LYS 278 1752 ?    ?   ?   A . n 
A 1 279 LEU 279 1753 ?    ?   ?   A . n 
A 1 280 ARG 280 1754 ?    ?   ?   A . n 
A 1 281 GLU 281 1755 ?    ?   ?   A . n 
A 1 282 GLU 282 1756 ?    ?   ?   A . n 
A 1 283 ILE 283 1757 ?    ?   ?   A . n 
A 1 284 VAL 284 1758 ?    ?   ?   A . n 
A 1 285 GLU 285 1759 ?    ?   ?   A . n 
A 1 286 LEU 286 1760 ?    ?   ?   A . n 
A 1 287 LYS 287 1761 ?    ?   ?   A . n 
A 1 288 GLU 288 1762 ?    ?   ?   A . n 
A 1 289 LEU 289 1763 ?    ?   ?   A . n 
A 1 290 ILE 290 1764 ?    ?   ?   A . n 
A 1 291 LYS 291 1765 ?    ?   ?   A . n 
A 1 292 THR 292 1766 ?    ?   ?   A . n 
A 1 293 SER 293 1767 ?    ?   ?   A . n 
A 1 294 LEU 294 1768 ?    ?   ?   A . n 
A 1 295 LYS 295 1769 ?    ?   ?   A . n 
A 1 296 ASN 296 1770 ?    ?   ?   A . n 
B 1 1   MET 1   -17  ?    ?   ?   B . n 
B 1 2   ASP 2   -16  ?    ?   ?   B . n 
B 1 3   TYR 3   -15  ?    ?   ?   B . n 
B 1 4   LYS 4   -14  ?    ?   ?   B . n 
B 1 5   ASP 5   -13  ?    ?   ?   B . n 
B 1 6   ASP 6   -12  ?    ?   ?   B . n 
B 1 7   ASP 7   -11  ?    ?   ?   B . n 
B 1 8   ASP 8   -10  ?    ?   ?   B . n 
B 1 9   LYS 9   -9   ?    ?   ?   B . n 
B 1 10  GLY 10  -8   ?    ?   ?   B . n 
B 1 11  SER 11  -7   ?    ?   ?   B . n 
B 1 12  LEU 12  -6   ?    ?   ?   B . n 
B 1 13  VAL 13  -5   ?    ?   ?   B . n 
B 1 14  PRO 14  -4   ?    ?   ?   B . n 
B 1 15  ARG 15  -3   ?    ?   ?   B . n 
B 1 16  GLY 16  -2   ?    ?   ?   B . n 
B 1 17  SER 17  -1   ?    ?   ?   B . n 
B 1 18  HIS 18  0    ?    ?   ?   B . n 
B 1 19  MET 19  1493 1493 MET MET B . n 
B 1 20  TYR 20  1494 1494 TYR TYR B . n 
B 1 21  LEU 21  1495 1495 LEU LEU B . n 
B 1 22  ARG 22  1496 1496 ARG ARG B . n 
B 1 23  ILE 23  1497 1497 ILE ILE B . n 
B 1 24  THR 24  1498 1498 THR THR B . n 
B 1 25  ASN 25  1499 1499 ASN ASN B . n 
B 1 26  ILE 26  1500 1500 ILE ILE B . n 
B 1 27  VAL 27  1501 1501 VAL VAL B . n 
B 1 28  GLU 28  1502 1502 GLU GLU B . n 
B 1 29  SER 29  1503 1503 SER SER B . n 
B 1 30  SER 30  1504 1504 SER SER B . n 
B 1 31  PHE 31  1505 1505 PHE PHE B . n 
B 1 32  PHE 32  1506 1506 PHE PHE B . n 
B 1 33  THR 33  1507 1507 THR THR B . n 
B 1 34  LYS 34  1508 1508 LYS LYS B . n 
B 1 35  PHE 35  1509 1509 PHE PHE B . n 
B 1 36  ILE 36  1510 1510 ILE ILE B . n 
B 1 37  ILE 37  1511 1511 ILE ILE B . n 
B 1 38  TYR 38  1512 1512 TYR TYR B . n 
B 1 39  LEU 39  1513 1513 LEU LEU B . n 
B 1 40  ILE 40  1514 1514 ILE ILE B . n 
B 1 41  VAL 41  1515 1515 VAL VAL B . n 
B 1 42  LEU 42  1516 1516 LEU LEU B . n 
B 1 43  ASN 43  1517 1517 ASN ASN B . n 
B 1 44  MET 44  1518 1518 MET MET B . n 
B 1 45  VAL 45  1519 1519 VAL VAL B . n 
B 1 46  THR 46  1520 1520 THR THR B . n 
B 1 47  MET 47  1521 1521 MET MET B . n 
B 1 48  MET 48  1522 1522 MET MET B . n 
B 1 49  VAL 49  1523 1523 VAL VAL B . n 
B 1 50  GLU 50  1524 1524 GLU GLU B . n 
B 1 51  LYS 51  1525 1525 LYS LYS B . n 
B 1 52  GLU 52  1526 1526 GLU GLU B . n 
B 1 53  GLY 53  1527 1527 GLY GLY B . n 
B 1 54  GLN 54  1528 1528 GLN GLN B . n 
B 1 55  SER 55  1529 1529 SER SER B . n 
B 1 56  GLN 56  1530 1530 GLN GLN B . n 
B 1 57  HIS 57  1531 1531 HIS HIS B . n 
B 1 58  MET 58  1532 1532 MET MET B . n 
B 1 59  THR 59  1533 1533 THR THR B . n 
B 1 60  GLU 60  1534 1534 GLU GLU B . n 
B 1 61  VAL 61  1535 1535 VAL VAL B . n 
B 1 62  LEU 62  1536 1536 LEU LEU B . n 
B 1 63  TYR 63  1537 1537 TYR TYR B . n 
B 1 64  TRP 64  1538 1538 TRP TRP B . n 
B 1 65  ILE 65  1539 1539 ILE ILE B . n 
B 1 66  ASN 66  1540 1540 ASN ASN B . n 
B 1 67  VAL 67  1541 1541 VAL VAL B . n 
B 1 68  VAL 68  1542 1542 VAL VAL B . n 
B 1 69  PHE 69  1543 1543 PHE PHE B . n 
B 1 70  ILE 70  1544 1544 ILE ILE B . n 
B 1 71  ILE 71  1545 1545 ILE ILE B . n 
B 1 72  LEU 72  1546 1546 LEU LEU B . n 
B 1 73  PHE 73  1547 1547 PHE PHE B . n 
B 1 74  THR 74  1548 1548 THR THR B . n 
B 1 75  ILE 75  1549 1549 ILE ILE B . n 
B 1 76  GLU 76  1550 1550 GLU GLU B . n 
B 1 77  ILE 77  1551 1551 ILE ILE B . n 
B 1 78  ILE 78  1552 1552 ILE ILE B . n 
B 1 79  LEU 79  1553 1553 LEU LEU B . n 
B 1 80  ARG 80  1554 1554 ARG ARG B . n 
B 1 81  ILE 81  1555 1555 ILE ILE B . n 
B 1 82  TYR 82  1556 1556 TYR TYR B . n 
B 1 83  VAL 83  1557 1557 VAL VAL B . n 
B 1 84  HIS 84  1558 1558 HIS HIS B . n 
B 1 85  ARG 85  1559 1559 ARG ARG B . n 
B 1 86  ILE 86  1560 1560 ILE ILE B . n 
B 1 87  SER 87  1561 1561 SER SER B . n 
B 1 88  PHE 88  1562 1562 PHE PHE B . n 
B 1 89  PHE 89  1563 1563 PHE PHE B . n 
B 1 90  LYS 90  1564 1564 LYS LYS B . n 
B 1 91  ASP 91  1565 1565 ASP ASP B . n 
B 1 92  PRO 92  1566 1566 PRO PRO B . n 
B 1 93  TRP 93  1567 1567 TRP TRP B . n 
B 1 94  SER 94  1568 1568 SER SER B . n 
B 1 95  LEU 95  1569 1569 LEU LEU B . n 
B 1 96  PHE 96  1570 1570 PHE PHE B . n 
B 1 97  ASP 97  1571 1571 ASP ASP B . n 
B 1 98  PHE 98  1572 1572 PHE PHE B . n 
B 1 99  VAL 99  1573 1573 VAL VAL B . n 
B 1 100 VAL 100 1574 1574 VAL VAL B . n 
B 1 101 VAL 101 1575 1575 VAL VAL B . n 
B 1 102 ILE 102 1576 1576 ILE ILE B . n 
B 1 103 ILE 103 1577 1577 ILE ILE B . n 
B 1 104 SER 104 1578 1578 SER SER B . n 
B 1 105 ILE 105 1579 1579 ILE ILE B . n 
B 1 106 VAL 106 1580 1580 VAL VAL B . n 
B 1 107 GLY 107 1581 1581 GLY GLY B . n 
B 1 108 MET 108 1582 1582 MET MET B . n 
B 1 109 PHE 109 1583 1583 PHE PHE B . n 
B 1 110 LEU 110 1584 1584 LEU LEU B . n 
B 1 111 ALA 111 1585 1585 ALA ALA B . n 
B 1 112 ASP 112 1586 1586 ASP ASP B . n 
B 1 113 LEU 113 1587 1587 LEU LEU B . n 
B 1 114 ILE 114 1588 1588 ILE ILE B . n 
B 1 115 GLU 115 1589 1589 GLU GLU B . n 
B 1 116 THR 116 1590 1590 THR THR B . n 
B 1 117 TYR 117 1591 1591 TYR TYR B . n 
B 1 118 PHE 118 1592 1592 PHE PHE B . n 
B 1 119 VAL 119 1593 1593 VAL VAL B . n 
B 1 120 SER 120 1594 1594 SER SER B . n 
B 1 121 PRO 121 1595 1595 PRO PRO B . n 
B 1 122 THR 122 1596 1596 THR THR B . n 
B 1 123 LEU 123 1597 1597 LEU LEU B . n 
B 1 124 PHE 124 1598 1598 PHE PHE B . n 
B 1 125 ARG 125 1599 1599 ARG ARG B . n 
B 1 126 VAL 126 1600 1600 VAL VAL B . n 
B 1 127 ILE 127 1601 1601 ILE ILE B . n 
B 1 128 ARG 128 1602 1602 ARG ARG B . n 
B 1 129 LEU 129 1603 1603 LEU LEU B . n 
B 1 130 ALA 130 1604 1604 ALA ALA B . n 
B 1 131 ARG 131 1605 1605 ARG ARG B . n 
B 1 132 ILE 132 1606 1606 ILE ILE B . n 
B 1 133 GLY 133 1607 1607 GLY GLY B . n 
B 1 134 ARG 134 1608 1608 ARG ARG B . n 
B 1 135 ILE 135 1609 1609 ILE ILE B . n 
B 1 136 LEU 136 1610 1610 LEU LEU B . n 
B 1 137 ARG 137 1611 1611 ARG ARG B . n 
B 1 138 LEU 138 1612 1612 LEU LEU B . n 
B 1 139 VAL 139 1613 1613 VAL VAL B . n 
B 1 140 THR 140 1614 1614 THR THR B . n 
B 1 141 ALA 141 1615 1615 ALA ALA B . n 
B 1 142 VAL 142 1616 1616 VAL VAL B . n 
B 1 143 PRO 143 1617 1617 PRO PRO B . n 
B 1 144 GLN 144 1618 1618 GLN GLN B . n 
B 1 145 MET 145 1619 1619 MET MET B . n 
B 1 146 ARG 146 1620 1620 ARG ARG B . n 
B 1 147 LYS 147 1621 1621 LYS LYS B . n 
B 1 148 ILE 148 1622 1622 ILE ILE B . n 
B 1 149 VAL 149 1623 1623 VAL VAL B . n 
B 1 150 SER 150 1624 1624 SER SER B . n 
B 1 151 ALA 151 1625 1625 ALA ALA B . n 
B 1 152 LEU 152 1626 1626 LEU LEU B . n 
B 1 153 ILE 153 1627 1627 ILE ILE B . n 
B 1 154 SER 154 1628 1628 SER SER B . n 
B 1 155 VAL 155 1629 1629 VAL VAL B . n 
B 1 156 ILE 156 1630 1630 ILE ILE B . n 
B 1 157 PRO 157 1631 1631 PRO PRO B . n 
B 1 158 GLY 158 1632 1632 GLY GLY B . n 
B 1 159 MET 159 1633 1633 MET MET B . n 
B 1 160 LEU 160 1634 1634 LEU LEU B . n 
B 1 161 SER 161 1635 1635 SER SER B . n 
B 1 162 VAL 162 1636 1636 VAL VAL B . n 
B 1 163 ILE 163 1637 1637 ILE ILE B . n 
B 1 164 ALA 164 1638 1638 ALA ALA B . n 
B 1 165 LEU 165 1639 1639 LEU LEU B . n 
B 1 166 MET 166 1640 1640 MET MET B . n 
B 1 167 THR 167 1641 1641 THR THR B . n 
B 1 168 LEU 168 1642 1642 LEU LEU B . n 
B 1 169 PHE 169 1643 1643 PHE PHE B . n 
B 1 170 PHE 170 1644 1644 PHE PHE B . n 
B 1 171 TYR 171 1645 1645 TYR TYR B . n 
B 1 172 ILE 172 1646 1646 ILE ILE B . n 
B 1 173 PHE 173 1647 1647 PHE PHE B . n 
B 1 174 ALA 174 1648 1648 ALA ALA B . n 
B 1 175 ILE 175 1649 1649 ILE ILE B . n 
B 1 176 MET 176 1650 1650 MET MET B . n 
B 1 177 ALA 177 1651 1651 ALA ALA B . n 
B 1 178 THR 178 1652 1652 THR THR B . n 
B 1 179 GLN 179 1653 1653 GLN GLN B . n 
B 1 180 LEU 180 1654 1654 LEU LEU B . n 
B 1 181 PHE 181 1655 1655 PHE PHE B . n 
B 1 182 GLY 182 1656 1656 GLY GLY B . n 
B 1 183 GLU 183 1657 1657 GLU GLU B . n 
B 1 184 ARG 184 1658 1658 ARG ARG B . n 
B 1 185 PHE 185 1659 1659 PHE PHE B . n 
B 1 186 PRO 186 1660 1660 PRO PRO B . n 
B 1 187 GLU 187 1661 1661 GLU GLU B . n 
B 1 188 TRP 188 1662 1662 TRP TRP B . n 
B 1 189 PHE 189 1663 1663 PHE PHE B . n 
B 1 190 GLY 190 1664 1664 GLY GLY B . n 
B 1 191 THR 191 1665 1665 THR THR B . n 
B 1 192 LEU 192 1666 1666 LEU LEU B . n 
B 1 193 GLY 193 1667 1667 GLY GLY B . n 
B 1 194 GLU 194 1668 1668 GLU GLU B . n 
B 1 195 SER 195 1669 1669 SER SER B . n 
B 1 196 PHE 196 1670 1670 PHE PHE B . n 
B 1 197 TYR 197 1671 1671 TYR TYR B . n 
B 1 198 THR 198 1672 1672 THR THR B . n 
B 1 199 LEU 199 1673 1673 LEU LEU B . n 
B 1 200 PHE 200 1674 1674 PHE PHE B . n 
B 1 201 GLN 201 1675 1675 GLN GLN B . n 
B 1 202 VAL 202 1676 1676 VAL VAL B . n 
B 1 203 MET 203 1677 1677 MET MET B . n 
B 1 204 THR 204 1678 1678 THR THR B . n 
B 1 205 LEU 205 1679 1679 LEU LEU B . n 
B 1 206 GLU 206 1680 1680 GLU GLU B . n 
B 1 207 SER 207 1681 1681 SER SER B . n 
B 1 208 TRP 208 1682 1682 TRP TRP B . n 
B 1 209 SER 209 1683 1683 SER SER B . n 
B 1 210 MET 210 1684 1684 MET MET B . n 
B 1 211 GLY 211 1685 1685 GLY GLY B . n 
B 1 212 ILE 212 1686 1686 ILE ILE B . n 
B 1 213 VAL 213 1687 1687 VAL VAL B . n 
B 1 214 ARG 214 1688 1688 ARG ARG B . n 
B 1 215 PRO 215 1689 1689 PRO PRO B . n 
B 1 216 LEU 216 1690 1690 LEU LEU B . n 
B 1 217 MET 217 1691 1691 MET MET B . n 
B 1 218 GLU 218 1692 1692 GLU GLU B . n 
B 1 219 VAL 219 1693 1693 VAL VAL B . n 
B 1 220 TYR 220 1694 1694 TYR TYR B . n 
B 1 221 PRO 221 1695 1695 PRO PRO B . n 
B 1 222 TYR 222 1696 1696 TYR TYR B . n 
B 1 223 ALA 223 1697 1697 ALA ALA B . n 
B 1 224 TRP 224 1698 1698 TRP TRP B . n 
B 1 225 VAL 225 1699 1699 VAL VAL B . n 
B 1 226 PHE 226 1700 1700 PHE PHE B . n 
B 1 227 PHE 227 1701 1701 PHE PHE B . n 
B 1 228 ILE 228 1702 1702 ILE ILE B . n 
B 1 229 PRO 229 1703 1703 PRO PRO B . n 
B 1 230 PHE 230 1704 1704 PHE PHE B . n 
B 1 231 ILE 231 1705 1705 ILE ILE B . n 
B 1 232 PHE 232 1706 1706 PHE PHE B . n 
B 1 233 VAL 233 1707 1707 VAL VAL B . n 
B 1 234 VAL 234 1708 1708 VAL VAL B . n 
B 1 235 THR 235 1709 1709 THR THR B . n 
B 1 236 PHE 236 1710 1710 PHE PHE B . n 
B 1 237 VAL 237 1711 1711 VAL VAL B . n 
B 1 238 MET 238 1712 1712 MET MET B . n 
B 1 239 ILE 239 1713 1713 ILE ILE B . n 
B 1 240 ASN 240 1714 1714 ASN ASN B . n 
B 1 241 LEU 241 1715 1715 LEU LEU B . n 
B 1 242 VAL 242 1716 1716 VAL VAL B . n 
B 1 243 VAL 243 1717 1717 VAL VAL B . n 
B 1 244 ALA 244 1718 1718 ALA ALA B . n 
B 1 245 ILE 245 1719 1719 ILE ILE B . n 
B 1 246 ILE 246 1720 1720 ILE ILE B . n 
B 1 247 VAL 247 1721 1721 VAL VAL B . n 
B 1 248 ASP 248 1722 1722 ASP ASP B . n 
B 1 249 ALA 249 1723 1723 ALA ALA B . n 
B 1 250 MET 250 1724 1724 MET MET B . n 
B 1 251 ALA 251 1725 1725 ALA ALA B . n 
B 1 252 ILE 252 1726 1726 ILE ILE B . n 
B 1 253 LEU 253 1727 1727 LEU LEU B . n 
B 1 254 ASN 254 1728 1728 ASN ASN B . n 
B 1 255 GLN 255 1729 1729 GLN GLN B . n 
B 1 256 LYS 256 1730 1730 LYS LYS B . n 
B 1 257 GLU 257 1731 1731 GLU GLU B . n 
B 1 258 GLU 258 1732 1732 GLU GLU B . n 
B 1 259 GLN 259 1733 1733 GLN GLN B . n 
B 1 260 HIS 260 1734 1734 HIS HIS B . n 
B 1 261 ILE 261 1735 1735 ILE ILE B . n 
B 1 262 ILE 262 1736 1736 ILE ILE B . n 
B 1 263 ASP 263 1737 1737 ASP ASP B . n 
B 1 264 GLU 264 1738 ?    ?   ?   B . n 
B 1 265 VAL 265 1739 ?    ?   ?   B . n 
B 1 266 GLN 266 1740 ?    ?   ?   B . n 
B 1 267 SER 267 1741 ?    ?   ?   B . n 
B 1 268 HIS 268 1742 ?    ?   ?   B . n 
B 1 269 GLU 269 1743 ?    ?   ?   B . n 
B 1 270 ASP 270 1744 ?    ?   ?   B . n 
B 1 271 ASN 271 1745 ?    ?   ?   B . n 
B 1 272 ILE 272 1746 ?    ?   ?   B . n 
B 1 273 ASN 273 1747 ?    ?   ?   B . n 
B 1 274 ASN 274 1748 ?    ?   ?   B . n 
B 1 275 GLU 275 1749 ?    ?   ?   B . n 
B 1 276 ILE 276 1750 ?    ?   ?   B . n 
B 1 277 ILE 277 1751 ?    ?   ?   B . n 
B 1 278 LYS 278 1752 ?    ?   ?   B . n 
B 1 279 LEU 279 1753 ?    ?   ?   B . n 
B 1 280 ARG 280 1754 ?    ?   ?   B . n 
B 1 281 GLU 281 1755 ?    ?   ?   B . n 
B 1 282 GLU 282 1756 ?    ?   ?   B . n 
B 1 283 ILE 283 1757 ?    ?   ?   B . n 
B 1 284 VAL 284 1758 ?    ?   ?   B . n 
B 1 285 GLU 285 1759 ?    ?   ?   B . n 
B 1 286 LEU 286 1760 ?    ?   ?   B . n 
B 1 287 LYS 287 1761 ?    ?   ?   B . n 
B 1 288 GLU 288 1762 ?    ?   ?   B . n 
B 1 289 LEU 289 1763 ?    ?   ?   B . n 
B 1 290 ILE 290 1764 ?    ?   ?   B . n 
B 1 291 LYS 291 1765 ?    ?   ?   B . n 
B 1 292 THR 292 1766 ?    ?   ?   B . n 
B 1 293 SER 293 1767 ?    ?   ?   B . n 
B 1 294 LEU 294 1768 ?    ?   ?   B . n 
B 1 295 LYS 295 1769 ?    ?   ?   B . n 
B 1 296 ASN 296 1770 ?    ?   ?   B . n 
C 1 1   MET 1   -17  ?    ?   ?   C . n 
C 1 2   ASP 2   -16  ?    ?   ?   C . n 
C 1 3   TYR 3   -15  ?    ?   ?   C . n 
C 1 4   LYS 4   -14  ?    ?   ?   C . n 
C 1 5   ASP 5   -13  ?    ?   ?   C . n 
C 1 6   ASP 6   -12  ?    ?   ?   C . n 
C 1 7   ASP 7   -11  ?    ?   ?   C . n 
C 1 8   ASP 8   -10  ?    ?   ?   C . n 
C 1 9   LYS 9   -9   ?    ?   ?   C . n 
C 1 10  GLY 10  -8   ?    ?   ?   C . n 
C 1 11  SER 11  -7   ?    ?   ?   C . n 
C 1 12  LEU 12  -6   ?    ?   ?   C . n 
C 1 13  VAL 13  -5   ?    ?   ?   C . n 
C 1 14  PRO 14  -4   ?    ?   ?   C . n 
C 1 15  ARG 15  -3   ?    ?   ?   C . n 
C 1 16  GLY 16  -2   ?    ?   ?   C . n 
C 1 17  SER 17  -1   ?    ?   ?   C . n 
C 1 18  HIS 18  0    ?    ?   ?   C . n 
C 1 19  MET 19  1493 1493 MET MET C . n 
C 1 20  TYR 20  1494 1494 TYR TYR C . n 
C 1 21  LEU 21  1495 1495 LEU LEU C . n 
C 1 22  ARG 22  1496 1496 ARG ARG C . n 
C 1 23  ILE 23  1497 1497 ILE ILE C . n 
C 1 24  THR 24  1498 1498 THR THR C . n 
C 1 25  ASN 25  1499 1499 ASN ASN C . n 
C 1 26  ILE 26  1500 1500 ILE ILE C . n 
C 1 27  VAL 27  1501 1501 VAL VAL C . n 
C 1 28  GLU 28  1502 1502 GLU GLU C . n 
C 1 29  SER 29  1503 1503 SER SER C . n 
C 1 30  SER 30  1504 1504 SER SER C . n 
C 1 31  PHE 31  1505 1505 PHE PHE C . n 
C 1 32  PHE 32  1506 1506 PHE PHE C . n 
C 1 33  THR 33  1507 1507 THR THR C . n 
C 1 34  LYS 34  1508 1508 LYS LYS C . n 
C 1 35  PHE 35  1509 1509 PHE PHE C . n 
C 1 36  ILE 36  1510 1510 ILE ILE C . n 
C 1 37  ILE 37  1511 1511 ILE ILE C . n 
C 1 38  TYR 38  1512 1512 TYR TYR C . n 
C 1 39  LEU 39  1513 1513 LEU LEU C . n 
C 1 40  ILE 40  1514 1514 ILE ILE C . n 
C 1 41  VAL 41  1515 1515 VAL VAL C . n 
C 1 42  LEU 42  1516 1516 LEU LEU C . n 
C 1 43  ASN 43  1517 1517 ASN ASN C . n 
C 1 44  MET 44  1518 1518 MET MET C . n 
C 1 45  VAL 45  1519 1519 VAL VAL C . n 
C 1 46  THR 46  1520 1520 THR THR C . n 
C 1 47  MET 47  1521 1521 MET MET C . n 
C 1 48  MET 48  1522 1522 MET MET C . n 
C 1 49  VAL 49  1523 1523 VAL VAL C . n 
C 1 50  GLU 50  1524 1524 GLU GLU C . n 
C 1 51  LYS 51  1525 1525 LYS LYS C . n 
C 1 52  GLU 52  1526 1526 GLU GLU C . n 
C 1 53  GLY 53  1527 1527 GLY GLY C . n 
C 1 54  GLN 54  1528 1528 GLN GLN C . n 
C 1 55  SER 55  1529 1529 SER SER C . n 
C 1 56  GLN 56  1530 1530 GLN GLN C . n 
C 1 57  HIS 57  1531 1531 HIS HIS C . n 
C 1 58  MET 58  1532 1532 MET MET C . n 
C 1 59  THR 59  1533 1533 THR THR C . n 
C 1 60  GLU 60  1534 1534 GLU GLU C . n 
C 1 61  VAL 61  1535 1535 VAL VAL C . n 
C 1 62  LEU 62  1536 1536 LEU LEU C . n 
C 1 63  TYR 63  1537 1537 TYR TYR C . n 
C 1 64  TRP 64  1538 1538 TRP TRP C . n 
C 1 65  ILE 65  1539 1539 ILE ILE C . n 
C 1 66  ASN 66  1540 1540 ASN ASN C . n 
C 1 67  VAL 67  1541 1541 VAL VAL C . n 
C 1 68  VAL 68  1542 1542 VAL VAL C . n 
C 1 69  PHE 69  1543 1543 PHE PHE C . n 
C 1 70  ILE 70  1544 1544 ILE ILE C . n 
C 1 71  ILE 71  1545 1545 ILE ILE C . n 
C 1 72  LEU 72  1546 1546 LEU LEU C . n 
C 1 73  PHE 73  1547 1547 PHE PHE C . n 
C 1 74  THR 74  1548 1548 THR THR C . n 
C 1 75  ILE 75  1549 1549 ILE ILE C . n 
C 1 76  GLU 76  1550 1550 GLU GLU C . n 
C 1 77  ILE 77  1551 1551 ILE ILE C . n 
C 1 78  ILE 78  1552 1552 ILE ILE C . n 
C 1 79  LEU 79  1553 1553 LEU LEU C . n 
C 1 80  ARG 80  1554 1554 ARG ARG C . n 
C 1 81  ILE 81  1555 1555 ILE ILE C . n 
C 1 82  TYR 82  1556 1556 TYR TYR C . n 
C 1 83  VAL 83  1557 1557 VAL VAL C . n 
C 1 84  HIS 84  1558 1558 HIS HIS C . n 
C 1 85  ARG 85  1559 1559 ARG ARG C . n 
C 1 86  ILE 86  1560 1560 ILE ILE C . n 
C 1 87  SER 87  1561 1561 SER SER C . n 
C 1 88  PHE 88  1562 1562 PHE PHE C . n 
C 1 89  PHE 89  1563 1563 PHE PHE C . n 
C 1 90  LYS 90  1564 1564 LYS LYS C . n 
C 1 91  ASP 91  1565 1565 ASP ASP C . n 
C 1 92  PRO 92  1566 1566 PRO PRO C . n 
C 1 93  TRP 93  1567 1567 TRP TRP C . n 
C 1 94  SER 94  1568 1568 SER SER C . n 
C 1 95  LEU 95  1569 1569 LEU LEU C . n 
C 1 96  PHE 96  1570 1570 PHE PHE C . n 
C 1 97  ASP 97  1571 1571 ASP ASP C . n 
C 1 98  PHE 98  1572 1572 PHE PHE C . n 
C 1 99  VAL 99  1573 1573 VAL VAL C . n 
C 1 100 VAL 100 1574 1574 VAL VAL C . n 
C 1 101 VAL 101 1575 1575 VAL VAL C . n 
C 1 102 ILE 102 1576 1576 ILE ILE C . n 
C 1 103 ILE 103 1577 1577 ILE ILE C . n 
C 1 104 SER 104 1578 1578 SER SER C . n 
C 1 105 ILE 105 1579 1579 ILE ILE C . n 
C 1 106 VAL 106 1580 1580 VAL VAL C . n 
C 1 107 GLY 107 1581 1581 GLY GLY C . n 
C 1 108 MET 108 1582 1582 MET MET C . n 
C 1 109 PHE 109 1583 1583 PHE PHE C . n 
C 1 110 LEU 110 1584 1584 LEU LEU C . n 
C 1 111 ALA 111 1585 1585 ALA ALA C . n 
C 1 112 ASP 112 1586 1586 ASP ASP C . n 
C 1 113 LEU 113 1587 1587 LEU LEU C . n 
C 1 114 ILE 114 1588 1588 ILE ILE C . n 
C 1 115 GLU 115 1589 1589 GLU GLU C . n 
C 1 116 THR 116 1590 1590 THR THR C . n 
C 1 117 TYR 117 1591 1591 TYR TYR C . n 
C 1 118 PHE 118 1592 ?    ?   ?   C . n 
C 1 119 VAL 119 1593 ?    ?   ?   C . n 
C 1 120 SER 120 1594 ?    ?   ?   C . n 
C 1 121 PRO 121 1595 1595 PRO PRO C . n 
C 1 122 THR 122 1596 1596 THR THR C . n 
C 1 123 LEU 123 1597 1597 LEU LEU C . n 
C 1 124 PHE 124 1598 1598 PHE PHE C . n 
C 1 125 ARG 125 1599 1599 ARG ARG C . n 
C 1 126 VAL 126 1600 1600 VAL VAL C . n 
C 1 127 ILE 127 1601 1601 ILE ILE C . n 
C 1 128 ARG 128 1602 1602 ARG ARG C . n 
C 1 129 LEU 129 1603 1603 LEU LEU C . n 
C 1 130 ALA 130 1604 1604 ALA ALA C . n 
C 1 131 ARG 131 1605 1605 ARG ARG C . n 
C 1 132 ILE 132 1606 1606 ILE ILE C . n 
C 1 133 GLY 133 1607 1607 GLY GLY C . n 
C 1 134 ARG 134 1608 1608 ARG ARG C . n 
C 1 135 ILE 135 1609 1609 ILE ILE C . n 
C 1 136 LEU 136 1610 1610 LEU LEU C . n 
C 1 137 ARG 137 1611 1611 ARG ARG C . n 
C 1 138 LEU 138 1612 1612 LEU LEU C . n 
C 1 139 VAL 139 1613 1613 VAL VAL C . n 
C 1 140 THR 140 1614 1614 THR THR C . n 
C 1 141 ALA 141 1615 1615 ALA ALA C . n 
C 1 142 VAL 142 1616 1616 VAL VAL C . n 
C 1 143 PRO 143 1617 1617 PRO PRO C . n 
C 1 144 GLN 144 1618 1618 GLN GLN C . n 
C 1 145 MET 145 1619 1619 MET MET C . n 
C 1 146 ARG 146 1620 1620 ARG ARG C . n 
C 1 147 LYS 147 1621 1621 LYS LYS C . n 
C 1 148 ILE 148 1622 1622 ILE ILE C . n 
C 1 149 VAL 149 1623 1623 VAL VAL C . n 
C 1 150 SER 150 1624 1624 SER SER C . n 
C 1 151 ALA 151 1625 1625 ALA ALA C . n 
C 1 152 LEU 152 1626 1626 LEU LEU C . n 
C 1 153 ILE 153 1627 1627 ILE ILE C . n 
C 1 154 SER 154 1628 1628 SER SER C . n 
C 1 155 VAL 155 1629 1629 VAL VAL C . n 
C 1 156 ILE 156 1630 1630 ILE ILE C . n 
C 1 157 PRO 157 1631 1631 PRO PRO C . n 
C 1 158 GLY 158 1632 1632 GLY GLY C . n 
C 1 159 MET 159 1633 1633 MET MET C . n 
C 1 160 LEU 160 1634 1634 LEU LEU C . n 
C 1 161 SER 161 1635 1635 SER SER C . n 
C 1 162 VAL 162 1636 1636 VAL VAL C . n 
C 1 163 ILE 163 1637 1637 ILE ILE C . n 
C 1 164 ALA 164 1638 1638 ALA ALA C . n 
C 1 165 LEU 165 1639 1639 LEU LEU C . n 
C 1 166 MET 166 1640 1640 MET MET C . n 
C 1 167 THR 167 1641 1641 THR THR C . n 
C 1 168 LEU 168 1642 1642 LEU LEU C . n 
C 1 169 PHE 169 1643 1643 PHE PHE C . n 
C 1 170 PHE 170 1644 1644 PHE PHE C . n 
C 1 171 TYR 171 1645 1645 TYR TYR C . n 
C 1 172 ILE 172 1646 1646 ILE ILE C . n 
C 1 173 PHE 173 1647 1647 PHE PHE C . n 
C 1 174 ALA 174 1648 1648 ALA ALA C . n 
C 1 175 ILE 175 1649 1649 ILE ILE C . n 
C 1 176 MET 176 1650 1650 MET MET C . n 
C 1 177 ALA 177 1651 1651 ALA ALA C . n 
C 1 178 THR 178 1652 1652 THR THR C . n 
C 1 179 GLN 179 1653 1653 GLN GLN C . n 
C 1 180 LEU 180 1654 1654 LEU LEU C . n 
C 1 181 PHE 181 1655 1655 PHE PHE C . n 
C 1 182 GLY 182 1656 1656 GLY GLY C . n 
C 1 183 GLU 183 1657 1657 GLU GLU C . n 
C 1 184 ARG 184 1658 1658 ARG ARG C . n 
C 1 185 PHE 185 1659 1659 PHE PHE C . n 
C 1 186 PRO 186 1660 1660 PRO PRO C . n 
C 1 187 GLU 187 1661 1661 GLU GLU C . n 
C 1 188 TRP 188 1662 1662 TRP TRP C . n 
C 1 189 PHE 189 1663 1663 PHE PHE C . n 
C 1 190 GLY 190 1664 1664 GLY GLY C . n 
C 1 191 THR 191 1665 1665 THR THR C . n 
C 1 192 LEU 192 1666 1666 LEU LEU C . n 
C 1 193 GLY 193 1667 1667 GLY GLY C . n 
C 1 194 GLU 194 1668 1668 GLU GLU C . n 
C 1 195 SER 195 1669 1669 SER SER C . n 
C 1 196 PHE 196 1670 1670 PHE PHE C . n 
C 1 197 TYR 197 1671 1671 TYR TYR C . n 
C 1 198 THR 198 1672 1672 THR THR C . n 
C 1 199 LEU 199 1673 1673 LEU LEU C . n 
C 1 200 PHE 200 1674 1674 PHE PHE C . n 
C 1 201 GLN 201 1675 1675 GLN GLN C . n 
C 1 202 VAL 202 1676 1676 VAL VAL C . n 
C 1 203 MET 203 1677 1677 MET MET C . n 
C 1 204 THR 204 1678 1678 THR THR C . n 
C 1 205 LEU 205 1679 1679 LEU LEU C . n 
C 1 206 GLU 206 1680 1680 GLU GLU C . n 
C 1 207 SER 207 1681 1681 SER SER C . n 
C 1 208 TRP 208 1682 1682 TRP TRP C . n 
C 1 209 SER 209 1683 1683 SER SER C . n 
C 1 210 MET 210 1684 1684 MET MET C . n 
C 1 211 GLY 211 1685 1685 GLY GLY C . n 
C 1 212 ILE 212 1686 1686 ILE ILE C . n 
C 1 213 VAL 213 1687 1687 VAL VAL C . n 
C 1 214 ARG 214 1688 1688 ARG ARG C . n 
C 1 215 PRO 215 1689 1689 PRO PRO C . n 
C 1 216 LEU 216 1690 1690 LEU LEU C . n 
C 1 217 MET 217 1691 1691 MET MET C . n 
C 1 218 GLU 218 1692 1692 GLU GLU C . n 
C 1 219 VAL 219 1693 1693 VAL VAL C . n 
C 1 220 TYR 220 1694 1694 TYR TYR C . n 
C 1 221 PRO 221 1695 1695 PRO PRO C . n 
C 1 222 TYR 222 1696 1696 TYR TYR C . n 
C 1 223 ALA 223 1697 1697 ALA ALA C . n 
C 1 224 TRP 224 1698 1698 TRP TRP C . n 
C 1 225 VAL 225 1699 1699 VAL VAL C . n 
C 1 226 PHE 226 1700 1700 PHE PHE C . n 
C 1 227 PHE 227 1701 1701 PHE PHE C . n 
C 1 228 ILE 228 1702 1702 ILE ILE C . n 
C 1 229 PRO 229 1703 1703 PRO PRO C . n 
C 1 230 PHE 230 1704 1704 PHE PHE C . n 
C 1 231 ILE 231 1705 1705 ILE ILE C . n 
C 1 232 PHE 232 1706 1706 PHE PHE C . n 
C 1 233 VAL 233 1707 1707 VAL VAL C . n 
C 1 234 VAL 234 1708 1708 VAL VAL C . n 
C 1 235 THR 235 1709 1709 THR THR C . n 
C 1 236 PHE 236 1710 1710 PHE PHE C . n 
C 1 237 VAL 237 1711 1711 VAL VAL C . n 
C 1 238 MET 238 1712 1712 MET MET C . n 
C 1 239 ILE 239 1713 1713 ILE ILE C . n 
C 1 240 ASN 240 1714 1714 ASN ASN C . n 
C 1 241 LEU 241 1715 1715 LEU LEU C . n 
C 1 242 VAL 242 1716 1716 VAL VAL C . n 
C 1 243 VAL 243 1717 1717 VAL VAL C . n 
C 1 244 ALA 244 1718 1718 ALA ALA C . n 
C 1 245 ILE 245 1719 1719 ILE ILE C . n 
C 1 246 ILE 246 1720 1720 ILE ILE C . n 
C 1 247 VAL 247 1721 1721 VAL VAL C . n 
C 1 248 ASP 248 1722 1722 ASP ASP C . n 
C 1 249 ALA 249 1723 1723 ALA ALA C . n 
C 1 250 MET 250 1724 1724 MET MET C . n 
C 1 251 ALA 251 1725 1725 ALA ALA C . n 
C 1 252 ILE 252 1726 1726 ILE ILE C . n 
C 1 253 LEU 253 1727 1727 LEU LEU C . n 
C 1 254 ASN 254 1728 1728 ASN ASN C . n 
C 1 255 GLN 255 1729 1729 GLN GLN C . n 
C 1 256 LYS 256 1730 1730 LYS LYS C . n 
C 1 257 GLU 257 1731 1731 GLU GLU C . n 
C 1 258 GLU 258 1732 1732 GLU GLU C . n 
C 1 259 GLN 259 1733 1733 GLN GLN C . n 
C 1 260 HIS 260 1734 1734 HIS HIS C . n 
C 1 261 ILE 261 1735 1735 ILE ILE C . n 
C 1 262 ILE 262 1736 1736 ILE ILE C . n 
C 1 263 ASP 263 1737 1737 ASP ASP C . n 
C 1 264 GLU 264 1738 ?    ?   ?   C . n 
C 1 265 VAL 265 1739 ?    ?   ?   C . n 
C 1 266 GLN 266 1740 ?    ?   ?   C . n 
C 1 267 SER 267 1741 ?    ?   ?   C . n 
C 1 268 HIS 268 1742 ?    ?   ?   C . n 
C 1 269 GLU 269 1743 ?    ?   ?   C . n 
C 1 270 ASP 270 1744 ?    ?   ?   C . n 
C 1 271 ASN 271 1745 ?    ?   ?   C . n 
C 1 272 ILE 272 1746 ?    ?   ?   C . n 
C 1 273 ASN 273 1747 ?    ?   ?   C . n 
C 1 274 ASN 274 1748 ?    ?   ?   C . n 
C 1 275 GLU 275 1749 ?    ?   ?   C . n 
C 1 276 ILE 276 1750 ?    ?   ?   C . n 
C 1 277 ILE 277 1751 ?    ?   ?   C . n 
C 1 278 LYS 278 1752 ?    ?   ?   C . n 
C 1 279 LEU 279 1753 ?    ?   ?   C . n 
C 1 280 ARG 280 1754 ?    ?   ?   C . n 
C 1 281 GLU 281 1755 ?    ?   ?   C . n 
C 1 282 GLU 282 1756 ?    ?   ?   C . n 
C 1 283 ILE 283 1757 ?    ?   ?   C . n 
C 1 284 VAL 284 1758 ?    ?   ?   C . n 
C 1 285 GLU 285 1759 ?    ?   ?   C . n 
C 1 286 LEU 286 1760 ?    ?   ?   C . n 
C 1 287 LYS 287 1761 ?    ?   ?   C . n 
C 1 288 GLU 288 1762 ?    ?   ?   C . n 
C 1 289 LEU 289 1763 ?    ?   ?   C . n 
C 1 290 ILE 290 1764 ?    ?   ?   C . n 
C 1 291 LYS 291 1765 ?    ?   ?   C . n 
C 1 292 THR 292 1766 ?    ?   ?   C . n 
C 1 293 SER 293 1767 ?    ?   ?   C . n 
C 1 294 LEU 294 1768 ?    ?   ?   C . n 
C 1 295 LYS 295 1769 ?    ?   ?   C . n 
C 1 296 ASN 296 1770 ?    ?   ?   C . n 
D 1 1   MET 1   -17  ?    ?   ?   D . n 
D 1 2   ASP 2   -16  ?    ?   ?   D . n 
D 1 3   TYR 3   -15  ?    ?   ?   D . n 
D 1 4   LYS 4   -14  ?    ?   ?   D . n 
D 1 5   ASP 5   -13  ?    ?   ?   D . n 
D 1 6   ASP 6   -12  ?    ?   ?   D . n 
D 1 7   ASP 7   -11  ?    ?   ?   D . n 
D 1 8   ASP 8   -10  ?    ?   ?   D . n 
D 1 9   LYS 9   -9   ?    ?   ?   D . n 
D 1 10  GLY 10  -8   ?    ?   ?   D . n 
D 1 11  SER 11  -7   ?    ?   ?   D . n 
D 1 12  LEU 12  -6   ?    ?   ?   D . n 
D 1 13  VAL 13  -5   ?    ?   ?   D . n 
D 1 14  PRO 14  -4   ?    ?   ?   D . n 
D 1 15  ARG 15  -3   ?    ?   ?   D . n 
D 1 16  GLY 16  -2   ?    ?   ?   D . n 
D 1 17  SER 17  -1   ?    ?   ?   D . n 
D 1 18  HIS 18  0    ?    ?   ?   D . n 
D 1 19  MET 19  1493 1493 MET MET D . n 
D 1 20  TYR 20  1494 1494 TYR TYR D . n 
D 1 21  LEU 21  1495 1495 LEU LEU D . n 
D 1 22  ARG 22  1496 1496 ARG ARG D . n 
D 1 23  ILE 23  1497 1497 ILE ILE D . n 
D 1 24  THR 24  1498 1498 THR THR D . n 
D 1 25  ASN 25  1499 1499 ASN ASN D . n 
D 1 26  ILE 26  1500 1500 ILE ILE D . n 
D 1 27  VAL 27  1501 1501 VAL VAL D . n 
D 1 28  GLU 28  1502 1502 GLU GLU D . n 
D 1 29  SER 29  1503 1503 SER SER D . n 
D 1 30  SER 30  1504 1504 SER SER D . n 
D 1 31  PHE 31  1505 1505 PHE PHE D . n 
D 1 32  PHE 32  1506 1506 PHE PHE D . n 
D 1 33  THR 33  1507 1507 THR THR D . n 
D 1 34  LYS 34  1508 1508 LYS LYS D . n 
D 1 35  PHE 35  1509 1509 PHE PHE D . n 
D 1 36  ILE 36  1510 1510 ILE ILE D . n 
D 1 37  ILE 37  1511 1511 ILE ILE D . n 
D 1 38  TYR 38  1512 1512 TYR TYR D . n 
D 1 39  LEU 39  1513 1513 LEU LEU D . n 
D 1 40  ILE 40  1514 1514 ILE ILE D . n 
D 1 41  VAL 41  1515 1515 VAL VAL D . n 
D 1 42  LEU 42  1516 1516 LEU LEU D . n 
D 1 43  ASN 43  1517 1517 ASN ASN D . n 
D 1 44  MET 44  1518 1518 MET MET D . n 
D 1 45  VAL 45  1519 1519 VAL VAL D . n 
D 1 46  THR 46  1520 1520 THR THR D . n 
D 1 47  MET 47  1521 1521 MET MET D . n 
D 1 48  MET 48  1522 1522 MET MET D . n 
D 1 49  VAL 49  1523 1523 VAL VAL D . n 
D 1 50  GLU 50  1524 1524 GLU GLU D . n 
D 1 51  LYS 51  1525 1525 LYS LYS D . n 
D 1 52  GLU 52  1526 1526 GLU GLU D . n 
D 1 53  GLY 53  1527 1527 GLY GLY D . n 
D 1 54  GLN 54  1528 1528 GLN GLN D . n 
D 1 55  SER 55  1529 1529 SER SER D . n 
D 1 56  GLN 56  1530 1530 GLN GLN D . n 
D 1 57  HIS 57  1531 1531 HIS HIS D . n 
D 1 58  MET 58  1532 1532 MET MET D . n 
D 1 59  THR 59  1533 1533 THR THR D . n 
D 1 60  GLU 60  1534 1534 GLU GLU D . n 
D 1 61  VAL 61  1535 1535 VAL VAL D . n 
D 1 62  LEU 62  1536 1536 LEU LEU D . n 
D 1 63  TYR 63  1537 1537 TYR TYR D . n 
D 1 64  TRP 64  1538 1538 TRP TRP D . n 
D 1 65  ILE 65  1539 1539 ILE ILE D . n 
D 1 66  ASN 66  1540 1540 ASN ASN D . n 
D 1 67  VAL 67  1541 1541 VAL VAL D . n 
D 1 68  VAL 68  1542 1542 VAL VAL D . n 
D 1 69  PHE 69  1543 1543 PHE PHE D . n 
D 1 70  ILE 70  1544 1544 ILE ILE D . n 
D 1 71  ILE 71  1545 1545 ILE ILE D . n 
D 1 72  LEU 72  1546 1546 LEU LEU D . n 
D 1 73  PHE 73  1547 1547 PHE PHE D . n 
D 1 74  THR 74  1548 1548 THR THR D . n 
D 1 75  ILE 75  1549 1549 ILE ILE D . n 
D 1 76  GLU 76  1550 1550 GLU GLU D . n 
D 1 77  ILE 77  1551 1551 ILE ILE D . n 
D 1 78  ILE 78  1552 1552 ILE ILE D . n 
D 1 79  LEU 79  1553 1553 LEU LEU D . n 
D 1 80  ARG 80  1554 1554 ARG ARG D . n 
D 1 81  ILE 81  1555 1555 ILE ILE D . n 
D 1 82  TYR 82  1556 1556 TYR TYR D . n 
D 1 83  VAL 83  1557 1557 VAL VAL D . n 
D 1 84  HIS 84  1558 1558 HIS HIS D . n 
D 1 85  ARG 85  1559 1559 ARG ARG D . n 
D 1 86  ILE 86  1560 1560 ILE ILE D . n 
D 1 87  SER 87  1561 1561 SER SER D . n 
D 1 88  PHE 88  1562 1562 PHE PHE D . n 
D 1 89  PHE 89  1563 1563 PHE PHE D . n 
D 1 90  LYS 90  1564 1564 LYS LYS D . n 
D 1 91  ASP 91  1565 1565 ASP ASP D . n 
D 1 92  PRO 92  1566 1566 PRO PRO D . n 
D 1 93  TRP 93  1567 1567 TRP TRP D . n 
D 1 94  SER 94  1568 1568 SER SER D . n 
D 1 95  LEU 95  1569 1569 LEU LEU D . n 
D 1 96  PHE 96  1570 1570 PHE PHE D . n 
D 1 97  ASP 97  1571 1571 ASP ASP D . n 
D 1 98  PHE 98  1572 1572 PHE PHE D . n 
D 1 99  VAL 99  1573 1573 VAL VAL D . n 
D 1 100 VAL 100 1574 1574 VAL VAL D . n 
D 1 101 VAL 101 1575 1575 VAL VAL D . n 
D 1 102 ILE 102 1576 1576 ILE ILE D . n 
D 1 103 ILE 103 1577 1577 ILE ILE D . n 
D 1 104 SER 104 1578 1578 SER SER D . n 
D 1 105 ILE 105 1579 1579 ILE ILE D . n 
D 1 106 VAL 106 1580 1580 VAL VAL D . n 
D 1 107 GLY 107 1581 1581 GLY GLY D . n 
D 1 108 MET 108 1582 1582 MET MET D . n 
D 1 109 PHE 109 1583 1583 PHE PHE D . n 
D 1 110 LEU 110 1584 1584 LEU LEU D . n 
D 1 111 ALA 111 1585 1585 ALA ALA D . n 
D 1 112 ASP 112 1586 1586 ASP ASP D . n 
D 1 113 LEU 113 1587 1587 LEU LEU D . n 
D 1 114 ILE 114 1588 1588 ILE ILE D . n 
D 1 115 GLU 115 1589 1589 GLU GLU D . n 
D 1 116 THR 116 1590 1590 THR THR D . n 
D 1 117 TYR 117 1591 1591 TYR TYR D . n 
D 1 118 PHE 118 1592 ?    ?   ?   D . n 
D 1 119 VAL 119 1593 ?    ?   ?   D . n 
D 1 120 SER 120 1594 ?    ?   ?   D . n 
D 1 121 PRO 121 1595 1595 PRO PRO D . n 
D 1 122 THR 122 1596 1596 THR THR D . n 
D 1 123 LEU 123 1597 1597 LEU LEU D . n 
D 1 124 PHE 124 1598 1598 PHE PHE D . n 
D 1 125 ARG 125 1599 1599 ARG ARG D . n 
D 1 126 VAL 126 1600 1600 VAL VAL D . n 
D 1 127 ILE 127 1601 1601 ILE ILE D . n 
D 1 128 ARG 128 1602 1602 ARG ARG D . n 
D 1 129 LEU 129 1603 1603 LEU LEU D . n 
D 1 130 ALA 130 1604 1604 ALA ALA D . n 
D 1 131 ARG 131 1605 1605 ARG ARG D . n 
D 1 132 ILE 132 1606 1606 ILE ILE D . n 
D 1 133 GLY 133 1607 1607 GLY GLY D . n 
D 1 134 ARG 134 1608 1608 ARG ARG D . n 
D 1 135 ILE 135 1609 1609 ILE ILE D . n 
D 1 136 LEU 136 1610 1610 LEU LEU D . n 
D 1 137 ARG 137 1611 1611 ARG ARG D . n 
D 1 138 LEU 138 1612 1612 LEU LEU D . n 
D 1 139 VAL 139 1613 1613 VAL VAL D . n 
D 1 140 THR 140 1614 1614 THR THR D . n 
D 1 141 ALA 141 1615 1615 ALA ALA D . n 
D 1 142 VAL 142 1616 1616 VAL VAL D . n 
D 1 143 PRO 143 1617 1617 PRO PRO D . n 
D 1 144 GLN 144 1618 1618 GLN GLN D . n 
D 1 145 MET 145 1619 1619 MET MET D . n 
D 1 146 ARG 146 1620 1620 ARG ARG D . n 
D 1 147 LYS 147 1621 1621 LYS LYS D . n 
D 1 148 ILE 148 1622 1622 ILE ILE D . n 
D 1 149 VAL 149 1623 1623 VAL VAL D . n 
D 1 150 SER 150 1624 1624 SER SER D . n 
D 1 151 ALA 151 1625 1625 ALA ALA D . n 
D 1 152 LEU 152 1626 1626 LEU LEU D . n 
D 1 153 ILE 153 1627 1627 ILE ILE D . n 
D 1 154 SER 154 1628 1628 SER SER D . n 
D 1 155 VAL 155 1629 1629 VAL VAL D . n 
D 1 156 ILE 156 1630 1630 ILE ILE D . n 
D 1 157 PRO 157 1631 1631 PRO PRO D . n 
D 1 158 GLY 158 1632 1632 GLY GLY D . n 
D 1 159 MET 159 1633 1633 MET MET D . n 
D 1 160 LEU 160 1634 1634 LEU LEU D . n 
D 1 161 SER 161 1635 1635 SER SER D . n 
D 1 162 VAL 162 1636 1636 VAL VAL D . n 
D 1 163 ILE 163 1637 1637 ILE ILE D . n 
D 1 164 ALA 164 1638 1638 ALA ALA D . n 
D 1 165 LEU 165 1639 1639 LEU LEU D . n 
D 1 166 MET 166 1640 1640 MET MET D . n 
D 1 167 THR 167 1641 1641 THR THR D . n 
D 1 168 LEU 168 1642 1642 LEU LEU D . n 
D 1 169 PHE 169 1643 1643 PHE PHE D . n 
D 1 170 PHE 170 1644 1644 PHE PHE D . n 
D 1 171 TYR 171 1645 1645 TYR TYR D . n 
D 1 172 ILE 172 1646 1646 ILE ILE D . n 
D 1 173 PHE 173 1647 1647 PHE PHE D . n 
D 1 174 ALA 174 1648 1648 ALA ALA D . n 
D 1 175 ILE 175 1649 1649 ILE ILE D . n 
D 1 176 MET 176 1650 1650 MET MET D . n 
D 1 177 ALA 177 1651 1651 ALA ALA D . n 
D 1 178 THR 178 1652 1652 THR THR D . n 
D 1 179 GLN 179 1653 1653 GLN GLN D . n 
D 1 180 LEU 180 1654 1654 LEU LEU D . n 
D 1 181 PHE 181 1655 1655 PHE PHE D . n 
D 1 182 GLY 182 1656 1656 GLY GLY D . n 
D 1 183 GLU 183 1657 1657 GLU GLU D . n 
D 1 184 ARG 184 1658 1658 ARG ARG D . n 
D 1 185 PHE 185 1659 1659 PHE PHE D . n 
D 1 186 PRO 186 1660 1660 PRO PRO D . n 
D 1 187 GLU 187 1661 1661 GLU GLU D . n 
D 1 188 TRP 188 1662 1662 TRP TRP D . n 
D 1 189 PHE 189 1663 1663 PHE PHE D . n 
D 1 190 GLY 190 1664 1664 GLY GLY D . n 
D 1 191 THR 191 1665 1665 THR THR D . n 
D 1 192 LEU 192 1666 1666 LEU LEU D . n 
D 1 193 GLY 193 1667 1667 GLY GLY D . n 
D 1 194 GLU 194 1668 1668 GLU GLU D . n 
D 1 195 SER 195 1669 1669 SER SER D . n 
D 1 196 PHE 196 1670 1670 PHE PHE D . n 
D 1 197 TYR 197 1671 1671 TYR TYR D . n 
D 1 198 THR 198 1672 1672 THR THR D . n 
D 1 199 LEU 199 1673 1673 LEU LEU D . n 
D 1 200 PHE 200 1674 1674 PHE PHE D . n 
D 1 201 GLN 201 1675 1675 GLN GLN D . n 
D 1 202 VAL 202 1676 1676 VAL VAL D . n 
D 1 203 MET 203 1677 1677 MET MET D . n 
D 1 204 THR 204 1678 1678 THR THR D . n 
D 1 205 LEU 205 1679 1679 LEU LEU D . n 
D 1 206 GLU 206 1680 1680 GLU GLU D . n 
D 1 207 SER 207 1681 1681 SER SER D . n 
D 1 208 TRP 208 1682 1682 TRP TRP D . n 
D 1 209 SER 209 1683 1683 SER SER D . n 
D 1 210 MET 210 1684 1684 MET MET D . n 
D 1 211 GLY 211 1685 1685 GLY GLY D . n 
D 1 212 ILE 212 1686 1686 ILE ILE D . n 
D 1 213 VAL 213 1687 1687 VAL VAL D . n 
D 1 214 ARG 214 1688 1688 ARG ARG D . n 
D 1 215 PRO 215 1689 1689 PRO PRO D . n 
D 1 216 LEU 216 1690 1690 LEU LEU D . n 
D 1 217 MET 217 1691 1691 MET MET D . n 
D 1 218 GLU 218 1692 1692 GLU GLU D . n 
D 1 219 VAL 219 1693 1693 VAL VAL D . n 
D 1 220 TYR 220 1694 1694 TYR TYR D . n 
D 1 221 PRO 221 1695 1695 PRO PRO D . n 
D 1 222 TYR 222 1696 1696 TYR TYR D . n 
D 1 223 ALA 223 1697 1697 ALA ALA D . n 
D 1 224 TRP 224 1698 1698 TRP TRP D . n 
D 1 225 VAL 225 1699 1699 VAL VAL D . n 
D 1 226 PHE 226 1700 1700 PHE PHE D . n 
D 1 227 PHE 227 1701 1701 PHE PHE D . n 
D 1 228 ILE 228 1702 1702 ILE ILE D . n 
D 1 229 PRO 229 1703 1703 PRO PRO D . n 
D 1 230 PHE 230 1704 1704 PHE PHE D . n 
D 1 231 ILE 231 1705 1705 ILE ILE D . n 
D 1 232 PHE 232 1706 1706 PHE PHE D . n 
D 1 233 VAL 233 1707 1707 VAL VAL D . n 
D 1 234 VAL 234 1708 1708 VAL VAL D . n 
D 1 235 THR 235 1709 1709 THR THR D . n 
D 1 236 PHE 236 1710 1710 PHE PHE D . n 
D 1 237 VAL 237 1711 1711 VAL VAL D . n 
D 1 238 MET 238 1712 1712 MET MET D . n 
D 1 239 ILE 239 1713 1713 ILE ILE D . n 
D 1 240 ASN 240 1714 1714 ASN ASN D . n 
D 1 241 LEU 241 1715 1715 LEU LEU D . n 
D 1 242 VAL 242 1716 1716 VAL VAL D . n 
D 1 243 VAL 243 1717 1717 VAL VAL D . n 
D 1 244 ALA 244 1718 1718 ALA ALA D . n 
D 1 245 ILE 245 1719 1719 ILE ILE D . n 
D 1 246 ILE 246 1720 1720 ILE ILE D . n 
D 1 247 VAL 247 1721 1721 VAL VAL D . n 
D 1 248 ASP 248 1722 1722 ASP ASP D . n 
D 1 249 ALA 249 1723 1723 ALA ALA D . n 
D 1 250 MET 250 1724 1724 MET MET D . n 
D 1 251 ALA 251 1725 1725 ALA ALA D . n 
D 1 252 ILE 252 1726 1726 ILE ILE D . n 
D 1 253 LEU 253 1727 1727 LEU LEU D . n 
D 1 254 ASN 254 1728 1728 ASN ASN D . n 
D 1 255 GLN 255 1729 1729 GLN GLN D . n 
D 1 256 LYS 256 1730 1730 LYS LYS D . n 
D 1 257 GLU 257 1731 1731 GLU GLU D . n 
D 1 258 GLU 258 1732 1732 GLU GLU D . n 
D 1 259 GLN 259 1733 1733 GLN GLN D . n 
D 1 260 HIS 260 1734 1734 HIS HIS D . n 
D 1 261 ILE 261 1735 1735 ILE ILE D . n 
D 1 262 ILE 262 1736 1736 ILE ILE D . n 
D 1 263 ASP 263 1737 1737 ASP ASP D . n 
D 1 264 GLU 264 1738 ?    ?   ?   D . n 
D 1 265 VAL 265 1739 ?    ?   ?   D . n 
D 1 266 GLN 266 1740 ?    ?   ?   D . n 
D 1 267 SER 267 1741 ?    ?   ?   D . n 
D 1 268 HIS 268 1742 ?    ?   ?   D . n 
D 1 269 GLU 269 1743 ?    ?   ?   D . n 
D 1 270 ASP 270 1744 ?    ?   ?   D . n 
D 1 271 ASN 271 1745 ?    ?   ?   D . n 
D 1 272 ILE 272 1746 ?    ?   ?   D . n 
D 1 273 ASN 273 1747 ?    ?   ?   D . n 
D 1 274 ASN 274 1748 ?    ?   ?   D . n 
D 1 275 GLU 275 1749 ?    ?   ?   D . n 
D 1 276 ILE 276 1750 ?    ?   ?   D . n 
D 1 277 ILE 277 1751 ?    ?   ?   D . n 
D 1 278 LYS 278 1752 ?    ?   ?   D . n 
D 1 279 LEU 279 1753 ?    ?   ?   D . n 
D 1 280 ARG 280 1754 ?    ?   ?   D . n 
D 1 281 GLU 281 1755 ?    ?   ?   D . n 
D 1 282 GLU 282 1756 ?    ?   ?   D . n 
D 1 283 ILE 283 1757 ?    ?   ?   D . n 
D 1 284 VAL 284 1758 ?    ?   ?   D . n 
D 1 285 GLU 285 1759 ?    ?   ?   D . n 
D 1 286 LEU 286 1760 ?    ?   ?   D . n 
D 1 287 LYS 287 1761 ?    ?   ?   D . n 
D 1 288 GLU 288 1762 ?    ?   ?   D . n 
D 1 289 LEU 289 1763 ?    ?   ?   D . n 
D 1 290 ILE 290 1764 ?    ?   ?   D . n 
D 1 291 LYS 291 1765 ?    ?   ?   D . n 
D 1 292 THR 292 1766 ?    ?   ?   D . n 
D 1 293 SER 293 1767 ?    ?   ?   D . n 
D 1 294 LEU 294 1768 ?    ?   ?   D . n 
D 1 295 LYS 295 1769 ?    ?   ?   D . n 
D 1 296 ASN 296 1770 ?    ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E  2 PX4 1 1801 2  PX4 PC1 A . 
F  2 PX4 1 1802 3  PX4 PC1 A . 
G  2 PX4 1 1803 10 PX4 PC1 A . 
H  2 PX4 1 1804 11 PX4 PC1 A . 
I  2 PX4 1 1805 13 PX4 PC1 A . 
J  2 PX4 1 1806 15 PX4 PC1 A . 
K  2 PX4 1 1807 19 PX4 PC1 A . 
L  3 5P2 1 1808 2  5P2 DRG A . 
M  2 PX4 1 1801 4  PX4 PC1 B . 
N  2 PX4 1 1802 5  PX4 PC1 B . 
O  2 PX4 1 1803 12 PX4 PC1 B . 
P  2 PX4 1 1804 16 PX4 PC1 B . 
Q  2 PX4 1 1805 20 PX4 PC1 B . 
R  3 5P2 1 1806 3  5P2 DRG B . 
S  2 PX4 1 1801 6  PX4 PC1 C . 
T  2 PX4 1 1802 7  PX4 PC1 C . 
U  2 PX4 1 1803 9  PX4 PC1 C . 
V  2 PX4 1 1804 21 PX4 PC1 C . 
W  3 5P2 1 1805 4  5P2 DRG C . 
X  2 PX4 1 1801 1  PX4 PC1 D . 
Y  2 PX4 1 1802 8  PX4 PC1 D . 
Z  2 PX4 1 1803 14 PX4 PC1 D . 
AA 2 PX4 1 1804 17 PX4 PC1 D . 
BA 2 PX4 1 1805 18 PX4 PC1 D . 
CA 3 5P2 1 1806 1  5P2 DRG D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 27610 ? 
1 MORE         -231  ? 
1 'SSA (A^2)'  48390 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-12-23 
2 'Structure model' 1 1 2015-12-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER  ? ? ? 2.11.5 1 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .      2 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? .      3 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? .      4 
# 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.entry_id             5EK0 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
'This construct is a chimera between the bacterial NavAb channel (A8EVM5) and human Nav1.7 (Q1585-3).' 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 1526 ? ? -20.52  -43.74  
2  1 GLN A 1528 ? ? 92.73   99.28   
3  1 ARG A 1559 ? ? 55.11   -126.57 
4  1 PHE A 1592 ? ? -53.21  15.12   
5  1 SER A 1594 ? ? 72.55   87.98   
6  1 GLN A 1618 ? ? 82.86   -32.45  
7  1 LEU A 1654 ? ? -77.03  -78.35  
8  1 VAL A 1693 ? ? -74.69  -70.26  
9  1 TYR A 1696 ? ? -98.69  32.26   
10 1 TYR B 1494 ? ? 52.57   2.67    
11 1 ILE B 1500 ? ? -71.05  -79.90  
12 1 GLU B 1502 ? ? 74.95   76.24   
13 1 SER B 1503 ? ? -147.92 -136.19 
14 1 SER B 1529 ? ? 94.01   136.31  
15 1 HIS B 1558 ? ? -118.82 69.50   
16 1 PHE B 1592 ? ? -40.67  86.17   
17 1 SER B 1594 ? ? 12.25   111.76  
18 1 LEU B 1603 ? ? -66.37  0.48    
19 1 THR B 1614 ? ? -108.28 -82.20  
20 1 GLN B 1618 ? ? 69.68   -30.12  
21 1 MET B 1633 ? ? -160.09 2.47    
22 1 LEU B 1654 ? ? -66.35  -70.08  
23 1 SER B 1681 ? ? 51.77   17.82   
24 1 VAL C 1523 ? ? -90.56  43.21   
25 1 GLN C 1528 ? ? -122.17 -51.14  
26 1 SER C 1529 ? ? 147.90  122.15  
27 1 ARG C 1559 ? ? 51.90   -86.94  
28 1 ARG C 1602 ? ? -57.60  -8.49   
29 1 ARG C 1611 ? ? -58.10  -4.53   
30 1 THR C 1614 ? ? -86.25  -75.36  
31 1 GLN C 1618 ? ? 77.80   -52.48  
32 1 LEU C 1634 ? ? -39.28  -28.84  
33 1 SER C 1681 ? ? 34.66   41.48   
34 1 TYR C 1696 ? ? -100.26 53.22   
35 1 TYR D 1494 ? ? -156.32 -20.46  
36 1 VAL D 1523 ? ? -72.33  25.63   
37 1 SER D 1529 ? ? 109.71  124.06  
38 1 VAL D 1557 ? ? -156.06 -42.25  
39 1 ARG D 1559 ? ? 53.56   -86.99  
40 1 ARG D 1602 ? ? -47.27  -18.68  
41 1 GLN D 1618 ? ? 175.04  -35.90  
42 1 GLU D 1657 ? ? -72.53  -71.46  
43 1 SER D 1681 ? ? 47.67   29.31   
44 1 ILE D 1686 ? ? -124.61 -63.37  
45 1 ILE D 1736 ? ? -150.15 -62.89  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 N 1 A PX4 1801 ? O5  ? E  PX4 1 O5  
2   1 N 1 A PX4 1801 ? C9  ? E  PX4 1 C9  
3   1 N 1 A PX4 1801 ? O6  ? E  PX4 1 O6  
4   1 N 1 A PX4 1801 ? C10 ? E  PX4 1 C10 
5   1 N 1 A PX4 1801 ? C11 ? E  PX4 1 C11 
6   1 N 1 A PX4 1801 ? C12 ? E  PX4 1 C12 
7   1 N 1 A PX4 1801 ? C13 ? E  PX4 1 C13 
8   1 N 1 A PX4 1801 ? C14 ? E  PX4 1 C14 
9   1 N 1 A PX4 1801 ? C15 ? E  PX4 1 C15 
10  1 N 1 A PX4 1801 ? C16 ? E  PX4 1 C16 
11  1 N 1 A PX4 1801 ? C17 ? E  PX4 1 C17 
12  1 N 1 A PX4 1801 ? C18 ? E  PX4 1 C18 
13  1 N 1 A PX4 1801 ? C19 ? E  PX4 1 C19 
14  1 N 1 A PX4 1801 ? C20 ? E  PX4 1 C20 
15  1 N 1 A PX4 1801 ? C21 ? E  PX4 1 C21 
16  1 N 1 A PX4 1801 ? C22 ? E  PX4 1 C22 
17  1 N 1 A PX4 1801 ? C23 ? E  PX4 1 C23 
18  1 N 1 A PX4 1801 ? O8  ? E  PX4 1 O8  
19  1 N 1 A PX4 1801 ? C24 ? E  PX4 1 C24 
20  1 N 1 A PX4 1801 ? C25 ? E  PX4 1 C25 
21  1 N 1 A PX4 1801 ? C26 ? E  PX4 1 C26 
22  1 N 1 A PX4 1801 ? C27 ? E  PX4 1 C27 
23  1 N 1 A PX4 1801 ? C28 ? E  PX4 1 C28 
24  1 N 1 A PX4 1801 ? C29 ? E  PX4 1 C29 
25  1 N 1 A PX4 1801 ? C30 ? E  PX4 1 C30 
26  1 N 1 A PX4 1801 ? C31 ? E  PX4 1 C31 
27  1 N 1 A PX4 1801 ? C32 ? E  PX4 1 C32 
28  1 N 1 A PX4 1801 ? C33 ? E  PX4 1 C33 
29  1 N 1 A PX4 1801 ? C34 ? E  PX4 1 C34 
30  1 N 1 A PX4 1801 ? C35 ? E  PX4 1 C35 
31  1 N 1 A PX4 1801 ? C36 ? E  PX4 1 C36 
32  1 N 1 A PX4 1802 ? C11 ? F  PX4 1 C11 
33  1 N 1 A PX4 1802 ? C12 ? F  PX4 1 C12 
34  1 N 1 A PX4 1802 ? C13 ? F  PX4 1 C13 
35  1 N 1 A PX4 1802 ? C14 ? F  PX4 1 C14 
36  1 N 1 A PX4 1802 ? C15 ? F  PX4 1 C15 
37  1 N 1 A PX4 1802 ? C16 ? F  PX4 1 C16 
38  1 N 1 A PX4 1802 ? C17 ? F  PX4 1 C17 
39  1 N 1 A PX4 1802 ? C18 ? F  PX4 1 C18 
40  1 N 1 A PX4 1802 ? C19 ? F  PX4 1 C19 
41  1 N 1 A PX4 1802 ? C20 ? F  PX4 1 C20 
42  1 N 1 A PX4 1802 ? C21 ? F  PX4 1 C21 
43  1 N 1 A PX4 1802 ? C22 ? F  PX4 1 C22 
44  1 N 1 A PX4 1802 ? C34 ? F  PX4 1 C34 
45  1 N 1 A PX4 1802 ? C35 ? F  PX4 1 C35 
46  1 N 1 A PX4 1802 ? C36 ? F  PX4 1 C36 
47  1 N 1 A PX4 1803 ? O1  ? G  PX4 1 O1  
48  1 N 1 A PX4 1803 ? O2  ? G  PX4 1 O2  
49  1 N 1 A PX4 1803 ? P1  ? G  PX4 1 P1  
50  1 N 1 A PX4 1803 ? O3  ? G  PX4 1 O3  
51  1 N 1 A PX4 1803 ? C1  ? G  PX4 1 C1  
52  1 N 1 A PX4 1803 ? C2  ? G  PX4 1 C2  
53  1 N 1 A PX4 1803 ? N1  ? G  PX4 1 N1  
54  1 N 1 A PX4 1803 ? C3  ? G  PX4 1 C3  
55  1 N 1 A PX4 1803 ? C4  ? G  PX4 1 C4  
56  1 N 1 A PX4 1803 ? C5  ? G  PX4 1 C5  
57  1 N 1 A PX4 1803 ? O4  ? G  PX4 1 O4  
58  1 N 1 A PX4 1803 ? C6  ? G  PX4 1 C6  
59  1 N 1 A PX4 1803 ? C7  ? G  PX4 1 C7  
60  1 N 1 A PX4 1803 ? C8  ? G  PX4 1 C8  
61  1 N 1 A PX4 1803 ? O5  ? G  PX4 1 O5  
62  1 N 1 A PX4 1803 ? C9  ? G  PX4 1 C9  
63  1 N 1 A PX4 1803 ? O6  ? G  PX4 1 O6  
64  1 N 1 A PX4 1803 ? C10 ? G  PX4 1 C10 
65  1 N 1 A PX4 1803 ? C11 ? G  PX4 1 C11 
66  1 N 1 A PX4 1803 ? C12 ? G  PX4 1 C12 
67  1 N 1 A PX4 1803 ? C13 ? G  PX4 1 C13 
68  1 N 1 A PX4 1803 ? C14 ? G  PX4 1 C14 
69  1 N 1 A PX4 1803 ? C15 ? G  PX4 1 C15 
70  1 N 1 A PX4 1803 ? C16 ? G  PX4 1 C16 
71  1 N 1 A PX4 1803 ? C17 ? G  PX4 1 C17 
72  1 N 1 A PX4 1803 ? C18 ? G  PX4 1 C18 
73  1 N 1 A PX4 1803 ? C19 ? G  PX4 1 C19 
74  1 N 1 A PX4 1803 ? C20 ? G  PX4 1 C20 
75  1 N 1 A PX4 1803 ? C21 ? G  PX4 1 C21 
76  1 N 1 A PX4 1803 ? C22 ? G  PX4 1 C22 
77  1 N 1 A PX4 1803 ? O7  ? G  PX4 1 O7  
78  1 N 1 A PX4 1803 ? O8  ? G  PX4 1 O8  
79  1 N 1 A PX4 1803 ? C29 ? G  PX4 1 C29 
80  1 N 1 A PX4 1803 ? C30 ? G  PX4 1 C30 
81  1 N 1 A PX4 1803 ? C31 ? G  PX4 1 C31 
82  1 N 1 A PX4 1803 ? C32 ? G  PX4 1 C32 
83  1 N 1 A PX4 1803 ? C33 ? G  PX4 1 C33 
84  1 N 1 A PX4 1803 ? C34 ? G  PX4 1 C34 
85  1 N 1 A PX4 1803 ? C35 ? G  PX4 1 C35 
86  1 N 1 A PX4 1803 ? C36 ? G  PX4 1 C36 
87  1 N 1 A PX4 1804 ? O1  ? H  PX4 1 O1  
88  1 N 1 A PX4 1804 ? O2  ? H  PX4 1 O2  
89  1 N 1 A PX4 1804 ? P1  ? H  PX4 1 P1  
90  1 N 1 A PX4 1804 ? O3  ? H  PX4 1 O3  
91  1 N 1 A PX4 1804 ? C1  ? H  PX4 1 C1  
92  1 N 1 A PX4 1804 ? C2  ? H  PX4 1 C2  
93  1 N 1 A PX4 1804 ? N1  ? H  PX4 1 N1  
94  1 N 1 A PX4 1804 ? C3  ? H  PX4 1 C3  
95  1 N 1 A PX4 1804 ? C4  ? H  PX4 1 C4  
96  1 N 1 A PX4 1804 ? C5  ? H  PX4 1 C5  
97  1 N 1 A PX4 1804 ? O4  ? H  PX4 1 O4  
98  1 N 1 A PX4 1804 ? C6  ? H  PX4 1 C6  
99  1 N 1 A PX4 1804 ? C7  ? H  PX4 1 C7  
100 1 N 1 A PX4 1804 ? C8  ? H  PX4 1 C8  
101 1 N 1 A PX4 1804 ? O5  ? H  PX4 1 O5  
102 1 N 1 A PX4 1804 ? C9  ? H  PX4 1 C9  
103 1 N 1 A PX4 1804 ? O6  ? H  PX4 1 O6  
104 1 N 1 A PX4 1804 ? C10 ? H  PX4 1 C10 
105 1 N 1 A PX4 1804 ? C11 ? H  PX4 1 C11 
106 1 N 1 A PX4 1804 ? O7  ? H  PX4 1 O7  
107 1 N 1 A PX4 1804 ? C23 ? H  PX4 1 C23 
108 1 N 1 A PX4 1804 ? O8  ? H  PX4 1 O8  
109 1 N 1 A PX4 1804 ? C24 ? H  PX4 1 C24 
110 1 N 1 A PX4 1804 ? C25 ? H  PX4 1 C25 
111 1 N 1 A PX4 1804 ? C26 ? H  PX4 1 C26 
112 1 N 1 A PX4 1804 ? C27 ? H  PX4 1 C27 
113 1 N 1 A PX4 1804 ? C28 ? H  PX4 1 C28 
114 1 N 1 A PX4 1804 ? C29 ? H  PX4 1 C29 
115 1 N 1 A PX4 1804 ? C30 ? H  PX4 1 C30 
116 1 N 1 A PX4 1804 ? C31 ? H  PX4 1 C31 
117 1 N 1 A PX4 1804 ? C32 ? H  PX4 1 C32 
118 1 N 1 A PX4 1804 ? C33 ? H  PX4 1 C33 
119 1 N 1 A PX4 1804 ? C34 ? H  PX4 1 C34 
120 1 N 1 A PX4 1804 ? C35 ? H  PX4 1 C35 
121 1 N 1 A PX4 1804 ? C36 ? H  PX4 1 C36 
122 1 N 1 A PX4 1805 ? O1  ? I  PX4 1 O1  
123 1 N 1 A PX4 1805 ? O2  ? I  PX4 1 O2  
124 1 N 1 A PX4 1805 ? P1  ? I  PX4 1 P1  
125 1 N 1 A PX4 1805 ? O3  ? I  PX4 1 O3  
126 1 N 1 A PX4 1805 ? C1  ? I  PX4 1 C1  
127 1 N 1 A PX4 1805 ? C2  ? I  PX4 1 C2  
128 1 N 1 A PX4 1805 ? N1  ? I  PX4 1 N1  
129 1 N 1 A PX4 1805 ? C3  ? I  PX4 1 C3  
130 1 N 1 A PX4 1805 ? C4  ? I  PX4 1 C4  
131 1 N 1 A PX4 1805 ? C5  ? I  PX4 1 C5  
132 1 N 1 A PX4 1805 ? O4  ? I  PX4 1 O4  
133 1 N 1 A PX4 1805 ? C6  ? I  PX4 1 C6  
134 1 N 1 A PX4 1805 ? C7  ? I  PX4 1 C7  
135 1 N 1 A PX4 1805 ? C8  ? I  PX4 1 C8  
136 1 N 1 A PX4 1805 ? O5  ? I  PX4 1 O5  
137 1 N 1 A PX4 1805 ? C9  ? I  PX4 1 C9  
138 1 N 1 A PX4 1805 ? O6  ? I  PX4 1 O6  
139 1 N 1 A PX4 1805 ? C10 ? I  PX4 1 C10 
140 1 N 1 A PX4 1805 ? C11 ? I  PX4 1 C11 
141 1 N 1 A PX4 1805 ? C12 ? I  PX4 1 C12 
142 1 N 1 A PX4 1805 ? C13 ? I  PX4 1 C13 
143 1 N 1 A PX4 1805 ? C14 ? I  PX4 1 C14 
144 1 N 1 A PX4 1805 ? C15 ? I  PX4 1 C15 
145 1 N 1 A PX4 1805 ? C16 ? I  PX4 1 C16 
146 1 N 1 A PX4 1805 ? C17 ? I  PX4 1 C17 
147 1 N 1 A PX4 1805 ? C18 ? I  PX4 1 C18 
148 1 N 1 A PX4 1805 ? C19 ? I  PX4 1 C19 
149 1 N 1 A PX4 1805 ? C20 ? I  PX4 1 C20 
150 1 N 1 A PX4 1805 ? C21 ? I  PX4 1 C21 
151 1 N 1 A PX4 1805 ? C22 ? I  PX4 1 C22 
152 1 N 1 A PX4 1805 ? O7  ? I  PX4 1 O7  
153 1 N 1 A PX4 1805 ? O8  ? I  PX4 1 O8  
154 1 N 1 A PX4 1805 ? C29 ? I  PX4 1 C29 
155 1 N 1 A PX4 1805 ? C30 ? I  PX4 1 C30 
156 1 N 1 A PX4 1805 ? C31 ? I  PX4 1 C31 
157 1 N 1 A PX4 1805 ? C32 ? I  PX4 1 C32 
158 1 N 1 A PX4 1805 ? C33 ? I  PX4 1 C33 
159 1 N 1 A PX4 1805 ? C34 ? I  PX4 1 C34 
160 1 N 1 A PX4 1805 ? C35 ? I  PX4 1 C35 
161 1 N 1 A PX4 1805 ? C36 ? I  PX4 1 C36 
162 1 N 1 A PX4 1806 ? O1  ? J  PX4 1 O1  
163 1 N 1 A PX4 1806 ? O2  ? J  PX4 1 O2  
164 1 N 1 A PX4 1806 ? P1  ? J  PX4 1 P1  
165 1 N 1 A PX4 1806 ? O3  ? J  PX4 1 O3  
166 1 N 1 A PX4 1806 ? C1  ? J  PX4 1 C1  
167 1 N 1 A PX4 1806 ? C2  ? J  PX4 1 C2  
168 1 N 1 A PX4 1806 ? N1  ? J  PX4 1 N1  
169 1 N 1 A PX4 1806 ? C3  ? J  PX4 1 C3  
170 1 N 1 A PX4 1806 ? C4  ? J  PX4 1 C4  
171 1 N 1 A PX4 1806 ? C5  ? J  PX4 1 C5  
172 1 N 1 A PX4 1806 ? O4  ? J  PX4 1 O4  
173 1 N 1 A PX4 1806 ? C6  ? J  PX4 1 C6  
174 1 N 1 A PX4 1806 ? C7  ? J  PX4 1 C7  
175 1 N 1 A PX4 1806 ? C8  ? J  PX4 1 C8  
176 1 N 1 A PX4 1806 ? O5  ? J  PX4 1 O5  
177 1 N 1 A PX4 1806 ? C9  ? J  PX4 1 C9  
178 1 N 1 A PX4 1806 ? O6  ? J  PX4 1 O6  
179 1 N 1 A PX4 1806 ? C10 ? J  PX4 1 C10 
180 1 N 1 A PX4 1806 ? C18 ? J  PX4 1 C18 
181 1 N 1 A PX4 1806 ? C19 ? J  PX4 1 C19 
182 1 N 1 A PX4 1806 ? C20 ? J  PX4 1 C20 
183 1 N 1 A PX4 1806 ? C21 ? J  PX4 1 C21 
184 1 N 1 A PX4 1806 ? C22 ? J  PX4 1 C22 
185 1 N 1 A PX4 1806 ? O7  ? J  PX4 1 O7  
186 1 N 1 A PX4 1806 ? C23 ? J  PX4 1 C23 
187 1 N 1 A PX4 1806 ? O8  ? J  PX4 1 O8  
188 1 N 1 A PX4 1806 ? C24 ? J  PX4 1 C24 
189 1 N 1 A PX4 1806 ? C25 ? J  PX4 1 C25 
190 1 N 1 A PX4 1806 ? C26 ? J  PX4 1 C26 
191 1 N 1 A PX4 1806 ? C27 ? J  PX4 1 C27 
192 1 N 1 A PX4 1806 ? C28 ? J  PX4 1 C28 
193 1 N 1 A PX4 1806 ? C29 ? J  PX4 1 C29 
194 1 N 1 A PX4 1806 ? C30 ? J  PX4 1 C30 
195 1 N 1 A PX4 1806 ? C31 ? J  PX4 1 C31 
196 1 N 1 A PX4 1806 ? C32 ? J  PX4 1 C32 
197 1 N 1 A PX4 1806 ? C33 ? J  PX4 1 C33 
198 1 N 1 A PX4 1806 ? C34 ? J  PX4 1 C34 
199 1 N 1 A PX4 1806 ? C35 ? J  PX4 1 C35 
200 1 N 1 A PX4 1806 ? C36 ? J  PX4 1 C36 
201 1 N 1 A PX4 1807 ? C8  ? K  PX4 1 C8  
202 1 N 1 A PX4 1807 ? O5  ? K  PX4 1 O5  
203 1 N 1 A PX4 1807 ? C9  ? K  PX4 1 C9  
204 1 N 1 A PX4 1807 ? O6  ? K  PX4 1 O6  
205 1 N 1 A PX4 1807 ? C10 ? K  PX4 1 C10 
206 1 N 1 A PX4 1807 ? C11 ? K  PX4 1 C11 
207 1 N 1 A PX4 1807 ? C12 ? K  PX4 1 C12 
208 1 N 1 A PX4 1807 ? C13 ? K  PX4 1 C13 
209 1 N 1 A PX4 1807 ? C14 ? K  PX4 1 C14 
210 1 N 1 A PX4 1807 ? C15 ? K  PX4 1 C15 
211 1 N 1 A PX4 1807 ? C16 ? K  PX4 1 C16 
212 1 N 1 A PX4 1807 ? C17 ? K  PX4 1 C17 
213 1 N 1 A PX4 1807 ? C18 ? K  PX4 1 C18 
214 1 N 1 A PX4 1807 ? C19 ? K  PX4 1 C19 
215 1 N 1 A PX4 1807 ? C20 ? K  PX4 1 C20 
216 1 N 1 A PX4 1807 ? C21 ? K  PX4 1 C21 
217 1 N 1 A PX4 1807 ? C22 ? K  PX4 1 C22 
218 1 N 1 A PX4 1807 ? O8  ? K  PX4 1 O8  
219 1 N 1 A PX4 1807 ? C24 ? K  PX4 1 C24 
220 1 N 1 A PX4 1807 ? C25 ? K  PX4 1 C25 
221 1 N 1 A PX4 1807 ? C26 ? K  PX4 1 C26 
222 1 N 1 A PX4 1807 ? C27 ? K  PX4 1 C27 
223 1 N 1 A PX4 1807 ? C28 ? K  PX4 1 C28 
224 1 N 1 A PX4 1807 ? C29 ? K  PX4 1 C29 
225 1 N 1 A PX4 1807 ? C30 ? K  PX4 1 C30 
226 1 N 1 A PX4 1807 ? C31 ? K  PX4 1 C31 
227 1 N 1 A PX4 1807 ? C32 ? K  PX4 1 C32 
228 1 N 1 A PX4 1807 ? C33 ? K  PX4 1 C33 
229 1 N 1 A PX4 1807 ? C34 ? K  PX4 1 C34 
230 1 N 1 A PX4 1807 ? C35 ? K  PX4 1 C35 
231 1 N 1 A PX4 1807 ? C36 ? K  PX4 1 C36 
232 1 N 1 B PX4 1801 ? O5  ? M  PX4 1 O5  
233 1 N 1 B PX4 1801 ? C9  ? M  PX4 1 C9  
234 1 N 1 B PX4 1801 ? O6  ? M  PX4 1 O6  
235 1 N 1 B PX4 1801 ? C10 ? M  PX4 1 C10 
236 1 N 1 B PX4 1801 ? C11 ? M  PX4 1 C11 
237 1 N 1 B PX4 1801 ? C12 ? M  PX4 1 C12 
238 1 N 1 B PX4 1801 ? C13 ? M  PX4 1 C13 
239 1 N 1 B PX4 1801 ? C14 ? M  PX4 1 C14 
240 1 N 1 B PX4 1801 ? C15 ? M  PX4 1 C15 
241 1 N 1 B PX4 1801 ? C16 ? M  PX4 1 C16 
242 1 N 1 B PX4 1801 ? C17 ? M  PX4 1 C17 
243 1 N 1 B PX4 1801 ? C18 ? M  PX4 1 C18 
244 1 N 1 B PX4 1801 ? C19 ? M  PX4 1 C19 
245 1 N 1 B PX4 1801 ? C20 ? M  PX4 1 C20 
246 1 N 1 B PX4 1801 ? C21 ? M  PX4 1 C21 
247 1 N 1 B PX4 1801 ? C22 ? M  PX4 1 C22 
248 1 N 1 B PX4 1801 ? C23 ? M  PX4 1 C23 
249 1 N 1 B PX4 1801 ? O8  ? M  PX4 1 O8  
250 1 N 1 B PX4 1801 ? C24 ? M  PX4 1 C24 
251 1 N 1 B PX4 1801 ? C25 ? M  PX4 1 C25 
252 1 N 1 B PX4 1801 ? C26 ? M  PX4 1 C26 
253 1 N 1 B PX4 1801 ? C27 ? M  PX4 1 C27 
254 1 N 1 B PX4 1801 ? C28 ? M  PX4 1 C28 
255 1 N 1 B PX4 1801 ? C29 ? M  PX4 1 C29 
256 1 N 1 B PX4 1801 ? C30 ? M  PX4 1 C30 
257 1 N 1 B PX4 1801 ? C31 ? M  PX4 1 C31 
258 1 N 1 B PX4 1801 ? C32 ? M  PX4 1 C32 
259 1 N 1 B PX4 1801 ? C33 ? M  PX4 1 C33 
260 1 N 1 B PX4 1801 ? C34 ? M  PX4 1 C34 
261 1 N 1 B PX4 1801 ? C35 ? M  PX4 1 C35 
262 1 N 1 B PX4 1801 ? C36 ? M  PX4 1 C36 
263 1 N 1 B PX4 1802 ? C19 ? N  PX4 1 C19 
264 1 N 1 B PX4 1802 ? C20 ? N  PX4 1 C20 
265 1 N 1 B PX4 1802 ? C21 ? N  PX4 1 C21 
266 1 N 1 B PX4 1802 ? C22 ? N  PX4 1 C22 
267 1 N 1 B PX4 1802 ? C26 ? N  PX4 1 C26 
268 1 N 1 B PX4 1802 ? C27 ? N  PX4 1 C27 
269 1 N 1 B PX4 1802 ? C28 ? N  PX4 1 C28 
270 1 N 1 B PX4 1802 ? C29 ? N  PX4 1 C29 
271 1 N 1 B PX4 1802 ? C30 ? N  PX4 1 C30 
272 1 N 1 B PX4 1802 ? C31 ? N  PX4 1 C31 
273 1 N 1 B PX4 1802 ? C32 ? N  PX4 1 C32 
274 1 N 1 B PX4 1802 ? C33 ? N  PX4 1 C33 
275 1 N 1 B PX4 1802 ? C34 ? N  PX4 1 C34 
276 1 N 1 B PX4 1802 ? C35 ? N  PX4 1 C35 
277 1 N 1 B PX4 1802 ? C36 ? N  PX4 1 C36 
278 1 N 1 B PX4 1803 ? C9  ? O  PX4 1 C9  
279 1 N 1 B PX4 1803 ? O6  ? O  PX4 1 O6  
280 1 N 1 B PX4 1803 ? C10 ? O  PX4 1 C10 
281 1 N 1 B PX4 1803 ? C11 ? O  PX4 1 C11 
282 1 N 1 B PX4 1803 ? C12 ? O  PX4 1 C12 
283 1 N 1 B PX4 1803 ? C13 ? O  PX4 1 C13 
284 1 N 1 B PX4 1803 ? C14 ? O  PX4 1 C14 
285 1 N 1 B PX4 1803 ? C15 ? O  PX4 1 C15 
286 1 N 1 B PX4 1803 ? C16 ? O  PX4 1 C16 
287 1 N 1 B PX4 1803 ? C17 ? O  PX4 1 C17 
288 1 N 1 B PX4 1803 ? C18 ? O  PX4 1 C18 
289 1 N 1 B PX4 1803 ? C19 ? O  PX4 1 C19 
290 1 N 1 B PX4 1803 ? C20 ? O  PX4 1 C20 
291 1 N 1 B PX4 1803 ? C21 ? O  PX4 1 C21 
292 1 N 1 B PX4 1803 ? C22 ? O  PX4 1 C22 
293 1 N 1 B PX4 1803 ? C34 ? O  PX4 1 C34 
294 1 N 1 B PX4 1803 ? C35 ? O  PX4 1 C35 
295 1 N 1 B PX4 1803 ? C36 ? O  PX4 1 C36 
296 1 N 1 B PX4 1804 ? O1  ? P  PX4 1 O1  
297 1 N 1 B PX4 1804 ? O2  ? P  PX4 1 O2  
298 1 N 1 B PX4 1804 ? P1  ? P  PX4 1 P1  
299 1 N 1 B PX4 1804 ? O3  ? P  PX4 1 O3  
300 1 N 1 B PX4 1804 ? C1  ? P  PX4 1 C1  
301 1 N 1 B PX4 1804 ? C2  ? P  PX4 1 C2  
302 1 N 1 B PX4 1804 ? N1  ? P  PX4 1 N1  
303 1 N 1 B PX4 1804 ? C3  ? P  PX4 1 C3  
304 1 N 1 B PX4 1804 ? C4  ? P  PX4 1 C4  
305 1 N 1 B PX4 1804 ? C5  ? P  PX4 1 C5  
306 1 N 1 B PX4 1804 ? O4  ? P  PX4 1 O4  
307 1 N 1 B PX4 1804 ? C6  ? P  PX4 1 C6  
308 1 N 1 B PX4 1804 ? C7  ? P  PX4 1 C7  
309 1 N 1 B PX4 1804 ? C8  ? P  PX4 1 C8  
310 1 N 1 B PX4 1804 ? O5  ? P  PX4 1 O5  
311 1 N 1 B PX4 1804 ? C9  ? P  PX4 1 C9  
312 1 N 1 B PX4 1804 ? O6  ? P  PX4 1 O6  
313 1 N 1 B PX4 1804 ? C10 ? P  PX4 1 C10 
314 1 N 1 B PX4 1804 ? C17 ? P  PX4 1 C17 
315 1 N 1 B PX4 1804 ? C18 ? P  PX4 1 C18 
316 1 N 1 B PX4 1804 ? C19 ? P  PX4 1 C19 
317 1 N 1 B PX4 1804 ? C20 ? P  PX4 1 C20 
318 1 N 1 B PX4 1804 ? C21 ? P  PX4 1 C21 
319 1 N 1 B PX4 1804 ? C22 ? P  PX4 1 C22 
320 1 N 1 B PX4 1804 ? O7  ? P  PX4 1 O7  
321 1 N 1 B PX4 1804 ? C23 ? P  PX4 1 C23 
322 1 N 1 B PX4 1804 ? O8  ? P  PX4 1 O8  
323 1 N 1 B PX4 1804 ? C24 ? P  PX4 1 C24 
324 1 N 1 B PX4 1804 ? C25 ? P  PX4 1 C25 
325 1 N 1 B PX4 1804 ? C26 ? P  PX4 1 C26 
326 1 N 1 B PX4 1804 ? C27 ? P  PX4 1 C27 
327 1 N 1 B PX4 1804 ? C28 ? P  PX4 1 C28 
328 1 N 1 B PX4 1804 ? C29 ? P  PX4 1 C29 
329 1 N 1 B PX4 1804 ? C30 ? P  PX4 1 C30 
330 1 N 1 B PX4 1804 ? C31 ? P  PX4 1 C31 
331 1 N 1 B PX4 1804 ? C32 ? P  PX4 1 C32 
332 1 N 1 B PX4 1804 ? C33 ? P  PX4 1 C33 
333 1 N 1 B PX4 1804 ? C34 ? P  PX4 1 C34 
334 1 N 1 B PX4 1804 ? C35 ? P  PX4 1 C35 
335 1 N 1 B PX4 1804 ? C36 ? P  PX4 1 C36 
336 1 N 1 B PX4 1805 ? C16 ? Q  PX4 1 C16 
337 1 N 1 B PX4 1805 ? C17 ? Q  PX4 1 C17 
338 1 N 1 B PX4 1805 ? C18 ? Q  PX4 1 C18 
339 1 N 1 B PX4 1805 ? C19 ? Q  PX4 1 C19 
340 1 N 1 B PX4 1805 ? C20 ? Q  PX4 1 C20 
341 1 N 1 B PX4 1805 ? C21 ? Q  PX4 1 C21 
342 1 N 1 B PX4 1805 ? C22 ? Q  PX4 1 C22 
343 1 N 1 B PX4 1805 ? O7  ? Q  PX4 1 O7  
344 1 N 1 B PX4 1805 ? C23 ? Q  PX4 1 C23 
345 1 N 1 B PX4 1805 ? O8  ? Q  PX4 1 O8  
346 1 N 1 B PX4 1805 ? C24 ? Q  PX4 1 C24 
347 1 N 1 B PX4 1805 ? C25 ? Q  PX4 1 C25 
348 1 N 1 B PX4 1805 ? C26 ? Q  PX4 1 C26 
349 1 N 1 B PX4 1805 ? C27 ? Q  PX4 1 C27 
350 1 N 1 B PX4 1805 ? C28 ? Q  PX4 1 C28 
351 1 N 1 B PX4 1805 ? C29 ? Q  PX4 1 C29 
352 1 N 1 B PX4 1805 ? C30 ? Q  PX4 1 C30 
353 1 N 1 B PX4 1805 ? C31 ? Q  PX4 1 C31 
354 1 N 1 B PX4 1805 ? C32 ? Q  PX4 1 C32 
355 1 N 1 B PX4 1805 ? C33 ? Q  PX4 1 C33 
356 1 N 1 B PX4 1805 ? C34 ? Q  PX4 1 C34 
357 1 N 1 B PX4 1805 ? C35 ? Q  PX4 1 C35 
358 1 N 1 B PX4 1805 ? C36 ? Q  PX4 1 C36 
359 1 N 1 C PX4 1801 ? C8  ? S  PX4 1 C8  
360 1 N 1 C PX4 1801 ? O5  ? S  PX4 1 O5  
361 1 N 1 C PX4 1801 ? C9  ? S  PX4 1 C9  
362 1 N 1 C PX4 1801 ? O6  ? S  PX4 1 O6  
363 1 N 1 C PX4 1801 ? C10 ? S  PX4 1 C10 
364 1 N 1 C PX4 1801 ? C11 ? S  PX4 1 C11 
365 1 N 1 C PX4 1801 ? C12 ? S  PX4 1 C12 
366 1 N 1 C PX4 1801 ? C13 ? S  PX4 1 C13 
367 1 N 1 C PX4 1801 ? C14 ? S  PX4 1 C14 
368 1 N 1 C PX4 1801 ? C15 ? S  PX4 1 C15 
369 1 N 1 C PX4 1801 ? C16 ? S  PX4 1 C16 
370 1 N 1 C PX4 1801 ? C17 ? S  PX4 1 C17 
371 1 N 1 C PX4 1801 ? C18 ? S  PX4 1 C18 
372 1 N 1 C PX4 1801 ? C19 ? S  PX4 1 C19 
373 1 N 1 C PX4 1801 ? C20 ? S  PX4 1 C20 
374 1 N 1 C PX4 1801 ? C21 ? S  PX4 1 C21 
375 1 N 1 C PX4 1801 ? C22 ? S  PX4 1 C22 
376 1 N 1 C PX4 1801 ? C23 ? S  PX4 1 C23 
377 1 N 1 C PX4 1801 ? O8  ? S  PX4 1 O8  
378 1 N 1 C PX4 1801 ? C24 ? S  PX4 1 C24 
379 1 N 1 C PX4 1801 ? C25 ? S  PX4 1 C25 
380 1 N 1 C PX4 1801 ? C26 ? S  PX4 1 C26 
381 1 N 1 C PX4 1801 ? C27 ? S  PX4 1 C27 
382 1 N 1 C PX4 1801 ? C28 ? S  PX4 1 C28 
383 1 N 1 C PX4 1801 ? C29 ? S  PX4 1 C29 
384 1 N 1 C PX4 1801 ? C30 ? S  PX4 1 C30 
385 1 N 1 C PX4 1801 ? C31 ? S  PX4 1 C31 
386 1 N 1 C PX4 1801 ? C32 ? S  PX4 1 C32 
387 1 N 1 C PX4 1801 ? C33 ? S  PX4 1 C33 
388 1 N 1 C PX4 1801 ? C34 ? S  PX4 1 C34 
389 1 N 1 C PX4 1801 ? C35 ? S  PX4 1 C35 
390 1 N 1 C PX4 1801 ? C36 ? S  PX4 1 C36 
391 1 N 1 C PX4 1802 ? C20 ? T  PX4 1 C20 
392 1 N 1 C PX4 1802 ? C21 ? T  PX4 1 C21 
393 1 N 1 C PX4 1802 ? C22 ? T  PX4 1 C22 
394 1 N 1 C PX4 1802 ? C28 ? T  PX4 1 C28 
395 1 N 1 C PX4 1802 ? C29 ? T  PX4 1 C29 
396 1 N 1 C PX4 1802 ? C30 ? T  PX4 1 C30 
397 1 N 1 C PX4 1802 ? C31 ? T  PX4 1 C31 
398 1 N 1 C PX4 1802 ? C32 ? T  PX4 1 C32 
399 1 N 1 C PX4 1802 ? C33 ? T  PX4 1 C33 
400 1 N 1 C PX4 1802 ? C34 ? T  PX4 1 C34 
401 1 N 1 C PX4 1802 ? C35 ? T  PX4 1 C35 
402 1 N 1 C PX4 1802 ? C36 ? T  PX4 1 C36 
403 1 N 1 C PX4 1803 ? O1  ? U  PX4 1 O1  
404 1 N 1 C PX4 1803 ? O2  ? U  PX4 1 O2  
405 1 N 1 C PX4 1803 ? P1  ? U  PX4 1 P1  
406 1 N 1 C PX4 1803 ? O3  ? U  PX4 1 O3  
407 1 N 1 C PX4 1803 ? C1  ? U  PX4 1 C1  
408 1 N 1 C PX4 1803 ? C2  ? U  PX4 1 C2  
409 1 N 1 C PX4 1803 ? N1  ? U  PX4 1 N1  
410 1 N 1 C PX4 1803 ? C3  ? U  PX4 1 C3  
411 1 N 1 C PX4 1803 ? C4  ? U  PX4 1 C4  
412 1 N 1 C PX4 1803 ? C5  ? U  PX4 1 C5  
413 1 N 1 C PX4 1803 ? O4  ? U  PX4 1 O4  
414 1 N 1 C PX4 1803 ? C6  ? U  PX4 1 C6  
415 1 N 1 C PX4 1803 ? C7  ? U  PX4 1 C7  
416 1 N 1 C PX4 1803 ? C8  ? U  PX4 1 C8  
417 1 N 1 C PX4 1803 ? O5  ? U  PX4 1 O5  
418 1 N 1 C PX4 1803 ? C9  ? U  PX4 1 C9  
419 1 N 1 C PX4 1803 ? O6  ? U  PX4 1 O6  
420 1 N 1 C PX4 1803 ? C10 ? U  PX4 1 C10 
421 1 N 1 C PX4 1803 ? C19 ? U  PX4 1 C19 
422 1 N 1 C PX4 1803 ? C20 ? U  PX4 1 C20 
423 1 N 1 C PX4 1803 ? C21 ? U  PX4 1 C21 
424 1 N 1 C PX4 1803 ? C22 ? U  PX4 1 C22 
425 1 N 1 C PX4 1803 ? O7  ? U  PX4 1 O7  
426 1 N 1 C PX4 1803 ? C23 ? U  PX4 1 C23 
427 1 N 1 C PX4 1803 ? O8  ? U  PX4 1 O8  
428 1 N 1 C PX4 1803 ? C24 ? U  PX4 1 C24 
429 1 N 1 C PX4 1803 ? C25 ? U  PX4 1 C25 
430 1 N 1 C PX4 1803 ? C26 ? U  PX4 1 C26 
431 1 N 1 C PX4 1803 ? C27 ? U  PX4 1 C27 
432 1 N 1 C PX4 1803 ? C28 ? U  PX4 1 C28 
433 1 N 1 C PX4 1803 ? C29 ? U  PX4 1 C29 
434 1 N 1 C PX4 1803 ? C30 ? U  PX4 1 C30 
435 1 N 1 C PX4 1803 ? C31 ? U  PX4 1 C31 
436 1 N 1 C PX4 1803 ? C32 ? U  PX4 1 C32 
437 1 N 1 C PX4 1803 ? C33 ? U  PX4 1 C33 
438 1 N 1 C PX4 1803 ? C34 ? U  PX4 1 C34 
439 1 N 1 C PX4 1803 ? C35 ? U  PX4 1 C35 
440 1 N 1 C PX4 1803 ? C36 ? U  PX4 1 C36 
441 1 N 1 C PX4 1804 ? C1  ? V  PX4 1 C1  
442 1 N 1 C PX4 1804 ? C2  ? V  PX4 1 C2  
443 1 N 1 C PX4 1804 ? N1  ? V  PX4 1 N1  
444 1 N 1 C PX4 1804 ? C3  ? V  PX4 1 C3  
445 1 N 1 C PX4 1804 ? C4  ? V  PX4 1 C4  
446 1 N 1 C PX4 1804 ? C5  ? V  PX4 1 C5  
447 1 N 1 C PX4 1804 ? C9  ? V  PX4 1 C9  
448 1 N 1 C PX4 1804 ? O6  ? V  PX4 1 O6  
449 1 N 1 C PX4 1804 ? C10 ? V  PX4 1 C10 
450 1 N 1 C PX4 1804 ? C11 ? V  PX4 1 C11 
451 1 N 1 C PX4 1804 ? C12 ? V  PX4 1 C12 
452 1 N 1 C PX4 1804 ? C13 ? V  PX4 1 C13 
453 1 N 1 C PX4 1804 ? C14 ? V  PX4 1 C14 
454 1 N 1 C PX4 1804 ? C15 ? V  PX4 1 C15 
455 1 N 1 C PX4 1804 ? C16 ? V  PX4 1 C16 
456 1 N 1 C PX4 1804 ? C17 ? V  PX4 1 C17 
457 1 N 1 C PX4 1804 ? C18 ? V  PX4 1 C18 
458 1 N 1 C PX4 1804 ? C19 ? V  PX4 1 C19 
459 1 N 1 C PX4 1804 ? C20 ? V  PX4 1 C20 
460 1 N 1 C PX4 1804 ? C21 ? V  PX4 1 C21 
461 1 N 1 C PX4 1804 ? C22 ? V  PX4 1 C22 
462 1 N 1 C PX4 1804 ? O7  ? V  PX4 1 O7  
463 1 N 1 C PX4 1804 ? C23 ? V  PX4 1 C23 
464 1 N 1 C PX4 1804 ? O8  ? V  PX4 1 O8  
465 1 N 1 C PX4 1804 ? C24 ? V  PX4 1 C24 
466 1 N 1 C PX4 1804 ? C25 ? V  PX4 1 C25 
467 1 N 1 C PX4 1804 ? C26 ? V  PX4 1 C26 
468 1 N 1 C PX4 1804 ? C27 ? V  PX4 1 C27 
469 1 N 1 C PX4 1804 ? C28 ? V  PX4 1 C28 
470 1 N 1 C PX4 1804 ? C29 ? V  PX4 1 C29 
471 1 N 1 C PX4 1804 ? C30 ? V  PX4 1 C30 
472 1 N 1 C PX4 1804 ? C31 ? V  PX4 1 C31 
473 1 N 1 C PX4 1804 ? C32 ? V  PX4 1 C32 
474 1 N 1 C PX4 1804 ? C33 ? V  PX4 1 C33 
475 1 N 1 C PX4 1804 ? C34 ? V  PX4 1 C34 
476 1 N 1 C PX4 1804 ? C35 ? V  PX4 1 C35 
477 1 N 1 C PX4 1804 ? C36 ? V  PX4 1 C36 
478 1 N 1 D PX4 1801 ? C9  ? X  PX4 1 C9  
479 1 N 1 D PX4 1801 ? O6  ? X  PX4 1 O6  
480 1 N 1 D PX4 1801 ? C10 ? X  PX4 1 C10 
481 1 N 1 D PX4 1801 ? C11 ? X  PX4 1 C11 
482 1 N 1 D PX4 1801 ? C12 ? X  PX4 1 C12 
483 1 N 1 D PX4 1801 ? C13 ? X  PX4 1 C13 
484 1 N 1 D PX4 1801 ? C14 ? X  PX4 1 C14 
485 1 N 1 D PX4 1801 ? C15 ? X  PX4 1 C15 
486 1 N 1 D PX4 1801 ? C16 ? X  PX4 1 C16 
487 1 N 1 D PX4 1801 ? C17 ? X  PX4 1 C17 
488 1 N 1 D PX4 1801 ? C18 ? X  PX4 1 C18 
489 1 N 1 D PX4 1801 ? C19 ? X  PX4 1 C19 
490 1 N 1 D PX4 1801 ? C20 ? X  PX4 1 C20 
491 1 N 1 D PX4 1801 ? C21 ? X  PX4 1 C21 
492 1 N 1 D PX4 1801 ? C22 ? X  PX4 1 C22 
493 1 N 1 D PX4 1801 ? C34 ? X  PX4 1 C34 
494 1 N 1 D PX4 1801 ? C35 ? X  PX4 1 C35 
495 1 N 1 D PX4 1801 ? C36 ? X  PX4 1 C36 
496 1 N 1 D PX4 1802 ? O5  ? Y  PX4 1 O5  
497 1 N 1 D PX4 1802 ? C9  ? Y  PX4 1 C9  
498 1 N 1 D PX4 1802 ? O6  ? Y  PX4 1 O6  
499 1 N 1 D PX4 1802 ? C10 ? Y  PX4 1 C10 
500 1 N 1 D PX4 1802 ? C11 ? Y  PX4 1 C11 
501 1 N 1 D PX4 1802 ? C12 ? Y  PX4 1 C12 
502 1 N 1 D PX4 1802 ? C13 ? Y  PX4 1 C13 
503 1 N 1 D PX4 1802 ? C14 ? Y  PX4 1 C14 
504 1 N 1 D PX4 1802 ? C15 ? Y  PX4 1 C15 
505 1 N 1 D PX4 1802 ? C16 ? Y  PX4 1 C16 
506 1 N 1 D PX4 1802 ? C17 ? Y  PX4 1 C17 
507 1 N 1 D PX4 1802 ? C18 ? Y  PX4 1 C18 
508 1 N 1 D PX4 1802 ? C19 ? Y  PX4 1 C19 
509 1 N 1 D PX4 1802 ? C20 ? Y  PX4 1 C20 
510 1 N 1 D PX4 1802 ? C21 ? Y  PX4 1 C21 
511 1 N 1 D PX4 1802 ? C22 ? Y  PX4 1 C22 
512 1 N 1 D PX4 1802 ? C23 ? Y  PX4 1 C23 
513 1 N 1 D PX4 1802 ? O8  ? Y  PX4 1 O8  
514 1 N 1 D PX4 1802 ? C24 ? Y  PX4 1 C24 
515 1 N 1 D PX4 1802 ? C25 ? Y  PX4 1 C25 
516 1 N 1 D PX4 1802 ? C26 ? Y  PX4 1 C26 
517 1 N 1 D PX4 1802 ? C27 ? Y  PX4 1 C27 
518 1 N 1 D PX4 1802 ? C28 ? Y  PX4 1 C28 
519 1 N 1 D PX4 1802 ? C29 ? Y  PX4 1 C29 
520 1 N 1 D PX4 1802 ? C30 ? Y  PX4 1 C30 
521 1 N 1 D PX4 1802 ? C31 ? Y  PX4 1 C31 
522 1 N 1 D PX4 1802 ? C32 ? Y  PX4 1 C32 
523 1 N 1 D PX4 1802 ? C33 ? Y  PX4 1 C33 
524 1 N 1 D PX4 1802 ? C34 ? Y  PX4 1 C34 
525 1 N 1 D PX4 1802 ? C35 ? Y  PX4 1 C35 
526 1 N 1 D PX4 1802 ? C36 ? Y  PX4 1 C36 
527 1 N 1 D PX4 1803 ? O1  ? Z  PX4 1 O1  
528 1 N 1 D PX4 1803 ? O2  ? Z  PX4 1 O2  
529 1 N 1 D PX4 1803 ? P1  ? Z  PX4 1 P1  
530 1 N 1 D PX4 1803 ? O3  ? Z  PX4 1 O3  
531 1 N 1 D PX4 1803 ? C1  ? Z  PX4 1 C1  
532 1 N 1 D PX4 1803 ? C2  ? Z  PX4 1 C2  
533 1 N 1 D PX4 1803 ? N1  ? Z  PX4 1 N1  
534 1 N 1 D PX4 1803 ? C3  ? Z  PX4 1 C3  
535 1 N 1 D PX4 1803 ? C4  ? Z  PX4 1 C4  
536 1 N 1 D PX4 1803 ? C5  ? Z  PX4 1 C5  
537 1 N 1 D PX4 1803 ? O4  ? Z  PX4 1 O4  
538 1 N 1 D PX4 1803 ? C6  ? Z  PX4 1 C6  
539 1 N 1 D PX4 1803 ? C7  ? Z  PX4 1 C7  
540 1 N 1 D PX4 1803 ? C8  ? Z  PX4 1 C8  
541 1 N 1 D PX4 1803 ? O5  ? Z  PX4 1 O5  
542 1 N 1 D PX4 1803 ? C9  ? Z  PX4 1 C9  
543 1 N 1 D PX4 1803 ? O6  ? Z  PX4 1 O6  
544 1 N 1 D PX4 1803 ? C10 ? Z  PX4 1 C10 
545 1 N 1 D PX4 1803 ? C16 ? Z  PX4 1 C16 
546 1 N 1 D PX4 1803 ? C17 ? Z  PX4 1 C17 
547 1 N 1 D PX4 1803 ? C18 ? Z  PX4 1 C18 
548 1 N 1 D PX4 1803 ? C19 ? Z  PX4 1 C19 
549 1 N 1 D PX4 1803 ? C20 ? Z  PX4 1 C20 
550 1 N 1 D PX4 1803 ? C21 ? Z  PX4 1 C21 
551 1 N 1 D PX4 1803 ? C22 ? Z  PX4 1 C22 
552 1 N 1 D PX4 1803 ? O7  ? Z  PX4 1 O7  
553 1 N 1 D PX4 1803 ? C23 ? Z  PX4 1 C23 
554 1 N 1 D PX4 1803 ? O8  ? Z  PX4 1 O8  
555 1 N 1 D PX4 1803 ? C24 ? Z  PX4 1 C24 
556 1 N 1 D PX4 1803 ? C25 ? Z  PX4 1 C25 
557 1 N 1 D PX4 1803 ? C26 ? Z  PX4 1 C26 
558 1 N 1 D PX4 1803 ? C27 ? Z  PX4 1 C27 
559 1 N 1 D PX4 1803 ? C28 ? Z  PX4 1 C28 
560 1 N 1 D PX4 1803 ? C29 ? Z  PX4 1 C29 
561 1 N 1 D PX4 1803 ? C30 ? Z  PX4 1 C30 
562 1 N 1 D PX4 1803 ? C31 ? Z  PX4 1 C31 
563 1 N 1 D PX4 1803 ? C32 ? Z  PX4 1 C32 
564 1 N 1 D PX4 1803 ? C33 ? Z  PX4 1 C33 
565 1 N 1 D PX4 1803 ? C34 ? Z  PX4 1 C34 
566 1 N 1 D PX4 1803 ? C35 ? Z  PX4 1 C35 
567 1 N 1 D PX4 1803 ? C36 ? Z  PX4 1 C36 
568 1 N 1 D PX4 1804 ? O1  ? AA PX4 1 O1  
569 1 N 1 D PX4 1804 ? O2  ? AA PX4 1 O2  
570 1 N 1 D PX4 1804 ? P1  ? AA PX4 1 P1  
571 1 N 1 D PX4 1804 ? O3  ? AA PX4 1 O3  
572 1 N 1 D PX4 1804 ? C1  ? AA PX4 1 C1  
573 1 N 1 D PX4 1804 ? C2  ? AA PX4 1 C2  
574 1 N 1 D PX4 1804 ? N1  ? AA PX4 1 N1  
575 1 N 1 D PX4 1804 ? C3  ? AA PX4 1 C3  
576 1 N 1 D PX4 1804 ? C4  ? AA PX4 1 C4  
577 1 N 1 D PX4 1804 ? C5  ? AA PX4 1 C5  
578 1 N 1 D PX4 1804 ? O4  ? AA PX4 1 O4  
579 1 N 1 D PX4 1804 ? C6  ? AA PX4 1 C6  
580 1 N 1 D PX4 1804 ? C7  ? AA PX4 1 C7  
581 1 N 1 D PX4 1804 ? C8  ? AA PX4 1 C8  
582 1 N 1 D PX4 1804 ? O5  ? AA PX4 1 O5  
583 1 N 1 D PX4 1804 ? C9  ? AA PX4 1 C9  
584 1 N 1 D PX4 1804 ? O6  ? AA PX4 1 O6  
585 1 N 1 D PX4 1804 ? C10 ? AA PX4 1 C10 
586 1 N 1 D PX4 1804 ? C11 ? AA PX4 1 C11 
587 1 N 1 D PX4 1804 ? C12 ? AA PX4 1 C12 
588 1 N 1 D PX4 1804 ? C13 ? AA PX4 1 C13 
589 1 N 1 D PX4 1804 ? C14 ? AA PX4 1 C14 
590 1 N 1 D PX4 1804 ? C15 ? AA PX4 1 C15 
591 1 N 1 D PX4 1804 ? C16 ? AA PX4 1 C16 
592 1 N 1 D PX4 1804 ? C17 ? AA PX4 1 C17 
593 1 N 1 D PX4 1804 ? C18 ? AA PX4 1 C18 
594 1 N 1 D PX4 1804 ? C19 ? AA PX4 1 C19 
595 1 N 1 D PX4 1804 ? C20 ? AA PX4 1 C20 
596 1 N 1 D PX4 1804 ? C21 ? AA PX4 1 C21 
597 1 N 1 D PX4 1804 ? C22 ? AA PX4 1 C22 
598 1 N 1 D PX4 1804 ? O7  ? AA PX4 1 O7  
599 1 N 1 D PX4 1804 ? O8  ? AA PX4 1 O8  
600 1 N 1 D PX4 1804 ? C29 ? AA PX4 1 C29 
601 1 N 1 D PX4 1804 ? C30 ? AA PX4 1 C30 
602 1 N 1 D PX4 1804 ? C31 ? AA PX4 1 C31 
603 1 N 1 D PX4 1804 ? C32 ? AA PX4 1 C32 
604 1 N 1 D PX4 1804 ? C33 ? AA PX4 1 C33 
605 1 N 1 D PX4 1804 ? C34 ? AA PX4 1 C34 
606 1 N 1 D PX4 1804 ? C35 ? AA PX4 1 C35 
607 1 N 1 D PX4 1804 ? C36 ? AA PX4 1 C36 
608 1 N 1 D PX4 1805 ? C13 ? BA PX4 1 C13 
609 1 N 1 D PX4 1805 ? C14 ? BA PX4 1 C14 
610 1 N 1 D PX4 1805 ? C15 ? BA PX4 1 C15 
611 1 N 1 D PX4 1805 ? C16 ? BA PX4 1 C16 
612 1 N 1 D PX4 1805 ? C17 ? BA PX4 1 C17 
613 1 N 1 D PX4 1805 ? C18 ? BA PX4 1 C18 
614 1 N 1 D PX4 1805 ? C19 ? BA PX4 1 C19 
615 1 N 1 D PX4 1805 ? C20 ? BA PX4 1 C20 
616 1 N 1 D PX4 1805 ? C21 ? BA PX4 1 C21 
617 1 N 1 D PX4 1805 ? C22 ? BA PX4 1 C22 
618 1 N 1 D PX4 1805 ? O7  ? BA PX4 1 O7  
619 1 N 1 D PX4 1805 ? C23 ? BA PX4 1 C23 
620 1 N 1 D PX4 1805 ? O8  ? BA PX4 1 O8  
621 1 N 1 D PX4 1805 ? C24 ? BA PX4 1 C24 
622 1 N 1 D PX4 1805 ? C25 ? BA PX4 1 C25 
623 1 N 1 D PX4 1805 ? C26 ? BA PX4 1 C26 
624 1 N 1 D PX4 1805 ? C27 ? BA PX4 1 C27 
625 1 N 1 D PX4 1805 ? C28 ? BA PX4 1 C28 
626 1 N 1 D PX4 1805 ? C29 ? BA PX4 1 C29 
627 1 N 1 D PX4 1805 ? C30 ? BA PX4 1 C30 
628 1 N 1 D PX4 1805 ? C31 ? BA PX4 1 C31 
629 1 N 1 D PX4 1805 ? C32 ? BA PX4 1 C32 
630 1 N 1 D PX4 1805 ? C33 ? BA PX4 1 C33 
631 1 N 1 D PX4 1805 ? C34 ? BA PX4 1 C34 
632 1 N 1 D PX4 1805 ? C35 ? BA PX4 1 C35 
633 1 N 1 D PX4 1805 ? C36 ? BA PX4 1 C36 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET -17  ? A MET 1   
2   1 Y 1 A ASP -16  ? A ASP 2   
3   1 Y 1 A TYR -15  ? A TYR 3   
4   1 Y 1 A LYS -14  ? A LYS 4   
5   1 Y 1 A ASP -13  ? A ASP 5   
6   1 Y 1 A ASP -12  ? A ASP 6   
7   1 Y 1 A ASP -11  ? A ASP 7   
8   1 Y 1 A ASP -10  ? A ASP 8   
9   1 Y 1 A LYS -9   ? A LYS 9   
10  1 Y 1 A GLY -8   ? A GLY 10  
11  1 Y 1 A SER -7   ? A SER 11  
12  1 Y 1 A LEU -6   ? A LEU 12  
13  1 Y 1 A VAL -5   ? A VAL 13  
14  1 Y 1 A GLU 1738 ? A GLU 264 
15  1 Y 1 A VAL 1739 ? A VAL 265 
16  1 Y 1 A GLN 1740 ? A GLN 266 
17  1 Y 1 A SER 1741 ? A SER 267 
18  1 Y 1 A HIS 1742 ? A HIS 268 
19  1 Y 1 A GLU 1743 ? A GLU 269 
20  1 Y 1 A ASP 1744 ? A ASP 270 
21  1 Y 1 A ASN 1745 ? A ASN 271 
22  1 Y 1 A ILE 1746 ? A ILE 272 
23  1 Y 1 A ASN 1747 ? A ASN 273 
24  1 Y 1 A ASN 1748 ? A ASN 274 
25  1 Y 1 A GLU 1749 ? A GLU 275 
26  1 Y 1 A ILE 1750 ? A ILE 276 
27  1 Y 1 A ILE 1751 ? A ILE 277 
28  1 Y 1 A LYS 1752 ? A LYS 278 
29  1 Y 1 A LEU 1753 ? A LEU 279 
30  1 Y 1 A ARG 1754 ? A ARG 280 
31  1 Y 1 A GLU 1755 ? A GLU 281 
32  1 Y 1 A GLU 1756 ? A GLU 282 
33  1 Y 1 A ILE 1757 ? A ILE 283 
34  1 Y 1 A VAL 1758 ? A VAL 284 
35  1 Y 1 A GLU 1759 ? A GLU 285 
36  1 Y 1 A LEU 1760 ? A LEU 286 
37  1 Y 1 A LYS 1761 ? A LYS 287 
38  1 Y 1 A GLU 1762 ? A GLU 288 
39  1 Y 1 A LEU 1763 ? A LEU 289 
40  1 Y 1 A ILE 1764 ? A ILE 290 
41  1 Y 1 A LYS 1765 ? A LYS 291 
42  1 Y 1 A THR 1766 ? A THR 292 
43  1 Y 1 A SER 1767 ? A SER 293 
44  1 Y 1 A LEU 1768 ? A LEU 294 
45  1 Y 1 A LYS 1769 ? A LYS 295 
46  1 Y 1 A ASN 1770 ? A ASN 296 
47  1 Y 1 B MET -17  ? B MET 1   
48  1 Y 1 B ASP -16  ? B ASP 2   
49  1 Y 1 B TYR -15  ? B TYR 3   
50  1 Y 1 B LYS -14  ? B LYS 4   
51  1 Y 1 B ASP -13  ? B ASP 5   
52  1 Y 1 B ASP -12  ? B ASP 6   
53  1 Y 1 B ASP -11  ? B ASP 7   
54  1 Y 1 B ASP -10  ? B ASP 8   
55  1 Y 1 B LYS -9   ? B LYS 9   
56  1 Y 1 B GLY -8   ? B GLY 10  
57  1 Y 1 B SER -7   ? B SER 11  
58  1 Y 1 B LEU -6   ? B LEU 12  
59  1 Y 1 B VAL -5   ? B VAL 13  
60  1 Y 1 B PRO -4   ? B PRO 14  
61  1 Y 1 B ARG -3   ? B ARG 15  
62  1 Y 1 B GLY -2   ? B GLY 16  
63  1 Y 1 B SER -1   ? B SER 17  
64  1 Y 1 B HIS 0    ? B HIS 18  
65  1 Y 1 B GLU 1738 ? B GLU 264 
66  1 Y 1 B VAL 1739 ? B VAL 265 
67  1 Y 1 B GLN 1740 ? B GLN 266 
68  1 Y 1 B SER 1741 ? B SER 267 
69  1 Y 1 B HIS 1742 ? B HIS 268 
70  1 Y 1 B GLU 1743 ? B GLU 269 
71  1 Y 1 B ASP 1744 ? B ASP 270 
72  1 Y 1 B ASN 1745 ? B ASN 271 
73  1 Y 1 B ILE 1746 ? B ILE 272 
74  1 Y 1 B ASN 1747 ? B ASN 273 
75  1 Y 1 B ASN 1748 ? B ASN 274 
76  1 Y 1 B GLU 1749 ? B GLU 275 
77  1 Y 1 B ILE 1750 ? B ILE 276 
78  1 Y 1 B ILE 1751 ? B ILE 277 
79  1 Y 1 B LYS 1752 ? B LYS 278 
80  1 Y 1 B LEU 1753 ? B LEU 279 
81  1 Y 1 B ARG 1754 ? B ARG 280 
82  1 Y 1 B GLU 1755 ? B GLU 281 
83  1 Y 1 B GLU 1756 ? B GLU 282 
84  1 Y 1 B ILE 1757 ? B ILE 283 
85  1 Y 1 B VAL 1758 ? B VAL 284 
86  1 Y 1 B GLU 1759 ? B GLU 285 
87  1 Y 1 B LEU 1760 ? B LEU 286 
88  1 Y 1 B LYS 1761 ? B LYS 287 
89  1 Y 1 B GLU 1762 ? B GLU 288 
90  1 Y 1 B LEU 1763 ? B LEU 289 
91  1 Y 1 B ILE 1764 ? B ILE 290 
92  1 Y 1 B LYS 1765 ? B LYS 291 
93  1 Y 1 B THR 1766 ? B THR 292 
94  1 Y 1 B SER 1767 ? B SER 293 
95  1 Y 1 B LEU 1768 ? B LEU 294 
96  1 Y 1 B LYS 1769 ? B LYS 295 
97  1 Y 1 B ASN 1770 ? B ASN 296 
98  1 Y 1 C MET -17  ? C MET 1   
99  1 Y 1 C ASP -16  ? C ASP 2   
100 1 Y 1 C TYR -15  ? C TYR 3   
101 1 Y 1 C LYS -14  ? C LYS 4   
102 1 Y 1 C ASP -13  ? C ASP 5   
103 1 Y 1 C ASP -12  ? C ASP 6   
104 1 Y 1 C ASP -11  ? C ASP 7   
105 1 Y 1 C ASP -10  ? C ASP 8   
106 1 Y 1 C LYS -9   ? C LYS 9   
107 1 Y 1 C GLY -8   ? C GLY 10  
108 1 Y 1 C SER -7   ? C SER 11  
109 1 Y 1 C LEU -6   ? C LEU 12  
110 1 Y 1 C VAL -5   ? C VAL 13  
111 1 Y 1 C PRO -4   ? C PRO 14  
112 1 Y 1 C ARG -3   ? C ARG 15  
113 1 Y 1 C GLY -2   ? C GLY 16  
114 1 Y 1 C SER -1   ? C SER 17  
115 1 Y 1 C HIS 0    ? C HIS 18  
116 1 Y 1 C PHE 1592 ? C PHE 118 
117 1 Y 1 C VAL 1593 ? C VAL 119 
118 1 Y 1 C SER 1594 ? C SER 120 
119 1 Y 1 C GLU 1738 ? C GLU 264 
120 1 Y 1 C VAL 1739 ? C VAL 265 
121 1 Y 1 C GLN 1740 ? C GLN 266 
122 1 Y 1 C SER 1741 ? C SER 267 
123 1 Y 1 C HIS 1742 ? C HIS 268 
124 1 Y 1 C GLU 1743 ? C GLU 269 
125 1 Y 1 C ASP 1744 ? C ASP 270 
126 1 Y 1 C ASN 1745 ? C ASN 271 
127 1 Y 1 C ILE 1746 ? C ILE 272 
128 1 Y 1 C ASN 1747 ? C ASN 273 
129 1 Y 1 C ASN 1748 ? C ASN 274 
130 1 Y 1 C GLU 1749 ? C GLU 275 
131 1 Y 1 C ILE 1750 ? C ILE 276 
132 1 Y 1 C ILE 1751 ? C ILE 277 
133 1 Y 1 C LYS 1752 ? C LYS 278 
134 1 Y 1 C LEU 1753 ? C LEU 279 
135 1 Y 1 C ARG 1754 ? C ARG 280 
136 1 Y 1 C GLU 1755 ? C GLU 281 
137 1 Y 1 C GLU 1756 ? C GLU 282 
138 1 Y 1 C ILE 1757 ? C ILE 283 
139 1 Y 1 C VAL 1758 ? C VAL 284 
140 1 Y 1 C GLU 1759 ? C GLU 285 
141 1 Y 1 C LEU 1760 ? C LEU 286 
142 1 Y 1 C LYS 1761 ? C LYS 287 
143 1 Y 1 C GLU 1762 ? C GLU 288 
144 1 Y 1 C LEU 1763 ? C LEU 289 
145 1 Y 1 C ILE 1764 ? C ILE 290 
146 1 Y 1 C LYS 1765 ? C LYS 291 
147 1 Y 1 C THR 1766 ? C THR 292 
148 1 Y 1 C SER 1767 ? C SER 293 
149 1 Y 1 C LEU 1768 ? C LEU 294 
150 1 Y 1 C LYS 1769 ? C LYS 295 
151 1 Y 1 C ASN 1770 ? C ASN 296 
152 1 Y 1 D MET -17  ? D MET 1   
153 1 Y 1 D ASP -16  ? D ASP 2   
154 1 Y 1 D TYR -15  ? D TYR 3   
155 1 Y 1 D LYS -14  ? D LYS 4   
156 1 Y 1 D ASP -13  ? D ASP 5   
157 1 Y 1 D ASP -12  ? D ASP 6   
158 1 Y 1 D ASP -11  ? D ASP 7   
159 1 Y 1 D ASP -10  ? D ASP 8   
160 1 Y 1 D LYS -9   ? D LYS 9   
161 1 Y 1 D GLY -8   ? D GLY 10  
162 1 Y 1 D SER -7   ? D SER 11  
163 1 Y 1 D LEU -6   ? D LEU 12  
164 1 Y 1 D VAL -5   ? D VAL 13  
165 1 Y 1 D PRO -4   ? D PRO 14  
166 1 Y 1 D ARG -3   ? D ARG 15  
167 1 Y 1 D GLY -2   ? D GLY 16  
168 1 Y 1 D SER -1   ? D SER 17  
169 1 Y 1 D HIS 0    ? D HIS 18  
170 1 Y 1 D PHE 1592 ? D PHE 118 
171 1 Y 1 D VAL 1593 ? D VAL 119 
172 1 Y 1 D SER 1594 ? D SER 120 
173 1 Y 1 D GLU 1738 ? D GLU 264 
174 1 Y 1 D VAL 1739 ? D VAL 265 
175 1 Y 1 D GLN 1740 ? D GLN 266 
176 1 Y 1 D SER 1741 ? D SER 267 
177 1 Y 1 D HIS 1742 ? D HIS 268 
178 1 Y 1 D GLU 1743 ? D GLU 269 
179 1 Y 1 D ASP 1744 ? D ASP 270 
180 1 Y 1 D ASN 1745 ? D ASN 271 
181 1 Y 1 D ILE 1746 ? D ILE 272 
182 1 Y 1 D ASN 1747 ? D ASN 273 
183 1 Y 1 D ASN 1748 ? D ASN 274 
184 1 Y 1 D GLU 1749 ? D GLU 275 
185 1 Y 1 D ILE 1750 ? D ILE 276 
186 1 Y 1 D ILE 1751 ? D ILE 277 
187 1 Y 1 D LYS 1752 ? D LYS 278 
188 1 Y 1 D LEU 1753 ? D LEU 279 
189 1 Y 1 D ARG 1754 ? D ARG 280 
190 1 Y 1 D GLU 1755 ? D GLU 281 
191 1 Y 1 D GLU 1756 ? D GLU 282 
192 1 Y 1 D ILE 1757 ? D ILE 283 
193 1 Y 1 D VAL 1758 ? D VAL 284 
194 1 Y 1 D GLU 1759 ? D GLU 285 
195 1 Y 1 D LEU 1760 ? D LEU 286 
196 1 Y 1 D LYS 1761 ? D LYS 287 
197 1 Y 1 D GLU 1762 ? D GLU 288 
198 1 Y 1 D LEU 1763 ? D LEU 289 
199 1 Y 1 D ILE 1764 ? D ILE 290 
200 1 Y 1 D LYS 1765 ? D LYS 291 
201 1 Y 1 D THR 1766 ? D THR 292 
202 1 Y 1 D SER 1767 ? D SER 293 
203 1 Y 1 D LEU 1768 ? D LEU 294 
204 1 Y 1 D LYS 1769 ? D LYS 295 
205 1 Y 1 D ASN 1770 ? D ASN 296 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE                                                                                      
PX4 
3 '3-cyano-4-[2-[2-(1-ethylazetidin-3-yl)pyrazol-3-yl]-4-(trifluoromethyl)phenoxy]-~{N}-(1,2,4-thiadiazol-5-yl)benzenesulfonamide' 
5P2 
#