data_5ELI
# 
_entry.id   5ELI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ELI         
WWPDB D_1000215083 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ELI 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brett, T.J.' 1 
'Kober, D.L.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            5 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Neurodegenerative disease mutations in TREM2 reveal a functional surface and distinct loss-of-function mechanisms.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.20391 
_citation.pdbx_database_id_PubMed   27995897 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kober, D.L.'           1 ? 
primary 'Alexander-Brett, J.M.' 2 ? 
primary 'Karch, C.M.'           3 ? 
primary 'Cruchaga, C.'          4 ? 
primary 'Colonna, M.'           5 ? 
primary 'Holtzman, M.J.'        6 ? 
primary 'Brett, T.J.'           7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5ELI 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     125.763 
_cell.length_a_esd                 ? 
_cell.length_b                     125.763 
_cell.length_b_esd                 ? 
_cell.length_c                     183.659 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        24 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5ELI 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                181 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 64 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Triggering receptor expressed on myeloid cells 2' 14148.990 2 ? ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose           221.208   2 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TREM-2,Triggering receptor expressed on monocytes 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TGHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTIT
LRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLGTKHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TGHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTIT
LRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLGTKHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   GLY n 
1 3   HIS n 
1 4   ASN n 
1 5   THR n 
1 6   THR n 
1 7   VAL n 
1 8   PHE n 
1 9   GLN n 
1 10  GLY n 
1 11  VAL n 
1 12  ALA n 
1 13  GLY n 
1 14  GLN n 
1 15  SER n 
1 16  LEU n 
1 17  GLN n 
1 18  VAL n 
1 19  SER n 
1 20  CYS n 
1 21  PRO n 
1 22  TYR n 
1 23  ASP n 
1 24  SER n 
1 25  MET n 
1 26  LYS n 
1 27  HIS n 
1 28  TRP n 
1 29  GLY n 
1 30  ARG n 
1 31  ARG n 
1 32  LYS n 
1 33  ALA n 
1 34  TRP n 
1 35  CYS n 
1 36  ARG n 
1 37  GLN n 
1 38  LEU n 
1 39  GLY n 
1 40  GLU n 
1 41  LYS n 
1 42  GLY n 
1 43  PRO n 
1 44  CYS n 
1 45  GLN n 
1 46  ARG n 
1 47  VAL n 
1 48  VAL n 
1 49  SER n 
1 50  THR n 
1 51  HIS n 
1 52  ASN n 
1 53  LEU n 
1 54  TRP n 
1 55  LEU n 
1 56  LEU n 
1 57  SER n 
1 58  PHE n 
1 59  LEU n 
1 60  ARG n 
1 61  ARG n 
1 62  TRP n 
1 63  ASN n 
1 64  GLY n 
1 65  SER n 
1 66  THR n 
1 67  ALA n 
1 68  ILE n 
1 69  THR n 
1 70  ASP n 
1 71  ASP n 
1 72  THR n 
1 73  LEU n 
1 74  GLY n 
1 75  GLY n 
1 76  THR n 
1 77  LEU n 
1 78  THR n 
1 79  ILE n 
1 80  THR n 
1 81  LEU n 
1 82  ARG n 
1 83  ASN n 
1 84  LEU n 
1 85  GLN n 
1 86  PRO n 
1 87  HIS n 
1 88  ASP n 
1 89  ALA n 
1 90  GLY n 
1 91  LEU n 
1 92  TYR n 
1 93  GLN n 
1 94  CYS n 
1 95  GLN n 
1 96  SER n 
1 97  LEU n 
1 98  HIS n 
1 99  GLY n 
1 100 SER n 
1 101 GLU n 
1 102 ALA n 
1 103 ASP n 
1 104 THR n 
1 105 LEU n 
1 106 ARG n 
1 107 LYS n 
1 108 VAL n 
1 109 LEU n 
1 110 VAL n 
1 111 GLU n 
1 112 VAL n 
1 113 LEU n 
1 114 ALA n 
1 115 ASP n 
1 116 PRO n 
1 117 LEU n 
1 118 GLY n 
1 119 THR n 
1 120 LYS n 
1 121 HIS n 
1 122 HIS n 
1 123 HIS n 
1 124 HIS n 
1 125 HIS n 
1 126 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   126 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TREM2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                kidney 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               'embryonic kidney' 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 epithelial 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHLSEC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TREM2_HUMAN 
_struct_ref.pdbx_db_accession          Q9NZC2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLR
NLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPL
;
_struct_ref.pdbx_align_begin           19 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5ELI A 3 ? 117 ? Q9NZC2 19 ? 133 ? 19 133 
2 1 5ELI B 3 ? 117 ? Q9NZC2 19 ? 133 ? 19 133 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5ELI THR A 1   ? UNP Q9NZC2 ? ? 'expression tag' 17  1  
1 5ELI GLY A 2   ? UNP Q9NZC2 ? ? 'expression tag' 18  2  
1 5ELI GLY A 118 ? UNP Q9NZC2 ? ? 'expression tag' 134 3  
1 5ELI THR A 119 ? UNP Q9NZC2 ? ? 'expression tag' 135 4  
1 5ELI LYS A 120 ? UNP Q9NZC2 ? ? 'expression tag' 136 5  
1 5ELI HIS A 121 ? UNP Q9NZC2 ? ? 'expression tag' 137 6  
1 5ELI HIS A 122 ? UNP Q9NZC2 ? ? 'expression tag' 138 7  
1 5ELI HIS A 123 ? UNP Q9NZC2 ? ? 'expression tag' 139 8  
1 5ELI HIS A 124 ? UNP Q9NZC2 ? ? 'expression tag' 140 9  
1 5ELI HIS A 125 ? UNP Q9NZC2 ? ? 'expression tag' 141 10 
1 5ELI HIS A 126 ? UNP Q9NZC2 ? ? 'expression tag' 142 11 
2 5ELI THR B 1   ? UNP Q9NZC2 ? ? 'expression tag' 17  12 
2 5ELI GLY B 2   ? UNP Q9NZC2 ? ? 'expression tag' 18  13 
2 5ELI GLY B 118 ? UNP Q9NZC2 ? ? 'expression tag' 134 14 
2 5ELI THR B 119 ? UNP Q9NZC2 ? ? 'expression tag' 135 15 
2 5ELI LYS B 120 ? UNP Q9NZC2 ? ? 'expression tag' 136 16 
2 5ELI HIS B 121 ? UNP Q9NZC2 ? ? 'expression tag' 137 17 
2 5ELI HIS B 122 ? UNP Q9NZC2 ? ? 'expression tag' 138 18 
2 5ELI HIS B 123 ? UNP Q9NZC2 ? ? 'expression tag' 139 19 
2 5ELI HIS B 124 ? UNP Q9NZC2 ? ? 'expression tag' 140 20 
2 5ELI HIS B 125 ? UNP Q9NZC2 ? ? 'expression tag' 141 21 
2 5ELI HIS B 126 ? UNP Q9NZC2 ? ? 'expression tag' 142 22 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ELI 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            7.41 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         85.23 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.1 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2 M NaCl, 0.2 M MgCl2, 0.2 M NDSB 201, 100 mM HEPES pH 7.1' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-07-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'ROSENBAUM-ROCK HIGH-RESOLUTION DOUBLE CRYSTAL SI(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979180 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979180 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            86.38 
_reflns.entry_id                         5ELI 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.0977 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       16285 
_reflns.number_obs                       16285 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       0 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.9 
_reflns.pdbx_Rmerge_I_obs                0.109 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.109 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.96 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.0977 
_reflns_shell.d_res_low                   3.21 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.72 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.8 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             13.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               85.86 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5ELI 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.0977 
_refine.ls_d_res_low                             40.689 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     16171 
_refine.ls_number_reflns_R_free                  807 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.61 
_refine.ls_percent_reflns_R_free                 4.99 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2611 
_refine.ls_R_factor_R_free                       0.2736 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2605 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1U9K 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 29.69 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.48 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1784 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1784 
_refine_hist.d_res_high                       3.0977 
_refine_hist.d_res_low                        40.689 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 1826 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.181  ? 2484 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.639 ? 1076 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.059  ? 284  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 314  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.0977 3.2917  . . 131 2482 100.00 . . . 0.4059 . 0.3745 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2917 3.5458  . . 130 2505 100.00 . . . 0.3451 . 0.3073 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5458 3.9023  . . 132 2529 100.00 . . . 0.2775 . 0.2952 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9023 4.4664  . . 134 2532 100.00 . . . 0.2655 . 0.2582 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4664 5.6248  . . 135 2576 100.00 . . . 0.2171 . 0.2195 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.6248 40.6921 . . 145 2740 99.00  . . . 0.2659 . 0.2422 . . . . . . . . . . 
# 
_struct.entry_id                     5ELI 
_struct.title                        'Triggering receptor expressed on myeloid cells 2' 
_struct.pdbx_descriptor              'Triggering receptor expressed on myeloid cells 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5ELI 
_struct_keywords.text            'Activating receptors, TREM2, innate immunity, immune system receptor, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'Monomer confirmed by size exclusion chromatography' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 LEU A 53 ? SER A 57 ? LEU A 69  SER A 73  5 ? 5 
HELX_P HELX_P2 AA2 LEU B 53 ? SER B 57 ? LEU B 69  SER B 73  5 ? 5 
HELX_P HELX_P3 AA3 GLN B 85 ? ALA B 89 ? GLN B 101 ALA B 105 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 20 SG  ? ? ? 1_555 A CYS 94 SG ? ? A CYS 36 A CYS 110 1_555 ? ? ? ? ? ? ? 2.061 ? ?               
disulf2 disulf ?   ? A CYS 35 SG  ? ? ? 1_555 A CYS 44 SG ? ? A CYS 51 A CYS 60  1_555 ? ? ? ? ? ? ? 2.096 ? ?               
disulf3 disulf ?   ? B CYS 20 SG  ? ? ? 1_555 B CYS 94 SG ? ? B CYS 36 B CYS 110 1_555 ? ? ? ? ? ? ? 2.080 ? ?               
disulf4 disulf ?   ? B CYS 35 SG  ? ? ? 1_555 B CYS 44 SG ? ? B CYS 51 B CYS 60  1_555 ? ? ? ? ? ? ? 2.085 ? ?               
covale1 covale one ? A ASN 63 ND2 ? ? ? 1_555 C NAG .  C1 ? ? A ASN 79 A NAG 201 1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation 
covale2 covale one ? B ASN 63 ND2 ? ? ? 1_555 D NAG .  C1 ? ? B ASN 79 B NAG 201 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 42 A . ? GLY 58 A PRO 43 A ? PRO 59 A 1 -2.18 
2 GLY 42 B . ? GLY 58 B PRO 43 B ? PRO 59 B 1 0.75  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 4 ? 
AA3 ? 5 ? 
AA4 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 6   ? VAL A 11  ? THR A 22  VAL A 27  
AA1 2 GLU A 101 ? LEU A 113 ? GLU A 117 LEU A 129 
AA1 3 GLY A 90  ? HIS A 98  ? GLY A 106 HIS A 114 
AA1 4 ARG A 31  ? GLN A 37  ? ARG A 47  GLN A 53  
AA1 5 CYS A 44  ? SER A 49  ? CYS A 60  SER A 65  
AA2 1 LEU A 16  ? PRO A 21  ? LEU A 32  PRO A 37  
AA2 2 THR A 76  ? LEU A 81  ? THR A 92  LEU A 97  
AA2 3 THR A 66  ? ASP A 71  ? THR A 82  ASP A 87  
AA2 4 ARG A 61  ? ASN A 63  ? ARG A 77  ASN A 79  
AA3 1 THR B 6   ? VAL B 11  ? THR B 22  VAL B 27  
AA3 2 GLU B 101 ? LEU B 113 ? GLU B 117 LEU B 129 
AA3 3 GLY B 90  ? HIS B 98  ? GLY B 106 HIS B 114 
AA3 4 ARG B 31  ? GLN B 37  ? ARG B 47  GLN B 53  
AA3 5 CYS B 44  ? SER B 49  ? CYS B 60  SER B 65  
AA4 1 LEU B 16  ? PRO B 21  ? LEU B 32  PRO B 37  
AA4 2 THR B 76  ? LEU B 81  ? THR B 92  LEU B 97  
AA4 3 THR B 66  ? ASP B 71  ? THR B 82  ASP B 87  
AA4 4 ARG B 61  ? ASN B 63  ? ARG B 77  ASN B 79  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR A 6   ? N THR A 22  O LYS A 107 ? O LYS A 123 
AA1 2 3 O ASP A 103 ? O ASP A 119 N SER A 96  ? N SER A 112 
AA1 3 4 O LEU A 91  ? O LEU A 107 N GLN A 37  ? N GLN A 53  
AA1 4 5 N TRP A 34  ? N TRP A 50  O VAL A 48  ? O VAL A 64  
AA2 1 2 N LEU A 16  ? N LEU A 32  O LEU A 81  ? O LEU A 97  
AA2 2 3 O THR A 78  ? O THR A 94  N THR A 69  ? N THR A 85  
AA2 3 4 O THR A 66  ? O THR A 82  N ASN A 63  ? N ASN A 79  
AA3 1 2 N PHE B 8   ? N PHE B 24  O GLU B 111 ? O GLU B 127 
AA3 2 3 O ARG B 106 ? O ARG B 122 N CYS B 94  ? N CYS B 110 
AA3 3 4 O LEU B 97  ? O LEU B 113 N ARG B 31  ? N ARG B 47  
AA3 4 5 N TRP B 34  ? N TRP B 50  O VAL B 48  ? O VAL B 64  
AA4 1 2 N LEU B 16  ? N LEU B 32  O LEU B 81  ? O LEU B 97  
AA4 2 3 O THR B 78  ? O THR B 94  N THR B 69  ? N THR B 85  
AA4 3 4 O THR B 66  ? O THR B 82  N ASN B 63  ? N ASN B 79  
# 
_atom_sites.entry_id                    5ELI 
_atom_sites.fract_transf_matrix[1][1]   0.007951 
_atom_sites.fract_transf_matrix[1][2]   0.004591 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009182 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005445 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 4   ? -36.584 27.168 -12.725 1.00 136.17 ? 20  ASN A N   1 
ATOM   2    C CA  . ASN A 1 4   ? -36.216 25.856 -13.251 1.00 135.78 ? 20  ASN A CA  1 
ATOM   3    C C   . ASN A 1 4   ? -37.379 24.885 -13.495 1.00 131.30 ? 20  ASN A C   1 
ATOM   4    O O   . ASN A 1 4   ? -37.626 23.986 -12.691 1.00 129.86 ? 20  ASN A O   1 
ATOM   5    C CB  . ASN A 1 4   ? -35.204 25.185 -12.313 1.00 138.00 ? 20  ASN A CB  1 
ATOM   6    C CG  . ASN A 1 4   ? -35.686 25.120 -10.870 1.00 136.68 ? 20  ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 4   ? -36.826 25.472 -10.558 1.00 133.38 ? 20  ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 4   ? -34.836 24.596 -9.995  1.00 138.43 ? 20  ASN A ND2 1 
ATOM   9    N N   . THR A 1 5   ? -38.058 25.035 -14.630 1.00 128.94 ? 21  THR A N   1 
ATOM   10   C CA  . THR A 1 5   ? -38.984 24.002 -15.067 1.00 125.21 ? 21  THR A CA  1 
ATOM   11   C C   . THR A 1 5   ? -38.218 22.796 -15.607 1.00 126.10 ? 21  THR A C   1 
ATOM   12   O O   . THR A 1 5   ? -36.999 22.827 -15.793 1.00 129.61 ? 21  THR A O   1 
ATOM   13   C CB  . THR A 1 5   ? -39.893 24.519 -16.177 1.00 125.23 ? 21  THR A CB  1 
ATOM   14   O OG1 . THR A 1 5   ? -39.088 24.863 -17.305 1.00 127.55 ? 21  THR A OG1 1 
ATOM   15   C CG2 . THR A 1 5   ? -40.625 25.776 -15.748 1.00 123.97 ? 21  THR A CG2 1 
ATOM   16   N N   . THR A 1 6   ? -38.951 21.718 -15.865 1.00 123.94 ? 22  THR A N   1 
ATOM   17   C CA  . THR A 1 6   ? -38.364 20.499 -16.400 1.00 125.01 ? 22  THR A CA  1 
ATOM   18   C C   . THR A 1 6   ? -39.039 20.148 -17.722 1.00 122.73 ? 22  THR A C   1 
ATOM   19   O O   . THR A 1 6   ? -40.162 20.578 -18.000 1.00 119.69 ? 22  THR A O   1 
ATOM   20   C CB  . THR A 1 6   ? -38.465 19.328 -15.406 1.00 119.56 ? 22  THR A CB  1 
ATOM   21   O OG1 . THR A 1 6   ? -39.840 19.019 -15.149 1.00 114.66 ? 22  THR A OG1 1 
ATOM   22   C CG2 . THR A 1 6   ? -37.764 19.667 -14.093 1.00 122.32 ? 22  THR A CG2 1 
ATOM   23   N N   . VAL A 1 7   ? -38.344 19.360 -18.542 1.00 123.97 ? 23  VAL A N   1 
ATOM   24   C CA  . VAL A 1 7   ? -38.744 19.149 -19.929 1.00 121.53 ? 23  VAL A CA  1 
ATOM   25   C C   . VAL A 1 7   ? -38.967 17.660 -20.171 1.00 119.85 ? 23  VAL A C   1 
ATOM   26   O O   . VAL A 1 7   ? -38.312 16.803 -19.569 1.00 120.42 ? 23  VAL A O   1 
ATOM   27   C CB  . VAL A 1 7   ? -37.703 19.726 -20.916 1.00 120.80 ? 23  VAL A CB  1 
ATOM   28   C CG1 . VAL A 1 7   ? -36.403 18.939 -20.858 1.00 123.26 ? 23  VAL A CG1 1 
ATOM   29   C CG2 . VAL A 1 7   ? -38.264 19.777 -22.333 1.00 119.98 ? 23  VAL A CG2 1 
ATOM   30   N N   . PHE A 1 8   ? -39.919 17.360 -21.055 1.00 121.99 ? 24  PHE A N   1 
ATOM   31   C CA  . PHE A 1 8   ? -40.290 15.993 -21.410 1.00 117.47 ? 24  PHE A CA  1 
ATOM   32   C C   . PHE A 1 8   ? -40.419 15.895 -22.922 1.00 117.36 ? 24  PHE A C   1 
ATOM   33   O O   . PHE A 1 8   ? -41.231 16.612 -23.513 1.00 119.27 ? 24  PHE A O   1 
ATOM   34   C CB  . PHE A 1 8   ? -41.610 15.599 -20.744 1.00 111.00 ? 24  PHE A CB  1 
ATOM   35   C CG  . PHE A 1 8   ? -41.472 15.202 -19.304 1.00 108.92 ? 24  PHE A CG  1 
ATOM   36   C CD1 . PHE A 1 8   ? -41.207 13.890 -18.955 1.00 104.02 ? 24  PHE A CD1 1 
ATOM   37   C CD2 . PHE A 1 8   ? -41.619 16.143 -18.295 1.00 113.05 ? 24  PHE A CD2 1 
ATOM   38   C CE1 . PHE A 1 8   ? -41.089 13.521 -17.626 1.00 103.38 ? 24  PHE A CE1 1 
ATOM   39   C CE2 . PHE A 1 8   ? -41.500 15.781 -16.963 1.00 112.56 ? 24  PHE A CE2 1 
ATOM   40   C CZ  . PHE A 1 8   ? -41.235 14.469 -16.629 1.00 107.42 ? 24  PHE A CZ  1 
ATOM   41   N N   . GLN A 1 9   ? -39.646 15.008 -23.546 1.00 126.10 ? 25  GLN A N   1 
ATOM   42   C CA  . GLN A 1 9   ? -39.605 14.886 -25.001 1.00 126.40 ? 25  GLN A CA  1 
ATOM   43   C C   . GLN A 1 9   ? -40.401 13.670 -25.457 1.00 120.07 ? 25  GLN A C   1 
ATOM   44   O O   . GLN A 1 9   ? -40.256 12.578 -24.896 1.00 111.29 ? 25  GLN A O   1 
ATOM   45   C CB  . GLN A 1 9   ? -38.173 14.770 -25.525 1.00 126.68 ? 25  GLN A CB  1 
ATOM   46   C CG  . GLN A 1 9   ? -37.257 15.924 -25.197 1.00 129.85 ? 25  GLN A CG  1 
ATOM   47   C CD  . GLN A 1 9   ? -35.887 15.741 -25.821 1.00 131.89 ? 25  GLN A CD  1 
ATOM   48   O OE1 . GLN A 1 9   ? -35.485 14.620 -26.138 1.00 130.91 ? 25  GLN A OE1 1 
ATOM   49   N NE2 . GLN A 1 9   ? -35.169 16.842 -26.016 1.00 134.99 ? 25  GLN A NE2 1 
ATOM   50   N N   . GLY A 1 10  ? -41.235 13.862 -26.466 1.00 119.76 ? 26  GLY A N   1 
ATOM   51   C CA  . GLY A 1 10  ? -42.061 12.785 -26.989 1.00 110.78 ? 26  GLY A CA  1 
ATOM   52   C C   . GLY A 1 10  ? -41.999 12.679 -28.496 1.00 116.36 ? 26  GLY A C   1 
ATOM   53   O O   . GLY A 1 10  ? -41.963 13.687 -29.205 1.00 126.64 ? 26  GLY A O   1 
ATOM   54   N N   . VAL A 1 11  ? -41.974 11.437 -28.982 1.00 117.74 ? 27  VAL A N   1 
ATOM   55   C CA  . VAL A 1 11  ? -42.210 11.189 -30.397 1.00 121.96 ? 27  VAL A CA  1 
ATOM   56   C C   . VAL A 1 11  ? -43.695 11.366 -30.678 1.00 120.98 ? 27  VAL A C   1 
ATOM   57   O O   . VAL A 1 11  ? -44.548 10.801 -29.981 1.00 104.16 ? 27  VAL A O   1 
ATOM   58   C CB  . VAL A 1 11  ? -41.732 9.782  -30.787 1.00 117.55 ? 27  VAL A CB  1 
ATOM   59   C CG1 . VAL A 1 11  ? -42.290 9.385  -32.149 1.00 119.84 ? 27  VAL A CG1 1 
ATOM   60   C CG2 . VAL A 1 11  ? -40.212 9.717  -30.785 1.00 118.12 ? 27  VAL A CG2 1 
ATOM   61   N N   . ALA A 1 12  ? -44.013 12.151 -31.703 1.00 114.85 ? 28  ALA A N   1 
ATOM   62   C CA  . ALA A 1 12  ? -45.407 12.353 -32.065 1.00 110.18 ? 28  ALA A CA  1 
ATOM   63   C C   . ALA A 1 12  ? -46.029 11.047 -32.544 1.00 109.43 ? 28  ALA A C   1 
ATOM   64   O O   . ALA A 1 12  ? -45.354 10.171 -33.094 1.00 113.84 ? 28  ALA A O   1 
ATOM   65   C CB  . ALA A 1 12  ? -45.528 13.426 -33.147 1.00 117.86 ? 28  ALA A CB  1 
ATOM   66   N N   . GLY A 1 13  ? -47.336 10.925 -32.331 1.00 106.47 ? 29  GLY A N   1 
ATOM   67   C CA  . GLY A 1 13  ? -48.071 9.730  -32.680 1.00 105.12 ? 29  GLY A CA  1 
ATOM   68   C C   . GLY A 1 13  ? -47.963 8.589  -31.691 1.00 104.53 ? 29  GLY A C   1 
ATOM   69   O O   . GLY A 1 13  ? -48.620 7.558  -31.890 1.00 103.40 ? 29  GLY A O   1 
ATOM   70   N N   . GLN A 1 14  ? -47.167 8.733  -30.634 1.00 103.38 ? 30  GLN A N   1 
ATOM   71   C CA  . GLN A 1 14  ? -47.031 7.704  -29.613 1.00 105.29 ? 30  GLN A CA  1 
ATOM   72   C C   . GLN A 1 14  ? -47.044 8.384  -28.249 1.00 103.21 ? 30  GLN A C   1 
ATOM   73   O O   . GLN A 1 14  ? -46.795 9.588  -28.131 1.00 101.37 ? 30  GLN A O   1 
ATOM   74   C CB  . GLN A 1 14  ? -45.783 6.829  -29.821 1.00 106.42 ? 30  GLN A CB  1 
ATOM   75   C CG  . GLN A 1 14  ? -44.451 7.454  -29.484 1.00 109.74 ? 30  GLN A CG  1 
ATOM   76   C CD  . GLN A 1 14  ? -43.355 6.405  -29.372 1.00 115.52 ? 30  GLN A CD  1 
ATOM   77   O OE1 . GLN A 1 14  ? -42.784 5.971  -30.376 1.00 119.06 ? 30  GLN A OE1 1 
ATOM   78   N NE2 . GLN A 1 14  ? -43.071 5.979  -28.144 1.00 116.20 ? 30  GLN A NE2 1 
ATOM   79   N N   . SER A 1 15  ? -47.325 7.599  -27.214 1.00 94.27  ? 31  SER A N   1 
ATOM   80   C CA  . SER A 1 15  ? -47.758 8.146  -25.936 1.00 91.08  ? 31  SER A CA  1 
ATOM   81   C C   . SER A 1 15  ? -46.595 8.528  -25.028 1.00 94.44  ? 31  SER A C   1 
ATOM   82   O O   . SER A 1 15  ? -45.529 7.908  -25.043 1.00 99.61  ? 31  SER A O   1 
ATOM   83   C CB  . SER A 1 15  ? -48.649 7.136  -25.215 1.00 94.90  ? 31  SER A CB  1 
ATOM   84   O OG  . SER A 1 15  ? -49.731 6.753  -26.042 1.00 91.64  ? 31  SER A OG  1 
ATOM   85   N N   . LEU A 1 16  ? -46.833 9.560  -24.216 1.00 89.27  ? 32  LEU A N   1 
ATOM   86   C CA  . LEU A 1 16  ? -45.839 10.147 -23.326 1.00 91.57  ? 32  LEU A CA  1 
ATOM   87   C C   . LEU A 1 16  ? -46.392 10.194 -21.913 1.00 88.36  ? 32  LEU A C   1 
ATOM   88   O O   . LEU A 1 16  ? -47.558 10.535 -21.714 1.00 83.91  ? 32  LEU A O   1 
ATOM   89   C CB  . LEU A 1 16  ? -45.464 11.572 -23.751 1.00 90.14  ? 32  LEU A CB  1 
ATOM   90   C CG  . LEU A 1 16  ? -44.553 12.324 -22.772 1.00 92.33  ? 32  LEU A CG  1 
ATOM   91   C CD1 . LEU A 1 16  ? -43.199 11.635 -22.623 1.00 96.95  ? 32  LEU A CD1 1 
ATOM   92   C CD2 . LEU A 1 16  ? -44.392 13.793 -23.149 1.00 93.33  ? 32  LEU A CD2 1 
ATOM   93   N N   . GLN A 1 17  ? -45.560 9.864  -20.931 1.00 84.49  ? 33  GLN A N   1 
ATOM   94   C CA  . GLN A 1 17  ? -45.962 9.914  -19.532 1.00 82.29  ? 33  GLN A CA  1 
ATOM   95   C C   . GLN A 1 17  ? -45.072 10.880 -18.765 1.00 84.75  ? 33  GLN A C   1 
ATOM   96   O O   . GLN A 1 17  ? -43.846 10.844 -18.899 1.00 88.98  ? 33  GLN A O   1 
ATOM   97   C CB  . GLN A 1 17  ? -45.917 8.525  -18.899 1.00 85.16  ? 33  GLN A CB  1 
ATOM   98   C CG  . GLN A 1 17  ? -47.213 7.762  -19.068 1.00 80.54  ? 33  GLN A CG  1 
ATOM   99   C CD  . GLN A 1 17  ? -47.297 6.549  -18.175 1.00 80.64  ? 33  GLN A CD  1 
ATOM   100  O OE1 . GLN A 1 17  ? -46.308 6.150  -17.555 1.00 82.90  ? 33  GLN A OE1 1 
ATOM   101  N NE2 . GLN A 1 17  ? -48.487 5.959  -18.087 1.00 75.49  ? 33  GLN A NE2 1 
ATOM   102  N N   . VAL A 1 18  ? -45.692 11.731 -17.954 1.00 86.19  ? 34  VAL A N   1 
ATOM   103  C CA  . VAL A 1 18  ? -44.985 12.650 -17.072 1.00 88.50  ? 34  VAL A CA  1 
ATOM   104  C C   . VAL A 1 18  ? -45.347 12.309 -15.632 1.00 87.89  ? 34  VAL A C   1 
ATOM   105  O O   . VAL A 1 18  ? -46.495 11.955 -15.333 1.00 83.36  ? 34  VAL A O   1 
ATOM   106  C CB  . VAL A 1 18  ? -45.319 14.125 -17.387 1.00 88.95  ? 34  VAL A CB  1 
ATOM   107  C CG1 . VAL A 1 18  ? -44.722 14.528 -18.716 1.00 91.17  ? 34  VAL A CG1 1 
ATOM   108  C CG2 . VAL A 1 18  ? -46.809 14.340 -17.416 1.00 84.35  ? 34  VAL A CG2 1 
ATOM   109  N N   . SER A 1 19  ? -44.363 12.408 -14.743 1.00 86.08  ? 35  SER A N   1 
ATOM   110  C CA  . SER A 1 19  ? -44.526 12.030 -13.345 1.00 86.18  ? 35  SER A CA  1 
ATOM   111  C C   . SER A 1 19  ? -44.246 13.246 -12.474 1.00 88.14  ? 35  SER A C   1 
ATOM   112  O O   . SER A 1 19  ? -43.171 13.847 -12.562 1.00 92.56  ? 35  SER A O   1 
ATOM   113  C CB  . SER A 1 19  ? -43.600 10.868 -12.974 1.00 91.38  ? 35  SER A CB  1 
ATOM   114  O OG  . SER A 1 19  ? -42.253 11.183 -13.303 1.00 94.92  ? 35  SER A OG  1 
ATOM   115  N N   . CYS A 1 20  ? -45.223 13.614 -11.654 1.00 82.47  ? 36  CYS A N   1 
ATOM   116  C CA  . CYS A 1 20  ? -45.087 14.664 -10.659 1.00 85.06  ? 36  CYS A CA  1 
ATOM   117  C C   . CYS A 1 20  ? -44.977 14.021 -9.284  1.00 86.07  ? 36  CYS A C   1 
ATOM   118  O O   . CYS A 1 20  ? -45.991 13.552 -8.748  1.00 82.56  ? 36  CYS A O   1 
ATOM   119  C CB  . CYS A 1 20  ? -46.298 15.599 -10.735 1.00 98.18  ? 36  CYS A CB  1 
ATOM   120  S SG  . CYS A 1 20  ? -46.239 16.562 -12.274 1.00 96.79  ? 36  CYS A SG  1 
ATOM   121  N N   . PRO A 1 21  ? -43.795 13.973 -8.683  1.00 79.34  ? 37  PRO A N   1 
ATOM   122  C CA  . PRO A 1 21  ? -43.688 13.451 -7.319  1.00 80.55  ? 37  PRO A CA  1 
ATOM   123  C C   . PRO A 1 21  ? -44.126 14.494 -6.310  1.00 81.89  ? 37  PRO A C   1 
ATOM   124  O O   . PRO A 1 21  ? -44.050 15.700 -6.552  1.00 83.62  ? 37  PRO A O   1 
ATOM   125  C CB  . PRO A 1 21  ? -42.191 13.139 -7.176  1.00 83.28  ? 37  PRO A CB  1 
ATOM   126  C CG  . PRO A 1 21  ? -41.620 13.244 -8.576  1.00 83.84  ? 37  PRO A CG  1 
ATOM   127  C CD  . PRO A 1 21  ? -42.479 14.234 -9.272  1.00 82.40  ? 37  PRO A CD  1 
ATOM   128  N N   . TYR A 1 22  ? -44.571 14.018 -5.149  1.00 81.72  ? 38  TYR A N   1 
ATOM   129  C CA  . TYR A 1 22  ? -44.970 14.940 -4.096  1.00 80.91  ? 38  TYR A CA  1 
ATOM   130  C C   . TYR A 1 22  ? -44.971 14.234 -2.748  1.00 81.68  ? 38  TYR A C   1 
ATOM   131  O O   . TYR A 1 22  ? -44.876 13.006 -2.656  1.00 82.15  ? 38  TYR A O   1 
ATOM   132  C CB  . TYR A 1 22  ? -46.342 15.556 -4.385  1.00 81.64  ? 38  TYR A CB  1 
ATOM   133  C CG  . TYR A 1 22  ? -47.496 14.578 -4.428  1.00 78.22  ? 38  TYR A CG  1 
ATOM   134  C CD1 . TYR A 1 22  ? -48.304 14.387 -3.317  1.00 76.92  ? 38  TYR A CD1 1 
ATOM   135  C CD2 . TYR A 1 22  ? -47.780 13.850 -5.576  1.00 76.85  ? 38  TYR A CD2 1 
ATOM   136  C CE1 . TYR A 1 22  ? -49.362 13.501 -3.346  1.00 74.04  ? 38  TYR A CE1 1 
ATOM   137  C CE2 . TYR A 1 22  ? -48.843 12.966 -5.616  1.00 73.95  ? 38  TYR A CE2 1 
ATOM   138  C CZ  . TYR A 1 22  ? -49.627 12.793 -4.497  1.00 72.41  ? 38  TYR A CZ  1 
ATOM   139  O OH  . TYR A 1 22  ? -50.682 11.909 -4.533  1.00 70.12  ? 38  TYR A OH  1 
ATOM   140  N N   . ASP A 1 23  ? -45.088 15.053 -1.702  1.00 81.57  ? 39  ASP A N   1 
ATOM   141  C CA  . ASP A 1 23  ? -45.151 14.605 -0.315  1.00 82.68  ? 39  ASP A CA  1 
ATOM   142  C C   . ASP A 1 23  ? -46.541 14.049 -0.043  1.00 79.75  ? 39  ASP A C   1 
ATOM   143  O O   . ASP A 1 23  ? -47.513 14.807 0.037   1.00 77.94  ? 39  ASP A O   1 
ATOM   144  C CB  . ASP A 1 23  ? -44.836 15.773 0.613   1.00 84.62  ? 39  ASP A CB  1 
ATOM   145  C CG  . ASP A 1 23  ? -44.536 15.338 2.032   1.00 86.87  ? 39  ASP A CG  1 
ATOM   146  O OD1 . ASP A 1 23  ? -45.180 14.389 2.526   1.00 85.60  ? 39  ASP A OD1 1 
ATOM   147  O OD2 . ASP A 1 23  ? -43.652 15.961 2.659   1.00 90.23  ? 39  ASP A OD2 1 
ATOM   148  N N   . SER A 1 24  ? -46.638 12.724 0.087   1.00 81.17  ? 40  SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? -47.937 12.084 0.273   1.00 79.06  ? 40  SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? -48.678 12.639 1.482   1.00 79.50  ? 40  SER A C   1 
ATOM   151  O O   . SER A 1 24  ? -49.913 12.694 1.480   1.00 76.90  ? 40  SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? -47.754 10.573 0.406   1.00 80.00  ? 40  SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? -46.996 10.243 1.553   1.00 81.98  ? 40  SER A OG  1 
ATOM   154  N N   . MET A 1 25  ? -47.946 13.070 2.508   1.00 78.80  ? 41  MET A N   1 
ATOM   155  C CA  . MET A 1 25  ? -48.525 13.569 3.749   1.00 80.14  ? 41  MET A CA  1 
ATOM   156  C C   . MET A 1 25  ? -48.917 15.040 3.654   1.00 80.22  ? 41  MET A C   1 
ATOM   157  O O   . MET A 1 25  ? -50.019 15.418 4.065   1.00 80.06  ? 41  MET A O   1 
ATOM   158  C CB  . MET A 1 25  ? -47.537 13.361 4.896   1.00 79.01  ? 41  MET A CB  1 
ATOM   159  C CG  . MET A 1 25  ? -47.184 11.909 5.154   1.00 78.87  ? 41  MET A CG  1 
ATOM   160  S SD  . MET A 1 25  ? -48.382 11.083 6.220   1.00 78.04  ? 41  MET A SD  1 
ATOM   161  C CE  . MET A 1 25  ? -49.246 10.052 5.037   1.00 74.05  ? 41  MET A CE  1 
ATOM   162  N N   . LYS A 1 26  ? -48.017 15.878 3.134   1.00 79.81  ? 42  LYS A N   1 
ATOM   163  C CA  . LYS A 1 26  ? -48.318 17.293 2.939   1.00 80.17  ? 42  LYS A CA  1 
ATOM   164  C C   . LYS A 1 26  ? -49.645 17.475 2.211   1.00 76.67  ? 42  LYS A C   1 
ATOM   165  O O   . LYS A 1 26  ? -50.496 18.270 2.626   1.00 77.38  ? 42  LYS A O   1 
ATOM   166  C CB  . LYS A 1 26  ? -47.173 17.957 2.168   1.00 80.16  ? 42  LYS A CB  1 
ATOM   167  C CG  . LYS A 1 26  ? -47.270 19.469 2.026   1.00 81.76  ? 42  LYS A CG  1 
ATOM   168  C CD  . LYS A 1 26  ? -45.936 20.052 1.562   1.00 84.54  ? 42  LYS A CD  1 
ATOM   169  C CE  . LYS A 1 26  ? -46.031 21.544 1.266   1.00 86.58  ? 42  LYS A CE  1 
ATOM   170  N NZ  . LYS A 1 26  ? -44.712 22.124 0.871   1.00 91.31  ? 42  LYS A NZ  1 
ATOM   171  N N   . HIS A 1 27  ? -49.836 16.737 1.117   1.00 78.83  ? 43  HIS A N   1 
ATOM   172  C CA  . HIS A 1 27  ? -51.012 16.858 0.270   1.00 75.08  ? 43  HIS A CA  1 
ATOM   173  C C   . HIS A 1 27  ? -52.047 15.768 0.530   1.00 72.84  ? 43  HIS A C   1 
ATOM   174  O O   . HIS A 1 27  ? -52.823 15.438 -0.372  1.00 69.41  ? 43  HIS A O   1 
ATOM   175  C CB  . HIS A 1 27  ? -50.594 16.845 -1.199  1.00 73.16  ? 43  HIS A CB  1 
ATOM   176  C CG  . HIS A 1 27  ? -49.576 17.887 -1.542  1.00 75.75  ? 43  HIS A CG  1 
ATOM   177  N ND1 . HIS A 1 27  ? -49.898 19.215 -1.720  1.00 76.73  ? 43  HIS A ND1 1 
ATOM   178  C CD2 . HIS A 1 27  ? -48.239 17.793 -1.737  1.00 78.17  ? 43  HIS A CD2 1 
ATOM   179  C CE1 . HIS A 1 27  ? -48.803 19.895 -2.011  1.00 79.53  ? 43  HIS A CE1 1 
ATOM   180  N NE2 . HIS A 1 27  ? -47.784 19.056 -2.028  1.00 80.38  ? 43  HIS A NE2 1 
ATOM   181  N N   . TRP A 1 28  ? -52.060 15.186 1.729   1.00 72.28  ? 44  TRP A N   1 
ATOM   182  C CA  . TRP A 1 28  ? -53.015 14.128 2.034   1.00 70.54  ? 44  TRP A CA  1 
ATOM   183  C C   . TRP A 1 28  ? -54.446 14.628 1.865   1.00 68.86  ? 44  TRP A C   1 
ATOM   184  O O   . TRP A 1 28  ? -54.786 15.738 2.282   1.00 71.14  ? 44  TRP A O   1 
ATOM   185  C CB  . TRP A 1 28  ? -52.809 13.618 3.461   1.00 71.83  ? 44  TRP A CB  1 
ATOM   186  C CG  . TRP A 1 28  ? -53.694 12.458 3.810   1.00 69.88  ? 44  TRP A CG  1 
ATOM   187  C CD1 . TRP A 1 28  ? -54.954 12.515 4.325   1.00 69.98  ? 44  TRP A CD1 1 
ATOM   188  C CD2 . TRP A 1 28  ? -53.373 11.069 3.689   1.00 68.52  ? 44  TRP A CD2 1 
ATOM   189  N NE1 . TRP A 1 28  ? -55.447 11.246 4.517   1.00 68.75  ? 44  TRP A NE1 1 
ATOM   190  C CE2 . TRP A 1 28  ? -54.493 10.341 4.136   1.00 67.64  ? 44  TRP A CE2 1 
ATOM   191  C CE3 . TRP A 1 28  ? -52.250 10.370 3.240   1.00 68.84  ? 44  TRP A CE3 1 
ATOM   192  C CZ2 . TRP A 1 28  ? -54.521 8.950  4.145   1.00 66.82  ? 44  TRP A CZ2 1 
ATOM   193  C CZ3 . TRP A 1 28  ? -52.280 8.991  3.250   1.00 67.85  ? 44  TRP A CZ3 1 
ATOM   194  C CH2 . TRP A 1 28  ? -53.407 8.295  3.699   1.00 66.76  ? 44  TRP A CH2 1 
ATOM   195  N N   . GLY A 1 29  ? -55.288 13.801 1.245   1.00 67.15  ? 45  GLY A N   1 
ATOM   196  C CA  . GLY A 1 29  ? -56.684 14.146 1.063   1.00 66.86  ? 45  GLY A CA  1 
ATOM   197  C C   . GLY A 1 29  ? -56.959 15.169 -0.016  1.00 65.90  ? 45  GLY A C   1 
ATOM   198  O O   . GLY A 1 29  ? -58.121 15.558 -0.196  1.00 66.82  ? 45  GLY A O   1 
ATOM   199  N N   . ARG A 1 30  ? -55.936 15.601 -0.746  1.00 70.42  ? 46  ARG A N   1 
ATOM   200  C CA  . ARG A 1 30  ? -56.029 16.689 -1.710  1.00 70.26  ? 46  ARG A CA  1 
ATOM   201  C C   . ARG A 1 30  ? -56.226 16.147 -3.117  1.00 67.54  ? 46  ARG A C   1 
ATOM   202  O O   . ARG A 1 30  ? -55.507 15.239 -3.545  1.00 66.11  ? 46  ARG A O   1 
ATOM   203  C CB  . ARG A 1 30  ? -54.762 17.539 -1.681  1.00 71.40  ? 46  ARG A CB  1 
ATOM   204  C CG  . ARG A 1 30  ? -54.756 18.706 -0.731  1.00 74.64  ? 46  ARG A CG  1 
ATOM   205  C CD  . ARG A 1 30  ? -53.346 19.263 -0.733  1.00 76.62  ? 46  ARG A CD  1 
ATOM   206  N NE  . ARG A 1 30  ? -53.219 20.635 -0.258  1.00 80.39  ? 46  ARG A NE  1 
ATOM   207  C CZ  . ARG A 1 30  ? -53.185 20.981 1.021   1.00 83.89  ? 46  ARG A CZ  1 
ATOM   208  N NH1 . ARG A 1 30  ? -53.304 20.052 1.958   1.00 84.11  ? 46  ARG A NH1 1 
ATOM   209  N NH2 . ARG A 1 30  ? -53.048 22.256 1.362   1.00 87.74  ? 46  ARG A NH2 1 
ATOM   210  N N   . ARG A 1 31  ? -57.191 16.713 -3.832  1.00 71.39  ? 47  ARG A N   1 
ATOM   211  C CA  . ARG A 1 31  ? -57.360 16.392 -5.237  1.00 69.96  ? 47  ARG A CA  1 
ATOM   212  C C   . ARG A 1 31  ? -56.221 17.006 -6.053  1.00 70.26  ? 47  ARG A C   1 
ATOM   213  O O   . ARG A 1 31  ? -55.541 17.941 -5.622  1.00 71.52  ? 47  ARG A O   1 
ATOM   214  C CB  . ARG A 1 31  ? -58.709 16.914 -5.726  1.00 64.17  ? 47  ARG A CB  1 
ATOM   215  C CG  . ARG A 1 31  ? -59.337 16.153 -6.863  1.00 63.32  ? 47  ARG A CG  1 
ATOM   216  C CD  . ARG A 1 31  ? -60.647 16.807 -7.230  1.00 65.72  ? 47  ARG A CD  1 
ATOM   217  N NE  . ARG A 1 31  ? -61.341 16.119 -8.309  1.00 66.19  ? 47  ARG A NE  1 
ATOM   218  C CZ  . ARG A 1 31  ? -62.451 16.571 -8.883  1.00 69.03  ? 47  ARG A CZ  1 
ATOM   219  N NH1 . ARG A 1 31  ? -62.985 17.715 -8.476  1.00 71.49  ? 47  ARG A NH1 1 
ATOM   220  N NH2 . ARG A 1 31  ? -63.023 15.884 -9.865  1.00 70.08  ? 47  ARG A NH2 1 
ATOM   221  N N   . LYS A 1 32  ? -56.006 16.460 -7.245  1.00 69.48  ? 48  LYS A N   1 
ATOM   222  C CA  . LYS A 1 32  ? -54.941 16.927 -8.117  1.00 71.37  ? 48  LYS A CA  1 
ATOM   223  C C   . LYS A 1 32  ? -55.515 17.228 -9.489  1.00 72.28  ? 48  LYS A C   1 
ATOM   224  O O   . LYS A 1 32  ? -56.551 16.688 -9.882  1.00 70.96  ? 48  LYS A O   1 
ATOM   225  C CB  . LYS A 1 32  ? -53.805 15.904 -8.252  1.00 71.74  ? 48  LYS A CB  1 
ATOM   226  C CG  . LYS A 1 32  ? -53.460 15.162 -6.974  1.00 70.62  ? 48  LYS A CG  1 
ATOM   227  C CD  . LYS A 1 32  ? -52.688 16.036 -6.008  1.00 72.14  ? 48  LYS A CD  1 
ATOM   228  C CE  . LYS A 1 32  ? -52.079 15.189 -4.909  1.00 71.57  ? 48  LYS A CE  1 
ATOM   229  N NZ  . LYS A 1 32  ? -53.125 14.521 -4.075  1.00 69.94  ? 48  LYS A NZ  1 
ATOM   230  N N   . ALA A 1 33  ? -54.809 18.082 -10.225 1.00 69.35  ? 49  ALA A N   1 
ATOM   231  C CA  . ALA A 1 33  ? -55.263 18.529 -11.531 1.00 71.31  ? 49  ALA A CA  1 
ATOM   232  C C   . ALA A 1 33  ? -54.062 18.747 -12.435 1.00 79.85  ? 49  ALA A C   1 
ATOM   233  O O   . ALA A 1 33  ? -52.963 19.064 -11.973 1.00 86.07  ? 49  ALA A O   1 
ATOM   234  C CB  . ALA A 1 33  ? -56.084 19.819 -11.438 1.00 77.30  ? 49  ALA A CB  1 
ATOM   235  N N   . TRP A 1 34  ? -54.295 18.579 -13.731 1.00 76.61  ? 50  TRP A N   1 
ATOM   236  C CA  . TRP A 1 34  ? -53.312 18.834 -14.768 1.00 83.12  ? 50  TRP A CA  1 
ATOM   237  C C   . TRP A 1 34  ? -53.884 19.908 -15.682 1.00 85.78  ? 50  TRP A C   1 
ATOM   238  O O   . TRP A 1 34  ? -54.999 19.744 -16.220 1.00 82.91  ? 50  TRP A O   1 
ATOM   239  C CB  . TRP A 1 34  ? -52.991 17.538 -15.526 1.00 78.53  ? 50  TRP A CB  1 
ATOM   240  C CG  . TRP A 1 34  ? -52.285 17.673 -16.854 1.00 83.32  ? 50  TRP A CG  1 
ATOM   241  C CD1 . TRP A 1 34  ? -52.869 17.767 -18.083 1.00 83.48  ? 50  TRP A CD1 1 
ATOM   242  C CD2 . TRP A 1 34  ? -50.866 17.666 -17.087 1.00 88.69  ? 50  TRP A CD2 1 
ATOM   243  N NE1 . TRP A 1 34  ? -51.907 17.844 -19.061 1.00 88.31  ? 50  TRP A NE1 1 
ATOM   244  C CE2 . TRP A 1 34  ? -50.671 17.784 -18.476 1.00 91.38  ? 50  TRP A CE2 1 
ATOM   245  C CE3 . TRP A 1 34  ? -49.746 17.591 -16.256 1.00 93.97  ? 50  TRP A CE3 1 
ATOM   246  C CZ2 . TRP A 1 34  ? -49.403 17.819 -19.052 1.00 96.47  ? 50  TRP A CZ2 1 
ATOM   247  C CZ3 . TRP A 1 34  ? -48.483 17.626 -16.833 1.00 97.97  ? 50  TRP A CZ3 1 
ATOM   248  C CH2 . TRP A 1 34  ? -48.324 17.742 -18.217 1.00 98.76  ? 50  TRP A CH2 1 
ATOM   249  N N   . CYS A 1 35  ? -53.114 20.999 -15.846 1.00 91.30  ? 51  CYS A N   1 
ATOM   250  C CA  . CYS A 1 35  ? -53.549 22.158 -16.624 1.00 94.42  ? 51  CYS A CA  1 
ATOM   251  C C   . CYS A 1 35  ? -52.420 22.634 -17.526 1.00 101.45 ? 51  CYS A C   1 
ATOM   252  O O   . CYS A 1 35  ? -51.240 22.343 -17.301 1.00 104.47 ? 51  CYS A O   1 
ATOM   253  C CB  . CYS A 1 35  ? -53.961 23.388 -15.782 1.00 107.13 ? 51  CYS A CB  1 
ATOM   254  S SG  . CYS A 1 35  ? -52.582 24.177 -14.836 1.00 112.27 ? 51  CYS A SG  1 
ATOM   255  N N   . ARG A 1 36  ? -52.820 23.405 -18.541 1.00 103.44 ? 52  ARG A N   1 
ATOM   256  C CA  . ARG A 1 36  ? -51.963 23.938 -19.590 1.00 110.44 ? 52  ARG A CA  1 
ATOM   257  C C   . ARG A 1 36  ? -51.932 25.462 -19.533 1.00 115.47 ? 52  ARG A C   1 
ATOM   258  O O   . ARG A 1 36  ? -52.906 26.107 -19.134 1.00 115.19 ? 52  ARG A O   1 
ATOM   259  C CB  . ARG A 1 36  ? -52.418 23.474 -20.976 1.00 110.37 ? 52  ARG A CB  1 
ATOM   260  C CG  . ARG A 1 36  ? -51.383 23.724 -22.061 1.00 117.57 ? 52  ARG A CG  1 
ATOM   261  C CD  . ARG A 1 36  ? -51.953 23.545 -23.448 1.00 122.27 ? 52  ARG A CD  1 
ATOM   262  N NE  . ARG A 1 36  ? -50.954 23.860 -24.463 1.00 130.20 ? 52  ARG A NE  1 
ATOM   263  C CZ  . ARG A 1 36  ? -50.874 23.262 -25.646 1.00 134.26 ? 52  ARG A CZ  1 
ATOM   264  N NH1 . ARG A 1 36  ? -51.736 22.308 -25.970 1.00 131.07 ? 52  ARG A NH1 1 
ATOM   265  N NH2 . ARG A 1 36  ? -49.929 23.619 -26.505 1.00 142.28 ? 52  ARG A NH2 1 
ATOM   266  N N   . GLN A 1 37  ? -50.800 26.025 -19.946 1.00 119.53 ? 53  GLN A N   1 
ATOM   267  C CA  . GLN A 1 37  ? -50.498 27.446 -19.850 1.00 126.50 ? 53  GLN A CA  1 
ATOM   268  C C   . GLN A 1 37  ? -50.624 28.140 -21.205 1.00 135.16 ? 53  GLN A C   1 
ATOM   269  O O   . GLN A 1 37  ? -50.367 27.545 -22.254 1.00 137.17 ? 53  GLN A O   1 
ATOM   270  C CB  . GLN A 1 37  ? -49.083 27.639 -19.305 1.00 134.57 ? 53  GLN A CB  1 
ATOM   271  C CG  . GLN A 1 37  ? -48.800 29.032 -18.802 1.00 139.57 ? 53  GLN A CG  1 
ATOM   272  C CD  . GLN A 1 37  ? -49.552 29.333 -17.530 1.00 134.47 ? 53  GLN A CD  1 
ATOM   273  O OE1 . GLN A 1 37  ? -49.842 28.435 -16.734 1.00 125.18 ? 53  GLN A OE1 1 
ATOM   274  N NE2 . GLN A 1 37  ? -49.881 30.600 -17.330 1.00 142.87 ? 53  GLN A NE2 1 
ATOM   275  N N   . LEU A 1 38  ? -51.041 29.408 -21.172 1.00 138.65 ? 54  LEU A N   1 
ATOM   276  C CA  . LEU A 1 38  ? -51.236 30.226 -22.369 1.00 140.18 ? 54  LEU A CA  1 
ATOM   277  C C   . LEU A 1 38  ? -50.333 31.444 -22.248 1.00 146.41 ? 54  LEU A C   1 
ATOM   278  O O   . LEU A 1 38  ? -50.556 32.303 -21.387 1.00 147.62 ? 54  LEU A O   1 
ATOM   279  C CB  . LEU A 1 38  ? -52.685 30.677 -22.521 1.00 147.56 ? 54  LEU A CB  1 
ATOM   280  C CG  . LEU A 1 38  ? -53.826 29.701 -22.767 1.00 139.29 ? 54  LEU A CG  1 
ATOM   281  C CD1 . LEU A 1 38  ? -55.109 30.494 -22.711 1.00 137.08 ? 54  LEU A CD1 1 
ATOM   282  C CD2 . LEU A 1 38  ? -53.672 29.026 -24.121 1.00 142.90 ? 54  LEU A CD2 1 
ATOM   283  N N   . GLY A 1 39  ? -49.333 31.536 -23.122 1.00 148.03 ? 55  GLY A N   1 
ATOM   284  C CA  . GLY A 1 39  ? -48.393 32.626 -22.968 1.00 153.22 ? 55  GLY A CA  1 
ATOM   285  C C   . GLY A 1 39  ? -47.599 32.449 -21.685 1.00 157.20 ? 55  GLY A C   1 
ATOM   286  O O   . GLY A 1 39  ? -47.346 31.330 -21.227 1.00 156.84 ? 55  GLY A O   1 
ATOM   287  N N   . GLU A 1 40  ? -47.218 33.573 -21.081 1.00 157.26 ? 56  GLU A N   1 
ATOM   288  C CA  . GLU A 1 40  ? -46.396 33.514 -19.879 1.00 162.27 ? 56  GLU A CA  1 
ATOM   289  C C   . GLU A 1 40  ? -47.225 33.611 -18.602 1.00 161.96 ? 56  GLU A C   1 
ATOM   290  O O   . GLU A 1 40  ? -47.468 32.593 -17.946 1.00 163.17 ? 56  GLU A O   1 
ATOM   291  C CB  . GLU A 1 40  ? -45.324 34.612 -19.912 1.00 162.69 ? 56  GLU A CB  1 
ATOM   292  C CG  . GLU A 1 40  ? -44.540 34.834 -18.601 1.00 167.44 ? 56  GLU A CG  1 
ATOM   293  C CD  . GLU A 1 40  ? -44.191 33.553 -17.845 1.00 173.88 ? 56  GLU A CD  1 
ATOM   294  O OE1 . GLU A 1 40  ? -44.280 33.564 -16.597 1.00 179.06 ? 56  GLU A OE1 1 
ATOM   295  O OE2 . GLU A 1 40  ? -43.830 32.541 -18.484 1.00 172.53 ? 56  GLU A OE2 1 
ATOM   296  N N   . LYS A 1 41  ? -47.665 34.821 -18.244 1.00 165.05 ? 57  LYS A N   1 
ATOM   297  C CA  . LYS A 1 41  ? -48.155 35.060 -16.888 1.00 164.13 ? 57  LYS A CA  1 
ATOM   298  C C   . LYS A 1 41  ? -49.433 34.288 -16.593 1.00 157.60 ? 57  LYS A C   1 
ATOM   299  O O   . LYS A 1 41  ? -49.677 33.913 -15.441 1.00 157.31 ? 57  LYS A O   1 
ATOM   300  C CB  . LYS A 1 41  ? -48.364 36.557 -16.667 1.00 157.33 ? 57  LYS A CB  1 
ATOM   301  C CG  . LYS A 1 41  ? -47.063 37.343 -16.582 1.00 161.44 ? 57  LYS A CG  1 
ATOM   302  C CD  . LYS A 1 41  ? -46.374 37.126 -15.241 1.00 170.34 ? 57  LYS A CD  1 
ATOM   303  C CE  . LYS A 1 41  ? -44.863 37.102 -15.395 1.00 181.18 ? 57  LYS A CE  1 
ATOM   304  N NZ  . LYS A 1 41  ? -44.393 38.137 -16.353 1.00 174.09 ? 57  LYS A NZ  1 
ATOM   305  N N   . GLY A 1 42  ? -50.252 34.038 -17.606 1.00 158.24 ? 58  GLY A N   1 
ATOM   306  C CA  . GLY A 1 42  ? -51.423 33.205 -17.430 1.00 150.91 ? 58  GLY A CA  1 
ATOM   307  C C   . GLY A 1 42  ? -52.308 33.208 -18.652 1.00 143.92 ? 58  GLY A C   1 
ATOM   308  O O   . GLY A 1 42  ? -51.981 33.844 -19.658 1.00 144.70 ? 58  GLY A O   1 
ATOM   309  N N   . PRO A 1 43  ? -53.453 32.518 -18.569 1.00 138.03 ? 59  PRO A N   1 
ATOM   310  C CA  . PRO A 1 43  ? -53.995 31.699 -17.474 1.00 133.48 ? 59  PRO A CA  1 
ATOM   311  C C   . PRO A 1 43  ? -53.620 30.214 -17.560 1.00 133.82 ? 59  PRO A C   1 
ATOM   312  O O   . PRO A 1 43  ? -53.059 29.790 -18.576 1.00 135.17 ? 59  PRO A O   1 
ATOM   313  C CB  . PRO A 1 43  ? -55.497 31.890 -17.626 1.00 133.81 ? 59  PRO A CB  1 
ATOM   314  C CG  . PRO A 1 43  ? -55.675 31.987 -19.110 1.00 134.17 ? 59  PRO A CG  1 
ATOM   315  C CD  . PRO A 1 43  ? -54.439 32.685 -19.651 1.00 143.03 ? 59  PRO A CD  1 
ATOM   316  N N   . CYS A 1 44  ? -53.904 29.443 -16.509 1.00 127.84 ? 60  CYS A N   1 
ATOM   317  C CA  . CYS A 1 44  ? -53.716 27.995 -16.541 1.00 122.93 ? 60  CYS A CA  1 
ATOM   318  C C   . CYS A 1 44  ? -55.097 27.375 -16.552 1.00 119.86 ? 60  CYS A C   1 
ATOM   319  O O   . CYS A 1 44  ? -55.937 27.726 -15.720 1.00 118.03 ? 60  CYS A O   1 
ATOM   320  C CB  . CYS A 1 44  ? -52.910 27.437 -15.355 1.00 117.46 ? 60  CYS A CB  1 
ATOM   321  S SG  . CYS A 1 44  ? -51.964 25.902 -15.853 1.00 116.71 ? 60  CYS A SG  1 
ATOM   322  N N   . GLN A 1 45  ? -55.346 26.498 -17.520 1.00 106.87 ? 61  GLN A N   1 
ATOM   323  C CA  . GLN A 1 45  ? -56.694 26.040 -17.822 1.00 108.24 ? 61  GLN A CA  1 
ATOM   324  C C   . GLN A 1 45  ? -56.781 24.547 -17.559 1.00 107.96 ? 61  GLN A C   1 
ATOM   325  O O   . GLN A 1 45  ? -55.979 23.771 -18.089 1.00 108.44 ? 61  GLN A O   1 
ATOM   326  C CB  . GLN A 1 45  ? -57.033 26.326 -19.282 1.00 122.82 ? 61  GLN A CB  1 
ATOM   327  C CG  . GLN A 1 45  ? -56.974 27.789 -19.633 1.00 123.90 ? 61  GLN A CG  1 
ATOM   328  C CD  . GLN A 1 45  ? -57.538 28.061 -21.000 1.00 127.94 ? 61  GLN A CD  1 
ATOM   329  O OE1 . GLN A 1 45  ? -57.876 27.133 -21.732 1.00 128.39 ? 61  GLN A OE1 1 
ATOM   330  N NE2 . GLN A 1 45  ? -57.707 29.335 -21.331 1.00 133.08 ? 61  GLN A NE2 1 
ATOM   331  N N   . ARG A 1 46  ? -57.764 24.142 -16.762 1.00 96.44  ? 62  ARG A N   1 
ATOM   332  C CA  . ARG A 1 46  ? -57.760 22.775 -16.271 1.00 92.15  ? 62  ARG A CA  1 
ATOM   333  C C   . ARG A 1 46  ? -58.070 21.828 -17.414 1.00 93.48  ? 62  ARG A C   1 
ATOM   334  O O   . ARG A 1 46  ? -59.086 21.974 -18.100 1.00 96.31  ? 62  ARG A O   1 
ATOM   335  C CB  . ARG A 1 46  ? -58.760 22.587 -15.135 1.00 93.84  ? 62  ARG A CB  1 
ATOM   336  C CG  . ARG A 1 46  ? -58.622 21.237 -14.460 1.00 91.28  ? 62  ARG A CG  1 
ATOM   337  C CD  . ARG A 1 46  ? -58.983 21.321 -13.004 1.00 87.63  ? 62  ARG A CD  1 
ATOM   338  N NE  . ARG A 1 46  ? -58.403 22.516 -12.404 1.00 88.22  ? 62  ARG A NE  1 
ATOM   339  C CZ  . ARG A 1 46  ? -58.669 22.938 -11.175 1.00 89.72  ? 62  ARG A CZ  1 
ATOM   340  N NH1 . ARG A 1 46  ? -59.507 22.256 -10.408 1.00 88.39  ? 62  ARG A NH1 1 
ATOM   341  N NH2 . ARG A 1 46  ? -58.098 24.044 -10.718 1.00 92.86  ? 62  ARG A NH2 1 
ATOM   342  N N   . VAL A 1 47  ? -57.184 20.862 -17.617 1.00 86.10  ? 63  VAL A N   1 
ATOM   343  C CA  . VAL A 1 47  ? -57.454 19.775 -18.539 1.00 86.88  ? 63  VAL A CA  1 
ATOM   344  C C   . VAL A 1 47  ? -58.201 18.658 -17.839 1.00 85.02  ? 63  VAL A C   1 
ATOM   345  O O   . VAL A 1 47  ? -59.254 18.217 -18.304 1.00 86.64  ? 63  VAL A O   1 
ATOM   346  C CB  . VAL A 1 47  ? -56.144 19.260 -19.167 1.00 84.65  ? 63  VAL A CB  1 
ATOM   347  C CG1 . VAL A 1 47  ? -56.426 18.049 -20.041 1.00 84.85  ? 63  VAL A CG1 1 
ATOM   348  C CG2 . VAL A 1 47  ? -55.459 20.363 -19.957 1.00 86.68  ? 63  VAL A CG2 1 
ATOM   349  N N   . VAL A 1 48  ? -57.705 18.194 -16.693 1.00 82.87  ? 64  VAL A N   1 
ATOM   350  C CA  . VAL A 1 48  ? -58.370 17.077 -16.023 1.00 81.01  ? 64  VAL A CA  1 
ATOM   351  C C   . VAL A 1 48  ? -57.946 17.054 -14.570 1.00 76.44  ? 64  VAL A C   1 
ATOM   352  O O   . VAL A 1 48  ? -56.864 17.519 -14.216 1.00 75.19  ? 64  VAL A O   1 
ATOM   353  C CB  . VAL A 1 48  ? -58.050 15.738 -16.737 1.00 77.78  ? 64  VAL A CB  1 
ATOM   354  C CG1 . VAL A 1 48  ? -56.569 15.400 -16.644 1.00 76.21  ? 64  VAL A CG1 1 
ATOM   355  C CG2 . VAL A 1 48  ? -58.920 14.606 -16.201 1.00 75.98  ? 64  VAL A CG2 1 
ATOM   356  N N   . SER A 1 49  ? -58.813 16.522 -13.711 1.00 76.74  ? 65  SER A N   1 
ATOM   357  C CA  . SER A 1 49  ? -58.480 16.350 -12.309 1.00 70.46  ? 65  SER A CA  1 
ATOM   358  C C   . SER A 1 49  ? -58.718 14.905 -11.887 1.00 66.77  ? 65  SER A C   1 
ATOM   359  O O   . SER A 1 49  ? -59.509 14.179 -12.496 1.00 68.06  ? 65  SER A O   1 
ATOM   360  C CB  . SER A 1 49  ? -59.297 17.308 -11.425 1.00 74.04  ? 65  SER A CB  1 
ATOM   361  O OG  . SER A 1 49  ? -60.680 17.028 -11.522 1.00 76.20  ? 65  SER A OG  1 
ATOM   362  N N   . THR A 1 50  ? -58.020 14.498 -10.827 1.00 68.60  ? 66  THR A N   1 
ATOM   363  C CA  . THR A 1 50  ? -58.195 13.168 -10.265 1.00 63.95  ? 66  THR A CA  1 
ATOM   364  C C   . THR A 1 50  ? -59.608 13.011 -9.714  1.00 64.42  ? 66  THR A C   1 
ATOM   365  O O   . THR A 1 50  ? -60.395 13.960 -9.675  1.00 67.73  ? 66  THR A O   1 
ATOM   366  C CB  . THR A 1 50  ? -57.167 12.911 -9.169  1.00 67.02  ? 66  THR A CB  1 
ATOM   367  O OG1 . THR A 1 50  ? -57.134 14.029 -8.276  1.00 66.26  ? 66  THR A OG1 1 
ATOM   368  C CG2 . THR A 1 50  ? -55.791 12.702 -9.765  1.00 66.47  ? 66  THR A CG2 1 
ATOM   369  N N   . HIS A 1 51  ? -59.940 11.780 -9.323  1.00 63.14  ? 67  HIS A N   1 
ATOM   370  C CA  . HIS A 1 51  ? -61.301 11.498 -8.890  1.00 64.20  ? 67  HIS A CA  1 
ATOM   371  C C   . HIS A 1 51  ? -61.707 12.423 -7.752  1.00 64.60  ? 67  HIS A C   1 
ATOM   372  O O   . HIS A 1 51  ? -60.902 12.764 -6.880  1.00 62.59  ? 67  HIS A O   1 
ATOM   373  C CB  . HIS A 1 51  ? -61.453 10.040 -8.465  1.00 58.00  ? 67  HIS A CB  1 
ATOM   374  C CG  . HIS A 1 51  ? -62.878 9.590  -8.386  1.00 60.20  ? 67  HIS A CG  1 
ATOM   375  N ND1 . HIS A 1 51  ? -63.770 10.105 -7.470  1.00 61.57  ? 67  HIS A ND1 1 
ATOM   376  C CD2 . HIS A 1 51  ? -63.582 8.713  -9.138  1.00 61.85  ? 67  HIS A CD2 1 
ATOM   377  C CE1 . HIS A 1 51  ? -64.952 9.545  -7.642  1.00 63.93  ? 67  HIS A CE1 1 
ATOM   378  N NE2 . HIS A 1 51  ? -64.867 8.700  -8.652  1.00 64.14  ? 67  HIS A NE2 1 
ATOM   379  N N   . ASN A 1 52  ? -62.975 12.827 -7.778  1.00 64.93  ? 68  ASN A N   1 
ATOM   380  C CA  . ASN A 1 52  ? -63.488 13.798 -6.824  1.00 68.47  ? 68  ASN A CA  1 
ATOM   381  C C   . ASN A 1 52  ? -63.480 13.250 -5.403  1.00 67.74  ? 68  ASN A C   1 
ATOM   382  O O   . ASN A 1 52  ? -63.269 14.005 -4.449  1.00 70.16  ? 68  ASN A O   1 
ATOM   383  C CB  . ASN A 1 52  ? -64.898 14.197 -7.264  1.00 71.95  ? 68  ASN A CB  1 
ATOM   384  C CG  . ASN A 1 52  ? -65.708 14.852 -6.166  1.00 75.17  ? 68  ASN A CG  1 
ATOM   385  O OD1 . ASN A 1 52  ? -65.231 15.747 -5.459  1.00 77.38  ? 68  ASN A OD1 1 
ATOM   386  N ND2 . ASN A 1 52  ? -66.960 14.416 -6.026  1.00 76.19  ? 68  ASN A ND2 1 
ATOM   387  N N   . LEU A 1 53  ? -63.677 11.947 -5.246  1.00 64.80  ? 69  LEU A N   1 
ATOM   388  C CA  . LEU A 1 53  ? -63.518 11.263 -3.968  1.00 63.92  ? 69  LEU A CA  1 
ATOM   389  C C   . LEU A 1 53  ? -62.068 10.791 -3.831  1.00 61.32  ? 69  LEU A C   1 
ATOM   390  O O   . LEU A 1 53  ? -61.619 9.925  -4.593  1.00 58.31  ? 69  LEU A O   1 
ATOM   391  C CB  . LEU A 1 53  ? -64.498 10.093 -3.894  1.00 62.49  ? 69  LEU A CB  1 
ATOM   392  C CG  . LEU A 1 53  ? -65.976 10.515 -3.885  1.00 65.53  ? 69  LEU A CG  1 
ATOM   393  C CD1 . LEU A 1 53  ? -66.894 9.321  -3.679  1.00 64.28  ? 69  LEU A CD1 1 
ATOM   394  C CD2 . LEU A 1 53  ? -66.284 11.617 -2.889  1.00 69.64  ? 69  LEU A CD2 1 
ATOM   395  N N   . TRP A 1 54  ? -61.348 11.342 -2.842  1.00 65.96  ? 70  TRP A N   1 
ATOM   396  C CA  . TRP A 1 54  ? -59.899 11.140 -2.744  1.00 63.38  ? 70  TRP A CA  1 
ATOM   397  C C   . TRP A 1 54  ? -59.510 9.668  -2.631  1.00 59.71  ? 70  TRP A C   1 
ATOM   398  O O   . TRP A 1 54  ? -58.511 9.242  -3.222  1.00 57.56  ? 70  TRP A O   1 
ATOM   399  C CB  . TRP A 1 54  ? -59.352 11.913 -1.548  1.00 65.34  ? 70  TRP A CB  1 
ATOM   400  C CG  . TRP A 1 54  ? -57.850 11.890 -1.410  1.00 64.28  ? 70  TRP A CG  1 
ATOM   401  C CD1 . TRP A 1 54  ? -56.966 12.707 -2.051  1.00 65.01  ? 70  TRP A CD1 1 
ATOM   402  C CD2 . TRP A 1 54  ? -57.065 11.044 -0.559  1.00 62.75  ? 70  TRP A CD2 1 
ATOM   403  N NE1 . TRP A 1 54  ? -55.681 12.417 -1.666  1.00 64.36  ? 70  TRP A NE1 1 
ATOM   404  C CE2 . TRP A 1 54  ? -55.715 11.399 -0.750  1.00 63.15  ? 70  TRP A CE2 1 
ATOM   405  C CE3 . TRP A 1 54  ? -57.369 10.019 0.341   1.00 62.32  ? 70  TRP A CE3 1 
ATOM   406  C CZ2 . TRP A 1 54  ? -54.675 10.772 -0.068  1.00 62.93  ? 70  TRP A CZ2 1 
ATOM   407  C CZ3 . TRP A 1 54  ? -56.328 9.393  1.008   1.00 62.15  ? 70  TRP A CZ3 1 
ATOM   408  C CH2 . TRP A 1 54  ? -54.998 9.770  0.794   1.00 62.34  ? 70  TRP A CH2 1 
ATOM   409  N N   . LEU A 1 55  ? -60.278 8.874  -1.880  1.00 63.97  ? 71  LEU A N   1 
ATOM   410  C CA  . LEU A 1 55  ? -59.953 7.456  -1.770  1.00 60.64  ? 71  LEU A CA  1 
ATOM   411  C C   . LEU A 1 55  ? -59.968 6.751  -3.123  1.00 58.99  ? 71  LEU A C   1 
ATOM   412  O O   . LEU A 1 55  ? -59.379 5.672  -3.253  1.00 56.09  ? 71  LEU A O   1 
ATOM   413  C CB  . LEU A 1 55  ? -60.891 6.760  -0.784  1.00 56.34  ? 71  LEU A CB  1 
ATOM   414  C CG  . LEU A 1 55  ? -60.425 6.890  0.672   1.00 58.40  ? 71  LEU A CG  1 
ATOM   415  C CD1 . LEU A 1 55  ? -61.239 6.002  1.603   1.00 59.04  ? 71  LEU A CD1 1 
ATOM   416  C CD2 . LEU A 1 55  ? -58.940 6.591  0.798   1.00 57.50  ? 71  LEU A CD2 1 
ATOM   417  N N   . LEU A 1 56  ? -60.641 7.316  -4.127  1.00 58.79  ? 72  LEU A N   1 
ATOM   418  C CA  . LEU A 1 56  ? -60.689 6.719  -5.454  1.00 58.89  ? 72  LEU A CA  1 
ATOM   419  C C   . LEU A 1 56  ? -59.777 7.423  -6.448  1.00 59.48  ? 72  LEU A C   1 
ATOM   420  O O   . LEU A 1 56  ? -59.949 7.251  -7.660  1.00 60.70  ? 72  LEU A O   1 
ATOM   421  C CB  . LEU A 1 56  ? -62.123 6.711  -5.984  1.00 55.22  ? 72  LEU A CB  1 
ATOM   422  C CG  . LEU A 1 56  ? -63.108 5.760  -5.315  1.00 53.91  ? 72  LEU A CG  1 
ATOM   423  C CD1 . LEU A 1 56  ? -64.525 6.051  -5.761  1.00 55.59  ? 72  LEU A CD1 1 
ATOM   424  C CD2 . LEU A 1 56  ? -62.721 4.353  -5.647  1.00 50.89  ? 72  LEU A CD2 1 
ATOM   425  N N   . SER A 1 57  ? -58.805 8.204  -5.973  1.00 63.83  ? 73  SER A N   1 
ATOM   426  C CA  . SER A 1 57  ? -57.997 8.948  -6.929  1.00 63.95  ? 73  SER A CA  1 
ATOM   427  C C   . SER A 1 57  ? -57.017 8.055  -7.676  1.00 61.39  ? 73  SER A C   1 
ATOM   428  O O   . SER A 1 57  ? -56.406 8.513  -8.648  1.00 61.74  ? 73  SER A O   1 
ATOM   429  C CB  . SER A 1 57  ? -57.245 10.082 -6.230  1.00 67.06  ? 73  SER A CB  1 
ATOM   430  O OG  . SER A 1 57  ? -56.442 9.575  -5.186  1.00 65.12  ? 73  SER A OG  1 
ATOM   431  N N   . PHE A 1 58  ? -56.885 6.787  -7.281  1.00 61.38  ? 74  PHE A N   1 
ATOM   432  C CA  . PHE A 1 58  ? -56.119 5.856  -8.097  1.00 60.18  ? 74  PHE A CA  1 
ATOM   433  C C   . PHE A 1 58  ? -56.799 5.547  -9.422  1.00 62.10  ? 74  PHE A C   1 
ATOM   434  O O   . PHE A 1 58  ? -56.162 4.947  -10.293 1.00 62.22  ? 74  PHE A O   1 
ATOM   435  C CB  . PHE A 1 58  ? -55.844 4.552  -7.342  1.00 53.20  ? 74  PHE A CB  1 
ATOM   436  C CG  . PHE A 1 58  ? -57.066 3.721  -7.072  1.00 52.51  ? 74  PHE A CG  1 
ATOM   437  C CD1 . PHE A 1 58  ? -57.399 2.672  -7.909  1.00 51.72  ? 74  PHE A CD1 1 
ATOM   438  C CD2 . PHE A 1 58  ? -57.879 3.984  -5.982  1.00 53.16  ? 74  PHE A CD2 1 
ATOM   439  C CE1 . PHE A 1 58  ? -58.516 1.902  -7.665  1.00 51.28  ? 74  PHE A CE1 1 
ATOM   440  C CE2 . PHE A 1 58  ? -58.997 3.213  -5.734  1.00 52.81  ? 74  PHE A CE2 1 
ATOM   441  C CZ  . PHE A 1 58  ? -59.312 2.168  -6.573  1.00 51.70  ? 74  PHE A CZ  1 
ATOM   442  N N   . LEU A 1 59  ? -58.062 5.938  -9.604  1.00 58.94  ? 75  LEU A N   1 
ATOM   443  C CA  . LEU A 1 59  ? -58.745 5.672  -10.862 1.00 61.96  ? 75  LEU A CA  1 
ATOM   444  C C   . LEU A 1 59  ? -58.283 6.659  -11.922 1.00 63.37  ? 75  LEU A C   1 
ATOM   445  O O   . LEU A 1 59  ? -58.272 7.875  -11.695 1.00 63.73  ? 75  LEU A O   1 
ATOM   446  C CB  . LEU A 1 59  ? -60.266 5.751  -10.716 1.00 61.93  ? 75  LEU A CB  1 
ATOM   447  C CG  . LEU A 1 59  ? -61.068 4.544  -10.225 1.00 58.71  ? 75  LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 59  ? -60.694 3.321  -11.029 1.00 56.55  ? 75  LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 59  ? -60.852 4.284  -8.773  1.00 56.42  ? 75  LEU A CD2 1 
ATOM   450  N N   . ARG A 1 60  ? -57.873 6.119  -13.067 1.00 61.69  ? 76  ARG A N   1 
ATOM   451  C CA  . ARG A 1 60  ? -57.586 6.923  -14.244 1.00 62.90  ? 76  ARG A CA  1 
ATOM   452  C C   . ARG A 1 60  ? -58.780 7.796  -14.599 1.00 65.75  ? 76  ARG A C   1 
ATOM   453  O O   . ARG A 1 60  ? -59.933 7.368  -14.518 1.00 67.99  ? 76  ARG A O   1 
ATOM   454  C CB  . ARG A 1 60  ? -57.248 6.013  -15.419 1.00 64.07  ? 76  ARG A CB  1 
ATOM   455  C CG  . ARG A 1 60  ? -58.170 4.814  -15.506 1.00 63.72  ? 76  ARG A CG  1 
ATOM   456  C CD  . ARG A 1 60  ? -58.488 4.502  -16.938 1.00 64.31  ? 76  ARG A CD  1 
ATOM   457  N NE  . ARG A 1 60  ? -59.800 3.884  -17.104 1.00 63.78  ? 76  ARG A NE  1 
ATOM   458  C CZ  . ARG A 1 60  ? -60.944 4.550  -17.008 1.00 65.81  ? 76  ARG A CZ  1 
ATOM   459  N NH1 . ARG A 1 60  ? -60.926 5.842  -16.716 1.00 68.14  ? 76  ARG A NH1 1 
ATOM   460  N NH2 . ARG A 1 60  ? -62.102 3.930  -17.191 1.00 65.87  ? 76  ARG A NH2 1 
ATOM   461  N N   . ARG A 1 61  ? -58.491 9.031  -14.982 1.00 65.73  ? 77  ARG A N   1 
ATOM   462  C CA  . ARG A 1 61  ? -59.472 9.980  -15.483 1.00 66.94  ? 77  ARG A CA  1 
ATOM   463  C C   . ARG A 1 61  ? -59.026 10.491 -16.842 1.00 66.75  ? 77  ARG A C   1 
ATOM   464  O O   . ARG A 1 61  ? -57.834 10.722 -17.059 1.00 65.15  ? 77  ARG A O   1 
ATOM   465  C CB  . ARG A 1 61  ? -59.627 11.152 -14.507 1.00 63.20  ? 77  ARG A CB  1 
ATOM   466  C CG  . ARG A 1 61  ? -60.330 10.845 -13.204 1.00 64.17  ? 77  ARG A CG  1 
ATOM   467  C CD  . ARG A 1 61  ? -61.792 11.052 -13.437 1.00 68.42  ? 77  ARG A CD  1 
ATOM   468  N NE  . ARG A 1 61  ? -62.174 12.342 -12.877 1.00 68.07  ? 77  ARG A NE  1 
ATOM   469  C CZ  . ARG A 1 61  ? -63.350 12.934 -13.054 1.00 71.34  ? 77  ARG A CZ  1 
ATOM   470  N NH1 . ARG A 1 61  ? -64.276 12.370 -13.821 1.00 75.28  ? 77  ARG A NH1 1 
ATOM   471  N NH2 . ARG A 1 61  ? -63.587 14.111 -12.477 1.00 70.83  ? 77  ARG A NH2 1 
ATOM   472  N N   . TRP A 1 62  ? -59.975 10.683 -17.756 1.00 70.16  ? 78  TRP A N   1 
ATOM   473  C CA  . TRP A 1 62  ? -59.655 11.107 -19.113 1.00 70.28  ? 78  TRP A CA  1 
ATOM   474  C C   . TRP A 1 62  ? -60.349 12.420 -19.449 1.00 70.84  ? 78  TRP A C   1 
ATOM   475  O O   . TRP A 1 62  ? -61.514 12.630 -19.098 1.00 72.71  ? 78  TRP A O   1 
ATOM   476  C CB  . TRP A 1 62  ? -60.067 10.072 -20.171 1.00 67.47  ? 78  TRP A CB  1 
ATOM   477  C CG  . TRP A 1 62  ? -59.317 8.767  -20.187 1.00 66.64  ? 78  TRP A CG  1 
ATOM   478  C CD1 . TRP A 1 62  ? -59.674 7.608  -19.561 1.00 67.00  ? 78  TRP A CD1 1 
ATOM   479  C CD2 . TRP A 1 62  ? -58.096 8.482  -20.888 1.00 66.61  ? 78  TRP A CD2 1 
ATOM   480  N NE1 . TRP A 1 62  ? -58.752 6.624  -19.824 1.00 67.03  ? 78  TRP A NE1 1 
ATOM   481  C CE2 . TRP A 1 62  ? -57.773 7.136  -20.633 1.00 67.22  ? 78  TRP A CE2 1 
ATOM   482  C CE3 . TRP A 1 62  ? -57.246 9.235  -21.702 1.00 67.68  ? 78  TRP A CE3 1 
ATOM   483  C CZ2 . TRP A 1 62  ? -56.636 6.527  -21.162 1.00 68.20  ? 78  TRP A CZ2 1 
ATOM   484  C CZ3 . TRP A 1 62  ? -56.117 8.629  -22.227 1.00 68.38  ? 78  TRP A CZ3 1 
ATOM   485  C CH2 . TRP A 1 62  ? -55.822 7.288  -21.953 1.00 68.54  ? 78  TRP A CH2 1 
ATOM   486  N N   . ASN A 1 63  ? -59.619 13.306 -20.119 1.00 73.41  ? 79  ASN A N   1 
ATOM   487  C CA  . ASN A 1 63  ? -60.192 14.332 -20.987 1.00 74.79  ? 79  ASN A CA  1 
ATOM   488  C C   . ASN A 1 63  ? -59.646 14.066 -22.384 1.00 76.63  ? 79  ASN A C   1 
ATOM   489  O O   . ASN A 1 63  ? -58.495 14.409 -22.687 1.00 76.30  ? 79  ASN A O   1 
ATOM   490  C CB  . ASN A 1 63  ? -59.896 15.746 -20.496 1.00 81.71  ? 79  ASN A CB  1 
ATOM   491  C CG  . ASN A 1 63  ? -60.747 16.793 -21.207 1.00 83.52  ? 79  ASN A CG  1 
ATOM   492  O OD1 . ASN A 1 63  ? -61.693 16.452 -21.919 1.00 85.90  ? 79  ASN A OD1 1 
ATOM   493  N ND2 . ASN A 1 63  ? -60.453 18.072 -20.970 1.00 83.55  ? 79  ASN A ND2 1 
ATOM   494  N N   . GLY A 1 64  ? -60.472 13.431 -23.217 1.00 73.94  ? 80  GLY A N   1 
ATOM   495  C CA  . GLY A 1 64  ? -60.035 13.006 -24.528 1.00 75.87  ? 80  GLY A CA  1 
ATOM   496  C C   . GLY A 1 64  ? -58.754 12.208 -24.453 1.00 73.89  ? 80  GLY A C   1 
ATOM   497  O O   . GLY A 1 64  ? -58.724 11.106 -23.900 1.00 72.08  ? 80  GLY A O   1 
ATOM   498  N N   . SER A 1 65  ? -57.697 12.750 -25.040 1.00 79.90  ? 81  SER A N   1 
ATOM   499  C CA  . SER A 1 65  ? -56.434 12.049 -25.162 1.00 79.20  ? 81  SER A CA  1 
ATOM   500  C C   . SER A 1 65  ? -55.557 12.176 -23.923 1.00 76.35  ? 81  SER A C   1 
ATOM   501  O O   . SER A 1 65  ? -54.409 11.724 -23.962 1.00 76.38  ? 81  SER A O   1 
ATOM   502  C CB  . SER A 1 65  ? -55.669 12.573 -26.377 1.00 87.49  ? 81  SER A CB  1 
ATOM   503  O OG  . SER A 1 65  ? -54.919 13.725 -26.026 1.00 87.20  ? 81  SER A OG  1 
ATOM   504  N N   . THR A 1 66  ? -56.040 12.777 -22.835 1.00 76.06  ? 82  THR A N   1 
ATOM   505  C CA  . THR A 1 66  ? -55.214 13.005 -21.655 1.00 74.89  ? 82  THR A CA  1 
ATOM   506  C C   . THR A 1 66  ? -55.762 12.222 -20.471 1.00 73.76  ? 82  THR A C   1 
ATOM   507  O O   . THR A 1 66  ? -56.963 12.264 -20.195 1.00 72.82  ? 82  THR A O   1 
ATOM   508  C CB  . THR A 1 66  ? -55.141 14.492 -21.304 1.00 77.26  ? 82  THR A CB  1 
ATOM   509  O OG1 . THR A 1 66  ? -54.675 15.237 -22.438 1.00 78.78  ? 82  THR A OG1 1 
ATOM   510  C CG2 . THR A 1 66  ? -54.185 14.714 -20.140 1.00 76.52  ? 82  THR A CG2 1 
ATOM   511  N N   . ALA A 1 67  ? -54.883 11.504 -19.780 1.00 70.86  ? 83  ALA A N   1 
ATOM   512  C CA  . ALA A 1 67  ? -55.270 10.680 -18.648 1.00 70.06  ? 83  ALA A CA  1 
ATOM   513  C C   . ALA A 1 67  ? -54.467 11.102 -17.430 1.00 69.65  ? 83  ALA A C   1 
ATOM   514  O O   . ALA A 1 67  ? -53.306 11.508 -17.540 1.00 70.99  ? 83  ALA A O   1 
ATOM   515  C CB  . ALA A 1 67  ? -55.051 9.190  -18.927 1.00 68.19  ? 83  ALA A CB  1 
ATOM   516  N N   . ILE A 1 68  ? -55.093 10.995 -16.264 1.00 66.19  ? 84  ILE A N   1 
ATOM   517  C CA  . ILE A 1 68  ? -54.474 11.351 -14.996 1.00 65.81  ? 84  ILE A CA  1 
ATOM   518  C C   . ILE A 1 68  ? -54.726 10.218 -14.017 1.00 65.72  ? 84  ILE A C   1 
ATOM   519  O O   . ILE A 1 68  ? -55.818 9.636  -13.985 1.00 64.94  ? 84  ILE A O   1 
ATOM   520  C CB  . ILE A 1 68  ? -55.006 12.693 -14.441 1.00 67.33  ? 84  ILE A CB  1 
ATOM   521  C CG1 . ILE A 1 68  ? -54.276 13.080 -13.160 1.00 67.41  ? 84  ILE A CG1 1 
ATOM   522  C CG2 . ILE A 1 68  ? -56.488 12.619 -14.165 1.00 66.58  ? 84  ILE A CG2 1 
ATOM   523  C CD1 . ILE A 1 68  ? -54.505 14.520 -12.748 1.00 66.78  ? 84  ILE A CD1 1 
ATOM   524  N N   . THR A 1 69  ? -53.696 9.878  -13.248 1.00 65.82  ? 85  THR A N   1 
ATOM   525  C CA  . THR A 1 69  ? -53.830 8.879  -12.204 1.00 65.89  ? 85  THR A CA  1 
ATOM   526  C C   . THR A 1 69  ? -52.939 9.286  -11.042 1.00 67.06  ? 85  THR A C   1 
ATOM   527  O O   . THR A 1 69  ? -51.880 9.885  -11.238 1.00 69.06  ? 85  THR A O   1 
ATOM   528  C CB  . THR A 1 69  ? -53.488 7.476  -12.713 1.00 64.95  ? 85  THR A CB  1 
ATOM   529  O OG1 . THR A 1 69  ? -53.844 6.517  -11.712 1.00 64.27  ? 85  THR A OG1 1 
ATOM   530  C CG2 . THR A 1 69  ? -52.004 7.352  -13.037 1.00 69.31  ? 85  THR A CG2 1 
ATOM   531  N N   . ASP A 1 70  ? -53.391 8.988  -9.826  1.00 66.43  ? 86  ASP A N   1 
ATOM   532  C CA  . ASP A 1 70  ? -52.758 9.506  -8.621  1.00 67.45  ? 86  ASP A CA  1 
ATOM   533  C C   . ASP A 1 70  ? -52.438 8.360  -7.676  1.00 69.26  ? 86  ASP A C   1 
ATOM   534  O O   . ASP A 1 70  ? -53.323 7.575  -7.322  1.00 67.76  ? 86  ASP A O   1 
ATOM   535  C CB  . ASP A 1 70  ? -53.672 10.529 -7.935  1.00 67.70  ? 86  ASP A CB  1 
ATOM   536  C CG  . ASP A 1 70  ? -52.997 11.247 -6.782  1.00 68.65  ? 86  ASP A CG  1 
ATOM   537  O OD1 . ASP A 1 70  ? -51.774 11.069 -6.594  1.00 71.19  ? 86  ASP A OD1 1 
ATOM   538  O OD2 . ASP A 1 70  ? -53.688 12.022 -6.083  1.00 67.69  ? 86  ASP A OD2 1 
ATOM   539  N N   . ASP A 1 71  ? -51.176 8.269  -7.270  1.00 66.75  ? 87  ASP A N   1 
ATOM   540  C CA  . ASP A 1 71  ? -50.727 7.313  -6.263  1.00 69.25  ? 87  ASP A CA  1 
ATOM   541  C C   . ASP A 1 71  ? -50.524 8.131  -4.992  1.00 69.57  ? 87  ASP A C   1 
ATOM   542  O O   . ASP A 1 71  ? -49.436 8.656  -4.739  1.00 73.43  ? 87  ASP A O   1 
ATOM   543  C CB  . ASP A 1 71  ? -49.455 6.593  -6.693  1.00 72.60  ? 87  ASP A CB  1 
ATOM   544  C CG  . ASP A 1 71  ? -48.841 5.772  -5.577  1.00 75.07  ? 87  ASP A CG  1 
ATOM   545  O OD1 . ASP A 1 71  ? -47.598 5.648  -5.544  1.00 80.69  ? 87  ASP A OD1 1 
ATOM   546  O OD2 . ASP A 1 71  ? -49.598 5.243  -4.734  1.00 71.34  ? 87  ASP A OD2 1 
ATOM   547  N N   . THR A 1 72  ? -51.598 8.251  -4.204  1.00 67.82  ? 88  THR A N   1 
ATOM   548  C CA  . THR A 1 72  ? -51.598 9.148  -3.056  1.00 67.62  ? 88  THR A CA  1 
ATOM   549  C C   . THR A 1 72  ? -50.766 8.620  -1.902  1.00 71.11  ? 88  THR A C   1 
ATOM   550  O O   . THR A 1 72  ? -50.344 9.407  -1.047  1.00 72.22  ? 88  THR A O   1 
ATOM   551  C CB  . THR A 1 72  ? -53.023 9.387  -2.565  1.00 64.24  ? 88  THR A CB  1 
ATOM   552  O OG1 . THR A 1 72  ? -53.674 8.132  -2.338  1.00 63.84  ? 88  THR A OG1 1 
ATOM   553  C CG2 . THR A 1 72  ? -53.802 10.183 -3.569  1.00 62.13  ? 88  THR A CG2 1 
ATOM   554  N N   . LEU A 1 73  ? -50.531 7.312  -1.851  1.00 68.13  ? 89  LEU A N   1 
ATOM   555  C CA  . LEU A 1 73  ? -49.728 6.754  -0.774  1.00 70.68  ? 89  LEU A CA  1 
ATOM   556  C C   . LEU A 1 73  ? -48.246 6.973  -1.040  1.00 75.52  ? 89  LEU A C   1 
ATOM   557  O O   . LEU A 1 73  ? -47.529 7.516  -0.193  1.00 77.62  ? 89  LEU A O   1 
ATOM   558  C CB  . LEU A 1 73  ? -50.050 5.273  -0.578  1.00 77.08  ? 89  LEU A CB  1 
ATOM   559  C CG  . LEU A 1 73  ? -51.142 5.034  0.479   1.00 74.31  ? 89  LEU A CG  1 
ATOM   560  C CD1 . LEU A 1 73  ? -52.485 5.634  0.054   1.00 71.60  ? 89  LEU A CD1 1 
ATOM   561  C CD2 . LEU A 1 73  ? -51.294 3.551  0.819   1.00 74.26  ? 89  LEU A CD2 1 
ATOM   562  N N   . GLY A 1 74  ? -47.763 6.537  -2.204  1.00 70.82  ? 90  GLY A N   1 
ATOM   563  C CA  . GLY A 1 74  ? -46.391 6.836  -2.569  1.00 76.41  ? 90  GLY A CA  1 
ATOM   564  C C   . GLY A 1 74  ? -46.161 8.294  -2.903  1.00 78.06  ? 90  GLY A C   1 
ATOM   565  O O   . GLY A 1 74  ? -45.029 8.775  -2.793  1.00 82.48  ? 90  GLY A O   1 
ATOM   566  N N   . GLY A 1 75  ? -47.204 8.999  -3.331  1.00 76.20  ? 91  GLY A N   1 
ATOM   567  C CA  . GLY A 1 75  ? -47.098 10.415 -3.614  1.00 74.81  ? 91  GLY A CA  1 
ATOM   568  C C   . GLY A 1 75  ? -46.553 10.662 -5.002  1.00 76.95  ? 91  GLY A C   1 
ATOM   569  O O   . GLY A 1 75  ? -45.547 11.363 -5.163  1.00 80.73  ? 91  GLY A O   1 
ATOM   570  N N   . THR A 1 76  ? -47.206 10.092 -6.015  1.00 77.81  ? 92  THR A N   1 
ATOM   571  C CA  . THR A 1 76  ? -46.777 10.269 -7.397  1.00 79.31  ? 92  THR A CA  1 
ATOM   572  C C   . THR A 1 76  ? -47.991 10.426 -8.294  1.00 72.64  ? 92  THR A C   1 
ATOM   573  O O   . THR A 1 76  ? -48.809 9.508  -8.408  1.00 70.44  ? 92  THR A O   1 
ATOM   574  C CB  . THR A 1 76  ? -45.914 9.100  -7.873  1.00 77.80  ? 92  THR A CB  1 
ATOM   575  O OG1 . THR A 1 76  ? -44.906 8.821  -6.895  1.00 84.19  ? 92  THR A OG1 1 
ATOM   576  C CG2 . THR A 1 76  ? -45.255 9.438  -9.201  1.00 79.81  ? 92  THR A CG2 1 
ATOM   577  N N   . LEU A 1 77  ? -48.098 11.588 -8.922  1.00 76.56  ? 93  LEU A N   1 
ATOM   578  C CA  . LEU A 1 77  ? -49.119 11.863 -9.916  1.00 71.75  ? 93  LEU A CA  1 
ATOM   579  C C   . LEU A 1 77  ? -48.540 11.509 -11.278 1.00 74.17  ? 93  LEU A C   1 
ATOM   580  O O   . LEU A 1 77  ? -47.356 11.729 -11.530 1.00 78.43  ? 93  LEU A O   1 
ATOM   581  C CB  . LEU A 1 77  ? -49.516 13.338 -9.857  1.00 76.17  ? 93  LEU A CB  1 
ATOM   582  C CG  . LEU A 1 77  ? -50.781 13.817 -10.557 1.00 72.21  ? 93  LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 77  ? -51.983 13.116 -9.964  1.00 70.27  ? 93  LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 77  ? -50.918 15.318 -10.411 1.00 70.86  ? 93  LEU A CD2 1 
ATOM   585  N N   . THR A 1 78  ? -49.357 10.925 -12.146 1.00 74.05  ? 94  THR A N   1 
ATOM   586  C CA  . THR A 1 78  ? -48.868 10.486 -13.449 1.00 76.67  ? 94  THR A CA  1 
ATOM   587  C C   . THR A 1 78  ? -49.874 10.866 -14.521 1.00 72.89  ? 94  THR A C   1 
ATOM   588  O O   . THR A 1 78  ? -51.042 10.462 -14.460 1.00 70.20  ? 94  THR A O   1 
ATOM   589  C CB  . THR A 1 78  ? -48.596 8.980  -13.467 1.00 74.57  ? 94  THR A CB  1 
ATOM   590  O OG1 . THR A 1 78  ? -47.498 8.683  -12.593 1.00 80.37  ? 94  THR A OG1 1 
ATOM   591  C CG2 . THR A 1 78  ? -48.242 8.521  -14.866 1.00 76.52  ? 94  THR A CG2 1 
ATOM   592  N N   . ILE A 1 79  ? -49.417 11.656 -15.487 1.00 78.36  ? 95  ILE A N   1 
ATOM   593  C CA  . ILE A 1 79  ? -50.229 12.101 -16.611 1.00 75.99  ? 95  ILE A CA  1 
ATOM   594  C C   . ILE A 1 79  ? -49.757 11.377 -17.859 1.00 78.84  ? 95  ILE A C   1 
ATOM   595  O O   . ILE A 1 79  ? -48.550 11.258 -18.102 1.00 82.29  ? 95  ILE A O   1 
ATOM   596  C CB  . ILE A 1 79  ? -50.142 13.624 -16.820 1.00 79.32  ? 95  ILE A CB  1 
ATOM   597  C CG1 . ILE A 1 79  ? -50.181 14.361 -15.482 1.00 77.76  ? 95  ILE A CG1 1 
ATOM   598  C CG2 . ILE A 1 79  ? -51.237 14.097 -17.765 1.00 77.33  ? 95  ILE A CG2 1 
ATOM   599  C CD1 . ILE A 1 79  ? -51.412 14.111 -14.683 1.00 75.50  ? 95  ILE A CD1 1 
ATOM   600  N N   . THR A 1 80  ? -50.708 10.896 -18.651 1.00 78.90  ? 96  THR A N   1 
ATOM   601  C CA  . THR A 1 80  ? -50.413 10.244 -19.916 1.00 81.29  ? 96  THR A CA  1 
ATOM   602  C C   . THR A 1 80  ? -51.043 11.062 -21.031 1.00 79.51  ? 96  THR A C   1 
ATOM   603  O O   . THR A 1 80  ? -52.259 11.286 -21.034 1.00 77.12  ? 96  THR A O   1 
ATOM   604  C CB  . THR A 1 80  ? -50.936 8.807  -19.950 1.00 75.57  ? 96  THR A CB  1 
ATOM   605  O OG1 . THR A 1 80  ? -50.341 8.049  -18.892 1.00 78.03  ? 96  THR A OG1 1 
ATOM   606  C CG2 . THR A 1 80  ? -50.591 8.156  -21.271 1.00 77.90  ? 96  THR A CG2 1 
ATOM   607  N N   . LEU A 1 81  ? -50.211 11.516 -21.958 1.00 83.05  ? 97  LEU A N   1 
ATOM   608  C CA  . LEU A 1 81  ? -50.659 12.119 -23.204 1.00 82.47  ? 97  LEU A CA  1 
ATOM   609  C C   . LEU A 1 81  ? -50.606 10.999 -24.234 1.00 84.59  ? 97  LEU A C   1 
ATOM   610  O O   . LEU A 1 81  ? -49.534 10.629 -24.720 1.00 87.33  ? 97  LEU A O   1 
ATOM   611  C CB  . LEU A 1 81  ? -49.790 13.310 -23.586 1.00 87.52  ? 97  LEU A CB  1 
ATOM   612  C CG  . LEU A 1 81  ? -49.777 14.406 -22.523 1.00 85.63  ? 97  LEU A CG  1 
ATOM   613  C CD1 . LEU A 1 81  ? -48.573 15.317 -22.684 1.00 86.68  ? 97  LEU A CD1 1 
ATOM   614  C CD2 . LEU A 1 81  ? -51.070 15.198 -22.580 1.00 83.21  ? 97  LEU A CD2 1 
ATOM   615  N N   . ARG A 1 82  ? -51.768 10.424 -24.518 1.00 85.58  ? 98  ARG A N   1 
ATOM   616  C CA  . ARG A 1 82  ? -51.870 9.318  -25.452 1.00 86.24  ? 98  ARG A CA  1 
ATOM   617  C C   . ARG A 1 82  ? -51.849 9.874  -26.863 1.00 89.59  ? 98  ARG A C   1 
ATOM   618  O O   . ARG A 1 82  ? -52.614 10.789 -27.185 1.00 90.17  ? 98  ARG A O   1 
ATOM   619  C CB  . ARG A 1 82  ? -53.157 8.534  -25.209 1.00 80.95  ? 98  ARG A CB  1 
ATOM   620  C CG  . ARG A 1 82  ? -53.524 7.574  -26.320 1.00 82.51  ? 98  ARG A CG  1 
ATOM   621  C CD  . ARG A 1 82  ? -54.819 6.866  -25.989 1.00 79.87  ? 98  ARG A CD  1 
ATOM   622  N NE  . ARG A 1 82  ? -55.365 6.124  -27.119 1.00 81.83  ? 98  ARG A NE  1 
ATOM   623  C CZ  . ARG A 1 82  ? -56.591 5.613  -27.145 1.00 80.65  ? 98  ARG A CZ  1 
ATOM   624  N NH1 . ARG A 1 82  ? -57.398 5.787  -26.107 1.00 77.60  ? 98  ARG A NH1 1 
ATOM   625  N NH2 . ARG A 1 82  ? -57.018 4.938  -28.204 1.00 82.76  ? 98  ARG A NH2 1 
ATOM   626  N N   . ASN A 1 83  ? -50.954 9.336  -27.695 1.00 97.18  ? 99  ASN A N   1 
ATOM   627  C CA  . ASN A 1 83  ? -50.816 9.773  -29.078 1.00 99.43  ? 99  ASN A CA  1 
ATOM   628  C C   . ASN A 1 83  ? -50.458 11.255 -29.102 1.00 101.04 ? 99  ASN A C   1 
ATOM   629  O O   . ASN A 1 83  ? -51.322 12.114 -29.307 1.00 101.06 ? 99  ASN A O   1 
ATOM   630  C CB  . ASN A 1 83  ? -52.098 9.483  -29.867 1.00 99.79  ? 99  ASN A CB  1 
ATOM   631  C CG  . ASN A 1 83  ? -52.085 10.093 -31.243 1.00 103.72 ? 99  ASN A CG  1 
ATOM   632  O OD1 . ASN A 1 83  ? -52.641 11.169 -31.463 1.00 104.46 ? 99  ASN A OD1 1 
ATOM   633  N ND2 . ASN A 1 83  ? -51.447 9.409  -32.184 1.00 106.70 ? 99  ASN A ND2 1 
ATOM   634  N N   . LEU A 1 84  ? -49.193 11.561 -28.832 1.00 101.85 ? 100 LEU A N   1 
ATOM   635  C CA  . LEU A 1 84  ? -48.752 12.946 -28.797 1.00 103.29 ? 100 LEU A CA  1 
ATOM   636  C C   . LEU A 1 84  ? -48.912 13.587 -30.173 1.00 107.52 ? 100 LEU A C   1 
ATOM   637  O O   . LEU A 1 84  ? -48.743 12.940 -31.210 1.00 110.08 ? 100 LEU A O   1 
ATOM   638  C CB  . LEU A 1 84  ? -47.300 13.025 -28.324 1.00 106.14 ? 100 LEU A CB  1 
ATOM   639  C CG  . LEU A 1 84  ? -46.837 14.370 -27.770 1.00 105.75 ? 100 LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 84  ? -47.808 14.851 -26.706 1.00 103.15 ? 100 LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 84  ? -45.433 14.249 -27.198 1.00 105.41 ? 100 LEU A CD2 1 
ATOM   642  N N   . GLN A 1 85  ? -49.259 14.868 -30.173 1.00 109.63 ? 101 GLN A N   1 
ATOM   643  C CA  . GLN A 1 85  ? -49.502 15.649 -31.374 1.00 115.15 ? 101 GLN A CA  1 
ATOM   644  C C   . GLN A 1 85  ? -48.570 16.856 -31.415 1.00 118.74 ? 101 GLN A C   1 
ATOM   645  O O   . GLN A 1 85  ? -47.949 17.204 -30.406 1.00 116.54 ? 101 GLN A O   1 
ATOM   646  C CB  . GLN A 1 85  ? -50.963 16.124 -31.416 1.00 115.14 ? 101 GLN A CB  1 
ATOM   647  C CG  . GLN A 1 85  ? -51.963 15.046 -31.782 1.00 113.42 ? 101 GLN A CG  1 
ATOM   648  C CD  . GLN A 1 85  ? -51.680 14.447 -33.144 1.00 117.31 ? 101 GLN A CD  1 
ATOM   649  O OE1 . GLN A 1 85  ? -51.552 15.168 -34.135 1.00 122.65 ? 101 GLN A OE1 1 
ATOM   650  N NE2 . GLN A 1 85  ? -51.577 13.123 -33.201 1.00 114.97 ? 101 GLN A NE2 1 
ATOM   651  N N   . PRO A 1 86  ? -48.431 17.501 -32.581 1.00 124.55 ? 102 PRO A N   1 
ATOM   652  C CA  . PRO A 1 86  ? -47.709 18.786 -32.593 1.00 128.30 ? 102 PRO A CA  1 
ATOM   653  C C   . PRO A 1 86  ? -48.359 19.822 -31.693 1.00 126.94 ? 102 PRO A C   1 
ATOM   654  O O   . PRO A 1 86  ? -47.687 20.412 -30.838 1.00 125.94 ? 102 PRO A O   1 
ATOM   655  C CB  . PRO A 1 86  ? -47.751 19.183 -34.075 1.00 134.90 ? 102 PRO A CB  1 
ATOM   656  C CG  . PRO A 1 86  ? -48.940 18.451 -34.625 1.00 134.18 ? 102 PRO A CG  1 
ATOM   657  C CD  . PRO A 1 86  ? -48.898 17.130 -33.927 1.00 128.37 ? 102 PRO A CD  1 
ATOM   658  N N   . HIS A 1 87  ? -49.662 20.057 -31.864 1.00 127.12 ? 103 HIS A N   1 
ATOM   659  C CA  . HIS A 1 87  ? -50.360 21.047 -31.053 1.00 126.34 ? 103 HIS A CA  1 
ATOM   660  C C   . HIS A 1 87  ? -50.426 20.661 -29.582 1.00 120.11 ? 103 HIS A C   1 
ATOM   661  O O   . HIS A 1 87  ? -50.736 21.518 -28.747 1.00 119.42 ? 103 HIS A O   1 
ATOM   662  C CB  . HIS A 1 87  ? -51.767 21.291 -31.605 1.00 128.28 ? 103 HIS A CB  1 
ATOM   663  C CG  . HIS A 1 87  ? -52.643 20.078 -31.603 1.00 124.53 ? 103 HIS A CG  1 
ATOM   664  N ND1 . HIS A 1 87  ? -53.060 19.458 -30.444 1.00 118.60 ? 103 HIS A ND1 1 
ATOM   665  C CD2 . HIS A 1 87  ? -53.192 19.376 -32.622 1.00 126.15 ? 103 HIS A CD2 1 
ATOM   666  C CE1 . HIS A 1 87  ? -53.819 18.421 -30.750 1.00 116.69 ? 103 HIS A CE1 1 
ATOM   667  N NE2 . HIS A 1 87  ? -53.917 18.350 -32.066 1.00 121.15 ? 103 HIS A NE2 1 
ATOM   668  N N   . ASP A 1 88  ? -50.144 19.402 -29.237 1.00 118.16 ? 104 ASP A N   1 
ATOM   669  C CA  . ASP A 1 88  ? -50.108 19.042 -27.825 1.00 114.31 ? 104 ASP A CA  1 
ATOM   670  C C   . ASP A 1 88  ? -48.872 19.591 -27.129 1.00 114.33 ? 104 ASP A C   1 
ATOM   671  O O   . ASP A 1 88  ? -48.830 19.603 -25.895 1.00 111.71 ? 104 ASP A O   1 
ATOM   672  C CB  . ASP A 1 88  ? -50.171 17.520 -27.639 1.00 111.13 ? 104 ASP A CB  1 
ATOM   673  C CG  . ASP A 1 88  ? -51.545 16.945 -27.954 1.00 109.85 ? 104 ASP A CG  1 
ATOM   674  O OD1 . ASP A 1 88  ? -52.542 17.687 -27.847 1.00 110.07 ? 104 ASP A OD1 1 
ATOM   675  O OD2 . ASP A 1 88  ? -51.629 15.742 -28.282 1.00 108.64 ? 104 ASP A OD2 1 
ATOM   676  N N   . ALA A 1 89  ? -47.869 20.029 -27.886 1.00 117.79 ? 105 ALA A N   1 
ATOM   677  C CA  . ALA A 1 89  ? -46.665 20.593 -27.298 1.00 118.11 ? 105 ALA A CA  1 
ATOM   678  C C   . ALA A 1 89  ? -46.987 21.910 -26.600 1.00 118.98 ? 105 ALA A C   1 
ATOM   679  O O   . ALA A 1 89  ? -47.886 22.649 -27.010 1.00 121.50 ? 105 ALA A O   1 
ATOM   680  C CB  . ALA A 1 89  ? -45.596 20.806 -28.369 1.00 120.49 ? 105 ALA A CB  1 
ATOM   681  N N   . GLY A 1 90  ? -46.243 22.207 -25.546 1.00 117.69 ? 106 GLY A N   1 
ATOM   682  C CA  . GLY A 1 90  ? -46.458 23.428 -24.799 1.00 118.55 ? 106 GLY A CA  1 
ATOM   683  C C   . GLY A 1 90  ? -46.028 23.278 -23.352 1.00 114.98 ? 106 GLY A C   1 
ATOM   684  O O   . GLY A 1 90  ? -45.332 22.336 -22.983 1.00 112.10 ? 106 GLY A O   1 
ATOM   685  N N   . LEU A 1 91  ? -46.460 24.244 -22.544 1.00 114.84 ? 107 LEU A N   1 
ATOM   686  C CA  . LEU A 1 91  ? -46.042 24.390 -21.153 1.00 112.31 ? 107 LEU A CA  1 
ATOM   687  C C   . LEU A 1 91  ? -47.210 24.051 -20.231 1.00 110.29 ? 107 LEU A C   1 
ATOM   688  O O   . LEU A 1 91  ? -48.250 24.716 -20.275 1.00 112.55 ? 107 LEU A O   1 
ATOM   689  C CB  . LEU A 1 91  ? -45.539 25.817 -20.925 1.00 118.88 ? 107 LEU A CB  1 
ATOM   690  C CG  . LEU A 1 91  ? -45.110 26.343 -19.559 1.00 117.42 ? 107 LEU A CG  1 
ATOM   691  C CD1 . LEU A 1 91  ? -43.734 25.816 -19.205 1.00 114.86 ? 107 LEU A CD1 1 
ATOM   692  C CD2 . LEU A 1 91  ? -45.101 27.865 -19.601 1.00 121.57 ? 107 LEU A CD2 1 
ATOM   693  N N   . TYR A 1 92  ? -47.033 23.027 -19.395 1.00 107.77 ? 108 TYR A N   1 
ATOM   694  C CA  . TYR A 1 92  ? -48.053 22.517 -18.479 1.00 106.21 ? 108 TYR A CA  1 
ATOM   695  C C   . TYR A 1 92  ? -47.582 22.522 -17.028 1.00 104.13 ? 108 TYR A C   1 
ATOM   696  O O   . TYR A 1 92  ? -46.396 22.700 -16.731 1.00 102.66 ? 108 TYR A O   1 
ATOM   697  C CB  . TYR A 1 92  ? -48.453 21.089 -18.851 1.00 102.42 ? 108 TYR A CB  1 
ATOM   698  C CG  . TYR A 1 92  ? -48.970 20.906 -20.253 1.00 103.64 ? 108 TYR A CG  1 
ATOM   699  C CD1 . TYR A 1 92  ? -48.106 20.853 -21.337 1.00 104.63 ? 108 TYR A CD1 1 
ATOM   700  C CD2 . TYR A 1 92  ? -50.321 20.701 -20.484 1.00 104.21 ? 108 TYR A CD2 1 
ATOM   701  C CE1 . TYR A 1 92  ? -48.583 20.666 -22.613 1.00 106.39 ? 108 TYR A CE1 1 
ATOM   702  C CE2 . TYR A 1 92  ? -50.803 20.495 -21.755 1.00 105.19 ? 108 TYR A CE2 1 
ATOM   703  C CZ  . TYR A 1 92  ? -49.932 20.486 -22.816 1.00 106.55 ? 108 TYR A CZ  1 
ATOM   704  O OH  . TYR A 1 92  ? -50.422 20.290 -24.083 1.00 108.18 ? 108 TYR A OH  1 
ATOM   705  N N   . GLN A 1 93  ? -48.540 22.317 -16.115 1.00 98.96  ? 109 GLN A N   1 
ATOM   706  C CA  . GLN A 1 93  ? -48.196 22.094 -14.716 1.00 96.00  ? 109 GLN A CA  1 
ATOM   707  C C   . GLN A 1 93  ? -49.199 21.172 -14.021 1.00 95.00  ? 109 GLN A C   1 
ATOM   708  O O   . GLN A 1 93  ? -50.374 21.067 -14.416 1.00 96.76  ? 109 GLN A O   1 
ATOM   709  C CB  . GLN A 1 93  ? -48.057 23.424 -13.958 1.00 96.23  ? 109 GLN A CB  1 
ATOM   710  C CG  . GLN A 1 93  ? -49.283 24.305 -13.956 1.00 100.03 ? 109 GLN A CG  1 
ATOM   711  C CD  . GLN A 1 93  ? -49.110 25.555 -13.105 1.00 102.27 ? 109 GLN A CD  1 
ATOM   712  O OE1 . GLN A 1 93  ? -49.295 25.526 -11.887 1.00 100.90 ? 109 GLN A OE1 1 
ATOM   713  N NE2 . GLN A 1 93  ? -48.755 26.664 -13.749 1.00 106.01 ? 109 GLN A NE2 1 
ATOM   714  N N   . CYS A 1 94  ? -48.687 20.499 -12.976 1.00 91.68  ? 110 CYS A N   1 
ATOM   715  C CA  . CYS A 1 94  ? -49.445 19.698 -12.018 1.00 90.95  ? 110 CYS A CA  1 
ATOM   716  C C   . CYS A 1 94  ? -49.804 20.540 -10.801 1.00 91.18  ? 110 CYS A C   1 
ATOM   717  O O   . CYS A 1 94  ? -49.005 21.360 -10.340 1.00 90.21  ? 110 CYS A O   1 
ATOM   718  C CB  . CYS A 1 94  ? -48.670 18.456 -11.543 1.00 89.38  ? 110 CYS A CB  1 
ATOM   719  S SG  . CYS A 1 94  ? -48.094 17.292 -12.796 1.00 89.24  ? 110 CYS A SG  1 
ATOM   720  N N   . GLN A 1 95  ? -51.010 20.328 -10.280 1.00 84.64  ? 111 GLN A N   1 
ATOM   721  C CA  . GLN A 1 95  ? -51.543 21.168 -9.220  1.00 86.09  ? 111 GLN A CA  1 
ATOM   722  C C   . GLN A 1 95  ? -52.212 20.329 -8.140  1.00 83.58  ? 111 GLN A C   1 
ATOM   723  O O   . GLN A 1 95  ? -52.988 19.416 -8.435  1.00 83.13  ? 111 GLN A O   1 
ATOM   724  C CB  . GLN A 1 95  ? -52.538 22.186 -9.786  1.00 88.12  ? 111 GLN A CB  1 
ATOM   725  C CG  . GLN A 1 95  ? -51.867 23.299 -10.574 1.00 90.95  ? 111 GLN A CG  1 
ATOM   726  C CD  . GLN A 1 95  ? -52.835 24.356 -11.061 1.00 96.26  ? 111 GLN A CD  1 
ATOM   727  O OE1 . GLN A 1 95  ? -53.991 24.065 -11.372 1.00 97.53  ? 111 GLN A OE1 1 
ATOM   728  N NE2 . GLN A 1 95  ? -52.362 25.596 -11.136 1.00 99.33  ? 111 GLN A NE2 1 
ATOM   729  N N   . SER A 1 96  ? -51.915 20.659 -6.887  1.00 82.07  ? 112 SER A N   1 
ATOM   730  C CA  . SER A 1 96  ? -52.607 20.106 -5.734  1.00 80.09  ? 112 SER A CA  1 
ATOM   731  C C   . SER A 1 96  ? -53.637 21.131 -5.279  1.00 84.28  ? 112 SER A C   1 
ATOM   732  O O   . SER A 1 96  ? -53.280 22.268 -4.967  1.00 86.47  ? 112 SER A O   1 
ATOM   733  C CB  . SER A 1 96  ? -51.613 19.787 -4.619  1.00 80.58  ? 112 SER A CB  1 
ATOM   734  O OG  . SER A 1 96  ? -52.236 19.110 -3.549  1.00 78.17  ? 112 SER A OG  1 
ATOM   735  N N   . LEU A 1 97  ? -54.899 20.732 -5.209  1.00 81.30  ? 113 LEU A N   1 
ATOM   736  C CA  . LEU A 1 97  ? -55.979 21.682 -4.983  1.00 86.34  ? 113 LEU A CA  1 
ATOM   737  C C   . LEU A 1 97  ? -56.404 21.670 -3.521  1.00 84.77  ? 113 LEU A C   1 
ATOM   738  O O   . LEU A 1 97  ? -56.565 20.604 -2.919  1.00 80.84  ? 113 LEU A O   1 
ATOM   739  C CB  . LEU A 1 97  ? -57.187 21.352 -5.864  1.00 78.18  ? 113 LEU A CB  1 
ATOM   740  C CG  . LEU A 1 97  ? -56.947 20.797 -7.269  1.00 77.84  ? 113 LEU A CG  1 
ATOM   741  C CD1 . LEU A 1 97  ? -58.270 20.480 -7.933  1.00 80.89  ? 113 LEU A CD1 1 
ATOM   742  C CD2 . LEU A 1 97  ? -56.138 21.752 -8.121  1.00 79.83  ? 113 LEU A CD2 1 
ATOM   743  N N   . HIS A 1 98  ? -56.594 22.861 -2.955  1.00 88.52  ? 114 HIS A N   1 
ATOM   744  C CA  . HIS A 1 98  ? -57.199 22.994 -1.635  1.00 87.84  ? 114 HIS A CA  1 
ATOM   745  C C   . HIS A 1 98  ? -58.057 24.248 -1.616  1.00 93.98  ? 114 HIS A C   1 
ATOM   746  O O   . HIS A 1 98  ? -57.564 25.354 -1.870  1.00 97.40  ? 114 HIS A O   1 
ATOM   747  C CB  . HIS A 1 98  ? -56.152 23.012 -0.513  1.00 90.46  ? 114 HIS A CB  1 
ATOM   748  C CG  . HIS A 1 98  ? -55.012 23.948 -0.747  1.00 91.62  ? 114 HIS A CG  1 
ATOM   749  N ND1 . HIS A 1 98  ? -55.097 25.302 -0.500  1.00 96.44  ? 114 HIS A ND1 1 
ATOM   750  C CD2 . HIS A 1 98  ? -53.750 23.725 -1.184  1.00 88.68  ? 114 HIS A CD2 1 
ATOM   751  C CE1 . HIS A 1 98  ? -53.941 25.872 -0.787  1.00 96.51  ? 114 HIS A CE1 1 
ATOM   752  N NE2 . HIS A 1 98  ? -53.105 24.937 -1.200  1.00 91.60  ? 114 HIS A NE2 1 
ATOM   753  N N   . GLY A 1 99  ? -59.350 24.056 -1.374  1.00 97.80  ? 115 GLY A N   1 
ATOM   754  C CA  . GLY A 1 99  ? -60.281 25.166 -1.361  1.00 102.60 ? 115 GLY A CA  1 
ATOM   755  C C   . GLY A 1 99  ? -60.278 25.887 -2.690  1.00 106.76 ? 115 GLY A C   1 
ATOM   756  O O   . GLY A 1 99  ? -60.237 25.274 -3.763  1.00 106.85 ? 115 GLY A O   1 
ATOM   757  N N   . SER A 1 100 ? -60.329 27.216 -2.620  1.00 108.07 ? 116 SER A N   1 
ATOM   758  C CA  . SER A 1 100 ? -60.288 28.024 -3.828  1.00 111.08 ? 116 SER A CA  1 
ATOM   759  C C   . SER A 1 100 ? -58.933 27.965 -4.527  1.00 110.94 ? 116 SER A C   1 
ATOM   760  O O   . SER A 1 100 ? -58.867 28.252 -5.727  1.00 112.25 ? 116 SER A O   1 
ATOM   761  C CB  . SER A 1 100 ? -60.661 29.471 -3.500  1.00 119.76 ? 116 SER A CB  1 
ATOM   762  O OG  . SER A 1 100 ? -59.653 30.108 -2.736  1.00 120.05 ? 116 SER A OG  1 
ATOM   763  N N   . GLU A 1 101 ? -57.857 27.608 -3.823  1.00 109.62 ? 117 GLU A N   1 
ATOM   764  C CA  . GLU A 1 101 ? -56.518 27.728 -4.387  1.00 107.73 ? 117 GLU A CA  1 
ATOM   765  C C   . GLU A 1 101 ? -55.979 26.396 -4.900  1.00 100.46 ? 117 GLU A C   1 
ATOM   766  O O   . GLU A 1 101 ? -56.472 25.309 -4.582  1.00 96.73  ? 117 GLU A O   1 
ATOM   767  C CB  . GLU A 1 101 ? -55.532 28.315 -3.370  1.00 110.00 ? 117 GLU A CB  1 
ATOM   768  C CG  . GLU A 1 101 ? -55.776 29.767 -3.003  1.00 118.14 ? 117 GLU A CG  1 
ATOM   769  C CD  . GLU A 1 101 ? -56.794 29.934 -1.895  1.00 122.70 ? 117 GLU A CD  1 
ATOM   770  O OE1 . GLU A 1 101 ? -57.296 28.912 -1.376  1.00 117.35 ? 117 GLU A OE1 1 
ATOM   771  O OE2 . GLU A 1 101 ? -57.094 31.095 -1.541  1.00 132.56 ? 117 GLU A OE2 1 
ATOM   772  N N   . ALA A 1 102 ? -54.923 26.511 -5.701  1.00 101.78 ? 118 ALA A N   1 
ATOM   773  C CA  . ALA A 1 102 ? -54.171 25.382 -6.222  1.00 95.75  ? 118 ALA A CA  1 
ATOM   774  C C   . ALA A 1 102 ? -52.695 25.695 -6.054  1.00 96.06  ? 118 ALA A C   1 
ATOM   775  O O   . ALA A 1 102 ? -52.253 26.804 -6.368  1.00 99.92  ? 118 ALA A O   1 
ATOM   776  C CB  . ALA A 1 102 ? -54.498 25.113 -7.696  1.00 91.32  ? 118 ALA A CB  1 
ATOM   777  N N   . ASP A 1 103 ? -51.939 24.721 -5.573  1.00 96.55  ? 119 ASP A N   1 
ATOM   778  C CA  . ASP A 1 103 ? -50.498 24.832 -5.437  1.00 97.42  ? 119 ASP A CA  1 
ATOM   779  C C   . ASP A 1 103 ? -49.829 24.048 -6.553  1.00 93.96  ? 119 ASP A C   1 
ATOM   780  O O   . ASP A 1 103 ? -50.395 23.105 -7.107  1.00 90.16  ? 119 ASP A O   1 
ATOM   781  C CB  . ASP A 1 103 ? -50.031 24.302 -4.079  1.00 96.87  ? 119 ASP A CB  1 
ATOM   782  C CG  . ASP A 1 103 ? -50.618 25.076 -2.917  1.00 100.72 ? 119 ASP A CG  1 
ATOM   783  O OD1 . ASP A 1 103 ? -51.248 26.129 -3.161  1.00 103.88 ? 119 ASP A OD1 1 
ATOM   784  O OD2 . ASP A 1 103 ? -50.453 24.633 -1.757  1.00 101.16 ? 119 ASP A OD2 1 
ATOM   785  N N   . THR A 1 104 ? -48.608 24.444 -6.878  1.00 95.71  ? 120 THR A N   1 
ATOM   786  C CA  . THR A 1 104 ? -47.926 23.922 -8.051  1.00 93.77  ? 120 THR A CA  1 
ATOM   787  C C   . THR A 1 104 ? -46.958 22.835 -7.608  1.00 93.89  ? 120 THR A C   1 
ATOM   788  O O   . THR A 1 104 ? -46.046 23.092 -6.815  1.00 98.05  ? 120 THR A O   1 
ATOM   789  C CB  . THR A 1 104 ? -47.191 25.035 -8.793  1.00 95.50  ? 120 THR A CB  1 
ATOM   790  O OG1 . THR A 1 104 ? -48.148 25.962 -9.317  1.00 96.71  ? 120 THR A OG1 1 
ATOM   791  C CG2 . THR A 1 104 ? -46.381 24.458 -9.943  1.00 94.21  ? 120 THR A CG2 1 
ATOM   792  N N   . LEU A 1 105 ? -47.164 21.625 -8.122  1.00 91.68  ? 121 LEU A N   1 
ATOM   793  C CA  . LEU A 1 105 ? -46.346 20.484 -7.742  1.00 94.22  ? 121 LEU A CA  1 
ATOM   794  C C   . LEU A 1 105 ? -45.157 20.322 -8.674  1.00 97.54  ? 121 LEU A C   1 
ATOM   795  O O   . LEU A 1 105 ? -44.076 19.919 -8.232  1.00 99.56  ? 121 LEU A O   1 
ATOM   796  C CB  . LEU A 1 105 ? -47.186 19.205 -7.736  1.00 90.77  ? 121 LEU A CB  1 
ATOM   797  C CG  . LEU A 1 105 ? -48.352 19.172 -6.745  1.00 85.99  ? 121 LEU A CG  1 
ATOM   798  C CD1 . LEU A 1 105 ? -49.505 18.370 -7.305  1.00 81.26  ? 121 LEU A CD1 1 
ATOM   799  C CD2 . LEU A 1 105 ? -47.920 18.615 -5.410  1.00 87.51  ? 121 LEU A CD2 1 
ATOM   800  N N   . ARG A 1 106 ? -45.338 20.638 -9.955  1.00 101.79 ? 122 ARG A N   1 
ATOM   801  C CA  . ARG A 1 106 ? -44.248 20.568 -10.914 1.00 105.27 ? 122 ARG A CA  1 
ATOM   802  C C   . ARG A 1 106 ? -44.618 21.403 -12.132 1.00 102.11 ? 122 ARG A C   1 
ATOM   803  O O   . ARG A 1 106 ? -45.798 21.649 -12.400 1.00 96.79  ? 122 ARG A O   1 
ATOM   804  C CB  . ARG A 1 106 ? -43.951 19.119 -11.315 1.00 100.40 ? 122 ARG A CB  1 
ATOM   805  C CG  . ARG A 1 106 ? -42.600 18.932 -11.976 1.00 105.19 ? 122 ARG A CG  1 
ATOM   806  C CD  . ARG A 1 106 ? -42.351 17.486 -12.344 1.00 105.17 ? 122 ARG A CD  1 
ATOM   807  N NE  . ARG A 1 106 ? -40.921 17.192 -12.380 1.00 107.44 ? 122 ARG A NE  1 
ATOM   808  C CZ  . ARG A 1 106 ? -40.390 16.069 -12.857 1.00 105.27 ? 122 ARG A CZ  1 
ATOM   809  N NH1 . ARG A 1 106 ? -41.169 15.125 -13.372 1.00 100.65 ? 122 ARG A NH1 1 
ATOM   810  N NH2 . ARG A 1 106 ? -39.074 15.900 -12.833 1.00 106.38 ? 122 ARG A NH2 1 
ATOM   811  N N   . LYS A 1 107 ? -43.592 21.840 -12.857 1.00 110.42 ? 123 LYS A N   1 
ATOM   812  C CA  . LYS A 1 107 ? -43.728 22.708 -14.019 1.00 107.93 ? 123 LYS A CA  1 
ATOM   813  C C   . LYS A 1 107 ? -42.951 22.097 -15.178 1.00 110.34 ? 123 LYS A C   1 
ATOM   814  O O   . LYS A 1 107 ? -41.749 21.842 -15.047 1.00 115.31 ? 123 LYS A O   1 
ATOM   815  C CB  . LYS A 1 107 ? -43.213 24.113 -13.684 1.00 114.86 ? 123 LYS A CB  1 
ATOM   816  C CG  . LYS A 1 107 ? -42.013 24.109 -12.721 1.00 119.51 ? 123 LYS A CG  1 
ATOM   817  C CD  . LYS A 1 107 ? -41.617 25.512 -12.261 1.00 119.70 ? 123 LYS A CD  1 
ATOM   818  C CE  . LYS A 1 107 ? -40.199 25.490 -11.668 1.00 123.98 ? 123 LYS A CE  1 
ATOM   819  N NZ  . LYS A 1 107 ? -39.547 26.823 -11.557 1.00 124.73 ? 123 LYS A NZ  1 
ATOM   820  N N   . VAL A 1 108 ? -43.628 21.847 -16.306 1.00 115.17 ? 124 VAL A N   1 
ATOM   821  C CA  . VAL A 1 108 ? -43.025 21.077 -17.390 1.00 117.56 ? 124 VAL A CA  1 
ATOM   822  C C   . VAL A 1 108 ? -43.295 21.688 -18.762 1.00 113.99 ? 124 VAL A C   1 
ATOM   823  O O   . VAL A 1 108 ? -44.324 22.329 -18.998 1.00 108.93 ? 124 VAL A O   1 
ATOM   824  C CB  . VAL A 1 108 ? -43.530 19.615 -17.389 1.00 112.05 ? 124 VAL A CB  1 
ATOM   825  C CG1 . VAL A 1 108 ? -43.101 18.890 -16.125 1.00 116.67 ? 124 VAL A CG1 1 
ATOM   826  C CG2 . VAL A 1 108 ? -45.040 19.568 -17.562 1.00 104.28 ? 124 VAL A CG2 1 
ATOM   827  N N   . LEU A 1 109 ? -42.341 21.475 -19.667 1.00 115.02 ? 125 LEU A N   1 
ATOM   828  C CA  . LEU A 1 109 ? -42.504 21.616 -21.106 1.00 112.49 ? 125 LEU A CA  1 
ATOM   829  C C   . LEU A 1 109 ? -42.638 20.233 -21.721 1.00 114.58 ? 125 LEU A C   1 
ATOM   830  O O   . LEU A 1 109 ? -42.050 19.264 -21.238 1.00 119.64 ? 125 LEU A O   1 
ATOM   831  C CB  . LEU A 1 109 ? -41.321 22.326 -21.771 1.00 119.00 ? 125 LEU A CB  1 
ATOM   832  C CG  . LEU A 1 109 ? -41.125 23.837 -21.760 1.00 118.38 ? 125 LEU A CG  1 
ATOM   833  C CD1 . LEU A 1 109 ? -39.888 24.176 -22.573 1.00 121.05 ? 125 LEU A CD1 1 
ATOM   834  C CD2 . LEU A 1 109 ? -42.343 24.520 -22.354 1.00 115.53 ? 125 LEU A CD2 1 
ATOM   835  N N   . VAL A 1 110 ? -43.429 20.140 -22.780 1.00 116.89 ? 126 VAL A N   1 
ATOM   836  C CA  . VAL A 1 110 ? -43.459 18.948 -23.615 1.00 118.76 ? 126 VAL A CA  1 
ATOM   837  C C   . VAL A 1 110 ? -42.933 19.316 -24.996 1.00 119.15 ? 126 VAL A C   1 
ATOM   838  O O   . VAL A 1 110 ? -43.266 20.375 -25.541 1.00 114.97 ? 126 VAL A O   1 
ATOM   839  C CB  . VAL A 1 110 ? -44.867 18.325 -23.686 1.00 116.69 ? 126 VAL A CB  1 
ATOM   840  C CG1 . VAL A 1 110 ? -45.280 17.818 -22.324 1.00 116.18 ? 126 VAL A CG1 1 
ATOM   841  C CG2 . VAL A 1 110 ? -45.865 19.333 -24.166 1.00 109.97 ? 126 VAL A CG2 1 
ATOM   842  N N   . GLU A 1 111 ? -42.087 18.451 -25.547 1.00 120.45 ? 127 GLU A N   1 
ATOM   843  C CA  . GLU A 1 111 ? -41.568 18.598 -26.895 1.00 121.03 ? 127 GLU A CA  1 
ATOM   844  C C   . GLU A 1 111 ? -42.042 17.420 -27.734 1.00 122.28 ? 127 GLU A C   1 
ATOM   845  O O   . GLU A 1 111 ? -42.461 16.386 -27.207 1.00 123.68 ? 127 GLU A O   1 
ATOM   846  C CB  . GLU A 1 111 ? -40.033 18.662 -26.912 1.00 131.63 ? 127 GLU A CB  1 
ATOM   847  C CG  . GLU A 1 111 ? -39.409 19.620 -25.908 1.00 131.25 ? 127 GLU A CG  1 
ATOM   848  C CD  . GLU A 1 111 ? -37.945 19.921 -26.222 1.00 133.72 ? 127 GLU A CD  1 
ATOM   849  O OE1 . GLU A 1 111 ? -37.355 19.223 -27.078 1.00 136.48 ? 127 GLU A OE1 1 
ATOM   850  O OE2 . GLU A 1 111 ? -37.383 20.855 -25.610 1.00 132.93 ? 127 GLU A OE2 1 
ATOM   851  N N   . VAL A 1 112 ? -41.967 17.582 -29.054 1.00 124.00 ? 128 VAL A N   1 
ATOM   852  C CA  . VAL A 1 112 ? -42.469 16.582 -29.988 1.00 124.33 ? 128 VAL A CA  1 
ATOM   853  C C   . VAL A 1 112 ? -41.493 16.435 -31.146 1.00 128.79 ? 128 VAL A C   1 
ATOM   854  O O   . VAL A 1 112 ? -40.823 17.393 -31.544 1.00 128.85 ? 128 VAL A O   1 
ATOM   855  C CB  . VAL A 1 112 ? -43.875 16.946 -30.526 1.00 123.48 ? 128 VAL A CB  1 
ATOM   856  C CG1 . VAL A 1 112 ? -44.850 17.198 -29.386 1.00 118.04 ? 128 VAL A CG1 1 
ATOM   857  C CG2 . VAL A 1 112 ? -43.805 18.159 -31.457 1.00 123.95 ? 128 VAL A CG2 1 
ATOM   858  N N   . LEU A 1 113 ? -41.387 15.213 -31.666 1.00 130.19 ? 129 LEU A N   1 
ATOM   859  C CA  . LEU A 1 113 ? -40.765 14.988 -32.966 1.00 133.18 ? 129 LEU A CA  1 
ATOM   860  C C   . LEU A 1 113 ? -41.691 14.177 -33.859 1.00 131.86 ? 129 LEU A C   1 
ATOM   861  O O   . LEU A 1 113 ? -42.236 13.155 -33.430 1.00 132.79 ? 129 LEU A O   1 
ATOM   862  C CB  . LEU A 1 113 ? -39.423 14.259 -32.841 1.00 130.97 ? 129 LEU A CB  1 
ATOM   863  C CG  . LEU A 1 113 ? -38.825 13.832 -34.192 1.00 136.30 ? 129 LEU A CG  1 
ATOM   864  C CD1 . LEU A 1 113 ? -38.578 15.019 -35.131 1.00 139.47 ? 129 LEU A CD1 1 
ATOM   865  C CD2 . LEU A 1 113 ? -37.561 13.001 -34.006 1.00 139.79 ? 129 LEU A CD2 1 
ATOM   866  N N   . ALA A 1 114 ? -41.863 14.635 -35.097 1.00 135.07 ? 130 ALA A N   1 
ATOM   867  C CA  . ALA A 1 114 ? -42.672 13.907 -36.062 1.00 134.12 ? 130 ALA A CA  1 
ATOM   868  C C   . ALA A 1 114 ? -42.026 12.563 -36.379 1.00 140.41 ? 130 ALA A C   1 
ATOM   869  O O   . ALA A 1 114 ? -40.812 12.386 -36.238 1.00 146.01 ? 130 ALA A O   1 
ATOM   870  C CB  . ALA A 1 114 ? -42.845 14.725 -37.341 1.00 138.99 ? 130 ALA A CB  1 
ATOM   871  N N   . ASP A 1 115 ? -42.849 11.613 -36.816 1.00 141.74 ? 131 ASP A N   1 
ATOM   872  C CA  . ASP A 1 115 ? -42.359 10.340 -37.342 1.00 147.62 ? 131 ASP A CA  1 
ATOM   873  C C   . ASP A 1 115 ? -41.522 9.581  -36.315 1.00 153.29 ? 131 ASP A C   1 
ATOM   874  O O   . ASP A 1 115 ? -41.696 8.379  -36.119 1.00 154.87 ? 131 ASP A O   1 
ATOM   875  C CB  . ASP A 1 115 ? -41.542 10.579 -38.619 1.00 150.35 ? 131 ASP A CB  1 
ATOM   876  C CG  . ASP A 1 115 ? -41.442 9.345  -39.488 1.00 154.10 ? 131 ASP A CG  1 
ATOM   877  O OD1 . ASP A 1 115 ? -40.454 9.225  -40.246 1.00 158.76 ? 131 ASP A OD1 1 
ATOM   878  O OD2 . ASP A 1 115 ? -42.356 8.498  -39.418 1.00 151.33 ? 131 ASP A OD2 1 
ATOM   879  N N   . ASN B 1 4   ? -71.650 32.009 -15.939 1.00 110.18 ? 20  ASN B N   1 
ATOM   880  C CA  . ASN B 1 4   ? -70.794 31.724 -17.077 1.00 112.70 ? 20  ASN B CA  1 
ATOM   881  C C   . ASN B 1 4   ? -70.661 30.229 -17.370 1.00 114.66 ? 20  ASN B C   1 
ATOM   882  O O   . ASN B 1 4   ? -69.734 29.559 -16.914 1.00 119.51 ? 20  ASN B O   1 
ATOM   883  C CB  . ASN B 1 4   ? -69.433 32.428 -16.895 1.00 119.83 ? 20  ASN B CB  1 
ATOM   884  C CG  . ASN B 1 4   ? -68.741 32.094 -15.585 1.00 124.71 ? 20  ASN B CG  1 
ATOM   885  O OD1 . ASN B 1 4   ? -69.042 31.101 -14.924 1.00 125.27 ? 20  ASN B OD1 1 
ATOM   886  N ND2 . ASN B 1 4   ? -67.901 33.028 -15.134 1.00 127.97 ? 20  ASN B ND2 1 
ATOM   887  N N   . THR B 1 5   ? -71.601 29.705 -18.159 1.00 109.15 ? 21  THR B N   1 
ATOM   888  C CA  . THR B 1 5   ? -71.389 28.376 -18.706 1.00 110.78 ? 21  THR B CA  1 
ATOM   889  C C   . THR B 1 5   ? -70.244 28.461 -19.709 1.00 113.25 ? 21  THR B C   1 
ATOM   890  O O   . THR B 1 5   ? -69.745 29.543 -20.036 1.00 113.76 ? 21  THR B O   1 
ATOM   891  C CB  . THR B 1 5   ? -72.669 27.808 -19.336 1.00 107.35 ? 21  THR B CB  1 
ATOM   892  O OG1 . THR B 1 5   ? -73.120 28.644 -20.405 1.00 102.83 ? 21  THR B OG1 1 
ATOM   893  C CG2 . THR B 1 5   ? -73.776 27.702 -18.292 1.00 103.80 ? 21  THR B CG2 1 
ATOM   894  N N   . THR B 1 6   ? -69.817 27.318 -20.216 1.00 109.53 ? 22  THR B N   1 
ATOM   895  C CA  . THR B 1 6   ? -68.603 27.304 -21.010 1.00 112.85 ? 22  THR B CA  1 
ATOM   896  C C   . THR B 1 6   ? -68.923 27.008 -22.464 1.00 109.93 ? 22  THR B C   1 
ATOM   897  O O   . THR B 1 6   ? -69.974 26.459 -22.808 1.00 105.96 ? 22  THR B O   1 
ATOM   898  C CB  . THR B 1 6   ? -67.596 26.283 -20.466 1.00 111.02 ? 22  THR B CB  1 
ATOM   899  O OG1 . THR B 1 6   ? -68.152 24.965 -20.551 1.00 109.97 ? 22  THR B OG1 1 
ATOM   900  C CG2 . THR B 1 6   ? -67.238 26.597 -19.010 1.00 114.15 ? 22  THR B CG2 1 
ATOM   901  N N   . VAL B 1 7   ? -67.988 27.397 -23.313 1.00 108.66 ? 23  VAL B N   1 
ATOM   902  C CA  . VAL B 1 7   ? -68.220 27.509 -24.740 1.00 106.02 ? 23  VAL B CA  1 
ATOM   903  C C   . VAL B 1 7   ? -67.274 26.569 -25.464 1.00 109.11 ? 23  VAL B C   1 
ATOM   904  O O   . VAL B 1 7   ? -66.152 26.309 -25.018 1.00 114.34 ? 23  VAL B O   1 
ATOM   905  C CB  . VAL B 1 7   ? -68.037 28.972 -25.212 1.00 111.01 ? 23  VAL B CB  1 
ATOM   906  C CG1 . VAL B 1 7   ? -66.580 29.414 -25.079 1.00 116.99 ? 23  VAL B CG1 1 
ATOM   907  C CG2 . VAL B 1 7   ? -68.528 29.148 -26.633 1.00 107.11 ? 23  VAL B CG2 1 
ATOM   908  N N   . PHE B 1 8   ? -67.750 26.047 -26.588 1.00 107.90 ? 24  PHE B N   1 
ATOM   909  C CA  . PHE B 1 8   ? -66.993 25.138 -27.434 1.00 109.94 ? 24  PHE B CA  1 
ATOM   910  C C   . PHE B 1 8   ? -67.105 25.669 -28.846 1.00 106.97 ? 24  PHE B C   1 
ATOM   911  O O   . PHE B 1 8   ? -68.204 25.735 -29.402 1.00 102.26 ? 24  PHE B O   1 
ATOM   912  C CB  . PHE B 1 8   ? -67.527 23.709 -27.354 1.00 99.96  ? 24  PHE B CB  1 
ATOM   913  C CG  . PHE B 1 8   ? -67.027 22.946 -26.173 1.00 105.19 ? 24  PHE B CG  1 
ATOM   914  C CD1 . PHE B 1 8   ? -65.839 22.239 -26.250 1.00 111.23 ? 24  PHE B CD1 1 
ATOM   915  C CD2 . PHE B 1 8   ? -67.736 22.934 -24.985 1.00 104.55 ? 24  PHE B CD2 1 
ATOM   916  C CE1 . PHE B 1 8   ? -65.367 21.529 -25.164 1.00 116.79 ? 24  PHE B CE1 1 
ATOM   917  C CE2 . PHE B 1 8   ? -67.269 22.224 -23.896 1.00 110.06 ? 24  PHE B CE2 1 
ATOM   918  C CZ  . PHE B 1 8   ? -66.082 21.522 -23.985 1.00 116.31 ? 24  PHE B CZ  1 
ATOM   919  N N   . GLN B 1 9   ? -65.971 26.025 -29.426 1.00 113.29 ? 25  GLN B N   1 
ATOM   920  C CA  . GLN B 1 9   ? -65.937 26.704 -30.707 1.00 110.00 ? 25  GLN B CA  1 
ATOM   921  C C   . GLN B 1 9   ? -65.499 25.720 -31.781 1.00 109.96 ? 25  GLN B C   1 
ATOM   922  O O   . GLN B 1 9   ? -64.488 25.026 -31.625 1.00 114.13 ? 25  GLN B O   1 
ATOM   923  C CB  . GLN B 1 9   ? -65.009 27.911 -30.604 1.00 118.96 ? 25  GLN B CB  1 
ATOM   924  C CG  . GLN B 1 9   ? -65.477 28.815 -29.475 1.00 120.47 ? 25  GLN B CG  1 
ATOM   925  C CD  . GLN B 1 9   ? -64.639 30.052 -29.288 1.00 120.00 ? 25  GLN B CD  1 
ATOM   926  O OE1 . GLN B 1 9   ? -63.476 30.100 -29.695 1.00 121.95 ? 25  GLN B OE1 1 
ATOM   927  N NE2 . GLN B 1 9   ? -65.219 31.064 -28.646 1.00 118.74 ? 25  GLN B NE2 1 
ATOM   928  N N   . GLY B 1 10  ? -66.270 25.651 -32.849 1.00 113.65 ? 26  GLY B N   1 
ATOM   929  C CA  . GLY B 1 10  ? -65.997 24.719 -33.929 1.00 113.23 ? 26  GLY B CA  1 
ATOM   930  C C   . GLY B 1 10  ? -66.086 25.374 -35.285 1.00 109.98 ? 26  GLY B C   1 
ATOM   931  O O   . GLY B 1 10  ? -66.950 26.222 -35.530 1.00 106.67 ? 26  GLY B O   1 
ATOM   932  N N   . VAL B 1 11  ? -65.166 24.991 -36.161 1.00 110.35 ? 27  VAL B N   1 
ATOM   933  C CA  . VAL B 1 11  ? -65.280 25.292 -37.579 1.00 107.81 ? 27  VAL B CA  1 
ATOM   934  C C   . VAL B 1 11  ? -66.324 24.360 -38.179 1.00 105.49 ? 27  VAL B C   1 
ATOM   935  O O   . VAL B 1 11  ? -66.310 23.150 -37.923 1.00 106.85 ? 27  VAL B O   1 
ATOM   936  C CB  . VAL B 1 11  ? -63.919 25.138 -38.275 1.00 109.65 ? 27  VAL B CB  1 
ATOM   937  C CG1 . VAL B 1 11  ? -64.086 25.125 -39.785 1.00 107.71 ? 27  VAL B CG1 1 
ATOM   938  C CG2 . VAL B 1 11  ? -62.972 26.248 -37.840 1.00 111.39 ? 27  VAL B CG2 1 
ATOM   939  N N   . ALA B 1 12  ? -67.245 24.919 -38.961 1.00 107.50 ? 28  ALA B N   1 
ATOM   940  C CA  . ALA B 1 12  ? -68.254 24.100 -39.618 1.00 102.75 ? 28  ALA B CA  1 
ATOM   941  C C   . ALA B 1 12  ? -67.596 23.130 -40.591 1.00 104.71 ? 28  ALA B C   1 
ATOM   942  O O   . ALA B 1 12  ? -66.514 23.389 -41.125 1.00 109.83 ? 28  ALA B O   1 
ATOM   943  C CB  . ALA B 1 12  ? -69.258 24.974 -40.367 1.00 107.17 ? 28  ALA B CB  1 
ATOM   944  N N   . GLY B 1 13  ? -68.255 21.996 -40.812 1.00 100.20 ? 29  GLY B N   1 
ATOM   945  C CA  . GLY B 1 13  ? -67.676 20.987 -41.663 1.00 101.44 ? 29  GLY B CA  1 
ATOM   946  C C   . GLY B 1 13  ? -66.630 20.137 -40.986 1.00 104.32 ? 29  GLY B C   1 
ATOM   947  O O   . GLY B 1 13  ? -66.043 19.265 -41.640 1.00 105.40 ? 29  GLY B O   1 
ATOM   948  N N   . GLN B 1 14  ? -66.371 20.369 -39.702 1.00 100.19 ? 30  GLN B N   1 
ATOM   949  C CA  . GLN B 1 14  ? -65.344 19.657 -38.964 1.00 103.69 ? 30  GLN B CA  1 
ATOM   950  C C   . GLN B 1 14  ? -65.912 19.236 -37.616 1.00 99.83  ? 30  GLN B C   1 
ATOM   951  O O   . GLN B 1 14  ? -66.852 19.846 -37.103 1.00 96.70  ? 30  GLN B O   1 
ATOM   952  C CB  . GLN B 1 14  ? -64.120 20.560 -38.778 1.00 105.85 ? 30  GLN B CB  1 
ATOM   953  C CG  . GLN B 1 14  ? -62.794 19.862 -38.624 1.00 110.65 ? 30  GLN B CG  1 
ATOM   954  C CD  . GLN B 1 14  ? -61.670 20.853 -38.391 1.00 117.66 ? 30  GLN B CD  1 
ATOM   955  O OE1 . GLN B 1 14  ? -61.209 21.524 -39.321 1.00 120.00 ? 30  GLN B OE1 1 
ATOM   956  N NE2 . GLN B 1 14  ? -61.235 20.964 -37.139 1.00 117.75 ? 30  GLN B NE2 1 
ATOM   957  N N   . SER B 1 15  ? -65.327 18.191 -37.036 1.00 97.73  ? 31  SER B N   1 
ATOM   958  C CA  . SER B 1 15  ? -65.922 17.529 -35.882 1.00 92.66  ? 31  SER B CA  1 
ATOM   959  C C   . SER B 1 15  ? -65.411 18.142 -34.581 1.00 97.15  ? 31  SER B C   1 
ATOM   960  O O   . SER B 1 15  ? -64.268 18.596 -34.489 1.00 104.55 ? 31  SER B O   1 
ATOM   961  C CB  . SER B 1 15  ? -65.636 16.027 -35.913 1.00 102.84 ? 31  SER B CB  1 
ATOM   962  O OG  . SER B 1 15  ? -66.093 15.459 -37.130 1.00 100.46 ? 31  SER B OG  1 
ATOM   963  N N   . LEU B 1 16  ? -66.280 18.154 -33.572 1.00 90.64  ? 32  LEU B N   1 
ATOM   964  C CA  . LEU B 1 16  ? -66.007 18.792 -32.288 1.00 94.20  ? 32  LEU B CA  1 
ATOM   965  C C   . LEU B 1 16  ? -66.316 17.815 -31.163 1.00 89.58  ? 32  LEU B C   1 
ATOM   966  O O   . LEU B 1 16  ? -67.298 17.079 -31.242 1.00 82.21  ? 32  LEU B O   1 
ATOM   967  C CB  . LEU B 1 16  ? -66.841 20.064 -32.130 1.00 89.51  ? 32  LEU B CB  1 
ATOM   968  C CG  . LEU B 1 16  ? -66.751 20.781 -30.790 1.00 91.58  ? 32  LEU B CG  1 
ATOM   969  C CD1 . LEU B 1 16  ? -65.329 21.241 -30.554 1.00 96.81  ? 32  LEU B CD1 1 
ATOM   970  C CD2 . LEU B 1 16  ? -67.701 21.955 -30.758 1.00 89.46  ? 32  LEU B CD2 1 
ATOM   971  N N   . GLN B 1 17  ? -65.485 17.784 -30.120 1.00 88.65  ? 33  GLN B N   1 
ATOM   972  C CA  . GLN B 1 17  ? -65.729 16.894 -28.987 1.00 85.19  ? 33  GLN B CA  1 
ATOM   973  C C   . GLN B 1 17  ? -65.910 17.679 -27.695 1.00 86.78  ? 33  GLN B C   1 
ATOM   974  O O   . GLN B 1 17  ? -65.138 18.600 -27.408 1.00 91.45  ? 33  GLN B O   1 
ATOM   975  C CB  . GLN B 1 17  ? -64.602 15.878 -28.817 1.00 95.66  ? 33  GLN B CB  1 
ATOM   976  C CG  . GLN B 1 17  ? -64.811 14.620 -29.628 1.00 90.71  ? 33  GLN B CG  1 
ATOM   977  C CD  . GLN B 1 17  ? -63.920 13.488 -29.172 1.00 90.89  ? 33  GLN B CD  1 
ATOM   978  O OE1 . GLN B 1 17  ? -63.015 13.678 -28.354 1.00 95.16  ? 33  GLN B OE1 1 
ATOM   979  N NE2 . GLN B 1 17  ? -64.173 12.294 -29.698 1.00 87.53  ? 33  GLN B NE2 1 
ATOM   980  N N   . VAL B 1 18  ? -66.923 17.302 -26.915 1.00 85.52  ? 34  VAL B N   1 
ATOM   981  C CA  . VAL B 1 18  ? -67.171 17.872 -25.596 1.00 86.19  ? 34  VAL B CA  1 
ATOM   982  C C   . VAL B 1 18  ? -67.087 16.763 -24.553 1.00 84.59  ? 34  VAL B C   1 
ATOM   983  O O   . VAL B 1 18  ? -67.499 15.624 -24.806 1.00 79.63  ? 34  VAL B O   1 
ATOM   984  C CB  . VAL B 1 18  ? -68.533 18.592 -25.529 1.00 91.41  ? 34  VAL B CB  1 
ATOM   985  C CG1 . VAL B 1 18  ? -68.485 19.866 -26.341 1.00 94.06  ? 34  VAL B CG1 1 
ATOM   986  C CG2 . VAL B 1 18  ? -69.612 17.700 -26.051 1.00 83.38  ? 34  VAL B CG2 1 
ATOM   987  N N   . SER B 1 19  ? -66.536 17.104 -23.387 1.00 79.05  ? 35  SER B N   1 
ATOM   988  C CA  . SER B 1 19  ? -66.283 16.165 -22.303 1.00 78.63  ? 35  SER B CA  1 
ATOM   989  C C   . SER B 1 19  ? -67.039 16.625 -21.061 1.00 76.94  ? 35  SER B C   1 
ATOM   990  O O   . SER B 1 19  ? -66.828 17.747 -20.586 1.00 78.30  ? 35  SER B O   1 
ATOM   991  C CB  . SER B 1 19  ? -64.782 16.070 -22.031 1.00 81.63  ? 35  SER B CB  1 
ATOM   992  O OG  . SER B 1 19  ? -64.504 15.268 -20.899 1.00 80.04  ? 35  SER B OG  1 
ATOM   993  N N   . CYS B 1 20  ? -67.919 15.763 -20.544 1.00 74.00  ? 36  CYS B N   1 
ATOM   994  C CA  . CYS B 1 20  ? -68.626 15.998 -19.287 1.00 72.27  ? 36  CYS B CA  1 
ATOM   995  C C   . CYS B 1 20  ? -68.028 15.117 -18.195 1.00 73.79  ? 36  CYS B C   1 
ATOM   996  O O   . CYS B 1 20  ? -68.256 13.898 -18.187 1.00 71.47  ? 36  CYS B O   1 
ATOM   997  C CB  . CYS B 1 20  ? -70.133 15.736 -19.457 1.00 82.96  ? 36  CYS B CB  1 
ATOM   998  S SG  . CYS B 1 20  ? -70.817 17.010 -20.544 1.00 80.53  ? 36  CYS B SG  1 
ATOM   999  N N   . PRO B 1 21  ? -67.249 15.672 -17.276 1.00 68.69  ? 37  PRO B N   1 
ATOM   1000 C CA  . PRO B 1 21  ? -66.743 14.881 -16.158 1.00 69.65  ? 37  PRO B CA  1 
ATOM   1001 C C   . PRO B 1 21  ? -67.826 14.713 -15.108 1.00 67.74  ? 37  PRO B C   1 
ATOM   1002 O O   . PRO B 1 21  ? -68.742 15.528 -14.991 1.00 66.65  ? 37  PRO B O   1 
ATOM   1003 C CB  . PRO B 1 21  ? -65.584 15.729 -15.616 1.00 69.21  ? 37  PRO B CB  1 
ATOM   1004 C CG  . PRO B 1 21  ? -65.364 16.815 -16.638 1.00 70.13  ? 37  PRO B CG  1 
ATOM   1005 C CD  . PRO B 1 21  ? -66.691 17.026 -17.270 1.00 66.98  ? 37  PRO B CD  1 
ATOM   1006 N N   . TYR B 1 22  ? -67.713 13.637 -14.334 1.00 68.20  ? 38  TYR B N   1 
ATOM   1007 C CA  . TYR B 1 22  ? -68.672 13.435 -13.259 1.00 67.09  ? 38  TYR B CA  1 
ATOM   1008 C C   . TYR B 1 22  ? -68.124 12.454 -12.235 1.00 68.02  ? 38  TYR B C   1 
ATOM   1009 O O   . TYR B 1 22  ? -67.121 11.772 -12.457 1.00 69.26  ? 38  TYR B O   1 
ATOM   1010 C CB  . TYR B 1 22  ? -70.020 12.970 -13.816 1.00 69.67  ? 38  TYR B CB  1 
ATOM   1011 C CG  . TYR B 1 22  ? -70.004 11.644 -14.539 1.00 68.47  ? 38  TYR B CG  1 
ATOM   1012 C CD1 . TYR B 1 22  ? -70.414 10.486 -13.903 1.00 67.96  ? 38  TYR B CD1 1 
ATOM   1013 C CD2 . TYR B 1 22  ? -69.606 11.556 -15.865 1.00 68.01  ? 38  TYR B CD2 1 
ATOM   1014 C CE1 . TYR B 1 22  ? -70.409 9.271  -14.559 1.00 67.06  ? 38  TYR B CE1 1 
ATOM   1015 C CE2 . TYR B 1 22  ? -69.605 10.345 -16.532 1.00 67.00  ? 38  TYR B CE2 1 
ATOM   1016 C CZ  . TYR B 1 22  ? -70.003 9.208  -15.872 1.00 66.56  ? 38  TYR B CZ  1 
ATOM   1017 O OH  . TYR B 1 22  ? -70.007 8.004  -16.533 1.00 66.00  ? 38  TYR B OH  1 
ATOM   1018 N N   . ASP B 1 23  ? -68.801 12.409 -11.093 1.00 68.93  ? 39  ASP B N   1 
ATOM   1019 C CA  . ASP B 1 23  ? -68.461 11.479 -10.025 1.00 69.68  ? 39  ASP B CA  1 
ATOM   1020 C C   . ASP B 1 23  ? -69.001 10.109 -10.405 1.00 68.30  ? 39  ASP B C   1 
ATOM   1021 O O   . ASP B 1 23  ? -70.216 9.883  -10.371 1.00 67.11  ? 39  ASP B O   1 
ATOM   1022 C CB  . ASP B 1 23  ? -69.038 11.964 -8.700  1.00 68.63  ? 39  ASP B CB  1 
ATOM   1023 C CG  . ASP B 1 23  ? -68.447 11.255 -7.508  1.00 69.82  ? 39  ASP B CG  1 
ATOM   1024 O OD1 . ASP B 1 23  ? -68.202 10.032 -7.587  1.00 69.62  ? 39  ASP B OD1 1 
ATOM   1025 O OD2 . ASP B 1 23  ? -68.225 11.934 -6.485  1.00 71.02  ? 39  ASP B OD2 1 
ATOM   1026 N N   . SER B 1 24  ? -68.102 9.207  -10.802 1.00 69.93  ? 40  SER B N   1 
ATOM   1027 C CA  . SER B 1 24  ? -68.520 7.888  -11.260 1.00 68.63  ? 40  SER B CA  1 
ATOM   1028 C C   . SER B 1 24  ? -69.310 7.129  -10.200 1.00 68.41  ? 40  SER B C   1 
ATOM   1029 O O   . SER B 1 24  ? -70.160 6.298  -10.541 1.00 67.35  ? 40  SER B O   1 
ATOM   1030 C CB  . SER B 1 24  ? -67.298 7.095  -11.707 1.00 65.37  ? 40  SER B CB  1 
ATOM   1031 O OG  . SER B 1 24  ? -66.402 6.889  -10.629 1.00 67.69  ? 40  SER B OG  1 
ATOM   1032 N N   . MET B 1 25  ? -69.059 7.400  -8.918  1.00 70.66  ? 41  MET B N   1 
ATOM   1033 C CA  . MET B 1 25  ? -69.764 6.696  -7.853  1.00 70.85  ? 41  MET B CA  1 
ATOM   1034 C C   . MET B 1 25  ? -71.107 7.337  -7.522  1.00 70.70  ? 41  MET B C   1 
ATOM   1035 O O   . MET B 1 25  ? -72.070 6.630  -7.206  1.00 70.85  ? 41  MET B O   1 
ATOM   1036 C CB  . MET B 1 25  ? -68.896 6.630  -6.596  1.00 77.32  ? 41  MET B CB  1 
ATOM   1037 C CG  . MET B 1 25  ? -69.439 5.680  -5.560  1.00 77.71  ? 41  MET B CG  1 
ATOM   1038 S SD  . MET B 1 25  ? -68.611 5.828  -3.971  1.00 79.57  ? 41  MET B SD  1 
ATOM   1039 C CE  . MET B 1 25  ? -69.546 4.663  -2.971  1.00 79.82  ? 41  MET B CE  1 
ATOM   1040 N N   . LYS B 1 26  ? -71.184 8.668  -7.580  1.00 70.26  ? 42  LYS B N   1 
ATOM   1041 C CA  . LYS B 1 26  ? -72.464 9.352  -7.428  1.00 70.45  ? 42  LYS B CA  1 
ATOM   1042 C C   . LYS B 1 26  ? -73.478 8.837  -8.440  1.00 69.48  ? 42  LYS B C   1 
ATOM   1043 O O   . LYS B 1 26  ? -74.607 8.474  -8.086  1.00 70.39  ? 42  LYS B O   1 
ATOM   1044 C CB  . LYS B 1 26  ? -72.258 10.857 -7.595  1.00 68.03  ? 42  LYS B CB  1 
ATOM   1045 C CG  . LYS B 1 26  ? -73.477 11.726 -7.325  1.00 68.74  ? 42  LYS B CG  1 
ATOM   1046 C CD  . LYS B 1 26  ? -73.048 13.180 -7.207  1.00 69.37  ? 42  LYS B CD  1 
ATOM   1047 C CE  . LYS B 1 26  ? -74.218 14.130 -7.100  1.00 71.15  ? 42  LYS B CE  1 
ATOM   1048 N NZ  . LYS B 1 26  ? -73.733 15.529 -6.942  1.00 73.01  ? 42  LYS B NZ  1 
ATOM   1049 N N   . HIS B 1 27  ? -73.076 8.781  -9.708  1.00 71.08  ? 43  HIS B N   1 
ATOM   1050 C CA  . HIS B 1 27  ? -73.950 8.400  -10.805 1.00 70.09  ? 43  HIS B CA  1 
ATOM   1051 C C   . HIS B 1 27  ? -73.765 6.945  -11.204 1.00 69.72  ? 43  HIS B C   1 
ATOM   1052 O O   . HIS B 1 27  ? -74.021 6.586  -12.358 1.00 68.90  ? 43  HIS B O   1 
ATOM   1053 C CB  . HIS B 1 27  ? -73.714 9.325  -11.997 1.00 70.35  ? 43  HIS B CB  1 
ATOM   1054 C CG  . HIS B 1 27  ? -73.873 10.775 -11.663 1.00 70.87  ? 43  HIS B CG  1 
ATOM   1055 N ND1 . HIS B 1 27  ? -75.106 11.378 -11.533 1.00 71.44  ? 43  HIS B ND1 1 
ATOM   1056 C CD2 . HIS B 1 27  ? -72.955 11.736 -11.407 1.00 71.46  ? 43  HIS B CD2 1 
ATOM   1057 C CE1 . HIS B 1 27  ? -74.941 12.653 -11.226 1.00 72.01  ? 43  HIS B CE1 1 
ATOM   1058 N NE2 . HIS B 1 27  ? -73.645 12.895 -11.140 1.00 72.07  ? 43  HIS B NE2 1 
ATOM   1059 N N   . TRP B 1 28  ? -73.301 6.110  -10.277 1.00 66.64  ? 44  TRP B N   1 
ATOM   1060 C CA  . TRP B 1 28  ? -73.097 4.705  -10.582 1.00 66.54  ? 44  TRP B CA  1 
ATOM   1061 C C   . TRP B 1 28  ? -74.403 4.076  -11.041 1.00 67.16  ? 44  TRP B C   1 
ATOM   1062 O O   . TRP B 1 28  ? -75.461 4.287  -10.443 1.00 68.55  ? 44  TRP B O   1 
ATOM   1063 C CB  . TRP B 1 28  ? -72.558 3.975  -9.359  1.00 64.05  ? 44  TRP B CB  1 
ATOM   1064 C CG  . TRP B 1 28  ? -72.246 2.552  -9.609  1.00 64.68  ? 44  TRP B CG  1 
ATOM   1065 C CD1 . TRP B 1 28  ? -73.085 1.490  -9.458  1.00 65.71  ? 44  TRP B CD1 1 
ATOM   1066 C CD2 . TRP B 1 28  ? -71.002 2.023  -10.068 1.00 64.99  ? 44  TRP B CD2 1 
ATOM   1067 N NE1 . TRP B 1 28  ? -72.435 0.328  -9.786  1.00 66.52  ? 44  TRP B NE1 1 
ATOM   1068 C CE2 . TRP B 1 28  ? -71.153 0.628  -10.164 1.00 66.18  ? 44  TRP B CE2 1 
ATOM   1069 C CE3 . TRP B 1 28  ? -69.771 2.593  -10.404 1.00 64.95  ? 44  TRP B CE3 1 
ATOM   1070 C CZ2 . TRP B 1 28  ? -70.121 -0.207 -10.584 1.00 67.37  ? 44  TRP B CZ2 1 
ATOM   1071 C CZ3 . TRP B 1 28  ? -68.746 1.762  -10.822 1.00 66.24  ? 44  TRP B CZ3 1 
ATOM   1072 C CH2 . TRP B 1 28  ? -68.928 0.379  -10.909 1.00 67.45  ? 44  TRP B CH2 1 
ATOM   1073 N N   . GLY B 1 29  ? -74.318 3.298  -12.114 1.00 67.64  ? 45  GLY B N   1 
ATOM   1074 C CA  . GLY B 1 29  ? -75.472 2.631  -12.669 1.00 68.89  ? 45  GLY B CA  1 
ATOM   1075 C C   . GLY B 1 29  ? -76.423 3.519  -13.440 1.00 69.09  ? 45  GLY B C   1 
ATOM   1076 O O   . GLY B 1 29  ? -77.447 3.022  -13.921 1.00 70.79  ? 45  GLY B O   1 
ATOM   1077 N N   . ARG B 1 30  ? -76.125 4.809  -13.580 1.00 74.87  ? 46  ARG B N   1 
ATOM   1078 C CA  . ARG B 1 30  ? -77.028 5.759  -14.216 1.00 74.93  ? 46  ARG B CA  1 
ATOM   1079 C C   . ARG B 1 30  ? -76.603 5.968  -15.664 1.00 72.72  ? 46  ARG B C   1 
ATOM   1080 O O   . ARG B 1 30  ? -75.433 6.256  -15.937 1.00 70.56  ? 46  ARG B O   1 
ATOM   1081 C CB  . ARG B 1 30  ? -77.028 7.100  -13.479 1.00 80.61  ? 46  ARG B CB  1 
ATOM   1082 C CG  . ARG B 1 30  ? -78.042 7.237  -12.350 1.00 83.48  ? 46  ARG B CG  1 
ATOM   1083 C CD  . ARG B 1 30  ? -77.801 8.551  -11.610 1.00 82.54  ? 46  ARG B CD  1 
ATOM   1084 N NE  . ARG B 1 30  ? -78.934 9.010  -10.803 1.00 85.00  ? 46  ARG B NE  1 
ATOM   1085 C CZ  . ARG B 1 30  ? -79.216 8.580  -9.574  1.00 87.09  ? 46  ARG B CZ  1 
ATOM   1086 N NH1 . ARG B 1 30  ? -78.460 7.654  -9.000  1.00 86.99  ? 46  ARG B NH1 1 
ATOM   1087 N NH2 . ARG B 1 30  ? -80.265 9.071  -8.924  1.00 89.26  ? 46  ARG B NH2 1 
ATOM   1088 N N   . ARG B 1 31  ? -77.555 5.832  -16.581 1.00 77.78  ? 47  ARG B N   1 
ATOM   1089 C CA  . ARG B 1 31  ? -77.313 6.151  -17.978 1.00 75.97  ? 47  ARG B CA  1 
ATOM   1090 C C   . ARG B 1 31  ? -77.218 7.664  -18.177 1.00 74.04  ? 47  ARG B C   1 
ATOM   1091 O O   . ARG B 1 31  ? -77.619 8.461  -17.323 1.00 74.59  ? 47  ARG B O   1 
ATOM   1092 C CB  . ARG B 1 31  ? -78.418 5.574  -18.857 1.00 76.08  ? 47  ARG B CB  1 
ATOM   1093 C CG  . ARG B 1 31  ? -78.441 4.060  -18.927 1.00 77.79  ? 47  ARG B CG  1 
ATOM   1094 C CD  . ARG B 1 31  ? -79.592 3.629  -19.800 1.00 79.87  ? 47  ARG B CD  1 
ATOM   1095 N NE  . ARG B 1 31  ? -79.827 4.627  -20.838 1.00 78.58  ? 47  ARG B NE  1 
ATOM   1096 C CZ  . ARG B 1 31  ? -80.844 4.604  -21.691 1.00 80.34  ? 47  ARG B CZ  1 
ATOM   1097 N NH1 . ARG B 1 31  ? -81.737 3.627  -21.630 1.00 83.55  ? 47  ARG B NH1 1 
ATOM   1098 N NH2 . ARG B 1 31  ? -80.971 5.562  -22.601 1.00 79.90  ? 47  ARG B NH2 1 
ATOM   1099 N N   . LYS B 1 32  ? -76.679 8.057  -19.327 1.00 77.44  ? 48  LYS B N   1 
ATOM   1100 C CA  . LYS B 1 32  ? -76.485 9.461  -19.647 1.00 74.76  ? 48  LYS B CA  1 
ATOM   1101 C C   . LYS B 1 32  ? -77.157 9.805  -20.967 1.00 74.82  ? 48  LYS B C   1 
ATOM   1102 O O   . LYS B 1 32  ? -77.447 8.937  -21.794 1.00 74.74  ? 48  LYS B O   1 
ATOM   1103 C CB  . LYS B 1 32  ? -75.004 9.831  -19.732 1.00 74.46  ? 48  LYS B CB  1 
ATOM   1104 C CG  . LYS B 1 32  ? -74.146 9.160  -18.697 1.00 72.69  ? 48  LYS B CG  1 
ATOM   1105 C CD  . LYS B 1 32  ? -74.358 9.787  -17.345 1.00 75.54  ? 48  LYS B CD  1 
ATOM   1106 C CE  . LYS B 1 32  ? -73.276 9.352  -16.395 1.00 70.08  ? 48  LYS B CE  1 
ATOM   1107 N NZ  . LYS B 1 32  ? -73.301 7.885  -16.141 1.00 69.53  ? 48  LYS B NZ  1 
ATOM   1108 N N   . ALA B 1 33  ? -77.412 11.097 -21.137 1.00 76.92  ? 49  ALA B N   1 
ATOM   1109 C CA  . ALA B 1 33  ? -78.102 11.613 -22.304 1.00 77.66  ? 49  ALA B CA  1 
ATOM   1110 C C   . ALA B 1 33  ? -77.535 12.982 -22.638 1.00 74.91  ? 49  ALA B C   1 
ATOM   1111 O O   . ALA B 1 33  ? -77.034 13.694 -21.768 1.00 75.15  ? 49  ALA B O   1 
ATOM   1112 C CB  . ALA B 1 33  ? -79.612 11.706 -22.071 1.00 77.33  ? 49  ALA B CB  1 
ATOM   1113 N N   . TRP B 1 34  ? -77.601 13.330 -23.912 1.00 77.03  ? 50  TRP B N   1 
ATOM   1114 C CA  . TRP B 1 34  ? -77.212 14.638 -24.411 1.00 75.65  ? 50  TRP B CA  1 
ATOM   1115 C C   . TRP B 1 34  ? -78.452 15.220 -25.068 1.00 80.21  ? 50  TRP B C   1 
ATOM   1116 O O   . TRP B 1 34  ? -79.025 14.594 -25.977 1.00 80.77  ? 50  TRP B O   1 
ATOM   1117 C CB  . TRP B 1 34  ? -76.042 14.497 -25.391 1.00 82.85  ? 50  TRP B CB  1 
ATOM   1118 C CG  . TRP B 1 34  ? -75.720 15.661 -26.288 1.00 80.22  ? 50  TRP B CG  1 
ATOM   1119 C CD1 . TRP B 1 34  ? -76.193 15.877 -27.552 1.00 79.66  ? 50  TRP B CD1 1 
ATOM   1120 C CD2 . TRP B 1 34  ? -74.801 16.731 -26.018 1.00 77.65  ? 50  TRP B CD2 1 
ATOM   1121 N NE1 . TRP B 1 34  ? -75.648 17.025 -28.073 1.00 79.59  ? 50  TRP B NE1 1 
ATOM   1122 C CE2 . TRP B 1 34  ? -74.789 17.567 -27.154 1.00 77.86  ? 50  TRP B CE2 1 
ATOM   1123 C CE3 . TRP B 1 34  ? -74.002 17.072 -24.921 1.00 77.23  ? 50  TRP B CE3 1 
ATOM   1124 C CZ2 . TRP B 1 34  ? -74.003 18.718 -27.228 1.00 79.06  ? 50  TRP B CZ2 1 
ATOM   1125 C CZ3 . TRP B 1 34  ? -73.223 18.217 -24.994 1.00 75.71  ? 50  TRP B CZ3 1 
ATOM   1126 C CH2 . TRP B 1 34  ? -73.232 19.028 -26.139 1.00 77.63  ? 50  TRP B CH2 1 
ATOM   1127 N N   . CYS B 1 35  ? -78.875 16.398 -24.595 1.00 80.93  ? 51  CYS B N   1 
ATOM   1128 C CA  . CYS B 1 35  ? -80.103 17.023 -25.084 1.00 85.59  ? 51  CYS B CA  1 
ATOM   1129 C C   . CYS B 1 35  ? -79.863 18.512 -25.269 1.00 86.67  ? 51  CYS B C   1 
ATOM   1130 O O   . CYS B 1 35  ? -78.881 19.069 -24.777 1.00 85.07  ? 51  CYS B O   1 
ATOM   1131 C CB  . CYS B 1 35  ? -81.323 16.792 -24.154 1.00 93.62  ? 51  CYS B CB  1 
ATOM   1132 S SG  . CYS B 1 35  ? -81.175 17.480 -22.465 1.00 99.81  ? 51  CYS B SG  1 
ATOM   1133 N N   . ARG B 1 36  ? -80.778 19.157 -25.989 1.00 90.10  ? 52  ARG B N   1 
ATOM   1134 C CA  . ARG B 1 36  ? -80.667 20.575 -26.295 1.00 93.28  ? 52  ARG B CA  1 
ATOM   1135 C C   . ARG B 1 36  ? -81.713 21.351 -25.511 1.00 97.52  ? 52  ARG B C   1 
ATOM   1136 O O   . ARG B 1 36  ? -82.873 20.935 -25.417 1.00 99.88  ? 52  ARG B O   1 
ATOM   1137 C CB  . ARG B 1 36  ? -80.888 20.857 -27.783 1.00 96.10  ? 52  ARG B CB  1 
ATOM   1138 C CG  . ARG B 1 36  ? -80.479 22.270 -28.206 1.00 98.97  ? 52  ARG B CG  1 
ATOM   1139 C CD  . ARG B 1 36  ? -81.107 22.696 -29.535 1.00 103.54 ? 52  ARG B CD  1 
ATOM   1140 N NE  . ARG B 1 36  ? -80.684 21.892 -30.678 1.00 102.41 ? 52  ARG B NE  1 
ATOM   1141 C CZ  . ARG B 1 36  ? -79.863 22.330 -31.625 1.00 103.15 ? 52  ARG B CZ  1 
ATOM   1142 N NH1 . ARG B 1 36  ? -79.368 23.558 -31.556 1.00 104.82 ? 52  ARG B NH1 1 
ATOM   1143 N NH2 . ARG B 1 36  ? -79.531 21.541 -32.636 1.00 102.83 ? 52  ARG B NH2 1 
ATOM   1144 N N   . GLN B 1 37  ? -81.308 22.504 -24.994 1.00 99.24  ? 53  GLN B N   1 
ATOM   1145 C CA  . GLN B 1 37  ? -82.160 23.322 -24.150 1.00 103.82 ? 53  GLN B CA  1 
ATOM   1146 C C   . GLN B 1 37  ? -82.596 24.550 -24.933 1.00 109.03 ? 53  GLN B C   1 
ATOM   1147 O O   . GLN B 1 37  ? -81.791 25.170 -25.634 1.00 108.94 ? 53  GLN B O   1 
ATOM   1148 C CB  . GLN B 1 37  ? -81.424 23.733 -22.876 1.00 103.14 ? 53  GLN B CB  1 
ATOM   1149 C CG  . GLN B 1 37  ? -82.315 24.253 -21.769 1.00 107.78 ? 53  GLN B CG  1 
ATOM   1150 C CD  . GLN B 1 37  ? -81.515 24.681 -20.559 1.00 107.95 ? 53  GLN B CD  1 
ATOM   1151 O OE1 . GLN B 1 37  ? -80.421 24.168 -20.315 1.00 103.54 ? 53  GLN B OE1 1 
ATOM   1152 N NE2 . GLN B 1 37  ? -82.045 25.638 -19.802 1.00 113.71 ? 53  GLN B NE2 1 
ATOM   1153 N N   . LEU B 1 38  ? -83.869 24.908 -24.800 1.00 114.05 ? 54  LEU B N   1 
ATOM   1154 C CA  . LEU B 1 38  ? -84.422 26.004 -25.579 1.00 119.60 ? 54  LEU B CA  1 
ATOM   1155 C C   . LEU B 1 38  ? -85.103 27.062 -24.717 1.00 125.41 ? 54  LEU B C   1 
ATOM   1156 O O   . LEU B 1 38  ? -85.760 27.958 -25.264 1.00 130.94 ? 54  LEU B O   1 
ATOM   1157 C CB  . LEU B 1 38  ? -85.401 25.470 -26.637 1.00 121.65 ? 54  LEU B CB  1 
ATOM   1158 C CG  . LEU B 1 38  ? -85.001 24.573 -27.826 1.00 118.51 ? 54  LEU B CG  1 
ATOM   1159 C CD1 . LEU B 1 38  ? -84.244 23.309 -27.464 1.00 112.06 ? 54  LEU B CD1 1 
ATOM   1160 C CD2 . LEU B 1 38  ? -86.256 24.181 -28.572 1.00 122.73 ? 54  LEU B CD2 1 
ATOM   1161 N N   . GLY B 1 39  ? -84.973 26.988 -23.401 1.00 124.94 ? 55  GLY B N   1 
ATOM   1162 C CA  . GLY B 1 39  ? -85.651 27.914 -22.517 1.00 131.17 ? 55  GLY B CA  1 
ATOM   1163 C C   . GLY B 1 39  ? -85.020 27.974 -21.139 1.00 130.41 ? 55  GLY B C   1 
ATOM   1164 O O   . GLY B 1 39  ? -83.864 27.589 -20.946 1.00 125.38 ? 55  GLY B O   1 
ATOM   1165 N N   . GLU B 1 40  ? -85.806 28.448 -20.169 1.00 136.10 ? 56  GLU B N   1 
ATOM   1166 C CA  . GLU B 1 40  ? -85.322 28.691 -18.814 1.00 137.47 ? 56  GLU B CA  1 
ATOM   1167 C C   . GLU B 1 40  ? -85.107 27.386 -18.047 1.00 132.49 ? 56  GLU B C   1 
ATOM   1168 O O   . GLU B 1 40  ? -83.975 26.891 -17.976 1.00 127.46 ? 56  GLU B O   1 
ATOM   1169 C CB  . GLU B 1 40  ? -86.290 29.638 -18.084 1.00 146.26 ? 56  GLU B CB  1 
ATOM   1170 C CG  . GLU B 1 40  ? -86.198 29.713 -16.554 1.00 149.48 ? 56  GLU B CG  1 
ATOM   1171 C CD  . GLU B 1 40  ? -84.797 29.980 -16.023 1.00 147.40 ? 56  GLU B CD  1 
ATOM   1172 O OE1 . GLU B 1 40  ? -83.912 30.417 -16.795 1.00 145.00 ? 56  GLU B OE1 1 
ATOM   1173 O OE2 . GLU B 1 40  ? -84.586 29.753 -14.811 1.00 148.79 ? 56  GLU B OE2 1 
ATOM   1174 N N   . LYS B 1 41  ? -86.171 26.825 -17.462 1.00 138.34 ? 57  LYS B N   1 
ATOM   1175 C CA  . LYS B 1 41  ? -86.066 25.516 -16.829 1.00 137.14 ? 57  LYS B CA  1 
ATOM   1176 C C   . LYS B 1 41  ? -86.160 24.395 -17.844 1.00 134.92 ? 57  LYS B C   1 
ATOM   1177 O O   . LYS B 1 41  ? -85.640 23.298 -17.605 1.00 133.01 ? 57  LYS B O   1 
ATOM   1178 C CB  . LYS B 1 41  ? -87.164 25.337 -15.779 1.00 141.04 ? 57  LYS B CB  1 
ATOM   1179 C CG  . LYS B 1 41  ? -87.056 26.275 -14.596 1.00 144.07 ? 57  LYS B CG  1 
ATOM   1180 C CD  . LYS B 1 41  ? -85.972 25.819 -13.636 1.00 142.07 ? 57  LYS B CD  1 
ATOM   1181 C CE  . LYS B 1 41  ? -85.263 27.009 -13.016 1.00 143.59 ? 57  LYS B CE  1 
ATOM   1182 N NZ  . LYS B 1 41  ? -86.210 28.103 -12.669 1.00 152.51 ? 57  LYS B NZ  1 
ATOM   1183 N N   . GLY B 1 42  ? -86.818 24.658 -18.961 1.00 130.61 ? 58  GLY B N   1 
ATOM   1184 C CA  . GLY B 1 42  ? -86.971 23.692 -20.017 1.00 128.00 ? 58  GLY B CA  1 
ATOM   1185 C C   . GLY B 1 42  ? -87.632 24.356 -21.203 1.00 129.39 ? 58  GLY B C   1 
ATOM   1186 O O   . GLY B 1 42  ? -87.904 25.560 -21.181 1.00 132.41 ? 58  GLY B O   1 
ATOM   1187 N N   . PRO B 1 43  ? -87.938 23.556 -22.230 1.00 124.71 ? 59  PRO B N   1 
ATOM   1188 C CA  . PRO B 1 43  ? -87.654 22.116 -22.178 1.00 121.21 ? 59  PRO B CA  1 
ATOM   1189 C C   . PRO B 1 43  ? -86.275 21.728 -22.691 1.00 115.39 ? 59  PRO B C   1 
ATOM   1190 O O   . PRO B 1 43  ? -85.642 22.519 -23.388 1.00 113.44 ? 59  PRO B O   1 
ATOM   1191 C CB  . PRO B 1 43  ? -88.731 21.541 -23.084 1.00 122.20 ? 59  PRO B CB  1 
ATOM   1192 C CG  . PRO B 1 43  ? -88.898 22.613 -24.145 1.00 125.88 ? 59  PRO B CG  1 
ATOM   1193 C CD  . PRO B 1 43  ? -88.673 23.938 -23.449 1.00 128.63 ? 59  PRO B CD  1 
ATOM   1194 N N   . CYS B 1 44  ? -85.798 20.538 -22.334 1.00 109.10 ? 60  CYS B N   1 
ATOM   1195 C CA  . CYS B 1 44  ? -84.565 20.012 -22.903 1.00 104.09 ? 60  CYS B CA  1 
ATOM   1196 C C   . CYS B 1 44  ? -84.978 18.747 -23.624 1.00 103.05 ? 60  CYS B C   1 
ATOM   1197 O O   . CYS B 1 44  ? -85.661 17.903 -23.039 1.00 105.22 ? 60  CYS B O   1 
ATOM   1198 C CB  . CYS B 1 44  ? -83.496 19.723 -21.842 1.00 104.43 ? 60  CYS B CB  1 
ATOM   1199 S SG  . CYS B 1 44  ? -81.799 19.469 -22.509 1.00 99.45  ? 60  CYS B SG  1 
ATOM   1200 N N   . GLN B 1 45  ? -84.652 18.651 -24.905 1.00 100.52 ? 61  GLN B N   1 
ATOM   1201 C CA  . GLN B 1 45  ? -85.222 17.599 -25.730 1.00 101.13 ? 61  GLN B CA  1 
ATOM   1202 C C   . GLN B 1 45  ? -84.108 16.725 -26.279 1.00 96.28  ? 61  GLN B C   1 
ATOM   1203 O O   . GLN B 1 45  ? -83.069 17.212 -26.743 1.00 94.11  ? 61  GLN B O   1 
ATOM   1204 C CB  . GLN B 1 45  ? -86.148 18.160 -26.809 1.00 107.24 ? 61  GLN B CB  1 
ATOM   1205 C CG  . GLN B 1 45  ? -87.299 18.884 -26.116 1.00 112.81 ? 61  GLN B CG  1 
ATOM   1206 C CD  . GLN B 1 45  ? -88.478 19.143 -27.001 1.00 118.32 ? 61  GLN B CD  1 
ATOM   1207 O OE1 . GLN B 1 45  ? -88.449 18.835 -28.188 1.00 119.29 ? 61  GLN B OE1 1 
ATOM   1208 N NE2 . GLN B 1 45  ? -89.552 19.681 -26.419 1.00 123.41 ? 61  GLN B NE2 1 
ATOM   1209 N N   . ARG B 1 46  ? -84.351 15.425 -26.181 1.00 95.14  ? 62  ARG B N   1 
ATOM   1210 C CA  . ARG B 1 46  ? -83.310 14.415 -26.260 1.00 90.35  ? 62  ARG B CA  1 
ATOM   1211 C C   . ARG B 1 46  ? -82.681 14.364 -27.640 1.00 90.31  ? 62  ARG B C   1 
ATOM   1212 O O   . ARG B 1 46  ? -83.383 14.241 -28.648 1.00 94.41  ? 62  ARG B O   1 
ATOM   1213 C CB  . ARG B 1 46  ? -83.919 13.060 -25.906 1.00 90.58  ? 62  ARG B CB  1 
ATOM   1214 C CG  . ARG B 1 46  ? -82.948 11.935 -25.735 1.00 86.03  ? 62  ARG B CG  1 
ATOM   1215 C CD  . ARG B 1 46  ? -82.100 12.129 -24.506 1.00 81.84  ? 62  ARG B CD  1 
ATOM   1216 N NE  . ARG B 1 46  ? -82.872 12.014 -23.273 1.00 83.24  ? 62  ARG B NE  1 
ATOM   1217 C CZ  . ARG B 1 46  ? -83.168 10.860 -22.684 1.00 83.84  ? 62  ARG B CZ  1 
ATOM   1218 N NH1 . ARG B 1 46  ? -82.765 9.717  -23.222 1.00 80.99  ? 62  ARG B NH1 1 
ATOM   1219 N NH2 . ARG B 1 46  ? -83.869 10.846 -21.559 1.00 87.82  ? 62  ARG B NH2 1 
ATOM   1220 N N   . VAL B 1 47  ? -81.354 14.478 -27.683 1.00 87.41  ? 63  VAL B N   1 
ATOM   1221 C CA  . VAL B 1 47  ? -80.604 14.229 -28.908 1.00 86.13  ? 63  VAL B CA  1 
ATOM   1222 C C   . VAL B 1 47  ? -80.230 12.753 -28.961 1.00 83.89  ? 63  VAL B C   1 
ATOM   1223 O O   . VAL B 1 47  ? -80.555 12.061 -29.934 1.00 86.64  ? 63  VAL B O   1 
ATOM   1224 C CB  . VAL B 1 47  ? -79.343 15.107 -28.996 1.00 84.83  ? 63  VAL B CB  1 
ATOM   1225 C CG1 . VAL B 1 47  ? -78.512 14.731 -30.221 1.00 83.90  ? 63  VAL B CG1 1 
ATOM   1226 C CG2 . VAL B 1 47  ? -79.723 16.582 -29.002 1.00 87.35  ? 63  VAL B CG2 1 
ATOM   1227 N N   . VAL B 1 48  ? -79.564 12.251 -27.925 1.00 83.48  ? 64  VAL B N   1 
ATOM   1228 C CA  . VAL B 1 48  ? -79.120 10.854 -27.944 1.00 81.75  ? 64  VAL B CA  1 
ATOM   1229 C C   . VAL B 1 48  ? -78.763 10.452 -26.526 1.00 80.86  ? 64  VAL B C   1 
ATOM   1230 O O   . VAL B 1 48  ? -78.397 11.292 -25.707 1.00 80.74  ? 64  VAL B O   1 
ATOM   1231 C CB  . VAL B 1 48  ? -77.932 10.654 -28.923 1.00 85.13  ? 64  VAL B CB  1 
ATOM   1232 C CG1 . VAL B 1 48  ? -76.706 11.427 -28.456 1.00 80.79  ? 64  VAL B CG1 1 
ATOM   1233 C CG2 . VAL B 1 48  ? -77.623 9.174  -29.126 1.00 85.26  ? 64  VAL B CG2 1 
ATOM   1234 N N   . SER B 1 49  ? -78.871 9.157  -26.231 1.00 80.57  ? 65  SER B N   1 
ATOM   1235 C CA  . SER B 1 49  ? -78.483 8.627  -24.933 1.00 81.14  ? 65  SER B CA  1 
ATOM   1236 C C   . SER B 1 49  ? -77.539 7.443  -25.100 1.00 78.45  ? 65  SER B C   1 
ATOM   1237 O O   . SER B 1 49  ? -77.491 6.797  -26.150 1.00 77.73  ? 65  SER B O   1 
ATOM   1238 C CB  . SER B 1 49  ? -79.712 8.210  -24.111 1.00 83.04  ? 65  SER B CB  1 
ATOM   1239 O OG  . SER B 1 49  ? -80.418 7.155  -24.745 1.00 84.93  ? 65  SER B OG  1 
ATOM   1240 N N   . THR B 1 50  ? -76.785 7.173  -24.035 1.00 74.66  ? 66  THR B N   1 
ATOM   1241 C CA  . THR B 1 50  ? -75.898 6.021  -23.985 1.00 73.68  ? 66  THR B CA  1 
ATOM   1242 C C   . THR B 1 50  ? -76.703 4.724  -24.048 1.00 78.83  ? 66  THR B C   1 
ATOM   1243 O O   . THR B 1 50  ? -77.937 4.721  -24.012 1.00 82.82  ? 66  THR B O   1 
ATOM   1244 C CB  . THR B 1 50  ? -75.048 6.042  -22.716 1.00 74.43  ? 66  THR B CB  1 
ATOM   1245 O OG1 . THR B 1 50  ? -75.888 6.265  -21.578 1.00 79.30  ? 66  THR B OG1 1 
ATOM   1246 C CG2 . THR B 1 50  ? -74.006 7.144  -22.798 1.00 68.20  ? 66  THR B CG2 1 
ATOM   1247 N N   . HIS B 1 51  ? -75.975 3.610  -24.155 1.00 72.17  ? 67  HIS B N   1 
ATOM   1248 C CA  . HIS B 1 51  ? -76.594 2.307  -24.368 1.00 75.36  ? 67  HIS B CA  1 
ATOM   1249 C C   . HIS B 1 51  ? -77.638 2.034  -23.291 1.00 79.00  ? 67  HIS B C   1 
ATOM   1250 O O   . HIS B 1 51  ? -77.460 2.404  -22.128 1.00 79.35  ? 67  HIS B O   1 
ATOM   1251 C CB  . HIS B 1 51  ? -75.517 1.224  -24.340 1.00 75.52  ? 67  HIS B CB  1 
ATOM   1252 C CG  . HIS B 1 51  ? -75.914 -0.051 -25.013 1.00 78.99  ? 67  HIS B CG  1 
ATOM   1253 N ND1 . HIS B 1 51  ? -76.967 -0.832 -24.584 1.00 81.83  ? 67  HIS B ND1 1 
ATOM   1254 C CD2 . HIS B 1 51  ? -75.364 -0.707 -26.062 1.00 80.32  ? 67  HIS B CD2 1 
ATOM   1255 C CE1 . HIS B 1 51  ? -77.065 -1.897 -25.360 1.00 83.95  ? 67  HIS B CE1 1 
ATOM   1256 N NE2 . HIS B 1 51  ? -76.102 -1.847 -26.263 1.00 83.39  ? 67  HIS B NE2 1 
ATOM   1257 N N   . ASN B 1 52  ? -78.743 1.392  -23.682 1.00 79.61  ? 68  ASN B N   1 
ATOM   1258 C CA  . ASN B 1 52  ? -79.823 1.191  -22.719 1.00 81.08  ? 68  ASN B CA  1 
ATOM   1259 C C   . ASN B 1 52  ? -79.397 0.254  -21.597 1.00 80.65  ? 68  ASN B C   1 
ATOM   1260 O O   . ASN B 1 52  ? -79.924 0.353  -20.484 1.00 81.27  ? 68  ASN B O   1 
ATOM   1261 C CB  . ASN B 1 52  ? -81.117 0.720  -23.409 1.00 88.97  ? 68  ASN B CB  1 
ATOM   1262 C CG  . ASN B 1 52  ? -80.963 -0.571 -24.183 1.00 89.50  ? 68  ASN B CG  1 
ATOM   1263 O OD1 . ASN B 1 52  ? -80.126 -1.413 -23.862 1.00 87.95  ? 68  ASN B OD1 1 
ATOM   1264 N ND2 . ASN B 1 52  ? -81.795 -0.737 -25.217 1.00 93.07  ? 68  ASN B ND2 1 
ATOM   1265 N N   . LEU B 1 53  ? -78.470 -0.666 -21.870 1.00 77.39  ? 69  LEU B N   1 
ATOM   1266 C CA  . LEU B 1 53  ? -77.794 -1.423 -20.818 1.00 74.50  ? 69  LEU B CA  1 
ATOM   1267 C C   . LEU B 1 53  ? -76.583 -0.636 -20.329 1.00 72.17  ? 69  LEU B C   1 
ATOM   1268 O O   . LEU B 1 53  ? -75.635 -0.407 -21.086 1.00 72.09  ? 69  LEU B O   1 
ATOM   1269 C CB  . LEU B 1 53  ? -77.361 -2.813 -21.284 1.00 73.41  ? 69  LEU B CB  1 
ATOM   1270 C CG  . LEU B 1 53  ? -78.254 -4.062 -21.383 1.00 74.86  ? 69  LEU B CG  1 
ATOM   1271 C CD1 . LEU B 1 53  ? -79.508 -3.916 -22.227 1.00 79.40  ? 69  LEU B CD1 1 
ATOM   1272 C CD2 . LEU B 1 53  ? -77.419 -5.278 -21.821 1.00 74.83  ? 69  LEU B CD2 1 
ATOM   1273 N N   . TRP B 1 54  ? -76.625 -0.221 -19.060 1.00 66.61  ? 70  TRP B N   1 
ATOM   1274 C CA  . TRP B 1 54  ? -75.560 0.600  -18.490 1.00 68.03  ? 70  TRP B CA  1 
ATOM   1275 C C   . TRP B 1 54  ? -74.211 -0.092 -18.594 1.00 70.37  ? 70  TRP B C   1 
ATOM   1276 O O   . TRP B 1 54  ? -73.179 0.573  -18.742 1.00 71.69  ? 70  TRP B O   1 
ATOM   1277 C CB  . TRP B 1 54  ? -75.878 0.933  -17.030 1.00 61.17  ? 70  TRP B CB  1 
ATOM   1278 C CG  . TRP B 1 54  ? -74.832 1.761  -16.334 1.00 63.04  ? 70  TRP B CG  1 
ATOM   1279 C CD1 . TRP B 1 54  ? -74.689 3.118  -16.371 1.00 63.42  ? 70  TRP B CD1 1 
ATOM   1280 C CD2 . TRP B 1 54  ? -73.806 1.275  -15.461 1.00 65.26  ? 70  TRP B CD2 1 
ATOM   1281 N NE1 . TRP B 1 54  ? -73.625 3.503  -15.590 1.00 65.54  ? 70  TRP B NE1 1 
ATOM   1282 C CE2 . TRP B 1 54  ? -73.066 2.388  -15.021 1.00 66.59  ? 70  TRP B CE2 1 
ATOM   1283 C CE3 . TRP B 1 54  ? -73.436 0.004  -15.015 1.00 67.14  ? 70  TRP B CE3 1 
ATOM   1284 C CZ2 . TRP B 1 54  ? -71.980 2.269  -14.154 1.00 68.82  ? 70  TRP B CZ2 1 
ATOM   1285 C CZ3 . TRP B 1 54  ? -72.359 -0.112 -14.157 1.00 69.41  ? 70  TRP B CZ3 1 
ATOM   1286 C CH2 . TRP B 1 54  ? -71.642 1.013  -13.736 1.00 69.98  ? 70  TRP B CH2 1 
ATOM   1287 N N   . LEU B 1 55  ? -74.201 -1.423 -18.489 1.00 66.59  ? 71  LEU B N   1 
ATOM   1288 C CA  . LEU B 1 55  ? -72.957 -2.175 -18.598 1.00 69.40  ? 71  LEU B CA  1 
ATOM   1289 C C   . LEU B 1 55  ? -72.259 -1.951 -19.932 1.00 70.94  ? 71  LEU B C   1 
ATOM   1290 O O   . LEU B 1 55  ? -71.029 -2.047 -20.013 1.00 74.11  ? 71  LEU B O   1 
ATOM   1291 C CB  . LEU B 1 55  ? -73.249 -3.662 -18.416 1.00 68.87  ? 71  LEU B CB  1 
ATOM   1292 C CG  . LEU B 1 55  ? -72.133 -4.641 -18.789 1.00 72.19  ? 71  LEU B CG  1 
ATOM   1293 C CD1 . LEU B 1 55  ? -70.999 -4.572 -17.777 1.00 74.60  ? 71  LEU B CD1 1 
ATOM   1294 C CD2 . LEU B 1 55  ? -72.667 -6.053 -18.929 1.00 73.07  ? 71  LEU B CD2 1 
ATOM   1295 N N   . LEU B 1 56  ? -73.007 -1.604 -20.976 1.00 67.09  ? 72  LEU B N   1 
ATOM   1296 C CA  . LEU B 1 56  ? -72.435 -1.414 -22.301 1.00 69.38  ? 72  LEU B CA  1 
ATOM   1297 C C   . LEU B 1 56  ? -72.317 0.053  -22.704 1.00 69.66  ? 72  LEU B C   1 
ATOM   1298 O O   . LEU B 1 56  ? -72.200 0.351  -23.896 1.00 71.05  ? 72  LEU B O   1 
ATOM   1299 C CB  . LEU B 1 56  ? -73.254 -2.178 -23.339 1.00 70.13  ? 72  LEU B CB  1 
ATOM   1300 C CG  . LEU B 1 56  ? -73.173 -3.703 -23.273 1.00 71.77  ? 72  LEU B CG  1 
ATOM   1301 C CD1 . LEU B 1 56  ? -74.214 -4.339 -24.181 1.00 71.06  ? 72  LEU B CD1 1 
ATOM   1302 C CD2 . LEU B 1 56  ? -71.773 -4.183 -23.617 1.00 76.52  ? 72  LEU B CD2 1 
ATOM   1303 N N   . SER B 1 57  ? -72.342 0.979  -21.749 1.00 66.36  ? 73  SER B N   1 
ATOM   1304 C CA  . SER B 1 57  ? -72.348 2.383  -22.150 1.00 67.29  ? 73  SER B CA  1 
ATOM   1305 C C   . SER B 1 57  ? -70.998 2.866  -22.685 1.00 73.67  ? 73  SER B C   1 
ATOM   1306 O O   . SER B 1 57  ? -70.916 4.009  -23.152 1.00 76.69  ? 73  SER B O   1 
ATOM   1307 C CB  . SER B 1 57  ? -72.822 3.259  -20.989 1.00 67.92  ? 73  SER B CB  1 
ATOM   1308 O OG  . SER B 1 57  ? -72.028 3.045  -19.843 1.00 70.08  ? 73  SER B OG  1 
ATOM   1309 N N   . PHE B 1 58  ? -69.951 2.039  -22.640 1.00 67.23  ? 74  PHE B N   1 
ATOM   1310 C CA  . PHE B 1 58  ? -68.710 2.346  -23.347 1.00 72.98  ? 74  PHE B CA  1 
ATOM   1311 C C   . PHE B 1 58  ? -68.881 2.315  -24.858 1.00 73.47  ? 74  PHE B C   1 
ATOM   1312 O O   . PHE B 1 58  ? -67.982 2.764  -25.580 1.00 76.39  ? 74  PHE B O   1 
ATOM   1313 C CB  . PHE B 1 58  ? -67.616 1.352  -22.944 1.00 73.26  ? 74  PHE B CB  1 
ATOM   1314 C CG  . PHE B 1 58  ? -67.890 -0.067 -23.381 1.00 73.02  ? 74  PHE B CG  1 
ATOM   1315 C CD1 . PHE B 1 58  ? -67.310 -0.593 -24.529 1.00 74.53  ? 74  PHE B CD1 1 
ATOM   1316 C CD2 . PHE B 1 58  ? -68.729 -0.878 -22.636 1.00 68.57  ? 74  PHE B CD2 1 
ATOM   1317 C CE1 . PHE B 1 58  ? -67.572 -1.900 -24.921 1.00 75.00  ? 74  PHE B CE1 1 
ATOM   1318 C CE2 . PHE B 1 58  ? -68.991 -2.181 -23.024 1.00 68.42  ? 74  PHE B CE2 1 
ATOM   1319 C CZ  . PHE B 1 58  ? -68.412 -2.692 -24.166 1.00 72.71  ? 74  PHE B CZ  1 
ATOM   1320 N N   . LEU B 1 59  ? -70.004 1.788  -25.339 1.00 75.02  ? 75  LEU B N   1 
ATOM   1321 C CA  . LEU B 1 59  ? -70.281 1.666  -26.761 1.00 75.34  ? 75  LEU B CA  1 
ATOM   1322 C C   . LEU B 1 59  ? -70.767 3.000  -27.312 1.00 74.99  ? 75  LEU B C   1 
ATOM   1323 O O   . LEU B 1 59  ? -71.627 3.649  -26.708 1.00 71.64  ? 75  LEU B O   1 
ATOM   1324 C CB  . LEU B 1 59  ? -71.340 0.590  -26.978 1.00 70.14  ? 75  LEU B CB  1 
ATOM   1325 C CG  . LEU B 1 59  ? -70.825 -0.844 -26.867 1.00 72.18  ? 75  LEU B CG  1 
ATOM   1326 C CD1 . LEU B 1 59  ? -71.940 -1.832 -27.151 1.00 69.82  ? 75  LEU B CD1 1 
ATOM   1327 C CD2 . LEU B 1 59  ? -69.632 -1.075 -27.772 1.00 77.03  ? 75  LEU B CD2 1 
ATOM   1328 N N   . ARG B 1 60  ? -70.223 3.408  -28.455 1.00 80.34  ? 76  ARG B N   1 
ATOM   1329 C CA  . ARG B 1 60  ? -70.658 4.658  -29.060 1.00 80.10  ? 76  ARG B CA  1 
ATOM   1330 C C   . ARG B 1 60  ? -72.086 4.513  -29.565 1.00 75.72  ? 76  ARG B C   1 
ATOM   1331 O O   . ARG B 1 60  ? -72.488 3.447  -30.036 1.00 74.30  ? 76  ARG B O   1 
ATOM   1332 C CB  . ARG B 1 60  ? -69.720 5.059  -30.202 1.00 84.46  ? 76  ARG B CB  1 
ATOM   1333 C CG  . ARG B 1 60  ? -69.438 6.553  -30.259 1.00 87.75  ? 76  ARG B CG  1 
ATOM   1334 C CD  . ARG B 1 60  ? -68.635 6.960  -31.477 1.00 92.16  ? 76  ARG B CD  1 
ATOM   1335 N NE  . ARG B 1 60  ? -67.228 6.572  -31.413 1.00 95.54  ? 76  ARG B NE  1 
ATOM   1336 C CZ  . ARG B 1 60  ? -66.400 6.622  -32.454 1.00 98.56  ? 76  ARG B CZ  1 
ATOM   1337 N NH1 . ARG B 1 60  ? -66.846 7.039  -33.632 1.00 99.85  ? 76  ARG B NH1 1 
ATOM   1338 N NH2 . ARG B 1 60  ? -65.131 6.251  -32.326 1.00 101.48 ? 76  ARG B NH2 1 
ATOM   1339 N N   . ARG B 1 61  ? -72.870 5.580  -29.433 1.00 87.92  ? 77  ARG B N   1 
ATOM   1340 C CA  . ARG B 1 61  ? -74.251 5.559  -29.886 1.00 90.62  ? 77  ARG B CA  1 
ATOM   1341 C C   . ARG B 1 61  ? -74.500 6.813  -30.711 1.00 91.17  ? 77  ARG B C   1 
ATOM   1342 O O   . ARG B 1 61  ? -73.935 7.874  -30.436 1.00 88.30  ? 77  ARG B O   1 
ATOM   1343 C CB  . ARG B 1 61  ? -75.229 5.454  -28.713 1.00 88.99  ? 77  ARG B CB  1 
ATOM   1344 C CG  . ARG B 1 61  ? -74.954 4.225  -27.872 1.00 88.55  ? 77  ARG B CG  1 
ATOM   1345 C CD  . ARG B 1 61  ? -75.424 2.933  -28.503 1.00 93.09  ? 77  ARG B CD  1 
ATOM   1346 N NE  . ARG B 1 61  ? -76.651 2.406  -27.922 1.00 94.38  ? 77  ARG B NE  1 
ATOM   1347 C CZ  . ARG B 1 61  ? -77.278 1.329  -28.381 1.00 98.78  ? 77  ARG B CZ  1 
ATOM   1348 N NH1 . ARG B 1 61  ? -76.780 0.671  -29.421 1.00 102.29 ? 77  ARG B NH1 1 
ATOM   1349 N NH2 . ARG B 1 61  ? -78.391 0.905  -27.796 1.00 100.06 ? 77  ARG B NH2 1 
ATOM   1350 N N   . TRP B 1 62  ? -75.330 6.680  -31.742 1.00 95.28  ? 78  TRP B N   1 
ATOM   1351 C CA  . TRP B 1 62  ? -75.508 7.736  -32.728 1.00 96.74  ? 78  TRP B CA  1 
ATOM   1352 C C   . TRP B 1 62  ? -76.952 8.211  -32.816 1.00 98.48  ? 78  TRP B C   1 
ATOM   1353 O O   . TRP B 1 62  ? -77.887 7.406  -32.776 1.00 101.11 ? 78  TRP B O   1 
ATOM   1354 C CB  . TRP B 1 62  ? -75.055 7.228  -34.092 1.00 100.97 ? 78  TRP B CB  1 
ATOM   1355 C CG  . TRP B 1 62  ? -73.594 6.952  -34.141 1.00 99.79  ? 78  TRP B CG  1 
ATOM   1356 C CD1 . TRP B 1 62  ? -72.976 5.768  -33.862 1.00 100.29 ? 78  TRP B CD1 1 
ATOM   1357 C CD2 . TRP B 1 62  ? -72.560 7.870  -34.509 1.00 98.41  ? 78  TRP B CD2 1 
ATOM   1358 N NE1 . TRP B 1 62  ? -71.618 5.897  -34.021 1.00 99.32  ? 78  TRP B NE1 1 
ATOM   1359 C CE2 . TRP B 1 62  ? -71.337 7.178  -34.421 1.00 98.19  ? 78  TRP B CE2 1 
ATOM   1360 C CE3 . TRP B 1 62  ? -72.550 9.213  -34.903 1.00 97.68  ? 78  TRP B CE3 1 
ATOM   1361 C CZ2 . TRP B 1 62  ? -70.116 7.783  -34.713 1.00 97.32  ? 78  TRP B CZ2 1 
ATOM   1362 C CZ3 . TRP B 1 62  ? -71.338 9.811  -35.193 1.00 96.74  ? 78  TRP B CZ3 1 
ATOM   1363 C CH2 . TRP B 1 62  ? -70.138 9.097  -35.097 1.00 96.60  ? 78  TRP B CH2 1 
ATOM   1364 N N   . ASN B 1 63  ? -77.123 9.527  -32.927 1.00 97.34  ? 79  ASN B N   1 
ATOM   1365 C CA  . ASN B 1 63  ? -78.298 10.125 -33.554 1.00 100.43 ? 79  ASN B CA  1 
ATOM   1366 C C   . ASN B 1 63  ? -77.763 10.905 -34.750 1.00 102.08 ? 79  ASN B C   1 
ATOM   1367 O O   . ASN B 1 63  ? -77.248 12.019 -34.586 1.00 99.55  ? 79  ASN B O   1 
ATOM   1368 C CB  . ASN B 1 63  ? -79.081 11.048 -32.630 1.00 98.28  ? 79  ASN B CB  1 
ATOM   1369 C CG  . ASN B 1 63  ? -80.506 11.233 -33.103 1.00 102.30 ? 79  ASN B CG  1 
ATOM   1370 O OD1 . ASN B 1 63  ? -81.009 10.396 -33.849 1.00 106.45 ? 79  ASN B OD1 1 
ATOM   1371 N ND2 . ASN B 1 63  ? -81.150 12.334 -32.733 1.00 101.67 ? 79  ASN B ND2 1 
ATOM   1372 N N   . GLY B 1 64  ? -77.868 10.319 -35.941 1.00 106.64 ? 80  GLY B N   1 
ATOM   1373 C CA  . GLY B 1 64  ? -77.289 10.935 -37.115 1.00 108.64 ? 80  GLY B CA  1 
ATOM   1374 C C   . GLY B 1 64  ? -75.839 11.318 -36.910 1.00 105.24 ? 80  GLY B C   1 
ATOM   1375 O O   . GLY B 1 64  ? -74.982 10.452 -36.716 1.00 104.49 ? 80  GLY B O   1 
ATOM   1376 N N   . SER B 1 65  ? -75.553 12.614 -36.974 1.00 103.60 ? 81  SER B N   1 
ATOM   1377 C CA  . SER B 1 65  ? -74.187 13.113 -36.925 1.00 101.19 ? 81  SER B CA  1 
ATOM   1378 C C   . SER B 1 65  ? -73.670 13.296 -35.502 1.00 96.12  ? 81  SER B C   1 
ATOM   1379 O O   . SER B 1 65  ? -72.590 13.868 -35.328 1.00 94.06  ? 81  SER B O   1 
ATOM   1380 C CB  . SER B 1 65  ? -74.079 14.434 -37.689 1.00 103.02 ? 81  SER B CB  1 
ATOM   1381 O OG  . SER B 1 65  ? -74.411 15.532 -36.856 1.00 100.81 ? 81  SER B OG  1 
ATOM   1382 N N   . THR B 1 66  ? -74.416 12.860 -34.484 1.00 94.43  ? 82  THR B N   1 
ATOM   1383 C CA  . THR B 1 66  ? -74.038 13.071 -33.090 1.00 89.99  ? 82  THR B CA  1 
ATOM   1384 C C   . THR B 1 66  ? -73.784 11.726 -32.423 1.00 89.05  ? 82  THR B C   1 
ATOM   1385 O O   . THR B 1 66  ? -74.596 10.807 -32.549 1.00 91.22  ? 82  THR B O   1 
ATOM   1386 C CB  . THR B 1 66  ? -75.127 13.841 -32.337 1.00 92.49  ? 82  THR B CB  1 
ATOM   1387 O OG1 . THR B 1 66  ? -75.427 15.053 -33.040 1.00 93.31  ? 82  THR B OG1 1 
ATOM   1388 C CG2 . THR B 1 66  ? -74.650 14.190 -30.943 1.00 88.94  ? 82  THR B CG2 1 
ATOM   1389 N N   . ALA B 1 67  ? -72.657 11.613 -31.718 1.00 86.18  ? 83  ALA B N   1 
ATOM   1390 C CA  . ALA B 1 67  ? -72.230 10.376 -31.079 1.00 85.33  ? 83  ALA B CA  1 
ATOM   1391 C C   . ALA B 1 67  ? -71.997 10.596 -29.590 1.00 82.20  ? 83  ALA B C   1 
ATOM   1392 O O   . ALA B 1 67  ? -71.616 11.688 -29.161 1.00 80.36  ? 83  ALA B O   1 
ATOM   1393 C CB  . ALA B 1 67  ? -70.951 9.836  -31.715 1.00 86.55  ? 83  ALA B CB  1 
ATOM   1394 N N   . ILE B 1 68  ? -72.246 9.553  -28.799 1.00 80.69  ? 84  ILE B N   1 
ATOM   1395 C CA  . ILE B 1 68  ? -72.058 9.594  -27.353 1.00 78.16  ? 84  ILE B CA  1 
ATOM   1396 C C   . ILE B 1 68  ? -71.331 8.334  -26.899 1.00 77.54  ? 84  ILE B C   1 
ATOM   1397 O O   . ILE B 1 68  ? -71.603 7.234  -27.393 1.00 79.60  ? 84  ILE B O   1 
ATOM   1398 C CB  . ILE B 1 68  ? -73.404 9.762  -26.613 1.00 76.89  ? 84  ILE B CB  1 
ATOM   1399 C CG1 . ILE B 1 68  ? -73.179 9.883  -25.105 1.00 74.60  ? 84  ILE B CG1 1 
ATOM   1400 C CG2 . ILE B 1 68  ? -74.363 8.625  -26.941 1.00 79.75  ? 84  ILE B CG2 1 
ATOM   1401 C CD1 . ILE B 1 68  ? -74.390 10.383 -24.351 1.00 75.02  ? 84  ILE B CD1 1 
ATOM   1402 N N   . THR B 1 69  ? -70.397 8.501  -25.961 1.00 78.03  ? 85  THR B N   1 
ATOM   1403 C CA  . THR B 1 69  ? -69.682 7.394  -25.338 1.00 76.79  ? 85  THR B CA  1 
ATOM   1404 C C   . THR B 1 69  ? -69.473 7.742  -23.876 1.00 73.83  ? 85  THR B C   1 
ATOM   1405 O O   . THR B 1 69  ? -69.232 8.905  -23.545 1.00 71.73  ? 85  THR B O   1 
ATOM   1406 C CB  . THR B 1 69  ? -68.326 7.138  -25.999 1.00 75.10  ? 85  THR B CB  1 
ATOM   1407 O OG1 . THR B 1 69  ? -68.528 6.793  -27.366 1.00 78.49  ? 85  THR B OG1 1 
ATOM   1408 C CG2 . THR B 1 69  ? -67.593 6.002  -25.316 1.00 74.98  ? 85  THR B CG2 1 
ATOM   1409 N N   . ASP B 1 70  ? -69.554 6.740  -23.003 1.00 73.56  ? 86  ASP B N   1 
ATOM   1410 C CA  . ASP B 1 70  ? -69.583 6.971  -21.565 1.00 71.48  ? 86  ASP B CA  1 
ATOM   1411 C C   . ASP B 1 70  ? -68.500 6.129  -20.907 1.00 69.94  ? 86  ASP B C   1 
ATOM   1412 O O   . ASP B 1 70  ? -68.442 4.912  -21.109 1.00 71.46  ? 86  ASP B O   1 
ATOM   1413 C CB  . ASP B 1 70  ? -70.965 6.636  -20.987 1.00 70.70  ? 86  ASP B CB  1 
ATOM   1414 C CG  . ASP B 1 70  ? -71.116 7.062  -19.539 1.00 69.11  ? 86  ASP B CG  1 
ATOM   1415 O OD1 . ASP B 1 70  ? -70.227 7.777  -19.031 1.00 66.21  ? 86  ASP B OD1 1 
ATOM   1416 O OD2 . ASP B 1 70  ? -72.126 6.676  -18.907 1.00 71.19  ? 86  ASP B OD2 1 
ATOM   1417 N N   . ASP B 1 71  ? -67.650 6.781  -20.119 1.00 67.91  ? 87  ASP B N   1 
ATOM   1418 C CA  . ASP B 1 71  ? -66.604 6.117  -19.343 1.00 66.85  ? 87  ASP B CA  1 
ATOM   1419 C C   . ASP B 1 71  ? -67.088 6.068  -17.899 1.00 66.32  ? 87  ASP B C   1 
ATOM   1420 O O   . ASP B 1 71  ? -66.836 6.976  -17.103 1.00 64.91  ? 87  ASP B O   1 
ATOM   1421 C CB  . ASP B 1 71  ? -65.281 6.859  -19.480 1.00 67.45  ? 87  ASP B CB  1 
ATOM   1422 C CG  . ASP B 1 71  ? -64.224 6.370  -18.511 1.00 66.82  ? 87  ASP B CG  1 
ATOM   1423 O OD1 . ASP B 1 71  ? -64.216 5.165  -18.174 1.00 67.68  ? 87  ASP B OD1 1 
ATOM   1424 O OD2 . ASP B 1 71  ? -63.384 7.200  -18.096 1.00 65.85  ? 87  ASP B OD2 1 
ATOM   1425 N N   . THR B 1 72  ? -67.809 4.994  -17.569 1.00 65.24  ? 88  THR B N   1 
ATOM   1426 C CA  . THR B 1 72  ? -68.468 4.896  -16.273 1.00 65.46  ? 88  THR B CA  1 
ATOM   1427 C C   . THR B 1 72  ? -67.491 4.638  -15.133 1.00 64.18  ? 88  THR B C   1 
ATOM   1428 O O   . THR B 1 72  ? -67.839 4.883  -13.973 1.00 64.10  ? 88  THR B O   1 
ATOM   1429 C CB  . THR B 1 72  ? -69.528 3.795  -16.296 1.00 64.49  ? 88  THR B CB  1 
ATOM   1430 O OG1 . THR B 1 72  ? -68.946 2.576  -16.769 1.00 66.30  ? 88  THR B OG1 1 
ATOM   1431 C CG2 . THR B 1 72  ? -70.675 4.185  -17.194 1.00 65.55  ? 88  THR B CG2 1 
ATOM   1432 N N   . LEU B 1 73  ? -66.287 4.142  -15.426 1.00 64.18  ? 89  LEU B N   1 
ATOM   1433 C CA  . LEU B 1 73  ? -65.333 3.874  -14.354 1.00 63.62  ? 89  LEU B CA  1 
ATOM   1434 C C   . LEU B 1 73  ? -64.655 5.154  -13.878 1.00 62.27  ? 89  LEU B C   1 
ATOM   1435 O O   . LEU B 1 73  ? -64.761 5.526  -12.706 1.00 62.19  ? 89  LEU B O   1 
ATOM   1436 C CB  . LEU B 1 73  ? -64.278 2.868  -14.817 1.00 64.32  ? 89  LEU B CB  1 
ATOM   1437 C CG  . LEU B 1 73  ? -63.196 2.600  -13.769 1.00 64.37  ? 89  LEU B CG  1 
ATOM   1438 C CD1 . LEU B 1 73  ? -63.734 1.671  -12.708 1.00 64.43  ? 89  LEU B CD1 1 
ATOM   1439 C CD2 . LEU B 1 73  ? -61.930 2.049  -14.396 1.00 66.40  ? 89  LEU B CD2 1 
ATOM   1440 N N   . GLY B 1 74  ? -63.945 5.838  -14.775 1.00 65.23  ? 90  GLY B N   1 
ATOM   1441 C CA  . GLY B 1 74  ? -63.383 7.126  -14.417 1.00 64.51  ? 90  GLY B CA  1 
ATOM   1442 C C   . GLY B 1 74  ? -64.432 8.214  -14.327 1.00 64.09  ? 90  GLY B C   1 
ATOM   1443 O O   . GLY B 1 74  ? -64.262 9.186  -13.582 1.00 64.04  ? 90  GLY B O   1 
ATOM   1444 N N   . GLY B 1 75  ? -65.537 8.057  -15.054 1.00 65.71  ? 91  GLY B N   1 
ATOM   1445 C CA  . GLY B 1 75  ? -66.605 9.030  -15.009 1.00 65.75  ? 91  GLY B CA  1 
ATOM   1446 C C   . GLY B 1 75  ? -66.413 10.165 -15.986 1.00 65.20  ? 91  GLY B C   1 
ATOM   1447 O O   . GLY B 1 75  ? -66.332 11.328 -15.584 1.00 64.90  ? 91  GLY B O   1 
ATOM   1448 N N   . THR B 1 76  ? -66.333 9.846  -17.275 1.00 68.87  ? 92  THR B N   1 
ATOM   1449 C CA  . THR B 1 76  ? -66.179 10.868 -18.305 1.00 68.36  ? 92  THR B CA  1 
ATOM   1450 C C   . THR B 1 76  ? -67.094 10.559 -19.475 1.00 69.50  ? 92  THR B C   1 
ATOM   1451 O O   . THR B 1 76  ? -66.912 9.553  -20.167 1.00 70.49  ? 92  THR B O   1 
ATOM   1452 C CB  . THR B 1 76  ? -64.738 10.958 -18.798 1.00 71.17  ? 92  THR B CB  1 
ATOM   1453 O OG1 . THR B 1 76  ? -63.843 10.981 -17.677 1.00 71.61  ? 92  THR B OG1 1 
ATOM   1454 C CG2 . THR B 1 76  ? -64.561 12.221 -19.622 1.00 70.47  ? 92  THR B CG2 1 
ATOM   1455 N N   . LEU B 1 77  ? -68.051 11.446 -19.704 1.00 69.49  ? 93  LEU B N   1 
ATOM   1456 C CA  . LEU B 1 77  ? -68.942 11.369 -20.845 1.00 71.64  ? 93  LEU B CA  1 
ATOM   1457 C C   . LEU B 1 77  ? -68.326 12.155 -21.993 1.00 71.40  ? 93  LEU B C   1 
ATOM   1458 O O   . LEU B 1 77  ? -67.682 13.184 -21.778 1.00 69.99  ? 93  LEU B O   1 
ATOM   1459 C CB  . LEU B 1 77  ? -70.318 11.929 -20.483 1.00 64.99  ? 93  LEU B CB  1 
ATOM   1460 C CG  . LEU B 1 77  ? -71.487 11.689 -21.435 1.00 68.24  ? 93  LEU B CG  1 
ATOM   1461 C CD1 . LEU B 1 77  ? -71.746 10.208 -21.595 1.00 70.44  ? 93  LEU B CD1 1 
ATOM   1462 C CD2 . LEU B 1 77  ? -72.729 12.393 -20.920 1.00 69.53  ? 93  LEU B CD2 1 
ATOM   1463 N N   . THR B 1 78  ? -68.487 11.648 -23.209 1.00 71.38  ? 94  THR B N   1 
ATOM   1464 C CA  . THR B 1 78  ? -67.880 12.278 -24.372 1.00 71.78  ? 94  THR B CA  1 
ATOM   1465 C C   . THR B 1 78  ? -68.903 12.325 -25.491 1.00 74.90  ? 94  THR B C   1 
ATOM   1466 O O   . THR B 1 78  ? -69.410 11.281 -25.919 1.00 77.56  ? 94  THR B O   1 
ATOM   1467 C CB  . THR B 1 78  ? -66.624 11.531 -24.826 1.00 71.52  ? 94  THR B CB  1 
ATOM   1468 O OG1 . THR B 1 78  ? -65.620 11.639 -23.814 1.00 69.23  ? 94  THR B OG1 1 
ATOM   1469 C CG2 . THR B 1 78  ? -66.095 12.130 -26.116 1.00 72.79  ? 94  THR B CG2 1 
ATOM   1470 N N   . ILE B 1 79  ? -69.208 13.534 -25.950 1.00 77.09  ? 95  ILE B N   1 
ATOM   1471 C CA  . ILE B 1 79  ? -70.115 13.750 -27.067 1.00 80.51  ? 95  ILE B CA  1 
ATOM   1472 C C   . ILE B 1 79  ? -69.267 14.205 -28.241 1.00 80.23  ? 95  ILE B C   1 
ATOM   1473 O O   . ILE B 1 79  ? -68.394 15.070 -28.087 1.00 77.96  ? 95  ILE B O   1 
ATOM   1474 C CB  . ILE B 1 79  ? -71.200 14.786 -26.735 1.00 74.89  ? 95  ILE B CB  1 
ATOM   1475 C CG1 . ILE B 1 79  ? -71.706 14.595 -25.304 1.00 73.55  ? 95  ILE B CG1 1 
ATOM   1476 C CG2 . ILE B 1 79  ? -72.351 14.693 -27.729 1.00 78.30  ? 95  ILE B CG2 1 
ATOM   1477 C CD1 . ILE B 1 79  ? -72.291 13.249 -25.037 1.00 75.44  ? 95  ILE B CD1 1 
ATOM   1478 N N   . THR B 1 80  ? -69.523 13.625 -29.408 1.00 81.20  ? 96  THR B N   1 
ATOM   1479 C CA  . THR B 1 80  ? -68.836 13.980 -30.638 1.00 82.67  ? 96  THR B CA  1 
ATOM   1480 C C   . THR B 1 80  ? -69.868 14.542 -31.599 1.00 84.89  ? 96  THR B C   1 
ATOM   1481 O O   . THR B 1 80  ? -70.853 13.871 -31.925 1.00 86.88  ? 96  THR B O   1 
ATOM   1482 C CB  . THR B 1 80  ? -68.126 12.769 -31.245 1.00 85.22  ? 96  THR B CB  1 
ATOM   1483 O OG1 . THR B 1 80  ? -67.176 12.252 -30.303 1.00 82.00  ? 96  THR B OG1 1 
ATOM   1484 C CG2 . THR B 1 80  ? -67.397 13.167 -32.518 1.00 87.05  ? 96  THR B CG2 1 
ATOM   1485 N N   . LEU B 1 81  ? -69.647 15.770 -32.031 1.00 85.71  ? 97  LEU B N   1 
ATOM   1486 C CA  . LEU B 1 81  ? -70.439 16.399 -33.074 1.00 87.96  ? 97  LEU B CA  1 
ATOM   1487 C C   . LEU B 1 81  ? -69.671 16.212 -34.373 1.00 90.16  ? 97  LEU B C   1 
ATOM   1488 O O   . LEU B 1 81  ? -68.728 16.950 -34.677 1.00 89.54  ? 97  LEU B O   1 
ATOM   1489 C CB  . LEU B 1 81  ? -70.691 17.863 -32.740 1.00 86.12  ? 97  LEU B CB  1 
ATOM   1490 C CG  . LEU B 1 81  ? -71.424 17.989 -31.404 1.00 84.29  ? 97  LEU B CG  1 
ATOM   1491 C CD1 . LEU B 1 81  ? -71.260 19.368 -30.792 1.00 82.03  ? 97  LEU B CD1 1 
ATOM   1492 C CD2 . LEU B 1 81  ? -72.894 17.642 -31.589 1.00 86.65  ? 97  LEU B CD2 1 
ATOM   1493 N N   . ARG B 1 82  ? -70.074 15.193 -35.117 1.00 91.95  ? 98  ARG B N   1 
ATOM   1494 C CA  . ARG B 1 82  ? -69.450 14.840 -36.378 1.00 94.45  ? 98  ARG B CA  1 
ATOM   1495 C C   . ARG B 1 82  ? -70.011 15.742 -37.465 1.00 97.19  ? 98  ARG B C   1 
ATOM   1496 O O   . ARG B 1 82  ? -71.232 15.861 -37.606 1.00 98.33  ? 98  ARG B O   1 
ATOM   1497 C CB  . ARG B 1 82  ? -69.712 13.360 -36.659 1.00 103.13 ? 98  ARG B CB  1 
ATOM   1498 C CG  . ARG B 1 82  ? -69.522 12.845 -38.071 1.00 105.89 ? 98  ARG B CG  1 
ATOM   1499 C CD  . ARG B 1 82  ? -69.832 11.352 -38.033 1.00 106.57 ? 98  ARG B CD  1 
ATOM   1500 N NE  . ARG B 1 82  ? -70.036 10.717 -39.331 1.00 111.94 ? 98  ARG B NE  1 
ATOM   1501 C CZ  . ARG B 1 82  ? -70.508 9.481  -39.480 1.00 114.58 ? 98  ARG B CZ  1 
ATOM   1502 N NH1 . ARG B 1 82  ? -70.816 8.759  -38.408 1.00 112.12 ? 98  ARG B NH1 1 
ATOM   1503 N NH2 . ARG B 1 82  ? -70.666 8.965  -40.697 1.00 120.01 ? 98  ARG B NH2 1 
ATOM   1504 N N   . ASN B 1 83  ? -69.116 16.402 -38.204 1.00 98.64  ? 99  ASN B N   1 
ATOM   1505 C CA  . ASN B 1 83  ? -69.510 17.319 -39.268 1.00 101.67 ? 99  ASN B CA  1 
ATOM   1506 C C   . ASN B 1 83  ? -70.357 18.449 -38.687 1.00 99.89  ? 99  ASN B C   1 
ATOM   1507 O O   . ASN B 1 83  ? -71.586 18.447 -38.813 1.00 101.13 ? 99  ASN B O   1 
ATOM   1508 C CB  . ASN B 1 83  ? -70.252 16.547 -40.367 1.00 106.07 ? 99  ASN B CB  1 
ATOM   1509 C CG  . ASN B 1 83  ? -70.889 17.446 -41.395 1.00 109.42 ? 99  ASN B CG  1 
ATOM   1510 O OD1 . ASN B 1 83  ? -70.358 18.504 -41.726 1.00 109.67 ? 99  ASN B OD1 1 
ATOM   1511 N ND2 . ASN B 1 83  ? -72.040 17.029 -41.907 1.00 112.37 ? 99  ASN B ND2 1 
ATOM   1512 N N   . LEU B 1 84  ? -69.708 19.398 -38.009 1.00 97.64  ? 100 LEU B N   1 
ATOM   1513 C CA  . LEU B 1 84  ? -70.429 20.504 -37.390 1.00 96.24  ? 100 LEU B CA  1 
ATOM   1514 C C   . LEU B 1 84  ? -71.084 21.384 -38.445 1.00 99.71  ? 100 LEU B C   1 
ATOM   1515 O O   . LEU B 1 84  ? -70.515 21.639 -39.510 1.00 102.47 ? 100 LEU B O   1 
ATOM   1516 C CB  . LEU B 1 84  ? -69.485 21.340 -36.522 1.00 97.82  ? 100 LEU B CB  1 
ATOM   1517 C CG  . LEU B 1 84  ? -70.104 22.252 -35.461 1.00 95.50  ? 100 LEU B CG  1 
ATOM   1518 C CD1 . LEU B 1 84  ? -71.081 21.487 -34.598 1.00 94.30  ? 100 LEU B CD1 1 
ATOM   1519 C CD2 . LEU B 1 84  ? -69.011 22.864 -34.600 1.00 93.26  ? 100 LEU B CD2 1 
ATOM   1520 N N   . GLN B 1 85  ? -72.284 21.851 -38.140 1.00 99.57  ? 101 GLN B N   1 
ATOM   1521 C CA  . GLN B 1 85  ? -73.065 22.716 -39.012 1.00 102.98 ? 101 GLN B CA  1 
ATOM   1522 C C   . GLN B 1 85  ? -73.481 23.968 -38.253 1.00 101.75 ? 101 GLN B C   1 
ATOM   1523 O O   . GLN B 1 85  ? -73.374 24.027 -37.029 1.00 98.44  ? 101 GLN B O   1 
ATOM   1524 C CB  . GLN B 1 85  ? -74.293 21.960 -39.542 1.00 105.74 ? 101 GLN B CB  1 
ATOM   1525 C CG  . GLN B 1 85  ? -73.922 20.953 -40.610 1.00 108.55 ? 101 GLN B CG  1 
ATOM   1526 C CD  . GLN B 1 85  ? -73.228 21.607 -41.790 1.00 111.56 ? 101 GLN B CD  1 
ATOM   1527 O OE1 . GLN B 1 85  ? -73.740 22.560 -42.377 1.00 114.08 ? 101 GLN B OE1 1 
ATOM   1528 N NE2 . GLN B 1 85  ? -72.042 21.118 -42.123 1.00 111.56 ? 101 GLN B NE2 1 
ATOM   1529 N N   . PRO B 1 86  ? -73.943 24.999 -38.967 1.00 104.76 ? 102 PRO B N   1 
ATOM   1530 C CA  . PRO B 1 86  ? -74.547 26.136 -38.252 1.00 104.31 ? 102 PRO B CA  1 
ATOM   1531 C C   . PRO B 1 86  ? -75.717 25.725 -37.375 1.00 103.27 ? 102 PRO B C   1 
ATOM   1532 O O   . PRO B 1 86  ? -75.778 26.127 -36.207 1.00 100.81 ? 102 PRO B O   1 
ATOM   1533 C CB  . PRO B 1 86  ? -74.958 27.079 -39.395 1.00 108.63 ? 102 PRO B CB  1 
ATOM   1534 C CG  . PRO B 1 86  ? -75.087 26.192 -40.592 1.00 111.50 ? 102 PRO B CG  1 
ATOM   1535 C CD  . PRO B 1 86  ? -73.964 25.212 -40.424 1.00 109.04 ? 102 PRO B CD  1 
ATOM   1536 N N   . HIS B 1 87  ? -76.651 24.930 -37.903 1.00 105.46 ? 103 HIS B N   1 
ATOM   1537 C CA  . HIS B 1 87  ? -77.835 24.550 -37.141 1.00 105.17 ? 103 HIS B CA  1 
ATOM   1538 C C   . HIS B 1 87  ? -77.499 23.757 -35.886 1.00 100.98 ? 103 HIS B C   1 
ATOM   1539 O O   . HIS B 1 87  ? -78.372 23.587 -35.028 1.00 100.32 ? 103 HIS B O   1 
ATOM   1540 C CB  . HIS B 1 87  ? -78.795 23.744 -38.023 1.00 108.82 ? 103 HIS B CB  1 
ATOM   1541 C CG  . HIS B 1 87  ? -78.238 22.438 -38.504 1.00 108.70 ? 103 HIS B CG  1 
ATOM   1542 N ND1 . HIS B 1 87  ? -77.957 21.388 -37.655 1.00 105.60 ? 103 HIS B ND1 1 
ATOM   1543 C CD2 . HIS B 1 87  ? -77.924 22.006 -39.748 1.00 111.73 ? 103 HIS B CD2 1 
ATOM   1544 C CE1 . HIS B 1 87  ? -77.488 20.371 -38.353 1.00 106.74 ? 103 HIS B CE1 1 
ATOM   1545 N NE2 . HIS B 1 87  ? -77.458 20.719 -39.627 1.00 110.52 ? 103 HIS B NE2 1 
ATOM   1546 N N   . ASP B 1 88  ? -76.274 23.248 -35.768 1.00 98.50  ? 104 ASP B N   1 
ATOM   1547 C CA  . ASP B 1 88  ? -75.857 22.565 -34.552 1.00 94.64  ? 104 ASP B CA  1 
ATOM   1548 C C   . ASP B 1 88  ? -75.550 23.523 -33.407 1.00 92.17  ? 104 ASP B C   1 
ATOM   1549 O O   . ASP B 1 88  ? -75.465 23.079 -32.259 1.00 89.36  ? 104 ASP B O   1 
ATOM   1550 C CB  . ASP B 1 88  ? -74.633 21.689 -34.834 1.00 93.35  ? 104 ASP B CB  1 
ATOM   1551 C CG  . ASP B 1 88  ? -74.973 20.463 -35.656 1.00 95.55  ? 104 ASP B CG  1 
ATOM   1552 O OD1 . ASP B 1 88  ? -76.129 20.004 -35.585 1.00 96.91  ? 104 ASP B OD1 1 
ATOM   1553 O OD2 . ASP B 1 88  ? -74.085 19.959 -36.373 1.00 96.33  ? 104 ASP B OD2 1 
ATOM   1554 N N   . ALA B 1 89  ? -75.375 24.813 -33.686 1.00 93.49  ? 105 ALA B N   1 
ATOM   1555 C CA  . ALA B 1 89  ? -75.044 25.758 -32.629 1.00 91.78  ? 105 ALA B CA  1 
ATOM   1556 C C   . ALA B 1 89  ? -76.205 25.900 -31.652 1.00 91.64  ? 105 ALA B C   1 
ATOM   1557 O O   . ALA B 1 89  ? -77.375 25.805 -32.027 1.00 94.02  ? 105 ALA B O   1 
ATOM   1558 C CB  . ALA B 1 89  ? -74.687 27.118 -33.226 1.00 93.97  ? 105 ALA B CB  1 
ATOM   1559 N N   . GLY B 1 90  ? -75.874 26.129 -30.390 1.00 87.45  ? 106 GLY B N   1 
ATOM   1560 C CA  . GLY B 1 90  ? -76.882 26.305 -29.367 1.00 87.55  ? 106 GLY B CA  1 
ATOM   1561 C C   . GLY B 1 90  ? -76.383 25.833 -28.016 1.00 84.74  ? 106 GLY B C   1 
ATOM   1562 O O   . GLY B 1 90  ? -75.195 25.597 -27.815 1.00 82.81  ? 106 GLY B O   1 
ATOM   1563 N N   . LEU B 1 91  ? -77.332 25.699 -27.091 1.00 85.20  ? 107 LEU B N   1 
ATOM   1564 C CA  . LEU B 1 91  ? -77.063 25.345 -25.702 1.00 83.61  ? 107 LEU B CA  1 
ATOM   1565 C C   . LEU B 1 91  ? -77.555 23.929 -25.451 1.00 83.34  ? 107 LEU B C   1 
ATOM   1566 O O   . LEU B 1 91  ? -78.745 23.649 -25.619 1.00 85.48  ? 107 LEU B O   1 
ATOM   1567 C CB  . LEU B 1 91  ? -77.753 26.308 -24.735 1.00 87.23  ? 107 LEU B CB  1 
ATOM   1568 C CG  . LEU B 1 91  ? -77.616 25.933 -23.252 1.00 86.13  ? 107 LEU B CG  1 
ATOM   1569 C CD1 . LEU B 1 91  ? -76.255 26.323 -22.704 1.00 84.28  ? 107 LEU B CD1 1 
ATOM   1570 C CD2 . LEU B 1 91  ? -78.733 26.515 -22.406 1.00 88.51  ? 107 LEU B CD2 1 
ATOM   1571 N N   . TYR B 1 92  ? -76.651 23.043 -25.050 1.00 84.30  ? 108 TYR B N   1 
ATOM   1572 C CA  . TYR B 1 92  ? -76.987 21.659 -24.752 1.00 84.52  ? 108 TYR B CA  1 
ATOM   1573 C C   . TYR B 1 92  ? -76.609 21.354 -23.311 1.00 83.39  ? 108 TYR B C   1 
ATOM   1574 O O   . TYR B 1 92  ? -75.915 22.131 -22.651 1.00 81.97  ? 108 TYR B O   1 
ATOM   1575 C CB  . TYR B 1 92  ? -76.261 20.672 -25.669 1.00 80.95  ? 108 TYR B CB  1 
ATOM   1576 C CG  . TYR B 1 92  ? -76.414 20.926 -27.140 1.00 82.47  ? 108 TYR B CG  1 
ATOM   1577 C CD1 . TYR B 1 92  ? -75.606 21.845 -27.786 1.00 82.03  ? 108 TYR B CD1 1 
ATOM   1578 C CD2 . TYR B 1 92  ? -77.368 20.251 -27.884 1.00 84.60  ? 108 TYR B CD2 1 
ATOM   1579 C CE1 . TYR B 1 92  ? -75.734 22.077 -29.130 1.00 83.65  ? 108 TYR B CE1 1 
ATOM   1580 C CE2 . TYR B 1 92  ? -77.508 20.484 -29.234 1.00 86.19  ? 108 TYR B CE2 1 
ATOM   1581 C CZ  . TYR B 1 92  ? -76.685 21.399 -29.853 1.00 85.71  ? 108 TYR B CZ  1 
ATOM   1582 O OH  . TYR B 1 92  ? -76.809 21.640 -31.199 1.00 87.54  ? 108 TYR B OH  1 
ATOM   1583 N N   . GLN B 1 93  ? -77.056 20.198 -22.824 1.00 81.98  ? 109 GLN B N   1 
ATOM   1584 C CA  . GLN B 1 93  ? -76.605 19.730 -21.525 1.00 80.95  ? 109 GLN B CA  1 
ATOM   1585 C C   . GLN B 1 93  ? -76.467 18.211 -21.512 1.00 81.10  ? 109 GLN B C   1 
ATOM   1586 O O   . GLN B 1 93  ? -77.130 17.487 -22.278 1.00 82.95  ? 109 GLN B O   1 
ATOM   1587 C CB  . GLN B 1 93  ? -77.544 20.211 -20.401 1.00 82.87  ? 109 GLN B CB  1 
ATOM   1588 C CG  . GLN B 1 93  ? -78.989 19.790 -20.533 1.00 86.31  ? 109 GLN B CG  1 
ATOM   1589 C CD  . GLN B 1 93  ? -79.829 20.191 -19.326 1.00 88.38  ? 109 GLN B CD  1 
ATOM   1590 O OE1 . GLN B 1 93  ? -79.854 19.487 -18.314 1.00 89.05  ? 109 GLN B OE1 1 
ATOM   1591 N NE2 . GLN B 1 93  ? -80.523 21.324 -19.430 1.00 89.55  ? 109 GLN B NE2 1 
ATOM   1592 N N   . CYS B 1 94  ? -75.565 17.755 -20.628 1.00 77.54  ? 110 CYS B N   1 
ATOM   1593 C CA  . CYS B 1 94  ? -75.366 16.349 -20.306 1.00 77.55  ? 110 CYS B CA  1 
ATOM   1594 C C   . CYS B 1 94  ? -76.250 16.020 -19.117 1.00 79.60  ? 110 CYS B C   1 
ATOM   1595 O O   . CYS B 1 94  ? -76.398 16.826 -18.194 1.00 79.70  ? 110 CYS B O   1 
ATOM   1596 C CB  . CYS B 1 94  ? -73.895 16.045 -19.971 1.00 83.99  ? 110 CYS B CB  1 
ATOM   1597 S SG  . CYS B 1 94  ? -72.770 16.741 -21.206 1.00 81.94  ? 110 CYS B SG  1 
ATOM   1598 N N   . GLN B 1 95  ? -76.845 14.838 -19.149 1.00 76.32  ? 111 GLN B N   1 
ATOM   1599 C CA  . GLN B 1 95  ? -77.847 14.458 -18.174 1.00 78.45  ? 111 GLN B CA  1 
ATOM   1600 C C   . GLN B 1 95  ? -77.590 13.047 -17.673 1.00 78.00  ? 111 GLN B C   1 
ATOM   1601 O O   . GLN B 1 95  ? -77.290 12.139 -18.452 1.00 77.67  ? 111 GLN B O   1 
ATOM   1602 C CB  . GLN B 1 95  ? -79.259 14.547 -18.761 1.00 79.15  ? 111 GLN B CB  1 
ATOM   1603 C CG  . GLN B 1 95  ? -79.743 15.970 -18.960 1.00 80.24  ? 111 GLN B CG  1 
ATOM   1604 C CD  . GLN B 1 95  ? -81.179 16.048 -19.436 1.00 83.61  ? 111 GLN B CD  1 
ATOM   1605 O OE1 . GLN B 1 95  ? -81.657 15.180 -20.166 1.00 84.77  ? 111 GLN B OE1 1 
ATOM   1606 N NE2 . GLN B 1 95  ? -81.875 17.103 -19.028 1.00 85.47  ? 111 GLN B NE2 1 
ATOM   1607 N N   . SER B 1 96  ? -77.712 12.878 -16.366 1.00 77.22  ? 112 SER B N   1 
ATOM   1608 C CA  . SER B 1 96  ? -77.716 11.576 -15.729 1.00 77.40  ? 112 SER B CA  1 
ATOM   1609 C C   . SER B 1 96  ? -79.169 11.199 -15.487 1.00 81.60  ? 112 SER B C   1 
ATOM   1610 O O   . SER B 1 96  ? -79.912 11.956 -14.858 1.00 83.83  ? 112 SER B O   1 
ATOM   1611 C CB  . SER B 1 96  ? -76.932 11.625 -14.419 1.00 80.69  ? 112 SER B CB  1 
ATOM   1612 O OG  . SER B 1 96  ? -76.789 10.341 -13.851 1.00 80.63  ? 112 SER B OG  1 
ATOM   1613 N N   . LEU B 1 97  ? -79.583 10.054 -16.003 1.00 81.16  ? 113 LEU B N   1 
ATOM   1614 C CA  . LEU B 1 97  ? -80.991 9.693  -16.001 1.00 85.99  ? 113 LEU B CA  1 
ATOM   1615 C C   . LEU B 1 97  ? -81.292 8.688  -14.897 1.00 88.45  ? 113 LEU B C   1 
ATOM   1616 O O   . LEU B 1 97  ? -80.527 7.744  -14.674 1.00 84.81  ? 113 LEU B O   1 
ATOM   1617 C CB  . LEU B 1 97  ? -81.399 9.120  -17.360 1.00 82.28  ? 113 LEU B CB  1 
ATOM   1618 C CG  . LEU B 1 97  ? -80.742 9.761  -18.588 1.00 80.28  ? 113 LEU B CG  1 
ATOM   1619 C CD1 . LEU B 1 97  ? -81.173 9.063  -19.864 1.00 81.70  ? 113 LEU B CD1 1 
ATOM   1620 C CD2 . LEU B 1 97  ? -81.056 11.242 -18.660 1.00 80.72  ? 113 LEU B CD2 1 
ATOM   1621 N N   . HIS B 1 98  ? -82.404 8.911  -14.197 1.00 93.81  ? 114 HIS B N   1 
ATOM   1622 C CA  . HIS B 1 98  ? -82.951 7.928  -13.266 1.00 97.93  ? 114 HIS B CA  1 
ATOM   1623 C C   . HIS B 1 98  ? -84.468 7.998  -13.332 1.00 104.58 ? 114 HIS B C   1 
ATOM   1624 O O   . HIS B 1 98  ? -85.061 9.052  -13.067 1.00 105.59 ? 114 HIS B O   1 
ATOM   1625 C CB  . HIS B 1 98  ? -82.453 8.145  -11.832 1.00 105.17 ? 114 HIS B CB  1 
ATOM   1626 C CG  . HIS B 1 98  ? -82.567 9.556  -11.351 1.00 103.74 ? 114 HIS B CG  1 
ATOM   1627 N ND1 . HIS B 1 98  ? -81.514 10.444 -11.398 1.00 104.19 ? 114 HIS B ND1 1 
ATOM   1628 C CD2 . HIS B 1 98  ? -83.601 10.229 -10.792 1.00 100.78 ? 114 HIS B CD2 1 
ATOM   1629 C CE1 . HIS B 1 98  ? -81.898 11.606 -10.900 1.00 101.97 ? 114 HIS B CE1 1 
ATOM   1630 N NE2 . HIS B 1 98  ? -83.162 11.503 -10.527 1.00 100.25 ? 114 HIS B NE2 1 
ATOM   1631 N N   . GLY B 1 99  ? -85.084 6.889  -13.736 1.00 104.62 ? 115 GLY B N   1 
ATOM   1632 C CA  . GLY B 1 99  ? -86.528 6.859  -13.859 1.00 111.15 ? 115 GLY B CA  1 
ATOM   1633 C C   . GLY B 1 99  ? -87.004 7.926  -14.819 1.00 110.03 ? 115 GLY B C   1 
ATOM   1634 O O   . GLY B 1 99  ? -86.404 8.171  -15.872 1.00 105.86 ? 115 GLY B O   1 
ATOM   1635 N N   . SER B 1 100 ? -88.102 8.579  -14.447 1.00 116.60 ? 116 SER B N   1 
ATOM   1636 C CA  . SER B 1 100 ? -88.633 9.662  -15.260 1.00 115.42 ? 116 SER B CA  1 
ATOM   1637 C C   . SER B 1 100 ? -87.734 10.894 -15.265 1.00 109.51 ? 116 SER B C   1 
ATOM   1638 O O   . SER B 1 100 ? -87.822 11.697 -16.200 1.00 107.31 ? 116 SER B O   1 
ATOM   1639 C CB  . SER B 1 100 ? -90.031 10.045 -14.774 1.00 116.34 ? 116 SER B CB  1 
ATOM   1640 O OG  . SER B 1 100 ? -89.971 10.691 -13.514 1.00 115.96 ? 116 SER B OG  1 
ATOM   1641 N N   . GLU B 1 101 ? -86.879 11.072 -14.257 1.00 105.09 ? 117 GLU B N   1 
ATOM   1642 C CA  . GLU B 1 101 ? -86.167 12.334 -14.112 1.00 101.02 ? 117 GLU B CA  1 
ATOM   1643 C C   . GLU B 1 101 ? -84.733 12.265 -14.632 1.00 105.48 ? 117 GLU B C   1 
ATOM   1644 O O   . GLU B 1 101 ? -84.148 11.191 -14.811 1.00 113.70 ? 117 GLU B O   1 
ATOM   1645 C CB  . GLU B 1 101 ? -86.182 12.794 -12.652 1.00 118.93 ? 117 GLU B CB  1 
ATOM   1646 C CG  . GLU B 1 101 ? -87.574 13.158 -12.171 1.00 114.50 ? 117 GLU B CG  1 
ATOM   1647 C CD  . GLU B 1 101 ? -87.614 13.569 -10.707 1.00 122.39 ? 117 GLU B CD  1 
ATOM   1648 O OE1 . GLU B 1 101 ? -86.605 13.364 -9.995  1.00 131.17 ? 117 GLU B OE1 1 
ATOM   1649 O OE2 . GLU B 1 101 ? -88.662 14.096 -10.267 1.00 121.42 ? 117 GLU B OE2 1 
ATOM   1650 N N   . ALA B 1 102 ? -84.173 13.453 -14.859 1.00 102.26 ? 118 ALA B N   1 
ATOM   1651 C CA  . ALA B 1 102 ? -82.799 13.642 -15.298 1.00 103.65 ? 118 ALA B CA  1 
ATOM   1652 C C   . ALA B 1 102 ? -82.154 14.766 -14.502 1.00 99.25  ? 118 ALA B C   1 
ATOM   1653 O O   . ALA B 1 102 ? -82.772 15.810 -14.275 1.00 94.31  ? 118 ALA B O   1 
ATOM   1654 C CB  . ALA B 1 102 ? -82.737 13.972 -16.789 1.00 89.56  ? 118 ALA B CB  1 
ATOM   1655 N N   . ASP B 1 103 ? -80.918 14.543 -14.066 1.00 93.97  ? 119 ASP B N   1 
ATOM   1656 C CA  . ASP B 1 103 ? -80.115 15.560 -13.405 1.00 92.60  ? 119 ASP B CA  1 
ATOM   1657 C C   . ASP B 1 103 ? -79.032 16.045 -14.359 1.00 87.90  ? 119 ASP B C   1 
ATOM   1658 O O   . ASP B 1 103 ? -78.642 15.339 -15.288 1.00 85.01  ? 119 ASP B O   1 
ATOM   1659 C CB  . ASP B 1 103 ? -79.503 15.016 -12.116 1.00 100.10 ? 119 ASP B CB  1 
ATOM   1660 C CG  . ASP B 1 103 ? -80.563 14.578 -11.118 1.00 105.06 ? 119 ASP B CG  1 
ATOM   1661 O OD1 . ASP B 1 103 ? -81.761 14.849 -11.373 1.00 105.66 ? 119 ASP B OD1 1 
ATOM   1662 O OD2 . ASP B 1 103 ? -80.207 13.976 -10.077 1.00 108.12 ? 119 ASP B OD2 1 
ATOM   1663 N N   . THR B 1 104 ? -78.551 17.262 -14.136 1.00 88.04  ? 120 THR B N   1 
ATOM   1664 C CA  . THR B 1 104 ? -77.684 17.941 -15.093 1.00 85.31  ? 120 THR B CA  1 
ATOM   1665 C C   . THR B 1 104 ? -76.228 17.854 -14.655 1.00 86.41  ? 120 THR B C   1 
ATOM   1666 O O   . THR B 1 104 ? -75.879 18.284 -13.551 1.00 90.15  ? 120 THR B O   1 
ATOM   1667 C CB  . THR B 1 104 ? -78.098 19.402 -15.260 1.00 86.23  ? 120 THR B CB  1 
ATOM   1668 O OG1 . THR B 1 104 ? -79.394 19.460 -15.865 1.00 85.10  ? 120 THR B OG1 1 
ATOM   1669 C CG2 . THR B 1 104 ? -77.105 20.134 -16.131 1.00 84.46  ? 120 THR B CG2 1 
ATOM   1670 N N   . LEU B 1 105 ? -75.385 17.293 -15.521 1.00 83.52  ? 121 LEU B N   1 
ATOM   1671 C CA  . LEU B 1 105 ? -73.969 17.121 -15.225 1.00 84.72  ? 121 LEU B CA  1 
ATOM   1672 C C   . LEU B 1 105 ? -73.146 18.303 -15.717 1.00 84.72  ? 121 LEU B C   1 
ATOM   1673 O O   . LEU B 1 105 ? -72.165 18.691 -15.072 1.00 87.59  ? 121 LEU B O   1 
ATOM   1674 C CB  . LEU B 1 105 ? -73.457 15.826 -15.863 1.00 82.28  ? 121 LEU B CB  1 
ATOM   1675 C CG  . LEU B 1 105 ? -74.123 14.547 -15.355 1.00 82.94  ? 121 LEU B CG  1 
ATOM   1676 C CD1 . LEU B 1 105 ? -74.233 13.495 -16.443 1.00 79.27  ? 121 LEU B CD1 1 
ATOM   1677 C CD2 . LEU B 1 105 ? -73.364 14.010 -14.177 1.00 86.92  ? 121 LEU B CD2 1 
ATOM   1678 N N   . ARG B 1 106 ? -73.528 18.865 -16.859 1.00 83.58  ? 122 ARG B N   1 
ATOM   1679 C CA  . ARG B 1 106 ? -72.884 20.031 -17.443 1.00 85.26  ? 122 ARG B CA  1 
ATOM   1680 C C   . ARG B 1 106 ? -73.816 20.611 -18.493 1.00 83.43  ? 122 ARG B C   1 
ATOM   1681 O O   . ARG B 1 106 ? -74.611 19.887 -19.095 1.00 79.66  ? 122 ARG B O   1 
ATOM   1682 C CB  . ARG B 1 106 ? -71.534 19.685 -18.079 1.00 81.48  ? 122 ARG B CB  1 
ATOM   1683 C CG  . ARG B 1 106 ? -70.711 20.905 -18.456 1.00 84.54  ? 122 ARG B CG  1 
ATOM   1684 C CD  . ARG B 1 106 ? -69.396 20.525 -19.110 1.00 87.17  ? 122 ARG B CD  1 
ATOM   1685 N NE  . ARG B 1 106 ? -68.404 21.586 -18.978 1.00 96.10  ? 122 ARG B NE  1 
ATOM   1686 C CZ  . ARG B 1 106 ? -67.238 21.597 -19.614 1.00 101.58 ? 122 ARG B CZ  1 
ATOM   1687 N NH1 . ARG B 1 106 ? -66.918 20.605 -20.433 1.00 97.09  ? 122 ARG B NH1 1 
ATOM   1688 N NH2 . ARG B 1 106 ? -66.392 22.603 -19.435 1.00 110.22 ? 122 ARG B NH2 1 
ATOM   1689 N N   . LYS B 1 107 ? -73.715 21.921 -18.708 1.00 85.03  ? 123 LYS B N   1 
ATOM   1690 C CA  . LYS B 1 107 ? -74.333 22.560 -19.859 1.00 83.34  ? 123 LYS B CA  1 
ATOM   1691 C C   . LYS B 1 107 ? -73.284 23.398 -20.577 1.00 87.20  ? 123 LYS B C   1 
ATOM   1692 O O   . LYS B 1 107 ? -72.488 24.096 -19.938 1.00 92.06  ? 123 LYS B O   1 
ATOM   1693 C CB  . LYS B 1 107 ? -75.540 23.416 -19.465 1.00 90.87  ? 123 LYS B CB  1 
ATOM   1694 C CG  . LYS B 1 107 ? -75.340 24.277 -18.241 1.00 92.00  ? 123 LYS B CG  1 
ATOM   1695 C CD  . LYS B 1 107 ? -76.486 25.269 -18.078 1.00 90.76  ? 123 LYS B CD  1 
ATOM   1696 C CE  . LYS B 1 107 ? -77.838 24.568 -18.064 1.00 89.36  ? 123 LYS B CE  1 
ATOM   1697 N NZ  . LYS B 1 107 ? -78.925 25.468 -17.564 1.00 92.50  ? 123 LYS B NZ  1 
ATOM   1698 N N   . VAL B 1 108 ? -73.277 23.310 -21.909 1.00 89.94  ? 124 VAL B N   1 
ATOM   1699 C CA  . VAL B 1 108 ? -72.277 23.963 -22.743 1.00 94.59  ? 124 VAL B CA  1 
ATOM   1700 C C   . VAL B 1 108 ? -72.963 24.677 -23.896 1.00 88.89  ? 124 VAL B C   1 
ATOM   1701 O O   . VAL B 1 108 ? -74.052 24.294 -24.336 1.00 78.49  ? 124 VAL B O   1 
ATOM   1702 C CB  . VAL B 1 108 ? -71.230 22.965 -23.278 1.00 94.13  ? 124 VAL B CB  1 
ATOM   1703 C CG1 . VAL B 1 108 ? -70.411 22.398 -22.135 1.00 98.67  ? 124 VAL B CG1 1 
ATOM   1704 C CG2 . VAL B 1 108 ? -71.918 21.847 -24.045 1.00 82.86  ? 124 VAL B CG2 1 
ATOM   1705 N N   . LEU B 1 109 ? -72.307 25.722 -24.388 1.00 92.08  ? 125 LEU B N   1 
ATOM   1706 C CA  . LEU B 1 109 ? -72.667 26.382 -25.633 1.00 84.73  ? 125 LEU B CA  1 
ATOM   1707 C C   . LEU B 1 109 ? -71.744 25.878 -26.731 1.00 87.49  ? 125 LEU B C   1 
ATOM   1708 O O   . LEU B 1 109 ? -70.570 25.607 -26.479 1.00 98.20  ? 125 LEU B O   1 
ATOM   1709 C CB  . LEU B 1 109 ? -72.518 27.900 -25.498 1.00 90.60  ? 125 LEU B CB  1 
ATOM   1710 C CG  . LEU B 1 109 ? -73.558 28.705 -24.719 1.00 90.37  ? 125 LEU B CG  1 
ATOM   1711 C CD1 . LEU B 1 109 ? -73.210 30.177 -24.764 1.00 95.26  ? 125 LEU B CD1 1 
ATOM   1712 C CD2 . LEU B 1 109 ? -74.931 28.484 -25.300 1.00 87.99  ? 125 LEU B CD2 1 
ATOM   1713 N N   . VAL B 1 110 ? -72.275 25.722 -27.941 1.00 91.77  ? 126 VAL B N   1 
ATOM   1714 C CA  . VAL B 1 110 ? -71.456 25.456 -29.121 1.00 93.34  ? 126 VAL B CA  1 
ATOM   1715 C C   . VAL B 1 110 ? -71.584 26.627 -30.087 1.00 94.14  ? 126 VAL B C   1 
ATOM   1716 O O   . VAL B 1 110 ? -72.687 27.135 -30.327 1.00 92.47  ? 126 VAL B O   1 
ATOM   1717 C CB  . VAL B 1 110 ? -71.825 24.121 -29.795 1.00 88.18  ? 126 VAL B CB  1 
ATOM   1718 C CG1 . VAL B 1 110 ? -71.511 22.965 -28.875 1.00 87.40  ? 126 VAL B CG1 1 
ATOM   1719 C CG2 . VAL B 1 110 ? -73.269 24.084 -30.150 1.00 85.16  ? 126 VAL B CG2 1 
ATOM   1720 N N   . GLU B 1 111 ? -70.445 27.065 -30.619 1.00 101.53 ? 127 GLU B N   1 
ATOM   1721 C CA  . GLU B 1 111 ? -70.341 28.096 -31.638 1.00 102.42 ? 127 GLU B CA  1 
ATOM   1722 C C   . GLU B 1 111 ? -69.681 27.513 -32.883 1.00 105.42 ? 127 GLU B C   1 
ATOM   1723 O O   . GLU B 1 111 ? -69.038 26.460 -32.836 1.00 110.40 ? 127 GLU B O   1 
ATOM   1724 C CB  . GLU B 1 111 ? -69.540 29.300 -31.125 1.00 113.17 ? 127 GLU B CB  1 
ATOM   1725 C CG  . GLU B 1 111 ? -69.995 29.808 -29.774 1.00 111.26 ? 127 GLU B CG  1 
ATOM   1726 C CD  . GLU B 1 111 ? -69.417 31.175 -29.442 1.00 116.37 ? 127 GLU B CD  1 
ATOM   1727 O OE1 . GLU B 1 111 ? -69.915 31.836 -28.496 1.00 114.63 ? 127 GLU B OE1 1 
ATOM   1728 O OE2 . GLU B 1 111 ? -68.470 31.596 -30.146 1.00 123.62 ? 127 GLU B OE2 1 
ATOM   1729 N N   . VAL B 1 112 ? -69.852 28.208 -34.009 1.00 101.14 ? 128 VAL B N   1 
ATOM   1730 C CA  . VAL B 1 112 ? -69.377 27.737 -35.304 1.00 102.63 ? 128 VAL B CA  1 
ATOM   1731 C C   . VAL B 1 112 ? -68.836 28.913 -36.113 1.00 109.78 ? 128 VAL B C   1 
ATOM   1732 O O   . VAL B 1 112 ? -69.348 30.032 -36.024 1.00 109.64 ? 128 VAL B O   1 
ATOM   1733 C CB  . VAL B 1 112 ? -70.520 27.027 -36.069 1.00 101.22 ? 128 VAL B CB  1 
ATOM   1734 C CG1 . VAL B 1 112 ? -70.059 26.574 -37.418 1.00 102.15 ? 128 VAL B CG1 1 
ATOM   1735 C CG2 . VAL B 1 112 ? -71.059 25.847 -35.279 1.00 95.05  ? 128 VAL B CG2 1 
ATOM   1736 N N   . LEU B 1 113 ? -67.798 28.656 -36.916 1.00 109.30 ? 129 LEU B N   1 
ATOM   1737 C CA  . LEU B 1 113 ? -67.390 29.570 -37.979 1.00 115.30 ? 129 LEU B CA  1 
ATOM   1738 C C   . LEU B 1 113 ? -67.345 28.780 -39.283 1.00 113.92 ? 129 LEU B C   1 
ATOM   1739 O O   . LEU B 1 113 ? -66.895 27.629 -39.304 1.00 117.10 ? 129 LEU B O   1 
ATOM   1740 C CB  . LEU B 1 113 ? -66.042 30.255 -37.665 1.00 115.09 ? 129 LEU B CB  1 
ATOM   1741 C CG  . LEU B 1 113 ? -65.368 31.225 -38.660 1.00 125.22 ? 129 LEU B CG  1 
ATOM   1742 C CD1 . LEU B 1 113 ? -64.685 30.602 -39.889 1.00 135.29 ? 129 LEU B CD1 1 
ATOM   1743 C CD2 . LEU B 1 113 ? -66.330 32.365 -39.043 1.00 119.69 ? 129 LEU B CD2 1 
ATOM   1744 N N   . ALA B 1 114 ? -67.822 29.405 -40.363 1.00 115.28 ? 130 ALA B N   1 
ATOM   1745 C CA  . ALA B 1 114 ? -68.008 28.712 -41.639 1.00 112.77 ? 130 ALA B CA  1 
ATOM   1746 C C   . ALA B 1 114 ? -66.730 28.097 -42.198 1.00 124.65 ? 130 ALA B C   1 
ATOM   1747 O O   . ALA B 1 114 ? -65.631 28.633 -42.042 1.00 139.14 ? 130 ALA B O   1 
ATOM   1748 C CB  . ALA B 1 114 ? -68.581 29.670 -42.675 1.00 109.81 ? 130 ALA B CB  1 
ATOM   1749 N N   . ASP B 1 115 ? -66.905 26.972 -42.889 1.00 114.22 ? 131 ASP B N   1 
ATOM   1750 C CA  . ASP B 1 115 ? -65.833 26.271 -43.584 1.00 124.39 ? 131 ASP B CA  1 
ATOM   1751 C C   . ASP B 1 115 ? -65.162 27.161 -44.629 1.00 135.13 ? 131 ASP B C   1 
ATOM   1752 O O   . ASP B 1 115 ? -65.665 28.236 -44.967 1.00 132.36 ? 131 ASP B O   1 
ATOM   1753 C CB  . ASP B 1 115 ? -66.391 25.004 -44.247 1.00 117.25 ? 131 ASP B CB  1 
ATOM   1754 C CG  . ASP B 1 115 ? -65.311 24.005 -44.607 1.00 124.96 ? 131 ASP B CG  1 
ATOM   1755 O OD1 . ASP B 1 115 ? -65.499 23.247 -45.584 1.00 114.43 ? 131 ASP B OD1 1 
ATOM   1756 O OD2 . ASP B 1 115 ? -64.279 23.970 -43.906 1.00 139.70 ? 131 ASP B OD2 1 
HETATM 1757 C C1  . NAG C 2 .   ? -61.226 19.136 -21.569 1.00 162.91 ? 201 NAG A C1  1 
HETATM 1758 C C2  . NAG C 2 .   ? -61.523 20.286 -20.597 1.00 163.26 ? 201 NAG A C2  1 
HETATM 1759 C C3  . NAG C 2 .   ? -61.452 21.620 -21.323 1.00 169.65 ? 201 NAG A C3  1 
HETATM 1760 C C4  . NAG C 2 .   ? -60.053 21.827 -21.882 1.00 175.61 ? 201 NAG A C4  1 
HETATM 1761 C C5  . NAG C 2 .   ? -59.666 20.654 -22.778 1.00 176.27 ? 201 NAG A C5  1 
HETATM 1762 C C6  . NAG C 2 .   ? -58.405 19.946 -22.339 1.00 177.19 ? 201 NAG A C6  1 
HETATM 1763 C C7  . NAG C 2 .   ? -63.027 20.289 -18.660 1.00 163.37 ? 201 NAG A C7  1 
HETATM 1764 C C8  . NAG C 2 .   ? -64.432 20.082 -18.181 1.00 154.32 ? 201 NAG A C8  1 
HETATM 1765 N N2  . NAG C 2 .   ? -62.824 20.119 -19.969 1.00 165.43 ? 201 NAG A N2  1 
HETATM 1766 O O3  . NAG C 2 .   ? -61.775 22.671 -20.421 1.00 155.20 ? 201 NAG A O3  1 
HETATM 1767 O O4  . NAG C 2 .   ? -60.004 23.032 -22.637 1.00 171.79 ? 201 NAG A O4  1 
HETATM 1768 O O5  . NAG C 2 .   ? -60.717 19.671 -22.838 1.00 166.95 ? 201 NAG A O5  1 
HETATM 1769 O O6  . NAG C 2 .   ? -57.348 20.154 -23.264 1.00 170.74 ? 201 NAG A O6  1 
HETATM 1770 O O7  . NAG C 2 .   ? -62.117 20.593 -17.896 1.00 161.41 ? 201 NAG A O7  1 
HETATM 1771 C C1  . NAG D 2 .   ? -82.496 12.389 -33.249 1.00 146.73 ? 201 NAG B C1  1 
HETATM 1772 C C2  . NAG D 2 .   ? -83.526 11.838 -32.259 1.00 161.76 ? 201 NAG B C2  1 
HETATM 1773 C C3  . NAG D 2 .   ? -84.862 12.555 -32.405 1.00 164.02 ? 201 NAG B C3  1 
HETATM 1774 C C4  . NAG D 2 .   ? -84.672 14.035 -32.110 1.00 160.31 ? 201 NAG B C4  1 
HETATM 1775 C C5  . NAG D 2 .   ? -83.573 14.628 -32.994 1.00 149.22 ? 201 NAG B C5  1 
HETATM 1776 C C6  . NAG D 2 .   ? -82.433 15.242 -32.214 1.00 146.78 ? 201 NAG B C6  1 
HETATM 1777 C C7  . NAG D 2 .   ? -84.073 9.591  -33.312 1.00 165.14 ? 201 NAG B C7  1 
HETATM 1778 C C8  . NAG D 2 .   ? -84.469 10.252 -34.609 1.00 156.17 ? 201 NAG B C8  1 
HETATM 1779 N N2  . NAG D 2 .   ? -83.666 10.382 -32.297 1.00 163.88 ? 201 NAG B N2  1 
HETATM 1780 O O3  . NAG D 2 .   ? -85.802 11.990 -31.499 1.00 171.94 ? 201 NAG B O3  1 
HETATM 1781 O O4  . NAG D 2 .   ? -85.890 14.734 -32.336 1.00 163.24 ? 201 NAG B O4  1 
HETATM 1782 O O5  . NAG D 2 .   ? -83.005 13.631 -33.865 1.00 140.66 ? 201 NAG B O5  1 
HETATM 1783 O O6  . NAG D 2 .   ? -81.313 15.503 -33.049 1.00 144.62 ? 201 NAG B O6  1 
HETATM 1784 O O7  . NAG D 2 .   ? -84.126 8.373  -33.181 1.00 169.59 ? 201 NAG B O7  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASN A 4   ? 1.7861 1.6643 1.7236 -0.3247 0.0022  0.3096  20  ASN A N   
2    C CA  . ASN A 4   ? 1.7325 1.7042 1.7223 -0.3101 0.0484  0.2973  20  ASN A CA  
3    C C   . ASN A 4   ? 1.6837 1.6537 1.6512 -0.2626 0.0687  0.2696  20  ASN A C   
4    O O   . ASN A 4   ? 1.6515 1.6366 1.6460 -0.2299 0.0670  0.2478  20  ASN A O   
5    C CB  . ASN A 4   ? 1.7159 1.7424 1.7852 -0.3101 0.0462  0.2920  20  ASN A CB  
6    C CG  . ASN A 4   ? 1.7214 1.6929 1.7789 -0.2874 0.0112  0.2759  20  ASN A CG  
7    O OD1 . ASN A 4   ? 1.7236 1.6263 1.7181 -0.2650 -0.0050 0.2626  20  ASN A OD1 
8    N ND2 . ASN A 4   ? 1.7106 1.7170 1.8320 -0.2937 0.0004  0.2750  20  ASN A ND2 
9    N N   . THR A 5   ? 1.6759 1.6285 1.5948 -0.2630 0.0849  0.2741  21  THR A N   
10   C CA  . THR A 5   ? 1.6296 1.5926 1.5352 -0.2221 0.1080  0.2532  21  THR A CA  
11   C C   . THR A 5   ? 1.5870 1.6505 1.5538 -0.2157 0.1478  0.2417  21  THR A C   
12   O O   . THR A 5   ? 1.5923 1.7210 1.6112 -0.2454 0.1629  0.2499  21  THR A O   
13   C CB  . THR A 5   ? 1.6710 1.5805 1.5068 -0.2289 0.1106  0.2642  21  THR A CB  
14   O OG1 . THR A 5   ? 1.6876 1.6383 1.5204 -0.2746 0.1323  0.2859  21  THR A OG1 
15   C CG2 . THR A 5   ? 1.7048 1.5146 1.4908 -0.2360 0.0667  0.2726  21  THR A CG2 
16   N N   . THR A 6   ? 1.5558 1.6328 1.5207 -0.1752 0.1629  0.2214  22  THR A N   
17   C CA  . THR A 6   ? 1.5200 1.6863 1.5435 -0.1611 0.1959  0.2034  22  THR A CA  
18   C C   . THR A 6   ? 1.5090 1.6719 1.4821 -0.1514 0.2235  0.2001  22  THR A C   
19   O O   . THR A 6   ? 1.5201 1.6065 1.4211 -0.1439 0.2108  0.2096  22  THR A O   
20   C CB  . THR A 6   ? 1.4230 1.6159 1.5038 -0.1216 0.1800  0.1809  22  THR A CB  
21   O OG1 . THR A 6   ? 1.3973 1.5322 1.4270 -0.0856 0.1629  0.1754  22  THR A OG1 
22   C CG2 . THR A 6   ? 1.4434 1.6351 1.5690 -0.1377 0.1502  0.1861  22  THR A CG2 
23   N N   . VAL A 7   ? 1.4836 1.7293 1.4976 -0.1518 0.2605  0.1848  23  VAL A N   
24   C CA  . VAL A 7   ? 1.4691 1.7184 1.4300 -0.1552 0.2915  0.1830  23  VAL A CA  
25   C C   . VAL A 7   ? 1.4209 1.7150 1.4177 -0.1073 0.3055  0.1509  23  VAL A C   
26   O O   . VAL A 7   ? 1.3776 1.7357 1.4621 -0.0856 0.3032  0.1280  23  VAL A O   
27   C CB  . VAL A 7   ? 1.4401 1.7493 1.4006 -0.2089 0.3272  0.1936  23  VAL A CB  
28   C CG1 . VAL A 7   ? 1.3977 1.8242 1.4615 -0.2064 0.3567  0.1675  23  VAL A CG1 
29   C CG2 . VAL A 7   ? 1.4629 1.7538 1.3420 -0.2249 0.3526  0.1993  23  VAL A CG2 
30   N N   . PHE A 8   ? 1.4839 1.7379 1.4135 -0.0917 0.3137  0.1507  24  PHE A N   
31   C CA  . PHE A 8   ? 1.4113 1.6922 1.3597 -0.0454 0.3210  0.1235  24  PHE A CA  
32   C C   . PHE A 8   ? 1.4284 1.7153 1.3156 -0.0602 0.3575  0.1203  24  PHE A C   
33   O O   . PHE A 8   ? 1.5083 1.7179 1.3055 -0.0808 0.3525  0.1465  24  PHE A O   
34   C CB  . PHE A 8   ? 1.3635 1.5701 1.2838 -0.0030 0.2813  0.1301  24  PHE A CB  
35   C CG  . PHE A 8   ? 1.3096 1.5313 1.2977 0.0191  0.2477  0.1232  24  PHE A CG  
36   C CD1 . PHE A 8   ? 1.2041 1.4822 1.2660 0.0543  0.2364  0.0982  24  PHE A CD1 
37   C CD2 . PHE A 8   ? 1.3810 1.5574 1.3572 0.0023  0.2228  0.1412  24  PHE A CD2 
38   C CE1 . PHE A 8   ? 1.1730 1.4620 1.2929 0.0666  0.1997  0.0958  24  PHE A CE1 
39   C CE2 . PHE A 8   ? 1.3530 1.5417 1.3819 0.0166  0.1917  0.1354  24  PHE A CE2 
40   C CZ  . PHE A 8   ? 1.2458 1.4906 1.3451 0.0459  0.1795  0.1150  24  PHE A CZ  
41   N N   . GLN A 9   ? 1.4929 1.8691 1.4292 -0.0507 0.3918  0.0867  25  GLN A N   
42   C CA  . GLN A 9   ? 1.5092 1.9057 1.3876 -0.0698 0.4331  0.0776  25  GLN A CA  
43   C C   . GLN A 9   ? 1.4416 1.8184 1.3021 -0.0184 0.4271  0.0552  25  GLN A C   
44   O O   . GLN A 9   ? 1.2908 1.7074 1.2303 0.0294  0.4111  0.0260  25  GLN A O   
45   C CB  . GLN A 9   ? 1.4516 1.9696 1.3923 -0.0971 0.4824  0.0499  25  GLN A CB  
46   C CG  . GLN A 9   ? 1.4739 2.0230 1.4366 -0.1522 0.4900  0.0741  25  GLN A CG  
47   C CD  . GLN A 9   ? 1.4355 2.1140 1.4615 -0.1791 0.5433  0.0462  25  GLN A CD  
48   O OE1 . GLN A 9   ? 1.3769 2.1317 1.4653 -0.1443 0.5682  -0.0011 25  GLN A OE1 
49   N NE2 . GLN A 9   ? 1.4696 2.1761 1.4832 -0.2416 0.5591  0.0743  25  GLN A NE2 
50   N N   . GLY A 10  ? 1.4938 1.8050 1.2517 -0.0307 0.4338  0.0714  26  GLY A N   
51   C CA  . GLY A 10  ? 1.4009 1.6798 1.1284 0.0146  0.4245  0.0562  26  GLY A CA  
52   C C   . GLY A 10  ? 1.4935 1.7820 1.1455 -0.0109 0.4656  0.0455  26  GLY A C   
53   O O   . GLY A 10  ? 1.6575 1.9206 1.2335 -0.0698 0.4849  0.0717  26  GLY A O   
54   N N   . VAL A 11  ? 1.4921 1.8172 1.1643 0.0314  0.4754  0.0059  27  VAL A N   
55   C CA  . VAL A 11  ? 1.5800 1.8912 1.1629 0.0160  0.5059  -0.0043 27  VAL A CA  
56   C C   . VAL A 11  ? 1.6473 1.8216 1.1277 0.0213  0.4671  0.0387  27  VAL A C   
57   O O   . VAL A 11  ? 1.4456 1.5650 0.9471 0.0719  0.4203  0.0487  27  VAL A O   
58   C CB  . VAL A 11  ? 1.4785 1.8680 1.1197 0.0650  0.5235  -0.0650 27  VAL A CB  
59   C CG1 . VAL A 11  ? 1.5573 1.9041 1.0919 0.0607  0.5417  -0.0732 27  VAL A CG1 
60   C CG2 . VAL A 11  ? 1.4068 1.9375 1.1438 0.0497  0.5718  -0.1104 27  VAL A CG2 
61   N N   . ALA A 12  ? 1.6242 1.7439 0.9955 -0.0346 0.4836  0.0665  28  ALA A N   
62   C CA  . ALA A 12  ? 1.6413 1.6268 0.9181 -0.0344 0.4454  0.1086  28  ALA A CA  
63   C C   . ALA A 12  ? 1.6475 1.6059 0.9045 0.0200  0.4328  0.0876  28  ALA A C   
64   O O   . ALA A 12  ? 1.6706 1.7063 0.9484 0.0376  0.4654  0.0396  28  ALA A O   
65   C CB  . ALA A 12  ? 1.7929 1.7267 0.9585 -0.1130 0.4617  0.1423  28  ALA A CB  
66   N N   . GLY A 13  ? 1.6594 1.5069 0.8790 0.0475  0.3830  0.1232  29  GLY A N   
67   C CA  . GLY A 13  ? 1.6627 1.4685 0.8628 0.1005  0.3582  0.1140  29  GLY A CA  
68   C C   . GLY A 13  ? 1.6018 1.4615 0.9084 0.1715  0.3304  0.0854  29  GLY A C   
69   O O   . GLY A 13  ? 1.6033 1.4254 0.9001 0.2187  0.2994  0.0815  29  GLY A O   
70   N N   . GLN A 14  ? 1.5267 1.4682 0.9333 0.1777  0.3348  0.0684  30  GLN A N   
71   C CA  . GLN A 14  ? 1.4992 1.4906 1.0107 0.2364  0.3011  0.0455  30  GLN A CA  
72   C C   . GLN A 14  ? 1.4524 1.4480 1.0210 0.2304  0.2791  0.0690  30  GLN A C   
73   O O   . GLN A 14  ? 1.4391 1.4269 0.9858 0.1831  0.2996  0.0882  30  GLN A O   
74   C CB  . GLN A 14  ? 1.4470 1.5564 1.0401 0.2558  0.3300  -0.0175 30  GLN A CB  
75   C CG  . GLN A 14  ? 1.4326 1.6429 1.0943 0.2207  0.3727  -0.0410 30  GLN A CG  
76   C CD  . GLN A 14  ? 1.4296 1.7547 1.2051 0.2550  0.3841  -0.1037 30  GLN A CD  
77   O OE1 . GLN A 14  ? 1.4592 1.8383 1.2263 0.2543  0.4245  -0.1474 30  GLN A OE1 
78   N NE2 . GLN A 14  ? 1.3894 1.7518 1.2738 0.2841  0.3462  -0.1100 30  GLN A NE2 
79   N N   . SER A 15  ? 1.3111 1.3192 0.9514 0.2763  0.2340  0.0673  31  SER A N   
80   C CA  . SER A 15  ? 1.2686 1.2540 0.9379 0.2753  0.2032  0.0970  31  SER A CA  
81   C C   . SER A 15  ? 1.2548 1.3241 1.0094 0.2568  0.2179  0.0772  31  SER A C   
82   O O   . SER A 15  ? 1.2661 1.4229 1.0955 0.2654  0.2325  0.0374  31  SER A O   
83   C CB  . SER A 15  ? 1.3150 1.2762 1.0144 0.3254  0.1449  0.1099  31  SER A CB  
84   O OG  . SER A 15  ? 1.3259 1.2063 0.9497 0.3436  0.1270  0.1319  31  SER A OG  
85   N N   . LEU A 16  ? 1.2023 1.2409 0.9487 0.2324  0.2106  0.1046  32  LEU A N   
86   C CA  . LEU A 16  ? 1.1901 1.2879 1.0012 0.2079  0.2210  0.0950  32  LEU A CA  
87   C C   . LEU A 16  ? 1.1457 1.2235 0.9880 0.2229  0.1781  0.1131  32  LEU A C   
88   O O   . LEU A 16  ? 1.1319 1.1355 0.9207 0.2298  0.1565  0.1420  32  LEU A O   
89   C CB  . LEU A 16  ? 1.1946 1.2741 0.9560 0.1529  0.2560  0.1100  32  LEU A CB  
90   C CG  . LEU A 16  ? 1.1884 1.3122 1.0074 0.1255  0.2598  0.1084  32  LEU A CG  
91   C CD1 . LEU A 16  ? 1.1789 1.4102 1.0946 0.1295  0.2774  0.0713  32  LEU A CD1 
92   C CD2 . LEU A 16  ? 1.2321 1.3201 0.9939 0.0715  0.2804  0.1315  32  LEU A CD2 
93   N N   . GLN A 17  ? 1.0454 1.1900 0.9747 0.2253  0.1656  0.0957  33  GLN A N   
94   C CA  . GLN A 17  ? 1.0121 1.1462 0.9685 0.2315  0.1265  0.1106  33  GLN A CA  
95   C C   . GLN A 17  ? 1.0243 1.1842 1.0117 0.1944  0.1392  0.1091  33  GLN A C   
96   O O   . GLN A 17  ? 1.0371 1.2616 1.0820 0.1780  0.1603  0.0879  33  GLN A O   
97   C CB  . GLN A 17  ? 1.0091 1.1879 1.0388 0.2659  0.0831  0.0979  33  GLN A CB  
98   C CG  . GLN A 17  ? 0.9797 1.1105 0.9700 0.3016  0.0485  0.1168  33  GLN A CG  
99   C CD  . GLN A 17  ? 0.9458 1.1136 1.0045 0.3271  -0.0078 0.1149  33  GLN A CD  
100  O OE1 . GLN A 17  ? 0.9257 1.1563 1.0678 0.3203  -0.0217 0.0944  33  GLN A OE1 
101  N NE2 . GLN A 17  ? 0.9047 1.0325 0.9310 0.3535  -0.0453 0.1395  33  GLN A NE2 
102  N N   . VAL A 18  ? 1.0706 1.1811 1.0231 0.1823  0.1249  0.1303  34  VAL A N   
103  C CA  . VAL A 18  ? 1.0882 1.2106 1.0635 0.1497  0.1272  0.1313  34  VAL A CA  
104  C C   . VAL A 18  ? 1.0700 1.1958 1.0737 0.1601  0.0867  0.1353  34  VAL A C   
105  O O   . VAL A 18  ? 1.0340 1.1265 1.0068 0.1837  0.0631  0.1473  34  VAL A O   
106  C CB  . VAL A 18  ? 1.1390 1.1970 1.0438 0.1202  0.1451  0.1489  34  VAL A CB  
107  C CG1 . VAL A 18  ? 1.1722 1.2391 1.0528 0.0952  0.1832  0.1475  34  VAL A CG1 
108  C CG2 . VAL A 18  ? 1.1274 1.1095 0.9679 0.1396  0.1285  0.1665  34  VAL A CG2 
109  N N   . SER A 19  ? 1.0137 1.1813 1.0756 0.1391  0.0776  0.1271  35  SER A N   
110  C CA  . SER A 19  ? 1.0018 1.1801 1.0926 0.1396  0.0374  0.1303  35  SER A CA  
111  C C   . SER A 19  ? 1.0421 1.1942 1.1128 0.1068  0.0392  0.1358  35  SER A C   
112  O O   . SER A 19  ? 1.0832 1.2528 1.1807 0.0793  0.0559  0.1318  35  SER A O   
113  C CB  . SER A 19  ? 1.0127 1.2605 1.1988 0.1431  0.0118  0.1157  35  SER A CB  
114  O OG  . SER A 19  ? 1.0257 1.3150 1.2658 0.1206  0.0364  0.1018  35  SER A OG  
115  N N   . CYS A 20  ? 0.9993 1.1111 1.0231 0.1100  0.0218  0.1441  36  CYS A N   
116  C CA  . CYS A 20  ? 1.0484 1.1330 1.0504 0.0835  0.0164  0.1444  36  CYS A CA  
117  C C   . CYS A 20  ? 1.0404 1.1558 1.0741 0.0748  -0.0208 0.1432  36  CYS A C   
118  O O   . CYS A 20  ? 1.0054 1.1171 1.0143 0.0901  -0.0404 0.1474  36  CYS A O   
119  C CB  . CYS A 20  ? 1.2616 1.2801 1.1886 0.0930  0.0248  0.1482  36  CYS A CB  
120  S SG  . CYS A 20  ? 1.2716 1.2449 1.1609 0.0866  0.0591  0.1545  36  CYS A SG  
121  N N   . PRO A 21  ? 0.9269 1.0730 1.0146 0.0470  -0.0338 0.1403  37  PRO A N   
122  C CA  . PRO A 21  ? 0.9280 1.0945 1.0382 0.0294  -0.0744 0.1423  37  PRO A CA  
123  C C   . PRO A 21  ? 0.9805 1.1031 1.0279 0.0101  -0.0771 0.1410  37  PRO A C   
124  O O   . PRO A 21  ? 1.0291 1.1090 1.0392 0.0028  -0.0538 0.1373  37  PRO A O   
125  C CB  . PRO A 21  ? 0.9207 1.1277 1.1159 0.0046  -0.0866 0.1401  37  PRO A CB  
126  C CG  . PRO A 21  ? 0.9129 1.1370 1.1356 0.0174  -0.0486 0.1336  37  PRO A CG  
127  C CD  . PRO A 21  ? 0.9403 1.1114 1.0791 0.0289  -0.0150 0.1367  37  PRO A CD  
128  N N   . TYR A 22  ? 1.1247 1.0078 0.9726 -0.2264 0.0064  -0.0100 38  TYR A N   
129  C CA  . TYR A 22  ? 1.1308 0.9779 0.9656 -0.2694 0.0017  -0.0223 38  TYR A CA  
130  C C   . TYR A 22  ? 1.1169 1.0155 0.9712 -0.2701 -0.0397 -0.0319 38  TYR A C   
131  O O   . TYR A 22  ? 1.1022 1.0431 0.9761 -0.2344 -0.0675 -0.0227 38  TYR A O   
132  C CB  . TYR A 22  ? 1.1980 0.9338 0.9704 -0.2579 0.0118  -0.0175 38  TYR A CB  
133  C CG  . TYR A 22  ? 1.1721 0.8801 0.9200 -0.2106 -0.0147 -0.0082 38  TYR A CG  
134  C CD1 . TYR A 22  ? 1.1603 0.8626 0.8998 -0.2117 -0.0381 -0.0134 38  TYR A CD1 
135  C CD2 . TYR A 22  ? 1.1656 0.8565 0.8980 -0.1677 -0.0165 0.0053  38  TYR A CD2 
136  C CE1 . TYR A 22  ? 1.1337 0.8179 0.8617 -0.1774 -0.0615 0.0003  38  TYR A CE1 
137  C CE2 . TYR A 22  ? 1.1433 0.8063 0.8603 -0.1328 -0.0461 0.0125  38  TYR A CE2 
138  C CZ  . TYR A 22  ? 1.1228 0.7847 0.8435 -0.1408 -0.0680 0.0129  38  TYR A CZ  
139  O OH  . TYR A 22  ? 1.1021 0.7438 0.8181 -0.1142 -0.0966 0.0254  38  TYR A OH  
140  N N   . ASP A 23  ? 1.1234 1.0102 0.9655 -0.3105 -0.0443 -0.0505 39  ASP A N   
141  C CA  . ASP A 23  ? 1.1222 1.0546 0.9647 -0.3174 -0.0803 -0.0597 39  ASP A CA  
142  C C   . ASP A 23  ? 1.1165 0.9983 0.9154 -0.2831 -0.0924 -0.0465 39  ASP A C   
143  O O   . ASP A 23  ? 1.1309 0.9428 0.8875 -0.2860 -0.0754 -0.0549 39  ASP A O   
144  C CB  . ASP A 23  ? 1.1511 1.0810 0.9831 -0.3715 -0.0784 -0.0913 39  ASP A CB  
145  C CG  . ASP A 23  ? 1.1549 1.1579 0.9879 -0.3838 -0.1176 -0.1029 39  ASP A CG  
146  O OD1 . ASP A 23  ? 1.1414 1.1567 0.9544 -0.3510 -0.1398 -0.0842 39  ASP A OD1 
147  O OD2 . ASP A 23  ? 1.1757 1.2244 1.0282 -0.4298 -0.1283 -0.1289 39  ASP A OD2 
148  N N   . SER A 24  ? 1.1174 1.0348 0.9319 -0.2504 -0.1221 -0.0244 40  SER A N   
149  C CA  . SER A 24  ? 1.1137 0.9909 0.8994 -0.2241 -0.1350 -0.0050 40  SER A CA  
150  C C   . SER A 24  ? 1.1332 1.0066 0.8808 -0.2447 -0.1339 -0.0144 40  SER A C   
151  O O   . SER A 24  ? 1.1230 0.9542 0.8446 -0.2305 -0.1253 -0.0058 40  SER A O   
152  C CB  . SER A 24  ? 1.1045 1.0180 0.9172 -0.1954 -0.1729 0.0215  40  SER A CB  
153  O OG  . SER A 24  ? 1.1000 1.0869 0.9281 -0.2107 -0.1997 0.0242  40  SER A OG  
154  N N   . MET A 25  ? 1.1088 1.0325 0.8528 -0.2765 -0.1425 -0.0347 41  MET A N   
155  C CA  . MET A 25  ? 1.1396 1.0691 0.8365 -0.2933 -0.1424 -0.0507 41  MET A CA  
156  C C   . MET A 25  ? 1.1744 1.0361 0.8376 -0.3104 -0.1085 -0.0886 41  MET A C   
157  O O   . MET A 25  ? 1.1966 1.0253 0.8199 -0.2983 -0.0932 -0.0959 41  MET A O   
158  C CB  . MET A 25  ? 1.0969 1.1097 0.7955 -0.3182 -0.1736 -0.0595 41  MET A CB  
159  C CG  . MET A 25  ? 1.0654 1.1390 0.7924 -0.2966 -0.2117 -0.0181 41  MET A CG  
160  S SD  . MET A 25  ? 1.0669 1.1521 0.7462 -0.2827 -0.2259 0.0196  41  MET A SD  
161  C CE  . MET A 25  ? 1.0243 1.0510 0.7381 -0.2456 -0.2247 0.0609  41  MET A CE  
162  N N   . LYS A 26  ? 1.1693 1.0113 0.8518 -0.3380 -0.0963 -0.1114 42  LYS A N   
163  C CA  . LYS A 26  ? 1.2120 0.9689 0.8651 -0.3554 -0.0667 -0.1438 42  LYS A CA  
164  C C   . LYS A 26  ? 1.2011 0.8805 0.8315 -0.3162 -0.0423 -0.1287 42  LYS A C   
165  O O   . LYS A 26  ? 1.2412 0.8672 0.8316 -0.3081 -0.0261 -0.1516 42  LYS A O   
166  C CB  . LYS A 26  ? 1.2036 0.9482 0.8940 -0.3912 -0.0553 -0.1518 42  LYS A CB  
167  C CG  . LYS A 26  ? 1.2654 0.9118 0.9294 -0.4203 -0.0301 -0.1832 42  LYS A CG  
168  C CD  . LYS A 26  ? 1.2805 0.9405 0.9909 -0.4731 -0.0248 -0.1885 42  LYS A CD  
169  C CE  . LYS A 26  ? 1.3538 0.8950 1.0406 -0.5056 0.0000  -0.2107 42  LYS A CE  
170  N NZ  . LYS A 26  ? 1.3893 0.9505 1.1293 -0.5687 0.0054  -0.2110 42  LYS A NZ  
171  N N   . HIS A 27  ? 1.2211 0.8969 0.8770 -0.2878 -0.0418 -0.0931 43  HIS A N   
172  C CA  . HIS A 27  ? 1.2002 0.8113 0.8412 -0.2512 -0.0258 -0.0762 43  HIS A CA  
173  C C   . HIS A 27  ? 1.1587 0.8050 0.8040 -0.2195 -0.0434 -0.0502 43  HIS A C   
174  O O   . HIS A 27  ? 1.1231 0.7398 0.7742 -0.1896 -0.0431 -0.0281 43  HIS A O   
175  C CB  . HIS A 27  ? 1.1817 0.7601 0.8380 -0.2424 -0.0149 -0.0565 43  HIS A CB  
176  C CG  . HIS A 27  ? 1.2233 0.7721 0.8828 -0.2800 0.0061  -0.0713 43  HIS A CG  
177  N ND1 . HIS A 27  ? 1.2759 0.7336 0.9059 -0.2912 0.0303  -0.0851 43  HIS A ND1 
178  C CD2 . HIS A 27  ? 1.2247 0.8253 0.9199 -0.3108 0.0064  -0.0716 43  HIS A CD2 
179  C CE1 . HIS A 27  ? 1.3094 0.7571 0.9552 -0.3342 0.0439  -0.0907 43  HIS A CE1 
180  N NE2 . HIS A 27  ? 1.2741 0.8169 0.9629 -0.3476 0.0313  -0.0827 43  HIS A NE2 
181  N N   . TRP A 28  ? 1.1311 0.8418 0.7734 -0.2286 -0.0610 -0.0494 44  TRP A N   
182  C CA  . TRP A 28  ? 1.0942 0.8408 0.7454 -0.2076 -0.0768 -0.0170 44  TRP A CA  
183  C C   . TRP A 28  ? 1.0879 0.8008 0.7275 -0.1828 -0.0557 -0.0158 44  TRP A C   
184  O O   . TRP A 28  ? 1.1361 0.8211 0.7459 -0.1817 -0.0305 -0.0465 44  TRP A O   
185  C CB  . TRP A 28  ? 1.0907 0.9104 0.7280 -0.2248 -0.0936 -0.0129 44  TRP A CB  
186  C CG  . TRP A 28  ? 1.0487 0.9073 0.6992 -0.2121 -0.1101 0.0306  44  TRP A CG  
187  C CD1 . TRP A 28  ? 1.0476 0.9249 0.6865 -0.2026 -0.0941 0.0420  44  TRP A CD1 
188  C CD2 . TRP A 28  ? 1.0125 0.8961 0.6949 -0.2096 -0.1456 0.0703  44  TRP A CD2 
189  N NE1 . TRP A 28  ? 1.0109 0.9256 0.6759 -0.2022 -0.1172 0.0912  44  TRP A NE1 
190  C CE2 . TRP A 28  ? 0.9908 0.8996 0.6796 -0.2060 -0.1513 0.1084  44  TRP A CE2 
191  C CE3 . TRP A 28  ? 1.0062 0.8933 0.7159 -0.2080 -0.1726 0.0772  44  TRP A CE3 
192  C CZ2 . TRP A 28  ? 0.9668 0.8872 0.6848 -0.2059 -0.1867 0.1544  44  TRP A CZ2 
193  C CZ3 . TRP A 28  ? 0.9814 0.8795 0.7173 -0.1983 -0.2074 0.1177  44  TRP A CZ3 
194  C CH2 . TRP A 28  ? 0.9640 0.8704 0.7022 -0.1999 -0.2161 0.1566  44  TRP A CH2 
195  N N   . GLY A 29  ? 1.0562 0.7719 0.7232 -0.1610 -0.0687 0.0175  45  GLY A N   
196  C CA  . GLY A 29  ? 1.0547 0.7593 0.7263 -0.1358 -0.0540 0.0238  45  GLY A CA  
197  C C   . GLY A 29  ? 1.0713 0.6999 0.7327 -0.1134 -0.0361 0.0092  45  GLY A C   
198  O O   . GLY A 29  ? 1.0830 0.7040 0.7518 -0.0861 -0.0252 0.0131  45  GLY A O   
199  N N   . ARG A 30  ? 1.1499 0.7282 0.7974 -0.1233 -0.0326 -0.0027 46  ARG A N   
200  C CA  . ARG A 30  ? 1.1816 0.6790 0.8089 -0.1081 -0.0129 -0.0115 46  ARG A CA  
201  C C   . ARG A 30  ? 1.1522 0.6264 0.7876 -0.0860 -0.0288 0.0150  46  ARG A C   
202  O O   . ARG A 30  ? 1.1229 0.6196 0.7692 -0.0939 -0.0470 0.0254  46  ARG A O   
203  C CB  . ARG A 30  ? 1.2158 0.6748 0.8223 -0.1398 0.0034  -0.0355 46  ARG A CB  
204  C CG  . ARG A 30  ? 1.2764 0.7032 0.8563 -0.1536 0.0240  -0.0728 46  ARG A CG  
205  C CD  . ARG A 30  ? 1.3105 0.7155 0.8852 -0.1980 0.0295  -0.0915 46  ARG A CD  
206  N NE  . ARG A 30  ? 1.3925 0.7244 0.9375 -0.2156 0.0483  -0.1292 46  ARG A NE  
207  C CZ  . ARG A 30  ? 1.4381 0.7871 0.9623 -0.2308 0.0471  -0.1690 46  ARG A CZ  
208  N NH1 . ARG A 30  ? 1.4077 0.8520 0.9360 -0.2300 0.0309  -0.1681 46  ARG A NH1 
209  N NH2 . ARG A 30  ? 1.5250 0.7901 1.0187 -0.2460 0.0609  -0.2093 46  ARG A NH2 
210  N N   . ARG A 31  ? 1.2187 0.6483 0.8455 -0.0540 -0.0235 0.0235  47  ARG A N   
211  C CA  . ARG A 31  ? 1.2133 0.6130 0.8319 -0.0315 -0.0391 0.0447  47  ARG A CA  
212  C C   . ARG A 31  ? 1.2470 0.5924 0.8300 -0.0441 -0.0201 0.0430  47  ARG A C   
213  O O   . ARG A 31  ? 1.2778 0.5922 0.8474 -0.0686 0.0059  0.0272  47  ARG A O   
214  C CB  . ARG A 31  ? 1.1484 0.5222 0.7676 0.0078  -0.0419 0.0563  47  ARG A CB  
215  C CG  . ARG A 31  ? 1.1340 0.5134 0.7585 0.0328  -0.0755 0.0786  47  ARG A CG  
216  C CD  . ARG A 31  ? 1.1668 0.5315 0.7988 0.0723  -0.0794 0.0897  47  ARG A CD  
217  N NE  . ARG A 31  ? 1.1673 0.5430 0.8048 0.0953  -0.1188 0.1087  47  ARG A NE  
218  C CZ  . ARG A 31  ? 1.2025 0.5726 0.8476 0.1335  -0.1330 0.1228  47  ARG A CZ  
219  N NH1 . ARG A 31  ? 1.2394 0.5880 0.8890 0.1583  -0.1073 0.1206  47  ARG A NH1 
220  N NH2 . ARG A 31  ? 1.2102 0.5947 0.8579 0.1498  -0.1761 0.1365  47  ARG A NH2 
221  N N   . LYS A 32  ? 1.2453 0.5821 0.8125 -0.0295 -0.0332 0.0588  48  LYS A N   
222  C CA  . LYS A 32  ? 1.2920 0.5942 0.8255 -0.0401 -0.0109 0.0641  48  LYS A CA  
223  C C   . LYS A 32  ? 1.3359 0.5857 0.8245 -0.0054 -0.0142 0.0869  48  LYS A C   
224  O O   . LYS A 32  ? 1.3162 0.5734 0.8065 0.0261  -0.0448 0.0946  48  LYS A O   
225  C CB  . LYS A 32  ? 1.2730 0.6312 0.8214 -0.0539 -0.0179 0.0584  48  LYS A CB  
226  C CG  . LYS A 32  ? 1.2220 0.6451 0.8163 -0.0758 -0.0328 0.0432  48  LYS A CG  
227  C CD  . LYS A 32  ? 1.2354 0.6657 0.8401 -0.1154 -0.0085 0.0267  48  LYS A CD  
228  C CE  . LYS A 32  ? 1.1907 0.6958 0.8327 -0.1351 -0.0270 0.0156  48  LYS A CE  
229  N NZ  . LYS A 32  ? 1.1574 0.6868 0.8130 -0.1236 -0.0516 0.0200  48  LYS A NZ  
230  N N   . ALA A 33  ? 1.3286 0.5294 0.7770 -0.0146 0.0156  0.1006  49  ALA A N   
231  C CA  . ALA A 33  ? 1.3910 0.5360 0.7826 0.0171  0.0162  0.1288  49  ALA A CA  
232  C C   . ALA A 33  ? 1.5150 0.6526 0.8665 0.0001  0.0470  0.1451  49  ALA A C   
233  O O   . ALA A 33  ? 1.5804 0.7351 0.9546 -0.0420 0.0758  0.1382  49  ALA A O   
234  C CB  . ALA A 33  ? 1.4985 0.5642 0.8745 0.0314  0.0262  0.1425  49  ALA A CB  
235  N N   . TRP A 34  ? 1.4995 0.6198 0.7916 0.0329  0.0403  0.1673  50  TRP A N   
236  C CA  . TRP A 34  ? 1.6007 0.7172 0.8402 0.0249  0.0741  0.1905  50  TRP A CA  
237  C C   . TRP A 34  ? 1.6864 0.7164 0.8565 0.0448  0.0836  0.2333  50  TRP A C   
238  O O   . TRP A 34  ? 1.6687 0.6758 0.8057 0.0899  0.0482  0.2419  50  TRP A O   
239  C CB  . TRP A 34  ? 1.5294 0.7088 0.7457 0.0522  0.0572  0.1754  50  TRP A CB  
240  C CG  . TRP A 34  ? 1.6143 0.7968 0.7547 0.0635  0.0881  0.1998  50  TRP A CG  
241  C CD1 . TRP A 34  ? 1.6577 0.8041 0.7100 0.1032  0.0769  0.2232  50  TRP A CD1 
242  C CD2 . TRP A 34  ? 1.6620 0.9005 0.8074 0.0371  0.1351  0.2034  50  TRP A CD2 
243  N NE1 . TRP A 34  ? 1.7303 0.9023 0.7226 0.1033  0.1180  0.2424  50  TRP A NE1 
244  C CE2 . TRP A 34  ? 1.7285 0.9614 0.7822 0.0627  0.1565  0.2311  50  TRP A CE2 
245  C CE3 . TRP A 34  ? 1.6829 0.9844 0.9030 -0.0053 0.1606  0.1875  50  TRP A CE3 
246  C CZ2 . TRP A 34  ? 1.7778 1.0718 0.8160 0.0474  0.2087  0.2441  50  TRP A CZ2 
247  C CZ3 . TRP A 34  ? 1.7144 1.0792 0.9290 -0.0211 0.2078  0.1996  50  TRP A CZ3 
248  C CH2 . TRP A 34  ? 1.7545 1.1175 0.8804 0.0050  0.2347  0.2283  50  TRP A CH2 
249  N N   . CYS A 35  ? 1.7781 0.7609 0.9298 0.0091  0.1281  0.2628  51  CYS A N   
250  C CA  . CYS A 35  ? 1.8726 0.7563 0.9588 0.0220  0.1405  0.3122  51  CYS A CA  
251  C C   . CYS A 35  ? 1.9760 0.8611 1.0175 -0.0083 0.1884  0.3520  51  CYS A C   
252  O O   . CYS A 35  ? 1.9827 0.9310 1.0557 -0.0500 0.2201  0.3419  51  CYS A O   
253  C CB  . CYS A 35  ? 2.0330 0.8610 1.1763 0.0045  0.1420  0.3053  51  CYS A CB  
254  S SG  . CYS A 35  ? 2.0874 0.8971 1.2814 -0.0773 0.1861  0.2959  51  CYS A SG  
255  N N   . ARG A 36  ? 2.0266 0.8783 1.0255 0.0129  0.1879  0.3909  52  ARG A N   
256  C CA  . ARG A 36  ? 2.1296 0.9864 1.0801 -0.0086 0.2290  0.4392  52  ARG A CA  
257  C C   . ARG A 36  ? 2.2080 0.9921 1.1873 -0.0402 0.2427  0.4732  52  ARG A C   
258  O O   . ARG A 36  ? 2.2154 0.9399 1.2215 -0.0183 0.2124  0.4659  52  ARG A O   
259  C CB  . ARG A 36  ? 2.1503 1.0321 1.0114 0.0447  0.2130  0.4611  52  ARG A CB  
260  C CG  . ARG A 36  ? 2.2486 1.1661 1.0525 0.0239  0.2617  0.5065  52  ARG A CG  
261  C CD  . ARG A 36  ? 2.3348 1.2651 1.0459 0.0756  0.2419  0.5307  52  ARG A CD  
262  N NE  . ARG A 36  ? 2.4390 1.4117 1.0964 0.0532  0.2924  0.5774  52  ARG A NE  
263  C CZ  . ARG A 36  ? 2.5014 1.5309 1.0689 0.0899  0.2948  0.5837  52  ARG A CZ  
264  N NH1 . ARG A 36  ? 2.4714 1.5142 0.9943 0.1491  0.2443  0.5432  52  ARG A NH1 
265  N NH2 . ARG A 36  ? 2.6008 1.6789 1.1261 0.0647  0.3460  0.6285  52  ARG A NH2 
266  N N   . GLN A 37  ? 2.2568 1.0513 1.2333 -0.0909 0.2884  0.5113  53  GLN A N   
267  C CA  . GLN A 37  ? 2.3567 1.0824 1.3673 -0.1351 0.3038  0.5462  53  GLN A CA  
268  C C   . GLN A 37  ? 2.4974 1.1962 1.4419 -0.1211 0.3117  0.6144  53  GLN A C   
269  O O   . GLN A 37  ? 2.5250 1.2861 1.4006 -0.1017 0.3267  0.6391  53  GLN A O   
270  C CB  . GLN A 37  ? 2.4259 1.1909 1.4964 -0.2135 0.3463  0.5454  53  GLN A CB  
271  C CG  . GLN A 37  ? 2.4964 1.1823 1.6243 -0.2656 0.3501  0.5613  53  GLN A CG  
272  C CD  . GLN A 37  ? 2.4371 1.0577 1.6144 -0.2545 0.3139  0.5052  53  GLN A CD  
273  O OE1 . GLN A 37  ? 2.3004 0.9607 1.4953 -0.2362 0.2973  0.4511  53  GLN A OE1 
274  N NE2 . GLN A 37  ? 2.5700 1.0906 1.7678 -0.2637 0.3019  0.5189  53  GLN A NE2 
275  N N   . LEU A 38  ? 1.8267 1.6711 1.7702 -0.0435 0.5684  0.3856  54  LEU A N   
276  C CA  . LEU A 38  ? 1.7663 1.7316 1.8282 -0.0852 0.5496  0.4616  54  LEU A CA  
277  C C   . LEU A 38  ? 1.7140 1.8415 2.0072 -0.0953 0.5104  0.5321  54  LEU A C   
278  O O   . LEU A 38  ? 1.6783 1.8051 2.1256 -0.1329 0.4632  0.5159  54  LEU A O   
279  C CB  . LEU A 38  ? 1.8641 1.7714 1.9709 -0.1620 0.5215  0.4344  54  LEU A CB  
280  C CG  . LEU A 38  ? 1.8719 1.6345 1.7859 -0.1790 0.5483  0.3733  54  LEU A CG  
281  C CD1 . LEU A 38  ? 1.8102 1.5624 1.8357 -0.2568 0.5081  0.3531  54  LEU A CD1 
282  C CD2 . LEU A 38  ? 1.9592 1.7369 1.7336 -0.1494 0.5839  0.4127  54  LEU A CD2 
283  N N   . GLY A 39  ? 1.6798 1.9484 1.9964 -0.0630 0.5261  0.6123  55  GLY A N   
284  C CA  . GLY A 39  ? 1.6229 2.0476 2.1512 -0.0762 0.4888  0.6830  55  GLY A CA  
285  C C   . GLY A 39  ? 1.6752 2.0803 2.2173 -0.0331 0.4863  0.6431  55  GLY A C   
286  O O   . GLY A 39  ? 1.7603 2.0754 2.1235 0.0309  0.5288  0.5847  55  GLY A O   
287  N N   . GLU A 40  ? 1.5809 2.0612 2.3332 -0.0680 0.4316  0.6727  56  GLU A N   
288  C CA  . GLU A 40  ? 1.6345 2.1105 2.4205 -0.0269 0.4237  0.6404  56  GLU A CA  
289  C C   . GLU A 40  ? 1.6767 2.0023 2.4748 -0.0445 0.3942  0.5501  56  GLU A C   
290  O O   . GLU A 40  ? 1.7917 1.9860 2.4222 -0.0013 0.4310  0.4700  56  GLU A O   
291  C CB  . GLU A 40  ? 1.5094 2.1621 2.5101 -0.0467 0.3800  0.7276  56  GLU A CB  
292  C CG  . GLU A 40  ? 1.5414 2.1965 2.6243 -0.0179 0.3539  0.6977  56  GLU A CG  
293  C CD  . GLU A 40  ? 1.7198 2.2773 2.6096 0.0682  0.4086  0.6165  56  GLU A CD  
294  O OE1 . GLU A 40  ? 1.8112 2.2742 2.7180 0.0827  0.3883  0.5485  56  GLU A OE1 
295  O OE2 . GLU A 40  ? 1.7567 2.3265 2.4721 0.1250  0.4684  0.6193  56  GLU A OE2 
296  N N   . LYS A 41  ? 1.6472 1.9890 2.6350 -0.1052 0.3255  0.5627  57  LYS A N   
297  C CA  . LYS A 41  ? 1.6570 1.8916 2.6875 -0.1078 0.2888  0.4857  57  LYS A CA  
298  C C   . LYS A 41  ? 1.6790 1.7558 2.5533 -0.1127 0.3158  0.3985  57  LYS A C   
299  O O   . LYS A 41  ? 1.7269 1.6999 2.5501 -0.0876 0.3172  0.3217  57  LYS A O   
300  C CB  . LYS A 41  ? 1.4776 1.7639 2.7364 -0.1670 0.2016  0.5214  57  LYS A CB  
301  C CG  . LYS A 41  ? 1.4296 1.8518 2.8524 -0.1653 0.1634  0.5958  57  LYS A CG  
302  C CD  . LYS A 41  ? 1.5516 1.9372 2.9835 -0.1117 0.1573  0.5433  57  LYS A CD  
303  C CE  . LYS A 41  ? 1.6259 2.1522 3.1058 -0.0786 0.1711  0.6072  57  LYS A CE  
304  N NZ  . LYS A 41  ? 1.4299 2.1112 3.0734 -0.1377 0.1293  0.7195  57  LYS A NZ  
305  N N   . GLY A 42  ? 1.7183 1.7784 2.5155 -0.1456 0.3368  0.4101  58  GLY A N   
306  C CA  . GLY A 42  ? 1.7261 1.6460 2.3619 -0.1546 0.3665  0.3336  58  GLY A CA  
307  C C   . GLY A 42  ? 1.6483 1.5760 2.2440 -0.2006 0.3751  0.3595  58  GLY A C   
308  O O   . GLY A 42  ? 1.5893 1.6303 2.2783 -0.2212 0.3605  0.4382  58  GLY A O   
309  N N   . PRO A 43  ? 1.6582 1.4686 2.1176 -0.2202 0.3969  0.2949  59  PRO A N   
310  C CA  . PRO A 43  ? 1.6891 1.3616 2.0211 -0.2065 0.4170  0.2046  59  PRO A CA  
311  C C   . PRO A 43  ? 1.8056 1.3815 1.8976 -0.1560 0.4827  0.1755  59  PRO A C   
312  O O   . PRO A 43  ? 1.8349 1.4514 1.8495 -0.1300 0.5131  0.2226  59  PRO A O   
313  C CB  . PRO A 43  ? 1.7093 1.3364 2.0383 -0.2693 0.3991  0.1690  59  PRO A CB  
314  C CG  . PRO A 43  ? 1.6973 1.3850 2.0154 -0.2945 0.4088  0.2283  59  PRO A CG  
315  C CD  . PRO A 43  ? 1.7225 1.5426 2.1692 -0.2712 0.3940  0.3138  59  PRO A CD  
316  N N   . CYS A 44  ? 2.2183 0.8632 1.7760 0.0753  0.1208  0.3804  60  CYS A N   
317  C CA  . CYS A 44  ? 2.1459 0.8544 1.6704 0.0609  0.1094  0.3663  60  CYS A CA  
318  C C   . CYS A 44  ? 2.0929 0.8334 1.6277 0.0983  0.0999  0.3786  60  CYS A C   
319  O O   . CYS A 44  ? 2.0708 0.7815 1.6321 0.1247  0.1131  0.3615  60  CYS A O   
320  C CB  . CYS A 44  ? 2.0842 0.7904 1.5881 0.0305  0.1203  0.3104  60  CYS A CB  
321  S SG  . CYS A 44  ? 2.0608 0.8423 1.5315 -0.0046 0.1041  0.3038  60  CYS A SG  
322  N N   . GLN A 45  ? 1.9141 0.7161 1.4303 0.1001  0.0789  0.4079  61  GLN A N   
323  C CA  . GLN A 45  ? 1.9140 0.7536 1.4448 0.1375  0.0642  0.4322  61  GLN A CA  
324  C C   . GLN A 45  ? 1.9021 0.7967 1.4030 0.1292  0.0586  0.4073  61  GLN A C   
325  O O   . GLN A 45  ? 1.9073 0.8394 1.3736 0.0973  0.0513  0.4050  61  GLN A O   
326  C CB  . GLN A 45  ? 2.0885 0.9582 1.6200 0.1456  0.0394  0.4936  61  GLN A CB  
327  C CG  . GLN A 45  ? 2.1107 0.9250 1.6721 0.1533  0.0407  0.5246  61  GLN A CG  
328  C CD  . GLN A 45  ? 2.1519 0.9959 1.7134 0.1643  0.0099  0.5894  61  GLN A CD  
329  O OE1 . GLN A 45  ? 2.1441 1.0555 1.6785 0.1612  -0.0113 0.6095  61  GLN A OE1 
330  N NE2 . GLN A 45  ? 2.2248 1.0176 1.8139 0.1766  0.0050  0.6220  61  GLN A NE2 
331  N N   . ARG A 46  ? 1.7488 0.6485 1.2670 0.1578  0.0641  0.3884  62  ARG A N   
332  C CA  . ARG A 46  ? 1.6904 0.6299 1.1811 0.1473  0.0627  0.3579  62  ARG A CA  
333  C C   . ARG A 46  ? 1.6900 0.7019 1.1601 0.1475  0.0384  0.3886  62  ARG A C   
334  O O   . ARG A 46  ? 1.7091 0.7510 1.1994 0.1791  0.0226  0.4262  62  ARG A O   
335  C CB  . ARG A 46  ? 1.7086 0.6345 1.2224 0.1775  0.0777  0.3298  62  ARG A CB  
336  C CG  . ARG A 46  ? 1.6669 0.6406 1.1609 0.1584  0.0765  0.2907  62  ARG A CG  
337  C CD  . ARG A 46  ? 1.6277 0.5687 1.1333 0.1642  0.0997  0.2459  62  ARG A CD  
338  N NE  . ARG A 46  ? 1.6684 0.5178 1.1659 0.1538  0.1214  0.2329  62  ARG A NE  
339  C CZ  . ARG A 46  ? 1.7006 0.5043 1.2040 0.1555  0.1471  0.1942  62  ARG A CZ  
340  N NH1 . ARG A 46  ? 1.6723 0.5019 1.1842 0.1695  0.1564  0.1679  62  ARG A NH1 
341  N NH2 . ARG A 46  ? 1.7580 0.5060 1.2644 0.1389  0.1632  0.1781  62  ARG A NH2 
342  N N   . VAL A 47  ? 1.5978 0.6416 1.0320 0.1100  0.0353  0.3719  63  VAL A N   
343  C CA  . VAL A 47  ? 1.5839 0.7126 1.0044 0.1016  0.0167  0.3839  63  VAL A CA  
344  C C   . VAL A 47  ? 1.5285 0.7246 0.9774 0.1116  0.0146  0.3489  63  VAL A C   
345  O O   . VAL A 47  ? 1.5207 0.7817 0.9895 0.1330  -0.0008 0.3624  63  VAL A O   
346  C CB  . VAL A 47  ? 1.5649 0.7038 0.9477 0.0537  0.0194  0.3789  63  VAL A CB  
347  C CG1 . VAL A 47  ? 1.5386 0.7722 0.9133 0.0396  0.0059  0.3795  63  VAL A CG1 
348  C CG2 . VAL A 47  ? 1.6026 0.7095 0.9812 0.0406  0.0213  0.4072  63  VAL A CG2 
349  N N   . VAL A 48  ? 1.5045 0.6875 0.9568 0.0956  0.0287  0.3052  64  VAL A N   
350  C CA  . VAL A 48  ? 1.4518 0.6978 0.9285 0.1021  0.0282  0.2738  64  VAL A CA  
351  C C   . VAL A 48  ? 1.4081 0.6117 0.8846 0.0912  0.0447  0.2343  64  VAL A C   
352  O O   . VAL A 48  ? 1.4187 0.5652 0.8731 0.0657  0.0523  0.2264  64  VAL A O   
353  C CB  . VAL A 48  ? 1.3858 0.7131 0.8566 0.0746  0.0187  0.2673  64  VAL A CB  
354  C CG1 . VAL A 48  ? 1.3788 0.6865 0.8303 0.0316  0.0269  0.2514  64  VAL A CG1 
355  C CG2 . VAL A 48  ? 1.3298 0.7260 0.8311 0.0853  0.0177  0.2409  64  VAL A CG2 
356  N N   . SER A 49  ? 1.3946 0.6271 0.8941 0.1082  0.0501  0.2096  65  SER A N   
357  C CA  . SER A 49  ? 1.3280 0.5299 0.8192 0.0932  0.0641  0.1719  65  SER A CA  
358  C C   . SER A 49  ? 1.2524 0.5274 0.7571 0.0831  0.0605  0.1489  65  SER A C   
359  O O   . SER A 49  ? 1.2376 0.5820 0.7666 0.0981  0.0526  0.1563  65  SER A O   
360  C CB  . SER A 49  ? 1.3890 0.5337 0.8903 0.1214  0.0835  0.1600  65  SER A CB  
361  O OG  . SER A 49  ? 1.3874 0.5801 0.9277 0.1577  0.0845  0.1633  65  SER A OG  
362  N N   . THR A 50  ? 1.2861 0.5451 0.7754 0.0556  0.0653  0.1224  66  THR A N   
363  C CA  . THR A 50  ? 1.2025 0.5215 0.7058 0.0448  0.0636  0.1024  66  THR A CA  
364  C C   . THR A 50  ? 1.1948 0.5356 0.7175 0.0760  0.0750  0.0889  66  THR A C   
365  O O   . THR A 50  ? 1.2458 0.5521 0.7753 0.1054  0.0855  0.0929  66  THR A O   
366  C CB  . THR A 50  ? 1.2579 0.5493 0.7393 0.0088  0.0632  0.0831  66  THR A CB  
367  O OG1 . THR A 50  ? 1.2841 0.4984 0.7349 0.0085  0.0751  0.0700  66  THR A OG1 
368  C CG2 . THR A 50  ? 1.2503 0.5436 0.7315 -0.0234 0.0512  0.0956  66  THR A CG2 
369  N N   . HIS A 51  ? 1.1533 0.5532 0.6927 0.0699  0.0749  0.0738  67  HIS A N   
370  C CA  . HIS A 51  ? 1.1482 0.5786 0.7124 0.0978  0.0872  0.0607  67  HIS A CA  
371  C C   . HIS A 51  ? 1.1818 0.5454 0.7273 0.1077  0.1086  0.0414  67  HIS A C   
372  O O   . HIS A 51  ? 1.1876 0.4968 0.6937 0.0813  0.1134  0.0272  67  HIS A O   
373  C CB  . HIS A 51  ? 1.0432 0.5367 0.6236 0.0836  0.0873  0.0452  67  HIS A CB  
374  C CG  . HIS A 51  ? 1.0428 0.5855 0.6591 0.1120  0.0977  0.0360  67  HIS A CG  
375  N ND1 . HIS A 51  ? 1.0696 0.5829 0.6870 0.1317  0.1188  0.0186  67  HIS A ND1 
376  C CD2 . HIS A 51  ? 1.0250 0.6445 0.6806 0.1227  0.0919  0.0401  67  HIS A CD2 
377  C CE1 . HIS A 51  ? 1.0656 0.6374 0.7260 0.1548  0.1249  0.0140  67  HIS A CE1 
378  N NE2 . HIS A 51  ? 1.0387 0.6765 0.7219 0.1494  0.1070  0.0271  67  HIS A NE2 
379  N N   . ASN A 52  ? 1.1734 0.5431 0.7506 0.1445  0.1223  0.0398  68  ASN A N   
380  C CA  . ASN A 52  ? 1.2426 0.5467 0.8123 0.1579  0.1500  0.0197  68  ASN A CA  
381  C C   . ASN A 52  ? 1.2474 0.5409 0.7856 0.1338  0.1679  -0.0156 68  ASN A C   
382  O O   . ASN A 52  ? 1.3135 0.5372 0.8153 0.1210  0.1882  -0.0377 68  ASN A O   
383  C CB  . ASN A 52  ? 1.2595 0.5864 0.8878 0.2046  0.1602  0.0290  68  ASN A CB  
384  C CG  . ASN A 52  ? 1.3136 0.5914 0.9513 0.2204  0.1976  -0.0003 68  ASN A CG  
385  O OD1 . ASN A 52  ? 1.3801 0.5771 0.9828 0.2074  0.2169  -0.0172 68  ASN A OD1 
386  N ND2 . ASN A 52  ? 1.2934 0.6203 0.9813 0.2471  0.2110  -0.0091 68  ASN A ND2 
387  N N   . LEU A 53  ? 1.1845 0.5446 0.7329 0.1240  0.1614  -0.0210 69  LEU A N   
388  C CA  . LEU A 53  ? 1.1862 0.5429 0.6995 0.0951  0.1722  -0.0464 69  LEU A CA  
389  C C   . LEU A 53  ? 1.1670 0.5190 0.6439 0.0531  0.1480  -0.0376 69  LEU A C   
390  O O   . LEU A 53  ? 1.1025 0.5085 0.6043 0.0463  0.1270  -0.0193 69  LEU A O   
391  C CB  . LEU A 53  ? 1.1310 0.5613 0.6821 0.1073  0.1788  -0.0531 69  LEU A CB  
392  C CG  . LEU A 53  ? 1.1518 0.5909 0.7473 0.1474  0.2046  -0.0641 69  LEU A CG  
393  C CD1 . LEU A 53  ? 1.1006 0.6107 0.7311 0.1537  0.2134  -0.0745 69  LEU A CD1 
394  C CD2 . LEU A 53  ? 1.2386 0.5996 0.8076 0.1504  0.2380  -0.0897 69  LEU A CD2 
395  N N   . TRP A 54  ? 1.2650 0.5542 0.6868 0.0229  0.1522  -0.0522 70  TRP A N   
396  C CA  . TRP A 54  ? 1.2454 0.5237 0.6391 -0.0164 0.1266  -0.0408 70  TRP A CA  
397  C C   . TRP A 54  ? 1.1716 0.5149 0.5823 -0.0365 0.1084  -0.0303 70  TRP A C   
398  O O   . TRP A 54  ? 1.1309 0.4963 0.5598 -0.0529 0.0855  -0.0104 70  TRP A O   
399  C CB  . TRP A 54  ? 1.3158 0.5219 0.6449 -0.0489 0.1342  -0.0619 70  TRP A CB  
400  C CG  . TRP A 54  ? 1.3160 0.5069 0.6197 -0.0902 0.1059  -0.0497 70  TRP A CG  
401  C CD1 . TRP A 54  ? 1.3371 0.4920 0.6410 -0.0968 0.0950  -0.0380 70  TRP A CD1 
402  C CD2 . TRP A 54  ? 1.2979 0.5091 0.5773 -0.1312 0.0848  -0.0461 70  TRP A CD2 
403  N NE1 . TRP A 54  ? 1.3351 0.4893 0.6209 -0.1390 0.0691  -0.0297 70  TRP A NE1 
404  C CE2 . TRP A 54  ? 1.3124 0.5023 0.5848 -0.1601 0.0604  -0.0325 70  TRP A CE2 
405  C CE3 . TRP A 54  ? 1.2851 0.5314 0.5512 -0.1466 0.0835  -0.0499 70  TRP A CE3 
406  C CZ2 . TRP A 54  ? 1.3088 0.5148 0.5673 -0.2026 0.0322  -0.0215 70  TRP A CZ2 
407  C CZ3 . TRP A 54  ? 1.2848 0.5444 0.5323 -0.1889 0.0548  -0.0361 70  TRP A CZ3 
408  C CH2 . TRP A 54  ? 1.2933 0.5349 0.5405 -0.2157 0.0281  -0.0214 70  TRP A CH2 
409  N N   . LEU A 55  ? 1.2158 0.5889 0.6260 -0.0360 0.1209  -0.0432 71  LEU A N   
410  C CA  . LEU A 55  ? 1.1458 0.5785 0.5796 -0.0535 0.1060  -0.0308 71  LEU A CA  
411  C C   . LEU A 55  ? 1.0830 0.5775 0.5810 -0.0355 0.0962  -0.0129 71  LEU A C   
412  O O   . LEU A 55  ? 1.0224 0.5596 0.5493 -0.0530 0.0827  0.0001  71  LEU A O   
413  C CB  . LEU A 55  ? 1.0884 0.5405 0.5115 -0.0540 0.1253  -0.0470 71  LEU A CB  
414  C CG  . LEU A 55  ? 1.1524 0.5610 0.5054 -0.0931 0.1247  -0.0570 71  LEU A CG  
415  C CD1 . LEU A 55  ? 1.1557 0.5901 0.4973 -0.0993 0.1421  -0.0674 71  LEU A CD1 
416  C CD2 . LEU A 55  ? 1.1446 0.5522 0.4878 -0.1304 0.0896  -0.0338 71  LEU A CD2 
417  N N   . LEU A 56  ? 1.0700 0.5711 0.5924 -0.0027 0.1034  -0.0115 72  LEU A N   
418  C CA  . LEU A 56  ? 1.0354 0.5944 0.6077 0.0096  0.0945  0.0032  72  LEU A CA  
419  C C   . LEU A 56  ? 1.0516 0.5876 0.6206 0.0049  0.0802  0.0206  72  LEU A C   
420  O O   . LEU A 56  ? 1.0448 0.6187 0.6430 0.0172  0.0757  0.0318  72  LEU A O   
421  C CB  . LEU A 56  ? 0.9656 0.5623 0.5703 0.0463  0.1078  -0.0028 72  LEU A CB  
422  C CG  . LEU A 56  ? 0.9279 0.5671 0.5535 0.0522  0.1237  -0.0190 72  LEU A CG  
423  C CD1 . LEU A 56  ? 0.9287 0.5956 0.5879 0.0897  0.1367  -0.0253 72  LEU A CD1 
424  C CD2 . LEU A 56  ? 0.8581 0.5571 0.5182 0.0340  0.1159  -0.0132 72  LEU A CD2 
425  N N   . SER A 57  ? 1.1393 0.6151 0.6708 -0.0159 0.0733  0.0227  73  SER A N   
426  C CA  . SER A 57  ? 1.1502 0.6005 0.6791 -0.0196 0.0634  0.0389  73  SER A CA  
427  C C   . SER A 57  ? 1.0928 0.5855 0.6543 -0.0418 0.0509  0.0524  73  SER A C   
428  O O   . SER A 57  ? 1.0999 0.5821 0.6639 -0.0457 0.0460  0.0659  73  SER A O   
429  C CB  . SER A 57  ? 1.2306 0.6031 0.7140 -0.0371 0.0619  0.0348  73  SER A CB  
430  O OG  . SER A 57  ? 1.2135 0.5807 0.6803 -0.0718 0.0519  0.0294  73  SER A OG  
431  N N   . PHE A 58  ? 1.0675 0.6070 0.6577 -0.0563 0.0488  0.0493  74  PHE A N   
432  C CA  . PHE A 58  ? 1.0221 0.6068 0.6579 -0.0733 0.0442  0.0590  74  PHE A CA  
433  C C   . PHE A 58  ? 1.0222 0.6543 0.6830 -0.0552 0.0524  0.0597  74  PHE A C   
434  O O   . PHE A 58  ? 1.0028 0.6661 0.6953 -0.0708 0.0538  0.0644  74  PHE A O   
435  C CB  . PHE A 58  ? 0.9098 0.5317 0.5800 -0.0918 0.0420  0.0579  74  PHE A CB  
436  C CG  . PHE A 58  ? 0.8810 0.5466 0.5676 -0.0741 0.0544  0.0462  74  PHE A CG  
437  C CD1 . PHE A 58  ? 0.8336 0.5606 0.5711 -0.0704 0.0640  0.0432  74  PHE A CD1 
438  C CD2 . PHE A 58  ? 0.9078 0.5526 0.5594 -0.0642 0.0599  0.0355  74  PHE A CD2 
439  C CE1 . PHE A 58  ? 0.8080 0.5761 0.5643 -0.0561 0.0762  0.0313  74  PHE A CE1 
440  C CE2 . PHE A 58  ? 0.8834 0.5690 0.5540 -0.0493 0.0738  0.0242  74  PHE A CE2 
441  C CZ  . PHE A 58  ? 0.8306 0.5786 0.5552 -0.0448 0.0808  0.0230  74  PHE A CZ  
442  N N   . LEU A 59  ? 0.9834 0.6233 0.6329 -0.0250 0.0583  0.0548  75  LEU A N   
443  C CA  . LEU A 59  ? 0.9983 0.6882 0.6679 -0.0107 0.0608  0.0578  75  LEU A CA  
444  C C   . LEU A 59  ? 1.0333 0.6950 0.6794 -0.0107 0.0540  0.0755  75  LEU A C   
445  O O   . LEU A 59  ? 1.0678 0.6717 0.6819 0.0012  0.0507  0.0841  75  LEU A O   
446  C CB  . LEU A 59  ? 0.9879 0.7021 0.6630 0.0216  0.0661  0.0504  75  LEU A CB  
447  C CG  . LEU A 59  ? 0.9173 0.6866 0.6269 0.0247  0.0762  0.0333  75  LEU A CG  
448  C CD1 . LEU A 59  ? 0.8578 0.6860 0.6050 0.0039  0.0788  0.0298  75  LEU A CD1 
449  C CD2 . LEU A 59  ? 0.9011 0.6423 0.6003 0.0145  0.0820  0.0236  75  LEU A CD2 
450  N N   . ARG A 60  ? 0.9941 0.6942 0.6557 -0.0268 0.0550  0.0797  76  ARG A N   
451  C CA  . ARG A 60  ? 1.0232 0.7076 0.6592 -0.0286 0.0501  0.0981  76  ARG A CA  
452  C C   . ARG A 60  ? 1.0664 0.7479 0.6839 0.0053  0.0418  0.1118  76  ARG A C   
453  O O   . ARG A 60  ? 1.0732 0.7993 0.7106 0.0255  0.0413  0.1046  76  ARG A O   
454  C CB  . ARG A 60  ? 1.0137 0.7528 0.6679 -0.0524 0.0572  0.0942  76  ARG A CB  
455  C CG  . ARG A 60  ? 0.9740 0.7846 0.6625 -0.0483 0.0634  0.0763  76  ARG A CG  
456  C CD  . ARG A 60  ? 0.9669 0.8281 0.6487 -0.0591 0.0646  0.0775  76  ARG A CD  
457  N NE  . ARG A 60  ? 0.9332 0.8569 0.6334 -0.0439 0.0621  0.0671  76  ARG A NE  
458  C CZ  . ARG A 60  ? 0.9608 0.8889 0.6510 -0.0113 0.0471  0.0793  76  ARG A CZ  
459  N NH1 . ARG A 60  ? 1.0192 0.8882 0.6816 0.0099  0.0362  0.1012  76  ARG A NH1 
460  N NH2 . ARG A 60  ? 0.9324 0.9234 0.6470 -0.0003 0.0447  0.0690  76  ARG A NH2 
461  N N   . ARG A 61  ? 1.1547 0.7155 0.6274 0.0927  0.0638  -0.0207 77  ARG A N   
462  C CA  . ARG A 61  ? 1.1717 0.7316 0.6402 0.1082  0.0428  -0.0360 77  ARG A CA  
463  C C   . ARG A 61  ? 1.1823 0.7348 0.6192 0.1305  0.0403  -0.0055 77  ARG A C   
464  O O   . ARG A 61  ? 1.1672 0.7097 0.5985 0.1262  0.0540  0.0316  77  ARG A O   
465  C CB  . ARG A 61  ? 1.1176 0.6671 0.6166 0.0944  0.0293  -0.0369 77  ARG A CB  
466  C CG  . ARG A 61  ? 1.1190 0.6767 0.6422 0.0690  0.0301  -0.0749 77  ARG A CG  
467  C CD  . ARG A 61  ? 1.1649 0.7341 0.7007 0.0803  0.0146  -0.1214 77  ARG A CD  
468  N NE  . ARG A 61  ? 1.1503 0.7138 0.7223 0.0753  -0.0010 -0.1318 77  ARG A NE  
469  C CZ  . ARG A 61  ? 1.1797 0.7513 0.7797 0.0891  -0.0209 -0.1691 77  ARG A CZ  
470  N NH1 . ARG A 61  ? 1.2261 0.8158 0.8185 0.1098  -0.0303 -0.1996 77  ARG A NH1 
471  N NH2 . ARG A 61  ? 1.1617 0.7258 0.8037 0.0830  -0.0322 -0.1786 77  ARG A NH2 
472  N N   . TRP A 62  ? 1.2310 0.7889 0.6458 0.1528  0.0224  -0.0222 78  TRP A N   
473  C CA  . TRP A 62  ? 1.2512 0.7992 0.6200 0.1724  0.0184  0.0071  78  TRP A CA  
474  C C   . TRP A 62  ? 1.2673 0.7944 0.6299 0.1913  -0.0143 0.0152  78  TRP A C   
475  O O   . TRP A 62  ? 1.2786 0.8158 0.6683 0.2003  -0.0384 -0.0207 78  TRP A O   
476  C CB  . TRP A 62  ? 1.2187 0.7925 0.5523 0.1854  0.0237  -0.0146 78  TRP A CB  
477  C CG  . TRP A 62  ? 1.2018 0.7918 0.5385 0.1722  0.0575  -0.0193 78  TRP A CG  
478  C CD1 . TRP A 62  ? 1.1917 0.7985 0.5554 0.1617  0.0706  -0.0545 78  TRP A CD1 
479  C CD2 . TRP A 62  ? 1.2089 0.7972 0.5247 0.1679  0.0839  0.0100  78  TRP A CD2 
480  N NE1 . TRP A 62  ? 1.1898 0.8027 0.5544 0.1547  0.1004  -0.0466 78  TRP A NE1 
481  C CE2 . TRP A 62  ? 1.2028 0.8088 0.5424 0.1583  0.1093  -0.0102 78  TRP A CE2 
482  C CE3 . TRP A 62  ? 1.2398 0.8112 0.5206 0.1692  0.0911  0.0495  78  TRP A CE3 
483  C CZ2 . TRP A 62  ? 1.2130 0.8257 0.5528 0.1528  0.1394  0.0041  78  TRP A CZ2 
484  C CZ3 . TRP A 62  ? 1.2473 0.8276 0.5231 0.1595  0.1245  0.0617  78  TRP A CZ3 
485  C CH2 . TRP A 62  ? 1.2302 0.8337 0.5402 0.1527  0.1473  0.0373  78  TRP A CH2 
486  N N   . ASN A 63  ? 1.3211 0.8166 0.6514 0.1965  -0.0139 0.0613  79  ASN A N   
487  C CA  . ASN A 63  ? 1.3589 0.8272 0.6556 0.2218  -0.0449 0.0798  79  ASN A CA  
488  C C   . ASN A 63  ? 1.4096 0.8719 0.6302 0.2287  -0.0340 0.1097  79  ASN A C   
489  O O   . ASN A 63  ? 1.4221 0.8594 0.6175 0.2144  -0.0087 0.1498  79  ASN A O   
490  C CB  . ASN A 63  ? 1.4526 0.8774 0.7745 0.2184  -0.0533 0.1090  79  ASN A CB  
491  C CG  . ASN A 63  ? 1.4933 0.8857 0.7945 0.2491  -0.0936 0.1221  79  ASN A CG  
492  O OD1 . ASN A 63  ? 1.5257 0.9367 0.8015 0.2740  -0.1212 0.1023  79  ASN A OD1 
493  N ND2 . ASN A 63  ? 1.5040 0.8486 0.8219 0.2483  -0.0994 0.1527  79  ASN A ND2 
494  N N   . GLY A 64  ? 1.3780 0.8677 0.5637 0.2472  -0.0504 0.0850  80  GLY A N   
495  C CA  . GLY A 64  ? 1.4259 0.9201 0.5366 0.2493  -0.0375 0.1033  80  GLY A CA  
496  C C   . GLY A 64  ? 1.3955 0.9014 0.5104 0.2222  0.0120  0.1110  80  GLY A C   
497  O O   . GLY A 64  ? 1.3473 0.8876 0.5037 0.2120  0.0309  0.0767  80  GLY A O   
498  N N   . SER A 65  ? 1.4957 0.9712 0.5688 0.2104  0.0336  0.1549  81  SER A N   
499  C CA  . SER A 65  ? 1.4804 0.9701 0.5587 0.1864  0.0805  0.1602  81  SER A CA  
500  C C   . SER A 65  ? 1.4216 0.9066 0.5727 0.1675  0.0997  0.1666  81  SER A C   
501  O O   . SER A 65  ? 1.4131 0.9091 0.5797 0.1490  0.1358  0.1729  81  SER A O   
502  C CB  . SER A 65  ? 1.6204 1.0829 0.6210 0.1772  0.0999  0.1993  81  SER A CB  
503  O OG  . SER A 65  ? 1.6294 1.0458 0.6379 0.1649  0.1081  0.2395  81  SER A OG  
504  N N   . THR A 66  ? 1.4062 0.8789 0.6048 0.1705  0.0765  0.1623  82  THR A N   
505  C CA  . THR A 66  ? 1.3716 0.8416 0.6324 0.1509  0.0909  0.1691  82  THR A CA  
506  C C   . THR A 66  ? 1.3294 0.8275 0.6455 0.1482  0.0820  0.1320  82  THR A C   
507  O O   . THR A 66  ? 1.3142 0.8164 0.6362 0.1603  0.0556  0.1060  82  THR A O   
508  C CB  . THR A 66  ? 1.4128 0.8408 0.6818 0.1484  0.0780  0.1971  82  THR A CB  
509  O OG1 . THR A 66  ? 1.4648 0.8562 0.6724 0.1489  0.0875  0.2355  82  THR A OG1 
510  C CG2 . THR A 66  ? 1.3809 0.8139 0.7126 0.1248  0.0952  0.2012  82  THR A CG2 
511  N N   . ALA A 67  ? 1.2732 0.7896 0.6294 0.1318  0.1039  0.1288  83  ALA A N   
512  C CA  . ALA A 67  ? 1.2429 0.7785 0.6406 0.1253  0.0986  0.1000  83  ALA A CA  
513  C C   . ALA A 67  ? 1.2233 0.7559 0.6672 0.1057  0.1010  0.1133  83  ALA A C   
514  O O   . ALA A 67  ? 1.2373 0.7670 0.6929 0.0966  0.1169  0.1390  83  ALA A O   
515  C CB  . ALA A 67  ? 1.2102 0.7700 0.6108 0.1262  0.1183  0.0817  83  ALA A CB  
516  N N   . ILE A 68  ? 1.1695 0.7062 0.6393 0.0967  0.0863  0.0920  84  ILE A N   
517  C CA  . ILE A 68  ? 1.1511 0.6900 0.6594 0.0756  0.0844  0.0992  84  ILE A CA  
518  C C   . ILE A 68  ? 1.1416 0.6929 0.6626 0.0648  0.0827  0.0787  84  ILE A C   
519  O O   . ILE A 68  ? 1.1362 0.6881 0.6432 0.0686  0.0776  0.0497  84  ILE A O   
520  C CB  . ILE A 68  ? 1.1708 0.6948 0.6928 0.0684  0.0679  0.0955  84  ILE A CB  
521  C CG1 . ILE A 68  ? 1.1562 0.6887 0.7164 0.0428  0.0681  0.1004  84  ILE A CG1 
522  C CG2 . ILE A 68  ? 1.1623 0.6866 0.6810 0.0732  0.0503  0.0590  84  ILE A CG2 
523  C CD1 . ILE A 68  ? 1.1458 0.6638 0.7278 0.0334  0.0594  0.0990  84  ILE A CD1 
524  N N   . THR A 69  ? 1.1313 0.6916 0.6779 0.0514  0.0869  0.0938  85  THR A N   
525  C CA  . THR A 69  ? 1.1296 0.6927 0.6815 0.0390  0.0823  0.0829  85  THR A CA  
526  C C   . THR A 69  ? 1.1325 0.7044 0.7109 0.0189  0.0730  0.0992  85  THR A C   
527  O O   . THR A 69  ? 1.1462 0.7288 0.7491 0.0191  0.0769  0.1200  85  THR A O   
528  C CB  . THR A 69  ? 1.1173 0.6825 0.6681 0.0517  0.0958  0.0842  85  THR A CB  
529  O OG1 . THR A 69  ? 1.1133 0.6688 0.6598 0.0395  0.0907  0.0741  85  THR A OG1 
530  C CG2 . THR A 69  ? 1.1576 0.7363 0.7396 0.0577  0.1056  0.1108  85  THR A CG2 
531  N N   . ASP A 70  ? 1.1281 0.6968 0.6991 -0.0015 0.0616  0.0869  86  ASP A N   
532  C CA  . ASP A 70  ? 1.1317 0.7121 0.7192 -0.0251 0.0486  0.0963  86  ASP A CA  
533  C C   . ASP A 70  ? 1.1595 0.7362 0.7358 -0.0355 0.0391  0.1054  86  ASP A C   
534  O O   . ASP A 70  ? 1.1575 0.7148 0.7023 -0.0432 0.0406  0.0896  86  ASP A O   
535  C CB  . ASP A 70  ? 1.1366 0.7158 0.7200 -0.0470 0.0424  0.0708  86  ASP A CB  
536  C CG  . ASP A 70  ? 1.1362 0.7335 0.7386 -0.0742 0.0315  0.0759  86  ASP A CG  
537  O OD1 . ASP A 70  ? 1.1566 0.7702 0.7783 -0.0731 0.0263  0.1009  86  ASP A OD1 
538  O OD2 . ASP A 70  ? 1.1229 0.7224 0.7265 -0.0969 0.0285  0.0507  86  ASP A OD2 
539  N N   . ASP A 71  ? 1.1132 0.7070 0.7160 -0.0358 0.0287  0.1305  87  ASP A N   
540  C CA  . ASP A 71  ? 1.1497 0.7387 0.7428 -0.0444 0.0111  0.1464  87  ASP A CA  
541  C C   . ASP A 71  ? 1.1490 0.7562 0.7381 -0.0756 -0.0077 0.1452  87  ASP A C   
542  O O   . ASP A 71  ? 1.1757 0.8131 0.8012 -0.0771 -0.0191 0.1590  87  ASP A O   
543  C CB  . ASP A 71  ? 1.1747 0.7755 0.8083 -0.0200 0.0076  0.1717  87  ASP A CB  
544  C CG  . ASP A 71  ? 1.2085 0.8054 0.8385 -0.0256 -0.0196 0.1938  87  ASP A CG  
545  O OD1 . ASP A 71  ? 1.2553 0.8776 0.9331 -0.0122 -0.0334 0.2126  87  ASP A OD1 
546  O OD2 . ASP A 71  ? 1.1880 0.7557 0.7670 -0.0440 -0.0278 0.1920  87  ASP A OD2 
547  N N   . THR A 72  ? 1.1458 0.7382 0.6930 -0.1032 -0.0083 0.1232  88  THR A N   
548  C CA  . THR A 72  ? 1.1387 0.7508 0.6797 -0.1382 -0.0202 0.1119  88  THR A CA  
549  C C   . THR A 72  ? 1.1856 0.8069 0.7092 -0.1538 -0.0472 0.1361  88  THR A C   
550  O O   . THR A 72  ? 1.1875 0.8386 0.7179 -0.1790 -0.0607 0.1317  88  THR A O   
551  C CB  . THR A 72  ? 1.1134 0.7096 0.6180 -0.1661 -0.0092 0.0747  88  THR A CB  
552  O OG1 . THR A 72  ? 1.1357 0.6978 0.5922 -0.1703 -0.0053 0.0742  88  THR A OG1 
553  C CG2 . THR A 72  ? 1.0783 0.6734 0.6089 -0.1510 0.0088  0.0489  88  THR A CG2 
554  N N   . LEU A 73  ? 1.1639 0.7593 0.6655 -0.1394 -0.0567 0.1608  89  LEU A N   
555  C CA  . LEU A 73  ? 1.2018 0.8004 0.6835 -0.1496 -0.0891 0.1897  89  LEU A CA  
556  C C   . LEU A 73  ? 1.2273 0.8668 0.7752 -0.1253 -0.1078 0.2116  89  LEU A C   
557  O O   . LEU A 73  ? 1.2386 0.9143 0.7963 -0.1423 -0.1322 0.2166  89  LEU A O   
558  C CB  . LEU A 73  ? 1.3157 0.8626 0.7505 -0.1430 -0.0933 0.2100  89  LEU A CB  
559  C CG  . LEU A 73  ? 1.3194 0.8324 0.6716 -0.1863 -0.0896 0.1964  89  LEU A CG  
560  C CD1 . LEU A 73  ? 1.2885 0.7980 0.6338 -0.2024 -0.0548 0.1491  89  LEU A CD1 
561  C CD2 . LEU A 73  ? 1.3555 0.8099 0.6560 -0.1836 -0.0960 0.2240  89  LEU A CD2 
562  N N   . GLY A 74  ? 1.1522 0.7906 0.7482 -0.0877 -0.0954 0.2205  90  GLY A N   
563  C CA  . GLY A 74  ? 1.1842 0.8662 0.8528 -0.0672 -0.1054 0.2320  90  GLY A CA  
564  C C   . GLY A 74  ? 1.1799 0.8997 0.8863 -0.0789 -0.0893 0.2111  90  GLY A C   
565  O O   . GLY A 74  ? 1.2030 0.9668 0.9642 -0.0767 -0.1006 0.2148  90  GLY A O   
566  N N   . GLY A 75  ? 1.1699 0.8724 0.8531 -0.0903 -0.0632 0.1882  91  GLY A N   
567  C CA  . GLY A 75  ? 1.1338 0.8600 0.8486 -0.1022 -0.0475 0.1704  91  GLY A CA  
568  C C   . GLY A 75  ? 1.1447 0.8750 0.9041 -0.0761 -0.0228 0.1743  91  GLY A C   
569  O O   . GLY A 75  ? 1.1645 0.9277 0.9752 -0.0777 -0.0188 0.1751  91  GLY A O   
570  N N   . THR A 76  ? 1.1732 0.8717 0.9116 -0.0549 -0.0041 0.1743  92  THR A N   
571  C CA  . THR A 76  ? 1.1827 0.8817 0.9492 -0.0334 0.0220  0.1775  92  THR A CA  
572  C C   . THR A 76  ? 1.1231 0.7879 0.8490 -0.0255 0.0412  0.1660  92  THR A C   
573  O O   . THR A 76  ? 1.1141 0.7563 0.8058 -0.0166 0.0406  0.1609  92  THR A O   
574  C CB  . THR A 76  ? 1.1502 0.8584 0.9476 -0.0088 0.0222  0.1910  92  THR A CB  
575  O OG1 . THR A 76  ? 1.2084 0.9479 1.0426 -0.0127 -0.0055 0.2017  92  THR A OG1 
576  C CG2 . THR A 76  ? 1.1607 0.8795 0.9921 0.0046  0.0525  0.1902  92  THR A CG2 
577  N N   . LEU A 77  ? 1.1726 0.8329 0.9035 -0.0286 0.0571  0.1617  93  LEU A N   
578  C CA  . LEU A 77  ? 1.1330 0.7635 0.8296 -0.0166 0.0711  0.1543  93  LEU A CA  
579  C C   . LEU A 77  ? 1.1630 0.7921 0.8631 0.0041  0.0932  0.1661  93  LEU A C   
580  O O   . LEU A 77  ? 1.1980 0.8469 0.9352 0.0023  0.1049  0.1768  93  LEU A O   
581  C CB  . LEU A 77  ? 1.1918 0.8113 0.8912 -0.0299 0.0737  0.1472  93  LEU A CB  
582  C CG  . LEU A 77  ? 1.1630 0.7508 0.8297 -0.0189 0.0761  0.1365  93  LEU A CG  
583  C CD1 . LEU A 77  ? 1.1485 0.7316 0.7899 -0.0209 0.0623  0.1128  93  LEU A CD1 
584  C CD2 . LEU A 77  ? 1.1440 0.7193 0.8289 -0.0313 0.0777  0.1332  93  LEU A CD2 
585  N N   . THR A 78  ? 1.1800 0.7901 0.8435 0.0212  0.1006  0.1599  94  THR A N   
586  C CA  . THR A 78  ? 1.2137 0.8253 0.8739 0.0374  0.1237  0.1666  94  THR A CA  
587  C C   . THR A 78  ? 1.1909 0.7776 0.8011 0.0486  0.1305  0.1620  94  THR A C   
588  O O   . THR A 78  ? 1.1699 0.7459 0.7514 0.0556  0.1190  0.1453  94  THR A O   
589  C CB  . THR A 78  ? 1.1788 0.8019 0.8526 0.0495  0.1257  0.1620  94  THR A CB  
590  O OG1 . THR A 78  ? 1.2274 0.8743 0.9521 0.0436  0.1155  0.1710  94  THR A OG1 
591  C CG2 . THR A 78  ? 1.2037 0.8308 0.8728 0.0634  0.1532  0.1605  94  THR A CG2 
592  N N   . ILE A 79  ? 1.2672 0.8445 0.8658 0.0489  0.1486  0.1762  95  ILE A N   
593  C CA  . ILE A 79  ? 1.2638 0.8151 0.8082 0.0607  0.1520  0.1789  95  ILE A CA  
594  C C   . ILE A 79  ? 1.3042 0.8638 0.8273 0.0690  0.1774  0.1808  95  ILE A C   
595  O O   . ILE A 79  ? 1.3329 0.9087 0.8851 0.0604  0.2009  0.1882  95  ILE A O   
596  C CB  . ILE A 79  ? 1.3190 0.8417 0.8530 0.0526  0.1536  0.1977  95  ILE A CB  
597  C CG1 . ILE A 79  ? 1.2848 0.8095 0.8601 0.0369  0.1373  0.1925  95  ILE A CG1 
598  C CG2 . ILE A 79  ? 1.3242 0.8146 0.7996 0.0691  0.1435  0.2016  95  ILE A CG2 
599  C CD1 . ILE A 79  ? 1.2571 0.7822 0.8296 0.0406  0.1112  0.1690  95  ILE A CD1 
600  N N   . THR A 80  ? 1.3227 0.8760 0.7992 0.0842  0.1738  0.1691  96  THR A N   
601  C CA  . THR A 80  ? 1.3595 0.9224 0.8069 0.0898  0.1986  0.1658  96  THR A CA  
602  C C   . THR A 80  ? 1.3699 0.9055 0.7458 0.0963  0.1956  0.1788  96  THR A C   
603  O O   . THR A 80  ? 1.3536 0.8765 0.7000 0.1100  0.1684  0.1708  96  THR A O   
604  C CB  . THR A 80  ? 1.2780 0.8619 0.7315 0.1009  0.1985  0.1371  96  THR A CB  
605  O OG1 . THR A 80  ? 1.2833 0.8833 0.7983 0.0964  0.1975  0.1314  96  THR A OG1 
606  C CG2 . THR A 80  ? 1.3112 0.9097 0.7391 0.1034  0.2276  0.1283  96  THR A CG2 
607  N N   . LEU A 81  ? 1.4269 0.9530 0.7755 0.0858  0.2228  0.1982  97  LEU A N   
608  C CA  . LEU A 81  ? 1.4565 0.9544 0.7227 0.0902  0.2238  0.2149  97  LEU A CA  
609  C C   . LEU A 81  ? 1.4838 1.0102 0.7200 0.0922  0.2457  0.1943  97  LEU A C   
610  O O   . LEU A 81  ? 1.5088 1.0522 0.7571 0.0761  0.2834  0.1920  97  LEU A O   
611  C CB  . LEU A 81  ? 1.5387 1.0022 0.7842 0.0716  0.2448  0.2490  97  LEU A CB  
612  C CG  . LEU A 81  ? 1.5096 0.9481 0.7958 0.0670  0.2274  0.2639  97  LEU A CG  
613  C CD1 . LEU A 81  ? 1.5273 0.9445 0.8218 0.0414  0.2601  0.2879  97  LEU A CD1 
614  C CD2 . LEU A 81  ? 1.5052 0.9058 0.7505 0.0862  0.1891  0.2743  97  LEU A CD2 
615  N N   . ARG A 82  ? 1.4722 1.1154 0.6642 0.1150  0.0587  0.1659  98  ARG A N   
616  C CA  . ARG A 82  ? 1.4809 1.1432 0.6526 0.1316  0.0387  0.1515  98  ARG A CA  
617  C C   . ARG A 82  ? 1.5857 1.1800 0.6385 0.1214  0.0513  0.1668  98  ARG A C   
618  O O   . ARG A 82  ? 1.6377 1.1582 0.6301 0.1270  0.0386  0.2005  98  ARG A O   
619  C CB  . ARG A 82  ? 1.3967 1.0690 0.6100 0.1703  -0.0177 0.1583  98  ARG A CB  
620  C CG  . ARG A 82  ? 1.4296 1.1015 0.6042 0.1892  -0.0437 0.1493  98  ARG A CG  
621  C CD  . ARG A 82  ? 1.3774 1.0596 0.5979 0.2247  -0.0990 0.1566  98  ARG A CD  
622  N NE  . ARG A 82  ? 1.4230 1.0918 0.5946 0.2431  -0.1278 0.1528  98  ARG A NE  
623  C CZ  . ARG A 82  ? 1.4040 1.0686 0.5919 0.2730  -0.1773 0.1623  98  ARG A CZ  
624  N NH1 . ARG A 82  ? 1.3413 1.0144 0.5928 0.2876  -0.2015 0.1762  98  ARG A NH1 
625  N NH2 . ARG A 82  ? 1.4498 1.1041 0.5905 0.2865  -0.2017 0.1563  98  ARG A NH2 
626  N N   . ASN A 83  ? 1.6840 1.3040 0.7043 0.1052  0.0767  0.1417  99  ASN A N   
627  C CA  . ASN A 83  ? 1.7707 1.3345 0.6728 0.0893  0.0925  0.1526  99  ASN A CA  
628  C C   . ASN A 83  ? 1.8331 1.3329 0.6731 0.0584  0.1274  0.1797  99  ASN A C   
629  O O   . ASN A 83  ? 1.8765 1.3005 0.6628 0.0672  0.1072  0.2179  99  ASN A O   
630  C CB  . ASN A 83  ? 1.8076 1.3274 0.6566 0.1201  0.0424  0.1739  99  ASN A CB  
631  C CG  . ASN A 83  ? 1.9236 1.3758 0.6415 0.1022  0.0535  0.1940  99  ASN A CG  
632  O OD1 . ASN A 83  ? 1.9796 1.3552 0.6343 0.1002  0.0454  0.2340  99  ASN A OD1 
633  N ND2 . ASN A 83  ? 1.9662 1.4460 0.6420 0.0881  0.0719  0.1661  99  ASN A ND2 
634  N N   . LEU A 84  ? 1.8281 1.3590 0.6828 0.0228  0.1786  0.1597  100 LEU A N   
635  C CA  . LEU A 84  ? 1.8834 1.3565 0.6847 -0.0110 0.2155  0.1821  100 LEU A CA  
636  C C   . LEU A 84  ? 2.0087 1.4008 0.6759 -0.0267 0.2221  0.2095  100 LEU A C   
637  O O   . LEU A 84  ? 2.0550 1.4589 0.6686 -0.0294 0.2229  0.1960  100 LEU A O   
638  C CB  . LEU A 84  ? 1.8856 1.4177 0.7296 -0.0484 0.2697  0.1506  100 LEU A CB  
639  C CG  . LEU A 84  ? 1.8983 1.3901 0.7297 -0.0815 0.3056  0.1674  100 LEU A CG  
640  C CD1 . LEU A 84  ? 1.8567 1.3218 0.7406 -0.0574 0.2736  0.1901  100 LEU A CD1 
641  C CD2 . LEU A 84  ? 1.8484 1.4162 0.7402 -0.1148 0.3532  0.1310  100 LEU A CD2 
642  N N   . GLN A 85  ? 2.0816 1.3896 0.6942 -0.0375 0.2256  0.2484  101 GLN A N   
643  C CA  . GLN A 85  ? 2.2248 1.4427 0.7079 -0.0532 0.2269  0.2843  101 GLN A CA  
644  C C   . GLN A 85  ? 2.2948 1.4762 0.7405 -0.1010 0.2776  0.2938  101 GLN A C   
645  O O   . GLN A 85  ? 2.2408 1.4447 0.7426 -0.1177 0.3089  0.2807  101 GLN A O   
646  C CB  . GLN A 85  ? 2.2570 1.3999 0.7180 -0.0166 0.1724  0.3277  101 GLN A CB  
647  C CG  . GLN A 85  ? 2.2224 1.3903 0.6969 0.0257  0.1185  0.3238  101 GLN A CG  
648  C CD  . GLN A 85  ? 2.2918 1.4731 0.6924 0.0125  0.1213  0.3124  101 GLN A CD  
649  O OE1 . GLN A 85  ? 2.3946 1.5365 0.7290 -0.0123 0.1297  0.3319  101 GLN A OE1 
650  N NE2 . GLN A 85  ? 2.2283 1.4784 0.6618 0.0282  0.1123  0.2764  101 GLN A NE2 
651  N N   . PRO A 86  ? 2.4065 1.5469 0.7791 -0.1244 0.2831  0.3123  102 PRO A N   
652  C CA  . PRO A 86  ? 2.4721 1.5753 0.8273 -0.1652 0.3205  0.3249  102 PRO A CA  
653  C C   . PRO A 86  ? 2.4663 1.5056 0.8512 -0.1527 0.3059  0.3543  102 PRO A C   
654  O O   . PRO A 86  ? 2.4375 1.4836 0.8640 -0.1761 0.3406  0.3440  102 PRO A O   
655  C CB  . PRO A 86  ? 2.5994 1.6623 0.8637 -0.1828 0.3149  0.3465  102 PRO A CB  
656  C CG  . PRO A 86  ? 2.6009 1.6543 0.8429 -0.1416 0.2600  0.3600  102 PRO A CG  
657  C CD  . PRO A 86  ? 2.4826 1.6094 0.7854 -0.1174 0.2563  0.3227  102 PRO A CD  
658  N N   . HIS A 87  ? 2.4921 1.4742 0.8639 -0.1160 0.2544  0.3878  103 HIS A N   
659  C CA  . HIS A 87  ? 2.4910 1.4126 0.8966 -0.1006 0.2383  0.4132  103 HIS A CA  
660  C C   . HIS A 87  ? 2.3710 1.3313 0.8613 -0.0837 0.2430  0.3929  103 HIS A C   
661  O O   . HIS A 87  ? 2.3640 1.2836 0.8896 -0.0802 0.2440  0.4050  103 HIS A O   
662  C CB  . HIS A 87  ? 2.5396 1.4067 0.9276 -0.0619 0.1791  0.4485  103 HIS A CB  
663  C CG  . HIS A 87  ? 2.4669 1.3790 0.8856 -0.0187 0.1344  0.4388  103 HIS A CG  
664  N ND1 . HIS A 87  ? 2.3529 1.3036 0.8497 0.0114  0.1200  0.4223  103 HIS A ND1 
665  C CD2 . HIS A 87  ? 2.4942 1.4208 0.8782 -0.0018 0.1002  0.4428  103 HIS A CD2 
666  C CE1 . HIS A 87  ? 2.3115 1.2989 0.8233 0.0454  0.0780  0.4160  103 HIS A CE1 
667  N NE2 . HIS A 87  ? 2.3948 1.3685 0.8398 0.0378  0.0657  0.4272  103 HIS A NE2 
668  N N   . ASP A 88  ? 2.3093 1.3469 0.8333 -0.0736 0.2463  0.3618  104 ASP A N   
669  C CA  . ASP A 88  ? 2.2001 1.3041 0.8391 -0.0610 0.2475  0.3348  104 ASP A CA  
670  C C   . ASP A 88  ? 2.1808 1.3125 0.8509 -0.1053 0.3038  0.3134  104 ASP A C   
671  O O   . ASP A 88  ? 2.1016 1.2780 0.8649 -0.1014 0.3068  0.2953  104 ASP A O   
672  C CB  . ASP A 88  ? 2.1038 1.3070 0.8115 -0.0352 0.2249  0.3009  104 ASP A CB  
673  C CG  . ASP A 88  ? 2.0926 1.2806 0.8006 0.0131  0.1641  0.3175  104 ASP A CG  
674  O OD1 . ASP A 88  ? 2.1222 1.2421 0.8180 0.0340  0.1355  0.3495  104 ASP A OD1 
675  O OD2 . ASP A 88  ? 2.0519 1.2978 0.7779 0.0305  0.1445  0.2968  104 ASP A OD2 
676  N N   . ALA A 89  ? 2.2573 1.3670 0.8511 -0.1493 0.3484  0.3140  105 ALA A N   
677  C CA  . ALA A 89  ? 2.2379 1.3809 0.8689 -0.1934 0.3999  0.2912  105 ALA A CA  
678  C C   . ALA A 89  ? 2.2675 1.3415 0.9117 -0.2008 0.4039  0.3126  105 ALA A C   
679  O O   . ALA A 89  ? 2.3424 1.3300 0.9442 -0.1835 0.3753  0.3484  105 ALA A O   
680  C CB  . ALA A 89  ? 2.2787 1.4365 0.8630 -0.2326 0.4323  0.2803  105 ALA A CB  
681  N N   . GLY A 90  ? 2.2156 1.3315 0.9245 -0.2264 0.4381  0.2884  106 GLY A N   
682  C CA  . GLY A 90  ? 2.2399 1.2969 0.9674 -0.2368 0.4469  0.3014  106 GLY A CA  
683  C C   . GLY A 90  ? 2.1407 1.2669 0.9613 -0.2482 0.4682  0.2704  106 GLY A C   
684  O O   . GLY A 90  ? 2.0502 1.2794 0.9297 -0.2537 0.4780  0.2363  106 GLY A O   
685  N N   . LEU A 91  ? 2.1459 1.2231 0.9942 -0.2491 0.4689  0.2790  107 LEU A N   
686  C CA  . LEU A 91  ? 2.0623 1.2018 1.0032 -0.2654 0.4880  0.2483  107 LEU A CA  
687  C C   . LEU A 91  ? 2.0035 1.1652 1.0219 -0.2209 0.4437  0.2453  107 LEU A C   
688  O O   . LEU A 91  ? 2.0644 1.1457 1.0664 -0.1962 0.4195  0.2700  107 LEU A O   
689  C CB  . LEU A 91  ? 2.1720 1.2496 1.0952 -0.3049 0.5240  0.2515  107 LEU A CB  
690  C CG  . LEU A 91  ? 2.1149 1.2308 1.1156 -0.3300 0.5489  0.2233  107 LEU A CG  
691  C CD1 . LEU A 91  ? 2.0239 1.2579 1.0825 -0.3604 0.5727  0.1826  107 LEU A CD1 
692  C CD2 . LEU A 91  ? 2.2087 1.2304 1.1799 -0.3510 0.5652  0.2362  107 LEU A CD2 
693  N N   . TYR A 92  ? 1.9066 1.1775 1.0106 -0.2118 0.4331  0.2151  108 TYR A N   
694  C CA  . TYR A 92  ? 1.8479 1.1582 1.0294 -0.1741 0.3924  0.2085  108 TYR A CA  
695  C C   . TYR A 92  ? 1.7663 1.1541 1.0362 -0.1964 0.4097  0.1771  108 TYR A C   
696  O O   . TYR A 92  ? 1.7306 1.1590 1.0110 -0.2381 0.4495  0.1572  108 TYR A O   
697  C CB  . TYR A 92  ? 1.7731 1.1443 0.9740 -0.1381 0.3529  0.2055  108 TYR A CB  
698  C CG  . TYR A 92  ? 1.8372 1.1458 0.9550 -0.1145 0.3307  0.2332  108 TYR A CG  
699  C CD1 . TYR A 92  ? 1.8787 1.1733 0.9235 -0.1385 0.3569  0.2362  108 TYR A CD1 
700  C CD2 . TYR A 92  ? 1.8572 1.1300 0.9723 -0.0692 0.2822  0.2537  108 TYR A CD2 
701  C CE1 . TYR A 92  ? 1.9458 1.1865 0.9101 -0.1198 0.3359  0.2608  108 TYR A CE1 
702  C CE2 . TYR A 92  ? 1.9124 1.1330 0.9514 -0.0485 0.2587  0.2787  108 TYR A CE2 
703  C CZ  . TYR A 92  ? 1.9613 1.1647 0.9223 -0.0746 0.2855  0.2828  108 TYR A CZ  
704  O OH  . TYR A 92  ? 2.0260 1.1785 0.9057 -0.0570 0.2618  0.3076  108 TYR A OH  
705  N N   . GLN A 93  ? 1.6713 1.0832 1.0053 -0.1694 0.3787  0.1721  109 GLN A N   
706  C CA  . GLN A 93  ? 1.5764 1.0753 0.9957 -0.1878 0.3871  0.1424  109 GLN A CA  
707  C C   . GLN A 93  ? 1.5225 1.0788 1.0085 -0.1513 0.3415  0.1376  109 GLN A C   
708  O O   . GLN A 93  ? 1.5635 1.0762 1.0367 -0.1116 0.3060  0.1562  109 GLN A O   
709  C CB  . GLN A 93  ? 1.5908 1.0475 1.0181 -0.2188 0.4200  0.1340  109 GLN A CB  
710  C CG  . GLN A 93  ? 1.6734 1.0395 1.0877 -0.1929 0.4035  0.1512  109 GLN A CG  
711  C CD  . GLN A 93  ? 1.7071 1.0388 1.1399 -0.2245 0.4373  0.1363  109 GLN A CD  
712  O OE1 . GLN A 93  ? 1.6477 1.0366 1.1496 -0.2317 0.4374  0.1114  109 GLN A OE1 
713  N NE2 . GLN A 93  ? 1.8075 1.0440 1.1764 -0.2455 0.4665  0.1513  109 GLN A NE2 
714  N N   . CYS A 94  ? 1.4230 1.0802 0.9803 -0.1675 0.3427  0.1130  110 CYS A N   
715  C CA  . CYS A 94  ? 1.3674 1.0919 0.9963 -0.1467 0.3070  0.1043  110 CYS A CA  
716  C C   . CYS A 94  ? 1.3561 1.0822 1.0261 -0.1643 0.3195  0.0900  110 CYS A C   
717  O O   . CYS A 94  ? 1.3447 1.0686 1.0144 -0.2039 0.3587  0.0756  110 CYS A O   
718  C CB  . CYS A 94  ? 1.2931 1.1269 0.9761 -0.1563 0.2982  0.0880  110 CYS A CB  
719  S SG  . CYS A 94  ? 1.2940 1.1483 0.9483 -0.1389 0.2860  0.0940  110 CYS A SG  
720  N N   . GLN A 95  ? 1.2590 0.9916 0.9656 -0.1362 0.2874  0.0914  111 GLN A N   
721  C CA  . GLN A 95  ? 1.2673 0.9935 1.0102 -0.1480 0.2981  0.0761  111 GLN A CA  
722  C C   . GLN A 95  ? 1.1839 0.9946 0.9971 -0.1393 0.2684  0.0635  111 GLN A C   
723  O O   . GLN A 95  ? 1.1687 0.9965 0.9932 -0.1043 0.2288  0.0756  111 GLN A O   
724  C CB  . GLN A 95  ? 1.3407 0.9597 1.0479 -0.1221 0.2948  0.0914  111 GLN A CB  
725  C CG  . GLN A 95  ? 1.4287 0.9577 1.0694 -0.1418 0.3307  0.1021  111 GLN A CG  
726  C CD  . GLN A 95  ? 1.5427 0.9619 1.1528 -0.1168 0.3252  0.1190  111 GLN A CD  
727  O OE1 . GLN A 95  ? 1.5635 0.9619 1.1803 -0.0739 0.2871  0.1329  111 GLN A OE1 
728  N NE2 . GLN A 95  ? 1.6160 0.9636 1.1945 -0.1438 0.3623  0.1181  111 GLN A NE2 
729  N N   . SER A 96  ? 1.1326 0.9954 0.9902 -0.1739 0.2881  0.0391  112 SER A N   
730  C CA  . SER A 96  ? 1.0621 0.9987 0.9821 -0.1734 0.2658  0.0254  112 SER A CA  
731  C C   . SER A 96  ? 1.1272 1.0151 1.0600 -0.1661 0.2735  0.0139  112 SER A C   
732  O O   . SER A 96  ? 1.1703 1.0207 1.0944 -0.1928 0.3103  -0.0014 112 SER A O   
733  C CB  . SER A 96  ? 1.0238 1.0546 0.9834 -0.2190 0.2812  0.0052  112 SER A CB  
734  O OG  . SER A 96  ? 0.9498 1.0567 0.9637 -0.2210 0.2562  -0.0039 112 SER A OG  
735  N N   . LEU A 97  ? 1.0801 0.9711 1.0378 -0.1315 0.2398  0.0186  113 LEU A N   
736  C CA  . LEU A 97  ? 1.1572 0.9945 1.1288 -0.1152 0.2435  0.0087  113 LEU A CA  
737  C C   . LEU A 97  ? 1.0915 1.0038 1.1254 -0.1384 0.2481  -0.0218 113 LEU A C   
738  O O   . LEU A 97  ? 1.0017 0.9997 1.0703 -0.1426 0.2242  -0.0236 113 LEU A O   
739  C CB  . LEU A 97  ? 1.0722 0.8639 1.0346 -0.0612 0.2041  0.0308  113 LEU A CB  
740  C CG  . LEU A 97  ? 1.1004 0.8503 1.0069 -0.0343 0.1835  0.0630  113 LEU A CG  
741  C CD1 . LEU A 97  ? 1.1500 0.8666 1.0569 0.0161  0.1420  0.0804  113 LEU A CD1 
742  C CD2 . LEU A 97  ? 1.1751 0.8398 1.0182 -0.0460 0.2146  0.0746  113 LEU A CD2 
743  N N   . HIS A 98  ? 1.1460 1.0243 1.1930 -0.1548 0.2792  -0.0462 114 HIS A N   
744  C CA  . HIS A 98  ? 1.0979 1.0375 1.2020 -0.1736 0.2853  -0.0788 114 HIS A CA  
745  C C   . HIS A 98  ? 1.1967 1.0606 1.3136 -0.1572 0.3019  -0.0964 114 HIS A C   
746  O O   . HIS A 98  ? 1.2728 1.0641 1.3639 -0.1697 0.3342  -0.1019 114 HIS A O   
747  C CB  . HIS A 98  ? 1.1006 1.1164 1.2202 -0.2319 0.3140  -0.1030 114 HIS A CB  
748  C CG  . HIS A 98  ? 1.1432 1.1107 1.2272 -0.2623 0.3544  -0.1083 114 HIS A CG  
749  N ND1 . HIS A 98  ? 1.2249 1.1306 1.3088 -0.2762 0.3903  -0.1319 114 HIS A ND1 
750  C CD2 . HIS A 98  ? 1.1151 1.0890 1.1654 -0.2832 0.3657  -0.0950 114 HIS A CD2 
751  C CE1 . HIS A 98  ? 1.2484 1.1221 1.2965 -0.3059 0.4216  -0.1311 114 HIS A CE1 
752  N NE2 . HIS A 98  ? 1.1785 1.0955 1.2064 -0.3110 0.4080  -0.1094 114 HIS A NE2 
753  N N   . GLY A 99  ? 1.2267 1.1047 1.3848 -0.1273 0.2782  -0.1041 115 GLY A N   
754  C CA  . GLY A 99  ? 1.3019 1.1129 1.4836 -0.1052 0.2889  -0.1222 115 GLY A CA  
755  C C   . GLY A 99  ? 1.4113 1.1010 1.5442 -0.0714 0.2860  -0.0933 115 GLY A C   
756  O O   . GLY A 99  ? 1.4351 1.0975 1.5271 -0.0433 0.2573  -0.0564 115 GLY A O   
757  N N   . SER A 100 ? 1.4522 1.0660 1.5880 -0.0756 0.3159  -0.1104 116 SER A N   
758  C CA  . SER A 100 ? 1.5478 1.0385 1.6342 -0.0487 0.3151  -0.0815 116 SER A CA  
759  C C   . SER A 100 ? 1.5790 1.0417 1.5945 -0.0748 0.3310  -0.0558 116 SER A C   
760  O O   . SER A 100 ? 1.6433 1.0173 1.6042 -0.0511 0.3206  -0.0212 116 SER A O   
761  C CB  . SER A 100 ? 1.6742 1.0894 1.7869 -0.0490 0.3435  -0.1078 116 SER A CB  
762  O OG  . SER A 100 ? 1.6749 1.1016 1.7850 -0.1033 0.3906  -0.1363 116 SER A OG  
763  N N   . GLU A 101 ? 1.7227 1.2989 1.1433 -0.1519 0.4359  -0.0072 117 GLU A N   
764  C CA  . GLU A 101 ? 1.7165 1.2601 1.1167 -0.1681 0.4049  0.0203  117 GLU A CA  
765  C C   . GLU A 101 ? 1.6045 1.2101 1.0023 -0.1827 0.3620  0.0509  117 GLU A C   
766  O O   . GLU A 101 ? 1.5398 1.2027 0.9328 -0.1923 0.3500  0.0501  117 GLU A O   
767  C CB  . GLU A 101 ? 1.7888 1.2620 1.1288 -0.2140 0.4111  -0.0060 117 GLU A CB  
768  C CG  . GLU A 101 ? 1.9172 1.3143 1.2574 -0.1997 0.4461  -0.0340 117 GLU A CG  
769  C CD  . GLU A 101 ? 1.9799 1.3763 1.3058 -0.2012 0.4863  -0.0809 117 GLU A CD  
770  O OE1 . GLU A 101 ? 1.8989 1.3523 1.2075 -0.2196 0.4891  -0.0893 117 GLU A OE1 
771  O OE2 . GLU A 101 ? 2.1225 1.4603 1.4538 -0.1858 0.5160  -0.1113 117 GLU A OE2 
772  N N   . ALA A 102 ? 1.6245 1.2164 1.0263 -0.1865 0.3390  0.0760  118 ALA A N   
773  C CA  . ALA A 102 ? 1.5297 1.1738 0.9345 -0.2011 0.2978  0.0984  118 ALA A CA  
774  C C   . ALA A 102 ? 1.5531 1.1585 0.9381 -0.2392 0.2845  0.0933  118 ALA A C   
775  O O   . ALA A 102 ? 1.6193 1.1698 1.0075 -0.2367 0.3036  0.0959  118 ALA A O   
776  C CB  . ALA A 102 ? 1.4459 1.1301 0.8937 -0.1586 0.2855  0.1353  118 ALA A CB  
777  N N   . ASP A 103 ? 1.5559 1.1877 0.9247 -0.2750 0.2480  0.0856  119 ASP A N   
778  C CA  . ASP A 103 ? 1.5754 1.1837 0.9424 -0.3112 0.2267  0.0775  119 ASP A CA  
779  C C   . ASP A 103 ? 1.4958 1.1666 0.9076 -0.3029 0.1974  0.0984  119 ASP A C   
780  O O   . ASP A 103 ? 1.4218 1.1535 0.8504 -0.2795 0.1795  0.1145  119 ASP A O   
781  C CB  . ASP A 103 ? 1.5915 1.1768 0.9122 -0.3586 0.1973  0.0491  119 ASP A CB  
782  C CG  . ASP A 103 ? 1.6810 1.2001 0.9460 -0.3726 0.2297  0.0231  119 ASP A CG  
783  O OD1 . ASP A 103 ? 1.7276 1.2174 1.0020 -0.3442 0.2739  0.0232  119 ASP A OD1 
784  O OD2 . ASP A 103 ? 1.7143 1.2063 0.9229 -0.4126 0.2090  0.0008  119 ASP A OD2 
785  N N   . THR A 104 ? 1.5153 1.1722 0.9489 -0.3237 0.1938  0.0954  120 THR A N   
786  C CA  . THR A 104 ? 1.4562 1.1706 0.9362 -0.3159 0.1798  0.1105  120 THR A CA  
787  C C   . THR A 104 ? 1.4365 1.1911 0.9399 -0.3461 0.1281  0.0885  120 THR A C   
788  O O   . THR A 104 ? 1.5009 1.2202 1.0044 -0.3836 0.1130  0.0639  120 THR A O   
789  C CB  . THR A 104 ? 1.4841 1.1645 0.9801 -0.3225 0.2128  0.1197  120 THR A CB  
790  O OG1 . THR A 104 ? 1.5207 1.1591 0.9946 -0.2906 0.2498  0.1431  120 THR A OG1 
791  C CG2 . THR A 104 ? 1.4316 1.1755 0.9727 -0.3228 0.2040  0.1283  120 THR A CG2 
792  N N   . LEU A 105 ? 1.3780 1.2019 0.9036 -0.3286 0.0953  0.0961  121 LEU A N   
793  C CA  . LEU A 105 ? 1.3882 1.2507 0.9411 -0.3518 0.0360  0.0742  121 LEU A CA  
794  C C   . LEU A 105 ? 1.3911 1.3021 1.0128 -0.3555 0.0299  0.0651  121 LEU A C   
795  O O   . LEU A 105 ? 1.4003 1.3215 1.0611 -0.3847 -0.0096 0.0357  121 LEU A O   
796  C CB  . LEU A 105 ? 1.3328 1.2418 0.8743 -0.3330 -0.0026 0.0839  121 LEU A CB  
797  C CG  . LEU A 105 ? 1.3055 1.1787 0.7829 -0.3369 0.0023  0.0879  121 LEU A CG  
798  C CD1 . LEU A 105 ? 1.2284 1.1528 0.7063 -0.3019 -0.0043 0.1117  121 LEU A CD1 
799  C CD2 . LEU A 105 ? 1.3492 1.1874 0.7885 -0.3822 -0.0466 0.0632  121 LEU A CD2 
800  N N   . ARG A 106 ? 1.4304 1.3692 1.0677 -0.3281 0.0680  0.0877  122 ARG A N   
801  C CA  . ARG A 106 ? 1.4389 1.4254 1.1355 -0.3351 0.0757  0.0775  122 ARG A CA  
802  C C   . ARG A 106 ? 1.4093 1.3846 1.0857 -0.3145 0.1330  0.1092  122 ARG A C   
803  O O   . ARG A 106 ? 1.3658 1.3159 0.9960 -0.2835 0.1494  0.1390  122 ARG A O   
804  C CB  . ARG A 106 ? 1.3341 1.4022 1.0784 -0.3230 0.0251  0.0624  122 ARG A CB  
805  C CG  . ARG A 106 ? 1.3501 1.4740 1.1727 -0.3395 0.0253  0.0335  122 ARG A CG  
806  C CD  . ARG A 106 ? 1.3063 1.5092 1.1804 -0.3229 -0.0289 0.0131  122 ARG A CD  
807  N NE  . ARG A 106 ? 1.2882 1.5391 1.2551 -0.3478 -0.0492 -0.0330 122 ARG A NE  
808  C CZ  . ARG A 106 ? 1.2118 1.5398 1.2481 -0.3358 -0.0901 -0.0627 122 ARG A CZ  
809  N NH1 . ARG A 106 ? 1.1488 1.5112 1.1641 -0.2997 -0.1159 -0.0475 122 ARG A NH1 
810  N NH2 . ARG A 106 ? 1.1787 1.5508 1.3125 -0.3590 -0.1063 -0.1106 122 ARG A NH2 
811  N N   . LYS A 107 ? 1.4974 1.4887 1.2093 -0.3347 0.1612  0.1014  123 LYS A N   
812  C CA  . LYS A 107 ? 1.4833 1.4515 1.1663 -0.3280 0.2148  0.1309  123 LYS A CA  
813  C C   . LYS A 107 ? 1.4747 1.5179 1.1998 -0.3312 0.2234  0.1207  123 LYS A C   
814  O O   . LYS A 107 ? 1.4998 1.5883 1.2930 -0.3614 0.2171  0.0842  123 LYS A O   
815  C CB  . LYS A 107 ? 1.5995 1.4948 1.2697 -0.3618 0.2525  0.1320  123 LYS A CB  
816  C CG  . LYS A 107 ? 1.6368 1.5396 1.3645 -0.4038 0.2325  0.0912  123 LYS A CG  
817  C CD  . LYS A 107 ? 1.6722 1.4936 1.3824 -0.4357 0.2638  0.0934  123 LYS A CD  
818  C CE  . LYS A 107 ? 1.6951 1.5368 1.4787 -0.4806 0.2471  0.0526  123 LYS A CE  
819  N NZ  . LYS A 107 ? 1.7262 1.5042 1.5088 -0.5180 0.2827  0.0546  123 LYS A NZ  
820  N N   . VAL A 108 ? 1.5437 1.6006 1.2315 -0.3002 0.2364  0.1491  124 VAL A N   
821  C CA  . VAL A 108 ? 1.5380 1.6709 1.2578 -0.2982 0.2408  0.1356  124 VAL A CA  
822  C C   . VAL A 108 ? 1.5240 1.6272 1.1801 -0.2934 0.2893  0.1708  124 VAL A C   
823  O O   . VAL A 108 ? 1.5071 1.5393 1.0923 -0.2721 0.2992  0.2119  124 VAL A O   
824  C CB  . VAL A 108 ? 1.4399 1.6367 1.1806 -0.2618 0.1852  0.1262  124 VAL A CB  
825  C CG1 . VAL A 108 ? 1.4695 1.6942 1.2693 -0.2736 0.1302  0.0892  124 VAL A CG1 
826  C CG2 . VAL A 108 ? 1.3769 1.5344 1.0506 -0.2196 0.1741  0.1684  124 VAL A CG2 
827  N N   . LEU A 109 ? 1.5101 1.6670 1.1930 -0.3153 0.3180  0.1514  125 LEU A N   
828  C CA  . LEU A 109 ? 1.5018 1.6507 1.1216 -0.3113 0.3554  0.1770  125 LEU A CA  
829  C C   . LEU A 109 ? 1.4940 1.7242 1.1354 -0.2787 0.3246  0.1600  125 LEU A C   
830  O O   . LEU A 109 ? 1.5030 1.8128 1.2300 -0.2767 0.2899  0.1155  125 LEU A O   
831  C CB  . LEU A 109 ? 1.5800 1.7350 1.2066 -0.3648 0.4176  0.1640  125 LEU A CB  
832  C CG  . LEU A 109 ? 1.6195 1.6824 1.1958 -0.4049 0.4636  0.1915  125 LEU A CG  
833  C CD1 . LEU A 109 ? 1.6364 1.7336 1.2294 -0.4598 0.5241  0.1717  125 LEU A CD1 
834  C CD2 . LEU A 109 ? 1.6562 1.6166 1.1169 -0.3801 0.4669  0.2508  125 LEU A CD2 
835  N N   . VAL A 110 ? 1.5586 1.7618 1.1210 -0.2520 0.3309  0.1953  126 VAL A N   
836  C CA  . VAL A 110 ? 1.5568 1.8296 1.1260 -0.2255 0.3114  0.1801  126 VAL A CA  
837  C C   . VAL A 110 ? 1.5831 1.8502 1.0937 -0.2517 0.3707  0.1855  126 VAL A C   
838  O O   . VAL A 110 ? 1.5906 1.7684 1.0095 -0.2679 0.4071  0.2281  126 VAL A O   
839  C CB  . VAL A 110 ? 1.5524 1.8031 1.0784 -0.1701 0.2595  0.2134  126 VAL A CB  
840  C CG1 . VAL A 110 ? 1.5203 1.7888 1.1052 -0.1526 0.2051  0.2015  126 VAL A CG1 
841  C CG2 . VAL A 110 ? 1.5353 1.6810 0.9619 -0.1593 0.2772  0.2700  126 VAL A CG2 
842  N N   . GLU A 111 ? 1.5515 1.9111 1.1141 -0.2588 0.3798  0.1396  127 GLU A N   
843  C CA  . GLU A 111 ? 1.5746 1.9429 1.0809 -0.2847 0.4383  0.1361  127 GLU A CA  
844  C C   . GLU A 111 ? 1.5850 1.9952 1.0659 -0.2417 0.4075  0.1300  127 GLU A C   
845  O O   . GLU A 111 ? 1.5684 2.0248 1.1061 -0.1988 0.3423  0.1149  127 GLU A O   
846  C CB  . GLU A 111 ? 1.6516 2.1012 1.2484 -0.3364 0.4889  0.0772  127 GLU A CB  
847  C CG  . GLU A 111 ? 1.6358 2.0627 1.2884 -0.3774 0.5068  0.0708  127 GLU A CG  
848  C CD  . GLU A 111 ? 1.6221 2.1144 1.3443 -0.4369 0.5718  0.0220  127 GLU A CD  
849  O OE1 . GLU A 111 ? 1.6204 2.1949 1.3703 -0.4425 0.5988  -0.0187 127 GLU A OE1 
850  O OE2 . GLU A 111 ? 1.6112 2.0749 1.3647 -0.4787 0.5968  0.0216  127 GLU A OE2 
851  N N   . VAL A 112 ? 1.6453 2.0332 1.0330 -0.2565 0.4534  0.1425  128 VAL A N   
852  C CA  . VAL A 112 ? 1.6579 2.0676 0.9983 -0.2174 0.4277  0.1418  128 VAL A CA  
853  C C   . VAL A 112 ? 1.7062 2.1651 1.0222 -0.2543 0.4944  0.1042  128 VAL A C   
854  O O   . VAL A 112 ? 1.7291 2.1455 1.0213 -0.2990 0.5543  0.1079  128 VAL A O   
855  C CB  . VAL A 112 ? 1.7298 2.0242 0.9374 -0.1854 0.4006  0.2134  128 VAL A CB  
856  C CG1 . VAL A 112 ? 1.6668 1.9154 0.9028 -0.1533 0.3457  0.2466  128 VAL A CG1 
857  C CG2 . VAL A 112 ? 1.8062 1.9870 0.9163 -0.2111 0.4502  0.2490  128 VAL A CG2 
858  N N   . LEU A 113 ? 1.6882 2.2247 1.0337 -0.2234 0.4710  0.0644  129 LEU A N   
859  C CA  . LEU A 113 ? 1.7343 2.2976 1.0284 -0.2459 0.5280  0.0353  129 LEU A CA  
860  C C   . LEU A 113 ? 1.7587 2.2909 0.9606 -0.1966 0.4856  0.0565  129 LEU A C   
861  O O   . LEU A 113 ? 1.7371 2.3154 0.9927 -0.1440 0.4124  0.0467  129 LEU A O   
862  C CB  . LEU A 113 ? 1.6093 2.3210 1.0459 -0.2656 0.5563  -0.0561 129 LEU A CB  
863  C CG  . LEU A 113 ? 1.6791 2.4177 1.0818 -0.2751 0.6032  -0.0939 129 LEU A CG  
864  C CD1 . LEU A 113 ? 1.7918 2.4192 1.0880 -0.3161 0.6666  -0.0526 129 LEU A CD1 
865  C CD2 . LEU A 113 ? 1.6162 2.5126 1.1826 -0.2857 0.6218  -0.1932 129 LEU A CD2 
866  N N   . ALA A 114 ? 1.8730 2.3049 0.9543 -0.2038 0.5173  0.0867  130 ALA A N   
867  C CA  . ALA A 114 ? 1.9072 2.2952 0.8935 -0.1616 0.4807  0.1038  130 ALA A CA  
868  C C   . ALA A 114 ? 1.9184 2.4424 0.9739 -0.1486 0.4786  0.0288  130 ALA A C   
869  O O   . ALA A 114 ? 1.9195 2.5512 1.0768 -0.1806 0.5264  -0.0382 130 ALA A O   
870  C CB  . ALA A 114 ? 2.0546 2.3222 0.9042 -0.1740 0.5176  0.1474  130 ALA A CB  
871  N N   . ASP A 115 ? 1.9526 2.4692 0.9638 -0.0974 0.4176  0.0370  131 ASP A N   
872  C CA  . ASP A 115 ? 1.9754 2.6021 1.0313 -0.0754 0.4097  -0.0311 131 ASP A CA  
873  C C   . ASP A 115 ? 1.9328 2.7155 1.1762 -0.0658 0.3893  -0.1056 131 ASP A C   
874  O O   . ASP A 115 ? 1.9069 2.7509 1.2266 -0.0151 0.3182  -0.1392 131 ASP A O   
875  C CB  . ASP A 115 ? 2.0404 2.6425 1.0298 -0.1154 0.4917  -0.0595 131 ASP A CB  
876  C CG  . ASP A 115 ? 2.0724 2.7308 1.0518 -0.0845 0.4755  -0.1100 131 ASP A CG  
877  O OD1 . ASP A 115 ? 2.1131 2.8159 1.1033 -0.1141 0.5419  -0.1643 131 ASP A OD1 
878  O OD2 . ASP A 115 ? 2.0425 2.6983 1.0089 -0.0286 0.3933  -0.0947 131 ASP A OD2 
879  N N   . ASN B 4   ? 1.4066 1.5198 1.2598 -0.1323 -0.0520 -0.5765 20  ASN B N   
880  C CA  . ASN B 4   ? 1.3885 1.5918 1.3019 -0.0907 -0.0552 -0.5754 20  ASN B CA  
881  C C   . ASN B 4   ? 1.4895 1.6021 1.2651 -0.0054 -0.0859 -0.5519 20  ASN B C   
882  O O   . ASN B 4   ? 1.5569 1.7100 1.2741 0.0716  -0.1341 -0.5737 20  ASN B O   
883  C CB  . ASN B 4   ? 1.3703 1.7733 1.4093 -0.0815 -0.0737 -0.6307 20  ASN B CB  
884  C CG  . ASN B 4   ? 1.4402 1.8864 1.4117 -0.0273 -0.1281 -0.6729 20  ASN B CG  
885  O OD1 . ASN B 4   ? 1.5404 1.8669 1.3525 0.0270  -0.1597 -0.6544 20  ASN B OD1 
886  N ND2 . ASN B 4   ? 1.3845 1.9986 1.4792 -0.0496 -0.1332 -0.7317 20  ASN B ND2 
887  N N   . THR B 5   ? 1.4769 1.4682 1.2020 -0.0170 -0.0566 -0.5107 21  THR B N   
888  C CA  . THR B 5   ? 1.5526 1.4770 1.1795 0.0587  -0.0775 -0.4929 21  THR B CA  
889  C C   . THR B 5   ? 1.4946 1.5796 1.2286 0.0957  -0.0881 -0.5103 21  THR B C   
890  O O   . THR B 5   ? 1.4043 1.6349 1.2832 0.0544  -0.0707 -0.5307 21  THR B O   
891  C CB  . THR B 5   ? 1.5831 1.3537 1.1422 0.0336  -0.0401 -0.4553 21  THR B CB  
892  O OG1 . THR B 5   ? 1.4638 1.2969 1.1462 -0.0246 0.0051  -0.4449 21  THR B OG1 
893  C CG2 . THR B 5   ? 1.6254 1.2421 1.0764 -0.0060 -0.0278 -0.4443 21  THR B CG2 
894  N N   . THR B 6   ? 1.4799 1.5378 1.1440 0.1722  -0.1138 -0.5040 22  THR B N   
895  C CA  . THR B 6   ? 1.4376 1.6582 1.1919 0.2173  -0.1330 -0.5286 22  THR B CA  
896  C C   . THR B 6   ? 1.3879 1.6075 1.1816 0.2145  -0.1025 -0.5035 22  THR B C   
897  O O   . THR B 6   ? 1.4079 1.4882 1.1300 0.2025  -0.0786 -0.4719 22  THR B O   
898  C CB  . THR B 6   ? 1.4420 1.6748 1.1014 0.3215  -0.1955 -0.5528 22  THR B CB  
899  O OG1 . THR B 6   ? 1.5381 1.5938 1.0467 0.3733  -0.2041 -0.5214 22  THR B OG1 
900  C CG2 . THR B 6   ? 1.4885 1.7412 1.1077 0.3324  -0.2281 -0.5815 22  THR B CG2 
901  N N   . VAL B 7   ? 1.2761 1.6636 1.1889 0.2244  -0.1019 -0.5230 23  VAL B N   
902  C CA  . VAL B 7   ? 1.2029 1.6348 1.1905 0.2064  -0.0644 -0.5018 23  VAL B CA  
903  C C   . VAL B 7   ? 1.2198 1.7263 1.1995 0.2892  -0.0988 -0.5188 23  VAL B C   
904  O O   . VAL B 7   ? 1.2569 1.8525 1.2350 0.3453  -0.1446 -0.5565 23  VAL B O   
905  C CB  . VAL B 7   ? 1.1688 1.7342 1.3149 0.1321  -0.0197 -0.5045 23  VAL B CB  
906  C CG1 . VAL B 7   ? 1.1512 1.9009 1.3930 0.1503  -0.0425 -0.5524 23  VAL B CG1 
907  C CG2 . VAL B 7   ? 1.0932 1.6790 1.2974 0.1104  0.0261  -0.4719 23  VAL B CG2 
908  N N   . PHE B 8   ? 1.2162 1.6921 1.1915 0.2996  -0.0775 -0.4955 24  PHE B N   
909  C CA  . PHE B 8   ? 1.2203 1.7633 1.1937 0.3742  -0.1047 -0.5103 24  PHE B CA  
910  C C   . PHE B 8   ? 1.1096 1.7586 1.1962 0.3409  -0.0604 -0.4953 24  PHE B C   
911  O O   . PHE B 8   ? 1.0785 1.6504 1.1563 0.3043  -0.0201 -0.4636 24  PHE B O   
912  C CB  . PHE B 8   ? 1.1975 1.5734 1.0270 0.4330  -0.1256 -0.4993 24  PHE B CB  
913  C CG  . PHE B 8   ? 1.3295 1.6273 1.0400 0.4988  -0.1788 -0.5164 24  PHE B CG  
914  C CD1 . PHE B 8   ? 1.3841 1.7631 1.0792 0.5888  -0.2305 -0.5484 24  PHE B CD1 
915  C CD2 . PHE B 8   ? 1.4054 1.5522 1.0149 0.4755  -0.1776 -0.5011 24  PHE B CD2 
916  C CE1 . PHE B 8   ? 1.5186 1.8251 1.0940 0.6608  -0.2811 -0.5623 24  PHE B CE1 
917  C CE2 . PHE B 8   ? 1.5401 1.6129 1.0286 0.5434  -0.2254 -0.5124 24  PHE B CE2 
918  C CZ  . PHE B 8   ? 1.6000 1.7506 1.0686 0.6393  -0.2777 -0.5418 24  PHE B CZ  
919  N N   . GLN B 9   ? 1.0952 1.9250 1.2843 0.3566  -0.0672 -0.5205 25  GLN B N   
920  C CA  . GLN B 9   ? 0.9760 1.9240 1.2795 0.3213  -0.0207 -0.5049 25  GLN B CA  
921  C C   . GLN B 9   ? 0.9561 1.9664 1.2556 0.3895  -0.0397 -0.5150 25  GLN B C   
922  O O   . GLN B 9   ? 0.9929 2.0678 1.2755 0.4568  -0.0893 -0.5530 25  GLN B O   
923  C CB  . GLN B 9   ? 0.9943 2.1018 1.4236 0.2771  -0.0035 -0.5272 25  GLN B CB  
924  C CG  . GLN B 9   ? 1.0361 2.0747 1.4665 0.2126  0.0123  -0.5229 25  GLN B CG  
925  C CD  . GLN B 9   ? 0.9394 2.1225 1.4978 0.1599  0.0360  -0.5504 25  GLN B CD  
926  O OE1 . GLN B 9   ? 0.8859 2.2282 1.5194 0.1818  0.0259  -0.5872 25  GLN B OE1 
927  N NE2 . GLN B 9   ? 0.9315 2.0616 1.5184 0.0877  0.0694  -0.5382 25  GLN B NE2 
928  N N   . GLY B 10  ? 1.0033 1.9982 1.3166 0.3763  -0.0021 -0.4850 26  GLY B N   
929  C CA  . GLY B 10  ? 0.9792 2.0317 1.2915 0.4375  -0.0158 -0.4954 26  GLY B CA  
930  C C   . GLY B 10  ? 0.8894 2.0148 1.2747 0.3888  0.0258  -0.4555 26  GLY B C   
931  O O   . GLY B 10  ? 0.8501 1.9410 1.2619 0.3311  0.0750  -0.4181 26  GLY B O   
932  N N   . VAL B 11  ? 0.8631 2.0670 1.2627 0.4102  0.0035  -0.4593 27  VAL B N   
933  C CA  . VAL B 11  ? 0.8122 2.0433 1.2407 0.3788  0.0341  -0.4186 27  VAL B CA  
934  C C   . VAL B 11  ? 0.8329 1.9745 1.2008 0.4008  0.0340  -0.4044 27  VAL B C   
935  O O   . VAL B 11  ? 0.8851 1.9824 1.1922 0.4558  -0.0046 -0.4342 27  VAL B O   
936  C CB  . VAL B 11  ? 0.7905 2.1303 1.2452 0.3949  0.0114  -0.4365 27  VAL B CB  
937  C CG1 . VAL B 11  ? 0.7600 2.1111 1.2214 0.3812  0.0341  -0.4006 27  VAL B CG1 
938  C CG2 . VAL B 11  ? 0.7599 2.1872 1.2854 0.3564  0.0251  -0.4479 27  VAL B CG2 
939  N N   . ALA B 12  ? 1.6816 1.4158 0.9872 0.3789  0.1650  0.1638  28  ALA B N   
940  C CA  . ALA B 12  ? 1.6800 1.3298 0.8945 0.3939  0.1604  0.1307  28  ALA B CA  
941  C C   . ALA B 12  ? 1.7394 1.3578 0.8814 0.4366  0.2084  0.1368  28  ALA B C   
942  O O   . ALA B 12  ? 1.7852 1.4479 0.9399 0.4546  0.2498  0.1710  28  ALA B O   
943  C CB  . ALA B 12  ? 1.7660 1.3688 0.9370 0.3691  0.1308  0.1224  28  ALA B CB  
944  N N   . GLY B 13  ? 1.7366 1.2734 0.7970 0.4546  0.2029  0.1074  29  GLY B N   
945  C CA  . GLY B 13  ? 1.8020 1.2830 0.7692 0.5018  0.2478  0.1090  29  GLY B CA  
946  C C   . GLY B 13  ? 1.8072 1.3372 0.8192 0.5391  0.2864  0.1223  29  GLY B C   
947  O O   . GLY B 13  ? 1.8626 1.3462 0.7959 0.5891  0.3323  0.1272  29  GLY B O   
948  N N   . GLN B 14  ? 1.6877 1.3027 0.8162 0.5191  0.2697  0.1300  30  GLN B N   
949  C CA  . GLN B 14  ? 1.6924 1.3665 0.8810 0.5489  0.3003  0.1487  30  GLN B CA  
950  C C   . GLN B 14  ? 1.6251 1.3051 0.8627 0.5265  0.2591  0.1241  30  GLN B C   
951  O O   . GLN B 14  ? 1.5801 1.2541 0.8398 0.4857  0.2130  0.1060  30  GLN B O   
952  C CB  . GLN B 14  ? 1.6444 1.4364 0.9412 0.5429  0.3240  0.2018  30  GLN B CB  
953  C CG  . GLN B 14  ? 1.6671 1.5252 1.0119 0.5889  0.3766  0.2413  30  GLN B CG  
954  C CD  . GLN B 14  ? 1.6732 1.6571 1.1404 0.5695  0.3866  0.3036  30  GLN B CD  
955  O OE1 . GLN B 14  ? 1.6942 1.7072 1.1583 0.5741  0.4150  0.3384  30  GLN B OE1 
956  N NE2 . GLN B 14  ? 1.6151 1.6706 1.1881 0.5434  0.3587  0.3215  30  GLN B NE2 
957  N N   . SER B 15  ? 1.5893 1.2812 0.8426 0.5574  0.2792  0.1265  31  SER B N   
958  C CA  . SER B 15  ? 1.5229 1.2003 0.7975 0.5432  0.2443  0.1001  31  SER B CA  
959  C C   . SER B 15  ? 1.5080 1.2795 0.9037 0.5154  0.2262  0.1203  31  SER B C   
960  O O   . SER B 15  ? 1.5512 1.4028 1.0183 0.5198  0.2484  0.1613  31  SER B O   
961  C CB  . SER B 15  ? 1.6897 1.3137 0.9042 0.5893  0.2690  0.0892  31  SER B CB  
962  O OG  . SER B 15  ? 1.7417 1.2547 0.8208 0.6141  0.2806  0.0704  31  SER B OG  
963  N N   . LEU B 16  ? 1.4240 1.1814 0.8383 0.4855  0.1837  0.0957  32  LEU B N   
964  C CA  . LEU B 16  ? 1.4206 1.2371 0.9215 0.4555  0.1581  0.1082  32  LEU B CA  
965  C C   . LEU B 16  ? 1.3641 1.1657 0.8739 0.4584  0.1420  0.0886  32  LEU B C   
966  O O   . LEU B 16  ? 1.3098 1.0505 0.7635 0.4629  0.1304  0.0589  32  LEU B O   
967  C CB  . LEU B 16  ? 1.3636 1.1696 0.8680 0.4168  0.1236  0.1002  32  LEU B CB  
968  C CG  . LEU B 16  ? 1.3622 1.1948 0.9225 0.3865  0.0919  0.1071  32  LEU B CG  
969  C CD1 . LEU B 16  ? 1.3837 1.2842 1.0106 0.3777  0.0981  0.1505  32  LEU B CD1 
970  C CD2 . LEU B 16  ? 1.3527 1.1537 0.8928 0.3605  0.0642  0.0960  32  LEU B CD2 
971  N N   . GLN B 17  ? 1.3112 1.1666 0.8907 0.4525  0.1372  0.1089  33  GLN B N   
972  C CA  . GLN B 17  ? 1.2688 1.1108 0.8574 0.4535  0.1210  0.0924  33  GLN B CA  
973  C C   . GLN B 17  ? 1.2704 1.1269 0.9001 0.4168  0.0842  0.0940  33  GLN B C   
974  O O   . GLN B 17  ? 1.3000 1.1979 0.9767 0.3958  0.0740  0.1233  33  GLN B O   
975  C CB  . GLN B 17  ? 1.3800 1.2558 0.9990 0.4864  0.1480  0.1133  33  GLN B CB  
976  C CG  . GLN B 17  ? 1.3623 1.1788 0.9055 0.5290  0.1757  0.0943  33  GLN B CG  
977  C CD  . GLN B 17  ? 1.3510 1.1856 0.9170 0.5642  0.1968  0.1085  33  GLN B CD  
978  O OE1 . GLN B 17  ? 1.3521 1.2594 1.0041 0.5570  0.1938  0.1400  33  GLN B OE1 
979  N NE2 . GLN B 17  ? 1.3605 1.1213 0.8441 0.6014  0.2141  0.0876  33  GLN B NE2 
980  N N   . VAL B 18  ? 1.2761 1.0921 0.8814 0.4093  0.0632  0.0661  34  VAL B N   
981  C CA  . VAL B 18  ? 1.2806 1.0913 0.9031 0.3838  0.0335  0.0644  34  VAL B CA  
982  C C   . VAL B 18  ? 1.2581 1.0650 0.8908 0.3912  0.0277  0.0572  34  VAL B C   
983  O O   . VAL B 18  ? 1.2102 0.9967 0.8187 0.4111  0.0383  0.0411  34  VAL B O   
984  C CB  . VAL B 18  ? 1.3733 1.1421 0.9576 0.3720  0.0187  0.0444  34  VAL B CB  
985  C CG1 . VAL B 18  ? 1.4083 1.1792 0.9862 0.3600  0.0179  0.0551  34  VAL B CG1 
986  C CG2 . VAL B 18  ? 1.2924 1.0333 0.8426 0.3861  0.0248  0.0237  34  VAL B CG2 
987  N N   . SER B 19  ? 1.1752 0.9925 0.8359 0.3725  0.0064  0.0707  35  SER B N   
988  C CA  . SER B 19  ? 1.1656 0.9818 0.8400 0.3755  -0.0027 0.0692  35  SER B CA  
989  C C   . SER B 19  ? 1.1692 0.9409 0.8132 0.3566  -0.0284 0.0557  35  SER B C   
990  O O   . SER B 19  ? 1.1954 0.9497 0.8301 0.3342  -0.0492 0.0664  35  SER B O   
991  C CB  . SER B 19  ? 1.1657 1.0347 0.9010 0.3718  -0.0058 0.1061  35  SER B CB  
992  O OG  . SER B 19  ? 1.1422 1.0077 0.8914 0.3706  -0.0205 0.1074  35  SER B OG  
993  N N   . CYS B 20  ? 1.1483 0.8945 0.7690 0.3668  -0.0267 0.0349  36  CYS B N   
994  C CA  . CYS B 20  ? 1.1505 0.8561 0.7395 0.3578  -0.0422 0.0258  36  CYS B CA  
995  C C   . CYS B 20  ? 1.1654 0.8708 0.7676 0.3549  -0.0547 0.0306  36  CYS B C   
996  O O   . CYS B 20  ? 1.1314 0.8436 0.7404 0.3686  -0.0464 0.0222  36  CYS B O   
997  C CB  . CYS B 20  ? 1.3011 0.9881 0.8628 0.3696  -0.0309 0.0089  36  CYS B CB  
998  S SG  . CYS B 20  ? 1.2772 0.9595 0.8229 0.3696  -0.0230 0.0085  36  CYS B SG  
999  N N   . PRO B 21  ? 1.1062 0.7968 0.7070 0.3348  -0.0793 0.0459  37  PRO B N   
1000 C CA  . PRO B 21  ? 1.1181 0.8018 0.7263 0.3292  -0.0960 0.0519  37  PRO B CA  
1001 C C   . PRO B 21  ? 1.1310 0.7603 0.6826 0.3327  -0.0974 0.0332  37  PRO B C   
1002 O O   . PRO B 21  ? 1.1460 0.7367 0.6499 0.3362  -0.0912 0.0235  37  PRO B O   
1003 C CB  . PRO B 21  ? 1.1110 0.7889 0.7296 0.2993  -0.1299 0.0805  37  PRO B CB  
1004 C CG  . PRO B 21  ? 1.1128 0.8090 0.7428 0.2916  -0.1265 0.0919  37  PRO B CG  
1005 C CD  . PRO B 21  ? 1.0928 0.7682 0.6840 0.3118  -0.0996 0.0629  37  PRO B CD  
1006 N N   . TYR B 22  ? 1.1353 0.7631 0.6928 0.3352  -0.1029 0.0320  38  TYR B N   
1007 C CA  . TYR B 22  ? 1.1544 0.7347 0.6598 0.3391  -0.1020 0.0204  38  TYR B CA  
1008 C C   . TYR B 22  ? 1.1673 0.7395 0.6778 0.3324  -0.1195 0.0258  38  TYR B C   
1009 O O   . TYR B 22  ? 1.1532 0.7635 0.7150 0.3298  -0.1286 0.0375  38  TYR B O   
1010 C CB  . TYR B 22  ? 1.1826 0.7776 0.6872 0.3583  -0.0752 0.0079  38  TYR B CB  
1011 C CG  . TYR B 22  ? 1.1412 0.7742 0.6861 0.3667  -0.0686 0.0045  38  TYR B CG  
1012 C CD1 . TYR B 22  ? 1.1380 0.7645 0.6797 0.3690  -0.0715 0.0026  38  TYR B CD1 
1013 C CD2 . TYR B 22  ? 1.1156 0.7793 0.6891 0.3736  -0.0597 0.0041  38  TYR B CD2 
1014 C CE1 . TYR B 22  ? 1.1153 0.7563 0.6763 0.3761  -0.0706 -0.0009 38  TYR B CE1 
1015 C CE2 . TYR B 22  ? 1.0957 0.7693 0.6808 0.3854  -0.0544 -0.0006 38  TYR B CE2 
1016 C CZ  . TYR B 22  ? 1.0983 0.7562 0.6745 0.3858  -0.0622 -0.0037 38  TYR B CZ  
1017 O OH  . TYR B 22  ? 1.0959 0.7447 0.6672 0.3968  -0.0619 -0.0087 38  TYR B OH  
1018 N N   . ASP B 23  ? 1.2146 0.7357 0.6689 0.3330  -0.1214 0.0202  39  ASP B N   
1019 C CA  . ASP B 23  ? 1.2319 0.7362 0.6795 0.3263  -0.1379 0.0241  39  ASP B CA  
1020 C C   . ASP B 23  ? 1.1888 0.7328 0.6735 0.3407  -0.1213 0.0176  39  ASP B C   
1021 O O   . ASP B 23  ? 1.1809 0.7217 0.6473 0.3518  -0.1019 0.0117  39  ASP B O   
1022 C CB  . ASP B 23  ? 1.2740 0.6997 0.6340 0.3250  -0.1418 0.0216  39  ASP B CB  
1023 C CG  . ASP B 23  ? 1.3063 0.6998 0.6468 0.3107  -0.1682 0.0287  39  ASP B CG  
1024 O OD1 . ASP B 23  ? 1.2718 0.7087 0.6649 0.3121  -0.1700 0.0307  39  ASP B OD1 
1025 O OD2 . ASP B 23  ? 1.3744 0.6878 0.6363 0.2982  -0.1898 0.0326  39  ASP B OD2 
1026 N N   . SER B 24  ? 1.1804 0.7602 0.7165 0.3416  -0.1299 0.0232  40  SER B N   
1027 C CA  . SER B 24  ? 1.1509 0.7497 0.7070 0.3552  -0.1197 0.0162  40  SER B CA  
1028 C C   . SER B 24  ? 1.1680 0.7383 0.6929 0.3513  -0.1240 0.0144  40  SER B C   
1029 O O   . SER B 24  ? 1.1522 0.7283 0.6785 0.3568  -0.1164 0.0108  40  SER B O   
1030 C CB  . SER B 24  ? 1.0846 0.7121 0.6871 0.3642  -0.1259 0.0252  40  SER B CB  
1031 O OG  . SER B 24  ? 1.1134 0.7330 0.7255 0.3520  -0.1505 0.0400  40  SER B OG  
1032 N N   . MET B 25  ? 1.2198 0.7538 0.7110 0.3396  -0.1391 0.0201  41  MET B N   
1033 C CA  . MET B 25  ? 1.2427 0.7489 0.7003 0.3372  -0.1403 0.0217  41  MET B CA  
1034 C C   . MET B 25  ? 1.2610 0.7501 0.6753 0.3455  -0.1155 0.0228  41  MET B C   
1035 O O   . MET B 25  ? 1.2614 0.7580 0.6727 0.3490  -0.1045 0.0300  41  MET B O   
1036 C CB  . MET B 25  ? 1.3474 0.8130 0.7774 0.3224  -0.1679 0.0293  41  MET B CB  
1037 C CG  . MET B 25  ? 1.3705 0.8108 0.7713 0.3200  -0.1708 0.0324  41  MET B CG  
1038 S SD  . MET B 25  ? 1.4363 0.8081 0.7787 0.3004  -0.2044 0.0415  41  MET B SD  
1039 C CE  . MET B 25  ? 1.4570 0.8089 0.7668 0.3028  -0.1963 0.0453  41  MET B CE  
1040 N N   . LYS B 26  ? 1.2739 0.7406 0.6552 0.3500  -0.1062 0.0208  42  LYS B N   
1041 C CA  . LYS B 26  ? 1.2922 0.7477 0.6369 0.3678  -0.0753 0.0256  42  LYS B CA  
1042 C C   . LYS B 26  ? 1.2409 0.7583 0.6407 0.3750  -0.0573 0.0319  42  LYS B C   
1043 O O   . LYS B 26  ? 1.2471 0.7802 0.6470 0.3834  -0.0388 0.0485  42  LYS B O   
1044 C CB  . LYS B 26  ? 1.2886 0.7059 0.5904 0.3731  -0.0717 0.0205  42  LYS B CB  
1045 C CG  . LYS B 26  ? 1.3235 0.7149 0.5735 0.4002  -0.0363 0.0274  42  LYS B CG  
1046 C CD  . LYS B 26  ? 1.3789 0.6991 0.5579 0.4032  -0.0425 0.0202  42  LYS B CD  
1047 C CE  . LYS B 26  ? 1.4293 0.7199 0.5543 0.4389  -0.0030 0.0272  42  LYS B CE  
1048 N NZ  . LYS B 26  ? 1.5125 0.7118 0.5499 0.4405  -0.0154 0.0183  42  LYS B NZ  
1049 N N   . HIS B 27  ? 1.2345 0.7862 0.6800 0.3702  -0.0646 0.0237  43  HIS B N   
1050 C CA  . HIS B 27  ? 1.1946 0.7891 0.6793 0.3721  -0.0564 0.0294  43  HIS B CA  
1051 C C   . HIS B 27  ? 1.1773 0.7832 0.6887 0.3614  -0.0757 0.0281  43  HIS B C   
1052 O O   . HIS B 27  ? 1.1551 0.7764 0.6862 0.3590  -0.0804 0.0268  43  HIS B O   
1053 C CB  . HIS B 27  ? 1.1891 0.7970 0.6868 0.3759  -0.0513 0.0209  43  HIS B CB  
1054 C CG  . HIS B 27  ? 1.2156 0.7996 0.6775 0.3864  -0.0363 0.0215  43  HIS B CG  
1055 N ND1 . HIS B 27  ? 1.2252 0.8145 0.6747 0.4028  -0.0116 0.0358  43  HIS B ND1 
1056 C CD2 . HIS B 27  ? 1.2456 0.7935 0.6762 0.3834  -0.0446 0.0134  43  HIS B CD2 
1057 C CE1 . HIS B 27  ? 1.2625 0.8098 0.6637 0.4144  -0.0024 0.0314  43  HIS B CE1 
1058 N NE2 . HIS B 27  ? 1.2783 0.7958 0.6641 0.3989  -0.0261 0.0174  43  HIS B NE2 
1059 N N   . TRP B 28  ? 1.1481 0.7345 0.6494 0.3555  -0.0894 0.0284  44  TRP B N   
1060 C CA  . TRP B 28  ? 1.1436 0.7265 0.6583 0.3484  -0.1091 0.0269  44  TRP B CA  
1061 C C   . TRP B 28  ? 1.1433 0.7408 0.6679 0.3385  -0.1127 0.0433  44  TRP B C   
1062 O O   . TRP B 28  ? 1.1532 0.7701 0.6814 0.3354  -0.1010 0.0652  44  TRP B O   
1063 C CB  . TRP B 28  ? 1.1248 0.6837 0.6252 0.3428  -0.1233 0.0289  44  TRP B CB  
1064 C CG  . TRP B 28  ? 1.1358 0.6801 0.6418 0.3391  -0.1445 0.0267  44  TRP B CG  
1065 C CD1 . TRP B 28  ? 1.1537 0.6890 0.6539 0.3265  -0.1579 0.0387  44  TRP B CD1 
1066 C CD2 . TRP B 28  ? 1.1407 0.6732 0.6556 0.3505  -0.1548 0.0156  44  TRP B CD2 
1067 N NE1 . TRP B 28  ? 1.1773 0.6812 0.6691 0.3290  -0.1789 0.0306  44  TRP B NE1 
1068 C CE2 . TRP B 28  ? 1.1699 0.6734 0.6712 0.3482  -0.1733 0.0165  44  TRP B CE2 
1069 C CE3 . TRP B 28  ? 1.1291 0.6746 0.6641 0.3636  -0.1497 0.0105  44  TRP B CE3 
1070 C CZ2 . TRP B 28  ? 1.1938 0.6735 0.6924 0.3663  -0.1815 0.0091  44  TRP B CZ2 
1071 C CZ3 . TRP B 28  ? 1.1436 0.6822 0.6911 0.3807  -0.1555 0.0091  44  TRP B CZ3 
1072 C CH2 . TRP B 28  ? 1.1784 0.6808 0.7036 0.3858  -0.1687 0.0067  44  TRP B CH2 
1073 N N   . GLY B 29  ? 1.1535 0.7379 0.6786 0.3344  -0.1298 0.0373  45  GLY B N   
1074 C CA  . GLY B 29  ? 1.1679 0.7536 0.6959 0.3165  -0.1466 0.0564  45  GLY B CA  
1075 C C   . GLY B 29  ? 1.1527 0.7719 0.7006 0.3137  -0.1361 0.0705  45  GLY B C   
1076 O O   . GLY B 29  ? 1.1688 0.7946 0.7264 0.2933  -0.1559 0.0948  45  GLY B O   
1077 N N   . ARG B 30  ? 1.2176 0.8556 0.7717 0.3306  -0.1103 0.0601  46  ARG B N   
1078 C CA  . ARG B 30  ? 1.2006 0.8715 0.7747 0.3318  -0.0975 0.0751  46  ARG B CA  
1079 C C   . ARG B 30  ? 1.1827 0.8357 0.7446 0.3328  -0.1054 0.0572  46  ARG B C   
1080 O O   . ARG B 30  ? 1.1665 0.8014 0.7130 0.3466  -0.0977 0.0320  46  ARG B O   
1081 C CB  . ARG B 30  ? 1.2673 0.9550 0.8407 0.3520  -0.0649 0.0754  46  ARG B CB  
1082 C CG  . ARG B 30  ? 1.2923 1.0049 0.8745 0.3587  -0.0453 0.1063  46  ARG B CG  
1083 C CD  . ARG B 30  ? 1.2975 0.9925 0.8463 0.3847  -0.0143 0.0984  46  ARG B CD  
1084 N NE  . ARG B 30  ? 1.3214 1.0383 0.8698 0.4052  0.0178  0.1315  46  ARG B NE  
1085 C CZ  . ARG B 30  ? 1.3566 1.0664 0.8861 0.4122  0.0306  0.1479  46  ARG B CZ  
1086 N NH1 . ARG B 30  ? 1.3708 1.0516 0.8829 0.3954  0.0082  0.1327  46  ARG B NH1 
1087 N NH2 . ARG B 30  ? 1.3774 1.1095 0.9047 0.4394  0.0687  0.1828  46  ARG B NH2 
1088 N N   . ARG B 31  ? 1.2422 0.9014 0.8117 0.3174  -0.1216 0.0754  47  ARG B N   
1089 C CA  . ARG B 31  ? 1.2338 0.8705 0.7821 0.3185  -0.1275 0.0614  47  ARG B CA  
1090 C C   . ARG B 31  ? 1.1930 0.8614 0.7586 0.3348  -0.0988 0.0565  47  ARG B C   
1091 O O   . ARG B 31  ? 1.1807 0.8832 0.7700 0.3443  -0.0774 0.0688  47  ARG B O   
1092 C CB  . ARG B 31  ? 1.2411 0.8650 0.7846 0.2910  -0.1620 0.0866  47  ARG B CB  
1093 C CG  . ARG B 31  ? 1.2952 0.8613 0.7991 0.2709  -0.2003 0.0891  47  ARG B CG  
1094 C CD  . ARG B 31  ? 1.3306 0.8781 0.8260 0.2357  -0.2436 0.1208  47  ARG B CD  
1095 N NE  . ARG B 31  ? 1.3099 0.8683 0.8076 0.2388  -0.2368 0.1204  47  ARG B NE  
1096 C CZ  . ARG B 31  ? 1.3335 0.8863 0.8326 0.2085  -0.2726 0.1515  47  ARG B CZ  
1097 N NH1 . ARG B 31  ? 1.3785 0.9163 0.8796 0.1692  -0.3209 0.1892  47  ARG B NH1 
1098 N NH2 . ARG B 31  ? 1.3248 0.8865 0.8245 0.2137  -0.2645 0.1489  47  ARG B NH2 
1099 N N   . LYS B 32  ? 1.0576 1.2047 0.6802 0.1102  -0.0873 -0.0048 48  LYS B N   
1100 C CA  . LYS B 32  ? 1.0698 1.1496 0.6211 0.1398  -0.0920 -0.0103 48  LYS B CA  
1101 C C   . LYS B 32  ? 1.0791 1.1362 0.6273 0.1932  -0.1276 -0.0290 48  LYS B C   
1102 O O   . LYS B 32  ? 1.0641 1.1374 0.6382 0.2037  -0.1541 -0.0348 48  LYS B O   
1103 C CB  . LYS B 32  ? 1.1133 1.1272 0.5887 0.1201  -0.0840 0.0277  48  LYS B CB  
1104 C CG  . LYS B 32  ? 1.0792 1.1213 0.5616 0.0636  -0.0596 0.0586  48  LYS B CG  
1105 C CD  . LYS B 32  ? 1.1142 1.1711 0.5848 0.0399  -0.0395 0.0444  48  LYS B CD  
1106 C CE  . LYS B 32  ? 1.0455 1.1170 0.5004 -0.0168 -0.0233 0.0831  48  LYS B CE  
1107 N NZ  . LYS B 32  ? 0.9904 1.1368 0.5148 -0.0420 -0.0107 0.1039  48  LYS B NZ  
1108 N N   . ALA B 33  ? 1.1311 1.1469 0.6447 0.2268  -0.1295 -0.0389 49  ALA B N   
1109 C CA  . ALA B 33  ? 1.1472 1.1459 0.6575 0.2810  -0.1622 -0.0516 49  ALA B CA  
1110 C C   . ALA B 33  ? 1.1623 1.0818 0.6021 0.3071  -0.1571 -0.0372 49  ALA B C   
1111 O O   . ALA B 33  ? 1.1855 1.0714 0.5983 0.2858  -0.1304 -0.0325 49  ALA B O   
1112 C CB  . ALA B 33  ? 1.0932 1.1572 0.6879 0.3040  -0.1703 -0.0812 49  ALA B CB  
1113 N N   . TRP B 34  ? 1.2105 1.0977 0.6186 0.3526  -0.1852 -0.0290 50  TRP B N   
1114 C CA  . TRP B 34  ? 1.2337 1.0509 0.5897 0.3865  -0.1832 -0.0100 50  TRP B CA  
1115 C C   . TRP B 34  ? 1.2739 1.1114 0.6624 0.4414  -0.2081 -0.0285 50  TRP B C   
1116 O O   . TRP B 34  ? 1.2655 1.1371 0.6664 0.4655  -0.2448 -0.0355 50  TRP B O   
1117 C CB  . TRP B 34  ? 1.3657 1.1299 0.6523 0.3955  -0.1888 0.0313  50  TRP B CB  
1118 C CG  . TRP B 34  ? 1.3666 1.0694 0.6121 0.4394  -0.1915 0.0593  50  TRP B CG  
1119 C CD1 . TRP B 34  ? 1.3555 1.0624 0.6087 0.4782  -0.2068 0.0570  50  TRP B CD1 
1120 C CD2 . TRP B 34  ? 1.3630 1.0011 0.5860 0.4294  -0.1684 0.0914  50  TRP B CD2 
1121 N NE1 . TRP B 34  ? 1.3756 1.0330 0.6156 0.4941  -0.1898 0.0864  50  TRP B NE1 
1122 C CE2 . TRP B 34  ? 1.3723 0.9859 0.6003 0.4651  -0.1678 0.1081  50  TRP B CE2 
1123 C CE3 . TRP B 34  ? 1.3720 0.9766 0.5858 0.3831  -0.1477 0.1038  50  TRP B CE3 
1124 C CZ2 . TRP B 34  ? 1.4078 0.9642 0.6318 0.4630  -0.1498 0.1417  50  TRP B CZ2 
1125 C CZ3 . TRP B 34  ? 1.3843 0.9161 0.5762 0.3861  -0.1392 0.1386  50  TRP B CZ3 
1126 C CH2 . TRP B 34  ? 1.4094 0.9219 0.6181 0.4248  -0.1384 0.1569  50  TRP B CH2 
1127 N N   . CYS B 35  ? 1.2858 1.1004 0.6887 0.4605  -0.1899 -0.0366 51  CYS B N   
1128 C CA  . CYS B 35  ? 1.3206 1.1611 0.7702 0.5139  -0.2071 -0.0482 51  CYS B CA  
1129 C C   . CYS B 35  ? 1.3700 1.1350 0.7880 0.5484  -0.1918 -0.0315 51  CYS B C   
1130 O O   . CYS B 35  ? 1.3881 1.0844 0.7600 0.5237  -0.1668 -0.0196 51  CYS B O   
1131 C CB  . CYS B 35  ? 1.3679 1.2821 0.9073 0.5091  -0.1933 -0.0795 51  CYS B CB  
1132 S SG  . CYS B 35  ? 1.4590 1.3410 0.9923 0.4809  -0.1327 -0.0996 51  CYS B SG  
1133 N N   . ARG B 36  ? 1.3979 1.1769 0.8486 0.6046  -0.2100 -0.0277 52  ARG B N   
1134 C CA  . ARG B 36  ? 1.4669 1.1769 0.9005 0.6453  -0.1968 -0.0072 52  ARG B CA  
1135 C C   . ARG B 36  ? 1.4960 1.2156 0.9939 0.6679  -0.1688 -0.0319 52  ARG B C   
1136 O O   . ARG B 36  ? 1.4741 1.2747 1.0462 0.6839  -0.1778 -0.0478 52  ARG B O   
1137 C CB  . ARG B 36  ? 1.5060 1.2202 0.9250 0.7021  -0.2345 0.0258  52  ARG B CB  
1138 C CG  . ARG B 36  ? 1.5769 1.2112 0.9722 0.7410  -0.2186 0.0608  52  ARG B CG  
1139 C CD  . ARG B 36  ? 1.6137 1.2861 1.0344 0.7701  -0.2380 0.0829  52  ARG B CD  
1140 N NE  . ARG B 36  ? 1.6031 1.3048 0.9832 0.7462  -0.2589 0.0933  52  ARG B NE  
1141 C CZ  . ARG B 36  ? 1.6348 1.3051 0.9795 0.7388  -0.2451 0.1262  52  ARG B CZ  
1142 N NH1 . ARG B 36  ? 1.6717 1.2865 1.0244 0.7472  -0.2169 0.1560  52  ARG B NH1 
1143 N NH2 . ARG B 36  ? 1.6360 1.3283 0.9429 0.7246  -0.2575 0.1287  52  ARG B NH2 
1144 N N   . GLN B 37  ? 1.5549 1.1880 1.0279 0.6719  -0.1348 -0.0320 53  GLN B N   
1145 C CA  . GLN B 37  ? 1.6034 1.2218 1.1196 0.6950  -0.0973 -0.0586 53  GLN B CA  
1146 C C   . GLN B 37  ? 1.6741 1.2532 1.2154 0.7601  -0.0977 -0.0329 53  GLN B C   
1147 O O   . GLN B 37  ? 1.7093 1.2214 1.2083 0.7705  -0.1078 0.0003  53  GLN B O   
1148 C CB  . GLN B 37  ? 1.6402 1.1769 1.1015 0.6504  -0.0584 -0.0864 53  GLN B CB  
1149 C CG  . GLN B 37  ? 1.6932 1.2207 1.1814 0.6673  -0.0124 -0.1257 53  GLN B CG  
1150 C CD  . GLN B 37  ? 1.7526 1.1861 1.1629 0.6222  0.0181  -0.1572 53  GLN B CD  
1151 O OE1 . GLN B 37  ? 1.7212 1.1365 1.0763 0.5640  0.0027  -0.1520 53  GLN B OE1 
1152 N NE2 . GLN B 37  ? 1.8493 1.2189 1.2522 0.6499  0.0604  -0.1892 53  GLN B NE2 
1153 N N   . LEU B 38  ? 1.6969 1.3208 1.3155 0.8059  -0.0833 -0.0416 54  LEU B N   
1154 C CA  . LEU B 38  ? 1.7609 1.3635 1.4199 0.8729  -0.0843 -0.0110 54  LEU B CA  
1155 C C   . LEU B 38  ? 1.8382 1.3908 1.5360 0.9063  -0.0285 -0.0324 54  LEU B C   
1156 O O   . LEU B 38  ? 1.8925 1.4380 1.6445 0.9677  -0.0223 -0.0060 54  LEU B O   
1157 C CB  . LEU B 38  ? 1.7265 1.4415 1.4543 0.9118  -0.1321 0.0160  54  LEU B CB  
1158 C CG  . LEU B 38  ? 1.6837 1.4462 1.3729 0.9015  -0.1943 0.0405  54  LEU B CG  
1159 C CD1 . LEU B 38  ? 1.6149 1.3921 1.2508 0.8369  -0.2063 0.0168  54  LEU B CD1 
1160 C CD2 . LEU B 38  ? 1.6717 1.5457 1.4456 0.9200  -0.2345 0.0534  54  LEU B CD2 
1161 N N   . GLY B 39  ? 1.8546 1.3704 1.5220 0.8714  0.0138  -0.0777 55  GLY B N   
1162 C CA  . GLY B 39  ? 1.9441 1.4062 1.6337 0.9065  0.0728  -0.1047 55  GLY B CA  
1163 C C   . GLY B 39  ? 1.9910 1.3695 1.5945 0.8579  0.1119  -0.1563 55  GLY B C   
1164 O O   . GLY B 39  ? 1.9664 1.3052 1.4922 0.7966  0.0908  -0.1635 55  GLY B O   
1165 N N   . GLU B 40  ? 2.0667 1.4210 1.6834 0.8880  0.1700  -0.1898 56  GLU B N   
1166 C CA  . GLU B 40  ? 2.1482 1.4072 1.6679 0.8529  0.2113  -0.2442 56  GLU B CA  
1167 C C   . GLU B 40  ? 2.0685 1.4068 1.5587 0.7945  0.2068  -0.2628 56  GLU B C   
1168 O O   . GLU B 40  ? 2.0347 1.3517 1.4565 0.7297  0.1732  -0.2641 56  GLU B O   
1169 C CB  . GLU B 40  ? 2.2733 1.4755 1.8084 0.9153  0.2813  -0.2731 56  GLU B CB  
1170 C CG  . GLU B 40  ? 2.3707 1.5012 1.8078 0.8945  0.3349  -0.3349 56  GLU B CG  
1171 C CD  . GLU B 40  ? 2.4319 1.4340 1.7347 0.8253  0.3126  -0.3696 56  GLU B CD  
1172 O OE1 . GLU B 40  ? 2.4258 1.3664 1.7169 0.8033  0.2679  -0.3463 56  GLU B OE1 
1173 O OE2 . GLU B 40  ? 2.4923 1.4582 1.7028 0.7934  0.3397  -0.4167 56  GLU B OE2 
1174 N N   . LYS B 41  ? 2.0915 1.5241 1.6408 0.8179  0.2428  -0.2708 57  LYS B N   
1175 C CA  . LYS B 41  ? 2.0476 1.5720 1.5912 0.7671  0.2385  -0.2777 57  LYS B CA  
1176 C C   . LYS B 41  ? 1.9501 1.5998 1.5767 0.7495  0.1804  -0.2364 57  LYS B C   
1177 O O   . LYS B 41  ? 1.9143 1.6171 1.5225 0.6933  0.1588  -0.2359 57  LYS B O   
1178 C CB  . LYS B 41  ? 2.0664 1.6451 1.6474 0.8004  0.3044  -0.2958 57  LYS B CB  
1179 C CG  . LYS B 41  ? 2.1836 1.6344 1.6559 0.8150  0.3673  -0.3466 57  LYS B CG  
1180 C CD  . LYS B 41  ? 2.2176 1.6198 1.5605 0.7416  0.3610  -0.3802 57  LYS B CD  
1181 C CE  . LYS B 41  ? 2.3423 1.5653 1.5482 0.7349  0.3784  -0.4294 57  LYS B CE  
1182 N NZ  . LYS B 41  ? 2.4713 1.6321 1.6912 0.8033  0.4400  -0.4505 57  LYS B NZ  
1183 N N   . GLY B 42  ? 1.8516 1.5454 1.5658 0.7976  0.1542  -0.2023 58  GLY B N   
1184 C CA  . GLY B 42  ? 1.7608 1.5599 1.5428 0.7869  0.0931  -0.1680 58  GLY B CA  
1185 C C   . GLY B 42  ? 1.7488 1.5654 1.6022 0.8480  0.0668  -0.1329 58  GLY B C   
1186 O O   . GLY B 42  ? 1.8102 1.5558 1.6649 0.8968  0.0999  -0.1321 58  GLY B O   
1187 N N   . PRO B 43  ? 1.6376 1.5492 1.5515 0.8469  0.0064  -0.1036 59  PRO B N   
1188 C CA  . PRO B 43  ? 1.5682 1.5537 1.4836 0.7899  -0.0275 -0.1091 59  PRO B CA  
1189 C C   . PRO B 43  ? 1.5482 1.4766 1.3594 0.7432  -0.0643 -0.1079 59  PRO B C   
1190 O O   . PRO B 43  ? 1.5685 1.4193 1.3224 0.7607  -0.0771 -0.0922 59  PRO B O   
1191 C CB  . PRO B 43  ? 1.5027 1.6060 1.5344 0.8164  -0.0782 -0.0808 59  PRO B CB  
1192 C CG  . PRO B 43  ? 1.5614 1.6270 1.5945 0.8733  -0.0997 -0.0521 59  PRO B CG  
1193 C CD  . PRO B 43  ? 1.6469 1.6048 1.6358 0.9014  -0.0334 -0.0646 59  PRO B CD  
1194 N N   . CYS B 44  ? 1.4618 1.4284 1.2550 0.6867  -0.0763 -0.1186 60  CYS B N   
1195 C CA  . CYS B 44  ? 1.4388 1.3669 1.1493 0.6466  -0.1106 -0.1100 60  CYS B CA  
1196 C C   . CYS B 44  ? 1.3769 1.3980 1.1406 0.6351  -0.1623 -0.1019 60  CYS B C   
1197 O O   . CYS B 44  ? 1.3516 1.4548 1.1913 0.6160  -0.1572 -0.1126 60  CYS B O   
1198 C CB  . CYS B 44  ? 1.4843 1.3635 1.1201 0.5874  -0.0796 -0.1273 60  CYS B CB  
1199 S SG  . CYS B 44  ? 1.4792 1.2872 1.0123 0.5473  -0.1083 -0.1039 60  CYS B SG  
1200 N N   . GLN B 45  ? 1.3611 1.3691 1.0891 0.6508  -0.2119 -0.0822 61  GLN B N   
1201 C CA  . GLN B 45  ? 1.3272 1.4131 1.1020 0.6499  -0.2698 -0.0797 61  GLN B CA  
1202 C C   . GLN B 45  ? 1.3060 1.3580 0.9941 0.6152  -0.2954 -0.0777 61  GLN B C   
1203 O O   . GLN B 45  ? 1.3361 1.3094 0.9304 0.6213  -0.2898 -0.0602 61  GLN B O   
1204 C CB  . GLN B 45  ? 1.3792 1.4969 1.1986 0.7087  -0.3126 -0.0602 61  GLN B CB  
1205 C CG  . GLN B 45  ? 1.3998 1.5618 1.3247 0.7413  -0.2779 -0.0587 61  GLN B CG  
1206 C CD  . GLN B 45  ? 1.4172 1.6487 1.4296 0.7912  -0.3243 -0.0355 61  GLN B CD  
1207 O OE1 . GLN B 45  ? 1.4360 1.6785 1.4182 0.8027  -0.3887 -0.0233 61  GLN B OE1 
1208 N NE2 . GLN B 45  ? 1.4284 1.7105 1.5501 0.8228  -0.2920 -0.0271 61  GLN B NE2 
1209 N N   . ARG B 46  ? 1.2575 1.3701 0.9873 0.5798  -0.3192 -0.0923 62  ARG B N   
1210 C CA  . ARG B 46  ? 1.2274 1.3129 0.8927 0.5364  -0.3240 -0.0951 62  ARG B CA  
1211 C C   . ARG B 46  ? 1.2760 1.3091 0.8464 0.5616  -0.3636 -0.0806 62  ARG B C   
1212 O O   . ARG B 46  ? 1.3159 1.3754 0.8960 0.5942  -0.4175 -0.0826 62  ARG B O   
1213 C CB  . ARG B 46  ? 1.1752 1.3404 0.9262 0.4992  -0.3436 -0.1134 62  ARG B CB  
1214 C CG  . ARG B 46  ? 1.1385 1.2838 0.8463 0.4509  -0.3375 -0.1162 62  ARG B CG  
1215 C CD  . ARG B 46  ? 1.1022 1.2223 0.7850 0.4147  -0.2755 -0.1086 62  ARG B CD  
1216 N NE  . ARG B 46  ? 1.0662 1.2541 0.8424 0.3962  -0.2427 -0.1184 62  ARG B NE  
1217 C CZ  . ARG B 46  ? 1.0269 1.2807 0.8781 0.3582  -0.2394 -0.1229 62  ARG B CZ  
1218 N NH1 . ARG B 46  ? 0.9928 1.2466 0.8379 0.3328  -0.2694 -0.1236 62  ARG B NH1 
1219 N NH2 . ARG B 46  ? 1.0292 1.3459 0.9616 0.3486  -0.2026 -0.1249 62  ARG B NH2 
1220 N N   . VAL B 47  ? 1.2945 1.2547 0.7721 0.5480  -0.3368 -0.0624 63  VAL B N   
1221 C CA  . VAL B 47  ? 1.3237 1.2331 0.7158 0.5590  -0.3528 -0.0462 63  VAL B CA  
1222 C C   . VAL B 47  ? 1.2933 1.2134 0.6807 0.5164  -0.3597 -0.0614 63  VAL B C   
1223 O O   . VAL B 47  ? 1.3286 1.2523 0.7111 0.5171  -0.3898 -0.0758 63  VAL B O   
1224 C CB  . VAL B 47  ? 1.3547 1.1859 0.6826 0.5563  -0.3061 -0.0118 63  VAL B CB  
1225 C CG1 . VAL B 47  ? 1.3715 1.1645 0.6519 0.5470  -0.2944 0.0029  63  VAL B CG1 
1226 C CG2 . VAL B 47  ? 1.3913 1.2012 0.7264 0.5999  -0.3000 0.0034  63  VAL B CG2 
1227 N N   . VAL B 48  ? 1.2882 1.2099 0.6736 0.4798  -0.3333 -0.0580 64  VAL B N   
1228 C CA  . VAL B 48  ? 1.2648 1.1916 0.6498 0.4407  -0.3336 -0.0664 64  VAL B CA  
1229 C C   . VAL B 48  ? 1.2277 1.1842 0.6604 0.3886  -0.2940 -0.0637 64  VAL B C   
1230 O O   . VAL B 48  ? 1.2310 1.1743 0.6625 0.3773  -0.2570 -0.0495 64  VAL B O   
1231 C CB  . VAL B 48  ? 1.3532 1.2093 0.6722 0.4357  -0.3050 -0.0425 64  VAL B CB  
1232 C CG1 . VAL B 48  ? 1.3211 1.1348 0.6136 0.4209  -0.2535 -0.0031 64  VAL B CG1 
1233 C CG2 . VAL B 48  ? 1.3572 1.2113 0.6710 0.4100  -0.3115 -0.0544 64  VAL B CG2 
1234 N N   . SER B 49  ? 1.1959 1.1897 0.6758 0.3524  -0.2993 -0.0775 65  SER B N   
1235 C CA  . SER B 49  ? 1.1751 1.2026 0.7054 0.2988  -0.2575 -0.0687 65  SER B CA  
1236 C C   . SER B 49  ? 1.1574 1.1620 0.6612 0.2710  -0.2478 -0.0538 65  SER B C   
1237 O O   . SER B 49  ? 1.1718 1.1448 0.6367 0.2906  -0.2778 -0.0640 65  SER B O   
1238 C CB  . SER B 49  ? 1.1297 1.2455 0.7799 0.2795  -0.2617 -0.0920 65  SER B CB  
1239 O OG  . SER B 49  ? 1.1256 1.2727 0.8287 0.2784  -0.3069 -0.1137 65  SER B OG  
1240 N N   . THR B 50  ? 1.0990 1.1173 0.6205 0.2266  -0.2047 -0.0290 66  THR B N   
1241 C CA  . THR B 50  ? 1.0913 1.0994 0.6089 0.1964  -0.1866 -0.0072 66  THR B CA  
1242 C C   . THR B 50  ? 1.1148 1.1678 0.7123 0.1806  -0.2101 -0.0354 66  THR B C   
1243 O O   . THR B 50  ? 1.1258 1.2283 0.7929 0.1872  -0.2401 -0.0670 66  THR B O   
1244 C CB  . THR B 50  ? 1.0884 1.1172 0.6223 0.1493  -0.1406 0.0289  66  THR B CB  
1245 O OG1 . THR B 50  ? 1.1046 1.2002 0.7081 0.1280  -0.1310 0.0119  66  THR B OG1 
1246 C CG2 . THR B 50  ? 1.0556 1.0255 0.5100 0.1582  -0.1234 0.0633  66  THR B CG2 
1247 N N   . HIS B 51  ? 1.0377 1.0715 0.6328 0.1597  -0.1957 -0.0195 67  HIS B N   
1248 C CA  . HIS B 51  ? 1.0480 1.1033 0.7119 0.1449  -0.2205 -0.0460 67  HIS B CA  
1249 C C   . HIS B 51  ? 1.0182 1.1698 0.8139 0.1119  -0.2201 -0.0561 67  HIS B C   
1250 O O   . HIS B 51  ? 0.9962 1.1950 0.8239 0.0868  -0.1805 -0.0310 67  HIS B O   
1251 C CB  . HIS B 51  ? 1.0648 1.0872 0.7172 0.1225  -0.1878 -0.0172 67  HIS B CB  
1252 C CG  . HIS B 51  ? 1.1078 1.1059 0.7876 0.1216  -0.2181 -0.0495 67  HIS B CG  
1253 N ND1 . HIS B 51  ? 1.0822 1.1421 0.8846 0.0924  -0.2433 -0.0751 67  HIS B ND1 
1254 C CD2 . HIS B 51  ? 1.1796 1.0923 0.7798 0.1458  -0.2254 -0.0593 67  HIS B CD2 
1255 C CE1 . HIS B 51  ? 1.1272 1.1363 0.9263 0.0948  -0.2718 -0.1035 67  HIS B CE1 
1256 N NE2 . HIS B 51  ? 1.1947 1.1102 0.8637 0.1288  -0.2602 -0.0977 67  HIS B NE2 
1257 N N   . ASN B 52  ? 0.9908 1.1715 0.8625 0.1127  -0.2657 -0.0911 68  ASN B N   
1258 C CA  . ASN B 52  ? 0.9304 1.2099 0.9402 0.0878  -0.2638 -0.0934 68  ASN B CA  
1259 C C   . ASN B 52  ? 0.8831 1.2107 0.9703 0.0396  -0.2167 -0.0602 68  ASN B C   
1260 O O   . ASN B 52  ? 0.8351 1.2447 1.0081 0.0204  -0.1888 -0.0442 68  ASN B O   
1261 C CB  . ASN B 52  ? 0.9941 1.3003 1.0861 0.0961  -0.3293 -0.1310 68  ASN B CB  
1262 C CG  . ASN B 52  ? 1.0160 1.2731 1.1117 0.0823  -0.3645 -0.1522 68  ASN B CG  
1263 O OD1 . ASN B 52  ? 1.0040 1.2387 1.0989 0.0559  -0.3291 -0.1326 68  ASN B OD1 
1264 N ND2 . ASN B 52  ? 1.0662 1.3037 1.1663 0.1007  -0.4372 -0.1929 68  ASN B ND2 
1265 N N   . LEU B 53  ? 0.8675 1.1467 0.9263 0.0234  -0.2040 -0.0464 69  LEU B N   
1266 C CA  . LEU B 53  ? 0.7998 1.1176 0.9131 -0.0188 -0.1520 -0.0025 69  LEU B CA  
1267 C C   . LEU B 53  ? 0.8095 1.1043 0.8282 -0.0209 -0.1077 0.0368  69  LEU B C   
1268 O O   . LEU B 53  ? 0.8684 1.0850 0.7857 -0.0012 -0.1058 0.0455  69  LEU B O   
1269 C CB  . LEU B 53  ? 0.7902 1.0677 0.9313 -0.0351 -0.1546 -0.0002 69  LEU B CB  
1270 C CG  . LEU B 53  ? 0.7561 1.0616 1.0266 -0.0575 -0.1848 -0.0218 69  LEU B CG  
1271 C CD1 . LEU B 53  ? 0.8055 1.1075 1.1038 -0.0372 -0.2561 -0.0761 69  LEU B CD1 
1272 C CD2 . LEU B 53  ? 0.7822 1.0188 1.0422 -0.0691 -0.1719 -0.0136 69  LEU B CD2 
1273 N N   . TRP B 54  ? 1.1887 0.6625 0.6795 0.0391  -0.2927 -0.0002 70  TRP B N   
1274 C CA  . TRP B 54  ? 1.1795 0.7256 0.6797 0.0568  -0.2838 -0.0198 70  TRP B CA  
1275 C C   . TRP B 54  ? 1.2249 0.7564 0.6924 0.0910  -0.2903 -0.0180 70  TRP B C   
1276 O O   . TRP B 54  ? 1.2215 0.7926 0.7096 0.1080  -0.2858 -0.0415 70  TRP B O   
1277 C CB  . TRP B 54  ? 1.0670 0.6821 0.5751 0.0507  -0.2730 -0.0180 70  TRP B CB  
1278 C CG  . TRP B 54  ? 1.0586 0.7529 0.5837 0.0720  -0.2713 -0.0462 70  TRP B CG  
1279 C CD1 . TRP B 54  ? 1.0224 0.7775 0.6100 0.0664  -0.2671 -0.0830 70  TRP B CD1 
1280 C CD2 . TRP B 54  ? 1.0898 0.8107 0.5791 0.1038  -0.2788 -0.0421 70  TRP B CD2 
1281 N NE1 . TRP B 54  ? 1.0238 0.8434 0.6230 0.0928  -0.2716 -0.1066 70  TRP B NE1 
1282 C CE2 . TRP B 54  ? 1.0650 0.8654 0.5999 0.1172  -0.2803 -0.0829 70  TRP B CE2 
1283 C CE3 . TRP B 54  ? 1.1459 0.8291 0.5759 0.1235  -0.2885 -0.0082 70  TRP B CE3 
1284 C CZ2 . TRP B 54  ? 1.0833 0.9284 0.6031 0.1514  -0.2938 -0.0953 70  TRP B CZ2 
1285 C CZ3 . TRP B 54  ? 1.1679 0.8927 0.5766 0.1573  -0.3015 -0.0149 70  TRP B CZ3 
1286 C CH2 . TRP B 54  ? 1.1337 0.9397 0.5854 0.1718  -0.3054 -0.0604 70  TRP B CH2 
1287 N N   . LEU B 55  ? 1.2080 0.6844 0.6377 0.1014  -0.3011 0.0087  71  LEU B N   
1288 C CA  . LEU B 55  ? 1.2573 0.7152 0.6645 0.1353  -0.3114 0.0084  71  LEU B CA  
1289 C C   . LEU B 55  ? 1.2816 0.7183 0.6956 0.1479  -0.3091 -0.0181 71  LEU B C   
1290 O O   . LEU B 55  ? 1.3151 0.7677 0.7330 0.1755  -0.3086 -0.0330 71  LEU B O   
1291 C CB  . LEU B 55  ? 1.2824 0.6730 0.6615 0.1406  -0.3265 0.0429  71  LEU B CB  
1292 C CG  . LEU B 55  ? 1.3419 0.6932 0.7076 0.1745  -0.3432 0.0402  71  LEU B CG  
1293 C CD1 . LEU B 55  ? 1.3572 0.7603 0.7168 0.2027  -0.3485 0.0398  71  LEU B CD1 
1294 C CD2 . LEU B 55  ? 1.3822 0.6533 0.7407 0.1736  -0.3610 0.0699  71  LEU B CD2 
1295 N N   . LEU B 56  ? 1.2426 0.6476 0.6587 0.1294  -0.3067 -0.0251 72  LEU B N   
1296 C CA  . LEU B 56  ? 1.2825 0.6653 0.6883 0.1423  -0.3009 -0.0449 72  LEU B CA  
1297 C C   . LEU B 56  ? 1.2595 0.6900 0.6973 0.1310  -0.2815 -0.0592 72  LEU B C   
1298 O O   . LEU B 56  ? 1.2903 0.6974 0.7118 0.1342  -0.2736 -0.0665 72  LEU B O   
1299 C CB  . LEU B 56  ? 1.3285 0.6336 0.7025 0.1378  -0.3179 -0.0433 72  LEU B CB  
1300 C CG  . LEU B 56  ? 1.3745 0.6219 0.7304 0.1544  -0.3387 -0.0351 72  LEU B CG  
1301 C CD1 . LEU B 56  ? 1.3934 0.5697 0.7368 0.1459  -0.3614 -0.0395 72  LEU B CD1 
1302 C CD2 . LEU B 56  ? 1.4386 0.6866 0.7824 0.1899  -0.3345 -0.0526 72  LEU B CD2 
1303 N N   . SER B 57  ? 1.1802 0.6773 0.6638 0.1196  -0.2741 -0.0634 73  SER B N   
1304 C CA  . SER B 57  ? 1.1630 0.6998 0.6941 0.1061  -0.2593 -0.0755 73  SER B CA  
1305 C C   . SER B 57  ? 1.2262 0.7902 0.7828 0.1264  -0.2380 -0.0889 73  SER B C   
1306 O O   . SER B 57  ? 1.2405 0.8309 0.8424 0.1159  -0.2224 -0.0928 73  SER B O   
1307 C CB  . SER B 57  ? 1.1305 0.7336 0.7164 0.0887  -0.2600 -0.0844 73  SER B CB  
1308 O OG  . SER B 57  ? 1.1385 0.7908 0.7334 0.1081  -0.2619 -0.0937 73  SER B OG  
1309 N N   . PHE B 58  ? 1.1526 0.7105 0.6913 0.1546  -0.2360 -0.0949 74  PHE B N   
1310 C CA  . PHE B 58  ? 1.2112 0.7866 0.7750 0.1739  -0.2105 -0.1079 74  PHE B CA  
1311 C C   . PHE B 58  ? 1.2504 0.7753 0.7659 0.1734  -0.1944 -0.0991 74  PHE B C   
1312 O O   . PHE B 58  ? 1.2751 0.8172 0.8103 0.1845  -0.1633 -0.1039 74  PHE B O   
1313 C CB  . PHE B 58  ? 1.2155 0.7928 0.7752 0.2059  -0.2163 -0.1202 74  PHE B CB  
1314 C CG  . PHE B 58  ? 1.2603 0.7654 0.7489 0.2182  -0.2334 -0.1117 74  PHE B CG  
1315 C CD1 . PHE B 58  ? 1.3005 0.7712 0.7602 0.2374  -0.2190 -0.1223 74  PHE B CD1 
1316 C CD2 . PHE B 58  ? 1.2247 0.6987 0.6819 0.2110  -0.2623 -0.0944 74  PHE B CD2 
1317 C CE1 . PHE B 58  ? 1.3456 0.7517 0.7523 0.2507  -0.2397 -0.1226 74  PHE B CE1 
1318 C CE2 . PHE B 58  ? 1.2606 0.6667 0.6721 0.2214  -0.2807 -0.0874 74  PHE B CE2 
1319 C CZ  . PHE B 58  ? 1.3338 0.7058 0.7231 0.2421  -0.2727 -0.1049 74  PHE B CZ  
1320 N N   . LEU B 59  ? 1.3103 0.7754 0.7646 0.1623  -0.2146 -0.0872 75  LEU B N   
1321 C CA  . LEU B 59  ? 1.3524 0.7657 0.7446 0.1665  -0.2089 -0.0827 75  LEU B CA  
1322 C C   . LEU B 59  ? 1.3370 0.7637 0.7485 0.1453  -0.1966 -0.0681 75  LEU B C   
1323 O O   . LEU B 59  ? 1.2753 0.7188 0.7281 0.1202  -0.2119 -0.0623 75  LEU B O   
1324 C CB  . LEU B 59  ? 1.3282 0.6737 0.6632 0.1644  -0.2443 -0.0816 75  LEU B CB  
1325 C CG  . LEU B 59  ? 1.3735 0.6869 0.6823 0.1902  -0.2570 -0.0941 75  LEU B CG  
1326 C CD1 . LEU B 59  ? 1.3789 0.6235 0.6505 0.1858  -0.2933 -0.0940 75  LEU B CD1 
1327 C CD2 . LEU B 59  ? 1.4427 0.7577 0.7265 0.2205  -0.2309 -0.1120 75  LEU B CD2 
1328 N N   . ARG B 60  ? 1.4166 0.8364 0.7998 0.1561  -0.1679 -0.0609 76  ARG B N   
1329 C CA  . ARG B 60  ? 1.4067 0.8317 0.8051 0.1378  -0.1571 -0.0385 76  ARG B CA  
1330 C C   . ARG B 60  ? 1.3895 0.7567 0.7308 0.1252  -0.1956 -0.0306 76  ARG B C   
1331 O O   . ARG B 60  ? 1.4143 0.7282 0.6807 0.1390  -0.2187 -0.0414 76  ARG B O   
1332 C CB  . ARG B 60  ? 1.4700 0.8984 0.8409 0.1541  -0.1120 -0.0246 76  ARG B CB  
1333 C CG  . ARG B 60  ? 1.4696 0.9413 0.9232 0.1361  -0.0827 -0.0002 76  ARG B CG  
1334 C CD  . ARG B 60  ? 1.5377 1.0071 0.9569 0.1497  -0.0322 0.0248  76  ARG B CD  
1335 N NE  . ARG B 60  ? 1.5575 1.0646 1.0081 0.1710  0.0104  0.0079  76  ARG B NE  
1336 C CZ  . ARG B 60  ? 1.6084 1.1163 1.0203 0.1883  0.0621  0.0226  76  ARG B CZ  
1337 N NH1 . ARG B 60  ? 1.6656 1.1367 0.9914 0.1884  0.0761  0.0587  76  ARG B NH1 
1338 N NH2 . ARG B 60  ? 1.6172 1.1640 1.0747 0.2071  0.1002  0.0012  76  ARG B NH2 
1339 N N   . ARG B 61  ? 1.6324 1.0304 0.6777 0.4304  -0.2591 -0.1397 77  ARG B N   
1340 C CA  . ARG B 61  ? 1.6603 1.0817 0.7010 0.4071  -0.3045 -0.1377 77  ARG B CA  
1341 C C   . ARG B 61  ? 1.6571 1.1220 0.6850 0.4305  -0.2942 -0.1174 77  ARG B C   
1342 O O   . ARG B 61  ? 1.5995 1.0956 0.6599 0.4517  -0.2533 -0.0970 77  ARG B O   
1343 C CB  . ARG B 61  ? 1.5957 1.0636 0.7222 0.3690  -0.3239 -0.1225 77  ARG B CB  
1344 C CG  . ARG B 61  ? 1.5996 1.0247 0.7401 0.3462  -0.3326 -0.1391 77  ARG B CG  
1345 C CD  . ARG B 61  ? 1.6971 1.0615 0.7782 0.3246  -0.3797 -0.1660 77  ARG B CD  
1346 N NE  . ARG B 61  ? 1.6873 1.0791 0.8196 0.2792  -0.4217 -0.1575 77  ARG B NE  
1347 C CZ  . ARG B 61  ? 1.7718 1.1177 0.8635 0.2492  -0.4709 -0.1764 77  ARG B CZ  
1348 N NH1 . ARG B 61  ? 1.8779 1.1403 0.8683 0.2627  -0.4823 -0.2087 77  ARG B NH1 
1349 N NH2 . ARG B 61  ? 1.7571 1.1378 0.9068 0.2055  -0.5078 -0.1624 77  ARG B NH2 
1350 N N   . TRP B 62  ? 1.7263 1.1901 0.7037 0.4252  -0.3329 -0.1220 78  TRP B N   
1351 C CA  . TRP B 62  ? 1.7437 1.2398 0.6922 0.4510  -0.3261 -0.1040 78  TRP B CA  
1352 C C   . TRP B 62  ? 1.7297 1.2922 0.7199 0.4302  -0.3621 -0.0793 78  TRP B C   
1353 O O   . TRP B 62  ? 1.7609 1.3252 0.7557 0.3951  -0.4106 -0.0863 78  TRP B O   
1354 C CB  . TRP B 62  ? 1.8563 1.2903 0.6898 0.4720  -0.3365 -0.1291 78  TRP B CB  
1355 C CG  . TRP B 62  ? 1.8726 1.2521 0.6669 0.5031  -0.2925 -0.1450 78  TRP B CG  
1356 C CD1 . TRP B 62  ? 1.9110 1.2236 0.6760 0.4993  -0.2919 -0.1735 78  TRP B CD1 
1357 C CD2 . TRP B 62  ? 1.8554 1.2452 0.6386 0.5438  -0.2417 -0.1290 78  TRP B CD2 
1358 N NE1 . TRP B 62  ? 1.9158 1.2021 0.6559 0.5376  -0.2425 -0.1745 78  TRP B NE1 
1359 C CE2 . TRP B 62  ? 1.8814 1.2160 0.6332 0.5635  -0.2120 -0.1469 78  TRP B CE2 
1360 C CE3 . TRP B 62  ? 1.8238 1.2644 0.6232 0.5657  -0.2180 -0.0982 78  TRP B CE3 
1361 C CZ2 . TRP B 62  ? 1.8734 1.2099 0.6144 0.6022  -0.1605 -0.1330 78  TRP B CZ2 
1362 C CZ3 . TRP B 62  ? 1.8184 1.2539 0.6032 0.6017  -0.1680 -0.0867 78  TRP B CZ3 
1363 C CH2 . TRP B 62  ? 1.8416 1.2291 0.5996 0.6188  -0.1402 -0.1031 78  TRP B CH2 
1364 N N   . ASN B 63  ? 1.6855 1.3035 0.7094 0.4519  -0.3375 -0.0473 79  ASN B N   
1365 C CA  . ASN B 63  ? 1.7019 1.3783 0.7356 0.4492  -0.3671 -0.0207 79  ASN B CA  
1366 C C   . ASN B 63  ? 1.7481 1.4162 0.7144 0.4881  -0.3475 -0.0137 79  ASN B C   
1367 O O   . ASN B 63  ? 1.7000 1.3884 0.6939 0.5160  -0.3017 0.0083  79  ASN B O   
1368 C CB  . ASN B 63  ? 1.6161 1.3668 0.7514 0.4451  -0.3527 0.0166  79  ASN B CB  
1369 C CG  . ASN B 63  ? 1.6374 1.4530 0.7966 0.4314  -0.3964 0.0440  79  ASN B CG  
1370 O OD1 . ASN B 63  ? 1.7103 1.5134 0.8208 0.4094  -0.4479 0.0303  79  ASN B OD1 
1371 N ND2 . ASN B 63  ? 1.5839 1.4663 0.8128 0.4450  -0.3770 0.0837  79  ASN B ND2 
1372 N N   . GLY B 64  ? 1.8480 1.4819 0.7219 0.4888  -0.3820 -0.0321 80  GLY B N   
1373 C CA  . GLY B 64  ? 1.9031 1.5230 0.7018 0.5267  -0.3624 -0.0274 80  GLY B CA  
1374 C C   . GLY B 64  ? 1.8740 1.4602 0.6643 0.5597  -0.3011 -0.0318 80  GLY B C   
1375 O O   . GLY B 64  ? 1.8954 1.4224 0.6525 0.5603  -0.2896 -0.0618 80  GLY B O   
1376 N N   . SER B 65  ? 1.8303 1.4543 0.6518 0.5872  -0.2618 0.0008  81  SER B N   
1377 C CA  . SER B 65  ? 1.8101 1.4104 0.6241 0.6173  -0.2056 0.0040  81  SER B CA  
1378 C C   . SER B 65  ? 1.7155 1.3216 0.6151 0.6050  -0.1736 0.0073  81  SER B C   
1379 O O   . SER B 65  ? 1.6887 1.2865 0.5987 0.6246  -0.1280 0.0171  81  SER B O   
1380 C CB  . SER B 65  ? 1.8187 1.4545 0.6409 0.6431  -0.1754 0.0370  81  SER B CB  
1381 O OG  . SER B 65  ? 1.7513 1.4304 0.6486 0.6457  -0.1562 0.0702  81  SER B OG  
1382 N N   . THR B 66  ? 1.6681 1.2909 0.6288 0.5719  -0.1967 0.0022  82  THR B N   
1383 C CA  . THR B 66  ? 1.5837 1.2140 0.6216 0.5584  -0.1692 0.0066  82  THR B CA  
1384 C C   . THR B 66  ? 1.5840 1.1769 0.6225 0.5338  -0.1857 -0.0243 82  THR B C   
1385 O O   . THR B 66  ? 1.6191 1.2045 0.6424 0.5110  -0.2294 -0.0402 82  THR B O   
1386 C CB  . THR B 66  ? 1.5716 1.2563 0.6862 0.5448  -0.1735 0.0328  82  THR B CB  
1387 O OG1 . THR B 66  ? 1.5730 1.2887 0.6836 0.5704  -0.1598 0.0633  82  THR B OG1 
1388 C CG2 . THR B 66  ? 1.5048 1.1898 0.6848 0.5342  -0.1407 0.0370  82  THR B CG2 
1389 N N   . ALA B 67  ? 1.5490 1.1191 0.6062 0.5371  -0.1521 -0.0301 83  ALA B N   
1390 C CA  . ALA B 67  ? 1.5507 1.0829 0.6087 0.5196  -0.1609 -0.0556 83  ALA B CA  
1391 C C   . ALA B 67  ? 1.4782 1.0296 0.6155 0.5000  -0.1416 -0.0461 83  ALA B C   
1392 O O   . ALA B 67  ? 1.4346 1.0102 0.6087 0.5076  -0.1093 -0.0247 83  ALA B O   
1393 C CB  . ALA B 67  ? 1.6033 1.0861 0.5993 0.5461  -0.1389 -0.0711 83  ALA B CB  
1394 N N   . ILE B 68  ? 1.4566 0.9932 0.6159 0.4731  -0.1628 -0.0620 84  ILE B N   
1395 C CA  . ILE B 68  ? 1.3971 0.9487 0.6238 0.4523  -0.1486 -0.0551 84  ILE B CA  
1396 C C   . ILE B 68  ? 1.4058 0.9159 0.6244 0.4434  -0.1522 -0.0750 84  ILE B C   
1397 O O   . ILE B 68  ? 1.4580 0.9311 0.6353 0.4381  -0.1810 -0.0964 84  ILE B O   
1398 C CB  . ILE B 68  ? 1.3494 0.9416 0.6304 0.4258  -0.1702 -0.0439 84  ILE B CB  
1399 C CG1 . ILE B 68  ? 1.2961 0.9008 0.6376 0.4069  -0.1516 -0.0364 84  ILE B CG1 
1400 C CG2 . ILE B 68  ? 1.3942 0.9768 0.6590 0.4042  -0.2178 -0.0590 84  ILE B CG2 
1401 C CD1 . ILE B 68  ? 1.2685 0.9179 0.6639 0.3905  -0.1579 -0.0187 84  ILE B CD1 
1402 N N   . THR B 69  ? 1.3986 0.9120 0.6541 0.4413  -0.1238 -0.0668 85  THR B N   
1403 C CA  . THR B 69  ? 1.3910 0.8740 0.6525 0.4331  -0.1238 -0.0785 85  THR B CA  
1404 C C   . THR B 69  ? 1.3224 0.8335 0.6493 0.4110  -0.1097 -0.0635 85  THR B C   
1405 O O   . THR B 69  ? 1.2783 0.8174 0.6296 0.4132  -0.0861 -0.0457 85  THR B O   
1406 C CB  . THR B 69  ? 1.3931 0.8459 0.6144 0.4647  -0.0980 -0.0816 85  THR B CB  
1407 O OG1 . THR B 69  ? 1.4715 0.8910 0.6198 0.4869  -0.1098 -0.0978 85  THR B OG1 
1408 C CG2 . THR B 69  ? 1.3972 0.8214 0.6302 0.4596  -0.0960 -0.0891 85  THR B CG2 
1409 N N   . ASP B 70  ? 1.3152 0.8140 0.6656 0.3891  -0.1244 -0.0706 86  ASP B N   
1410 C CA  . ASP B 70  ? 1.2612 0.7865 0.6681 0.3641  -0.1173 -0.0576 86  ASP B CA  
1411 C C   . ASP B 70  ? 1.2442 0.7506 0.6626 0.3614  -0.1090 -0.0576 86  ASP B C   
1412 O O   . ASP B 70  ? 1.2815 0.7524 0.6812 0.3622  -0.1252 -0.0715 86  ASP B O   
1413 C CB  . ASP B 70  ? 1.2365 0.7785 0.6715 0.3366  -0.1446 -0.0585 86  ASP B CB  
1414 C CG  . ASP B 70  ? 1.1897 0.7608 0.6753 0.3145  -0.1329 -0.0436 86  ASP B CG  
1415 O OD1 . ASP B 70  ? 1.1479 0.7253 0.6426 0.3181  -0.1063 -0.0338 86  ASP B OD1 
1416 O OD2 . ASP B 70  ? 1.2012 0.7885 0.7153 0.2924  -0.1508 -0.0407 86  ASP B OD2 
1417 N N   . ASP B 71  ? 1.2014 0.7294 0.6494 0.3573  -0.0851 -0.0407 87  ASP B N   
1418 C CA  . ASP B 71  ? 1.1824 0.7058 0.6518 0.3521  -0.0773 -0.0331 87  ASP B CA  
1419 C C   . ASP B 71  ? 1.1554 0.6984 0.6662 0.3184  -0.0860 -0.0259 87  ASP B C   
1420 O O   . ASP B 71  ? 1.1222 0.6896 0.6547 0.3049  -0.0720 -0.0123 87  ASP B O   
1421 C CB  . ASP B 71  ? 1.1831 0.7224 0.6573 0.3674  -0.0482 -0.0154 87  ASP B CB  
1422 C CG  . ASP B 71  ? 1.1603 0.7102 0.6682 0.3573  -0.0413 0.0003  87  ASP B CG  
1423 O OD1 . ASP B 71  ? 1.1760 0.7067 0.6888 0.3546  -0.0542 -0.0053 87  ASP B OD1 
1424 O OD2 . ASP B 71  ? 1.1317 0.7089 0.6613 0.3510  -0.0241 0.0204  87  ASP B OD2 
1425 N N   . THR B 72  ? 1.1446 0.6727 0.6618 0.3038  -0.1097 -0.0352 88  THR B N   
1426 C CA  . THR B 72  ? 1.1286 0.6767 0.6820 0.2731  -0.1185 -0.0275 88  THR B CA  
1427 C C   . THR B 72  ? 1.1009 0.6576 0.6801 0.2605  -0.1090 -0.0128 88  THR B C   
1428 O O   . THR B 72  ? 1.0850 0.6623 0.6882 0.2364  -0.1091 -0.0033 88  THR B O   
1429 C CB  . THR B 72  ? 1.1207 0.6528 0.6770 0.2589  -0.1478 -0.0376 88  THR B CB  
1430 O OG1 . THR B 72  ? 1.1648 0.6539 0.7006 0.2696  -0.1573 -0.0479 88  THR B OG1 
1431 C CG2 . THR B 72  ? 1.1373 0.6755 0.6777 0.2626  -0.1616 -0.0462 88  THR B CG2 
1432 N N   . LEU B 73  ? 1.1071 0.6504 0.6810 0.2774  -0.1004 -0.0084 89  LEU B N   
1433 C CA  . LEU B 73  ? 1.0851 0.6440 0.6880 0.2651  -0.0942 0.0106  89  LEU B CA  
1434 C C   . LEU B 73  ? 1.0541 0.6447 0.6673 0.2563  -0.0762 0.0263  89  LEU B C   
1435 O O   . LEU B 73  ? 1.0414 0.6503 0.6712 0.2292  -0.0776 0.0357  89  LEU B O   
1436 C CB  . LEU B 73  ? 1.1023 0.6400 0.7016 0.2892  -0.0896 0.0149  89  LEU B CB  
1437 C CG  . LEU B 73  ? 1.0827 0.6453 0.7176 0.2792  -0.0835 0.0409  89  LEU B CG  
1438 C CD1 . LEU B 73  ? 1.0788 0.6354 0.7339 0.2552  -0.1021 0.0438  89  LEU B CD1 
1439 C CD2 . LEU B 73  ? 1.1106 0.6664 0.7459 0.3121  -0.0679 0.0530  89  LEU B CD2 
1440 N N   . GLY B 74  ? 1.0950 0.6890 0.6946 0.2777  -0.0594 0.0298  90  GLY B N   
1441 C CA  . GLY B 74  ? 1.0757 0.6934 0.6822 0.2658  -0.0446 0.0442  90  GLY B CA  
1442 C C   . GLY B 74  ? 1.0761 0.6913 0.6678 0.2550  -0.0424 0.0342  90  GLY B C   
1443 O O   . GLY B 74  ? 1.0717 0.6954 0.6659 0.2344  -0.0346 0.0426  90  GLY B O   
1444 N N   . GLY B 75  ? 1.1069 0.7083 0.6814 0.2682  -0.0498 0.0175  91  GLY B N   
1445 C CA  . GLY B 75  ? 1.1097 0.7132 0.6753 0.2632  -0.0463 0.0122  91  GLY B CA  
1446 C C   . GLY B 75  ? 1.1102 0.7116 0.6556 0.2826  -0.0293 0.0145  91  GLY B C   
1447 O O   . GLY B 75  ? 1.1068 0.7091 0.6498 0.2732  -0.0146 0.0218  91  GLY B O   
1448 N N   . THR B 76  ? 1.1656 0.7594 0.6917 0.3097  -0.0306 0.0084  92  THR B N   
1449 C CA  . THR B 76  ? 1.1664 0.7596 0.6713 0.3309  -0.0144 0.0129  92  THR B CA  
1450 C C   . THR B 76  ? 1.1924 0.7777 0.6707 0.3528  -0.0266 -0.0002 92  THR B C   
1451 O O   . THR B 76  ? 1.2161 0.7866 0.6756 0.3673  -0.0374 -0.0105 92  THR B O   
1452 C CB  . THR B 76  ? 1.2014 0.7983 0.7046 0.3447  0.0022  0.0264  92  THR B CB  
1453 O OG1 . THR B 76  ? 1.1931 0.8024 0.7252 0.3203  0.0059  0.0405  92  THR B OG1 
1454 C CG2 . THR B 76  ? 1.1971 0.7961 0.6842 0.3599  0.0218  0.0367  92  THR B CG2 
1455 N N   . LEU B 77  ? 1.1916 0.7839 0.6649 0.3558  -0.0246 0.0013  93  LEU B N   
1456 C CA  . LEU B 77  ? 1.2270 0.8193 0.6757 0.3748  -0.0375 -0.0060 93  LEU B CA  
1457 C C   . LEU B 77  ? 1.2346 0.8235 0.6545 0.4019  -0.0189 0.0022  93  LEU B C   
1458 O O   . LEU B 77  ? 1.2133 0.8051 0.6408 0.4018  0.0049  0.0170  93  LEU B O   
1459 C CB  . LEU B 77  ? 1.1311 0.7416 0.5966 0.3667  -0.0437 -0.0019 93  LEU B CB  
1460 C CG  . LEU B 77  ? 1.1728 0.7948 0.6250 0.3777  -0.0664 -0.0058 93  LEU B CG  
1461 C CD1 . LEU B 77  ? 1.2069 0.8174 0.6521 0.3670  -0.0979 -0.0223 93  LEU B CD1 
1462 C CD2 . LEU B 77  ? 1.1706 0.8201 0.6513 0.3720  -0.0651 0.0068  93  LEU B CD2 
1463 N N   . THR B 78  ? 1.2499 0.8293 0.6328 0.4235  -0.0303 -0.0070 94  THR B N   
1464 C CA  . THR B 78  ? 1.2670 0.8434 0.6169 0.4522  -0.0119 0.0018  94  THR B CA  
1465 C C   . THR B 78  ? 1.3180 0.8957 0.6323 0.4684  -0.0296 -0.0039 94  THR B C   
1466 O O   . THR B 78  ? 1.3650 0.9283 0.6539 0.4679  -0.0570 -0.0221 94  THR B O   
1467 C CB  . THR B 78  ? 1.2762 0.8360 0.6053 0.4688  -0.0012 -0.0010 94  THR B CB  
1468 O OG1 . THR B 78  ? 1.2311 0.8000 0.5993 0.4531  0.0152  0.0116  94  THR B OG1 
1469 C CG2 . THR B 78  ? 1.3054 0.8643 0.5959 0.5013  0.0188  0.0095  94  THR B CG2 
1470 N N   . ILE B 79  ? 1.3417 0.9344 0.6530 0.4811  -0.0158 0.0129  95  ILE B N   
1471 C CA  . ILE B 79  ? 1.3930 0.9943 0.6716 0.4986  -0.0311 0.0143  95  ILE B CA  
1472 C C   . ILE B 79  ? 1.4069 0.9995 0.6420 0.5292  -0.0101 0.0235  95  ILE B C   
1473 O O   . ILE B 79  ? 1.3725 0.9675 0.6220 0.5350  0.0213  0.0416  95  ILE B O   
1474 C CB  . ILE B 79  ? 1.3026 0.9308 0.6121 0.4946  -0.0299 0.0314  95  ILE B CB  
1475 C CG1 . ILE B 79  ? 1.2663 0.9030 0.6254 0.4662  -0.0347 0.0285  95  ILE B CG1 
1476 C CG2 . ILE B 79  ? 1.3476 0.9942 0.6333 0.5057  -0.0574 0.0332  95  ILE B CG2 
1477 C CD1 . ILE B 79  ? 1.2882 0.9256 0.6526 0.4471  -0.0688 0.0103  95  ILE B CD1 
1478 N N   . THR B 80  ? 1.4415 1.0228 0.6211 0.5472  -0.0280 0.0122  96  THR B N   
1479 C CA  . THR B 80  ? 1.4799 1.0531 0.6080 0.5798  -0.0090 0.0209  96  THR B CA  
1480 C C   . THR B 80  ? 1.5125 1.1023 0.6107 0.5929  -0.0253 0.0300  96  THR B C   
1481 O O   . THR B 80  ? 1.5453 1.1345 0.6212 0.5845  -0.0628 0.0150  96  THR B O   
1482 C CB  . THR B 80  ? 1.5423 1.0797 0.6161 0.5947  -0.0124 -0.0008 96  THR B CB  
1483 O OG1 . THR B 80  ? 1.4925 1.0209 0.6021 0.5839  0.0030  -0.0040 96  THR B OG1 
1484 C CG2 . THR B 80  ? 1.5865 1.1173 0.6036 0.6322  0.0124  0.0107  96  THR B CG2 
1485 N N   . LEU B 81  ? 1.5168 1.1227 0.6172 0.6112  0.0010  0.0571  97  LEU B N   
1486 C CA  . LEU B 81  ? 1.5500 1.1737 0.6183 0.6302  -0.0090 0.0722  97  LEU B CA  
1487 C C   . LEU B 81  ? 1.6083 1.2139 0.6035 0.6613  0.0027  0.0718  97  LEU B C   
1488 O O   . LEU B 81  ? 1.6007 1.2074 0.5939 0.6803  0.0397  0.0930  97  LEU B O   
1489 C CB  . LEU B 81  ? 1.5040 1.1507 0.6173 0.6335  0.0149  0.1042  97  LEU B CB  
1490 C CG  . LEU B 81  ? 1.4556 1.1139 0.6333 0.6061  0.0076  0.1025  97  LEU B CG  
1491 C CD1 . LEU B 81  ? 1.4132 1.0723 0.6314 0.6071  0.0418  0.1281  97  LEU B CD1 
1492 C CD2 . LEU B 81  ? 1.4750 1.1608 0.6566 0.6001  -0.0307 0.1006  97  LEU B CD2 
1493 N N   . ARG B 82  ? 1.6582 1.2444 0.5911 0.6651  -0.0290 0.0476  98  ARG B N   
1494 C CA  . ARG B 82  ? 1.7271 1.2871 0.5745 0.6961  -0.0209 0.0412  98  ARG B CA  
1495 C C   . ARG B 82  ? 1.7574 1.3454 0.5898 0.7104  -0.0222 0.0624  98  ARG B C   
1496 O O   . ARG B 82  ? 1.7624 1.3735 0.6003 0.6974  -0.0566 0.0649  98  ARG B O   
1497 C CB  . ARG B 82  ? 1.8703 1.3882 0.6601 0.6875  -0.0561 0.0019  98  ARG B CB  
1498 C CG  . ARG B 82  ? 1.9385 1.4275 0.6573 0.7049  -0.0603 -0.0135 98  ARG B CG  
1499 C CD  . ARG B 82  ? 1.9788 1.4166 0.6538 0.6870  -0.0966 -0.0536 98  ARG B CD  
1500 N NE  . ARG B 82  ? 2.0844 1.4862 0.6827 0.6930  -0.1161 -0.0733 98  ARG B NE  
1501 C CZ  . ARG B 82  ? 2.1497 1.5020 0.7017 0.6726  -0.1545 -0.1074 98  ARG B CZ  
1502 N NH1 . ARG B 82  ? 2.1143 1.4513 0.6943 0.6461  -0.1767 -0.1241 98  ARG B NH1 
1503 N NH2 . ARG B 82  ? 2.2564 1.5714 0.7320 0.6771  -0.1708 -0.1244 98  ARG B NH2 
1504 N N   . ASN B 83  ? 1.7778 1.3696 0.6004 0.7355  0.0161  0.0812  99  ASN B N   
1505 C CA  . ASN B 83  ? 1.8109 1.4295 0.6225 0.7503  0.0206  0.1038  99  ASN B CA  
1506 C C   . ASN B 83  ? 1.7556 1.4122 0.6276 0.7397  0.0191  0.1317  99  ASN B C   
1507 O O   . ASN B 83  ? 1.7627 1.4416 0.6383 0.7284  -0.0160 0.1324  99  ASN B O   
1508 C CB  . ASN B 83  ? 1.8929 1.4996 0.6377 0.7496  -0.0184 0.0817  99  ASN B CB  
1509 C CG  . ASN B 83  ? 1.9275 1.5682 0.6619 0.7598  -0.0227 0.1060  99  ASN B CG  
1510 O OD1 . ASN B 83  ? 1.9176 1.5773 0.6722 0.7791  0.0141  0.1355  99  ASN B OD1 
1511 N ND2 . ASN B 83  ? 1.9717 1.6217 0.6762 0.7447  -0.0694 0.0960  99  ASN B ND2 
1512 N N   . LEU B 84  ? 1.7081 1.3711 0.6305 0.7417  0.0567  0.1561  100 LEU B N   
1513 C CA  . LEU B 84  ? 1.6631 1.3503 0.6432 0.7332  0.0616  0.1817  100 LEU B CA  
1514 C C   . LEU B 84  ? 1.6995 1.4159 0.6733 0.7479  0.0616  0.2052  100 LEU B C   
1515 O O   . LEU B 84  ? 1.7454 1.4624 0.6857 0.7672  0.0787  0.2138  100 LEU B O   
1516 C CB  . LEU B 84  ? 1.6714 1.3473 0.6981 0.7291  0.1025  0.2008  100 LEU B CB  
1517 C CG  . LEU B 84  ? 1.6205 1.3008 0.7072 0.7144  0.1088  0.2172  100 LEU B CG  
1518 C CD1 . LEU B 84  ? 1.5989 1.2825 0.7015 0.6975  0.0737  0.1984  100 LEU B CD1 
1519 C CD2 . LEU B 84  ? 1.5884 1.2455 0.7094 0.7036  0.1440  0.2293  100 LEU B CD2 
1520 N N   . GLN B 85  ? 1.6770 1.4202 0.6859 0.7402  0.0435  0.2183  101 GLN B N   
1521 C CA  . GLN B 85  ? 1.7078 1.4847 0.7204 0.7527  0.0409  0.2450  101 GLN B CA  
1522 C C   . GLN B 85  ? 1.6668 1.4548 0.7445 0.7521  0.0654  0.2738  101 GLN B C   
1523 O O   . GLN B 85  ? 1.6178 1.3884 0.7340 0.7387  0.0757  0.2689  101 GLN B O   
1524 C CB  . GLN B 85  ? 1.7412 1.5458 0.7305 0.7443  -0.0110 0.2355  101 GLN B CB  
1525 C CG  . GLN B 85  ? 1.8089 1.5951 0.7206 0.7475  -0.0319 0.2099  101 GLN B CG  
1526 C CD  . GLN B 85  ? 1.8590 1.6439 0.7360 0.7725  -0.0033 0.2262  101 GLN B CD  
1527 O OE1 . GLN B 85  ? 1.8756 1.6921 0.7667 0.7831  0.0018  0.2565  101 GLN B OE1 
1528 N NE2 . GLN B 85  ? 1.8841 1.6346 0.7200 0.7836  0.0179  0.2092  101 GLN B NE2 
1529 N N   . PRO B 86  ? 1.6933 1.5057 0.7814 0.7671  0.0764  0.3039  102 PRO B N   
1530 C CA  . PRO B 86  ? 1.6655 1.4850 0.8129 0.7676  0.0971  0.3296  102 PRO B CA  
1531 C C   . PRO B 86  ? 1.6322 1.4734 0.8180 0.7549  0.0701  0.3250  102 PRO B C   
1532 O O   . PRO B 86  ? 1.5931 1.4160 0.8213 0.7471  0.0894  0.3264  102 PRO B O   
1533 C CB  . PRO B 86  ? 1.7124 1.5599 0.8550 0.7879  0.1050  0.3614  102 PRO B CB  
1534 C CG  . PRO B 86  ? 1.7609 1.6295 0.8460 0.7923  0.0704  0.3499  102 PRO B CG  
1535 C CD  . PRO B 86  ? 1.7550 1.5869 0.8013 0.7850  0.0724  0.3169  102 PRO B CD  
1536 N N   . HIS B 87  ? 1.6519 1.5316 0.8236 0.7509  0.0251  0.3206  103 HIS B N   
1537 C CA  . HIS B 87  ? 1.6228 1.5345 0.8387 0.7385  -0.0023 0.3228  103 HIS B CA  
1538 C C   . HIS B 87  ? 1.5751 1.4580 0.8036 0.7200  -0.0055 0.2953  103 HIS B C   
1539 O O   . HIS B 87  ? 1.5439 1.4490 0.8186 0.7111  -0.0177 0.2998  103 HIS B O   
1540 C CB  . HIS B 87  ? 1.6611 1.6190 0.8546 0.7311  -0.0562 0.3232  103 HIS B CB  
1541 C CG  . HIS B 87  ? 1.6904 1.6233 0.8166 0.7176  -0.0873 0.2866  103 HIS B CG  
1542 N ND1 . HIS B 87  ? 1.6617 1.5679 0.7826 0.6988  -0.1022 0.2551  103 HIS B ND1 
1543 C CD2 . HIS B 87  ? 1.7539 1.6796 0.8119 0.7209  -0.1048 0.2756  103 HIS B CD2 
1544 C CE1 . HIS B 87  ? 1.7076 1.5880 0.7602 0.6915  -0.1263 0.2255  103 HIS B CE1 
1545 N NE2 . HIS B 87  ? 1.7657 1.6561 0.7774 0.7048  -0.1276 0.2364  103 HIS B NE2 
1546 N N   . ASP B 88  ? 1.5712 1.4090 0.7623 0.7148  0.0055  0.2697  104 ASP B N   
1547 C CA  . ASP B 88  ? 1.5279 1.3360 0.7319 0.6977  0.0054  0.2463  104 ASP B CA  
1548 C C   . ASP B 88  ? 1.4901 1.2720 0.7401 0.6962  0.0466  0.2570  104 ASP B C   
1549 O O   . ASP B 88  ? 1.4535 1.2171 0.7247 0.6813  0.0456  0.2423  104 ASP B O   
1550 C CB  . ASP B 88  ? 1.5419 1.3129 0.6921 0.6939  0.0042  0.2182  104 ASP B CB  
1551 C CG  . ASP B 88  ? 1.5841 1.3640 0.6824 0.6883  -0.0406 0.1960  104 ASP B CG  
1552 O OD1 . ASP B 88  ? 1.5857 1.3976 0.6989 0.6766  -0.0790 0.1964  104 ASP B OD1 
1553 O OD2 . ASP B 88  ? 1.6210 1.3748 0.6642 0.6947  -0.0369 0.1788  104 ASP B OD2 
1554 N N   . ALA B 89  ? 1.5051 1.2801 0.7670 0.7096  0.0818  0.2810  105 ALA B N   
1555 C CA  . ALA B 89  ? 1.4848 1.2229 0.7794 0.7043  0.1202  0.2879  105 ALA B CA  
1556 C C   . ALA B 89  ? 1.4623 1.2160 0.8038 0.7015  0.1176  0.2936  105 ALA B C   
1557 O O   . ALA B 89  ? 1.4694 1.2726 0.8303 0.7107  0.0966  0.3084  105 ALA B O   
1558 C CB  . ALA B 89  ? 1.5176 1.2420 0.8107 0.7182  0.1556  0.3133  105 ALA B CB  
1559 N N   . GLY B 90  ? 1.4221 0.9318 0.9688 0.5349  -0.0275 0.2997  106 GLY B N   
1560 C CA  . GLY B 90  ? 1.4229 0.9299 0.9737 0.5471  -0.0302 0.2838  106 GLY B CA  
1561 C C   . GLY B 90  ? 1.3999 0.8672 0.9527 0.5225  -0.0296 0.2611  106 GLY B C   
1562 O O   . GLY B 90  ? 1.3821 0.8216 0.9425 0.4940  -0.0281 0.2610  106 GLY B O   
1563 N N   . LEU B 91  ? 1.4067 0.8765 0.9541 0.5353  -0.0309 0.2442  107 LEU B N   
1564 C CA  . LEU B 91  ? 1.4007 0.8316 0.9445 0.5165  -0.0301 0.2220  107 LEU B CA  
1565 C C   . LEU B 91  ? 1.3947 0.8541 0.9177 0.5164  -0.0376 0.2061  107 LEU B C   
1566 O O   . LEU B 91  ? 1.4087 0.9135 0.9255 0.5428  -0.0426 0.2056  107 LEU B O   
1567 C CB  . LEU B 91  ? 1.4544 0.8582 1.0017 0.5336  -0.0234 0.2141  107 LEU B CB  
1568 C CG  . LEU B 91  ? 1.4585 0.8218 0.9922 0.5180  -0.0223 0.1896  107 LEU B CG  
1569 C CD1 . LEU B 91  ? 1.4523 0.7574 0.9926 0.4817  -0.0246 0.1883  107 LEU B CD1 
1570 C CD2 . LEU B 91  ? 1.4938 0.8498 1.0192 0.5482  -0.0128 0.1789  107 LEU B CD2 
1571 N N   . TYR B 92  ? 1.4170 0.8531 0.9328 0.4867  -0.0401 0.1958  108 TYR B N   
1572 C CA  . TYR B 92  ? 1.4224 0.8732 0.9160 0.4826  -0.0489 0.1807  108 TYR B CA  
1573 C C   . TYR B 92  ? 1.4228 0.8308 0.9149 0.4601  -0.0478 0.1625  108 TYR B C   
1574 O O   . TYR B 92  ? 1.4136 0.7814 0.9193 0.4436  -0.0423 0.1619  108 TYR B O   
1575 C CB  . TYR B 92  ? 1.3793 0.8389 0.8577 0.4691  -0.0527 0.1851  108 TYR B CB  
1576 C CG  . TYR B 92  ? 1.3894 0.8836 0.8603 0.4875  -0.0532 0.2032  108 TYR B CG  
1577 C CD1 . TYR B 92  ? 1.3805 0.8653 0.8710 0.4837  -0.0427 0.2218  108 TYR B CD1 
1578 C CD2 . TYR B 92  ? 1.4113 0.9495 0.8535 0.5071  -0.0673 0.2034  108 TYR B CD2 
1579 C CE1 . TYR B 92  ? 1.3948 0.9095 0.8743 0.5011  -0.0422 0.2395  108 TYR B CE1 
1580 C CE2 . TYR B 92  ? 1.4254 0.9951 0.8544 0.5227  -0.0695 0.2199  108 TYR B CE2 
1581 C CZ  . TYR B 92  ? 1.4180 0.9739 0.8647 0.5209  -0.0549 0.2378  108 TYR B CZ  
1582 O OH  . TYR B 92  ? 1.4367 1.0222 0.8671 0.5372  -0.0560 0.2555  108 TYR B OH  
1583 N N   . GLN B 93  ? 1.4089 0.8244 0.8815 0.4580  -0.0562 0.1488  109 GLN B N   
1584 C CA  . GLN B 93  ? 1.4087 0.7881 0.8790 0.4297  -0.0557 0.1315  109 GLN B CA  
1585 C C   . GLN B 93  ? 1.4024 0.8084 0.8708 0.3977  -0.0625 0.1169  109 GLN B C   
1586 O O   . GLN B 93  ? 1.4090 0.8675 0.8751 0.3976  -0.0691 0.1125  109 GLN B O   
1587 C CB  . GLN B 93  ? 1.4313 0.8139 0.9035 0.4391  -0.0497 0.1165  109 GLN B CB  
1588 C CG  . GLN B 93  ? 1.4441 0.9063 0.9291 0.4499  -0.0503 0.1084  109 GLN B CG  
1589 C CD  . GLN B 93  ? 1.4681 0.9347 0.9553 0.4603  -0.0390 0.0954  109 GLN B CD  
1590 O OE1 . GLN B 93  ? 1.4779 0.9441 0.9615 0.4343  -0.0379 0.0782  109 GLN B OE1 
1591 N NE2 . GLN B 93  ? 1.4804 0.9504 0.9717 0.5009  -0.0286 0.1050  109 GLN B NE2 
1592 N N   . CYS B 94  ? 1.3715 0.7360 0.8387 0.3696  -0.0625 0.1108  110 CYS B N   
1593 C CA  . CYS B 94  ? 1.3682 0.7443 0.8341 0.3380  -0.0674 0.0969  110 CYS B CA  
1594 C C   . CYS B 94  ? 1.3861 0.7829 0.8553 0.3242  -0.0681 0.0770  110 CYS B C   
1595 O O   . CYS B 94  ? 1.3961 0.7691 0.8630 0.3307  -0.0629 0.0739  110 CYS B O   
1596 C CB  . CYS B 94  ? 1.4660 0.7913 0.9338 0.3172  -0.0666 0.1067  110 CYS B CB  
1597 S SG  . CYS B 94  ? 1.4363 0.7569 0.9202 0.3273  -0.0585 0.1331  110 CYS B SG  
1598 N N   . GLN B 95  ? 1.3301 0.7683 0.8013 0.3051  -0.0740 0.0641  111 GLN B N   
1599 C CA  . GLN B 95  ? 1.3428 0.8163 0.8216 0.2929  -0.0738 0.0496  111 GLN B CA  
1600 C C   . GLN B 95  ? 1.3378 0.8103 0.8156 0.2552  -0.0799 0.0392  111 GLN B C   
1601 O O   . GLN B 95  ? 1.3350 0.8089 0.8072 0.2429  -0.0870 0.0382  111 GLN B O   
1602 C CB  . GLN B 95  ? 1.3236 0.8689 0.8148 0.3097  -0.0768 0.0492  111 GLN B CB  
1603 C CG  . GLN B 95  ? 1.3337 0.8851 0.8299 0.3501  -0.0678 0.0600  111 GLN B CG  
1604 C CD  . GLN B 95  ? 1.3428 0.9751 0.8590 0.3677  -0.0708 0.0642  111 GLN B CD  
1605 O OE1 . GLN B 95  ? 1.3394 1.0202 0.8610 0.3524  -0.0853 0.0632  111 GLN B OE1 
1606 N NE2 . GLN B 95  ? 1.3584 1.0042 0.8848 0.4003  -0.0578 0.0700  111 GLN B NE2 
1607 N N   . SER B 96  ? 1.3297 0.7956 0.8088 0.2385  -0.0761 0.0315  112 SER B N   
1608 C CA  . SER B 96  ? 1.3290 0.8018 0.8102 0.2033  -0.0812 0.0234  112 SER B CA  
1609 C C   . SER B 96  ? 1.3546 0.8957 0.8500 0.1981  -0.0819 0.0165  112 SER B C   
1610 O O   . SER B 96  ? 1.3730 0.9383 0.8737 0.2150  -0.0717 0.0161  112 SER B O   
1611 C CB  . SER B 96  ? 1.3889 0.8156 0.8614 0.1867  -0.0777 0.0234  112 SER B CB  
1612 O OG  . SER B 96  ? 1.3868 0.8150 0.8617 0.1532  -0.0827 0.0198  112 SER B OG  
1613 N N   . LEU B 97  ? 1.3370 0.9083 0.8384 0.1756  -0.0935 0.0125  113 LEU B N   
1614 C CA  . LEU B 97  ? 1.3666 1.0122 0.8883 0.1681  -0.0984 0.0110  113 LEU B CA  
1615 C C   . LEU B 97  ? 1.3906 1.0493 0.9209 0.1328  -0.0985 0.0074  113 LEU B C   
1616 O O   . LEU B 97  ? 1.3623 0.9787 0.8815 0.1058  -0.1039 0.0038  113 LEU B O   
1617 C CB  . LEU B 97  ? 1.3107 0.9844 0.8311 0.1625  -0.1161 0.0098  113 LEU B CB  
1618 C CG  . LEU B 97  ? 1.3018 0.9457 0.8029 0.1901  -0.1176 0.0139  113 LEU B CG  
1619 C CD1 . LEU B 97  ? 1.3158 0.9839 0.8045 0.1804  -0.1368 0.0099  113 LEU B CD1 
1620 C CD2 . LEU B 97  ? 1.2983 0.9594 0.8092 0.2304  -0.1065 0.0246  113 LEU B CD2 
1621 N N   . HIS B 98  ? 1.4315 1.1503 0.9828 0.1356  -0.0905 0.0111  114 HIS B N   
1622 C CA  . HIS B 98  ? 1.4686 1.2186 1.0338 0.1015  -0.0907 0.0123  114 HIS B CA  
1623 C C   . HIS B 98  ? 1.5092 1.3546 1.1099 0.1052  -0.0901 0.0217  114 HIS B C   
1624 O O   . HIS B 98  ? 1.5070 1.3869 1.1180 0.1400  -0.0734 0.0277  114 HIS B O   
1625 C CB  . HIS B 98  ? 1.5774 1.2916 1.1270 0.0992  -0.0742 0.0113  114 HIS B CB  
1626 C CG  . HIS B 98  ? 1.5650 1.2732 1.1036 0.1386  -0.0550 0.0109  114 HIS B CG  
1627 N ND1 . HIS B 98  ? 1.6032 1.2409 1.1146 0.1587  -0.0521 0.0067  114 HIS B ND1 
1628 C CD2 . HIS B 98  ? 1.5068 1.2662 1.0561 0.1622  -0.0370 0.0149  114 HIS B CD2 
1629 C CE1 . HIS B 98  ? 1.5787 1.2162 1.0796 0.1914  -0.0349 0.0054  114 HIS B CE1 
1630 N NE2 . HIS B 98  ? 1.5255 1.2359 1.0477 0.1972  -0.0235 0.0098  114 HIS B NE2 
1631 N N   . GLY B 99  ? 1.4897 1.3761 1.1093 0.0700  -0.1090 0.0246  115 GLY B N   
1632 C CA  . GLY B 99  ? 1.5251 1.5116 1.1864 0.0673  -0.1130 0.0385  115 GLY B CA  
1633 C C   . GLY B 99  ? 1.4948 1.5192 1.1666 0.1076  -0.1140 0.0447  115 GLY B C   
1634 O O   . GLY B 99  ? 1.4633 1.4472 1.1117 0.1196  -0.1257 0.0375  115 GLY B O   
1635 N N   . SER B 100 ? 1.5388 1.6443 1.2470 0.1314  -0.0995 0.0608  116 SER B N   
1636 C CA  . SER B 100 ? 1.5050 1.6522 1.2283 0.1746  -0.0978 0.0712  116 SER B CA  
1637 C C   . SER B 100 ? 1.4669 1.5387 1.1553 0.2194  -0.0793 0.0625  116 SER B C   
1638 O O   . SER B 100 ? 1.4362 1.5156 1.1255 0.2514  -0.0833 0.0688  116 SER B O   
1639 C CB  . SER B 100 ? 1.4634 1.7185 1.2386 0.1930  -0.0827 0.0942  116 SER B CB  
1640 O OG  . SER B 100 ? 1.4676 1.7047 1.2336 0.2202  -0.0473 0.0929  116 SER B OG  
1641 N N   . GLU B 101 ? 1.5360 1.4581 0.9989 0.4536  0.1707  0.0315  117 GLU B N   
1642 C CA  . GLU B 101 ? 1.5435 1.3918 0.9032 0.4730  0.1441  0.0282  117 GLU B CA  
1643 C C   . GLU B 101 ? 1.6021 1.4151 0.9905 0.4691  0.0695  0.0555  117 GLU B C   
1644 O O   . GLU B 101 ? 1.6785 1.5032 1.1386 0.4442  0.0309  0.0850  117 GLU B O   
1645 C CB  . GLU B 101 ? 1.8593 1.6118 1.0478 0.4391  0.1620  0.0427  117 GLU B CB  
1646 C CG  . GLU B 101 ? 1.8033 1.5936 0.9536 0.4497  0.2395  0.0043  117 GLU B CG  
1647 C CD  . GLU B 101 ? 1.9914 1.6902 0.9688 0.4149  0.2606  0.0173  117 GLU B CD  
1648 O OE1 . GLU B 101 ? 2.1634 1.7682 1.0521 0.3772  0.2141  0.0616  117 GLU B OE1 
1649 O OE2 . GLU B 101 ? 1.9863 1.7103 0.9166 0.4275  0.3224  -0.0205 117 GLU B OE2 
1650 N N   . ALA B 102 ? 1.5959 1.3638 0.9257 0.4934  0.0506  0.0422  118 ALA B N   
1651 C CA  . ALA B 102 ? 1.6211 1.3532 0.9640 0.4876  -0.0130 0.0594  118 ALA B CA  
1652 C C   . ALA B 102 ? 1.6492 1.2765 0.8455 0.4755  -0.0286 0.0619  118 ALA B C   
1653 O O   . ALA B 102 ? 1.6230 1.2225 0.7380 0.4996  0.0089  0.0349  118 ALA B O   
1654 C CB  . ALA B 102 ? 1.3840 1.1832 0.8357 0.5339  -0.0190 0.0332  118 ALA B CB  
1655 N N   . ASP B 103 ? 1.6116 1.1822 0.7764 0.4398  -0.0863 0.0904  119 ASP B N   
1656 C CA  . ASP B 103 ? 1.6665 1.1427 0.7092 0.4254  -0.1116 0.0901  119 ASP B CA  
1657 C C   . ASP B 103 ? 1.5857 1.0671 0.6872 0.4327  -0.1532 0.0813  119 ASP B C   
1658 O O   . ASP B 103 ? 1.4840 1.0337 0.7124 0.4374  -0.1770 0.0855  119 ASP B O   
1659 C CB  . ASP B 103 ? 1.8150 1.2201 0.7681 0.3794  -0.1480 0.1231  119 ASP B CB  
1660 C CG  . ASP B 103 ? 1.9086 1.2980 0.7852 0.3657  -0.1006 0.1337  119 ASP B CG  
1661 O OD1 . ASP B 103 ? 1.8955 1.3320 0.7870 0.3921  -0.0379 0.1084  119 ASP B OD1 
1662 O OD2 . ASP B 103 ? 1.9934 1.3229 0.7918 0.3291  -0.1255 0.1650  119 ASP B OD2 
1663 N N   . THR B 104 ? 1.6426 1.0514 0.6510 0.4318  -0.1593 0.0666  120 THR B N   
1664 C CA  . THR B 104 ? 1.5945 1.0019 0.6449 0.4382  -0.1825 0.0523  120 THR B CA  
1665 C C   . THR B 104 ? 1.6258 0.9935 0.6639 0.3947  -0.2455 0.0643  120 THR B C   
1666 O O   . THR B 104 ? 1.7375 1.0262 0.6616 0.3703  -0.2617 0.0675  120 THR B O   
1667 C CB  . THR B 104 ? 1.6560 1.0042 0.6163 0.4657  -0.1470 0.0242  120 THR B CB  
1668 O OG1 . THR B 104 ? 1.6137 1.0129 0.6066 0.5145  -0.0957 0.0061  120 THR B OG1 
1669 C CG2 . THR B 104 ? 1.6330 0.9598 0.6163 0.4611  -0.1698 0.0134  120 THR B CG2 
1670 N N   . LEU B 105 ? 1.5293 0.9569 0.6873 0.3871  -0.2819 0.0665  121 LEU B N   
1671 C CA  . LEU B 105 ? 1.5454 0.9561 0.7175 0.3490  -0.3452 0.0701  121 LEU B CA  
1672 C C   . LEU B 105 ? 1.5633 0.9395 0.7161 0.3380  -0.3502 0.0453  121 LEU B C   
1673 O O   . LEU B 105 ? 1.6333 0.9587 0.7359 0.3043  -0.3893 0.0387  121 LEU B O   
1674 C CB  . LEU B 105 ? 1.4360 0.9358 0.7544 0.3455  -0.3843 0.0808  121 LEU B CB  
1675 C CG  . LEU B 105 ? 1.4292 0.9529 0.7693 0.3483  -0.3867 0.1078  121 LEU B CG  
1676 C CD1 . LEU B 105 ? 1.2963 0.9221 0.7936 0.3661  -0.3925 0.1096  121 LEU B CD1 
1677 C CD2 . LEU B 105 ? 1.5177 0.9865 0.7982 0.3159  -0.4443 0.1271  121 LEU B CD2 
1678 N N   . ARG B 106 ? 1.5281 0.9289 0.7186 0.3654  -0.3118 0.0305  122 ARG B N   
1679 C CA  . ARG B 106 ? 1.5728 0.9306 0.7360 0.3552  -0.3053 0.0091  122 ARG B CA  
1680 C C   . ARG B 106 ? 1.5472 0.9113 0.7116 0.4009  -0.2516 -0.0010 122 ARG B C   
1681 O O   . ARG B 106 ? 1.4490 0.8874 0.6902 0.4357  -0.2327 0.0043  122 ARG B O   
1682 C CB  . ARG B 106 ? 1.4718 0.8831 0.7410 0.3227  -0.3483 0.0010  122 ARG B CB  
1683 C CG  . ARG B 106 ? 1.5433 0.8979 0.7709 0.2959  -0.3431 -0.0217 122 ARG B CG  
1684 C CD  . ARG B 106 ? 1.5151 0.9380 0.8588 0.2609  -0.3802 -0.0356 122 ARG B CD  
1685 N NE  . ARG B 106 ? 1.6662 1.0263 0.9588 0.2164  -0.3876 -0.0591 122 ARG B NE  
1686 C CZ  . ARG B 106 ? 1.6909 1.0993 1.0695 0.1794  -0.4071 -0.0804 122 ARG B CZ  
1687 N NH1 . ARG B 106 ? 1.5502 1.0706 1.0682 0.1859  -0.4232 -0.0813 122 ARG B NH1 
1688 N NH2 . ARG B 106 ? 1.8376 1.1847 1.1656 0.1344  -0.4090 -0.1044 122 ARG B NH2 
1689 N N   . LYS B 107 ? 1.6243 0.9058 0.7009 0.4018  -0.2297 -0.0171 123 LYS B N   
1690 C CA  . LYS B 107 ? 1.6059 0.8807 0.6798 0.4436  -0.1885 -0.0281 123 LYS B CA  
1691 C C   . LYS B 107 ? 1.6731 0.9029 0.7373 0.4136  -0.1927 -0.0393 123 LYS B C   
1692 O O   . LYS B 107 ? 1.7827 0.9378 0.7773 0.3708  -0.2090 -0.0469 123 LYS B O   
1693 C CB  . LYS B 107 ? 1.7650 0.9670 0.7207 0.4865  -0.1479 -0.0382 123 LYS B CB  
1694 C CG  . LYS B 107 ? 1.8594 0.9549 0.6813 0.4612  -0.1534 -0.0445 123 LYS B CG  
1695 C CD  . LYS B 107 ? 1.9058 0.9278 0.6147 0.5097  -0.1121 -0.0618 123 LYS B CD  
1696 C CE  . LYS B 107 ? 1.8497 0.9478 0.5979 0.5593  -0.0838 -0.0632 123 LYS B CE  
1697 N NZ  . LYS B 107 ? 1.9321 0.9808 0.6018 0.5925  -0.0506 -0.0784 123 LYS B NZ  
1698 N N   . VAL B 108 ? 1.6686 0.9454 0.8031 0.4337  -0.1770 -0.0420 124 VAL B N   
1699 C CA  . VAL B 108 ? 1.7362 0.9835 0.8743 0.4014  -0.1750 -0.0513 124 VAL B CA  
1700 C C   . VAL B 108 ? 1.6921 0.8993 0.7860 0.4485  -0.1328 -0.0553 124 VAL B C   
1701 O O   . VAL B 108 ? 1.5375 0.7888 0.6558 0.5079  -0.1147 -0.0535 124 VAL B O   
1702 C CB  . VAL B 108 ? 1.6441 1.0033 0.9291 0.3667  -0.2073 -0.0517 124 VAL B CB  
1703 C CG1 . VAL B 108 ? 1.6848 1.0657 0.9986 0.3205  -0.2563 -0.0515 124 VAL B CG1 
1704 C CG2 . VAL B 108 ? 1.4258 0.8982 0.8243 0.4126  -0.2038 -0.0440 124 VAL B CG2 
1705 N N   . LEU B 109 ? 1.7842 0.9040 0.8103 0.4211  -0.1181 -0.0626 125 LEU B N   
1706 C CA  . LEU B 109 ? 1.7211 0.7945 0.7037 0.4563  -0.0830 -0.0640 125 LEU B CA  
1707 C C   . LEU B 109 ? 1.6934 0.8474 0.7833 0.4261  -0.0861 -0.0644 125 LEU B C   
1708 O O   . LEU B 109 ? 1.7954 0.9879 0.9479 0.3622  -0.1094 -0.0702 125 LEU B O   
1709 C CB  . LEU B 109 ? 1.9032 0.8112 0.7277 0.4412  -0.0613 -0.0701 125 LEU B CB  
1710 C CG  . LEU B 109 ? 1.9794 0.7828 0.6716 0.4853  -0.0488 -0.0755 125 LEU B CG  
1711 C CD1 . LEU B 109 ? 2.1460 0.7821 0.6915 0.4638  -0.0306 -0.0821 125 LEU B CD1 
1712 C CD2 . LEU B 109 ? 1.9123 0.7923 0.6386 0.5505  -0.0337 -0.0634 125 LEU B CD2 
1713 N N   . VAL B 110 ? 1.7283 0.9151 0.8436 0.4743  -0.0645 -0.0621 126 VAL B N   
1714 C CA  . VAL B 110 ? 1.7036 0.9483 0.8946 0.4495  -0.0581 -0.0645 126 VAL B CA  
1715 C C   . VAL B 110 ? 1.7957 0.9188 0.8625 0.4647  -0.0184 -0.0625 126 VAL B C   
1716 O O   . VAL B 110 ? 1.8283 0.8817 0.8036 0.5315  -0.0004 -0.0594 126 VAL B O   
1717 C CB  . VAL B 110 ? 1.5380 0.9361 0.8762 0.4888  -0.0710 -0.0645 126 VAL B CB  
1718 C CG1 . VAL B 110 ? 1.4541 0.9575 0.9092 0.4641  -0.1126 -0.0645 126 VAL B CG1 
1719 C CG2 . VAL B 110 ? 1.5007 0.9170 0.8178 0.5538  -0.0544 -0.0599 126 VAL B CG2 
1720 N N   . GLU B 111 ? 1.9009 0.9954 0.9613 0.4016  -0.0051 -0.0661 127 GLU B N   
1721 C CA  . GLU B 111 ? 1.9891 0.9674 0.9350 0.4009  0.0347  -0.0613 127 GLU B CA  
1722 C C   . GLU B 111 ? 1.9626 1.0382 1.0047 0.3827  0.0466  -0.0644 127 GLU B C   
1723 O O   . GLU B 111 ? 1.9253 1.1476 1.1217 0.3534  0.0220  -0.0750 127 GLU B O   
1724 C CB  . GLU B 111 ? 2.2110 1.0467 1.0423 0.3306  0.0491  -0.0647 127 GLU B CB  
1725 C CG  . GLU B 111 ? 2.2412 0.9945 0.9917 0.3375  0.0324  -0.0668 127 GLU B CG  
1726 C CD  . GLU B 111 ? 2.4089 0.9933 1.0193 0.2823  0.0517  -0.0709 127 GLU B CD  
1727 O OE1 . GLU B 111 ? 2.4536 0.9382 0.9635 0.2980  0.0448  -0.0734 127 GLU B OE1 
1728 O OE2 . GLU B 111 ? 2.5155 1.0661 1.1155 0.2219  0.0759  -0.0736 127 GLU B OE2 
1729 N N   . VAL B 112 ? 1.9702 0.9587 0.9141 0.4031  0.0834  -0.0562 128 VAL B N   
1730 C CA  . VAL B 112 ? 1.9394 1.0083 0.9517 0.3960  0.1010  -0.0587 128 VAL B CA  
1731 C C   . VAL B 112 ? 2.1259 1.0487 0.9966 0.3558  0.1479  -0.0507 128 VAL B C   
1732 O O   . VAL B 112 ? 2.2386 0.9880 0.9394 0.3770  0.1664  -0.0379 128 VAL B O   
1733 C CB  . VAL B 112 ? 1.8833 1.0267 0.9358 0.4929  0.0942  -0.0554 128 VAL B CB  
1734 C CG1 . VAL B 112 ? 1.8490 1.0704 0.9618 0.4896  0.1122  -0.0594 128 VAL B CG1 
1735 C CG2 . VAL B 112 ? 1.7126 0.9949 0.9039 0.5257  0.0527  -0.0629 128 VAL B CG2 
1736 N N   . LEU B 113 ? 2.0750 1.0650 1.0130 0.2970  0.1683  -0.0596 129 LEU B N   
1737 C CA  . LEU B 113 ? 2.2332 1.1033 1.0445 0.2670  0.2198  -0.0498 129 LEU B CA  
1738 C C   . LEU B 113 ? 2.1499 1.1371 1.0413 0.2944  0.2318  -0.0531 129 LEU B C   
1739 O O   . LEU B 113 ? 2.0683 1.2399 1.1409 0.2815  0.2079  -0.0727 129 LEU B O   
1740 C CB  . LEU B 113 ? 2.2552 1.0708 1.0471 0.1507  0.2450  -0.0617 129 LEU B CB  
1741 C CG  . LEU B 113 ? 2.4673 1.1569 1.1337 0.0910  0.3060  -0.0540 129 LEU B CG  
1742 C CD1 . LEU B 113 ? 2.5251 1.3348 1.2806 0.0633  0.3342  -0.0646 129 LEU B CD1 
1743 C CD2 . LEU B 113 ? 2.5466 1.0151 0.9861 0.1494  0.3301  -0.0231 129 LEU B CD2 
1744 N N   . ALA B 114 ? 2.2518 1.1262 1.0020 0.3356  0.2661  -0.0350 130 ALA B N   
1745 C CA  . ALA B 114 ? 2.1711 1.1412 0.9726 0.3806  0.2753  -0.0370 130 ALA B CA  
1746 C C   . ALA B 114 ? 2.2316 1.3394 1.1651 0.3014  0.2937  -0.0579 130 ALA B C   
1747 O O   . ALA B 114 ? 2.4337 1.5024 1.3506 0.2038  0.3229  -0.0656 130 ALA B O   
1748 C CB  . ALA B 114 ? 2.2602 1.0553 0.8570 0.4272  0.3117  -0.0130 130 ALA B CB  
1749 N N   . ASP B 115 ? 2.0006 1.2723 1.0669 0.3459  0.2769  -0.0714 131 ASP B N   
1750 C CA  . ASP B 115 ? 2.0356 1.4556 1.2351 0.2893  0.2919  -0.0961 131 ASP B CA  
1751 C C   . ASP B 115 ? 2.2522 1.5643 1.3178 0.2335  0.3580  -0.0880 131 ASP B C   
1752 O O   . ASP B 115 ? 2.3494 1.4679 1.2117 0.2546  0.3885  -0.0590 131 ASP B O   
1753 C CB  . ASP B 115 ? 1.8442 1.4316 1.1791 0.3666  0.2620  -0.1093 131 ASP B CB  
1754 C CG  . ASP B 115 ? 1.8147 1.5949 1.3385 0.3142  0.2574  -0.1439 131 ASP B CG  
1755 O OD1 . ASP B 115 ? 1.6221 1.5098 1.2159 0.3594  0.2557  -0.1557 131 ASP B OD1 
1756 O OD2 . ASP B 115 ? 1.9583 1.7859 1.5636 0.2310  0.2526  -0.1632 131 ASP B OD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   17  ?   ?   ?   A . n 
A 1 2   GLY 2   18  ?   ?   ?   A . n 
A 1 3   HIS 3   19  ?   ?   ?   A . n 
A 1 4   ASN 4   20  20  ASN ASN A . n 
A 1 5   THR 5   21  21  THR THR A . n 
A 1 6   THR 6   22  22  THR THR A . n 
A 1 7   VAL 7   23  23  VAL VAL A . n 
A 1 8   PHE 8   24  24  PHE PHE A . n 
A 1 9   GLN 9   25  25  GLN GLN A . n 
A 1 10  GLY 10  26  26  GLY GLY A . n 
A 1 11  VAL 11  27  27  VAL VAL A . n 
A 1 12  ALA 12  28  28  ALA ALA A . n 
A 1 13  GLY 13  29  29  GLY GLY A . n 
A 1 14  GLN 14  30  30  GLN GLN A . n 
A 1 15  SER 15  31  31  SER SER A . n 
A 1 16  LEU 16  32  32  LEU LEU A . n 
A 1 17  GLN 17  33  33  GLN GLN A . n 
A 1 18  VAL 18  34  34  VAL VAL A . n 
A 1 19  SER 19  35  35  SER SER A . n 
A 1 20  CYS 20  36  36  CYS CYS A . n 
A 1 21  PRO 21  37  37  PRO PRO A . n 
A 1 22  TYR 22  38  38  TYR TYR A . n 
A 1 23  ASP 23  39  39  ASP ASP A . n 
A 1 24  SER 24  40  40  SER SER A . n 
A 1 25  MET 25  41  41  MET MET A . n 
A 1 26  LYS 26  42  42  LYS LYS A . n 
A 1 27  HIS 27  43  43  HIS HIS A . n 
A 1 28  TRP 28  44  44  TRP TRP A . n 
A 1 29  GLY 29  45  45  GLY GLY A . n 
A 1 30  ARG 30  46  46  ARG ARG A . n 
A 1 31  ARG 31  47  47  ARG ARG A . n 
A 1 32  LYS 32  48  48  LYS LYS A . n 
A 1 33  ALA 33  49  49  ALA ALA A . n 
A 1 34  TRP 34  50  50  TRP TRP A . n 
A 1 35  CYS 35  51  51  CYS CYS A . n 
A 1 36  ARG 36  52  52  ARG ARG A . n 
A 1 37  GLN 37  53  53  GLN GLN A . n 
A 1 38  LEU 38  54  54  LEU LEU A . n 
A 1 39  GLY 39  55  55  GLY GLY A . n 
A 1 40  GLU 40  56  56  GLU GLU A . n 
A 1 41  LYS 41  57  57  LYS LYS A . n 
A 1 42  GLY 42  58  58  GLY GLY A . n 
A 1 43  PRO 43  59  59  PRO PRO A . n 
A 1 44  CYS 44  60  60  CYS CYS A . n 
A 1 45  GLN 45  61  61  GLN GLN A . n 
A 1 46  ARG 46  62  62  ARG ARG A . n 
A 1 47  VAL 47  63  63  VAL VAL A . n 
A 1 48  VAL 48  64  64  VAL VAL A . n 
A 1 49  SER 49  65  65  SER SER A . n 
A 1 50  THR 50  66  66  THR THR A . n 
A 1 51  HIS 51  67  67  HIS HIS A . n 
A 1 52  ASN 52  68  68  ASN ASN A . n 
A 1 53  LEU 53  69  69  LEU LEU A . n 
A 1 54  TRP 54  70  70  TRP TRP A . n 
A 1 55  LEU 55  71  71  LEU LEU A . n 
A 1 56  LEU 56  72  72  LEU LEU A . n 
A 1 57  SER 57  73  73  SER SER A . n 
A 1 58  PHE 58  74  74  PHE PHE A . n 
A 1 59  LEU 59  75  75  LEU LEU A . n 
A 1 60  ARG 60  76  76  ARG ARG A . n 
A 1 61  ARG 61  77  77  ARG ARG A . n 
A 1 62  TRP 62  78  78  TRP TRP A . n 
A 1 63  ASN 63  79  79  ASN ASN A . n 
A 1 64  GLY 64  80  80  GLY GLY A . n 
A 1 65  SER 65  81  81  SER SER A . n 
A 1 66  THR 66  82  82  THR THR A . n 
A 1 67  ALA 67  83  83  ALA ALA A . n 
A 1 68  ILE 68  84  84  ILE ILE A . n 
A 1 69  THR 69  85  85  THR THR A . n 
A 1 70  ASP 70  86  86  ASP ASP A . n 
A 1 71  ASP 71  87  87  ASP ASP A . n 
A 1 72  THR 72  88  88  THR THR A . n 
A 1 73  LEU 73  89  89  LEU LEU A . n 
A 1 74  GLY 74  90  90  GLY GLY A . n 
A 1 75  GLY 75  91  91  GLY GLY A . n 
A 1 76  THR 76  92  92  THR THR A . n 
A 1 77  LEU 77  93  93  LEU LEU A . n 
A 1 78  THR 78  94  94  THR THR A . n 
A 1 79  ILE 79  95  95  ILE ILE A . n 
A 1 80  THR 80  96  96  THR THR A . n 
A 1 81  LEU 81  97  97  LEU LEU A . n 
A 1 82  ARG 82  98  98  ARG ARG A . n 
A 1 83  ASN 83  99  99  ASN ASN A . n 
A 1 84  LEU 84  100 100 LEU LEU A . n 
A 1 85  GLN 85  101 101 GLN GLN A . n 
A 1 86  PRO 86  102 102 PRO PRO A . n 
A 1 87  HIS 87  103 103 HIS HIS A . n 
A 1 88  ASP 88  104 104 ASP ASP A . n 
A 1 89  ALA 89  105 105 ALA ALA A . n 
A 1 90  GLY 90  106 106 GLY GLY A . n 
A 1 91  LEU 91  107 107 LEU LEU A . n 
A 1 92  TYR 92  108 108 TYR TYR A . n 
A 1 93  GLN 93  109 109 GLN GLN A . n 
A 1 94  CYS 94  110 110 CYS CYS A . n 
A 1 95  GLN 95  111 111 GLN GLN A . n 
A 1 96  SER 96  112 112 SER SER A . n 
A 1 97  LEU 97  113 113 LEU LEU A . n 
A 1 98  HIS 98  114 114 HIS HIS A . n 
A 1 99  GLY 99  115 115 GLY GLY A . n 
A 1 100 SER 100 116 116 SER SER A . n 
A 1 101 GLU 101 117 117 GLU GLU A . n 
A 1 102 ALA 102 118 118 ALA ALA A . n 
A 1 103 ASP 103 119 119 ASP ASP A . n 
A 1 104 THR 104 120 120 THR THR A . n 
A 1 105 LEU 105 121 121 LEU LEU A . n 
A 1 106 ARG 106 122 122 ARG ARG A . n 
A 1 107 LYS 107 123 123 LYS LYS A . n 
A 1 108 VAL 108 124 124 VAL VAL A . n 
A 1 109 LEU 109 125 125 LEU LEU A . n 
A 1 110 VAL 110 126 126 VAL VAL A . n 
A 1 111 GLU 111 127 127 GLU GLU A . n 
A 1 112 VAL 112 128 128 VAL VAL A . n 
A 1 113 LEU 113 129 129 LEU LEU A . n 
A 1 114 ALA 114 130 130 ALA ALA A . n 
A 1 115 ASP 115 131 131 ASP ASP A . n 
A 1 116 PRO 116 132 ?   ?   ?   A . n 
A 1 117 LEU 117 133 ?   ?   ?   A . n 
A 1 118 GLY 118 134 ?   ?   ?   A . n 
A 1 119 THR 119 135 ?   ?   ?   A . n 
A 1 120 LYS 120 136 ?   ?   ?   A . n 
A 1 121 HIS 121 137 ?   ?   ?   A . n 
A 1 122 HIS 122 138 ?   ?   ?   A . n 
A 1 123 HIS 123 139 ?   ?   ?   A . n 
A 1 124 HIS 124 140 ?   ?   ?   A . n 
A 1 125 HIS 125 141 ?   ?   ?   A . n 
A 1 126 HIS 126 142 ?   ?   ?   A . n 
B 1 1   THR 1   17  ?   ?   ?   B . n 
B 1 2   GLY 2   18  ?   ?   ?   B . n 
B 1 3   HIS 3   19  ?   ?   ?   B . n 
B 1 4   ASN 4   20  20  ASN ASN B . n 
B 1 5   THR 5   21  21  THR THR B . n 
B 1 6   THR 6   22  22  THR THR B . n 
B 1 7   VAL 7   23  23  VAL VAL B . n 
B 1 8   PHE 8   24  24  PHE PHE B . n 
B 1 9   GLN 9   25  25  GLN GLN B . n 
B 1 10  GLY 10  26  26  GLY GLY B . n 
B 1 11  VAL 11  27  27  VAL VAL B . n 
B 1 12  ALA 12  28  28  ALA ALA B . n 
B 1 13  GLY 13  29  29  GLY GLY B . n 
B 1 14  GLN 14  30  30  GLN GLN B . n 
B 1 15  SER 15  31  31  SER SER B . n 
B 1 16  LEU 16  32  32  LEU LEU B . n 
B 1 17  GLN 17  33  33  GLN GLN B . n 
B 1 18  VAL 18  34  34  VAL VAL B . n 
B 1 19  SER 19  35  35  SER SER B . n 
B 1 20  CYS 20  36  36  CYS CYS B . n 
B 1 21  PRO 21  37  37  PRO PRO B . n 
B 1 22  TYR 22  38  38  TYR TYR B . n 
B 1 23  ASP 23  39  39  ASP ASP B . n 
B 1 24  SER 24  40  40  SER SER B . n 
B 1 25  MET 25  41  41  MET MET B . n 
B 1 26  LYS 26  42  42  LYS LYS B . n 
B 1 27  HIS 27  43  43  HIS HIS B . n 
B 1 28  TRP 28  44  44  TRP TRP B . n 
B 1 29  GLY 29  45  45  GLY GLY B . n 
B 1 30  ARG 30  46  46  ARG ARG B . n 
B 1 31  ARG 31  47  47  ARG ARG B . n 
B 1 32  LYS 32  48  48  LYS LYS B . n 
B 1 33  ALA 33  49  49  ALA ALA B . n 
B 1 34  TRP 34  50  50  TRP TRP B . n 
B 1 35  CYS 35  51  51  CYS CYS B . n 
B 1 36  ARG 36  52  52  ARG ARG B . n 
B 1 37  GLN 37  53  53  GLN GLN B . n 
B 1 38  LEU 38  54  54  LEU LEU B . n 
B 1 39  GLY 39  55  55  GLY GLY B . n 
B 1 40  GLU 40  56  56  GLU GLU B . n 
B 1 41  LYS 41  57  57  LYS LYS B . n 
B 1 42  GLY 42  58  58  GLY GLY B . n 
B 1 43  PRO 43  59  59  PRO PRO B . n 
B 1 44  CYS 44  60  60  CYS CYS B . n 
B 1 45  GLN 45  61  61  GLN GLN B . n 
B 1 46  ARG 46  62  62  ARG ARG B . n 
B 1 47  VAL 47  63  63  VAL VAL B . n 
B 1 48  VAL 48  64  64  VAL VAL B . n 
B 1 49  SER 49  65  65  SER SER B . n 
B 1 50  THR 50  66  66  THR THR B . n 
B 1 51  HIS 51  67  67  HIS HIS B . n 
B 1 52  ASN 52  68  68  ASN ASN B . n 
B 1 53  LEU 53  69  69  LEU LEU B . n 
B 1 54  TRP 54  70  70  TRP TRP B . n 
B 1 55  LEU 55  71  71  LEU LEU B . n 
B 1 56  LEU 56  72  72  LEU LEU B . n 
B 1 57  SER 57  73  73  SER SER B . n 
B 1 58  PHE 58  74  74  PHE PHE B . n 
B 1 59  LEU 59  75  75  LEU LEU B . n 
B 1 60  ARG 60  76  76  ARG ARG B . n 
B 1 61  ARG 61  77  77  ARG ARG B . n 
B 1 62  TRP 62  78  78  TRP TRP B . n 
B 1 63  ASN 63  79  79  ASN ASN B . n 
B 1 64  GLY 64  80  80  GLY GLY B . n 
B 1 65  SER 65  81  81  SER SER B . n 
B 1 66  THR 66  82  82  THR THR B . n 
B 1 67  ALA 67  83  83  ALA ALA B . n 
B 1 68  ILE 68  84  84  ILE ILE B . n 
B 1 69  THR 69  85  85  THR THR B . n 
B 1 70  ASP 70  86  86  ASP ASP B . n 
B 1 71  ASP 71  87  87  ASP ASP B . n 
B 1 72  THR 72  88  88  THR THR B . n 
B 1 73  LEU 73  89  89  LEU LEU B . n 
B 1 74  GLY 74  90  90  GLY GLY B . n 
B 1 75  GLY 75  91  91  GLY GLY B . n 
B 1 76  THR 76  92  92  THR THR B . n 
B 1 77  LEU 77  93  93  LEU LEU B . n 
B 1 78  THR 78  94  94  THR THR B . n 
B 1 79  ILE 79  95  95  ILE ILE B . n 
B 1 80  THR 80  96  96  THR THR B . n 
B 1 81  LEU 81  97  97  LEU LEU B . n 
B 1 82  ARG 82  98  98  ARG ARG B . n 
B 1 83  ASN 83  99  99  ASN ASN B . n 
B 1 84  LEU 84  100 100 LEU LEU B . n 
B 1 85  GLN 85  101 101 GLN GLN B . n 
B 1 86  PRO 86  102 102 PRO PRO B . n 
B 1 87  HIS 87  103 103 HIS HIS B . n 
B 1 88  ASP 88  104 104 ASP ASP B . n 
B 1 89  ALA 89  105 105 ALA ALA B . n 
B 1 90  GLY 90  106 106 GLY GLY B . n 
B 1 91  LEU 91  107 107 LEU LEU B . n 
B 1 92  TYR 92  108 108 TYR TYR B . n 
B 1 93  GLN 93  109 109 GLN GLN B . n 
B 1 94  CYS 94  110 110 CYS CYS B . n 
B 1 95  GLN 95  111 111 GLN GLN B . n 
B 1 96  SER 96  112 112 SER SER B . n 
B 1 97  LEU 97  113 113 LEU LEU B . n 
B 1 98  HIS 98  114 114 HIS HIS B . n 
B 1 99  GLY 99  115 115 GLY GLY B . n 
B 1 100 SER 100 116 116 SER SER B . n 
B 1 101 GLU 101 117 117 GLU GLU B . n 
B 1 102 ALA 102 118 118 ALA ALA B . n 
B 1 103 ASP 103 119 119 ASP ASP B . n 
B 1 104 THR 104 120 120 THR THR B . n 
B 1 105 LEU 105 121 121 LEU LEU B . n 
B 1 106 ARG 106 122 122 ARG ARG B . n 
B 1 107 LYS 107 123 123 LYS LYS B . n 
B 1 108 VAL 108 124 124 VAL VAL B . n 
B 1 109 LEU 109 125 125 LEU LEU B . n 
B 1 110 VAL 110 126 126 VAL VAL B . n 
B 1 111 GLU 111 127 127 GLU GLU B . n 
B 1 112 VAL 112 128 128 VAL VAL B . n 
B 1 113 LEU 113 129 129 LEU LEU B . n 
B 1 114 ALA 114 130 130 ALA ALA B . n 
B 1 115 ASP 115 131 131 ASP ASP B . n 
B 1 116 PRO 116 132 ?   ?   ?   B . n 
B 1 117 LEU 117 133 ?   ?   ?   B . n 
B 1 118 GLY 118 134 ?   ?   ?   B . n 
B 1 119 THR 119 135 ?   ?   ?   B . n 
B 1 120 LYS 120 136 ?   ?   ?   B . n 
B 1 121 HIS 121 137 ?   ?   ?   B . n 
B 1 122 HIS 122 138 ?   ?   ?   B . n 
B 1 123 HIS 123 139 ?   ?   ?   B . n 
B 1 124 HIS 124 140 ?   ?   ?   B . n 
B 1 125 HIS 125 141 ?   ?   ?   B . n 
B 1 126 HIS 126 142 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1 201 1061 NAG NAG A . 
D 2 NAG 1 201 1061 NAG NAG B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-12-28 
2 'Structure model' 1 1 2017-01-04 
3 'Structure model' 1 2 2017-09-06 
4 'Structure model' 1 3 2017-11-01 
5 'Structure model' 1 4 2019-12-04 
6 'Structure model' 1 5 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 6 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Author supporting evidence' 
3 4 'Structure model' 'Author supporting evidence' 
4 5 'Structure model' 'Author supporting evidence' 
5 6 'Structure model' 'Data collection'            
6 6 'Structure model' 'Derived calculations'       
7 6 'Structure model' 'Structure summary'          
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' pdbx_audit_support                 
2  4 'Structure model' pdbx_struct_assembly_auth_evidence 
3  5 'Structure model' pdbx_audit_support                 
4  6 'Structure model' chem_comp                          
5  6 'Structure model' entity                             
6  6 'Structure model' pdbx_chem_comp_identifier          
7  6 'Structure model' pdbx_entity_nonpoly                
8  6 'Structure model' struct_conn                        
9  6 'Structure model' struct_site                        
10 6 'Structure model' struct_site_gen                    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_pdbx_audit_support.funding_organization' 
2 5 'Structure model' '_pdbx_audit_support.funding_organization' 
3 6 'Structure model' '_chem_comp.name'                          
4 6 'Structure model' '_chem_comp.type'                          
5 6 'Structure model' '_entity.pdbx_description'                 
6 6 'Structure model' '_pdbx_entity_nonpoly.name'                
7 6 'Structure model' '_struct_conn.pdbx_role'                   
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1  'X-RAY DIFFRACTION' ? refined -42.6273 14.2105 -20.4624 0.9475 ? 0.0583  ? 0.2537  ? 1.1375 ? 0.1169  ? 0.8778 ? 4.3476 ? 
3.0378  ? 4.8163  ? 4.6598 ? -0.3680 ? 2.0694 ? -0.0629 ? 0.9989  ? -0.1030 ? -0.9728 ? 0.3946  ? -1.3782 ? -0.9190 ? 1.7022  ? 
-0.3540 ? 
2  'X-RAY DIFFRACTION' ? refined -51.5995 17.4805 -6.1158  1.1101 ? -0.1561 ? 0.0317  ? 0.5007 ? 0.0190  ? 0.7011 ? 9.1589 ? 
-1.0820 ? 1.8383  ? 6.9655 ? -0.7374 ? 9.4532 ? 0.6773  ? -0.1467 ? 0.9355  ? -0.5209 ? -0.2297 ? -0.3936 ? -1.3944 ? 0.8116  ? 
0.1806  ? 
3  'X-RAY DIFFRACTION' ? refined -49.5151 32.9817 -19.1605 1.4628 ? -0.1027 ? 0.4137  ? 1.5922 ? 0.4727  ? 2.0853 ? 2.0012 ? 
-2.7144 ? 4.1481  ? 1.0513 ? -0.1725 ? 8.7695 ? -1.0800 ? 2.0790  ? 2.7319  ? -0.4493 ? -0.4643 ? -0.7516 ? 1.9879  ? 2.1828  ? 
1.7426  ? 
4  'X-RAY DIFFRACTION' ? refined -59.1279 13.0733 -9.9706  1.1544 ? 0.0660  ? 0.0703  ? 0.4888 ? 0.0950  ? 0.6706 ? 5.5521 ? 
2.8751  ? -1.7984 ? 5.4004 ? -0.2943 ? 2.0878 ? 0.2135  ? 0.3495  ? 1.1171  ? 0.3103  ? -0.1456 ? 0.4974  ? -1.4646 ? -0.5418 ? 
0.0261  ? 
5  'X-RAY DIFFRACTION' ? refined -53.2169 10.6045 -13.8902 0.9516 ? 0.0566  ? 0.0927  ? 0.5089 ? 0.1102  ? 0.4984 ? 5.7904 ? 
2.0204  ? -0.9887 ? 5.4382 ? 3.4519  ? 3.4202 ? 0.1777  ? 0.3889  ? 0.2857  ? -0.5002 ? -0.6018 ? -0.4902 ? -0.2119 ? 0.2039  ? 
0.0981  ? 
6  'X-RAY DIFFRACTION' ? refined -51.3878 19.4832 -19.2155 1.5716 ? -0.0258 ? 0.2307  ? 0.9417 ? 0.2336  ? 0.8093 ? 4.0961 ? 
1.9028  ? 0.4362  ? 2.9472 ? 1.0793  ? 2.8212 ? 0.4302  ? 0.6106  ? 0.8909  ? -1.7999 ? 0.1477  ? 0.1832  ? -1.6838 ? 0.7318  ? 
-0.5620 ? 
7  'X-RAY DIFFRACTION' ? refined -44.9775 20.1225 -18.3546 1.0755 ? -0.2227 ? 0.2094  ? 1.2122 ? 0.1849  ? 0.7196 ? 3.1638 ? 
2.2551  ? 3.3702  ? 8.0654 ? 2.4243  ? 3.4942 ? 0.7788  ? 0.8693  ? 0.7364  ? -0.6447 ? 0.3578  ? -1.1224 ? -1.5866 ? 0.8421  ? 
-0.9612 ? 
8  'X-RAY DIFFRACTION' ? refined -67.6226 27.0636 -25.7941 1.0445 ? 0.2492  ? -0.0701 ? 1.5618 ? -0.5065 ? 1.0705 ? 6.2477 ? 
-2.0708 ? -2.4228 ? 1.9988 ? 4.7820  ? 7.0503 ? 0.4808  ? -0.0610 ? 0.5837  ? 1.4549  ? 0.5584  ? -1.1499 ? 1.8941  ? 3.1512  ? 
-1.0779 ? 
9  'X-RAY DIFFRACTION' ? refined -70.1305 12.0165 -19.1175 1.0115 ? 0.3919  ? -0.0293 ? 0.7050 ? -0.0038 ? 0.5905 ? 1.2475 ? 
-0.5394 ? 1.9178  ? 7.9369 ? -6.0008 ? 7.5054 ? 0.1405  ? 0.1986  ? -0.1056 ? -0.0562 ? -0.2271 ? -0.4740 ? 0.1471  ? 0.3658  ? 
0.0746  ? 
10 'X-RAY DIFFRACTION' ? refined -81.0443 15.4114 -23.5929 1.1985 ? 0.4554  ? -0.1915 ? 1.1618 ? -0.0878 ? 0.7557 ? 7.4178 ? 
-1.9208 ? -0.5358 ? 8.4268 ? -4.9100 ? 4.2406 ? 0.7075  ? 0.1804  ? 0.5831  ? -0.4578 ? -0.7204 ? 1.7613  ? -1.1861 ? -1.3855 ? 
-0.1367 ? 
11 'X-RAY DIFFRACTION' ? refined -71.2889 1.0002  -22.9352 1.0862 ? 0.1413  ? -0.2595 ? 0.5668 ? -0.0751 ? 0.5581 ? 9.5806 ? 
-2.2137 ? 1.4872  ? 8.0958 ? 2.0564  ? 1.3002 ? 0.2577  ? -0.3100 ? -0.0597 ? -0.5958 ? 0.1469  ? -0.3132 ? 1.0752  ? 0.6112  ? 
-0.7543 ? 
12 'X-RAY DIFFRACTION' ? refined -71.5016 12.8413 -29.5424 1.4123 ? 0.5258  ? -0.0867 ? 1.0073 ? -0.0036 ? 0.5878 ? 3.3239 ? 
-0.1985 ? -0.3962 ? 4.3855 ? -3.2085 ? 5.1837 ? 0.7022  ? 1.1021  ? -0.0745 ? -1.2966 ? -0.3086 ? 0.2925  ? 0.5652  ? -0.5094 ? 
-0.1937 ? 
13 'X-RAY DIFFRACTION' ? refined -79.6007 15.9003 -19.5743 1.1992 ? 0.3527  ? -0.0720 ? 0.7536 ? 0.0645  ? 0.6933 ? 3.4944 ? 
-0.1993 ? 0.1106  ? 4.2529 ? -2.8789 ? 5.1012 ? 0.3108  ? 0.4578  ? 0.4419  ? -0.0451 ? -0.2018 ? 0.3405  ? -0.4349 ? -1.4223 ? 
-0.6338 ? 
14 'X-RAY DIFFRACTION' ? refined -73.5053 22.4653 -24.6848 1.3379 ? 0.4902  ? -0.1517 ? 0.7668 ? -0.0448 ? 0.6597 ? 3.4690 ? 
-0.6853 ? 0.9230  ? 5.3268 ? 4.1259  ? 6.0299 ? 0.6750  ? -0.2819 ? -0.2031 ? 1.0830  ? -0.3148 ? -0.7181 ? -2.5453 ? 0.0768  ? 
-0.0273 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1  'X-RAY DIFFRACTION' 1  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 20 through 37 )
;
2  'X-RAY DIFFRACTION' 2  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 38 through 53 )
;
3  'X-RAY DIFFRACTION' 3  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 54 through 59 )
;
4  'X-RAY DIFFRACTION' 4  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 60 through 76 )
;
5  'X-RAY DIFFRACTION' 5  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 77 through 97 )
;
6  'X-RAY DIFFRACTION' 6  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 98 through 116 )
;
7  'X-RAY DIFFRACTION' 7  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 117 through 131 )
;
8  'X-RAY DIFFRACTION' 8  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 20 through 27 )
;
9  'X-RAY DIFFRACTION' 9  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 28 through 47 )
;
10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 48 through 69 )
;
11 'X-RAY DIFFRACTION' 11 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 70 through 76 )
;
12 'X-RAY DIFFRACTION' 12 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 77 through 105 )
;
13 'X-RAY DIFFRACTION' 13 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 106 through 116 )
;
14 'X-RAY DIFFRACTION' 14 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 117 through 131 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX    ? ? ? '(1.10_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000  ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER    ? ? ? .                  4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 56 ? ? -96.22 -77.53 
2 1 ASN A 99 ? ? 59.93  77.75  
3 1 GLU B 56 ? ? -73.62 -83.01 
4 1 ASN B 99 ? ? 60.13  75.77  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A THR 17  ? A THR 1   
2  1 Y 1 A GLY 18  ? A GLY 2   
3  1 Y 1 A HIS 19  ? A HIS 3   
4  1 Y 1 A PRO 132 ? A PRO 116 
5  1 Y 1 A LEU 133 ? A LEU 117 
6  1 Y 1 A GLY 134 ? A GLY 118 
7  1 Y 1 A THR 135 ? A THR 119 
8  1 Y 1 A LYS 136 ? A LYS 120 
9  1 Y 1 A HIS 137 ? A HIS 121 
10 1 Y 1 A HIS 138 ? A HIS 122 
11 1 Y 1 A HIS 139 ? A HIS 123 
12 1 Y 1 A HIS 140 ? A HIS 124 
13 1 Y 1 A HIS 141 ? A HIS 125 
14 1 Y 1 A HIS 142 ? A HIS 126 
15 1 Y 1 B THR 17  ? B THR 1   
16 1 Y 1 B GLY 18  ? B GLY 2   
17 1 Y 1 B HIS 19  ? B HIS 3   
18 1 Y 1 B PRO 132 ? B PRO 116 
19 1 Y 1 B LEU 133 ? B LEU 117 
20 1 Y 1 B GLY 134 ? B GLY 118 
21 1 Y 1 B THR 135 ? B THR 119 
22 1 Y 1 B LYS 136 ? B LYS 120 
23 1 Y 1 B HIS 137 ? B HIS 121 
24 1 Y 1 B HIS 138 ? B HIS 122 
25 1 Y 1 B HIS 139 ? B HIS 123 
26 1 Y 1 B HIS 140 ? B HIS 124 
27 1 Y 1 B HIS 141 ? B HIS 125 
28 1 Y 1 B HIS 142 ? B HIS 126 
# 
_pdbx_audit_support.funding_organization   'National Institutes of Health/National Heart, Lung, and Blood Institute (NIH/NHLBI)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           R01-HL119813 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        2-acetamido-2-deoxy-beta-D-glucopyranose 
_pdbx_entity_nonpoly.comp_id     NAG 
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 'gel filtration' ? 
2 2 'gel filtration' ? 
#