data_5EMV
# 
_entry.id   5EMV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5EMV         
WWPDB D_1000215151 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          5EMW 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5EMV 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Noland, C.L.'      1  
'Gierke, S.'        2  
'Schnier, P.D.'     3  
'Murray, J.'        4  
'Sandoval, W.N.'    5  
'Sagolla, M.'       6  
'Dey, A.'           7  
'Hannoush, R.N.'    8  
'Fairbrother, W.J.' 9  
'Cunningham, C.N.'  10 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            24 
_citation.language                  ? 
_citation.page_first                179 
_citation.page_last                 186 
_citation.title                     
'Palmitoylation of TEAD Transcription Factors Is Required for Their Stability and Function in Hippo Pathway Signaling.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2015.11.005 
_citation.pdbx_database_id_PubMed   26724994 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Noland, C.L.'      1  
primary 'Gierke, S.'        2  
primary 'Schnier, P.D.'     3  
primary 'Murray, J.'        4  
primary 'Sandoval, W.N.'    5  
primary 'Sagolla, M.'       6  
primary 'Dey, A.'           7  
primary 'Hannoush, R.N.'    8  
primary 'Fairbrother, W.J.' 9  
primary 'Cunningham, C.N.'  10 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   101.890 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5EMV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     79.830 
_cell.length_a_esd                 ? 
_cell.length_b                     61.250 
_cell.length_b_esd                 ? 
_cell.length_c                     112.672 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5EMV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Transcriptional enhancer factor TEF-4' 26941.543 2   ? ? 'YAP binding domain, unp residues  219-435' ? 
2 water   nat water                                   18.015    167 ? ? ?                                           ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TEA domain family member 2,TEAD-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GSAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPP
HAFFLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRL
LRSPM(P1L)EYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVRDGNS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPP
HAFFLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRL
LRSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVRDGNS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   TRP n 
1 5   GLN n 
1 6   ALA n 
1 7   ARG n 
1 8   GLY n 
1 9   LEU n 
1 10  GLY n 
1 11  THR n 
1 12  ALA n 
1 13  ARG n 
1 14  LEU n 
1 15  GLN n 
1 16  LEU n 
1 17  VAL n 
1 18  GLU n 
1 19  PHE n 
1 20  SER n 
1 21  ALA n 
1 22  PHE n 
1 23  VAL n 
1 24  GLU n 
1 25  PRO n 
1 26  PRO n 
1 27  ASP n 
1 28  ALA n 
1 29  VAL n 
1 30  ASP n 
1 31  SER n 
1 32  TYR n 
1 33  GLN n 
1 34  ARG n 
1 35  HIS n 
1 36  LEU n 
1 37  PHE n 
1 38  VAL n 
1 39  HIS n 
1 40  ILE n 
1 41  SER n 
1 42  GLN n 
1 43  HIS n 
1 44  CYS n 
1 45  PRO n 
1 46  SER n 
1 47  PRO n 
1 48  GLY n 
1 49  ALA n 
1 50  PRO n 
1 51  PRO n 
1 52  LEU n 
1 53  GLU n 
1 54  SER n 
1 55  VAL n 
1 56  ASP n 
1 57  VAL n 
1 58  ARG n 
1 59  GLN n 
1 60  ILE n 
1 61  TYR n 
1 62  ASP n 
1 63  LYS n 
1 64  PHE n 
1 65  PRO n 
1 66  GLU n 
1 67  LYS n 
1 68  LYS n 
1 69  GLY n 
1 70  GLY n 
1 71  LEU n 
1 72  ARG n 
1 73  GLU n 
1 74  LEU n 
1 75  TYR n 
1 76  ASP n 
1 77  ARG n 
1 78  GLY n 
1 79  PRO n 
1 80  PRO n 
1 81  HIS n 
1 82  ALA n 
1 83  PHE n 
1 84  PHE n 
1 85  LEU n 
1 86  VAL n 
1 87  LYS n 
1 88  PHE n 
1 89  TRP n 
1 90  ALA n 
1 91  ASP n 
1 92  LEU n 
1 93  ASN n 
1 94  TRP n 
1 95  GLY n 
1 96  PRO n 
1 97  SER n 
1 98  GLY n 
1 99  GLU n 
1 100 GLU n 
1 101 ALA n 
1 102 GLY n 
1 103 ALA n 
1 104 GLY n 
1 105 GLY n 
1 106 SER n 
1 107 ILE n 
1 108 SER n 
1 109 SER n 
1 110 GLY n 
1 111 GLY n 
1 112 PHE n 
1 113 TYR n 
1 114 GLY n 
1 115 VAL n 
1 116 SER n 
1 117 SER n 
1 118 GLN n 
1 119 TYR n 
1 120 GLU n 
1 121 SER n 
1 122 LEU n 
1 123 GLU n 
1 124 HIS n 
1 125 MET n 
1 126 THR n 
1 127 LEU n 
1 128 THR n 
1 129 CYS n 
1 130 SER n 
1 131 SER n 
1 132 LYS n 
1 133 VAL n 
1 134 CYS n 
1 135 SER n 
1 136 PHE n 
1 137 GLY n 
1 138 LYS n 
1 139 GLN n 
1 140 VAL n 
1 141 VAL n 
1 142 GLU n 
1 143 LYS n 
1 144 VAL n 
1 145 GLU n 
1 146 THR n 
1 147 GLU n 
1 148 ARG n 
1 149 ALA n 
1 150 GLN n 
1 151 LEU n 
1 152 GLU n 
1 153 ASP n 
1 154 GLY n 
1 155 ARG n 
1 156 PHE n 
1 157 VAL n 
1 158 TYR n 
1 159 ARG n 
1 160 LEU n 
1 161 LEU n 
1 162 ARG n 
1 163 SER n 
1 164 PRO n 
1 165 MET n 
1 166 P1L n 
1 167 GLU n 
1 168 TYR n 
1 169 LEU n 
1 170 VAL n 
1 171 ASN n 
1 172 PHE n 
1 173 LEU n 
1 174 HIS n 
1 175 LYS n 
1 176 LEU n 
1 177 ARG n 
1 178 GLN n 
1 179 LEU n 
1 180 PRO n 
1 181 GLU n 
1 182 ARG n 
1 183 TYR n 
1 184 MET n 
1 185 MET n 
1 186 ASN n 
1 187 SER n 
1 188 VAL n 
1 189 LEU n 
1 190 GLU n 
1 191 ASN n 
1 192 PHE n 
1 193 THR n 
1 194 ILE n 
1 195 LEU n 
1 196 GLN n 
1 197 VAL n 
1 198 VAL n 
1 199 THR n 
1 200 ASN n 
1 201 ARG n 
1 202 ASP n 
1 203 THR n 
1 204 GLN n 
1 205 GLU n 
1 206 LEU n 
1 207 LEU n 
1 208 LEU n 
1 209 CYS n 
1 210 THR n 
1 211 ALA n 
1 212 TYR n 
1 213 VAL n 
1 214 PHE n 
1 215 GLU n 
1 216 VAL n 
1 217 SER n 
1 218 THR n 
1 219 SER n 
1 220 GLU n 
1 221 ARG n 
1 222 GLY n 
1 223 ALA n 
1 224 GLN n 
1 225 HIS n 
1 226 HIS n 
1 227 ILE n 
1 228 TYR n 
1 229 ARG n 
1 230 LEU n 
1 231 VAL n 
1 232 ARG n 
1 233 ASP n 
1 234 GLY n 
1 235 ASN n 
1 236 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   236 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TEAD2, TEF4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TEAD2_HUMAN 
_struct_ref.pdbx_db_accession          Q15562 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;WQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAF
FLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRLLRS
PMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVR
;
_struct_ref.pdbx_align_begin           218 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5EMV A 4 ? 232 ? Q15562 218 ? 446 ? 218 446 
2 1 5EMV B 4 ? 232 ? Q15562 218 ? 446 ? 218 446 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5EMV GLY A 1   ? UNP Q15562 ? ? 'expression tag' 215 1  
1 5EMV SER A 2   ? UNP Q15562 ? ? 'expression tag' 216 2  
1 5EMV ALA A 3   ? UNP Q15562 ? ? 'expression tag' 217 3  
1 5EMV ASP A 233 ? UNP Q15562 ? ? 'expression tag' 447 4  
1 5EMV GLY A 234 ? UNP Q15562 ? ? 'expression tag' 448 5  
1 5EMV ASN A 235 ? UNP Q15562 ? ? 'expression tag' 449 6  
1 5EMV SER A 236 ? UNP Q15562 ? ? 'expression tag' 450 7  
2 5EMV GLY B 1   ? UNP Q15562 ? ? 'expression tag' 215 8  
2 5EMV SER B 2   ? UNP Q15562 ? ? 'expression tag' 216 9  
2 5EMV ALA B 3   ? UNP Q15562 ? ? 'expression tag' 217 10 
2 5EMV ASP B 233 ? UNP Q15562 ? ? 'expression tag' 447 11 
2 5EMV GLY B 234 ? UNP Q15562 ? ? 'expression tag' 448 12 
2 5EMV ASN B 235 ? UNP Q15562 ? ? 'expression tag' 449 13 
2 5EMV SER B 236 ? UNP Q15562 ? ? 'expression tag' 450 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ? 'C5 H11 N O2 S'  149.211 
P1L 'L-peptide linking' n S-PALMITOYL-L-CYSTEINE ? 'C19 H37 N O3 S' 359.567 
PHE 'L-peptide linking' y PHENYLALANINE          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5EMV 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.56 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.90 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.7-2.1 M Sodium Formate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-08-06 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9787 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9787 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5EMV 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.000 
_reflns.d_resolution_low                 58.320 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       36163 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.800 
_reflns.pdbx_Rmerge_I_obs                0.072 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.900 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             35 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.043 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         137128 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.000 2.050  ? 2.000  10185 ? ? 2696 ? 100.000 ? ? ? ? 0.674 ? ? ? ? ? ? ? ? 3.800 ? ? ? ? ? 0.405 0 1 1 0.812 ? 
8.940 58.320 ? 26.200 1474  ? ? 432  ? 98.700  ? ? ? ? 0.024 ? ? ? ? ? ? ? ? 3.400 ? ? ? ? ? 0.016 0 2 1 0.996 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                117.390 
_refine.B_iso_mean                               47.2304 
_refine.B_iso_min                                16.260 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5EMV 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.0000 
_refine.ls_d_res_low                             53.5430 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     36087 
_refine.ls_number_reflns_R_free                  1761 
_refine.ls_number_reflns_R_work                  34326 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7800 
_refine.ls_percent_reflns_R_free                 4.8800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2034 
_refine.ls_R_factor_R_free                       0.2313 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2020 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3L15 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.4600 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.0000 
_refine_hist.d_res_low                        53.5430 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             167 
_refine_hist.number_atoms_total               3428 
_refine_hist.pdbx_number_residues_total       398 
_refine_hist.pdbx_B_iso_mean_solvent          48.44 
_refine_hist.pdbx_number_atoms_protein        3261 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 3354 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.668  ? 4530 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.027  ? 491  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 576  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.857 ? 1231 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.0000 2.0541 . . 137 2645 100.0000 . . . 0.3183 . 0.3064 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0541 2.1146 . . 122 2620 100.0000 . . . 0.3521 . 0.2861 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1146 2.1828 . . 128 2633 100.0000 . . . 0.2924 . 0.2675 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1828 2.2608 . . 145 2587 99.0000  . . . 0.3725 . 0.3286 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2608 2.3513 . . 137 2618 99.0000  . . . .      . .      . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3513 2.4584 . . 138 2634 100.0000 . . . 0.2427 . 0.2300 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4584 2.5880 . . 127 2621 100.0000 . . . 0.2434 . 0.2177 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5880 2.7501 . . 143 2647 100.0000 . . . 0.2772 . 0.2294 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7501 2.9624 . . 138 2632 100.0000 . . . 0.2604 . 0.2135 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9624 3.2605 . . 119 2675 100.0000 . . . 0.2414 . 0.2045 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2605 3.7322 . . 150 2621 100.0000 . . . 0.1962 . 0.1760 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7322 4.7018 . . 147 2661 100.0000 . . . 0.1662 . 0.1479 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7018 .      . . 130 2732 100.0000 . . . 0.2293 . 0.1813 . . . . . . . . . . 
# 
_struct.entry_id                     5EMV 
_struct.title                        'Crystal structure of the palmitoylated human TEAD2 transcription factor' 
_struct.pdbx_descriptor              'Transcriptional enhancer factor TEF-4' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5EMV 
_struct_keywords.text            'palmitoylated protein, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 58  ? PHE A 64  ? ARG A 272 PHE A 278 5 ? 7  
HELX_P HELX_P2  AA2 GLY A 70  ? GLY A 78  ? GLY A 284 GLY A 292 1 ? 9  
HELX_P HELX_P3  AA3 PRO A 79  ? HIS A 81  ? PRO A 293 HIS A 295 5 ? 3  
HELX_P HELX_P4  AA4 P1L A 166 ? ARG A 177 ? P1L A 380 ARG A 391 1 ? 12 
HELX_P HELX_P5  AA5 GLU A 181 ? GLU A 190 ? GLU A 395 GLU A 404 1 ? 10 
HELX_P HELX_P6  AA6 PRO B 25  ? ASP B 30  ? PRO B 239 ASP B 244 5 ? 6  
HELX_P HELX_P7  AA7 ARG B 58  ? PHE B 64  ? ARG B 272 PHE B 278 5 ? 7  
HELX_P HELX_P8  AA8 GLY B 70  ? GLY B 78  ? GLY B 284 GLY B 292 1 ? 9  
HELX_P HELX_P9  AA9 PRO B 79  ? HIS B 81  ? PRO B 293 HIS B 295 5 ? 3  
HELX_P HELX_P10 AB1 P1L B 166 ? GLN B 178 ? P1L B 380 GLN B 392 1 ? 13 
HELX_P HELX_P11 AB2 GLU B 181 ? GLU B 190 ? GLU B 395 GLU B 404 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A MET 165 C ? ? ? 1_555 A P1L 166 N ? ? A MET 379 A P1L 380 1_555 ? ? ? ? ? ? ? 1.315 ? 
covale2 covale both ? A P1L 166 C ? ? ? 1_555 A GLU 167 N ? ? A P1L 380 A GLU 381 1_555 ? ? ? ? ? ? ? 1.317 ? 
covale3 covale both ? B MET 165 C ? ? ? 1_555 B P1L 166 N ? ? B MET 379 B P1L 380 1_555 ? ? ? ? ? ? ? 1.313 ? 
covale4 covale both ? B P1L 166 C ? ? ? 1_555 B GLU 167 N ? ? B P1L 380 B GLU 381 1_555 ? ? ? ? ? ? ? 1.323 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 78 A . ? GLY 292 A PRO 79 A ? PRO 293 A 1 -1.83 
2 LYS 67 B . ? LYS 281 B LYS 68 B ? LYS 282 B 1 1.86  
3 GLY 78 B . ? GLY 292 B PRO 79 B ? PRO 293 B 1 -1.44 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5  ? 
AA2 ? 14 ? 
AA3 ? 5  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? anti-parallel 
AA1 4  5  ? anti-parallel 
AA2 1  2  ? parallel      
AA2 2  3  ? anti-parallel 
AA2 3  4  ? parallel      
AA2 4  5  ? anti-parallel 
AA2 5  6  ? anti-parallel 
AA2 6  7  ? anti-parallel 
AA2 7  8  ? parallel      
AA2 8  9  ? anti-parallel 
AA2 9  10 ? anti-parallel 
AA2 10 11 ? anti-parallel 
AA2 11 12 ? parallel      
AA2 12 13 ? anti-parallel 
AA2 13 14 ? parallel      
AA3 1  2  ? anti-parallel 
AA3 2  3  ? anti-parallel 
AA3 3  4  ? anti-parallel 
AA3 4  5  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  HIS A 35  ? SER A 41  ? HIS A 249 SER A 255 
AA1 2  GLN A 15  ? GLU A 24  ? GLN A 229 GLU A 238 
AA1 3  PHE A 112 ? SER A 121 ? PHE A 326 SER A 335 
AA1 4  ARG A 155 ? PRO A 164 ? ARG A 369 PRO A 378 
AA1 5  GLN A 150 ? GLU A 152 ? GLN A 364 GLU A 366 
AA2 1  SER A 54  ? ASP A 56  ? SER A 268 ASP A 270 
AA2 2  GLN A 224 ? VAL A 231 ? GLN A 438 VAL A 445 
AA2 3  PHE A 83  ? ASP A 91  ? PHE A 297 ASP A 305 
AA2 4  LEU A 206 ? SER A 217 ? LEU A 420 SER A 431 
AA2 5  PHE A 192 ? ASN A 200 ? PHE A 406 ASN A 414 
AA2 6  THR A 126 ? SER A 135 ? THR A 340 SER A 349 
AA2 7  LYS A 138 ? ARG A 148 ? LYS A 352 ARG A 362 
AA2 8  LYS B 138 ? ARG B 148 ? LYS B 352 ARG B 362 
AA2 9  THR B 126 ? SER B 135 ? THR B 340 SER B 349 
AA2 10 PHE B 192 ? ASN B 200 ? PHE B 406 ASN B 414 
AA2 11 LEU B 206 ? VAL B 216 ? LEU B 420 VAL B 430 
AA2 12 PHE B 83  ? ALA B 90  ? PHE B 297 ALA B 304 
AA2 13 GLN B 224 ? VAL B 231 ? GLN B 438 VAL B 445 
AA2 14 SER B 54  ? ASP B 56  ? SER B 268 ASP B 270 
AA3 1  HIS B 35  ? SER B 41  ? HIS B 249 SER B 255 
AA3 2  GLN B 15  ? GLU B 24  ? GLN B 229 GLU B 238 
AA3 3  PHE B 112 ? SER B 121 ? PHE B 326 SER B 335 
AA3 4  ARG B 155 ? PRO B 164 ? ARG B 369 PRO B 378 
AA3 5  GLN B 150 ? GLU B 152 ? GLN B 364 GLU B 366 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  O ILE A 40  ? O ILE A 254 N PHE A 19  ? N PHE A 233 
AA1 2  3  N SER A 20  ? N SER A 234 O SER A 116 ? O SER A 330 
AA1 3  4  N SER A 117 ? N SER A 331 O LEU A 160 ? O LEU A 374 
AA1 4  5  O ARG A 155 ? O ARG A 369 N GLU A 152 ? N GLU A 366 
AA2 1  2  N VAL A 55  ? N VAL A 269 O ARG A 229 ? O ARG A 443 
AA2 2  3  O TYR A 228 ? O TYR A 442 N LEU A 85  ? N LEU A 299 
AA2 3  4  N VAL A 86  ? N VAL A 300 O ALA A 211 ? O ALA A 425 
AA2 4  5  O LEU A 208 ? O LEU A 422 N VAL A 198 ? N VAL A 412 
AA2 5  6  O THR A 193 ? O THR A 407 N CYS A 134 ? N CYS A 348 
AA2 6  7  N VAL A 133 ? N VAL A 347 O VAL A 140 ? O VAL A 354 
AA2 7  8  N GLU A 142 ? N GLU A 356 O VAL B 144 ? O VAL B 358 
AA2 8  9  O GLU B 145 ? O GLU B 359 N CYS B 129 ? N CYS B 343 
AA2 9  10 N CYS B 134 ? N CYS B 348 O THR B 193 ? O THR B 407 
AA2 10 11 N VAL B 198 ? N VAL B 412 O LEU B 208 ? O LEU B 422 
AA2 11 12 O ALA B 211 ? O ALA B 425 N VAL B 86  ? N VAL B 300 
AA2 12 13 N LEU B 85  ? N LEU B 299 O TYR B 228 ? O TYR B 442 
AA2 13 14 O ARG B 229 ? O ARG B 443 N VAL B 55  ? N VAL B 269 
AA3 1  2  O ILE B 40  ? O ILE B 254 N PHE B 19  ? N PHE B 233 
AA3 2  3  N VAL B 17  ? N VAL B 231 O GLN B 118 ? O GLN B 332 
AA3 3  4  N SER B 117 ? N SER B 331 O LEU B 160 ? O LEU B 374 
AA3 4  5  O ARG B 155 ? O ARG B 369 N GLU B 152 ? N GLU B 366 
# 
_atom_sites.entry_id                    5EMV 
_atom_sites.fract_transf_matrix[1][1]   0.012527 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002638 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016327 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009070 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 8   ? -4.412  -4.440  -30.918 1.00 73.91  ? 222 GLY A N   1 
ATOM   2    C CA  . GLY A 1 8   ? -4.164  -5.350  -29.815 1.00 66.69  ? 222 GLY A CA  1 
ATOM   3    C C   . GLY A 1 8   ? -3.969  -6.785  -30.267 1.00 59.93  ? 222 GLY A C   1 
ATOM   4    O O   . GLY A 1 8   ? -4.134  -7.105  -31.445 1.00 60.37  ? 222 GLY A O   1 
ATOM   5    N N   . LEU A 1 9   ? -3.618  -7.653  -29.324 1.00 52.37  ? 223 LEU A N   1 
ATOM   6    C CA  . LEU A 1 9   ? -3.389  -9.060  -29.628 1.00 46.40  ? 223 LEU A CA  1 
ATOM   7    C C   . LEU A 1 9   ? -4.673  -9.866  -29.473 1.00 43.01  ? 223 LEU A C   1 
ATOM   8    O O   . LEU A 1 9   ? -5.070  -10.214 -28.360 1.00 41.35  ? 223 LEU A O   1 
ATOM   9    C CB  . LEU A 1 9   ? -2.294  -9.634  -28.727 1.00 43.22  ? 223 LEU A CB  1 
ATOM   10   C CG  . LEU A 1 9   ? -1.427  -10.767 -29.288 1.00 42.92  ? 223 LEU A CG  1 
ATOM   11   C CD1 . LEU A 1 9   ? -0.230  -11.000 -28.386 1.00 43.51  ? 223 LEU A CD1 1 
ATOM   12   C CD2 . LEU A 1 9   ? -2.213  -12.058 -29.462 1.00 39.74  ? 223 LEU A CD2 1 
ATOM   13   N N   . GLY A 1 10  ? -5.310  -10.173 -30.595 1.00 40.70  ? 224 GLY A N   1 
ATOM   14   C CA  . GLY A 1 10  ? -6.498  -11.001 -30.576 1.00 40.65  ? 224 GLY A CA  1 
ATOM   15   C C   . GLY A 1 10  ? -7.341  -10.848 -31.821 1.00 43.59  ? 224 GLY A C   1 
ATOM   16   O O   . GLY A 1 10  ? -7.049  -10.028 -32.692 1.00 47.98  ? 224 GLY A O   1 
ATOM   17   N N   . THR A 1 11  ? -8.392  -11.652 -31.904 1.00 41.30  ? 225 THR A N   1 
ATOM   18   C CA  . THR A 1 11  ? -9.327  -11.579 -33.013 1.00 39.47  ? 225 THR A CA  1 
ATOM   19   C C   . THR A 1 11  ? -10.706 -11.213 -32.483 1.00 42.37  ? 225 THR A C   1 
ATOM   20   O O   . THR A 1 11  ? -10.859 -10.875 -31.308 1.00 41.77  ? 225 THR A O   1 
ATOM   21   C CB  . THR A 1 11  ? -9.402  -12.910 -33.781 1.00 38.75  ? 225 THR A CB  1 
ATOM   22   O OG1 . THR A 1 11  ? -10.052 -13.896 -32.969 1.00 37.54  ? 225 THR A OG1 1 
ATOM   23   C CG2 . THR A 1 11  ? -8.002  -13.399 -34.141 1.00 39.93  ? 225 THR A CG2 1 
ATOM   24   N N   . ALA A 1 12  ? -11.709 -11.287 -33.350 1.00 42.77  ? 226 ALA A N   1 
ATOM   25   C CA  . ALA A 1 12  ? -13.080 -11.023 -32.941 1.00 45.20  ? 226 ALA A CA  1 
ATOM   26   C C   . ALA A 1 12  ? -13.600 -12.130 -32.028 1.00 44.04  ? 226 ALA A C   1 
ATOM   27   O O   . ALA A 1 12  ? -14.533 -11.916 -31.255 1.00 47.71  ? 226 ALA A O   1 
ATOM   28   C CB  . ALA A 1 12  ? -13.977 -10.873 -34.160 1.00 43.77  ? 226 ALA A CB  1 
ATOM   29   N N   . ARG A 1 13  ? -12.992 -13.310 -32.115 1.00 38.37  ? 227 ARG A N   1 
ATOM   30   C CA  . ARG A 1 13  ? -13.456 -14.462 -31.348 1.00 44.79  ? 227 ARG A CA  1 
ATOM   31   C C   . ARG A 1 13  ? -12.726 -14.633 -30.023 1.00 45.05  ? 227 ARG A C   1 
ATOM   32   O O   . ARG A 1 13  ? -13.268 -15.208 -29.082 1.00 39.04  ? 227 ARG A O   1 
ATOM   33   C CB  . ARG A 1 13  ? -13.310 -15.745 -32.168 1.00 43.73  ? 227 ARG A CB  1 
ATOM   34   C CG  . ARG A 1 13  ? -14.204 -15.811 -33.390 1.00 47.43  ? 227 ARG A CG  1 
ATOM   35   C CD  . ARG A 1 13  ? -14.189 -17.203 -34.001 1.00 48.38  ? 227 ARG A CD  1 
ATOM   36   N NE  . ARG A 1 13  ? -14.742 -18.203 -33.091 1.00 50.43  ? 227 ARG A NE  1 
ATOM   37   C CZ  . ARG A 1 13  ? -14.846 -19.496 -33.378 1.00 52.79  ? 227 ARG A CZ  1 
ATOM   38   N NH1 . ARG A 1 13  ? -14.431 -19.951 -34.553 1.00 52.11  ? 227 ARG A NH1 1 
ATOM   39   N NH2 . ARG A 1 13  ? -15.363 -20.335 -32.491 1.00 56.68  ? 227 ARG A NH2 1 
ATOM   40   N N   . LEU A 1 14  ? -11.490 -14.152 -29.953 1.00 40.67  ? 228 LEU A N   1 
ATOM   41   C CA  . LEU A 1 14  ? -10.690 -14.332 -28.751 1.00 37.54  ? 228 LEU A CA  1 
ATOM   42   C C   . LEU A 1 14  ? -9.623  -13.256 -28.630 1.00 34.68  ? 228 LEU A C   1 
ATOM   43   O O   . LEU A 1 14  ? -8.881  -12.995 -29.574 1.00 33.54  ? 228 LEU A O   1 
ATOM   44   C CB  . LEU A 1 14  ? -10.037 -15.713 -28.745 1.00 38.50  ? 228 LEU A CB  1 
ATOM   45   C CG  . LEU A 1 14  ? -9.299  -16.070 -27.455 1.00 38.27  ? 228 LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 14  ? -10.293 -16.305 -26.328 1.00 40.51  ? 228 LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 14  ? -8.404  -17.282 -27.656 1.00 33.08  ? 228 LEU A CD2 1 
ATOM   48   N N   . GLN A 1 15  ? -9.548  -12.634 -27.460 1.00 36.09  ? 229 GLN A N   1 
ATOM   49   C CA  . GLN A 1 15  ? -8.575  -11.580 -27.230 1.00 36.84  ? 229 GLN A CA  1 
ATOM   50   C C   . GLN A 1 15  ? -7.723  -11.876 -26.001 1.00 37.58  ? 229 GLN A C   1 
ATOM   51   O O   . GLN A 1 15  ? -8.227  -12.328 -24.974 1.00 39.82  ? 229 GLN A O   1 
ATOM   52   C CB  . GLN A 1 15  ? -9.272  -10.225 -27.073 1.00 44.61  ? 229 GLN A CB  1 
ATOM   53   C CG  . GLN A 1 15  ? -10.205 -9.858  -28.221 1.00 51.35  ? 229 GLN A CG  1 
ATOM   54   C CD  . GLN A 1 15  ? -11.623 -10.361 -28.012 1.00 59.76  ? 229 GLN A CD  1 
ATOM   55   O OE1 . GLN A 1 15  ? -12.196 -10.206 -26.933 1.00 67.33  ? 229 GLN A OE1 1 
ATOM   56   N NE2 . GLN A 1 15  ? -12.196 -10.968 -29.046 1.00 59.81  ? 229 GLN A NE2 1 
ATOM   57   N N   . LEU A 1 16  ? -6.425  -11.629 -26.117 1.00 36.91  ? 230 LEU A N   1 
ATOM   58   C CA  . LEU A 1 16  ? -5.544  -11.696 -24.961 1.00 41.38  ? 230 LEU A CA  1 
ATOM   59   C C   . LEU A 1 16  ? -5.732  -10.429 -24.140 1.00 44.06  ? 230 LEU A C   1 
ATOM   60   O O   . LEU A 1 16  ? -5.680  -9.323  -24.674 1.00 46.11  ? 230 LEU A O   1 
ATOM   61   C CB  . LEU A 1 16  ? -4.086  -11.855 -25.389 1.00 42.59  ? 230 LEU A CB  1 
ATOM   62   C CG  . LEU A 1 16  ? -3.035  -11.881 -24.275 1.00 42.48  ? 230 LEU A CG  1 
ATOM   63   C CD1 . LEU A 1 16  ? -3.100  -13.180 -23.485 1.00 36.93  ? 230 LEU A CD1 1 
ATOM   64   C CD2 . LEU A 1 16  ? -1.647  -11.664 -24.851 1.00 44.67  ? 230 LEU A CD2 1 
ATOM   65   N N   . VAL A 1 17  ? -5.968  -10.589 -22.845 1.00 37.71  ? 231 VAL A N   1 
ATOM   66   C CA  . VAL A 1 17  ? -6.192  -9.441  -21.977 1.00 43.80  ? 231 VAL A CA  1 
ATOM   67   C C   . VAL A 1 17  ? -4.971  -9.167  -21.113 1.00 41.31  ? 231 VAL A C   1 
ATOM   68   O O   . VAL A 1 17  ? -4.565  -8.016  -20.943 1.00 43.52  ? 231 VAL A O   1 
ATOM   69   C CB  . VAL A 1 17  ? -7.426  -9.652  -21.086 1.00 49.23  ? 231 VAL A CB  1 
ATOM   70   C CG1 . VAL A 1 17  ? -7.496  -8.597  -19.993 1.00 56.78  ? 231 VAL A CG1 1 
ATOM   71   C CG2 . VAL A 1 17  ? -8.667  -9.615  -21.936 1.00 45.90  ? 231 VAL A CG2 1 
ATOM   72   N N   . GLU A 1 18  ? -4.379  -10.229 -20.579 1.00 38.47  ? 232 GLU A N   1 
ATOM   73   C CA  . GLU A 1 18  ? -3.193  -10.086 -19.751 1.00 39.30  ? 232 GLU A CA  1 
ATOM   74   C C   . GLU A 1 18  ? -2.298  -11.317 -19.858 1.00 39.67  ? 232 GLU A C   1 
ATOM   75   O O   . GLU A 1 18  ? -2.779  -12.447 -19.944 1.00 38.69  ? 232 GLU A O   1 
ATOM   76   C CB  . GLU A 1 18  ? -3.585  -9.829  -18.293 1.00 46.65  ? 232 GLU A CB  1 
ATOM   77   C CG  . GLU A 1 18  ? -2.468  -9.238  -17.443 1.00 56.79  ? 232 GLU A CG  1 
ATOM   78   C CD  . GLU A 1 18  ? -2.976  -8.598  -16.164 1.00 66.38  ? 232 GLU A CD  1 
ATOM   79   O OE1 . GLU A 1 18  ? -2.144  -8.098  -15.378 1.00 68.84  ? 232 GLU A OE1 1 
ATOM   80   O OE2 . GLU A 1 18  ? -4.207  -8.590  -15.947 1.00 72.31  ? 232 GLU A OE2 1 
ATOM   81   N N   . PHE A 1 19  ? -0.991  -11.081 -19.872 1.00 37.13  ? 233 PHE A N   1 
ATOM   82   C CA  . PHE A 1 19  ? -0.008  -12.153 -19.907 1.00 36.43  ? 233 PHE A CA  1 
ATOM   83   C C   . PHE A 1 19  ? 1.229   -11.727 -19.134 1.00 38.78  ? 233 PHE A C   1 
ATOM   84   O O   . PHE A 1 19  ? 1.755   -10.636 -19.352 1.00 39.43  ? 233 PHE A O   1 
ATOM   85   C CB  . PHE A 1 19  ? 0.362   -12.514 -21.349 1.00 34.33  ? 233 PHE A CB  1 
ATOM   86   C CG  . PHE A 1 19  ? 1.449   -13.547 -21.457 1.00 36.39  ? 233 PHE A CG  1 
ATOM   87   C CD1 . PHE A 1 19  ? 1.158   -14.894 -21.323 1.00 36.16  ? 233 PHE A CD1 1 
ATOM   88   C CD2 . PHE A 1 19  ? 2.763   -13.171 -21.694 1.00 38.84  ? 233 PHE A CD2 1 
ATOM   89   C CE1 . PHE A 1 19  ? 2.154   -15.850 -21.421 1.00 35.85  ? 233 PHE A CE1 1 
ATOM   90   C CE2 . PHE A 1 19  ? 3.768   -14.122 -21.793 1.00 38.93  ? 233 PHE A CE2 1 
ATOM   91   C CZ  . PHE A 1 19  ? 3.462   -15.463 -21.657 1.00 38.26  ? 233 PHE A CZ  1 
ATOM   92   N N   . SER A 1 20  ? 1.690   -12.582 -18.228 1.00 38.06  ? 234 SER A N   1 
ATOM   93   C CA  . SER A 1 20  ? 2.883   -12.268 -17.455 1.00 41.47  ? 234 SER A CA  1 
ATOM   94   C C   . SER A 1 20  ? 3.638   -13.523 -17.041 1.00 40.00  ? 234 SER A C   1 
ATOM   95   O O   . SER A 1 20  ? 3.047   -14.576 -16.803 1.00 40.97  ? 234 SER A O   1 
ATOM   96   C CB  . SER A 1 20  ? 2.519   -11.446 -16.216 1.00 44.60  ? 234 SER A CB  1 
ATOM   97   O OG  . SER A 1 20  ? 1.747   -12.208 -15.305 1.00 47.70  ? 234 SER A OG  1 
ATOM   98   N N   . ALA A 1 21  ? 4.957   -13.395 -16.974 1.00 39.08  ? 235 ALA A N   1 
ATOM   99   C CA  . ALA A 1 21  ? 5.810   -14.430 -16.415 1.00 34.91  ? 235 ALA A CA  1 
ATOM   100  C C   . ALA A 1 21  ? 6.567   -13.808 -15.254 1.00 34.29  ? 235 ALA A C   1 
ATOM   101  O O   . ALA A 1 21  ? 7.112   -12.712 -15.381 1.00 33.90  ? 235 ALA A O   1 
ATOM   102  C CB  . ALA A 1 21  ? 6.754   -14.980 -17.459 1.00 30.93  ? 235 ALA A CB  1 
ATOM   103  N N   . PHE A 1 22  ? 6.593   -14.496 -14.120 1.00 31.12  ? 236 PHE A N   1 
ATOM   104  C CA  . PHE A 1 22  ? 7.050   -13.865 -12.893 1.00 33.67  ? 236 PHE A CA  1 
ATOM   105  C C   . PHE A 1 22  ? 7.739   -14.822 -11.931 1.00 34.98  ? 236 PHE A C   1 
ATOM   106  O O   . PHE A 1 22  ? 7.782   -16.032 -12.154 1.00 33.24  ? 236 PHE A O   1 
ATOM   107  C CB  . PHE A 1 22  ? 5.865   -13.202 -12.186 1.00 37.33  ? 236 PHE A CB  1 
ATOM   108  C CG  . PHE A 1 22  ? 4.727   -14.143 -11.903 1.00 37.79  ? 236 PHE A CG  1 
ATOM   109  C CD1 . PHE A 1 22  ? 4.680   -14.859 -10.719 1.00 41.62  ? 236 PHE A CD1 1 
ATOM   110  C CD2 . PHE A 1 22  ? 3.706   -14.314 -12.823 1.00 40.29  ? 236 PHE A CD2 1 
ATOM   111  C CE1 . PHE A 1 22  ? 3.638   -15.727 -10.456 1.00 44.53  ? 236 PHE A CE1 1 
ATOM   112  C CE2 . PHE A 1 22  ? 2.659   -15.181 -12.566 1.00 42.85  ? 236 PHE A CE2 1 
ATOM   113  C CZ  . PHE A 1 22  ? 2.626   -15.888 -11.380 1.00 45.90  ? 236 PHE A CZ  1 
ATOM   114  N N   . VAL A 1 23  ? 8.271   -14.255 -10.855 1.00 35.92  ? 237 VAL A N   1 
ATOM   115  C CA  . VAL A 1 23  ? 8.847   -15.034 -9.771  1.00 39.75  ? 237 VAL A CA  1 
ATOM   116  C C   . VAL A 1 23  ? 8.494   -14.377 -8.438  1.00 42.62  ? 237 VAL A C   1 
ATOM   117  O O   . VAL A 1 23  ? 8.553   -13.155 -8.300  1.00 44.23  ? 237 VAL A O   1 
ATOM   118  C CB  . VAL A 1 23  ? 10.384  -15.175 -9.919  1.00 40.50  ? 237 VAL A CB  1 
ATOM   119  C CG1 . VAL A 1 23  ? 11.047  -13.811 -10.069 1.00 41.41  ? 237 VAL A CG1 1 
ATOM   120  C CG2 . VAL A 1 23  ? 10.971  -15.943 -8.742  1.00 42.96  ? 237 VAL A CG2 1 
ATOM   121  N N   . GLU A 1 24  ? 8.096   -15.195 -7.469  1.00 47.99  ? 238 GLU A N   1 
ATOM   122  C CA  . GLU A 1 24  ? 7.738   -14.707 -6.143  1.00 56.36  ? 238 GLU A CA  1 
ATOM   123  C C   . GLU A 1 24  ? 8.742   -15.189 -5.105  1.00 64.13  ? 238 GLU A C   1 
ATOM   124  O O   . GLU A 1 24  ? 9.109   -16.362 -5.097  1.00 66.26  ? 238 GLU A O   1 
ATOM   125  C CB  . GLU A 1 24  ? 6.328   -15.163 -5.762  1.00 60.72  ? 238 GLU A CB  1 
ATOM   126  C CG  . GLU A 1 24  ? 5.233   -14.598 -6.650  1.00 61.32  ? 238 GLU A CG  1 
ATOM   127  C CD  . GLU A 1 24  ? 3.859   -15.138 -6.305  1.00 67.95  ? 238 GLU A CD  1 
ATOM   128  O OE1 . GLU A 1 24  ? 3.774   -16.281 -5.807  1.00 70.51  ? 238 GLU A OE1 1 
ATOM   129  O OE2 . GLU A 1 24  ? 2.862   -14.419 -6.530  1.00 70.54  ? 238 GLU A OE2 1 
ATOM   130  N N   . PRO A 1 25  ? 9.189   -14.282 -4.223  1.00 68.51  ? 239 PRO A N   1 
ATOM   131  C CA  . PRO A 1 25  ? 10.154  -14.622 -3.171  1.00 73.84  ? 239 PRO A CA  1 
ATOM   132  C C   . PRO A 1 25  ? 9.571   -15.572 -2.128  1.00 79.01  ? 239 PRO A C   1 
ATOM   133  O O   . PRO A 1 25  ? 8.354   -15.758 -2.097  1.00 80.50  ? 239 PRO A O   1 
ATOM   134  C CB  . PRO A 1 25  ? 10.484  -13.262 -2.548  1.00 75.15  ? 239 PRO A CB  1 
ATOM   135  C CG  . PRO A 1 25  ? 9.283   -12.425 -2.824  1.00 73.85  ? 239 PRO A CG  1 
ATOM   136  C CD  . PRO A 1 25  ? 8.795   -12.864 -4.173  1.00 69.31  ? 239 PRO A CD  1 
ATOM   137  N N   . GLN A 1 33  ? 6.621   -9.325  -2.984  1.00 75.33  ? 247 GLN A N   1 
ATOM   138  C CA  . GLN A 1 33  ? 6.027   -8.789  -4.203  1.00 73.28  ? 247 GLN A CA  1 
ATOM   139  C C   . GLN A 1 33  ? 6.603   -9.472  -5.438  1.00 69.47  ? 247 GLN A C   1 
ATOM   140  O O   . GLN A 1 33  ? 7.770   -9.866  -5.454  1.00 70.53  ? 247 GLN A O   1 
ATOM   141  C CB  . GLN A 1 33  ? 6.246   -7.277  -4.287  1.00 73.52  ? 247 GLN A CB  1 
ATOM   142  N N   . ARG A 1 34  ? 5.819   -9.622  -6.466  1.00 65.53  ? 248 ARG A N   1 
ATOM   143  C CA  . ARG A 1 34  ? 6.299   -10.286 -7.633  1.00 61.82  ? 248 ARG A CA  1 
ATOM   144  C C   . ARG A 1 34  ? 7.254   -9.480  -8.458  1.00 57.12  ? 248 ARG A C   1 
ATOM   145  O O   . ARG A 1 34  ? 7.177   -8.277  -8.486  1.00 59.82  ? 248 ARG A O   1 
ATOM   146  C CB  . ARG A 1 34  ? 5.112   -10.512 -8.556  1.00 63.56  ? 248 ARG A CB  1 
ATOM   147  C CG  . ARG A 1 34  ? 4.373   -11.819 -8.426  1.00 68.61  ? 248 ARG A CG  1 
ATOM   148  C CD  . ARG A 1 34  ? 3.272   -11.890 -9.455  1.00 69.12  ? 248 ARG A CD  1 
ATOM   149  N NE  . ARG A 1 34  ? 2.249   -12.832 -9.065  1.00 75.44  ? 248 ARG A NE  1 
ATOM   150  C CZ  . ARG A 1 34  ? 1.227   -13.181 -9.829  1.00 77.76  ? 248 ARG A CZ  1 
ATOM   151  N NH1 . ARG A 1 34  ? 1.071   -12.638 -11.035 1.00 76.39  ? 248 ARG A NH1 1 
ATOM   152  N NH2 . ARG A 1 34  ? 0.342   -14.049 -9.372  1.00 80.10  ? 248 ARG A NH2 1 
ATOM   153  N N   . HIS A 1 35  ? 8.135   -10.174 -9.154  1.00 49.56  ? 249 HIS A N   1 
ATOM   154  C CA  . HIS A 1 35  ? 8.970   -9.573  -10.180 1.00 45.03  ? 249 HIS A CA  1 
ATOM   155  C C   . HIS A 1 35  ? 8.518   -10.104 -11.529 1.00 41.88  ? 249 HIS A C   1 
ATOM   156  O O   . HIS A 1 35  ? 8.431   -11.314 -11.722 1.00 41.76  ? 249 HIS A O   1 
ATOM   157  C CB  . HIS A 1 35  ? 10.451  -9.880  -9.966  1.00 42.88  ? 249 HIS A CB  1 
ATOM   158  C CG  . HIS A 1 35  ? 11.310  -9.517  -11.138 1.00 42.79  ? 249 HIS A CG  1 
ATOM   159  N ND1 . HIS A 1 35  ? 11.769  -8.236  -11.356 1.00 46.75  ? 249 HIS A ND1 1 
ATOM   160  C CD2 . HIS A 1 35  ? 11.771  -10.263 -12.169 1.00 39.90  ? 249 HIS A CD2 1 
ATOM   161  C CE1 . HIS A 1 35  ? 12.488  -8.211  -12.464 1.00 45.90  ? 249 HIS A CE1 1 
ATOM   162  N NE2 . HIS A 1 35  ? 12.504  -9.427  -12.977 1.00 42.44  ? 249 HIS A NE2 1 
ATOM   163  N N   . LEU A 1 36  ? 8.234   -9.202  -12.460 1.00 39.92  ? 250 LEU A N   1 
ATOM   164  C CA  . LEU A 1 36  ? 7.756   -9.597  -13.780 1.00 38.63  ? 250 LEU A CA  1 
ATOM   165  C C   . LEU A 1 36  ? 8.895   -9.634  -14.797 1.00 34.93  ? 250 LEU A C   1 
ATOM   166  O O   . LEU A 1 36  ? 9.533   -8.617  -15.059 1.00 33.20  ? 250 LEU A O   1 
ATOM   167  C CB  . LEU A 1 36  ? 6.661   -8.639  -14.257 1.00 37.16  ? 250 LEU A CB  1 
ATOM   168  C CG  . LEU A 1 36  ? 5.515   -8.363  -13.277 1.00 38.20  ? 250 LEU A CG  1 
ATOM   169  C CD1 . LEU A 1 36  ? 4.554   -7.323  -13.841 1.00 41.94  ? 250 LEU A CD1 1 
ATOM   170  C CD2 . LEU A 1 36  ? 4.776   -9.644  -12.927 1.00 34.65  ? 250 LEU A CD2 1 
ATOM   171  N N   . PHE A 1 37  ? 9.155   -10.809 -15.363 1.00 34.64  ? 251 PHE A N   1 
ATOM   172  C CA  . PHE A 1 37  ? 10.138  -10.918 -16.436 1.00 33.92  ? 251 PHE A CA  1 
ATOM   173  C C   . PHE A 1 37  ? 9.599   -10.220 -17.674 1.00 35.34  ? 251 PHE A C   1 
ATOM   174  O O   . PHE A 1 37  ? 10.282  -9.405  -18.293 1.00 33.72  ? 251 PHE A O   1 
ATOM   175  C CB  . PHE A 1 37  ? 10.458  -12.379 -16.749 1.00 33.36  ? 251 PHE A CB  1 
ATOM   176  C CG  . PHE A 1 37  ? 10.908  -13.169 -15.557 1.00 32.96  ? 251 PHE A CG  1 
ATOM   177  C CD1 . PHE A 1 37  ? 12.118  -12.896 -14.946 1.00 34.93  ? 251 PHE A CD1 1 
ATOM   178  C CD2 . PHE A 1 37  ? 10.123  -14.193 -15.053 1.00 33.67  ? 251 PHE A CD2 1 
ATOM   179  C CE1 . PHE A 1 37  ? 12.534  -13.624 -13.849 1.00 35.11  ? 251 PHE A CE1 1 
ATOM   180  C CE2 . PHE A 1 37  ? 10.535  -14.924 -13.958 1.00 34.66  ? 251 PHE A CE2 1 
ATOM   181  C CZ  . PHE A 1 37  ? 11.743  -14.641 -13.358 1.00 35.82  ? 251 PHE A CZ  1 
ATOM   182  N N   . VAL A 1 38  ? 8.350   -10.517 -17.999 1.00 34.32  ? 252 VAL A N   1 
ATOM   183  C CA  . VAL A 1 38  ? 7.626   -9.923  -19.102 1.00 34.23  ? 252 VAL A CA  1 
ATOM   184  C C   . VAL A 1 38  ? 6.188   -9.700  -18.666 1.00 37.33  ? 252 VAL A C   1 
ATOM   185  O O   . VAL A 1 38  ? 5.735   -10.321 -17.744 1.00 38.41  ? 252 VAL A O   1 
ATOM   186  C CB  . VAL A 1 38  ? 7.645   -10.765 -20.363 1.00 33.80  ? 252 VAL A CB  1 
ATOM   187  C CG1 . VAL A 1 38  ? 9.046   -10.921 -20.887 1.00 31.28  ? 252 VAL A CG1 1 
ATOM   188  C CG2 . VAL A 1 38  ? 6.957   -12.090 -20.151 1.00 32.83  ? 252 VAL A CG2 1 
ATOM   189  N N   . HIS A 1 39  ? 5.490   -8.803  -19.332 1.00 37.75  ? 253 HIS A N   1 
ATOM   190  C CA  . HIS A 1 39  ? 4.129   -8.462  -18.983 1.00 39.72  ? 253 HIS A CA  1 
ATOM   191  C C   . HIS A 1 39  ? 3.377   -7.763  -20.080 1.00 39.28  ? 253 HIS A C   1 
ATOM   192  O O   . HIS A 1 39  ? 3.850   -6.844  -20.675 1.00 40.96  ? 253 HIS A O   1 
ATOM   193  C CB  . HIS A 1 39  ? 4.161   -7.554  -17.785 1.00 45.44  ? 253 HIS A CB  1 
ATOM   194  C CG  . HIS A 1 39  ? 2.825   -7.235  -17.221 1.00 52.76  ? 253 HIS A CG  1 
ATOM   195  N ND1 . HIS A 1 39  ? 1.787   -8.134  -17.197 1.00 54.00  ? 253 HIS A ND1 1 
ATOM   196  C CD2 . HIS A 1 39  ? 2.361   -6.114  -16.631 1.00 56.89  ? 253 HIS A CD2 1 
ATOM   197  C CE1 . HIS A 1 39  ? 0.743   -7.583  -16.617 1.00 57.42  ? 253 HIS A CE1 1 
ATOM   198  N NE2 . HIS A 1 39  ? 1.064   -6.357  -16.265 1.00 59.39  ? 253 HIS A NE2 1 
ATOM   199  N N   . ILE A 1 40  ? 2.182   -8.230  -20.336 1.00 39.01  ? 254 ILE A N   1 
ATOM   200  C CA  . ILE A 1 40  ? 1.345   -7.630  -21.328 1.00 40.38  ? 254 ILE A CA  1 
ATOM   201  C C   . ILE A 1 40  ? 0.034   -7.372  -20.656 1.00 43.42  ? 254 ILE A C   1 
ATOM   202  O O   . ILE A 1 40  ? -0.563  -8.259  -20.125 1.00 43.00  ? 254 ILE A O   1 
ATOM   203  C CB  . ILE A 1 40  ? 1.060   -8.542  -22.504 1.00 38.48  ? 254 ILE A CB  1 
ATOM   204  C CG1 . ILE A 1 40  ? 2.326   -8.878  -23.235 1.00 37.63  ? 254 ILE A CG1 1 
ATOM   205  C CG2 . ILE A 1 40  ? 0.088   -7.892  -23.455 1.00 41.52  ? 254 ILE A CG2 1 
ATOM   206  C CD1 . ILE A 1 40  ? 2.101   -9.629  -24.498 1.00 37.21  ? 254 ILE A CD1 1 
ATOM   207  N N   . SER A 1 41  ? -0.396  -6.132  -20.686 1.00 45.14  ? 255 SER A N   1 
ATOM   208  C CA  . SER A 1 41  ? -1.675  -5.794  -20.108 1.00 53.07  ? 255 SER A CA  1 
ATOM   209  C C   . SER A 1 41  ? -2.467  -5.105  -21.174 1.00 57.05  ? 255 SER A C   1 
ATOM   210  O O   . SER A 1 41  ? -1.930  -4.366  -21.961 1.00 57.93  ? 255 SER A O   1 
ATOM   211  C CB  . SER A 1 41  ? -1.534  -4.920  -18.911 1.00 57.22  ? 255 SER A CB  1 
ATOM   212  O OG  . SER A 1 41  ? -2.808  -4.549  -18.496 1.00 59.81  ? 255 SER A OG  1 
ATOM   213  N N   . GLN A 1 42  ? -3.755  -5.366  -21.220 1.00 64.21  ? 256 GLN A N   1 
ATOM   214  C CA  . GLN A 1 42  ? -4.578  -4.762  -22.240 1.00 68.69  ? 256 GLN A CA  1 
ATOM   215  C C   . GLN A 1 42  ? -5.973  -4.449  -21.770 1.00 74.02  ? 256 GLN A C   1 
ATOM   216  O O   . GLN A 1 42  ? -6.893  -5.198  -22.037 1.00 75.49  ? 256 GLN A O   1 
ATOM   217  C CB  . GLN A 1 42  ? -4.600  -5.670  -23.446 1.00 68.08  ? 256 GLN A CB  1 
ATOM   218  C CG  . GLN A 1 42  ? -3.323  -5.635  -24.230 1.00 68.00  ? 256 GLN A CG  1 
ATOM   219  C CD  . GLN A 1 42  ? -3.411  -6.395  -25.501 1.00 70.24  ? 256 GLN A CD  1 
ATOM   220  O OE1 . GLN A 1 42  ? -2.733  -6.084  -26.457 1.00 72.01  ? 256 GLN A OE1 1 
ATOM   221  N NE2 . GLN A 1 42  ? -4.248  -7.392  -25.530 1.00 70.13  ? 256 GLN A NE2 1 
ATOM   222  N N   . LEU A 1 52  ? -1.095  -1.611  -35.892 1.00 66.41  ? 266 LEU A N   1 
ATOM   223  C CA  . LEU A 1 52  ? -0.187  -2.735  -35.687 1.00 62.41  ? 266 LEU A CA  1 
ATOM   224  C C   . LEU A 1 52  ? 0.708   -2.945  -36.905 1.00 60.66  ? 266 LEU A C   1 
ATOM   225  O O   . LEU A 1 52  ? 0.221   -3.106  -38.024 1.00 58.75  ? 266 LEU A O   1 
ATOM   226  C CB  . LEU A 1 52  ? -0.975  -4.013  -35.383 1.00 59.73  ? 266 LEU A CB  1 
ATOM   227  C CG  . LEU A 1 52  ? -0.726  -4.683  -34.029 1.00 54.32  ? 266 LEU A CG  1 
ATOM   228  C CD1 . LEU A 1 52  ? -0.947  -3.707  -32.882 1.00 53.59  ? 266 LEU A CD1 1 
ATOM   229  C CD2 . LEU A 1 52  ? -1.611  -5.912  -33.869 1.00 54.16  ? 266 LEU A CD2 1 
ATOM   230  N N   . GLU A 1 53  ? 2.019   -2.938  -36.680 1.00 59.47  ? 267 GLU A N   1 
ATOM   231  C CA  . GLU A 1 53  ? 2.984   -3.132  -37.756 1.00 61.69  ? 267 GLU A CA  1 
ATOM   232  C C   . GLU A 1 53  ? 3.002   -4.593  -38.201 1.00 58.72  ? 267 GLU A C   1 
ATOM   233  O O   . GLU A 1 53  ? 2.510   -5.470  -37.493 1.00 54.82  ? 267 GLU A O   1 
ATOM   234  C CB  . GLU A 1 53  ? 4.378   -2.684  -37.309 1.00 64.49  ? 267 GLU A CB  1 
ATOM   235  C CG  . GLU A 1 53  ? 4.432   -1.236  -36.834 1.00 71.84  ? 267 GLU A CG  1 
ATOM   236  C CD  . GLU A 1 53  ? 5.786   -0.845  -36.270 1.00 75.41  ? 267 GLU A CD  1 
ATOM   237  O OE1 . GLU A 1 53  ? 5.835   0.082   -35.432 1.00 77.42  ? 267 GLU A OE1 1 
ATOM   238  O OE2 . GLU A 1 53  ? 6.802   -1.457  -36.664 1.00 75.63  ? 267 GLU A OE2 1 
ATOM   239  N N   . SER A 1 54  ? 3.571   -4.849  -39.376 1.00 62.13  ? 268 SER A N   1 
ATOM   240  C CA  . SER A 1 54  ? 3.547   -6.186  -39.960 1.00 61.59  ? 268 SER A CA  1 
ATOM   241  C C   . SER A 1 54  ? 4.928   -6.833  -40.020 1.00 62.07  ? 268 SER A C   1 
ATOM   242  O O   . SER A 1 54  ? 5.946   -6.149  -40.132 1.00 64.16  ? 268 SER A O   1 
ATOM   243  C CB  . SER A 1 54  ? 2.948   -6.136  -41.367 1.00 65.79  ? 268 SER A CB  1 
ATOM   244  O OG  . SER A 1 54  ? 1.643   -5.586  -41.348 1.00 69.15  ? 268 SER A OG  1 
ATOM   245  N N   . VAL A 1 55  ? 4.949   -8.160  -39.943 1.00 61.01  ? 269 VAL A N   1 
ATOM   246  C CA  . VAL A 1 55  ? 6.176   -8.933  -40.096 1.00 59.75  ? 269 VAL A CA  1 
ATOM   247  C C   . VAL A 1 55  ? 5.910   -10.150 -40.974 1.00 57.70  ? 269 VAL A C   1 
ATOM   248  O O   . VAL A 1 55  ? 4.984   -10.919 -40.713 1.00 55.63  ? 269 VAL A O   1 
ATOM   249  C CB  . VAL A 1 55  ? 6.741   -9.395  -38.734 1.00 56.45  ? 269 VAL A CB  1 
ATOM   250  C CG1 . VAL A 1 55  ? 7.829   -10.441 -38.932 1.00 55.47  ? 269 VAL A CG1 1 
ATOM   251  C CG2 . VAL A 1 55  ? 7.273   -8.207  -37.944 1.00 56.48  ? 269 VAL A CG2 1 
ATOM   252  N N   . ASP A 1 56  ? 6.712   -10.316 -42.021 1.00 58.25  ? 270 ASP A N   1 
ATOM   253  C CA  . ASP A 1 56  ? 6.554   -11.456 -42.914 1.00 60.20  ? 270 ASP A CA  1 
ATOM   254  C C   . ASP A 1 56  ? 6.861   -12.753 -42.175 1.00 57.91  ? 270 ASP A C   1 
ATOM   255  O O   . ASP A 1 56  ? 7.973   -12.951 -41.684 1.00 57.60  ? 270 ASP A O   1 
ATOM   256  C CB  . ASP A 1 56  ? 7.453   -11.316 -44.140 1.00 67.35  ? 270 ASP A CB  1 
ATOM   257  C CG  . ASP A 1 56  ? 7.084   -12.288 -45.240 1.00 73.73  ? 270 ASP A CG  1 
ATOM   258  O OD1 . ASP A 1 56  ? 6.228   -11.940 -46.081 1.00 79.36  ? 270 ASP A OD1 1 
ATOM   259  O OD2 . ASP A 1 56  ? 7.645   -13.403 -45.261 1.00 74.09  ? 270 ASP A OD2 1 
ATOM   260  N N   . VAL A 1 57  ? 5.864   -13.630 -42.106 1.00 55.19  ? 271 VAL A N   1 
ATOM   261  C CA  . VAL A 1 57  ? 5.948   -14.856 -41.317 1.00 53.93  ? 271 VAL A CA  1 
ATOM   262  C C   . VAL A 1 57  ? 7.076   -15.779 -41.791 1.00 57.55  ? 271 VAL A C   1 
ATOM   263  O O   . VAL A 1 57  ? 7.681   -16.495 -40.991 1.00 56.45  ? 271 VAL A O   1 
ATOM   264  C CB  . VAL A 1 57  ? 4.595   -15.618 -41.346 1.00 44.49  ? 271 VAL A CB  1 
ATOM   265  C CG1 . VAL A 1 57  ? 4.193   -15.963 -42.775 1.00 48.07  ? 271 VAL A CG1 1 
ATOM   266  C CG2 . VAL A 1 57  ? 4.648   -16.866 -40.478 1.00 41.20  ? 271 VAL A CG2 1 
ATOM   267  N N   . ARG A 1 58  ? 7.373   -15.707 -43.069 1.00 62.64  ? 272 ARG A N   1 
ATOM   268  C CA  . ARG A 1 58  ? 8.412   -16.518 -43.673 1.00 67.93  ? 272 ARG A CA  1 
ATOM   269  C C   . ARG A 1 58  ? 9.778   -16.223 -43.110 1.00 70.05  ? 272 ARG A C   1 
ATOM   270  O O   . ARG A 1 58  ? 10.656  -17.053 -43.152 1.00 72.55  ? 272 ARG A O   1 
ATOM   271  C CB  . ARG A 1 58  ? 8.447   -16.283 -45.179 1.00 72.93  ? 272 ARG A CB  1 
ATOM   272  C CG  . ARG A 1 58  ? 7.454   -17.112 -45.961 1.00 75.50  ? 272 ARG A CG  1 
ATOM   273  C CD  . ARG A 1 58  ? 7.219   -16.528 -47.339 1.00 81.96  ? 272 ARG A CD  1 
ATOM   274  N NE  . ARG A 1 58  ? 7.001   -15.094 -47.276 1.00 84.51  ? 272 ARG A NE  1 
ATOM   275  C CZ  . ARG A 1 58  ? 6.269   -14.410 -48.148 1.00 88.48  ? 272 ARG A CZ  1 
ATOM   276  N NH1 . ARG A 1 58  ? 5.687   -15.035 -49.158 1.00 91.26  ? 272 ARG A NH1 1 
ATOM   277  N NH2 . ARG A 1 58  ? 6.118   -13.103 -48.009 1.00 89.25  ? 272 ARG A NH2 1 
ATOM   278  N N   . GLN A 1 59  ? 9.939   -15.032 -42.581 1.00 69.17  ? 273 GLN A N   1 
ATOM   279  C CA  . GLN A 1 59  ? 11.215  -14.572 -42.046 1.00 69.38  ? 273 GLN A CA  1 
ATOM   280  C C   . GLN A 1 59  ? 11.526  -15.203 -40.691 1.00 66.19  ? 273 GLN A C   1 
ATOM   281  O O   . GLN A 1 59  ? 12.656  -15.126 -40.210 1.00 66.58  ? 273 GLN A O   1 
ATOM   282  C CB  . GLN A 1 59  ? 11.223  -13.046 -41.923 1.00 69.17  ? 273 GLN A CB  1 
ATOM   283  N N   . ILE A 1 60  ? 10.526  -15.824 -40.074 1.00 63.48  ? 274 ILE A N   1 
ATOM   284  C CA  . ILE A 1 60  ? 10.729  -16.456 -38.775 1.00 61.19  ? 274 ILE A CA  1 
ATOM   285  C C   . ILE A 1 60  ? 10.338  -17.935 -38.782 1.00 60.23  ? 274 ILE A C   1 
ATOM   286  O O   . ILE A 1 60  ? 10.088  -18.522 -37.728 1.00 58.06  ? 274 ILE A O   1 
ATOM   287  C CB  . ILE A 1 60  ? 9.945   -15.725 -37.663 1.00 58.59  ? 274 ILE A CB  1 
ATOM   288  C CG1 . ILE A 1 60  ? 8.442   -15.756 -37.941 1.00 58.62  ? 274 ILE A CG1 1 
ATOM   289  C CG2 . ILE A 1 60  ? 10.429  -14.288 -37.524 1.00 58.12  ? 274 ILE A CG2 1 
ATOM   290  C CD1 . ILE A 1 60  ? 7.610   -15.201 -36.804 1.00 56.70  ? 274 ILE A CD1 1 
ATOM   291  N N   . TYR A 1 61  ? 10.286  -18.555 -39.940 1.00 61.83  ? 275 TYR A N   1 
ATOM   292  C CA  . TYR A 1 61  ? 9.945   -19.958 -40.010 1.00 59.62  ? 275 TYR A CA  1 
ATOM   293  C C   . TYR A 1 61  ? 11.031  -20.791 -39.348 1.00 59.24  ? 275 TYR A C   1 
ATOM   294  O O   . TYR A 1 61  ? 10.770  -21.815 -38.792 1.00 57.97  ? 275 TYR A O   1 
ATOM   295  C CB  . TYR A 1 61  ? 9.919   -20.407 -41.455 1.00 60.23  ? 275 TYR A CB  1 
ATOM   296  C CG  . TYR A 1 61  ? 8.669   -20.190 -42.257 1.00 59.70  ? 275 TYR A CG  1 
ATOM   297  C CD1 . TYR A 1 61  ? 7.522   -19.670 -41.714 1.00 57.49  ? 275 TYR A CD1 1 
ATOM   298  C CD2 . TYR A 1 61  ? 8.654   -20.505 -43.584 1.00 63.96  ? 275 TYR A CD2 1 
ATOM   299  C CE1 . TYR A 1 61  ? 6.392   -19.488 -42.480 1.00 58.19  ? 275 TYR A CE1 1 
ATOM   300  C CE2 . TYR A 1 61  ? 7.533   -20.335 -44.353 1.00 65.81  ? 275 TYR A CE2 1 
ATOM   301  C CZ  . TYR A 1 61  ? 6.410   -19.817 -43.801 1.00 62.28  ? 275 TYR A CZ  1 
ATOM   302  O OH  . TYR A 1 61  ? 5.325   -19.655 -44.595 1.00 63.00  ? 275 TYR A OH  1 
ATOM   303  N N   . ASP A 1 62  ? 12.266  -20.351 -39.464 1.00 59.62  ? 276 ASP A N   1 
ATOM   304  C CA  . ASP A 1 62  ? 13.372  -21.106 -38.927 1.00 61.15  ? 276 ASP A CA  1 
ATOM   305  C C   . ASP A 1 62  ? 13.562  -21.037 -37.442 1.00 55.61  ? 276 ASP A C   1 
ATOM   306  O O   . ASP A 1 62  ? 14.431  -21.694 -36.915 1.00 55.68  ? 276 ASP A O   1 
ATOM   307  C CB  . ASP A 1 62  ? 14.678  -20.744 -39.622 1.00 66.78  ? 276 ASP A CB  1 
ATOM   308  C CG  . ASP A 1 62  ? 15.016  -19.284 -39.539 1.00 68.44  ? 276 ASP A CG  1 
ATOM   309  O OD1 . ASP A 1 62  ? 14.621  -18.586 -38.606 1.00 64.66  ? 276 ASP A OD1 1 
ATOM   310  O OD2 . ASP A 1 62  ? 15.725  -18.829 -40.438 1.00 74.38  ? 276 ASP A OD2 1 
ATOM   311  N N   . LYS A 1 63  ? 12.753  -20.243 -36.769 1.00 52.06  ? 277 LYS A N   1 
ATOM   312  C CA  . LYS A 1 63  ? 12.874  -20.133 -35.348 1.00 49.76  ? 277 LYS A CA  1 
ATOM   313  C C   . LYS A 1 63  ? 11.953  -21.112 -34.657 1.00 43.77  ? 277 LYS A C   1 
ATOM   314  O O   . LYS A 1 63  ? 11.848  -21.125 -33.472 1.00 37.82  ? 277 LYS A O   1 
ATOM   315  C CB  . LYS A 1 63  ? 12.605  -18.711 -34.924 1.00 51.39  ? 277 LYS A CB  1 
ATOM   316  C CG  . LYS A 1 63  ? 13.598  -17.720 -35.483 1.00 58.51  ? 277 LYS A CG  1 
ATOM   317  C CD  . LYS A 1 63  ? 12.966  -16.358 -35.614 1.00 60.19  ? 277 LYS A CD  1 
ATOM   318  C CE  . LYS A 1 63  ? 13.746  -15.289 -34.890 1.00 61.06  ? 277 LYS A CE  1 
ATOM   319  N NZ  . LYS A 1 63  ? 15.204  -15.539 -34.929 1.00 66.06  ? 277 LYS A NZ  1 
ATOM   320  N N   . PHE A 1 64  ? 11.305  -21.944 -35.448 1.00 45.86  ? 278 PHE A N   1 
ATOM   321  C CA  . PHE A 1 64  ? 10.377  -22.960 -34.961 1.00 42.90  ? 278 PHE A CA  1 
ATOM   322  C C   . PHE A 1 64  ? 10.512  -24.199 -35.850 1.00 44.74  ? 278 PHE A C   1 
ATOM   323  O O   . PHE A 1 64  ? 11.068  -24.102 -36.941 1.00 44.19  ? 278 PHE A O   1 
ATOM   324  C CB  . PHE A 1 64  ? 8.944   -22.415 -34.962 1.00 40.16  ? 278 PHE A CB  1 
ATOM   325  C CG  . PHE A 1 64  ? 8.797   -21.100 -34.248 1.00 36.25  ? 278 PHE A CG  1 
ATOM   326  C CD1 . PHE A 1 64  ? 8.634   -21.057 -32.873 1.00 34.44  ? 278 PHE A CD1 1 
ATOM   327  C CD2 . PHE A 1 64  ? 8.833   -19.907 -34.950 1.00 39.85  ? 278 PHE A CD2 1 
ATOM   328  C CE1 . PHE A 1 64  ? 8.503   -19.850 -32.212 1.00 31.46  ? 278 PHE A CE1 1 
ATOM   329  C CE2 . PHE A 1 64  ? 8.705   -18.695 -34.294 1.00 39.69  ? 278 PHE A CE2 1 
ATOM   330  C CZ  . PHE A 1 64  ? 8.540   -18.668 -32.922 1.00 34.42  ? 278 PHE A CZ  1 
ATOM   331  N N   . PRO A 1 65  ? 10.022  -25.334 -35.387 1.00 48.26  ? 279 PRO A N   1 
ATOM   332  C CA  . PRO A 1 65  ? 10.100  -26.584 -36.131 1.00 55.97  ? 279 PRO A CA  1 
ATOM   333  C C   . PRO A 1 65  ? 9.536   -26.397 -37.504 1.00 59.95  ? 279 PRO A C   1 
ATOM   334  O O   . PRO A 1 65  ? 8.477   -25.875 -37.701 1.00 55.15  ? 279 PRO A O   1 
ATOM   335  C CB  . PRO A 1 65  ? 9.244   -27.519 -35.311 1.00 55.49  ? 279 PRO A CB  1 
ATOM   336  C CG  . PRO A 1 65  ? 9.417   -27.040 -33.942 1.00 50.35  ? 279 PRO A CG  1 
ATOM   337  C CD  . PRO A 1 65  ? 9.608   -25.562 -34.005 1.00 45.82  ? 279 PRO A CD  1 
ATOM   338  N N   . GLU A 1 66  ? 10.308  -26.836 -38.467 1.00 67.67  ? 280 GLU A N   1 
ATOM   339  C CA  . GLU A 1 66  ? 9.973   -26.653 -39.851 1.00 75.73  ? 280 GLU A CA  1 
ATOM   340  C C   . GLU A 1 66  ? 9.092   -27.676 -40.484 1.00 78.72  ? 280 GLU A C   1 
ATOM   341  O O   . GLU A 1 66  ? 8.812   -27.553 -41.654 1.00 81.11  ? 280 GLU A O   1 
ATOM   342  C CB  . GLU A 1 66  ? 11.253  -26.601 -40.651 1.00 84.65  ? 280 GLU A CB  1 
ATOM   343  C CG  . GLU A 1 66  ? 12.373  -25.854 -39.950 1.00 88.19  ? 280 GLU A CG  1 
ATOM   344  C CD  . GLU A 1 66  ? 12.308  -24.377 -40.201 1.00 86.91  ? 280 GLU A CD  1 
ATOM   345  O OE1 . GLU A 1 66  ? 12.054  -24.022 -41.356 1.00 88.08  ? 280 GLU A OE1 1 
ATOM   346  O OE2 . GLU A 1 66  ? 12.504  -23.591 -39.255 1.00 83.79  ? 280 GLU A OE2 1 
ATOM   347  N N   . LYS A 1 67  ? 8.693   -28.701 -39.744 1.00 79.90  ? 281 LYS A N   1 
ATOM   348  C CA  . LYS A 1 67  ? 7.878   -29.756 -40.329 1.00 85.77  ? 281 LYS A CA  1 
ATOM   349  C C   . LYS A 1 67  ? 6.393   -29.989 -40.111 1.00 87.17  ? 281 LYS A C   1 
ATOM   350  O O   . LYS A 1 67  ? 5.578   -29.789 -41.011 1.00 85.60  ? 281 LYS A O   1 
ATOM   351  C CB  . LYS A 1 67  ? 8.454   -31.129 -39.969 1.00 88.24  ? 281 LYS A CB  1 
ATOM   352  N N   . LYS A 1 68  ? 6.053   -30.427 -38.906 1.00 90.40  ? 282 LYS A N   1 
ATOM   353  C CA  . LYS A 1 68  ? 4.684   -30.512 -38.468 1.00 90.46  ? 282 LYS A CA  1 
ATOM   354  C C   . LYS A 1 68  ? 4.460   -29.593 -37.308 1.00 89.05  ? 282 LYS A C   1 
ATOM   355  O O   . LYS A 1 68  ? 5.273   -29.507 -36.385 1.00 87.51  ? 282 LYS A O   1 
ATOM   356  C CB  . LYS A 1 68  ? 4.345   -31.923 -38.043 1.00 92.43  ? 282 LYS A CB  1 
ATOM   357  N N   . GLY A 1 69  ? 3.325   -28.916 -37.347 1.00 89.19  ? 283 GLY A N   1 
ATOM   358  C CA  . GLY A 1 69  ? 3.002   -27.987 -36.295 1.00 85.71  ? 283 GLY A CA  1 
ATOM   359  C C   . GLY A 1 69  ? 4.044   -26.905 -36.291 1.00 83.24  ? 283 GLY A C   1 
ATOM   360  O O   . GLY A 1 69  ? 4.283   -26.269 -35.279 1.00 82.61  ? 283 GLY A O   1 
ATOM   361  N N   . GLY A 1 70  ? 4.677   -26.711 -37.437 1.00 82.60  ? 284 GLY A N   1 
ATOM   362  C CA  . GLY A 1 70  ? 5.675   -25.692 -37.588 1.00 76.38  ? 284 GLY A CA  1 
ATOM   363  C C   . GLY A 1 70  ? 4.815   -24.519 -37.923 1.00 69.01  ? 284 GLY A C   1 
ATOM   364  O O   . GLY A 1 70  ? 3.651   -24.678 -38.149 1.00 69.87  ? 284 GLY A O   1 
ATOM   365  N N   . LEU A 1 71  ? 5.401   -23.351 -37.945 1.00 61.29  ? 285 LEU A N   1 
ATOM   366  C CA  . LEU A 1 71  ? 4.699   -22.159 -38.235 1.00 55.30  ? 285 LEU A CA  1 
ATOM   367  C C   . LEU A 1 71  ? 4.140   -22.143 -39.649 1.00 58.93  ? 285 LEU A C   1 
ATOM   368  O O   . LEU A 1 71  ? 3.062   -21.667 -39.871 1.00 59.66  ? 285 LEU A O   1 
ATOM   369  C CB  . LEU A 1 71  ? 5.653   -21.008 -38.036 1.00 49.55  ? 285 LEU A CB  1 
ATOM   370  C CG  . LEU A 1 71  ? 5.057   -19.636 -37.955 1.00 45.40  ? 285 LEU A CG  1 
ATOM   371  C CD1 . LEU A 1 71  ? 3.854   -19.643 -37.061 1.00 41.92  ? 285 LEU A CD1 1 
ATOM   372  C CD2 . LEU A 1 71  ? 6.060   -18.623 -37.501 1.00 43.01  ? 285 LEU A CD2 1 
ATOM   373  N N   . ARG A 1 72  ? 4.874   -22.706 -40.592 1.00 61.66  ? 286 ARG A N   1 
ATOM   374  C CA  . ARG A 1 72  ? 4.441   -22.754 -41.984 1.00 64.52  ? 286 ARG A CA  1 
ATOM   375  C C   . ARG A 1 72  ? 3.143   -23.491 -42.168 1.00 64.87  ? 286 ARG A C   1 
ATOM   376  O O   . ARG A 1 72  ? 2.243   -23.013 -42.826 1.00 65.86  ? 286 ARG A O   1 
ATOM   377  C CB  . ARG A 1 72  ? 5.512   -23.397 -42.850 1.00 68.77  ? 286 ARG A CB  1 
ATOM   378  C CG  . ARG A 1 72  ? 5.215   -23.417 -44.342 1.00 75.26  ? 286 ARG A CG  1 
ATOM   379  C CD  . ARG A 1 72  ? 6.099   -24.411 -45.080 1.00 82.53  ? 286 ARG A CD  1 
ATOM   380  N NE  . ARG A 1 72  ? 5.700   -25.794 -44.830 1.00 86.25  ? 286 ARG A NE  1 
ATOM   381  C CZ  . ARG A 1 72  ? 4.794   -26.459 -45.537 1.00 90.30  ? 286 ARG A CZ  1 
ATOM   382  N NH1 . ARG A 1 72  ? 4.184   -25.884 -46.563 1.00 92.01  ? 286 ARG A NH1 1 
ATOM   383  N NH2 . ARG A 1 72  ? 4.503   -27.706 -45.225 1.00 91.75  ? 286 ARG A NH2 1 
ATOM   384  N N   . GLU A 1 73  ? 3.053   -24.665 -41.581 1.00 64.53  ? 287 GLU A N   1 
ATOM   385  C CA  . GLU A 1 73  ? 1.868   -25.465 -41.710 1.00 66.93  ? 287 GLU A CA  1 
ATOM   386  C C   . GLU A 1 73  ? 0.668   -24.840 -41.069 1.00 60.31  ? 287 GLU A C   1 
ATOM   387  O O   . GLU A 1 73  ? -0.415  -24.919 -41.605 1.00 59.98  ? 287 GLU A O   1 
ATOM   388  C CB  . GLU A 1 73  ? 2.087   -26.849 -41.144 1.00 73.52  ? 287 GLU A CB  1 
ATOM   389  C CG  . GLU A 1 73  ? 1.147   -27.871 -41.746 1.00 80.66  ? 287 GLU A CG  1 
ATOM   390  C CD  . GLU A 1 73  ? 0.880   -29.033 -40.830 1.00 84.42  ? 287 GLU A CD  1 
ATOM   391  O OE1 . GLU A 1 73  ? -0.293  -29.409 -40.669 1.00 86.35  ? 287 GLU A OE1 1 
ATOM   392  O OE2 . GLU A 1 73  ? 1.849   -29.571 -40.288 1.00 84.78  ? 287 GLU A OE2 1 
ATOM   393  N N   . LEU A 1 74  ? 0.862   -24.217 -39.920 1.00 55.85  ? 288 LEU A N   1 
ATOM   394  C CA  . LEU A 1 74  ? -0.236  -23.583 -39.231 1.00 51.84  ? 288 LEU A CA  1 
ATOM   395  C C   . LEU A 1 74  ? -0.734  -22.401 -40.002 1.00 50.38  ? 288 LEU A C   1 
ATOM   396  O O   . LEU A 1 74  ? -1.892  -22.184 -40.099 1.00 47.56  ? 288 LEU A O   1 
ATOM   397  C CB  . LEU A 1 74  ? 0.185   -23.135 -37.864 1.00 47.11  ? 288 LEU A CB  1 
ATOM   398  C CG  . LEU A 1 74  ? 0.383   -24.233 -36.849 1.00 44.66  ? 288 LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 74  ? 1.217   -23.692 -35.728 1.00 41.81  ? 288 LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 74  ? -0.937  -24.731 -36.330 1.00 41.91  ? 288 LEU A CD2 1 
ATOM   401  N N   . TYR A 1 75  ? 0.170   -21.632 -40.552 1.00 51.84  ? 289 TYR A N   1 
ATOM   402  C CA  . TYR A 1 75  ? -0.244  -20.464 -41.313 1.00 54.33  ? 289 TYR A CA  1 
ATOM   403  C C   . TYR A 1 75  ? -0.960  -20.884 -42.593 1.00 60.00  ? 289 TYR A C   1 
ATOM   404  O O   . TYR A 1 75  ? -1.814  -20.157 -43.099 1.00 61.92  ? 289 TYR A O   1 
ATOM   405  C CB  . TYR A 1 75  ? 0.959   -19.574 -41.635 1.00 54.47  ? 289 TYR A CB  1 
ATOM   406  C CG  . TYR A 1 75  ? 0.580   -18.153 -41.982 1.00 53.55  ? 289 TYR A CG  1 
ATOM   407  C CD1 . TYR A 1 75  ? 0.544   -17.165 -41.007 1.00 49.64  ? 289 TYR A CD1 1 
ATOM   408  C CD2 . TYR A 1 75  ? 0.251   -17.801 -43.284 1.00 57.47  ? 289 TYR A CD2 1 
ATOM   409  C CE1 . TYR A 1 75  ? 0.193   -15.865 -41.320 1.00 50.65  ? 289 TYR A CE1 1 
ATOM   410  C CE2 . TYR A 1 75  ? -0.102  -16.506 -43.606 1.00 60.02  ? 289 TYR A CE2 1 
ATOM   411  C CZ  . TYR A 1 75  ? -0.128  -15.542 -42.621 1.00 56.40  ? 289 TYR A CZ  1 
ATOM   412  O OH  . TYR A 1 75  ? -0.478  -14.250 -42.941 1.00 59.83  ? 289 TYR A OH  1 
ATOM   413  N N   . ASP A 1 76  ? -0.616  -22.062 -43.107 1.00 63.48  ? 290 ASP A N   1 
ATOM   414  C CA  . ASP A 1 76  ? -1.276  -22.598 -44.296 1.00 69.36  ? 290 ASP A CA  1 
ATOM   415  C C   . ASP A 1 76  ? -2.750  -22.893 -44.025 1.00 69.84  ? 290 ASP A C   1 
ATOM   416  O O   . ASP A 1 76  ? -3.616  -22.541 -44.825 1.00 74.00  ? 290 ASP A O   1 
ATOM   417  C CB  . ASP A 1 76  ? -0.572  -23.867 -44.788 1.00 73.79  ? 290 ASP A CB  1 
ATOM   418  C CG  . ASP A 1 76  ? 0.681   -23.569 -45.591 1.00 77.14  ? 290 ASP A CG  1 
ATOM   419  O OD1 . ASP A 1 76  ? 0.815   -22.430 -46.086 1.00 78.27  ? 290 ASP A OD1 1 
ATOM   420  O OD2 . ASP A 1 76  ? 1.526   -24.477 -45.736 1.00 78.99  ? 290 ASP A OD2 1 
ATOM   421  N N   . ARG A 1 77  ? -3.028  -23.539 -42.896 1.00 67.10  ? 291 ARG A N   1 
ATOM   422  C CA  . ARG A 1 77  ? -4.401  -23.855 -42.514 1.00 68.75  ? 291 ARG A CA  1 
ATOM   423  C C   . ARG A 1 77  ? -5.185  -22.595 -42.159 1.00 67.79  ? 291 ARG A C   1 
ATOM   424  O O   . ARG A 1 77  ? -6.393  -22.527 -42.379 1.00 73.14  ? 291 ARG A O   1 
ATOM   425  C CB  . ARG A 1 77  ? -4.422  -24.838 -41.339 1.00 71.07  ? 291 ARG A CB  1 
ATOM   426  C CG  . ARG A 1 77  ? -4.197  -26.286 -41.747 1.00 78.95  ? 291 ARG A CG  1 
ATOM   427  C CD  . ARG A 1 77  ? -3.073  -26.931 -40.950 1.00 81.64  ? 291 ARG A CD  1 
ATOM   428  N NE  . ARG A 1 77  ? -3.442  -27.184 -39.559 1.00 83.42  ? 291 ARG A NE  1 
ATOM   429  C CZ  . ARG A 1 77  ? -2.627  -27.729 -38.660 1.00 82.77  ? 291 ARG A CZ  1 
ATOM   430  N NH1 . ARG A 1 77  ? -1.395  -28.076 -39.006 1.00 81.81  ? 291 ARG A NH1 1 
ATOM   431  N NH2 . ARG A 1 77  ? -3.040  -27.926 -37.416 1.00 82.80  ? 291 ARG A NH2 1 
ATOM   432  N N   . GLY A 1 78  ? -4.491  -21.601 -41.614 1.00 62.94  ? 292 GLY A N   1 
ATOM   433  C CA  . GLY A 1 78  ? -5.109  -20.331 -41.274 1.00 60.28  ? 292 GLY A CA  1 
ATOM   434  C C   . GLY A 1 78  ? -5.941  -20.395 -40.007 1.00 56.87  ? 292 GLY A C   1 
ATOM   435  O O   . GLY A 1 78  ? -5.876  -21.380 -39.272 1.00 55.84  ? 292 GLY A O   1 
ATOM   436  N N   . PRO A 1 79  ? -6.729  -19.340 -39.738 1.00 55.86  ? 293 PRO A N   1 
ATOM   437  C CA  . PRO A 1 79  ? -6.815  -18.122 -40.554 1.00 56.41  ? 293 PRO A CA  1 
ATOM   438  C C   . PRO A 1 79  ? -5.649  -17.166 -40.304 1.00 51.50  ? 293 PRO A C   1 
ATOM   439  O O   . PRO A 1 79  ? -5.165  -17.085 -39.177 1.00 43.97  ? 293 PRO A O   1 
ATOM   440  C CB  . PRO A 1 79  ? -8.140  -17.498 -40.104 1.00 58.71  ? 293 PRO A CB  1 
ATOM   441  C CG  . PRO A 1 79  ? -8.290  -17.940 -38.695 1.00 56.76  ? 293 PRO A CG  1 
ATOM   442  C CD  . PRO A 1 79  ? -7.687  -19.320 -38.618 1.00 56.18  ? 293 PRO A CD  1 
ATOM   443  N N   . PRO A 1 80  ? -5.202  -16.457 -41.352 1.00 39.95  ? 294 PRO A N   1 
ATOM   444  C CA  . PRO A 1 80  ? -4.048  -15.548 -41.309 1.00 42.92  ? 294 PRO A CA  1 
ATOM   445  C C   . PRO A 1 80  ? -4.162  -14.433 -40.274 1.00 40.53  ? 294 PRO A C   1 
ATOM   446  O O   . PRO A 1 80  ? -3.140  -13.950 -39.795 1.00 39.64  ? 294 PRO A O   1 
ATOM   447  C CB  . PRO A 1 80  ? -4.020  -14.952 -42.721 1.00 46.53  ? 294 PRO A CB  1 
ATOM   448  C CG  . PRO A 1 80  ? -4.693  -15.965 -43.571 1.00 46.81  ? 294 PRO A CG  1 
ATOM   449  C CD  . PRO A 1 80  ? -5.762  -16.568 -42.710 1.00 42.84  ? 294 PRO A CD  1 
ATOM   450  N N   . HIS A 1 81  ? -5.382  -14.025 -39.938 1.00 44.04  ? 295 HIS A N   1 
ATOM   451  C CA  . HIS A 1 81  ? -5.575  -12.885 -39.047 1.00 40.99  ? 295 HIS A CA  1 
ATOM   452  C C   . HIS A 1 81  ? -5.407  -13.263 -37.577 1.00 38.60  ? 295 HIS A C   1 
ATOM   453  O O   . HIS A 1 81  ? -5.442  -12.400 -36.701 1.00 38.27  ? 295 HIS A O   1 
ATOM   454  C CB  . HIS A 1 81  ? -6.955  -12.264 -39.269 1.00 41.92  ? 295 HIS A CB  1 
ATOM   455  C CG  . HIS A 1 81  ? -8.079  -13.083 -38.716 1.00 44.24  ? 295 HIS A CG  1 
ATOM   456  N ND1 . HIS A 1 81  ? -8.678  -14.102 -39.425 1.00 46.15  ? 295 HIS A ND1 1 
ATOM   457  C CD2 . HIS A 1 81  ? -8.710  -13.036 -37.519 1.00 43.68  ? 295 HIS A CD2 1 
ATOM   458  C CE1 . HIS A 1 81  ? -9.629  -14.646 -38.688 1.00 45.96  ? 295 HIS A CE1 1 
ATOM   459  N NE2 . HIS A 1 81  ? -9.668  -14.019 -37.526 1.00 43.14  ? 295 HIS A NE2 1 
ATOM   460  N N   . ALA A 1 82  ? -5.221  -14.553 -37.309 1.00 37.06  ? 296 ALA A N   1 
ATOM   461  C CA  . ALA A 1 82  ? -5.056  -15.029 -35.940 1.00 36.54  ? 296 ALA A CA  1 
ATOM   462  C C   . ALA A 1 82  ? -3.583  -15.115 -35.535 1.00 37.42  ? 296 ALA A C   1 
ATOM   463  O O   . ALA A 1 82  ? -3.263  -15.532 -34.422 1.00 37.30  ? 296 ALA A O   1 
ATOM   464  C CB  . ALA A 1 82  ? -5.726  -16.386 -35.772 1.00 36.84  ? 296 ALA A CB  1 
ATOM   465  N N   . PHE A 1 83  ? -2.694  -14.707 -36.436 1.00 33.33  ? 297 PHE A N   1 
ATOM   466  C CA  . PHE A 1 83  ? -1.259  -14.877 -36.224 1.00 33.05  ? 297 PHE A CA  1 
ATOM   467  C C   . PHE A 1 83  ? -0.551  -13.593 -35.807 1.00 32.22  ? 297 PHE A C   1 
ATOM   468  O O   . PHE A 1 83  ? -0.637  -12.572 -36.489 1.00 34.26  ? 297 PHE A O   1 
ATOM   469  C CB  . PHE A 1 83  ? -0.607  -15.433 -37.489 1.00 34.22  ? 297 PHE A CB  1 
ATOM   470  C CG  . PHE A 1 83  ? -0.912  -16.879 -37.736 1.00 35.46  ? 297 PHE A CG  1 
ATOM   471  C CD1 . PHE A 1 83  ? -0.016  -17.864 -37.352 1.00 34.62  ? 297 PHE A CD1 1 
ATOM   472  C CD2 . PHE A 1 83  ? -2.100  -17.256 -38.340 1.00 36.69  ? 297 PHE A CD2 1 
ATOM   473  C CE1 . PHE A 1 83  ? -0.294  -19.197 -37.573 1.00 36.41  ? 297 PHE A CE1 1 
ATOM   474  C CE2 . PHE A 1 83  ? -2.385  -18.589 -38.563 1.00 39.83  ? 297 PHE A CE2 1 
ATOM   475  C CZ  . PHE A 1 83  ? -1.481  -19.561 -38.178 1.00 39.28  ? 297 PHE A CZ  1 
ATOM   476  N N   . PHE A 1 84  ? 0.167   -13.663 -34.689 1.00 31.23  ? 298 PHE A N   1 
ATOM   477  C CA  . PHE A 1 84  ? 0.861   -12.500 -34.148 1.00 29.80  ? 298 PHE A CA  1 
ATOM   478  C C   . PHE A 1 84  ? 2.296   -12.816 -33.748 1.00 31.18  ? 298 PHE A C   1 
ATOM   479  O O   . PHE A 1 84  ? 2.632   -13.958 -33.439 1.00 29.51  ? 298 PHE A O   1 
ATOM   480  C CB  . PHE A 1 84  ? 0.108   -11.949 -32.938 1.00 31.48  ? 298 PHE A CB  1 
ATOM   481  C CG  . PHE A 1 84  ? -1.278  -11.477 -33.255 1.00 37.08  ? 298 PHE A CG  1 
ATOM   482  C CD1 . PHE A 1 84  ? -1.513  -10.153 -33.588 1.00 39.24  ? 298 PHE A CD1 1 
ATOM   483  C CD2 . PHE A 1 84  ? -2.348  -12.358 -33.223 1.00 35.58  ? 298 PHE A CD2 1 
ATOM   484  C CE1 . PHE A 1 84  ? -2.793  -9.715  -33.883 1.00 40.09  ? 298 PHE A CE1 1 
ATOM   485  C CE2 . PHE A 1 84  ? -3.627  -11.927 -33.520 1.00 37.76  ? 298 PHE A CE2 1 
ATOM   486  C CZ  . PHE A 1 84  ? -3.850  -10.604 -33.848 1.00 40.36  ? 298 PHE A CZ  1 
ATOM   487  N N   . LEU A 1 85  ? 3.136   -11.786 -33.762 1.00 28.98  ? 299 LEU A N   1 
ATOM   488  C CA  . LEU A 1 85  ? 4.496   -11.889 -33.251 1.00 30.30  ? 299 LEU A CA  1 
ATOM   489  C C   . LEU A 1 85  ? 4.694   -10.891 -32.118 1.00 31.34  ? 299 LEU A C   1 
ATOM   490  O O   . LEU A 1 85  ? 4.339   -9.718  -32.248 1.00 34.79  ? 299 LEU A O   1 
ATOM   491  C CB  . LEU A 1 85  ? 5.518   -11.642 -34.363 1.00 30.06  ? 299 LEU A CB  1 
ATOM   492  C CG  . LEU A 1 85  ? 6.970   -11.453 -33.910 1.00 32.34  ? 299 LEU A CG  1 
ATOM   493  C CD1 . LEU A 1 85  ? 7.524   -12.741 -33.327 1.00 29.68  ? 299 LEU A CD1 1 
ATOM   494  C CD2 . LEU A 1 85  ? 7.836   -10.962 -35.060 1.00 36.18  ? 299 LEU A CD2 1 
ATOM   495  N N   . VAL A 1 86  ? 5.245   -11.361 -31.004 1.00 29.27  ? 300 VAL A N   1 
ATOM   496  C CA  . VAL A 1 86  ? 5.565   -10.481 -29.885 1.00 29.35  ? 300 VAL A CA  1 
ATOM   497  C C   . VAL A 1 86  ? 7.057   -10.485 -29.580 1.00 29.10  ? 300 VAL A C   1 
ATOM   498  O O   . VAL A 1 86  ? 7.635   -11.540 -29.317 1.00 26.76  ? 300 VAL A O   1 
ATOM   499  C CB  . VAL A 1 86  ? 4.817   -10.887 -28.600 1.00 28.74  ? 300 VAL A CB  1 
ATOM   500  C CG1 . VAL A 1 86  ? 5.277   -10.016 -27.429 1.00 27.20  ? 300 VAL A CG1 1 
ATOM   501  C CG2 . VAL A 1 86  ? 3.319   -10.776 -28.794 1.00 30.14  ? 300 VAL A CG2 1 
ATOM   502  N N   . LYS A 1 87  ? 7.682   -9.312  -29.611 1.00 30.45  ? 301 LYS A N   1 
ATOM   503  C CA  . LYS A 1 87  ? 9.060   -9.204  -29.148 1.00 31.96  ? 301 LYS A CA  1 
ATOM   504  C C   . LYS A 1 87  ? 9.086   -8.680  -27.721 1.00 31.86  ? 301 LYS A C   1 
ATOM   505  O O   . LYS A 1 87  ? 8.516   -7.631  -27.422 1.00 34.39  ? 301 LYS A O   1 
ATOM   506  C CB  . LYS A 1 87  ? 9.894   -8.298  -30.055 1.00 35.43  ? 301 LYS A CB  1 
ATOM   507  C CG  . LYS A 1 87  ? 11.353  -8.221  -29.620 1.00 39.69  ? 301 LYS A CG  1 
ATOM   508  C CD  . LYS A 1 87  ? 12.271  -7.800  -30.756 1.00 42.63  ? 301 LYS A CD  1 
ATOM   509  C CE  . LYS A 1 87  ? 13.732  -7.993  -30.373 1.00 44.38  ? 301 LYS A CE  1 
ATOM   510  N NZ  . LYS A 1 87  ? 14.659  -7.624  -31.479 1.00 45.80  ? 301 LYS A NZ  1 
ATOM   511  N N   . PHE A 1 88  ? 9.744   -9.429  -26.845 1.00 26.26  ? 302 PHE A N   1 
ATOM   512  C CA  . PHE A 1 88  ? 9.874   -9.052  -25.446 1.00 26.82  ? 302 PHE A CA  1 
ATOM   513  C C   . PHE A 1 88  ? 11.264  -8.529  -25.124 1.00 33.54  ? 302 PHE A C   1 
ATOM   514  O O   . PHE A 1 88  ? 12.267  -9.095  -25.563 1.00 33.04  ? 302 PHE A O   1 
ATOM   515  C CB  . PHE A 1 88  ? 9.576   -10.241 -24.534 1.00 30.67  ? 302 PHE A CB  1 
ATOM   516  C CG  . PHE A 1 88  ? 8.119   -10.464 -24.271 1.00 31.71  ? 302 PHE A CG  1 
ATOM   517  C CD1 . PHE A 1 88  ? 7.340   -9.464  -23.716 1.00 32.35  ? 302 PHE A CD1 1 
ATOM   518  C CD2 . PHE A 1 88  ? 7.535   -11.687 -24.545 1.00 32.79  ? 302 PHE A CD2 1 
ATOM   519  C CE1 . PHE A 1 88  ? 5.999   -9.675  -23.457 1.00 30.48  ? 302 PHE A CE1 1 
ATOM   520  C CE2 . PHE A 1 88  ? 6.196   -11.902 -24.288 1.00 32.91  ? 302 PHE A CE2 1 
ATOM   521  C CZ  . PHE A 1 88  ? 5.427   -10.896 -23.745 1.00 31.08  ? 302 PHE A CZ  1 
ATOM   522  N N   . TRP A 1 89  ? 11.317  -7.450  -24.352 1.00 30.65  ? 303 TRP A N   1 
ATOM   523  C CA  . TRP A 1 89  ? 12.548  -7.072  -23.677 1.00 31.26  ? 303 TRP A CA  1 
ATOM   524  C C   . TRP A 1 89  ? 12.356  -7.386  -22.201 1.00 34.50  ? 303 TRP A C   1 
ATOM   525  O O   . TRP A 1 89  ? 11.731  -6.622  -21.464 1.00 36.70  ? 303 TRP A O   1 
ATOM   526  C CB  . TRP A 1 89  ? 12.891  -5.600  -23.913 1.00 34.85  ? 303 TRP A CB  1 
ATOM   527  C CG  . TRP A 1 89  ? 13.254  -5.326  -25.341 1.00 31.44  ? 303 TRP A CG  1 
ATOM   528  C CD1 . TRP A 1 89  ? 14.512  -5.253  -25.870 1.00 33.22  ? 303 TRP A CD1 1 
ATOM   529  C CD2 . TRP A 1 89  ? 12.348  -5.118  -26.429 1.00 31.09  ? 303 TRP A CD2 1 
ATOM   530  N NE1 . TRP A 1 89  ? 14.442  -5.002  -27.220 1.00 32.84  ? 303 TRP A NE1 1 
ATOM   531  C CE2 . TRP A 1 89  ? 13.124  -4.918  -27.587 1.00 33.23  ? 303 TRP A CE2 1 
ATOM   532  C CE3 . TRP A 1 89  ? 10.952  -5.080  -26.536 1.00 36.61  ? 303 TRP A CE3 1 
ATOM   533  C CZ2 . TRP A 1 89  ? 12.552  -4.679  -28.837 1.00 35.06  ? 303 TRP A CZ2 1 
ATOM   534  C CZ3 . TRP A 1 89  ? 10.386  -4.842  -27.776 1.00 36.66  ? 303 TRP A CZ3 1 
ATOM   535  C CH2 . TRP A 1 89  ? 11.184  -4.643  -28.909 1.00 38.99  ? 303 TRP A CH2 1 
ATOM   536  N N   . ALA A 1 90  ? 12.878  -8.537  -21.787 1.00 34.61  ? 304 ALA A N   1 
ATOM   537  C CA  . ALA A 1 90  ? 12.613  -9.073  -20.460 1.00 29.77  ? 304 ALA A CA  1 
ATOM   538  C C   . ALA A 1 90  ? 13.427  -8.384  -19.375 1.00 35.31  ? 304 ALA A C   1 
ATOM   539  O O   . ALA A 1 90  ? 14.528  -7.892  -19.621 1.00 38.78  ? 304 ALA A O   1 
ATOM   540  C CB  . ALA A 1 90  ? 12.881  -10.571 -20.441 1.00 28.66  ? 304 ALA A CB  1 
ATOM   541  N N   . ASP A 1 91  ? 12.917  -8.377  -18.175 1.00 35.77  ? 305 ASP A N   1 
ATOM   542  C CA  . ASP A 1 91  ? 13.611  -7.817  -17.057 1.00 38.70  ? 305 ASP A CA  1 
ATOM   543  C C   . ASP A 1 91  ? 14.132  -8.979  -16.233 1.00 39.26  ? 305 ASP A C   1 
ATOM   544  O O   . ASP A 1 91  ? 13.394  -9.641  -15.565 1.00 37.94  ? 305 ASP A O   1 
ATOM   545  C CB  . ASP A 1 91  ? 12.680  -6.960  -16.229 1.00 37.81  ? 305 ASP A CB  1 
ATOM   546  C CG  . ASP A 1 91  ? 13.363  -6.308  -15.070 1.00 40.24  ? 305 ASP A CG  1 
ATOM   547  O OD1 . ASP A 1 91  ? 14.494  -6.638  -14.742 1.00 42.48  ? 305 ASP A OD1 1 
ATOM   548  O OD2 . ASP A 1 91  ? 12.761  -5.459  -14.459 1.00 42.11  ? 305 ASP A OD2 1 
ATOM   549  N N   . LEU A 1 92  ? 15.423  -9.210  -16.313 1.00 41.40  ? 306 LEU A N   1 
ATOM   550  C CA  . LEU A 1 92  ? 16.060  -10.296 -15.590 1.00 45.27  ? 306 LEU A CA  1 
ATOM   551  C C   . LEU A 1 92  ? 16.854  -9.836  -14.371 1.00 52.93  ? 306 LEU A C   1 
ATOM   552  O O   . LEU A 1 92  ? 17.932  -10.318 -14.110 1.00 55.41  ? 306 LEU A O   1 
ATOM   553  C CB  . LEU A 1 92  ? 16.972  -11.055 -16.523 1.00 39.40  ? 306 LEU A CB  1 
ATOM   554  C CG  . LEU A 1 92  ? 16.350  -11.626 -17.760 1.00 39.69  ? 306 LEU A CG  1 
ATOM   555  C CD1 . LEU A 1 92  ? 17.311  -12.539 -18.432 1.00 43.37  ? 306 LEU A CD1 1 
ATOM   556  C CD2 . LEU A 1 92  ? 15.118  -12.384 -17.401 1.00 37.04  ? 306 LEU A CD2 1 
ATOM   557  N N   . ASN A 1 93  ? 16.306  -8.903  -13.624 1.00 57.68  ? 307 ASN A N   1 
ATOM   558  C CA  . ASN A 1 93  ? 16.960  -8.372  -12.458 1.00 61.81  ? 307 ASN A CA  1 
ATOM   559  C C   . ASN A 1 93  ? 16.147  -8.520  -11.201 1.00 58.09  ? 307 ASN A C   1 
ATOM   560  O O   . ASN A 1 93  ? 15.303  -7.709  -10.931 1.00 56.62  ? 307 ASN A O   1 
ATOM   561  C CB  . ASN A 1 93  ? 17.201  -6.895  -12.668 1.00 71.20  ? 307 ASN A CB  1 
ATOM   562  C CG  . ASN A 1 93  ? 18.393  -6.619  -13.515 1.00 74.76  ? 307 ASN A CG  1 
ATOM   563  O OD1 . ASN A 1 93  ? 18.272  -6.448  -14.706 1.00 75.78  ? 307 ASN A OD1 1 
ATOM   564  N ND2 . ASN A 1 93  ? 19.554  -6.551  -12.899 1.00 76.37  ? 307 ASN A ND2 1 
ATOM   565  N N   . TRP A 1 94  ? 16.408  -9.551  -10.424 1.00 57.48  ? 308 TRP A N   1 
ATOM   566  C CA  . TRP A 1 94  ? 15.671  -9.752  -9.195  1.00 57.29  ? 308 TRP A CA  1 
ATOM   567  C C   . TRP A 1 94  ? 16.541  -10.305 -8.071  1.00 58.32  ? 308 TRP A C   1 
ATOM   568  O O   . TRP A 1 94  ? 17.639  -10.770 -8.312  1.00 58.01  ? 308 TRP A O   1 
ATOM   569  C CB  . TRP A 1 94  ? 14.448  -10.628 -9.433  1.00 52.17  ? 308 TRP A CB  1 
ATOM   570  C CG  . TRP A 1 94  ? 14.716  -12.059 -9.663  1.00 50.45  ? 308 TRP A CG  1 
ATOM   571  C CD1 . TRP A 1 94  ? 14.565  -13.059 -8.785  1.00 52.66  ? 308 TRP A CD1 1 
ATOM   572  C CD2 . TRP A 1 94  ? 15.147  -12.654 -10.871 1.00 46.90  ? 308 TRP A CD2 1 
ATOM   573  N NE1 . TRP A 1 94  ? 14.889  -14.240 -9.352  1.00 50.34  ? 308 TRP A NE1 1 
ATOM   574  C CE2 . TRP A 1 94  ? 15.252  -14.018 -10.644 1.00 45.58  ? 308 TRP A CE2 1 
ATOM   575  C CE3 . TRP A 1 94  ? 15.471  -12.159 -12.128 1.00 45.98  ? 308 TRP A CE3 1 
ATOM   576  C CZ2 . TRP A 1 94  ? 15.663  -14.893 -11.610 1.00 41.23  ? 308 TRP A CZ2 1 
ATOM   577  C CZ3 . TRP A 1 94  ? 15.881  -13.031 -13.085 1.00 42.91  ? 308 TRP A CZ3 1 
ATOM   578  C CH2 . TRP A 1 94  ? 15.972  -14.385 -12.823 1.00 39.68  ? 308 TRP A CH2 1 
ATOM   579  N N   . GLY A 1 110 ? 14.910  -19.776 -5.321  1.00 71.56  ? 324 GLY A N   1 
ATOM   580  C CA  . GLY A 1 110 ? 14.047  -20.676 -4.594  1.00 71.31  ? 324 GLY A CA  1 
ATOM   581  C C   . GLY A 1 110 ? 12.603  -20.234 -4.488  1.00 70.90  ? 324 GLY A C   1 
ATOM   582  O O   . GLY A 1 110 ? 11.837  -20.816 -3.734  1.00 73.70  ? 324 GLY A O   1 
ATOM   583  N N   . GLY A 1 111 ? 12.239  -19.204 -5.241  1.00 64.87  ? 325 GLY A N   1 
ATOM   584  C CA  . GLY A 1 111 ? 10.884  -18.689 -5.238  1.00 60.53  ? 325 GLY A CA  1 
ATOM   585  C C   . GLY A 1 111 ? 9.941   -19.462 -6.129  1.00 54.29  ? 325 GLY A C   1 
ATOM   586  O O   . GLY A 1 111 ? 10.297  -20.471 -6.669  1.00 54.56  ? 325 GLY A O   1 
ATOM   587  N N   . PHE A 1 112 ? 8.721   -18.985 -6.272  1.00 50.84  ? 326 PHE A N   1 
ATOM   588  C CA  . PHE A 1 112 ? 7.769   -19.648 -7.149  1.00 46.06  ? 326 PHE A CA  1 
ATOM   589  C C   . PHE A 1 112 ? 7.832   -18.963 -8.506  1.00 40.71  ? 326 PHE A C   1 
ATOM   590  O O   . PHE A 1 112 ? 7.686   -17.792 -8.587  1.00 43.64  ? 326 PHE A O   1 
ATOM   591  C CB  . PHE A 1 112 ? 6.357   -19.600 -6.593  1.00 50.70  ? 326 PHE A CB  1 
ATOM   592  C CG  . PHE A 1 112 ? 5.336   -20.094 -7.535  1.00 52.99  ? 326 PHE A CG  1 
ATOM   593  C CD1 . PHE A 1 112 ? 5.142   -21.425 -7.714  1.00 54.02  ? 326 PHE A CD1 1 
ATOM   594  C CD2 . PHE A 1 112 ? 4.594   -19.214 -8.285  1.00 55.26  ? 326 PHE A CD2 1 
ATOM   595  C CE1 . PHE A 1 112 ? 4.210   -21.880 -8.589  1.00 54.92  ? 326 PHE A CE1 1 
ATOM   596  C CE2 . PHE A 1 112 ? 3.662   -19.668 -9.171  1.00 54.74  ? 326 PHE A CE2 1 
ATOM   597  C CZ  . PHE A 1 112 ? 3.471   -21.004 -9.316  1.00 53.80  ? 326 PHE A CZ  1 
ATOM   598  N N   . TYR A 1 113 ? 8.080   -19.727 -9.547  1.00 38.88  ? 327 TYR A N   1 
ATOM   599  C CA  . TYR A 1 113 ? 8.168   -19.221 -10.904 1.00 37.10  ? 327 TYR A CA  1 
ATOM   600  C C   . TYR A 1 113 ? 6.882   -19.605 -11.589 1.00 39.01  ? 327 TYR A C   1 
ATOM   601  O O   . TYR A 1 113 ? 6.552   -20.746 -11.694 1.00 40.69  ? 327 TYR A O   1 
ATOM   602  C CB  . TYR A 1 113 ? 9.334   -19.838 -11.619 1.00 36.54  ? 327 TYR A CB  1 
ATOM   603  C CG  . TYR A 1 113 ? 10.650  -19.321 -11.159 1.00 38.16  ? 327 TYR A CG  1 
ATOM   604  C CD1 . TYR A 1 113 ? 11.220  -19.769 -10.002 1.00 38.86  ? 327 TYR A CD1 1 
ATOM   605  C CD2 . TYR A 1 113 ? 11.312  -18.383 -11.877 1.00 39.76  ? 327 TYR A CD2 1 
ATOM   606  C CE1 . TYR A 1 113 ? 12.416  -19.287 -9.585  1.00 44.97  ? 327 TYR A CE1 1 
ATOM   607  C CE2 . TYR A 1 113 ? 12.510  -17.896 -11.470 1.00 40.57  ? 327 TYR A CE2 1 
ATOM   608  C CZ  . TYR A 1 113 ? 13.057  -18.357 -10.319 1.00 44.31  ? 327 TYR A CZ  1 
ATOM   609  O OH  . TYR A 1 113 ? 14.247  -17.877 -9.894  1.00 46.31  ? 327 TYR A OH  1 
ATOM   610  N N   . GLY A 1 114 ? 6.154   -18.618 -12.047 1.00 38.08  ? 328 GLY A N   1 
ATOM   611  C CA  . GLY A 1 114 ? 4.847   -18.863 -12.622 1.00 38.14  ? 328 GLY A CA  1 
ATOM   612  C C   . GLY A 1 114 ? 4.550   -18.064 -13.872 1.00 38.07  ? 328 GLY A C   1 
ATOM   613  O O   . GLY A 1 114 ? 5.200   -17.055 -14.161 1.00 39.56  ? 328 GLY A O   1 
ATOM   614  N N   . VAL A 1 115 ? 3.559   -18.538 -14.618 1.00 33.75  ? 329 VAL A N   1 
ATOM   615  C CA  . VAL A 1 115 ? 3.059   -17.847 -15.794 1.00 33.64  ? 329 VAL A CA  1 
ATOM   616  C C   . VAL A 1 115 ? 1.552   -17.651 -15.643 1.00 37.01  ? 329 VAL A C   1 
ATOM   617  O O   . VAL A 1 115 ? 0.834   -18.580 -15.268 1.00 38.23  ? 329 VAL A O   1 
ATOM   618  C CB  . VAL A 1 115 ? 3.355   -18.631 -17.091 1.00 34.29  ? 329 VAL A CB  1 
ATOM   619  C CG1 . VAL A 1 115 ? 2.813   -17.885 -18.301 1.00 36.95  ? 329 VAL A CG1 1 
ATOM   620  C CG2 . VAL A 1 115 ? 4.854   -18.882 -17.239 1.00 34.40  ? 329 VAL A CG2 1 
ATOM   621  N N   . SER A 1 116 ? 1.076   -16.441 -15.914 1.00 37.34  ? 330 SER A N   1 
ATOM   622  C CA  . SER A 1 116 ? -0.357  -16.169 -15.860 1.00 36.42  ? 330 SER A CA  1 
ATOM   623  C C   . SER A 1 116 ? -0.858  -15.647 -17.197 1.00 38.49  ? 330 SER A C   1 
ATOM   624  O O   . SER A 1 116 ? -0.213  -14.808 -17.830 1.00 35.39  ? 330 SER A O   1 
ATOM   625  C CB  . SER A 1 116 ? -0.681  -15.167 -14.750 1.00 38.15  ? 330 SER A CB  1 
ATOM   626  O OG  . SER A 1 116 ? -0.467  -15.734 -13.469 1.00 41.43  ? 330 SER A OG  1 
ATOM   627  N N   . SER A 1 117 ? -2.017  -16.143 -17.605 1.00 37.62  ? 331 SER A N   1 
ATOM   628  C CA  . SER A 1 117 ? -2.665  -15.742 -18.828 1.00 36.89  ? 331 SER A CA  1 
ATOM   629  C C   . SER A 1 117 ? -4.153  -15.564 -18.661 1.00 37.68  ? 331 SER A C   1 
ATOM   630  O O   . SER A 1 117 ? -4.807  -16.355 -18.050 1.00 37.27  ? 331 SER A O   1 
ATOM   631  C CB  . SER A 1 117 ? -2.479  -16.771 -19.902 1.00 39.67  ? 331 SER A CB  1 
ATOM   632  O OG  . SER A 1 117 ? -1.169  -16.839 -20.301 1.00 47.95  ? 331 SER A OG  1 
ATOM   633  N N   . GLN A 1 118 ? -4.671  -14.516 -19.256 1.00 39.05  ? 332 GLN A N   1 
ATOM   634  C CA  . GLN A 1 118 ? -6.084  -14.264 -19.244 1.00 42.42  ? 332 GLN A CA  1 
ATOM   635  C C   . GLN A 1 118 ? -6.581  -13.909 -20.651 1.00 41.63  ? 332 GLN A C   1 
ATOM   636  O O   . GLN A 1 118 ? -6.061  -13.041 -21.290 1.00 40.75  ? 332 GLN A O   1 
ATOM   637  C CB  . GLN A 1 118 ? -6.454  -13.181 -18.257 1.00 47.77  ? 332 GLN A CB  1 
ATOM   638  C CG  . GLN A 1 118 ? -7.955  -12.992 -18.093 1.00 53.86  ? 332 GLN A CG  1 
ATOM   639  C CD  . GLN A 1 118 ? -8.328  -12.024 -16.997 1.00 57.61  ? 332 GLN A CD  1 
ATOM   640  O OE1 . GLN A 1 118 ? -7.630  -11.879 -16.023 1.00 60.93  ? 332 GLN A OE1 1 
ATOM   641  N NE2 . GLN A 1 118 ? -9.433  -11.355 -17.167 1.00 57.11  ? 332 GLN A NE2 1 
ATOM   642  N N   . TYR A 1 119 ? -7.595  -14.613 -21.097 1.00 37.82  ? 333 TYR A N   1 
ATOM   643  C CA  . TYR A 1 119 ? -8.199  -14.367 -22.362 1.00 35.48  ? 333 TYR A CA  1 
ATOM   644  C C   . TYR A 1 119 ? -9.674  -14.045 -22.115 1.00 36.45  ? 333 TYR A C   1 
ATOM   645  O O   . TYR A 1 119 ? -10.223 -14.416 -21.130 1.00 35.60  ? 333 TYR A O   1 
ATOM   646  C CB  . TYR A 1 119 ? -8.113  -15.569 -23.255 1.00 34.94  ? 333 TYR A CB  1 
ATOM   647  C CG  . TYR A 1 119 ? -6.748  -16.052 -23.562 1.00 34.61  ? 333 TYR A CG  1 
ATOM   648  C CD1 . TYR A 1 119 ? -6.118  -15.690 -24.723 1.00 37.32  ? 333 TYR A CD1 1 
ATOM   649  C CD2 . TYR A 1 119 ? -6.107  -16.908 -22.728 1.00 36.37  ? 333 TYR A CD2 1 
ATOM   650  C CE1 . TYR A 1 119 ? -4.869  -16.152 -25.027 1.00 38.10  ? 333 TYR A CE1 1 
ATOM   651  C CE2 . TYR A 1 119 ? -4.853  -17.374 -23.026 1.00 38.18  ? 333 TYR A CE2 1 
ATOM   652  C CZ  . TYR A 1 119 ? -4.242  -16.990 -24.179 1.00 38.53  ? 333 TYR A CZ  1 
ATOM   653  O OH  . TYR A 1 119 ? -3.011  -17.440 -24.463 1.00 39.12  ? 333 TYR A OH  1 
ATOM   654  N N   . GLU A 1 120 ? -10.286 -13.344 -23.033 1.00 38.55  ? 334 GLU A N   1 
ATOM   655  C CA  A GLU A 1 120 ? -11.739 -13.062 -23.133 0.47 38.61  ? 334 GLU A CA  1 
ATOM   656  C CA  B GLU A 1 120 ? -11.739 -13.069 -23.133 0.53 38.54  ? 334 GLU A CA  1 
ATOM   657  C C   . GLU A 1 120 ? -12.464 -13.300 -24.619 1.00 39.84  ? 334 GLU A C   1 
ATOM   658  O O   . GLU A 1 120 ? -11.857 -13.297 -25.649 1.00 39.93  ? 334 GLU A O   1 
ATOM   659  C CB  A GLU A 1 120 ? -11.929 -11.600 -22.711 0.47 39.48  ? 334 GLU A CB  1 
ATOM   660  C CB  B GLU A 1 120 ? -11.925 -11.613 -22.698 0.53 39.44  ? 334 GLU A CB  1 
ATOM   661  C CG  A GLU A 1 120 ? -11.574 -10.572 -23.780 0.47 40.45  ? 334 GLU A CG  1 
ATOM   662  C CG  B GLU A 1 120 ? -11.674 -11.380 -21.217 0.53 41.14  ? 334 GLU A CG  1 
ATOM   663  C CD  A GLU A 1 120 ? -11.970 -9.157  -23.387 0.47 44.90  ? 334 GLU A CD  1 
ATOM   664  C CD  B GLU A 1 120 ? -11.761 -9.918  -20.827 0.53 45.01  ? 334 GLU A CD  1 
ATOM   665  O OE1 A GLU A 1 120 ? -12.544 -8.980  -22.291 0.47 46.75  ? 334 GLU A OE1 1 
ATOM   666  O OE1 B GLU A 1 120 ? -12.118 -9.086  -21.688 0.53 47.10  ? 334 GLU A OE1 1 
ATOM   667  O OE2 A GLU A 1 120 ? -11.713 -8.222  -24.175 0.47 44.90  ? 334 GLU A OE2 1 
ATOM   668  O OE2 B GLU A 1 120 ? -11.479 -9.598  -19.653 0.53 47.49  ? 334 GLU A OE2 1 
ATOM   669  N N   . SER A 1 121 ? -13.760 -13.499 -24.537 1.00 39.77  ? 335 SER A N   1 
ATOM   670  C CA  . SER A 1 121 ? -14.557 -13.706 -25.699 1.00 40.80  ? 335 SER A CA  1 
ATOM   671  C C   . SER A 1 121 ? -15.995 -13.473 -25.374 1.00 39.31  ? 335 SER A C   1 
ATOM   672  O O   . SER A 1 121 ? -16.381 -13.430 -24.233 1.00 39.04  ? 335 SER A O   1 
ATOM   673  C CB  . SER A 1 121 ? -14.420 -15.128 -26.178 1.00 43.15  ? 335 SER A CB  1 
ATOM   674  O OG  . SER A 1 121 ? -14.819 -15.995 -25.163 1.00 49.70  ? 335 SER A OG  1 
ATOM   675  N N   . LEU A 1 122 ? -16.788 -13.382 -26.409 1.00 40.79  ? 336 LEU A N   1 
ATOM   676  C CA  . LEU A 1 122 ? -18.209 -13.210 -26.278 1.00 41.44  ? 336 LEU A CA  1 
ATOM   677  C C   . LEU A 1 122 ? -18.914 -14.540 -26.395 1.00 41.30  ? 336 LEU A C   1 
ATOM   678  O O   . LEU A 1 122 ? -20.019 -14.658 -25.992 1.00 42.29  ? 336 LEU A O   1 
ATOM   679  C CB  . LEU A 1 122 ? -18.724 -12.248 -27.330 1.00 44.43  ? 336 LEU A CB  1 
ATOM   680  C CG  . LEU A 1 122 ? -18.208 -10.847 -27.170 1.00 45.13  ? 336 LEU A CG  1 
ATOM   681  C CD1 . LEU A 1 122 ? -18.696 -10.004 -28.304 1.00 46.85  ? 336 LEU A CD1 1 
ATOM   682  C CD2 . LEU A 1 122 ? -18.625 -10.240 -25.863 1.00 44.98  ? 336 LEU A CD2 1 
ATOM   683  N N   . GLU A 1 123 ? -18.256 -15.532 -26.953 1.00 40.70  ? 337 GLU A N   1 
ATOM   684  C CA  . GLU A 1 123 ? -18.842 -16.837 -27.106 1.00 47.85  ? 337 GLU A CA  1 
ATOM   685  C C   . GLU A 1 123 ? -18.292 -17.790 -26.082 1.00 50.31  ? 337 GLU A C   1 
ATOM   686  O O   . GLU A 1 123 ? -17.161 -17.686 -25.702 1.00 36.92  ? 337 GLU A O   1 
ATOM   687  C CB  . GLU A 1 123 ? -18.536 -17.396 -28.472 1.00 55.40  ? 337 GLU A CB  1 
ATOM   688  C CG  . GLU A 1 123 ? -18.745 -16.457 -29.644 1.00 64.83  ? 337 GLU A CG  1 
ATOM   689  C CD  . GLU A 1 123 ? -17.589 -16.481 -30.630 1.00 72.58  ? 337 GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 123 ? -16.890 -17.491 -30.730 1.00 73.59  ? 337 GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 123 ? -17.367 -15.475 -31.310 1.00 77.81  ? 337 GLU A OE2 1 
ATOM   692  N N   . HIS A 1 124 ? -19.108 -18.730 -25.651 1.00 39.65  ? 338 HIS A N   1 
ATOM   693  C CA  . HIS A 1 124 ? -18.675 -19.723 -24.697 1.00 45.77  ? 338 HIS A CA  1 
ATOM   694  C C   . HIS A 1 124 ? -17.887 -20.814 -25.397 1.00 43.32  ? 338 HIS A C   1 
ATOM   695  O O   . HIS A 1 124 ? -18.343 -21.396 -26.343 1.00 45.31  ? 338 HIS A O   1 
ATOM   696  C CB  . HIS A 1 124 ? -19.858 -20.337 -23.974 1.00 49.30  ? 338 HIS A CB  1 
ATOM   697  C CG  . HIS A 1 124 ? -19.481 -21.294 -22.894 1.00 50.55  ? 338 HIS A CG  1 
ATOM   698  N ND1 . HIS A 1 124 ? -19.449 -20.941 -21.570 1.00 50.76  ? 338 HIS A ND1 1 
ATOM   699  C CD2 . HIS A 1 124 ? -19.126 -22.591 -22.941 1.00 51.78  ? 338 HIS A CD2 1 
ATOM   700  C CE1 . HIS A 1 124 ? -19.099 -21.977 -20.846 1.00 50.85  ? 338 HIS A CE1 1 
ATOM   701  N NE2 . HIS A 1 124 ? -18.898 -22.992 -21.653 1.00 52.38  ? 338 HIS A NE2 1 
ATOM   702  N N   . MET A 1 125 ? -16.692 -21.068 -24.903 1.00 42.30  ? 339 MET A N   1 
ATOM   703  C CA  . MET A 1 125 ? -15.834 -22.072 -25.471 1.00 42.44  ? 339 MET A CA  1 
ATOM   704  C C   . MET A 1 125 ? -14.972 -22.727 -24.427 1.00 43.01  ? 339 MET A C   1 
ATOM   705  O O   . MET A 1 125 ? -14.941 -22.321 -23.307 1.00 38.03  ? 339 MET A O   1 
ATOM   706  C CB  . MET A 1 125 ? -14.873 -21.421 -26.462 1.00 40.71  ? 339 MET A CB  1 
ATOM   707  C CG  . MET A 1 125 ? -15.485 -20.781 -27.683 1.00 46.10  ? 339 MET A CG  1 
ATOM   708  S SD  . MET A 1 125 ? -14.383 -19.953 -28.829 1.00 43.03  ? 339 MET A SD  1 
ATOM   709  C CE  . MET A 1 125 ? -13.763 -18.675 -27.795 1.00 42.84  ? 339 MET A CE  1 
ATOM   710  N N   . THR A 1 126 ? -14.287 -23.769 -24.835 1.00 44.26  ? 340 THR A N   1 
ATOM   711  C CA  . THR A 1 126 ? -13.242 -24.377 -24.023 1.00 43.94  ? 340 THR A CA  1 
ATOM   712  C C   . THR A 1 126 ? -11.930 -24.271 -24.795 1.00 42.76  ? 340 THR A C   1 
ATOM   713  O O   . THR A 1 126 ? -11.846 -24.700 -25.946 1.00 43.79  ? 340 THR A O   1 
ATOM   714  C CB  . THR A 1 126 ? -13.545 -25.850 -23.687 1.00 45.58  ? 340 THR A CB  1 
ATOM   715  O OG1 . THR A 1 126 ? -14.685 -25.919 -22.825 1.00 46.91  ? 340 THR A OG1 1 
ATOM   716  C CG2 . THR A 1 126 ? -12.356 -26.492 -22.986 1.00 43.78  ? 340 THR A CG2 1 
ATOM   717  N N   . LEU A 1 127 ? -10.914 -23.685 -24.166 1.00 40.76  ? 341 LEU A N   1 
ATOM   718  C CA  . LEU A 1 127 ? -9.647  -23.418 -24.840 1.00 40.31  ? 341 LEU A CA  1 
ATOM   719  C C   . LEU A 1 127 ? -8.607  -24.515 -24.630 1.00 40.22  ? 341 LEU A C   1 
ATOM   720  O O   . LEU A 1 127 ? -8.402  -24.985 -23.511 1.00 41.79  ? 341 LEU A O   1 
ATOM   721  C CB  . LEU A 1 127 ? -9.057  -22.087 -24.365 1.00 40.59  ? 341 LEU A CB  1 
ATOM   722  C CG  . LEU A 1 127 ? -9.872  -20.808 -24.554 1.00 41.35  ? 341 LEU A CG  1 
ATOM   723  C CD1 . LEU A 1 127 ? -9.034  -19.587 -24.192 1.00 40.41  ? 341 LEU A CD1 1 
ATOM   724  C CD2 . LEU A 1 127 ? -10.388 -20.708 -25.974 1.00 41.91  ? 341 LEU A CD2 1 
ATOM   725  N N   . THR A 1 128 ? -7.955  -24.912 -25.717 1.00 36.63  ? 342 THR A N   1 
ATOM   726  C CA  . THR A 1 128 ? -6.749  -25.723 -25.636 1.00 35.42  ? 342 THR A CA  1 
ATOM   727  C C   . THR A 1 128 ? -5.557  -24.805 -25.884 1.00 36.58  ? 342 THR A C   1 
ATOM   728  O O   . THR A 1 128 ? -5.432  -24.217 -26.959 1.00 32.78  ? 342 THR A O   1 
ATOM   729  C CB  . THR A 1 128 ? -6.753  -26.883 -26.652 1.00 35.51  ? 342 THR A CB  1 
ATOM   730  O OG1 . THR A 1 128 ? -7.819  -27.789 -26.343 1.00 42.13  ? 342 THR A OG1 1 
ATOM   731  C CG2 . THR A 1 128 ? -5.434  -27.642 -26.604 1.00 36.38  ? 342 THR A CG2 1 
ATOM   732  N N   . CYS A 1 129 ? -4.698  -24.660 -24.881 1.00 35.35  ? 343 CYS A N   1 
ATOM   733  C CA  . CYS A 1 129 ? -3.549  -23.768 -24.997 1.00 35.22  ? 343 CYS A CA  1 
ATOM   734  C C   . CYS A 1 129 ? -2.250  -24.559 -25.053 1.00 37.66  ? 343 CYS A C   1 
ATOM   735  O O   . CYS A 1 129 ? -1.868  -25.214 -24.083 1.00 40.82  ? 343 CYS A O   1 
ATOM   736  C CB  . CYS A 1 129 ? -3.513  -22.780 -23.830 1.00 33.17  ? 343 CYS A CB  1 
ATOM   737  S SG  . CYS A 1 129 ? -4.973  -21.719 -23.710 1.00 58.08  ? 343 CYS A SG  1 
ATOM   738  N N   . SER A 1 130 ? -1.578  -24.495 -26.196 1.00 36.58  ? 344 SER A N   1 
ATOM   739  C CA  . SER A 1 130 ? -0.316  -25.199 -26.381 1.00 37.00  ? 344 SER A CA  1 
ATOM   740  C C   . SER A 1 130 ? 0.846   -24.214 -26.399 1.00 34.96  ? 344 SER A C   1 
ATOM   741  O O   . SER A 1 130 ? 0.828   -23.235 -27.143 1.00 37.40  ? 344 SER A O   1 
ATOM   742  C CB  . SER A 1 130 ? -0.343  -26.018 -27.673 1.00 42.12  ? 344 SER A CB  1 
ATOM   743  O OG  . SER A 1 130 ? 0.928   -26.581 -27.948 1.00 47.76  ? 344 SER A OG  1 
ATOM   744  N N   . SER A 1 131 ? 1.848   -24.446 -25.582 1.00 32.48  ? 345 SER A N   1 
ATOM   745  C CA  . SER A 1 131 ? 3.023   -23.603 -25.550 1.00 31.64  ? 345 SER A CA  1 
ATOM   746  C C   . SER A 1 131 ? 4.265   -24.407 -25.841 1.00 34.93  ? 345 SER A C   1 
ATOM   747  O O   . SER A 1 131 ? 4.611   -25.261 -25.069 1.00 38.42  ? 345 SER A O   1 
ATOM   748  C CB  . SER A 1 131 ? 3.221   -22.995 -24.212 1.00 36.33  ? 345 SER A CB  1 
ATOM   749  O OG  . SER A 1 131 ? 2.172   -22.184 -23.848 1.00 46.28  ? 345 SER A OG  1 
ATOM   750  N N   . LYS A 1 132 ? 4.937   -24.124 -26.933 1.00 33.00  ? 346 LYS A N   1 
ATOM   751  C CA  . LYS A 1 132 ? 6.137   -24.819 -27.299 1.00 32.92  ? 346 LYS A CA  1 
ATOM   752  C C   . LYS A 1 132 ? 7.377   -23.955 -27.148 1.00 33.13  ? 346 LYS A C   1 
ATOM   753  O O   . LYS A 1 132 ? 7.533   -22.988 -27.857 1.00 31.28  ? 346 LYS A O   1 
ATOM   754  C CB  . LYS A 1 132 ? 6.077   -25.230 -28.747 1.00 36.87  ? 346 LYS A CB  1 
ATOM   755  C CG  . LYS A 1 132 ? 5.012   -26.215 -29.123 1.00 47.46  ? 346 LYS A CG  1 
ATOM   756  C CD  . LYS A 1 132 ? 5.140   -26.601 -30.576 1.00 54.71  ? 346 LYS A CD  1 
ATOM   757  C CE  . LYS A 1 132 ? 4.076   -27.595 -31.002 1.00 60.28  ? 346 LYS A CE  1 
ATOM   758  N NZ  . LYS A 1 132 ? 2.782   -26.944 -31.320 1.00 62.45  ? 346 LYS A NZ  1 
ATOM   759  N N   . VAL A 1 133 ? 8.248   -24.318 -26.242 1.00 30.81  ? 347 VAL A N   1 
ATOM   760  C CA  . VAL A 1 133 ? 9.497   -23.634 -26.050 1.00 31.91  ? 347 VAL A CA  1 
ATOM   761  C C   . VAL A 1 133 ? 10.513  -24.239 -27.011 1.00 33.51  ? 347 VAL A C   1 
ATOM   762  O O   . VAL A 1 133 ? 10.684  -25.429 -27.067 1.00 30.86  ? 347 VAL A O   1 
ATOM   763  C CB  . VAL A 1 133 ? 9.972   -23.753 -24.619 1.00 31.70  ? 347 VAL A CB  1 
ATOM   764  C CG1 . VAL A 1 133 ? 11.325  -23.139 -24.449 1.00 32.57  ? 347 VAL A CG1 1 
ATOM   765  C CG2 . VAL A 1 133 ? 8.981   -23.135 -23.690 1.00 32.11  ? 347 VAL A CG2 1 
ATOM   766  N N   . CYS A 1 134 ? 11.165  -23.389 -27.781 1.00 32.12  ? 348 CYS A N   1 
ATOM   767  C CA  . CYS A 1 134 ? 12.128  -23.798 -28.776 1.00 32.23  ? 348 CYS A CA  1 
ATOM   768  C C   . CYS A 1 134 ? 13.543  -23.215 -28.621 1.00 31.85  ? 348 CYS A C   1 
ATOM   769  O O   . CYS A 1 134 ? 13.729  -22.090 -28.242 1.00 26.92  ? 348 CYS A O   1 
ATOM   770  C CB  . CYS A 1 134 ? 11.592  -23.504 -30.167 1.00 31.72  ? 348 CYS A CB  1 
ATOM   771  S SG  . CYS A 1 134 ? 10.023  -24.231 -30.626 1.00 37.84  ? 348 CYS A SG  1 
ATOM   772  N N   . SER A 1 135 ? 14.532  -24.032 -28.912 1.00 33.03  ? 349 SER A N   1 
ATOM   773  C CA  . SER A 1 135 ? 15.916  -23.649 -28.831 1.00 33.42  ? 349 SER A CA  1 
ATOM   774  C C   . SER A 1 135 ? 16.569  -24.031 -30.135 1.00 34.70  ? 349 SER A C   1 
ATOM   775  O O   . SER A 1 135 ? 16.558  -25.161 -30.531 1.00 34.50  ? 349 SER A O   1 
ATOM   776  C CB  . SER A 1 135 ? 16.575  -24.346 -27.670 1.00 36.35  ? 349 SER A CB  1 
ATOM   777  O OG  . SER A 1 135 ? 17.935  -24.098 -27.626 1.00 35.89  ? 349 SER A OG  1 
ATOM   778  N N   . PHE A 1 136 ? 17.106  -23.051 -30.818 1.00 36.03  ? 350 PHE A N   1 
ATOM   779  C CA  . PHE A 1 136 ? 17.727  -23.273 -32.084 1.00 38.63  ? 350 PHE A CA  1 
ATOM   780  C C   . PHE A 1 136 ? 16.740  -23.848 -33.061 1.00 40.76  ? 350 PHE A C   1 
ATOM   781  O O   . PHE A 1 136 ? 17.086  -24.643 -33.894 1.00 44.77  ? 350 PHE A O   1 
ATOM   782  C CB  . PHE A 1 136 ? 18.962  -24.166 -31.927 1.00 38.66  ? 350 PHE A CB  1 
ATOM   783  C CG  . PHE A 1 136 ? 20.086  -23.494 -31.219 1.00 39.23  ? 350 PHE A CG  1 
ATOM   784  C CD1 . PHE A 1 136 ? 20.945  -22.680 -31.892 1.00 37.34  ? 350 PHE A CD1 1 
ATOM   785  C CD2 . PHE A 1 136 ? 20.241  -23.630 -29.889 1.00 40.16  ? 350 PHE A CD2 1 
ATOM   786  C CE1 . PHE A 1 136 ? 21.962  -22.050 -31.251 1.00 39.28  ? 350 PHE A CE1 1 
ATOM   787  C CE2 . PHE A 1 136 ? 21.251  -22.993 -29.234 1.00 41.27  ? 350 PHE A CE2 1 
ATOM   788  C CZ  . PHE A 1 136 ? 22.117  -22.198 -29.914 1.00 37.61  ? 350 PHE A CZ  1 
ATOM   789  N N   . GLY A 1 137 ? 15.495  -23.436 -32.933 1.00 39.60  ? 351 GLY A N   1 
ATOM   790  C CA  . GLY A 1 137 ? 14.421  -23.864 -33.791 1.00 37.10  ? 351 GLY A CA  1 
ATOM   791  C C   . GLY A 1 137 ? 13.850  -25.245 -33.561 1.00 39.16  ? 351 GLY A C   1 
ATOM   792  O O   . GLY A 1 137 ? 13.073  -25.711 -34.329 1.00 39.08  ? 351 GLY A O   1 
ATOM   793  N N   . LYS A 1 138 ? 14.250  -25.868 -32.479 1.00 44.03  ? 352 LYS A N   1 
ATOM   794  C CA  . LYS A 1 138 ? 13.796  -27.176 -32.134 1.00 45.36  ? 352 LYS A CA  1 
ATOM   795  C C   . LYS A 1 138 ? 13.076  -27.159 -30.815 1.00 43.67  ? 352 LYS A C   1 
ATOM   796  O O   . LYS A 1 138 ? 13.491  -26.524 -29.904 1.00 36.46  ? 352 LYS A O   1 
ATOM   797  C CB  . LYS A 1 138 ? 14.977  -28.124 -32.051 1.00 49.45  ? 352 LYS A CB  1 
ATOM   798  C CG  . LYS A 1 138 ? 15.349  -28.747 -33.375 1.00 55.37  ? 352 LYS A CG  1 
ATOM   799  C CD  . LYS A 1 138 ? 16.834  -28.671 -33.634 1.00 61.37  ? 352 LYS A CD  1 
ATOM   800  C CE  . LYS A 1 138 ? 17.282  -29.603 -34.748 1.00 64.16  ? 352 LYS A CE  1 
ATOM   801  N NZ  . LYS A 1 138 ? 18.430  -30.449 -34.329 1.00 66.83  ? 352 LYS A NZ  1 
ATOM   802  N N   . GLN A 1 139 ? 11.988  -27.905 -30.743 1.00 39.62  ? 353 GLN A N   1 
ATOM   803  C CA  . GLN A 1 139 ? 11.190  -28.005 -29.549 1.00 39.03  ? 353 GLN A CA  1 
ATOM   804  C C   . GLN A 1 139 ? 11.913  -28.662 -28.403 1.00 41.40  ? 353 GLN A C   1 
ATOM   805  O O   . GLN A 1 139 ? 12.448  -29.720 -28.539 1.00 39.72  ? 353 GLN A O   1 
ATOM   806  C CB  . GLN A 1 139 ? 9.920   -28.778 -29.864 1.00 40.93  ? 353 GLN A CB  1 
ATOM   807  C CG  . GLN A 1 139 ? 8.911   -28.827 -28.745 1.00 43.97  ? 353 GLN A CG  1 
ATOM   808  C CD  . GLN A 1 139 ? 7.665   -29.629 -29.081 1.00 45.42  ? 353 GLN A CD  1 
ATOM   809  O OE1 . GLN A 1 139 ? 7.310   -30.533 -28.365 1.00 46.74  ? 353 GLN A OE1 1 
ATOM   810  N NE2 . GLN A 1 139 ? 7.008   -29.280 -30.145 1.00 43.81  ? 353 GLN A NE2 1 
ATOM   811  N N   . VAL A 1 140 ? 11.915  -28.013 -27.268 1.00 35.12  ? 354 VAL A N   1 
ATOM   812  C CA  . VAL A 1 140 ? 12.532  -28.565 -26.100 1.00 38.59  ? 354 VAL A CA  1 
ATOM   813  C C   . VAL A 1 140 ? 11.493  -28.744 -25.012 1.00 36.41  ? 354 VAL A C   1 
ATOM   814  O O   . VAL A 1 140 ? 11.712  -29.445 -24.070 1.00 36.51  ? 354 VAL A O   1 
ATOM   815  C CB  . VAL A 1 140 ? 13.716  -27.754 -25.577 1.00 40.46  ? 354 VAL A CB  1 
ATOM   816  C CG1 . VAL A 1 140 ? 14.834  -27.719 -26.580 1.00 41.50  ? 354 VAL A CG1 1 
ATOM   817  C CG2 . VAL A 1 140 ? 13.289  -26.378 -25.143 1.00 40.20  ? 354 VAL A CG2 1 
ATOM   818  N N   . VAL A 1 141 ? 10.362  -28.088 -25.180 1.00 35.24  ? 355 VAL A N   1 
ATOM   819  C CA  . VAL A 1 141 ? 9.253   -28.195 -24.273 1.00 35.15  ? 355 VAL A CA  1 
ATOM   820  C C   . VAL A 1 141 ? 7.942   -27.888 -24.939 1.00 37.62  ? 355 VAL A C   1 
ATOM   821  O O   . VAL A 1 141 ? 7.838   -26.962 -25.699 1.00 34.48  ? 355 VAL A O   1 
ATOM   822  C CB  . VAL A 1 141 ? 9.366   -27.271 -23.057 1.00 44.02  ? 355 VAL A CB  1 
ATOM   823  C CG1 . VAL A 1 141 ? 8.334   -27.602 -22.016 1.00 43.60  ? 355 VAL A CG1 1 
ATOM   824  C CG2 . VAL A 1 141 ? 10.732  -27.305 -22.459 1.00 44.99  ? 355 VAL A CG2 1 
ATOM   825  N N   . GLU A 1 142 ? 6.944   -28.701 -24.641 1.00 36.55  ? 356 GLU A N   1 
ATOM   826  C CA  . GLU A 1 142 ? 5.584   -28.481 -25.087 1.00 38.61  ? 356 GLU A CA  1 
ATOM   827  C C   . GLU A 1 142 ? 4.703   -28.669 -23.900 1.00 38.12  ? 356 GLU A C   1 
ATOM   828  O O   . GLU A 1 142 ? 4.733   -29.684 -23.273 1.00 37.36  ? 356 GLU A O   1 
ATOM   829  C CB  . GLU A 1 142 ? 5.084   -29.341 -26.218 1.00 39.74  ? 356 GLU A CB  1 
ATOM   830  C CG  . GLU A 1 142 ? 3.672   -28.904 -26.548 1.00 47.51  ? 356 GLU A CG  1 
ATOM   831  C CD  . GLU A 1 142 ? 3.002   -29.671 -27.645 1.00 55.21  ? 356 GLU A CD  1 
ATOM   832  O OE1 . GLU A 1 142 ? 3.489   -30.721 -28.027 1.00 58.06  ? 356 GLU A OE1 1 
ATOM   833  O OE2 . GLU A 1 142 ? 1.963   -29.225 -28.128 1.00 58.09  ? 356 GLU A OE2 1 
ATOM   834  N N   . LYS A 1 143 ? 3.933   -27.655 -23.589 1.00 39.80  ? 357 LYS A N   1 
ATOM   835  C CA  . LYS A 1 143 ? 3.029   -27.697 -22.472 1.00 41.35  ? 357 LYS A CA  1 
ATOM   836  C C   . LYS A 1 143 ? 1.629   -27.444 -22.977 1.00 39.91  ? 357 LYS A C   1 
ATOM   837  O O   . LYS A 1 143 ? 1.420   -26.532 -23.719 1.00 39.35  ? 357 LYS A O   1 
ATOM   838  C CB  . LYS A 1 143 ? 3.433   -26.689 -21.439 1.00 45.12  ? 357 LYS A CB  1 
ATOM   839  C CG  . LYS A 1 143 ? 2.534   -26.672 -20.246 1.00 54.60  ? 357 LYS A CG  1 
ATOM   840  C CD  . LYS A 1 143 ? 3.259   -26.277 -18.981 1.00 60.28  ? 357 LYS A CD  1 
ATOM   841  C CE  . LYS A 1 143 ? 3.555   -24.796 -18.910 1.00 64.03  ? 357 LYS A CE  1 
ATOM   842  N NZ  . LYS A 1 143 ? 2.944   -24.152 -17.726 1.00 65.90  ? 357 LYS A NZ  1 
ATOM   843  N N   . VAL A 1 144 ? 0.678   -28.276 -22.593 1.00 38.82  ? 358 VAL A N   1 
ATOM   844  C CA  . VAL A 1 144 ? -0.692  -28.146 -23.047 1.00 38.79  ? 358 VAL A CA  1 
ATOM   845  C C   . VAL A 1 144 ? -1.645  -28.038 -21.884 1.00 40.74  ? 358 VAL A C   1 
ATOM   846  O O   . VAL A 1 144 ? -1.624  -28.856 -20.999 1.00 40.20  ? 358 VAL A O   1 
ATOM   847  C CB  . VAL A 1 144 ? -1.085  -29.320 -23.920 1.00 40.14  ? 358 VAL A CB  1 
ATOM   848  C CG1 . VAL A 1 144 ? -2.476  -29.148 -24.486 1.00 42.28  ? 358 VAL A CG1 1 
ATOM   849  C CG2 . VAL A 1 144 ? -0.098  -29.475 -25.035 1.00 41.46  ? 358 VAL A CG2 1 
ATOM   850  N N   . GLU A 1 145 ? -2.459  -26.999 -21.887 1.00 42.06  ? 359 GLU A N   1 
ATOM   851  C CA  . GLU A 1 145 ? -3.399  -26.773 -20.821 1.00 46.72  ? 359 GLU A CA  1 
ATOM   852  C C   . GLU A 1 145 ? -4.783  -26.572 -21.366 1.00 47.63  ? 359 GLU A C   1 
ATOM   853  O O   . GLU A 1 145 ? -4.972  -26.304 -22.520 1.00 43.77  ? 359 GLU A O   1 
ATOM   854  C CB  . GLU A 1 145 ? -3.008  -25.574 -19.978 1.00 51.61  ? 359 GLU A CB  1 
ATOM   855  C CG  . GLU A 1 145 ? -1.752  -25.798 -19.195 1.00 59.58  ? 359 GLU A CG  1 
ATOM   856  C CD  . GLU A 1 145 ? -1.384  -24.638 -18.317 1.00 63.69  ? 359 GLU A CD  1 
ATOM   857  O OE1 . GLU A 1 145 ? -1.082  -24.854 -17.138 1.00 65.64  ? 359 GLU A OE1 1 
ATOM   858  O OE2 . GLU A 1 145 ? -1.387  -23.510 -18.814 1.00 65.98  ? 359 GLU A OE2 1 
ATOM   859  N N   . THR A 1 146 ? -5.764  -26.708 -20.498 1.00 45.81  ? 360 THR A N   1 
ATOM   860  C CA  . THR A 1 146 ? -7.153  -26.539 -20.878 1.00 51.67  ? 360 THR A CA  1 
ATOM   861  C C   . THR A 1 146 ? -7.838  -25.619 -19.892 1.00 47.32  ? 360 THR A C   1 
ATOM   862  O O   . THR A 1 146 ? -7.581  -25.677 -18.729 1.00 46.50  ? 360 THR A O   1 
ATOM   863  C CB  . THR A 1 146 ? -7.870  -27.890 -20.965 1.00 53.46  ? 360 THR A CB  1 
ATOM   864  O OG1 . THR A 1 146 ? -7.223  -28.714 -21.924 1.00 52.93  ? 360 THR A OG1 1 
ATOM   865  C CG2 . THR A 1 146 ? -9.258  -27.706 -21.407 1.00 56.24  ? 360 THR A CG2 1 
ATOM   866  N N   . GLU A 1 147 ? -8.696  -24.746 -20.391 1.00 48.87  ? 361 GLU A N   1 
ATOM   867  C CA  . GLU A 1 147 ? -9.427  -23.808 -19.557 1.00 52.51  ? 361 GLU A CA  1 
ATOM   868  C C   . GLU A 1 147 ? -10.800 -23.509 -20.118 1.00 52.89  ? 361 GLU A C   1 
ATOM   869  O O   . GLU A 1 147 ? -10.941 -23.153 -21.257 1.00 54.38  ? 361 GLU A O   1 
ATOM   870  C CB  . GLU A 1 147 ? -8.672  -22.517 -19.409 1.00 52.12  ? 361 GLU A CB  1 
ATOM   871  C CG  . GLU A 1 147 ? -9.422  -21.454 -18.657 1.00 56.59  ? 361 GLU A CG  1 
ATOM   872  C CD  . GLU A 1 147 ? -9.650  -21.797 -17.201 1.00 61.17  ? 361 GLU A CD  1 
ATOM   873  O OE1 . GLU A 1 147 ? -8.975  -22.689 -16.692 1.00 63.55  ? 361 GLU A OE1 1 
ATOM   874  O OE2 . GLU A 1 147 ? -10.497 -21.173 -16.563 1.00 62.56  ? 361 GLU A OE2 1 
ATOM   875  N N   . ARG A 1 148 ? -11.800 -23.657 -19.279 1.00 54.53  ? 362 ARG A N   1 
ATOM   876  C CA  . ARG A 1 148 ? -13.168 -23.429 -19.681 1.00 63.68  ? 362 ARG A CA  1 
ATOM   877  C C   . ARG A 1 148 ? -13.596 -22.017 -19.393 1.00 64.99  ? 362 ARG A C   1 
ATOM   878  O O   . ARG A 1 148 ? -13.104 -21.403 -18.502 1.00 56.43  ? 362 ARG A O   1 
ATOM   879  C CB  . ARG A 1 148 ? -14.097 -24.414 -18.975 1.00 60.45  ? 362 ARG A CB  1 
ATOM   880  N N   . ALA A 1 149 ? -14.536 -21.529 -20.164 1.00 44.06  ? 363 ALA A N   1 
ATOM   881  C CA  . ALA A 1 149 ? -15.033 -20.199 -19.986 1.00 41.25  ? 363 ALA A CA  1 
ATOM   882  C C   . ALA A 1 149 ? -15.694 -19.983 -18.648 1.00 43.03  ? 363 ALA A C   1 
ATOM   883  O O   . ALA A 1 149 ? -16.261 -20.874 -18.094 1.00 43.97  ? 363 ALA A O   1 
ATOM   884  C CB  . ALA A 1 149 ? -16.000 -19.876 -21.090 1.00 38.87  ? 363 ALA A CB  1 
ATOM   885  N N   . GLN A 1 150 ? -15.599 -18.771 -18.154 1.00 43.16  ? 364 GLN A N   1 
ATOM   886  C CA  . GLN A 1 150 ? -16.230 -18.374 -16.923 1.00 49.05  ? 364 GLN A CA  1 
ATOM   887  C C   . GLN A 1 150 ? -16.935 -17.079 -17.231 1.00 47.96  ? 364 GLN A C   1 
ATOM   888  O O   . GLN A 1 150 ? -16.332 -16.160 -17.711 1.00 47.99  ? 364 GLN A O   1 
ATOM   889  C CB  . GLN A 1 150 ? -15.219 -18.142 -15.823 1.00 55.11  ? 364 GLN A CB  1 
ATOM   890  C CG  . GLN A 1 150 ? -15.735 -17.345 -14.638 1.00 65.13  ? 364 GLN A CG  1 
ATOM   891  C CD  . GLN A 1 150 ? -16.488 -18.204 -13.629 1.00 73.01  ? 364 GLN A CD  1 
ATOM   892  O OE1 . GLN A 1 150 ? -16.212 -19.371 -13.488 1.00 75.91  ? 364 GLN A OE1 1 
ATOM   893  N NE2 . GLN A 1 150 ? -17.450 -17.621 -12.955 1.00 75.26  ? 364 GLN A NE2 1 
ATOM   894  N N   . LEU A 1 151 ? -18.218 -17.006 -16.921 1.00 48.87  ? 365 LEU A N   1 
ATOM   895  C CA  . LEU A 1 151 ? -19.008 -15.822 -17.160 1.00 46.27  ? 365 LEU A CA  1 
ATOM   896  C C   . LEU A 1 151 ? -18.696 -14.738 -16.179 1.00 49.20  ? 365 LEU A C   1 
ATOM   897  O O   . LEU A 1 151 ? -18.763 -14.934 -15.003 1.00 52.59  ? 365 LEU A O   1 
ATOM   898  C CB  . LEU A 1 151 ? -20.482 -16.160 -17.094 1.00 48.22  ? 365 LEU A CB  1 
ATOM   899  C CG  . LEU A 1 151 ? -21.435 -15.004 -17.343 1.00 49.51  ? 365 LEU A CG  1 
ATOM   900  C CD1 . LEU A 1 151 ? -21.300 -14.524 -18.756 1.00 48.25  ? 365 LEU A CD1 1 
ATOM   901  C CD2 . LEU A 1 151 ? -22.860 -15.402 -17.075 1.00 51.99  ? 365 LEU A CD2 1 
ATOM   902  N N   . GLU A 1 152 ? -18.379 -13.572 -16.686 1.00 58.08  ? 366 GLU A N   1 
ATOM   903  C CA  . GLU A 1 152 ? -18.042 -12.464 -15.852 1.00 61.55  ? 366 GLU A CA  1 
ATOM   904  C C   . GLU A 1 152 ? -18.233 -11.127 -16.535 1.00 60.29  ? 366 GLU A C   1 
ATOM   905  O O   . GLU A 1 152 ? -17.712 -10.879 -17.584 1.00 54.30  ? 366 GLU A O   1 
ATOM   906  C CB  . GLU A 1 152 ? -16.607 -12.611 -15.375 1.00 62.10  ? 366 GLU A CB  1 
ATOM   907  C CG  . GLU A 1 152 ? -16.227 -11.658 -14.274 1.00 70.12  ? 366 GLU A CG  1 
ATOM   908  C CD  . GLU A 1 152 ? -14.810 -11.839 -13.797 1.00 71.95  ? 366 GLU A CD  1 
ATOM   909  O OE1 . GLU A 1 152 ? -14.549 -12.794 -13.067 1.00 75.18  ? 366 GLU A OE1 1 
ATOM   910  O OE2 . GLU A 1 152 ? -13.976 -11.011 -14.144 1.00 71.35  ? 366 GLU A OE2 1 
ATOM   911  N N   . ASP A 1 153 ? -18.989 -10.255 -15.903 1.00 65.87  ? 367 ASP A N   1 
ATOM   912  C CA  . ASP A 1 153 ? -19.227 -8.939  -16.446 1.00 69.57  ? 367 ASP A CA  1 
ATOM   913  C C   . ASP A 1 153 ? -19.782 -8.918  -17.866 1.00 61.80  ? 367 ASP A C   1 
ATOM   914  O O   . ASP A 1 153 ? -19.405 -8.099  -18.671 1.00 58.81  ? 367 ASP A O   1 
ATOM   915  C CB  . ASP A 1 153 ? -17.957 -8.118  -16.393 1.00 77.39  ? 367 ASP A CB  1 
ATOM   916  C CG  . ASP A 1 153 ? -17.583 -7.716  -15.002 1.00 86.96  ? 367 ASP A CG  1 
ATOM   917  O OD1 . ASP A 1 153 ? -18.347 -7.978  -14.076 1.00 93.68  ? 367 ASP A OD1 1 
ATOM   918  O OD2 . ASP A 1 153 ? -16.514 -7.129  -14.832 1.00 89.23  ? 367 ASP A OD2 1 
ATOM   919  N N   . GLY A 1 154 ? -20.683 -9.821  -18.172 1.00 61.03  ? 368 GLY A N   1 
ATOM   920  C CA  . GLY A 1 154 ? -21.245 -9.824  -19.494 1.00 57.13  ? 368 GLY A CA  1 
ATOM   921  C C   . GLY A 1 154 ? -20.392 -10.407 -20.586 1.00 52.73  ? 368 GLY A C   1 
ATOM   922  O O   . GLY A 1 154 ? -20.685 -10.216 -21.736 1.00 49.71  ? 368 GLY A O   1 
ATOM   923  N N   . ARG A 1 155 ? -19.331 -11.112 -20.210 1.00 49.98  ? 369 ARG A N   1 
ATOM   924  C CA  . ARG A 1 155 ? -18.435 -11.720 -21.185 1.00 51.07  ? 369 ARG A CA  1 
ATOM   925  C C   . ARG A 1 155 ? -17.790 -12.971 -20.606 1.00 48.18  ? 369 ARG A C   1 
ATOM   926  O O   . ARG A 1 155 ? -17.899 -13.237 -19.409 1.00 47.03  ? 369 ARG A O   1 
ATOM   927  C CB  . ARG A 1 155 ? -17.358 -10.724 -21.618 1.00 56.33  ? 369 ARG A CB  1 
ATOM   928  C CG  . ARG A 1 155 ? -16.199 -10.599 -20.642 1.00 61.71  ? 369 ARG A CG  1 
ATOM   929  C CD  . ARG A 1 155 ? -15.953 -9.149  -20.261 1.00 68.51  ? 369 ARG A CD  1 
ATOM   930  N NE  . ARG A 1 155 ? -14.713 -8.985  -19.506 1.00 75.65  ? 369 ARG A NE  1 
ATOM   931  C CZ  . ARG A 1 155 ? -14.615 -8.301  -18.371 1.00 83.24  ? 369 ARG A CZ  1 
ATOM   932  N NH1 . ARG A 1 155 ? -15.685 -7.714  -17.853 1.00 88.60  ? 369 ARG A NH1 1 
ATOM   933  N NH2 . ARG A 1 155 ? -13.446 -8.205  -17.752 1.00 85.04  ? 369 ARG A NH2 1 
ATOM   934  N N   . PHE A 1 156 ? -17.118 -13.739 -21.457 1.00 36.06  ? 370 PHE A N   1 
ATOM   935  C CA  . PHE A 1 156 ? -16.473 -14.943 -21.012 1.00 35.51  ? 370 PHE A CA  1 
ATOM   936  C C   . PHE A 1 156 ? -14.985 -14.735 -20.777 1.00 35.36  ? 370 PHE A C   1 
ATOM   937  O O   . PHE A 1 156 ? -14.300 -14.252 -21.622 1.00 34.27  ? 370 PHE A O   1 
ATOM   938  C CB  . PHE A 1 156 ? -16.709 -16.052 -22.010 1.00 37.10  ? 370 PHE A CB  1 
ATOM   939  C CG  . PHE A 1 156 ? -18.133 -16.480 -22.091 1.00 37.79  ? 370 PHE A CG  1 
ATOM   940  C CD1 . PHE A 1 156 ? -18.705 -17.181 -21.067 1.00 37.27  ? 370 PHE A CD1 1 
ATOM   941  C CD2 . PHE A 1 156 ? -18.897 -16.139 -23.173 1.00 39.90  ? 370 PHE A CD2 1 
ATOM   942  C CE1 . PHE A 1 156 ? -20.008 -17.560 -21.119 1.00 41.98  ? 370 PHE A CE1 1 
ATOM   943  C CE2 . PHE A 1 156 ? -20.209 -16.519 -23.239 1.00 42.26  ? 370 PHE A CE2 1 
ATOM   944  C CZ  . PHE A 1 156 ? -20.764 -17.231 -22.209 1.00 41.86  ? 370 PHE A CZ  1 
ATOM   945  N N   . VAL A 1 157 ? -14.506 -15.113 -19.611 1.00 37.09  ? 371 VAL A N   1 
ATOM   946  C CA  . VAL A 1 157 ? -13.100 -14.959 -19.297 1.00 36.06  ? 371 VAL A CA  1 
ATOM   947  C C   . VAL A 1 157 ? -12.412 -16.298 -19.180 1.00 37.83  ? 371 VAL A C   1 
ATOM   948  O O   . VAL A 1 157 ? -13.008 -17.255 -18.778 1.00 36.03  ? 371 VAL A O   1 
ATOM   949  C CB  . VAL A 1 157 ? -12.869 -14.133 -18.040 1.00 39.91  ? 371 VAL A CB  1 
ATOM   950  C CG1 . VAL A 1 157 ? -13.455 -12.762 -18.178 1.00 40.41  ? 371 VAL A CG1 1 
ATOM   951  C CG2 . VAL A 1 157 ? -13.444 -14.821 -16.837 1.00 45.46  ? 371 VAL A CG2 1 
ATOM   952  N N   . TYR A 1 158 ? -11.147 -16.350 -19.555 1.00 33.50  ? 372 TYR A N   1 
ATOM   953  C CA  . TYR A 1 158 ? -10.387 -17.587 -19.494 1.00 36.47  ? 372 TYR A CA  1 
ATOM   954  C C   . TYR A 1 158 ? -9.116  -17.334 -18.697 1.00 36.11  ? 372 TYR A C   1 
ATOM   955  O O   . TYR A 1 158 ? -8.188  -16.701 -19.192 1.00 35.78  ? 372 TYR A O   1 
ATOM   956  C CB  . TYR A 1 158 ? -10.060 -18.095 -20.901 1.00 36.08  ? 372 TYR A CB  1 
ATOM   957  C CG  . TYR A 1 158 ? -11.276 -18.282 -21.784 1.00 35.08  ? 372 TYR A CG  1 
ATOM   958  C CD1 . TYR A 1 158 ? -11.864 -19.531 -21.935 1.00 38.35  ? 372 TYR A CD1 1 
ATOM   959  C CD2 . TYR A 1 158 ? -11.840 -17.207 -22.462 1.00 34.31  ? 372 TYR A CD2 1 
ATOM   960  C CE1 . TYR A 1 158 ? -12.978 -19.705 -22.742 1.00 38.50  ? 372 TYR A CE1 1 
ATOM   961  C CE2 . TYR A 1 158 ? -12.955 -17.371 -23.264 1.00 33.35  ? 372 TYR A CE2 1 
ATOM   962  C CZ  . TYR A 1 158 ? -13.520 -18.621 -23.401 1.00 36.14  ? 372 TYR A CZ  1 
ATOM   963  O OH  . TYR A 1 158 ? -14.630 -18.791 -24.202 1.00 36.40  ? 372 TYR A OH  1 
ATOM   964  N N   . ARG A 1 159 ? -9.086  -17.810 -17.456 1.00 37.99  ? 373 ARG A N   1 
ATOM   965  C CA  . ARG A 1 159 ? -7.971  -17.508 -16.567 1.00 42.71  ? 373 ARG A CA  1 
ATOM   966  C C   . ARG A 1 159 ? -7.070  -18.712 -16.329 1.00 43.54  ? 373 ARG A C   1 
ATOM   967  O O   . ARG A 1 159 ? -7.477  -19.704 -15.722 1.00 37.82  ? 373 ARG A O   1 
ATOM   968  C CB  . ARG A 1 159 ? -8.484  -16.972 -15.228 1.00 47.63  ? 373 ARG A CB  1 
ATOM   969  C CG  . ARG A 1 159 ? -9.244  -15.661 -15.345 1.00 53.97  ? 373 ARG A CG  1 
ATOM   970  C CD  . ARG A 1 159 ? -9.312  -14.932 -14.015 1.00 59.37  ? 373 ARG A CD  1 
ATOM   971  N NE  . ARG A 1 159 ? -9.909  -13.607 -14.156 1.00 61.40  ? 373 ARG A NE  1 
ATOM   972  C CZ  . ARG A 1 159 ? -11.181 -13.328 -13.893 1.00 61.59  ? 373 ARG A CZ  1 
ATOM   973  N NH1 . ARG A 1 159 ? -11.995 -14.284 -13.467 1.00 63.79  ? 373 ARG A NH1 1 
ATOM   974  N NH2 . ARG A 1 159 ? -11.638 -12.094 -14.052 1.00 60.73  ? 373 ARG A NH2 1 
ATOM   975  N N   . LEU A 1 160 ? -5.837  -18.578 -16.775 1.00 42.27  ? 374 LEU A N   1 
ATOM   976  C CA  . LEU A 1 160 ? -4.827  -19.587 -16.576 1.00 43.97  ? 374 LEU A CA  1 
ATOM   977  C C   . LEU A 1 160 ? -3.813  -18.904 -15.681 1.00 41.33  ? 374 LEU A C   1 
ATOM   978  O O   . LEU A 1 160 ? -2.784  -18.468 -16.113 1.00 38.09  ? 374 LEU A O   1 
ATOM   979  C CB  . LEU A 1 160 ? -4.217  -20.018 -17.899 1.00 46.18  ? 374 LEU A CB  1 
ATOM   980  C CG  . LEU A 1 160 ? -5.148  -20.663 -18.924 1.00 48.78  ? 374 LEU A CG  1 
ATOM   981  C CD1 . LEU A 1 160 ? -5.796  -19.668 -19.841 1.00 46.44  ? 374 LEU A CD1 1 
ATOM   982  C CD2 . LEU A 1 160 ? -4.482  -21.732 -19.746 1.00 50.76  ? 374 LEU A CD2 1 
ATOM   983  N N   . LEU A 1 161 ? -4.143  -18.796 -14.414 1.00 42.72  ? 375 LEU A N   1 
ATOM   984  C CA  . LEU A 1 161 ? -3.284  -18.121 -13.480 1.00 44.35  ? 375 LEU A CA  1 
ATOM   985  C C   . LEU A 1 161 ? -2.335  -19.006 -12.694 1.00 45.92  ? 375 LEU A C   1 
ATOM   986  O O   . LEU A 1 161 ? -2.603  -20.143 -12.428 1.00 45.55  ? 375 LEU A O   1 
ATOM   987  C CB  . LEU A 1 161 ? -4.087  -17.232 -12.546 1.00 46.50  ? 375 LEU A CB  1 
ATOM   988  C CG  . LEU A 1 161 ? -5.200  -16.365 -13.124 1.00 49.70  ? 375 LEU A CG  1 
ATOM   989  C CD1 . LEU A 1 161 ? -6.039  -15.773 -12.017 1.00 52.57  ? 375 LEU A CD1 1 
ATOM   990  C CD2 . LEU A 1 161 ? -4.652  -15.264 -13.997 1.00 50.02  ? 375 LEU A CD2 1 
ATOM   991  N N   . ARG A 1 162 ? -1.208  -18.419 -12.345 1.00 46.56  ? 376 ARG A N   1 
ATOM   992  C CA  . ARG A 1 162 ? -0.161  -19.070 -11.595 1.00 48.56  ? 376 ARG A CA  1 
ATOM   993  C C   . ARG A 1 162 ? 0.229   -20.446 -12.086 1.00 46.56  ? 376 ARG A C   1 
ATOM   994  O O   . ARG A 1 162 ? 0.450   -21.320 -11.313 1.00 49.42  ? 376 ARG A O   1 
ATOM   995  C CB  . ARG A 1 162 ? -0.502  -19.100 -10.118 1.00 54.78  ? 376 ARG A CB  1 
ATOM   996  C CG  . ARG A 1 162 ? -0.584  -17.733 -9.486  1.00 59.32  ? 376 ARG A CG  1 
ATOM   997  C CD  . ARG A 1 162 ? -0.957  -17.849 -8.042  1.00 64.67  ? 376 ARG A CD  1 
ATOM   998  N NE  . ARG A 1 162 ? 0.109   -18.465 -7.295  1.00 67.18  ? 376 ARG A NE  1 
ATOM   999  C CZ  . ARG A 1 162 ? 1.057   -17.778 -6.704  1.00 67.78  ? 376 ARG A CZ  1 
ATOM   1000 N NH1 . ARG A 1 162 ? 1.046   -16.467 -6.767  1.00 68.02  ? 376 ARG A NH1 1 
ATOM   1001 N NH2 . ARG A 1 162 ? 1.996   -18.404 -6.046  1.00 69.62  ? 376 ARG A NH2 1 
ATOM   1002 N N   . SER A 1 163 ? 0.320   -20.627 -13.384 1.00 42.81  ? 377 SER A N   1 
ATOM   1003 C CA  . SER A 1 163 ? 0.740   -21.893 -13.926 1.00 43.56  ? 377 SER A CA  1 
ATOM   1004 C C   . SER A 1 163 ? 2.234   -22.039 -13.648 1.00 44.65  ? 377 SER A C   1 
ATOM   1005 O O   . SER A 1 163 ? 2.992   -21.186 -14.011 1.00 39.92  ? 377 SER A O   1 
ATOM   1006 C CB  . SER A 1 163 ? 0.491   -21.922 -15.405 1.00 45.46  ? 377 SER A CB  1 
ATOM   1007 O OG  . SER A 1 163 ? 0.885   -23.137 -15.930 1.00 50.29  ? 377 SER A OG  1 
ATOM   1008 N N   . PRO A 1 164 ? 2.660   -23.101 -13.001 1.00 46.88  ? 378 PRO A N   1 
ATOM   1009 C CA  . PRO A 1 164 ? 4.073   -23.299 -12.711 1.00 45.82  ? 378 PRO A CA  1 
ATOM   1010 C C   . PRO A 1 164 ? 4.950   -23.318 -13.936 1.00 44.51  ? 378 PRO A C   1 
ATOM   1011 O O   . PRO A 1 164 ? 4.740   -24.085 -14.835 1.00 41.62  ? 378 PRO A O   1 
ATOM   1012 C CB  . PRO A 1 164 ? 4.101   -24.685 -12.101 1.00 47.69  ? 378 PRO A CB  1 
ATOM   1013 C CG  . PRO A 1 164 ? 2.747   -24.893 -11.587 1.00 49.59  ? 378 PRO A CG  1 
ATOM   1014 C CD  . PRO A 1 164 ? 1.863   -24.244 -12.576 1.00 48.12  ? 378 PRO A CD  1 
ATOM   1015 N N   . MET A 1 165 ? 5.955   -22.464 -13.940 1.00 45.09  ? 379 MET A N   1 
ATOM   1016 C CA  . MET A 1 165 ? 6.895   -22.411 -15.028 1.00 42.47  ? 379 MET A CA  1 
ATOM   1017 C C   . MET A 1 165 ? 7.657   -23.723 -15.110 1.00 44.01  ? 379 MET A C   1 
ATOM   1018 O O   . MET A 1 165 ? 8.044   -24.262 -14.125 1.00 43.87  ? 379 MET A O   1 
ATOM   1019 C CB  . MET A 1 165 ? 7.843   -21.248 -14.807 1.00 39.84  ? 379 MET A CB  1 
ATOM   1020 C CG  . MET A 1 165 ? 8.603   -20.816 -16.036 1.00 36.07  ? 379 MET A CG  1 
ATOM   1021 S SD  . MET A 1 165 ? 9.598   -19.355 -15.820 1.00 33.75  ? 379 MET A SD  1 
ATOM   1022 C CE  . MET A 1 165 ? 8.426   -18.076 -15.599 1.00 33.64  ? 379 MET A CE  1 
HETATM 1023 O O   . P1L A 1 166 ? 10.602  -24.370 -15.968 1.00 44.86  ? 380 P1L A O   1 
HETATM 1024 N N   . P1L A 1 166 ? 7.850   -24.222 -16.311 1.00 35.91  ? 380 P1L A N   1 
HETATM 1025 C CA  . P1L A 1 166 ? 8.549   -25.454 -16.524 1.00 52.01  ? 380 P1L A CA  1 
HETATM 1026 C CB  . P1L A 1 166 ? 8.538   -25.942 -17.966 1.00 51.81  ? 380 P1L A CB  1 
HETATM 1027 S SG  . P1L A 1 166 ? 8.857   -24.642 -19.077 1.00 117.39 ? 380 P1L A SG  1 
HETATM 1028 C C7  . P1L A 1 166 ? 7.312   -23.975 -18.951 1.00 68.12  ? 380 P1L A C7  1 
HETATM 1029 O O7  . P1L A 1 166 ? 6.893   -23.708 -17.843 1.00 69.14  ? 380 P1L A O7  1 
HETATM 1030 C C8  . P1L A 1 166 ? 6.379   -23.738 -20.089 1.00 65.09  ? 380 P1L A C8  1 
HETATM 1031 C C9  . P1L A 1 166 ? 5.703   -22.405 -19.969 1.00 60.03  ? 380 P1L A C9  1 
HETATM 1032 C C10 . P1L A 1 166 ? 5.667   -21.826 -21.363 1.00 58.06  ? 380 P1L A C10 1 
HETATM 1033 C C11 . P1L A 1 166 ? 4.738   -20.634 -21.449 1.00 58.06  ? 380 P1L A C11 1 
HETATM 1034 C C12 . P1L A 1 166 ? 5.450   -19.359 -21.836 1.00 56.04  ? 380 P1L A C12 1 
HETATM 1035 C C13 . P1L A 1 166 ? 6.685   -19.186 -20.983 1.00 55.87  ? 380 P1L A C13 1 
HETATM 1036 C C14 . P1L A 1 166 ? 6.782   -17.823 -20.354 1.00 54.19  ? 380 P1L A C14 1 
HETATM 1037 C C15 . P1L A 1 166 ? 7.302   -16.766 -21.289 1.00 53.87  ? 380 P1L A C15 1 
HETATM 1038 C C16 . P1L A 1 166 ? 8.758   -16.434 -21.012 1.00 55.57  ? 380 P1L A C16 1 
HETATM 1039 C C17 . P1L A 1 166 ? 9.073   -16.305 -19.543 1.00 54.57  ? 380 P1L A C17 1 
HETATM 1040 C C18 . P1L A 1 166 ? 10.209  -15.344 -19.275 1.00 52.50  ? 380 P1L A C18 1 
HETATM 1041 C C19 . P1L A 1 166 ? 11.373  -15.623 -20.190 1.00 51.03  ? 380 P1L A C19 1 
HETATM 1042 C C20 . P1L A 1 166 ? 11.934  -14.344 -20.750 1.00 49.51  ? 380 P1L A C20 1 
HETATM 1043 C C   . P1L A 1 166 ? 9.955   -25.414 -15.999 1.00 49.17  ? 380 P1L A C   1 
HETATM 1044 C C21 . P1L A 1 166 ? 13.138  -14.681 -21.587 1.00 48.82  ? 380 P1L A C21 1 
HETATM 1045 C C22 . P1L A 1 166 ? 14.351  -14.780 -20.731 1.00 48.62  ? 380 P1L A C22 1 
ATOM   1046 N N   . GLU A 1 167 ? 10.429  -26.568 -15.578 1.00 51.75  ? 381 GLU A N   1 
ATOM   1047 C CA  . GLU A 1 167 ? 11.762  -26.690 -14.993 1.00 56.94  ? 381 GLU A CA  1 
ATOM   1048 C C   . GLU A 1 167 ? 12.867  -26.214 -15.933 1.00 52.16  ? 381 GLU A C   1 
ATOM   1049 O O   . GLU A 1 167 ? 13.882  -25.686 -15.484 1.00 52.70  ? 381 GLU A O   1 
ATOM   1050 C CB  . GLU A 1 167 ? 12.034  -28.139 -14.579 1.00 67.30  ? 381 GLU A CB  1 
ATOM   1051 C CG  . GLU A 1 167 ? 11.131  -28.660 -13.477 1.00 75.75  ? 381 GLU A CG  1 
ATOM   1052 C CD  . GLU A 1 167 ? 10.073  -29.618 -13.989 1.00 81.58  ? 381 GLU A CD  1 
ATOM   1053 O OE1 . GLU A 1 167 ? 8.883   -29.238 -13.993 1.00 82.13  ? 381 GLU A OE1 1 
ATOM   1054 O OE2 . GLU A 1 167 ? 10.428  -30.752 -14.381 1.00 85.32  ? 381 GLU A OE2 1 
ATOM   1055 N N   . TYR A 1 168 ? 12.668  -26.402 -17.234 1.00 45.97  ? 382 TYR A N   1 
ATOM   1056 C CA  . TYR A 1 168 ? 13.665  -25.994 -18.218 1.00 44.16  ? 382 TYR A CA  1 
ATOM   1057 C C   . TYR A 1 168 ? 13.850  -24.478 -18.198 1.00 41.90  ? 382 TYR A C   1 
ATOM   1058 O O   . TYR A 1 168 ? 14.975  -23.981 -18.219 1.00 39.65  ? 382 TYR A O   1 
ATOM   1059 C CB  . TYR A 1 168 ? 13.271  -26.464 -19.622 1.00 41.77  ? 382 TYR A CB  1 
ATOM   1060 C CG  . TYR A 1 168 ? 14.202  -25.982 -20.715 1.00 41.83  ? 382 TYR A CG  1 
ATOM   1061 C CD1 . TYR A 1 168 ? 15.327  -26.716 -21.073 1.00 45.59  ? 382 TYR A CD1 1 
ATOM   1062 C CD2 . TYR A 1 168 ? 13.954  -24.794 -21.393 1.00 40.23  ? 382 TYR A CD2 1 
ATOM   1063 C CE1 . TYR A 1 168 ? 16.179  -26.276 -22.071 1.00 46.37  ? 382 TYR A CE1 1 
ATOM   1064 C CE2 . TYR A 1 168 ? 14.799  -24.346 -22.387 1.00 42.92  ? 382 TYR A CE2 1 
ATOM   1065 C CZ  . TYR A 1 168 ? 15.909  -25.092 -22.724 1.00 46.24  ? 382 TYR A CZ  1 
ATOM   1066 O OH  . TYR A 1 168 ? 16.749  -24.644 -23.717 1.00 47.85  ? 382 TYR A OH  1 
ATOM   1067 N N   . LEU A 1 169 ? 12.737  -23.752 -18.154 1.00 36.46  ? 383 LEU A N   1 
ATOM   1068 C CA  . LEU A 1 169 ? 12.767  -22.295 -18.134 1.00 32.53  ? 383 LEU A CA  1 
ATOM   1069 C C   . LEU A 1 169 ? 13.349  -21.742 -16.841 1.00 33.78  ? 383 LEU A C   1 
ATOM   1070 O O   . LEU A 1 169 ? 14.109  -20.771 -16.865 1.00 30.40  ? 383 LEU A O   1 
ATOM   1071 C CB  . LEU A 1 169 ? 11.362  -21.723 -18.340 1.00 34.16  ? 383 LEU A CB  1 
ATOM   1072 C CG  . LEU A 1 169 ? 10.850  -21.632 -19.775 1.00 38.02  ? 383 LEU A CG  1 
ATOM   1073 C CD1 . LEU A 1 169 ? 9.674   -20.671 -19.839 1.00 44.53  ? 383 LEU A CD1 1 
ATOM   1074 C CD2 . LEU A 1 169 ? 11.959  -21.188 -20.707 1.00 38.70  ? 383 LEU A CD2 1 
ATOM   1075 N N   . VAL A 1 170 ? 12.985  -22.356 -15.734 1.00 31.86  ? 384 VAL A N   1 
ATOM   1076 C CA  . VAL A 1 170 ? 13.472  -21.921 -14.469 1.00 33.75  ? 384 VAL A CA  1 
ATOM   1077 C C   . VAL A 1 170 ? 14.972  -22.082 -14.475 1.00 34.62  ? 384 VAL A C   1 
ATOM   1078 O O   . VAL A 1 170 ? 15.660  -21.201 -14.085 1.00 34.59  ? 384 VAL A O   1 
ATOM   1079 C CB  . VAL A 1 170 ? 12.876  -22.702 -13.309 1.00 36.99  ? 384 VAL A CB  1 
ATOM   1080 C CG1 . VAL A 1 170 ? 13.502  -22.236 -12.031 1.00 39.48  ? 384 VAL A CG1 1 
ATOM   1081 C CG2 . VAL A 1 170 ? 11.389  -22.502 -13.235 1.00 40.36  ? 384 VAL A CG2 1 
ATOM   1082 N N   . ASN A 1 171 ? 15.452  -23.217 -14.938 1.00 35.86  ? 385 ASN A N   1 
ATOM   1083 C CA  . ASN A 1 171 ? 16.867  -23.472 -15.005 1.00 43.25  ? 385 ASN A CA  1 
ATOM   1084 C C   . ASN A 1 171 ? 17.572  -22.513 -15.949 1.00 39.00  ? 385 ASN A C   1 
ATOM   1085 O O   . ASN A 1 171 ? 18.614  -22.019 -15.647 1.00 39.33  ? 385 ASN A O   1 
ATOM   1086 C CB  . ASN A 1 171 ? 17.162  -24.910 -15.391 1.00 49.88  ? 385 ASN A CB  1 
ATOM   1087 C CG  . ASN A 1 171 ? 16.794  -25.900 -14.304 1.00 57.83  ? 385 ASN A CG  1 
ATOM   1088 O OD1 . ASN A 1 171 ? 16.885  -25.619 -13.131 1.00 63.94  ? 385 ASN A OD1 1 
ATOM   1089 N ND2 . ASN A 1 171 ? 16.358  -27.063 -14.712 1.00 58.36  ? 385 ASN A ND2 1 
ATOM   1090 N N   . PHE A 1 172 ? 16.961  -22.267 -17.089 1.00 36.90  ? 386 PHE A N   1 
ATOM   1091 C CA  . PHE A 1 172 ? 17.495  -21.377 -18.090 1.00 39.16  ? 386 PHE A CA  1 
ATOM   1092 C C   . PHE A 1 172 ? 17.589  -19.956 -17.576 1.00 40.63  ? 386 PHE A C   1 
ATOM   1093 O O   . PHE A 1 172 ? 18.529  -19.270 -17.853 1.00 38.87  ? 386 PHE A O   1 
ATOM   1094 C CB  . PHE A 1 172 ? 16.633  -21.429 -19.333 1.00 36.91  ? 386 PHE A CB  1 
ATOM   1095 C CG  . PHE A 1 172 ? 17.065  -20.516 -20.425 1.00 33.07  ? 386 PHE A CG  1 
ATOM   1096 C CD1 . PHE A 1 172 ? 18.278  -20.663 -21.026 1.00 35.48  ? 386 PHE A CD1 1 
ATOM   1097 C CD2 . PHE A 1 172 ? 16.239  -19.543 -20.868 1.00 29.62  ? 386 PHE A CD2 1 
ATOM   1098 C CE1 . PHE A 1 172 ? 18.661  -19.843 -22.049 1.00 32.97  ? 386 PHE A CE1 1 
ATOM   1099 C CE2 . PHE A 1 172 ? 16.611  -18.715 -21.876 1.00 31.63  ? 386 PHE A CE2 1 
ATOM   1100 C CZ  . PHE A 1 172 ? 17.827  -18.868 -22.478 1.00 32.88  ? 386 PHE A CZ  1 
ATOM   1101 N N   . LEU A 1 173 ? 16.593  -19.539 -16.817 1.00 37.82  ? 387 LEU A N   1 
ATOM   1102 C CA  . LEU A 1 173 ? 16.569  -18.199 -16.241 1.00 32.82  ? 387 LEU A CA  1 
ATOM   1103 C C   . LEU A 1 173 ? 17.668  -17.998 -15.198 1.00 34.92  ? 387 LEU A C   1 
ATOM   1104 O O   . LEU A 1 173 ? 18.266  -16.926 -15.118 1.00 33.49  ? 387 LEU A O   1 
ATOM   1105 C CB  . LEU A 1 173 ? 15.199  -17.910 -15.618 1.00 32.09  ? 387 LEU A CB  1 
ATOM   1106 C CG  . LEU A 1 173 ? 14.087  -17.503 -16.591 1.00 31.62  ? 387 LEU A CG  1 
ATOM   1107 C CD1 . LEU A 1 173 ? 12.749  -17.343 -15.877 1.00 33.03  ? 387 LEU A CD1 1 
ATOM   1108 C CD2 . LEU A 1 173 ? 14.464  -16.217 -17.306 1.00 32.26  ? 387 LEU A CD2 1 
ATOM   1109 N N   . HIS A 1 174 ? 17.923  -19.033 -14.442 1.00 39.65  ? 388 HIS A N   1 
ATOM   1110 C CA  . HIS A 1 174 ? 18.932  -19.028 -13.423 1.00 49.39  ? 388 HIS A CA  1 
ATOM   1111 C C   . HIS A 1 174 ? 20.312  -18.878 -14.005 1.00 44.99  ? 388 HIS A C   1 
ATOM   1112 O O   . HIS A 1 174 ? 21.140  -18.260 -13.439 1.00 47.43  ? 388 HIS A O   1 
ATOM   1113 C CB  . HIS A 1 174 ? 18.852  -20.319 -12.643 1.00 63.96  ? 388 HIS A CB  1 
ATOM   1114 C CG  . HIS A 1 174 ? 19.625  -20.302 -11.378 1.00 79.54  ? 388 HIS A CG  1 
ATOM   1115 N ND1 . HIS A 1 174 ? 19.194  -20.936 -10.237 1.00 86.34  ? 388 HIS A ND1 1 
ATOM   1116 C CD2 . HIS A 1 174 ? 20.804  -19.728 -11.065 1.00 84.36  ? 388 HIS A CD2 1 
ATOM   1117 C CE1 . HIS A 1 174 ? 20.076  -20.751 -9.273  1.00 90.04  ? 388 HIS A CE1 1 
ATOM   1118 N NE2 . HIS A 1 174 ? 21.061  -20.019 -9.752  1.00 87.62  ? 388 HIS A NE2 1 
ATOM   1119 N N   . LYS A 1 175 ? 20.539  -19.474 -15.141 1.00 41.04  ? 389 LYS A N   1 
ATOM   1120 C CA  . LYS A 1 175 ? 21.811  -19.394 -15.849 1.00 42.76  ? 389 LYS A CA  1 
ATOM   1121 C C   . LYS A 1 175 ? 21.934  -18.064 -16.579 1.00 39.43  ? 389 LYS A C   1 
ATOM   1122 O O   . LYS A 1 175 ? 22.990  -17.434 -16.572 1.00 38.18  ? 389 LYS A O   1 
ATOM   1123 C CB  . LYS A 1 175 ? 21.952  -20.544 -16.846 1.00 43.32  ? 389 LYS A CB  1 
ATOM   1124 C CG  . LYS A 1 175 ? 21.971  -21.922 -16.217 1.00 48.46  ? 389 LYS A CG  1 
ATOM   1125 C CD  . LYS A 1 175 ? 21.897  -22.997 -17.287 1.00 50.88  ? 389 LYS A CD  1 
ATOM   1126 C CE  . LYS A 1 175 ? 21.739  -24.378 -16.678 1.00 55.61  ? 389 LYS A CE  1 
ATOM   1127 N NZ  . LYS A 1 175 ? 21.503  -25.411 -17.725 1.00 56.04  ? 389 LYS A NZ  1 
ATOM   1128 N N   . LEU A 1 176 ? 20.865  -17.673 -17.235 1.00 37.09  ? 390 LEU A N   1 
ATOM   1129 C CA  . LEU A 1 176 ? 20.831  -16.469 -18.004 1.00 35.72  ? 390 LEU A CA  1 
ATOM   1130 C C   . LEU A 1 176 ? 21.127  -15.242 -17.215 1.00 34.13  ? 390 LEU A C   1 
ATOM   1131 O O   . LEU A 1 176 ? 21.783  -14.366 -17.676 1.00 31.07  ? 390 LEU A O   1 
ATOM   1132 C CB  . LEU A 1 176 ? 19.470  -16.321 -18.630 1.00 38.05  ? 390 LEU A CB  1 
ATOM   1133 C CG  . LEU A 1 176 ? 19.363  -15.444 -19.849 1.00 40.31  ? 390 LEU A CG  1 
ATOM   1134 C CD1 . LEU A 1 176 ? 20.450  -15.731 -20.842 1.00 39.35  ? 390 LEU A CD1 1 
ATOM   1135 C CD2 . LEU A 1 176 ? 18.004  -15.572 -20.486 1.00 40.62  ? 390 LEU A CD2 1 
ATOM   1136 N N   . ARG A 1 177 ? 20.618  -15.191 -16.015 1.00 35.69  ? 391 ARG A N   1 
ATOM   1137 C CA  . ARG A 1 177 ? 20.817  -14.021 -15.222 1.00 41.73  ? 391 ARG A CA  1 
ATOM   1138 C C   . ARG A 1 177 ? 22.190  -13.891 -14.612 1.00 42.26  ? 391 ARG A C   1 
ATOM   1139 O O   . ARG A 1 177 ? 22.493  -12.892 -14.049 1.00 47.14  ? 391 ARG A O   1 
ATOM   1140 C CB  . ARG A 1 177 ? 19.729  -13.885 -14.196 1.00 42.07  ? 391 ARG A CB  1 
ATOM   1141 C CG  . ARG A 1 177 ? 19.974  -14.660 -12.957 1.00 48.67  ? 391 ARG A CG  1 
ATOM   1142 C CD  . ARG A 1 177 ? 19.096  -14.081 -11.875 1.00 55.12  ? 391 ARG A CD  1 
ATOM   1143 N NE  . ARG A 1 177 ? 18.846  -15.080 -10.888 1.00 59.40  ? 391 ARG A NE  1 
ATOM   1144 C CZ  . ARG A 1 177 ? 18.366  -14.825 -9.700  1.00 62.92  ? 391 ARG A CZ  1 
ATOM   1145 N NH1 . ARG A 1 177 ? 18.198  -15.817 -8.874  1.00 65.51  ? 391 ARG A NH1 1 
ATOM   1146 N NH2 . ARG A 1 177 ? 18.078  -13.592 -9.345  1.00 64.41  ? 391 ARG A NH2 1 
ATOM   1147 N N   . GLN A 1 178 ? 23.003  -14.909 -14.751 1.00 41.31  ? 392 GLN A N   1 
ATOM   1148 C CA  . GLN A 1 178 ? 24.354  -14.874 -14.255 1.00 44.50  ? 392 GLN A CA  1 
ATOM   1149 C C   . GLN A 1 178 ? 25.310  -14.286 -15.296 1.00 41.12  ? 392 GLN A C   1 
ATOM   1150 O O   . GLN A 1 178 ? 26.422  -14.007 -14.974 1.00 45.03  ? 392 GLN A O   1 
ATOM   1151 C CB  . GLN A 1 178 ? 24.827  -16.262 -13.865 1.00 51.80  ? 392 GLN A CB  1 
ATOM   1152 C CG  . GLN A 1 178 ? 24.045  -16.879 -12.735 1.00 62.35  ? 392 GLN A CG  1 
ATOM   1153 C CD  . GLN A 1 178 ? 24.755  -18.039 -12.088 1.00 74.72  ? 392 GLN A CD  1 
ATOM   1154 O OE1 . GLN A 1 178 ? 25.149  -19.006 -12.747 1.00 78.89  ? 392 GLN A OE1 1 
ATOM   1155 N NE2 . GLN A 1 178 ? 24.929  -17.947 -10.776 1.00 79.95  ? 392 GLN A NE2 1 
ATOM   1156 N N   . LEU A 1 179 ? 24.876  -14.108 -16.527 1.00 36.96  ? 393 LEU A N   1 
ATOM   1157 C CA  . LEU A 1 179 ? 25.724  -13.543 -17.549 1.00 38.83  ? 393 LEU A CA  1 
ATOM   1158 C C   . LEU A 1 179 ? 26.144  -12.144 -17.126 1.00 37.17  ? 393 LEU A C   1 
ATOM   1159 O O   . LEU A 1 179 ? 25.371  -11.432 -16.596 1.00 37.66  ? 393 LEU A O   1 
ATOM   1160 C CB  . LEU A 1 179 ? 25.029  -13.539 -18.883 1.00 40.94  ? 393 LEU A CB  1 
ATOM   1161 C CG  . LEU A 1 179 ? 25.193  -14.808 -19.694 1.00 46.32  ? 393 LEU A CG  1 
ATOM   1162 C CD1 . LEU A 1 179 ? 25.107  -16.044 -18.843 1.00 48.07  ? 393 LEU A CD1 1 
ATOM   1163 C CD2 . LEU A 1 179 ? 24.217  -14.875 -20.829 1.00 44.83  ? 393 LEU A CD2 1 
ATOM   1164 N N   . PRO A 1 180 ? 27.385  -11.764 -17.353 1.00 38.36  ? 394 PRO A N   1 
ATOM   1165 C CA  . PRO A 1 180 ? 27.888  -10.469 -16.879 1.00 41.88  ? 394 PRO A CA  1 
ATOM   1166 C C   . PRO A 1 180 ? 27.454  -9.280  -17.733 1.00 42.08  ? 394 PRO A C   1 
ATOM   1167 O O   . PRO A 1 180 ? 27.479  -8.144  -17.259 1.00 43.20  ? 394 PRO A O   1 
ATOM   1168 C CB  . PRO A 1 180 ? 29.409  -10.645 -16.940 1.00 43.37  ? 394 PRO A CB  1 
ATOM   1169 C CG  . PRO A 1 180 ? 29.619  -11.633 -18.031 1.00 40.55  ? 394 PRO A CG  1 
ATOM   1170 C CD  . PRO A 1 180 ? 28.443  -12.574 -17.983 1.00 38.46  ? 394 PRO A CD  1 
ATOM   1171 N N   . GLU A 1 181 ? 27.069  -9.537  -18.977 1.00 39.48  ? 395 GLU A N   1 
ATOM   1172 C CA  . GLU A 1 181 ? 26.737  -8.461  -19.899 1.00 42.34  ? 395 GLU A CA  1 
ATOM   1173 C C   . GLU A 1 181 ? 25.375  -8.690  -20.537 1.00 38.77  ? 395 GLU A C   1 
ATOM   1174 O O   . GLU A 1 181 ? 24.995  -9.828  -20.801 1.00 36.05  ? 395 GLU A O   1 
ATOM   1175 C CB  . GLU A 1 181 ? 27.811  -8.339  -20.983 1.00 48.74  ? 395 GLU A CB  1 
ATOM   1176 C CG  . GLU A 1 181 ? 29.225  -8.156  -20.446 1.00 58.24  ? 395 GLU A CG  1 
ATOM   1177 C CD  . GLU A 1 181 ? 29.543  -6.714  -20.106 1.00 66.89  ? 395 GLU A CD  1 
ATOM   1178 O OE1 . GLU A 1 181 ? 29.541  -5.875  -21.032 1.00 70.66  ? 395 GLU A OE1 1 
ATOM   1179 O OE2 . GLU A 1 181 ? 29.800  -6.419  -18.919 1.00 68.59  ? 395 GLU A OE2 1 
ATOM   1180 N N   . ARG A 1 182 ? 24.642  -7.609  -20.785 1.00 34.91  ? 396 ARG A N   1 
ATOM   1181 C CA  . ARG A 1 182 ? 23.338  -7.727  -21.417 1.00 34.27  ? 396 ARG A CA  1 
ATOM   1182 C C   . ARG A 1 182 ? 23.457  -8.200  -22.862 1.00 31.27  ? 396 ARG A C   1 
ATOM   1183 O O   . ARG A 1 182 ? 22.610  -8.954  -23.335 1.00 28.95  ? 396 ARG A O   1 
ATOM   1184 C CB  . ARG A 1 182 ? 22.580  -6.397  -21.354 1.00 40.53  ? 396 ARG A CB  1 
ATOM   1185 C CG  . ARG A 1 182 ? 21.846  -6.175  -20.039 1.00 45.98  ? 396 ARG A CG  1 
ATOM   1186 C CD  . ARG A 1 182 ? 20.984  -4.922  -20.080 1.00 50.99  ? 396 ARG A CD  1 
ATOM   1187 N NE  . ARG A 1 182 ? 21.773  -3.731  -20.379 1.00 58.95  ? 396 ARG A NE  1 
ATOM   1188 C CZ  . ARG A 1 182 ? 22.440  -3.027  -19.470 1.00 62.21  ? 396 ARG A CZ  1 
ATOM   1189 N NH1 . ARG A 1 182 ? 22.413  -3.390  -18.194 1.00 61.00  ? 396 ARG A NH1 1 
ATOM   1190 N NH2 . ARG A 1 182 ? 23.130  -1.956  -19.836 1.00 66.29  ? 396 ARG A NH2 1 
ATOM   1191 N N   . TYR A 1 183 ? 24.513  -7.781  -23.556 1.00 32.89  ? 397 TYR A N   1 
ATOM   1192 C CA  . TYR A 1 183 ? 24.679  -8.175  -24.954 1.00 28.19  ? 397 TYR A CA  1 
ATOM   1193 C C   . TYR A 1 183 ? 24.906  -9.683  -25.070 1.00 27.79  ? 397 TYR A C   1 
ATOM   1194 O O   . TYR A 1 183 ? 24.575  -10.286 -26.088 1.00 28.76  ? 397 TYR A O   1 
ATOM   1195 C CB  . TYR A 1 183 ? 25.820  -7.393  -25.626 1.00 29.45  ? 397 TYR A CB  1 
ATOM   1196 C CG  . TYR A 1 183 ? 27.233  -7.884  -25.355 1.00 32.16  ? 397 TYR A CG  1 
ATOM   1197 C CD1 . TYR A 1 183 ? 27.784  -8.928  -26.093 1.00 31.47  ? 397 TYR A CD1 1 
ATOM   1198 C CD2 . TYR A 1 183 ? 28.030  -7.271  -24.396 1.00 33.17  ? 397 TYR A CD2 1 
ATOM   1199 C CE1 . TYR A 1 183 ? 29.078  -9.370  -25.859 1.00 33.44  ? 397 TYR A CE1 1 
ATOM   1200 C CE2 . TYR A 1 183 ? 29.326  -7.704  -24.156 1.00 30.65  ? 397 TYR A CE2 1 
ATOM   1201 C CZ  . TYR A 1 183 ? 29.843  -8.753  -24.891 1.00 33.05  ? 397 TYR A CZ  1 
ATOM   1202 O OH  . TYR A 1 183 ? 31.130  -9.187  -24.656 1.00 33.91  ? 397 TYR A OH  1 
ATOM   1203 N N   . MET A 1 184 ? 25.464  -10.290 -24.027 1.00 27.46  ? 398 MET A N   1 
ATOM   1204 C CA  . MET A 1 184 ? 25.660  -11.735 -24.017 1.00 28.51  ? 398 MET A CA  1 
ATOM   1205 C C   . MET A 1 184 ? 24.326  -12.447 -23.819 1.00 26.41  ? 398 MET A C   1 
ATOM   1206 O O   . MET A 1 184 ? 24.082  -13.502 -24.401 1.00 28.25  ? 398 MET A O   1 
ATOM   1207 C CB  . MET A 1 184 ? 26.646  -12.148 -22.926 1.00 27.38  ? 398 MET A CB  1 
ATOM   1208 C CG  . MET A 1 184 ? 28.056  -11.611 -23.119 1.00 28.37  ? 398 MET A CG  1 
ATOM   1209 S SD  . MET A 1 184 ? 29.179  -12.325 -21.911 1.00 33.75  ? 398 MET A SD  1 
ATOM   1210 C CE  . MET A 1 184 ? 30.747  -11.639 -22.447 1.00 44.50  ? 398 MET A CE  1 
ATOM   1211 N N   . MET A 1 185 ? 23.474  -11.863 -22.985 1.00 29.32  ? 399 MET A N   1 
ATOM   1212 C CA  . MET A 1 185 ? 22.119  -12.367 -22.799 1.00 33.24  ? 399 MET A CA  1 
ATOM   1213 C C   . MET A 1 185 ? 21.361  -12.350 -24.120 1.00 30.79  ? 399 MET A C   1 
ATOM   1214 O O   . MET A 1 185 ? 20.716  -13.332 -24.484 1.00 26.10  ? 399 MET A O   1 
ATOM   1215 C CB  . MET A 1 185 ? 21.373  -11.543 -21.753 1.00 32.24  ? 399 MET A CB  1 
ATOM   1216 C CG  . MET A 1 185 ? 21.930  -11.679 -20.350 1.00 33.04  ? 399 MET A CG  1 
ATOM   1217 S SD  . MET A 1 185 ? 21.112  -10.562 -19.203 1.00 34.37  ? 399 MET A SD  1 
ATOM   1218 C CE  . MET A 1 185 ? 21.936  -10.983 -17.673 1.00 34.35  ? 399 MET A CE  1 
ATOM   1219 N N   . ASN A 1 186 ? 21.457  -11.236 -24.839 1.00 28.09  ? 400 ASN A N   1 
ATOM   1220 C CA  . ASN A 1 186 ? 20.811  -11.112 -26.141 1.00 28.81  ? 400 ASN A CA  1 
ATOM   1221 C C   . ASN A 1 186 ? 21.348  -12.129 -27.145 1.00 29.53  ? 400 ASN A C   1 
ATOM   1222 O O   . ASN A 1 186 ? 20.585  -12.676 -27.944 1.00 27.15  ? 400 ASN A O   1 
ATOM   1223 C CB  . ASN A 1 186 ? 20.976  -9.693  -26.691 1.00 31.02  ? 400 ASN A CB  1 
ATOM   1224 C CG  . ASN A 1 186 ? 20.140  -8.675  -25.936 1.00 33.94  ? 400 ASN A CG  1 
ATOM   1225 O OD1 . ASN A 1 186 ? 19.197  -9.033  -25.230 1.00 32.71  ? 400 ASN A OD1 1 
ATOM   1226 N ND2 . ASN A 1 186 ? 20.478  -7.398  -26.088 1.00 33.80  ? 400 ASN A ND2 1 
ATOM   1227 N N   . SER A 1 187 ? 22.656  -12.381 -27.100 1.00 28.37  ? 401 SER A N   1 
ATOM   1228 C CA  . SER A 1 187 ? 23.271  -13.392 -27.956 1.00 28.52  ? 401 SER A CA  1 
ATOM   1229 C C   . SER A 1 187 ? 22.670  -14.773 -27.696 1.00 27.03  ? 401 SER A C   1 
ATOM   1230 O O   . SER A 1 187 ? 22.314  -15.490 -28.630 1.00 30.02  ? 401 SER A O   1 
ATOM   1231 C CB  . SER A 1 187 ? 24.788  -13.436 -27.743 1.00 33.05  ? 401 SER A CB  1 
ATOM   1232 O OG  . SER A 1 187 ? 25.415  -12.266 -28.240 1.00 36.40  ? 401 SER A OG  1 
ATOM   1233 N N   . VAL A 1 188 ? 22.562  -15.139 -26.423 1.00 26.37  ? 402 VAL A N   1 
ATOM   1234 C CA  . VAL A 1 188 ? 21.969  -16.418 -26.038 1.00 31.19  ? 402 VAL A CA  1 
ATOM   1235 C C   . VAL A 1 188 ? 20.471  -16.464 -26.378 1.00 29.43  ? 402 VAL A C   1 
ATOM   1236 O O   . VAL A 1 188 ? 19.960  -17.488 -26.833 1.00 29.19  ? 402 VAL A O   1 
ATOM   1237 C CB  . VAL A 1 188 ? 22.172  -16.698 -24.525 1.00 25.64  ? 402 VAL A CB  1 
ATOM   1238 C CG1 . VAL A 1 188 ? 21.391  -17.935 -24.086 1.00 28.41  ? 402 VAL A CG1 1 
ATOM   1239 C CG2 . VAL A 1 188 ? 23.649  -16.865 -24.206 1.00 28.94  ? 402 VAL A CG2 1 
ATOM   1240 N N   . LEU A 1 189 ? 19.778  -15.349 -26.176 1.00 29.80  ? 403 LEU A N   1 
ATOM   1241 C CA  . LEU A 1 189 ? 18.333  -15.293 -26.417 1.00 28.74  ? 403 LEU A CA  1 
ATOM   1242 C C   . LEU A 1 189 ? 17.971  -15.295 -27.904 1.00 31.08  ? 403 LEU A C   1 
ATOM   1243 O O   . LEU A 1 189 ? 16.821  -15.558 -28.264 1.00 32.22  ? 403 LEU A O   1 
ATOM   1244 C CB  . LEU A 1 189 ? 17.735  -14.063 -25.736 1.00 27.17  ? 403 LEU A CB  1 
ATOM   1245 C CG  . LEU A 1 189 ? 17.591  -14.182 -24.219 1.00 29.00  ? 403 LEU A CG  1 
ATOM   1246 C CD1 . LEU A 1 189 ? 17.204  -12.847 -23.611 1.00 30.28  ? 403 LEU A CD1 1 
ATOM   1247 C CD2 . LEU A 1 189 ? 16.563  -15.248 -23.866 1.00 26.02  ? 403 LEU A CD2 1 
ATOM   1248 N N   . GLU A 1 190 ? 18.951  -15.006 -28.757 1.00 32.65  ? 404 GLU A N   1 
ATOM   1249 C CA  . GLU A 1 190 ? 18.783  -15.080 -30.209 1.00 35.16  ? 404 GLU A CA  1 
ATOM   1250 C C   . GLU A 1 190 ? 18.197  -16.411 -30.675 1.00 36.13  ? 404 GLU A C   1 
ATOM   1251 O O   . GLU A 1 190 ? 17.473  -16.464 -31.668 1.00 40.79  ? 404 GLU A O   1 
ATOM   1252 C CB  . GLU A 1 190 ? 20.126  -14.864 -30.917 1.00 38.13  ? 404 GLU A CB  1 
ATOM   1253 C CG  . GLU A 1 190 ? 20.511  -13.414 -31.145 1.00 44.37  ? 404 GLU A CG  1 
ATOM   1254 C CD  . GLU A 1 190 ? 21.822  -13.279 -31.903 1.00 47.34  ? 404 GLU A CD  1 
ATOM   1255 O OE1 . GLU A 1 190 ? 22.222  -14.247 -32.584 1.00 51.82  ? 404 GLU A OE1 1 
ATOM   1256 O OE2 . GLU A 1 190 ? 22.456  -12.209 -31.813 1.00 49.64  ? 404 GLU A OE2 1 
ATOM   1257 N N   . ASN A 1 191 ? 18.524  -17.483 -29.961 1.00 30.53  ? 405 ASN A N   1 
ATOM   1258 C CA  . ASN A 1 191 ? 18.146  -18.824 -30.386 1.00 32.71  ? 405 ASN A CA  1 
ATOM   1259 C C   . ASN A 1 191 ? 17.011  -19.411 -29.552 1.00 30.34  ? 405 ASN A C   1 
ATOM   1260 O O   . ASN A 1 191 ? 16.721  -20.603 -29.632 1.00 30.62  ? 405 ASN A O   1 
ATOM   1261 C CB  . ASN A 1 191 ? 19.369  -19.738 -30.337 1.00 33.27  ? 405 ASN A CB  1 
ATOM   1262 C CG  . ASN A 1 191 ? 20.597  -19.088 -30.946 1.00 36.35  ? 405 ASN A CG  1 
ATOM   1263 O OD1 . ASN A 1 191 ? 20.693  -18.940 -32.164 1.00 39.41  ? 405 ASN A OD1 1 
ATOM   1264 N ND2 . ASN A 1 191 ? 21.539  -18.686 -30.098 1.00 33.10  ? 405 ASN A ND2 1 
ATOM   1265 N N   . PHE A 1 192 ? 16.362  -18.556 -28.769 1.00 28.00  ? 406 PHE A N   1 
ATOM   1266 C CA  . PHE A 1 192 ? 15.313  -18.980 -27.851 1.00 25.62  ? 406 PHE A CA  1 
ATOM   1267 C C   . PHE A 1 192 ? 13.973  -18.363 -28.247 1.00 25.96  ? 406 PHE A C   1 
ATOM   1268 O O   . PHE A 1 192 ? 13.826  -17.142 -28.268 1.00 27.08  ? 406 PHE A O   1 
ATOM   1269 C CB  . PHE A 1 192 ? 15.695  -18.594 -26.419 1.00 30.35  ? 406 PHE A CB  1 
ATOM   1270 C CG  . PHE A 1 192 ? 14.613  -18.834 -25.409 1.00 35.80  ? 406 PHE A CG  1 
ATOM   1271 C CD1 . PHE A 1 192 ? 13.748  -17.812 -25.045 1.00 40.20  ? 406 PHE A CD1 1 
ATOM   1272 C CD2 . PHE A 1 192 ? 14.471  -20.073 -24.808 1.00 39.40  ? 406 PHE A CD2 1 
ATOM   1273 C CE1 . PHE A 1 192 ? 12.753  -18.025 -24.111 1.00 41.56  ? 406 PHE A CE1 1 
ATOM   1274 C CE2 . PHE A 1 192 ? 13.478  -20.291 -23.872 1.00 42.68  ? 406 PHE A CE2 1 
ATOM   1275 C CZ  . PHE A 1 192 ? 12.617  -19.264 -23.526 1.00 42.24  ? 406 PHE A CZ  1 
ATOM   1276 N N   . THR A 1 193 ? 13.002  -19.213 -28.570 1.00 24.97  ? 407 THR A N   1 
ATOM   1277 C CA  . THR A 1 193 ? 11.688  -18.750 -29.004 1.00 27.08  ? 407 THR A CA  1 
ATOM   1278 C C   . THR A 1 193 ? 10.571  -19.562 -28.362 1.00 28.10  ? 407 THR A C   1 
ATOM   1279 O O   . THR A 1 193 ? 10.774  -20.704 -27.943 1.00 25.61  ? 407 THR A O   1 
ATOM   1280 C CB  . THR A 1 193 ? 11.524  -18.835 -30.535 1.00 31.08  ? 407 THR A CB  1 
ATOM   1281 O OG1 . THR A 1 193 ? 11.634  -20.203 -30.949 1.00 32.46  ? 407 THR A OG1 1 
ATOM   1282 C CG2 . THR A 1 193 ? 12.579  -17.996 -31.250 1.00 32.79  ? 407 THR A CG2 1 
ATOM   1283 N N   . ILE A 1 194 ? 9.388   -18.964 -28.292 1.00 25.62  ? 408 ILE A N   1 
ATOM   1284 C CA  . ILE A 1 194 ? 8.216   -19.656 -27.779 1.00 28.93  ? 408 ILE A CA  1 
ATOM   1285 C C   . ILE A 1 194 ? 7.066   -19.498 -28.767 1.00 30.15  ? 408 ILE A C   1 
ATOM   1286 O O   . ILE A 1 194 ? 6.857   -18.418 -29.324 1.00 28.63  ? 408 ILE A O   1 
ATOM   1287 C CB  . ILE A 1 194 ? 7.807   -19.128 -26.387 1.00 29.06  ? 408 ILE A CB  1 
ATOM   1288 C CG1 . ILE A 1 194 ? 8.931   -19.380 -25.379 1.00 32.41  ? 408 ILE A CG1 1 
ATOM   1289 C CG2 . ILE A 1 194 ? 6.519   -19.792 -25.916 1.00 28.15  ? 408 ILE A CG2 1 
ATOM   1290 C CD1 . ILE A 1 194 ? 8.638   -18.872 -23.989 1.00 34.50  ? 408 ILE A CD1 1 
ATOM   1291 N N   . LEU A 1 195 ? 6.345   -20.588 -29.010 1.00 29.82  ? 409 LEU A N   1 
ATOM   1292 C CA  . LEU A 1 195 ? 5.200   -20.559 -29.907 1.00 29.83  ? 409 LEU A CA  1 
ATOM   1293 C C   . LEU A 1 195 ? 3.955   -20.991 -29.154 1.00 29.19  ? 409 LEU A C   1 
ATOM   1294 O O   . LEU A 1 195 ? 3.888   -22.108 -28.644 1.00 25.58  ? 409 LEU A O   1 
ATOM   1295 C CB  . LEU A 1 195 ? 5.430   -21.463 -31.120 1.00 31.34  ? 409 LEU A CB  1 
ATOM   1296 C CG  . LEU A 1 195 ? 4.296   -21.501 -32.150 1.00 35.29  ? 409 LEU A CG  1 
ATOM   1297 C CD1 . LEU A 1 195 ? 4.113   -20.138 -32.801 1.00 37.24  ? 409 LEU A CD1 1 
ATOM   1298 C CD2 . LEU A 1 195 ? 4.555   -22.572 -33.200 1.00 35.98  ? 409 LEU A CD2 1 
ATOM   1299 N N   . GLN A 1 196 ? 2.976   -20.096 -29.074 1.00 29.35  ? 410 GLN A N   1 
ATOM   1300 C CA  . GLN A 1 196 ? 1.727   -20.402 -28.393 1.00 30.54  ? 410 GLN A CA  1 
ATOM   1301 C C   . GLN A 1 196 ? 0.588   -20.558 -29.387 1.00 32.13  ? 410 GLN A C   1 
ATOM   1302 O O   . GLN A 1 196 ? 0.349   -19.683 -30.217 1.00 33.75  ? 410 GLN A O   1 
ATOM   1303 C CB  . GLN A 1 196 ? 1.381   -19.322 -27.370 1.00 34.73  ? 410 GLN A CB  1 
ATOM   1304 C CG  . GLN A 1 196 ? 2.002   -19.544 -26.004 1.00 41.08  ? 410 GLN A CG  1 
ATOM   1305 C CD  . GLN A 1 196 ? 1.445   -18.607 -24.953 1.00 48.17  ? 410 GLN A CD  1 
ATOM   1306 O OE1 . GLN A 1 196 ? 0.993   -17.503 -25.263 1.00 48.69  ? 410 GLN A OE1 1 
ATOM   1307 N NE2 . GLN A 1 196 ? 1.466   -19.046 -23.699 1.00 50.24  ? 410 GLN A NE2 1 
ATOM   1308 N N   . VAL A 1 197 ? -0.107  -21.685 -29.295 1.00 29.86  ? 411 VAL A N   1 
ATOM   1309 C CA  . VAL A 1 197 ? -1.253  -21.946 -30.145 1.00 33.40  ? 411 VAL A CA  1 
ATOM   1310 C C   . VAL A 1 197 ? -2.493  -22.155 -29.281 1.00 35.47  ? 411 VAL A C   1 
ATOM   1311 O O   . VAL A 1 197 ? -2.529  -23.039 -28.424 1.00 28.79  ? 411 VAL A O   1 
ATOM   1312 C CB  . VAL A 1 197 ? -1.020  -23.174 -31.049 1.00 36.40  ? 411 VAL A CB  1 
ATOM   1313 C CG1 . VAL A 1 197 ? -2.253  -23.457 -31.893 1.00 37.19  ? 411 VAL A CG1 1 
ATOM   1314 C CG2 . VAL A 1 197 ? 0.194   -22.949 -31.939 1.00 33.45  ? 411 VAL A CG2 1 
ATOM   1315 N N   . VAL A 1 198 ? -3.497  -21.312 -29.496 1.00 35.02  ? 412 VAL A N   1 
ATOM   1316 C CA  . VAL A 1 198 ? -4.756  -21.421 -28.774 1.00 34.84  ? 412 VAL A CA  1 
ATOM   1317 C C   . VAL A 1 198 ? -5.846  -21.862 -29.738 1.00 34.00  ? 412 VAL A C   1 
ATOM   1318 O O   . VAL A 1 198 ? -6.105  -21.200 -30.743 1.00 32.41  ? 412 VAL A O   1 
ATOM   1319 C CB  . VAL A 1 198 ? -5.157  -20.088 -28.112 1.00 33.93  ? 412 VAL A CB  1 
ATOM   1320 C CG1 . VAL A 1 198 ? -6.398  -20.280 -27.250 1.00 33.27  ? 412 VAL A CG1 1 
ATOM   1321 C CG2 . VAL A 1 198 ? -4.005  -19.543 -27.280 1.00 32.93  ? 412 VAL A CG2 1 
ATOM   1322 N N   . THR A 1 199 ? -6.472  -22.991 -29.435 1.00 35.77  ? 413 THR A N   1 
ATOM   1323 C CA  . THR A 1 199 ? -7.496  -23.549 -30.302 1.00 40.20  ? 413 THR A CA  1 
ATOM   1324 C C   . THR A 1 199 ? -8.802  -23.768 -29.551 1.00 41.30  ? 413 THR A C   1 
ATOM   1325 O O   . THR A 1 199 ? -8.806  -23.950 -28.333 1.00 33.95  ? 413 THR A O   1 
ATOM   1326 C CB  . THR A 1 199 ? -7.045  -24.889 -30.915 1.00 42.17  ? 413 THR A CB  1 
ATOM   1327 O OG1 . THR A 1 199 ? -6.751  -25.818 -29.865 1.00 43.97  ? 413 THR A OG1 1 
ATOM   1328 C CG2 . THR A 1 199 ? -5.803  -24.697 -31.773 1.00 40.52  ? 413 THR A CG2 1 
ATOM   1329 N N   . ASN A 1 200 ? -9.910  -23.729 -30.286 1.00 39.47  ? 414 ASN A N   1 
ATOM   1330 C CA  . ASN A 1 200 ? -11.200 -24.147 -29.758 1.00 35.78  ? 414 ASN A CA  1 
ATOM   1331 C C   . ASN A 1 200 ? -11.192 -25.665 -29.638 1.00 42.02  ? 414 ASN A C   1 
ATOM   1332 O O   . ASN A 1 200 ? -11.230 -26.361 -30.648 1.00 43.65  ? 414 ASN A O   1 
ATOM   1333 C CB  . ASN A 1 200 ? -12.335 -23.664 -30.671 1.00 36.76  ? 414 ASN A CB  1 
ATOM   1334 C CG  . ASN A 1 200 ? -13.719 -23.914 -30.089 1.00 40.88  ? 414 ASN A CG  1 
ATOM   1335 O OD1 . ASN A 1 200 ? -13.998 -24.976 -29.533 1.00 42.96  ? 414 ASN A OD1 1 
ATOM   1336 N ND2 . ASN A 1 200 ? -14.599 -22.930 -30.230 1.00 40.28  ? 414 ASN A ND2 1 
ATOM   1337 N N   . ARG A 1 201 ? -11.134 -26.171 -28.408 1.00 46.12  ? 415 ARG A N   1 
ATOM   1338 C CA  . ARG A 1 201 ? -10.968 -27.603 -28.161 1.00 50.02  ? 415 ARG A CA  1 
ATOM   1339 C C   . ARG A 1 201 ? -12.038 -28.463 -28.835 1.00 55.63  ? 415 ARG A C   1 
ATOM   1340 O O   . ARG A 1 201 ? -11.759 -29.577 -29.277 1.00 58.35  ? 415 ARG A O   1 
ATOM   1341 C CB  . ARG A 1 201 ? -10.968 -27.887 -26.656 1.00 54.21  ? 415 ARG A CB  1 
ATOM   1342 C CG  . ARG A 1 201 ? -10.693 -29.344 -26.305 1.00 58.42  ? 415 ARG A CG  1 
ATOM   1343 C CD  . ARG A 1 201 ? -11.373 -29.728 -25.006 1.00 64.79  ? 415 ARG A CD  1 
ATOM   1344 N NE  . ARG A 1 201 ? -12.816 -29.522 -25.081 1.00 68.48  ? 415 ARG A NE  1 
ATOM   1345 C CZ  . ARG A 1 201 ? -13.653 -29.749 -24.076 1.00 71.96  ? 415 ARG A CZ  1 
ATOM   1346 N NH1 . ARG A 1 201 ? -13.186 -30.191 -22.915 1.00 75.23  ? 415 ARG A NH1 1 
ATOM   1347 N NH2 . ARG A 1 201 ? -14.954 -29.532 -24.232 1.00 72.44  ? 415 ARG A NH2 1 
ATOM   1348 N N   . ASP A 1 202 ? -13.256 -27.942 -28.919 1.00 55.41  ? 416 ASP A N   1 
ATOM   1349 C CA  . ASP A 1 202 ? -14.367 -28.705 -29.479 1.00 60.93  ? 416 ASP A CA  1 
ATOM   1350 C C   . ASP A 1 202 ? -14.356 -28.743 -31.008 1.00 59.85  ? 416 ASP A C   1 
ATOM   1351 O O   . ASP A 1 202 ? -14.602 -29.790 -31.606 1.00 64.90  ? 416 ASP A O   1 
ATOM   1352 C CB  . ASP A 1 202 ? -15.699 -28.137 -28.981 1.00 62.06  ? 416 ASP A CB  1 
ATOM   1353 C CG  . ASP A 1 202 ? -15.895 -28.334 -27.490 1.00 68.30  ? 416 ASP A CG  1 
ATOM   1354 O OD1 . ASP A 1 202 ? -15.399 -29.346 -26.952 1.00 69.77  ? 416 ASP A OD1 1 
ATOM   1355 O OD2 . ASP A 1 202 ? -16.544 -27.477 -26.855 1.00 72.71  ? 416 ASP A OD2 1 
ATOM   1356 N N   . THR A 1 203 ? -14.068 -27.608 -31.637 1.00 52.73  ? 417 THR A N   1 
ATOM   1357 C CA  . THR A 1 203 ? -14.103 -27.515 -33.096 1.00 54.53  ? 417 THR A CA  1 
ATOM   1358 C C   . THR A 1 203 ? -12.721 -27.662 -33.726 1.00 59.02  ? 417 THR A C   1 
ATOM   1359 O O   . THR A 1 203 ? -12.600 -27.760 -34.949 1.00 62.41  ? 417 THR A O   1 
ATOM   1360 C CB  . THR A 1 203 ? -14.701 -26.175 -33.558 1.00 54.90  ? 417 THR A CB  1 
ATOM   1361 O OG1 . THR A 1 203 ? -13.827 -25.106 -33.174 1.00 53.27  ? 417 THR A OG1 1 
ATOM   1362 C CG2 . THR A 1 203 ? -16.070 -25.958 -32.936 1.00 55.03  ? 417 THR A CG2 1 
ATOM   1363 N N   . GLN A 1 204 ? -11.705 -27.632 -32.890 1.00 59.86  ? 418 GLN A N   1 
ATOM   1364 C CA  . GLN A 1 204 ? -10.342 -27.716 -33.325 1.00 61.48  ? 418 GLN A CA  1 
ATOM   1365 C C   . GLN A 1 204 ? -9.912  -26.549 -34.174 1.00 56.21  ? 418 GLN A C   1 
ATOM   1366 O O   . GLN A 1 204 ? -8.923  -26.623 -34.849 1.00 56.25  ? 418 GLN A O   1 
ATOM   1367 C CB  . GLN A 1 204 ? -10.154 -29.000 -34.068 1.00 71.04  ? 418 GLN A CB  1 
ATOM   1368 C CG  . GLN A 1 204 ? -10.283 -30.145 -33.120 1.00 80.45  ? 418 GLN A CG  1 
ATOM   1369 C CD  . GLN A 1 204 ? -9.198  -30.103 -32.099 1.00 83.57  ? 418 GLN A CD  1 
ATOM   1370 O OE1 . GLN A 1 204 ? -8.041  -30.158 -32.450 1.00 86.97  ? 418 GLN A OE1 1 
ATOM   1371 N NE2 . GLN A 1 204 ? -9.556  -29.998 -30.839 1.00 85.60  ? 418 GLN A NE2 1 
ATOM   1372 N N   . GLU A 1 205 ? -10.667 -25.473 -34.126 1.00 51.85  ? 419 GLU A N   1 
ATOM   1373 C CA  . GLU A 1 205 ? -10.352 -24.300 -34.890 1.00 48.80  ? 419 GLU A CA  1 
ATOM   1374 C C   . GLU A 1 205 ? -9.232  -23.524 -34.214 1.00 44.19  ? 419 GLU A C   1 
ATOM   1375 O O   . GLU A 1 205 ? -9.141  -23.474 -33.026 1.00 38.05  ? 419 GLU A O   1 
ATOM   1376 C CB  . GLU A 1 205 ? -11.558 -23.380 -34.979 1.00 51.87  ? 419 GLU A CB  1 
ATOM   1377 C CG  . GLU A 1 205 ? -12.738 -23.881 -35.793 1.00 58.92  ? 419 GLU A CG  1 
ATOM   1378 C CD  . GLU A 1 205 ? -13.947 -22.971 -35.686 1.00 62.33  ? 419 GLU A CD  1 
ATOM   1379 O OE1 . GLU A 1 205 ? -14.244 -22.283 -36.674 1.00 65.47  ? 419 GLU A OE1 1 
ATOM   1380 O OE2 . GLU A 1 205 ? -14.580 -22.935 -34.626 1.00 62.20  ? 419 GLU A OE2 1 
ATOM   1381 N N   . LEU A 1 206 ? -8.400  -22.903 -35.010 1.00 40.16  ? 420 LEU A N   1 
ATOM   1382 C CA  . LEU A 1 206 ? -7.336  -22.091 -34.483 1.00 40.24  ? 420 LEU A CA  1 
ATOM   1383 C C   . LEU A 1 206 ? -7.910  -20.754 -34.093 1.00 39.88  ? 420 LEU A C   1 
ATOM   1384 O O   . LEU A 1 206 ? -8.481  -20.098 -34.888 1.00 40.55  ? 420 LEU A O   1 
ATOM   1385 C CB  . LEU A 1 206 ? -6.254  -21.888 -35.515 1.00 41.43  ? 420 LEU A CB  1 
ATOM   1386 C CG  . LEU A 1 206 ? -5.240  -20.852 -35.084 1.00 40.56  ? 420 LEU A CG  1 
ATOM   1387 C CD1 . LEU A 1 206 ? -4.482  -21.383 -33.903 1.00 40.41  ? 420 LEU A CD1 1 
ATOM   1388 C CD2 . LEU A 1 206 ? -4.312  -20.501 -36.201 1.00 40.70  ? 420 LEU A CD2 1 
ATOM   1389 N N   . LEU A 1 207 ? -7.732  -20.366 -32.860 1.00 33.25  ? 421 LEU A N   1 
ATOM   1390 C CA  . LEU A 1 207 ? -8.221  -19.080 -32.379 1.00 36.97  ? 421 LEU A CA  1 
ATOM   1391 C C   . LEU A 1 207 ? -7.124  -18.024 -32.350 1.00 36.23  ? 421 LEU A C   1 
ATOM   1392 O O   . LEU A 1 207 ? -7.350  -16.866 -32.709 1.00 32.40  ? 421 LEU A O   1 
ATOM   1393 C CB  . LEU A 1 207 ? -8.830  -19.230 -30.985 1.00 36.76  ? 421 LEU A CB  1 
ATOM   1394 C CG  . LEU A 1 207 ? -10.121 -20.046 -30.910 1.00 37.79  ? 421 LEU A CG  1 
ATOM   1395 C CD1 . LEU A 1 207 ? -10.644 -20.066 -29.488 1.00 37.77  ? 421 LEU A CD1 1 
ATOM   1396 C CD2 . LEU A 1 207 ? -11.167 -19.488 -31.863 1.00 40.32  ? 421 LEU A CD2 1 
ATOM   1397 N N   . LEU A 1 208 ? -5.933  -18.428 -31.924 1.00 35.21  ? 422 LEU A N   1 
ATOM   1398 C CA  . LEU A 1 208 ? -4.833  -17.489 -31.753 1.00 34.67  ? 422 LEU A CA  1 
ATOM   1399 C C   . LEU A 1 208 ? -3.490  -18.206 -31.793 1.00 33.61  ? 422 LEU A C   1 
ATOM   1400 O O   . LEU A 1 208 ? -3.278  -19.181 -31.072 1.00 33.49  ? 422 LEU A O   1 
ATOM   1401 C CB  . LEU A 1 208 ? -4.985  -16.735 -30.431 1.00 39.01  ? 422 LEU A CB  1 
ATOM   1402 C CG  . LEU A 1 208 ? -4.454  -15.304 -30.362 1.00 46.23  ? 422 LEU A CG  1 
ATOM   1403 C CD1 . LEU A 1 208 ? -5.135  -14.443 -31.412 1.00 46.97  ? 422 LEU A CD1 1 
ATOM   1404 C CD2 . LEU A 1 208 ? -4.673  -14.728 -28.972 1.00 49.90  ? 422 LEU A CD2 1 
ATOM   1405 N N   . CYS A 1 209 ? -2.592  -17.725 -32.646 1.00 31.06  ? 423 CYS A N   1 
ATOM   1406 C CA  . CYS A 1 209 ? -1.226  -18.232 -32.678 1.00 31.47  ? 423 CYS A CA  1 
ATOM   1407 C C   . CYS A 1 209 ? -0.246  -17.080 -32.502 1.00 24.65  ? 423 CYS A C   1 
ATOM   1408 O O   . CYS A 1 209 ? -0.263  -16.120 -33.272 1.00 27.26  ? 423 CYS A O   1 
ATOM   1409 C CB  . CYS A 1 209 ? -0.943  -18.978 -33.982 1.00 26.71  ? 423 CYS A CB  1 
ATOM   1410 S SG  . CYS A 1 209 ? 0.773   -19.559 -34.135 1.00 32.18  ? 423 CYS A SG  1 
ATOM   1411 N N   . THR A 1 210 ? 0.604   -17.181 -31.485 1.00 27.88  ? 424 THR A N   1 
ATOM   1412 C CA  . THR A 1 210 ? 1.538   -16.109 -31.166 1.00 31.13  ? 424 THR A CA  1 
ATOM   1413 C C   . THR A 1 210 ? 2.971   -16.616 -31.046 1.00 30.86  ? 424 THR A C   1 
ATOM   1414 O O   . THR A 1 210 ? 3.252   -17.544 -30.286 1.00 30.67  ? 424 THR A O   1 
ATOM   1415 C CB  . THR A 1 210 ? 1.160   -15.401 -29.848 1.00 30.46  ? 424 THR A CB  1 
ATOM   1416 O OG1 . THR A 1 210 ? -0.209  -14.977 -29.901 1.00 34.23  ? 424 THR A OG1 1 
ATOM   1417 C CG2 . THR A 1 210 ? 2.058   -14.189 -29.620 1.00 26.78  ? 424 THR A CG2 1 
ATOM   1418 N N   . ALA A 1 211 ? 3.870   -16.001 -31.805 1.00 29.61  ? 425 ALA A N   1 
ATOM   1419 C CA  . ALA A 1 211 ? 5.292   -16.297 -31.695 1.00 29.80  ? 425 ALA A CA  1 
ATOM   1420 C C   . ALA A 1 211 ? 5.964   -15.274 -30.787 1.00 29.34  ? 425 ALA A C   1 
ATOM   1421 O O   . ALA A 1 211 ? 5.669   -14.079 -30.857 1.00 29.02  ? 425 ALA A O   1 
ATOM   1422 C CB  . ALA A 1 211 ? 5.944   -16.308 -33.066 1.00 29.83  ? 425 ALA A CB  1 
ATOM   1423 N N   . TYR A 1 212 ? 6.859   -15.749 -29.927 1.00 28.35  ? 426 TYR A N   1 
ATOM   1424 C CA  . TYR A 1 212 ? 7.581   -14.871 -29.014 1.00 28.81  ? 426 TYR A CA  1 
ATOM   1425 C C   . TYR A 1 212 ? 9.080   -14.904 -29.275 1.00 27.77  ? 426 TYR A C   1 
ATOM   1426 O O   . TYR A 1 212 ? 9.671   -15.976 -29.386 1.00 23.29  ? 426 TYR A O   1 
ATOM   1427 C CB  . TYR A 1 212 ? 7.314   -15.262 -27.559 1.00 30.68  ? 426 TYR A CB  1 
ATOM   1428 C CG  . TYR A 1 212 ? 5.864   -15.178 -27.138 1.00 33.76  ? 426 TYR A CG  1 
ATOM   1429 C CD1 . TYR A 1 212 ? 5.304   -13.971 -26.749 1.00 32.01  ? 426 TYR A CD1 1 
ATOM   1430 C CD2 . TYR A 1 212 ? 5.061   -16.310 -27.115 1.00 38.23  ? 426 TYR A CD2 1 
ATOM   1431 C CE1 . TYR A 1 212 ? 3.981   -13.890 -26.355 1.00 35.33  ? 426 TYR A CE1 1 
ATOM   1432 C CE2 . TYR A 1 212 ? 3.736   -16.239 -26.724 1.00 36.92  ? 426 TYR A CE2 1 
ATOM   1433 C CZ  . TYR A 1 212 ? 3.202   -15.028 -26.344 1.00 38.84  ? 426 TYR A CZ  1 
ATOM   1434 O OH  . TYR A 1 212 ? 1.884   -14.953 -25.954 1.00 44.97  ? 426 TYR A OH  1 
ATOM   1435 N N   . VAL A 1 213 ? 9.685   -13.724 -29.372 1.00 30.06  ? 427 VAL A N   1 
ATOM   1436 C CA  . VAL A 1 213 ? 11.137  -13.596 -29.445 1.00 27.15  ? 427 VAL A CA  1 
ATOM   1437 C C   . VAL A 1 213 ? 11.599  -12.680 -28.317 1.00 26.44  ? 427 VAL A C   1 
ATOM   1438 O O   . VAL A 1 213 ? 10.820  -11.871 -27.809 1.00 26.40  ? 427 VAL A O   1 
ATOM   1439 C CB  . VAL A 1 213 ? 11.609  -13.047 -30.805 1.00 26.72  ? 427 VAL A CB  1 
ATOM   1440 C CG1 . VAL A 1 213 ? 11.240  -14.010 -31.925 1.00 24.85  ? 427 VAL A CG1 1 
ATOM   1441 C CG2 . VAL A 1 213 ? 11.024  -11.669 -31.061 1.00 26.86  ? 427 VAL A CG2 1 
ATOM   1442 N N   . PHE A 1 214 ? 12.864  -12.797 -27.928 1.00 26.04  ? 428 PHE A N   1 
ATOM   1443 C CA  . PHE A 1 214 ? 13.307  -12.202 -26.672 1.00 27.57  ? 428 PHE A CA  1 
ATOM   1444 C C   . PHE A 1 214 ? 14.635  -11.458 -26.730 1.00 29.28  ? 428 PHE A C   1 
ATOM   1445 O O   . PHE A 1 214 ? 15.602  -11.919 -27.339 1.00 28.01  ? 428 PHE A O   1 
ATOM   1446 C CB  . PHE A 1 214 ? 13.415  -13.289 -25.598 1.00 30.00  ? 428 PHE A CB  1 
ATOM   1447 C CG  . PHE A 1 214 ? 12.109  -13.949 -25.264 1.00 27.17  ? 428 PHE A CG  1 
ATOM   1448 C CD1 . PHE A 1 214 ? 11.662  -15.042 -25.991 1.00 29.76  ? 428 PHE A CD1 1 
ATOM   1449 C CD2 . PHE A 1 214 ? 11.333  -13.484 -24.216 1.00 27.96  ? 428 PHE A CD2 1 
ATOM   1450 C CE1 . PHE A 1 214 ? 10.457  -15.654 -25.681 1.00 28.62  ? 428 PHE A CE1 1 
ATOM   1451 C CE2 . PHE A 1 214 ? 10.132  -14.089 -23.901 1.00 27.87  ? 428 PHE A CE2 1 
ATOM   1452 C CZ  . PHE A 1 214 ? 9.694   -15.176 -24.635 1.00 28.41  ? 428 PHE A CZ  1 
ATOM   1453 N N   . GLU A 1 215 ? 14.662  -10.303 -26.076 1.00 28.51  ? 429 GLU A N   1 
ATOM   1454 C CA  . GLU A 1 215 ? 15.904  -9.640  -25.710 1.00 30.20  ? 429 GLU A CA  1 
ATOM   1455 C C   . GLU A 1 215 ? 15.818  -9.270  -24.237 1.00 33.27  ? 429 GLU A C   1 
ATOM   1456 O O   . GLU A 1 215 ? 14.848  -9.617  -23.561 1.00 32.21  ? 429 GLU A O   1 
ATOM   1457 C CB  . GLU A 1 215 ? 16.159  -8.399  -26.567 1.00 31.65  ? 429 GLU A CB  1 
ATOM   1458 C CG  . GLU A 1 215 ? 16.474  -8.706  -28.016 1.00 33.33  ? 429 GLU A CG  1 
ATOM   1459 C CD  . GLU A 1 215 ? 17.034  -7.507  -28.752 1.00 36.44  ? 429 GLU A CD  1 
ATOM   1460 O OE1 . GLU A 1 215 ? 17.304  -6.480  -28.096 1.00 35.33  ? 429 GLU A OE1 1 
ATOM   1461 O OE2 . GLU A 1 215 ? 17.202  -7.596  -29.985 1.00 41.60  ? 429 GLU A OE2 1 
ATOM   1462 N N   . VAL A 1 216 ? 16.827  -8.565  -23.745 1.00 29.62  ? 430 VAL A N   1 
ATOM   1463 C CA  . VAL A 1 216 ? 16.875  -8.173  -22.344 1.00 30.63  ? 430 VAL A CA  1 
ATOM   1464 C C   . VAL A 1 216 ? 16.776  -6.655  -22.217 1.00 37.06  ? 430 VAL A C   1 
ATOM   1465 O O   . VAL A 1 216 ? 17.332  -5.920  -23.034 1.00 42.85  ? 430 VAL A O   1 
ATOM   1466 C CB  . VAL A 1 216 ? 18.170  -8.696  -21.669 1.00 44.83  ? 430 VAL A CB  1 
ATOM   1467 C CG1 . VAL A 1 216 ? 18.494  -7.923  -20.399 1.00 50.39  ? 430 VAL A CG1 1 
ATOM   1468 C CG2 . VAL A 1 216 ? 18.048  -10.183 -21.381 1.00 40.44  ? 430 VAL A CG2 1 
ATOM   1469 N N   . SER A 1 217 ? 16.144  -6.184  -21.162 1.00 34.86  ? 431 SER A N   1 
ATOM   1470 C CA  . SER A 1 217 ? 16.039  -4.762  -20.890 1.00 37.67  ? 431 SER A CA  1 
ATOM   1471 C C   . SER A 1 217 ? 16.730  -4.458  -19.568 1.00 43.43  ? 431 SER A C   1 
ATOM   1472 O O   . SER A 1 217 ? 16.944  -5.332  -18.785 1.00 46.41  ? 431 SER A O   1 
ATOM   1473 C CB  . SER A 1 217 ? 14.584  -4.345  -20.800 1.00 34.75  ? 431 SER A CB  1 
ATOM   1474 O OG  . SER A 1 217 ? 14.425  -2.976  -20.597 1.00 37.33  ? 431 SER A OG  1 
ATOM   1475 N N   . THR A 1 218 ? 17.062  -3.208  -19.315 1.00 46.99  ? 432 THR A N   1 
ATOM   1476 C CA  . THR A 1 218 ? 17.705  -2.830  -18.078 1.00 47.97  ? 432 THR A CA  1 
ATOM   1477 C C   . THR A 1 218 ? 16.707  -2.678  -16.949 1.00 51.28  ? 432 THR A C   1 
ATOM   1478 O O   . THR A 1 218 ? 15.531  -2.597  -17.171 1.00 50.93  ? 432 THR A O   1 
ATOM   1479 C CB  . THR A 1 218 ? 18.451  -1.524  -18.258 1.00 53.03  ? 432 THR A CB  1 
ATOM   1480 O OG1 . THR A 1 218 ? 17.518  -0.501  -18.575 1.00 51.84  ? 432 THR A OG1 1 
ATOM   1481 C CG2 . THR A 1 218 ? 19.400  -1.640  -19.375 1.00 50.45  ? 432 THR A CG2 1 
ATOM   1482 N N   . SER A 1 219 ? 17.185  -2.645  -15.722 1.00 59.19  ? 433 SER A N   1 
ATOM   1483 C CA  . SER A 1 219 ? 16.294  -2.498  -14.576 1.00 63.59  ? 433 SER A CA  1 
ATOM   1484 C C   . SER A 1 219 ? 15.661  -1.134  -14.617 1.00 61.70  ? 433 SER A C   1 
ATOM   1485 O O   . SER A 1 219 ? 14.559  -0.929  -14.160 1.00 62.54  ? 433 SER A O   1 
ATOM   1486 C CB  . SER A 1 219 ? 17.046  -2.603  -13.246 1.00 71.75  ? 433 SER A CB  1 
ATOM   1487 O OG  . SER A 1 219 ? 17.653  -3.853  -13.024 1.00 74.95  ? 433 SER A OG  1 
ATOM   1488 N N   . GLU A 1 220 ? 16.402  -0.198  -15.161 1.00 58.56  ? 434 GLU A N   1 
ATOM   1489 C CA  . GLU A 1 220 ? 15.953  1.162   -15.236 1.00 60.19  ? 434 GLU A CA  1 
ATOM   1490 C C   . GLU A 1 220 ? 14.753  1.309   -16.120 1.00 56.08  ? 434 GLU A C   1 
ATOM   1491 O O   . GLU A 1 220 ? 13.806  1.944   -15.745 1.00 58.45  ? 434 GLU A O   1 
ATOM   1492 C CB  . GLU A 1 220 ? 17.079  2.037   -15.752 1.00 62.56  ? 434 GLU A CB  1 
ATOM   1493 C CG  . GLU A 1 220 ? 17.158  3.397   -15.131 1.00 69.19  ? 434 GLU A CG  1 
ATOM   1494 C CD  . GLU A 1 220 ? 18.157  4.276   -15.833 1.00 74.02  ? 434 GLU A CD  1 
ATOM   1495 O OE1 . GLU A 1 220 ? 18.980  3.765   -16.598 1.00 75.35  ? 434 GLU A OE1 1 
ATOM   1496 O OE2 . GLU A 1 220 ? 18.118  5.480   -15.632 1.00 78.85  ? 434 GLU A OE2 1 
ATOM   1497 N N   . ARG A 1 221 ? 14.811  0.710   -17.296 1.00 52.05  ? 435 ARG A N   1 
ATOM   1498 C CA  . ARG A 1 221 ? 13.747  0.795   -18.258 1.00 52.15  ? 435 ARG A CA  1 
ATOM   1499 C C   . ARG A 1 221 ? 12.560  -0.079  -17.974 1.00 50.83  ? 435 ARG A C   1 
ATOM   1500 O O   . ARG A 1 221 ? 11.463  0.302   -18.228 1.00 53.20  ? 435 ARG A O   1 
ATOM   1501 C CB  . ARG A 1 221 ? 14.267  0.526   -19.666 1.00 51.40  ? 435 ARG A CB  1 
ATOM   1502 C CG  . ARG A 1 221 ? 15.131  1.619   -20.242 1.00 54.05  ? 435 ARG A CG  1 
ATOM   1503 C CD  . ARG A 1 221 ? 15.396  1.443   -21.724 1.00 50.84  ? 435 ARG A CD  1 
ATOM   1504 N NE  . ARG A 1 221 ? 14.216  1.625   -22.531 1.00 50.40  ? 435 ARG A NE  1 
ATOM   1505 C CZ  . ARG A 1 221 ? 14.236  1.815   -23.833 1.00 51.73  ? 435 ARG A CZ  1 
ATOM   1506 N NH1 . ARG A 1 221 ? 15.373  1.840   -24.474 1.00 53.84  ? 435 ARG A NH1 1 
ATOM   1507 N NH2 . ARG A 1 221 ? 13.116  1.947   -24.491 1.00 48.97  ? 435 ARG A NH2 1 
ATOM   1508 N N   . GLY A 1 222 ? 12.792  -1.270  -17.451 1.00 48.19  ? 436 GLY A N   1 
ATOM   1509 C CA  . GLY A 1 222 ? 11.729  -2.210  -17.170 1.00 45.46  ? 436 GLY A CA  1 
ATOM   1510 C C   . GLY A 1 222 ? 11.293  -2.996  -18.390 1.00 42.41  ? 436 GLY A C   1 
ATOM   1511 O O   . GLY A 1 222 ? 11.639  -2.662  -19.485 1.00 41.71  ? 436 GLY A O   1 
ATOM   1512 N N   . ALA A 1 223 ? 10.521  -4.044  -18.185 1.00 39.96  ? 437 ALA A N   1 
ATOM   1513 C CA  . ALA A 1 223 ? 10.062  -4.869  -19.287 1.00 35.05  ? 437 ALA A CA  1 
ATOM   1514 C C   . ALA A 1 223 ? 9.262   -4.107  -20.305 1.00 34.56  ? 437 ALA A C   1 
ATOM   1515 O O   . ALA A 1 223 ? 8.620   -3.158  -19.982 1.00 36.80  ? 437 ALA A O   1 
ATOM   1516 C CB  . ALA A 1 223 ? 9.259   -6.025  -18.772 1.00 33.75  ? 437 ALA A CB  1 
ATOM   1517 N N   . GLN A 1 224 ? 9.317   -4.551  -21.540 1.00 32.60  ? 438 GLN A N   1 
ATOM   1518 C CA  . GLN A 1 224 ? 8.601   -3.933  -22.622 1.00 32.94  ? 438 GLN A CA  1 
ATOM   1519 C C   . GLN A 1 224 ? 8.293   -4.953  -23.687 1.00 32.60  ? 438 GLN A C   1 
ATOM   1520 O O   . GLN A 1 224 ? 8.912   -5.985  -23.741 1.00 32.85  ? 438 GLN A O   1 
ATOM   1521 C CB  . GLN A 1 224 ? 9.441   -2.828  -23.246 1.00 41.98  ? 438 GLN A CB  1 
ATOM   1522 C CG  . GLN A 1 224 ? 8.713   -2.003  -24.273 1.00 47.18  ? 438 GLN A CG  1 
ATOM   1523 C CD  . GLN A 1 224 ? 9.442   -0.746  -24.685 1.00 51.14  ? 438 GLN A CD  1 
ATOM   1524 O OE1 . GLN A 1 224 ? 10.643  -0.669  -24.617 1.00 53.98  ? 438 GLN A OE1 1 
ATOM   1525 N NE2 . GLN A 1 224 ? 8.698   0.229   -25.154 1.00 50.18  ? 438 GLN A NE2 1 
ATOM   1526 N N   . HIS A 1 225 ? 7.349   -4.638  -24.546 1.00 30.74  ? 439 HIS A N   1 
ATOM   1527 C CA  . HIS A 1 225 ? 6.998   -5.508  -25.644 1.00 36.60  ? 439 HIS A CA  1 
ATOM   1528 C C   . HIS A 1 225 ? 6.572   -4.737  -26.875 1.00 35.58  ? 439 HIS A C   1 
ATOM   1529 O O   . HIS A 1 225 ? 6.282   -3.580  -26.789 1.00 39.15  ? 439 HIS A O   1 
ATOM   1530 C CB  . HIS A 1 225 ? 5.932   -6.502  -25.235 1.00 27.85  ? 439 HIS A CB  1 
ATOM   1531 C CG  . HIS A 1 225 ? 4.645   -5.871  -24.868 1.00 38.28  ? 439 HIS A CG  1 
ATOM   1532 N ND1 . HIS A 1 225 ? 4.351   -5.490  -23.588 1.00 41.49  ? 439 HIS A ND1 1 
ATOM   1533 C CD2 . HIS A 1 225 ? 3.581   -5.529  -25.615 1.00 42.18  ? 439 HIS A CD2 1 
ATOM   1534 C CE1 . HIS A 1 225 ? 3.155   -4.951  -23.558 1.00 43.36  ? 439 HIS A CE1 1 
ATOM   1535 N NE2 . HIS A 1 225 ? 2.666   -4.962  -24.777 1.00 43.45  ? 439 HIS A NE2 1 
ATOM   1536 N N   . HIS A 1 226 ? 6.560   -5.401  -28.011 1.00 36.19  ? 440 HIS A N   1 
ATOM   1537 C CA  . HIS A 1 226 ? 6.136   -4.846  -29.264 1.00 39.30  ? 440 HIS A CA  1 
ATOM   1538 C C   . HIS A 1 226 ? 5.352   -5.932  -29.979 1.00 36.96  ? 440 HIS A C   1 
ATOM   1539 O O   . HIS A 1 226 ? 5.879   -6.942  -30.318 1.00 31.39  ? 440 HIS A O   1 
ATOM   1540 C CB  . HIS A 1 226 ? 7.322   -4.415  -30.093 1.00 42.45  ? 440 HIS A CB  1 
ATOM   1541 C CG  . HIS A 1 226 ? 6.977   -3.497  -31.213 1.00 44.89  ? 440 HIS A CG  1 
ATOM   1542 N ND1 . HIS A 1 226 ? 5.861   -3.655  -31.992 1.00 46.10  ? 440 HIS A ND1 1 
ATOM   1543 C CD2 . HIS A 1 226 ? 7.610   -2.409  -31.692 1.00 46.50  ? 440 HIS A CD2 1 
ATOM   1544 C CE1 . HIS A 1 226 ? 5.825   -2.708  -32.903 1.00 48.84  ? 440 HIS A CE1 1 
ATOM   1545 N NE2 . HIS A 1 226 ? 6.877   -1.940  -32.744 1.00 48.59  ? 440 HIS A NE2 1 
ATOM   1546 N N   . ILE A 1 227 ? 4.075   -5.700  -30.188 1.00 38.51  ? 441 ILE A N   1 
ATOM   1547 C CA  . ILE A 1 227 ? 3.217   -6.686  -30.832 1.00 39.00  ? 441 ILE A CA  1 
ATOM   1548 C C   . ILE A 1 227 ? 3.136   -6.441  -32.335 1.00 38.56  ? 441 ILE A C   1 
ATOM   1549 O O   . ILE A 1 227 ? 2.905   -5.320  -32.780 1.00 40.02  ? 441 ILE A O   1 
ATOM   1550 C CB  . ILE A 1 227 ? 1.802   -6.672  -30.222 1.00 41.22  ? 441 ILE A CB  1 
ATOM   1551 C CG1 . ILE A 1 227 ? 1.883   -6.884  -28.708 1.00 38.52  ? 441 ILE A CG1 1 
ATOM   1552 C CG2 . ILE A 1 227 ? 0.924   -7.734  -30.871 1.00 39.47  ? 441 ILE A CG2 1 
ATOM   1553 C CD1 . ILE A 1 227 ? 0.557   -6.766  -27.995 1.00 42.23  ? 441 ILE A CD1 1 
ATOM   1554 N N   . TYR A 1 228 ? 3.345   -7.496  -33.116 1.00 37.28  ? 442 TYR A N   1 
ATOM   1555 C CA  . TYR A 1 228 ? 3.277   -7.389  -34.569 1.00 39.19  ? 442 TYR A CA  1 
ATOM   1556 C C   . TYR A 1 228 ? 2.219   -8.323  -35.134 1.00 41.06  ? 442 TYR A C   1 
ATOM   1557 O O   . TYR A 1 228 ? 1.847   -9.313  -34.503 1.00 39.94  ? 442 TYR A O   1 
ATOM   1558 C CB  . TYR A 1 228 ? 4.630   -7.714  -35.208 1.00 39.86  ? 442 TYR A CB  1 
ATOM   1559 C CG  . TYR A 1 228 ? 5.777   -6.832  -34.766 1.00 41.03  ? 442 TYR A CG  1 
ATOM   1560 C CD1 . TYR A 1 228 ? 6.155   -5.726  -35.515 1.00 43.13  ? 442 TYR A CD1 1 
ATOM   1561 C CD2 . TYR A 1 228 ? 6.493   -7.118  -33.611 1.00 39.07  ? 442 TYR A CD2 1 
ATOM   1562 C CE1 . TYR A 1 228 ? 7.206   -4.923  -35.121 1.00 46.14  ? 442 TYR A CE1 1 
ATOM   1563 C CE2 . TYR A 1 228 ? 7.544   -6.320  -33.207 1.00 43.02  ? 442 TYR A CE2 1 
ATOM   1564 C CZ  . TYR A 1 228 ? 7.897   -5.224  -33.966 1.00 47.34  ? 442 TYR A CZ  1 
ATOM   1565 O OH  . TYR A 1 228 ? 8.945   -4.427  -33.569 1.00 52.32  ? 442 TYR A OH  1 
ATOM   1566 N N   . ARG A 1 229 ? 1.736   -8.002  -36.329 1.00 46.11  ? 443 ARG A N   1 
ATOM   1567 C CA  . ARG A 1 229 ? 0.891   -8.920  -37.074 1.00 46.69  ? 443 ARG A CA  1 
ATOM   1568 C C   . ARG A 1 229 ? 1.755   -9.702  -38.054 1.00 44.60  ? 443 ARG A C   1 
ATOM   1569 O O   . ARG A 1 229 ? 2.573   -9.122  -38.767 1.00 44.62  ? 443 ARG A O   1 
ATOM   1570 C CB  . ARG A 1 229 ? -0.219  -8.171  -37.816 1.00 50.42  ? 443 ARG A CB  1 
ATOM   1571 N N   . LEU A 1 230 ? 1.579   -11.018 -38.075 1.00 42.51  ? 444 LEU A N   1 
ATOM   1572 C CA  . LEU A 1 230 ? 2.293   -11.871 -39.017 1.00 43.89  ? 444 LEU A CA  1 
ATOM   1573 C C   . LEU A 1 230 ? 1.529   -12.010 -40.333 1.00 46.62  ? 444 LEU A C   1 
ATOM   1574 O O   . LEU A 1 230 ? 0.431   -12.566 -40.370 1.00 48.09  ? 444 LEU A O   1 
ATOM   1575 C CB  . LEU A 1 230 ? 2.541   -13.250 -38.402 1.00 40.73  ? 444 LEU A CB  1 
ATOM   1576 C CG  . LEU A 1 230 ? 3.568   -13.333 -37.270 1.00 39.25  ? 444 LEU A CG  1 
ATOM   1577 C CD1 . LEU A 1 230 ? 3.580   -14.722 -36.654 1.00 36.11  ? 444 LEU A CD1 1 
ATOM   1578 C CD2 . LEU A 1 230 ? 4.953   -12.963 -37.780 1.00 40.13  ? 444 LEU A CD2 1 
ATOM   1579 N N   . VAL A 1 231 ? 2.114   -11.502 -41.412 1.00 47.55  ? 445 VAL A N   1 
ATOM   1580 C CA  . VAL A 1 231 ? 1.483   -11.583 -42.724 1.00 52.18  ? 445 VAL A CA  1 
ATOM   1581 C C   . VAL A 1 231 ? 2.317   -12.427 -43.680 1.00 56.58  ? 445 VAL A C   1 
ATOM   1582 O O   . VAL A 1 231 ? 3.419   -12.858 -43.340 1.00 55.83  ? 445 VAL A O   1 
ATOM   1583 C CB  . VAL A 1 231 ? 1.260   -10.183 -43.334 1.00 54.19  ? 445 VAL A CB  1 
ATOM   1584 C CG1 . VAL A 1 231 ? 0.341   -9.359  -42.441 1.00 52.86  ? 445 VAL A CG1 1 
ATOM   1585 C CG2 . VAL A 1 231 ? 2.588   -9.473  -43.550 1.00 53.50  ? 445 VAL A CG2 1 
ATOM   1586 N N   . ARG A 1 232 ? 1.784   -12.668 -44.873 1.00 61.57  ? 446 ARG A N   1 
ATOM   1587 C CA  . ARG A 1 232 ? 2.508   -13.427 -45.885 1.00 65.95  ? 446 ARG A CA  1 
ATOM   1588 C C   . ARG A 1 232 ? 2.155   -12.954 -47.293 1.00 71.14  ? 446 ARG A C   1 
ATOM   1589 O O   . ARG A 1 232 ? 1.211   -13.450 -47.908 1.00 73.88  ? 446 ARG A O   1 
ATOM   1590 C CB  . ARG A 1 232 ? 2.222   -14.923 -45.738 1.00 64.69  ? 446 ARG A CB  1 
ATOM   1591 C CG  . ARG A 1 232 ? 3.165   -15.809 -46.534 1.00 67.26  ? 446 ARG A CG  1 
ATOM   1592 C CD  . ARG A 1 232 ? 3.099   -17.263 -46.082 1.00 66.37  ? 446 ARG A CD  1 
ATOM   1593 N NE  . ARG A 1 232 ? 1.872   -17.929 -46.510 1.00 67.19  ? 446 ARG A NE  1 
ATOM   1594 C CZ  . ARG A 1 232 ? 1.553   -19.181 -46.196 1.00 64.80  ? 446 ARG A CZ  1 
ATOM   1595 N NH1 . ARG A 1 232 ? 2.369   -19.908 -45.444 1.00 62.15  ? 446 ARG A NH1 1 
ATOM   1596 N NH2 . ARG A 1 232 ? 0.416   -19.707 -46.630 1.00 66.30  ? 446 ARG A NH2 1 
ATOM   1597 N N   . TRP B 1 4   ? 3.392   -52.985 3.081   1.00 60.14  ? 218 TRP B N   1 
ATOM   1598 C CA  . TRP B 1 4   ? 3.355   -51.589 2.652   1.00 58.51  ? 218 TRP B CA  1 
ATOM   1599 C C   . TRP B 1 4   ? 4.130   -51.293 1.376   1.00 57.99  ? 218 TRP B C   1 
ATOM   1600 O O   . TRP B 1 4   ? 3.950   -50.250 0.794   1.00 56.54  ? 218 TRP B O   1 
ATOM   1601 C CB  . TRP B 1 4   ? 3.873   -50.671 3.736   1.00 59.53  ? 218 TRP B CB  1 
ATOM   1602 C CG  . TRP B 1 4   ? 3.129   -50.839 4.964   1.00 64.02  ? 218 TRP B CG  1 
ATOM   1603 C CD1 . TRP B 1 4   ? 3.567   -51.399 6.102   1.00 68.49  ? 218 TRP B CD1 1 
ATOM   1604 C CD2 . TRP B 1 4   ? 1.773   -50.485 5.184   1.00 64.50  ? 218 TRP B CD2 1 
ATOM   1605 N NE1 . TRP B 1 4   ? 2.578   -51.412 7.030   1.00 71.31  ? 218 TRP B NE1 1 
ATOM   1606 C CE2 . TRP B 1 4   ? 1.459   -50.855 6.486   1.00 68.80  ? 218 TRP B CE2 1 
ATOM   1607 C CE3 . TRP B 1 4   ? 0.794   -49.891 4.403   1.00 61.70  ? 218 TRP B CE3 1 
ATOM   1608 C CZ2 . TRP B 1 4   ? 0.217   -50.659 7.016   1.00 69.99  ? 218 TRP B CZ2 1 
ATOM   1609 C CZ3 . TRP B 1 4   ? -0.420  -49.695 4.928   1.00 62.08  ? 218 TRP B CZ3 1 
ATOM   1610 C CH2 . TRP B 1 4   ? -0.711  -50.072 6.220   1.00 66.47  ? 218 TRP B CH2 1 
ATOM   1611 N N   . GLN B 1 5   ? 5.000   -52.209 0.976   1.00 58.98  ? 219 GLN B N   1 
ATOM   1612 C CA  . GLN B 1 5   ? 5.805   -52.033 -0.201  1.00 56.42  ? 219 GLN B CA  1 
ATOM   1613 C C   . GLN B 1 5   ? 4.925   -52.297 -1.402  1.00 55.31  ? 219 GLN B C   1 
ATOM   1614 O O   . GLN B 1 5   ? 4.027   -53.101 -1.336  1.00 57.17  ? 219 GLN B O   1 
ATOM   1615 C CB  . GLN B 1 5   ? 7.007   -52.966 -0.155  1.00 59.66  ? 219 GLN B CB  1 
ATOM   1616 C CG  . GLN B 1 5   ? 8.046   -52.554 0.867   1.00 62.39  ? 219 GLN B CG  1 
ATOM   1617 C CD  . GLN B 1 5   ? 9.142   -53.576 1.069   1.00 69.30  ? 219 GLN B CD  1 
ATOM   1618 O OE1 . GLN B 1 5   ? 8.965   -54.757 0.816   1.00 73.46  ? 219 GLN B OE1 1 
ATOM   1619 N NE2 . GLN B 1 5   ? 10.283  -53.115 1.511   1.00 70.09  ? 219 GLN B NE2 1 
ATOM   1620 N N   . ALA B 1 6   ? 5.168   -51.599 -2.496  1.00 52.44  ? 220 ALA B N   1 
ATOM   1621 C CA  . ALA B 1 6   ? 4.350   -51.745 -3.692  1.00 48.94  ? 220 ALA B CA  1 
ATOM   1622 C C   . ALA B 1 6   ? 4.450   -53.096 -4.376  1.00 49.85  ? 220 ALA B C   1 
ATOM   1623 O O   . ALA B 1 6   ? 5.502   -53.662 -4.419  1.00 48.47  ? 220 ALA B O   1 
ATOM   1624 C CB  . ALA B 1 6   ? 4.682   -50.642 -4.684  1.00 45.22  ? 220 ALA B CB  1 
ATOM   1625 N N   . ARG B 1 7   ? 3.335   -53.578 -4.915  1.00 49.68  ? 221 ARG B N   1 
ATOM   1626 C CA  . ARG B 1 7   ? 3.304   -54.839 -5.645  1.00 52.20  ? 221 ARG B CA  1 
ATOM   1627 C C   . ARG B 1 7   ? 3.193   -54.565 -7.142  1.00 50.33  ? 221 ARG B C   1 
ATOM   1628 O O   . ARG B 1 7   ? 3.313   -55.472 -7.964  1.00 54.60  ? 221 ARG B O   1 
ATOM   1629 C CB  . ARG B 1 7   ? 2.138   -55.714 -5.181  1.00 55.24  ? 221 ARG B CB  1 
ATOM   1630 C CG  . ARG B 1 7   ? 1.933   -55.772 -3.673  1.00 59.33  ? 221 ARG B CG  1 
ATOM   1631 C CD  . ARG B 1 7   ? 3.110   -56.404 -2.938  1.00 63.76  ? 221 ARG B CD  1 
ATOM   1632 N NE  . ARG B 1 7   ? 2.686   -56.975 -1.661  1.00 68.12  ? 221 ARG B NE  1 
ATOM   1633 C CZ  . ARG B 1 7   ? 3.513   -57.422 -0.720  1.00 72.51  ? 221 ARG B CZ  1 
ATOM   1634 N NH1 . ARG B 1 7   ? 3.028   -57.929 0.405   1.00 75.20  ? 221 ARG B NH1 1 
ATOM   1635 N NH2 . ARG B 1 7   ? 4.824   -57.358 -0.898  1.00 74.64  ? 221 ARG B NH2 1 
ATOM   1636 N N   . GLY B 1 8   ? 2.960   -53.301 -7.483  1.00 44.68  ? 222 GLY B N   1 
ATOM   1637 C CA  . GLY B 1 8   ? 2.885   -52.870 -8.867  1.00 40.15  ? 222 GLY B CA  1 
ATOM   1638 C C   . GLY B 1 8   ? 3.315   -51.420 -8.989  1.00 36.39  ? 222 GLY B C   1 
ATOM   1639 O O   . GLY B 1 8   ? 3.715   -50.803 -8.004  1.00 33.28  ? 222 GLY B O   1 
ATOM   1640 N N   . LEU B 1 9   ? 3.234   -50.870 -10.195 1.00 34.46  ? 223 LEU B N   1 
ATOM   1641 C CA  . LEU B 1 9   ? 3.606   -49.477 -10.405 1.00 32.62  ? 223 LEU B CA  1 
ATOM   1642 C C   . LEU B 1 9   ? 2.463   -48.560 -9.986  1.00 30.60  ? 223 LEU B C   1 
ATOM   1643 O O   . LEU B 1 9   ? 1.482   -48.404 -10.710 1.00 29.26  ? 223 LEU B O   1 
ATOM   1644 C CB  . LEU B 1 9   ? 3.980   -49.227 -11.868 1.00 34.21  ? 223 LEU B CB  1 
ATOM   1645 C CG  . LEU B 1 9   ? 5.053   -48.168 -12.159 1.00 35.90  ? 223 LEU B CG  1 
ATOM   1646 C CD1 . LEU B 1 9   ? 5.393   -48.166 -13.637 1.00 36.59  ? 223 LEU B CD1 1 
ATOM   1647 C CD2 . LEU B 1 9   ? 4.626   -46.777 -11.713 1.00 32.45  ? 223 LEU B CD2 1 
ATOM   1648 N N   . GLY B 1 10  ? 2.602   -47.952 -8.815  1.00 31.76  ? 224 GLY B N   1 
ATOM   1649 C CA  . GLY B 1 10  ? 1.613   -47.013 -8.329  1.00 32.36  ? 224 GLY B CA  1 
ATOM   1650 C C   . GLY B 1 10  ? 1.629   -46.884 -6.822  1.00 33.23  ? 224 GLY B C   1 
ATOM   1651 O O   . GLY B 1 10  ? 2.430   -47.525 -6.137  1.00 31.15  ? 224 GLY B O   1 
ATOM   1652 N N   . THR B 1 11  ? 0.750   -46.032 -6.309  1.00 31.98  ? 225 THR B N   1 
ATOM   1653 C CA  . THR B 1 11  ? 0.534   -45.907 -4.876  1.00 33.09  ? 225 THR B CA  1 
ATOM   1654 C C   . THR B 1 11  ? -0.945  -46.123 -4.594  1.00 34.70  ? 225 THR B C   1 
ATOM   1655 O O   . THR B 1 11  ? -1.730  -46.338 -5.517  1.00 35.83  ? 225 THR B O   1 
ATOM   1656 C CB  . THR B 1 11  ? 0.966   -44.528 -4.338  1.00 34.14  ? 225 THR B CB  1 
ATOM   1657 O OG1 . THR B 1 11  ? 0.052   -43.525 -4.797  1.00 35.95  ? 225 THR B OG1 1 
ATOM   1658 C CG2 . THR B 1 11  ? 2.373   -44.181 -4.801  1.00 36.08  ? 225 THR B CG2 1 
ATOM   1659 N N   . ALA B 1 12  ? -1.328  -46.052 -3.324  1.00 37.28  ? 226 ALA B N   1 
ATOM   1660 C CA  . ALA B 1 12  ? -2.732  -46.153 -2.945  1.00 39.82  ? 226 ALA B CA  1 
ATOM   1661 C C   . ALA B 1 12  ? -3.501  -44.926 -3.426  1.00 40.78  ? 226 ALA B C   1 
ATOM   1662 O O   . ALA B 1 12  ? -4.728  -44.922 -3.467  1.00 42.93  ? 226 ALA B O   1 
ATOM   1663 C CB  . ALA B 1 12  ? -2.866  -46.310 -1.439  1.00 42.28  ? 226 ALA B CB  1 
ATOM   1664 N N   . ARG B 1 13  ? -2.757  -43.889 -3.798  1.00 40.40  ? 227 ARG B N   1 
ATOM   1665 C CA  . ARG B 1 13  ? -3.331  -42.620 -4.218  1.00 42.79  ? 227 ARG B CA  1 
ATOM   1666 C C   . ARG B 1 13  ? -3.494  -42.548 -5.736  1.00 40.66  ? 227 ARG B C   1 
ATOM   1667 O O   . ARG B 1 13  ? -4.399  -41.884 -6.241  1.00 39.95  ? 227 ARG B O   1 
ATOM   1668 C CB  . ARG B 1 13  ? -2.453  -41.469 -3.721  1.00 47.49  ? 227 ARG B CB  1 
ATOM   1669 C CG  . ARG B 1 13  ? -3.117  -40.109 -3.746  1.00 51.63  ? 227 ARG B CG  1 
ATOM   1670 C CD  . ARG B 1 13  ? -2.822  -39.352 -2.461  1.00 54.21  ? 227 ARG B CD  1 
ATOM   1671 N NE  . ARG B 1 13  ? -3.551  -38.090 -2.392  1.00 57.49  ? 227 ARG B NE  1 
ATOM   1672 C CZ  . ARG B 1 13  ? -2.983  -36.895 -2.497  1.00 59.39  ? 227 ARG B CZ  1 
ATOM   1673 N NH1 . ARG B 1 13  ? -1.672  -36.796 -2.666  1.00 56.65  ? 227 ARG B NH1 1 
ATOM   1674 N NH2 . ARG B 1 13  ? -3.724  -35.798 -2.424  1.00 63.55  ? 227 ARG B NH2 1 
ATOM   1675 N N   . LEU B 1 14  ? -2.611  -43.228 -6.461  1.00 36.43  ? 228 LEU B N   1 
ATOM   1676 C CA  . LEU B 1 14  ? -2.669  -43.238 -7.918  1.00 32.71  ? 228 LEU B CA  1 
ATOM   1677 C C   . LEU B 1 14  ? -1.964  -44.462 -8.482  1.00 32.42  ? 228 LEU B C   1 
ATOM   1678 O O   . LEU B 1 14  ? -0.796  -44.707 -8.178  1.00 31.98  ? 228 LEU B O   1 
ATOM   1679 C CB  . LEU B 1 14  ? -2.039  -41.968 -8.495  1.00 33.57  ? 228 LEU B CB  1 
ATOM   1680 C CG  . LEU B 1 14  ? -2.166  -41.795 -10.012 1.00 33.67  ? 228 LEU B CG  1 
ATOM   1681 C CD1 . LEU B 1 14  ? -3.598  -41.435 -10.388 1.00 34.89  ? 228 LEU B CD1 1 
ATOM   1682 C CD2 . LEU B 1 14  ? -1.189  -40.748 -10.532 1.00 31.76  ? 228 LEU B CD2 1 
ATOM   1683 N N   . GLN B 1 15  ? -2.667  -45.225 -9.312  1.00 30.70  ? 229 GLN B N   1 
ATOM   1684 C CA  . GLN B 1 15  ? -2.084  -46.422 -9.901  1.00 32.31  ? 229 GLN B CA  1 
ATOM   1685 C C   . GLN B 1 15  ? -2.004  -46.320 -11.416 1.00 32.91  ? 229 GLN B C   1 
ATOM   1686 O O   . GLN B 1 15  ? -2.908  -45.792 -12.063 1.00 32.13  ? 229 GLN B O   1 
ATOM   1687 C CB  . GLN B 1 15  ? -2.887  -47.667 -9.512  1.00 38.58  ? 229 GLN B CB  1 
ATOM   1688 C CG  . GLN B 1 15  ? -3.056  -47.863 -8.016  1.00 43.88  ? 229 GLN B CG  1 
ATOM   1689 C CD  . GLN B 1 15  ? -4.312  -47.203 -7.478  1.00 45.77  ? 229 GLN B CD  1 
ATOM   1690 O OE1 . GLN B 1 15  ? -5.379  -47.286 -8.087  1.00 50.43  ? 229 GLN B OE1 1 
ATOM   1691 N NE2 . GLN B 1 15  ? -4.190  -46.542 -6.332  1.00 43.13  ? 229 GLN B NE2 1 
ATOM   1692 N N   . LEU B 1 16  ? -0.911  -46.824 -11.976 1.00 32.05  ? 230 LEU B N   1 
ATOM   1693 C CA  . LEU B 1 16  ? -0.806  -46.963 -13.419 1.00 33.51  ? 230 LEU B CA  1 
ATOM   1694 C C   . LEU B 1 16  ? -1.610  -48.179 -13.860 1.00 35.34  ? 230 LEU B C   1 
ATOM   1695 O O   . LEU B 1 16  ? -1.435  -49.272 -13.320 1.00 36.64  ? 230 LEU B O   1 
ATOM   1696 C CB  . LEU B 1 16  ? 0.650   -47.102 -13.856 1.00 31.55  ? 230 LEU B CB  1 
ATOM   1697 C CG  . LEU B 1 16  ? 0.846   -47.343 -15.354 1.00 30.56  ? 230 LEU B CG  1 
ATOM   1698 C CD1 . LEU B 1 16  ? 0.498   -46.091 -16.145 1.00 27.35  ? 230 LEU B CD1 1 
ATOM   1699 C CD2 . LEU B 1 16  ? 2.267   -47.804 -15.657 1.00 30.78  ? 230 LEU B CD2 1 
ATOM   1700 N N   . VAL B 1 17  ? -2.495  -47.986 -14.832 1.00 32.55  ? 231 VAL B N   1 
ATOM   1701 C CA  . VAL B 1 17  ? -3.301  -49.084 -15.353 1.00 35.00  ? 231 VAL B CA  1 
ATOM   1702 C C   . VAL B 1 17  ? -2.670  -49.673 -16.604 1.00 36.86  ? 231 VAL B C   1 
ATOM   1703 O O   . VAL B 1 17  ? -2.464  -50.883 -16.700 1.00 39.47  ? 231 VAL B O   1 
ATOM   1704 C CB  . VAL B 1 17  ? -4.738  -48.633 -15.684 1.00 35.98  ? 231 VAL B CB  1 
ATOM   1705 C CG1 . VAL B 1 17  ? -5.453  -49.696 -16.508 1.00 36.08  ? 231 VAL B CG1 1 
ATOM   1706 C CG2 . VAL B 1 17  ? -5.503  -48.330 -14.411 1.00 36.71  ? 231 VAL B CG2 1 
ATOM   1707 N N   . GLU B 1 18  ? -2.372  -48.806 -17.565 1.00 37.92  ? 232 GLU B N   1 
ATOM   1708 C CA  . GLU B 1 18  ? -1.743  -49.232 -18.805 1.00 42.45  ? 232 GLU B CA  1 
ATOM   1709 C C   . GLU B 1 18  ? -0.879  -48.121 -19.394 1.00 37.98  ? 232 GLU B C   1 
ATOM   1710 O O   . GLU B 1 18  ? -1.230  -46.942 -19.328 1.00 38.60  ? 232 GLU B O   1 
ATOM   1711 C CB  . GLU B 1 18  ? -2.799  -49.682 -19.821 1.00 49.66  ? 232 GLU B CB  1 
ATOM   1712 C CG  . GLU B 1 18  ? -2.209  -50.242 -21.111 1.00 55.42  ? 232 GLU B CG  1 
ATOM   1713 C CD  . GLU B 1 18  ? -3.178  -51.124 -21.871 1.00 60.98  ? 232 GLU B CD  1 
ATOM   1714 O OE1 . GLU B 1 18  ? -3.175  -51.075 -23.119 1.00 62.04  ? 232 GLU B OE1 1 
ATOM   1715 O OE2 . GLU B 1 18  ? -3.934  -51.875 -21.221 1.00 65.00  ? 232 GLU B OE2 1 
ATOM   1716 N N   . PHE B 1 19  ? 0.260   -48.510 -19.956 1.00 31.79  ? 233 PHE B N   1 
ATOM   1717 C CA  . PHE B 1 19  ? 1.159   -47.575 -20.616 1.00 32.11  ? 233 PHE B CA  1 
ATOM   1718 C C   . PHE B 1 19  ? 1.758   -48.224 -21.854 1.00 34.03  ? 233 PHE B C   1 
ATOM   1719 O O   . PHE B 1 19  ? 2.194   -49.376 -21.808 1.00 37.46  ? 233 PHE B O   1 
ATOM   1720 C CB  . PHE B 1 19  ? 2.266   -47.123 -19.661 1.00 35.14  ? 233 PHE B CB  1 
ATOM   1721 C CG  . PHE B 1 19  ? 3.342   -46.303 -20.317 1.00 37.26  ? 233 PHE B CG  1 
ATOM   1722 C CD1 . PHE B 1 19  ? 3.147   -44.955 -20.571 1.00 37.74  ? 233 PHE B CD1 1 
ATOM   1723 C CD2 . PHE B 1 19  ? 4.557   -46.876 -20.664 1.00 40.94  ? 233 PHE B CD2 1 
ATOM   1724 C CE1 . PHE B 1 19  ? 4.138   -44.197 -21.169 1.00 39.54  ? 233 PHE B CE1 1 
ATOM   1725 C CE2 . PHE B 1 19  ? 5.553   -46.121 -21.263 1.00 39.06  ? 233 PHE B CE2 1 
ATOM   1726 C CZ  . PHE B 1 19  ? 5.342   -44.780 -21.515 1.00 38.47  ? 233 PHE B CZ  1 
ATOM   1727 N N   . SER B 1 20  ? 1.780   -47.492 -22.962 1.00 29.97  ? 234 SER B N   1 
ATOM   1728 C CA  . SER B 1 20  ? 2.369   -48.024 -24.183 1.00 32.60  ? 234 SER B CA  1 
ATOM   1729 C C   . SER B 1 20  ? 2.826   -46.935 -25.141 1.00 30.97  ? 234 SER B C   1 
ATOM   1730 O O   . SER B 1 20  ? 2.284   -45.827 -25.165 1.00 28.26  ? 234 SER B O   1 
ATOM   1731 C CB  . SER B 1 20  ? 1.379   -48.952 -24.894 1.00 35.87  ? 234 SER B CB  1 
ATOM   1732 O OG  . SER B 1 20  ? 0.210   -48.255 -25.278 1.00 35.36  ? 234 SER B OG  1 
ATOM   1733 N N   . ALA B 1 21  ? 3.846   -47.270 -25.920 1.00 26.56  ? 235 ALA B N   1 
ATOM   1734 C CA  . ALA B 1 21  ? 4.294   -46.441 -27.024 1.00 28.18  ? 235 ALA B CA  1 
ATOM   1735 C C   . ALA B 1 21  ? 4.207   -47.291 -28.275 1.00 27.40  ? 235 ALA B C   1 
ATOM   1736 O O   . ALA B 1 21  ? 4.613   -48.452 -28.270 1.00 30.20  ? 235 ALA B O   1 
ATOM   1737 C CB  . ALA B 1 21  ? 5.711   -45.942 -26.795 1.00 30.88  ? 235 ALA B CB  1 
ATOM   1738 N N   . PHE B 1 22  ? 3.668   -46.734 -29.349 1.00 27.57  ? 236 PHE B N   1 
ATOM   1739 C CA  . PHE B 1 22  ? 3.347   -47.569 -30.489 1.00 27.19  ? 236 PHE B CA  1 
ATOM   1740 C C   . PHE B 1 22  ? 3.432   -46.849 -31.819 1.00 24.39  ? 236 PHE B C   1 
ATOM   1741 O O   . PHE B 1 22  ? 3.507   -45.624 -31.881 1.00 29.49  ? 236 PHE B O   1 
ATOM   1742 C CB  . PHE B 1 22  ? 1.942   -48.161 -30.314 1.00 28.89  ? 236 PHE B CB  1 
ATOM   1743 C CG  . PHE B 1 22  ? 0.852   -47.127 -30.232 1.00 30.58  ? 236 PHE B CG  1 
ATOM   1744 C CD1 . PHE B 1 22  ? 0.241   -46.652 -31.381 1.00 31.63  ? 236 PHE B CD1 1 
ATOM   1745 C CD2 . PHE B 1 22  ? 0.436   -46.636 -29.005 1.00 30.70  ? 236 PHE B CD2 1 
ATOM   1746 C CE1 . PHE B 1 22  ? -0.765  -45.702 -31.309 1.00 35.40  ? 236 PHE B CE1 1 
ATOM   1747 C CE2 . PHE B 1 22  ? -0.570  -45.686 -28.925 1.00 33.77  ? 236 PHE B CE2 1 
ATOM   1748 C CZ  . PHE B 1 22  ? -1.170  -45.219 -30.079 1.00 35.42  ? 236 PHE B CZ  1 
ATOM   1749 N N   . VAL B 1 23  ? 3.422   -47.634 -32.888 1.00 29.91  ? 237 VAL B N   1 
ATOM   1750 C CA  . VAL B 1 23  ? 3.336   -47.087 -34.228 1.00 31.50  ? 237 VAL B CA  1 
ATOM   1751 C C   . VAL B 1 23  ? 2.260   -47.825 -35.016 1.00 35.12  ? 237 VAL B C   1 
ATOM   1752 O O   . VAL B 1 23  ? 2.168   -49.054 -34.980 1.00 33.13  ? 237 VAL B O   1 
ATOM   1753 C CB  . VAL B 1 23  ? 4.692   -47.159 -34.970 1.00 32.33  ? 237 VAL B CB  1 
ATOM   1754 C CG1 . VAL B 1 23  ? 5.210   -48.591 -35.035 1.00 27.38  ? 237 VAL B CG1 1 
ATOM   1755 C CG2 . VAL B 1 23  ? 4.566   -46.560 -36.367 1.00 32.83  ? 237 VAL B CG2 1 
ATOM   1756 N N   . GLU B 1 24  ? 1.420   -47.051 -35.693 1.00 37.01  ? 238 GLU B N   1 
ATOM   1757 C CA  . GLU B 1 24  ? 0.436   -47.589 -36.615 1.00 36.02  ? 238 GLU B CA  1 
ATOM   1758 C C   . GLU B 1 24  ? 0.877   -47.265 -38.036 1.00 41.52  ? 238 GLU B C   1 
ATOM   1759 O O   . GLU B 1 24  ? 1.020   -46.096 -38.387 1.00 44.69  ? 238 GLU B O   1 
ATOM   1760 C CB  . GLU B 1 24  ? -0.952  -47.007 -36.325 1.00 34.23  ? 238 GLU B CB  1 
ATOM   1761 C CG  . GLU B 1 24  ? -1.532  -47.424 -34.979 1.00 32.91  ? 238 GLU B CG  1 
ATOM   1762 C CD  . GLU B 1 24  ? -2.668  -46.526 -34.524 1.00 37.90  ? 238 GLU B CD  1 
ATOM   1763 O OE1 . GLU B 1 24  ? -2.872  -45.460 -35.143 1.00 39.38  ? 238 GLU B OE1 1 
ATOM   1764 O OE2 . GLU B 1 24  ? -3.355  -46.885 -33.544 1.00 40.25  ? 238 GLU B OE2 1 
ATOM   1765 N N   . PRO B 1 25  ? 1.061   -48.295 -38.834 1.00 50.39  ? 239 PRO B N   1 
ATOM   1766 C CA  . PRO B 1 25  ? 1.509   -48.159 -40.210 1.00 51.09  ? 239 PRO B CA  1 
ATOM   1767 C C   . PRO B 1 25  ? 0.491   -47.489 -41.084 1.00 55.23  ? 239 PRO B C   1 
ATOM   1768 O O   . PRO B 1 25  ? -0.683  -47.548 -40.815 1.00 55.98  ? 239 PRO B O   1 
ATOM   1769 C CB  . PRO B 1 25  ? 1.754   -49.590 -40.639 1.00 51.62  ? 239 PRO B CB  1 
ATOM   1770 C CG  . PRO B 1 25  ? 0.902   -50.403 -39.769 1.00 52.84  ? 239 PRO B CG  1 
ATOM   1771 C CD  . PRO B 1 25  ? 0.829   -49.690 -38.468 1.00 50.20  ? 239 PRO B CD  1 
ATOM   1772 N N   . PRO B 1 26  ? 1.012   -46.832 -42.182 1.00 57.33  ? 240 PRO B N   1 
ATOM   1773 C CA  . PRO B 1 26  ? 0.027   -46.131 -43.000 1.00 61.13  ? 240 PRO B CA  1 
ATOM   1774 C C   . PRO B 1 26  ? -1.074  -46.973 -43.559 1.00 66.94  ? 240 PRO B C   1 
ATOM   1775 O O   . PRO B 1 26  ? -2.070  -46.425 -43.976 1.00 70.32  ? 240 PRO B O   1 
ATOM   1776 C CB  . PRO B 1 26  ? 0.857   -45.546 -44.130 1.00 62.19  ? 240 PRO B CB  1 
ATOM   1777 C CG  . PRO B 1 26  ? 2.167   -45.318 -43.527 1.00 58.06  ? 240 PRO B CG  1 
ATOM   1778 C CD  . PRO B 1 26  ? 2.367   -46.605 -42.842 1.00 55.03  ? 240 PRO B CD  1 
ATOM   1779 N N   . ASP B 1 27  ? -0.913  -48.272 -43.570 1.00 68.43  ? 241 ASP B N   1 
ATOM   1780 C CA  . ASP B 1 27  ? -1.943  -49.111 -44.120 1.00 74.72  ? 241 ASP B CA  1 
ATOM   1781 C C   . ASP B 1 27  ? -2.869  -49.604 -43.047 1.00 70.09  ? 241 ASP B C   1 
ATOM   1782 O O   . ASP B 1 27  ? -3.590  -50.563 -43.245 1.00 74.32  ? 241 ASP B O   1 
ATOM   1783 C CB  . ASP B 1 27  ? -1.291  -50.290 -44.790 1.00 81.45  ? 241 ASP B CB  1 
ATOM   1784 C CG  . ASP B 1 27  ? -0.295  -50.935 -43.916 1.00 83.34  ? 241 ASP B CG  1 
ATOM   1785 O OD1 . ASP B 1 27  ? 0.852   -50.437 -43.839 1.00 85.12  ? 241 ASP B OD1 1 
ATOM   1786 O OD2 . ASP B 1 27  ? -0.666  -51.932 -43.291 1.00 82.98  ? 241 ASP B OD2 1 
ATOM   1787 N N   . ALA B 1 28  ? -2.833  -48.950 -41.903 1.00 61.49  ? 242 ALA B N   1 
ATOM   1788 C CA  . ALA B 1 28  ? -3.629  -49.345 -40.762 1.00 56.35  ? 242 ALA B CA  1 
ATOM   1789 C C   . ALA B 1 28  ? -5.119  -49.206 -41.007 1.00 57.62  ? 242 ALA B C   1 
ATOM   1790 O O   . ALA B 1 28  ? -5.904  -49.932 -40.443 1.00 57.47  ? 242 ALA B O   1 
ATOM   1791 C CB  . ALA B 1 28  ? -3.210  -48.554 -39.547 1.00 49.56  ? 242 ALA B CB  1 
ATOM   1792 N N   . VAL B 1 29  ? -5.467  -48.262 -41.852 1.00 62.10  ? 243 VAL B N   1 
ATOM   1793 C CA  . VAL B 1 29  ? -6.843  -47.993 -42.235 1.00 67.51  ? 243 VAL B CA  1 
ATOM   1794 C C   . VAL B 1 29  ? -7.499  -49.140 -42.981 1.00 74.81  ? 243 VAL B C   1 
ATOM   1795 O O   . VAL B 1 29  ? -8.692  -49.361 -42.847 1.00 76.04  ? 243 VAL B O   1 
ATOM   1796 C CB  . VAL B 1 29  ? -6.931  -46.761 -43.115 1.00 67.59  ? 243 VAL B CB  1 
ATOM   1797 C CG1 . VAL B 1 29  ? -6.661  -45.531 -42.300 1.00 63.71  ? 243 VAL B CG1 1 
ATOM   1798 C CG2 . VAL B 1 29  ? -5.927  -46.864 -44.219 1.00 68.12  ? 243 VAL B CG2 1 
ATOM   1799 N N   . ASP B 1 30  ? -6.727  -49.871 -43.766 1.00 77.42  ? 244 ASP B N   1 
ATOM   1800 C CA  . ASP B 1 30  ? -7.290  -50.981 -44.488 1.00 84.48  ? 244 ASP B CA  1 
ATOM   1801 C C   . ASP B 1 30  ? -7.427  -52.177 -43.574 1.00 84.54  ? 244 ASP B C   1 
ATOM   1802 O O   . ASP B 1 30  ? -8.480  -52.752 -43.472 1.00 89.94  ? 244 ASP B O   1 
ATOM   1803 C CB  . ASP B 1 30  ? -6.493  -51.298 -45.737 1.00 88.18  ? 244 ASP B CB  1 
ATOM   1804 C CG  . ASP B 1 30  ? -6.012  -50.068 -46.439 1.00 90.34  ? 244 ASP B CG  1 
ATOM   1805 O OD1 . ASP B 1 30  ? -4.857  -50.078 -46.834 1.00 91.26  ? 244 ASP B OD1 1 
ATOM   1806 O OD2 . ASP B 1 30  ? -6.751  -49.085 -46.577 1.00 91.86  ? 244 ASP B OD2 1 
ATOM   1807 N N   . SER B 1 31  ? -6.343  -52.518 -42.899 1.00 80.68  ? 245 SER B N   1 
ATOM   1808 C CA  . SER B 1 31  ? -6.358  -53.611 -41.941 1.00 79.60  ? 245 SER B CA  1 
ATOM   1809 C C   . SER B 1 31  ? -5.615  -53.228 -40.662 1.00 70.92  ? 245 SER B C   1 
ATOM   1810 O O   . SER B 1 31  ? -4.437  -53.450 -40.545 1.00 69.06  ? 245 SER B O   1 
ATOM   1811 C CB  . SER B 1 31  ? -5.741  -54.855 -42.513 1.00 84.68  ? 245 SER B CB  1 
ATOM   1812 O OG  . SER B 1 31  ? -5.863  -55.905 -41.575 1.00 85.81  ? 245 SER B OG  1 
ATOM   1813 N N   . TYR B 1 32  ? -6.320  -52.747 -39.665 1.00 65.33  ? 246 TYR B N   1 
ATOM   1814 C CA  . TYR B 1 32  ? -5.655  -52.252 -38.487 1.00 59.49  ? 246 TYR B CA  1 
ATOM   1815 C C   . TYR B 1 32  ? -4.600  -53.134 -37.834 1.00 57.66  ? 246 TYR B C   1 
ATOM   1816 O O   . TYR B 1 32  ? -4.756  -54.305 -37.613 1.00 57.91  ? 246 TYR B O   1 
ATOM   1817 C CB  . TYR B 1 32  ? -6.671  -51.807 -37.445 1.00 55.14  ? 246 TYR B CB  1 
ATOM   1818 C CG  . TYR B 1 32  ? -6.026  -51.105 -36.316 1.00 49.70  ? 246 TYR B CG  1 
ATOM   1819 C CD1 . TYR B 1 32  ? -5.694  -49.792 -36.419 1.00 47.62  ? 246 TYR B CD1 1 
ATOM   1820 C CD2 . TYR B 1 32  ? -5.707  -51.759 -35.179 1.00 50.38  ? 246 TYR B CD2 1 
ATOM   1821 C CE1 . TYR B 1 32  ? -5.088  -49.135 -35.404 1.00 43.25  ? 246 TYR B CE1 1 
ATOM   1822 C CE2 . TYR B 1 32  ? -5.082  -51.108 -34.155 1.00 48.15  ? 246 TYR B CE2 1 
ATOM   1823 C CZ  . TYR B 1 32  ? -4.780  -49.789 -34.283 1.00 44.73  ? 246 TYR B CZ  1 
ATOM   1824 O OH  . TYR B 1 32  ? -4.172  -49.115 -33.296 1.00 39.10  ? 246 TYR B OH  1 
ATOM   1825 N N   . GLN B 1 33  ? -3.491  -52.475 -37.548 1.00 52.70  ? 247 GLN B N   1 
ATOM   1826 C CA  . GLN B 1 33  ? -2.334  -53.071 -36.939 1.00 52.10  ? 247 GLN B CA  1 
ATOM   1827 C C   . GLN B 1 33  ? -1.589  -52.013 -36.141 1.00 43.78  ? 247 GLN B C   1 
ATOM   1828 O O   . GLN B 1 33  ? -1.549  -50.889 -36.544 1.00 41.52  ? 247 GLN B O   1 
ATOM   1829 C CB  . GLN B 1 33  ? -1.440  -53.527 -38.073 1.00 58.79  ? 247 GLN B CB  1 
ATOM   1830 C CG  . GLN B 1 33  ? -0.365  -54.508 -37.747 1.00 64.46  ? 247 GLN B CG  1 
ATOM   1831 C CD  . GLN B 1 33  ? 0.269   -55.035 -39.012 1.00 71.48  ? 247 GLN B CD  1 
ATOM   1832 O OE1 . GLN B 1 33  ? 1.431   -54.801 -39.286 1.00 71.57  ? 247 GLN B OE1 1 
ATOM   1833 N NE2 . GLN B 1 33  ? -0.508  -55.743 -39.787 1.00 76.50  ? 247 GLN B NE2 1 
ATOM   1834 N N   . ARG B 1 34  ? -1.003  -52.403 -35.021 1.00 41.19  ? 248 ARG B N   1 
ATOM   1835 C CA  . ARG B 1 34  ? -0.176  -51.508 -34.232 1.00 42.49  ? 248 ARG B CA  1 
ATOM   1836 C C   . ARG B 1 34  ? 1.011   -52.258 -33.661 1.00 41.42  ? 248 ARG B C   1 
ATOM   1837 O O   . ARG B 1 34  ? 0.881   -53.352 -33.177 1.00 45.96  ? 248 ARG B O   1 
ATOM   1838 C CB  . ARG B 1 34  ? -0.961  -50.696 -33.167 1.00 45.31  ? 248 ARG B CB  1 
ATOM   1839 C CG  . ARG B 1 34  ? -0.185  -49.707 -32.334 1.00 52.14  ? 248 ARG B CG  1 
ATOM   1840 C CD  . ARG B 1 34  ? -1.016  -48.987 -31.282 1.00 55.81  ? 248 ARG B CD  1 
ATOM   1841 N NE  . ARG B 1 34  ? -1.494  -49.934 -30.293 1.00 63.77  ? 248 ARG B NE  1 
ATOM   1842 C CZ  . ARG B 1 34  ? -2.492  -49.779 -29.425 1.00 68.71  ? 248 ARG B CZ  1 
ATOM   1843 N NH1 . ARG B 1 34  ? -3.176  -48.658 -29.294 1.00 68.37  ? 248 ARG B NH1 1 
ATOM   1844 N NH2 . ARG B 1 34  ? -2.788  -50.791 -28.659 1.00 70.98  ? 248 ARG B NH2 1 
ATOM   1845 N N   . HIS B 1 35  ? 2.167   -51.635 -33.715 1.00 35.61  ? 249 HIS B N   1 
ATOM   1846 C CA  . HIS B 1 35  ? 3.370   -52.217 -33.188 1.00 34.23  ? 249 HIS B CA  1 
ATOM   1847 C C   . HIS B 1 35  ? 3.733   -51.533 -31.892 1.00 31.82  ? 249 HIS B C   1 
ATOM   1848 O O   . HIS B 1 35  ? 3.846   -50.351 -31.827 1.00 30.70  ? 249 HIS B O   1 
ATOM   1849 C CB  . HIS B 1 35  ? 4.512   -52.057 -34.167 1.00 33.75  ? 249 HIS B CB  1 
ATOM   1850 C CG  . HIS B 1 35  ? 5.830   -52.436 -33.598 1.00 35.34  ? 249 HIS B CG  1 
ATOM   1851 N ND1 . HIS B 1 35  ? 6.293   -53.725 -33.597 1.00 37.06  ? 249 HIS B ND1 1 
ATOM   1852 C CD2 . HIS B 1 35  ? 6.766   -51.703 -32.970 1.00 33.14  ? 249 HIS B CD2 1 
ATOM   1853 C CE1 . HIS B 1 35  ? 7.463   -53.766 -33.004 1.00 36.05  ? 249 HIS B CE1 1 
ATOM   1854 N NE2 . HIS B 1 35  ? 7.767   -52.554 -32.604 1.00 35.53  ? 249 HIS B NE2 1 
ATOM   1855 N N   . LEU B 1 36  ? 3.917   -52.319 -30.868 1.00 30.58  ? 250 LEU B N   1 
ATOM   1856 C CA  . LEU B 1 36  ? 4.260   -51.794 -29.584 1.00 31.24  ? 250 LEU B CA  1 
ATOM   1857 C C   . LEU B 1 36  ? 5.749   -51.763 -29.321 1.00 28.75  ? 250 LEU B C   1 
ATOM   1858 O O   . LEU B 1 36  ? 6.393   -52.759 -29.334 1.00 33.63  ? 250 LEU B O   1 
ATOM   1859 C CB  . LEU B 1 36  ? 3.591   -52.589 -28.485 1.00 32.89  ? 250 LEU B CB  1 
ATOM   1860 C CG  . LEU B 1 36  ? 2.090   -52.821 -28.452 1.00 37.96  ? 250 LEU B CG  1 
ATOM   1861 C CD1 . LEU B 1 36  ? 1.758   -53.713 -27.290 1.00 39.01  ? 250 LEU B CD1 1 
ATOM   1862 C CD2 . LEU B 1 36  ? 1.314   -51.534 -28.365 1.00 36.26  ? 250 LEU B CD2 1 
ATOM   1863 N N   . PHE B 1 37  ? 6.270   -50.591 -29.070 1.00 28.21  ? 251 PHE B N   1 
ATOM   1864 C CA  . PHE B 1 37  ? 7.687   -50.473 -28.737 1.00 30.24  ? 251 PHE B CA  1 
ATOM   1865 C C   . PHE B 1 37  ? 7.898   -50.944 -27.306 1.00 32.57  ? 251 PHE B C   1 
ATOM   1866 O O   . PHE B 1 37  ? 8.792   -51.746 -27.023 1.00 34.21  ? 251 PHE B O   1 
ATOM   1867 C CB  . PHE B 1 37  ? 8.180   -49.035 -28.905 1.00 28.96  ? 251 PHE B CB  1 
ATOM   1868 C CG  . PHE B 1 37  ? 8.049   -48.508 -30.302 1.00 26.31  ? 251 PHE B CG  1 
ATOM   1869 C CD1 . PHE B 1 37  ? 8.888   -48.960 -31.307 1.00 27.10  ? 251 PHE B CD1 1 
ATOM   1870 C CD2 . PHE B 1 37  ? 7.089   -47.559 -30.609 1.00 24.71  ? 251 PHE B CD2 1 
ATOM   1871 C CE1 . PHE B 1 37  ? 8.770   -48.477 -32.595 1.00 29.36  ? 251 PHE B CE1 1 
ATOM   1872 C CE2 . PHE B 1 37  ? 6.965   -47.071 -31.895 1.00 29.20  ? 251 PHE B CE2 1 
ATOM   1873 C CZ  . PHE B 1 37  ? 7.806   -47.528 -32.888 1.00 29.82  ? 251 PHE B CZ  1 
ATOM   1874 N N   . VAL B 1 38  ? 7.066   -50.419 -26.411 1.00 29.77  ? 252 VAL B N   1 
ATOM   1875 C CA  . VAL B 1 38  ? 7.034   -50.827 -25.013 1.00 31.20  ? 252 VAL B CA  1 
ATOM   1876 C C   . VAL B 1 38  ? 5.585   -50.882 -24.556 1.00 35.72  ? 252 VAL B C   1 
ATOM   1877 O O   . VAL B 1 38  ? 4.722   -50.219 -25.135 1.00 34.96  ? 252 VAL B O   1 
ATOM   1878 C CB  . VAL B 1 38  ? 7.820   -49.863 -24.103 1.00 33.10  ? 252 VAL B CB  1 
ATOM   1879 C CG1 . VAL B 1 38  ? 9.305   -49.885 -24.443 1.00 35.93  ? 252 VAL B CG1 1 
ATOM   1880 C CG2 . VAL B 1 38  ? 7.259   -48.454 -24.211 1.00 34.35  ? 252 VAL B CG2 1 
ATOM   1881 N N   . HIS B 1 39  ? 5.319   -51.657 -23.512 1.00 36.17  ? 253 HIS B N   1 
ATOM   1882 C CA  . HIS B 1 39  ? 3.949   -51.860 -23.064 1.00 36.10  ? 253 HIS B CA  1 
ATOM   1883 C C   . HIS B 1 39  ? 3.884   -52.351 -21.624 1.00 36.04  ? 253 HIS B C   1 
ATOM   1884 O O   . HIS B 1 39  ? 4.466   -53.376 -21.283 1.00 40.36  ? 253 HIS B O   1 
ATOM   1885 C CB  . HIS B 1 39  ? 3.240   -52.857 -23.985 1.00 38.92  ? 253 HIS B CB  1 
ATOM   1886 C CG  . HIS B 1 39  ? 1.808   -53.101 -23.624 1.00 43.53  ? 253 HIS B CG  1 
ATOM   1887 N ND1 . HIS B 1 39  ? 0.884   -52.084 -23.515 1.00 45.34  ? 253 HIS B ND1 1 
ATOM   1888 C CD2 . HIS B 1 39  ? 1.140   -54.247 -23.352 1.00 47.75  ? 253 HIS B CD2 1 
ATOM   1889 C CE1 . HIS B 1 39  ? -0.291  -52.593 -23.190 1.00 45.50  ? 253 HIS B CE1 1 
ATOM   1890 N NE2 . HIS B 1 39  ? -0.163  -53.904 -23.085 1.00 47.25  ? 253 HIS B NE2 1 
ATOM   1891 N N   . ILE B 1 40  ? 3.173   -51.607 -20.784 1.00 30.18  ? 254 ILE B N   1 
ATOM   1892 C CA  . ILE B 1 40  ? 2.910   -52.036 -19.417 1.00 32.27  ? 254 ILE B CA  1 
ATOM   1893 C C   . ILE B 1 40  ? 1.410   -52.161 -19.195 1.00 34.93  ? 254 ILE B C   1 
ATOM   1894 O O   . ILE B 1 40  ? 0.667   -51.206 -19.415 1.00 34.93  ? 254 ILE B O   1 
ATOM   1895 C CB  . ILE B 1 40  ? 3.482   -51.056 -18.381 1.00 35.03  ? 254 ILE B CB  1 
ATOM   1896 C CG1 . ILE B 1 40  ? 5.001   -50.959 -18.509 1.00 38.69  ? 254 ILE B CG1 1 
ATOM   1897 C CG2 . ILE B 1 40  ? 3.100   -51.489 -16.974 1.00 36.29  ? 254 ILE B CG2 1 
ATOM   1898 C CD1 . ILE B 1 40  ? 5.620   -49.992 -17.523 1.00 41.63  ? 254 ILE B CD1 1 
ATOM   1899 N N   . SER B 1 41  ? 0.969   -53.336 -18.761 1.00 37.84  ? 255 SER B N   1 
ATOM   1900 C CA  . SER B 1 41  ? -0.440  -53.557 -18.468 1.00 45.04  ? 255 SER B CA  1 
ATOM   1901 C C   . SER B 1 41  ? -0.613  -54.135 -17.072 1.00 47.48  ? 255 SER B C   1 
ATOM   1902 O O   . SER B 1 41  ? -0.099  -55.211 -16.772 1.00 53.32  ? 255 SER B O   1 
ATOM   1903 C CB  . SER B 1 41  ? -1.067  -54.488 -19.506 1.00 50.38  ? 255 SER B CB  1 
ATOM   1904 O OG  . SER B 1 41  ? -2.447  -54.668 -19.251 1.00 55.02  ? 255 SER B OG  1 
ATOM   1905 N N   . GLN B 1 42  ? -1.337  -53.422 -16.218 1.00 48.76  ? 256 GLN B N   1 
ATOM   1906 C CA  . GLN B 1 42  ? -1.546  -53.883 -14.850 1.00 52.21  ? 256 GLN B CA  1 
ATOM   1907 C C   . GLN B 1 42  ? -3.011  -54.218 -14.583 1.00 56.01  ? 256 GLN B C   1 
ATOM   1908 O O   . GLN B 1 42  ? -3.801  -53.350 -14.216 1.00 58.51  ? 256 GLN B O   1 
ATOM   1909 C CB  . GLN B 1 42  ? -1.047  -52.832 -13.857 1.00 47.65  ? 256 GLN B CB  1 
ATOM   1910 C CG  . GLN B 1 42  ? 0.430   -52.512 -14.019 1.00 46.25  ? 256 GLN B CG  1 
ATOM   1911 C CD  . GLN B 1 42  ? 1.040   -51.897 -12.777 1.00 47.37  ? 256 GLN B CD  1 
ATOM   1912 O OE1 . GLN B 1 42  ? 2.140   -52.267 -12.367 1.00 44.79  ? 256 GLN B OE1 1 
ATOM   1913 N NE2 . GLN B 1 42  ? 0.330   -50.951 -12.172 1.00 50.72  ? 256 GLN B NE2 1 
ATOM   1914 N N   . PRO B 1 50  ? 3.938   -60.338 -2.817  1.00 73.89  ? 264 PRO B N   1 
ATOM   1915 C CA  . PRO B 1 50  ? 5.259   -60.345 -3.423  1.00 72.51  ? 264 PRO B CA  1 
ATOM   1916 C C   . PRO B 1 50  ? 5.596   -58.926 -3.845  1.00 68.20  ? 264 PRO B C   1 
ATOM   1917 O O   . PRO B 1 50  ? 5.120   -58.439 -4.852  1.00 66.08  ? 264 PRO B O   1 
ATOM   1918 C CB  . PRO B 1 50  ? 5.073   -61.241 -4.624  1.00 73.54  ? 264 PRO B CB  1 
ATOM   1919 C CG  . PRO B 1 50  ? 3.610   -61.272 -4.885  1.00 74.20  ? 264 PRO B CG  1 
ATOM   1920 C CD  . PRO B 1 50  ? 2.896   -60.517 -3.820  1.00 73.61  ? 264 PRO B CD  1 
ATOM   1921 N N   . PRO B 1 51  ? 6.399   -58.249 -3.061  1.00 67.87  ? 265 PRO B N   1 
ATOM   1922 C CA  . PRO B 1 51  ? 6.748   -56.879 -3.384  1.00 63.44  ? 265 PRO B CA  1 
ATOM   1923 C C   . PRO B 1 51  ? 7.690   -56.830 -4.568  1.00 61.83  ? 265 PRO B C   1 
ATOM   1924 O O   . PRO B 1 51  ? 8.234   -57.835 -4.966  1.00 65.83  ? 265 PRO B O   1 
ATOM   1925 C CB  . PRO B 1 51  ? 7.460   -56.399 -2.125  1.00 64.25  ? 265 PRO B CB  1 
ATOM   1926 C CG  . PRO B 1 51  ? 7.161   -57.421 -1.088  1.00 70.69  ? 265 PRO B CG  1 
ATOM   1927 C CD  . PRO B 1 51  ? 7.064   -58.690 -1.839  1.00 72.75  ? 265 PRO B CD  1 
ATOM   1928 N N   . LEU B 1 52  ? 7.874   -55.649 -5.114  1.00 56.68  ? 266 LEU B N   1 
ATOM   1929 C CA  . LEU B 1 52  ? 8.749   -55.464 -6.236  1.00 54.88  ? 266 LEU B CA  1 
ATOM   1930 C C   . LEU B 1 52  ? 10.135  -55.417 -5.695  1.00 55.90  ? 266 LEU B C   1 
ATOM   1931 O O   . LEU B 1 52  ? 10.346  -55.032 -4.581  1.00 54.63  ? 266 LEU B O   1 
ATOM   1932 C CB  . LEU B 1 52  ? 8.455   -54.139 -6.911  1.00 50.81  ? 266 LEU B CB  1 
ATOM   1933 C CG  . LEU B 1 52  ? 7.378   -53.942 -7.958  1.00 50.22  ? 266 LEU B CG  1 
ATOM   1934 C CD1 . LEU B 1 52  ? 7.543   -54.710 -9.231  1.00 48.92  ? 266 LEU B CD1 1 
ATOM   1935 C CD2 . LEU B 1 52  ? 6.006   -54.137 -7.390  1.00 50.39  ? 266 LEU B CD2 1 
ATOM   1936 N N   . GLU B 1 53  ? 11.081  -55.805 -6.516  1.00 58.30  ? 267 GLU B N   1 
ATOM   1937 C CA  . GLU B 1 53  ? 12.454  -55.786 -6.128  1.00 61.96  ? 267 GLU B CA  1 
ATOM   1938 C C   . GLU B 1 53  ? 12.789  -54.346 -6.145  1.00 56.91  ? 267 GLU B C   1 
ATOM   1939 O O   . GLU B 1 53  ? 12.117  -53.588 -6.778  1.00 52.37  ? 267 GLU B O   1 
ATOM   1940 C CB  . GLU B 1 53  ? 13.302  -56.581 -7.120  1.00 66.45  ? 267 GLU B CB  1 
ATOM   1941 C CG  . GLU B 1 53  ? 12.783  -58.000 -7.352  1.00 70.71  ? 267 GLU B CG  1 
ATOM   1942 C CD  . GLU B 1 53  ? 13.544  -58.770 -8.407  1.00 75.70  ? 267 GLU B CD  1 
ATOM   1943 O OE1 . GLU B 1 53  ? 14.757  -58.592 -8.533  1.00 77.22  ? 267 GLU B OE1 1 
ATOM   1944 O OE2 . GLU B 1 53  ? 12.914  -59.572 -9.097  1.00 78.14  ? 267 GLU B OE2 1 
ATOM   1945 N N   . SER B 1 54  ? 13.831  -53.966 -5.445  1.00 59.32  ? 268 SER B N   1 
ATOM   1946 C CA  . SER B 1 54  ? 14.209  -52.590 -5.350  1.00 56.20  ? 268 SER B CA  1 
ATOM   1947 C C   . SER B 1 54  ? 15.533  -52.239 -5.953  1.00 55.74  ? 268 SER B C   1 
ATOM   1948 O O   . SER B 1 54  ? 16.346  -53.088 -6.177  1.00 61.04  ? 268 SER B O   1 
ATOM   1949 C CB  . SER B 1 54  ? 14.212  -52.197 -3.888  1.00 58.44  ? 268 SER B CB  1 
ATOM   1950 O OG  . SER B 1 54  ? 15.097  -53.000 -3.149  1.00 63.93  ? 268 SER B OG  1 
ATOM   1951 N N   . VAL B 1 55  ? 15.722  -50.959 -6.215  1.00 51.51  ? 269 VAL B N   1 
ATOM   1952 C CA  . VAL B 1 55  ? 16.960  -50.430 -6.772  1.00 54.19  ? 269 VAL B CA  1 
ATOM   1953 C C   . VAL B 1 55  ? 17.288  -49.112 -6.080  1.00 54.34  ? 269 VAL B C   1 
ATOM   1954 O O   . VAL B 1 55  ? 16.437  -48.227 -5.993  1.00 45.88  ? 269 VAL B O   1 
ATOM   1955 C CB  . VAL B 1 55  ? 16.857  -50.208 -8.295  1.00 50.88  ? 269 VAL B CB  1 
ATOM   1956 C CG1 . VAL B 1 55  ? 18.032  -49.381 -8.797  1.00 52.31  ? 269 VAL B CG1 1 
ATOM   1957 C CG2 . VAL B 1 55  ? 16.780  -51.540 -9.024  1.00 50.98  ? 269 VAL B CG2 1 
ATOM   1958 N N   . ASP B 1 56  ? 18.512  -48.987 -5.577  1.00 55.16  ? 270 ASP B N   1 
ATOM   1959 C CA  . ASP B 1 56  ? 18.929  -47.767 -4.896  1.00 58.82  ? 270 ASP B CA  1 
ATOM   1960 C C   . ASP B 1 56  ? 18.970  -46.590 -5.870  1.00 56.63  ? 270 ASP B C   1 
ATOM   1961 O O   . ASP B 1 56  ? 19.642  -46.650 -6.900  1.00 56.33  ? 270 ASP B O   1 
ATOM   1962 C CB  . ASP B 1 56  ? 20.294  -47.958 -4.235  1.00 68.27  ? 270 ASP B CB  1 
ATOM   1963 C CG  . ASP B 1 56  ? 20.609  -46.867 -3.232  1.00 75.07  ? 270 ASP B CG  1 
ATOM   1964 O OD1 . ASP B 1 56  ? 20.408  -47.095 -2.020  1.00 78.94  ? 270 ASP B OD1 1 
ATOM   1965 O OD2 . ASP B 1 56  ? 21.047  -45.779 -3.656  1.00 77.17  ? 270 ASP B OD2 1 
ATOM   1966 N N   . VAL B 1 57  ? 18.253  -45.521 -5.528  1.00 54.06  ? 271 VAL B N   1 
ATOM   1967 C CA  . VAL B 1 57  ? 18.068  -44.381 -6.424  1.00 50.86  ? 271 VAL B CA  1 
ATOM   1968 C C   . VAL B 1 57  ? 19.376  -43.628 -6.711  1.00 53.56  ? 271 VAL B C   1 
ATOM   1969 O O   . VAL B 1 57  ? 19.492  -42.940 -7.727  1.00 51.25  ? 271 VAL B O   1 
ATOM   1970 C CB  . VAL B 1 57  ? 17.013  -43.398 -5.848  1.00 48.29  ? 271 VAL B CB  1 
ATOM   1971 C CG1 . VAL B 1 57  ? 17.567  -42.647 -4.643  1.00 49.90  ? 271 VAL B CG1 1 
ATOM   1972 C CG2 . VAL B 1 57  ? 16.526  -42.431 -6.920  1.00 44.42  ? 271 VAL B CG2 1 
ATOM   1973 N N   . ARG B 1 58  ? 20.362  -43.772 -5.830  1.00 55.91  ? 272 ARG B N   1 
ATOM   1974 C CA  . ARG B 1 58  ? 21.659  -43.128 -6.033  1.00 63.32  ? 272 ARG B CA  1 
ATOM   1975 C C   . ARG B 1 58  ? 22.387  -43.723 -7.235  1.00 64.87  ? 272 ARG B C   1 
ATOM   1976 O O   . ARG B 1 58  ? 23.181  -43.048 -7.889  1.00 65.29  ? 272 ARG B O   1 
ATOM   1977 C CB  . ARG B 1 58  ? 22.534  -43.252 -4.783  1.00 71.06  ? 272 ARG B CB  1 
ATOM   1978 C CG  . ARG B 1 58  ? 21.970  -42.582 -3.540  1.00 74.28  ? 272 ARG B CG  1 
ATOM   1979 C CD  . ARG B 1 58  ? 22.991  -42.591 -2.415  1.00 83.94  ? 272 ARG B CD  1 
ATOM   1980 N NE  . ARG B 1 58  ? 22.457  -42.051 -1.169  1.00 88.32  ? 272 ARG B NE  1 
ATOM   1981 C CZ  . ARG B 1 58  ? 21.919  -42.793 -0.207  1.00 89.73  ? 272 ARG B CZ  1 
ATOM   1982 N NH1 . ARG B 1 58  ? 21.458  -42.219 0.897   1.00 91.31  ? 272 ARG B NH1 1 
ATOM   1983 N NH2 . ARG B 1 58  ? 21.837  -44.109 -0.350  1.00 88.39  ? 272 ARG B NH2 1 
ATOM   1984 N N   . GLN B 1 59  ? 22.101  -44.988 -7.525  1.00 67.48  ? 273 GLN B N   1 
ATOM   1985 C CA  . GLN B 1 59  ? 22.748  -45.697 -8.624  1.00 69.32  ? 273 GLN B CA  1 
ATOM   1986 C C   . GLN B 1 59  ? 22.327  -45.169 -9.994  1.00 67.06  ? 273 GLN B C   1 
ATOM   1987 O O   . GLN B 1 59  ? 22.965  -45.478 -11.001 1.00 67.50  ? 273 GLN B O   1 
ATOM   1988 C CB  . GLN B 1 59  ? 22.448  -47.196 -8.536  1.00 70.66  ? 273 GLN B CB  1 
ATOM   1989 C CG  . GLN B 1 59  ? 22.879  -47.841 -7.230  1.00 79.86  ? 273 GLN B CG  1 
ATOM   1990 C CD  . GLN B 1 59  ? 24.376  -47.758 -7.005  1.00 90.14  ? 273 GLN B CD  1 
ATOM   1991 O OE1 . GLN B 1 59  ? 25.159  -48.389 -7.717  1.00 96.39  ? 273 GLN B OE1 1 
ATOM   1992 N NE2 . GLN B 1 59  ? 24.783  -46.974 -6.014  1.00 93.65  ? 273 GLN B NE2 1 
ATOM   1993 N N   . ILE B 1 60  ? 21.257  -44.379 -10.037 1.00 63.81  ? 274 ILE B N   1 
ATOM   1994 C CA  . ILE B 1 60  ? 20.763  -43.857 -11.309 1.00 60.82  ? 274 ILE B CA  1 
ATOM   1995 C C   . ILE B 1 60  ? 20.687  -42.330 -11.343 1.00 61.33  ? 274 ILE B C   1 
ATOM   1996 O O   . ILE B 1 60  ? 20.045  -41.756 -12.222 1.00 61.30  ? 274 ILE B O   1 
ATOM   1997 C CB  . ILE B 1 60  ? 19.370  -44.429 -11.654 1.00 55.46  ? 274 ILE B CB  1 
ATOM   1998 C CG1 . ILE B 1 60  ? 18.324  -43.977 -10.634 1.00 51.47  ? 274 ILE B CG1 1 
ATOM   1999 C CG2 . ILE B 1 60  ? 19.420  -45.947 -11.734 1.00 56.29  ? 274 ILE B CG2 1 
ATOM   2000 C CD1 . ILE B 1 60  ? 16.903  -44.307 -11.046 1.00 48.14  ? 274 ILE B CD1 1 
ATOM   2001 N N   . TYR B 1 61  ? 21.346  -41.677 -10.390 1.00 63.86  ? 275 TYR B N   1 
ATOM   2002 C CA  . TYR B 1 61  ? 21.462  -40.220 -10.403 1.00 67.65  ? 275 TYR B CA  1 
ATOM   2003 C C   . TYR B 1 61  ? 22.148  -39.737 -11.681 1.00 68.85  ? 275 TYR B C   1 
ATOM   2004 O O   . TYR B 1 61  ? 21.830  -38.668 -12.203 1.00 66.15  ? 275 TYR B O   1 
ATOM   2005 C CB  . TYR B 1 61  ? 22.241  -39.726 -9.182  1.00 74.88  ? 275 TYR B CB  1 
ATOM   2006 C CG  . TYR B 1 61  ? 21.431  -39.617 -7.909  1.00 73.43  ? 275 TYR B CG  1 
ATOM   2007 C CD1 . TYR B 1 61  ? 20.048  -39.742 -7.922  1.00 68.48  ? 275 TYR B CD1 1 
ATOM   2008 C CD2 . TYR B 1 61  ? 22.055  -39.374 -6.691  1.00 78.14  ? 275 TYR B CD2 1 
ATOM   2009 C CE1 . TYR B 1 61  ? 19.311  -39.637 -6.755  1.00 67.98  ? 275 TYR B CE1 1 
ATOM   2010 C CE2 . TYR B 1 61  ? 21.328  -39.266 -5.523  1.00 77.90  ? 275 TYR B CE2 1 
ATOM   2011 C CZ  . TYR B 1 61  ? 19.958  -39.398 -5.559  1.00 72.86  ? 275 TYR B CZ  1 
ATOM   2012 O OH  . TYR B 1 61  ? 19.238  -39.290 -4.392  1.00 73.90  ? 275 TYR B OH  1 
ATOM   2013 N N   . ASP B 1 62  ? 23.093  -40.538 -12.169 1.00 73.38  ? 276 ASP B N   1 
ATOM   2014 C CA  . ASP B 1 62  ? 23.837  -40.240 -13.391 1.00 78.08  ? 276 ASP B CA  1 
ATOM   2015 C C   . ASP B 1 62  ? 22.944  -40.028 -14.607 1.00 73.92  ? 276 ASP B C   1 
ATOM   2016 O O   . ASP B 1 62  ? 23.202  -39.153 -15.434 1.00 76.23  ? 276 ASP B O   1 
ATOM   2017 C CB  . ASP B 1 62  ? 24.823  -41.371 -13.695 1.00 85.04  ? 276 ASP B CB  1 
ATOM   2018 C CG  . ASP B 1 62  ? 26.176  -41.157 -13.054 1.00 97.40  ? 276 ASP B CG  1 
ATOM   2019 O OD1 . ASP B 1 62  ? 26.620  -39.993 -12.973 1.00 104.77 ? 276 ASP B OD1 1 
ATOM   2020 O OD2 . ASP B 1 62  ? 26.798  -42.157 -12.638 1.00 101.41 ? 276 ASP B OD2 1 
ATOM   2021 N N   . LYS B 1 63  ? 21.894  -40.838 -14.704 1.00 66.05  ? 277 LYS B N   1 
ATOM   2022 C CA  . LYS B 1 63  ? 21.083  -40.920 -15.913 1.00 62.14  ? 277 LYS B CA  1 
ATOM   2023 C C   . LYS B 1 63  ? 20.075  -39.781 -16.047 1.00 58.39  ? 277 LYS B C   1 
ATOM   2024 O O   . LYS B 1 63  ? 19.368  -39.687 -17.050 1.00 54.16  ? 277 LYS B O   1 
ATOM   2025 C CB  . LYS B 1 63  ? 20.337  -42.258 -15.944 1.00 61.99  ? 277 LYS B CB  1 
ATOM   2026 C CG  . LYS B 1 63  ? 21.101  -43.426 -15.334 1.00 64.46  ? 277 LYS B CG  1 
ATOM   2027 C CD  . LYS B 1 63  ? 21.794  -44.269 -16.391 1.00 66.43  ? 277 LYS B CD  1 
ATOM   2028 C CE  . LYS B 1 63  ? 22.405  -45.519 -15.774 1.00 68.78  ? 277 LYS B CE  1 
ATOM   2029 N NZ  . LYS B 1 63  ? 23.082  -46.380 -16.786 1.00 69.29  ? 277 LYS B NZ  1 
ATOM   2030 N N   . PHE B 1 64  ? 20.007  -38.920 -15.038 1.00 60.00  ? 278 PHE B N   1 
ATOM   2031 C CA  . PHE B 1 64  ? 18.966  -37.901 -14.985 1.00 60.19  ? 278 PHE B CA  1 
ATOM   2032 C C   . PHE B 1 64  ? 19.519  -36.556 -14.506 1.00 68.72  ? 278 PHE B C   1 
ATOM   2033 O O   . PHE B 1 64  ? 20.544  -36.516 -13.828 1.00 73.79  ? 278 PHE B O   1 
ATOM   2034 C CB  . PHE B 1 64  ? 17.823  -38.388 -14.084 1.00 54.43  ? 278 PHE B CB  1 
ATOM   2035 C CG  . PHE B 1 64  ? 17.164  -39.644 -14.584 1.00 50.15  ? 278 PHE B CG  1 
ATOM   2036 C CD1 . PHE B 1 64  ? 16.224  -39.586 -15.600 1.00 45.59  ? 278 PHE B CD1 1 
ATOM   2037 C CD2 . PHE B 1 64  ? 17.501  -40.882 -14.057 1.00 50.85  ? 278 PHE B CD2 1 
ATOM   2038 C CE1 . PHE B 1 64  ? 15.620  -40.738 -16.074 1.00 43.95  ? 278 PHE B CE1 1 
ATOM   2039 C CE2 . PHE B 1 64  ? 16.902  -42.038 -14.528 1.00 48.13  ? 278 PHE B CE2 1 
ATOM   2040 C CZ  . PHE B 1 64  ? 15.959  -41.963 -15.540 1.00 45.65  ? 278 PHE B CZ  1 
ATOM   2041 N N   . PRO B 1 65  ? 18.854  -35.472 -14.789 1.00 71.52  ? 279 PRO B N   1 
ATOM   2042 C CA  . PRO B 1 65  ? 19.333  -34.130 -14.460 1.00 78.59  ? 279 PRO B CA  1 
ATOM   2043 C C   . PRO B 1 65  ? 19.489  -33.791 -12.987 1.00 81.49  ? 279 PRO B C   1 
ATOM   2044 O O   . PRO B 1 65  ? 19.047  -34.565 -12.145 1.00 77.74  ? 279 PRO B O   1 
ATOM   2045 C CB  . PRO B 1 65  ? 18.242  -33.228 -15.025 1.00 77.39  ? 279 PRO B CB  1 
ATOM   2046 C CG  . PRO B 1 65  ? 17.482  -34.050 -15.977 1.00 71.70  ? 279 PRO B CG  1 
ATOM   2047 C CD  . PRO B 1 65  ? 17.568  -35.452 -15.477 1.00 67.97  ? 279 PRO B CD  1 
ATOM   2048 N N   . GLU B 1 66  ? 20.135  -32.656 -12.727 1.00 87.25  ? 280 GLU B N   1 
ATOM   2049 C CA  . GLU B 1 66  ? 20.379  -32.136 -11.390 1.00 88.53  ? 280 GLU B CA  1 
ATOM   2050 C C   . GLU B 1 66  ? 19.242  -31.183 -11.073 1.00 88.65  ? 280 GLU B C   1 
ATOM   2051 O O   . GLU B 1 66  ? 18.726  -30.509 -11.964 1.00 88.18  ? 280 GLU B O   1 
ATOM   2052 C CB  . GLU B 1 66  ? 21.720  -31.405 -11.330 1.00 95.13  ? 280 GLU B CB  1 
ATOM   2053 C CG  . GLU B 1 66  ? 22.918  -32.276 -11.671 1.00 96.37  ? 280 GLU B CG  1 
ATOM   2054 C CD  . GLU B 1 66  ? 22.836  -32.858 -13.068 1.00 98.57  ? 280 GLU B CD  1 
ATOM   2055 O OE1 . GLU B 1 66  ? 21.836  -32.592 -13.767 1.00 97.46  ? 280 GLU B OE1 1 
ATOM   2056 O OE2 . GLU B 1 66  ? 23.773  -33.582 -13.468 1.00 101.52 ? 280 GLU B OE2 1 
ATOM   2057 N N   . LYS B 1 67  ? 18.836  -31.131 -9.811  1.00 90.45  ? 281 LYS B N   1 
ATOM   2058 C CA  . LYS B 1 67  ? 17.721  -30.278 -9.431  1.00 92.46  ? 281 LYS B CA  1 
ATOM   2059 C C   . LYS B 1 67  ? 18.052  -28.878 -9.927  1.00 89.64  ? 281 LYS B C   1 
ATOM   2060 O O   . LYS B 1 67  ? 19.223  -28.503 -9.981  1.00 83.05  ? 281 LYS B O   1 
ATOM   2061 C CB  . LYS B 1 67  ? 17.533  -30.277 -7.915  1.00 95.67  ? 281 LYS B CB  1 
ATOM   2062 N N   . LYS B 1 68  ? 17.040  -28.106 -10.313 1.00 95.03  ? 282 LYS B N   1 
ATOM   2063 C CA  . LYS B 1 68  ? 15.635  -28.510 -10.251 1.00 92.17  ? 282 LYS B CA  1 
ATOM   2064 C C   . LYS B 1 68  ? 15.135  -29.528 -11.285 1.00 86.75  ? 282 LYS B C   1 
ATOM   2065 O O   . LYS B 1 68  ? 15.669  -29.652 -12.387 1.00 86.80  ? 282 LYS B O   1 
ATOM   2066 C CB  . LYS B 1 68  ? 14.734  -27.270 -10.281 1.00 96.69  ? 282 LYS B CB  1 
ATOM   2067 N N   . GLY B 1 69  ? 14.086  -30.239 -10.883 1.00 82.27  ? 283 GLY B N   1 
ATOM   2068 C CA  . GLY B 1 69  ? 13.389  -31.233 -11.670 1.00 77.48  ? 283 GLY B CA  1 
ATOM   2069 C C   . GLY B 1 69  ? 14.222  -32.492 -11.748 1.00 74.25  ? 283 GLY B C   1 
ATOM   2070 O O   . GLY B 1 69  ? 13.902  -33.410 -12.479 1.00 70.26  ? 283 GLY B O   1 
ATOM   2071 N N   . GLY B 1 70  ? 15.300  -32.506 -10.984 1.00 75.81  ? 284 GLY B N   1 
ATOM   2072 C CA  . GLY B 1 70  ? 16.258  -33.588 -10.888 1.00 71.57  ? 284 GLY B CA  1 
ATOM   2073 C C   . GLY B 1 70  ? 15.802  -34.680 -9.964  1.00 62.94  ? 284 GLY B C   1 
ATOM   2074 O O   . GLY B 1 70  ? 15.095  -34.429 -9.035  1.00 58.74  ? 284 GLY B O   1 
ATOM   2075 N N   . LEU B 1 71  ? 16.240  -35.891 -10.209 1.00 58.43  ? 285 LEU B N   1 
ATOM   2076 C CA  . LEU B 1 71  ? 15.849  -37.005 -9.420  1.00 51.48  ? 285 LEU B CA  1 
ATOM   2077 C C   . LEU B 1 71  ? 16.209  -36.888 -7.948  1.00 53.45  ? 285 LEU B C   1 
ATOM   2078 O O   . LEU B 1 71  ? 15.424  -37.253 -7.119  1.00 47.49  ? 285 LEU B O   1 
ATOM   2079 C CB  . LEU B 1 71  ? 16.471  -38.245 -10.024 1.00 49.65  ? 285 LEU B CB  1 
ATOM   2080 C CG  . LEU B 1 71  ? 15.973  -39.601 -9.616  1.00 46.14  ? 285 LEU B CG  1 
ATOM   2081 C CD1 . LEU B 1 71  ? 14.472  -39.652 -9.676  1.00 43.00  ? 285 LEU B CD1 1 
ATOM   2082 C CD2 . LEU B 1 71  ? 16.572  -40.637 -10.522 1.00 45.95  ? 285 LEU B CD2 1 
ATOM   2083 N N   . ARG B 1 72  ? 17.387  -36.384 -7.613  1.00 53.66  ? 286 ARG B N   1 
ATOM   2084 C CA  . ARG B 1 72  ? 17.770  -36.260 -6.212  1.00 58.22  ? 286 ARG B CA  1 
ATOM   2085 C C   . ARG B 1 72  ? 16.858  -35.338 -5.449  1.00 56.83  ? 286 ARG B C   1 
ATOM   2086 O O   . ARG B 1 72  ? 16.448  -35.632 -4.352  1.00 56.50  ? 286 ARG B O   1 
ATOM   2087 C CB  . ARG B 1 72  ? 19.191  -35.702 -6.101  1.00 65.32  ? 286 ARG B CB  1 
ATOM   2088 C CG  . ARG B 1 72  ? 19.810  -35.811 -4.715  1.00 69.82  ? 286 ARG B CG  1 
ATOM   2089 C CD  . ARG B 1 72  ? 21.132  -35.055 -4.576  1.00 78.84  ? 286 ARG B CD  1 
ATOM   2090 N NE  . ARG B 1 72  ? 22.052  -35.752 -3.686  1.00 84.25  ? 286 ARG B NE  1 
ATOM   2091 C CZ  . ARG B 1 72  ? 23.045  -35.179 -3.018  1.00 93.29  ? 286 ARG B CZ  1 
ATOM   2092 N NH1 . ARG B 1 72  ? 23.239  -33.880 -3.094  1.00 98.74  ? 286 ARG B NH1 1 
ATOM   2093 N NH2 . ARG B 1 72  ? 23.823  -35.901 -2.233  1.00 96.90  ? 286 ARG B NH2 1 
ATOM   2094 N N   . GLU B 1 73  ? 16.564  -34.210 -6.048  1.00 62.79  ? 287 GLU B N   1 
ATOM   2095 C CA  . GLU B 1 73  ? 15.699  -33.230 -5.436  1.00 64.48  ? 287 GLU B CA  1 
ATOM   2096 C C   . GLU B 1 73  ? 14.293  -33.733 -5.331  1.00 59.28  ? 287 GLU B C   1 
ATOM   2097 O O   . GLU B 1 73  ? 13.686  -33.641 -4.301  1.00 60.32  ? 287 GLU B O   1 
ATOM   2098 C CB  . GLU B 1 73  ? 15.715  -31.965 -6.270  1.00 71.62  ? 287 GLU B CB  1 
ATOM   2099 C CG  . GLU B 1 73  ? 14.590  -30.987 -6.002  1.00 79.89  ? 287 GLU B CG  1 
ATOM   2100 C CD  . GLU B 1 73  ? 14.746  -29.704 -6.771  1.00 87.15  ? 287 GLU B CD  1 
ATOM   2101 O OE1 . GLU B 1 73  ? 15.732  -29.564 -7.498  1.00 88.58  ? 287 GLU B OE1 1 
ATOM   2102 O OE2 . GLU B 1 73  ? 13.885  -28.833 -6.664  1.00 91.04  ? 287 GLU B OE2 1 
ATOM   2103 N N   . LEU B 1 74  ? 13.794  -34.284 -6.420  1.00 51.10  ? 288 LEU B N   1 
ATOM   2104 C CA  . LEU B 1 74  ? 12.450  -34.856 -6.420  1.00 50.03  ? 288 LEU B CA  1 
ATOM   2105 C C   . LEU B 1 74  ? 12.292  -35.890 -5.313  1.00 48.58  ? 288 LEU B C   1 
ATOM   2106 O O   . LEU B 1 74  ? 11.280  -35.913 -4.614  1.00 50.74  ? 288 LEU B O   1 
ATOM   2107 C CB  . LEU B 1 74  ? 12.137  -35.491 -7.776  1.00 45.53  ? 288 LEU B CB  1 
ATOM   2108 C CG  . LEU B 1 74  ? 11.795  -34.547 -8.930  1.00 47.61  ? 288 LEU B CG  1 
ATOM   2109 C CD1 . LEU B 1 74  ? 11.788  -35.296 -10.253 1.00 42.47  ? 288 LEU B CD1 1 
ATOM   2110 C CD2 . LEU B 1 74  ? 10.452  -33.875 -8.686  1.00 46.20  ? 288 LEU B CD2 1 
ATOM   2111 N N   . TYR B 1 75  ? 13.303  -36.737 -5.153  1.00 49.58  ? 289 TYR B N   1 
ATOM   2112 C CA  . TYR B 1 75  ? 13.269  -37.780 -4.139  1.00 48.06  ? 289 TYR B CA  1 
ATOM   2113 C C   . TYR B 1 75  ? 13.329  -37.180 -2.738  1.00 50.77  ? 289 TYR B C   1 
ATOM   2114 O O   . TYR B 1 75  ? 12.684  -37.679 -1.815  1.00 48.60  ? 289 TYR B O   1 
ATOM   2115 C CB  . TYR B 1 75  ? 14.417  -38.769 -4.347  1.00 50.69  ? 289 TYR B CB  1 
ATOM   2116 C CG  . TYR B 1 75  ? 14.163  -40.120 -3.722  1.00 49.84  ? 289 TYR B CG  1 
ATOM   2117 C CD1 . TYR B 1 75  ? 13.640  -41.164 -4.472  1.00 45.28  ? 289 TYR B CD1 1 
ATOM   2118 C CD2 . TYR B 1 75  ? 14.437  -40.350 -2.380  1.00 53.19  ? 289 TYR B CD2 1 
ATOM   2119 C CE1 . TYR B 1 75  ? 13.403  -42.401 -3.905  1.00 44.36  ? 289 TYR B CE1 1 
ATOM   2120 C CE2 . TYR B 1 75  ? 14.202  -41.581 -1.804  1.00 51.47  ? 289 TYR B CE2 1 
ATOM   2121 C CZ  . TYR B 1 75  ? 13.686  -42.603 -2.571  1.00 46.88  ? 289 TYR B CZ  1 
ATOM   2122 O OH  . TYR B 1 75  ? 13.452  -43.830 -1.998  1.00 48.09  ? 289 TYR B OH  1 
ATOM   2123 N N   . ASP B 1 76  ? 14.103  -36.108 -2.587  1.00 55.13  ? 290 ASP B N   1 
ATOM   2124 C CA  . ASP B 1 76  ? 14.199  -35.403 -1.313  1.00 59.86  ? 290 ASP B CA  1 
ATOM   2125 C C   . ASP B 1 76  ? 12.853  -34.809 -0.911  1.00 57.32  ? 290 ASP B C   1 
ATOM   2126 O O   . ASP B 1 76  ? 12.484  -34.831 0.262   1.00 57.73  ? 290 ASP B O   1 
ATOM   2127 C CB  . ASP B 1 76  ? 15.256  -34.294 -1.379  1.00 67.97  ? 290 ASP B CB  1 
ATOM   2128 C CG  . ASP B 1 76  ? 16.675  -34.830 -1.313  1.00 73.90  ? 290 ASP B CG  1 
ATOM   2129 O OD1 . ASP B 1 76  ? 16.856  -36.000 -0.917  1.00 74.12  ? 290 ASP B OD1 1 
ATOM   2130 O OD2 . ASP B 1 76  ? 17.611  -34.073 -1.647  1.00 78.38  ? 290 ASP B OD2 1 
ATOM   2131 N N   . ARG B 1 77  ? 12.127  -34.279 -1.889  1.00 57.89  ? 291 ARG B N   1 
ATOM   2132 C CA  . ARG B 1 77  ? 10.804  -33.715 -1.641  1.00 60.40  ? 291 ARG B CA  1 
ATOM   2133 C C   . ARG B 1 77  ? 9.800   -34.810 -1.285  1.00 58.43  ? 291 ARG B C   1 
ATOM   2134 O O   . ARG B 1 77  ? 8.836   -34.567 -0.558  1.00 60.99  ? 291 ARG B O   1 
ATOM   2135 C CB  . ARG B 1 77  ? 10.318  -32.928 -2.860  1.00 61.17  ? 291 ARG B CB  1 
ATOM   2136 N N   . GLY B 1 78  ? 10.033  -36.013 -1.801  1.00 53.73  ? 292 GLY B N   1 
ATOM   2137 C CA  . GLY B 1 78  ? 9.187   -37.156 -1.501  1.00 49.70  ? 292 GLY B CA  1 
ATOM   2138 C C   . GLY B 1 78  ? 7.838   -37.103 -2.193  1.00 47.64  ? 292 GLY B C   1 
ATOM   2139 O O   . GLY B 1 78  ? 7.569   -36.176 -2.958  1.00 48.40  ? 292 GLY B O   1 
ATOM   2140 N N   . PRO B 1 79  ? 6.977   -38.099 -1.931  1.00 46.85  ? 293 PRO B N   1 
ATOM   2141 C CA  . PRO B 1 79  ? 7.239   -39.249 -1.057  1.00 45.62  ? 293 PRO B CA  1 
ATOM   2142 C C   . PRO B 1 79  ? 8.000   -40.370 -1.765  1.00 42.86  ? 293 PRO B C   1 
ATOM   2143 O O   . PRO B 1 79  ? 7.739   -40.634 -2.938  1.00 42.21  ? 293 PRO B O   1 
ATOM   2144 C CB  . PRO B 1 79  ? 5.834   -39.709 -0.667  1.00 47.52  ? 293 PRO B CB  1 
ATOM   2145 C CG  . PRO B 1 79  ? 4.999   -39.352 -1.845  1.00 46.12  ? 293 PRO B CG  1 
ATOM   2146 C CD  . PRO B 1 79  ? 5.580   -38.079 -2.406  1.00 46.22  ? 293 PRO B CD  1 
ATOM   2147 N N   . PRO B 1 80  ? 8.929   -41.026 -1.051  1.00 40.69  ? 294 PRO B N   1 
ATOM   2148 C CA  . PRO B 1 80  ? 9.808   -42.072 -1.590  1.00 40.88  ? 294 PRO B CA  1 
ATOM   2149 C C   . PRO B 1 80  ? 9.054   -43.253 -2.195  1.00 40.54  ? 294 PRO B C   1 
ATOM   2150 O O   . PRO B 1 80  ? 9.509   -43.819 -3.187  1.00 39.30  ? 294 PRO B O   1 
ATOM   2151 C CB  . PRO B 1 80  ? 10.608  -42.524 -0.364  1.00 43.07  ? 294 PRO B CB  1 
ATOM   2152 C CG  . PRO B 1 80  ? 10.551  -41.376 0.571   1.00 45.43  ? 294 PRO B CG  1 
ATOM   2153 C CD  . PRO B 1 80  ? 9.201   -40.767 0.371   1.00 42.95  ? 294 PRO B CD  1 
ATOM   2154 N N   . HIS B 1 81  ? 7.916   -43.615 -1.612  1.00 42.86  ? 295 HIS B N   1 
ATOM   2155 C CA  . HIS B 1 81  ? 7.172   -44.782 -2.080  1.00 41.84  ? 295 HIS B CA  1 
ATOM   2156 C C   . HIS B 1 81  ? 6.508   -44.529 -3.433  1.00 38.61  ? 295 HIS B C   1 
ATOM   2157 O O   . HIS B 1 81  ? 5.954   -45.444 -4.038  1.00 37.76  ? 295 HIS B O   1 
ATOM   2158 C CB  . HIS B 1 81  ? 6.124   -45.203 -1.046  1.00 45.95  ? 295 HIS B CB  1 
ATOM   2159 C CG  . HIS B 1 81  ? 4.963   -44.264 -0.938  1.00 48.09  ? 295 HIS B CG  1 
ATOM   2160 N ND1 . HIS B 1 81  ? 4.976   -43.153 -0.123  1.00 48.66  ? 295 HIS B ND1 1 
ATOM   2161 C CD2 . HIS B 1 81  ? 3.746   -44.278 -1.534  1.00 49.48  ? 295 HIS B CD2 1 
ATOM   2162 C CE1 . HIS B 1 81  ? 3.821   -42.519 -0.226  1.00 49.79  ? 295 HIS B CE1 1 
ATOM   2163 N NE2 . HIS B 1 81  ? 3.057   -43.181 -1.077  1.00 49.63  ? 295 HIS B NE2 1 
ATOM   2164 N N   . ALA B 1 82  ? 6.580   -43.290 -3.912  1.00 37.70  ? 296 ALA B N   1 
ATOM   2165 C CA  . ALA B 1 82  ? 5.979   -42.922 -5.190  1.00 32.94  ? 296 ALA B CA  1 
ATOM   2166 C C   . ALA B 1 82  ? 6.970   -43.027 -6.345  1.00 31.88  ? 296 ALA B C   1 
ATOM   2167 O O   . ALA B 1 82  ? 6.630   -42.727 -7.489  1.00 32.77  ? 296 ALA B O   1 
ATOM   2168 C CB  . ALA B 1 82  ? 5.411   -41.511 -5.116  1.00 34.62  ? 296 ALA B CB  1 
ATOM   2169 N N   . PHE B 1 83  ? 8.194   -43.458 -6.047  1.00 29.54  ? 297 PHE B N   1 
ATOM   2170 C CA  . PHE B 1 83  ? 9.252   -43.514 -7.053  1.00 31.63  ? 297 PHE B CA  1 
ATOM   2171 C C   . PHE B 1 83  ? 9.483   -44.923 -7.582  1.00 31.66  ? 297 PHE B C   1 
ATOM   2172 O O   . PHE B 1 83  ? 9.593   -45.876 -6.813  1.00 35.20  ? 297 PHE B O   1 
ATOM   2173 C CB  . PHE B 1 83  ? 10.561  -42.962 -6.479  1.00 31.10  ? 297 PHE B CB  1 
ATOM   2174 C CG  . PHE B 1 83  ? 10.565  -41.473 -6.317  1.00 32.71  ? 297 PHE B CG  1 
ATOM   2175 C CD1 . PHE B 1 83  ? 11.220  -40.668 -7.232  1.00 31.55  ? 297 PHE B CD1 1 
ATOM   2176 C CD2 . PHE B 1 83  ? 9.902   -40.876 -5.256  1.00 36.02  ? 297 PHE B CD2 1 
ATOM   2177 C CE1 . PHE B 1 83  ? 11.223  -39.296 -7.090  1.00 36.45  ? 297 PHE B CE1 1 
ATOM   2178 C CE2 . PHE B 1 83  ? 9.902   -39.504 -5.107  1.00 38.63  ? 297 PHE B CE2 1 
ATOM   2179 C CZ  . PHE B 1 83  ? 10.559  -38.713 -6.027  1.00 39.13  ? 297 PHE B CZ  1 
ATOM   2180 N N   . PHE B 1 84  ? 9.574   -45.044 -8.903  1.00 28.72  ? 298 PHE B N   1 
ATOM   2181 C CA  . PHE B 1 84  ? 9.747   -46.346 -9.532  1.00 30.56  ? 298 PHE B CA  1 
ATOM   2182 C C   . PHE B 1 84  ? 10.772  -46.309 -10.656 1.00 32.66  ? 298 PHE B C   1 
ATOM   2183 O O   . PHE B 1 84  ? 10.939  -45.294 -11.330 1.00 31.49  ? 298 PHE B O   1 
ATOM   2184 C CB  . PHE B 1 84  ? 8.410   -46.859 -10.070 1.00 29.11  ? 298 PHE B CB  1 
ATOM   2185 C CG  . PHE B 1 84  ? 7.401   -47.144 -8.998  1.00 29.94  ? 298 PHE B CG  1 
ATOM   2186 C CD1 . PHE B 1 84  ? 7.321   -48.400 -8.425  1.00 30.56  ? 298 PHE B CD1 1 
ATOM   2187 C CD2 . PHE B 1 84  ? 6.541   -46.152 -8.555  1.00 27.75  ? 298 PHE B CD2 1 
ATOM   2188 C CE1 . PHE B 1 84  ? 6.400   -48.666 -7.432  1.00 34.44  ? 298 PHE B CE1 1 
ATOM   2189 C CE2 . PHE B 1 84  ? 5.619   -46.411 -7.562  1.00 28.69  ? 298 PHE B CE2 1 
ATOM   2190 C CZ  . PHE B 1 84  ? 5.547   -47.670 -7.000  1.00 32.15  ? 298 PHE B CZ  1 
ATOM   2191 N N   . LEU B 1 85  ? 11.408  -47.437 -10.904 1.00 32.81  ? 299 LEU B N   1 
ATOM   2192 C CA  . LEU B 1 85  ? 12.311  -47.577 -12.001 1.00 31.92  ? 299 LEU B CA  1 
ATOM   2193 C C   . LEU B 1 85  ? 11.805  -48.668 -12.872 1.00 29.73  ? 299 LEU B C   1 
ATOM   2194 O O   . LEU B 1 85  ? 11.483  -49.714 -12.404 1.00 32.08  ? 299 LEU B O   1 
ATOM   2195 C CB  . LEU B 1 85  ? 13.699  -47.911 -11.549 1.00 33.50  ? 299 LEU B CB  1 
ATOM   2196 C CG  . LEU B 1 85  ? 14.639  -48.394 -12.638 1.00 34.34  ? 299 LEU B CG  1 
ATOM   2197 C CD1 . LEU B 1 85  ? 15.021  -47.278 -13.547 1.00 29.68  ? 299 LEU B CD1 1 
ATOM   2198 C CD2 . LEU B 1 85  ? 15.884  -48.962 -12.009 1.00 36.40  ? 299 LEU B CD2 1 
ATOM   2199 N N   . VAL B 1 86  ? 11.740  -48.399 -14.153 1.00 28.04  ? 300 VAL B N   1 
ATOM   2200 C CA  . VAL B 1 86  ? 11.298  -49.337 -15.137 1.00 30.49  ? 300 VAL B CA  1 
ATOM   2201 C C   . VAL B 1 86  ? 12.341  -49.577 -16.217 1.00 31.10  ? 300 VAL B C   1 
ATOM   2202 O O   . VAL B 1 86  ? 12.784  -48.676 -16.876 1.00 28.51  ? 300 VAL B O   1 
ATOM   2203 C CB  . VAL B 1 86  ? 9.999   -48.872 -15.805 1.00 34.64  ? 300 VAL B CB  1 
ATOM   2204 C CG1 . VAL B 1 86  ? 9.590   -49.794 -16.921 1.00 37.67  ? 300 VAL B CG1 1 
ATOM   2205 C CG2 . VAL B 1 86  ? 8.896   -48.739 -14.796 1.00 33.36  ? 300 VAL B CG2 1 
ATOM   2206 N N   . LYS B 1 87  ? 12.709  -50.827 -16.376 1.00 29.04  ? 301 LYS B N   1 
ATOM   2207 C CA  . LYS B 1 87  ? 13.615  -51.206 -17.394 1.00 28.58  ? 301 LYS B CA  1 
ATOM   2208 C C   . LYS B 1 87  ? 12.805  -51.811 -18.524 1.00 28.18  ? 301 LYS B C   1 
ATOM   2209 O O   . LYS B 1 87  ? 12.007  -52.672 -18.332 1.00 29.17  ? 301 LYS B O   1 
ATOM   2210 C CB  . LYS B 1 87  ? 14.644  -52.184 -16.888 1.00 35.36  ? 301 LYS B CB  1 
ATOM   2211 C CG  . LYS B 1 87  ? 15.726  -52.410 -17.897 1.00 44.53  ? 301 LYS B CG  1 
ATOM   2212 C CD  . LYS B 1 87  ? 16.814  -53.281 -17.345 1.00 53.74  ? 301 LYS B CD  1 
ATOM   2213 C CE  . LYS B 1 87  ? 18.026  -53.230 -18.223 1.00 61.02  ? 301 LYS B CE  1 
ATOM   2214 N NZ  . LYS B 1 87  ? 17.686  -53.622 -19.598 1.00 66.07  ? 301 LYS B NZ  1 
ATOM   2215 N N   . PHE B 1 88  ? 13.041  -51.334 -19.710 1.00 29.44  ? 302 PHE B N   1 
ATOM   2216 C CA  . PHE B 1 88  ? 12.353  -51.792 -20.867 1.00 28.80  ? 302 PHE B CA  1 
ATOM   2217 C C   . PHE B 1 88  ? 13.271  -52.503 -21.862 1.00 30.14  ? 302 PHE B C   1 
ATOM   2218 O O   . PHE B 1 88  ? 14.392  -52.125 -22.025 1.00 29.72  ? 302 PHE B O   1 
ATOM   2219 C CB  . PHE B 1 88  ? 11.754  -50.596 -21.589 1.00 25.18  ? 302 PHE B CB  1 
ATOM   2220 C CG  . PHE B 1 88  ? 10.425  -50.145 -21.069 1.00 29.74  ? 302 PHE B CG  1 
ATOM   2221 C CD1 . PHE B 1 88  ? 9.403   -51.036 -20.856 1.00 29.59  ? 302 PHE B CD1 1 
ATOM   2222 C CD2 . PHE B 1 88  ? 10.189  -48.813 -20.846 1.00 29.93  ? 302 PHE B CD2 1 
ATOM   2223 C CE1 . PHE B 1 88  ? 8.184   -50.607 -20.412 1.00 31.06  ? 302 PHE B CE1 1 
ATOM   2224 C CE2 . PHE B 1 88  ? 8.975   -48.382 -20.403 1.00 30.72  ? 302 PHE B CE2 1 
ATOM   2225 C CZ  . PHE B 1 88  ? 7.972   -49.274 -20.180 1.00 29.11  ? 302 PHE B CZ  1 
ATOM   2226 N N   . TRP B 1 89  ? 12.750  -53.514 -22.537 1.00 30.07  ? 303 TRP B N   1 
ATOM   2227 C CA  . TRP B 1 89  ? 13.446  -54.203 -23.586 1.00 29.07  ? 303 TRP B CA  1 
ATOM   2228 C C   . TRP B 1 89  ? 12.518  -53.845 -24.713 1.00 30.93  ? 303 TRP B C   1 
ATOM   2229 O O   . TRP B 1 89  ? 11.487  -54.427 -24.873 1.00 32.55  ? 303 TRP B O   1 
ATOM   2230 C CB  . TRP B 1 89  ? 13.567  -55.700 -23.346 1.00 29.35  ? 303 TRP B CB  1 
ATOM   2231 C CG  . TRP B 1 89  ? 14.635  -56.023 -22.434 1.00 31.16  ? 303 TRP B CG  1 
ATOM   2232 C CD1 . TRP B 1 89  ? 15.912  -56.237 -22.736 1.00 33.38  ? 303 TRP B CD1 1 
ATOM   2233 C CD2 . TRP B 1 89  ? 14.537  -56.114 -21.037 1.00 35.14  ? 303 TRP B CD2 1 
ATOM   2234 N NE1 . TRP B 1 89  ? 16.624  -56.469 -21.626 1.00 35.46  ? 303 TRP B NE1 1 
ATOM   2235 C CE2 . TRP B 1 89  ? 15.798  -56.402 -20.555 1.00 36.65  ? 303 TRP B CE2 1 
ATOM   2236 C CE3 . TRP B 1 89  ? 13.497  -55.993 -20.139 1.00 36.24  ? 303 TRP B CE3 1 
ATOM   2237 C CZ2 . TRP B 1 89  ? 16.052  -56.553 -19.228 1.00 38.27  ? 303 TRP B CZ2 1 
ATOM   2238 C CZ3 . TRP B 1 89  ? 13.755  -56.142 -18.832 1.00 36.66  ? 303 TRP B CZ3 1 
ATOM   2239 C CH2 . TRP B 1 89  ? 15.015  -56.409 -18.382 1.00 37.45  ? 303 TRP B CH2 1 
ATOM   2240 N N   . ALA B 1 90  ? 12.884  -52.850 -25.478 1.00 27.09  ? 304 ALA B N   1 
ATOM   2241 C CA  . ALA B 1 90  ? 12.018  -52.315 -26.518 1.00 29.94  ? 304 ALA B CA  1 
ATOM   2242 C C   . ALA B 1 90  ? 12.082  -53.141 -27.793 1.00 33.64  ? 304 ALA B C   1 
ATOM   2243 O O   . ALA B 1 90  ? 13.143  -53.627 -28.184 1.00 34.97  ? 304 ALA B O   1 
ATOM   2244 C CB  . ALA B 1 90  ? 12.382  -50.869 -26.809 1.00 31.08  ? 304 ALA B CB  1 
ATOM   2245 N N   . ASP B 1 91  ? 10.957  -53.279 -28.454 1.00 30.32  ? 305 ASP B N   1 
ATOM   2246 C CA  . ASP B 1 91  ? 10.890  -54.005 -29.691 1.00 35.58  ? 305 ASP B CA  1 
ATOM   2247 C C   . ASP B 1 91  ? 11.001  -53.043 -30.836 1.00 37.78  ? 305 ASP B C   1 
ATOM   2248 O O   . ASP B 1 91  ? 10.076  -52.347 -31.157 1.00 33.57  ? 305 ASP B O   1 
ATOM   2249 C CB  . ASP B 1 91  ? 9.591   -54.776 -29.763 1.00 35.53  ? 305 ASP B CB  1 
ATOM   2250 C CG  . ASP B 1 91  ? 9.465   -55.587 -30.989 1.00 41.13  ? 305 ASP B CG  1 
ATOM   2251 O OD1 . ASP B 1 91  ? 10.334  -55.539 -31.847 1.00 43.09  ? 305 ASP B OD1 1 
ATOM   2252 O OD2 . ASP B 1 91  ? 8.463   -56.274 -31.119 1.00 42.32  ? 305 ASP B OD2 1 
ATOM   2253 N N   . LEU B 1 92  ? 12.164  -53.023 -31.456 1.00 35.19  ? 306 LEU B N   1 
ATOM   2254 C CA  . LEU B 1 92  ? 12.450  -52.136 -32.560 1.00 42.20  ? 306 LEU B CA  1 
ATOM   2255 C C   . LEU B 1 92  ? 12.330  -52.776 -33.918 1.00 47.43  ? 306 LEU B C   1 
ATOM   2256 O O   . LEU B 1 92  ? 12.782  -52.248 -34.898 1.00 48.31  ? 306 LEU B O   1 
ATOM   2257 C CB  . LEU B 1 92  ? 13.840  -51.550 -32.414 1.00 42.23  ? 306 LEU B CB  1 
ATOM   2258 C CG  . LEU B 1 92  ? 14.061  -50.743 -31.166 1.00 42.90  ? 306 LEU B CG  1 
ATOM   2259 C CD1 . LEU B 1 92  ? 15.380  -50.026 -31.204 1.00 44.54  ? 306 LEU B CD1 1 
ATOM   2260 C CD2 . LEU B 1 92  ? 12.958  -49.740 -31.060 1.00 45.02  ? 306 LEU B CD2 1 
ATOM   2261 N N   . ASN B 1 93  ? 11.694  -53.916 -33.962 1.00 51.11  ? 307 ASN B N   1 
ATOM   2262 C CA  . ASN B 1 93  ? 11.494  -54.605 -35.199 1.00 55.26  ? 307 ASN B CA  1 
ATOM   2263 C C   . ASN B 1 93  ? 10.173  -54.322 -35.849 1.00 55.66  ? 307 ASN B C   1 
ATOM   2264 O O   . ASN B 1 93  ? 9.208   -54.966 -35.557 1.00 54.85  ? 307 ASN B O   1 
ATOM   2265 C CB  . ASN B 1 93  ? 11.591  -56.087 -34.965 1.00 58.02  ? 307 ASN B CB  1 
ATOM   2266 C CG  . ASN B 1 93  ? 11.672  -56.863 -36.242 1.00 64.80  ? 307 ASN B CG  1 
ATOM   2267 O OD1 . ASN B 1 93  ? 11.791  -56.305 -37.324 1.00 68.46  ? 307 ASN B OD1 1 
ATOM   2268 N ND2 . ASN B 1 93  ? 11.600  -58.162 -36.121 1.00 67.14  ? 307 ASN B ND2 1 
ATOM   2269 N N   . TRP B 1 94  ? 10.144  -53.373 -36.757 1.00 57.06  ? 308 TRP B N   1 
ATOM   2270 C CA  . TRP B 1 94  ? 8.933   -53.058 -37.449 1.00 62.22  ? 308 TRP B CA  1 
ATOM   2271 C C   . TRP B 1 94  ? 9.217   -52.558 -38.871 1.00 67.63  ? 308 TRP B C   1 
ATOM   2272 O O   . TRP B 1 94  ? 8.303   -52.444 -39.678 1.00 71.07  ? 308 TRP B O   1 
ATOM   2273 C CB  . TRP B 1 94  ? 8.064   -52.087 -36.635 1.00 59.12  ? 308 TRP B CB  1 
ATOM   2274 C CG  . TRP B 1 94  ? 8.410   -50.644 -36.759 1.00 58.21  ? 308 TRP B CG  1 
ATOM   2275 C CD1 . TRP B 1 94  ? 7.770   -49.725 -37.491 1.00 56.72  ? 308 TRP B CD1 1 
ATOM   2276 C CD2 . TRP B 1 94  ? 9.470   -49.964 -36.107 1.00 57.74  ? 308 TRP B CD2 1 
ATOM   2277 N NE1 . TRP B 1 94  ? 8.363   -48.519 -37.366 1.00 56.31  ? 308 TRP B NE1 1 
ATOM   2278 C CE2 . TRP B 1 94  ? 9.422   -48.640 -36.518 1.00 56.35  ? 308 TRP B CE2 1 
ATOM   2279 C CE3 . TRP B 1 94  ? 10.472  -50.354 -35.228 1.00 57.02  ? 308 TRP B CE3 1 
ATOM   2280 C CZ2 . TRP B 1 94  ? 10.313  -47.701 -36.071 1.00 54.53  ? 308 TRP B CZ2 1 
ATOM   2281 C CZ3 . TRP B 1 94  ? 11.358  -49.413 -34.789 1.00 54.68  ? 308 TRP B CZ3 1 
ATOM   2282 C CH2 . TRP B 1 94  ? 11.276  -48.108 -35.207 1.00 53.32  ? 308 TRP B CH2 1 
ATOM   2283 N N   . GLY B 1 111 ? 3.860   -43.371 -40.741 1.00 59.83  ? 325 GLY B N   1 
ATOM   2284 C CA  . GLY B 1 111 ? 2.840   -43.868 -39.834 1.00 57.50  ? 325 GLY B CA  1 
ATOM   2285 C C   . GLY B 1 111 ? 2.643   -42.977 -38.623 1.00 54.18  ? 325 GLY B C   1 
ATOM   2286 O O   . GLY B 1 111 ? 3.343   -41.977 -38.460 1.00 52.19  ? 325 GLY B O   1 
ATOM   2287 N N   . PHE B 1 112 ? 1.687   -43.336 -37.770 1.00 48.26  ? 326 PHE B N   1 
ATOM   2288 C CA  . PHE B 1 112 ? 1.415   -42.558 -36.566 1.00 39.99  ? 326 PHE B CA  1 
ATOM   2289 C C   . PHE B 1 112 ? 2.114   -43.145 -35.347 1.00 38.75  ? 326 PHE B C   1 
ATOM   2290 O O   . PHE B 1 112 ? 1.867   -44.291 -34.966 1.00 36.07  ? 326 PHE B O   1 
ATOM   2291 C CB  . PHE B 1 112 ? -0.089  -42.462 -36.303 1.00 42.62  ? 326 PHE B CB  1 
ATOM   2292 C CG  . PHE B 1 112 ? -0.431  -41.826 -34.983 1.00 38.73  ? 326 PHE B CG  1 
ATOM   2293 C CD1 . PHE B 1 112 ? -0.351  -40.452 -34.819 1.00 44.24  ? 326 PHE B CD1 1 
ATOM   2294 C CD2 . PHE B 1 112 ? -0.827  -42.602 -33.906 1.00 37.25  ? 326 PHE B CD2 1 
ATOM   2295 C CE1 . PHE B 1 112 ? -0.661  -39.861 -33.604 1.00 40.69  ? 326 PHE B CE1 1 
ATOM   2296 C CE2 . PHE B 1 112 ? -1.139  -42.019 -32.687 1.00 36.76  ? 326 PHE B CE2 1 
ATOM   2297 C CZ  . PHE B 1 112 ? -1.057  -40.647 -32.536 1.00 38.01  ? 326 PHE B CZ  1 
ATOM   2298 N N   . TYR B 1 113 ? 2.985   -42.342 -34.742 1.00 34.58  ? 327 TYR B N   1 
ATOM   2299 C CA  . TYR B 1 113 ? 3.685   -42.714 -33.520 1.00 31.79  ? 327 TYR B CA  1 
ATOM   2300 C C   . TYR B 1 113 ? 2.982   -42.100 -32.319 1.00 30.53  ? 327 TYR B C   1 
ATOM   2301 O O   . TYR B 1 113 ? 2.851   -40.878 -32.226 1.00 35.74  ? 327 TYR B O   1 
ATOM   2302 C CB  . TYR B 1 113 ? 5.146   -42.261 -33.579 1.00 31.03  ? 327 TYR B CB  1 
ATOM   2303 C CG  . TYR B 1 113 ? 5.965   -42.990 -34.617 1.00 32.08  ? 327 TYR B CG  1 
ATOM   2304 C CD1 . TYR B 1 113 ? 5.843   -42.685 -35.966 1.00 36.59  ? 327 TYR B CD1 1 
ATOM   2305 C CD2 . TYR B 1 113 ? 6.860   -43.987 -34.249 1.00 31.14  ? 327 TYR B CD2 1 
ATOM   2306 C CE1 . TYR B 1 113 ? 6.587   -43.355 -36.920 1.00 42.18  ? 327 TYR B CE1 1 
ATOM   2307 C CE2 . TYR B 1 113 ? 7.608   -44.662 -35.196 1.00 34.06  ? 327 TYR B CE2 1 
ATOM   2308 C CZ  . TYR B 1 113 ? 7.467   -44.340 -36.529 1.00 39.26  ? 327 TYR B CZ  1 
ATOM   2309 O OH  . TYR B 1 113 ? 8.207   -45.007 -37.477 1.00 44.94  ? 327 TYR B OH  1 
ATOM   2310 N N   . GLY B 1 114 ? 2.526   -42.945 -31.400 1.00 29.45  ? 328 GLY B N   1 
ATOM   2311 C CA  . GLY B 1 114 ? 1.721   -42.471 -30.291 1.00 34.25  ? 328 GLY B CA  1 
ATOM   2312 C C   . GLY B 1 114 ? 2.100   -43.030 -28.935 1.00 32.76  ? 328 GLY B C   1 
ATOM   2313 O O   . GLY B 1 114 ? 2.768   -44.060 -28.830 1.00 32.33  ? 328 GLY B O   1 
ATOM   2314 N N   . VAL B 1 115 ? 1.670   -42.331 -27.892 1.00 31.36  ? 329 VAL B N   1 
ATOM   2315 C CA  . VAL B 1 115 ? 1.878   -42.768 -26.518 1.00 30.36  ? 329 VAL B CA  1 
ATOM   2316 C C   . VAL B 1 115 ? 0.545   -42.743 -25.779 1.00 29.45  ? 329 VAL B C   1 
ATOM   2317 O O   . VAL B 1 115 ? -0.161  -41.735 -25.799 1.00 30.83  ? 329 VAL B O   1 
ATOM   2318 C CB  . VAL B 1 115 ? 2.898   -41.874 -25.780 1.00 29.91  ? 329 VAL B CB  1 
ATOM   2319 C CG1 . VAL B 1 115 ? 3.030   -42.301 -24.327 1.00 29.55  ? 329 VAL B CG1 1 
ATOM   2320 C CG2 . VAL B 1 115 ? 4.253   -41.919 -26.482 1.00 30.71  ? 329 VAL B CG2 1 
ATOM   2321 N N   . SER B 1 116 ? 0.189   -43.854 -25.143 1.00 31.58  ? 330 SER B N   1 
ATOM   2322 C CA  . SER B 1 116 ? -1.053  -43.913 -24.378 1.00 31.43  ? 330 SER B CA  1 
ATOM   2323 C C   . SER B 1 116 ? -0.781  -44.234 -22.915 1.00 33.34  ? 330 SER B C   1 
ATOM   2324 O O   . SER B 1 116 ? 0.020   -45.117 -22.600 1.00 32.59  ? 330 SER B O   1 
ATOM   2325 C CB  . SER B 1 116 ? -2.011  -44.946 -24.973 1.00 29.79  ? 330 SER B CB  1 
ATOM   2326 O OG  . SER B 1 116 ? -2.555  -44.486 -26.197 1.00 33.67  ? 330 SER B OG  1 
ATOM   2327 N N   . SER B 1 117 ? -1.449  -43.504 -22.029 1.00 31.27  ? 331 SER B N   1 
ATOM   2328 C CA  . SER B 1 117 ? -1.322  -43.722 -20.595 1.00 32.86  ? 331 SER B CA  1 
ATOM   2329 C C   . SER B 1 117 ? -2.693  -43.711 -19.936 1.00 33.70  ? 331 SER B C   1 
ATOM   2330 O O   . SER B 1 117 ? -3.580  -42.955 -20.336 1.00 33.96  ? 331 SER B O   1 
ATOM   2331 C CB  . SER B 1 117 ? -0.428  -42.656 -19.960 1.00 35.71  ? 331 SER B CB  1 
ATOM   2332 O OG  . SER B 1 117 ? 0.877   -42.684 -20.512 1.00 43.61  ? 331 SER B OG  1 
ATOM   2333 N N   . GLN B 1 118 ? -2.870  -44.553 -18.926 1.00 30.82  ? 332 GLN B N   1 
ATOM   2334 C CA  . GLN B 1 118 ? -4.119  -44.559 -18.177 1.00 31.02  ? 332 GLN B CA  1 
ATOM   2335 C C   . GLN B 1 118 ? -3.869  -44.820 -16.700 1.00 31.89  ? 332 GLN B C   1 
ATOM   2336 O O   . GLN B 1 118 ? -3.182  -45.773 -16.331 1.00 32.03  ? 332 GLN B O   1 
ATOM   2337 C CB  . GLN B 1 118 ? -5.093  -45.599 -18.742 1.00 32.88  ? 332 GLN B CB  1 
ATOM   2338 C CG  . GLN B 1 118 ? -6.437  -45.627 -18.015 1.00 38.11  ? 332 GLN B CG  1 
ATOM   2339 C CD  . GLN B 1 118 ? -7.532  -46.318 -18.811 1.00 44.33  ? 332 GLN B CD  1 
ATOM   2340 O OE1 . GLN B 1 118 ? -7.487  -46.369 -20.040 1.00 48.83  ? 332 GLN B OE1 1 
ATOM   2341 N NE2 . GLN B 1 118 ? -8.526  -46.849 -18.110 1.00 46.18  ? 332 GLN B NE2 1 
ATOM   2342 N N   . TYR B 1 119 ? -4.441  -43.992 -15.862 1.00 34.51  ? 333 TYR B N   1 
ATOM   2343 C CA  . TYR B 1 119 ? -4.288  -44.132 -14.440 1.00 34.06  ? 333 TYR B CA  1 
ATOM   2344 C C   . TYR B 1 119 ? -5.625  -44.170 -13.725 1.00 33.73  ? 333 TYR B C   1 
ATOM   2345 O O   . TYR B 1 119 ? -6.607  -43.757 -14.247 1.00 32.86  ? 333 TYR B O   1 
ATOM   2346 C CB  . TYR B 1 119 ? -3.512  -42.952 -13.897 1.00 34.96  ? 333 TYR B CB  1 
ATOM   2347 C CG  . TYR B 1 119 ? -2.201  -42.633 -14.532 1.00 32.79  ? 333 TYR B CG  1 
ATOM   2348 C CD1 . TYR B 1 119 ? -1.033  -43.055 -13.977 1.00 33.68  ? 333 TYR B CD1 1 
ATOM   2349 C CD2 . TYR B 1 119 ? -2.130  -41.870 -15.651 1.00 32.77  ? 333 TYR B CD2 1 
ATOM   2350 C CE1 . TYR B 1 119 ? 0.174   -42.757 -14.540 1.00 32.32  ? 333 TYR B CE1 1 
ATOM   2351 C CE2 . TYR B 1 119 ? -0.930  -41.552 -16.217 1.00 32.35  ? 333 TYR B CE2 1 
ATOM   2352 C CZ  . TYR B 1 119 ? 0.222   -42.015 -15.653 1.00 33.13  ? 333 TYR B CZ  1 
ATOM   2353 O OH  . TYR B 1 119 ? 1.408   -41.709 -16.185 1.00 32.52  ? 333 TYR B OH  1 
ATOM   2354 N N   . GLU B 1 120 ? -5.630  -44.672 -12.510 1.00 35.79  ? 334 GLU B N   1 
ATOM   2355 C CA  . GLU B 1 120 ? -6.831  -44.699 -11.702 1.00 41.39  ? 334 GLU B CA  1 
ATOM   2356 C C   . GLU B 1 120 ? -6.570  -44.326 -10.260 1.00 43.55  ? 334 GLU B C   1 
ATOM   2357 O O   . GLU B 1 120 ? -5.487  -44.499 -9.747  1.00 39.64  ? 334 GLU B O   1 
ATOM   2358 C CB  . GLU B 1 120 ? -7.617  -45.994 -11.833 1.00 50.35  ? 334 GLU B CB  1 
ATOM   2359 C CG  . GLU B 1 120 ? -6.938  -47.242 -11.357 1.00 60.56  ? 334 GLU B CG  1 
ATOM   2360 C CD  . GLU B 1 120 ? -7.795  -48.472 -11.562 1.00 70.57  ? 334 GLU B CD  1 
ATOM   2361 O OE1 . GLU B 1 120 ? -7.377  -49.547 -11.122 1.00 77.64  ? 334 GLU B OE1 1 
ATOM   2362 O OE2 . GLU B 1 120 ? -8.875  -48.364 -12.158 1.00 70.90  ? 334 GLU B OE2 1 
ATOM   2363 N N   . SER B 1 121 ? -7.602  -43.806 -9.624  1.00 41.68  ? 335 SER B N   1 
ATOM   2364 C CA  . SER B 1 121 ? -7.516  -43.351 -8.275  1.00 43.48  ? 335 SER B CA  1 
ATOM   2365 C C   . SER B 1 121 ? -8.854  -43.332 -7.549  1.00 46.93  ? 335 SER B C   1 
ATOM   2366 O O   . SER B 1 121 ? -9.881  -43.452 -8.156  1.00 47.98  ? 335 SER B O   1 
ATOM   2367 C CB  . SER B 1 121 ? -6.977  -41.955 -8.333  1.00 41.90  ? 335 SER B CB  1 
ATOM   2368 O OG  . SER B 1 121 ? -7.093  -41.339 -7.105  1.00 48.03  ? 335 SER B OG  1 
ATOM   2369 N N   . LEU B 1 122 ? -8.820  -43.154 -6.244  1.00 47.03  ? 336 LEU B N   1 
ATOM   2370 C CA  . LEU B 1 122 ? -10.051 -43.091 -5.481  1.00 52.11  ? 336 LEU B CA  1 
ATOM   2371 C C   . LEU B 1 122 ? -10.445 -41.648 -5.231  1.00 51.17  ? 336 LEU B C   1 
ATOM   2372 O O   . LEU B 1 122 ? -11.556 -41.380 -4.886  1.00 52.07  ? 336 LEU B O   1 
ATOM   2373 C CB  . LEU B 1 122 ? -9.956  -43.875 -4.192  1.00 55.74  ? 336 LEU B CB  1 
ATOM   2374 C CG  . LEU B 1 122 ? -10.194 -45.368 -4.303  1.00 61.16  ? 336 LEU B CG  1 
ATOM   2375 C CD1 . LEU B 1 122 ? -10.520 -45.931 -2.954  1.00 66.80  ? 336 LEU B CD1 1 
ATOM   2376 C CD2 . LEU B 1 122 ? -11.282 -45.723 -5.295  1.00 60.82  ? 336 LEU B CD2 1 
ATOM   2377 N N   . GLU B 1 123 ? -9.506  -40.743 -5.441  1.00 49.81  ? 337 GLU B N   1 
ATOM   2378 C CA  . GLU B 1 123 ? -9.704  -39.305 -5.306  1.00 53.45  ? 337 GLU B CA  1 
ATOM   2379 C C   . GLU B 1 123 ? -9.975  -38.660 -6.652  1.00 51.30  ? 337 GLU B C   1 
ATOM   2380 O O   . GLU B 1 123 ? -9.411  -39.066 -7.669  1.00 50.83  ? 337 GLU B O   1 
ATOM   2381 C CB  . GLU B 1 123 ? -8.482  -38.641 -4.673  1.00 59.07  ? 337 GLU B CB  1 
ATOM   2382 C CG  . GLU B 1 123 ? -8.221  -39.039 -3.245  1.00 66.80  ? 337 GLU B CG  1 
ATOM   2383 C CD  . GLU B 1 123 ? -6.848  -38.619 -2.776  1.00 69.01  ? 337 GLU B CD  1 
ATOM   2384 O OE1 . GLU B 1 123 ? -6.005  -39.512 -2.559  1.00 66.01  ? 337 GLU B OE1 1 
ATOM   2385 O OE2 . GLU B 1 123 ? -6.611  -37.401 -2.626  1.00 72.57  ? 337 GLU B OE2 1 
ATOM   2386 N N   . HIS B 1 124 ? -10.758 -37.615 -6.669  1.00 52.60  ? 338 HIS B N   1 
ATOM   2387 C CA  . HIS B 1 124 ? -10.969 -36.931 -7.891  1.00 53.69  ? 338 HIS B CA  1 
ATOM   2388 C C   . HIS B 1 124 ? -9.925  -35.855 -7.836  1.00 52.89  ? 338 HIS B C   1 
ATOM   2389 O O   . HIS B 1 124 ? -9.889  -35.086 -6.891  1.00 55.53  ? 338 HIS B O   1 
ATOM   2390 C CB  . HIS B 1 124 ? -12.340 -36.314 -7.933  1.00 62.05  ? 338 HIS B CB  1 
ATOM   2391 C CG  . HIS B 1 124 ? -12.525 -35.356 -9.056  1.00 66.17  ? 338 HIS B CG  1 
ATOM   2392 N ND1 . HIS B 1 124 ? -13.307 -35.632 -10.146 1.00 66.77  ? 338 HIS B ND1 1 
ATOM   2393 C CD2 . HIS B 1 124 ? -11.996 -34.137 -9.274  1.00 68.90  ? 338 HIS B CD2 1 
ATOM   2394 C CE1 . HIS B 1 124 ? -13.274 -34.613 -10.977 1.00 68.37  ? 338 HIS B CE1 1 
ATOM   2395 N NE2 . HIS B 1 124 ? -12.478 -33.696 -10.475 1.00 68.79  ? 338 HIS B NE2 1 
ATOM   2396 N N   . MET B 1 125 ? -9.055  -35.816 -8.834  1.00 47.91  ? 339 MET B N   1 
ATOM   2397 C CA  . MET B 1 125 ? -8.019  -34.817 -8.898  1.00 51.46  ? 339 MET B CA  1 
ATOM   2398 C C   . MET B 1 125 ? -7.793  -34.452 -10.328 1.00 51.75  ? 339 MET B C   1 
ATOM   2399 O O   . MET B 1 125 ? -8.343  -35.045 -11.195 1.00 47.95  ? 339 MET B O   1 
ATOM   2400 C CB  . MET B 1 125 ? -6.689  -35.319 -8.353  1.00 51.49  ? 339 MET B CB  1 
ATOM   2401 C CG  . MET B 1 125 ? -6.756  -36.390 -7.310  1.00 54.71  ? 339 MET B CG  1 
ATOM   2402 S SD  . MET B 1 125 ? -5.133  -36.896 -6.755  1.00 54.16  ? 339 MET B SD  1 
ATOM   2403 C CE  . MET B 1 125 ? -5.110  -38.526 -7.419  1.00 43.59  ? 339 MET B CE  1 
ATOM   2404 N N   . THR B 1 126 ? -6.955  -33.467 -10.545 1.00 41.79  ? 340 THR B N   1 
ATOM   2405 C CA  . THR B 1 126 ? -6.569  -33.052 -11.867 1.00 40.76  ? 340 THR B CA  1 
ATOM   2406 C C   . THR B 1 126 ? -5.075  -33.355 -11.925 1.00 37.91  ? 340 THR B C   1 
ATOM   2407 O O   . THR B 1 126 ? -4.338  -32.873 -11.113 1.00 42.32  ? 340 THR B O   1 
ATOM   2408 C CB  . THR B 1 126 ? -6.819  -31.570 -12.092 1.00 45.58  ? 340 THR B CB  1 
ATOM   2409 O OG1 . THR B 1 126 ? -8.215  -31.341 -12.189 1.00 46.43  ? 340 THR B OG1 1 
ATOM   2410 C CG2 . THR B 1 126 ? -6.209  -31.147 -13.375 1.00 47.38  ? 340 THR B CG2 1 
ATOM   2411 N N   . LEU B 1 127 ? -4.650  -34.168 -12.877 1.00 34.87  ? 341 LEU B N   1 
ATOM   2412 C CA  . LEU B 1 127 ? -3.254  -34.582 -12.982 1.00 34.94  ? 341 LEU B CA  1 
ATOM   2413 C C   . LEU B 1 127 ? -2.464  -33.705 -13.939 1.00 37.56  ? 341 LEU B C   1 
ATOM   2414 O O   . LEU B 1 127 ? -2.981  -33.254 -14.959 1.00 39.09  ? 341 LEU B O   1 
ATOM   2415 C CB  . LEU B 1 127 ? -3.150  -36.040 -13.441 1.00 31.91  ? 341 LEU B CB  1 
ATOM   2416 C CG  . LEU B 1 127 ? -3.826  -37.112 -12.588 1.00 31.15  ? 341 LEU B CG  1 
ATOM   2417 C CD1 . LEU B 1 127 ? -3.489  -38.504 -13.107 1.00 27.82  ? 341 LEU B CD1 1 
ATOM   2418 C CD2 . LEU B 1 127 ? -3.429  -36.968 -11.132 1.00 35.30  ? 341 LEU B CD2 1 
ATOM   2419 N N   . THR B 1 128 ? -1.207  -33.461 -13.589 1.00 38.63  ? 342 THR B N   1 
ATOM   2420 C CA  . THR B 1 128 ? -0.237  -32.913 -14.524 1.00 39.14  ? 342 THR B CA  1 
ATOM   2421 C C   . THR B 1 128 ? 0.841   -33.961 -14.759 1.00 37.93  ? 342 THR B C   1 
ATOM   2422 O O   . THR B 1 128 ? 1.506   -34.396 -13.819 1.00 36.16  ? 342 THR B O   1 
ATOM   2423 C CB  . THR B 1 128 ? 0.409   -31.613 -14.009 1.00 39.60  ? 342 THR B CB  1 
ATOM   2424 O OG1 . THR B 1 128 ? -0.591  -30.599 -13.881 1.00 41.60  ? 342 THR B OG1 1 
ATOM   2425 C CG2 . THR B 1 128 ? 1.481   -31.130 -14.976 1.00 40.19  ? 342 THR B CG2 1 
ATOM   2426 N N   . CYS B 1 129 ? 1.000   -34.384 -16.008 1.00 35.87  ? 343 CYS B N   1 
ATOM   2427 C CA  A CYS B 1 129 ? 2.020   -35.373 -16.335 0.58 33.75  ? 343 CYS B CA  1 
ATOM   2428 C CA  B CYS B 1 129 ? 2.003   -35.378 -16.353 0.42 33.92  ? 343 CYS B CA  1 
ATOM   2429 C C   . CYS B 1 129 ? 3.158   -34.745 -17.120 1.00 35.82  ? 343 CYS B C   1 
ATOM   2430 O O   . CYS B 1 129 ? 2.954   -34.167 -18.189 1.00 35.48  ? 343 CYS B O   1 
ATOM   2431 C CB  A CYS B 1 129 ? 1.435   -36.542 -17.130 0.58 33.39  ? 343 CYS B CB  1 
ATOM   2432 C CB  B CYS B 1 129 ? 1.368   -36.498 -17.174 0.42 33.30  ? 343 CYS B CB  1 
ATOM   2433 S SG  A CYS B 1 129 ? 2.665   -37.824 -17.521 0.58 48.77  ? 343 CYS B SG  1 
ATOM   2434 S SG  B CYS B 1 129 ? -0.160  -37.136 -16.455 0.42 29.20  ? 343 CYS B SG  1 
ATOM   2435 N N   . SER B 1 130 ? 4.359   -34.857 -16.565 1.00 32.56  ? 344 SER B N   1 
ATOM   2436 C CA  . SER B 1 130 ? 5.556   -34.357 -17.218 1.00 37.52  ? 344 SER B CA  1 
ATOM   2437 C C   . SER B 1 130 ? 6.416   -35.524 -17.670 1.00 36.54  ? 344 SER B C   1 
ATOM   2438 O O   . SER B 1 130 ? 6.690   -36.438 -16.894 1.00 35.59  ? 344 SER B O   1 
ATOM   2439 C CB  . SER B 1 130 ? 6.351   -33.448 -16.282 1.00 41.54  ? 344 SER B CB  1 
ATOM   2440 O OG  . SER B 1 130 ? 7.687   -33.326 -16.734 1.00 45.80  ? 344 SER B OG  1 
ATOM   2441 N N   . SER B 1 131 ? 6.826   -35.493 -18.931 1.00 35.92  ? 345 SER B N   1 
ATOM   2442 C CA  . SER B 1 131 ? 7.696   -36.523 -19.478 1.00 38.71  ? 345 SER B CA  1 
ATOM   2443 C C   . SER B 1 131 ? 8.968   -35.896 -20.043 1.00 39.86  ? 345 SER B C   1 
ATOM   2444 O O   . SER B 1 131 ? 8.910   -35.100 -20.979 1.00 42.69  ? 345 SER B O   1 
ATOM   2445 C CB  . SER B 1 131 ? 6.966   -37.320 -20.558 1.00 40.90  ? 345 SER B CB  1 
ATOM   2446 O OG  . SER B 1 131 ? 5.751   -37.860 -20.062 1.00 39.51  ? 345 SER B OG  1 
ATOM   2447 N N   . LYS B 1 132 ? 10.109  -36.247 -19.456 1.00 37.84  ? 346 LYS B N   1 
ATOM   2448 C CA  . LYS B 1 132 ? 11.407  -35.735 -19.899 1.00 39.37  ? 346 LYS B CA  1 
ATOM   2449 C C   . LYS B 1 132 ? 12.209  -36.775 -20.668 1.00 37.86  ? 346 LYS B C   1 
ATOM   2450 O O   . LYS B 1 132 ? 12.558  -37.815 -20.121 1.00 40.55  ? 346 LYS B O   1 
ATOM   2451 C CB  . LYS B 1 132 ? 12.251  -35.273 -18.710 1.00 41.73  ? 346 LYS B CB  1 
ATOM   2452 C CG  . LYS B 1 132 ? 11.783  -34.030 -17.993 1.00 49.60  ? 346 LYS B CG  1 
ATOM   2453 C CD  . LYS B 1 132 ? 12.882  -33.563 -17.050 1.00 57.04  ? 346 LYS B CD  1 
ATOM   2454 C CE  . LYS B 1 132 ? 12.414  -32.451 -16.140 1.00 62.88  ? 346 LYS B CE  1 
ATOM   2455 N NZ  . LYS B 1 132 ? 11.344  -32.922 -15.221 1.00 64.71  ? 346 LYS B NZ  1 
ATOM   2456 N N   . VAL B 1 133 ? 12.516  -36.489 -21.926 1.00 37.93  ? 347 VAL B N   1 
ATOM   2457 C CA  . VAL B 1 133 ? 13.467  -37.304 -22.666 1.00 36.99  ? 347 VAL B CA  1 
ATOM   2458 C C   . VAL B 1 133 ? 14.867  -36.784 -22.351 1.00 38.19  ? 347 VAL B C   1 
ATOM   2459 O O   . VAL B 1 133 ? 15.118  -35.582 -22.429 1.00 39.07  ? 347 VAL B O   1 
ATOM   2460 C CB  . VAL B 1 133 ? 13.204  -37.266 -24.183 1.00 39.99  ? 347 VAL B CB  1 
ATOM   2461 C CG1 . VAL B 1 133 ? 14.211  -38.134 -24.923 1.00 38.81  ? 347 VAL B CG1 1 
ATOM   2462 C CG2 . VAL B 1 133 ? 11.780  -37.719 -24.482 1.00 44.24  ? 347 VAL B CG2 1 
ATOM   2463 N N   . CYS B 1 134 ? 15.770  -37.684 -21.975 1.00 35.97  ? 348 CYS B N   1 
ATOM   2464 C CA  . CYS B 1 134 ? 17.111  -37.282 -21.567 1.00 35.14  ? 348 CYS B CA  1 
ATOM   2465 C C   . CYS B 1 134 ? 18.198  -38.031 -22.326 1.00 34.19  ? 348 CYS B C   1 
ATOM   2466 O O   . CYS B 1 134 ? 18.112  -39.243 -22.519 1.00 35.04  ? 348 CYS B O   1 
ATOM   2467 C CB  . CYS B 1 134 ? 17.296  -37.496 -20.064 1.00 34.83  ? 348 CYS B CB  1 
ATOM   2468 S SG  . CYS B 1 134 ? 16.146  -36.573 -19.026 1.00 49.14  ? 348 CYS B SG  1 
ATOM   2469 N N   . SER B 1 135 ? 19.220  -37.294 -22.751 1.00 34.29  ? 349 SER B N   1 
ATOM   2470 C CA  . SER B 1 135 ? 20.386  -37.876 -23.400 1.00 40.22  ? 349 SER B CA  1 
ATOM   2471 C C   . SER B 1 135 ? 21.637  -37.551 -22.590 1.00 42.47  ? 349 SER B C   1 
ATOM   2472 O O   . SER B 1 135 ? 21.931  -36.381 -22.338 1.00 38.27  ? 349 SER B O   1 
ATOM   2473 C CB  . SER B 1 135 ? 20.524  -37.358 -24.832 1.00 42.52  ? 349 SER B CB  1 
ATOM   2474 O OG  . SER B 1 135 ? 21.686  -37.881 -25.451 1.00 42.58  ? 349 SER B OG  1 
ATOM   2475 N N   . PHE B 1 136 ? 22.358  -38.593 -22.183 1.00 41.76  ? 350 PHE B N   1 
ATOM   2476 C CA  . PHE B 1 136 ? 23.511  -38.463 -21.294 1.00 44.71  ? 350 PHE B CA  1 
ATOM   2477 C C   . PHE B 1 136 ? 23.126  -37.743 -20.006 1.00 47.33  ? 350 PHE B C   1 
ATOM   2478 O O   . PHE B 1 136 ? 23.897  -36.946 -19.470 1.00 48.86  ? 350 PHE B O   1 
ATOM   2479 C CB  . PHE B 1 136 ? 24.662  -37.734 -21.995 1.00 46.32  ? 350 PHE B CB  1 
ATOM   2480 C CG  . PHE B 1 136 ? 25.223  -38.485 -23.167 1.00 45.69  ? 350 PHE B CG  1 
ATOM   2481 C CD1 . PHE B 1 136 ? 26.241  -39.409 -22.990 1.00 46.11  ? 350 PHE B CD1 1 
ATOM   2482 C CD2 . PHE B 1 136 ? 24.724  -38.281 -24.443 1.00 44.95  ? 350 PHE B CD2 1 
ATOM   2483 C CE1 . PHE B 1 136 ? 26.757  -40.107 -24.064 1.00 45.23  ? 350 PHE B CE1 1 
ATOM   2484 C CE2 . PHE B 1 136 ? 25.236  -38.979 -25.522 1.00 45.83  ? 350 PHE B CE2 1 
ATOM   2485 C CZ  . PHE B 1 136 ? 26.253  -39.893 -25.331 1.00 45.52  ? 350 PHE B CZ  1 
ATOM   2486 N N   . GLY B 1 137 ? 21.921  -38.028 -19.521 1.00 43.37  ? 351 GLY B N   1 
ATOM   2487 C CA  . GLY B 1 137 ? 21.442  -37.465 -18.271 1.00 45.12  ? 351 GLY B CA  1 
ATOM   2488 C C   . GLY B 1 137 ? 20.937  -36.039 -18.376 1.00 50.67  ? 351 GLY B C   1 
ATOM   2489 O O   . GLY B 1 137 ? 20.514  -35.453 -17.381 1.00 57.31  ? 351 GLY B O   1 
ATOM   2490 N N   . LYS B 1 138 ? 20.920  -35.485 -19.575 1.00 48.89  ? 352 LYS B N   1 
ATOM   2491 C CA  . LYS B 1 138 ? 20.446  -34.138 -19.785 1.00 46.95  ? 352 LYS B CA  1 
ATOM   2492 C C   . LYS B 1 138 ? 19.189  -34.038 -20.639 1.00 46.33  ? 352 LYS B C   1 
ATOM   2493 O O   . LYS B 1 138 ? 19.084  -34.649 -21.658 1.00 43.95  ? 352 LYS B O   1 
ATOM   2494 C CB  . LYS B 1 138 ? 21.538  -33.274 -20.403 1.00 50.69  ? 352 LYS B CB  1 
ATOM   2495 N N   . GLN B 1 139 ? 18.250  -33.220 -20.197 1.00 49.29  ? 353 GLN B N   1 
ATOM   2496 C CA  . GLN B 1 139 ? 17.002  -33.021 -20.880 1.00 47.58  ? 353 GLN B CA  1 
ATOM   2497 C C   . GLN B 1 139 ? 17.204  -32.571 -22.285 1.00 46.50  ? 353 GLN B C   1 
ATOM   2498 O O   . GLN B 1 139 ? 18.024  -31.744 -22.546 1.00 48.97  ? 353 GLN B O   1 
ATOM   2499 C CB  . GLN B 1 139 ? 16.155  -32.005 -20.135 1.00 51.22  ? 353 GLN B CB  1 
ATOM   2500 C CG  . GLN B 1 139 ? 14.869  -31.674 -20.843 1.00 53.71  ? 353 GLN B CG  1 
ATOM   2501 C CD  . GLN B 1 139 ? 13.937  -30.760 -20.061 1.00 53.67  ? 353 GLN B CD  1 
ATOM   2502 O OE1 . GLN B 1 139 ? 13.991  -30.681 -18.867 1.00 53.45  ? 353 GLN B OE1 1 
ATOM   2503 N NE2 . GLN B 1 139 ? 13.085  -30.069 -20.775 1.00 52.92  ? 353 GLN B NE2 1 
ATOM   2504 N N   . VAL B 1 140 ? 16.447  -33.127 -23.198 1.00 43.16  ? 354 VAL B N   1 
ATOM   2505 C CA  . VAL B 1 140 ? 16.537  -32.737 -24.571 1.00 45.87  ? 354 VAL B CA  1 
ATOM   2506 C C   . VAL B 1 140 ? 15.176  -32.366 -25.061 1.00 43.93  ? 354 VAL B C   1 
ATOM   2507 O O   . VAL B 1 140 ? 15.036  -31.532 -25.904 1.00 47.82  ? 354 VAL B O   1 
ATOM   2508 C CB  . VAL B 1 140 ? 17.208  -33.782 -25.437 1.00 50.29  ? 354 VAL B CB  1 
ATOM   2509 C CG1 . VAL B 1 140 ? 18.452  -34.301 -24.756 1.00 50.94  ? 354 VAL B CG1 1 
ATOM   2510 C CG2 . VAL B 1 140 ? 16.267  -34.889 -25.811 1.00 51.18  ? 354 VAL B CG2 1 
ATOM   2511 N N   . VAL B 1 141 ? 14.162  -32.991 -24.507 1.00 41.52  ? 355 VAL B N   1 
ATOM   2512 C CA  . VAL B 1 141 ? 12.810  -32.652 -24.861 1.00 41.60  ? 355 VAL B CA  1 
ATOM   2513 C C   . VAL B 1 141 ? 11.878  -32.944 -23.721 1.00 43.52  ? 355 VAL B C   1 
ATOM   2514 O O   . VAL B 1 141 ? 12.114  -33.831 -22.939 1.00 40.60  ? 355 VAL B O   1 
ATOM   2515 C CB  . VAL B 1 141 ? 12.311  -33.329 -26.104 1.00 65.52  ? 355 VAL B CB  1 
ATOM   2516 C CG1 . VAL B 1 141 ? 11.077  -32.615 -26.587 1.00 68.49  ? 355 VAL B CG1 1 
ATOM   2517 C CG2 . VAL B 1 141 ? 13.346  -33.245 -27.167 1.00 67.84  ? 355 VAL B CG2 1 
ATOM   2518 N N   . GLU B 1 142 ? 10.773  -32.240 -23.659 1.00 46.31  ? 356 GLU B N   1 
ATOM   2519 C CA  . GLU B 1 142 ? 9.823   -32.480 -22.613 1.00 46.08  ? 356 GLU B CA  1 
ATOM   2520 C C   . GLU B 1 142 ? 8.404   -32.205 -23.045 1.00 46.04  ? 356 GLU B C   1 
ATOM   2521 O O   . GLU B 1 142 ? 8.162   -31.338 -23.834 1.00 47.35  ? 356 GLU B O   1 
ATOM   2522 C CB  . GLU B 1 142 ? 10.190  -31.666 -21.405 1.00 50.15  ? 356 GLU B CB  1 
ATOM   2523 C CG  . GLU B 1 142 ? 9.123   -31.606 -20.350 1.00 49.97  ? 356 GLU B CG  1 
ATOM   2524 C CD  . GLU B 1 142 ? 9.487   -30.686 -19.241 1.00 53.87  ? 356 GLU B CD  1 
ATOM   2525 O OE1 . GLU B 1 142 ? 10.267  -29.782 -19.473 1.00 56.33  ? 356 GLU B OE1 1 
ATOM   2526 O OE2 . GLU B 1 142 ? 9.000   -30.865 -18.132 1.00 55.64  ? 356 GLU B OE2 1 
ATOM   2527 N N   . LYS B 1 143 ? 7.476   -32.975 -22.522 1.00 43.19  ? 357 LYS B N   1 
ATOM   2528 C CA  . LYS B 1 143 ? 6.090   -32.798 -22.824 1.00 46.63  ? 357 LYS B CA  1 
ATOM   2529 C C   . LYS B 1 143 ? 5.295   -32.762 -21.537 1.00 42.35  ? 357 LYS B C   1 
ATOM   2530 O O   . LYS B 1 143 ? 5.453   -33.607 -20.706 1.00 39.65  ? 357 LYS B O   1 
ATOM   2531 C CB  . LYS B 1 143 ? 5.631   -33.911 -23.712 1.00 52.09  ? 357 LYS B CB  1 
ATOM   2532 C CG  . LYS B 1 143 ? 4.142   -33.973 -23.866 1.00 56.50  ? 357 LYS B CG  1 
ATOM   2533 C CD  . LYS B 1 143 ? 3.700   -33.039 -24.955 1.00 63.45  ? 357 LYS B CD  1 
ATOM   2534 C CE  . LYS B 1 143 ? 2.198   -32.956 -25.019 1.00 67.06  ? 357 LYS B CE  1 
ATOM   2535 N NZ  . LYS B 1 143 ? 1.629   -34.136 -25.703 1.00 68.46  ? 357 LYS B NZ  1 
ATOM   2536 N N   . VAL B 1 144 ? 4.458   -31.755 -21.367 1.00 42.15  ? 358 VAL B N   1 
ATOM   2537 C CA  . VAL B 1 144 ? 3.650   -31.621 -20.177 1.00 36.96  ? 358 VAL B CA  1 
ATOM   2538 C C   . VAL B 1 144 ? 2.182   -31.601 -20.545 1.00 41.65  ? 358 VAL B C   1 
ATOM   2539 O O   . VAL B 1 144 ? 1.770   -30.822 -21.353 1.00 41.92  ? 358 VAL B O   1 
ATOM   2540 C CB  . VAL B 1 144 ? 3.973   -30.360 -19.404 1.00 41.69  ? 358 VAL B CB  1 
ATOM   2541 C CG1 . VAL B 1 144 ? 3.156   -30.293 -18.155 1.00 42.53  ? 358 VAL B CG1 1 
ATOM   2542 C CG2 . VAL B 1 144 ? 5.434   -30.246 -19.083 1.00 37.91  ? 358 VAL B CG2 1 
ATOM   2543 N N   . GLU B 1 145 ? 1.409   -32.482 -19.949 1.00 42.25  ? 359 GLU B N   1 
ATOM   2544 C CA  . GLU B 1 145 ? -0.002  -32.594 -20.213 1.00 44.76  ? 359 GLU B CA  1 
ATOM   2545 C C   . GLU B 1 145 ? -0.777  -32.579 -18.924 1.00 41.72  ? 359 GLU B C   1 
ATOM   2546 O O   . GLU B 1 145 ? -0.258  -32.908 -17.903 1.00 38.83  ? 359 GLU B O   1 
ATOM   2547 C CB  . GLU B 1 145 ? -0.295  -33.916 -20.887 1.00 50.47  ? 359 GLU B CB  1 
ATOM   2548 C CG  . GLU B 1 145 ? -0.184  -33.926 -22.375 1.00 60.44  ? 359 GLU B CG  1 
ATOM   2549 C CD  . GLU B 1 145 ? 0.156   -35.288 -22.927 1.00 65.84  ? 359 GLU B CD  1 
ATOM   2550 O OE1 . GLU B 1 145 ? 0.880   -36.058 -22.278 1.00 68.24  ? 359 GLU B OE1 1 
ATOM   2551 O OE2 . GLU B 1 145 ? -0.291  -35.602 -24.029 1.00 68.11  ? 359 GLU B OE2 1 
ATOM   2552 N N   . THR B 1 146 ? -2.040  -32.217 -18.997 1.00 39.28  ? 360 THR B N   1 
ATOM   2553 C CA  . THR B 1 146 ? -2.896  -32.184 -17.824 1.00 41.87  ? 360 THR B CA  1 
ATOM   2554 C C   . THR B 1 146 ? -4.149  -32.994 -18.137 1.00 39.30  ? 360 THR B C   1 
ATOM   2555 O O   . THR B 1 146 ? -4.629  -32.962 -19.235 1.00 42.72  ? 360 THR B O   1 
ATOM   2556 C CB  . THR B 1 146 ? -3.224  -30.741 -17.427 1.00 51.34  ? 360 THR B CB  1 
ATOM   2557 O OG1 . THR B 1 146 ? -2.090  -30.129 -16.815 1.00 55.58  ? 360 THR B OG1 1 
ATOM   2558 C CG2 . THR B 1 146 ? -4.353  -30.687 -16.471 1.00 52.53  ? 360 THR B CG2 1 
ATOM   2559 N N   . GLU B 1 147 ? -4.661  -33.745 -17.180 1.00 35.81  ? 361 GLU B N   1 
ATOM   2560 C CA  . GLU B 1 147 ? -5.845  -34.564 -17.404 1.00 38.01  ? 361 GLU B CA  1 
ATOM   2561 C C   . GLU B 1 147 ? -6.790  -34.603 -16.209 1.00 36.64  ? 361 GLU B C   1 
ATOM   2562 O O   . GLU B 1 147 ? -6.390  -34.903 -15.120 1.00 33.03  ? 361 GLU B O   1 
ATOM   2563 C CB  . GLU B 1 147 ? -5.456  -35.980 -17.794 1.00 37.58  ? 361 GLU B CB  1 
ATOM   2564 C CG  . GLU B 1 147 ? -6.617  -36.885 -18.101 1.00 42.27  ? 361 GLU B CG  1 
ATOM   2565 C CD  . GLU B 1 147 ? -7.342  -36.526 -19.386 1.00 48.71  ? 361 GLU B CD  1 
ATOM   2566 O OE1 . GLU B 1 147 ? -6.777  -35.859 -20.243 1.00 50.43  ? 361 GLU B OE1 1 
ATOM   2567 O OE2 . GLU B 1 147 ? -8.482  -36.945 -19.544 1.00 50.09  ? 361 GLU B OE2 1 
ATOM   2568 N N   . ARG B 1 148 ? -8.053  -34.301 -16.448 1.00 37.48  ? 362 ARG B N   1 
ATOM   2569 C CA  . ARG B 1 148 ? -9.042  -34.295 -15.391 1.00 36.51  ? 362 ARG B CA  1 
ATOM   2570 C C   . ARG B 1 148 ? -9.658  -35.651 -15.200 1.00 37.20  ? 362 ARG B C   1 
ATOM   2571 O O   . ARG B 1 148 ? -9.851  -36.381 -16.128 1.00 39.51  ? 362 ARG B O   1 
ATOM   2572 C CB  . ARG B 1 148 ? -10.115 -33.235 -15.608 1.00 38.84  ? 362 ARG B CB  1 
ATOM   2573 N N   . ALA B 1 149 ? -9.970  -35.958 -13.963 1.00 41.60  ? 363 ALA B N   1 
ATOM   2574 C CA  . ALA B 1 149 ? -10.537 -37.254 -13.608 1.00 45.20  ? 363 ALA B CA  1 
ATOM   2575 C C   . ALA B 1 149 ? -11.891 -37.492 -14.263 1.00 49.08  ? 363 ALA B C   1 
ATOM   2576 O O   . ALA B 1 149 ? -12.560 -36.558 -14.702 1.00 51.98  ? 363 ALA B O   1 
ATOM   2577 C CB  . ALA B 1 149 ? -10.665 -37.370 -12.098 1.00 46.61  ? 363 ALA B CB  1 
ATOM   2578 N N   . GLN B 1 150 ? -12.284 -38.757 -14.333 1.00 49.14  ? 364 GLN B N   1 
ATOM   2579 C CA  . GLN B 1 150 ? -13.609 -39.114 -14.811 1.00 54.54  ? 364 GLN B CA  1 
ATOM   2580 C C   . GLN B 1 150 ? -14.179 -40.188 -13.898 1.00 53.17  ? 364 GLN B C   1 
ATOM   2581 O O   . GLN B 1 150 ? -13.564 -41.239 -13.698 1.00 49.10  ? 364 GLN B O   1 
ATOM   2582 C CB  . GLN B 1 150 ? -13.567 -39.609 -16.259 1.00 57.56  ? 364 GLN B CB  1 
ATOM   2583 C CG  . GLN B 1 150 ? -12.908 -38.659 -17.259 1.00 61.20  ? 364 GLN B CG  1 
ATOM   2584 C CD  . GLN B 1 150 ? -13.909 -37.986 -18.189 1.00 66.73  ? 364 GLN B CD  1 
ATOM   2585 O OE1 . GLN B 1 150 ? -15.079 -37.805 -17.843 1.00 72.12  ? 364 GLN B OE1 1 
ATOM   2586 N NE2 . GLN B 1 150 ? -13.457 -37.641 -19.389 1.00 65.54  ? 364 GLN B NE2 1 
ATOM   2587 N N   . LEU B 1 151 ? -15.353 -39.911 -13.341 1.00 53.54  ? 365 LEU B N   1 
ATOM   2588 C CA  . LEU B 1 151 ? -15.985 -40.812 -12.390 1.00 53.95  ? 365 LEU B CA  1 
ATOM   2589 C C   . LEU B 1 151 ? -16.582 -42.019 -13.102 1.00 53.75  ? 365 LEU B C   1 
ATOM   2590 O O   . LEU B 1 151 ? -17.551 -41.896 -13.849 1.00 56.62  ? 365 LEU B O   1 
ATOM   2591 C CB  . LEU B 1 151 ? -17.059 -40.069 -11.593 1.00 55.73  ? 365 LEU B CB  1 
ATOM   2592 C CG  . LEU B 1 151 ? -17.790 -40.861 -10.510 1.00 58.66  ? 365 LEU B CG  1 
ATOM   2593 C CD1 . LEU B 1 151 ? -16.792 -41.540 -9.587  1.00 56.52  ? 365 LEU B CD1 1 
ATOM   2594 C CD2 . LEU B 1 151 ? -18.721 -39.949 -9.720  1.00 59.17  ? 365 LEU B CD2 1 
ATOM   2595 N N   . GLU B 1 152 ? -15.992 -43.185 -12.867 1.00 50.94  ? 366 GLU B N   1 
ATOM   2596 C CA  . GLU B 1 152 ? -16.452 -44.416 -13.493 1.00 52.79  ? 366 GLU B CA  1 
ATOM   2597 C C   . GLU B 1 152 ? -16.497 -45.554 -12.485 1.00 58.99  ? 366 GLU B C   1 
ATOM   2598 O O   . GLU B 1 152 ? -15.461 -45.974 -11.972 1.00 58.78  ? 366 GLU B O   1 
ATOM   2599 C CB  . GLU B 1 152 ? -15.550 -44.799 -14.667 1.00 50.80  ? 366 GLU B CB  1 
ATOM   2600 C CG  . GLU B 1 152 ? -15.532 -43.793 -15.802 1.00 51.35  ? 366 GLU B CG  1 
ATOM   2601 C CD  . GLU B 1 152 ? -14.778 -44.303 -17.012 1.00 55.69  ? 366 GLU B CD  1 
ATOM   2602 O OE1 . GLU B 1 152 ? -14.648 -43.543 -17.995 1.00 61.92  ? 366 GLU B OE1 1 
ATOM   2603 O OE2 . GLU B 1 152 ? -14.319 -45.465 -16.983 1.00 57.16  ? 366 GLU B OE2 1 
ATOM   2604 N N   . ASP B 1 153 ? -17.690 -46.074 -12.269 1.00 66.96  ? 367 ASP B N   1 
ATOM   2605 C CA  . ASP B 1 153 ? -17.904 -47.206 -11.395 1.00 72.83  ? 367 ASP B CA  1 
ATOM   2606 C C   . ASP B 1 153 ? -17.233 -47.069 -10.055 1.00 69.84  ? 367 ASP B C   1 
ATOM   2607 O O   . ASP B 1 153 ? -16.546 -47.959 -9.611  1.00 70.00  ? 367 ASP B O   1 
ATOM   2608 C CB  . ASP B 1 153 ? -17.452 -48.485 -12.091 1.00 77.21  ? 367 ASP B CB  1 
ATOM   2609 C CG  . ASP B 1 153 ? -18.053 -49.729 -11.470 1.00 84.85  ? 367 ASP B CG  1 
ATOM   2610 O OD1 . ASP B 1 153 ? -19.166 -49.675 -10.930 1.00 87.47  ? 367 ASP B OD1 1 
ATOM   2611 O OD2 . ASP B 1 153 ? -17.408 -50.773 -11.538 1.00 88.22  ? 367 ASP B OD2 1 
ATOM   2612 N N   . GLY B 1 154 ? -17.449 -45.941 -9.413  1.00 67.21  ? 368 GLY B N   1 
ATOM   2613 C CA  . GLY B 1 154 ? -16.886 -45.708 -8.107  1.00 69.23  ? 368 GLY B CA  1 
ATOM   2614 C C   . GLY B 1 154 ? -15.486 -45.139 -8.016  1.00 66.70  ? 368 GLY B C   1 
ATOM   2615 O O   . GLY B 1 154 ? -15.109 -44.639 -6.976  1.00 67.32  ? 368 GLY B O   1 
ATOM   2616 N N   . ARG B 1 155 ? -14.717 -45.215 -9.088  1.00 63.32  ? 369 ARG B N   1 
ATOM   2617 C CA  . ARG B 1 155 ? -13.376 -44.694 -9.061  1.00 61.99  ? 369 ARG B CA  1 
ATOM   2618 C C   . ARG B 1 155 ? -13.122 -43.699 -10.163 1.00 54.09  ? 369 ARG B C   1 
ATOM   2619 O O   . ARG B 1 155 ? -13.880 -43.595 -11.083 1.00 53.13  ? 369 ARG B O   1 
ATOM   2620 C CB  . ARG B 1 155 ? -12.365 -45.838 -9.155  1.00 20.00  ? 369 ARG B CB  1 
ATOM   2621 N N   . PHE B 1 156 ? -12.046 -42.949 -10.037 1.00 47.25  ? 370 PHE B N   1 
ATOM   2622 C CA  . PHE B 1 156 ? -11.719 -41.946 -11.007 1.00 41.68  ? 370 PHE B CA  1 
ATOM   2623 C C   . PHE B 1 156 ? -10.671 -42.418 -12.007 1.00 40.96  ? 370 PHE B C   1 
ATOM   2624 O O   . PHE B 1 156 ? -9.637  -42.925 -11.645 1.00 40.15  ? 370 PHE B O   1 
ATOM   2625 C CB  . PHE B 1 156 ? -11.276 -40.713 -10.277 1.00 44.08  ? 370 PHE B CB  1 
ATOM   2626 C CG  . PHE B 1 156 ? -12.319 -40.153 -9.367  1.00 48.55  ? 370 PHE B CG  1 
ATOM   2627 C CD1 . PHE B 1 156 ? -13.302 -39.348 -9.858  1.00 49.86  ? 370 PHE B CD1 1 
ATOM   2628 C CD2 . PHE B 1 156 ? -12.309 -40.432 -8.040  1.00 51.36  ? 370 PHE B CD2 1 
ATOM   2629 C CE1 . PHE B 1 156 ? -14.267 -38.822 -9.042  1.00 53.41  ? 370 PHE B CE1 1 
ATOM   2630 C CE2 . PHE B 1 156 ? -13.274 -39.915 -7.209  1.00 56.73  ? 370 PHE B CE2 1 
ATOM   2631 C CZ  . PHE B 1 156 ? -14.255 -39.102 -7.711  1.00 55.68  ? 370 PHE B CZ  1 
ATOM   2632 N N   . VAL B 1 157 ? -10.962 -42.241 -13.275 1.00 39.59  ? 371 VAL B N   1 
ATOM   2633 C CA  . VAL B 1 157 ? -10.069 -42.669 -14.303 1.00 40.16  ? 371 VAL B CA  1 
ATOM   2634 C C   . VAL B 1 157 ? -9.436  -41.516 -15.060 1.00 37.43  ? 371 VAL B C   1 
ATOM   2635 O O   . VAL B 1 157 ? -10.075 -40.534 -15.318 1.00 36.82  ? 371 VAL B O   1 
ATOM   2636 C CB  . VAL B 1 157 ? -10.792 -43.587 -15.266 1.00 39.87  ? 371 VAL B CB  1 
ATOM   2637 C CG1 . VAL B 1 157 ? -9.824  -44.171 -16.251 1.00 38.31  ? 371 VAL B CG1 1 
ATOM   2638 C CG2 . VAL B 1 157 ? -11.484 -44.683 -14.505 1.00 44.08  ? 371 VAL B CG2 1 
ATOM   2639 N N   . TYR B 1 158 ? -8.166  -41.660 -15.391 1.00 33.09  ? 372 TYR B N   1 
ATOM   2640 C CA  . TYR B 1 158 ? -7.452  -40.621 -16.117 1.00 29.08  ? 372 TYR B CA  1 
ATOM   2641 C C   . TYR B 1 158 ? -6.930  -41.190 -17.428 1.00 34.83  ? 372 TYR B C   1 
ATOM   2642 O O   . TYR B 1 158 ? -6.123  -42.117 -17.428 1.00 37.40  ? 372 TYR B O   1 
ATOM   2643 C CB  . TYR B 1 158 ? -6.294  -40.067 -15.277 1.00 28.39  ? 372 TYR B CB  1 
ATOM   2644 C CG  . TYR B 1 158 ? -6.698  -39.606 -13.894 1.00 29.91  ? 372 TYR B CG  1 
ATOM   2645 C CD1 . TYR B 1 158 ? -6.941  -38.265 -13.632 1.00 30.60  ? 372 TYR B CD1 1 
ATOM   2646 C CD2 . TYR B 1 158 ? -6.839  -40.513 -12.850 1.00 34.58  ? 372 TYR B CD2 1 
ATOM   2647 C CE1 . TYR B 1 158 ? -7.304  -37.841 -12.367 1.00 32.24  ? 372 TYR B CE1 1 
ATOM   2648 C CE2 . TYR B 1 158 ? -7.211  -40.100 -11.586 1.00 35.19  ? 372 TYR B CE2 1 
ATOM   2649 C CZ  . TYR B 1 158 ? -7.443  -38.764 -11.350 1.00 36.89  ? 372 TYR B CZ  1 
ATOM   2650 O OH  . TYR B 1 158 ? -7.811  -38.352 -10.089 1.00 38.55  ? 372 TYR B OH  1 
ATOM   2651 N N   . ARG B 1 159 ? -7.382  -40.634 -18.543 1.00 33.85  ? 373 ARG B N   1 
ATOM   2652 C CA  . ARG B 1 159 ? -7.020  -41.173 -19.847 1.00 34.79  ? 373 ARG B CA  1 
ATOM   2653 C C   . ARG B 1 159 ? -6.224  -40.175 -20.675 1.00 35.14  ? 373 ARG B C   1 
ATOM   2654 O O   . ARG B 1 159 ? -6.713  -39.098 -21.016 1.00 34.88  ? 373 ARG B O   1 
ATOM   2655 C CB  . ARG B 1 159 ? -8.272  -41.606 -20.614 1.00 36.32  ? 373 ARG B CB  1 
ATOM   2656 C CG  . ARG B 1 159 ? -8.913  -42.884 -20.094 1.00 38.81  ? 373 ARG B CG  1 
ATOM   2657 C CD  . ARG B 1 159 ? -10.126 -43.264 -20.930 1.00 43.69  ? 373 ARG B CD  1 
ATOM   2658 N NE  . ARG B 1 159 ? -10.775 -44.478 -20.445 1.00 48.11  ? 373 ARG B NE  1 
ATOM   2659 C CZ  . ARG B 1 159 ? -11.711 -44.499 -19.502 1.00 48.33  ? 373 ARG B CZ  1 
ATOM   2660 N NH1 . ARG B 1 159 ? -12.108 -43.369 -18.932 1.00 46.65  ? 373 ARG B NH1 1 
ATOM   2661 N NH2 . ARG B 1 159 ? -12.247 -45.651 -19.124 1.00 50.93  ? 373 ARG B NH2 1 
ATOM   2662 N N   . LEU B 1 160 ? -4.988  -40.546 -20.986 1.00 31.26  ? 374 LEU B N   1 
ATOM   2663 C CA  . LEU B 1 160 ? -4.142  -39.757 -21.871 1.00 32.06  ? 374 LEU B CA  1 
ATOM   2664 C C   . LEU B 1 160 ? -3.778  -40.621 -23.067 1.00 32.18  ? 374 LEU B C   1 
ATOM   2665 O O   . LEU B 1 160 ? -2.639  -41.061 -23.203 1.00 29.07  ? 374 LEU B O   1 
ATOM   2666 C CB  . LEU B 1 160 ? -2.883  -39.267 -21.148 1.00 30.26  ? 374 LEU B CB  1 
ATOM   2667 C CG  . LEU B 1 160 ? -3.042  -38.308 -19.961 1.00 34.99  ? 374 LEU B CG  1 
ATOM   2668 C CD1 . LEU B 1 160 ? -3.349  -39.056 -18.669 1.00 35.90  ? 374 LEU B CD1 1 
ATOM   2669 C CD2 . LEU B 1 160 ? -1.798  -37.443 -19.797 1.00 38.82  ? 374 LEU B CD2 1 
ATOM   2670 N N   . LEU B 1 161 ? -4.758  -40.873 -23.929 1.00 31.50  ? 375 LEU B N   1 
ATOM   2671 C CA  . LEU B 1 161 ? -4.595  -41.856 -24.994 1.00 32.72  ? 375 LEU B CA  1 
ATOM   2672 C C   . LEU B 1 161 ? -4.183  -41.228 -26.323 1.00 33.30  ? 375 LEU B C   1 
ATOM   2673 O O   . LEU B 1 161 ? -4.553  -40.092 -26.627 1.00 33.44  ? 375 LEU B O   1 
ATOM   2674 C CB  . LEU B 1 161 ? -5.894  -42.651 -25.174 1.00 33.07  ? 375 LEU B CB  1 
ATOM   2675 C CG  . LEU B 1 161 ? -6.454  -43.334 -23.922 1.00 34.43  ? 375 LEU B CG  1 
ATOM   2676 C CD1 . LEU B 1 161 ? -7.765  -44.042 -24.230 1.00 38.54  ? 375 LEU B CD1 1 
ATOM   2677 C CD2 . LEU B 1 161 ? -5.445  -44.307 -23.329 1.00 32.82  ? 375 LEU B CD2 1 
ATOM   2678 N N   . ARG B 1 162 ? -3.406  -41.981 -27.100 1.00 31.50  ? 376 ARG B N   1 
ATOM   2679 C CA  . ARG B 1 162 ? -3.024  -41.605 -28.460 1.00 33.73  ? 376 ARG B CA  1 
ATOM   2680 C C   . ARG B 1 162 ? -2.350  -40.238 -28.539 1.00 35.91  ? 376 ARG B C   1 
ATOM   2681 O O   . ARG B 1 162 ? -2.490  -39.523 -29.530 1.00 36.08  ? 376 ARG B O   1 
ATOM   2682 C CB  . ARG B 1 162 ? -4.245  -41.633 -29.381 1.00 36.28  ? 376 ARG B CB  1 
ATOM   2683 C CG  . ARG B 1 162 ? -4.956  -42.974 -29.404 1.00 36.13  ? 376 ARG B CG  1 
ATOM   2684 C CD  . ARG B 1 162 ? -6.060  -43.010 -30.441 1.00 36.71  ? 376 ARG B CD  1 
ATOM   2685 N NE  . ARG B 1 162 ? -5.566  -42.774 -31.795 1.00 39.82  ? 376 ARG B NE  1 
ATOM   2686 C CZ  . ARG B 1 162 ? -4.989  -43.701 -32.555 1.00 39.63  ? 376 ARG B CZ  1 
ATOM   2687 N NH1 . ARG B 1 162 ? -4.817  -44.931 -32.092 1.00 35.03  ? 376 ARG B NH1 1 
ATOM   2688 N NH2 . ARG B 1 162 ? -4.578  -43.394 -33.778 1.00 40.40  ? 376 ARG B NH2 1 
ATOM   2689 N N   . SER B 1 163 ? -1.624  -39.880 -27.489 1.00 35.21  ? 377 SER B N   1 
ATOM   2690 C CA  . SER B 1 163 ? -0.837  -38.656 -27.494 1.00 38.41  ? 377 SER B CA  1 
ATOM   2691 C C   . SER B 1 163 ? 0.277   -38.781 -28.531 1.00 35.73  ? 377 SER B C   1 
ATOM   2692 O O   . SER B 1 163 ? 1.030   -39.751 -28.513 1.00 36.94  ? 377 SER B O   1 
ATOM   2693 C CB  . SER B 1 163 ? -0.260  -38.382 -26.104 1.00 41.37  ? 377 SER B CB  1 
ATOM   2694 O OG  . SER B 1 163 ? 0.574   -37.238 -26.116 1.00 47.94  ? 377 SER B OG  1 
ATOM   2695 N N   . PRO B 1 164 ? 0.382   -37.860 -29.460 1.00 35.41  ? 378 PRO B N   1 
ATOM   2696 C CA  . PRO B 1 164 ? 1.417   -37.953 -30.492 1.00 33.29  ? 378 PRO B CA  1 
ATOM   2697 C C   . PRO B 1 164 ? 2.835   -37.892 -29.954 1.00 32.14  ? 378 PRO B C   1 
ATOM   2698 O O   . PRO B 1 164 ? 3.179   -37.077 -29.151 1.00 32.02  ? 378 PRO B O   1 
ATOM   2699 C CB  . PRO B 1 164 ? 1.141   -36.757 -31.389 1.00 37.80  ? 378 PRO B CB  1 
ATOM   2700 C CG  . PRO B 1 164 ? -0.197  -36.283 -31.016 1.00 38.80  ? 378 PRO B CG  1 
ATOM   2701 C CD  . PRO B 1 164 ? -0.424  -36.655 -29.602 1.00 36.03  ? 378 PRO B CD  1 
ATOM   2702 N N   . MET B 1 165 ? 3.652   -38.804 -30.420 1.00 31.83  ? 379 MET B N   1 
ATOM   2703 C CA  . MET B 1 165 ? 5.022   -38.868 -29.990 1.00 32.76  ? 379 MET B CA  1 
ATOM   2704 C C   . MET B 1 165 ? 5.826   -37.665 -30.476 1.00 33.79  ? 379 MET B C   1 
ATOM   2705 O O   . MET B 1 165 ? 5.685   -37.241 -31.573 1.00 35.19  ? 379 MET B O   1 
ATOM   2706 C CB  . MET B 1 165 ? 5.629   -40.157 -30.521 1.00 31.88  ? 379 MET B CB  1 
ATOM   2707 C CG  . MET B 1 165 ? 6.932   -40.575 -29.904 1.00 38.50  ? 379 MET B CG  1 
ATOM   2708 S SD  . MET B 1 165 ? 7.503   -42.163 -30.504 1.00 34.85  ? 379 MET B SD  1 
ATOM   2709 C CE  . MET B 1 165 ? 6.751   -43.237 -29.359 1.00 38.30  ? 379 MET B CE  1 
HETATM 2710 O O   . P1L B 1 166 ? 8.759   -37.540 -31.336 1.00 35.73  ? 380 P1L B O   1 
HETATM 2711 N N   . P1L B 1 166 ? 6.673   -37.126 -29.630 1.00 37.69  ? 380 P1L B N   1 
HETATM 2712 C CA  . P1L B 1 166 ? 7.542   -36.024 -30.004 1.00 41.17  ? 380 P1L B CA  1 
HETATM 2713 C CB  . P1L B 1 166 ? 8.571   -35.818 -28.909 1.00 45.75  ? 380 P1L B CB  1 
HETATM 2714 S SG  . P1L B 1 166 ? 7.861   -35.361 -27.386 1.00 102.07 ? 380 P1L B SG  1 
HETATM 2715 C C7  . P1L B 1 166 ? 7.071   -36.678 -26.757 1.00 81.60  ? 380 P1L B C7  1 
HETATM 2716 O O7  . P1L B 1 166 ? 5.974   -36.988 -27.187 1.00 81.33  ? 380 P1L B O7  1 
HETATM 2717 C C8  . P1L B 1 166 ? 7.714   -37.466 -25.640 1.00 78.03  ? 380 P1L B C8  1 
HETATM 2718 C C9  . P1L B 1 166 ? 6.841   -38.650 -25.270 1.00 71.66  ? 380 P1L B C9  1 
HETATM 2719 C C10 . P1L B 1 166 ? 6.405   -38.578 -23.839 1.00 67.44  ? 380 P1L B C10 1 
HETATM 2720 C C11 . P1L B 1 166 ? 6.383   -39.965 -23.235 1.00 62.08  ? 380 P1L B C11 1 
HETATM 2721 C C12 . P1L B 1 166 ? 7.693   -40.661 -23.443 1.00 57.11  ? 380 P1L B C12 1 
HETATM 2722 C C13 . P1L B 1 166 ? 7.481   -42.143 -23.329 1.00 52.56  ? 380 P1L B C13 1 
HETATM 2723 C C14 . P1L B 1 166 ? 7.767   -42.819 -24.640 1.00 50.34  ? 380 P1L B C14 1 
HETATM 2724 C C15 . P1L B 1 166 ? 7.770   -44.294 -24.362 1.00 51.10  ? 380 P1L B C15 1 
HETATM 2725 C C16 . P1L B 1 166 ? 9.031   -44.987 -24.794 1.00 52.07  ? 380 P1L B C16 1 
HETATM 2726 C C17 . P1L B 1 166 ? 9.360   -44.601 -26.200 1.00 54.12  ? 380 P1L B C17 1 
HETATM 2727 C C18 . P1L B 1 166 ? 10.032  -45.739 -26.900 1.00 54.66  ? 380 P1L B C18 1 
HETATM 2728 C C19 . P1L B 1 166 ? 11.508  -45.520 -26.918 1.00 55.33  ? 380 P1L B C19 1 
HETATM 2729 C C20 . P1L B 1 166 ? 12.170  -46.864 -26.927 1.00 56.62  ? 380 P1L B C20 1 
HETATM 2730 C C   . P1L B 1 166 ? 8.351   -36.393 -31.216 1.00 38.17  ? 380 P1L B C   1 
HETATM 2731 C C21 . P1L B 1 166 ? 13.648  -46.688 -27.065 1.00 57.12  ? 380 P1L B C21 1 
HETATM 2732 C C22 . P1L B 1 166 ? 14.255  -48.042 -27.055 1.00 58.60  ? 380 P1L B C22 1 
ATOM   2733 N N   . GLU B 1 167 ? 8.600   -35.460 -32.121 1.00 39.58  ? 381 GLU B N   1 
ATOM   2734 C CA  . GLU B 1 167 ? 9.374   -35.775 -33.293 1.00 49.01  ? 381 GLU B CA  1 
ATOM   2735 C C   . GLU B 1 167 ? 10.804  -36.203 -32.965 1.00 46.29  ? 381 GLU B C   1 
ATOM   2736 O O   . GLU B 1 167 ? 11.384  -36.943 -33.687 1.00 43.99  ? 381 GLU B O   1 
ATOM   2737 C CB  . GLU B 1 167 ? 9.354   -34.658 -34.319 1.00 64.06  ? 381 GLU B CB  1 
ATOM   2738 C CG  . GLU B 1 167 ? 10.101  -34.997 -35.587 1.00 78.72  ? 381 GLU B CG  1 
ATOM   2739 C CD  . GLU B 1 167 ? 9.481   -36.135 -36.377 1.00 88.66  ? 381 GLU B CD  1 
ATOM   2740 O OE1 . GLU B 1 167 ? 8.331   -36.516 -36.080 1.00 99.25  ? 381 GLU B OE1 1 
ATOM   2741 O OE2 . GLU B 1 167 ? 10.123  -36.643 -37.314 1.00 91.62  ? 381 GLU B OE2 1 
ATOM   2742 N N   . TYR B 1 168 ? 11.342  -35.734 -31.861 1.00 38.93  ? 382 TYR B N   1 
ATOM   2743 C CA  . TYR B 1 168 ? 12.672  -36.124 -31.473 1.00 38.28  ? 382 TYR B CA  1 
ATOM   2744 C C   . TYR B 1 168 ? 12.695  -37.626 -31.299 1.00 34.67  ? 382 TYR B C   1 
ATOM   2745 O O   . TYR B 1 168 ? 13.544  -38.304 -31.786 1.00 33.37  ? 382 TYR B O   1 
ATOM   2746 C CB  . TYR B 1 168 ? 13.094  -35.453 -30.196 1.00 37.76  ? 382 TYR B CB  1 
ATOM   2747 C CG  . TYR B 1 168 ? 14.444  -35.896 -29.718 1.00 39.18  ? 382 TYR B CG  1 
ATOM   2748 C CD1 . TYR B 1 168 ? 15.583  -35.296 -30.183 1.00 43.86  ? 382 TYR B CD1 1 
ATOM   2749 C CD2 . TYR B 1 168 ? 14.583  -36.918 -28.810 1.00 36.71  ? 382 TYR B CD2 1 
ATOM   2750 C CE1 . TYR B 1 168 ? 16.823  -35.697 -29.765 1.00 45.36  ? 382 TYR B CE1 1 
ATOM   2751 C CE2 . TYR B 1 168 ? 15.819  -37.327 -28.388 1.00 40.97  ? 382 TYR B CE2 1 
ATOM   2752 C CZ  . TYR B 1 168 ? 16.936  -36.705 -28.872 1.00 44.08  ? 382 TYR B CZ  1 
ATOM   2753 O OH  . TYR B 1 168 ? 18.164  -37.074 -28.466 1.00 45.99  ? 382 TYR B OH  1 
ATOM   2754 N N   . LEU B 1 169 ? 11.708  -38.130 -30.598 1.00 33.00  ? 383 LEU B N   1 
ATOM   2755 C CA  . LEU B 1 169 ? 11.590  -39.541 -30.343 1.00 36.16  ? 383 LEU B CA  1 
ATOM   2756 C C   . LEU B 1 169 ? 11.352  -40.338 -31.602 1.00 35.67  ? 383 LEU B C   1 
ATOM   2757 O O   . LEU B 1 169 ? 11.951  -41.359 -31.795 1.00 31.13  ? 383 LEU B O   1 
ATOM   2758 C CB  . LEU B 1 169 ? 10.485  -39.769 -29.346 1.00 40.45  ? 383 LEU B CB  1 
ATOM   2759 C CG  . LEU B 1 169 ? 10.572  -40.947 -28.422 1.00 46.59  ? 383 LEU B CG  1 
ATOM   2760 C CD1 . LEU B 1 169 ? 11.802  -40.835 -27.562 1.00 49.18  ? 383 LEU B CD1 1 
ATOM   2761 C CD2 . LEU B 1 169 ? 9.331   -40.908 -27.572 1.00 49.46  ? 383 LEU B CD2 1 
ATOM   2762 N N   . VAL B 1 170 ? 10.471  -39.854 -32.459 1.00 38.03  ? 384 VAL B N   1 
ATOM   2763 C CA  . VAL B 1 170 ? 10.204  -40.529 -33.691 1.00 38.32  ? 384 VAL B CA  1 
ATOM   2764 C C   . VAL B 1 170 ? 11.494  -40.613 -34.493 1.00 38.05  ? 384 VAL B C   1 
ATOM   2765 O O   . VAL B 1 170 ? 11.838  -41.634 -35.005 1.00 39.10  ? 384 VAL B O   1 
ATOM   2766 C CB  . VAL B 1 170 ? 9.136   -39.817 -34.503 1.00 35.96  ? 384 VAL B CB  1 
ATOM   2767 C CG1 . VAL B 1 170 ? 8.962   -40.499 -35.835 1.00 38.77  ? 384 VAL B CG1 1 
ATOM   2768 C CG2 . VAL B 1 170 ? 7.819   -39.805 -33.751 1.00 36.61  ? 384 VAL B CG2 1 
ATOM   2769 N N   . ASN B 1 171 ? 12.203  -39.512 -34.582 1.00 35.49  ? 385 ASN B N   1 
ATOM   2770 C CA  . ASN B 1 171 ? 13.446  -39.493 -35.319 1.00 39.76  ? 385 ASN B CA  1 
ATOM   2771 C C   . ASN B 1 171 ? 14.456  -40.428 -34.683 1.00 35.24  ? 385 ASN B C   1 
ATOM   2772 O O   . ASN B 1 171 ? 15.067  -41.176 -35.365 1.00 34.82  ? 385 ASN B O   1 
ATOM   2773 C CB  . ASN B 1 171 ? 14.004  -38.085 -35.443 1.00 51.04  ? 385 ASN B CB  1 
ATOM   2774 C CG  . ASN B 1 171 ? 13.234  -37.243 -36.431 1.00 69.81  ? 385 ASN B CG  1 
ATOM   2775 O OD1 . ASN B 1 171 ? 12.494  -37.752 -37.270 1.00 83.96  ? 385 ASN B OD1 1 
ATOM   2776 N ND2 . ASN B 1 171 ? 13.408  -35.946 -36.346 1.00 74.19  ? 385 ASN B ND2 1 
ATOM   2777 N N   . PHE B 1 172 ? 14.581  -40.376 -33.372 1.00 30.81  ? 386 PHE B N   1 
ATOM   2778 C CA  . PHE B 1 172 ? 15.503  -41.253 -32.656 1.00 32.55  ? 386 PHE B CA  1 
ATOM   2779 C C   . PHE B 1 172 ? 15.225  -42.723 -32.952 1.00 32.89  ? 386 PHE B C   1 
ATOM   2780 O O   . PHE B 1 172 ? 16.149  -43.505 -33.176 1.00 33.35  ? 386 PHE B O   1 
ATOM   2781 C CB  . PHE B 1 172 ? 15.416  -40.999 -31.148 1.00 34.17  ? 386 PHE B CB  1 
ATOM   2782 C CG  . PHE B 1 172 ? 16.306  -41.890 -30.327 1.00 32.75  ? 386 PHE B CG  1 
ATOM   2783 C CD1 . PHE B 1 172 ? 17.684  -41.705 -30.321 1.00 31.97  ? 386 PHE B CD1 1 
ATOM   2784 C CD2 . PHE B 1 172 ? 15.768  -42.905 -29.551 1.00 28.87  ? 386 PHE B CD2 1 
ATOM   2785 C CE1 . PHE B 1 172 ? 18.507  -42.526 -29.560 1.00 30.79  ? 386 PHE B CE1 1 
ATOM   2786 C CE2 . PHE B 1 172 ? 16.583  -43.726 -28.788 1.00 32.16  ? 386 PHE B CE2 1 
ATOM   2787 C CZ  . PHE B 1 172 ? 17.957  -43.536 -28.793 1.00 30.87  ? 386 PHE B CZ  1 
ATOM   2788 N N   . LEU B 1 173 ? 13.963  -43.098 -32.981 1.00 30.52  ? 387 LEU B N   1 
ATOM   2789 C CA  . LEU B 1 173 ? 13.589  -44.458 -33.240 1.00 31.54  ? 387 LEU B CA  1 
ATOM   2790 C C   . LEU B 1 173 ? 13.970  -44.893 -34.637 1.00 33.41  ? 387 LEU B C   1 
ATOM   2791 O O   . LEU B 1 173 ? 14.504  -45.946 -34.827 1.00 35.08  ? 387 LEU B O   1 
ATOM   2792 C CB  . LEU B 1 173 ? 12.095  -44.678 -32.973 1.00 34.87  ? 387 LEU B CB  1 
ATOM   2793 C CG  . LEU B 1 173 ? 11.658  -44.709 -31.506 1.00 34.43  ? 387 LEU B CG  1 
ATOM   2794 C CD1 . LEU B 1 173 ? 10.160  -44.535 -31.374 1.00 33.09  ? 387 LEU B CD1 1 
ATOM   2795 C CD2 . LEU B 1 173 ? 12.108  -45.982 -30.847 1.00 36.01  ? 387 LEU B CD2 1 
ATOM   2796 N N   . HIS B 1 174 ? 13.691  -44.058 -35.605 1.00 34.64  ? 388 HIS B N   1 
ATOM   2797 C CA  . HIS B 1 174 ? 13.997  -44.351 -36.986 1.00 54.81  ? 388 HIS B CA  1 
ATOM   2798 C C   . HIS B 1 174 ? 15.496  -44.611 -37.202 1.00 49.20  ? 388 HIS B C   1 
ATOM   2799 O O   . HIS B 1 174 ? 15.864  -45.514 -37.885 1.00 48.88  ? 388 HIS B O   1 
ATOM   2800 C CB  . HIS B 1 174 ? 13.504  -43.204 -37.830 1.00 60.94  ? 388 HIS B CB  1 
ATOM   2801 C CG  . HIS B 1 174 ? 13.645  -43.415 -39.294 1.00 73.44  ? 388 HIS B CG  1 
ATOM   2802 N ND1 . HIS B 1 174 ? 12.889  -44.324 -39.990 1.00 83.38  ? 388 HIS B ND1 1 
ATOM   2803 C CD2 . HIS B 1 174 ? 14.438  -42.809 -40.206 1.00 79.91  ? 388 HIS B CD2 1 
ATOM   2804 C CE1 . HIS B 1 174 ? 13.218  -44.281 -41.266 1.00 89.35  ? 388 HIS B CE1 1 
ATOM   2805 N NE2 . HIS B 1 174 ? 14.152  -43.365 -41.423 1.00 86.57  ? 388 HIS B NE2 1 
ATOM   2806 N N   . LYS B 1 175 ? 16.324  -43.801 -36.580 1.00 42.21  ? 389 LYS B N   1 
ATOM   2807 C CA  . LYS B 1 175 ? 17.754  -43.920 -36.648 1.00 41.62  ? 389 LYS B CA  1 
ATOM   2808 C C   . LYS B 1 175 ? 18.234  -45.149 -35.919 1.00 40.76  ? 389 LYS B C   1 
ATOM   2809 O O   . LYS B 1 175 ? 18.999  -45.906 -36.433 1.00 42.10  ? 389 LYS B O   1 
ATOM   2810 C CB  . LYS B 1 175 ? 18.381  -42.720 -35.999 1.00 40.02  ? 389 LYS B CB  1 
ATOM   2811 C CG  . LYS B 1 175 ? 18.301  -41.481 -36.825 1.00 43.01  ? 389 LYS B CG  1 
ATOM   2812 C CD  . LYS B 1 175 ? 18.671  -40.269 -36.036 1.00 44.84  ? 389 LYS B CD  1 
ATOM   2813 C CE  . LYS B 1 175 ? 18.468  -39.009 -36.843 1.00 46.43  ? 389 LYS B CE  1 
ATOM   2814 N NZ  . LYS B 1 175 ? 18.858  -37.824 -36.050 1.00 46.38  ? 389 LYS B NZ  1 
ATOM   2815 N N   . LEU B 1 176 ? 17.776  -45.320 -34.700 1.00 38.13  ? 390 LEU B N   1 
ATOM   2816 C CA  . LEU B 1 176 ? 18.155  -46.451 -33.902 1.00 38.15  ? 390 LEU B CA  1 
ATOM   2817 C C   . LEU B 1 176 ? 17.880  -47.776 -34.580 1.00 39.98  ? 390 LEU B C   1 
ATOM   2818 O O   . LEU B 1 176 ? 18.664  -48.670 -34.517 1.00 38.38  ? 390 LEU B O   1 
ATOM   2819 C CB  . LEU B 1 176 ? 17.483  -46.399 -32.549 1.00 36.35  ? 390 LEU B CB  1 
ATOM   2820 C CG  . LEU B 1 176 ? 17.934  -47.297 -31.414 1.00 39.88  ? 390 LEU B CG  1 
ATOM   2821 C CD1 . LEU B 1 176 ? 19.293  -46.960 -30.856 1.00 40.77  ? 390 LEU B CD1 1 
ATOM   2822 C CD2 . LEU B 1 176 ? 16.934  -47.211 -30.316 1.00 40.96  ? 390 LEU B CD2 1 
ATOM   2823 N N   . ARG B 1 177 ? 16.742  -47.882 -35.218 1.00 38.43  ? 391 ARG B N   1 
ATOM   2824 C CA  . ARG B 1 177 ? 16.346  -49.111 -35.900 1.00 43.77  ? 391 ARG B CA  1 
ATOM   2825 C C   . ARG B 1 177 ? 17.360  -49.541 -36.962 1.00 45.06  ? 391 ARG B C   1 
ATOM   2826 O O   . ARG B 1 177 ? 17.518  -50.732 -37.233 1.00 46.93  ? 391 ARG B O   1 
ATOM   2827 C CB  . ARG B 1 177 ? 14.960  -48.943 -36.542 1.00 47.94  ? 391 ARG B CB  1 
ATOM   2828 C CG  . ARG B 1 177 ? 14.534  -50.121 -37.410 1.00 57.30  ? 391 ARG B CG  1 
ATOM   2829 C CD  . ARG B 1 177 ? 13.055  -50.088 -37.770 1.00 64.06  ? 391 ARG B CD  1 
ATOM   2830 N NE  . ARG B 1 177 ? 12.689  -48.917 -38.562 1.00 67.61  ? 391 ARG B NE  1 
ATOM   2831 C CZ  . ARG B 1 177 ? 11.538  -48.794 -39.217 1.00 73.10  ? 391 ARG B CZ  1 
ATOM   2832 N NH1 . ARG B 1 177 ? 10.647  -49.775 -39.182 1.00 75.86  ? 391 ARG B NH1 1 
ATOM   2833 N NH2 . ARG B 1 177 ? 11.279  -47.695 -39.913 1.00 74.90  ? 391 ARG B NH2 1 
ATOM   2834 N N   . GLN B 1 178 ? 18.059  -48.572 -37.545 1.00 47.17  ? 392 GLN B N   1 
ATOM   2835 C CA  . GLN B 1 178 ? 18.919  -48.844 -38.691 1.00 52.05  ? 392 GLN B CA  1 
ATOM   2836 C C   . GLN B 1 178 ? 20.379  -49.105 -38.313 1.00 47.08  ? 392 GLN B C   1 
ATOM   2837 O O   . GLN B 1 178 ? 21.226  -49.270 -39.189 1.00 45.18  ? 392 GLN B O   1 
ATOM   2838 C CB  . GLN B 1 178 ? 18.837  -47.685 -39.690 1.00 61.71  ? 392 GLN B CB  1 
ATOM   2839 C CG  . GLN B 1 178 ? 17.414  -47.356 -40.125 1.00 71.43  ? 392 GLN B CG  1 
ATOM   2840 C CD  . GLN B 1 178 ? 17.360  -46.511 -41.383 1.00 80.46  ? 392 GLN B CD  1 
ATOM   2841 O OE1 . GLN B 1 178 ? 17.191  -45.293 -41.323 1.00 85.17  ? 392 GLN B OE1 1 
ATOM   2842 N NE2 . GLN B 1 178 ? 17.495  -47.159 -42.535 1.00 84.81  ? 392 GLN B NE2 1 
ATOM   2843 N N   . LEU B 1 179 ? 20.668  -49.146 -37.015 1.00 43.59  ? 393 LEU B N   1 
ATOM   2844 C CA  . LEU B 1 179 ? 22.010  -49.485 -36.544 1.00 45.07  ? 393 LEU B CA  1 
ATOM   2845 C C   . LEU B 1 179 ? 22.351  -50.921 -36.938 1.00 48.68  ? 393 LEU B C   1 
ATOM   2846 O O   . LEU B 1 179 ? 21.503  -51.810 -36.847 1.00 41.36  ? 393 LEU B O   1 
ATOM   2847 C CB  . LEU B 1 179 ? 22.118  -49.298 -35.027 1.00 43.78  ? 393 LEU B CB  1 
ATOM   2848 C CG  . LEU B 1 179 ? 22.753  -47.989 -34.545 1.00 46.68  ? 393 LEU B CG  1 
ATOM   2849 C CD1 . LEU B 1 179 ? 22.103  -46.788 -35.210 1.00 47.06  ? 393 LEU B CD1 1 
ATOM   2850 C CD2 . LEU B 1 179 ? 22.672  -47.870 -33.029 1.00 43.93  ? 393 LEU B CD2 1 
ATOM   2851 N N   . PRO B 1 180 ? 23.594  -51.150 -37.387 1.00 45.94  ? 394 PRO B N   1 
ATOM   2852 C CA  . PRO B 1 180 ? 23.989  -52.449 -37.946 1.00 46.94  ? 394 PRO B CA  1 
ATOM   2853 C C   . PRO B 1 180 ? 24.075  -53.559 -36.903 1.00 45.53  ? 394 PRO B C   1 
ATOM   2854 O O   . PRO B 1 180 ? 23.962  -54.734 -37.253 1.00 51.08  ? 394 PRO B O   1 
ATOM   2855 C CB  . PRO B 1 180 ? 25.370  -52.163 -38.549 1.00 49.53  ? 394 PRO B CB  1 
ATOM   2856 C CG  . PRO B 1 180 ? 25.891  -51.013 -37.766 1.00 49.34  ? 394 PRO B CG  1 
ATOM   2857 C CD  . PRO B 1 180 ? 24.704  -50.180 -37.393 1.00 46.95  ? 394 PRO B CD  1 
ATOM   2858 N N   . GLU B 1 181 ? 24.262  -53.188 -35.641 1.00 43.27  ? 395 GLU B N   1 
ATOM   2859 C CA  . GLU B 1 181 ? 24.468  -54.162 -34.576 1.00 44.11  ? 395 GLU B CA  1 
ATOM   2860 C C   . GLU B 1 181 ? 23.593  -53.882 -33.363 1.00 44.48  ? 395 GLU B C   1 
ATOM   2861 O O   . GLU B 1 181 ? 23.373  -52.727 -32.997 1.00 39.35  ? 395 GLU B O   1 
ATOM   2862 C CB  . GLU B 1 181 ? 25.938  -54.182 -34.155 1.00 49.77  ? 395 GLU B CB  1 
ATOM   2863 C CG  . GLU B 1 181 ? 26.880  -54.732 -35.208 1.00 55.86  ? 395 GLU B CG  1 
ATOM   2864 C CD  . GLU B 1 181 ? 26.780  -56.236 -35.344 1.00 61.41  ? 395 GLU B CD  1 
ATOM   2865 O OE1 . GLU B 1 181 ? 26.278  -56.886 -34.404 1.00 66.08  ? 395 GLU B OE1 1 
ATOM   2866 O OE2 . GLU B 1 181 ? 27.204  -56.770 -36.391 1.00 63.69  ? 395 GLU B OE2 1 
ATOM   2867 N N   . ARG B 1 182 ? 23.110  -54.951 -32.739 1.00 43.11  ? 396 ARG B N   1 
ATOM   2868 C CA  . ARG B 1 182 ? 22.254  -54.840 -31.566 1.00 39.87  ? 396 ARG B CA  1 
ATOM   2869 C C   . ARG B 1 182 ? 23.012  -54.295 -30.357 1.00 37.02  ? 396 ARG B C   1 
ATOM   2870 O O   . ARG B 1 182 ? 22.441  -53.579 -29.536 1.00 39.36  ? 396 ARG B O   1 
ATOM   2871 C CB  . ARG B 1 182 ? 21.634  -56.200 -31.227 1.00 46.60  ? 396 ARG B CB  1 
ATOM   2872 N N   . TYR B 1 183 ? 24.294  -54.633 -30.242 1.00 37.04  ? 397 TYR B N   1 
ATOM   2873 C CA  . TYR B 1 183 ? 25.080  -54.153 -29.113 1.00 36.12  ? 397 TYR B CA  1 
ATOM   2874 C C   . TYR B 1 183 ? 25.290  -52.645 -29.232 1.00 32.30  ? 397 TYR B C   1 
ATOM   2875 O O   . TYR B 1 183 ? 25.441  -51.955 -28.224 1.00 33.79  ? 397 TYR B O   1 
ATOM   2876 C CB  . TYR B 1 183 ? 26.425  -54.890 -29.012 1.00 37.71  ? 397 TYR B CB  1 
ATOM   2877 C CG  . TYR B 1 183 ? 27.508  -54.413 -29.960 1.00 40.52  ? 397 TYR B CG  1 
ATOM   2878 C CD1 . TYR B 1 183 ? 28.356  -53.367 -29.611 1.00 41.42  ? 397 TYR B CD1 1 
ATOM   2879 C CD2 . TYR B 1 183 ? 27.705  -55.031 -31.188 1.00 40.81  ? 397 TYR B CD2 1 
ATOM   2880 C CE1 . TYR B 1 183 ? 29.350  -52.936 -30.466 1.00 39.27  ? 397 TYR B CE1 1 
ATOM   2881 C CE2 . TYR B 1 183 ? 28.701  -54.608 -32.049 1.00 39.54  ? 397 TYR B CE2 1 
ATOM   2882 C CZ  . TYR B 1 183 ? 29.518  -53.560 -31.684 1.00 41.37  ? 397 TYR B CZ  1 
ATOM   2883 O OH  . TYR B 1 183 ? 30.508  -53.136 -32.539 1.00 43.89  ? 397 TYR B OH  1 
ATOM   2884 N N   . MET B 1 184 ? 25.296  -52.143 -30.464 1.00 31.63  ? 398 MET B N   1 
ATOM   2885 C CA  . MET B 1 184 ? 25.427  -50.708 -30.706 1.00 30.91  ? 398 MET B CA  1 
ATOM   2886 C C   . MET B 1 184 ? 24.148  -49.972 -30.313 1.00 32.90  ? 398 MET B C   1 
ATOM   2887 O O   . MET B 1 184 ? 24.195  -48.851 -29.805 1.00 30.71  ? 398 MET B O   1 
ATOM   2888 C CB  . MET B 1 184 ? 25.762  -50.432 -32.172 1.00 30.59  ? 398 MET B CB  1 
ATOM   2889 C CG  . MET B 1 184 ? 27.187  -50.793 -32.574 1.00 31.21  ? 398 MET B CG  1 
ATOM   2890 S SD  . MET B 1 184 ? 27.526  -50.349 -34.290 1.00 40.18  ? 398 MET B SD  1 
ATOM   2891 C CE  . MET B 1 184 ? 29.256  -50.790 -34.438 1.00 33.08  ? 398 MET B CE  1 
ATOM   2892 N N   . MET B 1 185 ? 23.008  -50.607 -30.558 1.00 30.10  ? 399 MET B N   1 
ATOM   2893 C CA  . MET B 1 185 ? 21.729  -50.065 -30.123 1.00 34.57  ? 399 MET B CA  1 
ATOM   2894 C C   . MET B 1 185 ? 21.711  -49.933 -28.604 1.00 29.34  ? 399 MET B C   1 
ATOM   2895 O O   . MET B 1 185 ? 21.313  -48.902 -28.066 1.00 30.42  ? 399 MET B O   1 
ATOM   2896 C CB  . MET B 1 185 ? 20.575  -50.953 -30.589 1.00 35.76  ? 399 MET B CB  1 
ATOM   2897 C CG  . MET B 1 185 ? 20.440  -51.092 -32.096 1.00 34.89  ? 399 MET B CG  1 
ATOM   2898 S SD  . MET B 1 185 ? 18.981  -52.069 -32.519 1.00 41.42  ? 399 MET B SD  1 
ATOM   2899 C CE  . MET B 1 185 ? 19.146  -52.193 -34.299 1.00 34.66  ? 399 MET B CE  1 
ATOM   2900 N N   . ASN B 1 186 ? 22.160  -50.983 -27.923 1.00 30.18  ? 400 ASN B N   1 
ATOM   2901 C CA  . ASN B 1 186 ? 22.229  -50.984 -26.467 1.00 32.85  ? 400 ASN B CA  1 
ATOM   2902 C C   . ASN B 1 186 ? 23.236  -49.975 -25.914 1.00 34.79  ? 400 ASN B C   1 
ATOM   2903 O O   . ASN B 1 186 ? 23.009  -49.392 -24.854 1.00 29.97  ? 400 ASN B O   1 
ATOM   2904 C CB  . ASN B 1 186 ? 22.561  -52.390 -25.956 1.00 32.15  ? 400 ASN B CB  1 
ATOM   2905 C CG  . ASN B 1 186 ? 21.385  -53.345 -26.081 1.00 38.49  ? 400 ASN B CG  1 
ATOM   2906 O OD1 . ASN B 1 186 ? 20.233  -52.916 -26.141 1.00 34.33  ? 400 ASN B OD1 1 
ATOM   2907 N ND2 . ASN B 1 186 ? 21.669  -54.644 -26.117 1.00 35.12  ? 400 ASN B ND2 1 
ATOM   2908 N N   . SER B 1 187 ? 24.344  -49.772 -26.627 1.00 35.74  ? 401 SER B N   1 
ATOM   2909 C CA  . SER B 1 187 ? 25.339  -48.778 -26.224 1.00 30.47  ? 401 SER B CA  1 
ATOM   2910 C C   . SER B 1 187 ? 24.762  -47.371 -26.302 1.00 30.97  ? 401 SER B C   1 
ATOM   2911 O O   . SER B 1 187 ? 24.986  -46.543 -25.416 1.00 30.02  ? 401 SER B O   1 
ATOM   2912 C CB  . SER B 1 187 ? 26.594  -48.870 -27.099 1.00 32.57  ? 401 SER B CB  1 
ATOM   2913 O OG  . SER B 1 187 ? 27.326  -50.051 -26.828 1.00 34.17  ? 401 SER B OG  1 
ATOM   2914 N N   . VAL B 1 188 ? 24.028  -47.104 -27.375 1.00 28.93  ? 402 VAL B N   1 
ATOM   2915 C CA  . VAL B 1 188 ? 23.354  -45.824 -27.534 1.00 30.82  ? 402 VAL B CA  1 
ATOM   2916 C C   . VAL B 1 188 ? 22.286  -45.654 -26.451 1.00 30.99  ? 402 VAL B C   1 
ATOM   2917 O O   . VAL B 1 188 ? 22.208  -44.609 -25.811 1.00 33.62  ? 402 VAL B O   1 
ATOM   2918 C CB  . VAL B 1 188 ? 22.725  -45.695 -28.935 1.00 31.09  ? 402 VAL B CB  1 
ATOM   2919 C CG1 . VAL B 1 188 ? 21.785  -44.495 -29.000 1.00 31.32  ? 402 VAL B CG1 1 
ATOM   2920 C CG2 . VAL B 1 188 ? 23.818  -45.584 -29.996 1.00 31.26  ? 402 VAL B CG2 1 
ATOM   2921 N N   . LEU B 1 189 ? 21.483  -46.677 -26.245 1.00 27.95  ? 403 LEU B N   1 
ATOM   2922 C CA  . LEU B 1 189 ? 20.428  -46.648 -25.262 1.00 32.53  ? 403 LEU B CA  1 
ATOM   2923 C C   . LEU B 1 189 ? 20.892  -46.512 -23.844 1.00 33.91  ? 403 LEU B C   1 
ATOM   2924 O O   . LEU B 1 189 ? 20.154  -46.112 -23.003 1.00 31.59  ? 403 LEU B O   1 
ATOM   2925 C CB  . LEU B 1 189 ? 19.544  -47.869 -25.399 1.00 32.95  ? 403 LEU B CB  1 
ATOM   2926 C CG  . LEU B 1 189 ? 18.577  -47.865 -26.550 1.00 27.99  ? 403 LEU B CG  1 
ATOM   2927 C CD1 . LEU B 1 189 ? 17.898  -49.200 -26.667 1.00 28.86  ? 403 LEU B CD1 1 
ATOM   2928 C CD2 . LEU B 1 189 ? 17.586  -46.747 -26.361 1.00 32.73  ? 403 LEU B CD2 1 
ATOM   2929 N N   . GLU B 1 190 ? 22.139  -46.836 -23.592 1.00 32.24  ? 404 GLU B N   1 
ATOM   2930 C CA  . GLU B 1 190 ? 22.695  -46.697 -22.288 1.00 36.98  ? 404 GLU B CA  1 
ATOM   2931 C C   . GLU B 1 190 ? 22.633  -45.242 -21.846 1.00 34.93  ? 404 GLU B C   1 
ATOM   2932 O O   . GLU B 1 190 ? 22.499  -44.959 -20.717 1.00 31.23  ? 404 GLU B O   1 
ATOM   2933 C CB  . GLU B 1 190 ? 24.131  -47.203 -22.273 1.00 41.63  ? 404 GLU B CB  1 
ATOM   2934 C CG  . GLU B 1 190 ? 24.864  -47.020 -20.972 1.00 50.46  ? 404 GLU B CG  1 
ATOM   2935 C CD  . GLU B 1 190 ? 24.405  -47.970 -19.893 1.00 57.46  ? 404 GLU B CD  1 
ATOM   2936 O OE1 . GLU B 1 190 ? 24.085  -47.509 -18.807 1.00 61.23  ? 404 GLU B OE1 1 
ATOM   2937 O OE2 . GLU B 1 190 ? 24.380  -49.176 -20.118 1.00 59.43  ? 404 GLU B OE2 1 
ATOM   2938 N N   . ASN B 1 191 ? 22.737  -44.335 -22.788 1.00 29.54  ? 405 ASN B N   1 
ATOM   2939 C CA  . ASN B 1 191 ? 22.698  -42.916 -22.499 1.00 30.15  ? 405 ASN B CA  1 
ATOM   2940 C C   . ASN B 1 191 ? 21.386  -42.228 -22.868 1.00 29.33  ? 405 ASN B C   1 
ATOM   2941 O O   . ASN B 1 191 ? 21.353  -41.051 -23.109 1.00 34.57  ? 405 ASN B O   1 
ATOM   2942 C CB  . ASN B 1 191 ? 23.864  -42.222 -23.180 1.00 31.29  ? 405 ASN B CB  1 
ATOM   2943 C CG  . ASN B 1 191 ? 25.187  -42.818 -22.800 1.00 37.36  ? 405 ASN B CG  1 
ATOM   2944 O OD1 . ASN B 1 191 ? 25.515  -42.877 -21.669 1.00 38.70  ? 405 ASN B OD1 1 
ATOM   2945 N ND2 . ASN B 1 191 ? 25.906  -43.299 -23.765 1.00 38.98  ? 405 ASN B ND2 1 
ATOM   2946 N N   . PHE B 1 192 ? 20.319  -43.003 -22.905 1.00 29.38  ? 406 PHE B N   1 
ATOM   2947 C CA  . PHE B 1 192 ? 19.001  -42.535 -23.240 1.00 30.55  ? 406 PHE B CA  1 
ATOM   2948 C C   . PHE B 1 192 ? 18.042  -42.958 -22.179 1.00 29.21  ? 406 PHE B C   1 
ATOM   2949 O O   . PHE B 1 192 ? 17.858  -44.113 -21.964 1.00 28.36  ? 406 PHE B O   1 
ATOM   2950 C CB  . PHE B 1 192 ? 18.568  -43.120 -24.553 1.00 32.90  ? 406 PHE B CB  1 
ATOM   2951 C CG  . PHE B 1 192 ? 17.162  -42.805 -24.931 1.00 32.51  ? 406 PHE B CG  1 
ATOM   2952 C CD1 . PHE B 1 192 ? 16.137  -43.645 -24.574 1.00 34.07  ? 406 PHE B CD1 1 
ATOM   2953 C CD2 . PHE B 1 192 ? 16.864  -41.685 -25.656 1.00 32.32  ? 406 PHE B CD2 1 
ATOM   2954 C CE1 . PHE B 1 192 ? 14.851  -43.378 -24.952 1.00 30.91  ? 406 PHE B CE1 1 
ATOM   2955 C CE2 . PHE B 1 192 ? 15.580  -41.422 -26.025 1.00 35.38  ? 406 PHE B CE2 1 
ATOM   2956 C CZ  . PHE B 1 192 ? 14.577  -42.260 -25.663 1.00 28.42  ? 406 PHE B CZ  1 
ATOM   2957 N N   . THR B 1 193 ? 17.451  -41.987 -21.523 1.00 30.66  ? 407 THR B N   1 
ATOM   2958 C CA  . THR B 1 193 ? 16.503  -42.242 -20.444 1.00 28.77  ? 407 THR B CA  1 
ATOM   2959 C C   . THR B 1 193 ? 15.282  -41.337 -20.537 1.00 27.24  ? 407 THR B C   1 
ATOM   2960 O O   . THR B 1 193 ? 15.314  -40.290 -21.186 1.00 27.91  ? 407 THR B O   1 
ATOM   2961 C CB  . THR B 1 193 ? 17.141  -42.038 -19.057 1.00 31.19  ? 407 THR B CB  1 
ATOM   2962 O OG1 . THR B 1 193 ? 17.544  -40.671 -18.916 1.00 34.23  ? 407 THR B OG1 1 
ATOM   2963 C CG2 . THR B 1 193 ? 18.347  -42.952 -18.867 1.00 33.00  ? 407 THR B CG2 1 
ATOM   2964 N N   . ILE B 1 194 ? 14.206  -41.752 -19.875 1.00 27.24  ? 408 ILE B N   1 
ATOM   2965 C CA  . ILE B 1 194 ? 12.998  -40.949 -19.788 1.00 27.06  ? 408 ILE B CA  1 
ATOM   2966 C C   . ILE B 1 194 ? 12.555  -40.850 -18.329 1.00 32.70  ? 408 ILE B C   1 
ATOM   2967 O O   . ILE B 1 194 ? 12.585  -41.837 -17.593 1.00 32.63  ? 408 ILE B O   1 
ATOM   2968 C CB  . ILE B 1 194 ? 11.866  -41.537 -20.665 1.00 30.86  ? 408 ILE B CB  1 
ATOM   2969 C CG1 . ILE B 1 194 ? 12.269  -41.463 -22.141 1.00 31.39  ? 408 ILE B CG1 1 
ATOM   2970 C CG2 . ILE B 1 194 ? 10.551  -40.790 -20.432 1.00 32.55  ? 408 ILE B CG2 1 
ATOM   2971 C CD1 . ILE B 1 194 ? 11.252  -42.018 -23.094 1.00 33.82  ? 408 ILE B CD1 1 
ATOM   2972 N N   . LEU B 1 195 ? 12.175  -39.649 -17.906 1.00 31.24  ? 409 LEU B N   1 
ATOM   2973 C CA  . LEU B 1 195 ? 11.683  -39.436 -16.550 1.00 33.79  ? 409 LEU B CA  1 
ATOM   2974 C C   . LEU B 1 195 ? 10.261  -38.892 -16.584 1.00 35.16  ? 409 LEU B C   1 
ATOM   2975 O O   . LEU B 1 195 ? 10.009  -37.833 -17.157 1.00 37.96  ? 409 LEU B O   1 
ATOM   2976 C CB  . LEU B 1 195 ? 12.599  -38.478 -15.785 1.00 35.66  ? 409 LEU B CB  1 
ATOM   2977 C CG  . LEU B 1 195 ? 12.234  -38.216 -14.322 1.00 34.07  ? 409 LEU B CG  1 
ATOM   2978 C CD1 . LEU B 1 195 ? 12.449  -39.469 -13.480 1.00 29.50  ? 409 LEU B CD1 1 
ATOM   2979 C CD2 . LEU B 1 195 ? 13.034  -37.044 -13.769 1.00 34.48  ? 409 LEU B CD2 1 
ATOM   2980 N N   . GLN B 1 196 ? 9.331   -39.624 -15.977 1.00 34.90  ? 410 GLN B N   1 
ATOM   2981 C CA  . GLN B 1 196 ? 7.937   -39.196 -15.928 1.00 39.53  ? 410 GLN B CA  1 
ATOM   2982 C C   . GLN B 1 196 ? 7.541   -38.758 -14.528 1.00 38.48  ? 410 GLN B C   1 
ATOM   2983 O O   . GLN B 1 196 ? 7.739   -39.490 -13.560 1.00 38.39  ? 410 GLN B O   1 
ATOM   2984 C CB  . GLN B 1 196 ? 7.005   -40.312 -16.400 1.00 41.12  ? 410 GLN B CB  1 
ATOM   2985 C CG  . GLN B 1 196 ? 6.808   -40.358 -17.902 1.00 44.29  ? 410 GLN B CG  1 
ATOM   2986 C CD  . GLN B 1 196 ? 5.616   -41.205 -18.306 1.00 44.84  ? 410 GLN B CD  1 
ATOM   2987 O OE1 . GLN B 1 196 ? 5.304   -42.208 -17.665 1.00 43.45  ? 410 GLN B OE1 1 
ATOM   2988 N NE2 . GLN B 1 196 ? 4.939   -40.798 -19.373 1.00 47.60  ? 410 GLN B NE2 1 
ATOM   2989 N N   . VAL B 1 197 ? 6.975   -37.560 -14.430 1.00 35.48  ? 411 VAL B N   1 
ATOM   2990 C CA  . VAL B 1 197 ? 6.540   -37.031 -13.147 1.00 32.92  ? 411 VAL B CA  1 
ATOM   2991 C C   . VAL B 1 197 ? 5.053   -36.696 -13.188 1.00 33.80  ? 411 VAL B C   1 
ATOM   2992 O O   . VAL B 1 197 ? 4.614   -35.870 -13.990 1.00 35.86  ? 411 VAL B O   1 
ATOM   2993 C CB  . VAL B 1 197 ? 7.352   -35.782 -12.757 1.00 37.16  ? 411 VAL B CB  1 
ATOM   2994 C CG1 . VAL B 1 197 ? 6.803   -35.165 -11.484 1.00 39.37  ? 411 VAL B CG1 1 
ATOM   2995 C CG2 . VAL B 1 197 ? 8.825   -36.143 -12.595 1.00 36.28  ? 411 VAL B CG2 1 
ATOM   2996 N N   . VAL B 1 198 ? 4.280   -37.358 -12.333 1.00 31.45  ? 412 VAL B N   1 
ATOM   2997 C CA  . VAL B 1 198 ? 2.849   -37.095 -12.233 1.00 33.56  ? 412 VAL B CA  1 
ATOM   2998 C C   . VAL B 1 198 ? 2.544   -36.407 -10.909 1.00 36.73  ? 412 VAL B C   1 
ATOM   2999 O O   . VAL B 1 198 ? 2.860   -36.932 -9.840  1.00 38.08  ? 412 VAL B O   1 
ATOM   3000 C CB  . VAL B 1 198 ? 2.016   -38.388 -12.347 1.00 32.85  ? 412 VAL B CB  1 
ATOM   3001 C CG1 . VAL B 1 198 ? 0.528   -38.059 -12.330 1.00 33.84  ? 412 VAL B CG1 1 
ATOM   3002 C CG2 . VAL B 1 198 ? 2.379   -39.143 -13.615 1.00 33.49  ? 412 VAL B CG2 1 
ATOM   3003 N N   . THR B 1 199 ? 1.958   -35.225 -10.979 1.00 35.95  ? 413 THR B N   1 
ATOM   3004 C CA  . THR B 1 199 ? 1.617   -34.463 -9.792  1.00 38.37  ? 413 THR B CA  1 
ATOM   3005 C C   . THR B 1 199 ? 0.185   -33.985 -9.754  1.00 41.68  ? 413 THR B C   1 
ATOM   3006 O O   . THR B 1 199 ? -0.464  -33.927 -10.745 1.00 39.46  ? 413 THR B O   1 
ATOM   3007 C CB  . THR B 1 199 ? 2.454   -33.188 -9.659  1.00 39.14  ? 413 THR B CB  1 
ATOM   3008 O OG1 . THR B 1 199 ? 2.256   -32.384 -10.794 1.00 40.33  ? 413 THR B OG1 1 
ATOM   3009 C CG2 . THR B 1 199 ? 3.901   -33.490 -9.552  1.00 37.21  ? 413 THR B CG2 1 
ATOM   3010 N N   . ASN B 1 200 ? -0.271  -33.630 -8.570  1.00 43.09  ? 414 ASN B N   1 
ATOM   3011 C CA  . ASN B 1 200 ? -1.587  -33.081 -8.369  1.00 42.25  ? 414 ASN B CA  1 
ATOM   3012 C C   . ASN B 1 200 ? -1.507  -31.638 -8.828  1.00 42.39  ? 414 ASN B C   1 
ATOM   3013 O O   . ASN B 1 200 ? -0.873  -30.837 -8.212  1.00 43.78  ? 414 ASN B O   1 
ATOM   3014 C CB  . ASN B 1 200 ? -1.975  -33.168 -6.900  1.00 43.02  ? 414 ASN B CB  1 
ATOM   3015 C CG  . ASN B 1 200 ? -3.382  -32.659 -6.615  1.00 44.36  ? 414 ASN B CG  1 
ATOM   3016 O OD1 . ASN B 1 200 ? -3.790  -31.649 -7.104  1.00 44.93  ? 414 ASN B OD1 1 
ATOM   3017 N ND2 . ASN B 1 200 ? -4.096  -33.362 -5.793  1.00 45.35  ? 414 ASN B ND2 1 
ATOM   3018 N N   . ARG B 1 201 ? -2.137  -31.333 -9.944  1.00 46.82  ? 415 ARG B N   1 
ATOM   3019 C CA  . ARG B 1 201 ? -2.144  -29.989 -10.509 1.00 52.91  ? 415 ARG B CA  1 
ATOM   3020 C C   . ARG B 1 201 ? -2.493  -28.920 -9.484  1.00 54.91  ? 415 ARG B C   1 
ATOM   3021 O O   . ARG B 1 201 ? -1.896  -27.877 -9.436  1.00 56.87  ? 415 ARG B O   1 
ATOM   3022 C CB  . ARG B 1 201 ? -3.177  -29.915 -11.603 1.00 57.23  ? 415 ARG B CB  1 
ATOM   3023 C CG  . ARG B 1 201 ? -2.811  -29.061 -12.790 1.00 61.14  ? 415 ARG B CG  1 
ATOM   3024 C CD  . ARG B 1 201 ? -3.369  -27.673 -12.681 1.00 68.85  ? 415 ARG B CD  1 
ATOM   3025 N NE  . ARG B 1 201 ? -4.818  -27.648 -12.691 1.00 73.85  ? 415 ARG B NE  1 
ATOM   3026 C CZ  . ARG B 1 201 ? -5.542  -27.416 -13.769 1.00 76.28  ? 415 ARG B CZ  1 
ATOM   3027 N NH1 . ARG B 1 201 ? -6.855  -27.403 -13.684 1.00 77.42  ? 415 ARG B NH1 1 
ATOM   3028 N NH2 . ARG B 1 201 ? -4.952  -27.195 -14.929 1.00 76.05  ? 415 ARG B NH2 1 
ATOM   3029 N N   . ASP B 1 202 ? -3.480  -29.216 -8.677  1.00 53.27  ? 416 ASP B N   1 
ATOM   3030 C CA  . ASP B 1 202 ? -3.945  -28.284 -7.693  1.00 58.88  ? 416 ASP B CA  1 
ATOM   3031 C C   . ASP B 1 202 ? -3.066  -28.092 -6.472  1.00 59.63  ? 416 ASP B C   1 
ATOM   3032 O O   . ASP B 1 202 ? -2.986  -27.000 -5.953  1.00 63.00  ? 416 ASP B O   1 
ATOM   3033 C CB  . ASP B 1 202 ? -5.381  -28.622 -7.323  1.00 60.63  ? 416 ASP B CB  1 
ATOM   3034 C CG  . ASP B 1 202 ? -6.297  -28.535 -8.508  1.00 65.26  ? 416 ASP B CG  1 
ATOM   3035 O OD1 . ASP B 1 202 ? -6.134  -27.612 -9.309  1.00 65.87  ? 416 ASP B OD1 1 
ATOM   3036 O OD2 . ASP B 1 202 ? -7.159  -29.398 -8.663  1.00 68.09  ? 416 ASP B OD2 1 
ATOM   3037 N N   . THR B 1 203 ? -2.405  -29.138 -6.022  1.00 56.37  ? 417 THR B N   1 
ATOM   3038 C CA  . THR B 1 203 ? -1.568  -29.015 -4.862  1.00 59.40  ? 417 THR B CA  1 
ATOM   3039 C C   . THR B 1 203 ? -0.093  -29.076 -5.142  1.00 60.65  ? 417 THR B C   1 
ATOM   3040 O O   . THR B 1 203 ? 0.691   -28.778 -4.282  1.00 65.07  ? 417 THR B O   1 
ATOM   3041 C CB  . THR B 1 203 ? -1.932  -30.057 -3.805  1.00 56.91  ? 417 THR B CB  1 
ATOM   3042 O OG1 . THR B 1 203 ? -1.634  -31.355 -4.283  1.00 51.94  ? 417 THR B OG1 1 
ATOM   3043 C CG2 . THR B 1 203 ? -3.365  -30.005 -3.547  1.00 57.51  ? 417 THR B CG2 1 
ATOM   3044 N N   . GLN B 1 204 ? 0.282   -29.456 -6.348  1.00 58.30  ? 418 GLN B N   1 
ATOM   3045 C CA  . GLN B 1 204 ? 1.673   -29.550 -6.713  1.00 57.35  ? 418 GLN B CA  1 
ATOM   3046 C C   . GLN B 1 204 ? 2.364   -30.721 -6.047  1.00 55.74  ? 418 GLN B C   1 
ATOM   3047 O O   . GLN B 1 204 ? 3.545   -30.894 -6.187  1.00 56.80  ? 418 GLN B O   1 
ATOM   3048 C CB  . GLN B 1 204 ? 2.406   -28.283 -6.315  1.00 63.76  ? 418 GLN B CB  1 
ATOM   3049 C CG  . GLN B 1 204 ? 1.737   -26.992 -6.714  1.00 71.24  ? 418 GLN B CG  1 
ATOM   3050 C CD  . GLN B 1 204 ? 2.022   -26.640 -8.136  1.00 74.26  ? 418 GLN B CD  1 
ATOM   3051 O OE1 . GLN B 1 204 ? 2.828   -27.285 -8.788  1.00 72.86  ? 418 GLN B OE1 1 
ATOM   3052 N NE2 . GLN B 1 204 ? 1.352   -25.625 -8.633  1.00 78.06  ? 418 GLN B NE2 1 
ATOM   3053 N N   . GLU B 1 205 ? 1.632   -31.542 -5.330  1.00 52.46  ? 419 GLU B N   1 
ATOM   3054 C CA  . GLU B 1 205 ? 2.240   -32.667 -4.658  1.00 51.75  ? 419 GLU B CA  1 
ATOM   3055 C C   . GLU B 1 205 ? 2.520   -33.826 -5.595  1.00 45.88  ? 419 GLU B C   1 
ATOM   3056 O O   . GLU B 1 205 ? 1.745   -34.117 -6.449  1.00 45.45  ? 419 GLU B O   1 
ATOM   3057 C CB  . GLU B 1 205 ? 1.417   -33.098 -3.450  1.00 56.90  ? 419 GLU B CB  1 
ATOM   3058 C CG  . GLU B 1 205 ? 0.156   -33.874 -3.750  1.00 62.48  ? 419 GLU B CG  1 
ATOM   3059 C CD  . GLU B 1 205 ? -0.937  -33.658 -2.715  1.00 67.50  ? 419 GLU B CD  1 
ATOM   3060 O OE1 . GLU B 1 205 ? -0.751  -34.041 -1.558  1.00 70.35  ? 419 GLU B OE1 1 
ATOM   3061 O OE2 . GLU B 1 205 ? -1.976  -33.100 -3.071  1.00 67.06  ? 419 GLU B OE2 1 
ATOM   3062 N N   . LEU B 1 206 ? 3.652   -34.470 -5.422  1.00 41.25  ? 420 LEU B N   1 
ATOM   3063 C CA  . LEU B 1 206 ? 4.031   -35.586 -6.277  1.00 39.94  ? 420 LEU B CA  1 
ATOM   3064 C C   . LEU B 1 206 ? 3.169   -36.810 -6.003  1.00 38.20  ? 420 LEU B C   1 
ATOM   3065 O O   . LEU B 1 206 ? 2.953   -37.179 -4.849  1.00 42.69  ? 420 LEU B O   1 
ATOM   3066 C CB  . LEU B 1 206 ? 5.505   -35.939 -6.076  1.00 39.57  ? 420 LEU B CB  1 
ATOM   3067 C CG  . LEU B 1 206 ? 5.960   -37.158 -6.875  1.00 40.59  ? 420 LEU B CG  1 
ATOM   3068 C CD1 . LEU B 1 206 ? 6.077   -36.813 -8.348  1.00 38.72  ? 420 LEU B CD1 1 
ATOM   3069 C CD2 . LEU B 1 206 ? 7.267   -37.684 -6.339  1.00 46.14  ? 420 LEU B CD2 1 
ATOM   3070 N N   . LEU B 1 207 ? 2.677   -37.438 -7.064  1.00 36.61  ? 421 LEU B N   1 
ATOM   3071 C CA  . LEU B 1 207 ? 1.879   -38.647 -6.915  1.00 36.65  ? 421 LEU B CA  1 
ATOM   3072 C C   . LEU B 1 207 ? 2.641   -39.871 -7.405  1.00 38.09  ? 421 LEU B C   1 
ATOM   3073 O O   . LEU B 1 207 ? 2.548   -40.950 -6.819  1.00 37.86  ? 421 LEU B O   1 
ATOM   3074 C CB  . LEU B 1 207 ? 0.558   -38.513 -7.670  1.00 31.79  ? 421 LEU B CB  1 
ATOM   3075 C CG  . LEU B 1 207 ? -0.332  -37.364 -7.196  1.00 34.40  ? 421 LEU B CG  1 
ATOM   3076 C CD1 . LEU B 1 207 ? -1.538  -37.215 -8.102  1.00 32.79  ? 421 LEU B CD1 1 
ATOM   3077 C CD2 . LEU B 1 207 ? -0.765  -37.590 -5.756  1.00 38.51  ? 421 LEU B CD2 1 
ATOM   3078 N N   . LEU B 1 208 ? 3.402   -39.694 -8.479  1.00 36.34  ? 422 LEU B N   1 
ATOM   3079 C CA  . LEU B 1 208 ? 4.099   -40.808 -9.103  1.00 34.83  ? 422 LEU B CA  1 
ATOM   3080 C C   . LEU B 1 208 ? 5.279   -40.323 -9.936  1.00 33.25  ? 422 LEU B C   1 
ATOM   3081 O O   . LEU B 1 208 ? 5.129   -39.449 -10.790 1.00 34.15  ? 422 LEU B O   1 
ATOM   3082 C CB  . LEU B 1 208 ? 3.133   -41.606 -9.978  1.00 38.26  ? 422 LEU B CB  1 
ATOM   3083 C CG  . LEU B 1 208 ? 3.449   -43.076 -10.241 1.00 39.97  ? 422 LEU B CG  1 
ATOM   3084 C CD1 . LEU B 1 208 ? 3.533   -43.838 -8.931  1.00 38.59  ? 422 LEU B CD1 1 
ATOM   3085 C CD2 . LEU B 1 208 ? 2.386   -43.680 -11.145 1.00 41.94  ? 422 LEU B CD2 1 
ATOM   3086 N N   . CYS B 1 209 ? 6.455   -40.887 -9.677  1.00 28.66  ? 423 CYS B N   1 
ATOM   3087 C CA  . CYS B 1 209 ? 7.634   -40.589 -10.478 1.00 28.37  ? 423 CYS B CA  1 
ATOM   3088 C C   . CYS B 1 209 ? 8.236   -41.878 -11.023 1.00 27.99  ? 423 CYS B C   1 
ATOM   3089 O O   . CYS B 1 209 ? 8.553   -42.796 -10.266 1.00 27.89  ? 423 CYS B O   1 
ATOM   3090 C CB  . CYS B 1 209 ? 8.676   -39.825 -9.660  1.00 28.70  ? 423 CYS B CB  1 
ATOM   3091 S SG  . CYS B 1 209 ? 10.217  -39.496 -10.558 1.00 31.77  ? 423 CYS B SG  1 
ATOM   3092 N N   . THR B 1 210 ? 8.393   -41.944 -12.339 1.00 25.04  ? 424 THR B N   1 
ATOM   3093 C CA  . THR B 1 210 ? 8.906   -43.151 -12.966 1.00 28.37  ? 424 THR B CA  1 
ATOM   3094 C C   . THR B 1 210 ? 10.136  -42.866 -13.818 1.00 28.24  ? 424 THR B C   1 
ATOM   3095 O O   . THR B 1 210 ? 10.099  -42.035 -14.725 1.00 26.45  ? 424 THR B O   1 
ATOM   3096 C CB  . THR B 1 210 ? 7.834   -43.827 -13.842 1.00 29.93  ? 424 THR B CB  1 
ATOM   3097 O OG1 . THR B 1 210 ? 6.604   -43.923 -13.110 1.00 31.80  ? 424 THR B OG1 1 
ATOM   3098 C CG2 . THR B 1 210 ? 8.287   -45.219 -14.250 1.00 28.76  ? 424 THR B CG2 1 
ATOM   3099 N N   . ALA B 1 211 ? 11.226  -43.562 -13.510 1.00 30.31  ? 425 ALA B N   1 
ATOM   3100 C CA  . ALA B 1 211 ? 12.439  -43.496 -14.311 1.00 29.34  ? 425 ALA B CA  1 
ATOM   3101 C C   . ALA B 1 211 ? 12.466  -44.661 -15.293 1.00 28.92  ? 425 ALA B C   1 
ATOM   3102 O O   . ALA B 1 211 ? 12.263  -45.810 -14.906 1.00 30.71  ? 425 ALA B O   1 
ATOM   3103 C CB  . ALA B 1 211 ? 13.677  -43.517 -13.416 1.00 29.51  ? 425 ALA B CB  1 
ATOM   3104 N N   . TYR B 1 212 ? 12.708  -44.363 -16.564 1.00 27.78  ? 426 TYR B N   1 
ATOM   3105 C CA  . TYR B 1 212 ? 12.760  -45.397 -17.590 1.00 25.63  ? 426 TYR B CA  1 
ATOM   3106 C C   . TYR B 1 212 ? 14.176  -45.570 -18.138 1.00 28.02  ? 426 TYR B C   1 
ATOM   3107 O O   . TYR B 1 212 ? 14.804  -44.599 -18.568 1.00 28.54  ? 426 TYR B O   1 
ATOM   3108 C CB  . TYR B 1 212 ? 11.804  -45.066 -18.738 1.00 29.32  ? 426 TYR B CB  1 
ATOM   3109 C CG  . TYR B 1 212 ? 10.343  -44.962 -18.346 1.00 31.43  ? 426 TYR B CG  1 
ATOM   3110 C CD1 . TYR B 1 212 ? 9.580   -46.101 -18.122 1.00 32.89  ? 426 TYR B CD1 1 
ATOM   3111 C CD2 . TYR B 1 212 ? 9.723   -43.726 -18.224 1.00 33.86  ? 426 TYR B CD2 1 
ATOM   3112 C CE1 . TYR B 1 212 ? 8.237   -46.010 -17.778 1.00 33.33  ? 426 TYR B CE1 1 
ATOM   3113 C CE2 . TYR B 1 212 ? 8.385   -43.624 -17.880 1.00 34.98  ? 426 TYR B CE2 1 
ATOM   3114 C CZ  . TYR B 1 212 ? 7.646   -44.768 -17.659 1.00 34.11  ? 426 TYR B CZ  1 
ATOM   3115 O OH  . TYR B 1 212 ? 6.315   -44.669 -17.316 1.00 31.42  ? 426 TYR B OH  1 
ATOM   3116 N N   . VAL B 1 213 ? 14.654  -46.801 -18.150 1.00 26.48  ? 427 VAL B N   1 
ATOM   3117 C CA  . VAL B 1 213 ? 15.942  -47.157 -18.725 1.00 29.42  ? 427 VAL B CA  1 
ATOM   3118 C C   . VAL B 1 213 ? 15.671  -48.170 -19.814 1.00 27.85  ? 427 VAL B C   1 
ATOM   3119 O O   . VAL B 1 213 ? 14.729  -48.893 -19.730 1.00 29.62  ? 427 VAL B O   1 
ATOM   3120 C CB  . VAL B 1 213 ? 16.965  -47.652 -17.714 1.00 32.18  ? 427 VAL B CB  1 
ATOM   3121 C CG1 . VAL B 1 213 ? 17.297  -46.551 -16.746 1.00 35.29  ? 427 VAL B CG1 1 
ATOM   3122 C CG2 . VAL B 1 213 ? 16.467  -48.868 -16.990 1.00 27.24  ? 427 VAL B CG2 1 
ATOM   3123 N N   . PHE B 1 214 ? 16.498  -48.213 -20.828 1.00 26.20  ? 428 PHE B N   1 
ATOM   3124 C CA  . PHE B 1 214 ? 16.255  -49.045 -21.964 1.00 25.98  ? 428 PHE B CA  1 
ATOM   3125 C C   . PHE B 1 214 ? 17.330  -49.961 -22.556 1.00 29.83  ? 428 PHE B C   1 
ATOM   3126 O O   . PHE B 1 214 ? 18.496  -49.696 -22.487 1.00 28.47  ? 428 PHE B O   1 
ATOM   3127 C CB  . PHE B 1 214 ? 15.849  -48.124 -23.095 1.00 29.00  ? 428 PHE B CB  1 
ATOM   3128 C CG  . PHE B 1 214 ? 14.626  -47.295 -22.832 1.00 28.64  ? 428 PHE B CG  1 
ATOM   3129 C CD1 . PHE B 1 214 ? 14.708  -46.067 -22.230 1.00 26.21  ? 428 PHE B CD1 1 
ATOM   3130 C CD2 . PHE B 1 214 ? 13.398  -47.722 -23.265 1.00 29.30  ? 428 PHE B CD2 1 
ATOM   3131 C CE1 . PHE B 1 214 ? 13.587  -45.319 -22.022 1.00 27.56  ? 428 PHE B CE1 1 
ATOM   3132 C CE2 . PHE B 1 214 ? 12.276  -46.971 -23.054 1.00 26.40  ? 428 PHE B CE2 1 
ATOM   3133 C CZ  . PHE B 1 214 ? 12.375  -45.771 -22.433 1.00 26.03  ? 428 PHE B CZ  1 
ATOM   3134 N N   . GLU B 1 215 ? 16.863  -51.028 -23.175 1.00 28.10  ? 429 GLU B N   1 
ATOM   3135 C CA  . GLU B 1 215 ? 17.674  -51.968 -23.902 1.00 31.39  ? 429 GLU B CA  1 
ATOM   3136 C C   . GLU B 1 215 ? 16.813  -52.411 -25.059 1.00 32.98  ? 429 GLU B C   1 
ATOM   3137 O O   . GLU B 1 215 ? 15.646  -52.189 -25.075 1.00 30.86  ? 429 GLU B O   1 
ATOM   3138 C CB  . GLU B 1 215 ? 18.090  -53.159 -23.066 1.00 34.04  ? 429 GLU B CB  1 
ATOM   3139 C CG  . GLU B 1 215 ? 19.305  -52.958 -22.212 1.00 37.86  ? 429 GLU B CG  1 
ATOM   3140 C CD  . GLU B 1 215 ? 19.760  -54.232 -21.520 1.00 43.12  ? 429 GLU B CD  1 
ATOM   3141 O OE1 . GLU B 1 215 ? 19.739  -55.295 -22.127 1.00 42.24  ? 429 GLU B OE1 1 
ATOM   3142 O OE2 . GLU B 1 215 ? 20.136  -54.164 -20.371 1.00 48.59  ? 429 GLU B OE2 1 
ATOM   3143 N N   . VAL B 1 216 ? 17.415  -53.056 -26.026 1.00 35.48  ? 430 VAL B N   1 
ATOM   3144 C CA  . VAL B 1 216 ? 16.688  -53.549 -27.166 1.00 36.86  ? 430 VAL B CA  1 
ATOM   3145 C C   . VAL B 1 216 ? 16.350  -55.024 -27.012 1.00 36.54  ? 430 VAL B C   1 
ATOM   3146 O O   . VAL B 1 216 ? 17.147  -55.773 -26.582 1.00 37.68  ? 430 VAL B O   1 
ATOM   3147 C CB  . VAL B 1 216 ? 17.469  -53.288 -28.441 1.00 43.41  ? 430 VAL B CB  1 
ATOM   3148 C CG1 . VAL B 1 216 ? 16.815  -53.951 -29.609 1.00 45.80  ? 430 VAL B CG1 1 
ATOM   3149 C CG2 . VAL B 1 216 ? 17.482  -51.813 -28.717 1.00 46.88  ? 430 VAL B CG2 1 
ATOM   3150 N N   . SER B 1 217 ? 15.148  -55.419 -27.364 1.00 35.30  ? 431 SER B N   1 
ATOM   3151 C CA  . SER B 1 217 ? 14.753  -56.817 -27.267 1.00 41.41  ? 431 SER B CA  1 
ATOM   3152 C C   . SER B 1 217 ? 15.307  -57.624 -28.437 1.00 47.96  ? 431 SER B C   1 
ATOM   3153 O O   . SER B 1 217 ? 15.445  -57.108 -29.547 1.00 52.78  ? 431 SER B O   1 
ATOM   3154 C CB  . SER B 1 217 ? 13.229  -56.941 -27.214 1.00 39.22  ? 431 SER B CB  1 
ATOM   3155 O OG  . SER B 1 217 ? 12.834  -58.299 -27.185 1.00 45.27  ? 431 SER B OG  1 
ATOM   3156 N N   . GLU B 1 220 ? 13.025  -61.811 -32.374 1.00 55.02  ? 434 GLU B N   1 
ATOM   3157 C CA  . GLU B 1 220 ? 11.783  -62.588 -32.353 1.00 59.04  ? 434 GLU B CA  1 
ATOM   3158 C C   . GLU B 1 220 ? 11.103  -62.468 -31.020 1.00 56.17  ? 434 GLU B C   1 
ATOM   3159 O O   . GLU B 1 220 ? 10.067  -63.043 -30.817 1.00 54.81  ? 434 GLU B O   1 
ATOM   3160 C CB  . GLU B 1 220 ? 12.058  -64.076 -32.587 1.00 65.28  ? 434 GLU B CB  1 
ATOM   3161 C CG  . GLU B 1 220 ? 12.568  -64.452 -33.954 1.00 68.87  ? 434 GLU B CG  1 
ATOM   3162 C CD  . GLU B 1 220 ? 12.887  -65.926 -34.096 1.00 74.36  ? 434 GLU B CD  1 
ATOM   3163 O OE1 . GLU B 1 220 ? 12.904  -66.669 -33.108 1.00 81.88  ? 434 GLU B OE1 1 
ATOM   3164 O OE2 . GLU B 1 220 ? 13.157  -66.317 -35.222 1.00 73.45  ? 434 GLU B OE2 1 
ATOM   3165 N N   . ARG B 1 221 ? 11.714  -61.730 -30.107 1.00 45.11  ? 435 ARG B N   1 
ATOM   3166 C CA  . ARG B 1 221 ? 11.179  -61.536 -28.779 1.00 42.85  ? 435 ARG B CA  1 
ATOM   3167 C C   . ARG B 1 221 ? 10.467  -60.192 -28.698 1.00 46.80  ? 435 ARG B C   1 
ATOM   3168 O O   . ARG B 1 221 ? 10.999  -59.184 -29.099 1.00 48.05  ? 435 ARG B O   1 
ATOM   3169 C CB  . ARG B 1 221 ? 12.285  -61.564 -27.760 1.00 41.64  ? 435 ARG B CB  1 
ATOM   3170 C CG  . ARG B 1 221 ? 12.989  -62.880 -27.597 1.00 52.31  ? 435 ARG B CG  1 
ATOM   3171 C CD  . ARG B 1 221 ? 13.937  -62.863 -26.416 1.00 51.62  ? 435 ARG B CD  1 
ATOM   3172 N NE  . ARG B 1 221 ? 13.260  -62.939 -25.137 1.00 49.46  ? 435 ARG B NE  1 
ATOM   3173 C CZ  . ARG B 1 221 ? 13.874  -63.091 -23.983 1.00 49.38  ? 435 ARG B CZ  1 
ATOM   3174 N NH1 . ARG B 1 221 ? 15.169  -63.191 -23.935 1.00 51.77  ? 435 ARG B NH1 1 
ATOM   3175 N NH2 . ARG B 1 221 ? 13.191  -63.144 -22.884 1.00 45.69  ? 435 ARG B NH2 1 
ATOM   3176 N N   . GLY B 1 222 ? 9.268   -60.178 -28.174 1.00 42.16  ? 436 GLY B N   1 
ATOM   3177 C CA  . GLY B 1 222 ? 8.540   -58.943 -28.059 1.00 41.33  ? 436 GLY B CA  1 
ATOM   3178 C C   . GLY B 1 222 ? 9.112   -58.041 -26.983 1.00 39.64  ? 436 GLY B C   1 
ATOM   3179 O O   . GLY B 1 222 ? 10.162  -58.275 -26.454 1.00 39.15  ? 436 GLY B O   1 
ATOM   3180 N N   . ALA B 1 223 ? 8.379   -57.002 -26.662 1.00 34.84  ? 437 ALA B N   1 
ATOM   3181 C CA  . ALA B 1 223 ? 8.785   -56.107 -25.629 1.00 32.38  ? 437 ALA B CA  1 
ATOM   3182 C C   . ALA B 1 223 ? 8.583   -56.701 -24.261 1.00 31.80  ? 437 ALA B C   1 
ATOM   3183 O O   . ALA B 1 223 ? 7.680   -57.434 -24.045 1.00 32.28  ? 437 ALA B O   1 
ATOM   3184 C CB  . ALA B 1 223 ? 8.008   -54.833 -25.749 1.00 34.28  ? 437 ALA B CB  1 
ATOM   3185 N N   . GLN B 1 224 ? 9.449   -56.355 -23.344 1.00 31.27  ? 438 GLN B N   1 
ATOM   3186 C CA  . GLN B 1 224 ? 9.326   -56.806 -21.993 1.00 31.85  ? 438 GLN B CA  1 
ATOM   3187 C C   . GLN B 1 224 ? 9.720   -55.673 -21.067 1.00 29.60  ? 438 GLN B C   1 
ATOM   3188 O O   . GLN B 1 224 ? 10.281  -54.715 -21.488 1.00 26.30  ? 438 GLN B O   1 
ATOM   3189 C CB  . GLN B 1 224 ? 10.223  -58.004 -21.727 1.00 36.59  ? 438 GLN B CB  1 
ATOM   3190 C CG  . GLN B 1 224 ? 9.704   -59.331 -22.231 1.00 48.46  ? 438 GLN B CG  1 
ATOM   3191 C CD  . GLN B 1 224 ? 10.430  -60.501 -21.592 1.00 49.76  ? 438 GLN B CD  1 
ATOM   3192 O OE1 . GLN B 1 224 ? 11.607  -60.660 -21.775 1.00 50.88  ? 438 GLN B OE1 1 
ATOM   3193 N NE2 . GLN B 1 224 ? 9.725   -61.279 -20.820 1.00 48.60  ? 438 GLN B NE2 1 
ATOM   3194 N N   . HIS B 1 225 ? 9.431   -55.831 -19.794 1.00 31.32  ? 439 HIS B N   1 
ATOM   3195 C CA  . HIS B 1 225 ? 9.745   -54.852 -18.807 1.00 30.34  ? 439 HIS B CA  1 
ATOM   3196 C C   . HIS B 1 225 ? 9.910   -55.453 -17.432 1.00 31.37  ? 439 HIS B C   1 
ATOM   3197 O O   . HIS B 1 225 ? 9.481   -56.525 -17.178 1.00 30.47  ? 439 HIS B O   1 
ATOM   3198 C CB  . HIS B 1 225 ? 8.654   -53.784 -18.785 1.00 32.22  ? 439 HIS B CB  1 
ATOM   3199 C CG  . HIS B 1 225 ? 7.318   -54.278 -18.334 1.00 35.34  ? 439 HIS B CG  1 
ATOM   3200 N ND1 . HIS B 1 225 ? 6.954   -54.309 -17.019 1.00 37.44  ? 439 HIS B ND1 1 
ATOM   3201 C CD2 . HIS B 1 225 ? 6.256   -54.738 -19.027 1.00 36.79  ? 439 HIS B CD2 1 
ATOM   3202 C CE1 . HIS B 1 225 ? 5.732   -54.778 -16.913 1.00 40.34  ? 439 HIS B CE1 1 
ATOM   3203 N NE2 . HIS B 1 225 ? 5.280   -55.029 -18.120 1.00 40.47  ? 439 HIS B NE2 1 
ATOM   3204 N N   . HIS B 1 226 ? 10.556  -54.719 -16.559 1.00 32.55  ? 440 HIS B N   1 
ATOM   3205 C CA  . HIS B 1 226 ? 10.750  -55.097 -15.194 1.00 35.40  ? 440 HIS B CA  1 
ATOM   3206 C C   . HIS B 1 226 ? 10.594  -53.850 -14.364 1.00 36.70  ? 440 HIS B C   1 
ATOM   3207 O O   . HIS B 1 226 ? 11.210  -52.874 -14.635 1.00 36.22  ? 440 HIS B O   1 
ATOM   3208 C CB  . HIS B 1 226 ? 12.104  -55.722 -14.961 1.00 35.04  ? 440 HIS B CB  1 
ATOM   3209 C CG  . HIS B 1 226 ? 12.221  -56.386 -13.631 1.00 39.19  ? 440 HIS B CG  1 
ATOM   3210 N ND1 . HIS B 1 226 ? 12.853  -57.588 -13.455 1.00 44.14  ? 440 HIS B ND1 1 
ATOM   3211 C CD2 . HIS B 1 226 ? 11.769  -56.023 -12.416 1.00 40.09  ? 440 HIS B CD2 1 
ATOM   3212 C CE1 . HIS B 1 226 ? 12.793  -57.931 -12.190 1.00 46.68  ? 440 HIS B CE1 1 
ATOM   3213 N NE2 . HIS B 1 226 ? 12.133  -57.001 -11.538 1.00 44.58  ? 440 HIS B NE2 1 
ATOM   3214 N N   . ILE B 1 227 ? 9.760   -53.904 -13.350 1.00 36.46  ? 441 ILE B N   1 
ATOM   3215 C CA  . ILE B 1 227 ? 9.469   -52.748 -12.515 1.00 34.89  ? 441 ILE B CA  1 
ATOM   3216 C C   . ILE B 1 227 ? 10.170  -52.858 -11.168 1.00 34.72  ? 441 ILE B C   1 
ATOM   3217 O O   . ILE B 1 227 ? 10.129  -53.902 -10.519 1.00 35.58  ? 441 ILE B O   1 
ATOM   3218 C CB  . ILE B 1 227 ? 7.953   -52.584 -12.285 1.00 36.68  ? 441 ILE B CB  1 
ATOM   3219 C CG1 . ILE B 1 227 ? 7.196   -52.695 -13.611 1.00 36.07  ? 441 ILE B CG1 1 
ATOM   3220 C CG2 . ILE B 1 227 ? 7.659   -51.256 -11.602 1.00 33.82  ? 441 ILE B CG2 1 
ATOM   3221 C CD1 . ILE B 1 227 ? 5.689   -52.663 -13.455 1.00 38.06  ? 441 ILE B CD1 1 
ATOM   3222 N N   . TYR B 1 228 ? 10.817  -51.773 -10.756 1.00 34.21  ? 442 TYR B N   1 
ATOM   3223 C CA  . TYR B 1 228 ? 11.518  -51.741 -9.482  1.00 35.82  ? 442 TYR B CA  1 
ATOM   3224 C C   . TYR B 1 228 ? 11.037  -50.585 -8.611  1.00 33.72  ? 442 TYR B C   1 
ATOM   3225 O O   . TYR B 1 228 ? 10.618  -49.547 -9.118  1.00 33.96  ? 442 TYR B O   1 
ATOM   3226 C CB  . TYR B 1 228 ? 13.029  -51.621 -9.699  1.00 37.53  ? 442 TYR B CB  1 
ATOM   3227 C CG  . TYR B 1 228 ? 13.658  -52.774 -10.451 1.00 41.88  ? 442 TYR B CG  1 
ATOM   3228 C CD1 . TYR B 1 228 ? 14.045  -53.932 -9.788  1.00 45.46  ? 442 TYR B CD1 1 
ATOM   3229 C CD2 . TYR B 1 228 ? 13.881  -52.697 -11.820 1.00 41.22  ? 442 TYR B CD2 1 
ATOM   3230 C CE1 . TYR B 1 228 ? 14.627  -54.986 -10.470 1.00 47.92  ? 442 TYR B CE1 1 
ATOM   3231 C CE2 . TYR B 1 228 ? 14.465  -53.746 -12.509 1.00 45.30  ? 442 TYR B CE2 1 
ATOM   3232 C CZ  . TYR B 1 228 ? 14.835  -54.887 -11.829 1.00 48.03  ? 442 TYR B CZ  1 
ATOM   3233 O OH  . TYR B 1 228 ? 15.413  -55.933 -12.510 1.00 51.98  ? 442 TYR B OH  1 
ATOM   3234 N N   . ARG B 1 229 ? 11.099  -50.773 -7.298  1.00 39.01  ? 443 ARG B N   1 
ATOM   3235 C CA  . ARG B 1 229 ? 10.887  -49.677 -6.364  1.00 41.50  ? 443 ARG B CA  1 
ATOM   3236 C C   . ARG B 1 229 ? 12.198  -48.924 -6.169  1.00 42.24  ? 443 ARG B C   1 
ATOM   3237 O O   . ARG B 1 229 ? 13.243  -49.536 -5.951  1.00 44.34  ? 443 ARG B O   1 
ATOM   3238 C CB  . ARG B 1 229 ? 10.366  -50.191 -5.020  1.00 45.26  ? 443 ARG B CB  1 
ATOM   3239 C CG  . ARG B 1 229 ? 8.990   -50.833 -5.082  1.00 45.91  ? 443 ARG B CG  1 
ATOM   3240 C CD  . ARG B 1 229 ? 8.594   -51.448 -3.744  1.00 50.47  ? 443 ARG B CD  1 
ATOM   3241 N NE  . ARG B 1 229 ? 9.434   -52.589 -3.385  1.00 54.47  ? 443 ARG B NE  1 
ATOM   3242 C CZ  . ARG B 1 229 ? 10.423  -52.545 -2.497  1.00 56.36  ? 443 ARG B CZ  1 
ATOM   3243 N NH1 . ARG B 1 229 ? 10.700  -51.414 -1.863  1.00 56.66  ? 443 ARG B NH1 1 
ATOM   3244 N NH2 . ARG B 1 229 ? 11.132  -53.635 -2.238  1.00 58.54  ? 443 ARG B NH2 1 
ATOM   3245 N N   . LEU B 1 230 ? 12.146  -47.600 -6.261  1.00 39.58  ? 444 LEU B N   1 
ATOM   3246 C CA  . LEU B 1 230 ? 13.327  -46.783 -6.009  1.00 38.93  ? 444 LEU B CA  1 
ATOM   3247 C C   . LEU B 1 230 ? 13.430  -46.432 -4.529  1.00 43.32  ? 444 LEU B C   1 
ATOM   3248 O O   . LEU B 1 230 ? 12.589  -45.706 -3.996  1.00 38.09  ? 444 LEU B O   1 
ATOM   3249 C CB  . LEU B 1 230 ? 13.297  -45.515 -6.860  1.00 37.21  ? 444 LEU B CB  1 
ATOM   3250 C CG  . LEU B 1 230 ? 13.624  -45.722 -8.339  1.00 34.07  ? 444 LEU B CG  1 
ATOM   3251 C CD1 . LEU B 1 230 ? 13.387  -44.446 -9.128  1.00 32.79  ? 444 LEU B CD1 1 
ATOM   3252 C CD2 . LEU B 1 230 ? 15.066  -46.187 -8.490  1.00 35.98  ? 444 LEU B CD2 1 
ATOM   3253 N N   . VAL B 1 231 ? 14.462  -46.962 -3.874  1.00 47.41  ? 445 VAL B N   1 
ATOM   3254 C CA  . VAL B 1 231 ? 14.695  -46.725 -2.451  1.00 50.05  ? 445 VAL B CA  1 
ATOM   3255 C C   . VAL B 1 231 ? 16.003  -45.970 -2.219  1.00 51.11  ? 445 VAL B C   1 
ATOM   3256 O O   . VAL B 1 231 ? 16.777  -45.750 -3.151  1.00 49.61  ? 445 VAL B O   1 
ATOM   3257 C CB  . VAL B 1 231 ? 14.738  -48.044 -1.658  1.00 50.20  ? 445 VAL B CB  1 
ATOM   3258 C CG1 . VAL B 1 231 ? 13.442  -48.818 -1.846  1.00 48.93  ? 445 VAL B CG1 1 
ATOM   3259 C CG2 . VAL B 1 231 ? 15.933  -48.880 -2.087  1.00 50.22  ? 445 VAL B CG2 1 
ATOM   3260 N N   . ARG B 1 232 ? 16.249  -45.579 -0.972  1.00 53.66  ? 446 ARG B N   1 
ATOM   3261 C CA  . ARG B 1 232 ? 17.477  -44.865 -0.632  1.00 59.42  ? 446 ARG B CA  1 
ATOM   3262 C C   . ARG B 1 232 ? 17.935  -45.169 0.792   1.00 63.11  ? 446 ARG B C   1 
ATOM   3263 O O   . ARG B 1 232 ? 17.126  -45.241 1.715   1.00 64.75  ? 446 ARG B O   1 
ATOM   3264 C CB  . ARG B 1 232 ? 17.285  -43.357 -0.813  1.00 59.18  ? 446 ARG B CB  1 
ATOM   3265 C CG  . ARG B 1 232 ? 18.569  -42.552 -0.670  1.00 59.78  ? 446 ARG B CG  1 
ATOM   3266 C CD  . ARG B 1 232 ? 18.431  -41.155 -1.260  1.00 57.49  ? 446 ARG B CD  1 
ATOM   3267 N NE  . ARG B 1 232 ? 17.608  -40.280 -0.432  1.00 60.18  ? 446 ARG B NE  1 
ATOM   3268 C CZ  . ARG B 1 232 ? 17.262  -39.041 -0.770  1.00 59.25  ? 446 ARG B CZ  1 
ATOM   3269 N NH1 . ARG B 1 232 ? 17.665  -38.530 -1.925  1.00 55.41  ? 446 ARG B NH1 1 
ATOM   3270 N NH2 . ARG B 1 232 ? 16.511  -38.314 0.045   1.00 60.23  ? 446 ARG B NH2 1 
HETATM 3271 O O   . HOH C 2 .   ? -17.005 -6.314  -19.142 1.00 61.01  ? 501 HOH A O   1 
HETATM 3272 O O   . HOH C 2 .   ? -7.522  -29.589 -24.145 1.00 53.62  ? 502 HOH A O   1 
HETATM 3273 O O   . HOH C 2 .   ? -9.758  -16.294 -33.273 1.00 47.57  ? 503 HOH A O   1 
HETATM 3274 O O   . HOH C 2 .   ? 17.654  -7.337  -17.451 1.00 46.51  ? 504 HOH A O   1 
HETATM 3275 O O   . HOH C 2 .   ? 8.257   -1.787  -17.881 1.00 55.54  ? 505 HOH A O   1 
HETATM 3276 O O   . HOH C 2 .   ? 1.353   -14.669 -50.143 1.00 62.34  ? 506 HOH A O   1 
HETATM 3277 O O   . HOH C 2 .   ? 5.346   -32.489 -28.070 1.00 48.54  ? 507 HOH A O   1 
HETATM 3278 O O   . HOH C 2 .   ? -6.773  -10.323 -35.910 1.00 44.22  ? 508 HOH A O   1 
HETATM 3279 O O   . HOH C 2 .   ? -1.496  -16.775 -26.462 1.00 41.41  ? 509 HOH A O   1 
HETATM 3280 O O   . HOH C 2 .   ? -11.463 -18.830 -15.981 1.00 44.80  ? 510 HOH A O   1 
HETATM 3281 O O   . HOH C 2 .   ? 19.816  -6.860  -16.760 1.00 62.40  ? 511 HOH A O   1 
HETATM 3282 O O   . HOH C 2 .   ? 5.707   -4.971  -20.682 1.00 38.75  ? 512 HOH A O   1 
HETATM 3283 O O   . HOH C 2 .   ? 18.154  -11.884 -28.615 1.00 35.39  ? 513 HOH A O   1 
HETATM 3284 O O   . HOH C 2 .   ? 0.450   -26.895 -32.587 1.00 57.47  ? 514 HOH A O   1 
HETATM 3285 O O   . HOH C 2 .   ? 3.062   -2.688  -34.236 1.00 49.28  ? 515 HOH A O   1 
HETATM 3286 O O   . HOH C 2 .   ? -3.157  -31.050 -21.138 1.00 47.36  ? 516 HOH A O   1 
HETATM 3287 O O   . HOH C 2 .   ? -15.400 -25.073 -27.221 1.00 37.63  ? 517 HOH A O   1 
HETATM 3288 O O   . HOH C 2 .   ? 18.221  -5.382  -25.513 1.00 41.14  ? 518 HOH A O   1 
HETATM 3289 O O   . HOH C 2 .   ? -15.946 -15.123 -28.863 1.00 53.70  ? 519 HOH A O   1 
HETATM 3290 O O   . HOH C 2 .   ? 18.583  -24.161 -11.630 1.00 46.33  ? 520 HOH A O   1 
HETATM 3291 O O   . HOH C 2 .   ? 19.129  -0.378  -15.038 1.00 56.75  ? 521 HOH A O   1 
HETATM 3292 O O   . HOH C 2 .   ? -0.554  -14.099 -27.313 1.00 43.79  ? 522 HOH A O   1 
HETATM 3293 O O   . HOH C 2 .   ? 14.404  -14.640 -29.296 0.65 16.26  ? 523 HOH A O   1 
HETATM 3294 O O   . HOH C 2 .   ? 5.230   -20.239 -47.299 1.00 69.50  ? 524 HOH A O   1 
HETATM 3295 O O   . HOH C 2 .   ? 2.439   -24.311 -29.492 1.00 51.91  ? 525 HOH A O   1 
HETATM 3296 O O   . HOH C 2 .   ? -22.625 -15.598 -25.786 1.00 34.84  ? 526 HOH A O   1 
HETATM 3297 O O   . HOH C 2 .   ? -7.757  -29.946 -28.101 1.00 48.39  ? 527 HOH A O   1 
HETATM 3298 O O   . HOH C 2 .   ? 32.617  -7.905  -22.682 1.00 44.30  ? 528 HOH A O   1 
HETATM 3299 O O   . HOH C 2 .   ? -1.506  -17.243 -28.917 1.00 28.93  ? 529 HOH A O   1 
HETATM 3300 O O   . HOH C 2 .   ? -21.692 -18.765 -26.729 1.00 39.91  ? 530 HOH A O   1 
HETATM 3301 O O   . HOH C 2 .   ? 6.859   -7.157  -21.142 1.00 39.74  ? 531 HOH A O   1 
HETATM 3302 O O   . HOH C 2 .   ? 23.461  -13.157 -34.852 1.00 60.66  ? 532 HOH A O   1 
HETATM 3303 O O   . HOH C 2 .   ? 17.327  -25.404 -18.788 1.00 41.21  ? 533 HOH A O   1 
HETATM 3304 O O   . HOH C 2 .   ? -2.968  -11.250 -37.391 1.00 52.70  ? 534 HOH A O   1 
HETATM 3305 O O   . HOH C 2 .   ? 14.540  -21.231 -31.317 1.00 34.93  ? 535 HOH A O   1 
HETATM 3306 O O   . HOH C 2 .   ? -4.978  -27.311 -17.835 1.00 51.02  ? 536 HOH A O   1 
HETATM 3307 O O   . HOH C 2 .   ? 25.758  -5.335  -22.770 1.00 37.74  ? 537 HOH A O   1 
HETATM 3308 O O   . HOH C 2 .   ? 22.789  -6.852  -27.683 1.00 33.78  ? 538 HOH A O   1 
HETATM 3309 O O   . HOH C 2 .   ? -11.385 -25.316 -16.985 1.00 48.69  ? 539 HOH A O   1 
HETATM 3310 O O   . HOH C 2 .   ? -3.969  -25.553 -29.129 1.00 36.42  ? 540 HOH A O   1 
HETATM 3311 O O   . HOH C 2 .   ? 13.883  -26.159 -37.086 1.00 53.30  ? 541 HOH A O   1 
HETATM 3312 O O   . HOH C 2 .   ? 8.459   -6.338  -11.973 1.00 47.01  ? 542 HOH A O   1 
HETATM 3313 O O   . HOH C 2 .   ? 12.886  -18.205 -41.668 1.00 56.63  ? 543 HOH A O   1 
HETATM 3314 O O   . HOH C 2 .   ? 18.787  -9.948  -30.711 1.00 43.99  ? 544 HOH A O   1 
HETATM 3315 O O   . HOH C 2 .   ? 0.201   -23.662 -22.265 1.00 39.80  ? 545 HOH A O   1 
HETATM 3316 O O   . HOH C 2 .   ? 2.934   -3.098  -29.426 1.00 41.36  ? 546 HOH A O   1 
HETATM 3317 O O   . HOH C 2 .   ? 13.954  -9.696  -33.484 1.00 57.49  ? 547 HOH A O   1 
HETATM 3318 O O   . HOH C 2 .   ? 18.095  -27.465 -29.436 1.00 52.49  ? 548 HOH A O   1 
HETATM 3319 O O   . HOH C 2 .   ? -14.733 -9.536  -25.512 1.00 58.12  ? 549 HOH A O   1 
HETATM 3320 O O   . HOH C 2 .   ? 9.398   -5.655  -14.646 1.00 55.75  ? 550 HOH A O   1 
HETATM 3321 O O   . HOH C 2 .   ? 20.100  -3.346  -15.675 1.00 52.92  ? 551 HOH A O   1 
HETATM 3322 O O   . HOH C 2 .   ? 12.595  -31.640 -30.850 1.00 56.39  ? 552 HOH A O   1 
HETATM 3323 O O   . HOH C 2 .   ? 7.667   -23.814 -40.399 1.00 48.46  ? 553 HOH A O   1 
HETATM 3324 O O   . HOH C 2 .   ? -8.830  -3.134  -21.009 1.00 65.77  ? 554 HOH A O   1 
HETATM 3325 O O   . HOH C 2 .   ? 25.486  -4.991  -19.559 1.00 39.07  ? 555 HOH A O   1 
HETATM 3326 O O   . HOH C 2 .   ? 11.755  0.171   -14.195 1.00 54.46  ? 556 HOH A O   1 
HETATM 3327 O O   . HOH C 2 .   ? 18.793  2.145   -19.248 1.00 47.87  ? 557 HOH A O   1 
HETATM 3328 O O   . HOH C 2 .   ? -0.624  -18.994 -18.173 1.00 41.87  ? 558 HOH A O   1 
HETATM 3329 O O   . HOH C 2 .   ? 16.776  -14.906 -6.356  1.00 56.72  ? 559 HOH A O   1 
HETATM 3330 O O   . HOH C 2 .   ? -22.650 -11.315 -16.404 1.00 54.88  ? 560 HOH A O   1 
HETATM 3331 O O   . HOH C 2 .   ? -6.418  -20.686 -13.043 1.00 61.24  ? 561 HOH A O   1 
HETATM 3332 O O   . HOH C 2 .   ? 18.143  -22.101 -24.647 1.00 39.21  ? 562 HOH A O   1 
HETATM 3333 O O   . HOH C 2 .   ? 9.888   -2.381  -35.634 1.00 58.94  ? 563 HOH A O   1 
HETATM 3334 O O   . HOH C 2 .   ? 20.103  -23.533 -13.404 1.00 49.28  ? 564 HOH A O   1 
HETATM 3335 O O   . HOH C 2 .   ? 20.522  -27.184 -15.341 1.00 66.31  ? 565 HOH A O   1 
HETATM 3336 O O   . HOH C 2 .   ? -5.491  -3.722  -33.782 1.00 52.81  ? 566 HOH A O   1 
HETATM 3337 O O   . HOH C 2 .   ? -7.947  -23.509 -38.069 1.00 57.85  ? 567 HOH A O   1 
HETATM 3338 O O   . HOH C 2 .   ? 14.737  -16.746 -6.978  1.00 66.69  ? 568 HOH A O   1 
HETATM 3339 O O   . HOH C 2 .   ? 20.022  -25.821 -25.980 1.00 51.00  ? 569 HOH A O   1 
HETATM 3340 O O   . HOH C 2 .   ? 5.763   -29.275 -14.592 1.00 54.47  ? 570 HOH A O   1 
HETATM 3341 O O   . HOH C 2 .   ? 5.629   -2.312  -23.225 1.00 45.75  ? 571 HOH A O   1 
HETATM 3342 O O   . HOH C 2 .   ? 11.439  -30.034 -33.127 1.00 37.83  ? 572 HOH A O   1 
HETATM 3343 O O   . HOH C 2 .   ? 14.765  -14.520 -31.830 0.50 25.50  ? 573 HOH A O   1 
HETATM 3344 O O   . HOH C 2 .   ? -3.881  -1.614  -21.227 1.00 63.59  ? 574 HOH A O   1 
HETATM 3345 O O   . HOH C 2 .   ? -4.451  -8.758  -37.189 1.00 56.09  ? 575 HOH A O   1 
HETATM 3346 O O   . HOH C 2 .   ? -11.185 -30.122 -19.196 1.00 56.36  ? 576 HOH A O   1 
HETATM 3347 O O   . HOH C 2 .   ? -7.803  -4.875  -33.519 1.00 57.84  ? 577 HOH A O   1 
HETATM 3348 O O   . HOH C 2 .   ? 8.870   -30.736 -33.769 1.00 55.55  ? 578 HOH A O   1 
HETATM 3349 O O   . HOH C 2 .   ? -12.979 -28.638 -18.677 1.00 62.69  ? 579 HOH A O   1 
HETATM 3350 O O   . HOH C 2 .   ? 12.123  -10.611 -34.906 1.00 58.95  ? 580 HOH A O   1 
HETATM 3351 O O   . HOH D 2 .   ? -7.433  -46.629 -7.162  1.00 53.95  ? 501 HOH B O   1 
HETATM 3352 O O   . HOH D 2 .   ? 12.253  -60.027 -33.855 1.00 58.73  ? 502 HOH B O   1 
HETATM 3353 O O   . HOH D 2 .   ? -14.187 -47.802 -16.258 1.00 52.21  ? 503 HOH B O   1 
HETATM 3354 O O   . HOH D 2 .   ? 14.047  -29.897 -23.030 1.00 48.79  ? 504 HOH B O   1 
HETATM 3355 O O   . HOH D 2 .   ? 3.651   -42.243 -15.263 1.00 33.92  ? 505 HOH B O   1 
HETATM 3356 O O   . HOH D 2 .   ? 5.412   -41.669 -13.145 1.00 28.60  ? 506 HOH B O   1 
HETATM 3357 O O   . HOH D 2 .   ? 0.914   -41.126 -4.587  1.00 40.79  ? 507 HOH B O   1 
HETATM 3358 O O   . HOH D 2 .   ? 13.945  -55.647 -31.020 1.00 42.42  ? 508 HOH B O   1 
HETATM 3359 O O   . HOH D 2 .   ? 9.335   -35.142 -15.982 1.00 42.45  ? 509 HOH B O   1 
HETATM 3360 O O   . HOH D 2 .   ? -9.599  -38.851 -18.189 1.00 45.22  ? 510 HOH B O   1 
HETATM 3361 O O   . HOH D 2 .   ? 21.429  -40.420 -25.918 1.00 32.35  ? 511 HOH B O   1 
HETATM 3362 O O   . HOH D 2 .   ? 19.260  -56.364 -25.110 1.00 36.59  ? 512 HOH B O   1 
HETATM 3363 O O   . HOH D 2 .   ? 24.041  -55.753 -25.675 1.00 55.46  ? 513 HOH B O   1 
HETATM 3364 O O   . HOH D 2 .   ? -16.194 -45.019 -19.574 1.00 45.27  ? 514 HOH B O   1 
HETATM 3365 O O   . HOH D 2 .   ? 17.182  -63.420 -25.661 1.00 53.30  ? 515 HOH B O   1 
HETATM 3366 O O   . HOH D 2 .   ? 29.895  -50.232 -27.534 1.00 45.30  ? 516 HOH B O   1 
HETATM 3367 O O   . HOH D 2 .   ? 21.454  -50.173 -22.821 1.00 37.49  ? 517 HOH B O   1 
HETATM 3368 O O   . HOH D 2 .   ? 17.460  -62.982 -22.534 1.00 49.62  ? 518 HOH B O   1 
HETATM 3369 O O   . HOH D 2 .   ? 23.354  -42.405 -26.871 1.00 32.38  ? 519 HOH B O   1 
HETATM 3370 O O   . HOH D 2 .   ? 4.061   -47.354 -3.722  1.00 38.29  ? 520 HOH B O   1 
HETATM 3371 O O   . HOH D 2 .   ? 19.128  -52.905 -37.640 1.00 50.40  ? 521 HOH B O   1 
HETATM 3372 O O   . HOH D 2 .   ? 18.604  -46.425 -20.709 1.00 28.17  ? 522 HOH B O   1 
HETATM 3373 O O   . HOH D 2 .   ? 3.628   -36.205 -20.688 1.00 45.73  ? 523 HOH B O   1 
HETATM 3374 O O   . HOH D 2 .   ? -2.148  -48.345 -23.825 1.00 49.68  ? 524 HOH B O   1 
HETATM 3375 O O   . HOH D 2 .   ? 3.972   -33.224 -13.299 1.00 40.65  ? 525 HOH B O   1 
HETATM 3376 O O   . HOH D 2 .   ? 0.618   -46.537 -1.386  1.00 48.12  ? 526 HOH B O   1 
HETATM 3377 O O   . HOH D 2 .   ? 3.294   -54.809 -12.313 1.00 44.53  ? 527 HOH B O   1 
HETATM 3378 O O   . HOH D 2 .   ? 8.084   -47.173 -4.587  1.00 47.52  ? 528 HOH B O   1 
HETATM 3379 O O   . HOH D 2 .   ? 22.681  -35.037 -15.660 1.00 63.15  ? 529 HOH B O   1 
HETATM 3380 O O   . HOH D 2 .   ? 4.587   -57.962 -7.720  1.00 54.50  ? 530 HOH B O   1 
HETATM 3381 O O   . HOH D 2 .   ? 6.050   -55.546 -22.135 1.00 48.24  ? 531 HOH B O   1 
HETATM 3382 O O   . HOH D 2 .   ? 10.400  -56.447 -9.179  0.69 38.75  ? 532 HOH B O   1 
HETATM 3383 O O   . HOH D 2 .   ? 0.091   -40.535 -22.693 1.00 33.38  ? 533 HOH B O   1 
HETATM 3384 O O   . HOH D 2 .   ? -11.022 -48.196 -19.293 1.00 44.69  ? 534 HOH B O   1 
HETATM 3385 O O   . HOH D 2 .   ? 20.190  -40.072 -20.444 1.00 30.26  ? 535 HOH B O   1 
HETATM 3386 O O   . HOH D 2 .   ? 4.588   -44.773 -14.910 1.00 37.02  ? 536 HOH B O   1 
HETATM 3387 O O   . HOH D 2 .   ? 31.232  -54.673 -34.813 1.00 58.75  ? 537 HOH B O   1 
HETATM 3388 O O   . HOH D 2 .   ? -4.346  -46.589 -26.884 1.00 42.31  ? 538 HOH B O   1 
HETATM 3389 O O   . HOH D 2 .   ? 15.379  -56.215 -4.638  1.00 60.11  ? 539 HOH B O   1 
HETATM 3390 O O   . HOH D 2 .   ? -2.932  -43.905 -37.545 1.00 42.42  ? 540 HOH B O   1 
HETATM 3391 O O   . HOH D 2 .   ? 2.428   -55.794 -18.986 1.00 46.08  ? 541 HOH B O   1 
HETATM 3392 O O   . HOH D 2 .   ? 20.621  -35.608 -28.655 1.00 43.18  ? 542 HOH B O   1 
HETATM 3393 O O   . HOH D 2 .   ? 5.469   -34.080 -3.228  1.00 46.30  ? 543 HOH B O   1 
HETATM 3394 O O   . HOH D 2 .   ? -5.647  -47.587 -21.905 1.00 44.19  ? 544 HOH B O   1 
HETATM 3395 O O   . HOH D 2 .   ? 23.008  -35.895 -27.101 1.00 53.63  ? 545 HOH B O   1 
HETATM 3396 O O   . HOH D 2 .   ? 7.303   -62.312 -28.185 1.00 57.99  ? 546 HOH B O   1 
HETATM 3397 O O   . HOH D 2 .   ? 3.444   -39.647 -35.756 1.00 47.60  ? 547 HOH B O   1 
HETATM 3398 O O   . HOH D 2 .   ? -8.681  -49.873 -39.539 1.00 47.56  ? 548 HOH B O   1 
HETATM 3399 O O   . HOH D 2 .   ? 6.209   -55.817 -29.318 1.00 40.90  ? 549 HOH B O   1 
HETATM 3400 O O   . HOH D 2 .   ? 6.015   -45.291 -40.236 1.00 56.99  ? 550 HOH B O   1 
HETATM 3401 O O   . HOH D 2 .   ? -3.942  -38.329 -31.794 1.00 46.82  ? 551 HOH B O   1 
HETATM 3402 O O   . HOH D 2 .   ? 6.671   -49.068 -2.197  1.00 52.87  ? 552 HOH B O   1 
HETATM 3403 O O   . HOH D 2 .   ? 12.411  -58.307 -31.547 1.00 62.38  ? 553 HOH B O   1 
HETATM 3404 O O   . HOH D 2 .   ? 7.665   -58.186 -19.415 1.00 42.66  ? 554 HOH B O   1 
HETATM 3405 O O   . HOH D 2 .   ? 3.557   -55.259 -31.073 1.00 41.00  ? 555 HOH B O   1 
HETATM 3406 O O   . HOH D 2 .   ? 7.479   -53.563 -22.737 1.00 31.62  ? 556 HOH B O   1 
HETATM 3407 O O   . HOH D 2 .   ? 1.681   -40.256 -18.967 1.00 52.08  ? 557 HOH B O   1 
HETATM 3408 O O   . HOH D 2 .   ? -1.310  -44.633 -39.554 1.00 50.28  ? 558 HOH B O   1 
HETATM 3409 O O   . HOH D 2 .   ? 25.057  -57.310 -31.702 1.00 46.99  ? 559 HOH B O   1 
HETATM 3410 O O   . HOH D 2 .   ? 19.273  -39.751 -27.677 1.00 29.60  ? 560 HOH B O   1 
HETATM 3411 O O   . HOH D 2 .   ? 20.624  -45.111 -38.845 1.00 44.16  ? 561 HOH B O   1 
HETATM 3412 O O   . HOH D 2 .   ? -2.984  -46.673 -21.771 1.00 51.27  ? 562 HOH B O   1 
HETATM 3413 O O   . HOH D 2 .   ? -5.843  -36.546 -23.032 1.00 56.98  ? 563 HOH B O   1 
HETATM 3414 O O   . HOH D 2 .   ? -7.419  -39.459 -24.168 1.00 40.67  ? 564 HOH B O   1 
HETATM 3415 O O   . HOH D 2 .   ? 7.936   -56.295 -12.969 1.00 41.16  ? 565 HOH B O   1 
HETATM 3416 O O   . HOH D 2 .   ? 5.632   -55.037 3.212   1.00 55.18  ? 566 HOH B O   1 
HETATM 3417 O O   . HOH D 2 .   ? 16.309  -37.424 -32.710 1.00 43.77  ? 567 HOH B O   1 
HETATM 3418 O O   . HOH D 2 .   ? -16.944 -41.648 -18.691 1.00 39.31  ? 568 HOH B O   1 
HETATM 3419 O O   . HOH D 2 .   ? 10.595  -33.029 -30.608 1.00 42.08  ? 569 HOH B O   1 
HETATM 3420 O O   . HOH D 2 .   ? 25.287  -36.874 -15.408 1.00 62.46  ? 570 HOH B O   1 
HETATM 3421 O O   . HOH D 2 .   ? 26.010  -52.422 -25.194 1.00 38.26  ? 571 HOH B O   1 
HETATM 3422 O O   . HOH D 2 .   ? -3.316  -51.034 -11.536 1.00 50.10  ? 572 HOH B O   1 
HETATM 3423 O O   . HOH D 2 .   ? 16.967  -35.811 -37.582 1.00 52.62  ? 573 HOH B O   1 
HETATM 3424 O O   . HOH D 2 .   ? 22.548  -57.715 -34.197 1.00 51.65  ? 574 HOH B O   1 
HETATM 3425 O O   . HOH D 2 .   ? 18.845  -31.197 -17.800 1.00 48.82  ? 575 HOH B O   1 
HETATM 3426 O O   . HOH D 2 .   ? 27.555  -47.457 -23.748 1.00 46.66  ? 576 HOH B O   1 
HETATM 3427 O O   . HOH D 2 .   ? -3.910  -40.073 -34.373 1.00 56.99  ? 577 HOH B O   1 
HETATM 3428 O O   . HOH D 2 .   ? 19.691  -43.081 -40.487 1.00 55.86  ? 578 HOH B O   1 
HETATM 3429 O O   . HOH D 2 .   ? -4.326  -34.923 0.886   1.00 55.12  ? 579 HOH B O   1 
HETATM 3430 O O   . HOH D 2 .   ? 2.664   -48.134 -1.683  1.00 43.89  ? 580 HOH B O   1 
HETATM 3431 O O   . HOH D 2 .   ? 20.480  -56.529 -34.707 1.00 60.23  ? 581 HOH B O   1 
HETATM 3432 O O   . HOH D 2 .   ? 23.179  -52.153 -21.966 1.00 54.69  ? 582 HOH B O   1 
HETATM 3433 O O   . HOH D 2 .   ? 8.764   -57.959 -10.197 1.00 57.00  ? 583 HOH B O   1 
HETATM 3434 O O   . HOH D 2 .   ? -0.173  -42.016 -40.827 1.00 58.91  ? 584 HOH B O   1 
HETATM 3435 O O   . HOH D 2 .   ? 25.340  -40.892 -18.172 1.00 63.85  ? 585 HOH B O   1 
HETATM 3436 O O   . HOH D 2 .   ? 25.606  -43.287 -17.514 1.00 64.59  ? 586 HOH B O   1 
HETATM 3437 O O   . HOH D 2 .   ? 1.545   -56.379 -30.153 1.00 53.76  ? 587 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 8   ? 0.9795 0.6471 1.1815 -0.0466 -0.3382 0.1738  222 GLY A N   
2    C CA  . GLY A 8   ? 0.8586 0.6081 1.0670 -0.0284 -0.2772 0.1380  222 GLY A CA  
3    C C   . GLY A 8   ? 0.7648 0.5805 0.9316 -0.0395 -0.2098 0.1597  222 GLY A C   
4    O O   . GLY A 8   ? 0.7833 0.5914 0.9191 -0.0539 -0.2070 0.1944  222 GLY A O   
5    N N   . LEU A 9   ? 0.6495 0.5264 0.8138 -0.0307 -0.1624 0.1374  223 LEU A N   
6    C CA  . LEU A 9   ? 0.5700 0.4974 0.6957 -0.0365 -0.1113 0.1517  223 LEU A CA  
7    C C   . LEU A 9   ? 0.5158 0.4716 0.6468 -0.0129 -0.0969 0.1215  223 LEU A C   
8    O O   . LEU A 9   ? 0.4749 0.4726 0.6234 0.0012  -0.0811 0.0862  223 LEU A O   
9    C CB  . LEU A 9   ? 0.5196 0.4877 0.6349 -0.0430 -0.0777 0.1480  223 LEU A CB  
10   C CG  . LEU A 9   ? 0.5185 0.5224 0.5900 -0.0547 -0.0438 0.1733  223 LEU A CG  
11   C CD1 . LEU A 9   ? 0.5168 0.5505 0.5858 -0.0599 -0.0248 0.1677  223 LEU A CD1 
12   C CD2 . LEU A 9   ? 0.4797 0.5009 0.5294 -0.0388 -0.0248 0.1613  223 LEU A CD2 
13   N N   . GLY A 10  ? 0.4972 0.4379 0.6114 -0.0129 -0.1032 0.1381  224 GLY A N   
14   C CA  . GLY A 10  ? 0.4855 0.4547 0.6042 0.0024  -0.0920 0.1161  224 GLY A CA  
15   C C   . GLY A 10  ? 0.5350 0.4722 0.6490 0.0076  -0.1163 0.1279  224 GLY A C   
16   O O   . GLY A 10  ? 0.6097 0.4987 0.7144 -0.0016 -0.1452 0.1547  224 GLY A O   
17   N N   . THR A 11  ? 0.4954 0.4601 0.6137 0.0174  -0.1078 0.1116  225 THR A N   
18   C CA  . THR A 11  ? 0.4810 0.4200 0.5988 0.0262  -0.1317 0.1163  225 THR A CA  
19   C C   . THR A 11  ? 0.4897 0.4606 0.6596 0.0488  -0.1494 0.0704  225 THR A C   
20   O O   . THR A 11  ? 0.4554 0.4715 0.6602 0.0587  -0.1451 0.0349  225 THR A O   
21   C CB  . THR A 11  ? 0.4825 0.4293 0.5606 0.0197  -0.1135 0.1357  225 THR A CB  
22   O OG1 . THR A 11  ? 0.4471 0.4413 0.5380 0.0177  -0.0952 0.1151  225 THR A OG1 
23   C CG2 . THR A 11  ? 0.5145 0.4575 0.5452 0.0067  -0.0945 0.1660  225 THR A CG2 
24   N N   . ALA A 12  ? 0.4966 0.4558 0.6725 0.0594  -0.1698 0.0670  226 ALA A N   
25   C CA  . ALA A 12  ? 0.4934 0.5019 0.7223 0.0832  -0.1867 0.0187  226 ALA A CA  
26   C C   . ALA A 12  ? 0.4431 0.5463 0.6840 0.0701  -0.1494 0.0023  226 ALA A C   
27   O O   . ALA A 12  ? 0.4461 0.6315 0.7351 0.0840  -0.1516 -0.0426 226 ALA A O   
28   C CB  . ALA A 12  ? 0.4873 0.4582 0.7177 0.0963  -0.2200 0.0215  226 ALA A CB  
29   N N   . ARG A 13  ? 0.3881 0.4851 0.5846 0.0425  -0.1204 0.0382  227 ARG A N   
30   C CA  . ARG A 13  ? 0.4452 0.6135 0.6431 0.0186  -0.0959 0.0365  227 ARG A CA  
31   C C   . ARG A 13  ? 0.4364 0.6467 0.6287 0.0033  -0.0696 0.0339  227 ARG A C   
32   O O   . ARG A 13  ? 0.3284 0.6214 0.5335 -0.0174 -0.0540 0.0245  227 ARG A O   
33   C CB  . ARG A 13  ? 0.4611 0.5870 0.6134 -0.0005 -0.0950 0.0731  227 ARG A CB  
34   C CG  . ARG A 13  ? 0.5154 0.6143 0.6725 0.0113  -0.1201 0.0740  227 ARG A CG  
35   C CD  . ARG A 13  ? 0.5509 0.6190 0.6683 -0.0057 -0.1251 0.1010  227 ARG A CD  
36   N NE  . ARG A 13  ? 0.5549 0.6789 0.6821 -0.0401 -0.1184 0.1043  227 ARG A NE  
37   C CZ  . ARG A 13  ? 0.6042 0.6994 0.7021 -0.0618 -0.1342 0.1271  227 ARG A CZ  
38   N NH1 . ARG A 13  ? 0.6338 0.6531 0.6929 -0.0428 -0.1548 0.1387  227 ARG A NH1 
39   N NH2 . ARG A 13  ? 0.6343 0.7792 0.7399 -0.1040 -0.1348 0.1385  227 ARG A NH2 
40   N N   . LEU A 14  ? 0.4049 0.5647 0.5759 0.0088  -0.0658 0.0455  228 LEU A N   
41   C CA  . LEU A 14  ? 0.3581 0.5484 0.5196 -0.0037 -0.0432 0.0441  228 LEU A CA  
42   C C   . LEU A 14  ? 0.3354 0.4833 0.4991 0.0112  -0.0497 0.0410  228 LEU A C   
43   O O   . LEU A 14  ? 0.3509 0.4324 0.4911 0.0120  -0.0596 0.0674  228 LEU A O   
44   C CB  . LEU A 14  ? 0.3945 0.5626 0.5056 -0.0303 -0.0292 0.0791  228 LEU A CB  
45   C CG  . LEU A 14  ? 0.3864 0.5851 0.4828 -0.0468 -0.0101 0.0802  228 LEU A CG  
46   C CD1 . LEU A 14  ? 0.3737 0.6712 0.4941 -0.0666 0.0000  0.0628  228 LEU A CD1 
47   C CD2 . LEU A 14  ? 0.3554 0.5029 0.3987 -0.0620 -0.0109 0.1117  228 LEU A CD2 
48   N N   . GLN A 15  ? 0.3282 0.5232 0.5200 0.0203  -0.0462 0.0090  229 GLN A N   
49   C CA  . GLN A 15  ? 0.3491 0.5022 0.5483 0.0323  -0.0598 0.0039  229 GLN A CA  
50   C C   . GLN A 15  ? 0.3510 0.5385 0.5381 0.0220  -0.0354 0.0000  229 GLN A C   
51   O O   . GLN A 15  ? 0.3505 0.6176 0.5450 0.0173  -0.0178 -0.0214 229 GLN A O   
52   C CB  . GLN A 15  ? 0.4290 0.5856 0.6803 0.0662  -0.0987 -0.0420 229 GLN A CB  
53   C CG  . GLN A 15  ? 0.5215 0.6421 0.7874 0.0804  -0.1311 -0.0434 229 GLN A CG  
54   C CD  . GLN A 15  ? 0.5891 0.7984 0.8831 0.0903  -0.1233 -0.0766 229 GLN A CD  
55   O OE1 . GLN A 15  ? 0.6411 0.9471 0.9701 0.1057  -0.1173 -0.1245 229 GLN A OE1 
56   N NE2 . GLN A 15  ? 0.6016 0.7902 0.8807 0.0804  -0.1240 -0.0524 229 GLN A NE2 
57   N N   . LEU A 16  ? 0.3665 0.5024 0.5335 0.0148  -0.0351 0.0228  230 LEU A N   
58   C CA  . LEU A 16  ? 0.4173 0.5773 0.5778 0.0102  -0.0192 0.0147  230 LEU A CA  
59   C C   . LEU A 16  ? 0.4298 0.6086 0.6357 0.0360  -0.0431 -0.0308 230 LEU A C   
60   O O   . LEU A 16  ? 0.4659 0.5900 0.6960 0.0496  -0.0803 -0.0360 230 LEU A O   
61   C CB  . LEU A 16  ? 0.4594 0.5704 0.5886 -0.0046 -0.0130 0.0502  230 LEU A CB  
62   C CG  . LEU A 16  ? 0.4544 0.5821 0.5774 -0.0082 -0.0005 0.0428  230 LEU A CG  
63   C CD1 . LEU A 16  ? 0.3812 0.5490 0.4728 -0.0197 0.0241  0.0444  230 LEU A CD1 
64   C CD2 . LEU A 16  ? 0.4999 0.5896 0.6077 -0.0198 -0.0025 0.0719  230 LEU A CD2 
65   N N   . VAL A 17  ? 0.3205 0.5766 0.5358 0.0426  -0.0281 -0.0643 231 VAL A N   
66   C CA  . VAL A 17  ? 0.3721 0.6611 0.6311 0.0765  -0.0542 -0.1202 231 VAL A CA  
67   C C   . VAL A 17  ? 0.3480 0.6229 0.5988 0.0747  -0.0518 -0.1224 231 VAL A C   
68   O O   . VAL A 17  ? 0.3799 0.6134 0.6603 0.0962  -0.0896 -0.1463 231 VAL A O   
69   C CB  . VAL A 17  ? 0.3910 0.8068 0.6726 0.0919  -0.0421 -0.1688 231 VAL A CB  
70   C CG1 . VAL A 17  ? 0.4552 0.9257 0.7766 0.1336  -0.0668 -0.2365 231 VAL A CG1 
71   C CG2 . VAL A 17  ? 0.3360 0.7670 0.6410 0.1023  -0.0558 -0.1788 231 VAL A CG2 
72   N N   . GLU A 18  ? 0.3166 0.6181 0.5270 0.0485  -0.0149 -0.0968 232 GLU A N   
73   C CA  . GLU A 18  ? 0.3341 0.6253 0.5340 0.0462  -0.0112 -0.0980 232 GLU A CA  
74   C C   . GLU A 18  ? 0.3629 0.6330 0.5113 0.0146  0.0177  -0.0512 232 GLU A C   
75   O O   . GLU A 18  ? 0.3528 0.6472 0.4702 -0.0047 0.0370  -0.0307 232 GLU A O   
76   C CB  . GLU A 18  ? 0.3909 0.7756 0.6061 0.0669  -0.0082 -0.1506 232 GLU A CB  
77   C CG  . GLU A 18  ? 0.5238 0.8901 0.7438 0.0779  -0.0200 -0.1677 232 GLU A CG  
78   C CD  . GLU A 18  ? 0.6059 1.0632 0.8531 0.1134  -0.0316 -0.2353 232 GLU A CD  
79   O OE1 . GLU A 18  ? 0.6383 1.0863 0.8909 0.1268  -0.0448 -0.2564 232 GLU A OE1 
80   O OE2 . GLU A 18  ? 0.6447 1.1930 0.9097 0.1300  -0.0289 -0.2712 232 GLU A OE2 
81   N N   . PHE A 19  ? 0.3484 0.5723 0.4901 0.0100  0.0134  -0.0364 233 PHE A N   
82   C CA  . PHE A 19  ? 0.3592 0.5674 0.4576 -0.0093 0.0325  -0.0044 233 PHE A CA  
83   C C   . PHE A 19  ? 0.3895 0.5915 0.4925 -0.0059 0.0284  -0.0140 233 PHE A C   
84   O O   . PHE A 19  ? 0.3967 0.5695 0.5319 -0.0007 0.0073  -0.0190 233 PHE A O   
85   C CB  . PHE A 19  ? 0.3531 0.5151 0.4360 -0.0199 0.0321  0.0322  233 PHE A CB  
86   C CG  . PHE A 19  ? 0.3954 0.5477 0.4396 -0.0282 0.0430  0.0526  233 PHE A CG  
87   C CD1 . PHE A 19  ? 0.4051 0.5593 0.4093 -0.0344 0.0490  0.0621  233 PHE A CD1 
88   C CD2 . PHE A 19  ? 0.4277 0.5710 0.4771 -0.0300 0.0403  0.0607  233 PHE A CD2 
89   C CE1 . PHE A 19  ? 0.4184 0.5558 0.3880 -0.0331 0.0464  0.0721  233 PHE A CE1 
90   C CE2 . PHE A 19  ? 0.4378 0.5854 0.4561 -0.0290 0.0463  0.0688  233 PHE A CE2 
91   C CZ  . PHE A 19  ? 0.4452 0.5849 0.4234 -0.0259 0.0466  0.0709  233 PHE A CZ  
92   N N   . SER A 20  ? 0.3838 0.6085 0.4538 -0.0119 0.0424  -0.0139 234 SER A N   
93   C CA  . SER A 20  ? 0.4273 0.6484 0.4999 -0.0074 0.0380  -0.0247 234 SER A CA  
94   C C   . SER A 20  ? 0.4255 0.6440 0.4503 -0.0173 0.0481  -0.0086 234 SER A C   
95   O O   . SER A 20  ? 0.4469 0.6759 0.4339 -0.0291 0.0540  0.0034  234 SER A O   
96   C CB  . SER A 20  ? 0.4448 0.7081 0.5418 0.0105  0.0293  -0.0677 234 SER A CB  
97   O OG  . SER A 20  ? 0.4733 0.7989 0.5403 0.0052  0.0453  -0.0768 234 SER A OG  
98   N N   . ALA A 21  ? 0.4183 0.6207 0.4458 -0.0143 0.0432  -0.0076 235 ALA A N   
99   C CA  . ALA A 21  ? 0.3804 0.5780 0.3681 -0.0150 0.0429  -0.0033 235 ALA A CA  
100  C C   . ALA A 21  ? 0.3626 0.5761 0.3643 -0.0068 0.0373  -0.0278 235 ALA A C   
101  O O   . ALA A 21  ? 0.3440 0.5556 0.3884 -0.0021 0.0295  -0.0382 235 ALA A O   
102  C CB  . ALA A 21  ? 0.3391 0.5182 0.3179 -0.0121 0.0397  0.0123  235 ALA A CB  
103  N N   . PHE A 22  ? 0.3308 0.5570 0.2945 -0.0084 0.0362  -0.0340 236 PHE A N   
104  C CA  . PHE A 22  ? 0.3516 0.6020 0.3256 0.0017  0.0309  -0.0622 236 PHE A CA  
105  C C   . PHE A 22  ? 0.3864 0.6318 0.3110 -0.0011 0.0231  -0.0595 236 PHE A C   
106  O O   . PHE A 22  ? 0.3891 0.6056 0.2683 -0.0117 0.0157  -0.0355 236 PHE A O   
107  C CB  . PHE A 22  ? 0.3761 0.6785 0.3638 0.0066  0.0355  -0.0872 236 PHE A CB  
108  C CG  . PHE A 22  ? 0.3840 0.7233 0.3286 -0.0135 0.0472  -0.0707 236 PHE A CG  
109  C CD1 . PHE A 22  ? 0.4370 0.8124 0.3320 -0.0284 0.0475  -0.0667 236 PHE A CD1 
110  C CD2 . PHE A 22  ? 0.4129 0.7532 0.3649 -0.0232 0.0545  -0.0549 236 PHE A CD2 
111  C CE1 . PHE A 22  ? 0.4740 0.8904 0.3276 -0.0596 0.0542  -0.0421 236 PHE A CE1 
112  C CE2 . PHE A 22  ? 0.4440 0.8244 0.3596 -0.0492 0.0623  -0.0357 236 PHE A CE2 
113  C CZ  . PHE A 22  ? 0.4857 0.9063 0.3521 -0.0711 0.0617  -0.0267 236 PHE A CZ  
114  N N   . VAL A 23  ? 0.3884 0.6552 0.3213 0.0102  0.0171  -0.0860 237 VAL A N   
115  C CA  . VAL A 23  ? 0.4539 0.7191 0.3374 0.0077  0.0060  -0.0860 237 VAL A CA  
116  C C   . VAL A 23  ? 0.4713 0.7943 0.3540 0.0147  0.0077  -0.1163 237 VAL A C   
117  O O   . VAL A 23  ? 0.4677 0.8109 0.4019 0.0352  0.0054  -0.1500 237 VAL A O   
118  C CB  . VAL A 23  ? 0.4719 0.7024 0.3646 0.0219  -0.0093 -0.0916 237 VAL A CB  
119  C CG1 . VAL A 23  ? 0.4570 0.7002 0.4163 0.0353  -0.0100 -0.1160 237 VAL A CG1 
120  C CG2 . VAL A 23  ? 0.5236 0.7447 0.3641 0.0228  -0.0280 -0.0946 237 VAL A CG2 
121  N N   . GLU A 24  ? 0.5499 0.9017 0.3718 -0.0037 0.0062  -0.1040 238 GLU A N   
122  C CA  . GLU A 24  ? 0.6339 1.0632 0.4442 0.0020  0.0094  -0.1335 238 GLU A CA  
123  C C   . GLU A 24  ? 0.7527 1.1656 0.5184 0.0022  -0.0091 -0.1337 238 GLU A C   
124  O O   . GLU A 24  ? 0.8148 1.1767 0.5261 -0.0194 -0.0252 -0.0971 238 GLU A O   
125  C CB  . GLU A 24  ? 0.6747 1.1836 0.4490 -0.0271 0.0249  -0.1174 238 GLU A CB  
126  C CG  . GLU A 24  ? 0.6560 1.1969 0.4769 -0.0219 0.0413  -0.1271 238 GLU A CG  
127  C CD  . GLU A 24  ? 0.7207 1.3287 0.5323 -0.0536 0.0513  -0.1031 238 GLU A CD  
128  O OE1 . GLU A 24  ? 0.7736 1.3688 0.5365 -0.0924 0.0442  -0.0591 238 GLU A OE1 
129  O OE2 . GLU A 24  ? 0.7173 1.3885 0.5745 -0.0396 0.0601  -0.1298 238 GLU A OE2 
130  N N   . PRO A 25  ? 0.9356 0.9897 0.6777 0.0563  -0.0175 -0.0022 239 PRO A N   
131  C CA  . PRO A 25  ? 1.0278 1.0641 0.7136 0.0607  -0.0465 0.0054  239 PRO A CA  
132  C C   . PRO A 25  ? 1.1257 1.1487 0.7275 0.0502  -0.0325 0.0269  239 PRO A C   
133  O O   . PRO A 25  ? 1.1439 1.1818 0.7330 0.0374  0.0037  0.0291  239 PRO A O   
134  C CB  . PRO A 25  ? 1.0431 1.0894 0.7230 0.0688  -0.0624 -0.0315 239 PRO A CB  
135  C CG  . PRO A 25  ? 1.0128 1.0788 0.7143 0.0688  -0.0317 -0.0565 239 PRO A CG  
136  C CD  . PRO A 25  ? 0.9328 1.0045 0.6960 0.0632  -0.0131 -0.0394 239 PRO A CD  
137  N N   . GLN A 33  ? 0.9982 1.1100 0.7540 0.0974  0.0159  -0.1568 247 GLN A N   
138  C CA  . GLN A 33  ? 0.9473 1.0630 0.7742 0.1032  0.0230  -0.1632 247 GLN A CA  
139  C C   . GLN A 33  ? 0.8874 0.9907 0.7616 0.0900  0.0147  -0.1272 247 GLN A C   
140  O O   . GLN A 33  ? 0.9086 0.9940 0.7773 0.0823  -0.0082 -0.1090 247 GLN A O   
141  C CB  . GLN A 33  ? 0.9513 1.0422 0.7998 0.1192  -0.0010 -0.2007 247 GLN A CB  
142  N N   . ARG A 34  ? 0.8173 0.9341 0.7386 0.0891  0.0324  -0.1196 248 ARG A N   
143  C CA  . ARG A 34  ? 0.7597 0.8667 0.7223 0.0779  0.0275  -0.0893 248 ARG A CA  
144  C C   . ARG A 34  ? 0.6971 0.7777 0.6954 0.0777  -0.0018 -0.0914 248 ARG A C   
145  O O   . ARG A 34  ? 0.7330 0.7983 0.7414 0.0859  -0.0164 -0.1169 248 ARG A O   
146  C CB  . ARG A 34  ? 0.7616 0.8894 0.7638 0.0771  0.0502  -0.0845 248 ARG A CB  
147  C CG  . ARG A 34  ? 0.8235 0.9807 0.8028 0.0662  0.0804  -0.0707 248 ARG A CG  
148  C CD  . ARG A 34  ? 0.8071 0.9840 0.8351 0.0619  0.0957  -0.0635 248 ARG A CD  
149  N NE  . ARG A 34  ? 0.8817 1.0908 0.8938 0.0460  0.1249  -0.0513 248 ARG A NE  
150  C CZ  . ARG A 34  ? 0.8897 1.1245 0.9404 0.0376  0.1401  -0.0454 248 ARG A CZ  
151  N NH1 . ARG A 34  ? 0.8568 1.0863 0.9593 0.0471  0.1277  -0.0503 248 ARG A NH1 
152  N NH2 . ARG A 34  ? 0.9143 1.1795 0.9495 0.0172  0.1664  -0.0333 248 ARG A NH2 
153  N N   . HIS A 35  ? 0.5970 0.6724 0.6137 0.0672  -0.0104 -0.0650 249 HIS A N   
154  C CA  . HIS A 35  ? 0.5294 0.5920 0.5896 0.0612  -0.0290 -0.0611 249 HIS A CA  
155  C C   . HIS A 35  ? 0.4760 0.5441 0.5713 0.0563  -0.0145 -0.0420 249 HIS A C   
156  O O   . HIS A 35  ? 0.4736 0.5506 0.5624 0.0531  -0.0022 -0.0223 249 HIS A O   
157  C CB  . HIS A 35  ? 0.5023 0.5654 0.5616 0.0545  -0.0511 -0.0509 249 HIS A CB  
158  C CG  . HIS A 35  ? 0.4848 0.5488 0.5923 0.0433  -0.0625 -0.0417 249 HIS A CG  
159  N ND1 . HIS A 35  ? 0.5330 0.5824 0.6609 0.0342  -0.0810 -0.0552 249 HIS A ND1 
160  C CD2 . HIS A 35  ? 0.4341 0.5116 0.5703 0.0379  -0.0566 -0.0209 249 HIS A CD2 
161  C CE1 . HIS A 35  ? 0.5063 0.5646 0.6730 0.0202  -0.0840 -0.0399 249 HIS A CE1 
162  N NE2 . HIS A 35  ? 0.4537 0.5323 0.6264 0.0242  -0.0684 -0.0210 249 HIS A NE2 
163  N N   . LEU A 36  ? 0.4440 0.5010 0.5718 0.0555  -0.0188 -0.0476 250 LEU A N   
164  C CA  . LEU A 36  ? 0.4170 0.4776 0.5732 0.0511  -0.0079 -0.0314 250 LEU A CA  
165  C C   . LEU A 36  ? 0.3635 0.4203 0.5433 0.0380  -0.0184 -0.0147 250 LEU A C   
166  O O   . LEU A 36  ? 0.3420 0.3842 0.5353 0.0300  -0.0351 -0.0192 250 LEU A O   
167  C CB  . LEU A 36  ? 0.3957 0.4467 0.5695 0.0598  -0.0076 -0.0456 250 LEU A CB  
168  C CG  . LEU A 36  ? 0.4092 0.4739 0.5684 0.0764  0.0034  -0.0698 250 LEU A CG  
169  C CD1 . LEU A 36  ? 0.4513 0.5060 0.6362 0.0910  -0.0028 -0.0865 250 LEU A CD1 
170  C CD2 . LEU A 36  ? 0.3575 0.4554 0.5037 0.0734  0.0294  -0.0599 250 LEU A CD2 
171  N N   . PHE A 37  ? 0.3540 0.4243 0.5379 0.0347  -0.0082 0.0035  251 PHE A N   
172  C CA  . PHE A 37  ? 0.3345 0.4117 0.5426 0.0246  -0.0124 0.0166  251 PHE A CA  
173  C C   . PHE A 37  ? 0.3507 0.4157 0.5763 0.0175  -0.0110 0.0205  251 PHE A C   
174  O O   . PHE A 37  ? 0.3273 0.3863 0.5675 0.0043  -0.0210 0.0243  251 PHE A O   
175  C CB  . PHE A 37  ? 0.3238 0.4145 0.5292 0.0285  -0.0026 0.0301  251 PHE A CB  
176  C CG  . PHE A 37  ? 0.3258 0.4194 0.5072 0.0374  -0.0076 0.0303  251 PHE A CG  
177  C CD1 . PHE A 37  ? 0.3452 0.4509 0.5310 0.0381  -0.0252 0.0260  251 PHE A CD1 
178  C CD2 . PHE A 37  ? 0.3476 0.4312 0.5006 0.0428  0.0031  0.0365  251 PHE A CD2 
179  C CE1 . PHE A 37  ? 0.3566 0.4616 0.5156 0.0482  -0.0346 0.0276  251 PHE A CE1 
180  C CE2 . PHE A 37  ? 0.3724 0.4504 0.4943 0.0495  -0.0042 0.0408  251 PHE A CE2 
181  C CZ  . PHE A 37  ? 0.3834 0.4708 0.5068 0.0544  -0.0243 0.0363  251 PHE A CZ  
182  N N   . VAL A 38  ? 0.3398 0.4016 0.5625 0.0242  0.0004  0.0209  252 VAL A N   
183  C CA  . VAL A 38  ? 0.3391 0.3873 0.5741 0.0218  -0.0021 0.0239  252 VAL A CA  
184  C C   . VAL A 38  ? 0.3785 0.4267 0.6133 0.0357  0.0018  0.0103  252 VAL A C   
185  O O   . VAL A 38  ? 0.3898 0.4556 0.6142 0.0420  0.0143  0.0041  252 VAL A O   
186  C CB  . VAL A 38  ? 0.3294 0.3858 0.5690 0.0150  0.0072  0.0398  252 VAL A CB  
187  C CG1 . VAL A 38  ? 0.2919 0.3597 0.5369 0.0034  0.0065  0.0496  252 VAL A CG1 
188  C CG2 . VAL A 38  ? 0.3156 0.3849 0.5471 0.0213  0.0217  0.0410  252 VAL A CG2 
189  N N   . HIS A 39  ? 0.3859 0.4162 0.6321 0.0405  -0.0093 0.0059  253 HIS A N   
190  C CA  . HIS A 39  ? 0.4051 0.4439 0.6603 0.0583  -0.0076 -0.0117 253 HIS A CA  
191  C C   . HIS A 39  ? 0.3999 0.4213 0.6713 0.0647  -0.0221 -0.0097 253 HIS A C   
192  O O   . HIS A 39  ? 0.4349 0.4181 0.7035 0.0612  -0.0422 -0.0048 253 HIS A O   
193  C CB  . HIS A 39  ? 0.4828 0.5140 0.7297 0.0714  -0.0141 -0.0355 253 HIS A CB  
194  C CG  . HIS A 39  ? 0.5650 0.6156 0.8239 0.0937  -0.0091 -0.0592 253 HIS A CG  
195  N ND1 . HIS A 39  ? 0.5624 0.6567 0.8326 0.0958  0.0118  -0.0598 253 HIS A ND1 
196  C CD2 . HIS A 39  ? 0.6205 0.6564 0.8848 0.1154  -0.0223 -0.0856 253 HIS A CD2 
197  C CE1 . HIS A 39  ? 0.5931 0.7092 0.8796 0.1175  0.0138  -0.0856 253 HIS A CE1 
198  N NE2 . HIS A 39  ? 0.6315 0.7112 0.9139 0.1329  -0.0071 -0.1032 253 HIS A NE2 
199  N N   . ILE A 40  ? 0.3823 0.4306 0.6694 0.0720  -0.0140 -0.0121 254 ILE A N   
200  C CA  . ILE A 40  ? 0.3972 0.4352 0.7019 0.0833  -0.0311 -0.0132 254 ILE A CA  
201  C C   . ILE A 40  ? 0.4162 0.4864 0.7470 0.1079  -0.0288 -0.0396 254 ILE A C   
202  O O   . ILE A 40  ? 0.3914 0.5096 0.7328 0.1062  -0.0068 -0.0461 254 ILE A O   
203  C CB  . ILE A 40  ? 0.3690 0.4175 0.6755 0.0707  -0.0282 0.0054  254 ILE A CB  
204  C CG1 . ILE A 40  ? 0.3746 0.3988 0.6564 0.0493  -0.0281 0.0279  254 ILE A CG1 
205  C CG2 . ILE A 40  ? 0.4042 0.4452 0.7282 0.0850  -0.0500 0.0029  254 ILE A CG2 
206  C CD1 . ILE A 40  ? 0.3691 0.3998 0.6451 0.0387  -0.0258 0.0424  254 ILE A CD1 
207  N N   . SER A 41  ? 0.4432 0.4875 0.7844 0.1305  -0.0516 -0.0553 255 SER A N   
208  C CA  . SER A 41  ? 0.5208 0.6020 0.8937 0.1602  -0.0511 -0.0851 255 SER A CA  
209  C C   . SER A 41  ? 0.5719 0.6339 0.9617 0.1775  -0.0796 -0.0849 255 SER A C   
210  O O   . SER A 41  ? 0.6107 0.6089 0.9816 0.1778  -0.1075 -0.0735 255 SER A O   
211  C CB  . SER A 41  ? 0.5798 0.6501 0.9443 0.1795  -0.0521 -0.1138 255 SER A CB  
212  O OG  . SER A 41  ? 0.5924 0.7038 0.9762 0.2046  -0.0464 -0.1419 255 SER A OG  
213  N N   . GLN A 42  ? 0.6368 0.7519 1.0508 0.1851  -0.0720 -0.0934 256 GLN A N   
214  C CA  . GLN A 42  ? 0.6948 0.7973 1.1180 0.1996  -0.0985 -0.0926 256 GLN A CA  
215  C C   . GLN A 42  ? 0.7336 0.8925 1.1861 0.2219  -0.0909 -0.1199 256 GLN A C   
216  O O   . GLN A 42  ? 0.7254 0.9377 1.2051 0.2184  -0.0837 -0.1194 256 GLN A O   
217  C CB  . GLN A 42  ? 0.6838 0.7918 1.1112 0.1815  -0.1048 -0.0678 256 GLN A CB  
218  C CG  . GLN A 42  ? 0.7123 0.7612 1.1101 0.1616  -0.1168 -0.0385 256 GLN A CG  
219  C CD  . GLN A 42  ? 0.7381 0.7959 1.1349 0.1437  -0.1206 -0.0161 256 GLN A CD  
220  O OE1 . GLN A 42  ? 0.7890 0.7974 1.1498 0.1288  -0.1353 0.0085  256 GLN A OE1 
221  N NE2 . GLN A 42  ? 0.7060 0.8263 1.1322 0.1396  -0.1045 -0.0244 256 GLN A NE2 
222  N N   . LEU A 52  ? 0.9735 0.5823 0.9673 0.0342  -0.3163 0.2041  266 LEU A N   
223  C CA  . LEU A 52  ? 0.9095 0.5567 0.9051 0.0115  -0.2811 0.2105  266 LEU A CA  
224  C C   . LEU A 52  ? 0.9150 0.5468 0.8430 -0.0261 -0.2704 0.2424  266 LEU A C   
225  O O   . LEU A 52  ? 0.9061 0.5299 0.7963 -0.0273 -0.2869 0.2535  266 LEU A O   
226  C CB  . LEU A 52  ? 0.8397 0.5481 0.8815 0.0318  -0.2745 0.1908  266 LEU A CB  
227  C CG  . LEU A 52  ? 0.7363 0.4943 0.8334 0.0382  -0.2424 0.1666  266 LEU A CG  
228  C CD1 . LEU A 52  ? 0.7210 0.4618 0.8533 0.0602  -0.2513 0.1481  266 LEU A CD1 
229  C CD2 . LEU A 52  ? 0.6983 0.5242 0.8354 0.0512  -0.2295 0.1422  266 LEU A CD2 
230  N N   . GLU A 53  ? 0.9039 0.5381 0.8177 -0.0570 -0.2413 0.2544  267 GLU A N   
231  C CA  . GLU A 53  ? 0.9515 0.5865 0.8059 -0.0946 -0.2221 0.2801  267 GLU A CA  
232  C C   . GLU A 53  ? 0.9007 0.5842 0.7461 -0.0984 -0.2019 0.2793  267 GLU A C   
233  O O   . GLU A 53  ? 0.8192 0.5477 0.7159 -0.0754 -0.1912 0.2506  267 GLU A O   
234  C CB  . GLU A 53  ? 0.9862 0.6241 0.8402 -0.1254 -0.1952 0.2878  267 GLU A CB  
235  C CG  . GLU A 53  ? 1.0952 0.6805 0.9539 -0.1248 -0.2175 0.2884  267 GLU A CG  
236  C CD  . GLU A 53  ? 1.1348 0.7289 1.0015 -0.1549 -0.1939 0.2924  267 GLU A CD  
237  O OE1 . GLU A 53  ? 1.1644 0.7257 1.0516 -0.1491 -0.2092 0.2836  267 GLU A OE1 
238  O OE2 . GLU A 53  ? 1.1276 0.7647 0.9812 -0.1832 -0.1607 0.3018  267 GLU A OE2 
239  N N   . SER A 54  ? 0.9626 0.6511 0.7471 -0.1251 -0.1882 0.2973  268 SER A N   
240  C CA  . SER A 54  ? 0.9446 0.6819 0.7137 -0.1251 -0.1674 0.2854  268 SER A CA  
241  C C   . SER A 54  ? 0.9370 0.7238 0.6977 -0.1502 -0.1186 0.2825  268 SER A C   
242  O O   . SER A 54  ? 0.9739 0.7516 0.7125 -0.1807 -0.1050 0.3051  268 SER A O   
243  C CB  . SER A 54  ? 1.0309 0.7394 0.7295 -0.1296 -0.1939 0.3034  268 SER A CB  
244  O OG  . SER A 54  ? 1.0790 0.7532 0.7952 -0.1008 -0.2395 0.2993  268 SER A OG  
245  N N   . VAL A 55  ? 0.8991 0.7389 0.6802 -0.1370 -0.0941 0.2536  269 VAL A N   
246  C CA  . VAL A 55  ? 0.8678 0.7598 0.6427 -0.1520 -0.0503 0.2445  269 VAL A CA  
247  C C   . VAL A 55  ? 0.8440 0.7615 0.5869 -0.1430 -0.0410 0.2252  269 VAL A C   
248  O O   . VAL A 55  ? 0.8081 0.7283 0.5772 -0.1189 -0.0540 0.2023  269 VAL A O   
249  C CB  . VAL A 55  ? 0.7899 0.7197 0.6352 -0.1400 -0.0272 0.2220  269 VAL A CB  
250  C CG1 . VAL A 55  ? 0.7583 0.7462 0.6033 -0.1439 0.0128  0.2048  269 VAL A CG1 
251  C CG2 . VAL A 55  ? 0.7893 0.6983 0.6585 -0.1545 -0.0322 0.2391  269 VAL A CG2 
252  N N   . ASP A 56  ? 0.8638 0.8006 0.5487 -0.1641 -0.0185 0.2333  270 ASP A N   
253  C CA  . ASP A 56  ? 0.8941 0.8526 0.5406 -0.1553 -0.0090 0.2114  270 ASP A CA  
254  C C   . ASP A 56  ? 0.8335 0.8340 0.5328 -0.1322 0.0152  0.1733  270 ASP A C   
255  O O   . ASP A 56  ? 0.8066 0.8474 0.5346 -0.1351 0.0471  0.1659  270 ASP A O   
256  C CB  . ASP A 56  ? 1.0034 0.9809 0.5745 -0.1829 0.0153  0.2260  270 ASP A CB  
257  C CG  . ASP A 56  ? 1.1011 1.0859 0.6144 -0.1738 0.0153  0.2053  270 ASP A CG  
258  O OD1 . ASP A 56  ? 1.2051 1.1486 0.6615 -0.1782 -0.0174 0.2207  270 ASP A OD1 
259  O OD2 . ASP A 56  ? 1.0876 1.1163 0.6112 -0.1603 0.0449  0.1721  270 ASP A OD2 
260  N N   . VAL A 57  ? 0.7985 0.7880 0.5105 -0.1105 -0.0030 0.1502  271 VAL A N   
261  C CA  . VAL A 57  ? 0.7590 0.7709 0.5193 -0.0891 0.0114  0.1175  271 VAL A CA  
262  C C   . VAL A 57  ? 0.7993 0.8494 0.5379 -0.0856 0.0467  0.0956  271 VAL A C   
263  O O   . VAL A 57  ? 0.7629 0.8367 0.5451 -0.0706 0.0656  0.0760  271 VAL A O   
264  C CB  . VAL A 57  ? 0.6442 0.6335 0.4129 -0.0743 -0.0171 0.0995  271 VAL A CB  
265  C CG1 . VAL A 57  ? 0.7172 0.6939 0.4153 -0.0792 -0.0303 0.0942  271 VAL A CG1 
266  C CG2 . VAL A 57  ? 0.5834 0.5844 0.3974 -0.0571 -0.0048 0.0706  271 VAL A CG2 
267  N N   . ARG A 58  ? 0.8845 0.9417 0.5539 -0.0978 0.0549  0.0985  272 ARG A N   
268  C CA  . ARG A 58  ? 0.9455 1.0452 0.5902 -0.0914 0.0896  0.0732  272 ARG A CA  
269  C C   . ARG A 58  ? 0.9430 1.0949 0.6239 -0.0984 0.1248  0.0783  272 ARG A C   
270  O O   . ARG A 58  ? 0.9565 1.1538 0.6462 -0.0837 0.1540  0.0510  272 ARG A O   
271  C CB  . ARG A 58  ? 1.0390 1.1380 0.5938 -0.1060 0.0917  0.0769  272 ARG A CB  
272  C CG  . ARG A 58  ? 1.0989 1.1546 0.6152 -0.0963 0.0572  0.0630  272 ARG A CG  
273  C CD  . ARG A 58  ? 1.2162 1.2610 0.6369 -0.1156 0.0497  0.0778  272 ARG A CD  
274  N NE  . ARG A 58  ? 1.2627 1.2829 0.6656 -0.1411 0.0317  0.1250  272 ARG A NE  
275  C CZ  . ARG A 58  ? 1.3495 1.3355 0.6768 -0.1567 0.0048  0.1481  272 ARG A CZ  
276  N NH1 . ARG A 58  ? 1.4089 1.3869 0.6715 -0.1505 -0.0064 0.1269  272 ARG A NH1 
277  N NH2 . ARG A 58  ? 1.3744 1.3289 0.6878 -0.1778 -0.0146 0.1919  272 ARG A NH2 
278  N N   . GLN A 59  ? 0.9260 1.0716 0.6306 -0.1195 0.1193  0.1111  273 GLN A N   
279  C CA  . GLN A 59  ? 0.8993 1.0946 0.6421 -0.1322 0.1479  0.1186  273 GLN A CA  
280  C C   . GLN A 59  ? 0.8278 1.0397 0.6474 -0.1062 0.1516  0.0969  273 GLN A C   
281  O O   . GLN A 59  ? 0.8028 1.0656 0.6612 -0.1088 0.1751  0.0934  273 GLN A O   
282  C CB  . GLN A 59  ? 0.9065 1.0778 0.6440 -0.1662 0.1358  0.1607  273 GLN A CB  
283  N N   . ILE A 60  ? 0.7999 0.9712 0.6407 -0.0833 0.1275  0.0836  274 ILE A N   
284  C CA  . ILE A 60  ? 0.7479 0.9262 0.6510 -0.0604 0.1282  0.0666  274 ILE A CA  
285  C C   . ILE A 60  ? 0.7414 0.9047 0.6424 -0.0313 0.1244  0.0340  274 ILE A C   
286  O O   . ILE A 60  ? 0.7061 0.8531 0.6468 -0.0142 0.1153  0.0242  274 ILE A O   
287  C CB  . ILE A 60  ? 0.7147 0.8568 0.6547 -0.0639 0.1034  0.0844  274 ILE A CB  
288  C CG1 . ILE A 60  ? 0.7381 0.8315 0.6577 -0.0615 0.0740  0.0875  274 ILE A CG1 
289  C CG2 . ILE A 60  ? 0.7050 0.8529 0.6503 -0.0909 0.1041  0.1135  274 ILE A CG2 
290  C CD1 . ILE A 60  ? 0.7086 0.7759 0.6696 -0.0585 0.0526  0.0971  274 ILE A CD1 
291  N N   . TYR A 61  ? 0.7782 0.9432 0.6278 -0.0276 0.1305  0.0176  275 TYR A N   
292  C CA  . TYR A 61  ? 0.7593 0.9056 0.6005 -0.0008 0.1267  -0.0169 275 TYR A CA  
293  C C   . TYR A 61  ? 0.7305 0.9062 0.6140 0.0259  0.1444  -0.0399 275 TYR A C   
294  O O   . TYR A 61  ? 0.7191 0.8616 0.6219 0.0472  0.1316  -0.0573 275 TYR A O   
295  C CB  . TYR A 61  ? 0.7887 0.9380 0.5617 -0.0007 0.1333  -0.0343 275 TYR A CB  
296  C CG  . TYR A 61  ? 0.8126 0.9161 0.5398 -0.0154 0.1041  -0.0240 275 TYR A CG  
297  C CD1 . TYR A 61  ? 0.7873 0.8545 0.5427 -0.0245 0.0747  -0.0038 275 TYR A CD1 
298  C CD2 . TYR A 61  ? 0.8908 0.9924 0.5471 -0.0185 0.1053  -0.0372 275 TYR A CD2 
299  C CE1 . TYR A 61  ? 0.8188 0.8523 0.5400 -0.0351 0.0451  0.0035  275 TYR A CE1 
300  C CE2 . TYR A 61  ? 0.9414 1.0031 0.5558 -0.0308 0.0740  -0.0285 275 TYR A CE2 
301  C CZ  . TYR A 61  ? 0.8955 0.9248 0.5461 -0.0385 0.0429  -0.0080 275 TYR A CZ  
302  O OH  . TYR A 61  ? 0.9267 0.9240 0.5432 -0.0482 0.0090  -0.0012 275 TYR A OH  
303  N N   . ASP A 62  ? 0.7096 0.9478 0.6079 0.0233  0.1720  -0.0388 276 ASP A N   
304  C CA  . ASP A 62  ? 0.7022 0.9812 0.6399 0.0529  0.1890  -0.0649 276 ASP A CA  
305  C C   . ASP A 62  ? 0.6138 0.8863 0.6127 0.0610  0.1775  -0.0553 276 ASP A C   
306  O O   . ASP A 62  ? 0.5933 0.8940 0.6283 0.0880  0.1846  -0.0747 276 ASP A O   
307  C CB  . ASP A 62  ? 0.7456 1.1087 0.6831 0.0454  0.2243  -0.0692 276 ASP A CB  
308  C CG  . ASP A 62  ? 0.7565 1.1449 0.6991 0.0031  0.2311  -0.0299 276 ASP A CG  
309  O OD1 . ASP A 62  ? 0.7076 1.0667 0.6823 -0.0089 0.2119  -0.0060 276 ASP A OD1 
310  O OD2 . ASP A 62  ? 0.8266 1.2621 0.7375 -0.0192 0.2556  -0.0232 276 ASP A OD2 
311  N N   . LYS A 63  ? 0.5777 0.8139 0.5864 0.0400  0.1583  -0.0271 277 LYS A N   
312  C CA  . LYS A 63  ? 0.5350 0.7630 0.5927 0.0450  0.1471  -0.0174 277 LYS A CA  
313  C C   . LYS A 63  ? 0.4793 0.6464 0.5373 0.0617  0.1252  -0.0258 277 LYS A C   
314  O O   . LYS A 63  ? 0.3990 0.5505 0.4874 0.0660  0.1144  -0.0180 277 LYS A O   
315  C CB  . LYS A 63  ? 0.5527 0.7785 0.6214 0.0144  0.1403  0.0147  277 LYS A CB  
316  C CG  . LYS A 63  ? 0.6266 0.9047 0.6916 -0.0100 0.1601  0.0280  277 LYS A CG  
317  C CD  . LYS A 63  ? 0.6594 0.9121 0.7154 -0.0419 0.1472  0.0601  277 LYS A CD  
318  C CE  . LYS A 63  ? 0.6469 0.9274 0.7459 -0.0564 0.1495  0.0735  277 LYS A CE  
319  N NZ  . LYS A 63  ? 0.6796 1.0343 0.7959 -0.0638 0.1768  0.0670  277 LYS A NZ  
320  N N   . PHE A 64  ? 0.5299 0.6624 0.5501 0.0680  0.1185  -0.0417 278 PHE A N   
321  C CA  . PHE A 64  ? 0.5141 0.5863 0.5295 0.0771  0.0976  -0.0498 278 PHE A CA  
322  C C   . PHE A 64  ? 0.5559 0.6069 0.5371 0.0984  0.0976  -0.0820 278 PHE A C   
323  O O   . PHE A 64  ? 0.5463 0.6308 0.5017 0.1022  0.1137  -0.0959 278 PHE A O   
324  C CB  . PHE A 64  ? 0.4929 0.5337 0.4993 0.0516  0.0801  -0.0306 278 PHE A CB  
325  C CG  . PHE A 64  ? 0.4276 0.4876 0.4621 0.0341  0.0795  -0.0035 278 PHE A CG  
326  C CD1 . PHE A 64  ? 0.3967 0.4470 0.4649 0.0358  0.0733  0.0057  278 PHE A CD1 
327  C CD2 . PHE A 64  ? 0.4700 0.5525 0.4917 0.0158  0.0837  0.0123  278 PHE A CD2 
328  C CE1 . PHE A 64  ? 0.3466 0.4112 0.4376 0.0225  0.0716  0.0255  278 PHE A CE1 
329  C CE2 . PHE A 64  ? 0.4577 0.5475 0.5029 0.0015  0.0795  0.0347  278 PHE A CE2 
330  C CZ  . PHE A 64  ? 0.3815 0.4635 0.4627 0.0064  0.0737  0.0389  278 PHE A CZ  
331  N N   . PRO A 65  ? 0.6210 0.6143 0.5984 0.1114  0.0796  -0.0946 279 PRO A N   
332  C CA  . PRO A 65  ? 0.7414 0.7013 0.6838 0.1333  0.0747  -0.1286 279 PRO A CA  
333  C C   . PRO A 65  ? 0.8070 0.7690 0.7017 0.1200  0.0758  -0.1390 279 PRO A C   
334  O O   . PRO A 65  ? 0.7513 0.7068 0.6375 0.0912  0.0658  -0.1185 279 PRO A O   
335  C CB  . PRO A 65  ? 0.7605 0.6450 0.7030 0.1318  0.0489  -0.1277 279 PRO A CB  
336  C CG  . PRO A 65  ? 0.6785 0.5723 0.6622 0.1268  0.0485  -0.1012 279 PRO A CG  
337  C CD  . PRO A 65  ? 0.5945 0.5494 0.5972 0.1066  0.0636  -0.0785 279 PRO A CD  
338  N N   . GLU A 66  ? 0.9118 0.8845 0.7749 0.1433  0.0868  -0.1724 280 GLU A N   
339  C CA  . GLU A 66  ? 1.0273 1.0132 0.8370 0.1326  0.0924  -0.1835 280 GLU A CA  
340  C C   . GLU A 66  ? 1.1024 1.0199 0.8685 0.1294  0.0657  -0.2041 280 GLU A C   
341  O O   . GLU A 66  ? 1.1479 1.0679 0.8660 0.1157  0.0627  -0.2095 280 GLU A O   
342  C CB  . GLU A 66  ? 1.1265 1.1704 0.9195 0.1580  0.1224  -0.2123 280 GLU A CB  
343  C CG  . GLU A 66  ? 1.1300 1.2496 0.9710 0.1618  0.1493  -0.1982 280 GLU A CG  
344  C CD  . GLU A 66  ? 1.1000 1.2561 0.9459 0.1222  0.1577  -0.1568 280 GLU A CD  
345  O OE1 . GLU A 66  ? 1.1292 1.2919 0.9256 0.1006  0.1615  -0.1499 280 GLU A OE1 
346  O OE2 . GLU A 66  ? 1.0386 1.2112 0.9340 0.1133  0.1577  -0.1315 280 GLU A OE2 
347  N N   . LYS A 67  ? 1.1342 0.9882 0.9134 0.1400  0.0444  -0.2148 281 LYS A N   
348  C CA  . LYS A 67  ? 1.2454 1.0292 0.9842 0.1378  0.0177  -0.2398 281 LYS A CA  
349  C C   . LYS A 67  ? 1.2718 1.0148 1.0253 0.1014  -0.0096 -0.2147 281 LYS A C   
350  O O   . LYS A 67  ? 1.2480 1.0117 0.9927 0.0745  -0.0161 -0.1982 281 LYS A O   
351  C CB  . LYS A 67  ? 1.2962 1.0258 1.0306 0.1742  0.0093  -0.2739 281 LYS A CB  
352  N N   . LYS A 68  ? 1.3240 1.0110 1.0998 0.1006  -0.0263 -0.2118 282 LYS A N   
353  C CA  . LYS A 68  ? 1.3295 0.9843 1.1232 0.0638  -0.0491 -0.1903 282 LYS A CA  
354  C C   . LYS A 68  ? 1.2818 0.9735 1.1281 0.0489  -0.0387 -0.1514 282 LYS A C   
355  O O   . LYS A 68  ? 1.2503 0.9548 1.1196 0.0679  -0.0242 -0.1433 282 LYS A O   
356  C CB  . LYS A 68  ? 1.3880 0.9551 1.1688 0.0623  -0.0743 -0.2067 282 LYS A CB  
357  N N   . GLY A 69  ? 1.2708 0.9817 1.1363 0.0168  -0.0479 -0.1301 283 GLY A N   
358  C CA  . GLY A 69  ? 1.1983 0.9475 1.1107 0.0038  -0.0384 -0.0976 283 GLY A CA  
359  C C   . GLY A 69  ? 1.1445 0.9532 1.0651 0.0174  -0.0161 -0.0863 283 GLY A C   
360  O O   . GLY A 69  ? 1.1147 0.9535 1.0707 0.0140  -0.0059 -0.0636 283 GLY A O   
361  N N   . GLY A 70  ? 1.1430 0.9679 1.0276 0.0308  -0.0085 -0.1030 284 GLY A N   
362  C CA  . GLY A 70  ? 1.0452 0.9253 0.9315 0.0378  0.0135  -0.0919 284 GLY A CA  
363  C C   . GLY A 70  ? 0.9424 0.8488 0.8309 0.0152  0.0064  -0.0689 284 GLY A C   
364  O O   . GLY A 70  ? 0.9603 0.8488 0.8457 -0.0016 -0.0160 -0.0675 284 GLY A O   
365  N N   . LEU A 71  ? 0.8284 0.7763 0.7239 0.0146  0.0229  -0.0512 285 LEU A N   
366  C CA  . LEU A 71  ? 0.7468 0.7112 0.6430 -0.0036 0.0135  -0.0271 285 LEU A CA  
367  C C   . LEU A 71  ? 0.8135 0.7695 0.6561 -0.0118 -0.0007 -0.0337 285 LEU A C   
368  O O   . LEU A 71  ? 0.8244 0.7761 0.6664 -0.0252 -0.0231 -0.0201 285 LEU A O   
369  C CB  . LEU A 71  ? 0.6577 0.6586 0.5663 -0.0050 0.0330  -0.0071 285 LEU A CB  
370  C CG  . LEU A 71  ? 0.6000 0.6064 0.5185 -0.0211 0.0202  0.0207  285 LEU A CG  
371  C CD1 . LEU A 71  ? 0.5467 0.5389 0.5074 -0.0238 0.0010  0.0252  285 LEU A CD1 
372  C CD2 . LEU A 71  ? 0.5552 0.5888 0.4902 -0.0248 0.0383  0.0385  285 LEU A CD2 
373  N N   . ARG A 72  ? 0.8636 0.8188 0.6604 -0.0011 0.0108  -0.0567 286 ARG A N   
374  C CA  . ARG A 72  ? 0.9234 0.8702 0.6579 -0.0079 -0.0016 -0.0660 286 ARG A CA  
375  C C   . ARG A 72  ? 0.9418 0.8505 0.6725 -0.0156 -0.0353 -0.0791 286 ARG A C   
376  O O   . ARG A 72  ? 0.9622 0.8676 0.6725 -0.0294 -0.0597 -0.0693 286 ARG A O   
377  C CB  . ARG A 72  ? 0.9894 0.9477 0.6758 0.0084  0.0215  -0.0942 286 ARG A CB  
378  C CG  . ARG A 72  ? 1.0982 1.0527 0.7084 0.0007  0.0129  -0.1034 286 ARG A CG  
379  C CD  . ARG A 72  ? 1.2054 1.1617 0.7687 0.0219  0.0308  -0.1442 286 ARG A CD  
380  N NE  . ARG A 72  ? 1.2662 1.1727 0.8379 0.0364  0.0116  -0.1770 286 ARG A NE  
381  C CZ  . ARG A 72  ? 1.3445 1.2088 0.8776 0.0295  -0.0188 -0.1958 286 ARG A CZ  
382  N NH1 . ARG A 72  ? 1.3814 1.2504 0.8640 0.0117  -0.0348 -0.1855 286 ARG A NH1 
383  N NH2 . ARG A 72  ? 1.3766 1.1902 0.9193 0.0388  -0.0364 -0.2240 286 ARG A NH2 
384  N N   . GLU A 73  ? 0.9408 0.8196 0.6913 -0.0078 -0.0391 -0.1005 287 GLU A N   
385  C CA  . GLU A 73  ? 0.9843 0.8258 0.7328 -0.0201 -0.0705 -0.1150 287 GLU A CA  
386  C C   . GLU A 73  ? 0.8787 0.7320 0.6809 -0.0398 -0.0897 -0.0910 287 GLU A C   
387  O O   . GLU A 73  ? 0.8777 0.7244 0.6771 -0.0552 -0.1191 -0.0945 287 GLU A O   
388  C CB  . GLU A 73  ? 1.0807 0.8781 0.8345 -0.0099 -0.0704 -0.1409 287 GLU A CB  
389  C CG  . GLU A 73  ? 1.1906 0.9429 0.9314 -0.0265 -0.1035 -0.1603 287 GLU A CG  
390  C CD  . GLU A 73  ? 1.2489 0.9491 1.0094 -0.0260 -0.1084 -0.1731 287 GLU A CD  
391  O OE1 . GLU A 73  ? 1.2783 0.9491 1.0533 -0.0510 -0.1342 -0.1757 287 GLU A OE1 
392  O OE2 . GLU A 73  ? 1.2569 0.9456 1.0187 -0.0019 -0.0882 -0.1796 287 GLU A OE2 
393  N N   . LEU A 74  ? 0.7982 0.6732 0.6506 -0.0380 -0.0738 -0.0694 288 LEU A N   
394  C CA  . LEU A 74  ? 0.7230 0.6178 0.6287 -0.0520 -0.0872 -0.0495 288 LEU A CA  
395  C C   . LEU A 74  ? 0.7010 0.6182 0.5952 -0.0564 -0.1048 -0.0345 288 LEU A C   
396  O O   . LEU A 74  ? 0.6530 0.5807 0.5733 -0.0673 -0.1308 -0.0314 288 LEU A O   
397  C CB  . LEU A 74  ? 0.6420 0.5543 0.5937 -0.0460 -0.0651 -0.0324 288 LEU A CB  
398  C CG  . LEU A 74  ? 0.6122 0.5002 0.5845 -0.0451 -0.0554 -0.0400 288 LEU A CG  
399  C CD1 . LEU A 74  ? 0.5581 0.4659 0.5644 -0.0368 -0.0344 -0.0229 288 LEU A CD1 
400  C CD2 . LEU A 74  ? 0.5726 0.4487 0.5712 -0.0672 -0.0750 -0.0436 288 LEU A CD2 
401  N N   . TYR A 75  ? 0.7296 0.6550 0.5850 -0.0487 -0.0919 -0.0245 289 TYR A N   
402  C CA  . TYR A 75  ? 0.7654 0.7004 0.5986 -0.0532 -0.1104 -0.0057 289 TYR A CA  
403  C C   . TYR A 75  ? 0.8588 0.7783 0.6425 -0.0597 -0.1395 -0.0197 289 TYR A C   
404  O O   . TYR A 75  ? 0.8835 0.8070 0.6621 -0.0643 -0.1694 -0.0074 289 TYR A O   
405  C CB  . TYR A 75  ? 0.7754 0.7196 0.5745 -0.0500 -0.0872 0.0118  289 TYR A CB  
406  C CG  . TYR A 75  ? 0.7667 0.7121 0.5560 -0.0556 -0.1059 0.0405  289 TYR A CG  
407  C CD1 . TYR A 75  ? 0.6981 0.6518 0.5362 -0.0534 -0.1043 0.0605  289 TYR A CD1 
408  C CD2 . TYR A 75  ? 0.8416 0.7737 0.5683 -0.0620 -0.1282 0.0471  289 TYR A CD2 
409  C CE1 . TYR A 75  ? 0.7178 0.6615 0.5451 -0.0559 -0.1258 0.0856  289 TYR A CE1 
410  C CE2 . TYR A 75  ? 0.8817 0.8043 0.5946 -0.0659 -0.1504 0.0758  289 TYR A CE2 
411  C CZ  . TYR A 75  ? 0.8175 0.7434 0.5822 -0.0620 -0.1498 0.0947  289 TYR A CZ  
412  O OH  . TYR A 75  ? 0.8728 0.7786 0.6217 -0.0633 -0.1759 0.1222  289 TYR A OH  
413  N N   . ASP A 76  ? 0.9222 0.8214 0.6685 -0.0579 -0.1340 -0.0472 290 ASP A N   
414  C CA  . ASP A 76  ? 1.0199 0.9003 0.7151 -0.0646 -0.1631 -0.0662 290 ASP A CA  
415  C C   . ASP A 76  ? 1.0098 0.8914 0.7526 -0.0779 -0.1992 -0.0709 290 ASP A C   
416  O O   . ASP A 76  ? 1.0674 0.9526 0.7916 -0.0845 -0.2338 -0.0691 290 ASP A O   
417  C CB  . ASP A 76  ? 1.1006 0.9542 0.7490 -0.0568 -0.1494 -0.1004 290 ASP A CB  
418  C CG  . ASP A 76  ? 1.1614 1.0250 0.7445 -0.0455 -0.1211 -0.1023 290 ASP A CG  
419  O OD1 . ASP A 76  ? 1.1785 1.0610 0.7343 -0.0511 -0.1206 -0.0762 290 ASP A OD1 
420  O OD2 . ASP A 76  ? 1.1964 1.0494 0.7553 -0.0313 -0.0998 -0.1302 290 ASP A OD2 
421  N N   . ARG A 77  ? 0.9546 0.8363 0.7587 -0.0831 -0.1917 -0.0764 291 ARG A N   
422  C CA  . ARG A 77  ? 0.9531 0.8472 0.8120 -0.1006 -0.2199 -0.0804 291 ARG A CA  
423  C C   . ARG A 77  ? 0.9097 0.8471 0.8190 -0.0991 -0.2342 -0.0568 291 ARG A C   
424  O O   . ARG A 77  ? 0.9598 0.9194 0.8999 -0.1093 -0.2673 -0.0604 291 ARG A O   
425  C CB  . ARG A 77  ? 0.9710 0.8532 0.8762 -0.1104 -0.2038 -0.0878 291 ARG A CB  
426  C CG  . ARG A 77  ? 1.1012 0.9316 0.9670 -0.1168 -0.2086 -0.1167 291 ARG A CG  
427  C CD  . ARG A 77  ? 1.1464 0.9468 1.0088 -0.1038 -0.1764 -0.1199 291 ARG A CD  
428  N NE  . ARG A 77  ? 1.1465 0.9526 1.0704 -0.1173 -0.1670 -0.1062 291 ARG A NE  
429  C CZ  . ARG A 77  ? 1.1456 0.9254 1.0740 -0.1084 -0.1442 -0.1041 291 ARG A CZ  
430  N NH1 . ARG A 77  ? 1.1576 0.9092 1.0417 -0.0831 -0.1287 -0.1174 291 ARG A NH1 
431  N NH2 . ARG A 77  ? 1.1282 0.9133 1.1047 -0.1240 -0.1371 -0.0892 291 ARG A NH2 
432  N N   . GLY A 78  ? 0.8408 0.7904 0.7602 -0.0852 -0.2112 -0.0349 292 GLY A N   
433  C CA  . GLY A 78  ? 0.7827 0.7636 0.7440 -0.0782 -0.2250 -0.0145 292 GLY A CA  
434  C C   . GLY A 78  ? 0.6991 0.7160 0.7457 -0.0831 -0.2221 -0.0154 292 GLY A C   
435  O O   . GLY A 78  ? 0.6799 0.6930 0.7489 -0.0949 -0.2042 -0.0258 292 GLY A O   
436  N N   . PRO A 79  ? 0.6597 0.7109 0.7519 -0.0735 -0.2400 -0.0048 293 PRO A N   
437  C CA  . PRO A 79  ? 0.6784 0.7232 0.7417 -0.0581 -0.2660 0.0108  293 PRO A CA  
438  C C   . PRO A 79  ? 0.6336 0.6550 0.6680 -0.0459 -0.2422 0.0321  293 PRO A C   
439  O O   . PRO A 79  ? 0.5240 0.5541 0.5927 -0.0430 -0.2127 0.0347  293 PRO A O   
440  C CB  . PRO A 79  ? 0.6665 0.7592 0.8051 -0.0492 -0.2929 0.0090  293 PRO A CB  
441  C CG  . PRO A 79  ? 0.6087 0.7345 0.8136 -0.0557 -0.2627 0.0012  293 PRO A CG  
442  C CD  . PRO A 79  ? 0.6195 0.7192 0.7960 -0.0771 -0.2386 -0.0092 293 PRO A CD  
443  N N   . PRO A 80  ? 0.4385 0.5834 0.4959 0.0038  -0.0973 0.0002  294 PRO A N   
444  C CA  . PRO A 80  ? 0.4826 0.6183 0.5298 0.0103  -0.0883 0.0189  294 PRO A CA  
445  C C   . PRO A 80  ? 0.4538 0.5717 0.5144 0.0109  -0.0834 0.0376  294 PRO A C   
446  O O   . PRO A 80  ? 0.4489 0.5484 0.5089 0.0120  -0.0759 0.0478  294 PRO A O   
447  C CB  . PRO A 80  ? 0.5227 0.6927 0.5524 0.0204  -0.0923 0.0278  294 PRO A CB  
448  C CG  . PRO A 80  ? 0.5205 0.7145 0.5435 0.0191  -0.1025 0.0046  294 PRO A CG  
449  C CD  . PRO A 80  ? 0.4671 0.6482 0.5123 0.0088  -0.1075 -0.0078 294 PRO A CD  
450  N N   . HIS A 81  ? 0.4916 0.6160 0.5656 0.0106  -0.0881 0.0409  295 HIS A N   
451  C CA  . HIS A 81  ? 0.4535 0.5639 0.5401 0.0137  -0.0841 0.0564  295 HIS A CA  
452  C C   . HIS A 81  ? 0.4287 0.5120 0.5260 0.0077  -0.0783 0.0501  295 HIS A C   
453  O O   . HIS A 81  ? 0.4259 0.4959 0.5324 0.0107  -0.0748 0.0586  295 HIS A O   
454  C CB  . HIS A 81  ? 0.4551 0.5855 0.5523 0.0180  -0.0905 0.0631  295 HIS A CB  
455  C CG  . HIS A 81  ? 0.4788 0.6132 0.5890 0.0114  -0.0944 0.0499  295 HIS A CG  
456  N ND1 . HIS A 81  ? 0.4966 0.6509 0.6059 0.0062  -0.1027 0.0352  295 HIS A ND1 
457  C CD2 . HIS A 81  ? 0.4701 0.5930 0.5967 0.0092  -0.0913 0.0498  295 HIS A CD2 
458  C CE1 . HIS A 81  ? 0.4883 0.6420 0.6162 0.0000  -0.1044 0.0283  295 HIS A CE1 
459  N NE2 . HIS A 81  ? 0.4551 0.5915 0.5926 0.0023  -0.0968 0.0381  295 HIS A NE2 
460  N N   . ALA A 82  ? 0.4115 0.4881 0.5087 0.0001  -0.0775 0.0351  296 ALA A N   
461  C CA  . ALA A 82  ? 0.4083 0.4643 0.5158 -0.0050 -0.0716 0.0315  296 ALA A CA  
462  C C   . ALA A 82  ? 0.4288 0.4648 0.5283 -0.0056 -0.0645 0.0331  296 ALA A C   
463  O O   . ALA A 82  ? 0.4301 0.4512 0.5359 -0.0089 -0.0594 0.0312  296 ALA A O   
464  C CB  . ALA A 82  ? 0.4069 0.4667 0.5260 -0.0132 -0.0741 0.0179  296 ALA A CB  
465  N N   . PHE A 83  ? 0.3802 0.4195 0.4668 -0.0017 -0.0641 0.0384  297 PHE A N   
466  C CA  . PHE A 83  ? 0.3837 0.4081 0.4639 -0.0023 -0.0579 0.0401  297 PHE A CA  
467  C C   . PHE A 83  ? 0.3759 0.3898 0.4586 0.0015  -0.0549 0.0547  297 PHE A C   
468  O O   . PHE A 83  ? 0.3987 0.4218 0.4814 0.0069  -0.0570 0.0668  297 PHE A O   
469  C CB  . PHE A 83  ? 0.3992 0.4360 0.4651 -0.0004 -0.0582 0.0355  297 PHE A CB  
470  C CG  . PHE A 83  ? 0.4139 0.4533 0.4802 -0.0052 -0.0605 0.0164  297 PHE A CG  
471  C CD1 . PHE A 83  ? 0.4078 0.4321 0.4753 -0.0085 -0.0551 0.0085  297 PHE A CD1 
472  C CD2 . PHE A 83  ? 0.4228 0.4796 0.4917 -0.0064 -0.0686 0.0063  297 PHE A CD2 
473  C CE1 . PHE A 83  ? 0.4288 0.4526 0.5021 -0.0128 -0.0574 -0.0095 297 PHE A CE1 
474  C CE2 . PHE A 83  ? 0.4605 0.5178 0.5350 -0.0118 -0.0720 -0.0131 297 PHE A CE2 
475  C CZ  . PHE A 83  ? 0.4584 0.4977 0.5362 -0.0149 -0.0662 -0.0212 297 PHE A CZ  
476  N N   . PHE A 84  ? 0.3678 0.3635 0.4551 -0.0012 -0.0505 0.0540  298 PHE A N   
477  C CA  . PHE A 84  ? 0.3517 0.3355 0.4452 0.0012  -0.0493 0.0639  298 PHE A CA  
478  C C   . PHE A 84  ? 0.3736 0.3459 0.4652 -0.0017 -0.0448 0.0647  298 PHE A C   
479  O O   . PHE A 84  ? 0.3547 0.3242 0.4422 -0.0053 -0.0416 0.0567  298 PHE A O   
480  C CB  . PHE A 84  ? 0.3720 0.3481 0.4759 0.0026  -0.0506 0.0610  298 PHE A CB  
481  C CG  . PHE A 84  ? 0.4374 0.4252 0.5464 0.0066  -0.0547 0.0623  298 PHE A CG  
482  C CD1 . PHE A 84  ? 0.4618 0.4498 0.5792 0.0126  -0.0574 0.0726  298 PHE A CD1 
483  C CD2 . PHE A 84  ? 0.4146 0.4136 0.5238 0.0044  -0.0558 0.0546  298 PHE A CD2 
484  C CE1 . PHE A 84  ? 0.4664 0.4668 0.5901 0.0174  -0.0609 0.0751  298 PHE A CE1 
485  C CE2 . PHE A 84  ? 0.4355 0.4480 0.5511 0.0081  -0.0598 0.0567  298 PHE A CE2 
486  C CZ  . PHE A 84  ? 0.4660 0.4797 0.5877 0.0152  -0.0622 0.0670  298 PHE A CZ  
487  N N   . LEU A 85  ? 0.3457 0.3118 0.4437 -0.0002 -0.0448 0.0754  299 LEU A N   
488  C CA  . LEU A 85  ? 0.3649 0.3211 0.4653 -0.0032 -0.0417 0.0773  299 LEU A CA  
489  C C   . LEU A 85  ? 0.3781 0.3206 0.4919 -0.0034 -0.0449 0.0771  299 LEU A C   
490  O O   . LEU A 85  ? 0.4191 0.3585 0.5443 -0.0004 -0.0486 0.0830  299 LEU A O   
491  C CB  . LEU A 85  ? 0.3597 0.3237 0.4587 -0.0018 -0.0390 0.0903  299 LEU A CB  
492  C CG  . LEU A 85  ? 0.3887 0.3444 0.4958 -0.0048 -0.0365 0.0963  299 LEU A CG  
493  C CD1 . LEU A 85  ? 0.3586 0.3110 0.4579 -0.0076 -0.0325 0.0862  299 LEU A CD1 
494  C CD2 . LEU A 85  ? 0.4323 0.3996 0.5427 -0.0024 -0.0335 0.1137  299 LEU A CD2 
495  N N   . VAL A 86  ? 0.3544 0.2897 0.4679 -0.0062 -0.0438 0.0697  300 VAL A N   
496  C CA  . VAL A 86  ? 0.3552 0.2803 0.4797 -0.0059 -0.0479 0.0658  300 VAL A CA  
497  C C   . VAL A 86  ? 0.3517 0.2725 0.4816 -0.0099 -0.0477 0.0692  300 VAL A C   
498  O O   . VAL A 86  ? 0.3235 0.2479 0.4453 -0.0121 -0.0436 0.0676  300 VAL A O   
499  C CB  . VAL A 86  ? 0.3486 0.2750 0.4685 -0.0040 -0.0482 0.0533  300 VAL A CB  
500  C CG1 . VAL A 86  ? 0.3287 0.2478 0.4571 -0.0024 -0.0533 0.0458  300 VAL A CG1 
501  C CG2 . VAL A 86  ? 0.3649 0.2970 0.4834 0.0001  -0.0487 0.0505  300 VAL A CG2 
502  N N   . LYS A 87  ? 0.3657 0.2789 0.5125 -0.0109 -0.0524 0.0748  301 LYS A N   
503  C CA  . LYS A 87  ? 0.3827 0.2928 0.5390 -0.0153 -0.0540 0.0767  301 LYS A CA  
504  C C   . LYS A 87  ? 0.3814 0.2848 0.5444 -0.0150 -0.0612 0.0621  301 LYS A C   
505  O O   . LYS A 87  ? 0.4123 0.3073 0.5870 -0.0123 -0.0672 0.0557  301 LYS A O   
506  C CB  . LYS A 87  ? 0.4207 0.3289 0.5964 -0.0179 -0.0551 0.0931  301 LYS A CB  
507  C CG  . LYS A 87  ? 0.4707 0.3780 0.6595 -0.0234 -0.0570 0.0964  301 LYS A CG  
508  C CD  . LYS A 87  ? 0.5008 0.4137 0.7051 -0.0258 -0.0538 0.1178  301 LYS A CD  
509  C CE  . LYS A 87  ? 0.5180 0.4346 0.7337 -0.0312 -0.0543 0.1221  301 LYS A CE  
510  N NZ  . LYS A 87  ? 0.5272 0.4533 0.7596 -0.0329 -0.0497 0.1455  301 LYS A NZ  
511  N N   . PHE A 88  ? 0.3110 0.2200 0.4668 -0.0167 -0.0606 0.0563  302 PHE A N   
512  C CA  . PHE A 88  ? 0.3172 0.2263 0.4755 -0.0153 -0.0677 0.0414  302 PHE A CA  
513  C C   . PHE A 88  ? 0.3973 0.3044 0.5728 -0.0207 -0.0744 0.0421  302 PHE A C   
514  O O   . PHE A 88  ? 0.3886 0.3008 0.5657 -0.0250 -0.0704 0.0538  302 PHE A O   
515  C CB  . PHE A 88  ? 0.3679 0.2902 0.5072 -0.0121 -0.0631 0.0356  302 PHE A CB  
516  C CG  . PHE A 88  ? 0.3834 0.3098 0.5116 -0.0061 -0.0601 0.0293  302 PHE A CG  
517  C CD1 . PHE A 88  ? 0.3912 0.3144 0.5235 -0.0006 -0.0659 0.0170  302 PHE A CD1 
518  C CD2 . PHE A 88  ? 0.3984 0.3323 0.5149 -0.0057 -0.0518 0.0352  302 PHE A CD2 
519  C CE1 . PHE A 88  ? 0.3682 0.2983 0.4917 0.0056  -0.0624 0.0127  302 PHE A CE1 
520  C CE2 . PHE A 88  ? 0.4001 0.3399 0.5104 -0.0010 -0.0492 0.0311  302 PHE A CE2 
521  C CZ  . PHE A 88  ? 0.3762 0.3155 0.4893 0.0049  -0.0540 0.0208  302 PHE A CZ  
522  N N   . TRP A 89  ? 0.3581 0.2584 0.5481 -0.0202 -0.0848 0.0284  303 TRP A N   
523  C CA  . TRP A 89  ? 0.3601 0.2623 0.5653 -0.0252 -0.0936 0.0230  303 TRP A CA  
524  C C   . TRP A 89  ? 0.4020 0.3173 0.5916 -0.0197 -0.0982 0.0036  303 TRP A C   
525  O O   . TRP A 89  ? 0.4303 0.3425 0.6218 -0.0143 -0.1056 -0.0151 303 TRP A O   
526  C CB  . TRP A 89  ? 0.4000 0.2858 0.6385 -0.0294 -0.1038 0.0206  303 TRP A CB  
527  C CG  . TRP A 89  ? 0.3533 0.2326 0.6089 -0.0344 -0.0984 0.0447  303 TRP A CG  
528  C CD1 . TRP A 89  ? 0.3683 0.2506 0.6432 -0.0421 -0.0983 0.0607  303 TRP A CD1 
529  C CD2 . TRP A 89  ? 0.3512 0.2248 0.6053 -0.0310 -0.0917 0.0571  303 TRP A CD2 
530  N NE1 . TRP A 89  ? 0.3610 0.2410 0.6458 -0.0428 -0.0912 0.0830  303 TRP A NE1 
531  C CE2 . TRP A 89  ? 0.3720 0.2472 0.6435 -0.0360 -0.0876 0.0809  303 TRP A CE2 
532  C CE3 . TRP A 89  ? 0.4266 0.2973 0.6672 -0.0235 -0.0888 0.0515  303 TRP A CE3 
533  C CZ2 . TRP A 89  ? 0.3944 0.2698 0.6678 -0.0332 -0.0810 0.0989  303 TRP A CZ2 
534  C CZ3 . TRP A 89  ? 0.4266 0.2959 0.6706 -0.0217 -0.0832 0.0686  303 TRP A CZ3 
535  C CH2 . TRP A 89  ? 0.4499 0.3223 0.7092 -0.0262 -0.0795 0.0919  303 TRP A CH2 
536  N N   . ALA A 90  ? 0.4029 0.3349 0.5771 -0.0198 -0.0932 0.0091  304 ALA A N   
537  C CA  . ALA A 90  ? 0.3414 0.2925 0.4972 -0.0129 -0.0944 -0.0031 304 ALA A CA  
538  C C   . ALA A 90  ? 0.4056 0.3654 0.5706 -0.0133 -0.1083 -0.0201 304 ALA A C   
539  O O   . ALA A 90  ? 0.4442 0.3987 0.6305 -0.0213 -0.1156 -0.0176 304 ALA A O   
540  C CB  . ALA A 90  ? 0.3275 0.2934 0.4680 -0.0125 -0.0837 0.0120  304 ALA A CB  
541  N N   . ASP A 91  ? 0.4111 0.3872 0.5607 -0.0042 -0.1122 -0.0375 305 ASP A N   
542  C CA  . ASP A 91  ? 0.4421 0.4334 0.5950 -0.0024 -0.1260 -0.0571 305 ASP A CA  
543  C C   . ASP A 91  ? 0.4450 0.4670 0.5798 0.0008  -0.1222 -0.0486 305 ASP A C   
544  O O   . ASP A 91  ? 0.4293 0.4707 0.5417 0.0102  -0.1146 -0.0467 305 ASP A O   
545  C CB  . ASP A 91  ? 0.4320 0.4260 0.5786 0.0080  -0.1335 -0.0841 305 ASP A CB  
546  C CG  . ASP A 91  ? 0.4561 0.4638 0.6090 0.0100  -0.1507 -0.1102 305 ASP A CG  
547  O OD1 . ASP A 91  ? 0.4782 0.5009 0.6350 0.0046  -0.1562 -0.1060 305 ASP A OD1 
548  O OD2 . ASP A 91  ? 0.4801 0.4851 0.6347 0.0178  -0.1593 -0.1365 305 ASP A OD2 
549  N N   . LEU A 92  ? 0.4659 0.4938 0.6131 -0.0067 -0.1271 -0.0411 306 LEU A N   
550  C CA  . LEU A 92  ? 0.5096 0.5668 0.6439 -0.0038 -0.1235 -0.0297 306 LEU A CA  
551  C C   . LEU A 92  ? 0.5975 0.6804 0.7331 -0.0015 -0.1395 -0.0479 306 LEU A C   
552  O O   . LEU A 92  ? 0.6214 0.7215 0.7624 -0.0050 -0.1422 -0.0380 306 LEU A O   
553  C CB  . LEU A 92  ? 0.4337 0.4836 0.5797 -0.0122 -0.1151 -0.0045 306 LEU A CB  
554  C CG  . LEU A 92  ? 0.4453 0.4736 0.5893 -0.0141 -0.1000 0.0125  306 LEU A CG  
555  C CD1 . LEU A 92  ? 0.4893 0.5161 0.6426 -0.0198 -0.0920 0.0342  306 LEU A CD1 
556  C CD2 . LEU A 92  ? 0.4162 0.4530 0.5382 -0.0052 -0.0894 0.0155  306 LEU A CD2 
557  N N   . ASN A 93  ? 0.6578 0.7450 0.7887 0.0051  -0.1505 -0.0758 307 ASN A N   
558  C CA  . ASN A 93  ? 0.7015 0.8154 0.8318 0.0086  -0.1677 -0.0989 307 ASN A CA  
559  C C   . ASN A 93  ? 0.6538 0.7994 0.7541 0.0252  -0.1681 -0.1155 307 ASN A C   
560  O O   . ASN A 93  ? 0.6392 0.7761 0.7359 0.0321  -0.1722 -0.1384 307 ASN A O   
561  C CB  . ASN A 93  ? 0.8181 0.9086 0.9785 0.0004  -0.1855 -0.1234 307 ASN A CB  
562  C CG  . ASN A 93  ? 0.8597 0.9279 1.0530 -0.0156 -0.1867 -0.1055 307 ASN A CG  
563  O OD1 . ASN A 93  ? 0.8784 0.9163 1.0847 -0.0217 -0.1776 -0.0906 307 ASN A OD1 
564  N ND2 . ASN A 93  ? 0.8694 0.9558 1.0764 -0.0219 -0.1979 -0.1060 307 ASN A ND2 
565  N N   . TRP A 94  ? 0.6398 0.8243 0.7199 0.0328  -0.1632 -0.1024 308 TRP A N   
566  C CA  . TRP A 94  ? 0.6342 0.8574 0.6850 0.0501  -0.1621 -0.1133 308 TRP A CA  
567  C C   . TRP A 94  ? 0.6354 0.9073 0.6730 0.0564  -0.1672 -0.1074 308 TRP A C   
568  O O   . TRP A 94  ? 0.6261 0.8999 0.6782 0.0471  -0.1703 -0.0930 308 TRP A O   
569  C CB  . TRP A 94  ? 0.5751 0.7967 0.6104 0.0570  -0.1415 -0.0919 308 TRP A CB  
570  C CG  . TRP A 94  ? 0.5507 0.7821 0.5842 0.0545  -0.1262 -0.0548 308 TRP A CG  
571  C CD1 . TRP A 94  ? 0.5706 0.8434 0.5869 0.0653  -0.1178 -0.0367 308 TRP A CD1 
572  C CD2 . TRP A 94  ? 0.5100 0.7100 0.5619 0.0414  -0.1173 -0.0313 308 TRP A CD2 
573  N NE1 . TRP A 94  ? 0.5404 0.8058 0.5663 0.0591  -0.1045 -0.0039 308 TRP A NE1 
574  C CE2 . TRP A 94  ? 0.4881 0.7093 0.5343 0.0449  -0.1041 -0.0020 308 TRP A CE2 
575  C CE3 . TRP A 94  ? 0.5052 0.6634 0.5784 0.0282  -0.1187 -0.0317 308 TRP A CE3 
576  C CZ2 . TRP A 94  ? 0.4354 0.6350 0.4961 0.0359  -0.0932 0.0228  308 TRP A CZ2 
577  C CZ3 . TRP A 94  ? 0.4684 0.6096 0.5525 0.0199  -0.1074 -0.0059 308 TRP A CZ3 
578  C CH2 . TRP A 94  ? 0.4232 0.5838 0.5007 0.0240  -0.0951 0.0190  308 TRP A CH2 
579  N N   . GLY A 110 ? 0.7505 1.2217 0.7466 0.1104  -0.0564 0.1339  324 GLY A N   
580  C CA  . GLY A 110 ? 0.7370 1.2391 0.7334 0.1215  -0.0394 0.1663  324 GLY A CA  
581  C C   . GLY A 110 ? 0.7354 1.2394 0.7191 0.1280  -0.0337 0.1553  324 GLY A C   
582  O O   . GLY A 110 ? 0.7594 1.3033 0.7375 0.1409  -0.0222 0.1771  324 GLY A O   
583  N N   . GLY A 111 ? 0.6736 1.1364 0.6548 0.1197  -0.0411 0.1236  325 GLY A N   
584  C CA  . GLY A 111 ? 0.6224 1.0842 0.5931 0.1257  -0.0367 0.1106  325 GLY A CA  
585  C C   . GLY A 111 ? 0.5482 0.9750 0.5397 0.1171  -0.0213 0.1302  325 GLY A C   
586  O O   . GLY A 111 ? 0.5514 0.9564 0.5652 0.1075  -0.0135 0.1541  325 GLY A O   
587  N N   . PHE A 112 ? 0.5080 0.9303 0.4934 0.1210  -0.0175 0.1189  326 PHE A N   
588  C CA  . PHE A 112 ? 0.4511 0.8423 0.4567 0.1126  -0.0050 0.1342  326 PHE A CA  
589  C C   . PHE A 112 ? 0.3998 0.7331 0.4141 0.0975  -0.0121 0.1119  326 PHE A C   
590  O O   . PHE A 112 ? 0.4448 0.7662 0.4472 0.0988  -0.0218 0.0821  326 PHE A O   
591  C CB  . PHE A 112 ? 0.5028 0.9225 0.5009 0.1247  0.0041  0.1378  326 PHE A CB  
592  C CG  . PHE A 112 ? 0.5348 0.9235 0.5550 0.1153  0.0146  0.1495  326 PHE A CG  
593  C CD1 . PHE A 112 ? 0.5389 0.9282 0.5852 0.1103  0.0281  0.1849  326 PHE A CD1 
594  C CD2 . PHE A 112 ? 0.5743 0.9334 0.5918 0.1115  0.0102  0.1250  326 PHE A CD2 
595  C CE1 . PHE A 112 ? 0.5520 0.9138 0.6208 0.1008  0.0358  0.1931  326 PHE A CE1 
596  C CE2 . PHE A 112 ? 0.5693 0.9033 0.6071 0.1029  0.0185  0.1351  326 PHE A CE2 
597  C CZ  . PHE A 112 ? 0.5484 0.8841 0.6115 0.0972  0.0307  0.1680  326 PHE A CZ  
598  N N   . TYR A 113 ? 0.3808 0.6795 0.4168 0.0841  -0.0070 0.1269  327 TYR A N   
599  C CA  . TYR A 113 ? 0.3722 0.6204 0.4170 0.0707  -0.0117 0.1107  327 TYR A CA  
600  C C   . TYR A 113 ? 0.3981 0.6289 0.4554 0.0667  -0.0021 0.1181  327 TYR A C   
601  O O   . TYR A 113 ? 0.4127 0.6455 0.4880 0.0642  0.0091  0.1429  327 TYR A O   
602  C CB  . TYR A 113 ? 0.3687 0.5918 0.4278 0.0597  -0.0129 0.1191  327 TYR A CB  
603  C CG  . TYR A 113 ? 0.3879 0.6237 0.4383 0.0611  -0.0245 0.1093  327 TYR A CG  
604  C CD1 . TYR A 113 ? 0.3847 0.6627 0.4291 0.0706  -0.0239 0.1234  327 TYR A CD1 
605  C CD2 . TYR A 113 ? 0.4173 0.6253 0.4680 0.0528  -0.0362 0.0877  327 TYR A CD2 
606  C CE1 . TYR A 113 ? 0.4595 0.7518 0.4972 0.0715  -0.0360 0.1137  327 TYR A CE1 
607  C CE2 . TYR A 113 ? 0.4247 0.6449 0.4719 0.0528  -0.0478 0.0788  327 TYR A CE2 
608  C CZ  . TYR A 113 ? 0.4603 0.7227 0.5005 0.0620  -0.0482 0.0906  327 TYR A CZ  
609  O OH  . TYR A 113 ? 0.4813 0.7587 0.5193 0.0616  -0.0612 0.0810  327 TYR A OH  
610  N N   . GLY A 114 ? 0.3940 0.6079 0.4448 0.0661  -0.0071 0.0967  328 GLY A N   
611  C CA  . GLY A 114 ? 0.3949 0.5978 0.4565 0.0635  0.0005  0.1020  328 GLY A CA  
612  C C   . GLY A 114 ? 0.4061 0.5696 0.4707 0.0546  -0.0057 0.0835  328 GLY A C   
613  O O   . GLY A 114 ? 0.4332 0.5800 0.4900 0.0525  -0.0164 0.0638  328 GLY A O   
614  N N   . VAL A 115 ? 0.3510 0.5015 0.4297 0.0491  0.0007  0.0914  329 VAL A N   
615  C CA  . VAL A 115 ? 0.3588 0.4786 0.4407 0.0423  -0.0040 0.0772  329 VAL A CA  
616  C C   . VAL A 115 ? 0.3963 0.5288 0.4809 0.0479  0.0005  0.0773  329 VAL A C   
617  O O   . VAL A 115 ? 0.4015 0.5533 0.4977 0.0493  0.0099  0.0956  329 VAL A O   
618  C CB  . VAL A 115 ? 0.3716 0.4622 0.4690 0.0294  -0.0022 0.0847  329 VAL A CB  
619  C CG1 . VAL A 115 ? 0.4134 0.4785 0.5120 0.0239  -0.0074 0.0714  329 VAL A CG1 
620  C CG2 . VAL A 115 ? 0.3766 0.4573 0.4729 0.0251  -0.0051 0.0865  329 VAL A CG2 
621  N N   . SER A 116 ? 0.4063 0.5291 0.4835 0.0513  -0.0060 0.0584  330 SER A N   
622  C CA  . SER A 116 ? 0.3896 0.5238 0.4705 0.0571  -0.0021 0.0577  330 SER A CA  
623  C C   . SER A 116 ? 0.4228 0.5276 0.5118 0.0495  -0.0068 0.0497  330 SER A C   
624  O O   . SER A 116 ? 0.3930 0.4738 0.4778 0.0460  -0.0152 0.0364  330 SER A O   
625  C CB  . SER A 116 ? 0.4088 0.5669 0.4737 0.0729  -0.0043 0.0428  330 SER A CB  
626  O OG  . SER A 116 ? 0.4409 0.6360 0.4975 0.0823  0.0016  0.0532  330 SER A OG  
627  N N   . SER A 117 ? 0.4057 0.5152 0.5084 0.0468  -0.0014 0.0593  331 SER A N   
628  C CA  . SER A 117 ? 0.4009 0.4894 0.5114 0.0407  -0.0058 0.0535  331 SER A CA  
629  C C   . SER A 117 ? 0.4019 0.5092 0.5206 0.0472  -0.0017 0.0562  331 SER A C   
630  O O   . SER A 117 ? 0.3851 0.5177 0.5132 0.0496  0.0067  0.0705  331 SER A O   
631  C CB  . SER A 117 ? 0.4379 0.5084 0.5610 0.0269  -0.0055 0.0621  331 SER A CB  
632  O OG  . SER A 117 ? 0.5503 0.6047 0.6669 0.0219  -0.0083 0.0603  331 SER A OG  
633  N N   . GLN A 118 ? 0.4231 0.5198 0.5410 0.0503  -0.0072 0.0445  332 GLN A N   
634  C CA  . GLN A 118 ? 0.4568 0.5703 0.5846 0.0561  -0.0039 0.0473  332 GLN A CA  
635  C C   . GLN A 118 ? 0.4499 0.5448 0.5870 0.0492  -0.0100 0.0447  332 GLN A C   
636  O O   . GLN A 118 ? 0.4480 0.5212 0.5789 0.0490  -0.0173 0.0344  332 GLN A O   
637  C CB  . GLN A 118 ? 0.5226 0.6525 0.6399 0.0732  -0.0032 0.0353  332 GLN A CB  
638  C CG  . GLN A 118 ? 0.5891 0.7400 0.7175 0.0815  0.0015  0.0389  332 GLN A CG  
639  C CD  . GLN A 118 ? 0.6331 0.8052 0.7506 0.1009  0.0042  0.0266  332 GLN A CD  
640  O OE1 . GLN A 118 ? 0.6767 0.8596 0.7786 0.1086  0.0050  0.0194  332 GLN A OE1 
641  N NE2 . GLN A 118 ? 0.6212 0.8014 0.7471 0.1099  0.0052  0.0231  332 GLN A NE2 
642  N N   . TYR A 119 ? 0.3924 0.4983 0.5464 0.0435  -0.0073 0.0554  333 TYR A N   
643  C CA  . TYR A 119 ? 0.3629 0.4592 0.5261 0.0379  -0.0134 0.0539  333 TYR A CA  
644  C C   . TYR A 119 ? 0.3633 0.4826 0.5389 0.0457  -0.0108 0.0576  333 TYR A C   
645  O O   . TYR A 119 ? 0.3425 0.4870 0.5233 0.0526  -0.0027 0.0647  333 TYR A O   
646  C CB  . TYR A 119 ? 0.3546 0.4437 0.5294 0.0229  -0.0152 0.0603  333 TYR A CB  
647  C CG  . TYR A 119 ? 0.3605 0.4289 0.5256 0.0156  -0.0167 0.0579  333 TYR A CG  
648  C CD1 . TYR A 119 ? 0.4048 0.4522 0.5608 0.0115  -0.0237 0.0505  333 TYR A CD1 
649  C CD2 . TYR A 119 ? 0.3807 0.4536 0.5475 0.0137  -0.0104 0.0653  333 TYR A CD2 
650  C CE1 . TYR A 119 ? 0.4228 0.4538 0.5710 0.0057  -0.0242 0.0492  333 TYR A CE1 
651  C CE2 . TYR A 119 ? 0.4120 0.4672 0.5716 0.0079  -0.0114 0.0638  333 TYR A CE2 
652  C CZ  . TYR A 119 ? 0.4265 0.4607 0.5768 0.0039  -0.0182 0.0551  333 TYR A CZ  
653  O OH  . TYR A 119 ? 0.4410 0.4603 0.5852 -0.0009 -0.0184 0.0544  333 TYR A OH  
654  N N   . GLU A 120 ? 0.3899 0.5038 0.5711 0.0454  -0.0170 0.0545  334 GLU A N   
655  C CA  A GLU A 120 ? 0.3785 0.5146 0.5739 0.0527  -0.0152 0.0588  334 GLU A CA  
656  C CA  B GLU A 120 ? 0.3776 0.5138 0.5730 0.0527  -0.0152 0.0589  334 GLU A CA  
657  C C   . GLU A 120 ? 0.3892 0.5258 0.5986 0.0434  -0.0222 0.0626  334 GLU A C   
658  O O   . GLU A 120 ? 0.3989 0.5164 0.6018 0.0356  -0.0295 0.0585  334 GLU A O   
659  C CB  A GLU A 120 ? 0.3926 0.5273 0.5803 0.0691  -0.0155 0.0490  334 GLU A CB  
660  C CB  B GLU A 120 ? 0.3920 0.5269 0.5797 0.0690  -0.0155 0.0490  334 GLU A CB  
661  C CG  A GLU A 120 ? 0.4140 0.5246 0.5985 0.0690  -0.0245 0.0423  334 GLU A CG  
662  C CG  B GLU A 120 ? 0.4131 0.5602 0.5898 0.0817  -0.0082 0.0436  334 GLU A CG  
663  C CD  A GLU A 120 ? 0.4704 0.5797 0.6560 0.0856  -0.0248 0.0337  334 GLU A CD  
664  C CD  B GLU A 120 ? 0.4660 0.6075 0.6365 0.0981  -0.0100 0.0288  334 GLU A CD  
665  O OE1 A GLU A 120 ? 0.4872 0.6159 0.6733 0.0980  -0.0181 0.0304  334 GLU A OE1 
666  O OE1 B GLU A 120 ? 0.4941 0.6231 0.6724 0.0998  -0.0159 0.0263  334 GLU A OE1 
667  O OE2 A GLU A 120 ? 0.4760 0.5662 0.6636 0.0870  -0.0314 0.0307  334 GLU A OE2 
668  O OE2 B GLU A 120 ? 0.4982 0.6491 0.6571 0.1099  -0.0060 0.0194  334 GLU A OE2 
669  N N   . SER A 121 ? 0.3733 0.5355 0.6022 0.0448  -0.0202 0.0707  335 SER A N   
670  C CA  . SER A 121 ? 0.3791 0.5480 0.6233 0.0367  -0.0280 0.0735  335 SER A CA  
671  C C   . SER A 121 ? 0.3437 0.5424 0.6076 0.0446  -0.0253 0.0813  335 SER A C   
672  O O   . SER A 121 ? 0.3330 0.5496 0.6006 0.0548  -0.0158 0.0861  335 SER A O   
673  C CB  . SER A 121 ? 0.4052 0.5728 0.6616 0.0197  -0.0307 0.0763  335 SER A CB  
674  O OG  . SER A 121 ? 0.4744 0.6628 0.7514 0.0171  -0.0229 0.0874  335 SER A OG  
675  N N   . LEU A 122 ? 0.3555 0.5628 0.6316 0.0408  -0.0337 0.0829  336 LEU A N   
676  C CA  . LEU A 122 ? 0.3458 0.5841 0.6447 0.0464  -0.0324 0.0916  336 LEU A CA  
677  C C   . LEU A 122 ? 0.3279 0.5868 0.6546 0.0319  -0.0338 0.1001  336 LEU A C   
678  O O   . LEU A 122 ? 0.3224 0.6112 0.6733 0.0348  -0.0303 0.1105  336 LEU A O   
679  C CB  . LEU A 122 ? 0.3827 0.6230 0.6824 0.0520  -0.0412 0.0904  336 LEU A CB  
680  C CG  . LEU A 122 ? 0.4035 0.6253 0.6857 0.0676  -0.0398 0.0845  336 LEU A CG  
681  C CD1 . LEU A 122 ? 0.4225 0.6477 0.7098 0.0720  -0.0486 0.0877  336 LEU A CD1 
682  C CD2 . LEU A 122 ? 0.3970 0.6306 0.6816 0.0842  -0.0287 0.0846  336 LEU A CD2 
683  N N   . GLU A 123 ? 0.3258 0.5687 0.6520 0.0164  -0.0390 0.0954  337 GLU A N   
684  C CA  . GLU A 123 ? 0.4013 0.6585 0.7582 0.0010  -0.0418 0.1009  337 GLU A CA  
685  C C   . GLU A 123 ? 0.4315 0.6848 0.7953 -0.0035 -0.0314 0.1084  337 GLU A C   
686  O O   . GLU A 123 ? 0.2774 0.5082 0.6172 -0.0007 -0.0272 0.1035  337 GLU A O   
687  C CB  . GLU A 123 ? 0.5011 0.7458 0.8580 -0.0130 -0.0559 0.0887  337 GLU A CB  
688  C CG  . GLU A 123 ? 0.6240 0.8718 0.9676 -0.0076 -0.0664 0.0822  337 GLU A CG  
689  C CD  . GLU A 123 ? 0.7377 0.9623 1.0575 -0.0129 -0.0749 0.0688  337 GLU A CD  
690  O OE1 . GLU A 123 ? 0.7554 0.9647 1.0759 -0.0238 -0.0756 0.0618  337 GLU A OE1 
691  O OE2 . GLU A 123 ? 0.8104 1.0336 1.1125 -0.0052 -0.0803 0.0666  337 GLU A OE2 
692  N N   . HIS A 124 ? 0.2768 0.5538 0.6759 -0.0103 -0.0272 0.1222  338 HIS A N   
693  C CA  . HIS A 124 ? 0.3501 0.6269 0.7621 -0.0151 -0.0172 0.1339  338 HIS A CA  
694  C C   . HIS A 124 ? 0.3258 0.5761 0.7442 -0.0318 -0.0246 0.1249  338 HIS A C   
695  O O   . HIS A 124 ? 0.3430 0.5936 0.7849 -0.0453 -0.0357 0.1184  338 HIS A O   
696  C CB  . HIS A 124 ? 0.3689 0.6818 0.8224 -0.0172 -0.0096 0.1553  338 HIS A CB  
697  C CG  . HIS A 124 ? 0.3780 0.6960 0.8469 -0.0198 0.0026  0.1727  338 HIS A CG  
698  N ND1 . HIS A 124 ? 0.3780 0.7159 0.8348 -0.0040 0.0178  0.1867  338 HIS A ND1 
699  C CD2 . HIS A 124 ? 0.3879 0.6951 0.8844 -0.0353 0.0019  0.1789  338 HIS A CD2 
700  C CE1 . HIS A 124 ? 0.3714 0.7134 0.8470 -0.0096 0.0263  0.2035  338 HIS A CE1 
701  N NE2 . HIS A 124 ? 0.3889 0.7106 0.8907 -0.0289 0.0171  0.1998  338 HIS A NE2 
702  N N   . MET A 125 ? 0.3269 0.5555 0.7248 -0.0300 -0.0189 0.1232  339 MET A N   
703  C CA  . MET A 125 ? 0.3363 0.5382 0.7382 -0.0432 -0.0242 0.1144  339 MET A CA  
704  C C   . MET A 125 ? 0.3439 0.5405 0.7497 -0.0427 -0.0124 0.1277  339 MET A C   
705  O O   . MET A 125 ? 0.2779 0.4914 0.6756 -0.0308 -0.0008 0.1416  339 MET A O   
706  C CB  . MET A 125 ? 0.3356 0.5107 0.7005 -0.0412 -0.0329 0.0938  339 MET A CB  
707  C CG  . MET A 125 ? 0.4030 0.5836 0.7649 -0.0429 -0.0459 0.0814  339 MET A CG  
708  S SD  . MET A 125 ? 0.3867 0.5417 0.7067 -0.0388 -0.0540 0.0630  339 MET A SD  
709  C CE  . MET A 125 ? 0.3966 0.5453 0.6859 -0.0218 -0.0434 0.0693  339 MET A CE  
710  N N   . THR A 126 ? 0.3625 0.5376 0.7815 -0.0546 -0.0156 0.1231  340 THR A N   
711  C CA  . THR A 126 ? 0.3633 0.5270 0.7795 -0.0533 -0.0061 0.1328  340 THR A CA  
712  C C   . THR A 126 ? 0.3691 0.4999 0.7555 -0.0545 -0.0123 0.1133  340 THR A C   
713  O O   . THR A 126 ? 0.3854 0.5001 0.7782 -0.0642 -0.0228 0.0968  340 THR A O   
714  C CB  . THR A 126 ? 0.3659 0.5338 0.8319 -0.0654 -0.0021 0.1493  340 THR A CB  
715  O OG1 . THR A 126 ? 0.3618 0.5647 0.8559 -0.0627 0.0062  0.1724  340 THR A OG1 
716  C CG2 . THR A 126 ? 0.3488 0.5029 0.8116 -0.0637 0.0068  0.1592  340 THR A CG2 
717  N N   . LEU A 127 ? 0.3570 0.4806 0.7110 -0.0441 -0.0061 0.1144  341 LEU A N   
718  C CA  . LEU A 127 ? 0.3703 0.4663 0.6949 -0.0437 -0.0109 0.0981  341 LEU A CA  
719  C C   . LEU A 127 ? 0.3715 0.4504 0.7062 -0.0490 -0.0067 0.1022  341 LEU A C   
720  O O   . LEU A 127 ? 0.3844 0.4733 0.7300 -0.0459 0.0034  0.1207  341 LEU A O   
721  C CB  . LEU A 127 ? 0.3867 0.4827 0.6728 -0.0303 -0.0085 0.0950  341 LEU A CB  
722  C CG  . LEU A 127 ? 0.3968 0.5050 0.6694 -0.0222 -0.0123 0.0896  341 LEU A CG  
723  C CD1 . LEU A 127 ? 0.3990 0.4990 0.6376 -0.0106 -0.0114 0.0831  341 LEU A CD1 
724  C CD2 . LEU A 127 ? 0.4043 0.5070 0.6810 -0.0291 -0.0237 0.0769  341 LEU A CD2 
725  N N   . THR A 128 ? 0.3351 0.3906 0.6661 -0.0556 -0.0140 0.0856  342 THR A N   
726  C CA  . THR A 128 ? 0.3256 0.3616 0.6586 -0.0577 -0.0103 0.0860  342 THR A CA  
727  C C   . THR A 128 ? 0.3583 0.3815 0.6501 -0.0499 -0.0114 0.0761  342 THR A C   
728  O O   . THR A 128 ? 0.3192 0.3342 0.5919 -0.0499 -0.0194 0.0597  342 THR A O   
729  C CB  . THR A 128 ? 0.3236 0.3424 0.6833 -0.0691 -0.0171 0.0727  342 THR A CB  
730  O OG1 . THR A 128 ? 0.3886 0.4184 0.7938 -0.0778 -0.0163 0.0836  342 THR A OG1 
731  C CG2 . THR A 128 ? 0.3415 0.3391 0.7016 -0.0691 -0.0126 0.0721  342 THR A CG2 
732  N N   . CYS A 129 ? 0.3464 0.3708 0.6261 -0.0430 -0.0035 0.0875  343 CYS A N   
733  C CA  . CYS A 129 ? 0.3596 0.3736 0.6050 -0.0364 -0.0047 0.0799  343 CYS A CA  
734  C C   . CYS A 129 ? 0.3956 0.3929 0.6424 -0.0380 -0.0015 0.0806  343 CYS A C   
735  O O   . CYS A 129 ? 0.4298 0.4322 0.6891 -0.0364 0.0061  0.0960  343 CYS A O   
736  C CB  . CYS A 129 ? 0.3343 0.3645 0.5614 -0.0260 -0.0004 0.0883  343 CYS A CB  
737  S SG  . CYS A 129 ? 0.6442 0.6942 0.8682 -0.0209 -0.0030 0.0866  343 CYS A SG  
738  N N   . SER A 130 ? 0.3917 0.3719 0.6263 -0.0400 -0.0069 0.0652  344 SER A N   
739  C CA  . SER A 130 ? 0.4020 0.3666 0.6373 -0.0403 -0.0039 0.0640  344 SER A CA  
740  C C   . SER A 130 ? 0.3877 0.3484 0.5924 -0.0339 -0.0043 0.0616  344 SER A C   
741  O O   . SER A 130 ? 0.4255 0.3850 0.6105 -0.0323 -0.0100 0.0518  344 SER A O   
742  C CB  . SER A 130 ? 0.4677 0.4179 0.7149 -0.0464 -0.0089 0.0476  344 SER A CB  
743  O OG  . SER A 130 ? 0.5448 0.4803 0.7897 -0.0446 -0.0057 0.0444  344 SER A OG  
744  N N   . SER A 131 ? 0.3565 0.3170 0.5604 -0.0305 0.0016  0.0724  345 SER A N   
745  C CA  . SER A 131 ? 0.3547 0.3123 0.5351 -0.0256 0.0008  0.0709  345 SER A CA  
746  C C   . SER A 131 ? 0.3988 0.3443 0.5840 -0.0257 0.0044  0.0715  345 SER A C   
747  O O   . SER A 131 ? 0.4369 0.3840 0.6387 -0.0251 0.0105  0.0835  345 SER A O   
748  C CB  . SER A 131 ? 0.4119 0.3851 0.5835 -0.0198 0.0029  0.0815  345 SER A CB  
749  O OG  . SER A 131 ? 0.5356 0.5205 0.7023 -0.0177 0.0002  0.0796  345 SER A OG  
750  N N   . LYS A 132 ? 0.3821 0.3180 0.5539 -0.0254 0.0013  0.0604  346 LYS A N   
751  C CA  . LYS A 132 ? 0.3833 0.3094 0.5583 -0.0239 0.0051  0.0596  346 LYS A CA  
752  C C   . LYS A 132 ? 0.3907 0.3198 0.5482 -0.0198 0.0051  0.0642  346 LYS A C   
753  O O   . LYS A 132 ? 0.3726 0.3022 0.5136 -0.0191 0.0006  0.0585  346 LYS A O   
754  C CB  . LYS A 132 ? 0.4364 0.3530 0.6113 -0.0252 0.0026  0.0431  346 LYS A CB  
755  C CG  . LYS A 132 ? 0.5645 0.4757 0.7630 -0.0302 0.0016  0.0355  346 LYS A CG  
756  C CD  . LYS A 132 ? 0.6597 0.5644 0.8548 -0.0301 -0.0025 0.0150  346 LYS A CD  
757  C CE  . LYS A 132 ? 0.7231 0.6221 0.9451 -0.0362 -0.0058 0.0039  346 LYS A CE  
758  N NZ  . LYS A 132 ? 0.7461 0.6561 0.9705 -0.0413 -0.0118 0.0049  346 LYS A NZ  
759  N N   . VAL A 133 ? 0.3580 0.2906 0.5221 -0.0173 0.0098  0.0762  347 VAL A N   
760  C CA  . VAL A 133 ? 0.3745 0.3110 0.5271 -0.0143 0.0091  0.0807  347 VAL A CA  
761  C C   . VAL A 133 ? 0.3967 0.3245 0.5519 -0.0125 0.0129  0.0775  347 VAL A C   
762  O O   . VAL A 133 ? 0.3599 0.2812 0.5314 -0.0113 0.0186  0.0790  347 VAL A O   
763  C CB  . VAL A 133 ? 0.3659 0.3153 0.5232 -0.0115 0.0114  0.0949  347 VAL A CB  
764  C CG1 . VAL A 133 ? 0.3782 0.3325 0.5270 -0.0095 0.0092  0.0981  347 VAL A CG1 
765  C CG2 . VAL A 133 ? 0.3685 0.3306 0.5209 -0.0111 0.0083  0.0967  347 VAL A CG2 
766  N N   . CYS A 134 ? 0.3836 0.3120 0.5250 -0.0115 0.0103  0.0737  348 CYS A N   
767  C CA  . CYS A 134 ? 0.3862 0.3107 0.5276 -0.0081 0.0146  0.0703  348 CYS A CA  
768  C C   . CYS A 134 ? 0.3799 0.3117 0.5185 -0.0058 0.0157  0.0803  348 CYS A C   
769  O O   . CYS A 134 ? 0.3177 0.2559 0.4493 -0.0079 0.0102  0.0844  348 CYS A O   
770  C CB  . CYS A 134 ? 0.3841 0.3074 0.5135 -0.0078 0.0119  0.0577  348 CYS A CB  
771  S SG  . CYS A 134 ? 0.4618 0.3784 0.5975 -0.0109 0.0093  0.0432  348 CYS A SG  
772  N N   . SER A 135 ? 0.3922 0.3232 0.5395 -0.0014 0.0224  0.0836  349 SER A N   
773  C CA  . SER A 135 ? 0.3940 0.3339 0.5422 0.0012  0.0243  0.0936  349 SER A CA  
774  C C   . SER A 135 ? 0.4108 0.3509 0.5566 0.0071  0.0304  0.0885  349 SER A C   
775  O O   . SER A 135 ? 0.4082 0.3409 0.5617 0.0117  0.0364  0.0814  349 SER A O   
776  C CB  . SER A 135 ? 0.4246 0.3692 0.5873 0.0031  0.0276  0.1060  349 SER A CB  
777  O OG  . SER A 135 ? 0.4142 0.3697 0.5798 0.0052  0.0285  0.1159  349 SER A OG  
778  N N   . PHE A 136 ? 0.4275 0.3771 0.5643 0.0074  0.0290  0.0921  350 PHE A N   
779  C CA  . PHE A 136 ? 0.4601 0.4164 0.5912 0.0144  0.0352  0.0887  350 PHE A CA  
780  C C   . PHE A 136 ? 0.4922 0.4424 0.6140 0.0175  0.0358  0.0705  350 PHE A C   
781  O O   . PHE A 136 ? 0.5427 0.4944 0.6638 0.0255  0.0422  0.0613  350 PHE A O   
782  C CB  . PHE A 136 ? 0.4551 0.4155 0.5983 0.0214  0.0439  0.0951  350 PHE A CB  
783  C CG  . PHE A 136 ? 0.4554 0.4268 0.6083 0.0188  0.0426  0.1130  350 PHE A CG  
784  C CD1 . PHE A 136 ? 0.4265 0.4132 0.5791 0.0201  0.0441  0.1233  350 PHE A CD1 
785  C CD2 . PHE A 136 ? 0.4641 0.4337 0.6281 0.0151  0.0394  0.1203  350 PHE A CD2 
786  C CE1 . PHE A 136 ? 0.4431 0.4406 0.6088 0.0165  0.0414  0.1387  350 PHE A CE1 
787  C CE2 . PHE A 136 ? 0.4708 0.4532 0.6439 0.0126  0.0363  0.1344  350 PHE A CE2 
788  C CZ  . PHE A 136 ? 0.4196 0.4147 0.5947 0.0126  0.0367  0.1427  350 PHE A CZ  
789  N N   . GLY A 137 ? 0.4814 0.4262 0.5970 0.0116  0.0286  0.0640  351 GLY A N   
790  C CA  . GLY A 137 ? 0.4534 0.3956 0.5608 0.0132  0.0267  0.0465  351 GLY A CA  
791  C C   . GLY A 137 ? 0.4796 0.4073 0.6009 0.0129  0.0281  0.0336  351 GLY A C   
792  O O   . GLY A 137 ? 0.4805 0.4054 0.5991 0.0136  0.0254  0.0163  351 GLY A O   
793  N N   . LYS A 138 ? 0.5236 0.3538 0.7956 -0.0888 0.0866  0.0185  352 LYS A N   
794  C CA  . LYS A 138 ? 0.5454 0.3903 0.7878 -0.0814 0.0618  0.0228  352 LYS A CA  
795  C C   . LYS A 138 ? 0.5272 0.3709 0.7609 -0.0707 0.0516  0.0193  352 LYS A C   
796  O O   . LYS A 138 ? 0.4287 0.2739 0.6825 -0.0676 0.0525  -0.0023 352 LYS A O   
797  C CB  . LYS A 138 ? 0.5929 0.4521 0.8340 -0.0810 0.0503  0.0013  352 LYS A CB  
798  C CG  . LYS A 138 ? 0.6657 0.5257 0.9123 -0.0915 0.0598  0.0057  352 LYS A CG  
799  C CD  . LYS A 138 ? 0.7368 0.6138 0.9812 -0.0868 0.0491  -0.0158 352 LYS A CD  
800  C CE  . LYS A 138 ? 0.7713 0.6472 1.0192 -0.0973 0.0592  -0.0097 352 LYS A CE  
801  N NZ  . LYS A 138 ? 0.8008 0.6948 1.0435 -0.0890 0.0497  -0.0291 352 LYS A NZ  
802  N N   . GLN A 139 ? 0.4853 0.3290 0.6910 -0.0666 0.0445  0.0368  353 GLN A N   
803  C CA  . GLN A 139 ? 0.4839 0.3220 0.6772 -0.0561 0.0387  0.0367  353 GLN A CA  
804  C C   . GLN A 139 ? 0.5192 0.3546 0.6990 -0.0413 0.0282  0.0149  353 GLN A C   
805  O O   . GLN A 139 ? 0.5064 0.3386 0.6642 -0.0370 0.0255  0.0114  353 GLN A O   
806  C CB  . GLN A 139 ? 0.5137 0.3567 0.6847 -0.0601 0.0394  0.0545  353 GLN A CB  
807  C CG  . GLN A 139 ? 0.5610 0.3933 0.7163 -0.0510 0.0384  0.0541  353 GLN A CG  
808  C CD  . GLN A 139 ? 0.5804 0.4234 0.7219 -0.0622 0.0450  0.0626  353 GLN A CD  
809  O OE1 . GLN A 139 ? 0.6114 0.4341 0.7304 -0.0616 0.0524  0.0574  353 GLN A OE1 
810  N NE2 . GLN A 139 ? 0.5443 0.4220 0.6982 -0.0706 0.0460  0.0728  353 GLN A NE2 
811  N N   . VAL A 140 ? 0.4362 0.2736 0.6246 -0.0288 0.0243  0.0003  354 VAL A N   
812  C CA  . VAL A 140 ? 0.4851 0.3285 0.6526 -0.0033 0.0132  -0.0200 354 VAL A CA  
813  C C   . VAL A 140 ? 0.4743 0.2970 0.6120 0.0135  0.0141  -0.0091 354 VAL A C   
814  O O   . VAL A 140 ? 0.4916 0.3043 0.5914 0.0413  0.0117  -0.0137 354 VAL A O   
815  C CB  . VAL A 140 ? 0.4859 0.3639 0.6876 0.0023  0.0059  -0.0580 354 VAL A CB  
816  C CG1 . VAL A 140 ? 0.4823 0.3825 0.7121 -0.0126 0.0081  -0.0737 354 VAL A CG1 
817  C CG2 . VAL A 140 ? 0.4732 0.3474 0.7069 -0.0104 0.0150  -0.0640 354 VAL A CG2 
818  N N   . VAL A 141 ? 0.4579 0.2724 0.6085 0.0012  0.0209  0.0068  355 VAL A N   
819  C CA  . VAL A 141 ? 0.4710 0.2668 0.5978 0.0128  0.0249  0.0189  355 VAL A CA  
820  C C   . VAL A 141 ? 0.4993 0.2955 0.6346 -0.0062 0.0347  0.0429  355 VAL A C   
821  O O   . VAL A 141 ? 0.4463 0.2558 0.6079 -0.0172 0.0373  0.0502  355 VAL A O   
822  C CB  . VAL A 141 ? 0.5788 0.3789 0.7149 0.0292  0.0194  0.0034  355 VAL A CB  
823  C CG1 . VAL A 141 ? 0.5910 0.3682 0.6973 0.0444  0.0253  0.0175  355 VAL A CG1 
824  C CG2 . VAL A 141 ? 0.5835 0.4072 0.7188 0.0506  0.0063  -0.0301 355 VAL A CG2 
825  N N   . GLU A 142 ? 0.4977 0.2818 0.6094 -0.0077 0.0440  0.0532  356 GLU A N   
826  C CA  . GLU A 142 ? 0.5139 0.3153 0.6375 -0.0199 0.0512  0.0680  356 GLU A CA  
827  C C   . GLU A 142 ? 0.5202 0.3024 0.6257 -0.0088 0.0601  0.0705  356 GLU A C   
828  O O   . GLU A 142 ? 0.5311 0.2827 0.6056 -0.0033 0.0724  0.0665  356 GLU A O   
829  C CB  . GLU A 142 ? 0.5202 0.3441 0.6456 -0.0428 0.0583  0.0706  356 GLU A CB  
830  C CG  . GLU A 142 ? 0.5990 0.4647 0.7415 -0.0508 0.0622  0.0793  356 GLU A CG  
831  C CD  . GLU A 142 ? 0.6813 0.5866 0.8297 -0.0745 0.0686  0.0712  356 GLU A CD  
832  O OE1 . GLU A 142 ? 0.7280 0.6145 0.8635 -0.0879 0.0745  0.0606  356 GLU A OE1 
833  O OE2 . GLU A 142 ? 0.6935 0.6543 0.8593 -0.0779 0.0684  0.0727  356 GLU A OE2 
834  N N   . LYS A 143 ? 0.5328 0.3262 0.6533 -0.0026 0.0587  0.0789  357 LYS A N   
835  C CA  . LYS A 143 ? 0.5621 0.3405 0.6685 0.0074  0.0684  0.0828  357 LYS A CA  
836  C C   . LYS A 143 ? 0.5245 0.3415 0.6505 -0.0049 0.0755  0.0934  357 LYS A C   
837  O O   . LYS A 143 ? 0.5003 0.3480 0.6469 -0.0022 0.0692  0.1036  357 LYS A O   
838  C CB  . LYS A 143 ? 0.6168 0.3773 0.7202 0.0309  0.0609  0.0791  357 LYS A CB  
839  C CG  . LYS A 143 ? 0.7531 0.4891 0.8324 0.0472  0.0713  0.0825  357 LYS A CG  
840  C CD  . LYS A 143 ? 0.8343 0.5537 0.9024 0.0744  0.0620  0.0712  357 LYS A CD  
841  C CE  . LYS A 143 ? 0.8669 0.6004 0.9657 0.0718  0.0574  0.0723  357 LYS A CE  
842  N NZ  . LYS A 143 ? 0.8994 0.6176 0.9868 0.0949  0.0542  0.0594  357 LYS A NZ  
843  N N   . VAL A 144 ? 0.5134 0.3302 0.6314 -0.0160 0.0927  0.0893  358 VAL A N   
844  C CA  . VAL A 144 ? 0.4868 0.3582 0.6290 -0.0287 0.0996  0.0905  358 VAL A CA  
845  C C   . VAL A 144 ? 0.5188 0.3748 0.6545 -0.0196 0.1137  0.0933  358 VAL A C   
846  O O   . VAL A 144 ? 0.5363 0.3441 0.6471 -0.0209 0.1339  0.0869  358 VAL A O   
847  C CB  . VAL A 144 ? 0.4894 0.3939 0.6419 -0.0607 0.1131  0.0725  358 VAL A CB  
848  C CG1 . VAL A 144 ? 0.4790 0.4639 0.6635 -0.0724 0.1173  0.0645  358 VAL A CG1 
849  C CG2 . VAL A 144 ? 0.5005 0.4186 0.6561 -0.0681 0.0996  0.0705  358 VAL A CG2 
850  N N   . GLU A 145 ? 0.5177 0.4096 0.6708 -0.0062 0.1069  0.1050  359 GLU A N   
851  C CA  . GLU A 145 ? 0.5809 0.4638 0.7305 0.0040  0.1194  0.1090  359 GLU A CA  
852  C C   . GLU A 145 ? 0.5553 0.5185 0.7362 -0.0035 0.1241  0.1064  359 GLU A C   
853  O O   . GLU A 145 ? 0.4780 0.5063 0.6786 -0.0044 0.1123  0.1069  359 GLU A O   
854  C CB  . GLU A 145 ? 0.6595 0.5053 0.7960 0.0342  0.1089  0.1237  359 GLU A CB  
855  C CG  . GLU A 145 ? 0.7914 0.5737 0.8985 0.0463  0.1045  0.1172  359 GLU A CG  
856  C CD  . GLU A 145 ? 0.8542 0.6112 0.9545 0.0713  0.0959  0.1210  359 GLU A CD  
857  O OE1 . GLU A 145 ? 0.9013 0.6186 0.9743 0.0886  0.0957  0.1125  359 GLU A OE1 
858  O OE2 . GLU A 145 ? 0.8708 0.6470 0.9894 0.0763  0.0925  0.1311  359 GLU A OE2 
859  N N   . THR A 146 ? 0.5312 0.4947 0.7148 -0.0051 0.1424  0.1023  360 THR A N   
860  C CA  . THR A 146 ? 0.5647 0.6164 0.7823 -0.0116 0.1484  0.0933  360 THR A CA  
861  C C   . THR A 146 ? 0.5140 0.5571 0.7271 0.0156  0.1515  0.1104  360 THR A C   
862  O O   . THR A 146 ? 0.5367 0.5056 0.7243 0.0231  0.1636  0.1161  360 THR A O   
863  C CB  . THR A 146 ? 0.5724 0.6487 0.8100 -0.0529 0.1778  0.0596  360 THR A CB  
864  O OG1 . THR A 146 ? 0.5670 0.6402 0.8040 -0.0782 0.1781  0.0435  360 THR A OG1 
865  C CG2 . THR A 146 ? 0.5533 0.7469 0.8366 -0.0622 0.1811  0.0397  360 THR A CG2 
866  N N   . GLU A 147 ? 0.5017 0.6210 0.7342 0.0360  0.1416  0.1197  361 GLU A N   
867  C CA  . GLU A 147 ? 0.5510 0.6659 0.7783 0.0648  0.1459  0.1375  361 GLU A CA  
868  C C   . GLU A 147 ? 0.5061 0.7370 0.7666 0.0731  0.1474  0.1298  361 GLU A C   
869  O O   . GLU A 147 ? 0.4949 0.8050 0.7665 0.0882  0.1329  0.1318  361 GLU A O   
870  C CB  . GLU A 147 ? 0.5730 0.6341 0.7731 0.1002  0.1332  0.1673  361 GLU A CB  
871  C CG  . GLU A 147 ? 0.6358 0.6875 0.8267 0.1327  0.1401  0.1871  361 GLU A CG  
872  C CD  . GLU A 147 ? 0.7175 0.7107 0.8961 0.1267  0.1541  0.1816  361 GLU A CD  
873  O OE1 . GLU A 147 ? 0.7722 0.7067 0.9358 0.1082  0.1576  0.1693  361 GLU A OE1 
874  O OE2 . GLU A 147 ? 0.7307 0.7363 0.9101 0.1458  0.1634  0.1913  361 GLU A OE2 
875  N N   . ARG A 148 ? 0.5174 0.7627 0.7918 0.0670  0.1660  0.1198  362 ARG A N   
876  C CA  . ARG A 148 ? 0.5804 0.9479 0.8914 0.0754  0.1685  0.1066  362 ARG A CA  
877  C C   . ARG A 148 ? 0.6005 0.9762 0.8926 0.1300  0.1598  0.1422  362 ARG A C   
878  O O   . ARG A 148 ? 0.5373 0.8124 0.7942 0.1498  0.1618  0.1697  362 ARG A O   
879  C CB  . ARG A 148 ? 0.5251 0.9071 0.8648 0.0401  0.1993  0.0752  362 ARG A CB  
880  N N   . ALA A 149 ? 0.4246 0.6201 0.6292 -0.0468 0.0224  0.2398  363 ALA A N   
881  C CA  . ALA A 149 ? 0.3933 0.6029 0.5712 -0.0320 0.0279  0.1951  363 ALA A CA  
882  C C   . ALA A 149 ? 0.3713 0.7082 0.5553 -0.0170 0.0349  0.2016  363 ALA A C   
883  O O   . ALA A 149 ? 0.3490 0.7601 0.5617 -0.0228 0.0347  0.2517  363 ALA A O   
884  C CB  . ALA A 149 ? 0.3860 0.5263 0.5645 -0.0353 0.0202  0.1855  363 ALA A CB  
885  N N   . GLN A 150 ? 0.3705 0.7385 0.5310 0.0021  0.0379  0.1506  364 GLN A N   
886  C CA  . GLN A 150 ? 0.4011 0.8983 0.5645 0.0230  0.0432  0.1402  364 GLN A CA  
887  C C   . GLN A 150 ? 0.3953 0.8769 0.5502 0.0432  0.0348  0.0833  364 GLN A C   
888  O O   . GLN A 150 ? 0.4259 0.8335 0.5640 0.0483  0.0248  0.0354  364 GLN A O   
889  C CB  . GLN A 150 ? 0.4577 1.0286 0.6079 0.0331  0.0496  0.1261  364 GLN A CB  
890  C CG  . GLN A 150 ? 0.5408 1.2464 0.6874 0.0617  0.0527  0.0932  364 GLN A CG  
891  C CD  . GLN A 150 ? 0.5869 1.4317 0.7553 0.0595  0.0612  0.1466  364 GLN A CD  
892  O OE1 . GLN A 150 ? 0.6261 1.4572 0.8010 0.0352  0.0586  0.2093  364 GLN A OE1 
893  N NE2 . GLN A 150 ? 0.5946 1.5158 0.7492 0.0821  0.0575  0.1153  364 GLN A NE2 
894  N N   . LEU A 151 ? 0.3777 0.9297 0.5493 0.0535  0.0354  0.0908  365 LEU A N   
895  C CA  . LEU A 151 ? 0.3483 0.8902 0.5197 0.0751  0.0238  0.0356  365 LEU A CA  
896  C C   . LEU A 151 ? 0.3617 0.9831 0.5247 0.1072  0.0183  -0.0269 365 LEU A C   
897  O O   . LEU A 151 ? 0.3579 1.1172 0.5231 0.1218  0.0289  -0.0213 365 LEU A O   
898  C CB  . LEU A 151 ? 0.3439 0.9500 0.5382 0.0787  0.0262  0.0608  365 LEU A CB  
899  C CG  . LEU A 151 ? 0.3591 0.9622 0.5599 0.1035  0.0121  0.0030  365 LEU A CG  
900  C CD1 . LEU A 151 ? 0.3996 0.8403 0.5936 0.0907  -0.0052 -0.0199 365 LEU A CD1 
901  C CD2 . LEU A 151 ? 0.3532 1.0446 0.5777 0.1084  0.0173  0.0310  365 LEU A CD2 
902  N N   . GLU A 152 ? 0.5039 1.0422 0.6608 0.1176  -0.0020 -0.0857 366 GLU A N   
903  C CA  . GLU A 152 ? 0.5289 1.1248 0.6848 0.1498  -0.0163 -0.1528 366 GLU A CA  
904  C C   . GLU A 152 ? 0.5398 1.0434 0.7075 0.1619  -0.0494 -0.2139 366 GLU A C   
905  O O   . GLU A 152 ? 0.5094 0.8819 0.6717 0.1375  -0.0614 -0.2068 366 GLU A O   
906  C CB  . GLU A 152 ? 0.5422 1.1379 0.6795 0.1430  -0.0106 -0.1497 366 GLU A CB  
907  C CG  . GLU A 152 ? 0.6161 1.2942 0.7538 0.1778  -0.0242 -0.2144 366 GLU A CG  
908  C CD  . GLU A 152 ? 0.6441 1.3261 0.7635 0.1693  -0.0171 -0.2056 366 GLU A CD  
909  O OE1 . GLU A 152 ? 0.6570 1.4305 0.7689 0.1628  0.0063  -0.1618 366 GLU A OE1 
910  O OE2 . GLU A 152 ? 0.6666 1.2616 0.7826 0.1671  -0.0373 -0.2391 366 GLU A OE2 
911  N N   . ASP A 153 ? 0.5784 1.1588 0.7657 0.1995  -0.0669 -0.2735 367 ASP A N   
912  C CA  . ASP A 153 ? 0.6424 1.1475 0.8533 0.2159  -0.1072 -0.3369 367 ASP A CA  
913  C C   . ASP A 153 ? 0.5852 0.9601 0.8029 0.1878  -0.1170 -0.3102 367 ASP A C   
914  O O   . ASP A 153 ? 0.5815 0.8439 0.8091 0.1771  -0.1483 -0.3321 367 ASP A O   
915  C CB  . ASP A 153 ? 0.7611 1.2075 0.9717 0.2185  -0.1339 -0.3770 367 ASP A CB  
916  C CG  . ASP A 153 ? 0.8410 1.4141 1.0490 0.2520  -0.1320 -0.4177 367 ASP A CG  
917  O OD1 . ASP A 153 ? 0.8772 1.5925 1.0897 0.2809  -0.1180 -0.4319 367 ASP A OD1 
918  O OD2 . ASP A 153 ? 0.8838 1.4209 1.0856 0.2490  -0.1453 -0.4350 367 ASP A OD2 
919  N N   . GLY A 154 ? 0.5701 0.9641 0.7846 0.1741  -0.0928 -0.2598 368 GLY A N   
920  C CA  . GLY A 154 ? 0.5546 0.8400 0.7761 0.1508  -0.1014 -0.2366 368 GLY A CA  
921  C C   . GLY A 154 ? 0.5460 0.7126 0.7451 0.1087  -0.0941 -0.1884 368 GLY A C   
922  O O   . GLY A 154 ? 0.5398 0.6067 0.7422 0.0879  -0.1066 -0.1760 368 GLY A O   
923  N N   . ARG A 155 ? 0.5124 0.6967 0.6898 0.0972  -0.0746 -0.1627 369 ARG A N   
924  C CA  . ARG A 155 ? 0.5642 0.6549 0.7214 0.0616  -0.0660 -0.1214 369 ARG A CA  
925  C C   . ARG A 155 ? 0.5132 0.6606 0.6569 0.0529  -0.0362 -0.0759 369 ARG A C   
926  O O   . ARG A 155 ? 0.4597 0.7193 0.6081 0.0715  -0.0235 -0.0737 369 ARG A O   
927  C CB  . ARG A 155 ? 0.6572 0.6746 0.8083 0.0527  -0.0890 -0.1505 369 ARG A CB  
928  C CG  . ARG A 155 ? 0.7079 0.7858 0.8512 0.0671  -0.0856 -0.1712 369 ARG A CG  
929  C CD  . ARG A 155 ? 0.8141 0.8264 0.9624 0.0625  -0.1178 -0.2065 369 ARG A CD  
930  N NE  . ARG A 155 ? 0.8889 0.9559 1.0297 0.0755  -0.1151 -0.2253 369 ARG A NE  
931  C CZ  . ARG A 155 ? 0.9551 1.0964 1.1113 0.1105  -0.1305 -0.2768 369 ARG A CZ  
932  N NH1 . ARG A 155 ? 1.0037 1.1765 1.1860 0.1382  -0.1508 -0.3182 369 ARG A NH1 
933  N NH2 . ARG A 155 ? 0.9657 1.1531 1.1125 0.1195  -0.1272 -0.2901 369 ARG A NH2 
934  N N   . PHE A 156 ? 0.3880 0.4641 0.5182 0.0250  -0.0278 -0.0402 370 PHE A N   
935  C CA  . PHE A 156 ? 0.3692 0.4857 0.4945 0.0159  -0.0066 0.0019  370 PHE A CA  
936  C C   . PHE A 156 ? 0.3781 0.4790 0.4862 0.0109  -0.0057 -0.0106 370 PHE A C   
937  O O   . PHE A 156 ? 0.3959 0.4138 0.4924 -0.0042 -0.0160 -0.0225 370 PHE A O   
938  C CB  . PHE A 156 ? 0.4071 0.4653 0.5372 -0.0073 -0.0006 0.0480  370 PHE A CB  
939  C CG  . PHE A 156 ? 0.4016 0.4821 0.5523 -0.0046 -0.0009 0.0698  370 PHE A CG  
940  C CD1 . PHE A 156 ? 0.3549 0.5367 0.5245 0.0028  0.0095  0.1030  370 PHE A CD1 
941  C CD2 . PHE A 156 ? 0.4526 0.4582 0.6053 -0.0117 -0.0129 0.0613  370 PHE A CD2 
942  C CE1 . PHE A 156 ? 0.3983 0.6072 0.5896 0.0034  0.0082  0.1273  370 PHE A CE1 
943  C CE2 . PHE A 156 ? 0.4689 0.4949 0.6418 -0.0094 -0.0137 0.0819  370 PHE A CE2 
944  C CZ  . PHE A 156 ? 0.4234 0.5513 0.6160 -0.0017 -0.0030 0.1150  370 PHE A CZ  
945  N N   . VAL A 157 ? 0.3713 0.5594 0.4786 0.0222  0.0058  -0.0052 371 VAL A N   
946  C CA  . VAL A 157 ? 0.3652 0.5470 0.4578 0.0186  0.0074  -0.0153 371 VAL A CA  
947  C C   . VAL A 157 ? 0.3825 0.5780 0.4770 0.0036  0.0238  0.0327  371 VAL A C   
948  O O   . VAL A 157 ? 0.3359 0.5859 0.4474 0.0025  0.0324  0.0721  371 VAL A O   
949  C CB  . VAL A 157 ? 0.3856 0.6542 0.4767 0.0450  0.0031  -0.0542 371 VAL A CB  
950  C CG1 . VAL A 157 ? 0.3963 0.6440 0.4950 0.0629  -0.0220 -0.1097 371 VAL A CG1 
951  C CG2 . VAL A 157 ? 0.4101 0.8062 0.5111 0.0590  0.0187  -0.0307 371 VAL A CG2 
952  N N   . TYR A 158 ? 0.3478 0.4952 0.4297 -0.0088 0.0243  0.0305  372 TYR A N   
953  C CA  . TYR A 158 ? 0.3813 0.5346 0.4699 -0.0209 0.0347  0.0683  372 TYR A CA  
954  C C   . TYR A 158 ? 0.3690 0.5569 0.4463 -0.0165 0.0384  0.0550  372 TYR A C   
955  O O   . TYR A 158 ? 0.3869 0.5238 0.4487 -0.0228 0.0331  0.0309  372 TYR A O   
956  C CB  . TYR A 158 ? 0.4070 0.4691 0.4947 -0.0399 0.0318  0.0787  372 TYR A CB  
957  C CG  . TYR A 158 ? 0.4051 0.4255 0.5023 -0.0449 0.0261  0.0886  372 TYR A CG  
958  C CD1 . TYR A 158 ? 0.4366 0.4612 0.5595 -0.0500 0.0263  0.1279  372 TYR A CD1 
959  C CD2 . TYR A 158 ? 0.4143 0.3894 0.4999 -0.0453 0.0163  0.0604  372 TYR A CD2 
960  C CE1 . TYR A 158 ? 0.4482 0.4338 0.5810 -0.0544 0.0196  0.1368  372 TYR A CE1 
961  C CE2 . TYR A 158 ? 0.4117 0.3493 0.5060 -0.0502 0.0108  0.0699  372 TYR A CE2 
962  C CZ  . TYR A 158 ? 0.4380 0.3814 0.5539 -0.0542 0.0139  0.1072  372 TYR A CZ  
963  O OH  . TYR A 158 ? 0.4508 0.3557 0.5765 -0.0590 0.0069  0.1167  372 TYR A OH  
964  N N   . ARG A 159 ? 0.3588 0.6396 0.4451 -0.0072 0.0460  0.0735  373 ARG A N   
965  C CA  . ARG A 159 ? 0.4077 0.7320 0.4830 -0.0006 0.0488  0.0589  373 ARG A CA  
966  C C   . ARG A 159 ? 0.4100 0.7466 0.4978 -0.0131 0.0555  0.0987  373 ARG A C   
967  O O   . ARG A 159 ? 0.3096 0.7071 0.4202 -0.0161 0.0584  0.1419  373 ARG A O   
968  C CB  . ARG A 159 ? 0.4336 0.8685 0.5077 0.0221  0.0499  0.0416  373 ARG A CB  
969  C CG  . ARG A 159 ? 0.5185 0.9457 0.5863 0.0406  0.0372  -0.0101 373 ARG A CG  
970  C CD  . ARG A 159 ? 0.5522 1.0869 0.6165 0.0686  0.0338  -0.0468 373 ARG A CD  
971  N NE  . ARG A 159 ? 0.5828 1.1010 0.6489 0.0896  0.0137  -0.1058 373 ARG A NE  
972  C CZ  . ARG A 159 ? 0.5623 1.1380 0.6397 0.1087  0.0104  -0.1220 373 ARG A CZ  
973  N NH1 . ARG A 159 ? 0.5597 1.2188 0.6453 0.1067  0.0279  -0.0783 373 ARG A NH1 
974  N NH2 . ARG A 159 ? 0.5564 1.1090 0.6419 0.1292  -0.0138 -0.1805 373 ARG A NH2 
975  N N   . LEU A 160 ? 0.4160 0.6972 0.4931 -0.0215 0.0547  0.0855  374 LEU A N   
976  C CA  . LEU A 160 ? 0.4291 0.7220 0.5193 -0.0298 0.0582  0.1129  374 LEU A CA  
977  C C   . LEU A 160 ? 0.3877 0.7217 0.4610 -0.0221 0.0606  0.0901  374 LEU A C   
978  O O   . LEU A 160 ? 0.3669 0.6536 0.4269 -0.0276 0.0590  0.0686  374 LEU A O   
979  C CB  . LEU A 160 ? 0.4841 0.6917 0.5791 -0.0435 0.0552  0.1142  374 LEU A CB  
980  C CG  . LEU A 160 ? 0.5283 0.6851 0.6400 -0.0503 0.0496  0.1299  374 LEU A CG  
981  C CD1 . LEU A 160 ? 0.5239 0.6277 0.6128 -0.0516 0.0474  0.0999  374 LEU A CD1 
982  C CD2 . LEU A 160 ? 0.5614 0.6738 0.6933 -0.0584 0.0441  0.1405  374 LEU A CD2 
983  N N   . LEU A 161 ? 0.3730 0.8027 0.4474 -0.0097 0.0635  0.0952  375 LEU A N   
984  C CA  . LEU A 161 ? 0.3835 0.8606 0.4410 0.0021  0.0632  0.0660  375 LEU A CA  
985  C C   . LEU A 161 ? 0.3835 0.9095 0.4517 -0.0043 0.0680  0.0980  375 LEU A C   
986  O O   . LEU A 161 ? 0.3564 0.9245 0.4500 -0.0128 0.0695  0.1471  375 LEU A O   
987  C CB  . LEU A 161 ? 0.3838 0.9487 0.4341 0.0245  0.0613  0.0404  375 LEU A CB  
988  C CG  . LEU A 161 ? 0.4390 0.9646 0.4847 0.0344  0.0523  0.0053  375 LEU A CG  
989  C CD1 . LEU A 161 ? 0.4416 1.0706 0.4853 0.0619  0.0486  -0.0261 375 LEU A CD1 
990  C CD2 . LEU A 161 ? 0.4809 0.9051 0.5146 0.0296  0.0387  -0.0338 375 LEU A CD2 
991  N N   . ARG A 162 ? 0.3991 0.9177 0.4524 -0.0017 0.0667  0.0722  376 ARG A N   
992  C CA  . ARG A 162 ? 0.4063 0.9712 0.4677 -0.0062 0.0697  0.0959  376 ARG A CA  
993  C C   . ARG A 162 ? 0.3817 0.9141 0.4733 -0.0238 0.0692  0.1426  376 ARG A C   
994  O O   . ARG A 162 ? 0.3903 0.9831 0.5046 -0.0292 0.0676  0.1829  376 ARG A O   
995  C CB  . ARG A 162 ? 0.4424 1.1342 0.5047 0.0057  0.0725  0.1090  376 ARG A CB  
996  C CG  . ARG A 162 ? 0.4926 1.2311 0.5300 0.0294  0.0685  0.0533  376 ARG A CG  
997  C CD  . ARG A 162 ? 0.5276 1.3708 0.5587 0.0412  0.0602  0.0628  376 ARG A CD  
998  N NE  . ARG A 162 ? 0.5518 1.4157 0.5852 0.0321  0.0563  0.0894  376 ARG A NE  
999  C CZ  . ARG A 162 ? 0.5578 1.4399 0.5777 0.0410  0.0535  0.0575  376 ARG A CZ  
1000 N NH1 . ARG A 162 ? 0.5664 1.4461 0.5719 0.0602  0.0506  -0.0038 376 ARG A NH1 
1001 N NH2 . ARG A 162 ? 0.5731 1.4749 0.5975 0.0317  0.0500  0.0856  376 ARG A NH2 
1002 N N   . SER A 163 ? 0.3631 0.8044 0.4590 -0.0323 0.0670  0.1362  377 SER A N   
1003 C CA  . SER A 163 ? 0.3745 0.7780 0.5026 -0.0439 0.0614  0.1663  377 SER A CA  
1004 C C   . SER A 163 ? 0.3878 0.7911 0.5176 -0.0464 0.0615  0.1608  377 SER A C   
1005 O O   . SER A 163 ? 0.3478 0.7173 0.4517 -0.0455 0.0657  0.1248  377 SER A O   
1006 C CB  . SER A 163 ? 0.4275 0.7439 0.5558 -0.0488 0.0589  0.1512  377 SER A CB  
1007 O OG  . SER A 163 ? 0.4882 0.7715 0.6511 -0.0549 0.0498  0.1696  377 SER A OG  
1008 N N   . PRO A 164 ? 0.3913 0.8346 0.5555 -0.0512 0.0540  0.1999  378 PRO A N   
1009 C CA  . PRO A 164 ? 0.3736 0.8219 0.5455 -0.0532 0.0522  0.1982  378 PRO A CA  
1010 C C   . PRO A 164 ? 0.3832 0.7556 0.5525 -0.0547 0.0526  0.1675  378 PRO A C   
1011 O O   . PRO A 164 ? 0.3530 0.6799 0.5485 -0.0566 0.0440  0.1722  378 PRO A O   
1012 C CB  . PRO A 164 ? 0.3672 0.8533 0.5915 -0.0611 0.0360  0.2525  378 PRO A CB  
1013 C CG  . PRO A 164 ? 0.3712 0.9091 0.6039 -0.0635 0.0335  0.2859  378 PRO A CG  
1014 C CD  . PRO A 164 ? 0.3792 0.8654 0.5836 -0.0576 0.0426  0.2526  378 PRO A CD  
1015 N N   . MET A 165 ? 0.4027 0.7684 0.5421 -0.0535 0.0606  0.1357  379 MET A N   
1016 C CA  . MET A 165 ? 0.3874 0.7026 0.5236 -0.0569 0.0619  0.1101  379 MET A CA  
1017 C C   . MET A 165 ? 0.3920 0.7075 0.5727 -0.0564 0.0516  0.1268  379 MET A C   
1018 O O   . MET A 165 ? 0.3688 0.7264 0.5715 -0.0562 0.0454  0.1517  379 MET A O   
1019 C CB  . MET A 165 ? 0.3633 0.6837 0.4665 -0.0588 0.0683  0.0823  379 MET A CB  
1020 C CG  . MET A 165 ? 0.3328 0.6119 0.4256 -0.0663 0.0707  0.0575  379 MET A CG  
1021 S SD  . MET A 165 ? 0.3119 0.5973 0.3732 -0.0733 0.0713  0.0336  379 MET A SD  
1022 C CE  . MET A 165 ? 0.3217 0.5985 0.3578 -0.0703 0.0652  0.0202  379 MET A CE  
1023 O O   . P1L A 166 ? 0.3967 0.7021 0.6055 -0.0535 0.0485  0.0893  380 P1L A O   
1024 N N   . P1L A 166 ? 0.2982 0.5708 0.4954 -0.0551 0.0467  0.1117  380 P1L A N   
1025 C CA  . P1L A 166 ? 0.4871 0.7559 0.7330 -0.0499 0.0315  0.1164  380 P1L A CA  
1026 C CB  . P1L A 166 ? 0.4935 0.7214 0.7537 -0.0439 0.0256  0.0888  380 P1L A CB  
1027 S SG  . P1L A 166 ? 1.3501 1.5581 1.5522 -0.0507 0.0458  0.0514  380 P1L A SG  
1028 C C7  . P1L A 166 ? 0.7429 0.9307 0.9147 -0.0572 0.0516  0.0631  380 P1L A C7  
1029 O O7  . P1L A 166 ? 0.7502 0.9538 0.9232 -0.0574 0.0503  0.0879  380 P1L A O7  
1030 C C8  . P1L A 166 ? 0.7246 0.8873 0.8612 -0.0649 0.0601  0.0371  380 P1L A C8  
1031 C C9  . P1L A 166 ? 0.6746 0.8101 0.7963 -0.0681 0.0600  0.0434  380 P1L A C9  
1032 C C10 . P1L A 166 ? 0.6677 0.7797 0.7586 -0.0789 0.0647  0.0219  380 P1L A C10 
1033 C C11 . P1L A 166 ? 0.6824 0.7794 0.7441 -0.0869 0.0659  0.0238  380 P1L A C11 
1034 C C12 . P1L A 166 ? 0.6653 0.7648 0.6992 -0.1014 0.0666  0.0105  380 P1L A C12 
1035 C C13 . P1L A 166 ? 0.6511 0.7843 0.6875 -0.0996 0.0691  0.0101  380 P1L A C13 
1036 C C14 . P1L A 166 ? 0.6355 0.7706 0.6527 -0.1057 0.0626  0.0046  380 P1L A C14 
1037 C C15 . P1L A 166 ? 0.6409 0.7637 0.6422 -0.1267 0.0553  -0.0027 380 P1L A C15 
1038 C C16 . P1L A 166 ? 0.6516 0.8055 0.6544 -0.1337 0.0575  -0.0037 380 P1L A C16 
1039 C C17 . P1L A 166 ? 0.6302 0.8055 0.6375 -0.1216 0.0561  -0.0045 380 P1L A C17 
1040 C C18 . P1L A 166 ? 0.6046 0.7856 0.6047 -0.1353 0.0430  -0.0092 380 P1L A C18 
1041 C C19 . P1L A 166 ? 0.5761 0.7836 0.5793 -0.1487 0.0492  -0.0046 380 P1L A C19 
1042 C C20 . P1L A 166 ? 0.5611 0.7629 0.5572 -0.1762 0.0332  0.0009  380 P1L A C20 
1043 C C   . P1L A 166 ? 0.4413 0.7374 0.6895 -0.0493 0.0339  0.1090  380 P1L A C   
1044 C C21 . P1L A 166 ? 0.5371 0.7821 0.5358 -0.1901 0.0419  0.0076  380 P1L A C21 
1045 C C22 . P1L A 166 ? 0.5228 0.7951 0.5293 -0.1866 0.0417  0.0071  380 P1L A C22 
1046 N N   . GLU A 167 ? 0.4525 0.7601 0.7537 -0.0448 0.0148  0.1272  381 GLU A N   
1047 C CA  . GLU A 167 ? 0.5053 0.8404 0.8178 -0.0437 0.0133  0.1249  381 GLU A CA  
1048 C C   . GLU A 167 ? 0.4542 0.7806 0.7470 -0.0402 0.0249  0.0815  381 GLU A C   
1049 O O   . GLU A 167 ? 0.4588 0.8096 0.7341 -0.0435 0.0338  0.0747  381 GLU A O   
1050 C CB  . GLU A 167 ? 0.6104 0.9515 0.9954 -0.0391 -0.0166 0.1511  381 GLU A CB  
1051 C CG  . GLU A 167 ? 0.6993 1.0681 1.1107 -0.0484 -0.0316 0.2065  381 GLU A CG  
1052 C CD  . GLU A 167 ? 0.7673 1.1055 1.2267 -0.0472 -0.0564 0.2259  381 GLU A CD  
1053 O OE1 . GLU A 167 ? 0.7821 1.1208 1.2175 -0.0528 -0.0478 0.2404  381 GLU A OE1 
1054 O OE2 . GLU A 167 ? 0.8008 1.1148 1.3260 -0.0395 -0.0875 0.2250  381 GLU A OE2 
1055 N N   . TYR A 168 ? 0.6169 0.5419 0.5879 -0.1023 -0.0154 0.1553  382 TYR A N   
1056 C CA  . TYR A 168 ? 0.5844 0.4823 0.6112 -0.0621 0.0025  0.1365  382 TYR A CA  
1057 C C   . TYR A 168 ? 0.5367 0.4860 0.5694 -0.0467 0.0137  0.1104  382 TYR A C   
1058 O O   . TYR A 168 ? 0.4940 0.4429 0.5698 -0.0252 0.0122  0.1083  382 TYR A O   
1059 C CB  . TYR A 168 ? 0.5705 0.4226 0.5939 -0.0558 0.0313  0.1149  382 TYR A CB  
1060 C CG  . TYR A 168 ? 0.5634 0.3929 0.6333 -0.0245 0.0554  0.0890  382 TYR A CG  
1061 C CD1 . TYR A 168 ? 0.6079 0.3875 0.7366 -0.0050 0.0587  0.0929  382 TYR A CD1 
1062 C CD2 . TYR A 168 ? 0.5378 0.3959 0.5948 -0.0163 0.0746  0.0600  382 TYR A CD2 
1063 C CE1 . TYR A 168 ? 0.6082 0.3752 0.7783 0.0169  0.0853  0.0639  382 TYR A CE1 
1064 C CE2 . TYR A 168 ? 0.5685 0.4055 0.6570 0.0026  0.0961  0.0370  382 TYR A CE2 
1065 C CZ  . TYR A 168 ? 0.6061 0.4016 0.7493 0.0166  0.1038  0.0368  382 TYR A CZ  
1066 O OH  . TYR A 168 ? 0.6208 0.4031 0.7941 0.0289  0.1298  0.0086  382 TYR A OH  
1067 N N   . LEU A 169 ? 0.4665 0.4599 0.4589 -0.0581 0.0248  0.0899  383 LEU A N   
1068 C CA  . LEU A 169 ? 0.4027 0.4353 0.3980 -0.0432 0.0357  0.0635  383 LEU A CA  
1069 C C   . LEU A 169 ? 0.4058 0.4754 0.4024 -0.0534 0.0188  0.0725  383 LEU A C   
1070 O O   . LEU A 169 ? 0.3541 0.4304 0.3705 -0.0369 0.0235  0.0592  383 LEU A O   
1071 C CB  . LEU A 169 ? 0.4205 0.4929 0.3844 -0.0497 0.0491  0.0399  383 LEU A CB  
1072 C CG  . LEU A 169 ? 0.4774 0.5262 0.4408 -0.0358 0.0664  0.0237  383 LEU A CG  
1073 C CD1 . LEU A 169 ? 0.5467 0.6468 0.4986 -0.0319 0.0732  0.0008  383 LEU A CD1 
1074 C CD2 . LEU A 169 ? 0.4915 0.4961 0.4829 -0.0113 0.0762  0.0154  383 LEU A CD2 
1075 N N   . VAL A 170 ? 0.3830 0.4766 0.3507 -0.0876 -0.0008 0.0947  384 VAL A N   
1076 C CA  . VAL A 170 ? 0.3979 0.5279 0.3565 -0.1094 -0.0197 0.1070  384 VAL A CA  
1077 C C   . VAL A 170 ? 0.4016 0.5049 0.4090 -0.0917 -0.0380 0.1303  384 VAL A C   
1078 O O   . VAL A 170 ? 0.3893 0.5178 0.4072 -0.0895 -0.0398 0.1228  384 VAL A O   
1079 C CB  . VAL A 170 ? 0.4468 0.5996 0.3591 -0.1591 -0.0421 0.1340  384 VAL A CB  
1080 C CG1 . VAL A 170 ? 0.4710 0.6615 0.3674 -0.1900 -0.0636 0.1490  384 VAL A CG1 
1081 C CG2 . VAL A 170 ? 0.4896 0.6841 0.3597 -0.1802 -0.0211 0.1063  384 VAL A CG2 
1082 N N   . ASN A 171 ? 0.4228 0.4762 0.4636 -0.0792 -0.0501 0.1561  385 ASN A N   
1083 C CA  . ASN A 171 ? 0.5017 0.5341 0.6073 -0.0565 -0.0667 0.1763  385 ASN A CA  
1084 C C   . ASN A 171 ? 0.4358 0.4670 0.5790 -0.0230 -0.0387 0.1418  385 ASN A C   
1085 O O   . ASN A 171 ? 0.4210 0.4725 0.6010 -0.0152 -0.0479 0.1458  385 ASN A O   
1086 C CB  . ASN A 171 ? 0.5939 0.5663 0.7351 -0.0455 -0.0794 0.2034  385 ASN A CB  
1087 C CG  . ASN A 171 ? 0.7084 0.6727 0.8161 -0.0822 -0.1180 0.2490  385 ASN A CG  
1088 O OD1 . ASN A 171 ? 0.7789 0.7815 0.8688 -0.1103 -0.1489 0.2755  385 ASN A OD1 
1089 N ND2 . ASN A 171 ? 0.7381 0.6499 0.8293 -0.0888 -0.1170 0.2591  385 ASN A ND2 
1090 N N   . PHE A 172 ? 0.4211 0.4305 0.5503 -0.0091 -0.0068 0.1098  386 PHE A N   
1091 C CA  . PHE A 172 ? 0.4454 0.4466 0.5957 0.0143  0.0195  0.0777  386 PHE A CA  
1092 C C   . PHE A 172 ? 0.4584 0.4993 0.5859 0.0086  0.0219  0.0605  386 PHE A C   
1093 O O   . PHE A 172 ? 0.4267 0.4701 0.5800 0.0194  0.0285  0.0488  386 PHE A O   
1094 C CB  . PHE A 172 ? 0.4352 0.4054 0.5618 0.0204  0.0468  0.0534  386 PHE A CB  
1095 C CG  . PHE A 172 ? 0.3886 0.3454 0.5225 0.0353  0.0712  0.0233  386 PHE A CG  
1096 C CD1 . PHE A 172 ? 0.4086 0.3469 0.5925 0.0483  0.0814  0.0164  386 PHE A CD1 
1097 C CD2 . PHE A 172 ? 0.3566 0.3195 0.4494 0.0343  0.0828  0.0021  386 PHE A CD2 
1098 C CE1 . PHE A 172 ? 0.3821 0.3079 0.5627 0.0523  0.1042  -0.0114 386 PHE A CE1 
1099 C CE2 . PHE A 172 ? 0.3897 0.3320 0.4801 0.0418  0.1001  -0.0202 386 PHE A CE2 
1100 C CZ  . PHE A 172 ? 0.3993 0.3224 0.5275 0.0469  0.1116  -0.0271 386 PHE A CZ  
1101 N N   . LEU A 173 ? 0.4286 0.5005 0.5079 -0.0110 0.0190  0.0560  387 LEU A N   
1102 C CA  . LEU A 173 ? 0.3626 0.4667 0.4177 -0.0183 0.0250  0.0345  387 LEU A CA  
1103 C C   . LEU A 173 ? 0.3757 0.5079 0.4430 -0.0356 0.0043  0.0524  387 LEU A C   
1104 O O   . LEU A 173 ? 0.3551 0.4966 0.4208 -0.0351 0.0119  0.0346  387 LEU A O   
1105 C CB  . LEU A 173 ? 0.3574 0.4941 0.3677 -0.0363 0.0308  0.0200  387 LEU A CB  
1106 C CG  . LEU A 173 ? 0.3585 0.4840 0.3588 -0.0172 0.0521  -0.0068 387 LEU A CG  
1107 C CD1 . LEU A 173 ? 0.3705 0.5427 0.3419 -0.0347 0.0576  -0.0220 387 LEU A CD1 
1108 C CD2 . LEU A 173 ? 0.3719 0.4750 0.3789 0.0058  0.0669  -0.0326 387 LEU A CD2 
1109 N N   . HIS A 174 ? 0.4288 0.5726 0.5051 -0.0544 -0.0248 0.0902  388 HIS A N   
1110 C CA  . HIS A 174 ? 0.5371 0.7130 0.6263 -0.0756 -0.0529 0.1161  388 HIS A CA  
1111 C C   . HIS A 174 ? 0.4624 0.6298 0.6171 -0.0498 -0.0551 0.1197  388 HIS A C   
1112 O O   . HIS A 174 ? 0.4792 0.6798 0.6430 -0.0634 -0.0668 0.1245  388 HIS A O   
1113 C CB  . HIS A 174 ? 0.7211 0.9046 0.8047 -0.1033 -0.0908 0.1634  388 HIS A CB  
1114 C CG  . HIS A 174 ? 0.9320 1.1469 0.9432 -0.1481 -0.0930 0.1611  388 HIS A CG  
1115 N ND1 . HIS A 174 ? 1.0292 1.2382 1.0131 -0.1759 -0.1152 0.1926  388 HIS A ND1 
1116 C CD2 . HIS A 174 ? 0.9972 1.2499 0.9583 -0.1728 -0.0728 0.1271  388 HIS A CD2 
1117 C CE1 . HIS A 174 ? 1.0843 1.3341 1.0028 -0.2193 -0.1074 0.1771  388 HIS A CE1 
1118 N NE2 . HIS A 174 ? 1.0479 1.3255 0.9558 -0.2159 -0.0802 0.1353  388 HIS A NE2 
1119 N N   . LYS A 175 ? 0.4107 0.5383 0.6102 -0.0171 -0.0416 0.1147  389 LYS A N   
1120 C CA  . LYS A 175 ? 0.4113 0.5356 0.6779 0.0067  -0.0352 0.1086  389 LYS A CA  
1121 C C   . LYS A 175 ? 0.3778 0.4987 0.6217 0.0112  -0.0031 0.0668  389 LYS A C   
1122 O O   . LYS A 175 ? 0.3456 0.4894 0.6156 0.0094  -0.0024 0.0601  389 LYS A O   
1123 C CB  . LYS A 175 ? 0.4147 0.4958 0.7356 0.0349  -0.0261 0.1110  389 LYS A CB  
1124 C CG  . LYS A 175 ? 0.4732 0.5425 0.8254 0.0343  -0.0602 0.1546  389 LYS A CG  
1125 C CD  . LYS A 175 ? 0.5088 0.5222 0.9023 0.0602  -0.0422 0.1471  389 LYS A CD  
1126 C CE  . LYS A 175 ? 0.5719 0.5564 0.9848 0.0578  -0.0765 0.1909  389 LYS A CE  
1127 N NZ  . LYS A 175 ? 0.5898 0.5098 1.0297 0.0780  -0.0534 0.1778  389 LYS A NZ  
1128 N N   . LEU A 176 ? 0.3741 0.4661 0.5690 0.0148  0.0206  0.0412  390 LEU A N   
1129 C CA  . LEU A 176 ? 0.3715 0.4443 0.5412 0.0202  0.0472  0.0061  390 LEU A CA  
1130 C C   . LEU A 176 ? 0.3535 0.4516 0.4918 0.0016  0.0449  -0.0052 390 LEU A C   
1131 O O   . LEU A 176 ? 0.3179 0.4070 0.4555 0.0008  0.0578  -0.0243 390 LEU A O   
1132 C CB  . LEU A 176 ? 0.4256 0.4673 0.5527 0.0272  0.0635  -0.0107 390 LEU A CB  
1133 C CG  . LEU A 176 ? 0.4738 0.4793 0.5784 0.0351  0.0860  -0.0391 390 LEU A CG  
1134 C CD1 . LEU A 176 ? 0.4560 0.4413 0.5977 0.0400  0.0999  -0.0457 390 LEU A CD1 
1135 C CD2 . LEU A 176 ? 0.4952 0.4800 0.5680 0.0416  0.0926  -0.0457 390 LEU A CD2 
1136 N N   . ARG A 177 ? 0.3738 0.5019 0.4804 -0.0192 0.0303  0.0044  391 ARG A N   
1137 C CA  . ARG A 177 ? 0.4563 0.6042 0.5251 -0.0421 0.0330  -0.0123 391 ARG A CA  
1138 C C   . ARG A 177 ? 0.4416 0.6273 0.5368 -0.0622 0.0140  0.0059  391 ARG A C   
1139 O O   . ARG A 177 ? 0.5089 0.7109 0.5713 -0.0874 0.0166  -0.0078 391 ARG A O   
1140 C CB  . ARG A 177 ? 0.4683 0.6397 0.4907 -0.0641 0.0306  -0.0167 391 ARG A CB  
1141 C CG  . ARG A 177 ? 0.5371 0.7504 0.5618 -0.0929 0.0006  0.0203  391 ARG A CG  
1142 C CD  . ARG A 177 ? 0.6266 0.8737 0.5939 -0.1316 0.0039  0.0057  391 ARG A CD  
1143 N NE  . ARG A 177 ? 0.6744 0.9550 0.6276 -0.1651 -0.0234 0.0405  391 ARG A NE  
1144 C CZ  . ARG A 177 ? 0.7238 1.0431 0.6239 -0.2121 -0.0243 0.0335  391 ARG A CZ  
1145 N NH1 . ARG A 177 ? 0.7544 1.0996 0.6352 -0.2487 -0.0528 0.0701  391 ARG A NH1 
1146 N NH2 . ARG A 177 ? 0.7518 1.0803 0.6153 -0.2262 0.0042  -0.0113 391 ARG A NH2 
1147 N N   . GLN A 178 ? 0.4037 0.6039 0.5617 -0.0515 -0.0051 0.0358  392 GLN A N   
1148 C CA  . GLN A 178 ? 0.4147 0.6602 0.6159 -0.0657 -0.0274 0.0566  392 GLN A CA  
1149 C C   . GLN A 178 ? 0.3624 0.6017 0.5984 -0.0527 -0.0067 0.0332  392 GLN A C   
1150 O O   . GLN A 178 ? 0.3867 0.6697 0.6547 -0.0676 -0.0190 0.0410  392 GLN A O   
1151 C CB  . GLN A 178 ? 0.4784 0.7458 0.7439 -0.0578 -0.0627 0.1025  392 GLN A CB  
1152 C CG  . GLN A 178 ? 0.6192 0.9049 0.8448 -0.0877 -0.0931 0.1350  392 GLN A CG  
1153 C CD  . GLN A 178 ? 0.7480 1.0539 1.0371 -0.0858 -0.1385 0.1889  392 GLN A CD  
1154 O OE1 . GLN A 178 ? 0.7838 1.0671 1.1468 -0.0485 -0.1397 0.1979  392 GLN A OE1 
1155 N NE2 . GLN A 178 ? 0.8102 1.1565 1.0710 -0.1283 -0.1768 0.2249  392 GLN A NE2 
1156 N N   . LEU A 179 ? 0.3292 0.5186 0.5563 -0.0305 0.0235  0.0053  393 LEU A N   
1157 C CA  . LEU A 179 ? 0.3509 0.5286 0.5958 -0.0267 0.0470  -0.0208 393 LEU A CA  
1158 C C   . LEU A 179 ? 0.3460 0.5285 0.5378 -0.0561 0.0535  -0.0402 393 LEU A C   
1159 O O   . LEU A 179 ? 0.3822 0.5412 0.5074 -0.0676 0.0572  -0.0516 393 LEU A O   
1160 C CB  . LEU A 179 ? 0.4039 0.5220 0.6296 -0.0077 0.0749  -0.0441 393 LEU A CB  
1161 C CG  . LEU A 179 ? 0.4541 0.5629 0.7431 0.0155  0.0832  -0.0404 393 LEU A CG  
1162 C CD1 . LEU A 179 ? 0.4533 0.5840 0.7890 0.0281  0.0559  -0.0051 393 LEU A CD1 
1163 C CD2 . LEU A 179 ? 0.4686 0.5189 0.7158 0.0233  0.1068  -0.0600 393 LEU A CD2 
1164 N N   . PRO A 180 ? 0.3398 0.5539 0.5637 -0.0698 0.0565  -0.0468 394 PRO A N   
1165 C CA  . PRO A 180 ? 0.3985 0.6212 0.5716 -0.1053 0.0598  -0.0621 394 PRO A CA  
1166 C C   . PRO A 180 ? 0.4485 0.6001 0.5501 -0.1116 0.0881  -0.0970 394 PRO A C   
1167 O O   . PRO A 180 ? 0.4885 0.6234 0.5295 -0.1387 0.0921  -0.1120 394 PRO A O   
1168 C CB  . PRO A 180 ? 0.3724 0.6601 0.6156 -0.1168 0.0531  -0.0559 394 PRO A CB  
1169 C CG  . PRO A 180 ? 0.3136 0.5973 0.6299 -0.0837 0.0658  -0.0590 394 PRO A CG  
1170 C CD  . PRO A 180 ? 0.2992 0.5481 0.6142 -0.0547 0.0583  -0.0424 394 PRO A CD  
1171 N N   . GLU A 181 ? 0.4292 0.5355 0.5352 -0.0901 0.1059  -0.1088 395 GLU A N   
1172 C CA  . GLU A 181 ? 0.5108 0.5465 0.5514 -0.0989 0.1260  -0.1349 395 GLU A CA  
1173 C C   . GLU A 181 ? 0.4926 0.4722 0.5082 -0.0721 0.1303  -0.1358 395 GLU A C   
1174 O O   . GLU A 181 ? 0.4399 0.4325 0.4972 -0.0498 0.1280  -0.1229 395 GLU A O   
1175 C CB  . GLU A 181 ? 0.5847 0.6232 0.6441 -0.1152 0.1442  -0.1507 395 GLU A CB  
1176 C CG  . GLU A 181 ? 0.6695 0.7774 0.7658 -0.1424 0.1405  -0.1510 395 GLU A CG  
1177 C CD  . GLU A 181 ? 0.8128 0.8949 0.8339 -0.1813 0.1437  -0.1665 395 GLU A CD  
1178 O OE1 . GLU A 181 ? 0.9003 0.9203 0.8643 -0.1992 0.1608  -0.1870 395 GLU A OE1 
1179 O OE2 . GLU A 181 ? 0.8242 0.9439 0.8378 -0.1985 0.1285  -0.1576 395 GLU A OE2 
1180 N N   . ARG A 182 ? 0.3690 0.4093 0.5480 0.0600  -0.0271 -0.0073 396 ARG A N   
1181 C CA  . ARG A 182 ? 0.3698 0.3967 0.5354 0.0559  -0.0290 -0.0047 396 ARG A CA  
1182 C C   . ARG A 182 ? 0.3406 0.3569 0.4907 0.0388  -0.0183 0.0038  396 ARG A C   
1183 O O   . ARG A 182 ? 0.3179 0.3276 0.4544 0.0374  -0.0113 0.0060  396 ARG A O   
1184 C CB  . ARG A 182 ? 0.4503 0.4663 0.6232 0.0554  -0.0512 -0.0078 396 ARG A CB  
1185 C CG  . ARG A 182 ? 0.5118 0.5401 0.6952 0.0736  -0.0596 -0.0201 396 ARG A CG  
1186 C CD  . ARG A 182 ? 0.5754 0.5927 0.7695 0.0747  -0.0826 -0.0266 396 ARG A CD  
1187 N NE  . ARG A 182 ? 0.6765 0.6816 0.8818 0.0662  -0.0994 -0.0241 396 ARG A NE  
1188 C CZ  . ARG A 182 ? 0.7095 0.7230 0.9312 0.0745  -0.1097 -0.0324 396 ARG A CZ  
1189 N NH1 . ARG A 182 ? 0.6850 0.7206 0.9123 0.0915  -0.1042 -0.0441 396 ARG A NH1 
1190 N NH2 . ARG A 182 ? 0.7624 0.7623 0.9940 0.0644  -0.1264 -0.0282 396 ARG A NH2 
1191 N N   . TYR A 183 ? 0.3602 0.3773 0.5121 0.0248  -0.0166 0.0082  397 TYR A N   
1192 C CA  . TYR A 183 ? 0.3080 0.3197 0.4435 0.0063  -0.0056 0.0147  397 TYR A CA  
1193 C C   . TYR A 183 ? 0.3014 0.3229 0.4315 0.0124  0.0156  0.0105  397 TYR A C   
1194 O O   . TYR A 183 ? 0.3212 0.3365 0.4351 0.0024  0.0249  0.0129  397 TYR A O   
1195 C CB  . TYR A 183 ? 0.3213 0.3378 0.4600 -0.0122 -0.0073 0.0199  397 TYR A CB  
1196 C CG  . TYR A 183 ? 0.3433 0.3831 0.4954 -0.0095 0.0073  0.0143  397 TYR A CG  
1197 C CD1 . TYR A 183 ? 0.3324 0.3850 0.4785 -0.0150 0.0280  0.0108  397 TYR A CD1 
1198 C CD2 . TYR A 183 ? 0.3459 0.3958 0.5186 -0.0016 -0.0009 0.0111  397 TYR A CD2 
1199 C CE1 . TYR A 183 ? 0.3440 0.4198 0.5070 -0.0113 0.0401  0.0033  397 TYR A CE1 
1200 C CE2 . TYR A 183 ? 0.3018 0.3736 0.4894 0.0010  0.0110  0.0057  397 TYR A CE2 
1201 C CZ  . TYR A 183 ? 0.3288 0.4141 0.5128 -0.0035 0.0314  0.0015  397 TYR A CZ  
1202 O OH  . TYR A 183 ? 0.3254 0.4343 0.5287 0.0004  0.0422  -0.0062 397 TYR A OH  
1203 N N   . MET A 184 ? 0.2879 0.3233 0.4320 0.0287  0.0211  0.0041  398 MET A N   
1204 C CA  . MET A 184 ? 0.2997 0.3412 0.4424 0.0364  0.0367  0.0000  398 MET A CA  
1205 C C   . MET A 184 ? 0.2810 0.3110 0.4113 0.0433  0.0360  0.0019  398 MET A C   
1206 O O   . MET A 184 ? 0.3091 0.3344 0.4298 0.0418  0.0464  0.0014  398 MET A O   
1207 C CB  . MET A 184 ? 0.2737 0.3308 0.4358 0.0508  0.0388  -0.0057 398 MET A CB  
1208 C CG  . MET A 184 ? 0.2761 0.3482 0.4538 0.0444  0.0413  -0.0087 398 MET A CG  
1209 S SD  . MET A 184 ? 0.3305 0.4197 0.5321 0.0624  0.0435  -0.0158 398 MET A SD  
1210 C CE  . MET A 184 ? 0.4539 0.5630 0.6739 0.0507  0.0480  -0.0199 398 MET A CE  
1211 N N   . MET A 185 ? 0.3183 0.3458 0.4501 0.0508  0.0235  0.0027  399 MET A N   
1212 C CA  . MET A 185 ? 0.3737 0.3942 0.4950 0.0553  0.0219  0.0045  399 MET A CA  
1213 C C   . MET A 185 ? 0.3534 0.3577 0.4585 0.0414  0.0228  0.0091  399 MET A C   
1214 O O   . MET A 185 ? 0.2999 0.2978 0.3939 0.0409  0.0299  0.0108  399 MET A O   
1215 C CB  . MET A 185 ? 0.3567 0.3828 0.4853 0.0644  0.0081  0.0012  399 MET A CB  
1216 C CG  . MET A 185 ? 0.3572 0.4006 0.4975 0.0779  0.0070  -0.0032 399 MET A CG  
1217 S SD  . MET A 185 ? 0.3674 0.4219 0.5166 0.0876  -0.0090 -0.0115 399 MET A SD  
1218 C CE  . MET A 185 ? 0.3576 0.4329 0.5147 0.1002  -0.0073 -0.0149 399 MET A CE  
1219 N N   . ASN A 186 ? 0.3224 0.3189 0.4258 0.0290  0.0140  0.0119  400 ASN A N   
1220 C CA  . ASN A 186 ? 0.3428 0.3229 0.4289 0.0131  0.0124  0.0179  400 ASN A CA  
1221 C C   . ASN A 186 ? 0.3561 0.3367 0.4292 0.0037  0.0297  0.0180  400 ASN A C   
1222 O O   . ASN A 186 ? 0.3351 0.3043 0.3921 -0.0032 0.0331  0.0205  400 ASN A O   
1223 C CB  . ASN A 186 ? 0.3736 0.3445 0.4605 -0.0008 -0.0031 0.0230  400 ASN A CB  
1224 C CG  . ASN A 186 ? 0.4081 0.3736 0.5077 0.0080  -0.0238 0.0207  400 ASN A CG  
1225 O OD1 . ASN A 186 ? 0.3901 0.3592 0.4936 0.0214  -0.0252 0.0156  400 ASN A OD1 
1226 N ND2 . ASN A 186 ? 0.4063 0.3644 0.5134 -0.0001 -0.0407 0.0236  400 ASN A ND2 
1227 N N   . SER A 187 ? 0.3336 0.3288 0.4155 0.0039  0.0403  0.0134  401 SER A N   
1228 C CA  . SER A 187 ? 0.3359 0.3370 0.4108 -0.0021 0.0574  0.0086  401 SER A CA  
1229 C C   . SER A 187 ? 0.3197 0.3157 0.3917 0.0100  0.0643  0.0051  401 SER A C   
1230 O O   . SER A 187 ? 0.3649 0.3533 0.4223 0.0027  0.0718  0.0037  401 SER A O   
1231 C CB  . SER A 187 ? 0.3806 0.4027 0.4725 -0.0003 0.0663  0.0015  401 SER A CB  
1232 O OG  . SER A 187 ? 0.4212 0.4489 0.5129 -0.0166 0.0617  0.0057  401 SER A OG  
1233 N N   . VAL A 188 ? 0.3056 0.3056 0.3906 0.0271  0.0606  0.0041  402 VAL A N   
1234 C CA  . VAL A 188 ? 0.3693 0.3636 0.4521 0.0371  0.0639  0.0037  402 VAL A CA  
1235 C C   . VAL A 188 ? 0.3574 0.3367 0.4239 0.0322  0.0584  0.0100  402 VAL A C   
1236 O O   . VAL A 188 ? 0.3608 0.3305 0.4179 0.0312  0.0633  0.0101  402 VAL A O   
1237 C CB  . VAL A 188 ? 0.2910 0.2945 0.3889 0.0532  0.0590  0.0039  402 VAL A CB  
1238 C CG1 . VAL A 188 ? 0.3302 0.3262 0.4231 0.0600  0.0590  0.0073  402 VAL A CG1 
1239 C CG2 . VAL A 188 ? 0.3222 0.3393 0.4381 0.0592  0.0638  -0.0028 402 VAL A CG2 
1240 N N   . LEU A 189 ? 0.3632 0.3404 0.4287 0.0296  0.0468  0.0142  403 LEU A N   
1241 C CA  . LEU A 189 ? 0.3571 0.3229 0.4119 0.0262  0.0397  0.0189  403 LEU A CA  
1242 C C   . LEU A 189 ? 0.3980 0.3482 0.4345 0.0100  0.0413  0.0218  403 LEU A C   
1243 O O   . LEU A 189 ? 0.4195 0.3586 0.4460 0.0067  0.0374  0.0254  403 LEU A O   
1244 C CB  . LEU A 189 ? 0.3328 0.3026 0.3968 0.0300  0.0250  0.0191  403 LEU A CB  
1245 C CG  . LEU A 189 ? 0.3460 0.3326 0.4232 0.0454  0.0226  0.0158  403 LEU A CG  
1246 C CD1 . LEU A 189 ? 0.3559 0.3493 0.4451 0.0498  0.0080  0.0115  403 LEU A CD1 
1247 C CD2 . LEU A 189 ? 0.3100 0.2977 0.3808 0.0490  0.0260  0.0185  403 LEU A CD2 
1248 N N   . GLU A 190 ? 0.4191 0.3705 0.4508 -0.0012 0.0471  0.0203  404 GLU A N   
1249 C CA  . GLU A 190 ? 0.4615 0.4018 0.4725 -0.0191 0.0506  0.0224  404 GLU A CA  
1250 C C   . GLU A 190 ? 0.4805 0.4123 0.4801 -0.0180 0.0589  0.0199  404 GLU A C   
1251 O O   . GLU A 190 ? 0.5502 0.4684 0.5313 -0.0304 0.0567  0.0235  404 GLU A O   
1252 C CB  . GLU A 190 ? 0.4960 0.4480 0.5049 -0.0307 0.0605  0.0184  404 GLU A CB  
1253 C CG  . GLU A 190 ? 0.5746 0.5275 0.5837 -0.0438 0.0497  0.0252  404 GLU A CG  
1254 C CD  . GLU A 190 ? 0.6081 0.5770 0.6137 -0.0585 0.0614  0.0217  404 GLU A CD  
1255 O OE1 . GLU A 190 ? 0.6647 0.6418 0.6624 -0.0620 0.0775  0.0132  404 GLU A OE1 
1256 O OE2 . GLU A 190 ? 0.6331 0.6079 0.6451 -0.0668 0.0541  0.0264  404 GLU A OE2 
1257 N N   . ASN A 191 ? 0.4037 0.3418 0.4143 -0.0038 0.0665  0.0143  405 ASN A N   
1258 C CA  . ASN A 191 ? 0.4371 0.3660 0.4398 -0.0023 0.0732  0.0108  405 ASN A CA  
1259 C C   . ASN A 191 ? 0.4085 0.3303 0.4140 0.0071  0.0661  0.0169  405 ASN A C   
1260 O O   . ASN A 191 ? 0.4157 0.3293 0.4185 0.0104  0.0692  0.0155  405 ASN A O   
1261 C CB  . ASN A 191 ? 0.4369 0.3760 0.4511 0.0052  0.0848  -0.0007 405 ASN A CB  
1262 C CG  . ASN A 191 ? 0.4700 0.4246 0.4864 -0.0035 0.0929  -0.0077 405 ASN A CG  
1263 O OD1 . ASN A 191 ? 0.5143 0.4687 0.5142 -0.0191 0.0988  -0.0108 405 ASN A OD1 
1264 N ND2 . ASN A 191 ? 0.4173 0.3872 0.4532 0.0051  0.0930  -0.0099 405 ASN A ND2 
1265 N N   . PHE A 192 ? 0.3755 0.3016 0.3870 0.0105  0.0560  0.0230  406 PHE A N   
1266 C CA  . PHE A 192 ? 0.3434 0.2708 0.3591 0.0182  0.0501  0.0280  406 PHE A CA  
1267 C C   . PHE A 192 ? 0.3526 0.2729 0.3609 0.0110  0.0405  0.0327  406 PHE A C   
1268 O O   . PHE A 192 ? 0.3646 0.2874 0.3769 0.0086  0.0319  0.0328  406 PHE A O   
1269 C CB  . PHE A 192 ? 0.3918 0.3372 0.4241 0.0303  0.0470  0.0276  406 PHE A CB  
1270 C CG  . PHE A 192 ? 0.4568 0.4108 0.4925 0.0358  0.0413  0.0322  406 PHE A CG  
1271 C CD1 . PHE A 192 ? 0.5079 0.4710 0.5485 0.0363  0.0325  0.0316  406 PHE A CD1 
1272 C CD2 . PHE A 192 ? 0.5024 0.4568 0.5377 0.0396  0.0438  0.0365  406 PHE A CD2 
1273 C CE1 . PHE A 192 ? 0.5189 0.4965 0.5636 0.0404  0.0290  0.0334  406 PHE A CE1 
1274 C CE2 . PHE A 192 ? 0.5395 0.5060 0.5762 0.0414  0.0394  0.0418  406 PHE A CE2 
1275 C CZ  . PHE A 192 ? 0.5276 0.5084 0.5689 0.0417  0.0334  0.0394  406 PHE A CZ  
1276 N N   . THR A 193 ? 0.3463 0.2567 0.3459 0.0077  0.0401  0.0363  407 THR A N   
1277 C CA  . THR A 193 ? 0.3769 0.2806 0.3714 0.0009  0.0305  0.0402  407 THR A CA  
1278 C C   . THR A 193 ? 0.3872 0.2957 0.3848 0.0044  0.0287  0.0443  407 THR A C   
1279 O O   . THR A 193 ? 0.3558 0.2644 0.3529 0.0080  0.0346  0.0463  407 THR A O   
1280 C CB  . THR A 193 ? 0.4408 0.3241 0.4159 -0.0135 0.0305  0.0413  407 THR A CB  
1281 O OG1 . THR A 193 ? 0.4645 0.3385 0.4302 -0.0148 0.0393  0.0400  407 THR A OG1 
1282 C CG2 . THR A 193 ? 0.4651 0.3465 0.4343 -0.0214 0.0322  0.0389  407 THR A CG2 
1283 N N   . ILE A 194 ? 0.3528 0.2656 0.3550 0.0027  0.0190  0.0456  408 ILE A N   
1284 C CA  . ILE A 194 ? 0.3909 0.3121 0.3964 0.0032  0.0173  0.0494  408 ILE A CA  
1285 C C   . ILE A 194 ? 0.4128 0.3206 0.4121 -0.0063 0.0090  0.0516  408 ILE A C   
1286 O O   . ILE A 194 ? 0.3948 0.2970 0.3961 -0.0094 -0.0005 0.0491  408 ILE A O   
1287 C CB  . ILE A 194 ? 0.3766 0.3277 0.3999 0.0124  0.0143  0.0461  408 ILE A CB  
1288 C CG1 . ILE A 194 ? 0.4136 0.3768 0.4409 0.0207  0.0214  0.0454  408 ILE A CG1 
1289 C CG2 . ILE A 194 ? 0.3594 0.3242 0.3859 0.0097  0.0130  0.0501  408 ILE A CG2 
1290 C CD1 . ILE A 194 ? 0.4248 0.4195 0.4665 0.0288  0.0193  0.0411  408 ILE A CD1 
1291 N N   . LEU A 195 ? 0.4134 0.3142 0.4054 -0.0116 0.0106  0.0570  409 LEU A N   
1292 C CA  . LEU A 195 ? 0.4194 0.3079 0.4060 -0.0208 0.0022  0.0595  409 LEU A CA  
1293 C C   . LEU A 195 ? 0.4012 0.3086 0.3995 -0.0201 -0.0007 0.0623  409 LEU A C   
1294 O O   . LEU A 195 ? 0.3550 0.2663 0.3506 -0.0210 0.0052  0.0680  409 LEU A O   
1295 C CB  . LEU A 195 ? 0.4549 0.3157 0.4201 -0.0306 0.0058  0.0624  409 LEU A CB  
1296 C CG  . LEU A 195 ? 0.5132 0.3581 0.4695 -0.0415 -0.0037 0.0656  409 LEU A CG  
1297 C CD1 . LEU A 195 ? 0.5397 0.3789 0.4963 -0.0459 -0.0153 0.0640  409 LEU A CD1 
1298 C CD2 . LEU A 195 ? 0.5372 0.3577 0.4722 -0.0501 0.0012  0.0667  409 LEU A CD2 
1299 N N   . GLN A 196 ? 0.3941 0.3144 0.4068 -0.0192 -0.0109 0.0582  410 GLN A N   
1300 C CA  . GLN A 196 ? 0.3963 0.3411 0.4229 -0.0195 -0.0131 0.0586  410 GLN A CA  
1301 C C   . GLN A 196 ? 0.4220 0.3524 0.4462 -0.0290 -0.0226 0.0615  410 GLN A C   
1302 O O   . GLN A 196 ? 0.4469 0.3631 0.4724 -0.0309 -0.0341 0.0582  410 GLN A O   
1303 C CB  . GLN A 196 ? 0.4299 0.4088 0.4810 -0.0093 -0.0174 0.0476  410 GLN A CB  
1304 C CG  . GLN A 196 ? 0.4999 0.5058 0.5554 -0.0021 -0.0071 0.0462  410 GLN A CG  
1305 C CD  . GLN A 196 ? 0.5683 0.6138 0.6482 0.0070  -0.0107 0.0329  410 GLN A CD  
1306 O OE1 . GLN A 196 ? 0.5687 0.6163 0.6649 0.0120  -0.0224 0.0220  410 GLN A OE1 
1307 N NE2 . GLN A 196 ? 0.5827 0.6604 0.6656 0.0088  -0.0019 0.0330  410 GLN A NE2 
1308 N N   . VAL A 197 ? 0.3937 0.3267 0.4142 -0.0360 -0.0195 0.0689  411 VAL A N   
1309 C CA  . VAL A 197 ? 0.4426 0.3643 0.4620 -0.0454 -0.0286 0.0722  411 VAL A CA  
1310 C C   . VAL A 197 ? 0.4502 0.4076 0.4901 -0.0464 -0.0297 0.0716  411 VAL A C   
1311 O O   . VAL A 197 ? 0.3599 0.3347 0.3992 -0.0490 -0.0213 0.0779  411 VAL A O   
1312 C CB  . VAL A 197 ? 0.4996 0.3884 0.4948 -0.0554 -0.0256 0.0813  411 VAL A CB  
1313 C CG1 . VAL A 197 ? 0.5137 0.3914 0.5079 -0.0656 -0.0360 0.0848  411 VAL A CG1 
1314 C CG2 . VAL A 197 ? 0.4784 0.3384 0.4542 -0.0554 -0.0229 0.0790  411 VAL A CG2 
1315 N N   . VAL A 198 ? 0.4338 0.4037 0.4931 -0.0451 -0.0412 0.0638  412 VAL A N   
1316 C CA  . VAL A 198 ? 0.4108 0.4196 0.4932 -0.0465 -0.0425 0.0602  412 VAL A CA  
1317 C C   . VAL A 198 ? 0.4056 0.3990 0.4874 -0.0574 -0.0525 0.0656  412 VAL A C   
1318 O O   . VAL A 198 ? 0.3928 0.3632 0.4754 -0.0578 -0.0660 0.0625  412 VAL A O   
1319 C CB  . VAL A 198 ? 0.3775 0.4210 0.4908 -0.0342 -0.0489 0.0426  412 VAL A CB  
1320 C CG1 . VAL A 198 ? 0.3444 0.4372 0.4826 -0.0359 -0.0468 0.0362  412 VAL A CG1 
1321 C CG2 . VAL A 198 ? 0.3618 0.4153 0.4742 -0.0232 -0.0412 0.0365  412 VAL A CG2 
1322 N N   . THR A 199 ? 0.4248 0.4299 0.5044 -0.0676 -0.0472 0.0749  413 THR A N   
1323 C CA  . THR A 199 ? 0.4862 0.4768 0.5646 -0.0790 -0.0564 0.0812  413 THR A CA  
1324 C C   . THR A 199 ? 0.4763 0.5128 0.5803 -0.0841 -0.0563 0.0792  413 THR A C   
1325 O O   . THR A 199 ? 0.3669 0.4430 0.4801 -0.0835 -0.0456 0.0782  413 THR A O   
1326 C CB  . THR A 199 ? 0.5334 0.4865 0.5822 -0.0899 -0.0527 0.0960  413 THR A CB  
1327 O OG1 . THR A 199 ? 0.5515 0.5224 0.5968 -0.0933 -0.0415 0.1045  413 THR A OG1 
1328 C CG2 . THR A 199 ? 0.5345 0.4463 0.5589 -0.0861 -0.0520 0.0954  413 THR A CG2 
1329 N N   . ASN A 200 ? 0.4503 0.4834 0.5659 -0.0903 -0.0686 0.0783  414 ASN A N   
1330 C CA  . ASN A 200 ? 0.3823 0.4564 0.5206 -0.0987 -0.0686 0.0783  414 ASN A CA  
1331 C C   . ASN A 200 ? 0.4719 0.5356 0.5892 -0.1146 -0.0614 0.0974  414 ASN A C   
1332 O O   . ASN A 200 ? 0.5127 0.5348 0.6111 -0.1232 -0.0684 0.1076  414 ASN A O   
1333 C CB  . ASN A 200 ? 0.3899 0.4592 0.5476 -0.1003 -0.0860 0.0719  414 ASN A CB  
1334 C CG  . ASN A 200 ? 0.4148 0.5349 0.6033 -0.1074 -0.0862 0.0679  414 ASN A CG  
1335 O OD1 . ASN A 200 ? 0.4370 0.5756 0.6195 -0.1207 -0.0765 0.0798  414 ASN A OD1 
1336 N ND2 . ASN A 200 ? 0.3880 0.5313 0.6112 -0.0994 -0.0987 0.0509  414 ASN A ND2 
1337 N N   . ARG A 201 ? 0.4254 0.6056 0.7213 -0.2071 0.0121  0.1146  415 ARG A N   
1338 C CA  . ARG A 201 ? 0.4814 0.6197 0.7996 -0.2390 0.0093  0.1353  415 ARG A CA  
1339 C C   . ARG A 201 ? 0.5327 0.6869 0.8941 -0.2688 0.0035  0.1226  415 ARG A C   
1340 O O   . ARG A 201 ? 0.5764 0.6786 0.9621 -0.2866 -0.0069 0.1211  415 ARG A O   
1341 C CB  . ARG A 201 ? 0.5325 0.6848 0.8425 -0.2584 0.0214  0.1759  415 ARG A CB  
1342 C CG  . ARG A 201 ? 0.5971 0.6950 0.9274 -0.2890 0.0143  0.2050  415 ARG A CG  
1343 C CD  . ARG A 201 ? 0.6704 0.8036 0.9877 -0.3107 0.0274  0.2336  415 ARG A CD  
1344 N NE  . ARG A 201 ? 0.6843 0.8929 1.0246 -0.3294 0.0391  0.2209  415 ARG A NE  
1345 C CZ  . ARG A 201 ? 0.7139 0.9708 1.0494 -0.3504 0.0538  0.2382  415 ARG A CZ  
1346 N NH1 . ARG A 201 ? 0.7721 1.0096 1.0767 -0.3576 0.0565  0.2720  415 ARG A NH1 
1347 N NH2 . ARG A 201 ? 0.6872 1.0155 1.0498 -0.3637 0.0642  0.2207  415 ARG A NH2 
1348 N N   . ASP A 202 ? 0.5007 0.7277 0.8769 -0.2733 0.0086  0.1101  416 ASP A N   
1349 C CA  . ASP A 202 ? 0.5468 0.8007 0.9674 -0.3041 0.0031  0.0978  416 ASP A CA  
1350 C C   . ASP A 202 ? 0.5364 0.7733 0.9643 -0.2931 -0.0151 0.0592  416 ASP A C   
1351 O O   . ASP A 202 ? 0.5974 0.8112 1.0572 -0.3186 -0.0249 0.0472  416 ASP A O   
1352 C CB  . ASP A 202 ? 0.5231 0.8718 0.9633 -0.3129 0.0151  0.0964  416 ASP A CB  
1353 C CG  . ASP A 202 ? 0.5927 0.9727 1.0297 -0.3361 0.0355  0.1327  416 ASP A CG  
1354 O OD1 . ASP A 202 ? 0.6351 0.9545 1.0613 -0.3527 0.0368  0.1580  416 ASP A OD1 
1355 O OD2 . ASP A 202 ? 0.6234 1.0802 1.0590 -0.3274 0.0500  0.1284  416 ASP A OD2 
1356 N N   . THR A 203 ? 0.4522 0.7012 0.8502 -0.2572 -0.0207 0.0401  417 THR A N   
1357 C CA  . THR A 203 ? 0.4768 0.7228 0.8725 -0.2482 -0.0383 0.0065  417 THR A CA  
1358 C C   . THR A 203 ? 0.5658 0.7454 0.9314 -0.2324 -0.0436 -0.0038 417 THR A C   
1359 O O   . THR A 203 ? 0.6121 0.7872 0.9719 -0.2298 -0.0563 -0.0331 417 THR A O   
1360 C CB  . THR A 203 ? 0.4664 0.7696 0.8499 -0.2214 -0.0460 -0.0056 417 THR A CB  
1361 O OG1 . THR A 203 ? 0.4651 0.7495 0.8093 -0.1888 -0.0410 0.0060  417 THR A OG1 
1362 C CG2 . THR A 203 ? 0.4304 0.8094 0.8512 -0.2325 -0.0401 -0.0018 417 THR A CG2 
1363 N N   . GLN A 204 ? 0.5972 0.7333 0.9440 -0.2227 -0.0336 0.0187  418 GLN A N   
1364 C CA  . GLN A 204 ? 0.6447 0.7244 0.9670 -0.2051 -0.0361 0.0100  418 GLN A CA  
1365 C C   . GLN A 204 ? 0.5854 0.6812 0.8689 -0.1774 -0.0414 -0.0065 418 GLN A C   
1366 O O   . GLN A 204 ? 0.6025 0.6676 0.8673 -0.1675 -0.0442 -0.0232 418 GLN A O   
1367 C CB  . GLN A 204 ? 0.7698 0.8075 1.1218 -0.2239 -0.0446 -0.0134 418 GLN A CB  
1368 C CG  . GLN A 204 ? 0.8871 0.8901 1.2794 -0.2512 -0.0432 0.0095  418 GLN A CG  
1369 C CD  . GLN A 204 ? 0.9442 0.9091 1.3220 -0.2407 -0.0360 0.0451  418 GLN A CD  
1370 O OE1 . GLN A 204 ? 1.0053 0.9323 1.3668 -0.2187 -0.0374 0.0375  418 GLN A OE1 
1371 N NE2 . GLN A 204 ? 0.9624 0.9440 1.3458 -0.2579 -0.0284 0.0838  418 GLN A NE2 
1372 N N   . GLU A 205 ? 0.5165 0.6622 0.7913 -0.1656 -0.0433 -0.0013 419 GLU A N   
1373 C CA  . GLU A 205 ? 0.4852 0.6432 0.7256 -0.1404 -0.0518 -0.0077 419 GLU A CA  
1374 C C   . GLU A 205 ? 0.4474 0.5740 0.6576 -0.1183 -0.0432 0.0093  419 GLU A C   
1375 O O   . GLU A 205 ? 0.3686 0.4933 0.5837 -0.1156 -0.0320 0.0284  419 GLU A O   
1376 C CB  . GLU A 205 ? 0.5005 0.7179 0.7524 -0.1322 -0.0610 -0.0069 419 GLU A CB  
1377 C CG  . GLU A 205 ? 0.5682 0.8254 0.8449 -0.1499 -0.0755 -0.0271 419 GLU A CG  
1378 C CD  . GLU A 205 ? 0.5827 0.9033 0.8823 -0.1398 -0.0853 -0.0255 419 GLU A CD  
1379 O OE1 . GLU A 205 ? 0.6163 0.9632 0.9082 -0.1305 -0.1065 -0.0347 419 GLU A OE1 
1380 O OE2 . GLU A 205 ? 0.5629 0.9110 0.8893 -0.1413 -0.0725 -0.0154 419 GLU A OE2 
1381 N N   . LEU A 206 ? 0.4135 0.5208 0.5916 -0.1051 -0.0482 0.0018  420 LEU A N   
1382 C CA  . LEU A 206 ? 0.4318 0.5140 0.5831 -0.0850 -0.0421 0.0162  420 LEU A CA  
1383 C C   . LEU A 206 ? 0.4199 0.5295 0.5658 -0.0659 -0.0475 0.0282  420 LEU A C   
1384 O O   . LEU A 206 ? 0.4227 0.5556 0.5623 -0.0592 -0.0627 0.0243  420 LEU A O   
1385 C CB  . LEU A 206 ? 0.4642 0.5247 0.5854 -0.0808 -0.0447 0.0048  420 LEU A CB  
1386 C CG  . LEU A 206 ? 0.4685 0.5086 0.5639 -0.0621 -0.0405 0.0199  420 LEU A CG  
1387 C CD1 . LEU A 206 ? 0.4730 0.4831 0.5793 -0.0598 -0.0277 0.0298  420 LEU A CD1 
1388 C CD2 . LEU A 206 ? 0.4829 0.5162 0.5475 -0.0620 -0.0432 0.0106  420 LEU A CD2 
1389 N N   . LEU A 207 ? 0.3352 0.4430 0.4853 -0.0569 -0.0372 0.0415  421 LEU A N   
1390 C CA  . LEU A 207 ? 0.3729 0.5061 0.5257 -0.0363 -0.0416 0.0456  421 LEU A CA  
1391 C C   . LEU A 207 ? 0.3832 0.4845 0.5087 -0.0172 -0.0443 0.0522  421 LEU A C   
1392 O O   . LEU A 207 ? 0.3335 0.4410 0.4567 -0.0004 -0.0580 0.0530  421 LEU A O   
1393 C CB  . LEU A 207 ? 0.3530 0.5163 0.5274 -0.0390 -0.0278 0.0502  421 LEU A CB  
1394 C CG  . LEU A 207 ? 0.3400 0.5478 0.5480 -0.0592 -0.0249 0.0455  421 LEU A CG  
1395 C CD1 . LEU A 207 ? 0.3217 0.5683 0.5452 -0.0640 -0.0084 0.0516  421 LEU A CD1 
1396 C CD2 . LEU A 207 ? 0.3534 0.5985 0.5801 -0.0513 -0.0425 0.0319  421 LEU A CD2 
1397 N N   . LEU A 208 ? 0.3873 0.4535 0.4968 -0.0205 -0.0334 0.0578  422 LEU A N   
1398 C CA  . LEU A 208 ? 0.3969 0.4357 0.4848 -0.0057 -0.0341 0.0634  422 LEU A CA  
1399 C C   . LEU A 208 ? 0.3996 0.4036 0.4738 -0.0133 -0.0255 0.0650  422 LEU A C   
1400 O O   . LEU A 208 ? 0.3971 0.3935 0.4818 -0.0219 -0.0165 0.0685  422 LEU A O   
1401 C CB  . LEU A 208 ? 0.4449 0.4965 0.5406 0.0085  -0.0292 0.0659  422 LEU A CB  
1402 C CG  . LEU A 208 ? 0.5447 0.5805 0.6312 0.0281  -0.0379 0.0661  422 LEU A CG  
1403 C CD1 . LEU A 208 ? 0.5501 0.5921 0.6423 0.0369  -0.0574 0.0656  422 LEU A CD1 
1404 C CD2 . LEU A 208 ? 0.5808 0.6364 0.6788 0.0406  -0.0313 0.0595  422 LEU A CD2 
1405 N N   . CYS A 209 ? 0.3804 0.3658 0.4340 -0.0108 -0.0295 0.0635  423 CYS A N   
1406 C CA  . CYS A 209 ? 0.3966 0.3562 0.4427 -0.0144 -0.0210 0.0608  423 CYS A CA  
1407 C C   . CYS A 209 ? 0.3206 0.2657 0.3501 -0.0039 -0.0222 0.0681  423 CYS A C   
1408 O O   . CYS A 209 ? 0.3584 0.3049 0.3724 -0.0023 -0.0310 0.0722  423 CYS A O   
1409 C CB  . CYS A 209 ? 0.3378 0.2982 0.3790 -0.0274 -0.0205 0.0449  423 CYS A CB  
1410 S SG  . CYS A 209 ? 0.4143 0.3524 0.4561 -0.0287 -0.0096 0.0334  423 CYS A SG  
1411 N N   . THR A 210 ? 0.3649 0.2958 0.3986 0.0014  -0.0155 0.0719  424 THR A N   
1412 C CA  . THR A 210 ? 0.4137 0.3321 0.4369 0.0098  -0.0170 0.0767  424 THR A CA  
1413 C C   . THR A 210 ? 0.4143 0.3185 0.4397 0.0073  -0.0097 0.0732  424 THR A C   
1414 O O   . THR A 210 ? 0.4087 0.3083 0.4483 0.0078  -0.0058 0.0740  424 THR A O   
1415 C CB  . THR A 210 ? 0.4015 0.3257 0.4300 0.0220  -0.0191 0.0808  424 THR A CB  
1416 O OG1 . THR A 210 ? 0.4401 0.3843 0.4761 0.0270  -0.0254 0.0791  424 THR A OG1 
1417 C CG2 . THR A 210 ? 0.3624 0.2714 0.3838 0.0296  -0.0237 0.0819  424 THR A CG2 
1418 N N   . ALA A 211 ? 0.4038 0.3036 0.4177 0.0036  -0.0091 0.0712  425 ALA A N   
1419 C CA  . ALA A 211 ? 0.4055 0.2999 0.4269 0.0026  -0.0021 0.0651  425 ALA A CA  
1420 C C   . ALA A 211 ? 0.4028 0.2890 0.4230 0.0098  -0.0058 0.0727  425 ALA A C   
1421 O O   . ALA A 211 ? 0.4040 0.2853 0.4133 0.0111  -0.0130 0.0798  425 ALA A O   
1422 C CB  . ALA A 211 ? 0.4053 0.3110 0.4172 -0.0100 0.0042  0.0548  425 ALA A CB  
1423 N N   . TYR A 212 ? 0.3863 0.2699 0.4211 0.0149  -0.0038 0.0706  426 TYR A N   
1424 C CA  . TYR A 212 ? 0.3930 0.2733 0.4282 0.0206  -0.0083 0.0738  426 TYR A CA  
1425 C C   . TYR A 212 ? 0.3744 0.2587 0.4221 0.0165  -0.0042 0.0667  426 TYR A C   
1426 O O   . TYR A 212 ? 0.3095 0.1991 0.3762 0.0178  0.0001  0.0590  426 TYR A O   
1427 C CB  . TYR A 212 ? 0.4142 0.2979 0.4537 0.0296  -0.0126 0.0793  426 TYR A CB  
1428 C CG  . TYR A 212 ? 0.4535 0.3449 0.4843 0.0324  -0.0141 0.0836  426 TYR A CG  
1429 C CD1 . TYR A 212 ? 0.4322 0.3280 0.4560 0.0387  -0.0188 0.0796  426 TYR A CD1 
1430 C CD2 . TYR A 212 ? 0.5068 0.4031 0.5428 0.0284  -0.0110 0.0891  426 TYR A CD2 
1431 C CE1 . TYR A 212 ? 0.4692 0.3811 0.4920 0.0429  -0.0189 0.0783  426 TYR A CE1 
1432 C CE2 . TYR A 212 ? 0.4862 0.3984 0.5181 0.0285  -0.0105 0.0917  426 TYR A CE2 
1433 C CZ  . TYR A 212 ? 0.5088 0.4325 0.5346 0.0367  -0.0136 0.0851  426 TYR A CZ  
1434 O OH  . TYR A 212 ? 0.5773 0.5256 0.6058 0.0385  -0.0119 0.0827  426 TYR A OH  
1435 N N   . VAL A 213 ? 0.4057 0.2880 0.4483 0.0114  -0.0065 0.0680  427 VAL A N   
1436 C CA  . VAL A 213 ? 0.3602 0.2530 0.4183 0.0058  -0.0027 0.0610  427 VAL A CA  
1437 C C   . VAL A 213 ? 0.3517 0.2392 0.4138 0.0103  -0.0126 0.0625  427 VAL A C   
1438 O O   . VAL A 213 ? 0.3594 0.2340 0.4098 0.0149  -0.0207 0.0664  427 VAL A O   
1439 C CB  . VAL A 213 ? 0.3544 0.2568 0.4041 -0.0129 0.0057  0.0605  427 VAL A CB  
1440 C CG1 . VAL A 213 ? 0.3275 0.2443 0.3722 -0.0184 0.0161  0.0520  427 VAL A CG1 
1441 C CG2 . VAL A 213 ? 0.3692 0.2527 0.3988 -0.0207 -0.0033 0.0761  427 VAL A CG2 
1442 N N   . PHE A 214 ? 0.3352 0.2363 0.4180 0.0098  -0.0128 0.0554  428 PHE A N   
1443 C CA  . PHE A 214 ? 0.3524 0.2545 0.4406 0.0157  -0.0243 0.0532  428 PHE A CA  
1444 C C   . PHE A 214 ? 0.3642 0.2773 0.4708 0.0047  -0.0255 0.0459  428 PHE A C   
1445 O O   . PHE A 214 ? 0.3346 0.2680 0.4617 -0.0018 -0.0171 0.0397  428 PHE A O   
1446 C CB  . PHE A 214 ? 0.3768 0.2895 0.4737 0.0295  -0.0309 0.0551  428 PHE A CB  
1447 C CG  . PHE A 214 ? 0.3493 0.2542 0.4290 0.0366  -0.0312 0.0649  428 PHE A CG  
1448 C CD1 . PHE A 214 ? 0.3820 0.2819 0.4670 0.0366  -0.0242 0.0682  428 PHE A CD1 
1449 C CD2 . PHE A 214 ? 0.3645 0.2721 0.4257 0.0416  -0.0377 0.0673  428 PHE A CD2 
1450 C CE1 . PHE A 214 ? 0.3734 0.2680 0.4462 0.0393  -0.0245 0.0781  428 PHE A CE1 
1451 C CE2 . PHE A 214 ? 0.3674 0.2766 0.4150 0.0446  -0.0357 0.0763  428 PHE A CE2 
1452 C CZ  . PHE A 214 ? 0.3749 0.2760 0.4288 0.0425  -0.0295 0.0838  428 PHE A CZ  
1453 N N   . GLU A 215 ? 0.3589 0.2617 0.4625 0.0023  -0.0358 0.0432  429 GLU A N   
1454 C CA  . GLU A 215 ? 0.3692 0.2842 0.4942 -0.0069 -0.0414 0.0341  429 GLU A CA  
1455 C C   . GLU A 215 ? 0.4080 0.3254 0.5306 0.0044  -0.0568 0.0244  429 GLU A C   
1456 O O   . GLU A 215 ? 0.4017 0.3168 0.5053 0.0179  -0.0601 0.0259  429 GLU A O   
1457 C CB  . GLU A 215 ? 0.3922 0.2910 0.5194 -0.0287 -0.0398 0.0386  429 GLU A CB  
1458 C CG  . GLU A 215 ? 0.4098 0.3205 0.5360 -0.0458 -0.0235 0.0476  429 GLU A CG  
1459 C CD  . GLU A 215 ? 0.4502 0.3534 0.5808 -0.0740 -0.0229 0.0572  429 GLU A CD  
1460 O OE1 . GLU A 215 ? 0.4382 0.3233 0.5808 -0.0791 -0.0365 0.0541  429 GLU A OE1 
1461 O OE2 . GLU A 215 ? 0.5140 0.4307 0.6358 -0.0931 -0.0094 0.0678  429 GLU A OE2 
1462 N N   . VAL A 216 ? 0.3519 0.2799 0.4936 -0.0036 -0.0655 0.0127  430 VAL A N   
1463 C CA  . VAL A 216 ? 0.3622 0.3008 0.5010 0.0046  -0.0811 -0.0019 430 VAL A CA  
1464 C C   . VAL A 216 ? 0.4495 0.3645 0.5941 -0.0050 -0.0896 -0.0166 430 VAL A C   
1465 O O   . VAL A 216 ? 0.5221 0.4213 0.6846 -0.0236 -0.0876 -0.0134 430 VAL A O   
1466 C CB  . VAL A 216 ? 0.5224 0.4977 0.6833 0.0056  -0.0900 -0.0076 430 VAL A CB  
1467 C CG1 . VAL A 216 ? 0.5879 0.5779 0.7488 0.0058  -0.1077 -0.0273 430 VAL A CG1 
1468 C CG2 . VAL A 216 ? 0.4627 0.4550 0.6188 0.0210  -0.0900 0.0065  430 VAL A CG2 
1469 N N   . SER A 217 ? 0.4266 0.3401 0.5580 0.0064  -0.0991 -0.0331 431 SER A N   
1470 C CA  . SER A 217 ? 0.4650 0.3561 0.6103 0.0011  -0.1111 -0.0556 431 SER A CA  
1471 C C   . SER A 217 ? 0.5250 0.4475 0.6776 0.0015  -0.1252 -0.0824 431 SER A C   
1472 O O   . SER A 217 ? 0.5539 0.5159 0.6934 0.0084  -0.1271 -0.0796 431 SER A O   
1473 C CB  . SER A 217 ? 0.4393 0.3088 0.5724 0.0154  -0.1119 -0.0643 431 SER A CB  
1474 O OG  . SER A 217 ? 0.4733 0.3156 0.6296 0.0129  -0.1261 -0.0896 431 SER A OG  
1475 N N   . THR A 218 ? 0.5688 0.4728 0.7436 -0.0069 -0.1379 -0.1076 432 THR A N   
1476 C CA  . THR A 218 ? 0.5682 0.5039 0.7504 -0.0082 -0.1533 -0.1394 432 THR A CA  
1477 C C   . THR A 218 ? 0.6112 0.5686 0.7687 0.0100  -0.1575 -0.1677 432 THR A C   
1478 O O   . THR A 218 ? 0.6164 0.5569 0.7618 0.0227  -0.1496 -0.1667 432 THR A O   
1479 C CB  . THR A 218 ? 0.6284 0.5359 0.8505 -0.0277 -0.1664 -0.1596 432 THR A CB  
1480 O OG1 . THR A 218 ? 0.6259 0.4845 0.8595 -0.0233 -0.1715 -0.1736 432 THR A OG1 
1481 C CG2 . THR A 218 ? 0.5920 0.4875 0.8374 -0.0507 -0.1591 -0.1309 432 THR A CG2 
1482 N N   . SER A 219 ? 0.6989 0.7012 0.8490 0.0103  -0.1699 -0.1940 433 SER A N   
1483 C CA  . SER A 219 ? 0.7517 0.7876 0.8769 0.0234  -0.1732 -0.2278 433 SER A CA  
1484 C C   . SER A 219 ? 0.7309 0.7297 0.8837 0.0280  -0.1782 -0.2672 433 SER A C   
1485 O O   . SER A 219 ? 0.7417 0.7527 0.8819 0.0435  -0.1730 -0.2901 433 SER A O   
1486 C CB  . SER A 219 ? 0.8397 0.9348 0.9515 0.0186  -0.1887 -0.2502 433 SER A CB  
1487 O OG  . SER A 219 ? 0.8759 1.0033 0.9684 0.0171  -0.1893 -0.2122 433 SER A OG  
1488 N N   . GLU A 220 ? 0.6919 0.6461 0.8871 0.0136  -0.1892 -0.2748 434 GLU A N   
1489 C CA  . GLU A 220 ? 0.7150 0.6235 0.9485 0.0161  -0.2008 -0.3116 434 GLU A CA  
1490 C C   . GLU A 220 ? 0.6765 0.5381 0.9162 0.0292  -0.1926 -0.2932 434 GLU A C   
1491 O O   . GLU A 220 ? 0.7048 0.5558 0.9603 0.0464  -0.1975 -0.3287 434 GLU A O   
1492 C CB  . GLU A 220 ? 0.7433 0.6117 1.0221 -0.0085 -0.2157 -0.3132 434 GLU A CB  
1493 C CG  . GLU A 220 ? 0.8247 0.6599 1.1442 -0.0076 -0.2303 -0.3541 434 GLU A CG  
1494 C CD  . GLU A 220 ? 0.8837 0.6893 1.2395 -0.0348 -0.2387 -0.3416 434 GLU A CD  
1495 O OE1 . GLU A 220 ? 0.9003 0.7051 1.2577 -0.0564 -0.2358 -0.3079 434 GLU A OE1 
1496 O OE2 . GLU A 220 ? 0.9412 0.7282 1.3265 -0.0354 -0.2478 -0.3665 434 GLU A OE2 
1497 N N   . ARG A 221 ? 0.6363 0.4750 0.8663 0.0218  -0.1810 -0.2409 435 ARG A N   
1498 C CA  . ARG A 221 ? 0.6503 0.4467 0.8846 0.0313  -0.1758 -0.2180 435 ARG A CA  
1499 C C   . ARG A 221 ? 0.6324 0.4666 0.8323 0.0529  -0.1607 -0.2163 435 ARG A C   
1500 O O   . ARG A 221 ? 0.6644 0.4812 0.8758 0.0694  -0.1615 -0.2262 435 ARG A O   
1501 C CB  . ARG A 221 ? 0.6514 0.4160 0.8854 0.0117  -0.1690 -0.1656 435 ARG A CB  
1502 C CG  . ARG A 221 ? 0.6863 0.4101 0.9573 -0.0146 -0.1826 -0.1607 435 ARG A CG  
1503 C CD  . ARG A 221 ? 0.6568 0.3485 0.9264 -0.0348 -0.1753 -0.1097 435 ARG A CD  
1504 N NE  . ARG A 221 ? 0.6648 0.3193 0.9309 -0.0223 -0.1773 -0.0911 435 ARG A NE  
1505 C CZ  . ARG A 221 ? 0.6918 0.3227 0.9509 -0.0380 -0.1729 -0.0473 435 ARG A CZ  
1506 N NH1 . ARG A 221 ? 0.7178 0.3497 0.9784 -0.0690 -0.1672 -0.0214 435 ARG A NH1 
1507 N NH2 . ARG A 221 ? 0.6650 0.2815 0.9143 -0.0237 -0.1735 -0.0310 435 ARG A NH2 
1508 N N   . GLY A 222 ? 0.5941 0.4804 0.7564 0.0518  -0.1487 -0.2025 436 GLY A N   
1509 C CA  . GLY A 222 ? 0.5583 0.4819 0.6872 0.0659  -0.1340 -0.1941 436 GLY A CA  
1510 C C   . GLY A 222 ? 0.5307 0.4309 0.6499 0.0643  -0.1217 -0.1483 436 GLY A C   
1511 O O   . GLY A 222 ? 0.5306 0.3869 0.6671 0.0534  -0.1243 -0.1256 436 GLY A O   
1512 N N   . ALA A 223 ? 0.4983 0.4312 0.5889 0.0724  -0.1084 -0.1351 437 ALA A N   
1513 C CA  . ALA A 223 ? 0.4448 0.3610 0.5258 0.0708  -0.0970 -0.0967 437 ALA A CA  
1514 C C   . ALA A 223 ? 0.4457 0.3181 0.5492 0.0763  -0.1008 -0.0940 437 ALA A C   
1515 O O   . ALA A 223 ? 0.4695 0.3350 0.5939 0.0891  -0.1091 -0.1236 437 ALA A O   
1516 C CB  . ALA A 223 ? 0.4239 0.3832 0.4753 0.0766  -0.0843 -0.0867 437 ALA A CB  
1517 N N   . GLN A 224 ? 0.4308 0.2762 0.5318 0.0669  -0.0964 -0.0598 438 GLN A N   
1518 C CA  . GLN A 224 ? 0.4430 0.2490 0.5596 0.0692  -0.1027 -0.0480 438 GLN A CA  
1519 C C   . GLN A 224 ? 0.4446 0.2532 0.5409 0.0634  -0.0906 -0.0149 438 GLN A C   
1520 O O   . GLN A 224 ? 0.4468 0.2756 0.5255 0.0550  -0.0791 -0.0013 438 GLN A O   
1521 C CB  . GLN A 224 ? 0.5648 0.3244 0.7058 0.0551  -0.1174 -0.0425 438 GLN A CB  
1522 C CG  . GLN A 224 ? 0.6387 0.3525 0.8013 0.0589  -0.1325 -0.0316 438 GLN A CG  
1523 C CD  . GLN A 224 ? 0.6964 0.3633 0.8835 0.0406  -0.1488 -0.0220 438 GLN A CD  
1524 O OE1 . GLN A 224 ? 0.7319 0.4003 0.9188 0.0212  -0.1461 -0.0190 438 GLN A OE1 
1525 N NE2 . GLN A 224 ? 0.6857 0.3325 0.8884 0.0431  -0.1601 -0.0150 438 GLN A NE2 
1526 N N   . HIS A 225 ? 0.4255 0.2146 0.5280 0.0689  -0.0955 -0.0042 439 HIS A N   
1527 C CA  . HIS A 225 ? 0.5052 0.2963 0.5893 0.0612  -0.0865 0.0241  439 HIS A CA  
1528 C C   . HIS A 225 ? 0.5014 0.2562 0.5943 0.0565  -0.1002 0.0439  439 HIS A C   
1529 O O   . HIS A 225 ? 0.5478 0.2736 0.6662 0.0645  -0.1184 0.0358  439 HIS A O   
1530 C CB  . HIS A 225 ? 0.3862 0.2122 0.4597 0.0732  -0.0759 0.0193  439 HIS A CB  
1531 C CG  . HIS A 225 ? 0.5099 0.3415 0.6031 0.0923  -0.0843 0.0001  439 HIS A CG  
1532 N ND1 . HIS A 225 ? 0.5386 0.3940 0.6439 0.1059  -0.0850 -0.0330 439 HIS A ND1 
1533 C CD2 . HIS A 225 ? 0.5580 0.3802 0.6646 0.1009  -0.0933 0.0061  439 HIS A CD2 
1534 C CE1 . HIS A 225 ? 0.5522 0.4137 0.6817 0.1234  -0.0921 -0.0497 439 HIS A CE1 
1535 N NE2 . HIS A 225 ? 0.5595 0.3994 0.6920 0.1215  -0.0987 -0.0249 439 HIS A NE2 
1536 N N   . HIS A 226 ? 0.5151 0.2721 0.5878 0.0429  -0.0932 0.0696  440 HIS A N   
1537 C CA  . HIS A 226 ? 0.5624 0.2984 0.6323 0.0350  -0.1047 0.0930  440 HIS A CA  
1538 C C   . HIS A 226 ? 0.5324 0.2891 0.5827 0.0347  -0.0975 0.1054  440 HIS A C   
1539 O O   . HIS A 226 ? 0.4615 0.2393 0.4919 0.0220  -0.0805 0.1095  440 HIS A O   
1540 C CB  . HIS A 226 ? 0.6101 0.3314 0.6715 0.0084  -0.1044 0.1129  440 HIS A CB  
1541 C CG  . HIS A 226 ? 0.6472 0.3549 0.7036 -0.0018 -0.1164 0.1353  440 HIS A CG  
1542 N ND1 . HIS A 226 ? 0.6628 0.3792 0.7095 0.0047  -0.1219 0.1457  440 HIS A ND1 
1543 C CD2 . HIS A 226 ? 0.6731 0.3596 0.7342 -0.0193 -0.1262 0.1514  440 HIS A CD2 
1544 C CE1 . HIS A 226 ? 0.7034 0.4046 0.7478 -0.0072 -0.1357 0.1677  440 HIS A CE1 
1545 N NE2 . HIS A 226 ? 0.7038 0.3860 0.7563 -0.0223 -0.1382 0.1727  440 HIS A NE2 
1546 N N   . ILE A 227 ? 0.5479 0.3088 0.6067 0.0485  -0.1073 0.1041  441 ILE A N   
1547 C CA  . ILE A 227 ? 0.5513 0.3342 0.5965 0.0487  -0.1034 0.1125  441 ILE A CA  
1548 C C   . ILE A 227 ? 0.5541 0.3316 0.5795 0.0316  -0.1115 0.1388  441 ILE A C   
1549 O O   . ILE A 227 ? 0.5753 0.3364 0.6089 0.0312  -0.1267 0.1479  441 ILE A O   
1550 C CB  . ILE A 227 ? 0.5655 0.3668 0.6340 0.0722  -0.1094 0.0951  441 ILE A CB  
1551 C CG1 . ILE A 227 ? 0.5207 0.3421 0.6009 0.0846  -0.0967 0.0665  441 ILE A CG1 
1552 C CG2 . ILE A 227 ? 0.5375 0.3685 0.5935 0.0685  -0.1030 0.1006  441 ILE A CG2 
1553 C CD1 . ILE A 227 ? 0.5497 0.3996 0.6553 0.1059  -0.0993 0.0443  441 ILE A CD1 
1554 N N   . TYR A 228 ? 0.5402 0.3367 0.5395 0.0160  -0.1003 0.1481  442 TYR A N   
1555 C CA  . TYR A 228 ? 0.5722 0.3712 0.5456 -0.0033 -0.1087 0.1737  442 TYR A CA  
1556 C C   . TYR A 228 ? 0.5888 0.4187 0.5525 -0.0010 -0.1074 0.1692  442 TYR A C   
1557 O O   . TYR A 228 ? 0.5647 0.4149 0.5378 0.0084  -0.0932 0.1472  442 TYR A O   
1558 C CB  . TYR A 228 ? 0.5858 0.3949 0.5338 -0.0301 -0.0917 0.1802  442 TYR A CB  
1559 C CG  . TYR A 228 ? 0.6050 0.3905 0.5635 -0.0380 -0.0915 0.1845  442 TYR A CG  
1560 C CD1 . TYR A 228 ? 0.6373 0.4120 0.5894 -0.0544 -0.1009 0.2041  442 TYR A CD1 
1561 C CD2 . TYR A 228 ? 0.5741 0.3594 0.5510 -0.0290 -0.0788 0.1622  442 TYR A CD2 
1562 C CE1 . TYR A 228 ? 0.6765 0.4344 0.6421 -0.0635 -0.0996 0.2044  442 TYR A CE1 
1563 C CE2 . TYR A 228 ? 0.6264 0.3929 0.6154 -0.0378 -0.0805 0.1643  442 TYR A CE2 
1564 C CZ  . TYR A 228 ? 0.6869 0.4407 0.6713 -0.0554 -0.0897 0.1837  442 TYR A CZ  
1565 O OH  . TYR A 228 ? 0.7497 0.4885 0.7495 -0.0661 -0.0905 0.1831  442 TYR A OH  
1566 N N   . ARG A 229 ? 0.6578 0.4919 0.6025 -0.0122 -0.1242 0.1924  443 ARG A N   
1567 C CA  . ARG A 229 ? 0.6584 0.5271 0.5887 -0.0164 -0.1234 0.1875  443 ARG A CA  
1568 C C   . ARG A 229 ? 0.6356 0.5301 0.5290 -0.0437 -0.1053 0.1860  443 ARG A C   
1569 O O   . ARG A 229 ? 0.6452 0.5362 0.5139 -0.0645 -0.1068 0.2068  443 ARG A O   
1570 C CB  . ARG A 229 ? 0.7057 0.5727 0.6373 -0.0117 -0.1552 0.2111  443 ARG A CB  
1571 N N   . LEU A 230 ? 0.5999 0.5224 0.4930 -0.0448 -0.0879 0.1596  444 LEU A N   
1572 C CA  . LEU A 230 ? 0.6161 0.5692 0.4821 -0.0673 -0.0705 0.1474  444 LEU A CA  
1573 C C   . LEU A 230 ? 0.6501 0.6349 0.4861 -0.0824 -0.0835 0.1551  444 LEU A C   
1574 O O   . LEU A 230 ? 0.6606 0.6592 0.5074 -0.0742 -0.0913 0.1440  444 LEU A O   
1575 C CB  . LEU A 230 ? 0.5660 0.5283 0.4534 -0.0606 -0.0484 0.1128  444 LEU A CB  
1576 C CG  . LEU A 230 ? 0.5465 0.4882 0.4565 -0.0510 -0.0340 0.1041  444 LEU A CG  
1577 C CD1 . LEU A 230 ? 0.4971 0.4433 0.4317 -0.0431 -0.0200 0.0774  444 LEU A CD1 
1578 C CD2 . LEU A 230 ? 0.5605 0.5093 0.4549 -0.0682 -0.0230 0.1074  444 LEU A CD2 
1579 N N   . VAL A 231 ? 0.6694 0.6705 0.4667 -0.1072 -0.0862 0.1750  445 VAL A N   
1580 C CA  . VAL A 231 ? 0.7281 0.7664 0.4881 -0.1256 -0.1001 0.1851  445 VAL A CA  
1581 C C   . VAL A 231 ? 0.7784 0.8657 0.5058 -0.1521 -0.0760 0.1602  445 VAL A C   
1582 O O   . VAL A 231 ? 0.7644 0.8542 0.5029 -0.1547 -0.0501 0.1378  445 VAL A O   
1583 C CB  . VAL A 231 ? 0.7665 0.7903 0.5021 -0.1360 -0.1304 0.2365  445 VAL A CB  
1584 C CG1 . VAL A 231 ? 0.7508 0.7296 0.5280 -0.1058 -0.1566 0.2531  445 VAL A CG1 
1585 C CG2 . VAL A 231 ? 0.7671 0.7827 0.4831 -0.1581 -0.1194 0.2569  445 VAL A CG2 
1586 N N   . ARG A 232 ? 0.8394 0.9708 0.5293 -0.1711 -0.0856 0.1609  446 ARG A N   
1587 C CA  . ARG A 232 ? 0.8869 1.0757 0.5433 -0.1979 -0.0630 0.1317  446 ARG A CA  
1588 C C   . ARG A 232 ? 0.9573 1.1930 0.5528 -0.2279 -0.0809 0.1587  446 ARG A C   
1589 O O   . ARG A 232 ? 0.9861 1.2529 0.5679 -0.2308 -0.0946 0.1464  446 ARG A O   
1590 C CB  . ARG A 232 ? 0.8554 1.0621 0.5403 -0.1875 -0.0469 0.0749  446 ARG A CB  
1591 C CG  . ARG A 232 ? 0.8753 1.1361 0.5441 -0.2079 -0.0186 0.0303  446 ARG A CG  
1592 C CD  . ARG A 232 ? 0.8492 1.1067 0.5659 -0.1917 -0.0030 -0.0263 446 ARG A CD  
1593 N NE  . ARG A 232 ? 0.8539 1.1278 0.5710 -0.1921 -0.0183 -0.0446 446 ARG A NE  
1594 C CZ  . ARG A 232 ? 0.8118 1.0789 0.5715 -0.1815 -0.0114 -0.0891 446 ARG A CZ  
1595 N NH1 . ARG A 232 ? 0.7716 1.0132 0.5767 -0.1676 0.0084  -0.1170 446 ARG A NH1 
1596 N NH2 . ARG A 232 ? 0.8247 1.1096 0.5849 -0.1857 -0.0269 -0.1040 446 ARG A NH2 
1597 N N   . TRP B 4   ? 0.9585 0.9282 0.3983 -0.0196 -0.0667 0.1525  218 TRP B N   
1598 C CA  . TRP B 4   ? 0.8809 0.9349 0.4074 -0.0299 -0.0592 0.1149  218 TRP B CA  
1599 C C   . TRP B 4   ? 0.8588 0.9087 0.4358 -0.0002 -0.0626 0.1020  218 TRP B C   
1600 O O   . TRP B 4   ? 0.8059 0.8973 0.4451 -0.0097 -0.0536 0.0748  218 TRP B O   
1601 C CB  . TRP B 4   ? 0.8541 1.0019 0.4058 -0.0279 -0.0644 0.0984  218 TRP B CB  
1602 C CG  . TRP B 4   ? 0.9208 1.0844 0.4274 -0.0592 -0.0600 0.1077  218 TRP B CG  
1603 C CD1 . TRP B 4   ? 0.9925 1.1549 0.4549 -0.0469 -0.0702 0.1260  218 TRP B CD1 
1604 C CD2 . TRP B 4   ? 0.9194 1.0966 0.4347 -0.1031 -0.0417 0.0942  218 TRP B CD2 
1605 N NE1 . TRP B 4   ? 1.0311 1.2012 0.4773 -0.0824 -0.0581 0.1240  218 TRP B NE1 
1606 C CE2 . TRP B 4   ? 0.9830 1.1663 0.4647 -0.1168 -0.0407 0.1037  218 TRP B CE2 
1607 C CE3 . TRP B 4   ? 0.8668 1.0575 0.4200 -0.1277 -0.0260 0.0736  218 TRP B CE3 
1608 C CZ2 . TRP B 4   ? 0.9879 1.1945 0.4768 -0.1564 -0.0247 0.0921  218 TRP B CZ2 
1609 C CZ3 . TRP B 4   ? 0.8601 1.0770 0.4216 -0.1623 -0.0110 0.0620  218 TRP B CZ3 
1610 C CH2 . TRP B 4   ? 0.9227 1.1489 0.4538 -0.1777 -0.0105 0.0707  218 TRP B CH2 
1611 N N   . GLN B 5   ? 0.8991 0.8971 0.4448 0.0381  -0.0750 0.1218  219 GLN B N   
1612 C CA  . GLN B 5   ? 0.8539 0.8483 0.4415 0.0669  -0.0781 0.1105  219 GLN B CA  
1613 C C   . GLN B 5   ? 0.8599 0.7915 0.4501 0.0459  -0.0649 0.1088  219 GLN B C   
1614 O O   . GLN B 5   ? 0.9247 0.7873 0.4604 0.0217  -0.0577 0.1260  219 GLN B O   
1615 C CB  . GLN B 5   ? 0.9166 0.8826 0.4677 0.1197  -0.0953 0.1307  219 GLN B CB  
1616 C CG  . GLN B 5   ? 0.9209 0.9722 0.4776 0.1449  -0.1106 0.1289  219 GLN B CG  
1617 C CD  . GLN B 5   ? 1.0302 1.0547 0.5483 0.1986  -0.1270 0.1513  219 GLN B CD  
1618 O OE1 . GLN B 5   ? 1.1336 1.0560 0.6016 0.2103  -0.1250 0.1747  219 GLN B OE1 
1619 N NE2 . GLN B 5   ? 0.9963 1.1134 0.5535 0.2222  -0.1376 0.1372  219 GLN B NE2 
1620 N N   . ALA B 6   ? 0.7947 0.7529 0.4449 0.0514  -0.0608 0.0873  220 ALA B N   
1621 C CA  . ALA B 6   ? 0.7597 0.6785 0.4212 0.0309  -0.0487 0.0819  220 ALA B CA  
1622 C C   . ALA B 6   ? 0.8217 0.6439 0.4284 0.0428  -0.0500 0.1018  220 ALA B C   
1623 O O   . ALA B 6   ? 0.8211 0.6149 0.4055 0.0837  -0.0614 0.1129  220 ALA B O   
1624 C CB  . ALA B 6   ? 0.6734 0.6400 0.4048 0.0387  -0.0450 0.0572  220 ALA B CB  
1625 N N   . ARG B 7   ? 0.8431 0.6181 0.4264 0.0073  -0.0374 0.1041  221 ARG B N   
1626 C CA  . ARG B 7   ? 0.9270 0.6017 0.4548 0.0091  -0.0339 0.1178  221 ARG B CA  
1627 C C   . ARG B 7   ? 0.8866 0.5673 0.4586 0.0070  -0.0276 0.0999  221 ARG B C   
1628 O O   . ARG B 7   ? 0.9770 0.5830 0.5145 0.0121  -0.0242 0.1046  221 ARG B O   
1629 C CB  . ARG B 7   ? 1.0098 0.6218 0.4674 -0.0382 -0.0219 0.1318  221 ARG B CB  
1630 C CG  . ARG B 7   ? 1.0705 0.6942 0.4896 -0.0503 -0.0246 0.1469  221 ARG B CG  
1631 C CD  . ARG B 7   ? 1.1583 0.7362 0.5281 -0.0020 -0.0398 0.1710  221 ARG B CD  
1632 N NE  . ARG B 7   ? 1.2406 0.7943 0.5534 -0.0226 -0.0374 0.1902  221 ARG B NE  
1633 C CZ  . ARG B 7   ? 1.3078 0.8531 0.5941 0.0137  -0.0491 0.2089  221 ARG B CZ  
1634 N NH1 . ARG B 7   ? 1.3612 0.8912 0.6048 -0.0091 -0.0445 0.2242  221 ARG B NH1 
1635 N NH2 . ARG B 7   ? 1.3226 0.8846 0.6286 0.0725  -0.0652 0.2108  221 ARG B NH2 
1636 N N   . GLY B 8   ? 0.7629 0.5284 0.4062 0.0000  -0.0251 0.0794  222 GLY B N   
1637 C CA  . GLY B 8   ? 0.6856 0.4672 0.3730 0.0005  -0.0200 0.0637  222 GLY B CA  
1638 C C   . GLY B 8   ? 0.5875 0.4505 0.3446 0.0147  -0.0220 0.0461  222 GLY B C   
1639 O O   . GLY B 8   ? 0.5296 0.4348 0.2999 0.0229  -0.0269 0.0437  222 GLY B O   
1640 N N   . LEU B 9   ? 0.5441 0.4253 0.3400 0.0154  -0.0170 0.0336  223 LEU B N   
1641 C CA  . LEU B 9   ? 0.4822 0.4236 0.3337 0.0254  -0.0155 0.0178  223 LEU B CA  
1642 C C   . LEU B 9   ? 0.4358 0.4206 0.3064 0.0041  -0.0069 0.0101  223 LEU B C   
1643 O O   . LEU B 9   ? 0.4127 0.4067 0.2923 -0.0100 0.0005  0.0069  223 LEU B O   
1644 C CB  . LEU B 9   ? 0.4942 0.4332 0.3726 0.0354  -0.0127 0.0099  223 LEU B CB  
1645 C CG  . LEU B 9   ? 0.4896 0.4664 0.4081 0.0529  -0.0132 -0.0033 223 LEU B CG  
1646 C CD1 . LEU B 9   ? 0.4964 0.4633 0.4304 0.0596  -0.0100 -0.0081 223 LEU B CD1 
1647 C CD2 . LEU B 9   ? 0.4229 0.4408 0.3693 0.0427  -0.0054 -0.0143 223 LEU B CD2 
1648 N N   . GLY B 10  ? 0.4377 0.4552 0.3140 0.0042  -0.0079 0.0057  224 GLY B N   
1649 C CA  . GLY B 10  ? 0.4250 0.4852 0.3191 -0.0097 0.0011  -0.0048 224 GLY B CA  
1650 C C   . GLY B 10  ? 0.4328 0.5169 0.3128 -0.0167 -0.0007 -0.0057 224 GLY B C   
1651 O O   . GLY B 10  ? 0.4198 0.4892 0.2747 -0.0098 -0.0103 0.0040  224 GLY B O   
1652 N N   . THR B 11  ? 0.3986 0.5233 0.2934 -0.0269 0.0085  -0.0180 225 THR B N   
1653 C CA  . THR B 11  ? 0.4077 0.5618 0.2876 -0.0387 0.0091  -0.0212 225 THR B CA  
1654 C C   . THR B 11  ? 0.4237 0.6028 0.2918 -0.0620 0.0174  -0.0213 225 THR B C   
1655 O O   . THR B 11  ? 0.4364 0.6150 0.3099 -0.0680 0.0218  -0.0199 225 THR B O   
1656 C CB  . THR B 11  ? 0.4000 0.5888 0.3084 -0.0298 0.0152  -0.0430 225 THR B CB  
1657 O OG1 . THR B 11  ? 0.4085 0.6155 0.3419 -0.0262 0.0283  -0.0577 225 THR B OG1 
1658 C CG2 . THR B 11  ? 0.4236 0.5995 0.3478 -0.0134 0.0102  -0.0480 225 THR B CG2 
1659 N N   . ALA B 12  ? 0.4510 0.6621 0.3035 -0.0770 0.0199  -0.0249 226 ALA B N   
1660 C CA  . ALA B 12  ? 0.4723 0.7245 0.3162 -0.1014 0.0295  -0.0295 226 ALA B CA  
1661 C C   . ALA B 12  ? 0.4543 0.7541 0.3409 -0.0861 0.0406  -0.0510 226 ALA B C   
1662 O O   . ALA B 12  ? 0.4649 0.8118 0.3545 -0.0985 0.0486  -0.0576 226 ALA B O   
1663 C CB  . ALA B 12  ? 0.5040 0.7823 0.3201 -0.1203 0.0301  -0.0294 226 ALA B CB  
1664 N N   . ARG B 13  ? 0.4441 0.7313 0.3596 -0.0584 0.0417  -0.0620 227 ARG B N   
1665 C CA  . ARG B 13  ? 0.4557 0.7683 0.4020 -0.0361 0.0532  -0.0805 227 ARG B CA  
1666 C C   . ARG B 13  ? 0.4295 0.7232 0.3922 -0.0194 0.0528  -0.0740 227 ARG B C   
1667 O O   . ARG B 13  ? 0.4046 0.7291 0.3840 -0.0022 0.0606  -0.0822 227 ARG B O   
1668 C CB  . ARG B 13  ? 0.5163 0.8147 0.4736 -0.0212 0.0586  -0.0975 227 ARG B CB  
1669 C CG  . ARG B 13  ? 0.5575 0.8722 0.5319 0.0014  0.0741  -0.1190 227 ARG B CG  
1670 C CD  . ARG B 13  ? 0.5878 0.9154 0.5565 -0.0036 0.0826  -0.1407 227 ARG B CD  
1671 N NE  . ARG B 13  ? 0.6239 0.9596 0.6011 0.0210  0.0998  -0.1630 227 ARG B NE  
1672 C CZ  . ARG B 13  ? 0.6636 0.9531 0.6400 0.0364  0.1122  -0.1802 227 ARG B CZ  
1673 N NH1 . ARG B 13  ? 0.6446 0.8908 0.6170 0.0239  0.1091  -0.1795 227 ARG B NH1 
1674 N NH2 . ARG B 13  ? 0.7199 0.9988 0.6961 0.0623  0.1260  -0.1943 227 ARG B NH2 
1675 N N   . LEU B 14  ? 0.3936 0.6407 0.3500 -0.0212 0.0434  -0.0595 228 LEU B N   
1676 C CA  . LEU B 14  ? 0.3483 0.5773 0.3172 -0.0084 0.0426  -0.0532 228 LEU B CA  
1677 C C   . LEU B 14  ? 0.3648 0.5511 0.3160 -0.0202 0.0322  -0.0369 228 LEU B C   
1678 O O   . LEU B 14  ? 0.3724 0.5266 0.3159 -0.0173 0.0255  -0.0330 228 LEU B O   
1679 C CB  . LEU B 14  ? 0.3604 0.5654 0.3497 0.0186  0.0486  -0.0620 228 LEU B CB  
1680 C CG  . LEU B 14  ? 0.3632 0.5531 0.3633 0.0346  0.0491  -0.0550 228 LEU B CG  
1681 C CD1 . LEU B 14  ? 0.3596 0.5982 0.3678 0.0476  0.0548  -0.0576 228 LEU B CD1 
1682 C CD2 . LEU B 14  ? 0.3507 0.4976 0.3585 0.0521  0.0549  -0.0602 228 LEU B CD2 
1683 N N   . GLN B 15  ? 0.3446 0.5342 0.2877 -0.0322 0.0314  -0.0294 229 GLN B N   
1684 C CA  . GLN B 15  ? 0.3892 0.5294 0.3092 -0.0428 0.0241  -0.0163 229 GLN B CA  
1685 C C   . GLN B 15  ? 0.3947 0.5248 0.3308 -0.0311 0.0242  -0.0155 229 GLN B C   
1686 O O   . GLN B 15  ? 0.3656 0.5363 0.3189 -0.0266 0.0293  -0.0205 229 GLN B O   
1687 C CB  . GLN B 15  ? 0.4826 0.6194 0.3637 -0.0781 0.0250  -0.0088 229 GLN B CB  
1688 C CG  . GLN B 15  ? 0.5542 0.7013 0.4116 -0.0943 0.0256  -0.0071 229 GLN B CG  
1689 C CD  . GLN B 15  ? 0.5478 0.7709 0.4205 -0.1051 0.0347  -0.0205 229 GLN B CD  
1690 O OE1 . GLN B 15  ? 0.5903 0.8566 0.4693 -0.1184 0.0405  -0.0261 229 GLN B OE1 
1691 N NE2 . GLN B 15  ? 0.5040 0.7517 0.3828 -0.0986 0.0363  -0.0278 229 GLN B NE2 
1692 N N   . LEU B 16  ? 0.4022 0.4838 0.3316 -0.0235 0.0183  -0.0094 230 LEU B N   
1693 C CA  . LEU B 16  ? 0.4220 0.4914 0.3596 -0.0178 0.0184  -0.0083 230 LEU B CA  
1694 C C   . LEU B 16  ? 0.4576 0.5187 0.3663 -0.0460 0.0195  -0.0042 230 LEU B C   
1695 O O   . LEU B 16  ? 0.5007 0.5196 0.3719 -0.0630 0.0175  0.0024  230 LEU B O   
1696 C CB  . LEU B 16  ? 0.4100 0.4384 0.3504 -0.0006 0.0130  -0.0066 230 LEU B CB  
1697 C CG  . LEU B 16  ? 0.4003 0.4150 0.3458 0.0034  0.0136  -0.0063 230 LEU B CG  
1698 C CD1 . LEU B 16  ? 0.3395 0.3860 0.3137 0.0160  0.0194  -0.0104 230 LEU B CD1 
1699 C CD2 . LEU B 16  ? 0.4166 0.3948 0.3582 0.0179  0.0082  -0.0060 230 LEU B CD2 
1700 N N   . VAL B 17  ? 0.4054 0.5051 0.3262 -0.0517 0.0235  -0.0084 231 VAL B N   
1701 C CA  . VAL B 17  ? 0.4453 0.5463 0.3384 -0.0855 0.0267  -0.0092 231 VAL B CA  
1702 C C   . VAL B 17  ? 0.4857 0.5443 0.3707 -0.0835 0.0252  -0.0085 231 VAL B C   
1703 O O   . VAL B 17  ? 0.5504 0.5530 0.3962 -0.1046 0.0265  -0.0068 231 VAL B O   
1704 C CB  . VAL B 17  ? 0.4233 0.6112 0.3328 -0.0966 0.0317  -0.0172 231 VAL B CB  
1705 C CG1 . VAL B 17  ? 0.4299 0.6273 0.3136 -0.1350 0.0358  -0.0222 231 VAL B CG1 
1706 C CG2 . VAL B 17  ? 0.4172 0.6509 0.3269 -0.1060 0.0351  -0.0211 231 VAL B CG2 
1707 N N   . GLU B 18  ? 0.4811 0.5616 0.3981 -0.0580 0.0239  -0.0100 232 GLU B N   
1708 C CA  . GLU B 18  ? 0.5498 0.6000 0.4632 -0.0545 0.0231  -0.0110 232 GLU B CA  
1709 C C   . GLU B 18  ? 0.4813 0.5352 0.4265 -0.0211 0.0213  -0.0095 232 GLU B C   
1710 O O   . GLU B 18  ? 0.4689 0.5602 0.4374 -0.0039 0.0230  -0.0082 232 GLU B O   
1711 C CB  . GLU B 18  ? 0.6308 0.7204 0.5359 -0.0799 0.0272  -0.0171 232 GLU B CB  
1712 C CG  . GLU B 18  ? 0.7172 0.7753 0.6133 -0.0813 0.0277  -0.0208 232 GLU B CG  
1713 C CD  . GLU B 18  ? 0.7882 0.8689 0.6599 -0.1202 0.0333  -0.0305 232 GLU B CD  
1714 O OE1 . GLU B 18  ? 0.7922 0.8942 0.6709 -0.1191 0.0338  -0.0352 232 GLU B OE1 
1715 O OE2 . GLU B 18  ? 0.8497 0.9282 0.6917 -0.1557 0.0382  -0.0346 232 GLU B OE2 
1716 N N   . PHE B 19  ? 0.4184 0.4299 0.3596 -0.0121 0.0195  -0.0105 233 PHE B N   
1717 C CA  . PHE B 19  ? 0.4136 0.4276 0.3789 0.0109  0.0200  -0.0108 233 PHE B CA  
1718 C C   . PHE B 19  ? 0.4468 0.4412 0.4048 0.0095  0.0204  -0.0150 233 PHE B C   
1719 O O   . PHE B 19  ? 0.5112 0.4659 0.4462 0.0036  0.0189  -0.0187 233 PHE B O   
1720 C CB  . PHE B 19  ? 0.4549 0.4508 0.4293 0.0263  0.0178  -0.0119 233 PHE B CB  
1721 C CG  . PHE B 19  ? 0.4757 0.4716 0.4685 0.0407  0.0206  -0.0155 233 PHE B CG  
1722 C CD1 . PHE B 19  ? 0.4718 0.4834 0.4788 0.0478  0.0271  -0.0138 233 PHE B CD1 
1723 C CD2 . PHE B 19  ? 0.5286 0.5071 0.5198 0.0473  0.0181  -0.0213 233 PHE B CD2 
1724 C CE1 . PHE B 19  ? 0.4941 0.4988 0.5096 0.0533  0.0325  -0.0174 233 PHE B CE1 
1725 C CE2 . PHE B 19  ? 0.4962 0.4844 0.5034 0.0543  0.0224  -0.0271 233 PHE B CE2 
1726 C CZ  . PHE B 19  ? 0.4819 0.4806 0.4994 0.0533  0.0303  -0.0249 233 PHE B CZ  
1727 N N   . SER B 20  ? 0.3826 0.4006 0.3554 0.0168  0.0234  -0.0143 234 SER B N   
1728 C CA  . SER B 20  ? 0.4216 0.4284 0.3888 0.0148  0.0248  -0.0200 234 SER B CA  
1729 C C   . SER B 20  ? 0.3892 0.4146 0.3729 0.0271  0.0287  -0.0170 234 SER B C   
1730 O O   . SER B 20  ? 0.3448 0.3918 0.3370 0.0357  0.0310  -0.0082 234 SER B O   
1731 C CB  . SER B 20  ? 0.4661 0.4837 0.4131 -0.0086 0.0261  -0.0241 234 SER B CB  
1732 O OG  . SER B 20  ? 0.4379 0.5115 0.3940 -0.0119 0.0267  -0.0184 234 SER B OG  
1733 N N   . ALA B 21  ? 0.3378 0.3505 0.3210 0.0293  0.0304  -0.0245 235 ALA B N   
1734 C CA  . ALA B 21  ? 0.3507 0.3788 0.3413 0.0335  0.0358  -0.0224 235 ALA B CA  
1735 C C   . ALA B 21  ? 0.3419 0.3781 0.3210 0.0231  0.0368  -0.0296 235 ALA B C   
1736 O O   . ALA B 21  ? 0.3886 0.4021 0.3568 0.0191  0.0358  -0.0417 235 ALA B O   
1737 C CB  . ALA B 21  ? 0.3842 0.4026 0.3864 0.0410  0.0393  -0.0288 235 ALA B CB  
1738 N N   . PHE B 22  ? 0.3352 0.4007 0.3117 0.0204  0.0394  -0.0223 236 PHE B N   
1739 C CA  . PHE B 22  ? 0.3291 0.4115 0.2924 0.0060  0.0402  -0.0304 236 PHE B CA  
1740 C C   . PHE B 22  ? 0.2847 0.3961 0.2458 0.0074  0.0442  -0.0237 236 PHE B C   
1741 O O   . PHE B 22  ? 0.3475 0.4616 0.3116 0.0201  0.0467  -0.0086 236 PHE B O   
1742 C CB  . PHE B 22  ? 0.3466 0.4521 0.2988 -0.0098 0.0366  -0.0304 236 PHE B CB  
1743 C CG  . PHE B 22  ? 0.3507 0.5013 0.3098 0.0002  0.0338  -0.0141 236 PHE B CG  
1744 C CD1 . PHE B 22  ? 0.3492 0.5489 0.3038 0.0030  0.0335  -0.0062 236 PHE B CD1 
1745 C CD2 . PHE B 22  ? 0.3506 0.4973 0.3185 0.0105  0.0315  -0.0069 236 PHE B CD2 
1746 C CE1 . PHE B 22  ? 0.3815 0.6244 0.3391 0.0218  0.0303  0.0099  236 PHE B CE1 
1747 C CE2 . PHE B 22  ? 0.3739 0.5626 0.3465 0.0266  0.0297  0.0063  236 PHE B CE2 
1748 C CZ  . PHE B 22  ? 0.3809 0.6171 0.3479 0.0352  0.0288  0.0153  236 PHE B CZ  
1749 N N   . VAL B 23  ? 0.3533 0.4802 0.3029 -0.0068 0.0460  -0.0352 237 VAL B N   
1750 C CA  . VAL B 23  ? 0.3641 0.5264 0.3065 -0.0086 0.0490  -0.0283 237 VAL B CA  
1751 C C   . VAL B 23  ? 0.4002 0.6057 0.3283 -0.0271 0.0465  -0.0348 237 VAL B C   
1752 O O   . VAL B 23  ? 0.3828 0.5750 0.3009 -0.0465 0.0479  -0.0548 237 VAL B O   
1753 C CB  . VAL B 23  ? 0.3781 0.5294 0.3209 -0.0105 0.0564  -0.0398 237 VAL B CB  
1754 C CG1 . VAL B 23  ? 0.3234 0.4552 0.2617 -0.0196 0.0581  -0.0660 237 VAL B CG1 
1755 C CG2 . VAL B 23  ? 0.3766 0.5643 0.3063 -0.0151 0.0601  -0.0303 237 VAL B CG2 
1756 N N   . GLU B 24  ? 0.4092 0.6652 0.3319 -0.0207 0.0436  -0.0179 238 GLU B N   
1757 C CA  . GLU B 24  ? 0.3804 0.6982 0.2901 -0.0389 0.0410  -0.0242 238 GLU B CA  
1758 C C   . GLU B 24  ? 0.4457 0.7886 0.3432 -0.0397 0.0445  -0.0207 238 GLU B C   
1759 O O   . GLU B 24  ? 0.4861 0.8329 0.3792 -0.0179 0.0445  0.0028  238 GLU B O   
1760 C CB  . GLU B 24  ? 0.3374 0.7138 0.2492 -0.0269 0.0331  -0.0080 238 GLU B CB  
1761 C CG  . GLU B 24  ? 0.3212 0.6866 0.2427 -0.0331 0.0306  -0.0143 238 GLU B CG  
1762 C CD  . GLU B 24  ? 0.3639 0.7833 0.2930 -0.0089 0.0239  0.0038  238 GLU B CD  
1763 O OE1 . GLU B 24  ? 0.3747 0.8219 0.2995 0.0212  0.0212  0.0250  238 GLU B OE1 
1764 O OE2 . GLU B 24  ? 0.3871 0.8194 0.3228 -0.0181 0.0220  -0.0029 238 GLU B OE2 
1765 N N   . PRO B 25  ? 0.5461 0.9429 0.4258 -0.0106 0.0155  -0.1184 239 PRO B N   
1766 C CA  . PRO B 25  ? 0.5619 0.9854 0.3937 -0.0105 0.0209  -0.1282 239 PRO B CA  
1767 C C   . PRO B 25  ? 0.6112 1.0903 0.3969 0.0041  0.0013  -0.1145 239 PRO B C   
1768 O O   . PRO B 25  ? 0.6038 1.1150 0.4081 0.0085  -0.0178 -0.1127 239 PRO B O   
1769 C CB  . PRO B 25  ? 0.5565 0.9932 0.4116 -0.0335 0.0268  -0.1799 239 PRO B CB  
1770 C CG  . PRO B 25  ? 0.5542 0.9911 0.4624 -0.0460 0.0152  -0.1947 239 PRO B CG  
1771 C CD  . PRO B 25  ? 0.5271 0.9241 0.4561 -0.0331 0.0159  -0.1555 239 PRO B CD  
1772 N N   . PRO B 26  ? 0.6527 1.1459 0.3796 0.0124  0.0063  -0.1026 240 PRO B N   
1773 C CA  . PRO B 26  ? 0.7011 1.2246 0.3970 0.0290  -0.0128 -0.0802 240 PRO B CA  
1774 C C   . PRO B 26  ? 0.7484 1.3340 0.4611 0.0195  -0.0342 -0.1133 240 PRO B C   
1775 O O   . PRO B 26  ? 0.7826 1.4028 0.4866 0.0349  -0.0541 -0.0961 240 PRO B O   
1776 C CB  . PRO B 26  ? 0.7357 1.2424 0.3849 0.0296  0.0026  -0.0691 240 PRO B CB  
1777 C CG  . PRO B 26  ? 0.6968 1.1550 0.3544 0.0224  0.0293  -0.0634 240 PRO B CG  
1778 C CD  . PRO B 26  ? 0.6411 1.1005 0.3493 0.0072  0.0326  -0.0996 240 PRO B CD  
1779 N N   . ASP B 27  ? 0.7545 1.3507 0.4947 -0.0061 -0.0295 -0.1613 241 ASP B N   
1780 C CA  . ASP B 27  ? 0.8099 1.4586 0.5706 -0.0217 -0.0483 -0.1977 241 ASP B CA  
1781 C C   . ASP B 27  ? 0.7259 1.3948 0.5426 -0.0323 -0.0614 -0.2091 241 ASP B C   
1782 O O   . ASP B 27  ? 0.7574 1.4605 0.6059 -0.0534 -0.0731 -0.2439 241 ASP B O   
1783 C CB  . ASP B 27  ? 0.8976 1.5380 0.6592 -0.0448 -0.0355 -0.2456 241 ASP B CB  
1784 C CG  . ASP B 27  ? 0.9261 1.5169 0.7235 -0.0594 -0.0139 -0.2678 241 ASP B CG  
1785 O OD1 . ASP B 27  ? 0.9674 1.5188 0.7481 -0.0514 0.0087  -0.2533 241 ASP B OD1 
1786 O OD2 . ASP B 27  ? 0.9059 1.4951 0.7520 -0.0795 -0.0191 -0.2984 241 ASP B OD2 
1787 N N   . ALA B 28  ? 0.6204 1.2664 0.4496 -0.0187 -0.0588 -0.1788 242 ALA B N   
1788 C CA  . ALA B 28  ? 0.5327 1.1839 0.4243 -0.0275 -0.0650 -0.1803 242 ALA B CA  
1789 C C   . ALA B 28  ? 0.5191 1.2484 0.4219 -0.0192 -0.0914 -0.1748 242 ALA B C   
1790 O O   . ALA B 28  ? 0.4892 1.2477 0.4468 -0.0339 -0.0989 -0.1860 242 ALA B O   
1791 C CB  . ALA B 28  ? 0.4626 1.0504 0.3699 -0.0110 -0.0496 -0.1419 242 ALA B CB  
1792 N N   . VAL B 29  ? 0.5827 1.3321 0.4448 0.0047  -0.0995 -0.1515 243 VAL B N   
1793 C CA  . VAL B 29  ? 0.6257 1.4367 0.5028 0.0176  -0.1199 -0.1414 243 VAL B CA  
1794 C C   . VAL B 29  ? 0.6934 1.5552 0.5938 -0.0118 -0.1329 -0.1849 243 VAL B C   
1795 O O   . VAL B 29  ? 0.6791 1.5959 0.6140 -0.0135 -0.1485 -0.1877 243 VAL B O   
1796 C CB  . VAL B 29  ? 0.6442 1.4540 0.4699 0.0520  -0.1258 -0.1036 243 VAL B CB  
1797 C CG1 . VAL B 29  ? 0.6168 1.3741 0.4297 0.0825  -0.1152 -0.0585 243 VAL B CG1 
1798 C CG2 . VAL B 29  ? 0.6749 1.4652 0.4483 0.0448  -0.1195 -0.1137 243 VAL B CG2 
1799 N N   . ASP B 30  ? 0.7398 1.5800 0.6220 -0.0346 -0.1249 -0.2192 244 ASP B N   
1800 C CA  . ASP B 30  ? 0.8123 1.6871 0.7103 -0.0630 -0.1356 -0.2635 244 ASP B CA  
1801 C C   . ASP B 30  ? 0.7974 1.6567 0.7580 -0.0979 -0.1295 -0.2966 244 ASP B C   
1802 O O   . ASP B 30  ? 0.8393 1.7376 0.8405 -0.1172 -0.1426 -0.3146 244 ASP B O   
1803 C CB  . ASP B 30  ? 0.8830 1.7371 0.7302 -0.0683 -0.1280 -0.2856 244 ASP B CB  
1804 C CG  . ASP B 30  ? 0.9307 1.7872 0.7144 -0.0366 -0.1299 -0.2481 244 ASP B CG  
1805 O OD1 . ASP B 30  ? 0.9695 1.7868 0.7112 -0.0339 -0.1126 -0.2476 244 ASP B OD1 
1806 O OD2 . ASP B 30  ? 0.9393 1.8339 0.7171 -0.0143 -0.1473 -0.2179 244 ASP B OD2 
1807 N N   . SER B 31  ? 0.7661 1.5641 0.7354 -0.1065 -0.1090 -0.3026 245 SER B N   
1808 C CA  . SER B 31  ? 0.7428 1.5092 0.7723 -0.1369 -0.0999 -0.3255 245 SER B CA  
1809 C C   . SER B 31  ? 0.6447 1.3642 0.6856 -0.1276 -0.0849 -0.3009 245 SER B C   
1810 O O   . SER B 31  ? 0.6474 1.3147 0.6619 -0.1228 -0.0687 -0.3042 245 SER B O   
1811 C CB  . SER B 31  ? 0.8190 1.5466 0.8516 -0.1638 -0.0900 -0.3728 245 SER B CB  
1812 O OG  . SER B 31  ? 0.8294 1.5113 0.9196 -0.1906 -0.0791 -0.3885 245 SER B OG  
1813 N N   . TYR B 32  ? 0.5547 1.2918 0.6356 -0.1235 -0.0884 -0.2746 246 TYR B N   
1814 C CA  . TYR B 32  ? 0.5012 1.1759 0.5831 -0.1019 -0.0690 -0.2341 246 TYR B CA  
1815 C C   . TYR B 32  ? 0.5003 1.0898 0.6006 -0.1177 -0.0460 -0.2455 246 TYR B C   
1816 O O   . TYR B 32  ? 0.4952 1.0708 0.6341 -0.1493 -0.0430 -0.2783 246 TYR B O   
1817 C CB  . TYR B 32  ? 0.4238 1.1246 0.5468 -0.0942 -0.0709 -0.2051 246 TYR B CB  
1818 C CG  . TYR B 32  ? 0.3808 1.0147 0.4929 -0.0689 -0.0523 -0.1650 246 TYR B CG  
1819 C CD1 . TYR B 32  ? 0.3750 0.9968 0.4374 -0.0323 -0.0533 -0.1331 246 TYR B CD1 
1820 C CD2 . TYR B 32  ? 0.3959 0.9745 0.5437 -0.0827 -0.0346 -0.1595 246 TYR B CD2 
1821 C CE1 . TYR B 32  ? 0.3446 0.9029 0.3956 -0.0122 -0.0385 -0.1012 246 TYR B CE1 
1822 C CE2 . TYR B 32  ? 0.3924 0.9120 0.5250 -0.0603 -0.0208 -0.1260 246 TYR B CE2 
1823 C CZ  . TYR B 32  ? 0.3680 0.8783 0.4533 -0.0262 -0.0234 -0.0994 246 TYR B CZ  
1824 O OH  . TYR B 32  ? 0.3219 0.7721 0.3917 -0.0069 -0.0118 -0.0705 246 TYR B OH  
1825 N N   . GLN B 33  ? 0.4655 0.9976 0.5393 -0.0948 -0.0309 -0.2170 247 GLN B N   
1826 C CA  . GLN B 33  ? 0.4785 0.9348 0.5661 -0.1022 -0.0112 -0.2228 247 GLN B CA  
1827 C C   . GLN B 33  ? 0.3955 0.8059 0.4622 -0.0750 -0.0010 -0.1807 247 GLN B C   
1828 O O   . GLN B 33  ? 0.3759 0.8017 0.4001 -0.0522 -0.0052 -0.1585 247 GLN B O   
1829 C CB  . GLN B 33  ? 0.5733 1.0216 0.6390 -0.1116 -0.0057 -0.2606 247 GLN B CB  
1830 C CG  . GLN B 33  ? 0.6620 1.0394 0.7476 -0.1164 0.0143  -0.2715 247 GLN B CG  
1831 C CD  . GLN B 33  ? 0.7571 1.1356 0.8234 -0.1241 0.0217  -0.3146 247 GLN B CD  
1832 O OE1 . GLN B 33  ? 0.7731 1.1330 0.8134 -0.1092 0.0359  -0.3096 247 GLN B OE1 
1833 N NE2 . GLN B 33  ? 0.8084 1.2105 0.8878 -0.1486 0.0129  -0.3588 247 GLN B NE2 
1834 N N   . ARG B 34  ? 0.3724 0.7253 0.4673 -0.0778 0.0109  -0.1688 248 ARG B N   
1835 C CA  . ARG B 34  ? 0.4110 0.7166 0.4869 -0.0561 0.0188  -0.1355 248 ARG B CA  
1836 C C   . ARG B 34  ? 0.4096 0.6539 0.5102 -0.0636 0.0316  -0.1415 248 ARG B C   
1837 O O   . ARG B 34  ? 0.4610 0.6855 0.5998 -0.0809 0.0348  -0.1551 248 ARG B O   
1838 C CB  . ARG B 34  ? 0.4462 0.7526 0.5229 -0.0408 0.0151  -0.1018 248 ARG B CB  
1839 C CG  . ARG B 34  ? 0.5221 0.8173 0.6416 -0.0561 0.0191  -0.1008 248 ARG B CG  
1840 C CD  . ARG B 34  ? 0.5820 0.8456 0.6930 -0.0375 0.0234  -0.0660 248 ARG B CD  
1841 N NE  . ARG B 34  ? 0.6791 0.9791 0.7649 -0.0135 0.0167  -0.0463 248 ARG B NE  
1842 C CZ  . ARG B 34  ? 0.7198 1.0667 0.8239 -0.0112 0.0150  -0.0402 248 ARG B CZ  
1843 N NH1 . ARG B 34  ? 0.7128 1.0905 0.7946 0.0166  0.0091  -0.0225 248 ARG B NH1 
1844 N NH2 . ARG B 34  ? 0.7288 1.0919 0.8761 -0.0365 0.0201  -0.0510 248 ARG B NH2 
1845 N N   . HIS B 35  ? 0.3523 0.5678 0.4331 -0.0505 0.0386  -0.1301 249 HIS B N   
1846 C CA  . HIS B 35  ? 0.3432 0.5075 0.4497 -0.0523 0.0485  -0.1319 249 HIS B CA  
1847 C C   . HIS B 35  ? 0.3257 0.4521 0.4312 -0.0395 0.0461  -0.0967 249 HIS B C   
1848 O O   . HIS B 35  ? 0.3219 0.4486 0.3959 -0.0251 0.0428  -0.0736 249 HIS B O   
1849 C CB  . HIS B 35  ? 0.3412 0.5060 0.4350 -0.0485 0.0590  -0.1450 249 HIS B CB  
1850 C CG  . HIS B 35  ? 0.3656 0.4870 0.4901 -0.0456 0.0679  -0.1437 249 HIS B CG  
1851 N ND1 . HIS B 35  ? 0.3814 0.4819 0.5446 -0.0534 0.0749  -0.1707 249 HIS B ND1 
1852 C CD2 . HIS B 35  ? 0.3459 0.4422 0.4711 -0.0349 0.0692  -0.1189 249 HIS B CD2 
1853 C CE1 . HIS B 35  ? 0.3712 0.4399 0.5588 -0.0444 0.0797  -0.1607 249 HIS B CE1 
1854 N NE2 . HIS B 35  ? 0.3717 0.4405 0.5379 -0.0349 0.0755  -0.1301 249 HIS B NE2 
1855 N N   . LEU B 36  ? 0.3115 0.4019 0.4483 -0.0448 0.0471  -0.0928 250 LEU B N   
1856 C CA  . LEU B 36  ? 0.3335 0.3883 0.4650 -0.0334 0.0431  -0.0621 250 LEU B CA  
1857 C C   . LEU B 36  ? 0.3097 0.3309 0.4518 -0.0270 0.0449  -0.0582 250 LEU B C   
1858 O O   . LEU B 36  ? 0.3664 0.3693 0.5422 -0.0322 0.0495  -0.0731 250 LEU B O   
1859 C CB  . LEU B 36  ? 0.3532 0.3896 0.5069 -0.0415 0.0429  -0.0541 250 LEU B CB  
1860 C CG  . LEU B 36  ? 0.4035 0.4789 0.5600 -0.0516 0.0428  -0.0570 250 LEU B CG  
1861 C CD1 . LEU B 36  ? 0.4163 0.4678 0.5981 -0.0633 0.0471  -0.0460 250 LEU B CD1 
1862 C CD2 . LEU B 36  ? 0.3838 0.4890 0.5050 -0.0343 0.0379  -0.0384 250 LEU B CD2 
1863 N N   . PHE B 37  ? 0.3139 0.3274 0.4307 -0.0158 0.0408  -0.0390 251 PHE B N   
1864 C CA  . PHE B 37  ? 0.3427 0.3313 0.4751 -0.0119 0.0399  -0.0333 251 PHE B CA  
1865 C C   . PHE B 37  ? 0.3794 0.3311 0.5271 -0.0083 0.0308  -0.0179 251 PHE B C   
1866 O O   . PHE B 37  ? 0.3945 0.3286 0.5767 -0.0078 0.0302  -0.0222 251 PHE B O   
1867 C CB  . PHE B 37  ? 0.3365 0.3249 0.4389 -0.0059 0.0372  -0.0172 251 PHE B CB  
1868 C CG  . PHE B 37  ? 0.2991 0.3206 0.3798 -0.0082 0.0467  -0.0258 251 PHE B CG  
1869 C CD1 . PHE B 37  ? 0.2963 0.3378 0.3957 -0.0144 0.0596  -0.0448 251 PHE B CD1 
1870 C CD2 . PHE B 37  ? 0.2885 0.3224 0.3281 -0.0016 0.0433  -0.0139 251 PHE B CD2 
1871 C CE1 . PHE B 37  ? 0.3237 0.3970 0.3951 -0.0164 0.0693  -0.0508 251 PHE B CE1 
1872 C CE2 . PHE B 37  ? 0.3438 0.4077 0.3579 -0.0019 0.0502  -0.0175 251 PHE B CE2 
1873 C CZ  . PHE B 37  ? 0.3408 0.4244 0.3677 -0.0105 0.0634  -0.0354 251 PHE B CZ  
1874 N N   . VAL B 38  ? 0.3567 0.2984 0.4762 -0.0033 0.0240  0.0008  252 VAL B N   
1875 C CA  . VAL B 38  ? 0.3848 0.2947 0.5059 0.0002  0.0165  0.0180  252 VAL B CA  
1876 C C   . VAL B 38  ? 0.4448 0.3648 0.5476 -0.0009 0.0205  0.0257  252 VAL B C   
1877 O O   . VAL B 38  ? 0.4317 0.3816 0.5151 0.0012  0.0240  0.0224  252 VAL B O   
1878 C CB  . VAL B 38  ? 0.4248 0.3094 0.5235 0.0102  0.0031  0.0360  252 VAL B CB  
1879 C CG1 . VAL B 38  ? 0.4517 0.3337 0.5797 0.0091  -0.0014 0.0299  252 VAL B CG1 
1880 C CG2 . VAL B 38  ? 0.4533 0.3434 0.5083 0.0171  0.0018  0.0429  252 VAL B CG2 
1881 N N   . HIS B 39  ? 0.4554 0.3536 0.5652 -0.0032 0.0204  0.0383  253 HIS B N   
1882 C CA  . HIS B 39  ? 0.4524 0.3661 0.5533 -0.0077 0.0284  0.0461  253 HIS B CA  
1883 C C   . HIS B 39  ? 0.4653 0.3469 0.5572 -0.0060 0.0278  0.0698  253 HIS B C   
1884 O O   . HIS B 39  ? 0.5218 0.3738 0.6377 -0.0116 0.0262  0.0741  253 HIS B O   
1885 C CB  . HIS B 39  ? 0.4674 0.4080 0.6035 -0.0265 0.0382  0.0258  253 HIS B CB  
1886 C CG  . HIS B 39  ? 0.5161 0.4838 0.6541 -0.0357 0.0472  0.0324  253 HIS B CG  
1887 N ND1 . HIS B 39  ? 0.5362 0.5389 0.6477 -0.0244 0.0487  0.0400  253 HIS B ND1 
1888 C CD2 . HIS B 39  ? 0.5602 0.5267 0.7275 -0.0557 0.0563  0.0329  253 HIS B CD2 
1889 C CE1 . HIS B 39  ? 0.5235 0.5540 0.6511 -0.0364 0.0589  0.0444  253 HIS B CE1 
1890 N NE2 . HIS B 39  ? 0.5419 0.5503 0.7031 -0.0581 0.0639  0.0409  253 HIS B NE2 
1891 N N   . ILE B 40  ? 0.4019 0.2884 0.4564 0.0042  0.0297  0.0856  254 ILE B N   
1892 C CA  . ILE B 40  ? 0.4421 0.3053 0.4787 0.0055  0.0329  0.1094  254 ILE B CA  
1893 C C   . ILE B 40  ? 0.4645 0.3628 0.4998 -0.0009 0.0508  0.1154  254 ILE B C   
1894 O O   . ILE B 40  ? 0.4596 0.3912 0.4765 0.0099  0.0549  0.1107  254 ILE B O   
1895 C CB  . ILE B 40  ? 0.5024 0.3390 0.4893 0.0247  0.0204  0.1230  254 ILE B CB  
1896 C CG1 . ILE B 40  ? 0.5550 0.3640 0.5508 0.0284  0.0010  0.1185  254 ILE B CG1 
1897 C CG2 . ILE B 40  ? 0.5341 0.3518 0.4928 0.0271  0.0255  0.1481  254 ILE B CG2 
1898 C CD1 . ILE B 40  ? 0.6162 0.4000 0.5656 0.0430  -0.0155 0.1277  254 ILE B CD1 
1899 N N   . SER B 41  ? 0.4961 0.3874 0.5541 -0.0183 0.0621  0.1269  255 SER B N   
1900 C CA  . SER B 41  ? 0.5724 0.5019 0.6369 -0.0290 0.0816  0.1351  255 SER B CA  
1901 C C   . SER B 41  ? 0.6195 0.5213 0.6631 -0.0320 0.0921  0.1665  255 SER B C   
1902 O O   . SER B 41  ? 0.7017 0.5624 0.7618 -0.0446 0.0910  0.1785  255 SER B O   
1903 C CB  . SER B 41  ? 0.6117 0.5706 0.7319 -0.0564 0.0891  0.1164  255 SER B CB  
1904 O OG  . SER B 41  ? 0.6501 0.6557 0.7848 -0.0696 0.1073  0.1237  255 SER B OG  
1905 N N   . GLN B 42  ? 0.6625 0.5994 0.5909 -0.0935 0.0566  -0.0770 256 GLN B N   
1906 C CA  . GLN B 42  ? 0.7226 0.6301 0.6311 -0.1219 0.0680  -0.0615 256 GLN B CA  
1907 C C   . GLN B 42  ? 0.7518 0.7064 0.6699 -0.1695 0.0803  -0.0808 256 GLN B C   
1908 O O   . GLN B 42  ? 0.7484 0.7832 0.6917 -0.1703 0.0822  -0.0889 256 GLN B O   
1909 C CB  . GLN B 42  ? 0.6570 0.5840 0.5696 -0.0983 0.0655  -0.0415 256 GLN B CB  
1910 C CG  . GLN B 42  ? 0.6528 0.5446 0.5598 -0.0591 0.0550  -0.0246 256 GLN B CG  
1911 C CD  . GLN B 42  ? 0.6694 0.5615 0.5691 -0.0477 0.0536  -0.0051 256 GLN B CD  
1912 O OE1 . GLN B 42  ? 0.6573 0.5067 0.5379 -0.0317 0.0488  0.0123  256 GLN B OE1 
1913 N NE2 . GLN B 42  ? 0.6894 0.6345 0.6033 -0.0528 0.0567  -0.0107 256 GLN B NE2 
1914 N N   . PRO B 50  ? 1.4023 0.6536 0.7515 -0.0426 0.0966  0.2607  264 PRO B N   
1915 C CA  . PRO B 50  ? 1.3785 0.6397 0.7367 0.0246  0.0688  0.2613  264 PRO B CA  
1916 C C   . PRO B 50  ? 1.2719 0.6316 0.6878 0.0393  0.0548  0.2410  264 PRO B C   
1917 O O   . PRO B 50  ? 1.2098 0.6144 0.6864 0.0114  0.0601  0.2107  264 PRO B O   
1918 C CB  . PRO B 50  ? 1.4164 0.6029 0.7749 0.0338  0.0686  0.2487  264 PRO B CB  
1919 C CG  . PRO B 50  ? 1.4283 0.5919 0.7991 -0.0342 0.0931  0.2307  264 PRO B CG  
1920 C CD  . PRO B 50  ? 1.4006 0.6214 0.7749 -0.0824 0.1101  0.2358  264 PRO B CD  
1921 N N   . PRO B 51  ? 1.2446 0.6678 0.6664 0.0814  0.0339  0.2467  265 PRO B N   
1922 C CA  . PRO B 51  ? 1.1223 0.6646 0.6233 0.0880  0.0195  0.2165  265 PRO B CA  
1923 C C   . PRO B 51  ? 1.0813 0.6402 0.6278 0.1206  0.0051  0.1980  265 PRO B C   
1924 O O   . PRO B 51  ? 1.1659 0.6571 0.6783 0.1553  -0.0007 0.2103  265 PRO B O   
1925 C CB  . PRO B 51  ? 1.1219 0.7173 0.6022 0.1167  0.0033  0.2288  265 PRO B CB  
1926 C CG  . PRO B 51  ? 1.2630 0.7670 0.6561 0.1502  0.0004  0.2672  265 PRO B CG  
1927 C CD  . PRO B 51  ? 1.3295 0.7315 0.7032 0.1262  0.0192  0.2719  265 PRO B CD  
1928 N N   . LEU B 52  ? 0.9642 0.6077 0.5818 0.1107  0.0009  0.1692  266 LEU B N   
1929 C CA  . LEU B 52  ? 0.9160 0.5918 0.5775 0.1403  -0.0114 0.1526  266 LEU B CA  
1930 C C   . LEU B 52  ? 0.9203 0.6313 0.5726 0.1897  -0.0328 0.1616  266 LEU B C   
1931 O O   . LEU B 52  ? 0.8979 0.6449 0.5331 0.1948  -0.0412 0.1704  266 LEU B O   
1932 C CB  . LEU B 52  ? 0.8151 0.5702 0.5452 0.1181  -0.0097 0.1245  266 LEU B CB  
1933 C CG  . LEU B 52  ? 0.8032 0.5461 0.5588 0.0859  0.0052  0.1078  266 LEU B CG  
1934 C CD1 . LEU B 52  ? 0.8258 0.4840 0.5488 0.0863  0.0129  0.1133  266 LEU B CD1 
1935 C CD2 . LEU B 52  ? 0.7974 0.5614 0.5558 0.0471  0.0175  0.1029  266 LEU B CD2 
1936 N N   . GLU B 53  ? 0.9475 0.6564 0.6112 0.2281  -0.0420 0.1570  267 GLU B N   
1937 C CA  . GLU B 53  ? 0.9710 0.7417 0.6417 0.2768  -0.0636 0.1580  267 GLU B CA  
1938 C C   . GLU B 53  ? 0.8467 0.7320 0.5835 0.2566  -0.0695 0.1338  267 GLU B C   
1939 O O   . GLU B 53  ? 0.7688 0.6729 0.5483 0.2198  -0.0574 0.1158  267 GLU B O   
1940 C CB  . GLU B 53  ? 1.0338 0.7850 0.7062 0.3229  -0.0695 0.1543  267 GLU B CB  
1941 C CG  . GLU B 53  ? 1.1477 0.7762 0.7627 0.3274  -0.0583 0.1677  267 GLU B CG  
1942 C CD  . GLU B 53  ? 1.2093 0.8292 0.8377 0.3593  -0.0597 0.1519  267 GLU B CD  
1943 O OE1 . GLU B 53  ? 1.1908 0.8930 0.8501 0.3954  -0.0732 0.1409  267 GLU B OE1 
1944 O OE2 . GLU B 53  ? 1.2754 0.8111 0.8826 0.3458  -0.0466 0.1480  267 GLU B OE2 
1945 N N   . SER B 54  ? 0.8517 0.8099 0.5923 0.2803  -0.0882 0.1329  268 SER B N   
1946 C CA  . SER B 54  ? 0.7605 0.8188 0.5562 0.2545  -0.0932 0.1081  268 SER B CA  
1947 C C   . SER B 54  ? 0.7076 0.8540 0.5561 0.2758  -0.1040 0.0886  268 SER B C   
1948 O O   . SER B 54  ? 0.7754 0.9311 0.6126 0.3252  -0.1156 0.0954  268 SER B O   
1949 C CB  . SER B 54  ? 0.7860 0.8804 0.5541 0.2541  -0.1058 0.1127  268 SER B CB  
1950 O OG  . SER B 54  ? 0.8621 0.9733 0.5938 0.3078  -0.1264 0.1282  268 SER B OG  
1951 N N   . VAL B 55  ? 0.6147 0.8241 0.5184 0.2384  -0.0983 0.0640  269 VAL B N   
1952 C CA  . VAL B 55  ? 0.5982 0.9041 0.5568 0.2439  -0.1042 0.0428  269 VAL B CA  
1953 C C   . VAL B 55  ? 0.5636 0.9473 0.5539 0.2069  -0.1095 0.0199  269 VAL B C   
1954 O O   . VAL B 55  ? 0.4658 0.8187 0.4586 0.1645  -0.0974 0.0129  269 VAL B O   
1955 C CB  . VAL B 55  ? 0.5493 0.8413 0.5426 0.2283  -0.0854 0.0346  269 VAL B CB  
1956 C CG1 . VAL B 55  ? 0.5125 0.9102 0.5647 0.2169  -0.0854 0.0114  269 VAL B CG1 
1957 C CG2 . VAL B 55  ? 0.5811 0.8098 0.5462 0.2689  -0.0829 0.0495  269 VAL B CG2 
1958 N N   . ASP B 56  ? 0.5322 1.0181 0.5454 0.2245  -0.1281 0.0058  270 ASP B N   
1959 C CA  . ASP B 56  ? 0.5422 1.1069 0.5855 0.1860  -0.1346 -0.0216 270 ASP B CA  
1960 C C   . ASP B 56  ? 0.4939 1.0710 0.5867 0.1334  -0.1139 -0.0426 270 ASP B C   
1961 O O   . ASP B 56  ? 0.4657 1.0800 0.5946 0.1364  -0.1057 -0.0475 270 ASP B O   
1962 C CB  . ASP B 56  ? 0.6150 1.3022 0.6768 0.2167  -0.1603 -0.0359 270 ASP B CB  
1963 C CG  . ASP B 56  ? 0.6707 1.4328 0.7489 0.1789  -0.1716 -0.0651 270 ASP B CG  
1964 O OD1 . ASP B 56  ? 0.7332 1.4973 0.7690 0.1967  -0.1890 -0.0595 270 ASP B OD1 
1965 O OD2 . ASP B 56  ? 0.6630 1.4773 0.7919 0.1295  -0.1618 -0.0941 270 ASP B OD2 
1966 N N   . VAL B 57  ? 0.4742 1.0168 0.5632 0.0878  -0.1046 -0.0542 271 VAL B N   
1967 C CA  . VAL B 57  ? 0.4309 0.9523 0.5491 0.0399  -0.0825 -0.0680 271 VAL B CA  
1968 C C   . VAL B 57  ? 0.4145 1.0352 0.5852 0.0103  -0.0817 -0.0951 271 VAL B C   
1969 O O   . VAL B 57  ? 0.3812 0.9899 0.5761 -0.0223 -0.0606 -0.1003 271 VAL B O   
1970 C CB  . VAL B 57  ? 0.4275 0.8856 0.5219 0.0055  -0.0749 -0.0764 271 VAL B CB  
1971 C CG1 . VAL B 57  ? 0.4251 0.9463 0.5244 -0.0173 -0.0898 -0.1049 271 VAL B CG1 
1972 C CG2 . VAL B 57  ? 0.3939 0.7941 0.4997 -0.0294 -0.0502 -0.0798 271 VAL B CG2 
1973 N N   . ARG B 58  ? 0.4051 1.1280 0.5913 0.0211  -0.1039 -0.1121 272 ARG B N   
1974 C CA  . ARG B 58  ? 0.4420 1.2801 0.6836 -0.0101 -0.1041 -0.1420 272 ARG B CA  
1975 C C   . ARG B 58  ? 0.4350 1.3197 0.7101 0.0116  -0.0943 -0.1341 272 ARG B C   
1976 O O   . ARG B 58  ? 0.4030 1.3535 0.7240 -0.0275 -0.0797 -0.1531 272 ARG B O   
1977 C CB  . ARG B 58  ? 0.4985 1.4518 0.7495 0.0036  -0.1342 -0.1644 272 ARG B CB  
1978 C CG  . ARG B 58  ? 0.5588 1.4852 0.7785 -0.0206 -0.1447 -0.1794 272 ARG B CG  
1979 C CD  . ARG B 58  ? 0.6503 1.6679 0.8713 -0.0108 -0.1636 -0.2006 272 ARG B CD  
1980 N NE  . ARG B 58  ? 0.7245 1.7201 0.9111 -0.0265 -0.1745 -0.2147 272 ARG B NE  
1981 C CZ  . ARG B 58  ? 0.7679 1.7385 0.9030 0.0180  -0.1914 -0.1952 272 ARG B CZ  
1982 N NH1 . ARG B 58  ? 0.8034 1.7583 0.9077 0.0007  -0.1980 -0.2107 272 ARG B NH1 
1983 N NH2 . ARG B 58  ? 0.7657 1.7178 0.8749 0.0795  -0.1990 -0.1594 272 ARG B NH2 
1984 N N   . GLN B 59  ? 0.4894 1.3363 0.7382 0.0720  -0.1003 -0.1069 273 GLN B N   
1985 C CA  . GLN B 59  ? 0.4915 1.3779 0.7644 0.1037  -0.0928 -0.1006 273 GLN B CA  
1986 C C   . GLN B 59  ? 0.4796 1.3061 0.7625 0.0691  -0.0611 -0.0945 273 GLN B C   
1987 O O   . GLN B 59  ? 0.4605 1.3341 0.7701 0.0818  -0.0498 -0.0953 273 GLN B O   
1988 C CB  . GLN B 59  ? 0.5393 1.3761 0.7694 0.1773  -0.1070 -0.0742 273 GLN B CB  
1989 C CG  . GLN B 59  ? 0.6550 1.5239 0.8554 0.2184  -0.1344 -0.0726 273 GLN B CG  
1990 C CD  . GLN B 59  ? 0.7399 1.7174 0.9676 0.2214  -0.1390 -0.0963 273 GLN B CD  
1991 O OE1 . GLN B 59  ? 0.8068 1.8129 1.0428 0.2514  -0.1336 -0.0970 273 GLN B OE1 
1992 N NE2 . GLN B 59  ? 0.7596 1.7996 0.9989 0.1901  -0.1488 -0.1183 273 GLN B NE2 
1993 N N   . ILE B 60  ? 0.4800 1.2063 0.7383 0.0300  -0.0470 -0.0884 274 ILE B N   
1994 C CA  . ILE B 60  ? 0.4639 1.1255 0.7214 0.0031  -0.0187 -0.0794 274 ILE B CA  
1995 C C   . ILE B 60  ? 0.4742 1.1156 0.7404 -0.0640 -0.0010 -0.0938 274 ILE B C   
1996 O O   . ILE B 60  ? 0.5052 1.0689 0.7551 -0.0852 0.0212  -0.0826 274 ILE B O   
1997 C CB  . ILE B 60  ? 0.4518 0.9928 0.6625 0.0283  -0.0150 -0.0544 274 ILE B CB  
1998 C CG1 . ILE B 60  ? 0.4351 0.9078 0.6128 0.0134  -0.0219 -0.0531 274 ILE B CG1 
1999 C CG2 . ILE B 60  ? 0.4683 1.0076 0.6629 0.0893  -0.0285 -0.0403 274 ILE B CG2 
2000 C CD1 . ILE B 60  ? 0.4406 0.8083 0.5802 0.0260  -0.0142 -0.0335 274 ILE B CD1 
2001 N N   . TYR B 61  ? 0.4772 1.1850 0.7644 -0.0958 -0.0111 -0.1193 275 TYR B N   
2002 C CA  . TYR B 61  ? 0.5287 1.2181 0.8237 -0.1644 0.0067  -0.1381 275 TYR B CA  
2003 C C   . TYR B 61  ? 0.5255 1.2421 0.8482 -0.1991 0.0357  -0.1377 275 TYR B C   
2004 O O   . TYR B 61  ? 0.5214 1.1638 0.8281 -0.2459 0.0602  -0.1358 275 TYR B O   
2005 C CB  . TYR B 61  ? 0.5831 1.3604 0.9016 -0.1939 -0.0110 -0.1723 275 TYR B CB  
2006 C CG  . TYR B 61  ? 0.5943 1.3205 0.8753 -0.1843 -0.0306 -0.1775 275 TYR B CG  
2007 C CD1 . TYR B 61  ? 0.5882 1.1928 0.8209 -0.1619 -0.0267 -0.1544 275 TYR B CD1 
2008 C CD2 . TYR B 61  ? 0.6216 1.4315 0.9160 -0.1984 -0.0525 -0.2082 275 TYR B CD2 
2009 C CE1 . TYR B 61  ? 0.6056 1.1729 0.8043 -0.1538 -0.0417 -0.1603 275 TYR B CE1 
2010 C CE2 . TYR B 61  ? 0.6452 1.4131 0.9015 -0.1890 -0.0690 -0.2138 275 TYR B CE2 
2011 C CZ  . TYR B 61  ? 0.6379 1.2841 0.8463 -0.1669 -0.0623 -0.1891 275 TYR B CZ  
2012 O OH  . TYR B 61  ? 0.6745 1.2882 0.8453 -0.1580 -0.0761 -0.1957 275 TYR B OH  
2013 N N   . ASP B 62  ? 0.5357 1.3574 0.8951 -0.1731 0.0335  -0.1388 276 ASP B N   
2014 C CA  . ASP B 62  ? 0.5698 1.4390 0.9580 -0.2009 0.0618  -0.1384 276 ASP B CA  
2015 C C   . ASP B 62  ? 0.5693 1.3208 0.9185 -0.2008 0.0876  -0.1095 276 ASP B C   
2016 O O   . ASP B 62  ? 0.6036 1.3390 0.9538 -0.2492 0.1177  -0.1070 276 ASP B O   
2017 C CB  . ASP B 62  ? 0.6104 1.5919 1.0289 -0.1500 0.0509  -0.1410 276 ASP B CB  
2018 C CG  . ASP B 62  ? 0.7262 1.8064 1.1683 -0.1650 0.0390  -0.1679 276 ASP B CG  
2019 O OD1 . ASP B 62  ? 0.8159 1.8989 1.2659 -0.2305 0.0539  -0.1845 276 ASP B OD1 
2020 O OD2 . ASP B 62  ? 0.7521 1.9015 1.1994 -0.1101 0.0157  -0.1725 276 ASP B OD2 
2021 N N   . LYS B 63  ? 0.5088 1.1798 0.8209 -0.1473 0.0760  -0.0879 277 LYS B N   
2022 C CA  . LYS B 63  ? 0.4997 1.0831 0.7782 -0.1330 0.0946  -0.0628 277 LYS B CA  
2023 C C   . LYS B 63  ? 0.5067 0.9688 0.7432 -0.1664 0.1095  -0.0525 277 LYS B C   
2024 O O   . LYS B 63  ? 0.4877 0.8777 0.6924 -0.1562 0.1247  -0.0320 277 LYS B O   
2025 C CB  . LYS B 63  ? 0.5168 1.0656 0.7729 -0.0671 0.0758  -0.0485 277 LYS B CB  
2026 C CG  . LYS B 63  ? 0.5100 1.1482 0.7909 -0.0227 0.0521  -0.0582 277 LYS B CG  
2027 C CD  . LYS B 63  ? 0.5090 1.2077 0.8075 0.0120  0.0600  -0.0565 277 LYS B CD  
2028 C CE  . LYS B 63  ? 0.5126 1.2780 0.8228 0.0700  0.0341  -0.0635 277 LYS B CE  
2029 N NZ  . LYS B 63  ? 0.4956 1.3176 0.8196 0.1116  0.0411  -0.0653 277 LYS B NZ  
2030 N N   . PHE B 64  ? 0.5352 0.9762 0.7685 -0.2021 0.1041  -0.0683 278 PHE B N   
2031 C CA  . PHE B 64  ? 0.5935 0.9122 0.7812 -0.2221 0.1138  -0.0612 278 PHE B CA  
2032 C C   . PHE B 64  ? 0.7040 1.0121 0.8949 -0.2882 0.1267  -0.0822 278 PHE B C   
2033 O O   . PHE B 64  ? 0.7227 1.1267 0.9541 -0.3161 0.1188  -0.1078 278 PHE B O   
2034 C CB  . PHE B 64  ? 0.5455 0.8147 0.7080 -0.1828 0.0898  -0.0591 278 PHE B CB  
2035 C CG  . PHE B 64  ? 0.4972 0.7585 0.6499 -0.1273 0.0804  -0.0398 278 PHE B CG  
2036 C CD1 . PHE B 64  ? 0.4748 0.6618 0.5955 -0.1106 0.0928  -0.0199 278 PHE B CD1 
2037 C CD2 . PHE B 64  ? 0.4782 0.8041 0.6498 -0.0915 0.0593  -0.0424 278 PHE B CD2 
2038 C CE1 . PHE B 64  ? 0.4587 0.6402 0.5710 -0.0660 0.0844  -0.0074 278 PHE B CE1 
2039 C CE2 . PHE B 64  ? 0.4554 0.7604 0.6129 -0.0458 0.0527  -0.0268 278 PHE B CE2 
2040 C CZ  . PHE B 64  ? 0.4563 0.6914 0.5865 -0.0366 0.0655  -0.0114 278 PHE B CZ  
2041 N N   . PRO B 65  ? 0.7940 0.9843 0.9392 -0.3127 0.1463  -0.0728 279 PRO B N   
2042 C CA  . PRO B 65  ? 0.8984 1.0521 1.0356 -0.3803 0.1633  -0.0921 279 PRO B CA  
2043 C C   . PRO B 65  ? 0.9233 1.1007 1.0722 -0.3983 0.1414  -0.1267 279 PRO B C   
2044 O O   . PRO B 65  ? 0.8658 1.0698 1.0184 -0.3541 0.1137  -0.1308 279 PRO B O   
2045 C CB  . PRO B 65  ? 0.9569 0.9562 1.0272 -0.3778 0.1825  -0.0700 279 PRO B CB  
2046 C CG  . PRO B 65  ? 0.8930 0.8821 0.9493 -0.3232 0.1839  -0.0379 279 PRO B CG  
2047 C CD  . PRO B 65  ? 0.8005 0.8858 0.8962 -0.2773 0.1548  -0.0439 279 PRO B CD  
2048 N N   . GLU B 66  ? 0.9992 1.1657 1.1503 -0.4664 0.1555  -0.1519 280 GLU B N   
2049 C CA  . GLU B 66  ? 1.0142 1.1840 1.1654 -0.4910 0.1379  -0.1890 280 GLU B CA  
2050 C C   . GLU B 66  ? 1.0893 1.1018 1.1771 -0.5139 0.1539  -0.1913 280 GLU B C   
2051 O O   . GLU B 66  ? 1.1352 1.0369 1.1784 -0.5050 0.1759  -0.1623 280 GLU B O   
2052 C CB  . GLU B 66  ? 1.0410 1.3349 1.2385 -0.5232 0.1295  -0.2172 280 GLU B CB  
2053 C CG  . GLU B 66  ? 0.9864 1.4368 1.2385 -0.4865 0.1011  -0.2257 280 GLU B CG  
2054 C CD  . GLU B 66  ? 0.9805 1.5011 1.2638 -0.4600 0.1101  -0.2004 280 GLU B CD  
2055 O OE1 . GLU B 66  ? 0.9168 1.5498 1.2364 -0.4168 0.0872  -0.2021 280 GLU B OE1 
2056 O OE2 . GLU B 66  ? 1.0442 1.5035 1.3097 -0.4768 0.1397  -0.1779 280 GLU B OE2 
2057 N N   . LYS B 67  ? 1.1177 1.1219 1.1972 -0.5345 0.1413  -0.2244 281 LYS B N   
2058 C CA  . LYS B 67  ? 1.2120 1.0710 1.2300 -0.5444 0.1513  -0.2308 281 LYS B CA  
2059 C C   . LYS B 67  ? 1.2274 0.9803 1.1981 -0.4942 0.1495  -0.2129 281 LYS B C   
2060 O O   . LYS B 67  ? 1.1200 0.9277 1.1080 -0.4488 0.1299  -0.2066 281 LYS B O   
2061 C CB  . LYS B 67  ? 1.2877 1.0694 1.2778 -0.5827 0.1820  -0.2162 281 LYS B CB  
2062 N N   . LYS B 68  ? 1.3641 0.9735 1.2729 -0.4876 0.1668  -0.1997 282 LYS B N   
2063 C CA  . LYS B 68  ? 1.3787 0.8863 1.2371 -0.4323 0.1644  -0.1852 282 LYS B CA  
2064 C C   . LYS B 68  ? 1.2968 0.8338 1.1654 -0.3837 0.1638  -0.1483 282 LYS B C   
2065 O O   . LYS B 68  ? 1.3105 0.8191 1.1684 -0.3874 0.1844  -0.1179 282 LYS B O   
2066 C CB  . LYS B 68  ? 1.5067 0.8685 1.2984 -0.4260 0.1822  -0.1724 282 LYS B CB  
2067 N N   . GLY B 69  ? 1.2117 0.8144 1.0998 -0.3314 0.1381  -0.1482 283 GLY B N   
2068 C CA  . GLY B 69  ? 1.1342 0.7757 1.0341 -0.2777 0.1319  -0.1152 283 GLY B CA  
2069 C C   . GLY B 69  ? 1.0281 0.8046 0.9883 -0.2790 0.1193  -0.1122 283 GLY B C   
2070 O O   . GLY B 69  ? 0.9615 0.7739 0.9341 -0.2406 0.1150  -0.0878 283 GLY B O   
2071 N N   . GLY B 70  ? 1.0109 0.8629 1.0066 -0.3212 0.1124  -0.1395 284 GLY B N   
2072 C CA  . GLY B 70  ? 0.8944 0.8793 0.9455 -0.3180 0.0987  -0.1399 284 GLY B CA  
2073 C C   . GLY B 70  ? 0.7635 0.8038 0.8240 -0.2683 0.0709  -0.1390 284 GLY B C   
2074 O O   . GLY B 70  ? 0.7319 0.7341 0.7660 -0.2529 0.0602  -0.1501 284 GLY B O   
2075 N N   . LEU B 71  ? 0.6662 0.7934 0.7604 -0.2429 0.0608  -0.1256 285 LEU B N   
2076 C CA  . LEU B 71  ? 0.5638 0.7323 0.6598 -0.1963 0.0374  -0.1189 285 LEU B CA  
2077 C C   . LEU B 71  ? 0.5686 0.7921 0.6700 -0.2053 0.0163  -0.1461 285 LEU B C   
2078 O O   . LEU B 71  ? 0.5045 0.7165 0.5834 -0.1766 0.0023  -0.1444 285 LEU B O   
2079 C CB  . LEU B 71  ? 0.5074 0.7466 0.6325 -0.1677 0.0325  -0.1008 285 LEU B CB  
2080 C CG  . LEU B 71  ? 0.4574 0.7200 0.5758 -0.1183 0.0121  -0.0877 285 LEU B CG  
2081 C CD1 . LEU B 71  ? 0.4583 0.6366 0.5388 -0.0954 0.0147  -0.0736 285 LEU B CD1 
2082 C CD2 . LEU B 71  ? 0.4307 0.7440 0.5714 -0.0901 0.0109  -0.0720 285 LEU B CD2 
2083 N N   . ARG B 72  ? 0.5397 0.8291 0.6701 -0.2471 0.0147  -0.1724 286 ARG B N   
2084 C CA  . ARG B 72  ? 0.5749 0.9269 0.7102 -0.2579 -0.0070 -0.2029 286 ARG B CA  
2085 C C   . ARG B 72  ? 0.5996 0.8667 0.6928 -0.2710 -0.0054 -0.2217 286 ARG B C   
2086 O O   . ARG B 72  ? 0.5956 0.8809 0.6703 -0.2500 -0.0238 -0.2314 286 ARG B O   
2087 C CB  . ARG B 72  ? 0.6180 1.0666 0.7971 -0.3069 -0.0079 -0.2331 286 ARG B CB  
2088 C CG  . ARG B 72  ? 0.6423 1.1803 0.8301 -0.3125 -0.0352 -0.2664 286 ARG B CG  
2089 C CD  . ARG B 72  ? 0.7134 1.3396 0.9425 -0.3716 -0.0335 -0.3037 286 ARG B CD  
2090 N NE  . ARG B 72  ? 0.7361 1.4826 0.9826 -0.3435 -0.0606 -0.3158 286 ARG B NE  
2091 C CZ  . ARG B 72  ? 0.8252 1.6326 1.0868 -0.3725 -0.0626 -0.3442 286 ARG B CZ  
2092 N NH1 . ARG B 72  ? 0.9117 1.6675 1.1725 -0.4327 -0.0394 -0.3633 286 ARG B NH1 
2093 N NH2 . ARG B 72  ? 0.8310 1.7466 1.1043 -0.3398 -0.0871 -0.3529 286 ARG B NH2 
2094 N N   . GLU B 73  ? 0.7136 0.8853 0.7869 -0.3031 0.0177  -0.2263 287 GLU B N   
2095 C CA  . GLU B 73  ? 0.7813 0.8588 0.8097 -0.3110 0.0218  -0.2457 287 GLU B CA  
2096 C C   . GLU B 73  ? 0.7429 0.7713 0.7384 -0.2550 0.0176  -0.2241 287 GLU B C   
2097 O O   . GLU B 73  ? 0.7675 0.7869 0.7377 -0.2418 0.0069  -0.2416 287 GLU B O   
2098 C CB  . GLU B 73  ? 0.9149 0.8857 0.9207 -0.3512 0.0495  -0.2495 287 GLU B CB  
2099 C CG  . GLU B 73  ? 1.0763 0.9317 1.0276 -0.3494 0.0553  -0.2681 287 GLU B CG  
2100 C CD  . GLU B 73  ? 1.2249 0.9482 1.1381 -0.3656 0.0838  -0.2558 287 GLU B CD  
2101 O OE1 . GLU B 73  ? 1.2407 0.9598 1.1651 -0.3645 0.0985  -0.2238 287 GLU B OE1 
2102 O OE2 . GLU B 73  ? 1.3242 0.9440 1.1908 -0.3764 0.0917  -0.2778 287 GLU B OE2 
2103 N N   . LEU B 74  ? 0.6472 0.6506 0.6436 -0.2247 0.0269  -0.1886 288 LEU B N   
2104 C CA  . LEU B 74  ? 0.6526 0.6232 0.6251 -0.1763 0.0243  -0.1684 288 LEU B CA  
2105 C C   . LEU B 74  ? 0.6094 0.6511 0.5855 -0.1517 0.0033  -0.1689 288 LEU B C   
2106 O O   . LEU B 74  ? 0.6527 0.6739 0.6015 -0.1301 -0.0002 -0.1725 288 LEU B O   
2107 C CB  . LEU B 74  ? 0.5983 0.5530 0.5785 -0.1528 0.0346  -0.1340 288 LEU B CB  
2108 C CG  . LEU B 74  ? 0.6621 0.5272 0.6197 -0.1592 0.0564  -0.1239 288 LEU B CG  
2109 C CD1 . LEU B 74  ? 0.5891 0.4647 0.5599 -0.1401 0.0639  -0.0930 288 LEU B CD1 
2110 C CD2 . LEU B 74  ? 0.6844 0.4714 0.5996 -0.1334 0.0598  -0.1288 288 LEU B CD2 
2111 N N   . TYR B 75  ? 0.5837 0.7100 0.5900 -0.1532 -0.0096 -0.1647 289 TYR B N   
2112 C CA  . TYR B 75  ? 0.5458 0.7332 0.5472 -0.1267 -0.0293 -0.1598 289 TYR B CA  
2113 C C   . TYR B 75  ? 0.5790 0.7885 0.5616 -0.1405 -0.0416 -0.1918 289 TYR B C   
2114 O O   . TYR B 75  ? 0.5567 0.7773 0.5127 -0.1168 -0.0507 -0.1882 289 TYR B O   
2115 C CB  . TYR B 75  ? 0.5409 0.8105 0.5746 -0.1177 -0.0413 -0.1485 289 TYR B CB  
2116 C CG  . TYR B 75  ? 0.5254 0.8257 0.5427 -0.0768 -0.0566 -0.1270 289 TYR B CG  
2117 C CD1 . TYR B 75  ? 0.4792 0.7498 0.4914 -0.0473 -0.0510 -0.0954 289 TYR B CD1 
2118 C CD2 . TYR B 75  ? 0.5559 0.9087 0.5564 -0.0689 -0.0760 -0.1384 289 TYR B CD2 
2119 C CE1 . TYR B 75  ? 0.4717 0.7528 0.4608 -0.0142 -0.0620 -0.0744 289 TYR B CE1 
2120 C CE2 . TYR B 75  ? 0.5378 0.9053 0.5125 -0.0314 -0.0877 -0.1141 289 TYR B CE2 
2121 C CZ  . TYR B 75  ? 0.4959 0.8215 0.4638 -0.0058 -0.0795 -0.0814 289 TYR B CZ  
2122 O OH  . TYR B 75  ? 0.5231 0.8467 0.4576 0.0273  -0.0884 -0.0560 289 TYR B OH  
2123 N N   . ASP B 76  ? 0.6285 0.8441 0.6221 -0.1820 -0.0402 -0.2244 290 ASP B N   
2124 C CA  . ASP B 76  ? 0.6892 0.9218 0.6634 -0.2003 -0.0514 -0.2625 290 ASP B CA  
2125 C C   . ASP B 76  ? 0.6990 0.8499 0.6291 -0.1856 -0.0423 -0.2698 290 ASP B C   
2126 O O   . ASP B 76  ? 0.7052 0.8793 0.6090 -0.1744 -0.0535 -0.2864 290 ASP B O   
2127 C CB  . ASP B 76  ? 0.7819 1.0242 0.7764 -0.2565 -0.0478 -0.2995 290 ASP B CB  
2128 C CG  . ASP B 76  ? 0.8018 1.1641 0.8419 -0.2717 -0.0632 -0.3064 290 ASP B CG  
2129 O OD1 . ASP B 76  ? 0.7777 1.2146 0.8240 -0.2328 -0.0818 -0.2876 290 ASP B OD1 
2130 O OD2 . ASP B 76  ? 0.8427 1.2250 0.9103 -0.3225 -0.0560 -0.3313 290 ASP B OD2 
2131 N N   . ARG B 77  ? 0.7394 0.8006 0.6594 -0.1820 -0.0220 -0.2577 291 ARG B N   
2132 C CA  . ARG B 77  ? 0.8085 0.7975 0.6890 -0.1598 -0.0128 -0.2642 291 ARG B CA  
2133 C C   . ARG B 77  ? 0.7765 0.7968 0.6466 -0.1175 -0.0173 -0.2395 291 ARG B C   
2134 O O   . ARG B 77  ? 0.8237 0.8298 0.6637 -0.0991 -0.0157 -0.2518 291 ARG B O   
2135 C CB  . ARG B 77  ? 0.8548 0.7449 0.7246 -0.1593 0.0082  -0.2540 291 ARG B CB  
2136 N N   . GLY B 78  ? 0.6953 0.7575 0.5888 -0.1041 -0.0211 -0.2061 292 GLY B N   
2137 C CA  . GLY B 78  ? 0.6398 0.7266 0.5220 -0.0728 -0.0234 -0.1809 292 GLY B CA  
2138 C C   . GLY B 78  ? 0.6340 0.6701 0.5060 -0.0513 -0.0078 -0.1678 292 GLY B C   
2139 O O   . GLY B 78  ? 0.6638 0.6414 0.5339 -0.0533 0.0034  -0.1752 292 GLY B O   
2140 N N   . PRO B 79  ? 0.6195 0.6785 0.4821 -0.0309 -0.0065 -0.1482 293 PRO B N   
2141 C CA  . PRO B 79  ? 0.5896 0.7011 0.4426 -0.0263 -0.0171 -0.1331 293 PRO B CA  
2142 C C   . PRO B 79  ? 0.5430 0.6686 0.4170 -0.0228 -0.0228 -0.1044 293 PRO B C   
2143 O O   . PRO B 79  ? 0.5384 0.6360 0.4296 -0.0182 -0.0141 -0.0891 293 PRO B O   
2144 C CB  . PRO B 79  ? 0.6204 0.7339 0.4513 -0.0115 -0.0063 -0.1244 293 PRO B CB  
2145 C CG  . PRO B 79  ? 0.6105 0.6854 0.4564 -0.0034 0.0069  -0.1218 293 PRO B CG  
2146 C CD  . PRO B 79  ? 0.6225 0.6562 0.4776 -0.0113 0.0069  -0.1419 293 PRO B CD  
2147 N N   . PRO B 80  ? 0.4828 0.6783 0.3851 -0.0118 -0.0669 -0.0125 294 PRO B N   
2148 C CA  . PRO B 80  ? 0.4856 0.6649 0.4026 -0.0130 -0.0758 0.0089  294 PRO B CA  
2149 C C   . PRO B 80  ? 0.4880 0.6492 0.4030 -0.0170 -0.0660 0.0395  294 PRO B C   
2150 O O   . PRO B 80  ? 0.4727 0.6092 0.4112 -0.0186 -0.0669 0.0492  294 PRO B O   
2151 C CB  . PRO B 80  ? 0.5116 0.7191 0.4058 -0.0065 -0.0937 0.0134  294 PRO B CB  
2152 C CG  . PRO B 80  ? 0.5366 0.7729 0.4164 -0.0042 -0.0967 -0.0173 294 PRO B CG  
2153 C CD  . PRO B 80  ? 0.5088 0.7405 0.3826 -0.0070 -0.0774 -0.0247 294 PRO B CD  
2154 N N   . HIS B 81  ? 0.5214 0.6967 0.4105 -0.0200 -0.0558 0.0519  295 HIS B N   
2155 C CA  . HIS B 81  ? 0.5136 0.6737 0.4025 -0.0278 -0.0458 0.0792  295 HIS B CA  
2156 C C   . HIS B 81  ? 0.4692 0.6113 0.3866 -0.0318 -0.0342 0.0717  295 HIS B C   
2157 O O   . HIS B 81  ? 0.4603 0.5891 0.3855 -0.0394 -0.0269 0.0884  295 HIS B O   
2158 C CB  . HIS B 81  ? 0.5688 0.7534 0.4237 -0.0335 -0.0351 0.0936  295 HIS B CB  
2159 C CG  . HIS B 81  ? 0.5880 0.7982 0.4412 -0.0344 -0.0208 0.0730  295 HIS B CG  
2160 N ND1 . HIS B 81  ? 0.5910 0.8285 0.4295 -0.0262 -0.0230 0.0477  295 HIS B ND1 
2161 C CD2 . HIS B 81  ? 0.5994 0.8149 0.4657 -0.0408 -0.0049 0.0716  295 HIS B CD2 
2162 C CE1 . HIS B 81  ? 0.5979 0.8535 0.4402 -0.0257 -0.0087 0.0324  295 HIS B CE1 
2163 N NE2 . HIS B 81  ? 0.5936 0.8390 0.4532 -0.0341 0.0020  0.0468  295 HIS B NE2 
2164 N N   . ALA B 82  ? 0.4534 0.5937 0.3854 -0.0263 -0.0331 0.0465  296 ALA B N   
2165 C CA  . ALA B 82  ? 0.3913 0.5154 0.3447 -0.0259 -0.0238 0.0399  296 ALA B CA  
2166 C C   . ALA B 82  ? 0.3796 0.4740 0.3575 -0.0254 -0.0288 0.0405  296 ALA B C   
2167 O O   . ALA B 82  ? 0.3913 0.4704 0.3835 -0.0237 -0.0223 0.0363  296 ALA B O   
2168 C CB  . ALA B 82  ? 0.4103 0.5428 0.3623 -0.0177 -0.0182 0.0153  296 ALA B CB  
2169 N N   . PHE B 83  ? 0.3503 0.4403 0.3319 -0.0256 -0.0403 0.0453  297 PHE B N   
2170 C CA  . PHE B 83  ? 0.3752 0.4445 0.3822 -0.0251 -0.0440 0.0426  297 PHE B CA  
2171 C C   . PHE B 83  ? 0.3771 0.4328 0.3929 -0.0268 -0.0466 0.0623  297 PHE B C   
2172 O O   . PHE B 83  ? 0.4247 0.4845 0.4281 -0.0265 -0.0535 0.0786  297 PHE B O   
2173 C CB  . PHE B 83  ? 0.3630 0.4415 0.3773 -0.0233 -0.0555 0.0286  297 PHE B CB  
2174 C CG  . PHE B 83  ? 0.3823 0.4625 0.3981 -0.0238 -0.0516 0.0039  297 PHE B CG  
2175 C CD1 . PHE B 83  ? 0.3665 0.4272 0.4052 -0.0272 -0.0464 -0.0092 297 PHE B CD1 
2176 C CD2 . PHE B 83  ? 0.4252 0.5243 0.4189 -0.0212 -0.0516 -0.0064 297 PHE B CD2 
2177 C CE1 . PHE B 83  ? 0.4305 0.4837 0.4708 -0.0288 -0.0417 -0.0310 297 PHE B CE1 
2178 C CE2 . PHE B 83  ? 0.4587 0.5539 0.4551 -0.0207 -0.0482 -0.0317 297 PHE B CE2 
2179 C CZ  . PHE B 83  ? 0.4659 0.5346 0.4861 -0.0248 -0.0433 -0.0434 297 PHE B CZ  
2180 N N   . PHE B 84  ? 0.3395 0.3770 0.3749 -0.0275 -0.0409 0.0606  298 PHE B N   
2181 C CA  . PHE B 84  ? 0.3641 0.3865 0.4106 -0.0285 -0.0424 0.0741  298 PHE B CA  
2182 C C   . PHE B 84  ? 0.3863 0.3969 0.4576 -0.0255 -0.0425 0.0657  298 PHE B C   
2183 O O   . PHE B 84  ? 0.3700 0.3785 0.4481 -0.0257 -0.0357 0.0527  298 PHE B O   
2184 C CB  . PHE B 84  ? 0.3485 0.3664 0.3913 -0.0345 -0.0326 0.0805  298 PHE B CB  
2185 C CG  . PHE B 84  ? 0.3610 0.3935 0.3830 -0.0405 -0.0295 0.0909  298 PHE B CG  
2186 C CD1 . PHE B 84  ? 0.3743 0.3983 0.3885 -0.0462 -0.0317 0.1108  298 PHE B CD1 
2187 C CD2 . PHE B 84  ? 0.3304 0.3841 0.3399 -0.0400 -0.0232 0.0809  298 PHE B CD2 
2188 C CE1 . PHE B 84  ? 0.4259 0.4640 0.4187 -0.0543 -0.0256 0.1225  298 PHE B CE1 
2189 C CE2 . PHE B 84  ? 0.3420 0.4153 0.3328 -0.0462 -0.0179 0.0891  298 PHE B CE2 
2190 C CZ  . PHE B 84  ? 0.3911 0.4578 0.3727 -0.0548 -0.0181 0.1108  298 PHE B CZ  
2191 N N   . LEU B 85  ? 0.3871 0.3887 0.4708 -0.0222 -0.0493 0.0737  299 LEU B N   
2192 C CA  . LEU B 85  ? 0.3700 0.3644 0.4785 -0.0188 -0.0476 0.0653  299 LEU B CA  
2193 C C   . LEU B 85  ? 0.3464 0.3230 0.4603 -0.0197 -0.0431 0.0708  299 LEU B C   
2194 O O   . LEU B 85  ? 0.3814 0.3463 0.4910 -0.0200 -0.0481 0.0841  299 LEU B O   
2195 C CB  . LEU B 85  ? 0.3813 0.3851 0.5063 -0.0108 -0.0603 0.0634  299 LEU B CB  
2196 C CG  . LEU B 85  ? 0.3831 0.3845 0.5372 -0.0057 -0.0588 0.0546  299 LEU B CG  
2197 C CD1 . LEU B 85  ? 0.3182 0.3261 0.4836 -0.0122 -0.0454 0.0387  299 LEU B CD1 
2198 C CD2 . LEU B 85  ? 0.3986 0.4143 0.5702 0.0061  -0.0745 0.0539  299 LEU B CD2 
2199 N N   . VAL B 86  ? 0.3235 0.2967 0.4453 -0.0206 -0.0334 0.0605  300 VAL B N   
2200 C CA  . VAL B 86  ? 0.3564 0.3171 0.4851 -0.0212 -0.0300 0.0599  300 VAL B CA  
2201 C C   . VAL B 86  ? 0.3578 0.3168 0.5071 -0.0148 -0.0279 0.0489  300 VAL B C   
2202 O O   . VAL B 86  ? 0.3214 0.2887 0.4732 -0.0143 -0.0197 0.0396  300 VAL B O   
2203 C CB  . VAL B 86  ? 0.4116 0.3763 0.5282 -0.0257 -0.0210 0.0556  300 VAL B CB  
2204 C CG1 . VAL B 86  ? 0.4493 0.4064 0.5755 -0.0263 -0.0185 0.0488  300 VAL B CG1 
2205 C CG2 . VAL B 86  ? 0.3983 0.3701 0.4991 -0.0322 -0.0215 0.0643  300 VAL B CG2 
2206 N N   . LYS B 87  ? 0.3309 0.2776 0.4948 -0.0098 -0.0341 0.0501  301 LYS B N   
2207 C CA  . LYS B 87  ? 0.3177 0.2656 0.5027 -0.0024 -0.0312 0.0365  301 LYS B CA  
2208 C C   . LYS B 87  ? 0.3161 0.2549 0.4996 -0.0050 -0.0245 0.0279  301 LYS B C   
2209 O O   . LYS B 87  ? 0.3350 0.2570 0.5165 -0.0095 -0.0281 0.0325  301 LYS B O   
2210 C CB  . LYS B 87  ? 0.3993 0.3402 0.6042 0.0091  -0.0430 0.0387  301 LYS B CB  
2211 C CG  . LYS B 87  ? 0.5028 0.4551 0.7339 0.0189  -0.0394 0.0212  301 LYS B CG  
2212 C CD  . LYS B 87  ? 0.6116 0.5655 0.8648 0.0345  -0.0533 0.0222  301 LYS B CD  
2213 C CE  . LYS B 87  ? 0.6865 0.6623 0.9699 0.0444  -0.0480 0.0014  301 LYS B CE  
2214 N NZ  . LYS B 87  ? 0.7535 0.7191 1.0376 0.0433  -0.0365 -0.0118 301 LYS B NZ  
2215 N N   . PHE B 88  ? 0.3280 0.2791 0.5115 -0.0032 -0.0142 0.0150  302 PHE B N   
2216 C CA  . PHE B 88  ? 0.3217 0.2716 0.5011 -0.0037 -0.0088 0.0031  302 PHE B CA  
2217 C C   . PHE B 88  ? 0.3316 0.2832 0.5305 0.0053  -0.0062 -0.0134 302 PHE B C   
2218 O O   . PHE B 88  ? 0.3179 0.2829 0.5282 0.0108  -0.0013 -0.0182 302 PHE B O   
2219 C CB  . PHE B 88  ? 0.2787 0.2425 0.4353 -0.0053 0.0010  0.0017  302 PHE B CB  
2220 C CG  . PHE B 88  ? 0.3421 0.3069 0.4809 -0.0113 -0.0017 0.0102  302 PHE B CG  
2221 C CD1 . PHE B 88  ? 0.3405 0.3004 0.4833 -0.0178 -0.0077 0.0096  302 PHE B CD1 
2222 C CD2 . PHE B 88  ? 0.3488 0.3195 0.4691 -0.0107 0.0030  0.0173  302 PHE B CD2 
2223 C CE1 . PHE B 88  ? 0.3602 0.3293 0.4906 -0.0238 -0.0085 0.0150  302 PHE B CE1 
2224 C CE2 . PHE B 88  ? 0.3614 0.3377 0.4680 -0.0131 0.0006  0.0223  302 PHE B CE2 
2225 C CZ  . PHE B 88  ? 0.3380 0.3175 0.4505 -0.0197 -0.0049 0.0207  302 PHE B CZ  
2226 N N   . TRP B 89  ? 0.3323 0.2723 0.5377 0.0058  -0.0089 -0.0247 303 TRP B N   
2227 C CA  . TRP B 89  ? 0.3133 0.2589 0.5322 0.0148  -0.0043 -0.0463 303 TRP B CA  
2228 C C   . TRP B 89  ? 0.3387 0.2990 0.5374 0.0118  0.0028  -0.0586 303 TRP B C   
2229 O O   . TRP B 89  ? 0.3622 0.3153 0.5593 0.0060  -0.0022 -0.0662 303 TRP B O   
2230 C CB  . TRP B 89  ? 0.3178 0.2369 0.5603 0.0199  -0.0135 -0.0544 303 TRP B CB  
2231 C CG  . TRP B 89  ? 0.3379 0.2469 0.5993 0.0299  -0.0216 -0.0441 303 TRP B CG  
2232 C CD1 . TRP B 89  ? 0.3542 0.2751 0.6390 0.0453  -0.0213 -0.0562 303 TRP B CD1 
2233 C CD2 . TRP B 89  ? 0.3955 0.2865 0.6533 0.0272  -0.0321 -0.0203 303 TRP B CD2 
2234 N NE1 . TRP B 89  ? 0.3793 0.2913 0.6768 0.0538  -0.0332 -0.0419 303 TRP B NE1 
2235 C CE2 . TRP B 89  ? 0.4074 0.2996 0.6856 0.0431  -0.0400 -0.0188 303 TRP B CE2 
2236 C CE3 . TRP B 89  ? 0.4202 0.2983 0.6587 0.0137  -0.0351 -0.0011 303 TRP B CE3 
2237 C CZ2 . TRP B 89  ? 0.4329 0.3124 0.7088 0.0473  -0.0527 0.0027  303 TRP B CZ2 
2238 C CZ3 . TRP B 89  ? 0.4311 0.2956 0.6663 0.0159  -0.0450 0.0206  303 TRP B CZ3 
2239 C CH2 . TRP B 89  ? 0.4356 0.3000 0.6873 0.0332  -0.0545 0.0230  303 TRP B CH2 
2240 N N   . ALA B 90  ? 0.2883 0.2702 0.4707 0.0153  0.0143  -0.0598 304 ALA B N   
2241 C CA  . ALA B 90  ? 0.3285 0.3261 0.4830 0.0158  0.0200  -0.0656 304 ALA B CA  
2242 C C   . ALA B 90  ? 0.3708 0.3801 0.5272 0.0227  0.0225  -0.0917 304 ALA B C   
2243 O O   . ALA B 90  ? 0.3807 0.3938 0.5542 0.0295  0.0278  -0.1046 304 ALA B O   
2244 C CB  . ALA B 90  ? 0.3471 0.3557 0.4782 0.0174  0.0326  -0.0526 304 ALA B CB  
2245 N N   . ASP B 91  ? 0.3309 0.3502 0.4711 0.0217  0.0182  -0.1020 305 ASP B N   
2246 C CA  . ASP B 91  ? 0.3931 0.4284 0.5306 0.0280  0.0192  -0.1304 305 ASP B CA  
2247 C C   . ASP B 91  ? 0.4241 0.4864 0.5250 0.0378  0.0313  -0.1298 305 ASP B C   
2248 O O   . ASP B 91  ? 0.3765 0.4513 0.4476 0.0401  0.0293  -0.1218 305 ASP B O   
2249 C CB  . ASP B 91  ? 0.3904 0.4273 0.5322 0.0205  0.0068  -0.1456 305 ASP B CB  
2250 C CG  . ASP B 91  ? 0.4552 0.5067 0.6009 0.0255  0.0053  -0.1811 305 ASP B CG  
2251 O OD1 . ASP B 91  ? 0.4779 0.5418 0.6173 0.0369  0.0148  -0.1933 305 ASP B OD1 
2252 O OD2 . ASP B 91  ? 0.4661 0.5195 0.6223 0.0168  -0.0048 -0.1992 305 ASP B OD2 
2253 N N   . LEU B 92  ? 0.3874 0.4594 0.4901 0.0446  0.0444  -0.1377 306 LEU B N   
2254 C CA  . LEU B 92  ? 0.4810 0.5760 0.5465 0.0524  0.0601  -0.1338 306 LEU B CA  
2255 C C   . LEU B 92  ? 0.5429 0.6645 0.5947 0.0623  0.0623  -0.1642 306 LEU B C   
2256 O O   . LEU B 92  ? 0.5557 0.6988 0.5810 0.0696  0.0785  -0.1658 306 LEU B O   
2257 C CB  . LEU B 92  ? 0.4784 0.5733 0.5529 0.0504  0.0777  -0.1215 306 LEU B CB  
2258 C CG  . LEU B 92  ? 0.4901 0.5635 0.5764 0.0405  0.0767  -0.0947 306 LEU B CG  
2259 C CD1 . LEU B 92  ? 0.5045 0.5862 0.6018 0.0367  0.0953  -0.0884 306 LEU B CD1 
2260 C CD2 . LEU B 92  ? 0.5318 0.5958 0.5831 0.0393  0.0741  -0.0727 306 LEU B CD2 
2261 N N   . ASN B 93  ? 0.5839 0.7045 0.6535 0.0612  0.0469  -0.1892 307 ASN B N   
2262 C CA  . ASN B 93  ? 0.6310 0.7780 0.6905 0.0700  0.0460  -0.2243 307 ASN B CA  
2263 C C   . ASN B 93  ? 0.6394 0.8093 0.6662 0.0732  0.0347  -0.2304 307 ASN B C   
2264 O O   . ASN B 93  ? 0.6240 0.7899 0.6701 0.0652  0.0184  -0.2444 307 ASN B O   
2265 C CB  . ASN B 93  ? 0.6566 0.7866 0.7612 0.0669  0.0368  -0.2549 307 ASN B CB  
2266 C CG  . ASN B 93  ? 0.7358 0.8925 0.8339 0.0762  0.0366  -0.2971 307 ASN B CG  
2267 O OD1 . ASN B 93  ? 0.7831 0.9748 0.8434 0.0871  0.0475  -0.3027 307 ASN B OD1 
2268 N ND2 . ASN B 93  ? 0.7597 0.8983 0.8931 0.0718  0.0250  -0.3272 307 ASN B ND2 
2269 N N   . TRP B 94  ? 0.6652 0.8602 0.6427 0.0850  0.0438  -0.2194 308 TRP B N   
2270 C CA  . TRP B 94  ? 0.7330 0.9561 0.6749 0.0938  0.0316  -0.2252 308 TRP B CA  
2271 C C   . TRP B 94  ? 0.8093 1.0645 0.6959 0.1113  0.0436  -0.2260 308 TRP B C   
2272 O O   . TRP B 94  ? 0.8518 1.1411 0.7075 0.1232  0.0325  -0.2429 308 TRP B O   
2273 C CB  . TRP B 94  ? 0.7013 0.9109 0.6339 0.0913  0.0239  -0.1928 308 TRP B CB  
2274 C CG  . TRP B 94  ? 0.7069 0.9083 0.5964 0.1006  0.0385  -0.1555 308 TRP B CG  
2275 C CD1 . TRP B 94  ? 0.6998 0.9188 0.5365 0.1178  0.0373  -0.1415 308 TRP B CD1 
2276 C CD2 . TRP B 94  ? 0.7088 0.8798 0.6051 0.0930  0.0564  -0.1278 308 TRP B CD2 
2277 N NE1 . TRP B 94  ? 0.7122 0.9061 0.5212 0.1203  0.0550  -0.1049 308 TRP B NE1 
2278 C CE2 . TRP B 94  ? 0.7092 0.8757 0.5562 0.1034  0.0673  -0.0978 308 TRP B CE2 
2279 C CE3 . TRP B 94  ? 0.6930 0.8410 0.6325 0.0793  0.0633  -0.1262 308 TRP B CE3 
2280 C CZ2 . TRP B 94  ? 0.6969 0.8352 0.5400 0.0962  0.0865  -0.0687 308 TRP B CZ2 
2281 C CZ3 . TRP B 94  ? 0.6710 0.7993 0.6074 0.0739  0.0803  -0.0991 308 TRP B CZ3 
2282 C CH2 . TRP B 94  ? 0.6709 0.7938 0.5611 0.0804  0.0926  -0.0718 308 TRP B CH2 
2283 N N   . GLY B 111 ? 0.8399 1.0671 0.3664 0.2541  0.0143  0.0028  325 GLY B N   
2284 C CA  . GLY B 111 ? 0.7882 1.0405 0.3561 0.2531  -0.0094 -0.0202 325 GLY B CA  
2285 C C   . GLY B 111 ? 0.7552 0.9639 0.3395 0.2506  -0.0076 0.0063  325 GLY B C   
2286 O O   . GLY B 111 ? 0.7556 0.9123 0.3151 0.2504  0.0123  0.0414  325 GLY B O   
2287 N N   . PHE B 112 ? 0.4668 0.8888 0.4782 0.0389  0.0354  0.0608  326 PHE B N   
2288 C CA  . PHE B 112 ? 0.3567 0.7483 0.4145 0.0412  0.0349  0.0776  326 PHE B CA  
2289 C C   . PHE B 112 ? 0.3648 0.6691 0.4385 0.0168  0.0353  0.0547  326 PHE B C   
2290 O O   . PHE B 112 ? 0.3432 0.6299 0.3974 -0.0139 0.0271  0.0186  326 PHE B O   
2291 C CB  . PHE B 112 ? 0.3674 0.8237 0.4284 0.0326  0.0179  0.0711  326 PHE B CB  
2292 C CG  . PHE B 112 ? 0.3154 0.7370 0.4194 0.0301  0.0181  0.0806  326 PHE B CG  
2293 C CD1 . PHE B 112 ? 0.3714 0.7932 0.5163 0.0613  0.0327  0.1218  326 PHE B CD1 
2294 C CD2 . PHE B 112 ? 0.3073 0.6953 0.4127 -0.0024 0.0081  0.0479  326 PHE B CD2 
2295 C CE1 . PHE B 112 ? 0.3234 0.7147 0.5080 0.0576  0.0346  0.1244  326 PHE B CE1 
2296 C CE2 . PHE B 112 ? 0.2991 0.6593 0.4385 -0.0028 0.0089  0.0551  326 PHE B CE2 
2297 C CZ  . PHE B 112 ? 0.3011 0.6642 0.4791 0.0259  0.0208  0.0904  326 PHE B CZ  
2298 N N   . TYR B 113 ? 0.3155 0.5699 0.4285 0.0322  0.0473  0.0759  327 TYR B N   
2299 C CA  . TYR B 113 ? 0.2972 0.4826 0.4282 0.0165  0.0457  0.0585  327 TYR B CA  
2300 C C   . TYR B 113 ? 0.2715 0.4559 0.4328 0.0134  0.0387  0.0595  327 TYR B C   
2301 O O   . TYR B 113 ? 0.3203 0.5182 0.5195 0.0335  0.0474  0.0837  327 TYR B O   
2302 C CB  . TYR B 113 ? 0.2933 0.4330 0.4528 0.0330  0.0616  0.0724  327 TYR B CB  
2303 C CG  . TYR B 113 ? 0.3201 0.4493 0.4495 0.0345  0.0709  0.0689  327 TYR B CG  
2304 C CD1 . TYR B 113 ? 0.3691 0.5431 0.4782 0.0537  0.0810  0.0884  327 TYR B CD1 
2305 C CD2 . TYR B 113 ? 0.3286 0.4060 0.4487 0.0198  0.0718  0.0479  327 TYR B CD2 
2306 C CE1 . TYR B 113 ? 0.4529 0.6184 0.5311 0.0556  0.0913  0.0827  327 TYR B CE1 
2307 C CE2 . TYR B 113 ? 0.3782 0.4430 0.4728 0.0211  0.0836  0.0436  327 TYR B CE2 
2308 C CZ  . TYR B 113 ? 0.4370 0.5449 0.5099 0.0377  0.0932  0.0589  327 TYR B CZ  
2309 O OH  . TYR B 113 ? 0.5221 0.6187 0.5666 0.0395  0.1067  0.0524  327 TYR B OH  
2310 N N   . GLY B 114 ? 0.2684 0.4350 0.4154 -0.0105 0.0275  0.0342  328 GLY B N   
2311 C CA  . GLY B 114 ? 0.3209 0.4920 0.4885 -0.0142 0.0214  0.0332  328 GLY B CA  
2312 C C   . GLY B 114 ? 0.3184 0.4407 0.4856 -0.0265 0.0174  0.0150  328 GLY B C   
2313 O O   . GLY B 114 ? 0.3317 0.4192 0.4774 -0.0362 0.0185  0.0017  328 GLY B O   
2314 N N   . VAL B 115 ? 0.2925 0.4154 0.4834 -0.0230 0.0149  0.0162  329 VAL B N   
2315 C CA  . VAL B 115 ? 0.2926 0.3825 0.4785 -0.0299 0.0104  0.0012  329 VAL B CA  
2316 C C   . VAL B 115 ? 0.2755 0.3853 0.4580 -0.0389 0.0074  -0.0028 329 VAL B C   
2317 O O   . VAL B 115 ? 0.2747 0.4142 0.4827 -0.0313 0.0091  0.0073  329 VAL B O   
2318 C CB  . VAL B 115 ? 0.2812 0.3525 0.5026 -0.0149 0.0112  -0.0004 329 VAL B CB  
2319 C CG1 . VAL B 115 ? 0.2868 0.3399 0.4963 -0.0176 0.0039  -0.0160 329 VAL B CG1 
2320 C CG2 . VAL B 115 ? 0.2944 0.3463 0.5262 -0.0065 0.0162  0.0033  329 VAL B CG2 
2321 N N   . SER B 116 ? 0.3178 0.4097 0.4726 -0.0536 0.0074  -0.0149 330 SER B N   
2322 C CA  . SER B 116 ? 0.3114 0.4181 0.4646 -0.0625 0.0082  -0.0184 330 SER B CA  
2323 C C   . SER B 116 ? 0.3501 0.4255 0.4913 -0.0582 0.0102  -0.0237 330 SER B C   
2324 O O   . SER B 116 ? 0.3585 0.4009 0.4788 -0.0569 0.0134  -0.0263 330 SER B O   
2325 C CB  . SER B 116 ? 0.2906 0.4141 0.4274 -0.0848 0.0123  -0.0278 330 SER B CB  
2326 O OG  . SER B 116 ? 0.3192 0.4939 0.4662 -0.0855 0.0070  -0.0236 330 SER B OG  
2327 N N   . SER B 117 ? 0.3151 0.4044 0.4688 -0.0529 0.0098  -0.0237 331 SER B N   
2328 C CA  . SER B 117 ? 0.3468 0.4178 0.4840 -0.0453 0.0116  -0.0287 331 SER B CA  
2329 C C   . SER B 117 ? 0.3533 0.4385 0.4887 -0.0521 0.0194  -0.0278 331 SER B C   
2330 O O   . SER B 117 ? 0.3380 0.4535 0.4987 -0.0559 0.0195  -0.0247 331 SER B O   
2331 C CB  . SER B 117 ? 0.3751 0.4493 0.5324 -0.0278 0.0035  -0.0369 331 SER B CB  
2332 O OG  . SER B 117 ? 0.4767 0.5387 0.6417 -0.0216 -0.0020 -0.0383 331 SER B OG  
2333 N N   . GLN B 118 ? 0.3328 0.3978 0.4403 -0.0508 0.0288  -0.0271 332 GLN B N   
2334 C CA  . GLN B 118 ? 0.3325 0.4074 0.4388 -0.0553 0.0400  -0.0252 332 GLN B CA  
2335 C C   . GLN B 118 ? 0.3589 0.4180 0.4350 -0.0376 0.0467  -0.0232 332 GLN B C   
2336 O O   . GLN B 118 ? 0.3787 0.4121 0.4263 -0.0290 0.0530  -0.0161 332 GLN B O   
2337 C CB  . GLN B 118 ? 0.3560 0.4298 0.4635 -0.0783 0.0543  -0.0237 332 GLN B CB  
2338 C CG  . GLN B 118 ? 0.4160 0.5017 0.5303 -0.0845 0.0689  -0.0214 332 GLN B CG  
2339 C CD  . GLN B 118 ? 0.4816 0.5856 0.6173 -0.1117 0.0790  -0.0278 332 GLN B CD  
2340 O OE1 . GLN B 118 ? 0.5264 0.6531 0.6761 -0.1248 0.0687  -0.0360 332 GLN B OE1 
2341 N NE2 . GLN B 118 ? 0.5051 0.6043 0.6454 -0.1201 0.1003  -0.0261 332 GLN B NE2 
2342 N N   . TYR B 119 ? 0.3838 0.4616 0.4658 -0.0294 0.0472  -0.0281 333 TYR B N   
2343 C CA  . TYR B 119 ? 0.3901 0.4647 0.4393 -0.0095 0.0529  -0.0284 333 TYR B CA  
2344 C C   . TYR B 119 ? 0.3857 0.4645 0.4316 -0.0134 0.0724  -0.0216 333 TYR B C   
2345 O O   . TYR B 119 ? 0.3590 0.4522 0.4373 -0.0302 0.0764  -0.0217 333 TYR B O   
2346 C CB  . TYR B 119 ? 0.3911 0.4881 0.4493 0.0063  0.0365  -0.0492 333 TYR B CB  
2347 C CG  . TYR B 119 ? 0.3579 0.4552 0.4328 0.0090  0.0190  -0.0589 333 TYR B CG  
2348 C CD1 . TYR B 119 ? 0.3783 0.4748 0.4266 0.0264  0.0096  -0.0618 333 TYR B CD1 
2349 C CD2 . TYR B 119 ? 0.3413 0.4435 0.4604 -0.0028 0.0138  -0.0625 333 TYR B CD2 
2350 C CE1 . TYR B 119 ? 0.3532 0.4520 0.4229 0.0284  -0.0052 -0.0716 333 TYR B CE1 
2351 C CE2 . TYR B 119 ? 0.3302 0.4304 0.4684 0.0004  0.0023  -0.0698 333 TYR B CE2 
2352 C CZ  . TYR B 119 ? 0.3485 0.4461 0.4640 0.0142  -0.0075 -0.0762 333 TYR B CZ  
2353 O OH  . TYR B 119 ? 0.3327 0.4300 0.4730 0.0167  -0.0177 -0.0841 333 TYR B OH  
2354 N N   . GLU B 120 ? 0.4272 0.4983 0.4345 0.0049  0.0855  -0.0137 334 GLU B N   
2355 C CA  . GLU B 120 ? 0.4983 0.5732 0.5009 0.0054  0.1069  -0.0069 334 GLU B CA  
2356 C C   . GLU B 120 ? 0.5340 0.6234 0.4974 0.0345  0.1081  -0.0117 334 GLU B C   
2357 O O   . GLU B 120 ? 0.4933 0.5884 0.4245 0.0562  0.0965  -0.0142 334 GLU B O   
2358 C CB  . GLU B 120 ? 0.6233 0.6695 0.6203 -0.0054 0.1360  0.0144  334 GLU B CB  
2359 C CG  . GLU B 120 ? 0.7763 0.7935 0.7313 0.0150  0.1507  0.0341  334 GLU B CG  
2360 C CD  . GLU B 120 ? 0.9120 0.8937 0.8757 0.0008  0.1879  0.0531  334 GLU B CD  
2361 O OE1 . GLU B 120 ? 1.0210 0.9729 0.9562 0.0194  0.2101  0.0757  334 GLU B OE1 
2362 O OE2 . GLU B 120 ? 0.9011 0.8875 0.9052 -0.0282 0.1972  0.0449  334 GLU B OE2 
2363 N N   . SER B 121 ? 0.5051 0.6066 0.4719 0.0358  0.1221  -0.0143 335 SER B N   
2364 C CA  . SER B 121 ? 0.5335 0.6558 0.4628 0.0623  0.1246  -0.0242 335 SER B CA  
2365 C C   . SER B 121 ? 0.5785 0.6997 0.5051 0.0628  0.1534  -0.0136 335 SER B C   
2366 O O   . SER B 121 ? 0.5818 0.6933 0.5479 0.0397  0.1667  -0.0043 335 SER B O   
2367 C CB  . SER B 121 ? 0.4960 0.6484 0.4478 0.0640  0.1005  -0.0613 335 SER B CB  
2368 O OG  . SER B 121 ? 0.5755 0.7549 0.4943 0.0862  0.1037  -0.0798 335 SER B OG  
2369 N N   . LEU B 122 ? 0.5898 0.7271 0.4700 0.0903  0.1628  -0.0160 336 LEU B N   
2370 C CA  . LEU B 122 ? 0.6557 0.7937 0.5305 0.0944  0.1919  -0.0077 336 LEU B CA  
2371 C C   . LEU B 122 ? 0.6260 0.7911 0.5272 0.0906  0.1840  -0.0417 336 LEU B C   
2372 O O   . LEU B 122 ? 0.6325 0.7986 0.5471 0.0877  0.2068  -0.0386 336 LEU B O   
2373 C CB  . LEU B 122 ? 0.7241 0.8646 0.5293 0.1305  0.2135  0.0136  336 LEU B CB  
2374 C CG  . LEU B 122 ? 0.8112 0.9155 0.5973 0.1373  0.2396  0.0566  336 LEU B CG  
2375 C CD1 . LEU B 122 ? 0.9030 1.0122 0.6227 0.1788  0.2698  0.0847  336 LEU B CD1 
2376 C CD2 . LEU B 122 ? 0.7987 0.8699 0.6421 0.1022  0.2631  0.0708  336 LEU B CD2 
2377 N N   . GLU B 123 ? 0.5975 0.7829 0.5122 0.0904  0.1557  -0.0747 337 GLU B N   
2378 C CA  . GLU B 123 ? 0.6244 0.8299 0.5767 0.0846  0.1526  -0.1107 337 GLU B CA  
2379 C C   . GLU B 123 ? 0.5760 0.7715 0.6017 0.0582  0.1470  -0.1103 337 GLU B C   
2380 O O   . GLU B 123 ? 0.5684 0.7529 0.6098 0.0471  0.1311  -0.0994 337 GLU B O   
2381 C CB  . GLU B 123 ? 0.6908 0.9289 0.6246 0.0995  0.1305  -0.1534 337 GLU B CB  
2382 C CG  . GLU B 123 ? 0.8040 1.0711 0.6630 0.1313  0.1337  -0.1600 337 GLU B CG  
2383 C CD  . GLU B 123 ? 0.8233 1.1343 0.6645 0.1452  0.1046  -0.2024 337 GLU B CD  
2384 O OE1 . GLU B 123 ? 0.7962 1.1208 0.5910 0.1653  0.0906  -0.1863 337 GLU B OE1 
2385 O OE2 . GLU B 123 ? 0.8482 1.1821 0.7272 0.1362  0.0981  -0.2526 337 GLU B OE2 
2386 N N   . HIS B 124 ? 0.5758 0.7773 0.6454 0.0513  0.1623  -0.1201 338 HIS B N   
2387 C CA  . HIS B 124 ? 0.5663 0.7672 0.7065 0.0346  0.1593  -0.1193 338 HIS B CA  
2388 C C   . HIS B 124 ? 0.5447 0.7540 0.7110 0.0370  0.1466  -0.1570 338 HIS B C   
2389 O O   . HIS B 124 ? 0.5717 0.7928 0.7455 0.0440  0.1568  -0.1914 338 HIS B O   
2390 C CB  . HIS B 124 ? 0.6557 0.8620 0.8397 0.0300  0.1848  -0.1099 338 HIS B CB  
2391 C CG  . HIS B 124 ? 0.6821 0.8944 0.9377 0.0198  0.1850  -0.1005 338 HIS B CG  
2392 N ND1 . HIS B 124 ? 0.6775 0.8988 0.9607 0.0085  0.1841  -0.0671 338 HIS B ND1 
2393 C CD2 . HIS B 124 ? 0.6988 0.9132 1.0058 0.0216  0.1888  -0.1190 338 HIS B CD2 
2394 C CE1 . HIS B 124 ? 0.6743 0.9073 1.0161 0.0080  0.1855  -0.0607 338 HIS B CE1 
2395 N NE2 . HIS B 124 ? 0.6768 0.9005 1.0365 0.0161  0.1914  -0.0894 338 HIS B NE2 
2396 N N   . MET B 125 ? 0.4777 0.6814 0.6614 0.0301  0.1271  -0.1535 339 MET B N   
2397 C CA  . MET B 125 ? 0.5090 0.7189 0.7272 0.0302  0.1175  -0.1884 339 MET B CA  
2398 C C   . MET B 125 ? 0.4955 0.6954 0.7753 0.0196  0.1176  -0.1708 339 MET B C   
2399 O O   . MET B 125 ? 0.4481 0.6431 0.7306 0.0131  0.1164  -0.1337 339 MET B O   
2400 C CB  . MET B 125 ? 0.5219 0.7414 0.6931 0.0388  0.0924  -0.2060 339 MET B CB  
2401 C CG  . MET B 125 ? 0.5777 0.8185 0.6824 0.0568  0.0910  -0.2225 339 MET B CG  
2402 S SD  . MET B 125 ? 0.5805 0.8440 0.6332 0.0729  0.0603  -0.2347 339 MET B SD  
2403 C CE  . MET B 125 ? 0.4668 0.6941 0.4954 0.0684  0.0580  -0.1764 339 MET B CE  
2404 N N   . THR B 126 ? 0.5279 0.5186 0.5413 0.0745  0.0106  -0.0027 340 THR B N   
2405 C CA  . THR B 126 ? 0.5103 0.4976 0.5407 0.0723  0.0171  0.0215  340 THR B CA  
2406 C C   . THR B 126 ? 0.4756 0.4516 0.5130 0.0668  0.0184  0.0203  340 THR B C   
2407 O O   . THR B 126 ? 0.5241 0.4943 0.5894 0.0684  0.0141  0.0020  340 THR B O   
2408 C CB  . THR B 126 ? 0.5581 0.5388 0.6352 0.0810  0.0203  0.0320  340 THR B CB  
2409 O OG1 . THR B 126 ? 0.5666 0.5630 0.6347 0.0886  0.0192  0.0361  340 THR B OG1 
2410 C CG2 . THR B 126 ? 0.5760 0.5534 0.6709 0.0829  0.0315  0.0629  340 THR B CG2 
2411 N N   . LEU B 127 ? 0.4437 0.4233 0.4580 0.0600  0.0246  0.0352  341 LEU B N   
2412 C CA  . LEU B 127 ? 0.4467 0.4172 0.4638 0.0550  0.0263  0.0345  341 LEU B CA  
2413 C C   . LEU B 127 ? 0.4705 0.4333 0.5235 0.0536  0.0320  0.0519  341 LEU B C   
2414 O O   . LEU B 127 ? 0.4855 0.4557 0.5441 0.0567  0.0387  0.0753  341 LEU B O   
2415 C CB  . LEU B 127 ? 0.4195 0.3955 0.3976 0.0476  0.0338  0.0390  341 LEU B CB  
2416 C CG  . LEU B 127 ? 0.4203 0.3978 0.3655 0.0488  0.0378  0.0262  341 LEU B CG  
2417 C CD1 . LEU B 127 ? 0.3867 0.3624 0.3079 0.0402  0.0528  0.0299  341 LEU B CD1 
2418 C CD2 . LEU B 127 ? 0.4730 0.4475 0.4208 0.0603  0.0300  0.0104  341 LEU B CD2 
2419 N N   . THR B 128 ? 0.4789 0.4318 0.5571 0.0510  0.0312  0.0405  342 THR B N   
2420 C CA  . THR B 128 ? 0.4781 0.4213 0.5877 0.0469  0.0407  0.0562  342 THR B CA  
2421 C C   . THR B 128 ? 0.4693 0.4153 0.5566 0.0398  0.0402  0.0544  342 THR B C   
2422 O O   . THR B 128 ? 0.4469 0.3971 0.5300 0.0409  0.0331  0.0318  342 THR B O   
2423 C CB  . THR B 128 ? 0.4674 0.3971 0.6400 0.0471  0.0454  0.0396  342 THR B CB  
2424 O OG1 . THR B 128 ? 0.4860 0.4089 0.6856 0.0545  0.0507  0.0442  342 THR B OG1 
2425 C CG2 . THR B 128 ? 0.4677 0.3841 0.6752 0.0418  0.0603  0.0562  342 THR B CG2 
2426 N N   . CYS B 129 ? 0.4466 0.3969 0.5193 0.0351  0.0482  0.0781  343 CYS B N   
2427 C CA  A CYS B 129 ? 0.4251 0.3771 0.4803 0.0278  0.0500  0.0770  343 CYS B CA  
2428 C CA  B CYS B 129 ? 0.4273 0.3794 0.4820 0.0277  0.0501  0.0774  343 CYS B CA  
2429 C C   . CYS B 129 ? 0.4424 0.3869 0.5318 0.0234  0.0579  0.0887  343 CYS B C   
2430 O O   . CYS B 129 ? 0.4330 0.3803 0.5347 0.0249  0.0680  0.1148  343 CYS B O   
2431 C CB  A CYS B 129 ? 0.4288 0.3968 0.4431 0.0224  0.0554  0.0870  343 CYS B CB  
2432 C CB  B CYS B 129 ? 0.4272 0.3961 0.4418 0.0226  0.0555  0.0880  343 CYS B CB  
2433 S SG  A CYS B 129 ? 0.6294 0.5964 0.6271 0.0132  0.0618  0.0842  343 CYS B SG  
2434 S SG  B CYS B 129 ? 0.3830 0.3607 0.3658 0.0255  0.0532  0.0753  343 CYS B SG  
2435 N N   . SER B 130 ? 0.3974 0.3371 0.5026 0.0203  0.0548  0.0698  344 SER B N   
2436 C CA  . SER B 130 ? 0.4508 0.3834 0.5912 0.0140  0.0638  0.0753  344 SER B CA  
2437 C C   . SER B 130 ? 0.4452 0.3852 0.5579 0.0082  0.0637  0.0773  344 SER B C   
2438 O O   . SER B 130 ? 0.4389 0.3859 0.5274 0.0114  0.0561  0.0606  344 SER B O   
2439 C CB  . SER B 130 ? 0.4856 0.4148 0.6781 0.0132  0.0626  0.0449  344 SER B CB  
2440 O OG  . SER B 130 ? 0.5306 0.4580 0.7516 0.0052  0.0703  0.0412  344 SER B OG  
2441 N N   . SER B 131 ? 0.4357 0.3764 0.5527 0.0021  0.0746  0.1000  345 SER B N   
2442 C CA  . SER B 131 ? 0.4753 0.4231 0.5725 -0.0049 0.0767  0.1013  345 SER B CA  
2443 C C   . SER B 131 ? 0.4789 0.4204 0.6150 -0.0111 0.0855  0.1052  345 SER B C   
2444 O O   . SER B 131 ? 0.5085 0.4470 0.6665 -0.0114 0.0985  0.1296  345 SER B O   
2445 C CB  . SER B 131 ? 0.5088 0.4748 0.5702 -0.0084 0.0827  0.1198  345 SER B CB  
2446 O OG  . SER B 131 ? 0.4987 0.4711 0.5312 -0.0049 0.0783  0.1126  345 SER B OG  
2447 N N   . LYS B 132 ? 0.4496 0.3925 0.5956 -0.0135 0.0805  0.0825  346 LYS B N   
2448 C CA  . LYS B 132 ? 0.4567 0.3964 0.6428 -0.0212 0.0893  0.0793  346 LYS B CA  
2449 C C   . LYS B 132 ? 0.4425 0.3909 0.6051 -0.0273 0.0918  0.0869  346 LYS B C   
2450 O O   . LYS B 132 ? 0.4823 0.4394 0.6189 -0.0237 0.0837  0.0728  346 LYS B O   
2451 C CB  . LYS B 132 ? 0.4715 0.4187 0.6953 -0.0199 0.0823  0.0409  346 LYS B CB  
2452 C CG  . LYS B 132 ? 0.5583 0.4995 0.8267 -0.0183 0.0846  0.0238  346 LYS B CG  
2453 C CD  . LYS B 132 ? 0.6293 0.5919 0.9461 -0.0210 0.0812  -0.0220 346 LYS B CD  
2454 C CE  . LYS B 132 ? 0.6864 0.6521 1.0505 -0.0203 0.0829  -0.0509 346 LYS B CE  
2455 N NZ  . LYS B 132 ? 0.7199 0.6989 1.0399 -0.0066 0.0651  -0.0551 346 LYS B NZ  
2456 N N   . VAL B 133 ? 0.4401 0.3876 0.6135 -0.0342 0.1055  0.1108  347 VAL B N   
2457 C CA  . VAL B 133 ? 0.4287 0.3859 0.5908 -0.0418 0.1095  0.1137  347 VAL B CA  
2458 C C   . VAL B 133 ? 0.4304 0.3832 0.6375 -0.0470 0.1123  0.0939  347 VAL B C   
2459 O O   . VAL B 133 ? 0.4294 0.3700 0.6849 -0.0501 0.1238  0.0947  347 VAL B O   
2460 C CB  . VAL B 133 ? 0.4657 0.4358 0.6180 -0.0454 0.1230  0.1464  347 VAL B CB  
2461 C CG1 . VAL B 133 ? 0.4495 0.4326 0.5924 -0.0546 0.1272  0.1451  347 VAL B CG1 
2462 C CG2 . VAL B 133 ? 0.5265 0.5146 0.6399 -0.0403 0.1201  0.1584  347 VAL B CG2 
2463 N N   . CYS B 134 ? 0.4023 0.3665 0.5979 -0.0472 0.1046  0.0747  348 CYS B N   
2464 C CA  . CYS B 134 ? 0.3752 0.3472 0.6128 -0.0508 0.1048  0.0485  348 CYS B CA  
2465 C C   . CYS B 134 ? 0.3624 0.3430 0.5938 -0.0576 0.1096  0.0519  348 CYS B C   
2466 O O   . CYS B 134 ? 0.3849 0.3715 0.5748 -0.0542 0.1062  0.0590  348 CYS B O   
2467 C CB  . CYS B 134 ? 0.3646 0.3570 0.6016 -0.0381 0.0883  0.0141  348 CYS B CB  
2468 S SG  . CYS B 134 ? 0.5424 0.5315 0.7932 -0.0308 0.0818  0.0014  348 CYS B SG  
2469 N N   . SER B 135 ? 0.3483 0.3283 0.6264 -0.0680 0.1208  0.0450  349 SER B N   
2470 C CA  . SER B 135 ? 0.4193 0.4098 0.6993 -0.0751 0.1254  0.0435  349 SER B CA  
2471 C C   . SER B 135 ? 0.4265 0.4375 0.7497 -0.0758 0.1210  0.0032  349 SER B C   
2472 O O   . SER B 135 ? 0.3554 0.3637 0.7351 -0.0833 0.1303  -0.0156 349 SER B O   
2473 C CB  . SER B 135 ? 0.4470 0.4257 0.7430 -0.0870 0.1462  0.0741  349 SER B CB  
2474 O OG  . SER B 135 ? 0.4424 0.4326 0.7430 -0.0950 0.1509  0.0705  349 SER B OG  
2475 N N   . PHE B 136 ? 0.4168 0.4523 0.7175 -0.0670 0.1095  -0.0116 350 PHE B N   
2476 C CA  . PHE B 136 ? 0.4308 0.5037 0.7644 -0.0614 0.1013  -0.0532 350 PHE B CA  
2477 C C   . PHE B 136 ? 0.4492 0.5433 0.8057 -0.0521 0.0909  -0.0849 350 PHE B C   
2478 O O   . PHE B 136 ? 0.4401 0.5640 0.8522 -0.0571 0.0918  -0.1261 350 PHE B O   
2479 C CB  . PHE B 136 ? 0.4318 0.5063 0.8218 -0.0805 0.1168  -0.0667 350 PHE B CB  
2480 C CG  . PHE B 136 ? 0.4338 0.4992 0.8032 -0.0881 0.1252  -0.0420 350 PHE B CG  
2481 C CD1 . PHE B 136 ? 0.4331 0.5277 0.7911 -0.0804 0.1171  -0.0572 350 PHE B CD1 
2482 C CD2 . PHE B 136 ? 0.4374 0.4717 0.7986 -0.1003 0.1417  -0.0036 350 PHE B CD2 
2483 C CE1 . PHE B 136 ? 0.4297 0.5168 0.7719 -0.0884 0.1258  -0.0375 350 PHE B CE1 
2484 C CE2 . PHE B 136 ? 0.4544 0.4894 0.7977 -0.1074 0.1492  0.0150  350 PHE B CE2 
2485 C CZ  . PHE B 136 ? 0.4453 0.5036 0.7806 -0.1033 0.1415  -0.0034 350 PHE B CZ  
2486 N N   . GLY B 137 ? 0.4160 0.4990 0.7330 -0.0399 0.0826  -0.0693 351 GLY B N   
2487 C CA  . GLY B 137 ? 0.4256 0.5323 0.7566 -0.0290 0.0715  -0.0975 351 GLY B CA  
2488 C C   . GLY B 137 ? 0.4859 0.5698 0.8696 -0.0450 0.0837  -0.1062 351 GLY B C   
2489 O O   . GLY B 137 ? 0.5569 0.6602 0.9606 -0.0391 0.0768  -0.1339 351 GLY B O   
2490 N N   . LYS B 138 ? 0.4682 0.5131 0.8763 -0.0633 0.1046  -0.0812 352 LYS B N   
2491 C CA  . LYS B 138 ? 0.4346 0.4513 0.8981 -0.0755 0.1243  -0.0809 352 LYS B CA  
2492 C C   . LYS B 138 ? 0.4520 0.4286 0.8800 -0.0731 0.1319  -0.0294 352 LYS B C   
2493 O O   . LYS B 138 ? 0.4393 0.4043 0.8263 -0.0734 0.1349  0.0080  352 LYS B O   
2494 C CB  . LYS B 138 ? 0.4626 0.4694 0.9941 -0.0944 0.1502  -0.0905 352 LYS B CB  
2495 N N   . GLN B 139 ? 0.4877 0.4509 0.9343 -0.0700 0.1352  -0.0313 353 GLN B N   
2496 C CA  . GLN B 139 ? 0.4853 0.4191 0.9033 -0.0647 0.1423  0.0142  353 GLN B CA  
2497 C C   . GLN B 139 ? 0.4733 0.3823 0.9111 -0.0710 0.1699  0.0556  353 GLN B C   
2498 O O   . GLN B 139 ? 0.4880 0.3847 0.9881 -0.0796 0.1927  0.0463  353 GLN B O   
2499 C CB  . GLN B 139 ? 0.5242 0.4483 0.9735 -0.0607 0.1450  0.0006  353 GLN B CB  
2500 C CG  . GLN B 139 ? 0.5716 0.4699 0.9993 -0.0526 0.1545  0.0468  353 GLN B CG  
2501 C CD  . GLN B 139 ? 0.5628 0.4499 1.0267 -0.0486 0.1589  0.0320  353 GLN B CD  
2502 O OE1 . GLN B 139 ? 0.5485 0.4564 1.0261 -0.0486 0.1439  -0.0133 353 GLN B OE1 
2503 N NE2 . GLN B 139 ? 0.5569 0.4166 1.0374 -0.0425 0.1806  0.0707  353 GLN B NE2 
2504 N N   . VAL B 140 ? 0.4493 0.3579 0.8325 -0.0643 0.1686  0.0986  354 VAL B N   
2505 C CA  . VAL B 140 ? 0.4866 0.3908 0.8654 -0.0582 0.1859  0.1358  354 VAL B CA  
2506 C C   . VAL B 140 ? 0.4708 0.3752 0.8230 -0.0412 0.1885  0.1708  354 VAL B C   
2507 O O   . VAL B 140 ? 0.5154 0.4141 0.8873 -0.0291 0.2064  0.1939  354 VAL B O   
2508 C CB  . VAL B 140 ? 0.5501 0.4749 0.8860 -0.0620 0.1794  0.1473  354 VAL B CB  
2509 C CG1 . VAL B 140 ? 0.5464 0.4729 0.9161 -0.0759 0.1814  0.1166  354 VAL B CG1 
2510 C CG2 . VAL B 140 ? 0.5744 0.5175 0.8528 -0.0618 0.1622  0.1519  354 VAL B CG2 
2511 N N   . VAL B 141 ? 0.4510 0.3653 0.7614 -0.0386 0.1728  0.1747  355 VAL B N   
2512 C CA  . VAL B 141 ? 0.4574 0.3798 0.7432 -0.0226 0.1729  0.2022  355 VAL B CA  
2513 C C   . VAL B 141 ? 0.4875 0.4023 0.7637 -0.0239 0.1603  0.1879  355 VAL B C   
2514 O O   . VAL B 141 ? 0.4570 0.3807 0.7048 -0.0296 0.1397  0.1574  355 VAL B O   
2515 C CB  . VAL B 141 ? 0.7666 0.7269 0.9961 -0.0155 0.1668  0.2267  355 VAL B CB  
2516 C CG1 . VAL B 141 ? 0.8041 0.7833 1.0148 0.0028  0.1676  0.2517  355 VAL B CG1 
2517 C CG2 . VAL B 141 ? 0.7899 0.7605 1.0270 -0.0138 0.1782  0.2404  355 VAL B CG2 
2518 N N   . GLU B 142 ? 0.5216 0.4279 0.8102 -0.0119 0.1655  0.2000  356 GLU B N   
2519 C CA  . GLU B 142 ? 0.5250 0.4309 0.7949 -0.0088 0.1476  0.1795  356 GLU B CA  
2520 C C   . GLU B 142 ? 0.5288 0.4484 0.7722 0.0067  0.1495  0.2112  356 GLU B C   
2521 O O   . GLU B 142 ? 0.5383 0.4609 0.8001 0.0203  0.1667  0.2414  356 GLU B O   
2522 C CB  . GLU B 142 ? 0.5653 0.4477 0.8924 -0.0126 0.1505  0.1458  356 GLU B CB  
2523 C CG  . GLU B 142 ? 0.5680 0.4562 0.8743 -0.0078 0.1301  0.1204  356 GLU B CG  
2524 C CD  . GLU B 142 ? 0.6011 0.4777 0.9679 -0.0116 0.1336  0.0820  356 GLU B CD  
2525 O OE1 . GLU B 142 ? 0.6160 0.4756 1.0488 -0.0189 0.1563  0.0755  356 GLU B OE1 
2526 O OE2 . GLU B 142 ? 0.6249 0.5128 0.9766 -0.0077 0.1158  0.0556  356 GLU B OE2 
2527 N N   . LYS B 143 ? 0.5025 0.4393 0.6992 0.0079  0.1292  0.1968  357 LYS B N   
2528 C CA  . LYS B 143 ? 0.5475 0.5045 0.7197 0.0216  0.1281  0.2177  357 LYS B CA  
2529 C C   . LYS B 143 ? 0.4982 0.4427 0.6681 0.0229  0.1139  0.1906  357 LYS B C   
2530 O O   . LYS B 143 ? 0.4719 0.4158 0.6188 0.0147  0.0979  0.1594  357 LYS B O   
2531 C CB  . LYS B 143 ? 0.6200 0.6216 0.7378 0.0206  0.1212  0.2249  357 LYS B CB  
2532 C CG  . LYS B 143 ? 0.6727 0.7097 0.7643 0.0343  0.1186  0.2390  357 LYS B CG  
2533 C CD  . LYS B 143 ? 0.7487 0.7981 0.8639 0.0562  0.1363  0.2820  357 LYS B CD  
2534 C CE  . LYS B 143 ? 0.7884 0.8812 0.8782 0.0733  0.1319  0.2938  357 LYS B CE  
2535 N NZ  . LYS B 143 ? 0.8016 0.9558 0.8438 0.0673  0.1218  0.2798  357 LYS B NZ  
2536 N N   . VAL B 144 ? 0.4902 0.4258 0.6854 0.0355  0.1221  0.2048  358 VAL B N   
2537 C CA  . VAL B 144 ? 0.4274 0.3540 0.6230 0.0375  0.1097  0.1797  358 VAL B CA  
2538 C C   . VAL B 144 ? 0.4882 0.4402 0.6543 0.0516  0.1073  0.2003  358 VAL B C   
2539 O O   . VAL B 144 ? 0.4834 0.4435 0.6657 0.0678  0.1234  0.2367  358 VAL B O   
2540 C CB  . VAL B 144 ? 0.4758 0.3694 0.7387 0.0376  0.1217  0.1654  358 VAL B CB  
2541 C CG1 . VAL B 144 ? 0.4875 0.3796 0.7488 0.0386  0.1065  0.1334  358 VAL B CG1 
2542 C CG2 . VAL B 144 ? 0.4206 0.2999 0.7199 0.0234  0.1262  0.1409  358 VAL B CG2 
2543 N N   . GLU B 145 ? 0.5045 0.4720 0.6289 0.0474  0.0898  0.1778  359 GLU B N   
2544 C CA  . GLU B 145 ? 0.5355 0.5343 0.6309 0.0579  0.0860  0.1881  359 GLU B CA  
2545 C C   . GLU B 145 ? 0.5021 0.4883 0.5949 0.0579  0.0741  0.1613  359 GLU B C   
2546 O O   . GLU B 145 ? 0.4718 0.4377 0.5661 0.0487  0.0652  0.1315  359 GLU B O   
2547 C CB  . GLU B 145 ? 0.6098 0.6503 0.6574 0.0508  0.0815  0.1846  359 GLU B CB  
2548 C CG  . GLU B 145 ? 0.7258 0.8014 0.7694 0.0561  0.0928  0.2142  359 GLU B CG  
2549 C CD  . GLU B 145 ? 0.7929 0.9100 0.7988 0.0433  0.0898  0.1978  359 GLU B CD  
2550 O OE1 . GLU B 145 ? 0.8344 0.9328 0.8257 0.0273  0.0837  0.1666  359 GLU B OE1 
2551 O OE2 . GLU B 145 ? 0.8073 0.9795 0.8009 0.0506  0.0962  0.2158  359 GLU B OE2 
2552 N N   . THR B 146 ? 0.4667 0.4718 0.5541 0.0709  0.0742  0.1729  360 THR B N   
2553 C CA  . THR B 146 ? 0.5033 0.5013 0.5861 0.0717  0.0637  0.1491  360 THR B CA  
2554 C C   . THR B 146 ? 0.4712 0.5105 0.5113 0.0734  0.0578  0.1460  360 THR B C   
2555 O O   . THR B 146 ? 0.5042 0.5839 0.5348 0.0845  0.0635  0.1697  360 THR B O   
2556 C CB  . THR B 146 ? 0.6143 0.5913 0.7451 0.0853  0.0719  0.1588  360 THR B CB  
2557 O OG1 . THR B 146 ? 0.6643 0.6048 0.8427 0.0781  0.0782  0.1447  360 THR B OG1 
2558 C CG2 . THR B 146 ? 0.6313 0.6112 0.7533 0.0882  0.0609  0.1372  360 THR B CG2 
2559 N N   . GLU B 147 ? 0.4364 0.4716 0.4527 0.0639  0.0487  0.1161  361 GLU B N   
2560 C CA  . GLU B 147 ? 0.4630 0.5353 0.4458 0.0613  0.0474  0.1053  361 GLU B CA  
2561 C C   . GLU B 147 ? 0.4511 0.5125 0.4285 0.0621  0.0405  0.0833  361 GLU B C   
2562 O O   . GLU B 147 ? 0.4157 0.4473 0.3922 0.0569  0.0366  0.0648  361 GLU B O   
2563 C CB  . GLU B 147 ? 0.4628 0.5462 0.4188 0.0447  0.0526  0.0904  361 GLU B CB  
2564 C CG  . GLU B 147 ? 0.5162 0.6418 0.4480 0.0375  0.0574  0.0717  361 GLU B CG  
2565 C CD  . GLU B 147 ? 0.5770 0.7666 0.5072 0.0478  0.0586  0.0858  361 GLU B CD  
2566 O OE1 . GLU B 147 ? 0.5909 0.7935 0.5318 0.0584  0.0601  0.1143  361 GLU B OE1 
2567 O OE2 . GLU B 147 ? 0.5840 0.8165 0.5029 0.0472  0.0595  0.0686  361 GLU B OE2 
2568 N N   . ARG B 148 ? 0.4528 0.5457 0.4255 0.0710  0.0393  0.0859  362 ARG B N   
2569 C CA  . ARG B 148 ? 0.4442 0.5314 0.4115 0.0719  0.0337  0.0653  362 ARG B CA  
2570 C C   . ARG B 148 ? 0.4580 0.5615 0.3939 0.0574  0.0388  0.0398  362 ARG B C   
2571 O O   . ARG B 148 ? 0.4801 0.6188 0.4024 0.0492  0.0468  0.0364  362 ARG B O   
2572 C CB  . ARG B 148 ? 0.4606 0.5739 0.4413 0.0894  0.0317  0.0791  362 ARG B CB  
2573 N N   . ALA B 149 ? 0.4059 0.7342 0.4405 0.1036  -0.0112 -0.0346 363 ALA B N   
2574 C CA  . ALA B 149 ? 0.4445 0.8083 0.4646 0.0727  -0.0092 -0.0273 363 ALA B CA  
2575 C C   . ALA B 149 ? 0.4671 0.9004 0.4975 0.0696  -0.0023 -0.0260 363 ALA B C   
2576 O O   . ALA B 149 ? 0.4889 0.9551 0.5312 0.0987  -0.0002 -0.0320 363 ALA B O   
2577 C CB  . ALA B 149 ? 0.4644 0.8427 0.4638 0.0693  -0.0067 -0.0341 363 ALA B CB  
2578 N N   . GLN B 150 ? 0.4614 0.9172 0.4886 0.0350  0.0017  -0.0199 364 GLN B N   
2579 C CA  . GLN B 150 ? 0.4988 1.0323 0.5413 0.0253  0.0093  -0.0258 364 GLN B CA  
2580 C C   . GLN B 150 ? 0.4756 1.0357 0.5088 -0.0119 0.0223  -0.0237 364 GLN B C   
2581 O O   . GLN B 150 ? 0.4439 0.9573 0.4645 -0.0415 0.0240  -0.0120 364 GLN B O   
2582 C CB  . GLN B 150 ? 0.5297 1.0683 0.5889 0.0174  0.0039  -0.0246 364 GLN B CB  
2583 C CG  . GLN B 150 ? 0.5856 1.0910 0.6487 0.0524  -0.0051 -0.0201 364 GLN B CG  
2584 C CD  . GLN B 150 ? 0.6288 1.2016 0.7051 0.0834  -0.0053 -0.0267 364 GLN B CD  
2585 O OE1 . GLN B 150 ? 0.6703 1.3158 0.7540 0.0900  -0.0002 -0.0386 364 GLN B OE1 
2586 N NE2 . GLN B 150 ? 0.6196 1.1733 0.6975 0.1045  -0.0107 -0.0188 364 GLN B NE2 
2587 N N   . LEU B 151 ? 0.4540 1.0876 0.4926 -0.0086 0.0334  -0.0342 365 LEU B N   
2588 C CA  . LEU B 151 ? 0.4523 1.1160 0.4816 -0.0431 0.0516  -0.0306 365 LEU B CA  
2589 C C   . LEU B 151 ? 0.4324 1.1255 0.4843 -0.0854 0.0619  -0.0329 365 LEU B C   
2590 O O   . LEU B 151 ? 0.4332 1.2021 0.5161 -0.0845 0.0633  -0.0513 365 LEU B O   
2591 C CB  . LEU B 151 ? 0.4484 1.1893 0.4799 -0.0253 0.0617  -0.0443 365 LEU B CB  
2592 C CG  . LEU B 151 ? 0.4761 1.2567 0.4960 -0.0584 0.0854  -0.0397 365 LEU B CG  
2593 C CD1 . LEU B 151 ? 0.4884 1.1909 0.4682 -0.0737 0.0890  -0.0160 365 LEU B CD1 
2594 C CD2 . LEU B 151 ? 0.4579 1.3116 0.4786 -0.0327 0.0915  -0.0558 365 LEU B CD2 
2595 N N   . GLU B 152 ? 0.4214 1.0553 0.4589 -0.1205 0.0688  -0.0168 366 GLU B N   
2596 C CA  . GLU B 152 ? 0.4323 1.0799 0.4936 -0.1651 0.0806  -0.0211 366 GLU B CA  
2597 C C   . GLU B 152 ? 0.5293 1.1427 0.5695 -0.2054 0.1047  -0.0021 366 GLU B C   
2598 O O   . GLU B 152 ? 0.5662 1.0954 0.5717 -0.2053 0.1018  0.0206  366 GLU B O   
2599 C CB  . GLU B 152 ? 0.4220 1.0158 0.4923 -0.1660 0.0633  -0.0212 366 GLU B CB  
2600 C CG  . GLU B 152 ? 0.4121 1.0382 0.5007 -0.1280 0.0438  -0.0356 366 GLU B CG  
2601 C CD  . GLU B 152 ? 0.4766 1.0638 0.5754 -0.1333 0.0306  -0.0374 366 GLU B CD  
2602 O OE1 . GLU B 152 ? 0.5464 1.1521 0.6542 -0.1012 0.0165  -0.0442 366 GLU B OE1 
2603 O OE2 . GLU B 152 ? 0.5129 1.0500 0.6090 -0.1675 0.0357  -0.0313 366 GLU B OE2 
2604 N N   . ASP B 153 ? 0.6008 1.2817 0.6618 -0.2381 0.1299  -0.0112 367 ASP B N   
2605 C CA  . ASP B 153 ? 0.6939 1.3363 0.7372 -0.2785 0.1577  0.0082  367 ASP B CA  
2606 C C   . ASP B 153 ? 0.6906 1.2859 0.6771 -0.2632 0.1650  0.0395  367 ASP B C   
2607 O O   . ASP B 153 ? 0.7311 1.2442 0.6845 -0.2788 0.1738  0.0669  367 ASP B O   
2608 C CB  . ASP B 153 ? 0.7687 1.3421 0.8227 -0.3142 0.1612  0.0133  367 ASP B CB  
2609 C CG  . ASP B 153 ? 0.8772 1.4164 0.9304 -0.3550 0.1916  0.0239  367 ASP B CG  
2610 O OD1 . ASP B 153 ? 0.8889 1.4819 0.9526 -0.3622 0.2083  0.0156  367 ASP B OD1 
2611 O OD2 . ASP B 153 ? 0.9508 1.4070 0.9941 -0.3781 0.1994  0.0407  367 ASP B OD2 
2612 N N   . GLY B 154 ? 0.6461 1.2882 0.6193 -0.2260 0.1578  0.0330  368 GLY B N   
2613 C CA  . GLY B 154 ? 0.6995 1.3109 0.6200 -0.2051 0.1616  0.0546  368 GLY B CA  
2614 C C   . GLY B 154 ? 0.7009 1.2409 0.5923 -0.1654 0.1317  0.0608  368 GLY B C   
2615 O O   . GLY B 154 ? 0.7234 1.2568 0.5777 -0.1373 0.1276  0.0671  368 GLY B O   
2616 N N   . ARG B 155 ? 0.6676 1.1606 0.5779 -0.1634 0.1113  0.0558  369 ARG B N   
2617 C CA  . ARG B 155 ? 0.6793 1.1065 0.5697 -0.1309 0.0848  0.0588  369 ARG B CA  
2618 C C   . ARG B 155 ? 0.5630 1.0035 0.4884 -0.1056 0.0622  0.0360  369 ARG B C   
2619 O O   . ARG B 155 ? 0.5224 1.0125 0.4839 -0.1141 0.0646  0.0216  369 ARG B O   
2621 N N   . PHE B 156 ? 0.4942 0.8921 0.4088 -0.0738 0.0417  0.0323  370 PHE B N   
2622 C CA  . PHE B 156 ? 0.4135 0.8132 0.3571 -0.0483 0.0249  0.0153  370 PHE B CA  
2623 C C   . PHE B 156 ? 0.4221 0.7602 0.3739 -0.0538 0.0113  0.0200  370 PHE B C   
2624 O O   . PHE B 156 ? 0.4385 0.7186 0.3684 -0.0543 0.0038  0.0293  370 PHE B O   
2625 C CB  . PHE B 156 ? 0.4464 0.8458 0.3826 -0.0105 0.0151  0.0020  370 PHE B CB  
2626 C CG  . PHE B 156 ? 0.4826 0.9485 0.4135 0.0006  0.0268  -0.0074 370 PHE B CG  
2627 C CD1 . PHE B 156 ? 0.4705 0.9949 0.4289 0.0153  0.0300  -0.0224 370 PHE B CD1 
2628 C CD2 . PHE B 156 ? 0.5273 1.0009 0.4231 0.0000  0.0348  -0.0013 370 PHE B CD2 
2629 C CE1 . PHE B 156 ? 0.4945 1.0850 0.4500 0.0276  0.0405  -0.0339 370 PHE B CE1 
2630 C CE2 . PHE B 156 ? 0.5746 1.1153 0.4655 0.0109  0.0465  -0.0116 370 PHE B CE2 
2631 C CZ  . PHE B 156 ? 0.5310 1.1306 0.4539 0.0239  0.0492  -0.0293 370 PHE B CZ  
2632 N N   . VAL B 157 ? 0.3886 0.7452 0.3705 -0.0549 0.0078  0.0123  371 VAL B N   
2633 C CA  . VAL B 157 ? 0.4083 0.7175 0.3999 -0.0605 -0.0033 0.0149  371 VAL B CA  
2634 C C   . VAL B 157 ? 0.3728 0.6696 0.3796 -0.0285 -0.0149 0.0070  371 VAL B C   
2635 O O   . VAL B 157 ? 0.3472 0.6851 0.3667 -0.0063 -0.0125 -0.0007 371 VAL B O   
2636 C CB  . VAL B 157 ? 0.3877 0.7264 0.4008 -0.0890 0.0029  0.0116  371 VAL B CB  
2637 C CG1 . VAL B 157 ? 0.3826 0.6709 0.4021 -0.0959 -0.0082 0.0131  371 VAL B CG1 
2638 C CG2 . VAL B 157 ? 0.4393 0.7918 0.4438 -0.1246 0.0212  0.0183  371 VAL B CG2 
2639 N N   . TYR B 158 ? 0.3380 0.5764 0.3429 -0.0253 -0.0256 0.0096  372 TYR B N   
2640 C CA  . TYR B 158 ? 0.2891 0.5064 0.3095 -0.0003 -0.0319 0.0045  372 TYR B CA  
2641 C C   . TYR B 158 ? 0.3640 0.5630 0.3963 -0.0094 -0.0368 0.0078  372 TYR B C   
2642 O O   . TYR B 158 ? 0.4116 0.5723 0.4373 -0.0257 -0.0430 0.0106  372 TYR B O   
2643 C CB  . TYR B 158 ? 0.2977 0.4699 0.3113 0.0134  -0.0388 -0.0018 372 TYR B CB  
2644 C CG  . TYR B 158 ? 0.3153 0.5074 0.3139 0.0233  -0.0360 -0.0089 372 TYR B CG  
2645 C CD1 . TYR B 158 ? 0.3154 0.5216 0.3258 0.0490  -0.0329 -0.0219 372 TYR B CD1 
2646 C CD2 . TYR B 158 ? 0.3826 0.5779 0.3533 0.0088  -0.0349 -0.0020 372 TYR B CD2 
2647 C CE1 . TYR B 158 ? 0.3327 0.5623 0.3301 0.0597  -0.0311 -0.0326 372 TYR B CE1 
2648 C CE2 . TYR B 158 ? 0.3879 0.6081 0.3410 0.0202  -0.0316 -0.0084 372 TYR B CE2 
2649 C CZ  . TYR B 158 ? 0.3976 0.6385 0.3654 0.0455  -0.0309 -0.0260 372 TYR B CZ  
2650 O OH  . TYR B 158 ? 0.4143 0.6851 0.3654 0.0585  -0.0284 -0.0365 372 TYR B OH  
2651 N N   . ARG B 159 ? 0.3369 0.5651 0.3842 0.0050  -0.0342 0.0074  373 ARG B N   
2652 C CA  . ARG B 159 ? 0.3470 0.5714 0.4036 -0.0011 -0.0382 0.0088  373 ARG B CA  
2653 C C   . ARG B 159 ? 0.3576 0.5557 0.4218 0.0246  -0.0373 0.0135  373 ARG B C   
2654 O O   . ARG B 159 ? 0.3469 0.5643 0.4141 0.0515  -0.0303 0.0176  373 ARG B O   
2655 C CB  . ARG B 159 ? 0.3405 0.6328 0.4066 -0.0076 -0.0354 0.0034  373 ARG B CB  
2656 C CG  . ARG B 159 ? 0.3657 0.6771 0.4320 -0.0437 -0.0325 -0.0027 373 ARG B CG  
2657 C CD  . ARG B 159 ? 0.3957 0.7835 0.4807 -0.0519 -0.0297 -0.0164 373 ARG B CD  
2658 N NE  . ARG B 159 ? 0.4439 0.8481 0.5360 -0.0920 -0.0219 -0.0245 373 ARG B NE  
2659 C CZ  . ARG B 159 ? 0.4353 0.8742 0.5268 -0.1041 -0.0102 -0.0259 373 ARG B CZ  
2660 N NH1 . ARG B 159 ? 0.4081 0.8720 0.4922 -0.0764 -0.0080 -0.0224 373 ARG B NH1 
2661 N NH2 . ARG B 159 ? 0.4630 0.9097 0.5624 -0.1444 0.0016  -0.0313 373 ARG B NH2 
2662 N N   . LEU B 160 ? 0.3229 0.4751 0.3896 0.0170  -0.0424 0.0137  374 LEU B N   
2663 C CA  . LEU B 160 ? 0.3386 0.4650 0.4146 0.0351  -0.0376 0.0189  374 LEU B CA  
2664 C C   . LEU B 160 ? 0.3370 0.4700 0.4158 0.0258  -0.0422 0.0192  374 LEU B C   
2665 O O   . LEU B 160 ? 0.3081 0.4049 0.3914 0.0162  -0.0469 0.0155  374 LEU B O   
2666 C CB  . LEU B 160 ? 0.3314 0.4040 0.4145 0.0357  -0.0379 0.0130  374 LEU B CB  
2667 C CG  . LEU B 160 ? 0.3938 0.4576 0.4781 0.0470  -0.0340 0.0061  374 LEU B CG  
2668 C CD1 . LEU B 160 ? 0.4072 0.4810 0.4758 0.0326  -0.0435 -0.0011 374 LEU B CD1 
2669 C CD2 . LEU B 160 ? 0.4511 0.4693 0.5545 0.0536  -0.0290 -0.0033 374 LEU B CD2 
2670 N N   . LEU B 161 ? 0.3111 0.4973 0.3886 0.0301  -0.0417 0.0198  375 LEU B N   
2671 C CA  . LEU B 161 ? 0.3192 0.5239 0.4002 0.0191  -0.0481 0.0131  375 LEU B CA  
2672 C C   . LEU B 161 ? 0.3243 0.5370 0.4041 0.0443  -0.0418 0.0227  375 LEU B C   
2673 O O   . LEU B 161 ? 0.3245 0.5482 0.3981 0.0735  -0.0312 0.0368  375 LEU B O   
2674 C CB  . LEU B 161 ? 0.3014 0.5690 0.3861 0.0054  -0.0520 0.0007  375 LEU B CB  
2675 C CG  . LEU B 161 ? 0.3197 0.5841 0.4043 -0.0220 -0.0525 -0.0057 375 LEU B CG  
2676 C CD1 . LEU B 161 ? 0.3449 0.6780 0.4412 -0.0384 -0.0520 -0.0213 375 LEU B CD1 
2677 C CD2 . LEU B 161 ? 0.3214 0.5239 0.4019 -0.0461 -0.0582 -0.0071 375 LEU B CD2 
2678 N N   . ARG B 162 ? 0.3027 0.5077 0.3864 0.0348  -0.0470 0.0162  376 ARG B N   
2679 C CA  . ARG B 162 ? 0.3270 0.5483 0.4064 0.0568  -0.0405 0.0246  376 ARG B CA  
2680 C C   . ARG B 162 ? 0.3692 0.5501 0.4452 0.0801  -0.0227 0.0463  376 ARG B C   
2681 O O   . ARG B 162 ? 0.3691 0.5683 0.4334 0.1085  -0.0105 0.0633  376 ARG B O   
2682 C CB  . ARG B 162 ? 0.3361 0.6345 0.4077 0.0751  -0.0424 0.0219  376 ARG B CB  
2683 C CG  . ARG B 162 ? 0.3154 0.6587 0.3986 0.0481  -0.0568 -0.0053 376 ARG B CG  
2684 C CD  . ARG B 162 ? 0.2939 0.7261 0.3748 0.0676  -0.0603 -0.0157 376 ARG B CD  
2685 N NE  . ARG B 162 ? 0.3302 0.7842 0.3986 0.0948  -0.0579 -0.0092 376 ARG B NE  
2686 C CZ  . ARG B 162 ? 0.3224 0.7859 0.3974 0.0825  -0.0656 -0.0273 376 ARG B CZ  
2687 N NH1 . ARG B 162 ? 0.2637 0.7086 0.3588 0.0436  -0.0760 -0.0523 376 ARG B NH1 
2688 N NH2 . ARG B 162 ? 0.3286 0.8182 0.3882 0.1111  -0.0614 -0.0193 376 ARG B NH2 
2689 N N   . SER B 163 ? 0.3751 0.5015 0.4613 0.0688  -0.0200 0.0451  377 SER B N   
2690 C CA  . SER B 163 ? 0.4285 0.5097 0.5211 0.0829  -0.0011 0.0588  377 SER B CA  
2691 C C   . SER B 163 ? 0.3969 0.4659 0.4946 0.0827  0.0072  0.0627  377 SER B C   
2692 O O   . SER B 163 ? 0.4108 0.4750 0.5177 0.0624  -0.0051 0.0460  377 SER B O   
2693 C CB  . SER B 163 ? 0.4758 0.5123 0.5837 0.0679  -0.0034 0.0467  377 SER B CB  
2694 O OG  . SER B 163 ? 0.5686 0.5614 0.6917 0.0760  0.0162  0.0529  377 SER B OG  
2695 N N   . PRO B 164 ? 0.3972 0.4615 0.4867 0.1076  0.0295  0.0859  378 PRO B N   
2696 C CA  . PRO B 164 ? 0.3719 0.4291 0.4638 0.1091  0.0425  0.0929  378 PRO B CA  
2697 C C   . PRO B 164 ? 0.3627 0.3741 0.4843 0.0843  0.0457  0.0771  378 PRO B C   
2698 O O   . PRO B 164 ? 0.3690 0.3385 0.5089 0.0787  0.0555  0.0743  378 PRO B O   
2699 C CB  . PRO B 164 ? 0.4385 0.4836 0.5139 0.1421  0.0720  0.1267  378 PRO B CB  
2700 C CG  . PRO B 164 ? 0.4475 0.5229 0.5036 0.1646  0.0650  0.1344  378 PRO B CG  
2701 C CD  . PRO B 164 ? 0.4090 0.4778 0.4822 0.1394  0.0448  0.1091  378 PRO B CD  
2702 N N   . MET B 165 ? 0.3520 0.3768 0.4806 0.0709  0.0363  0.0624  379 MET B N   
2703 C CA  . MET B 165 ? 0.3643 0.3580 0.5224 0.0510  0.0380  0.0442  379 MET B CA  
2704 C C   . MET B 165 ? 0.3824 0.3460 0.5556 0.0565  0.0730  0.0607  379 MET B C   
2705 O O   . MET B 165 ? 0.4026 0.3774 0.5572 0.0757  0.0941  0.0871  379 MET B O   
2706 C CB  . MET B 165 ? 0.3440 0.3633 0.5041 0.0408  0.0205  0.0251  379 MET B CB  
2707 C CG  . MET B 165 ? 0.4250 0.4227 0.6149 0.0229  0.0147  0.0001  379 MET B CG  
2708 S SD  . MET B 165 ? 0.3706 0.3944 0.5592 0.0156  -0.0111 -0.0248 379 MET B SD  
2709 C CE  . MET B 165 ? 0.4222 0.4379 0.5952 0.0070  -0.0413 -0.0355 379 MET B CE  
2710 O O   . P1L B 166 ? 0.3914 0.3404 0.6257 0.0275  0.1068  0.0376  380 P1L B O   
2711 N N   . P1L B 166 ? 0.4329 0.3594 0.6395 0.0403  0.0807  0.0447  380 P1L B N   
2712 C CA  . P1L B 166 ? 0.4792 0.3739 0.7112 0.0363  0.1161  0.0529  380 P1L B CA  
2713 C CB  . P1L B 166 ? 0.5315 0.3975 0.8093 0.0136  0.1173  0.0210  380 P1L B CB  
2714 S SG  . P1L B 166 ? 1.2508 1.0944 1.5331 0.0142  0.1037  0.0075  380 P1L B SG  
2715 C C7  . P1L B 166 ? 0.9909 0.8704 1.2392 0.0184  0.0608  -0.0003 380 P1L B C7  
2716 O O7  . P1L B 166 ? 0.9909 0.8937 1.2054 0.0316  0.0528  0.0192  380 P1L B O7  
2717 C C8  . P1L B 166 ? 0.9371 0.8238 1.2039 0.0027  0.0354  -0.0355 380 P1L B C8  
2718 C C9  . P1L B 166 ? 0.8597 0.7681 1.0950 0.0047  0.0035  -0.0377 380 P1L B C9  
2719 C C10 . P1L B 166 ? 0.8095 0.7112 1.0418 0.0042  -0.0117 -0.0517 380 P1L B C10 
2720 C C11 . P1L B 166 ? 0.7449 0.6596 0.9541 0.0010  -0.0411 -0.0599 380 P1L B C11 
2721 C C12 . P1L B 166 ? 0.6765 0.5941 0.8994 -0.0046 -0.0526 -0.0786 380 P1L B C12 
2722 C C13 . P1L B 166 ? 0.6270 0.5484 0.8216 -0.0051 -0.0771 -0.0786 380 P1L B C13 
2723 C C14 . P1L B 166 ? 0.5959 0.5274 0.7895 -0.0072 -0.0783 -0.0762 380 P1L B C14 
2724 C C15 . P1L B 166 ? 0.6143 0.5405 0.7866 -0.0070 -0.1001 -0.0822 380 P1L B C15 
2725 C C16 . P1L B 166 ? 0.6198 0.5569 0.8017 -0.0022 -0.1016 -0.0940 380 P1L B C16 
2726 C C17 . P1L B 166 ? 0.6337 0.5841 0.8387 -0.0073 -0.0904 -0.0963 380 P1L B C17 
2727 C C18 . P1L B 166 ? 0.6360 0.5987 0.8422 -0.0032 -0.0974 -0.1085 380 P1L B C18 
2728 C C19 . P1L B 166 ? 0.6347 0.6075 0.8603 0.0036  -0.0947 -0.1237 380 P1L B C19 
2729 C C20 . P1L B 166 ? 0.6516 0.6301 0.8696 0.0133  -0.1076 -0.1338 380 P1L B C20 
2730 C C   . P1L B 166 ? 0.4336 0.3502 0.6667 0.0351  0.1295  0.0582  380 P1L B C   
2731 C C21 . P1L B 166 ? 0.6412 0.6409 0.8881 0.0203  -0.1055 -0.1537 380 P1L B C21 
2732 C C22 . P1L B 166 ? 0.6587 0.6652 0.9026 0.0325  -0.1183 -0.1653 380 P1L B C22 
2733 N N   . GLU B 167 ? 0.4588 0.3551 0.6900 0.0445  0.1692  0.0874  381 GLU B N   
2734 C CA  . GLU B 167 ? 0.5714 0.4895 0.8012 0.0452  0.1892  0.0970  381 GLU B CA  
2735 C C   . GLU B 167 ? 0.5191 0.4446 0.7950 0.0165  0.1848  0.0592  381 GLU B C   
2736 O O   . GLU B 167 ? 0.4777 0.4417 0.7519 0.0156  0.1795  0.0503  381 GLU B O   
2737 C CB  . GLU B 167 ? 0.7770 0.6596 0.9976 0.0590  0.2395  0.1388  381 GLU B CB  
2738 C CG  . GLU B 167 ? 0.9565 0.8602 1.1743 0.0597  0.2679  0.1532  381 GLU B CG  
2739 C CD  . GLU B 167 ? 1.0820 1.0412 1.2455 0.0919  0.2577  0.1755  381 GLU B CD  
2740 O OE1 . GLU B 167 ? 1.2315 1.1828 1.3568 0.1217  0.2873  0.2200  381 GLU B OE1 
2741 O OE2 . GLU B 167 ? 1.1038 1.1147 1.2627 0.0892  0.2206  0.1473  381 GLU B OE2 
2742 N N   . TYR B 168 ? 0.4303 0.5817 0.4672 0.0885  0.1276  0.2016  382 TYR B N   
2743 C CA  . TYR B 168 ? 0.4250 0.5282 0.5014 0.0586  0.1150  0.1973  382 TYR B CA  
2744 C C   . TYR B 168 ? 0.3656 0.4853 0.4665 0.0335  0.0891  0.1669  382 TYR B C   
2745 O O   . TYR B 168 ? 0.3371 0.4610 0.4697 0.0255  0.0826  0.1569  382 TYR B O   
2746 C CB  . TYR B 168 ? 0.4480 0.4683 0.5184 0.0405  0.1075  0.2092  382 TYR B CB  
2747 C CG  . TYR B 168 ? 0.4645 0.4420 0.5820 0.0134  0.0857  0.1989  382 TYR B CG  
2748 C CD1 . TYR B 168 ? 0.5127 0.4775 0.6763 0.0122  0.0988  0.2108  382 TYR B CD1 
2749 C CD2 . TYR B 168 ? 0.4419 0.3921 0.5607 -0.0079 0.0549  0.1776  382 TYR B CD2 
2750 C CE1 . TYR B 168 ? 0.5213 0.4599 0.7423 -0.0108 0.0756  0.1982  382 TYR B CE1 
2751 C CE2 . TYR B 168 ? 0.4941 0.4098 0.6528 -0.0249 0.0305  0.1659  382 TYR B CE2 
2752 C CZ  . TYR B 168 ? 0.5143 0.4308 0.7296 -0.0269 0.0379  0.1746  382 TYR B CZ  
2753 O OH  . TYR B 168 ? 0.5280 0.4225 0.7968 -0.0422 0.0105  0.1600  382 TYR B OH  
2754 N N   . LEU B 169 ? 0.3475 0.4723 0.4339 0.0226  0.0796  0.1539  383 LEU B N   
2755 C CA  . LEU B 169 ? 0.3805 0.5072 0.4862 -0.0028 0.0625  0.1266  383 LEU B CA  
2756 C C   . LEU B 169 ? 0.3428 0.5433 0.4692 0.0049  0.0595  0.1028  383 LEU B C   
2757 O O   . LEU B 169 ? 0.2810 0.4753 0.4266 -0.0095 0.0479  0.0842  383 LEU B O   
2758 C CB  . LEU B 169 ? 0.4460 0.5554 0.5354 -0.0149 0.0648  0.1228  383 LEU B CB  
2759 C CG  . LEU B 169 ? 0.5387 0.5992 0.6322 -0.0426 0.0557  0.1058  383 LEU B CG  
2760 C CD1 . LEU B 169 ? 0.6031 0.5831 0.6826 -0.0477 0.0390  0.1123  383 LEU B CD1 
2761 C CD2 . LEU B 169 ? 0.5885 0.6271 0.6636 -0.0483 0.0715  0.1100  383 LEU B CD2 
2762 N N   . VAL B 170 ? 0.3539 0.6210 0.4699 0.0328  0.0674  0.1018  384 VAL B N   
2763 C CA  . VAL B 170 ? 0.3318 0.6682 0.4559 0.0506  0.0587  0.0758  384 VAL B CA  
2764 C C   . VAL B 170 ? 0.3345 0.6565 0.4548 0.0662  0.0644  0.0833  384 VAL B C   
2765 O O   . VAL B 170 ? 0.3393 0.6760 0.4704 0.0627  0.0521  0.0588  384 VAL B O   
2766 C CB  . VAL B 170 ? 0.2854 0.6928 0.3879 0.0915  0.0629  0.0754  384 VAL B CB  
2767 C CG1 . VAL B 170 ? 0.3008 0.7726 0.3998 0.1190  0.0471  0.0446  384 VAL B CG1 
2768 C CG2 . VAL B 170 ? 0.2779 0.7143 0.3989 0.0776  0.0595  0.0660  384 VAL B CG2 
2769 N N   . ASN B 171 ? 0.3171 0.6068 0.4244 0.0835  0.0870  0.1179  385 ASN B N   
2770 C CA  . ASN B 171 ? 0.3737 0.6469 0.4900 0.0979  0.1034  0.1321  385 ASN B CA  
2771 C C   . ASN B 171 ? 0.3156 0.5512 0.4722 0.0633  0.0879  0.1209  385 ASN B C   
2772 O O   . ASN B 171 ? 0.3033 0.5497 0.4699 0.0720  0.0889  0.1119  385 ASN B O   
2773 C CB  . ASN B 171 ? 0.5306 0.7679 0.6409 0.1140  0.1357  0.1715  385 ASN B CB  
2774 C CG  . ASN B 171 ? 0.7654 0.9888 0.8981 0.1296  0.1638  0.1902  385 ASN B CG  
2775 O OD1 . ASN B 171 ? 0.9380 1.1916 1.0605 0.1532  0.1680  0.1801  385 ASN B OD1 
2776 N ND2 . ASN B 171 ? 0.8256 1.0011 0.9923 0.1170  0.1846  0.2166  385 ASN B ND2 
2777 N N   . PHE B 172 ? 0.2707 0.4583 0.4416 0.0305  0.0734  0.1217  386 PHE B N   
2778 C CA  . PHE B 172 ? 0.2971 0.4435 0.4963 0.0041  0.0545  0.1100  386 PHE B CA  
2779 C C   . PHE B 172 ? 0.2966 0.4613 0.4918 -0.0043 0.0399  0.0785  386 PHE B C   
2780 O O   . PHE B 172 ? 0.3002 0.4542 0.5128 -0.0061 0.0345  0.0702  386 PHE B O   
2781 C CB  . PHE B 172 ? 0.3400 0.4257 0.5324 -0.0190 0.0386  0.1132  386 PHE B CB  
2782 C CG  . PHE B 172 ? 0.3329 0.3706 0.5407 -0.0370 0.0153  0.0997  386 PHE B CG  
2783 C CD1 . PHE B 172 ? 0.3135 0.3363 0.5650 -0.0363 0.0088  0.1057  386 PHE B CD1 
2784 C CD2 . PHE B 172 ? 0.3032 0.3095 0.4843 -0.0518 0.0026  0.0813  386 PHE B CD2 
2785 C CE1 . PHE B 172 ? 0.3078 0.2909 0.5711 -0.0454 -0.0172 0.0912  386 PHE B CE1 
2786 C CE2 . PHE B 172 ? 0.3625 0.3163 0.5432 -0.0594 -0.0173 0.0703  386 PHE B CE2 
2787 C CZ  . PHE B 172 ? 0.3363 0.2812 0.5556 -0.0538 -0.0309 0.0741  386 PHE B CZ  
2788 N N   . LEU B 173 ? 0.2631 0.4558 0.4406 -0.0097 0.0348  0.0599  387 LEU B N   
2789 C CA  . LEU B 173 ? 0.2706 0.4769 0.4509 -0.0230 0.0220  0.0255  387 LEU B CA  
2790 C C   . LEU B 173 ? 0.2822 0.5295 0.4575 0.0035  0.0222  0.0125  387 LEU B C   
2791 O O   . LEU B 173 ? 0.3081 0.5393 0.4855 -0.0034 0.0136  -0.0075 387 LEU B O   
2792 C CB  . LEU B 173 ? 0.3012 0.5402 0.4834 -0.0358 0.0192  0.0065  387 LEU B CB  
2793 C CG  . LEU B 173 ? 0.3140 0.4997 0.4946 -0.0627 0.0240  0.0145  387 LEU B CG  
2794 C CD1 . LEU B 173 ? 0.2763 0.5086 0.4723 -0.0703 0.0302  0.0020  387 LEU B CD1 
2795 C CD2 . LEU B 173 ? 0.3568 0.4760 0.5356 -0.0871 0.0191  0.0013  387 LEU B CD2 
2796 N N   . HIS B 174 ? 0.2887 0.5806 0.4467 0.0397  0.0344  0.0252  388 HIS B N   
2797 C CA  . HIS B 174 ? 0.5411 0.8653 0.6762 0.0776  0.0381  0.0159  388 HIS B CA  
2798 C C   . HIS B 174 ? 0.4778 0.7664 0.6250 0.0846  0.0528  0.0332  388 HIS B C   
2799 O O   . HIS B 174 ? 0.4774 0.7693 0.6105 0.1001  0.0492  0.0156  388 HIS B O   
2800 C CB  . HIS B 174 ? 0.6167 0.9817 0.7172 0.1244  0.0547  0.0335  388 HIS B CB  
2801 C CG  . HIS B 174 ? 0.7791 1.1750 0.8362 0.1748  0.0563  0.0203  388 HIS B CG  
2802 N ND1 . HIS B 174 ? 0.8969 1.3357 0.9354 0.1848  0.0242  -0.0260 388 HIS B ND1 
2803 C CD2 . HIS B 174 ? 0.8752 1.2601 0.9008 0.2212  0.0873  0.0466  388 HIS B CD2 
2804 C CE1 . HIS B 174 ? 0.9865 1.4364 0.9720 0.2400  0.0301  -0.0296 388 HIS B CE1 
2805 N NE2 . HIS B 174 ? 0.9667 1.3822 0.9403 0.2647  0.0726  0.0172  388 HIS B NE2 
2806 N N   . LYS B 175 ? 0.3902 0.6458 0.5677 0.0742  0.0683  0.0654  389 LYS B N   
2807 C CA  . LYS B 175 ? 0.3795 0.6103 0.5914 0.0772  0.0819  0.0816  389 LYS B CA  
2808 C C   . LYS B 175 ? 0.3739 0.5722 0.6025 0.0493  0.0571  0.0593  389 LYS B C   
2809 O O   . LYS B 175 ? 0.3899 0.5842 0.6254 0.0622  0.0613  0.0550  389 LYS B O   
2810 C CB  . LYS B 175 ? 0.3527 0.5610 0.6068 0.0693  0.0997  0.1153  389 LYS B CB  
2811 C CG  . LYS B 175 ? 0.3908 0.6161 0.6271 0.1014  0.1357  0.1442  389 LYS B CG  
2812 C CD  . LYS B 175 ? 0.4102 0.6027 0.6906 0.0838  0.1495  0.1713  389 LYS B CD  
2813 C CE  . LYS B 175 ? 0.4362 0.6324 0.6957 0.1180  0.1951  0.2039  389 LYS B CE  
2814 N NZ  . LYS B 175 ? 0.4367 0.5931 0.7323 0.0966  0.2054  0.2252  389 LYS B NZ  
2815 N N   . LEU B 176 ? 0.3508 0.5198 0.5784 0.0165  0.0356  0.0477  390 LEU B N   
2816 C CA  . LEU B 176 ? 0.3652 0.4882 0.5960 -0.0054 0.0159  0.0302  390 LEU B CA  
2817 C C   . LEU B 176 ? 0.3959 0.5230 0.6000 -0.0024 0.0102  -0.0006 390 LEU B C   
2818 O O   . LEU B 176 ? 0.3863 0.4816 0.5905 -0.0022 0.0046  -0.0094 390 LEU B O   
2819 C CB  . LEU B 176 ? 0.3603 0.4425 0.5783 -0.0328 0.0024  0.0267  390 LEU B CB  
2820 C CG  . LEU B 176 ? 0.4304 0.4457 0.6390 -0.0478 -0.0145 0.0168  390 LEU B CG  
2821 C CD1 . LEU B 176 ? 0.4362 0.4335 0.6795 -0.0374 -0.0248 0.0306  390 LEU B CD1 
2822 C CD2 . LEU B 176 ? 0.4678 0.4398 0.6486 -0.0658 -0.0182 0.0175  390 LEU B CD2 
2823 N N   . ARG B 177 ? 0.3707 0.5369 0.5524 0.0024  0.0093  -0.0193 391 ARG B N   
2824 C CA  . ARG B 177 ? 0.4445 0.6151 0.6032 0.0030  -0.0012 -0.0562 391 ARG B CA  
2825 C C   . ARG B 177 ? 0.4653 0.6385 0.6082 0.0379  0.0067  -0.0552 391 ARG B C   
2826 O O   . ARG B 177 ? 0.5043 0.6522 0.6267 0.0369  -0.0019 -0.0817 391 ARG B O   
2827 C CB  . ARG B 177 ? 0.4824 0.7081 0.6311 0.0064  -0.0103 -0.0805 391 ARG B CB  
2828 C CG  . ARG B 177 ? 0.6038 0.8403 0.7332 0.0101  -0.0275 -0.1261 391 ARG B CG  
2829 C CD  . ARG B 177 ? 0.6667 0.9605 0.8067 0.0033  -0.0460 -0.1604 391 ARG B CD  
2830 N NE  . ARG B 177 ? 0.6971 1.0524 0.8194 0.0454  -0.0447 -0.1463 391 ARG B NE  
2831 C CZ  . ARG B 177 ? 0.7452 1.1648 0.8673 0.0598  -0.0662 -0.1780 391 ARG B CZ  
2832 N NH1 . ARG B 177 ? 0.7641 1.2002 0.9181 0.0284  -0.0914 -0.2284 391 ARG B NH1 
2833 N NH2 . ARG B 177 ? 0.7622 1.2287 0.8548 0.1071  -0.0623 -0.1610 391 ARG B NH2 
2834 N N   . GLN B 178 ? 0.4814 0.6782 0.6327 0.0699  0.0281  -0.0229 392 GLN B N   
2835 C CA  . GLN B 178 ? 0.5474 0.7506 0.6796 0.1118  0.0455  -0.0167 392 GLN B CA  
2836 C C   . GLN B 178 ? 0.4814 0.6555 0.6522 0.1129  0.0581  0.0041  392 GLN B C   
2837 O O   . GLN B 178 ? 0.4574 0.6365 0.6228 0.1492  0.0803  0.0162  392 GLN B O   
2838 C CB  . GLN B 178 ? 0.6627 0.9042 0.7779 0.1545  0.0724  0.0089  392 GLN B CB  
2839 C CG  . GLN B 178 ? 0.7863 1.0655 0.8622 0.1639  0.0563  -0.0124 392 GLN B CG  
2840 C CD  . GLN B 178 ? 0.9071 1.2140 0.9360 0.2246  0.0820  0.0064  392 GLN B CD  
2841 O OE1 . GLN B 178 ? 0.9610 1.2802 0.9949 0.2355  0.1036  0.0368  392 GLN B OE1 
2842 N NE2 . GLN B 178 ? 0.9809 1.2885 0.9532 0.2694  0.0815  -0.0113 392 GLN B NE2 
2843 N N   . LEU B 179 ? 0.4347 0.5791 0.6425 0.0785  0.0436  0.0075  393 LEU B N   
2844 C CA  . LEU B 179 ? 0.4472 0.5691 0.6961 0.0808  0.0451  0.0195  393 LEU B CA  
2845 C C   . LEU B 179 ? 0.5148 0.6087 0.7259 0.0947  0.0400  -0.0035 393 LEU B C   
2846 O O   . LEU B 179 ? 0.4471 0.5139 0.6104 0.0794  0.0234  -0.0348 393 LEU B O   
2847 C CB  . LEU B 179 ? 0.4324 0.5208 0.7100 0.0485  0.0217  0.0206  393 LEU B CB  
2848 C CG  . LEU B 179 ? 0.4416 0.5465 0.7855 0.0438  0.0268  0.0484  393 LEU B CG  
2849 C CD1 . LEU B 179 ? 0.4350 0.5754 0.7775 0.0502  0.0507  0.0670  393 LEU B CD1 
2850 C CD2 . LEU B 179 ? 0.4196 0.4813 0.7683 0.0178  -0.0044 0.0420  393 LEU B CD2 
2851 N N   . PRO B 180 ? 0.4698 0.5689 0.7066 0.1238  0.0573  0.0120  394 PRO B N   
2852 C CA  . PRO B 180 ? 0.5067 0.5779 0.6988 0.1472  0.0585  -0.0061 394 PRO B CA  
2853 C C   . PRO B 180 ? 0.5148 0.5276 0.6876 0.1261  0.0329  -0.0282 394 PRO B C   
2854 O O   . PRO B 180 ? 0.6171 0.5906 0.7333 0.1353  0.0297  -0.0524 394 PRO B O   
2855 C CB  . PRO B 180 ? 0.5137 0.6127 0.7557 0.1848  0.0901  0.0249  394 PRO B CB  
2856 C CG  . PRO B 180 ? 0.4716 0.5987 0.8042 0.1653  0.0919  0.0507  394 PRO B CG  
2857 C CD  . PRO B 180 ? 0.4451 0.5768 0.7620 0.1359  0.0799  0.0471  394 PRO B CD  
2858 N N   . GLU B 181 ? 0.4783 0.4769 0.6887 0.1023  0.0158  -0.0207 395 GLU B N   
2859 C CA  . GLU B 181 ? 0.5194 0.4537 0.7030 0.0932  -0.0046 -0.0362 395 GLU B CA  
2860 C C   . GLU B 181 ? 0.5402 0.4396 0.7101 0.0585  -0.0225 -0.0425 395 GLU B C   
2861 O O   . GLU B 181 ? 0.4525 0.3821 0.6606 0.0451  -0.0264 -0.0273 395 GLU B O   
2862 C CB  . GLU B 181 ? 0.5712 0.5123 0.8074 0.1176  -0.0103 -0.0207 395 GLU B CB  
2863 C CG  . GLU B 181 ? 0.6391 0.6010 0.8824 0.1569  0.0118  -0.0141 395 GLU B CG  
2864 C CD  . GLU B 181 ? 0.7593 0.6550 0.9192 0.1703  0.0103  -0.0382 395 GLU B CD  
2865 O OE1 . GLU B 181 ? 0.8564 0.6865 0.9679 0.1510  -0.0075 -0.0564 395 GLU B OE1 
2866 O OE2 . GLU B 181 ? 0.7937 0.6951 0.9313 0.2025  0.0308  -0.0378 395 GLU B OE2 
2867 N N   . ARG B 182 ? 0.4340 0.4743 0.7296 -0.0425 0.1334  -0.0156 396 ARG B N   
2868 C CA  . ARG B 182 ? 0.4069 0.4166 0.6913 -0.0406 0.1382  -0.0102 396 ARG B CA  
2869 C C   . ARG B 182 ? 0.3841 0.3716 0.6509 -0.0151 0.1220  0.0203  396 ARG B C   
2870 O O   . ARG B 182 ? 0.4168 0.4022 0.6765 -0.0130 0.1099  0.0284  396 ARG B O   
2871 C CB  . ARG B 182 ? 0.5086 0.4696 0.7924 -0.0501 0.1814  -0.0283 396 ARG B CB  
2872 N N   . TYR B 183 ? 0.3891 0.3685 0.6499 0.0049  0.1221  0.0339  397 TYR B N   
2873 C CA  . TYR B 183 ? 0.3825 0.3610 0.6289 0.0304  0.1067  0.0559  397 TYR B CA  
2874 C C   . TYR B 183 ? 0.3164 0.3379 0.5732 0.0224  0.0743  0.0580  397 TYR B C   
2875 O O   . TYR B 183 ? 0.3351 0.3628 0.5857 0.0323  0.0611  0.0666  397 TYR B O   
2876 C CB  . TYR B 183 ? 0.4068 0.3813 0.6448 0.0575  0.1149  0.0668  397 TYR B CB  
2877 C CG  . TYR B 183 ? 0.4222 0.4414 0.6758 0.0535  0.0961  0.0626  397 TYR B CG  
2878 C CD1 . TYR B 183 ? 0.4182 0.4792 0.6766 0.0598  0.0700  0.0671  397 TYR B CD1 
2879 C CD2 . TYR B 183 ? 0.4213 0.4425 0.6867 0.0417  0.1081  0.0504  397 TYR B CD2 
2880 C CE1 . TYR B 183 ? 0.3731 0.4719 0.6469 0.0536  0.0581  0.0612  397 TYR B CE1 
2881 C CE2 . TYR B 183 ? 0.3876 0.4487 0.6661 0.0386  0.0927  0.0474  397 TYR B CE2 
2882 C CZ  . TYR B 183 ? 0.3975 0.4947 0.6796 0.0444  0.0686  0.0538  397 TYR B CZ  
2883 O OH  . TYR B 183 ? 0.4123 0.5467 0.7088 0.0386  0.0581  0.0488  397 TYR B OH  
2884 N N   . MET B 184 ? 0.2930 0.3436 0.5652 0.0052  0.0660  0.0493  398 MET B N   
2885 C CA  . MET B 184 ? 0.2717 0.3508 0.5520 -0.0021 0.0459  0.0534  398 MET B CA  
2886 C C   . MET B 184 ? 0.2997 0.3736 0.5767 -0.0097 0.0418  0.0540  398 MET B C   
2887 O O   . MET B 184 ? 0.2702 0.3482 0.5482 -0.0095 0.0309  0.0607  398 MET B O   
2888 C CB  . MET B 184 ? 0.2540 0.3624 0.5460 -0.0120 0.0439  0.0490  398 MET B CB  
2889 C CG  . MET B 184 ? 0.2556 0.3766 0.5537 -0.0057 0.0436  0.0490  398 MET B CG  
2890 S SD  . MET B 184 ? 0.3536 0.5098 0.6634 -0.0169 0.0424  0.0459  398 MET B SD  
2891 C CE  . MET B 184 ? 0.2567 0.4259 0.5742 -0.0090 0.0417  0.0442  398 MET B CE  
2892 N N   . MET B 185 ? 0.2669 0.3346 0.5421 -0.0178 0.0534  0.0434  399 MET B N   
2893 C CA  . MET B 185 ? 0.3250 0.3920 0.5964 -0.0230 0.0508  0.0416  399 MET B CA  
2894 C C   . MET B 185 ? 0.2723 0.3095 0.5329 -0.0135 0.0485  0.0510  399 MET B C   
2895 O O   . MET B 185 ? 0.2854 0.3255 0.5447 -0.0132 0.0374  0.0569  399 MET B O   
2896 C CB  . MET B 185 ? 0.3365 0.4106 0.6116 -0.0361 0.0676  0.0201  399 MET B CB  
2897 C CG  . MET B 185 ? 0.3059 0.4272 0.5926 -0.0449 0.0695  0.0046  399 MET B CG  
2898 S SD  . MET B 185 ? 0.3762 0.5240 0.6737 -0.0656 0.0915  -0.0336 399 MET B SD  
2899 C CE  . MET B 185 ? 0.2619 0.4816 0.5733 -0.0712 0.0903  -0.0529 399 MET B CE  
2900 N N   . ASN B 186 ? 0.2953 0.3048 0.5466 -0.0026 0.0617  0.0535  400 ASN B N   
2901 C CA  . ASN B 186 ? 0.3408 0.3298 0.5775 0.0134  0.0613  0.0644  400 ASN B CA  
2902 C C   . ASN B 186 ? 0.3554 0.3712 0.5951 0.0232  0.0406  0.0713  400 ASN B C   
2903 O O   . ASN B 186 ? 0.2956 0.3132 0.5300 0.0285  0.0329  0.0741  400 ASN B O   
2904 C CB  . ASN B 186 ? 0.3491 0.3024 0.5699 0.0315  0.0864  0.0706  400 ASN B CB  
2905 C CG  . ASN B 186 ? 0.4425 0.3590 0.6609 0.0179  0.1161  0.0588  400 ASN B CG  
2906 O OD1 . ASN B 186 ? 0.3851 0.3089 0.6103 -0.0008 0.1134  0.0468  400 ASN B OD1 
2907 N ND2 . ASN B 186 ? 0.4156 0.2932 0.6254 0.0271  0.1486  0.0598  400 ASN B ND2 
2908 N N   . SER B 187 ? 0.3557 0.3961 0.6062 0.0232  0.0338  0.0697  401 SER B N   
2909 C CA  . SER B 187 ? 0.2747 0.3480 0.5350 0.0253  0.0191  0.0670  401 SER B CA  
2910 C C   . SER B 187 ? 0.2763 0.3525 0.5477 0.0073  0.0122  0.0633  401 SER B C   
2911 O O   . SER B 187 ? 0.2581 0.3478 0.5348 0.0064  0.0059  0.0574  401 SER B O   
2912 C CB  . SER B 187 ? 0.2889 0.3878 0.5609 0.0251  0.0174  0.0629  401 SER B CB  
2913 O OG  . SER B 187 ? 0.3123 0.4132 0.5728 0.0485  0.0242  0.0675  401 SER B OG  
2914 N N   . VAL B 188 ? 0.2522 0.3200 0.5270 -0.0047 0.0160  0.0657  402 VAL B N   
2915 C CA  . VAL B 188 ? 0.2758 0.3401 0.5553 -0.0140 0.0153  0.0682  402 VAL B CA  
2916 C C   . VAL B 188 ? 0.2859 0.3348 0.5566 -0.0118 0.0132  0.0686  402 VAL B C   
2917 O O   . VAL B 188 ? 0.3185 0.3648 0.5941 -0.0154 0.0115  0.0669  402 VAL B O   
2918 C CB  . VAL B 188 ? 0.2773 0.3476 0.5561 -0.0172 0.0205  0.0737  402 VAL B CB  
2919 C CG1 . VAL B 188 ? 0.2833 0.3475 0.5590 -0.0166 0.0235  0.0820  402 VAL B CG1 
2920 C CG2 . VAL B 188 ? 0.2715 0.3571 0.5592 -0.0198 0.0237  0.0751  402 VAL B CG2 
2921 N N   . LEU B 189 ? 0.2552 0.2921 0.5145 -0.0078 0.0171  0.0681  403 LEU B N   
2922 C CA  . LEU B 189 ? 0.3213 0.3431 0.5715 -0.0065 0.0176  0.0677  403 LEU B CA  
2923 C C   . LEU B 189 ? 0.3411 0.3613 0.5861 0.0031  0.0125  0.0681  403 LEU B C   
2924 O O   . LEU B 189 ? 0.3161 0.3282 0.5558 0.0034  0.0107  0.0676  403 LEU B O   
2925 C CB  . LEU B 189 ? 0.3342 0.3418 0.5760 -0.0081 0.0305  0.0626  403 LEU B CB  
2926 C CG  . LEU B 189 ? 0.2630 0.2895 0.5110 -0.0192 0.0350  0.0533  403 LEU B CG  
2927 C CD1 . LEU B 189 ? 0.2790 0.2931 0.5244 -0.0269 0.0542  0.0385  403 LEU B CD1 
2928 C CD2 . LEU B 189 ? 0.3187 0.3583 0.5667 -0.0194 0.0270  0.0558  403 LEU B CD2 
2929 N N   . GLU B 190 ? 0.3142 0.3506 0.5602 0.0133  0.0101  0.0674  404 GLU B N   
2930 C CA  . GLU B 190 ? 0.3686 0.4259 0.6107 0.0267  0.0036  0.0639  404 GLU B CA  
2931 C C   . GLU B 190 ? 0.3324 0.4047 0.5901 0.0125  -0.0034 0.0520  404 GLU B C   
2932 O O   . GLU B 190 ? 0.2820 0.3682 0.5364 0.0186  -0.0078 0.0459  404 GLU B O   
2933 C CB  . GLU B 190 ? 0.4157 0.5063 0.6597 0.0414  0.0011  0.0612  404 GLU B CB  
2934 C CG  . GLU B 190 ? 0.5141 0.6493 0.7539 0.0605  -0.0068 0.0535  404 GLU B CG  
2935 C CD  . GLU B 190 ? 0.6180 0.7372 0.8282 0.0891  0.0006  0.0695  404 GLU B CD  
2936 O OE1 . GLU B 190 ? 0.6596 0.8025 0.8644 0.0977  -0.0056 0.0645  404 GLU B OE1 
2937 O OE2 . GLU B 190 ? 0.6616 0.7427 0.8537 0.1027  0.0165  0.0862  404 GLU B OE2 
2938 N N   . ASN B 191 ? 0.2603 0.3279 0.5343 -0.0050 -0.0004 0.0490  405 ASN B N   
2939 C CA  . ASN B 191 ? 0.2618 0.3316 0.5522 -0.0199 0.0031  0.0376  405 ASN B CA  
2940 C C   . ASN B 191 ? 0.2642 0.3005 0.5499 -0.0248 0.0096  0.0485  405 ASN B C   
2941 O O   . ASN B 191 ? 0.3311 0.3544 0.6282 -0.0348 0.0210  0.0463  405 ASN B O   
2942 C CB  . ASN B 191 ? 0.2641 0.3492 0.5755 -0.0332 0.0109  0.0267  405 ASN B CB  
2943 C CG  . ASN B 191 ? 0.3232 0.4553 0.6409 -0.0264 0.0034  0.0121  405 ASN B CG  
2944 O OD1 . ASN B 191 ? 0.3284 0.4963 0.6457 -0.0175 -0.0043 -0.0015 405 ASN B OD1 
2945 N ND2 . ASN B 191 ? 0.3398 0.4794 0.6618 -0.0268 0.0055  0.0150  405 ASN B ND2 
2946 N N   . PHE B 192 ? 0.2746 0.2982 0.5436 -0.0164 0.0064  0.0591  406 PHE B N   
2947 C CA  . PHE B 192 ? 0.2969 0.3042 0.5598 -0.0165 0.0102  0.0670  406 PHE B CA  
2948 C C   . PHE B 192 ? 0.2858 0.2867 0.5375 -0.0125 0.0059  0.0646  406 PHE B C   
2949 O O   . PHE B 192 ? 0.2793 0.2781 0.5202 -0.0077 0.0058  0.0648  406 PHE B O   
2950 C CB  . PHE B 192 ? 0.3266 0.3397 0.5839 -0.0135 0.0130  0.0748  406 PHE B CB  
2951 C CG  . PHE B 192 ? 0.3231 0.3395 0.5727 -0.0085 0.0153  0.0794  406 PHE B CG  
2952 C CD1 . PHE B 192 ? 0.3433 0.3658 0.5855 -0.0094 0.0138  0.0717  406 PHE B CD1 
2953 C CD2 . PHE B 192 ? 0.3212 0.3366 0.5703 -0.0009 0.0230  0.0910  406 PHE B CD2 
2954 C CE1 . PHE B 192 ? 0.2989 0.3391 0.5364 -0.0046 0.0151  0.0707  406 PHE B CE1 
2955 C CE2 . PHE B 192 ? 0.3583 0.3885 0.5977 0.0110  0.0246  0.0963  406 PHE B CE2 
2956 C CZ  . PHE B 192 ? 0.2652 0.3143 0.5003 0.0082  0.0182  0.0837  406 PHE B CZ  
2957 N N   . THR B 193 ? 0.3058 0.2990 0.5601 -0.0146 0.0068  0.0622  407 THR B N   
2958 C CA  . THR B 193 ? 0.2868 0.2751 0.5311 -0.0115 0.0032  0.0595  407 THR B CA  
2959 C C   . THR B 193 ? 0.2708 0.2500 0.5141 -0.0110 0.0068  0.0628  407 THR B C   
2960 O O   . THR B 193 ? 0.2794 0.2516 0.5293 -0.0102 0.0148  0.0685  407 THR B O   
2961 C CB  . THR B 193 ? 0.3127 0.3124 0.5599 -0.0105 -0.0017 0.0486  407 THR B CB  
2962 O OG1 . THR B 193 ? 0.3445 0.3463 0.6097 -0.0207 0.0031  0.0380  407 THR B OG1 
2963 C CG2 . THR B 193 ? 0.3301 0.3498 0.5741 -0.0022 -0.0054 0.0470  407 THR B CG2 
2964 N N   . ILE B 194 ? 0.2746 0.2525 0.5080 -0.0090 0.0045  0.0603  408 ILE B N   
2965 C CA  . ILE B 194 ? 0.2736 0.2496 0.5051 -0.0056 0.0066  0.0618  408 ILE B CA  
2966 C C   . ILE B 194 ? 0.3481 0.3181 0.5762 -0.0074 0.0032  0.0540  408 ILE B C   
2967 O O   . ILE B 194 ? 0.3500 0.3203 0.5694 -0.0076 0.0011  0.0505  408 ILE B O   
2968 C CB  . ILE B 194 ? 0.3175 0.3132 0.5419 -0.0017 0.0081  0.0619  408 ILE B CB  
2969 C CG1 . ILE B 194 ? 0.3181 0.3296 0.5450 0.0038  0.0112  0.0696  408 ILE B CG1 
2970 C CG2 . ILE B 194 ? 0.3372 0.3416 0.5578 0.0061  0.0089  0.0618  408 ILE B CG2 
2971 C CD1 . ILE B 194 ? 0.3370 0.3879 0.5601 0.0081  0.0124  0.0632  408 ILE B CD1 
2972 N N   . LEU B 195 ? 0.3304 0.2925 0.5641 -0.0064 0.0063  0.0524  409 LEU B N   
2973 C CA  . LEU B 195 ? 0.3638 0.3247 0.5955 -0.0082 0.0031  0.0432  409 LEU B CA  
2974 C C   . LEU B 195 ? 0.3835 0.3422 0.6104 -0.0019 0.0061  0.0459  409 LEU B C   
2975 O O   . LEU B 195 ? 0.4207 0.3701 0.6516 0.0054  0.0151  0.0531  409 LEU B O   
2976 C CB  . LEU B 195 ? 0.3827 0.3429 0.6295 -0.0155 0.0062  0.0306  409 LEU B CB  
2977 C CG  . LEU B 195 ? 0.3596 0.3288 0.6063 -0.0174 0.0023  0.0169  409 LEU B CG  
2978 C CD1 . LEU B 195 ? 0.3003 0.2890 0.5316 -0.0106 -0.0076 0.0167  409 LEU B CD1 
2979 C CD2 . LEU B 195 ? 0.3553 0.3303 0.6242 -0.0293 0.0108  -0.0038 409 LEU B CD2 
2980 N N   . GLN B 196 ? 0.3807 0.3476 0.5978 -0.0025 0.0020  0.0410  410 GLN B N   
2981 C CA  . GLN B 196 ? 0.4377 0.4130 0.6510 0.0034  0.0035  0.0395  410 GLN B CA  
2982 C C   . GLN B 196 ? 0.4270 0.3951 0.6399 0.0009  0.0018  0.0312  410 GLN B C   
2983 O O   . GLN B 196 ? 0.4280 0.3958 0.6347 -0.0045 -0.0013 0.0255  410 GLN B O   
2984 C CB  . GLN B 196 ? 0.4525 0.4508 0.6590 0.0007  0.0044  0.0332  410 GLN B CB  
2985 C CG  . GLN B 196 ? 0.4830 0.5085 0.6912 0.0081  0.0063  0.0366  410 GLN B CG  
2986 C CD  . GLN B 196 ? 0.4769 0.5425 0.6842 0.0032  0.0094  0.0193  410 GLN B CD  
2987 O OE1 . GLN B 196 ? 0.4619 0.5208 0.6683 -0.0127 0.0158  0.0052  410 GLN B OE1 
2988 N NE2 . GLN B 196 ? 0.4965 0.6080 0.7041 0.0181  0.0088  0.0187  410 GLN B NE2 
2989 N N   . VAL B 197 ? 0.3895 0.3517 0.6068 0.0081  0.0065  0.0322  411 VAL B N   
2990 C CA  . VAL B 197 ? 0.3580 0.3157 0.5771 0.0052  0.0060  0.0218  411 VAL B CA  
2991 C C   . VAL B 197 ? 0.3674 0.3364 0.5806 0.0157  0.0076  0.0224  411 VAL B C   
2992 O O   . VAL B 197 ? 0.3938 0.3621 0.6067 0.0318  0.0156  0.0327  411 VAL B O   
2993 C CB  . VAL B 197 ? 0.4130 0.3512 0.6478 0.0009  0.0157  0.0154  411 VAL B CB  
2994 C CG1 . VAL B 197 ? 0.4396 0.3779 0.6783 -0.0025 0.0168  0.0010  411 VAL B CG1 
2995 C CG2 . VAL B 197 ? 0.3972 0.3411 0.6404 -0.0105 0.0126  0.0076  411 VAL B CG2 
2996 N N   . VAL B 198 ? 0.3356 0.3174 0.5420 0.0099  0.0024  0.0125  412 VAL B N   
2997 C CA  . VAL B 198 ? 0.3572 0.3581 0.5598 0.0177  0.0033  0.0078  412 VAL B CA  
2998 C C   . VAL B 198 ? 0.4001 0.3904 0.6050 0.0156  0.0034  -0.0006 412 VAL B C   
2999 O O   . VAL B 198 ? 0.4194 0.4065 0.6211 0.0047  -0.0003 -0.0084 412 VAL B O   
3000 C CB  . VAL B 198 ? 0.3414 0.3692 0.5374 0.0087  0.0028  -0.0029 412 VAL B CB  
3001 C CG1 . VAL B 198 ? 0.3429 0.4044 0.5383 0.0166  0.0035  -0.0128 412 VAL B CG1 
3002 C CG2 . VAL B 198 ? 0.3443 0.3867 0.5413 0.0069  0.0046  -0.0007 412 VAL B CG2 
3003 N N   . THR B 199 ? 0.3905 0.3765 0.5990 0.0295  0.0099  0.0021  413 THR B N   
3004 C CA  . THR B 199 ? 0.4230 0.3985 0.6365 0.0270  0.0127  -0.0086 413 THR B CA  
3005 C C   . THR B 199 ? 0.4603 0.4547 0.6686 0.0420  0.0145  -0.0098 413 THR B C   
3006 O O   . THR B 199 ? 0.4263 0.4445 0.6284 0.0601  0.0159  -0.0009 413 THR B O   
3007 C CB  . THR B 199 ? 0.4393 0.3808 0.6672 0.0269  0.0274  -0.0093 413 THR B CB  
3008 O OG1 . THR B 199 ? 0.4607 0.3850 0.6866 0.0488  0.0433  0.0089  413 THR B OG1 
3009 C CG2 . THR B 199 ? 0.4139 0.3492 0.6506 0.0105  0.0253  -0.0149 413 THR B CG2 
3010 N N   . ASN B 200 ? 0.4779 0.4708 0.6886 0.0365  0.0139  -0.0226 414 ASN B N   
3011 C CA  . ASN B 200 ? 0.4633 0.4705 0.6714 0.0522  0.0176  -0.0250 414 ASN B CA  
3012 C C   . ASN B 200 ? 0.4739 0.4502 0.6867 0.0742  0.0366  -0.0123 414 ASN B C   
3013 O O   . ASN B 200 ? 0.4996 0.4391 0.7249 0.0650  0.0492  -0.0190 414 ASN B O   
3014 C CB  . ASN B 200 ? 0.4711 0.4831 0.6806 0.0386  0.0130  -0.0428 414 ASN B CB  
3015 C CG  . ASN B 200 ? 0.4816 0.5155 0.6882 0.0532  0.0150  -0.0479 414 ASN B CG  
3016 O OD1 . ASN B 200 ? 0.4903 0.5197 0.6969 0.0779  0.0255  -0.0377 414 ASN B OD1 
3017 N ND2 . ASN B 200 ? 0.4880 0.5451 0.6901 0.0406  0.0078  -0.0624 414 ASN B ND2 
3018 N N   . ARG B 201 ? 0.5603 0.5189 0.6996 0.1753  -0.0151 -0.1289 415 ARG B N   
3019 C CA  . ARG B 201 ? 0.6618 0.5485 0.8002 0.2010  -0.0117 -0.1273 415 ARG B CA  
3020 C C   . ARG B 201 ? 0.6838 0.5615 0.8409 0.2168  -0.0020 -0.1628 415 ARG B C   
3021 O O   . ARG B 201 ? 0.7325 0.5392 0.8891 0.2219  0.0077  -0.1704 415 ARG B O   
3022 C CB  . ARG B 201 ? 0.7184 0.6024 0.8535 0.2349  -0.0240 -0.1047 415 ARG B CB  
3023 C CG  . ARG B 201 ? 0.8032 0.5988 0.9211 0.2587  -0.0211 -0.0848 415 ARG B CG  
3024 C CD  . ARG B 201 ? 0.9053 0.6741 1.0367 0.2879  -0.0129 -0.0985 415 ARG B CD  
3025 N NE  . ARG B 201 ? 0.9436 0.7721 1.0901 0.3176  -0.0250 -0.0989 415 ARG B NE  
3026 C CZ  . ARG B 201 ? 0.9794 0.8030 1.1159 0.3409  -0.0353 -0.0713 415 ARG B CZ  
3027 N NH1 . ARG B 201 ? 0.9667 0.8530 1.1219 0.3653  -0.0475 -0.0779 415 ARG B NH1 
3028 N NH2 . ARG B 201 ? 1.0061 0.7680 1.1154 0.3378  -0.0335 -0.0389 415 ARG B NH2 
3029 N N   . ASP B 202 ? 0.6338 0.5825 0.8078 0.2229  -0.0021 -0.1862 416 ASP B N   
3030 C CA  . ASP B 202 ? 0.6980 0.6482 0.8912 0.2434  0.0069  -0.2232 416 ASP B CA  
3031 C C   . ASP B 202 ? 0.7067 0.6612 0.8979 0.2163  0.0180  -0.2553 416 ASP B C   
3032 O O   . ASP B 202 ? 0.7587 0.6795 0.9554 0.2223  0.0275  -0.2798 416 ASP B O   
3033 C CB  . ASP B 202 ? 0.6856 0.7177 0.9002 0.2647  0.0038  -0.2362 416 ASP B CB  
3034 C CG  . ASP B 202 ? 0.7416 0.7777 0.9603 0.2919  -0.0091 -0.2086 416 ASP B CG  
3035 O OD1 . ASP B 202 ? 0.7768 0.7423 0.9835 0.3099  -0.0108 -0.1883 416 ASP B OD1 
3036 O OD2 . ASP B 202 ? 0.7474 0.8594 0.9804 0.2927  -0.0160 -0.2067 416 ASP B OD2 
3037 N N   . THR B 203 ? 0.6562 0.6527 0.8330 0.1828  0.0161  -0.2487 417 THR B N   
3038 C CA  . THR B 203 ? 0.6896 0.7065 0.8610 0.1598  0.0227  -0.2793 417 THR B CA  
3039 C C   . THR B 203 ? 0.7220 0.7018 0.8808 0.1297  0.0210  -0.2699 417 THR B C   
3040 O O   . THR B 203 ? 0.7730 0.7715 0.9279 0.1104  0.0233  -0.2959 417 THR B O   
3041 C CB  . THR B 203 ? 0.6316 0.7369 0.7938 0.1485  0.0234  -0.2835 417 THR B CB  
3042 O OG1 . THR B 203 ? 0.5683 0.6903 0.7150 0.1292  0.0159  -0.2460 417 THR B OG1 
3043 C CG2 . THR B 203 ? 0.6173 0.7703 0.7975 0.1748  0.0279  -0.2950 417 THR B CG2 
3044 N N   . GLN B 204 ? 0.7092 0.6439 0.8619 0.1268  0.0166  -0.2345 418 GLN B N   
3045 C CA  . GLN B 204 ? 0.7117 0.6102 0.8572 0.0999  0.0170  -0.2236 418 GLN B CA  
3046 C C   . GLN B 204 ? 0.6766 0.6320 0.8092 0.0741  0.0104  -0.2194 418 GLN B C   
3047 O O   . GLN B 204 ? 0.6956 0.6360 0.8267 0.0523  0.0099  -0.2171 418 GLN B O   
3048 C CB  . GLN B 204 ? 0.8057 0.6513 0.9655 0.0920  0.0282  -0.2561 418 GLN B CB  
3049 C CG  . GLN B 204 ? 0.9191 0.6970 1.0907 0.1197  0.0375  -0.2624 418 GLN B CG  
3050 C CD  . GLN B 204 ? 0.9838 0.6935 1.1444 0.1284  0.0396  -0.2204 418 GLN B CD  
3051 O OE1 . GLN B 204 ? 0.9717 0.6755 1.1213 0.1084  0.0374  -0.1948 418 GLN B OE1 
3052 N NE2 . GLN B 204 ? 1.0499 0.7136 1.2023 0.1579  0.0437  -0.2072 418 GLN B NE2 
3053 N N   . GLU B 205 ? 0.6163 0.6367 0.7403 0.0774  0.0067  -0.2175 419 GLU B N   
3054 C CA  . GLU B 205 ? 0.5968 0.6660 0.7034 0.0576  0.0016  -0.2103 419 GLU B CA  
3055 C C   . GLU B 205 ? 0.5281 0.5906 0.6246 0.0491  -0.0047 -0.1698 419 GLU B C   
3056 O O   . GLU B 205 ? 0.5253 0.5773 0.6245 0.0599  -0.0061 -0.1488 419 GLU B O   
3057 C CB  . GLU B 205 ? 0.6430 0.7792 0.7397 0.0625  0.0046  -0.2224 419 GLU B CB  
3058 C CG  . GLU B 205 ? 0.7042 0.8653 0.8043 0.0741  0.0069  -0.2025 419 GLU B CG  
3059 C CD  . GLU B 205 ? 0.7482 0.9695 0.8469 0.0818  0.0162  -0.2237 419 GLU B CD  
3060 O OE1 . GLU B 205 ? 0.7787 1.0377 0.8567 0.0716  0.0191  -0.2354 419 GLU B OE1 
3061 O OE2 . GLU B 205 ? 0.7318 0.9667 0.8495 0.0996  0.0208  -0.2291 419 GLU B OE2 
3062 N N   . LEU B 206 ? 0.4698 0.5415 0.5559 0.0313  -0.0094 -0.1621 420 LEU B N   
3063 C CA  . LEU B 206 ? 0.4588 0.5228 0.5358 0.0234  -0.0143 -0.1278 420 LEU B CA  
3064 C C   . LEU B 206 ? 0.4279 0.5316 0.4919 0.0245  -0.0149 -0.1086 420 LEU B C   
3065 O O   . LEU B 206 ? 0.4744 0.6215 0.5263 0.0228  -0.0127 -0.1164 420 LEU B O   
3066 C CB  . LEU B 206 ? 0.4542 0.5217 0.5277 0.0076  -0.0190 -0.1280 420 LEU B CB  
3067 C CG  . LEU B 206 ? 0.4721 0.5335 0.5366 0.0015  -0.0233 -0.0954 420 LEU B CG  
3068 C CD1 . LEU B 206 ? 0.4628 0.4729 0.5355 0.0021  -0.0201 -0.0812 420 LEU B CD1 
3069 C CD2 . LEU B 206 ? 0.5360 0.6206 0.5965 -0.0083 -0.0297 -0.0976 420 LEU B CD2 
3070 N N   . LEU B 207 ? 0.4123 0.5011 0.4776 0.0261  -0.0165 -0.0843 421 LEU B N   
3071 C CA  . LEU B 207 ? 0.4045 0.5254 0.4628 0.0219  -0.0146 -0.0674 421 LEU B CA  
3072 C C   . LEU B 207 ? 0.4308 0.5393 0.4772 0.0096  -0.0181 -0.0420 421 LEU B C   
3073 O O   . LEU B 207 ? 0.4248 0.5556 0.4582 0.0017  -0.0148 -0.0290 421 LEU B O   
3074 C CB  . LEU B 207 ? 0.3362 0.4612 0.4103 0.0329  -0.0142 -0.0657 421 LEU B CB  
3075 C CG  . LEU B 207 ? 0.3591 0.4996 0.4483 0.0504  -0.0104 -0.0909 421 LEU B CG  
3076 C CD1 . LEU B 207 ? 0.3306 0.4774 0.4379 0.0661  -0.0139 -0.0883 421 LEU B CD1 
3077 C CD2 . LEU B 207 ? 0.3959 0.5875 0.4797 0.0460  -0.0009 -0.1051 421 LEU B CD2 
3078 N N   . LEU B 208 ? 0.4203 0.4904 0.4699 0.0089  -0.0228 -0.0346 422 LEU B N   
3079 C CA  . LEU B 208 ? 0.4086 0.4648 0.4500 0.0002  -0.0255 -0.0136 422 LEU B CA  
3080 C C   . LEU B 208 ? 0.3989 0.4206 0.4438 -0.0015 -0.0276 -0.0131 422 LEU B C   
3081 O O   . LEU B 208 ? 0.4178 0.4111 0.4685 0.0044  -0.0263 -0.0159 422 LEU B O   
3082 C CB  . LEU B 208 ? 0.4519 0.5064 0.4956 -0.0009 -0.0254 0.0001  422 LEU B CB  
3083 C CG  . LEU B 208 ? 0.4780 0.5275 0.5131 -0.0116 -0.0247 0.0189  422 LEU B CG  
3084 C CD1 . LEU B 208 ? 0.4570 0.5297 0.4797 -0.0174 -0.0192 0.0255  422 LEU B CD1 
3085 C CD2 . LEU B 208 ? 0.4997 0.5508 0.5429 -0.0148 -0.0248 0.0233  422 LEU B CD2 
3086 N N   . CYS B 209 ? 0.3409 0.3663 0.3818 -0.0082 -0.0297 -0.0087 423 CYS B N   
3087 C CA  . CYS B 209 ? 0.3432 0.3437 0.3912 -0.0126 -0.0289 -0.0085 423 CYS B CA  
3088 C C   . CYS B 209 ? 0.3415 0.3384 0.3834 -0.0151 -0.0307 0.0097  423 CYS B C   
3089 O O   . CYS B 209 ? 0.3356 0.3536 0.3704 -0.0144 -0.0344 0.0162  423 CYS B O   
3090 C CB  . CYS B 209 ? 0.3387 0.3538 0.3981 -0.0177 -0.0296 -0.0297 423 CYS B CB  
3091 S SG  . CYS B 209 ? 0.3789 0.3733 0.4551 -0.0282 -0.0248 -0.0325 423 CYS B SG  
3092 N N   . THR B 210 ? 0.3138 0.2821 0.3556 -0.0160 -0.0275 0.0184  424 THR B N   
3093 C CA  . THR B 210 ? 0.3597 0.3218 0.3966 -0.0171 -0.0279 0.0319  424 THR B CA  
3094 C C   . THR B 210 ? 0.3604 0.3076 0.4049 -0.0207 -0.0225 0.0301  424 THR B C   
3095 O O   . THR B 210 ? 0.3463 0.2694 0.3894 -0.0221 -0.0159 0.0296  424 THR B O   
3096 C CB  . THR B 210 ? 0.3869 0.3361 0.4142 -0.0158 -0.0281 0.0419  424 THR B CB  
3097 O OG1 . THR B 210 ? 0.4047 0.3722 0.4312 -0.0152 -0.0300 0.0405  424 THR B OG1 
3098 C CG2 . THR B 210 ? 0.3759 0.3180 0.3990 -0.0176 -0.0278 0.0520  424 THR B CG2 
3099 N N   . ALA B 211 ? 0.3789 0.3418 0.4308 -0.0205 -0.0242 0.0303  425 ALA B N   
3100 C CA  . ALA B 211 ? 0.3644 0.3223 0.4280 -0.0242 -0.0173 0.0275  425 ALA B CA  
3101 C C   . ALA B 211 ? 0.3676 0.3101 0.4212 -0.0196 -0.0152 0.0396  425 ALA B C   
3102 O O   . ALA B 211 ? 0.3909 0.3374 0.4386 -0.0130 -0.0209 0.0475  425 ALA B O   
3103 C CB  . ALA B 211 ? 0.3479 0.3416 0.4318 -0.0242 -0.0217 0.0155  425 ALA B CB  
3104 N N   . TYR B 212 ? 0.3613 0.2834 0.4108 -0.0230 -0.0053 0.0408  426 TYR B N   
3105 C CA  . TYR B 212 ? 0.3420 0.2511 0.3807 -0.0188 -0.0024 0.0470  426 TYR B CA  
3106 C C   . TYR B 212 ? 0.3647 0.2824 0.4175 -0.0195 0.0076  0.0416  426 TYR B C   
3107 O O   . TYR B 212 ? 0.3690 0.2858 0.4294 -0.0280 0.0192  0.0370  426 TYR B O   
3108 C CB  . TYR B 212 ? 0.4042 0.2895 0.4202 -0.0189 0.0004  0.0520  426 TYR B CB  
3109 C CG  . TYR B 212 ? 0.4342 0.3188 0.4413 -0.0166 -0.0095 0.0545  426 TYR B CG  
3110 C CD1 . TYR B 212 ? 0.4519 0.3410 0.4568 -0.0160 -0.0164 0.0557  426 TYR B CD1 
3111 C CD2 . TYR B 212 ? 0.4679 0.3468 0.4717 -0.0153 -0.0099 0.0544  426 TYR B CD2 
3112 C CE1 . TYR B 212 ? 0.4557 0.3523 0.4583 -0.0164 -0.0231 0.0553  426 TYR B CE1 
3113 C CE2 . TYR B 212 ? 0.4809 0.3669 0.4813 -0.0109 -0.0185 0.0540  426 TYR B CE2 
3114 C CZ  . TYR B 212 ? 0.4653 0.3644 0.4665 -0.0125 -0.0250 0.0538  426 TYR B CZ  
3115 O OH  . TYR B 212 ? 0.4254 0.3393 0.4289 -0.0106 -0.0314 0.0509  426 TYR B OH  
3116 N N   . VAL B 213 ? 0.3411 0.2658 0.3992 -0.0105 0.0050  0.0420  427 VAL B N   
3117 C CA  . VAL B 213 ? 0.3696 0.3058 0.4425 -0.0076 0.0150  0.0350  427 VAL B CA  
3118 C C   . VAL B 213 ? 0.3627 0.2770 0.4186 -0.0012 0.0192  0.0365  427 VAL B C   
3119 O O   . VAL B 213 ? 0.3962 0.2919 0.4374 0.0020  0.0113  0.0416  427 VAL B O   
3120 C CB  . VAL B 213 ? 0.3841 0.3546 0.4841 0.0029  0.0077  0.0296  427 VAL B CB  
3121 C CG1 . VAL B 213 ? 0.4076 0.4073 0.5260 -0.0053 0.0032  0.0211  427 VAL B CG1 
3122 C CG2 . VAL B 213 ? 0.3282 0.2888 0.4178 0.0179  -0.0047 0.0404  427 VAL B CG2 
3123 N N   . PHE B 214 ? 0.3393 0.2577 0.3985 -0.0011 0.0333  0.0294  428 PHE B N   
3124 C CA  . PHE B 214 ? 0.3505 0.2486 0.3880 0.0031  0.0389  0.0264  428 PHE B CA  
3125 C C   . PHE B 214 ? 0.3911 0.2994 0.4429 0.0142  0.0482  0.0150  428 PHE B C   
3126 O O   . PHE B 214 ? 0.3559 0.2928 0.4330 0.0152  0.0577  0.0084  428 PHE B O   
3127 C CB  . PHE B 214 ? 0.4018 0.2879 0.4120 -0.0060 0.0497  0.0294  428 PHE B CB  
3128 C CG  . PHE B 214 ? 0.4077 0.2797 0.4006 -0.0112 0.0400  0.0396  428 PHE B CG  
3129 C CD1 . PHE B 214 ? 0.3726 0.2477 0.3756 -0.0189 0.0420  0.0448  428 PHE B CD1 
3130 C CD2 . PHE B 214 ? 0.4281 0.2867 0.3984 -0.0083 0.0292  0.0404  428 PHE B CD2 
3131 C CE1 . PHE B 214 ? 0.3988 0.2605 0.3878 -0.0199 0.0335  0.0524  428 PHE B CE1 
3132 C CE2 . PHE B 214 ? 0.3970 0.2500 0.3560 -0.0098 0.0197  0.0477  428 PHE B CE2 
3133 C CZ  . PHE B 214 ? 0.3895 0.2425 0.3569 -0.0138 0.0221  0.0546  428 PHE B CZ  
3134 N N   . GLU B 215 ? 0.3809 0.2673 0.4196 0.0221  0.0459  0.0098  429 GLU B N   
3135 C CA  . GLU B 215 ? 0.4205 0.3083 0.4637 0.0329  0.0575  -0.0049 429 GLU B CA  
3136 C C   . GLU B 215 ? 0.4596 0.3240 0.4695 0.0291  0.0603  -0.0139 429 GLU B C   
3137 O O   . GLU B 215 ? 0.4446 0.2945 0.4335 0.0201  0.0504  -0.0083 429 GLU B O   
3138 C CB  . GLU B 215 ? 0.4480 0.3307 0.5146 0.0518  0.0509  -0.0072 429 GLU B CB  
3139 C CG  . GLU B 215 ? 0.4729 0.3919 0.5737 0.0623  0.0479  -0.0041 429 GLU B CG  
3140 C CD  . GLU B 215 ? 0.5359 0.4479 0.6545 0.0882  0.0409  -0.0037 429 GLU B CD  
3141 O OE1 . GLU B 215 ? 0.5371 0.4187 0.6492 0.0986  0.0465  -0.0125 429 GLU B OE1 
3142 O OE2 . GLU B 215 ? 0.5911 0.5266 0.7286 0.0998  0.0295  0.0051  429 GLU B OE2 
3143 N N   . VAL B 216 ? 0.4917 0.3582 0.4982 0.0369  0.0733  -0.0309 430 VAL B N   
3144 C CA  . VAL B 216 ? 0.5254 0.3749 0.5001 0.0349  0.0747  -0.0457 430 VAL B CA  
3145 C C   . VAL B 216 ? 0.5274 0.3482 0.5128 0.0429  0.0685  -0.0599 430 VAL B C   
3146 O O   . VAL B 216 ? 0.5343 0.3509 0.5464 0.0580  0.0726  -0.0642 430 VAL B O   
3147 C CB  . VAL B 216 ? 0.6082 0.4759 0.5655 0.0377  0.0951  -0.0591 430 VAL B CB  
3148 C CG1 . VAL B 216 ? 0.6542 0.5095 0.5767 0.0381  0.0944  -0.0794 430 VAL B CG1 
3149 C CG2 . VAL B 216 ? 0.6515 0.5366 0.5930 0.0269  0.1052  -0.0420 430 VAL B CG2 
3150 N N   . SER B 217 ? 0.5247 0.3255 0.4912 0.0332  0.0590  -0.0678 431 SER B N   
3151 C CA  . SER B 217 ? 0.6101 0.3765 0.5868 0.0352  0.0563  -0.0840 431 SER B CA  
3152 C C   . SER B 217 ? 0.6970 0.4586 0.6665 0.0445  0.0690  -0.1144 431 SER B C   
3153 O O   . SER B 217 ? 0.7588 0.5450 0.7018 0.0433  0.0760  -0.1258 431 SER B O   
3154 C CB  . SER B 217 ? 0.5902 0.3442 0.5558 0.0172  0.0434  -0.0872 431 SER B CB  
3155 O OG  . SER B 217 ? 0.6753 0.3919 0.6530 0.0139  0.0446  -0.1056 431 SER B OG  
3156 N N   . GLU B 220 ? 0.8246 0.5150 0.7507 0.0185  0.0741  -0.2833 434 GLU B N   
3157 C CA  . GLU B 220 ? 0.8797 0.5460 0.8175 -0.0047 0.0644  -0.3065 434 GLU B CA  
3158 C C   . GLU B 220 ? 0.8426 0.4837 0.8078 -0.0173 0.0579  -0.2723 434 GLU B C   
3159 O O   . GLU B 220 ? 0.8267 0.4483 0.8077 -0.0381 0.0520  -0.2807 434 GLU B O   
3160 C CB  . GLU B 220 ? 0.9670 0.5964 0.9170 -0.0016 0.0715  -0.3332 434 GLU B CB  
3161 C CG  . GLU B 220 ? 1.0180 0.6068 0.9918 0.0218  0.0845  -0.3135 434 GLU B CG  
3162 C CD  . GLU B 220 ? 1.0980 0.6476 1.0799 0.0277  0.0906  -0.3365 434 GLU B CD  
3163 O OE1 . GLU B 220 ? 1.1963 0.7422 1.1724 0.0081  0.0852  -0.3652 434 GLU B OE1 
3164 O OE2 . GLU B 220 ? 1.0905 0.6147 1.0857 0.0529  0.1005  -0.3270 434 GLU B OE2 
3165 N N   . ARG B 221 ? 0.6984 0.3479 0.6678 -0.0045 0.0581  -0.2297 435 ARG B N   
3166 C CA  . ARG B 221 ? 0.6682 0.3037 0.6562 -0.0143 0.0516  -0.1956 435 ARG B CA  
3167 C C   . ARG B 221 ? 0.7076 0.3926 0.6780 -0.0237 0.0370  -0.1780 435 ARG B C   
3168 O O   . ARG B 221 ? 0.7187 0.4392 0.6677 -0.0121 0.0360  -0.1662 435 ARG B O   
3169 C CB  . ARG B 221 ? 0.6540 0.2693 0.6588 0.0071  0.0588  -0.1624 435 ARG B CB  
3170 C CG  . ARG B 221 ? 0.8004 0.3634 0.8239 0.0237  0.0724  -0.1746 435 ARG B CG  
3171 C CD  . ARG B 221 ? 0.7906 0.3411 0.8297 0.0469  0.0733  -0.1372 435 ARG B CD  
3172 N NE  . ARG B 221 ? 0.7665 0.3039 0.8090 0.0347  0.0647  -0.1045 435 ARG B NE  
3173 C CZ  . ARG B 221 ? 0.7669 0.2931 0.8160 0.0519  0.0616  -0.0715 435 ARG B CZ  
3174 N NH1 . ARG B 221 ? 0.7939 0.3213 0.8519 0.0830  0.0645  -0.0676 435 ARG B NH1 
3175 N NH2 . ARG B 221 ? 0.7236 0.2428 0.7696 0.0390  0.0553  -0.0446 435 ARG B NH2 
3176 N N   . GLY B 222 ? 0.6450 0.3309 0.6259 -0.0448 0.0277  -0.1764 436 GLY B N   
3177 C CA  . GLY B 222 ? 0.6236 0.3543 0.5924 -0.0506 0.0135  -0.1601 436 GLY B CA  
3178 C C   . GLY B 222 ? 0.5996 0.3352 0.5713 -0.0393 0.0141  -0.1190 436 GLY B C   
3179 O O   . GLY B 222 ? 0.5977 0.3108 0.5790 -0.0254 0.0237  -0.1040 436 GLY B O   
3180 N N   . ALA B 223 ? 0.5303 0.2984 0.4950 -0.0436 0.0027  -0.1036 437 ALA B N   
3181 C CA  . ALA B 223 ? 0.4956 0.2702 0.4644 -0.0360 0.0024  -0.0699 437 ALA B CA  
3182 C C   . ALA B 223 ? 0.4891 0.2366 0.4825 -0.0428 0.0063  -0.0540 437 ALA B C   
3183 O O   . ALA B 223 ? 0.4955 0.2285 0.5025 -0.0598 0.0069  -0.0642 437 ALA B O   
3184 C CB  . ALA B 223 ? 0.5121 0.3233 0.4672 -0.0373 -0.0097 -0.0608 437 ALA B CB  
3185 N N   . GLN B 224 ? 0.4823 0.2251 0.4808 -0.0300 0.0098  -0.0294 438 GLN B N   
3186 C CA  . GLN B 224 ? 0.4918 0.2139 0.5045 -0.0321 0.0125  -0.0089 438 GLN B CA  
3187 C C   . GLN B 224 ? 0.4550 0.2034 0.4663 -0.0238 0.0074  0.0147  438 GLN B C   
3188 O O   . GLN B 224 ? 0.4073 0.1808 0.4114 -0.0160 0.0048  0.0149  438 GLN B O   
3189 C CB  . GLN B 224 ? 0.5631 0.2423 0.5847 -0.0197 0.0227  -0.0063 438 GLN B CB  
3190 C CG  . GLN B 224 ? 0.7251 0.3619 0.7544 -0.0335 0.0309  -0.0255 438 GLN B CG  
3191 C CD  . GLN B 224 ? 0.7554 0.3442 0.7912 -0.0180 0.0401  -0.0151 438 GLN B CD  
3192 O OE1 . GLN B 224 ? 0.7703 0.3552 0.8075 0.0062  0.0427  -0.0151 438 GLN B OE1 
3193 N NE2 . GLN B 224 ? 0.7483 0.3130 0.7854 -0.0299 0.0421  -0.0052 438 GLN B NE2 
3194 N N   . HIS B 225 ? 0.4771 0.2187 0.4942 -0.0269 0.0076  0.0335  439 HIS B N   
3195 C CA  . HIS B 225 ? 0.4562 0.2249 0.4718 -0.0197 0.0022  0.0513  439 HIS B CA  
3196 C C   . HIS B 225 ? 0.4741 0.2269 0.4908 -0.0132 0.0050  0.0732  439 HIS B C   
3197 O O   . HIS B 225 ? 0.4743 0.1917 0.4916 -0.0193 0.0130  0.0785  439 HIS B O   
3198 C CB  . HIS B 225 ? 0.4710 0.2694 0.4838 -0.0321 -0.0044 0.0488  439 HIS B CB  
3199 C CG  . HIS B 225 ? 0.5100 0.3040 0.5287 -0.0497 -0.0021 0.0480  439 HIS B CG  
3200 N ND1 . HIS B 225 ? 0.5359 0.3306 0.5561 -0.0536 0.0017  0.0653  439 HIS B ND1 
3201 C CD2 . HIS B 225 ? 0.5263 0.3203 0.5512 -0.0660 -0.0019 0.0299  439 HIS B CD2 
3202 C CE1 . HIS B 225 ? 0.5700 0.3635 0.5992 -0.0733 0.0069  0.0594  439 HIS B CE1 
3203 N NE2 . HIS B 225 ? 0.5692 0.3641 0.6044 -0.0817 0.0038  0.0362  439 HIS B NE2 
3204 N N   . HIS B 226 ? 0.4809 0.2593 0.4964 -0.0008 -0.0008 0.0856  440 HIS B N   
3205 C CA  . HIS B 226 ? 0.5207 0.2945 0.5297 0.0087  -0.0009 0.1079  440 HIS B CA  
3206 C C   . HIS B 226 ? 0.5243 0.3404 0.5300 0.0071  -0.0087 0.1113  440 HIS B C   
3207 O O   . HIS B 226 ? 0.5060 0.3511 0.5190 0.0111  -0.0148 0.1008  440 HIS B O   
3208 C CB  . HIS B 226 ? 0.5187 0.2823 0.5304 0.0346  -0.0023 0.1161  440 HIS B CB  
3209 C CG  . HIS B 226 ? 0.5813 0.3299 0.5778 0.0482  -0.0022 0.1413  440 HIS B CG  
3210 N ND1 . HIS B 226 ? 0.6555 0.3753 0.6465 0.0673  -0.0015 0.1476  440 HIS B ND1 
3211 C CD2 . HIS B 226 ? 0.5934 0.3570 0.5730 0.0455  -0.0041 0.1575  440 HIS B CD2 
3212 C CE1 . HIS B 226 ? 0.6957 0.4118 0.6662 0.0752  -0.0041 0.1685  440 HIS B CE1 
3213 N NE2 . HIS B 226 ? 0.6632 0.4060 0.6245 0.0620  -0.0046 0.1745  440 HIS B NE2 
3214 N N   . ILE B 227 ? 0.5239 0.3422 0.5194 -0.0006 -0.0060 0.1242  441 ILE B N   
3215 C CA  . ILE B 227 ? 0.4920 0.3499 0.4838 -0.0027 -0.0119 0.1234  441 ILE B CA  
3216 C C   . ILE B 227 ? 0.4894 0.3627 0.4672 0.0145  -0.0166 0.1401  441 ILE B C   
3217 O O   . ILE B 227 ? 0.5137 0.3623 0.4757 0.0213  -0.0108 0.1616  441 ILE B O   
3218 C CB  . ILE B 227 ? 0.5134 0.3765 0.5037 -0.0221 -0.0055 0.1220  441 ILE B CB  
3219 C CG1 . ILE B 227 ? 0.5052 0.3568 0.5085 -0.0367 -0.0033 0.1051  441 ILE B CG1 
3220 C CG2 . ILE B 227 ? 0.4638 0.3679 0.4533 -0.0222 -0.0114 0.1149  441 ILE B CG2 
3221 C CD1 . ILE B 227 ? 0.5241 0.3884 0.5337 -0.0556 0.0024  0.1002  441 ILE B CD1 
3222 N N   . TYR B 228 ? 0.4680 0.3813 0.4504 0.0216  -0.0269 0.1299  442 TYR B N   
3223 C CA  . TYR B 228 ? 0.4835 0.4247 0.4527 0.0391  -0.0354 0.1398  442 TYR B CA  
3224 C C   . TYR B 228 ? 0.4455 0.4262 0.4093 0.0323  -0.0393 0.1293  442 TYR B C   
3225 O O   . TYR B 228 ? 0.4405 0.4309 0.4190 0.0190  -0.0387 0.1100  442 TYR B O   
3226 C CB  . TYR B 228 ? 0.4927 0.4551 0.4783 0.0569  -0.0460 0.1308  442 TYR B CB  
3227 C CG  . TYR B 228 ? 0.5570 0.4853 0.5488 0.0697  -0.0425 0.1389  442 TYR B CG  
3228 C CD1 . TYR B 228 ? 0.6142 0.5239 0.5892 0.0924  -0.0439 0.1627  442 TYR B CD1 
3229 C CD2 . TYR B 228 ? 0.5469 0.4605 0.5588 0.0616  -0.0369 0.1230  442 TYR B CD2 
3230 C CE1 . TYR B 228 ? 0.6546 0.5289 0.6373 0.1069  -0.0399 0.1680  442 TYR B CE1 
3231 C CE2 . TYR B 228 ? 0.6062 0.4905 0.6244 0.0743  -0.0326 0.1261  442 TYR B CE2 
3232 C CZ  . TYR B 228 ? 0.6518 0.5155 0.6578 0.0972  -0.0342 0.1473  442 TYR B CZ  
3233 O OH  . TYR B 228 ? 0.7102 0.5404 0.7243 0.1125  -0.0291 0.1484  442 TYR B OH  
3234 N N   . ARG B 229 ? 0.5134 0.5153 0.4534 0.0437  -0.0430 0.1423  443 ARG B N   
3235 C CA  . ARG B 229 ? 0.5321 0.5787 0.4661 0.0414  -0.0485 0.1275  443 ARG B CA  
3236 C C   . ARG B 229 ? 0.5225 0.6099 0.4725 0.0525  -0.0644 0.1068  443 ARG B C   
3237 O O   . ARG B 229 ? 0.5462 0.6442 0.4944 0.0720  -0.0739 0.1151  443 ARG B O   
3238 C CB  . ARG B 229 ? 0.5887 0.6460 0.4851 0.0486  -0.0444 0.1490  443 ARG B CB  
3239 C CG  . ARG B 229 ? 0.6115 0.6360 0.4967 0.0319  -0.0248 0.1661  443 ARG B CG  
3240 C CD  . ARG B 229 ? 0.6809 0.7121 0.5245 0.0391  -0.0163 0.1927  443 ARG B CD  
3241 N NE  . ARG B 229 ? 0.7480 0.7550 0.5666 0.0617  -0.0193 0.2232  443 ARG B NE  
3242 C CZ  . ARG B 229 ? 0.7684 0.8072 0.5660 0.0872  -0.0352 0.2261  443 ARG B CZ  
3243 N NH1 . ARG B 229 ? 0.7524 0.8527 0.5479 0.0922  -0.0491 0.2036  443 ARG B NH1 
3244 N NH2 . ARG B 229 ? 0.8106 0.8191 0.5944 0.1050  -0.0380 0.2427  443 ARG B NH2 
3245 N N   . LEU B 230 ? 0.4748 0.5852 0.4437 0.0403  -0.0665 0.0784  444 LEU B N   
3246 C CA  . LEU B 230 ? 0.4458 0.5980 0.4353 0.0444  -0.0790 0.0532  444 LEU B CA  
3247 C C   . LEU B 230 ? 0.4915 0.6937 0.4607 0.0539  -0.0898 0.0442  444 LEU B C   
3248 O O   . LEU B 230 ? 0.4252 0.6369 0.3851 0.0447  -0.0854 0.0324  444 LEU B O   
3249 C CB  . LEU B 230 ? 0.4164 0.5608 0.4365 0.0251  -0.0731 0.0267  444 LEU B CB  
3250 C CG  . LEU B 230 ? 0.3819 0.4907 0.4219 0.0187  -0.0650 0.0306  444 LEU B CG  
3251 C CD1 . LEU B 230 ? 0.3647 0.4573 0.4239 0.0012  -0.0563 0.0117  444 LEU B CD1 
3252 C CD2 . LEU B 230 ? 0.3925 0.5240 0.4507 0.0300  -0.0723 0.0276  444 LEU B CD2 
3253 N N   . VAL B 231 ? 0.5341 0.7718 0.4957 0.0751  -0.1048 0.0488  445 VAL B N   
3254 C CA  . VAL B 231 ? 0.5570 0.8506 0.4939 0.0888  -0.1187 0.0403  445 VAL B CA  
3255 C C   . VAL B 231 ? 0.5398 0.8935 0.5087 0.0919  -0.1366 0.0040  445 VAL B C   
3256 O O   . VAL B 231 ? 0.5084 0.8583 0.5184 0.0841  -0.1360 -0.0099 445 VAL B O   
3257 C CB  . VAL B 231 ? 0.5745 0.8669 0.4659 0.1166  -0.1235 0.0793  445 VAL B CB  
3258 C CG1 . VAL B 231 ? 0.5873 0.8206 0.4513 0.1083  -0.1023 0.1131  445 VAL B CG1 
3259 C CG2 . VAL B 231 ? 0.5695 0.8630 0.4755 0.1389  -0.1348 0.0911  445 VAL B CG2 
3260 N N   . ARG B 232 ? 0.5586 0.9711 0.5093 0.1019  -0.1513 -0.0136 446 ARG B N   
3261 C CA  . ARG B 232 ? 0.6039 1.0656 0.5883 0.0993  -0.1625 -0.0521 446 ARG B CA  
3262 C C   . ARG B 232 ? 0.6479 1.1493 0.6007 0.1203  -0.1728 -0.0516 446 ARG B C   
3263 O O   . ARG B 232 ? 0.6825 1.1846 0.5932 0.1256  -0.1690 -0.0410 446 ARG B O   
3264 C CB  . ARG B 232 ? 0.5860 1.0587 0.6039 0.0701  -0.1573 -0.0970 446 ARG B CB  
3265 C CG  . ARG B 232 ? 0.5656 1.0794 0.6265 0.0605  -0.1629 -0.1380 446 ARG B CG  
3266 C CD  . ARG B 232 ? 0.5278 1.0266 0.6300 0.0276  -0.1507 -0.1758 446 ARG B CD  
3267 N NE  . ARG B 232 ? 0.5669 1.0679 0.6516 0.0197  -0.1463 -0.1974 446 ARG B NE  
3268 C CZ  . ARG B 232 ? 0.5541 1.0310 0.6660 -0.0053 -0.1335 -0.2280 446 ARG B CZ  
3269 N NH1 . ARG B 232 ? 0.5017 0.9471 0.6565 -0.0268 -0.1223 -0.2375 446 ARG B NH1 
3270 N NH2 . ARG B 232 ? 0.5710 1.0513 0.6663 -0.0079 -0.1296 -0.2479 446 ARG B NH2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   215 ?   ?   ?   A . n 
A 1 2   SER 2   216 ?   ?   ?   A . n 
A 1 3   ALA 3   217 ?   ?   ?   A . n 
A 1 4   TRP 4   218 ?   ?   ?   A . n 
A 1 5   GLN 5   219 ?   ?   ?   A . n 
A 1 6   ALA 6   220 ?   ?   ?   A . n 
A 1 7   ARG 7   221 ?   ?   ?   A . n 
A 1 8   GLY 8   222 222 GLY GLY A . n 
A 1 9   LEU 9   223 223 LEU LEU A . n 
A 1 10  GLY 10  224 224 GLY GLY A . n 
A 1 11  THR 11  225 225 THR THR A . n 
A 1 12  ALA 12  226 226 ALA ALA A . n 
A 1 13  ARG 13  227 227 ARG ARG A . n 
A 1 14  LEU 14  228 228 LEU LEU A . n 
A 1 15  GLN 15  229 229 GLN GLN A . n 
A 1 16  LEU 16  230 230 LEU LEU A . n 
A 1 17  VAL 17  231 231 VAL VAL A . n 
A 1 18  GLU 18  232 232 GLU GLU A . n 
A 1 19  PHE 19  233 233 PHE PHE A . n 
A 1 20  SER 20  234 234 SER SER A . n 
A 1 21  ALA 21  235 235 ALA ALA A . n 
A 1 22  PHE 22  236 236 PHE PHE A . n 
A 1 23  VAL 23  237 237 VAL VAL A . n 
A 1 24  GLU 24  238 238 GLU GLU A . n 
A 1 25  PRO 25  239 239 PRO PRO A . n 
A 1 26  PRO 26  240 ?   ?   ?   A . n 
A 1 27  ASP 27  241 ?   ?   ?   A . n 
A 1 28  ALA 28  242 ?   ?   ?   A . n 
A 1 29  VAL 29  243 ?   ?   ?   A . n 
A 1 30  ASP 30  244 ?   ?   ?   A . n 
A 1 31  SER 31  245 ?   ?   ?   A . n 
A 1 32  TYR 32  246 ?   ?   ?   A . n 
A 1 33  GLN 33  247 247 GLN GLN A . n 
A 1 34  ARG 34  248 248 ARG ARG A . n 
A 1 35  HIS 35  249 249 HIS HIS A . n 
A 1 36  LEU 36  250 250 LEU LEU A . n 
A 1 37  PHE 37  251 251 PHE PHE A . n 
A 1 38  VAL 38  252 252 VAL VAL A . n 
A 1 39  HIS 39  253 253 HIS HIS A . n 
A 1 40  ILE 40  254 254 ILE ILE A . n 
A 1 41  SER 41  255 255 SER SER A . n 
A 1 42  GLN 42  256 256 GLN GLN A . n 
A 1 43  HIS 43  257 ?   ?   ?   A . n 
A 1 44  CYS 44  258 ?   ?   ?   A . n 
A 1 45  PRO 45  259 ?   ?   ?   A . n 
A 1 46  SER 46  260 ?   ?   ?   A . n 
A 1 47  PRO 47  261 ?   ?   ?   A . n 
A 1 48  GLY 48  262 ?   ?   ?   A . n 
A 1 49  ALA 49  263 ?   ?   ?   A . n 
A 1 50  PRO 50  264 ?   ?   ?   A . n 
A 1 51  PRO 51  265 ?   ?   ?   A . n 
A 1 52  LEU 52  266 266 LEU LEU A . n 
A 1 53  GLU 53  267 267 GLU GLU A . n 
A 1 54  SER 54  268 268 SER SER A . n 
A 1 55  VAL 55  269 269 VAL VAL A . n 
A 1 56  ASP 56  270 270 ASP ASP A . n 
A 1 57  VAL 57  271 271 VAL VAL A . n 
A 1 58  ARG 58  272 272 ARG ARG A . n 
A 1 59  GLN 59  273 273 GLN GLN A . n 
A 1 60  ILE 60  274 274 ILE ILE A . n 
A 1 61  TYR 61  275 275 TYR TYR A . n 
A 1 62  ASP 62  276 276 ASP ASP A . n 
A 1 63  LYS 63  277 277 LYS LYS A . n 
A 1 64  PHE 64  278 278 PHE PHE A . n 
A 1 65  PRO 65  279 279 PRO PRO A . n 
A 1 66  GLU 66  280 280 GLU GLU A . n 
A 1 67  LYS 67  281 281 LYS LYS A . n 
A 1 68  LYS 68  282 282 LYS LYS A . n 
A 1 69  GLY 69  283 283 GLY GLY A . n 
A 1 70  GLY 70  284 284 GLY GLY A . n 
A 1 71  LEU 71  285 285 LEU LEU A . n 
A 1 72  ARG 72  286 286 ARG ARG A . n 
A 1 73  GLU 73  287 287 GLU GLU A . n 
A 1 74  LEU 74  288 288 LEU LEU A . n 
A 1 75  TYR 75  289 289 TYR TYR A . n 
A 1 76  ASP 76  290 290 ASP ASP A . n 
A 1 77  ARG 77  291 291 ARG ARG A . n 
A 1 78  GLY 78  292 292 GLY GLY A . n 
A 1 79  PRO 79  293 293 PRO PRO A . n 
A 1 80  PRO 80  294 294 PRO PRO A . n 
A 1 81  HIS 81  295 295 HIS HIS A . n 
A 1 82  ALA 82  296 296 ALA ALA A . n 
A 1 83  PHE 83  297 297 PHE PHE A . n 
A 1 84  PHE 84  298 298 PHE PHE A . n 
A 1 85  LEU 85  299 299 LEU LEU A . n 
A 1 86  VAL 86  300 300 VAL VAL A . n 
A 1 87  LYS 87  301 301 LYS LYS A . n 
A 1 88  PHE 88  302 302 PHE PHE A . n 
A 1 89  TRP 89  303 303 TRP TRP A . n 
A 1 90  ALA 90  304 304 ALA ALA A . n 
A 1 91  ASP 91  305 305 ASP ASP A . n 
A 1 92  LEU 92  306 306 LEU LEU A . n 
A 1 93  ASN 93  307 307 ASN ASN A . n 
A 1 94  TRP 94  308 308 TRP TRP A . n 
A 1 95  GLY 95  309 ?   ?   ?   A . n 
A 1 96  PRO 96  310 ?   ?   ?   A . n 
A 1 97  SER 97  311 ?   ?   ?   A . n 
A 1 98  GLY 98  312 ?   ?   ?   A . n 
A 1 99  GLU 99  313 ?   ?   ?   A . n 
A 1 100 GLU 100 314 ?   ?   ?   A . n 
A 1 101 ALA 101 315 ?   ?   ?   A . n 
A 1 102 GLY 102 316 ?   ?   ?   A . n 
A 1 103 ALA 103 317 ?   ?   ?   A . n 
A 1 104 GLY 104 318 ?   ?   ?   A . n 
A 1 105 GLY 105 319 ?   ?   ?   A . n 
A 1 106 SER 106 320 ?   ?   ?   A . n 
A 1 107 ILE 107 321 ?   ?   ?   A . n 
A 1 108 SER 108 322 ?   ?   ?   A . n 
A 1 109 SER 109 323 ?   ?   ?   A . n 
A 1 110 GLY 110 324 324 GLY GLY A . n 
A 1 111 GLY 111 325 325 GLY GLY A . n 
A 1 112 PHE 112 326 326 PHE PHE A . n 
A 1 113 TYR 113 327 327 TYR TYR A . n 
A 1 114 GLY 114 328 328 GLY GLY A . n 
A 1 115 VAL 115 329 329 VAL VAL A . n 
A 1 116 SER 116 330 330 SER SER A . n 
A 1 117 SER 117 331 331 SER SER A . n 
A 1 118 GLN 118 332 332 GLN GLN A . n 
A 1 119 TYR 119 333 333 TYR TYR A . n 
A 1 120 GLU 120 334 334 GLU GLU A . n 
A 1 121 SER 121 335 335 SER SER A . n 
A 1 122 LEU 122 336 336 LEU LEU A . n 
A 1 123 GLU 123 337 337 GLU GLU A . n 
A 1 124 HIS 124 338 338 HIS HIS A . n 
A 1 125 MET 125 339 339 MET MET A . n 
A 1 126 THR 126 340 340 THR THR A . n 
A 1 127 LEU 127 341 341 LEU LEU A . n 
A 1 128 THR 128 342 342 THR THR A . n 
A 1 129 CYS 129 343 343 CYS CYS A . n 
A 1 130 SER 130 344 344 SER SER A . n 
A 1 131 SER 131 345 345 SER SER A . n 
A 1 132 LYS 132 346 346 LYS LYS A . n 
A 1 133 VAL 133 347 347 VAL VAL A . n 
A 1 134 CYS 134 348 348 CYS CYS A . n 
A 1 135 SER 135 349 349 SER SER A . n 
A 1 136 PHE 136 350 350 PHE PHE A . n 
A 1 137 GLY 137 351 351 GLY GLY A . n 
A 1 138 LYS 138 352 352 LYS LYS A . n 
A 1 139 GLN 139 353 353 GLN GLN A . n 
A 1 140 VAL 140 354 354 VAL VAL A . n 
A 1 141 VAL 141 355 355 VAL VAL A . n 
A 1 142 GLU 142 356 356 GLU GLU A . n 
A 1 143 LYS 143 357 357 LYS LYS A . n 
A 1 144 VAL 144 358 358 VAL VAL A . n 
A 1 145 GLU 145 359 359 GLU GLU A . n 
A 1 146 THR 146 360 360 THR THR A . n 
A 1 147 GLU 147 361 361 GLU GLU A . n 
A 1 148 ARG 148 362 362 ARG ARG A . n 
A 1 149 ALA 149 363 363 ALA ALA A . n 
A 1 150 GLN 150 364 364 GLN GLN A . n 
A 1 151 LEU 151 365 365 LEU LEU A . n 
A 1 152 GLU 152 366 366 GLU GLU A . n 
A 1 153 ASP 153 367 367 ASP ASP A . n 
A 1 154 GLY 154 368 368 GLY GLY A . n 
A 1 155 ARG 155 369 369 ARG ARG A . n 
A 1 156 PHE 156 370 370 PHE PHE A . n 
A 1 157 VAL 157 371 371 VAL VAL A . n 
A 1 158 TYR 158 372 372 TYR TYR A . n 
A 1 159 ARG 159 373 373 ARG ARG A . n 
A 1 160 LEU 160 374 374 LEU LEU A . n 
A 1 161 LEU 161 375 375 LEU LEU A . n 
A 1 162 ARG 162 376 376 ARG ARG A . n 
A 1 163 SER 163 377 377 SER SER A . n 
A 1 164 PRO 164 378 378 PRO PRO A . n 
A 1 165 MET 165 379 379 MET MET A . n 
A 1 166 P1L 166 380 380 P1L P1L A . n 
A 1 167 GLU 167 381 381 GLU GLU A . n 
A 1 168 TYR 168 382 382 TYR TYR A . n 
A 1 169 LEU 169 383 383 LEU LEU A . n 
A 1 170 VAL 170 384 384 VAL VAL A . n 
A 1 171 ASN 171 385 385 ASN ASN A . n 
A 1 172 PHE 172 386 386 PHE PHE A . n 
A 1 173 LEU 173 387 387 LEU LEU A . n 
A 1 174 HIS 174 388 388 HIS HIS A . n 
A 1 175 LYS 175 389 389 LYS LYS A . n 
A 1 176 LEU 176 390 390 LEU LEU A . n 
A 1 177 ARG 177 391 391 ARG ARG A . n 
A 1 178 GLN 178 392 392 GLN GLN A . n 
A 1 179 LEU 179 393 393 LEU LEU A . n 
A 1 180 PRO 180 394 394 PRO PRO A . n 
A 1 181 GLU 181 395 395 GLU GLU A . n 
A 1 182 ARG 182 396 396 ARG ARG A . n 
A 1 183 TYR 183 397 397 TYR TYR A . n 
A 1 184 MET 184 398 398 MET MET A . n 
A 1 185 MET 185 399 399 MET MET A . n 
A 1 186 ASN 186 400 400 ASN ASN A . n 
A 1 187 SER 187 401 401 SER SER A . n 
A 1 188 VAL 188 402 402 VAL VAL A . n 
A 1 189 LEU 189 403 403 LEU LEU A . n 
A 1 190 GLU 190 404 404 GLU GLU A . n 
A 1 191 ASN 191 405 405 ASN ASN A . n 
A 1 192 PHE 192 406 406 PHE PHE A . n 
A 1 193 THR 193 407 407 THR THR A . n 
A 1 194 ILE 194 408 408 ILE ILE A . n 
A 1 195 LEU 195 409 409 LEU LEU A . n 
A 1 196 GLN 196 410 410 GLN GLN A . n 
A 1 197 VAL 197 411 411 VAL VAL A . n 
A 1 198 VAL 198 412 412 VAL VAL A . n 
A 1 199 THR 199 413 413 THR THR A . n 
A 1 200 ASN 200 414 414 ASN ASN A . n 
A 1 201 ARG 201 415 415 ARG ARG A . n 
A 1 202 ASP 202 416 416 ASP ASP A . n 
A 1 203 THR 203 417 417 THR THR A . n 
A 1 204 GLN 204 418 418 GLN GLN A . n 
A 1 205 GLU 205 419 419 GLU GLU A . n 
A 1 206 LEU 206 420 420 LEU LEU A . n 
A 1 207 LEU 207 421 421 LEU LEU A . n 
A 1 208 LEU 208 422 422 LEU LEU A . n 
A 1 209 CYS 209 423 423 CYS CYS A . n 
A 1 210 THR 210 424 424 THR THR A . n 
A 1 211 ALA 211 425 425 ALA ALA A . n 
A 1 212 TYR 212 426 426 TYR TYR A . n 
A 1 213 VAL 213 427 427 VAL VAL A . n 
A 1 214 PHE 214 428 428 PHE PHE A . n 
A 1 215 GLU 215 429 429 GLU GLU A . n 
A 1 216 VAL 216 430 430 VAL VAL A . n 
A 1 217 SER 217 431 431 SER SER A . n 
A 1 218 THR 218 432 432 THR THR A . n 
A 1 219 SER 219 433 433 SER SER A . n 
A 1 220 GLU 220 434 434 GLU GLU A . n 
A 1 221 ARG 221 435 435 ARG ARG A . n 
A 1 222 GLY 222 436 436 GLY GLY A . n 
A 1 223 ALA 223 437 437 ALA ALA A . n 
A 1 224 GLN 224 438 438 GLN GLN A . n 
A 1 225 HIS 225 439 439 HIS HIS A . n 
A 1 226 HIS 226 440 440 HIS HIS A . n 
A 1 227 ILE 227 441 441 ILE ILE A . n 
A 1 228 TYR 228 442 442 TYR TYR A . n 
A 1 229 ARG 229 443 443 ARG ARG A . n 
A 1 230 LEU 230 444 444 LEU LEU A . n 
A 1 231 VAL 231 445 445 VAL VAL A . n 
A 1 232 ARG 232 446 446 ARG ARG A . n 
A 1 233 ASP 233 447 ?   ?   ?   A . n 
A 1 234 GLY 234 448 ?   ?   ?   A . n 
A 1 235 ASN 235 449 ?   ?   ?   A . n 
A 1 236 SER 236 450 ?   ?   ?   A . n 
B 1 1   GLY 1   215 ?   ?   ?   B . n 
B 1 2   SER 2   216 ?   ?   ?   B . n 
B 1 3   ALA 3   217 ?   ?   ?   B . n 
B 1 4   TRP 4   218 218 TRP TRP B . n 
B 1 5   GLN 5   219 219 GLN GLN B . n 
B 1 6   ALA 6   220 220 ALA ALA B . n 
B 1 7   ARG 7   221 221 ARG ARG B . n 
B 1 8   GLY 8   222 222 GLY GLY B . n 
B 1 9   LEU 9   223 223 LEU LEU B . n 
B 1 10  GLY 10  224 224 GLY GLY B . n 
B 1 11  THR 11  225 225 THR THR B . n 
B 1 12  ALA 12  226 226 ALA ALA B . n 
B 1 13  ARG 13  227 227 ARG ARG B . n 
B 1 14  LEU 14  228 228 LEU LEU B . n 
B 1 15  GLN 15  229 229 GLN GLN B . n 
B 1 16  LEU 16  230 230 LEU LEU B . n 
B 1 17  VAL 17  231 231 VAL VAL B . n 
B 1 18  GLU 18  232 232 GLU GLU B . n 
B 1 19  PHE 19  233 233 PHE PHE B . n 
B 1 20  SER 20  234 234 SER SER B . n 
B 1 21  ALA 21  235 235 ALA ALA B . n 
B 1 22  PHE 22  236 236 PHE PHE B . n 
B 1 23  VAL 23  237 237 VAL VAL B . n 
B 1 24  GLU 24  238 238 GLU GLU B . n 
B 1 25  PRO 25  239 239 PRO PRO B . n 
B 1 26  PRO 26  240 240 PRO PRO B . n 
B 1 27  ASP 27  241 241 ASP ASP B . n 
B 1 28  ALA 28  242 242 ALA ALA B . n 
B 1 29  VAL 29  243 243 VAL VAL B . n 
B 1 30  ASP 30  244 244 ASP ASP B . n 
B 1 31  SER 31  245 245 SER SER B . n 
B 1 32  TYR 32  246 246 TYR TYR B . n 
B 1 33  GLN 33  247 247 GLN GLN B . n 
B 1 34  ARG 34  248 248 ARG ARG B . n 
B 1 35  HIS 35  249 249 HIS HIS B . n 
B 1 36  LEU 36  250 250 LEU LEU B . n 
B 1 37  PHE 37  251 251 PHE PHE B . n 
B 1 38  VAL 38  252 252 VAL VAL B . n 
B 1 39  HIS 39  253 253 HIS HIS B . n 
B 1 40  ILE 40  254 254 ILE ILE B . n 
B 1 41  SER 41  255 255 SER SER B . n 
B 1 42  GLN 42  256 256 GLN GLN B . n 
B 1 43  HIS 43  257 ?   ?   ?   B . n 
B 1 44  CYS 44  258 ?   ?   ?   B . n 
B 1 45  PRO 45  259 ?   ?   ?   B . n 
B 1 46  SER 46  260 ?   ?   ?   B . n 
B 1 47  PRO 47  261 ?   ?   ?   B . n 
B 1 48  GLY 48  262 ?   ?   ?   B . n 
B 1 49  ALA 49  263 ?   ?   ?   B . n 
B 1 50  PRO 50  264 264 PRO PRO B . n 
B 1 51  PRO 51  265 265 PRO PRO B . n 
B 1 52  LEU 52  266 266 LEU LEU B . n 
B 1 53  GLU 53  267 267 GLU GLU B . n 
B 1 54  SER 54  268 268 SER SER B . n 
B 1 55  VAL 55  269 269 VAL VAL B . n 
B 1 56  ASP 56  270 270 ASP ASP B . n 
B 1 57  VAL 57  271 271 VAL VAL B . n 
B 1 58  ARG 58  272 272 ARG ARG B . n 
B 1 59  GLN 59  273 273 GLN GLN B . n 
B 1 60  ILE 60  274 274 ILE ILE B . n 
B 1 61  TYR 61  275 275 TYR TYR B . n 
B 1 62  ASP 62  276 276 ASP ASP B . n 
B 1 63  LYS 63  277 277 LYS LYS B . n 
B 1 64  PHE 64  278 278 PHE PHE B . n 
B 1 65  PRO 65  279 279 PRO PRO B . n 
B 1 66  GLU 66  280 280 GLU GLU B . n 
B 1 67  LYS 67  281 281 LYS LYS B . n 
B 1 68  LYS 68  282 282 LYS LYS B . n 
B 1 69  GLY 69  283 283 GLY GLY B . n 
B 1 70  GLY 70  284 284 GLY GLY B . n 
B 1 71  LEU 71  285 285 LEU LEU B . n 
B 1 72  ARG 72  286 286 ARG ARG B . n 
B 1 73  GLU 73  287 287 GLU GLU B . n 
B 1 74  LEU 74  288 288 LEU LEU B . n 
B 1 75  TYR 75  289 289 TYR TYR B . n 
B 1 76  ASP 76  290 290 ASP ASP B . n 
B 1 77  ARG 77  291 291 ARG ARG B . n 
B 1 78  GLY 78  292 292 GLY GLY B . n 
B 1 79  PRO 79  293 293 PRO PRO B . n 
B 1 80  PRO 80  294 294 PRO PRO B . n 
B 1 81  HIS 81  295 295 HIS HIS B . n 
B 1 82  ALA 82  296 296 ALA ALA B . n 
B 1 83  PHE 83  297 297 PHE PHE B . n 
B 1 84  PHE 84  298 298 PHE PHE B . n 
B 1 85  LEU 85  299 299 LEU LEU B . n 
B 1 86  VAL 86  300 300 VAL VAL B . n 
B 1 87  LYS 87  301 301 LYS LYS B . n 
B 1 88  PHE 88  302 302 PHE PHE B . n 
B 1 89  TRP 89  303 303 TRP TRP B . n 
B 1 90  ALA 90  304 304 ALA ALA B . n 
B 1 91  ASP 91  305 305 ASP ASP B . n 
B 1 92  LEU 92  306 306 LEU LEU B . n 
B 1 93  ASN 93  307 307 ASN ASN B . n 
B 1 94  TRP 94  308 308 TRP TRP B . n 
B 1 95  GLY 95  309 ?   ?   ?   B . n 
B 1 96  PRO 96  310 ?   ?   ?   B . n 
B 1 97  SER 97  311 ?   ?   ?   B . n 
B 1 98  GLY 98  312 ?   ?   ?   B . n 
B 1 99  GLU 99  313 ?   ?   ?   B . n 
B 1 100 GLU 100 314 ?   ?   ?   B . n 
B 1 101 ALA 101 315 ?   ?   ?   B . n 
B 1 102 GLY 102 316 ?   ?   ?   B . n 
B 1 103 ALA 103 317 ?   ?   ?   B . n 
B 1 104 GLY 104 318 ?   ?   ?   B . n 
B 1 105 GLY 105 319 ?   ?   ?   B . n 
B 1 106 SER 106 320 ?   ?   ?   B . n 
B 1 107 ILE 107 321 ?   ?   ?   B . n 
B 1 108 SER 108 322 ?   ?   ?   B . n 
B 1 109 SER 109 323 ?   ?   ?   B . n 
B 1 110 GLY 110 324 ?   ?   ?   B . n 
B 1 111 GLY 111 325 325 GLY GLY B . n 
B 1 112 PHE 112 326 326 PHE PHE B . n 
B 1 113 TYR 113 327 327 TYR TYR B . n 
B 1 114 GLY 114 328 328 GLY GLY B . n 
B 1 115 VAL 115 329 329 VAL VAL B . n 
B 1 116 SER 116 330 330 SER SER B . n 
B 1 117 SER 117 331 331 SER SER B . n 
B 1 118 GLN 118 332 332 GLN GLN B . n 
B 1 119 TYR 119 333 333 TYR TYR B . n 
B 1 120 GLU 120 334 334 GLU GLU B . n 
B 1 121 SER 121 335 335 SER SER B . n 
B 1 122 LEU 122 336 336 LEU LEU B . n 
B 1 123 GLU 123 337 337 GLU GLU B . n 
B 1 124 HIS 124 338 338 HIS HIS B . n 
B 1 125 MET 125 339 339 MET MET B . n 
B 1 126 THR 126 340 340 THR THR B . n 
B 1 127 LEU 127 341 341 LEU LEU B . n 
B 1 128 THR 128 342 342 THR THR B . n 
B 1 129 CYS 129 343 343 CYS CYS B . n 
B 1 130 SER 130 344 344 SER SER B . n 
B 1 131 SER 131 345 345 SER SER B . n 
B 1 132 LYS 132 346 346 LYS LYS B . n 
B 1 133 VAL 133 347 347 VAL VAL B . n 
B 1 134 CYS 134 348 348 CYS CYS B . n 
B 1 135 SER 135 349 349 SER SER B . n 
B 1 136 PHE 136 350 350 PHE PHE B . n 
B 1 137 GLY 137 351 351 GLY GLY B . n 
B 1 138 LYS 138 352 352 LYS LYS B . n 
B 1 139 GLN 139 353 353 GLN GLN B . n 
B 1 140 VAL 140 354 354 VAL VAL B . n 
B 1 141 VAL 141 355 355 VAL VAL B . n 
B 1 142 GLU 142 356 356 GLU GLU B . n 
B 1 143 LYS 143 357 357 LYS LYS B . n 
B 1 144 VAL 144 358 358 VAL VAL B . n 
B 1 145 GLU 145 359 359 GLU GLU B . n 
B 1 146 THR 146 360 360 THR THR B . n 
B 1 147 GLU 147 361 361 GLU GLU B . n 
B 1 148 ARG 148 362 362 ARG ARG B . n 
B 1 149 ALA 149 363 363 ALA ALA B . n 
B 1 150 GLN 150 364 364 GLN GLN B . n 
B 1 151 LEU 151 365 365 LEU LEU B . n 
B 1 152 GLU 152 366 366 GLU GLU B . n 
B 1 153 ASP 153 367 367 ASP ASP B . n 
B 1 154 GLY 154 368 368 GLY GLY B . n 
B 1 155 ARG 155 369 369 ARG ARG B . n 
B 1 156 PHE 156 370 370 PHE PHE B . n 
B 1 157 VAL 157 371 371 VAL VAL B . n 
B 1 158 TYR 158 372 372 TYR TYR B . n 
B 1 159 ARG 159 373 373 ARG ARG B . n 
B 1 160 LEU 160 374 374 LEU LEU B . n 
B 1 161 LEU 161 375 375 LEU LEU B . n 
B 1 162 ARG 162 376 376 ARG ARG B . n 
B 1 163 SER 163 377 377 SER SER B . n 
B 1 164 PRO 164 378 378 PRO PRO B . n 
B 1 165 MET 165 379 379 MET MET B . n 
B 1 166 P1L 166 380 380 P1L P1L B . n 
B 1 167 GLU 167 381 381 GLU GLU B . n 
B 1 168 TYR 168 382 382 TYR TYR B . n 
B 1 169 LEU 169 383 383 LEU LEU B . n 
B 1 170 VAL 170 384 384 VAL VAL B . n 
B 1 171 ASN 171 385 385 ASN ASN B . n 
B 1 172 PHE 172 386 386 PHE PHE B . n 
B 1 173 LEU 173 387 387 LEU LEU B . n 
B 1 174 HIS 174 388 388 HIS HIS B . n 
B 1 175 LYS 175 389 389 LYS LYS B . n 
B 1 176 LEU 176 390 390 LEU LEU B . n 
B 1 177 ARG 177 391 391 ARG ARG B . n 
B 1 178 GLN 178 392 392 GLN GLN B . n 
B 1 179 LEU 179 393 393 LEU LEU B . n 
B 1 180 PRO 180 394 394 PRO PRO B . n 
B 1 181 GLU 181 395 395 GLU GLU B . n 
B 1 182 ARG 182 396 396 ARG ARG B . n 
B 1 183 TYR 183 397 397 TYR TYR B . n 
B 1 184 MET 184 398 398 MET MET B . n 
B 1 185 MET 185 399 399 MET MET B . n 
B 1 186 ASN 186 400 400 ASN ASN B . n 
B 1 187 SER 187 401 401 SER SER B . n 
B 1 188 VAL 188 402 402 VAL VAL B . n 
B 1 189 LEU 189 403 403 LEU LEU B . n 
B 1 190 GLU 190 404 404 GLU GLU B . n 
B 1 191 ASN 191 405 405 ASN ASN B . n 
B 1 192 PHE 192 406 406 PHE PHE B . n 
B 1 193 THR 193 407 407 THR THR B . n 
B 1 194 ILE 194 408 408 ILE ILE B . n 
B 1 195 LEU 195 409 409 LEU LEU B . n 
B 1 196 GLN 196 410 410 GLN GLN B . n 
B 1 197 VAL 197 411 411 VAL VAL B . n 
B 1 198 VAL 198 412 412 VAL VAL B . n 
B 1 199 THR 199 413 413 THR THR B . n 
B 1 200 ASN 200 414 414 ASN ASN B . n 
B 1 201 ARG 201 415 415 ARG ARG B . n 
B 1 202 ASP 202 416 416 ASP ASP B . n 
B 1 203 THR 203 417 417 THR THR B . n 
B 1 204 GLN 204 418 418 GLN GLN B . n 
B 1 205 GLU 205 419 419 GLU GLU B . n 
B 1 206 LEU 206 420 420 LEU LEU B . n 
B 1 207 LEU 207 421 421 LEU LEU B . n 
B 1 208 LEU 208 422 422 LEU LEU B . n 
B 1 209 CYS 209 423 423 CYS CYS B . n 
B 1 210 THR 210 424 424 THR THR B . n 
B 1 211 ALA 211 425 425 ALA ALA B . n 
B 1 212 TYR 212 426 426 TYR TYR B . n 
B 1 213 VAL 213 427 427 VAL VAL B . n 
B 1 214 PHE 214 428 428 PHE PHE B . n 
B 1 215 GLU 215 429 429 GLU GLU B . n 
B 1 216 VAL 216 430 430 VAL VAL B . n 
B 1 217 SER 217 431 431 SER SER B . n 
B 1 218 THR 218 432 ?   ?   ?   B . n 
B 1 219 SER 219 433 ?   ?   ?   B . n 
B 1 220 GLU 220 434 434 GLU GLU B . n 
B 1 221 ARG 221 435 435 ARG ARG B . n 
B 1 222 GLY 222 436 436 GLY GLY B . n 
B 1 223 ALA 223 437 437 ALA ALA B . n 
B 1 224 GLN 224 438 438 GLN GLN B . n 
B 1 225 HIS 225 439 439 HIS HIS B . n 
B 1 226 HIS 226 440 440 HIS HIS B . n 
B 1 227 ILE 227 441 441 ILE ILE B . n 
B 1 228 TYR 228 442 442 TYR TYR B . n 
B 1 229 ARG 229 443 443 ARG ARG B . n 
B 1 230 LEU 230 444 444 LEU LEU B . n 
B 1 231 VAL 231 445 445 VAL VAL B . n 
B 1 232 ARG 232 446 446 ARG ARG B . n 
B 1 233 ASP 233 447 ?   ?   ?   B . n 
B 1 234 GLY 234 448 ?   ?   ?   B . n 
B 1 235 ASN 235 449 ?   ?   ?   B . n 
B 1 236 SER 236 450 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  501 186 HOH HOH A . 
C 2 HOH 2  502 158 HOH HOH A . 
C 2 HOH 3  503 36  HOH HOH A . 
C 2 HOH 4  504 146 HOH HOH A . 
C 2 HOH 5  505 60  HOH HOH A . 
C 2 HOH 6  506 112 HOH HOH A . 
C 2 HOH 7  507 93  HOH HOH A . 
C 2 HOH 8  508 50  HOH HOH A . 
C 2 HOH 9  509 31  HOH HOH A . 
C 2 HOH 10 510 61  HOH HOH A . 
C 2 HOH 11 511 147 HOH HOH A . 
C 2 HOH 12 512 18  HOH HOH A . 
C 2 HOH 13 513 5   HOH HOH A . 
C 2 HOH 14 514 76  HOH HOH A . 
C 2 HOH 15 515 173 HOH HOH A . 
C 2 HOH 16 516 74  HOH HOH A . 
C 2 HOH 17 517 23  HOH HOH A . 
C 2 HOH 18 518 46  HOH HOH A . 
C 2 HOH 19 519 150 HOH HOH A . 
C 2 HOH 20 520 40  HOH HOH A . 
C 2 HOH 21 521 81  HOH HOH A . 
C 2 HOH 22 522 44  HOH HOH A . 
C 2 HOH 23 523 63  HOH HOH A . 
C 2 HOH 24 524 138 HOH HOH A . 
C 2 HOH 25 525 179 HOH HOH A . 
C 2 HOH 26 526 9   HOH HOH A . 
C 2 HOH 27 527 45  HOH HOH A . 
C 2 HOH 28 528 39  HOH HOH A . 
C 2 HOH 29 529 20  HOH HOH A . 
C 2 HOH 30 530 41  HOH HOH A . 
C 2 HOH 31 531 7   HOH HOH A . 
C 2 HOH 32 532 106 HOH HOH A . 
C 2 HOH 33 533 12  HOH HOH A . 
C 2 HOH 34 534 110 HOH HOH A . 
C 2 HOH 35 535 6   HOH HOH A . 
C 2 HOH 36 536 79  HOH HOH A . 
C 2 HOH 37 537 97  HOH HOH A . 
C 2 HOH 38 538 16  HOH HOH A . 
C 2 HOH 39 539 103 HOH HOH A . 
C 2 HOH 40 540 67  HOH HOH A . 
C 2 HOH 41 541 101 HOH HOH A . 
C 2 HOH 42 542 54  HOH HOH A . 
C 2 HOH 43 543 118 HOH HOH A . 
C 2 HOH 44 544 38  HOH HOH A . 
C 2 HOH 45 545 43  HOH HOH A . 
C 2 HOH 46 546 100 HOH HOH A . 
C 2 HOH 47 547 55  HOH HOH A . 
C 2 HOH 48 548 123 HOH HOH A . 
C 2 HOH 49 549 176 HOH HOH A . 
C 2 HOH 50 550 135 HOH HOH A . 
C 2 HOH 51 551 165 HOH HOH A . 
C 2 HOH 52 552 70  HOH HOH A . 
C 2 HOH 53 553 161 HOH HOH A . 
C 2 HOH 54 554 137 HOH HOH A . 
C 2 HOH 55 555 95  HOH HOH A . 
C 2 HOH 56 556 177 HOH HOH A . 
C 2 HOH 57 557 119 HOH HOH A . 
C 2 HOH 58 558 53  HOH HOH A . 
C 2 HOH 59 559 136 HOH HOH A . 
C 2 HOH 60 560 88  HOH HOH A . 
C 2 HOH 61 561 57  HOH HOH A . 
C 2 HOH 62 562 129 HOH HOH A . 
C 2 HOH 63 563 139 HOH HOH A . 
C 2 HOH 64 564 80  HOH HOH A . 
C 2 HOH 65 565 122 HOH HOH A . 
C 2 HOH 66 566 90  HOH HOH A . 
C 2 HOH 67 567 105 HOH HOH A . 
C 2 HOH 68 568 117 HOH HOH A . 
C 2 HOH 69 569 180 HOH HOH A . 
C 2 HOH 70 570 113 HOH HOH A . 
C 2 HOH 71 571 145 HOH HOH A . 
C 2 HOH 72 572 65  HOH HOH A . 
C 2 HOH 73 573 62  HOH HOH A . 
C 2 HOH 74 574 171 HOH HOH A . 
C 2 HOH 75 575 94  HOH HOH A . 
C 2 HOH 76 576 170 HOH HOH A . 
C 2 HOH 77 577 111 HOH HOH A . 
C 2 HOH 78 578 83  HOH HOH A . 
C 2 HOH 79 579 167 HOH HOH A . 
C 2 HOH 80 580 132 HOH HOH A . 
D 2 HOH 1  501 69  HOH HOH B . 
D 2 HOH 2  502 126 HOH HOH B . 
D 2 HOH 3  503 77  HOH HOH B . 
D 2 HOH 4  504 92  HOH HOH B . 
D 2 HOH 5  505 34  HOH HOH B . 
D 2 HOH 6  506 2   HOH HOH B . 
D 2 HOH 7  507 30  HOH HOH B . 
D 2 HOH 8  508 115 HOH HOH B . 
D 2 HOH 9  509 33  HOH HOH B . 
D 2 HOH 10 510 19  HOH HOH B . 
D 2 HOH 11 511 64  HOH HOH B . 
D 2 HOH 12 512 148 HOH HOH B . 
D 2 HOH 13 513 73  HOH HOH B . 
D 2 HOH 14 514 134 HOH HOH B . 
D 2 HOH 15 515 104 HOH HOH B . 
D 2 HOH 16 516 68  HOH HOH B . 
D 2 HOH 17 517 26  HOH HOH B . 
D 2 HOH 18 518 84  HOH HOH B . 
D 2 HOH 19 519 1   HOH HOH B . 
D 2 HOH 20 520 22  HOH HOH B . 
D 2 HOH 21 521 72  HOH HOH B . 
D 2 HOH 22 522 98  HOH HOH B . 
D 2 HOH 23 523 42  HOH HOH B . 
D 2 HOH 24 524 11  HOH HOH B . 
D 2 HOH 25 525 25  HOH HOH B . 
D 2 HOH 26 526 29  HOH HOH B . 
D 2 HOH 27 527 185 HOH HOH B . 
D 2 HOH 28 528 21  HOH HOH B . 
D 2 HOH 29 529 184 HOH HOH B . 
D 2 HOH 30 530 192 HOH HOH B . 
D 2 HOH 31 531 128 HOH HOH B . 
D 2 HOH 32 532 4   HOH HOH B . 
D 2 HOH 33 533 10  HOH HOH B . 
D 2 HOH 34 534 86  HOH HOH B . 
D 2 HOH 35 535 3   HOH HOH B . 
D 2 HOH 36 536 8   HOH HOH B . 
D 2 HOH 37 537 172 HOH HOH B . 
D 2 HOH 38 538 78  HOH HOH B . 
D 2 HOH 39 539 71  HOH HOH B . 
D 2 HOH 40 540 35  HOH HOH B . 
D 2 HOH 41 541 24  HOH HOH B . 
D 2 HOH 42 542 27  HOH HOH B . 
D 2 HOH 43 543 48  HOH HOH B . 
D 2 HOH 44 544 49  HOH HOH B . 
D 2 HOH 45 545 47  HOH HOH B . 
D 2 HOH 46 546 82  HOH HOH B . 
D 2 HOH 47 547 32  HOH HOH B . 
D 2 HOH 48 548 58  HOH HOH B . 
D 2 HOH 49 549 99  HOH HOH B . 
D 2 HOH 50 550 116 HOH HOH B . 
D 2 HOH 51 551 87  HOH HOH B . 
D 2 HOH 52 552 121 HOH HOH B . 
D 2 HOH 53 553 120 HOH HOH B . 
D 2 HOH 54 554 52  HOH HOH B . 
D 2 HOH 55 555 89  HOH HOH B . 
D 2 HOH 56 556 17  HOH HOH B . 
D 2 HOH 57 557 114 HOH HOH B . 
D 2 HOH 58 558 75  HOH HOH B . 
D 2 HOH 59 559 59  HOH HOH B . 
D 2 HOH 60 560 28  HOH HOH B . 
D 2 HOH 61 561 91  HOH HOH B . 
D 2 HOH 62 562 56  HOH HOH B . 
D 2 HOH 63 563 96  HOH HOH B . 
D 2 HOH 64 564 37  HOH HOH B . 
D 2 HOH 65 565 13  HOH HOH B . 
D 2 HOH 66 566 149 HOH HOH B . 
D 2 HOH 67 567 15  HOH HOH B . 
D 2 HOH 68 568 153 HOH HOH B . 
D 2 HOH 69 569 14  HOH HOH B . 
D 2 HOH 70 570 102 HOH HOH B . 
D 2 HOH 71 571 157 HOH HOH B . 
D 2 HOH 72 572 191 HOH HOH B . 
D 2 HOH 73 573 124 HOH HOH B . 
D 2 HOH 74 574 85  HOH HOH B . 
D 2 HOH 75 575 182 HOH HOH B . 
D 2 HOH 76 576 162 HOH HOH B . 
D 2 HOH 77 577 187 HOH HOH B . 
D 2 HOH 78 578 125 HOH HOH B . 
D 2 HOH 79 579 140 HOH HOH B . 
D 2 HOH 80 580 51  HOH HOH B . 
D 2 HOH 81 581 194 HOH HOH B . 
D 2 HOH 82 582 144 HOH HOH B . 
D 2 HOH 83 583 190 HOH HOH B . 
D 2 HOH 84 584 189 HOH HOH B . 
D 2 HOH 85 585 108 HOH HOH B . 
D 2 HOH 86 586 109 HOH HOH B . 
D 2 HOH 87 587 107 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A P1L 166 A P1L 380 ? CYS 'modified residue' 
2 B P1L 166 B P1L 380 ? CYS 'modified residue' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-12-23 
2 'Structure model' 1 1 2016-01-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1  'X-RAY DIFFRACTION' ? refined -3.0459 -12.6079 -22.3055 0.2904 ? -0.0110 ? 0.0242  ? 0.4955 ? 0.0144  ? 0.4028 ? 8.6061 ? 
0.3086  ? 8.0210  ? 2.6487 ? 1.8578  ? 9.1356 ? -0.3142 ? -1.0062 ? 1.0850  ? -0.0930 ? -0.2072 ? 0.3702  ? -0.2203 ? -0.8162 ? 
0.6657  ? 
2  'X-RAY DIFFRACTION' ? refined 4.9343  -16.3113 -32.6135 0.2976 ? -0.0207 ? 0.0207  ? 0.3317 ? 0.0723  ? 0.3968 ? 4.4767 ? 
0.4107  ? 2.1626  ? 4.5884 ? 1.1146  ? 6.4244 ? -0.1853 ? 0.6334  ? 0.0749  ? -0.7340 ? 0.0656  ? 0.1604  ? 0.0127  ? 0.2660  ? 
0.1599  ? 
3  'X-RAY DIFFRACTION' ? refined 1.5421  -16.3295 -23.9160 0.2808 ? 0.0006  ? -0.0233 ? 0.2653 ? 0.0470  ? 0.3913 ? 4.2631 ? 
-0.9285 ? 0.1352  ? 1.2941 ? -0.6286 ? 1.3187 ? -0.1553 ? -0.3124 ? -0.0615 ? 0.0390  ? 0.0715  ? 0.1053  ? -0.0808 ? -0.1865 ? 
0.0804  ? 
4  'X-RAY DIFFRACTION' ? refined 2.2859  -26.9578 -23.8431 0.4654 ? -0.0081 ? 0.0658  ? 0.2980 ? 0.0951  ? 0.6051 ? 4.5371 ? 
-3.1312 ? -5.3430 ? 2.9730 ? 2.9870  ? 7.2481 ? -0.2866 ? 0.4165  ? 0.1472  ? 0.3455  ? 0.3035  ? 0.1272  ? 0.1656  ? -0.5598 ? 
0.0234  ? 
5  'X-RAY DIFFRACTION' ? refined -6.3820 -17.6627 -16.8675 0.3279 ? -0.0127 ? 0.0500  ? 0.6055 ? 0.0565  ? 0.3938 ? 8.2494 ? 
0.0894  ? 4.6462  ? 0.8573 ? -0.2999 ? 2.6234 ? -0.3012 ? -1.9350 ? -0.1214 ? -0.0513 ? 0.2803  ? 0.1857  ? -0.2728 ? -0.4281 ? 
0.0852  ? 
6  'X-RAY DIFFRACTION' ? refined 19.6970 -18.0718 -16.6432 0.2965 ? 0.0030  ? 0.0122  ? 0.3912 ? 0.0517  ? 0.4529 ? 5.7708 ? 
5.3764  ? 0.3316  ? 5.1336 ? 0.8592  ? 6.4088 ? 0.5528  ? -1.1689 ? -0.8830 ? 0.3572  ? -0.4733 ? -1.0332 ? 0.2411  ? 0.1857  ? 
0.0128  ? 
7  'X-RAY DIFFRACTION' ? refined 13.2668 -16.1521 -26.9267 0.3119 ? 0.0198  ? 0.0206  ? 0.2528 ? 0.0308  ? 0.3433 ? 2.7804 ? 
1.0504  ? 1.7966  ? 1.6250 ? 0.6423  ? 1.7088 ? -0.3271 ? -0.1007 ? 0.1198  ? -0.3022 ? 0.2041  ? -0.0170 ? 0.0433  ? 0.0339  ? 
0.0415  ? 
8  'X-RAY DIFFRACTION' ? refined 3.5840  -12.4092 -28.9933 0.3165 ? 0.0378  ? -0.0311 ? 0.2002 ? 0.0812  ? 0.3344 ? 7.8328 ? 
1.5629  ? 1.8080  ? 3.2953 ? 1.2345  ? 3.9262 ? -0.2763 ? -0.0160 ? 0.2828  ? -0.1556 ? 0.1134  ? 0.0901  ? -0.2515 ? -0.2642 ? 
0.2065  ? 
9  'X-RAY DIFFRACTION' ? refined 0.9393  -48.0742 -13.1839 0.3278 ? -0.0083 ? 0.0082  ? 0.3267 ? -0.0002 ? 0.2391 ? 3.5440 ? 
0.6340  ? -1.4835 ? 1.2262 ? 1.5038  ? 9.4305 ? 0.1033  ? -0.3613 ? -0.0864 ? 0.2475  ? -0.0612 ? -0.0880 ? 0.8656  ? -0.5326 ? 
0.1086  ? 
10 'X-RAY DIFFRACTION' ? refined 0.0175  -50.9715 -33.9030 0.3201 ? -0.0461 ? 0.0197  ? 0.6128 ? -0.1189 ? 0.3873 ? 5.2550 ? 
-0.3425 ? -0.1769 ? 4.3378 ? 0.0405  ? 5.3439 ? -0.1011 ? 1.2283  ? -0.9094 ? -0.4427 ? 0.0428  ? 0.1646  ? 0.1153  ? -1.0144 ? 
0.2348  ? 
11 'X-RAY DIFFRACTION' ? refined 15.7556 -41.9471 -7.7862  0.3887 ? -0.0427 ? -0.0311 ? 0.7192 ? -0.0729 ? 0.4878 ? 4.8001 ? 
-0.9520 ? -0.7684 ? 2.8574 ? 1.8360  ? 9.4609 ? 0.1267  ? -0.8179 ? 0.4642  ? 0.2895  ? 0.1987  ? -0.7131 ? -0.3196 ? 1.7536  ? 
-0.3792 ? 
12 'X-RAY DIFFRACTION' ? refined 10.4818 -49.2948 -19.5412 0.2358 ? -0.0153 ? -0.0056 ? 0.1987 ? 0.0261  ? 0.3691 ? 4.5371 ? 
-0.6593 ? -0.3489 ? 2.7692 ? 1.5600  ? 4.3779 ? 0.1423  ? 0.1039  ? -0.4638 ? -0.0240 ? -0.0323 ? -0.2844 ? 0.1582  ? -0.0572 ? 
-0.2365 ? 
13 'X-RAY DIFFRACTION' ? refined -3.8421 -41.9988 -17.7355 0.2682 ? -0.0339 ? 0.0252  ? 0.3796 ? -0.0374 ? 0.4220 ? 7.6601 ? 
-1.9141 ? -4.1640 ? 3.2960 ? 0.4625  ? 3.0716 ? -0.1904 ? -0.2671 ? 0.3229  ? 0.4150  ? 0.2406  ? 0.1426  ? 0.4098  ? -0.3151 ? 
0.0822  ? 
14 'X-RAY DIFFRACTION' ? refined 7.4996  -34.5210 -19.5604 0.3626 ? -0.0007 ? 0.0867  ? 0.2938 ? 0.1120  ? 0.5220 ? 7.6903 ? 
-1.8246 ? -3.8698 ? 1.0075 ? 1.6134  ? 2.8332 ? 0.1093  ? 0.2273  ? 1.3257  ? -0.1262 ? 0.1914  ? -0.5102 ? -0.3047 ? -0.1100 ? 
-0.3763 ? 
15 'X-RAY DIFFRACTION' ? refined -5.4080 -41.2718 -20.3159 0.2476 ? -0.0003 ? -0.0450 ? 0.4095 ? 0.0108  ? 0.3069 ? 5.8773 ? 
-2.0592 ? -1.5013 ? 2.4562 ? 2.3294  ? 5.1679 ? 0.1620  ? 0.0988  ? 0.0738  ? 0.2182  ? -0.0834 ? -0.0189 ? 0.0214  ? -1.1359 ? 
0.1026  ? 
16 'X-RAY DIFFRACTION' ? refined 16.7010 -44.8436 -34.7566 0.2830 ? 0.0178  ? 0.0373  ? 0.4745 ? 0.0467  ? 0.4913 ? 3.5235 ? 
-5.2554 ? -2.0490 ? 8.8085 ? 0.9989  ? 5.7940 ? 0.6732  ? 1.2167  ? -0.0693 ? -0.2951 ? -0.6627 ? -0.5690 ? 0.2222  ? -0.4904 ? 
0.0506  ? 
17 'X-RAY DIFFRACTION' ? refined 16.5561 -44.3077 -22.0655 0.2629 ? -0.0095 ? 0.0090  ? 0.2559 ? 0.0649  ? 0.4976 ? 5.8712 ? 
-1.8385 ? -4.9112 ? 1.0572 ? 2.3123  ? 5.9342 ? -0.1098 ? 0.0823  ? 0.0912  ? 0.1124  ? 0.0215  ? -0.1140 ? 0.0809  ? 0.0620  ? 
0.0387  ? 
18 'X-RAY DIFFRACTION' ? refined 9.1448  -46.5407 -14.1682 0.2335 ? -0.0163 ? -0.0272 ? 0.1716 ? 0.0605  ? 0.2556 ? 5.4458 ? 
-0.9149 ? -1.2842 ? 3.4676 ? 1.7718  ? 5.1641 ? -0.0291 ? -0.4027 ? -0.0662 ? -0.0181 ? 0.0365  ? -0.1207 ? 0.1636  ? 0.0241  ? 
0.0043  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1  'X-RAY DIFFRACTION' 1  ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 222 through 238 )
;
2  'X-RAY DIFFRACTION' 2  ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 239 through 293 )
;
3  'X-RAY DIFFRACTION' 3  ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 294 through 351 )
;
4  'X-RAY DIFFRACTION' 4  ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 352 through 362 )
;
5  'X-RAY DIFFRACTION' 5  ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 363 through 381 )
;
6  'X-RAY DIFFRACTION' 6  ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 382 through 395 )
;
7  'X-RAY DIFFRACTION' 7  ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 396 through 414 )
;
8  'X-RAY DIFFRACTION' 8  ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 415 through 446 )
;
9  'X-RAY DIFFRACTION' 9  ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 218 through 238 )
;
10 'X-RAY DIFFRACTION' 10 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 239 through 255 )
;
11 'X-RAY DIFFRACTION' 11 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 256 through 293 )
;
12 'X-RAY DIFFRACTION' 12 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 294 through 325 )
;
13 'X-RAY DIFFRACTION' 13 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 326 through 339 )
;
14 'X-RAY DIFFRACTION' 14 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 340 through 362 )
;
15 'X-RAY DIFFRACTION' 15 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 363 through 381 )
;
16 'X-RAY DIFFRACTION' 16 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 382 through 395 )
;
17 'X-RAY DIFFRACTION' 17 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 396 through 414 )
;
18 'X-RAY DIFFRACTION' 18 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 415 through 446 )
;
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? MOSFLM      ? ? ? .     1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? 0.5.4 2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .     3 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .     4 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15  5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CB  B LYS 281 ? ? OE1 B GLU 287 ? ? 1.98 
2 1 OG1 B THR 417 ? ? OE2 B GLU 419 ? ? 2.15 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              248 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              248 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              248 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.50 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            3.20 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 281 ? ? -105.97 -70.43 
2 1 LEU A 306 ? ? -104.67 41.61  
3 1 LEU A 374 ? ? -114.95 76.53  
4 1 LEU B 374 ? ? -119.93 71.31  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 247 ? CG  ? A GLN 33  CG  
2  1 Y 1 A GLN 247 ? CD  ? A GLN 33  CD  
3  1 Y 1 A GLN 247 ? OE1 ? A GLN 33  OE1 
4  1 Y 1 A GLN 247 ? NE2 ? A GLN 33  NE2 
5  1 Y 1 A GLN 273 ? CG  ? A GLN 59  CG  
6  1 Y 1 A GLN 273 ? CD  ? A GLN 59  CD  
7  1 Y 1 A GLN 273 ? OE1 ? A GLN 59  OE1 
8  1 Y 1 A GLN 273 ? NE2 ? A GLN 59  NE2 
9  1 Y 1 A LYS 281 ? CG  ? A LYS 67  CG  
10 1 Y 1 A LYS 281 ? CD  ? A LYS 67  CD  
11 1 Y 1 A LYS 281 ? CE  ? A LYS 67  CE  
12 1 Y 1 A LYS 281 ? NZ  ? A LYS 67  NZ  
13 1 Y 1 A LYS 282 ? CG  ? A LYS 68  CG  
14 1 Y 1 A LYS 282 ? CD  ? A LYS 68  CD  
15 1 Y 1 A LYS 282 ? CE  ? A LYS 68  CE  
16 1 Y 1 A LYS 282 ? NZ  ? A LYS 68  NZ  
17 1 Y 1 A ARG 362 ? CG  ? A ARG 148 CG  
18 1 Y 1 A ARG 362 ? CD  ? A ARG 148 CD  
19 1 Y 1 A ARG 362 ? NE  ? A ARG 148 NE  
20 1 Y 1 A ARG 362 ? CZ  ? A ARG 148 CZ  
21 1 Y 1 A ARG 362 ? NH1 ? A ARG 148 NH1 
22 1 Y 1 A ARG 362 ? NH2 ? A ARG 148 NH2 
23 1 Y 1 A ARG 443 ? CG  ? A ARG 229 CG  
24 1 Y 1 A ARG 443 ? CD  ? A ARG 229 CD  
25 1 Y 1 A ARG 443 ? NE  ? A ARG 229 NE  
26 1 Y 1 A ARG 443 ? CZ  ? A ARG 229 CZ  
27 1 Y 1 A ARG 443 ? NH1 ? A ARG 229 NH1 
28 1 Y 1 A ARG 443 ? NH2 ? A ARG 229 NH2 
29 1 Y 1 B LYS 281 ? CG  ? B LYS 67  CG  
30 1 Y 1 B LYS 281 ? CD  ? B LYS 67  CD  
31 1 Y 1 B LYS 281 ? CE  ? B LYS 67  CE  
32 1 Y 1 B LYS 281 ? NZ  ? B LYS 67  NZ  
33 1 Y 1 B LYS 282 ? CG  ? B LYS 68  CG  
34 1 Y 1 B LYS 282 ? CD  ? B LYS 68  CD  
35 1 Y 1 B LYS 282 ? CE  ? B LYS 68  CE  
36 1 Y 1 B LYS 282 ? NZ  ? B LYS 68  NZ  
37 1 Y 1 B ARG 291 ? CG  ? B ARG 77  CG  
38 1 Y 1 B ARG 291 ? CD  ? B ARG 77  CD  
39 1 Y 1 B ARG 291 ? NE  ? B ARG 77  NE  
40 1 Y 1 B ARG 291 ? CZ  ? B ARG 77  CZ  
41 1 Y 1 B ARG 291 ? NH1 ? B ARG 77  NH1 
42 1 Y 1 B ARG 291 ? NH2 ? B ARG 77  NH2 
43 1 Y 1 B LYS 352 ? CG  ? B LYS 138 CG  
44 1 Y 1 B LYS 352 ? CD  ? B LYS 138 CD  
45 1 Y 1 B LYS 352 ? CE  ? B LYS 138 CE  
46 1 Y 1 B LYS 352 ? NZ  ? B LYS 138 NZ  
47 1 Y 1 B ARG 362 ? CG  ? B ARG 148 CG  
48 1 Y 1 B ARG 362 ? CD  ? B ARG 148 CD  
49 1 Y 1 B ARG 362 ? NE  ? B ARG 148 NE  
50 1 Y 1 B ARG 362 ? CZ  ? B ARG 148 CZ  
51 1 Y 1 B ARG 362 ? NH1 ? B ARG 148 NH1 
52 1 Y 1 B ARG 362 ? NH2 ? B ARG 148 NH2 
53 1 Y 1 B ARG 369 ? CG  ? B ARG 155 CG  
54 1 Y 1 B ARG 369 ? CD  ? B ARG 155 CD  
55 1 Y 1 B ARG 369 ? NE  ? B ARG 155 NE  
56 1 Y 1 B ARG 369 ? CZ  ? B ARG 155 CZ  
57 1 Y 1 B ARG 369 ? NH1 ? B ARG 155 NH1 
58 1 Y 1 B ARG 369 ? NH2 ? B ARG 155 NH2 
59 1 Y 1 B ARG 396 ? CG  ? B ARG 182 CG  
60 1 Y 1 B ARG 396 ? CD  ? B ARG 182 CD  
61 1 Y 1 B ARG 396 ? NE  ? B ARG 182 NE  
62 1 Y 1 B ARG 396 ? CZ  ? B ARG 182 CZ  
63 1 Y 1 B ARG 396 ? NH1 ? B ARG 182 NH1 
64 1 Y 1 B ARG 396 ? NH2 ? B ARG 182 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 215 ? A GLY 1   
2  1 Y 1 A SER 216 ? A SER 2   
3  1 Y 1 A ALA 217 ? A ALA 3   
4  1 Y 1 A TRP 218 ? A TRP 4   
5  1 Y 1 A GLN 219 ? A GLN 5   
6  1 Y 1 A ALA 220 ? A ALA 6   
7  1 Y 1 A ARG 221 ? A ARG 7   
8  1 Y 1 A PRO 240 ? A PRO 26  
9  1 Y 1 A ASP 241 ? A ASP 27  
10 1 Y 1 A ALA 242 ? A ALA 28  
11 1 Y 1 A VAL 243 ? A VAL 29  
12 1 Y 1 A ASP 244 ? A ASP 30  
13 1 Y 1 A SER 245 ? A SER 31  
14 1 Y 1 A TYR 246 ? A TYR 32  
15 1 Y 1 A HIS 257 ? A HIS 43  
16 1 Y 1 A CYS 258 ? A CYS 44  
17 1 Y 1 A PRO 259 ? A PRO 45  
18 1 Y 1 A SER 260 ? A SER 46  
19 1 Y 1 A PRO 261 ? A PRO 47  
20 1 Y 1 A GLY 262 ? A GLY 48  
21 1 Y 1 A ALA 263 ? A ALA 49  
22 1 Y 1 A PRO 264 ? A PRO 50  
23 1 Y 1 A PRO 265 ? A PRO 51  
24 1 Y 1 A GLY 309 ? A GLY 95  
25 1 Y 1 A PRO 310 ? A PRO 96  
26 1 Y 1 A SER 311 ? A SER 97  
27 1 Y 1 A GLY 312 ? A GLY 98  
28 1 Y 1 A GLU 313 ? A GLU 99  
29 1 Y 1 A GLU 314 ? A GLU 100 
30 1 Y 1 A ALA 315 ? A ALA 101 
31 1 Y 1 A GLY 316 ? A GLY 102 
32 1 Y 1 A ALA 317 ? A ALA 103 
33 1 Y 1 A GLY 318 ? A GLY 104 
34 1 Y 1 A GLY 319 ? A GLY 105 
35 1 Y 1 A SER 320 ? A SER 106 
36 1 Y 1 A ILE 321 ? A ILE 107 
37 1 Y 1 A SER 322 ? A SER 108 
38 1 Y 1 A SER 323 ? A SER 109 
39 1 Y 1 A ASP 447 ? A ASP 233 
40 1 Y 1 A GLY 448 ? A GLY 234 
41 1 Y 1 A ASN 449 ? A ASN 235 
42 1 Y 1 A SER 450 ? A SER 236 
43 1 Y 1 B GLY 215 ? B GLY 1   
44 1 Y 1 B SER 216 ? B SER 2   
45 1 Y 1 B ALA 217 ? B ALA 3   
46 1 Y 1 B HIS 257 ? B HIS 43  
47 1 Y 1 B CYS 258 ? B CYS 44  
48 1 Y 1 B PRO 259 ? B PRO 45  
49 1 Y 1 B SER 260 ? B SER 46  
50 1 Y 1 B PRO 261 ? B PRO 47  
51 1 Y 1 B GLY 262 ? B GLY 48  
52 1 Y 1 B ALA 263 ? B ALA 49  
53 1 Y 1 B GLY 309 ? B GLY 95  
54 1 Y 1 B PRO 310 ? B PRO 96  
55 1 Y 1 B SER 311 ? B SER 97  
56 1 Y 1 B GLY 312 ? B GLY 98  
57 1 Y 1 B GLU 313 ? B GLU 99  
58 1 Y 1 B GLU 314 ? B GLU 100 
59 1 Y 1 B ALA 315 ? B ALA 101 
60 1 Y 1 B GLY 316 ? B GLY 102 
61 1 Y 1 B ALA 317 ? B ALA 103 
62 1 Y 1 B GLY 318 ? B GLY 104 
63 1 Y 1 B GLY 319 ? B GLY 105 
64 1 Y 1 B SER 320 ? B SER 106 
65 1 Y 1 B ILE 321 ? B ILE 107 
66 1 Y 1 B SER 322 ? B SER 108 
67 1 Y 1 B SER 323 ? B SER 109 
68 1 Y 1 B GLY 324 ? B GLY 110 
69 1 Y 1 B THR 432 ? B THR 218 
70 1 Y 1 B SER 433 ? B SER 219 
71 1 Y 1 B ASP 447 ? B ASP 233 
72 1 Y 1 B GLY 448 ? B GLY 234 
73 1 Y 1 B ASN 449 ? B ASN 235 
74 1 Y 1 B SER 450 ? B SER 236 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#