data_5EN1
# 
_entry.id   5EN1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.288 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5EN1         
WWPDB D_1000215212 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5EN1 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, B.X.' 1 
'Su, S.C.' 2 
'Ma, J.B.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Molecular basis for the specific and multivariant recognitions of RNA substrates by human hnRNP A2/B1' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-017-02770-z 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, B.X.'      1 
primary 'Su, S.C.'      2 
primary 'Patil, D.P.'   3 
primary 'Liu, H.H.'     4 
primary 'Gan, J.H.'     5 
primary 'Jaffrey, S.R.' 6 
primary 'Ma, J.B.'      7 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   96.02 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5EN1 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     122.623 
_cell.length_a_esd                 ? 
_cell.length_b                     46.380 
_cell.length_b_esd                 ? 
_cell.length_c                     37.516 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5EN1 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Heterogeneous nuclear ribonucleoproteins A2/B1' 21206.969 1  ? ? 'UNP residues 12-195' ? 
2 polymer syn 
;RNA (5'-R(*AP*GP*GP*AP*CP*UP*G)-3')
;
2260.419  1  ? ? ?                     ? 
3 water   nat water                                            18.015    11 ? ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'hnRNP A2/B1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;RKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVV
EPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVL
QKYHTINGHNAEVRKALSRQEMQE
;
;RKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVV
EPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVL
QKYHTINGHNAEVRKALSRQEMQE
;
A ? 
2 polyribonucleotide no no AGGACUG AGGACUG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   LYS n 
1 3   LYS n 
1 4   ARG n 
1 5   GLU n 
1 6   LYS n 
1 7   GLU n 
1 8   GLN n 
1 9   PHE n 
1 10  ARG n 
1 11  LYS n 
1 12  LEU n 
1 13  PHE n 
1 14  ILE n 
1 15  GLY n 
1 16  GLY n 
1 17  LEU n 
1 18  SER n 
1 19  PHE n 
1 20  GLU n 
1 21  THR n 
1 22  THR n 
1 23  GLU n 
1 24  GLU n 
1 25  SER n 
1 26  LEU n 
1 27  ARG n 
1 28  ASN n 
1 29  TYR n 
1 30  TYR n 
1 31  GLU n 
1 32  GLN n 
1 33  TRP n 
1 34  GLY n 
1 35  LYS n 
1 36  LEU n 
1 37  THR n 
1 38  ASP n 
1 39  CYS n 
1 40  VAL n 
1 41  VAL n 
1 42  MET n 
1 43  ARG n 
1 44  ASP n 
1 45  PRO n 
1 46  ALA n 
1 47  SER n 
1 48  LYS n 
1 49  ARG n 
1 50  SER n 
1 51  ARG n 
1 52  GLY n 
1 53  PHE n 
1 54  GLY n 
1 55  PHE n 
1 56  VAL n 
1 57  THR n 
1 58  PHE n 
1 59  SER n 
1 60  SER n 
1 61  MET n 
1 62  ALA n 
1 63  GLU n 
1 64  VAL n 
1 65  ASP n 
1 66  ALA n 
1 67  ALA n 
1 68  MET n 
1 69  ALA n 
1 70  ALA n 
1 71  ARG n 
1 72  PRO n 
1 73  HIS n 
1 74  SER n 
1 75  ILE n 
1 76  ASP n 
1 77  GLY n 
1 78  ARG n 
1 79  VAL n 
1 80  VAL n 
1 81  GLU n 
1 82  PRO n 
1 83  LYS n 
1 84  ARG n 
1 85  ALA n 
1 86  VAL n 
1 87  ALA n 
1 88  ARG n 
1 89  GLU n 
1 90  GLU n 
1 91  SER n 
1 92  GLY n 
1 93  LYS n 
1 94  PRO n 
1 95  GLY n 
1 96  ALA n 
1 97  HIS n 
1 98  VAL n 
1 99  THR n 
1 100 VAL n 
1 101 LYS n 
1 102 LYS n 
1 103 LEU n 
1 104 PHE n 
1 105 VAL n 
1 106 GLY n 
1 107 GLY n 
1 108 ILE n 
1 109 LYS n 
1 110 GLU n 
1 111 ASP n 
1 112 THR n 
1 113 GLU n 
1 114 GLU n 
1 115 HIS n 
1 116 HIS n 
1 117 LEU n 
1 118 ARG n 
1 119 ASP n 
1 120 TYR n 
1 121 PHE n 
1 122 GLU n 
1 123 GLU n 
1 124 TYR n 
1 125 GLY n 
1 126 LYS n 
1 127 ILE n 
1 128 ASP n 
1 129 THR n 
1 130 ILE n 
1 131 GLU n 
1 132 ILE n 
1 133 ILE n 
1 134 THR n 
1 135 ASP n 
1 136 ARG n 
1 137 GLN n 
1 138 SER n 
1 139 GLY n 
1 140 LYS n 
1 141 LYS n 
1 142 ARG n 
1 143 GLY n 
1 144 PHE n 
1 145 GLY n 
1 146 PHE n 
1 147 VAL n 
1 148 THR n 
1 149 PHE n 
1 150 ASP n 
1 151 ASP n 
1 152 HIS n 
1 153 ASP n 
1 154 PRO n 
1 155 VAL n 
1 156 ASP n 
1 157 LYS n 
1 158 ILE n 
1 159 VAL n 
1 160 LEU n 
1 161 GLN n 
1 162 LYS n 
1 163 TYR n 
1 164 HIS n 
1 165 THR n 
1 166 ILE n 
1 167 ASN n 
1 168 GLY n 
1 169 HIS n 
1 170 ASN n 
1 171 ALA n 
1 172 GLU n 
1 173 VAL n 
1 174 ARG n 
1 175 LYS n 
1 176 ALA n 
1 177 LEU n 
1 178 SER n 
1 179 ARG n 
1 180 GLN n 
1 181 GLU n 
1 182 MET n 
1 183 GLN n 
1 184 GLU n 
2 1   A   n 
2 2   G   n 
2 3   G   n 
2 4   A   n 
2 5   C   n 
2 6   U   n 
2 7   G   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   184 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'HNRNPA2B1, HNRPA2B1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       7 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ROA2_HUMAN P22626 ? 1 
;RKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVV
EPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVL
QKYHTINGHNAEVRKALSRQEMQE
;
12 
2 PDB 5EN1       5EN1   ? 2 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5EN1 A 1 ? 184 ? P22626 12 ? 195 ? 12 195 
2 2 5EN1 B 1 ? 7   ? 5EN1   1  ? 7   ? 1  7   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5EN1 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.26 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.59 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '25% PEG3350, 0.1M Tris pH8.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         RIGAKU 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.987 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL18U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.987 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL18U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5EN1 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.58 
_reflns.d_resolution_low                 28.81 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       6187 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             91.89 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            1.60 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.09 
_refine.aniso_B[2][2]                            1.28 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -2.59 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               45.201 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.940 
_refine.correlation_coeff_Fo_to_Fc_free          0.925 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5EN1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.58 
_refine.ls_d_res_low                             28.81 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     5889 
_refine.ls_number_reflns_R_free                  299 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    91.76 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.19387 
_refine.ls_R_factor_R_free                       0.23624 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.19162 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1U1Q 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.338 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             14.648 
_refine.overall_SU_ML                            0.298 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        1491 
_refine_hist.pdbx_number_atoms_nucleic_acid   150 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             11 
_refine_hist.number_atoms_total               1652 
_refine_hist.d_res_high                       2.58 
_refine_hist.d_res_low                        28.81 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  0.018  1688 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  1522 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.615  1.864  2295 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.417  3.000  3512 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 7.489  5.000  183  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 34.183 23.000 80   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 16.347 15.000 286  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 19.227 15.000 16   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.095  0.200  238  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  1799 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  406  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 2.771  4.157  735  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.754  4.154  734  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 4.475  6.219  917  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.476  6.225  918  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 3.202  4.835  953  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 3.185  4.826  952  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 5.368  7.130  1379 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 7.099  35.244 1838 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 7.100  35.293 1839 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.581 
_refine_ls_shell.d_res_low                        2.648 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             18 
_refine_ls_shell.number_reflns_R_work             300 
_refine_ls_shell.percent_reflns_obs               64.90 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.280 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.293 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5EN1 
_struct.title                        'Crystal structure of hnRNPA2B1 in complex with RNA' 
_struct.pdbx_descriptor              'Heterogeneous nuclear ribonucleoproteins A2/B1/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5EN1 
_struct_keywords.text            'HNRNP, RRM, RNA BINDING PROTEIN-RNA complex' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN/RNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 LYS A 6   ? PHE A 9   ? LYS A 17  PHE A 20  5 ? 4  
HELX_P HELX_P2 AA2 THR A 22  ? GLU A 31  ? THR A 33  GLU A 42  1 ? 10 
HELX_P HELX_P3 AA3 SER A 60  ? ALA A 70  ? SER A 71  ALA A 81  1 ? 11 
HELX_P HELX_P4 AA4 ALA A 87  ? SER A 91  ? ALA A 98  SER A 102 5 ? 5  
HELX_P HELX_P5 AA5 GLU A 113 ? GLU A 122 ? GLU A 124 GLU A 133 1 ? 10 
HELX_P HELX_P6 AA6 GLU A 123 ? GLY A 125 ? GLU A 134 GLY A 136 5 ? 3  
HELX_P HELX_P7 AA7 ASP A 151 ? GLN A 161 ? ASP A 162 GLN A 172 1 ? 11 
HELX_P HELX_P8 AA8 SER A 178 ? MET A 182 ? SER A 189 MET A 193 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ARG 
_struct_mon_prot_cis.label_seq_id           71 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ARG 
_struct_mon_prot_cis.auth_seq_id            82 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    72 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     83 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       5.88 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 36  ? ARG A 43  ? LEU A 47  ARG A 54  
AA1 2 SER A 50  ? PHE A 58  ? SER A 61  PHE A 69  
AA1 3 LYS A 11  ? GLY A 15  ? LYS A 22  GLY A 26  
AA1 4 VAL A 79  ? ARG A 84  ? VAL A 90  ARG A 95  
AA1 5 HIS A 73  ? SER A 74  ? HIS A 84  SER A 85  
AA2 1 ILE A 127 ? THR A 134 ? ILE A 138 THR A 145 
AA2 2 LYS A 141 ? PHE A 149 ? LYS A 152 PHE A 160 
AA2 3 LYS A 102 ? GLY A 106 ? LYS A 113 GLY A 117 
AA2 4 HIS A 169 ? LYS A 175 ? HIS A 180 LYS A 186 
AA2 5 HIS A 164 ? ILE A 166 ? HIS A 175 ILE A 177 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N MET A 42  ? N MET A 53  O ARG A 51  ? O ARG A 62  
AA1 2 3 O VAL A 56  ? O VAL A 67  N LEU A 12  ? N LEU A 23  
AA1 3 4 N PHE A 13  ? N PHE A 24  O LYS A 83  ? O LYS A 94  
AA1 4 5 O VAL A 80  ? O VAL A 91  N HIS A 73  ? N HIS A 84  
AA2 1 2 N ASP A 128 ? N ASP A 139 O THR A 148 ? O THR A 159 
AA2 2 3 O VAL A 147 ? O VAL A 158 N LEU A 103 ? N LEU A 114 
AA2 3 4 N PHE A 104 ? N PHE A 115 O ARG A 174 ? O ARG A 185 
AA2 4 5 O HIS A 169 ? O HIS A 180 N ILE A 166 ? N ILE A 177 
# 
_atom_sites.entry_id                    5EN1 
_atom_sites.fract_transf_matrix[1][1]   0.008155 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000859 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021561 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026803 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ARG A 1 1   ? 142.796 -47.522 0.763   1.00 104.85 ? 12  ARG A N     1 
ATOM   2    C CA    . ARG A 1 1   ? 144.068 -47.477 -0.032  1.00 106.96 ? 12  ARG A CA    1 
ATOM   3    C C     . ARG A 1 1   ? 144.730 -46.100 0.106   1.00 102.95 ? 12  ARG A C     1 
ATOM   4    O O     . ARG A 1 1   ? 144.952 -45.386 -0.880  1.00 99.11  ? 12  ARG A O     1 
ATOM   5    C CB    . ARG A 1 1   ? 143.802 -47.844 -1.512  1.00 106.67 ? 12  ARG A CB    1 
ATOM   6    C CG    . ARG A 1 1   ? 145.030 -47.950 -2.421  1.00 104.06 ? 12  ARG A CG    1 
ATOM   7    C CD    . ARG A 1 1   ? 146.054 -48.965 -1.933  1.00 101.41 ? 12  ARG A CD    1 
ATOM   8    N NE    . ARG A 1 1   ? 145.577 -50.343 -2.100  1.00 98.36  ? 12  ARG A NE    1 
ATOM   9    C CZ    . ARG A 1 1   ? 145.830 -51.368 -1.280  1.00 92.97  ? 12  ARG A CZ    1 
ATOM   10   N NH1   . ARG A 1 1   ? 145.336 -52.568 -1.575  1.00 95.76  ? 12  ARG A NH1   1 
ATOM   11   N NH2   . ARG A 1 1   ? 146.547 -51.219 -0.166  1.00 88.33  ? 12  ARG A NH2   1 
ATOM   12   N N     . LYS A 1 2   ? 145.017 -45.743 1.356   1.00 97.15  ? 13  LYS A N     1 
ATOM   13   C CA    . LYS A 1 2   ? 145.677 -44.490 1.719   1.00 94.08  ? 13  LYS A CA    1 
ATOM   14   C C     . LYS A 1 2   ? 147.016 -44.829 2.406   1.00 93.38  ? 13  LYS A C     1 
ATOM   15   O O     . LYS A 1 2   ? 147.254 -45.990 2.776   1.00 88.74  ? 13  LYS A O     1 
ATOM   16   C CB    . LYS A 1 2   ? 144.735 -43.674 2.633   1.00 91.21  ? 13  LYS A CB    1 
ATOM   17   C CG    . LYS A 1 2   ? 145.097 -42.207 2.851   1.00 90.29  ? 13  LYS A CG    1 
ATOM   18   C CD    . LYS A 1 2   ? 144.828 -41.342 1.632   1.00 90.26  ? 13  LYS A CD    1 
ATOM   19   C CE    . LYS A 1 2   ? 145.665 -40.064 1.640   1.00 91.02  ? 13  LYS A CE    1 
ATOM   20   N NZ    . LYS A 1 2   ? 145.633 -39.373 0.316   1.00 86.33  ? 13  LYS A NZ    1 
ATOM   21   N N     . LYS A 1 3   ? 147.907 -43.837 2.505   1.00 95.16  ? 14  LYS A N     1 
ATOM   22   C CA    . LYS A 1 3   ? 149.070 -43.885 3.416   1.00 89.92  ? 14  LYS A CA    1 
ATOM   23   C C     . LYS A 1 3   ? 148.659 -43.267 4.751   1.00 74.90  ? 14  LYS A C     1 
ATOM   24   O O     . LYS A 1 3   ? 147.612 -42.607 4.843   1.00 63.58  ? 14  LYS A O     1 
ATOM   25   C CB    . LYS A 1 3   ? 150.269 -43.113 2.838   1.00 98.15  ? 14  LYS A CB    1 
ATOM   26   C CG    . LYS A 1 3   ? 150.896 -43.734 1.589   1.00 105.11 ? 14  LYS A CG    1 
ATOM   27   C CD    . LYS A 1 3   ? 151.532 -42.679 0.684   1.00 107.38 ? 14  LYS A CD    1 
ATOM   28   C CE    . LYS A 1 3   ? 152.208 -43.288 -0.541  1.00 107.17 ? 14  LYS A CE    1 
ATOM   29   N NZ    . LYS A 1 3   ? 153.612 -43.697 -0.249  1.00 108.50 ? 14  LYS A NZ    1 
ATOM   30   N N     . ARG A 1 4   ? 149.465 -43.491 5.790   1.00 66.00  ? 15  ARG A N     1 
ATOM   31   C CA    . ARG A 1 4   ? 149.253 -42.786 7.063   1.00 63.76  ? 15  ARG A CA    1 
ATOM   32   C C     . ARG A 1 4   ? 149.443 -41.304 6.773   1.00 53.23  ? 15  ARG A C     1 
ATOM   33   O O     . ARG A 1 4   ? 150.427 -40.910 6.147   1.00 45.29  ? 15  ARG A O     1 
ATOM   34   C CB    . ARG A 1 4   ? 150.219 -43.240 8.176   1.00 69.10  ? 15  ARG A CB    1 
ATOM   35   C CG    . ARG A 1 4   ? 149.980 -44.667 8.676   1.00 78.68  ? 15  ARG A CG    1 
ATOM   36   C CD    . ARG A 1 4   ? 151.266 -45.492 8.851   1.00 82.63  ? 15  ARG A CD    1 
ATOM   37   N NE    . ARG A 1 4   ? 151.043 -46.952 8.709   1.00 84.44  ? 15  ARG A NE    1 
ATOM   38   C CZ    . ARG A 1 4   ? 151.084 -47.666 7.571   1.00 77.30  ? 15  ARG A CZ    1 
ATOM   39   N NH1   . ARG A 1 4   ? 150.866 -48.985 7.610   1.00 72.10  ? 15  ARG A NH1   1 
ATOM   40   N NH2   . ARG A 1 4   ? 151.344 -47.093 6.395   1.00 79.44  ? 15  ARG A NH2   1 
ATOM   41   N N     . GLU A 1 5   ? 148.475 -40.493 7.190   1.00 47.42  ? 16  GLU A N     1 
ATOM   42   C CA    . GLU A 1 5   ? 148.625 -39.051 7.107   1.00 43.88  ? 16  GLU A CA    1 
ATOM   43   C C     . GLU A 1 5   ? 149.583 -38.672 8.228   1.00 39.99  ? 16  GLU A C     1 
ATOM   44   O O     . GLU A 1 5   ? 149.879 -39.485 9.099   1.00 36.31  ? 16  GLU A O     1 
ATOM   45   C CB    . GLU A 1 5   ? 147.288 -38.321 7.252   1.00 44.19  ? 16  GLU A CB    1 
ATOM   46   C CG    . GLU A 1 5   ? 146.222 -38.728 6.238   1.00 44.40  ? 16  GLU A CG    1 
ATOM   47   C CD    . GLU A 1 5   ? 145.338 -39.877 6.691   1.00 46.10  ? 16  GLU A CD    1 
ATOM   48   O OE1   . GLU A 1 5   ? 145.566 -40.400 7.802   1.00 42.41  ? 16  GLU A OE1   1 
ATOM   49   O OE2   . GLU A 1 5   ? 144.415 -40.263 5.927   1.00 46.45  ? 16  GLU A OE2   1 
ATOM   50   N N     . LYS A 1 6   ? 150.087 -37.452 8.196   1.00 38.64  ? 17  LYS A N     1 
ATOM   51   C CA    . LYS A 1 6   ? 150.877 -36.960 9.297   1.00 41.35  ? 17  LYS A CA    1 
ATOM   52   C C     . LYS A 1 6   ? 149.954 -36.844 10.537  1.00 42.66  ? 17  LYS A C     1 
ATOM   53   O O     . LYS A 1 6   ? 148.723 -36.858 10.430  1.00 40.37  ? 17  LYS A O     1 
ATOM   54   C CB    . LYS A 1 6   ? 151.491 -35.602 8.972   1.00 45.13  ? 17  LYS A CB    1 
ATOM   55   C CG    . LYS A 1 6   ? 152.330 -35.521 7.713   1.00 49.28  ? 17  LYS A CG    1 
ATOM   56   C CD    . LYS A 1 6   ? 153.575 -36.385 7.744   1.00 53.87  ? 17  LYS A CD    1 
ATOM   57   C CE    . LYS A 1 6   ? 154.860 -35.573 7.678   1.00 57.57  ? 17  LYS A CE    1 
ATOM   58   N NZ    . LYS A 1 6   ? 155.986 -36.442 7.215   1.00 60.62  ? 17  LYS A NZ    1 
ATOM   59   N N     . GLU A 1 7   ? 150.569 -36.716 11.702  1.00 44.79  ? 18  GLU A N     1 
ATOM   60   C CA    . GLU A 1 7   ? 149.872 -36.766 12.990  1.00 47.40  ? 18  GLU A CA    1 
ATOM   61   C C     . GLU A 1 7   ? 148.795 -35.712 13.155  1.00 43.46  ? 18  GLU A C     1 
ATOM   62   O O     . GLU A 1 7   ? 147.709 -36.032 13.634  1.00 41.08  ? 18  GLU A O     1 
ATOM   63   C CB    . GLU A 1 7   ? 150.879 -36.654 14.150  1.00 52.19  ? 18  GLU A CB    1 
ATOM   64   C CG    . GLU A 1 7   ? 151.882 -37.809 14.202  1.00 55.93  ? 18  GLU A CG    1 
ATOM   65   C CD    . GLU A 1 7   ? 152.411 -38.068 15.604  1.00 61.48  ? 18  GLU A CD    1 
ATOM   66   O OE1   . GLU A 1 7   ? 152.731 -37.063 16.292  1.00 62.33  ? 18  GLU A OE1   1 
ATOM   67   O OE2   . GLU A 1 7   ? 152.491 -39.264 16.011  1.00 56.04  ? 18  GLU A OE2   1 
ATOM   68   N N     . GLN A 1 8   ? 149.080 -34.480 12.729  1.00 40.56  ? 19  GLN A N     1 
ATOM   69   C CA    . GLN A 1 8   ? 148.161 -33.361 12.935  1.00 41.86  ? 19  GLN A CA    1 
ATOM   70   C C     . GLN A 1 8   ? 146.779 -33.567 12.350  1.00 39.73  ? 19  GLN A C     1 
ATOM   71   O O     . GLN A 1 8   ? 145.800 -32.997 12.840  1.00 43.79  ? 19  GLN A O     1 
ATOM   72   C CB    . GLN A 1 8   ? 148.737 -32.056 12.382  1.00 45.13  ? 19  GLN A CB    1 
ATOM   73   C CG    . GLN A 1 8   ? 148.739 -31.910 10.866  1.00 48.63  ? 19  GLN A CG    1 
ATOM   74   C CD    . GLN A 1 8   ? 149.330 -30.579 10.435  1.00 50.97  ? 19  GLN A CD    1 
ATOM   75   O OE1   . GLN A 1 8   ? 148.741 -29.522 10.670  1.00 53.59  ? 19  GLN A OE1   1 
ATOM   76   N NE2   . GLN A 1 8   ? 150.506 -30.622 9.813   1.00 51.97  ? 19  GLN A NE2   1 
ATOM   77   N N     . PHE A 1 9   ? 146.722 -34.369 11.297  1.00 38.27  ? 20  PHE A N     1 
ATOM   78   C CA    . PHE A 1 9   ? 145.492 -34.697 10.591  1.00 37.88  ? 20  PHE A CA    1 
ATOM   79   C C     . PHE A 1 9   ? 144.743 -35.825 11.250  1.00 35.23  ? 20  PHE A C     1 
ATOM   80   O O     . PHE A 1 9   ? 143.587 -36.024 10.933  1.00 39.88  ? 20  PHE A O     1 
ATOM   81   C CB    . PHE A 1 9   ? 145.784 -35.071 9.116   1.00 40.89  ? 20  PHE A CB    1 
ATOM   82   C CG    . PHE A 1 9   ? 146.647 -34.059 8.387   1.00 41.52  ? 20  PHE A CG    1 
ATOM   83   C CD1   . PHE A 1 9   ? 146.228 -32.745 8.261   1.00 44.02  ? 20  PHE A CD1   1 
ATOM   84   C CD2   . PHE A 1 9   ? 147.880 -34.416 7.854   1.00 42.93  ? 20  PHE A CD2   1 
ATOM   85   C CE1   . PHE A 1 9   ? 147.014 -31.800 7.620   1.00 47.03  ? 20  PHE A CE1   1 
ATOM   86   C CE2   . PHE A 1 9   ? 148.669 -33.480 7.201   1.00 46.31  ? 20  PHE A CE2   1 
ATOM   87   C CZ    . PHE A 1 9   ? 148.234 -32.166 7.082   1.00 46.21  ? 20  PHE A CZ    1 
ATOM   88   N N     . ARG A 1 10  ? 145.387 -36.543 12.166  1.00 35.99  ? 21  ARG A N     1 
ATOM   89   C CA    . ARG A 1 10  ? 144.792 -37.687 12.886  1.00 36.13  ? 21  ARG A CA    1 
ATOM   90   C C     . ARG A 1 10  ? 144.504 -37.435 14.379  1.00 35.14  ? 21  ARG A C     1 
ATOM   91   O O     . ARG A 1 10  ? 143.936 -38.288 15.045  1.00 40.78  ? 21  ARG A O     1 
ATOM   92   C CB    . ARG A 1 10  ? 145.721 -38.899 12.735  1.00 34.74  ? 21  ARG A CB    1 
ATOM   93   C CG    . ARG A 1 10  ? 146.338 -39.005 11.339  1.00 35.37  ? 21  ARG A CG    1 
ATOM   94   C CD    . ARG A 1 10  ? 146.991 -40.343 11.032  1.00 35.86  ? 21  ARG A CD    1 
ATOM   95   N NE    . ARG A 1 10  ? 147.702 -40.893 12.189  1.00 37.22  ? 21  ARG A NE    1 
ATOM   96   C CZ    . ARG A 1 10  ? 149.008 -40.821 12.432  1.00 34.85  ? 21  ARG A CZ    1 
ATOM   97   N NH1   . ARG A 1 10  ? 149.856 -40.214 11.614  1.00 32.34  ? 21  ARG A NH1   1 
ATOM   98   N NH2   . ARG A 1 10  ? 149.460 -41.370 13.546  1.00 38.99  ? 21  ARG A NH2   1 
ATOM   99   N N     . LYS A 1 11  ? 144.871 -36.261 14.880  1.00 34.07  ? 22  LYS A N     1 
ATOM   100  C CA    . LYS A 1 11  ? 144.836 -35.922 16.295  1.00 31.17  ? 22  LYS A CA    1 
ATOM   101  C C     . LYS A 1 11  ? 143.573 -35.157 16.686  1.00 30.26  ? 22  LYS A C     1 
ATOM   102  O O     . LYS A 1 11  ? 143.149 -34.251 15.995  1.00 28.04  ? 22  LYS A O     1 
ATOM   103  C CB    . LYS A 1 11  ? 146.068 -35.081 16.637  1.00 31.89  ? 22  LYS A CB    1 
ATOM   104  C CG    . LYS A 1 11  ? 146.500 -35.164 18.097  1.00 35.12  ? 22  LYS A CG    1 
ATOM   105  C CD    . LYS A 1 11  ? 148.030 -35.157 18.268  1.00 37.90  ? 22  LYS A CD    1 
ATOM   106  C CE    . LYS A 1 11  ? 148.409 -35.585 19.681  1.00 40.34  ? 22  LYS A CE    1 
ATOM   107  N NZ    . LYS A 1 11  ? 149.862 -35.472 20.012  1.00 43.54  ? 22  LYS A NZ    1 
ATOM   108  N N     . LEU A 1 12  ? 143.013 -35.524 17.832  1.00 32.31  ? 23  LEU A N     1 
ATOM   109  C CA    . LEU A 1 12  ? 141.836 -34.891 18.426  1.00 33.63  ? 23  LEU A CA    1 
ATOM   110  C C     . LEU A 1 12  ? 142.215 -34.240 19.782  1.00 31.21  ? 23  LEU A C     1 
ATOM   111  O O     . LEU A 1 12  ? 142.882 -34.852 20.601  1.00 28.62  ? 23  LEU A O     1 
ATOM   112  C CB    . LEU A 1 12  ? 140.753 -35.972 18.640  1.00 36.80  ? 23  LEU A CB    1 
ATOM   113  C CG    . LEU A 1 12  ? 139.272 -35.738 18.303  1.00 39.98  ? 23  LEU A CG    1 
ATOM   114  C CD1   . LEU A 1 12  ? 139.056 -35.304 16.859  1.00 41.24  ? 23  LEU A CD1   1 
ATOM   115  C CD2   . LEU A 1 12  ? 138.492 -37.013 18.553  1.00 41.49  ? 23  LEU A CD2   1 
ATOM   116  N N     . PHE A 1 13  ? 141.806 -32.994 19.986  1.00 30.27  ? 24  PHE A N     1 
ATOM   117  C CA    . PHE A 1 13  ? 141.790 -32.365 21.298  1.00 30.33  ? 24  PHE A CA    1 
ATOM   118  C C     . PHE A 1 13  ? 140.405 -32.535 21.934  1.00 30.70  ? 24  PHE A C     1 
ATOM   119  O O     . PHE A 1 13  ? 139.382 -32.178 21.351  1.00 28.95  ? 24  PHE A O     1 
ATOM   120  C CB    . PHE A 1 13  ? 142.111 -30.871 21.203  1.00 32.20  ? 24  PHE A CB    1 
ATOM   121  C CG    . PHE A 1 13  ? 141.779 -30.104 22.463  1.00 34.03  ? 24  PHE A CG    1 
ATOM   122  C CD1   . PHE A 1 13  ? 142.712 -29.975 23.490  1.00 33.76  ? 24  PHE A CD1   1 
ATOM   123  C CD2   . PHE A 1 13  ? 140.523 -29.532 22.636  1.00 35.31  ? 24  PHE A CD2   1 
ATOM   124  C CE1   . PHE A 1 13  ? 142.403 -29.289 24.655  1.00 33.15  ? 24  PHE A CE1   1 
ATOM   125  C CE2   . PHE A 1 13  ? 140.208 -28.849 23.806  1.00 35.93  ? 24  PHE A CE2   1 
ATOM   126  C CZ    . PHE A 1 13  ? 141.150 -28.722 24.813  1.00 33.74  ? 24  PHE A CZ    1 
ATOM   127  N N     . ILE A 1 14  ? 140.392 -33.038 23.162  1.00 34.65  ? 25  ILE A N     1 
ATOM   128  C CA    . ILE A 1 14  ? 139.160 -33.291 23.927  1.00 33.11  ? 25  ILE A CA    1 
ATOM   129  C C     . ILE A 1 14  ? 139.104 -32.332 25.107  1.00 31.46  ? 25  ILE A C     1 
ATOM   130  O O     . ILE A 1 14  ? 139.897 -32.417 26.039  1.00 28.49  ? 25  ILE A O     1 
ATOM   131  C CB    . ILE A 1 14  ? 139.108 -34.722 24.492  1.00 33.02  ? 25  ILE A CB    1 
ATOM   132  C CG1   . ILE A 1 14  ? 139.742 -35.753 23.522  1.00 31.89  ? 25  ILE A CG1   1 
ATOM   133  C CG2   . ILE A 1 14  ? 137.668 -35.047 24.890  1.00 33.30  ? 25  ILE A CG2   1 
ATOM   134  C CD1   . ILE A 1 14  ? 138.988 -35.943 22.240  1.00 32.78  ? 25  ILE A CD1   1 
ATOM   135  N N     . GLY A 1 15  ? 138.165 -31.412 25.047  1.00 33.15  ? 26  GLY A N     1 
ATOM   136  C CA    . GLY A 1 15  ? 138.012 -30.412 26.092  1.00 35.03  ? 26  GLY A CA    1 
ATOM   137  C C     . GLY A 1 15  ? 136.931 -30.804 27.060  1.00 32.59  ? 26  GLY A C     1 
ATOM   138  O O     . GLY A 1 15  ? 136.050 -31.577 26.711  1.00 33.12  ? 26  GLY A O     1 
ATOM   139  N N     . GLY A 1 16  ? 137.024 -30.274 28.277  1.00 32.82  ? 27  GLY A N     1 
ATOM   140  C CA    . GLY A 1 16  ? 135.975 -30.403 29.281  1.00 33.06  ? 27  GLY A CA    1 
ATOM   141  C C     . GLY A 1 16  ? 135.792 -31.815 29.778  1.00 36.09  ? 27  GLY A C     1 
ATOM   142  O O     . GLY A 1 16  ? 134.670 -32.251 30.026  1.00 41.24  ? 27  GLY A O     1 
ATOM   143  N N     . LEU A 1 17  ? 136.894 -32.541 29.914  1.00 37.13  ? 28  LEU A N     1 
ATOM   144  C CA    . LEU A 1 17  ? 136.855 -33.885 30.470  1.00 38.67  ? 28  LEU A CA    1 
ATOM   145  C C     . LEU A 1 17  ? 136.447 -33.773 31.917  1.00 39.36  ? 28  LEU A C     1 
ATOM   146  O O     . LEU A 1 17  ? 136.731 -32.754 32.565  1.00 40.78  ? 28  LEU A O     1 
ATOM   147  C CB    . LEU A 1 17  ? 138.246 -34.543 30.421  1.00 38.41  ? 28  LEU A CB    1 
ATOM   148  C CG    . LEU A 1 17  ? 138.918 -34.784 29.075  1.00 38.47  ? 28  LEU A CG    1 
ATOM   149  C CD1   . LEU A 1 17  ? 140.309 -35.348 29.317  1.00 38.53  ? 28  LEU A CD1   1 
ATOM   150  C CD2   . LEU A 1 17  ? 138.089 -35.733 28.214  1.00 39.31  ? 28  LEU A CD2   1 
ATOM   151  N N     . SER A 1 18  ? 135.825 -34.821 32.448  1.00 41.10  ? 29  SER A N     1 
ATOM   152  C CA    . SER A 1 18  ? 135.651 -34.892 33.897  1.00 41.02  ? 29  SER A CA    1 
ATOM   153  C C     . SER A 1 18  ? 137.009 -35.172 34.566  1.00 40.42  ? 29  SER A C     1 
ATOM   154  O O     . SER A 1 18  ? 137.947 -35.692 33.937  1.00 40.11  ? 29  SER A O     1 
ATOM   155  C CB    . SER A 1 18  ? 134.566 -35.892 34.307  1.00 39.22  ? 29  SER A CB    1 
ATOM   156  O OG    . SER A 1 18  ? 134.954 -37.185 33.950  1.00 41.97  ? 29  SER A OG    1 
ATOM   157  N N     . PHE A 1 19  ? 137.088 -34.768 35.836  1.00 41.66  ? 30  PHE A N     1 
ATOM   158  C CA    . PHE A 1 19  ? 138.264 -34.917 36.724  1.00 40.08  ? 30  PHE A CA    1 
ATOM   159  C C     . PHE A 1 19  ? 138.634 -36.398 36.950  1.00 37.17  ? 30  PHE A C     1 
ATOM   160  O O     . PHE A 1 19  ? 139.780 -36.726 37.220  1.00 34.34  ? 30  PHE A O     1 
ATOM   161  C CB    . PHE A 1 19  ? 137.911 -34.228 38.062  1.00 43.29  ? 30  PHE A CB    1 
ATOM   162  C CG    . PHE A 1 19  ? 139.052 -34.077 39.040  1.00 46.48  ? 30  PHE A CG    1 
ATOM   163  C CD1   . PHE A 1 19  ? 139.284 -35.038 40.024  1.00 46.29  ? 30  PHE A CD1   1 
ATOM   164  C CD2   . PHE A 1 19  ? 139.847 -32.932 39.036  1.00 48.43  ? 30  PHE A CD2   1 
ATOM   165  C CE1   . PHE A 1 19  ? 140.315 -34.876 40.942  1.00 47.39  ? 30  PHE A CE1   1 
ATOM   166  C CE2   . PHE A 1 19  ? 140.871 -32.767 39.969  1.00 45.31  ? 30  PHE A CE2   1 
ATOM   167  C CZ    . PHE A 1 19  ? 141.097 -33.740 40.924  1.00 45.73  ? 30  PHE A CZ    1 
ATOM   168  N N     . GLU A 1 20  ? 137.665 -37.294 36.828  1.00 38.66  ? 31  GLU A N     1 
ATOM   169  C CA    . GLU A 1 20  ? 137.918 -38.717 37.010  1.00 43.15  ? 31  GLU A CA    1 
ATOM   170  C C     . GLU A 1 20  ? 138.237 -39.432 35.704  1.00 38.31  ? 31  GLU A C     1 
ATOM   171  O O     . GLU A 1 20  ? 138.511 -40.629 35.717  1.00 37.83  ? 31  GLU A O     1 
ATOM   172  C CB    . GLU A 1 20  ? 136.745 -39.389 37.731  1.00 49.20  ? 31  GLU A CB    1 
ATOM   173  C CG    . GLU A 1 20  ? 136.577 -38.922 39.184  1.00 54.34  ? 31  GLU A CG    1 
ATOM   174  C CD    . GLU A 1 20  ? 135.883 -37.571 39.338  1.00 60.12  ? 31  GLU A CD    1 
ATOM   175  O OE1   . GLU A 1 20  ? 135.248 -37.072 38.372  1.00 68.10  ? 31  GLU A OE1   1 
ATOM   176  O OE2   . GLU A 1 20  ? 135.992 -36.987 40.443  1.00 72.60  ? 31  GLU A OE2   1 
ATOM   177  N N     . THR A 1 21  ? 138.232 -38.706 34.588  1.00 36.99  ? 32  THR A N     1 
ATOM   178  C CA    . THR A 1 21  ? 138.650 -39.276 33.301  1.00 36.37  ? 32  THR A CA    1 
ATOM   179  C C     . THR A 1 21  ? 140.156 -39.508 33.266  1.00 34.23  ? 32  THR A C     1 
ATOM   180  O O     . THR A 1 21  ? 140.946 -38.641 33.608  1.00 35.23  ? 32  THR A O     1 
ATOM   181  C CB    . THR A 1 21  ? 138.225 -38.412 32.087  1.00 34.84  ? 32  THR A CB    1 
ATOM   182  O OG1   . THR A 1 21  ? 136.796 -38.333 32.028  1.00 33.89  ? 32  THR A OG1   1 
ATOM   183  C CG2   . THR A 1 21  ? 138.748 -39.007 30.773  1.00 34.15  ? 32  THR A CG2   1 
ATOM   184  N N     . THR A 1 22  ? 140.511 -40.699 32.821  1.00 34.93  ? 33  THR A N     1 
ATOM   185  C CA    . THR A 1 22  ? 141.869 -41.154 32.675  1.00 35.48  ? 33  THR A CA    1 
ATOM   186  C C     . THR A 1 22  ? 142.147 -41.491 31.232  1.00 35.07  ? 33  THR A C     1 
ATOM   187  O O     . THR A 1 22  ? 141.255 -41.432 30.398  1.00 32.27  ? 33  THR A O     1 
ATOM   188  C CB    . THR A 1 22  ? 142.017 -42.453 33.444  1.00 36.78  ? 33  THR A CB    1 
ATOM   189  O OG1   . THR A 1 22  ? 141.074 -43.407 32.917  1.00 35.75  ? 33  THR A OG1   1 
ATOM   190  C CG2   . THR A 1 22  ? 141.770 -42.185 34.930  1.00 36.92  ? 33  THR A CG2   1 
ATOM   191  N N     . GLU A 1 23  ? 143.394 -41.877 30.975  1.00 39.05  ? 34  GLU A N     1 
ATOM   192  C CA    . GLU A 1 23  ? 143.874 -42.258 29.652  1.00 39.33  ? 34  GLU A CA    1 
ATOM   193  C C     . GLU A 1 23  ? 143.217 -43.523 29.187  1.00 40.19  ? 34  GLU A C     1 
ATOM   194  O O     . GLU A 1 23  ? 142.886 -43.641 28.010  1.00 35.68  ? 34  GLU A O     1 
ATOM   195  C CB    . GLU A 1 23  ? 145.394 -42.402 29.634  1.00 40.84  ? 34  GLU A CB    1 
ATOM   196  C CG    . GLU A 1 23  ? 146.071 -41.041 29.766  1.00 47.65  ? 34  GLU A CG    1 
ATOM   197  C CD    . GLU A 1 23  ? 147.596 -41.067 29.998  1.00 55.70  ? 34  GLU A CD    1 
ATOM   198  O OE1   . GLU A 1 23  ? 148.232 -42.167 29.969  1.00 61.17  ? 34  GLU A OE1   1 
ATOM   199  O OE2   . GLU A 1 23  ? 148.165 -39.952 30.210  1.00 53.55  ? 34  GLU A OE2   1 
ATOM   200  N N     . GLU A 1 24  ? 142.997 -44.452 30.112  1.00 42.06  ? 35  GLU A N     1 
ATOM   201  C CA    . GLU A 1 24  ? 142.434 -45.755 29.739  1.00 44.75  ? 35  GLU A CA    1 
ATOM   202  C C     . GLU A 1 24  ? 140.933 -45.652 29.396  1.00 42.62  ? 35  GLU A C     1 
ATOM   203  O O     . GLU A 1 24  ? 140.474 -46.274 28.428  1.00 43.72  ? 35  GLU A O     1 
ATOM   204  C CB    . GLU A 1 24  ? 142.758 -46.865 30.766  1.00 49.14  ? 35  GLU A CB    1 
ATOM   205  C CG    . GLU A 1 24  ? 142.706 -46.527 32.254  1.00 56.43  ? 35  GLU A CG    1 
ATOM   206  C CD    . GLU A 1 24  ? 144.063 -46.143 32.887  1.00 60.48  ? 35  GLU A CD    1 
ATOM   207  O OE1   . GLU A 1 24  ? 144.938 -45.569 32.199  1.00 58.77  ? 35  GLU A OE1   1 
ATOM   208  O OE2   . GLU A 1 24  ? 144.240 -46.403 34.106  1.00 64.55  ? 35  GLU A OE2   1 
ATOM   209  N N     . SER A 1 25  ? 140.193 -44.835 30.149  1.00 40.20  ? 36  SER A N     1 
ATOM   210  C CA    . SER A 1 25  ? 138.771 -44.578 29.874  1.00 35.72  ? 36  SER A CA    1 
ATOM   211  C C     . SER A 1 25  ? 138.557 -43.681 28.651  1.00 33.16  ? 36  SER A C     1 
ATOM   212  O O     . SER A 1 25  ? 137.564 -43.845 27.940  1.00 34.54  ? 36  SER A O     1 
ATOM   213  C CB    . SER A 1 25  ? 138.051 -43.985 31.107  1.00 35.20  ? 36  SER A CB    1 
ATOM   214  O OG    . SER A 1 25  ? 138.084 -42.564 31.156  1.00 34.31  ? 36  SER A OG    1 
ATOM   215  N N     . LEU A 1 26  ? 139.450 -42.720 28.430  1.00 28.68  ? 37  LEU A N     1 
ATOM   216  C CA    . LEU A 1 26  ? 139.400 -41.886 27.234  1.00 27.35  ? 37  LEU A CA    1 
ATOM   217  C C     . LEU A 1 26  ? 139.686 -42.753 25.999  1.00 28.99  ? 37  LEU A C     1 
ATOM   218  O O     . LEU A 1 26  ? 138.976 -42.689 24.979  1.00 26.79  ? 37  LEU A O     1 
ATOM   219  C CB    . LEU A 1 26  ? 140.429 -40.762 27.351  1.00 27.32  ? 37  LEU A CB    1 
ATOM   220  C CG    . LEU A 1 26  ? 140.523 -39.666 26.289  1.00 26.78  ? 37  LEU A CG    1 
ATOM   221  C CD1   . LEU A 1 26  ? 139.185 -38.968 26.117  1.00 27.05  ? 37  LEU A CD1   1 
ATOM   222  C CD2   . LEU A 1 26  ? 141.604 -38.677 26.689  1.00 26.86  ? 37  LEU A CD2   1 
ATOM   223  N N     . ARG A 1 27  ? 140.728 -43.578 26.124  1.00 30.03  ? 38  ARG A N     1 
ATOM   224  C CA    . ARG A 1 27  ? 141.125 -44.547 25.102  1.00 30.15  ? 38  ARG A CA    1 
ATOM   225  C C     . ARG A 1 27  ? 140.047 -45.554 24.868  1.00 30.25  ? 38  ARG A C     1 
ATOM   226  O O     . ARG A 1 27  ? 139.783 -45.918 23.742  1.00 31.48  ? 38  ARG A O     1 
ATOM   227  C CB    . ARG A 1 27  ? 142.418 -45.248 25.509  1.00 31.82  ? 38  ARG A CB    1 
ATOM   228  C CG    . ARG A 1 27  ? 142.976 -46.282 24.560  1.00 34.97  ? 38  ARG A CG    1 
ATOM   229  C CD    . ARG A 1 27  ? 144.222 -46.956 25.135  1.00 39.37  ? 38  ARG A CD    1 
ATOM   230  N NE    . ARG A 1 27  ? 145.434 -46.123 25.082  1.00 41.11  ? 38  ARG A NE    1 
ATOM   231  C CZ    . ARG A 1 27  ? 146.152 -45.896 23.978  1.00 41.05  ? 38  ARG A CZ    1 
ATOM   232  N NH1   . ARG A 1 27  ? 145.781 -46.405 22.789  1.00 39.97  ? 38  ARG A NH1   1 
ATOM   233  N NH2   . ARG A 1 27  ? 147.241 -45.131 24.057  1.00 41.08  ? 38  ARG A NH2   1 
ATOM   234  N N     . ASN A 1 28  ? 139.400 -46.002 25.925  1.00 33.40  ? 39  ASN A N     1 
ATOM   235  C CA    . ASN A 1 28  ? 138.300 -46.914 25.747  1.00 35.85  ? 39  ASN A CA    1 
ATOM   236  C C     . ASN A 1 28  ? 137.216 -46.295 24.911  1.00 34.99  ? 39  ASN A C     1 
ATOM   237  O O     . ASN A 1 28  ? 136.728 -46.931 23.973  1.00 40.10  ? 39  ASN A O     1 
ATOM   238  C CB    . ASN A 1 28  ? 137.697 -47.389 27.064  1.00 39.29  ? 39  ASN A CB    1 
ATOM   239  C CG    . ASN A 1 28  ? 136.695 -48.516 26.845  1.00 42.08  ? 39  ASN A CG    1 
ATOM   240  O OD1   . ASN A 1 28  ? 135.473 -48.289 26.781  1.00 40.60  ? 39  ASN A OD1   1 
ATOM   241  N ND2   . ASN A 1 28  ? 137.214 -49.735 26.661  1.00 43.44  ? 39  ASN A ND2   1 
ATOM   242  N N     . TYR A 1 29  ? 136.847 -45.066 25.238  1.00 32.22  ? 40  TYR A N     1 
ATOM   243  C CA    . TYR A 1 29  ? 135.769 -44.401 24.529  1.00 33.37  ? 40  TYR A CA    1 
ATOM   244  C C     . TYR A 1 29  ? 136.098 -44.233 23.020  1.00 33.85  ? 40  TYR A C     1 
ATOM   245  O O     . TYR A 1 29  ? 135.374 -44.731 22.155  1.00 34.83  ? 40  TYR A O     1 
ATOM   246  C CB    . TYR A 1 29  ? 135.439 -43.062 25.201  1.00 34.98  ? 40  TYR A CB    1 
ATOM   247  C CG    . TYR A 1 29  ? 134.219 -42.390 24.627  1.00 35.71  ? 40  TYR A CG    1 
ATOM   248  C CD1   . TYR A 1 29  ? 132.942 -42.763 25.024  1.00 36.95  ? 40  TYR A CD1   1 
ATOM   249  C CD2   . TYR A 1 29  ? 134.340 -41.383 23.678  1.00 38.08  ? 40  TYR A CD2   1 
ATOM   250  C CE1   . TYR A 1 29  ? 131.819 -42.149 24.492  1.00 40.26  ? 40  TYR A CE1   1 
ATOM   251  C CE2   . TYR A 1 29  ? 133.228 -40.780 23.120  1.00 39.68  ? 40  TYR A CE2   1 
ATOM   252  C CZ    . TYR A 1 29  ? 131.978 -41.164 23.535  1.00 42.34  ? 40  TYR A CZ    1 
ATOM   253  O OH    . TYR A 1 29  ? 130.886 -40.575 22.969  1.00 50.73  ? 40  TYR A OH    1 
ATOM   254  N N     . TYR A 1 30  ? 137.199 -43.573 22.698  1.00 32.39  ? 41  TYR A N     1 
ATOM   255  C CA    . TYR A 1 30  ? 137.495 -43.275 21.293  1.00 32.73  ? 41  TYR A CA    1 
ATOM   256  C C     . TYR A 1 30  ? 137.874 -44.489 20.431  1.00 34.66  ? 41  TYR A C     1 
ATOM   257  O O     . TYR A 1 30  ? 137.761 -44.436 19.208  1.00 33.36  ? 41  TYR A O     1 
ATOM   258  C CB    . TYR A 1 30  ? 138.515 -42.133 21.174  1.00 31.52  ? 41  TYR A CB    1 
ATOM   259  C CG    . TYR A 1 30  ? 137.826 -40.819 21.423  1.00 30.36  ? 41  TYR A CG    1 
ATOM   260  C CD1   . TYR A 1 30  ? 136.928 -40.310 20.482  1.00 30.40  ? 41  TYR A CD1   1 
ATOM   261  C CD2   . TYR A 1 30  ? 138.017 -40.112 22.600  1.00 30.03  ? 41  TYR A CD2   1 
ATOM   262  C CE1   . TYR A 1 30  ? 136.245 -39.137 20.703  1.00 30.68  ? 41  TYR A CE1   1 
ATOM   263  C CE2   . TYR A 1 30  ? 137.327 -38.925 22.840  1.00 30.38  ? 41  TYR A CE2   1 
ATOM   264  C CZ    . TYR A 1 30  ? 136.440 -38.444 21.886  1.00 30.78  ? 41  TYR A CZ    1 
ATOM   265  O OH    . TYR A 1 30  ? 135.748 -37.268 22.082  1.00 32.63  ? 41  TYR A OH    1 
ATOM   266  N N     . GLU A 1 31  ? 138.244 -45.597 21.072  1.00 37.33  ? 42  GLU A N     1 
ATOM   267  C CA    . GLU A 1 31  ? 138.489 -46.851 20.356  1.00 36.77  ? 42  GLU A CA    1 
ATOM   268  C C     . GLU A 1 31  ? 137.256 -47.458 19.662  1.00 33.79  ? 42  GLU A C     1 
ATOM   269  O O     . GLU A 1 31  ? 137.378 -48.406 18.899  1.00 30.74  ? 42  GLU A O     1 
ATOM   270  C CB    . GLU A 1 31  ? 139.180 -47.860 21.272  1.00 37.93  ? 42  GLU A CB    1 
ATOM   271  C CG    . GLU A 1 31  ? 140.690 -47.642 21.312  1.00 40.36  ? 42  GLU A CG    1 
ATOM   272  C CD    . GLU A 1 31  ? 141.421 -48.563 22.277  1.00 42.80  ? 42  GLU A CD    1 
ATOM   273  O OE1   . GLU A 1 31  ? 142.673 -48.680 22.148  1.00 41.65  ? 42  GLU A OE1   1 
ATOM   274  O OE2   . GLU A 1 31  ? 140.741 -49.158 23.162  1.00 45.84  ? 42  GLU A OE2   1 
ATOM   275  N N     . GLN A 1 32  ? 136.081 -46.902 19.909  1.00 34.36  ? 43  GLN A N     1 
ATOM   276  C CA    . GLN A 1 32  ? 134.879 -47.317 19.186  1.00 37.05  ? 43  GLN A CA    1 
ATOM   277  C C     . GLN A 1 32  ? 134.947 -47.015 17.700  1.00 34.98  ? 43  GLN A C     1 
ATOM   278  O O     . GLN A 1 32  ? 134.325 -47.710 16.926  1.00 33.20  ? 43  GLN A O     1 
ATOM   279  C CB    . GLN A 1 32  ? 133.646 -46.605 19.730  1.00 38.78  ? 43  GLN A CB    1 
ATOM   280  C CG    . GLN A 1 32  ? 133.335 -46.893 21.187  1.00 40.91  ? 43  GLN A CG    1 
ATOM   281  C CD    . GLN A 1 32  ? 132.170 -46.052 21.648  1.00 41.62  ? 43  GLN A CD    1 
ATOM   282  O OE1   . GLN A 1 32  ? 131.066 -46.178 21.110  1.00 44.79  ? 43  GLN A OE1   1 
ATOM   283  N NE2   . GLN A 1 32  ? 132.410 -45.164 22.603  1.00 39.42  ? 43  GLN A NE2   1 
ATOM   284  N N     . TRP A 1 33  ? 135.669 -45.960 17.325  1.00 35.74  ? 44  TRP A N     1 
ATOM   285  C CA    . TRP A 1 33  ? 135.705 -45.467 15.950  1.00 36.16  ? 44  TRP A CA    1 
ATOM   286  C C     . TRP A 1 33  ? 137.048 -45.619 15.266  1.00 37.15  ? 44  TRP A C     1 
ATOM   287  O O     . TRP A 1 33  ? 137.217 -45.105 14.153  1.00 38.33  ? 44  TRP A O     1 
ATOM   288  C CB    . TRP A 1 33  ? 135.325 -43.989 15.942  1.00 37.39  ? 44  TRP A CB    1 
ATOM   289  C CG    . TRP A 1 33  ? 133.976 -43.731 16.541  1.00 38.21  ? 44  TRP A CG    1 
ATOM   290  C CD1   . TRP A 1 33  ? 132.758 -43.975 15.961  1.00 37.84  ? 44  TRP A CD1   1 
ATOM   291  C CD2   . TRP A 1 33  ? 133.707 -43.198 17.834  1.00 37.42  ? 44  TRP A CD2   1 
ATOM   292  N NE1   . TRP A 1 33  ? 131.753 -43.625 16.814  1.00 37.46  ? 44  TRP A NE1   1 
ATOM   293  C CE2   . TRP A 1 33  ? 132.307 -43.139 17.973  1.00 38.57  ? 44  TRP A CE2   1 
ATOM   294  C CE3   . TRP A 1 33  ? 134.514 -42.750 18.887  1.00 37.58  ? 44  TRP A CE3   1 
ATOM   295  C CZ2   . TRP A 1 33  ? 131.695 -42.641 19.121  1.00 38.14  ? 44  TRP A CZ2   1 
ATOM   296  C CZ3   . TRP A 1 33  ? 133.903 -42.257 20.039  1.00 37.44  ? 44  TRP A CZ3   1 
ATOM   297  C CH2   . TRP A 1 33  ? 132.507 -42.209 20.143  1.00 39.81  ? 44  TRP A CH2   1 
ATOM   298  N N     . GLY A 1 34  ? 138.001 -46.295 15.912  1.00 37.18  ? 45  GLY A N     1 
ATOM   299  C CA    . GLY A 1 34  ? 139.349 -46.414 15.355  1.00 39.26  ? 45  GLY A CA    1 
ATOM   300  C C     . GLY A 1 34  ? 140.422 -46.846 16.346  1.00 42.12  ? 45  GLY A C     1 
ATOM   301  O O     . GLY A 1 34  ? 140.189 -46.909 17.552  1.00 44.02  ? 45  GLY A O     1 
ATOM   302  N N     . LYS A 1 35  ? 141.597 -47.147 15.808  1.00 41.96  ? 46  LYS A N     1 
ATOM   303  C CA    . LYS A 1 35  ? 142.710 -47.678 16.570  1.00 43.96  ? 46  LYS A CA    1 
ATOM   304  C C     . LYS A 1 35  ? 143.542 -46.510 17.068  1.00 43.88  ? 46  LYS A C     1 
ATOM   305  O O     . LYS A 1 35  ? 143.932 -45.646 16.279  1.00 42.00  ? 46  LYS A O     1 
ATOM   306  C CB    . LYS A 1 35  ? 143.569 -48.595 15.682  1.00 48.08  ? 46  LYS A CB    1 
ATOM   307  C CG    . LYS A 1 35  ? 142.846 -49.844 15.196  1.00 49.33  ? 46  LYS A CG    1 
ATOM   308  C CD    . LYS A 1 35  ? 143.607 -50.554 14.100  1.00 52.62  ? 46  LYS A CD    1 
ATOM   309  C CE    . LYS A 1 35  ? 143.220 -50.046 12.719  1.00 56.49  ? 46  LYS A CE    1 
ATOM   310  N NZ    . LYS A 1 35  ? 144.218 -50.479 11.691  1.00 59.38  ? 46  LYS A NZ    1 
ATOM   311  N N     . LEU A 1 36  ? 143.821 -46.489 18.372  1.00 44.11  ? 47  LEU A N     1 
ATOM   312  C CA    . LEU A 1 36  ? 144.487 -45.335 18.982  1.00 42.47  ? 47  LEU A CA    1 
ATOM   313  C C     . LEU A 1 36  ? 145.970 -45.604 19.098  1.00 38.77  ? 47  LEU A C     1 
ATOM   314  O O     . LEU A 1 36  ? 146.409 -46.650 19.528  1.00 39.33  ? 47  LEU A O     1 
ATOM   315  C CB    . LEU A 1 36  ? 143.885 -44.924 20.353  1.00 42.54  ? 47  LEU A CB    1 
ATOM   316  C CG    . LEU A 1 36  ? 142.440 -44.379 20.389  1.00 42.68  ? 47  LEU A CG    1 
ATOM   317  C CD1   . LEU A 1 36  ? 142.135 -43.784 21.750  1.00 41.13  ? 47  LEU A CD1   1 
ATOM   318  C CD2   . LEU A 1 36  ? 142.127 -43.348 19.305  1.00 43.43  ? 47  LEU A CD2   1 
ATOM   319  N N     . THR A 1 37  ? 146.714 -44.594 18.705  1.00 38.90  ? 48  THR A N     1 
ATOM   320  C CA    . THR A 1 37  ? 148.154 -44.620 18.518  1.00 36.86  ? 48  THR A CA    1 
ATOM   321  C C     . THR A 1 37  ? 148.857 -43.999 19.734  1.00 36.86  ? 48  THR A C     1 
ATOM   322  O O     . THR A 1 37  ? 150.006 -44.310 20.032  1.00 35.22  ? 48  THR A O     1 
ATOM   323  C CB    . THR A 1 37  ? 148.426 -43.897 17.174  1.00 33.78  ? 48  THR A CB    1 
ATOM   324  O OG1   . THR A 1 37  ? 148.721 -44.887 16.196  1.00 37.55  ? 48  THR A OG1   1 
ATOM   325  C CG2   . THR A 1 37  ? 149.521 -42.977 17.217  1.00 33.29  ? 48  THR A CG2   1 
ATOM   326  N N     . ASP A 1 38  ? 148.127 -43.115 20.411  1.00 36.68  ? 49  ASP A N     1 
ATOM   327  C CA    . ASP A 1 38  ? 148.577 -42.392 21.563  1.00 35.62  ? 49  ASP A CA    1 
ATOM   328  C C     . ASP A 1 38  ? 147.341 -41.769 22.206  1.00 34.55  ? 49  ASP A C     1 
ATOM   329  O O     . ASP A 1 38  ? 146.342 -41.482 21.550  1.00 32.61  ? 49  ASP A O     1 
ATOM   330  C CB    . ASP A 1 38  ? 149.577 -41.320 21.125  1.00 37.79  ? 49  ASP A CB    1 
ATOM   331  C CG    . ASP A 1 38  ? 150.095 -40.465 22.269  1.00 36.67  ? 49  ASP A CG    1 
ATOM   332  O OD1   . ASP A 1 38  ? 150.210 -40.938 23.421  1.00 35.32  ? 49  ASP A OD1   1 
ATOM   333  O OD2   . ASP A 1 38  ? 150.416 -39.295 21.990  1.00 38.57  ? 49  ASP A OD2   1 
ATOM   334  N N     . CYS A 1 39  ? 147.416 -41.606 23.511  1.00 36.12  ? 50  CYS A N     1 
ATOM   335  C CA    . CYS A 1 39  ? 146.322 -41.043 24.280  1.00 38.69  ? 50  CYS A CA    1 
ATOM   336  C C     . CYS A 1 39  ? 146.857 -40.507 25.609  1.00 38.19  ? 50  CYS A C     1 
ATOM   337  O O     . CYS A 1 39  ? 147.562 -41.234 26.334  1.00 42.16  ? 50  CYS A O     1 
ATOM   338  C CB    . CYS A 1 39  ? 145.208 -42.079 24.506  1.00 37.87  ? 50  CYS A CB    1 
ATOM   339  S SG    . CYS A 1 39  ? 143.834 -41.378 25.455  1.00 38.50  ? 50  CYS A SG    1 
ATOM   340  N N     . VAL A 1 40  ? 146.525 -39.251 25.920  1.00 35.49  ? 51  VAL A N     1 
ATOM   341  C CA    . VAL A 1 40  ? 147.098 -38.566 27.076  1.00 32.53  ? 51  VAL A CA    1 
ATOM   342  C C     . VAL A 1 40  ? 146.107 -37.565 27.719  1.00 29.93  ? 51  VAL A C     1 
ATOM   343  O O     . VAL A 1 40  ? 145.455 -36.808 27.028  1.00 27.30  ? 51  VAL A O     1 
ATOM   344  C CB    . VAL A 1 40  ? 148.483 -37.954 26.700  1.00 33.27  ? 51  VAL A CB    1 
ATOM   345  C CG1   . VAL A 1 40  ? 148.417 -37.137 25.414  1.00 34.94  ? 51  VAL A CG1   1 
ATOM   346  C CG2   . VAL A 1 40  ? 149.071 -37.131 27.831  1.00 33.44  ? 51  VAL A CG2   1 
ATOM   347  N N     . VAL A 1 41  ? 146.007 -37.612 29.058  1.00 31.68  ? 52  VAL A N     1 
ATOM   348  C CA    . VAL A 1 41  ? 145.241 -36.662 29.890  1.00 30.03  ? 52  VAL A CA    1 
ATOM   349  C C     . VAL A 1 41  ? 146.221 -35.868 30.740  1.00 29.70  ? 52  VAL A C     1 
ATOM   350  O O     . VAL A 1 41  ? 146.987 -36.425 31.528  1.00 28.96  ? 52  VAL A O     1 
ATOM   351  C CB    . VAL A 1 41  ? 144.257 -37.360 30.843  1.00 29.81  ? 52  VAL A CB    1 
ATOM   352  C CG1   . VAL A 1 41  ? 143.520 -36.323 31.700  1.00 30.33  ? 52  VAL A CG1   1 
ATOM   353  C CG2   . VAL A 1 41  ? 143.273 -38.222 30.069  1.00 30.18  ? 52  VAL A CG2   1 
ATOM   354  N N     . MET A 1 42  ? 146.149 -34.555 30.596  1.00 30.88  ? 53  MET A N     1 
ATOM   355  C CA    . MET A 1 42  ? 147.170 -33.666 31.102  1.00 31.55  ? 53  MET A CA    1 
ATOM   356  C C     . MET A 1 42  ? 146.852 -33.344 32.555  1.00 32.06  ? 53  MET A C     1 
ATOM   357  O O     . MET A 1 42  ? 145.693 -33.086 32.919  1.00 32.04  ? 53  MET A O     1 
ATOM   358  C CB    . MET A 1 42  ? 147.218 -32.389 30.268  1.00 33.06  ? 53  MET A CB    1 
ATOM   359  C CG    . MET A 1 42  ? 147.365 -32.575 28.743  1.00 35.24  ? 53  MET A CG    1 
ATOM   360  S SD    . MET A 1 42  ? 148.872 -33.281 28.048  1.00 35.91  ? 53  MET A SD    1 
ATOM   361  C CE    . MET A 1 42  ? 150.042 -32.625 29.201  1.00 36.53  ? 53  MET A CE    1 
ATOM   362  N N     . ARG A 1 43  ? 147.888 -33.373 33.386  1.00 30.20  ? 54  ARG A N     1 
ATOM   363  C CA    . ARG A 1 43  ? 147.729 -33.169 34.801  1.00 30.03  ? 54  ARG A CA    1 
ATOM   364  C C     . ARG A 1 43  ? 148.619 -32.072 35.345  1.00 30.89  ? 54  ARG A C     1 
ATOM   365  O O     . ARG A 1 43  ? 149.674 -31.767 34.790  1.00 27.13  ? 54  ARG A O     1 
ATOM   366  C CB    . ARG A 1 43  ? 148.023 -34.465 35.537  1.00 29.99  ? 54  ARG A CB    1 
ATOM   367  C CG    . ARG A 1 43  ? 147.122 -35.553 35.047  1.00 28.65  ? 54  ARG A CG    1 
ATOM   368  C CD    . ARG A 1 43  ? 147.320 -36.842 35.793  1.00 28.59  ? 54  ARG A CD    1 
ATOM   369  N NE    . ARG A 1 43  ? 146.168 -37.668 35.478  1.00 27.81  ? 54  ARG A NE    1 
ATOM   370  C CZ    . ARG A 1 43  ? 144.969 -37.538 36.024  1.00 28.66  ? 54  ARG A CZ    1 
ATOM   371  N NH1   . ARG A 1 43  ? 144.745 -36.638 36.977  1.00 29.90  ? 54  ARG A NH1   1 
ATOM   372  N NH2   . ARG A 1 43  ? 143.977 -38.327 35.619  1.00 31.01  ? 54  ARG A NH2   1 
ATOM   373  N N     . ASP A 1 44  ? 148.182 -31.477 36.450  1.00 32.59  ? 55  ASP A N     1 
ATOM   374  C CA    . ASP A 1 44  ? 149.076 -30.653 37.225  1.00 35.03  ? 55  ASP A CA    1 
ATOM   375  C C     . ASP A 1 44  ? 150.238 -31.524 37.731  1.00 34.89  ? 55  ASP A C     1 
ATOM   376  O O     . ASP A 1 44  ? 150.013 -32.590 38.293  1.00 36.30  ? 55  ASP A O     1 
ATOM   377  C CB    . ASP A 1 44  ? 148.350 -30.031 38.395  1.00 37.14  ? 55  ASP A CB    1 
ATOM   378  C CG    . ASP A 1 44  ? 149.161 -28.966 39.052  1.00 39.17  ? 55  ASP A CG    1 
ATOM   379  O OD1   . ASP A 1 44  ? 149.580 -28.036 38.335  1.00 41.63  ? 55  ASP A OD1   1 
ATOM   380  O OD2   . ASP A 1 44  ? 149.403 -29.060 40.269  1.00 40.94  ? 55  ASP A OD2   1 
ATOM   381  N N     . PRO A 1 45  ? 151.488 -31.103 37.496  1.00 38.18  ? 56  PRO A N     1 
ATOM   382  C CA    . PRO A 1 45  ? 152.620 -31.880 38.049  1.00 39.81  ? 56  PRO A CA    1 
ATOM   383  C C     . PRO A 1 45  ? 152.650 -31.961 39.588  1.00 40.21  ? 56  PRO A C     1 
ATOM   384  O O     . PRO A 1 45  ? 152.815 -33.057 40.151  1.00 42.78  ? 56  PRO A O     1 
ATOM   385  C CB    . PRO A 1 45  ? 153.846 -31.121 37.521  1.00 39.55  ? 56  PRO A CB    1 
ATOM   386  C CG    . PRO A 1 45  ? 153.359 -30.425 36.284  1.00 37.41  ? 56  PRO A CG    1 
ATOM   387  C CD    . PRO A 1 45  ? 151.962 -30.019 36.610  1.00 38.13  ? 56  PRO A CD    1 
ATOM   388  N N     . ALA A 1 46  ? 152.484 -30.815 40.249  1.00 38.96  ? 57  ALA A N     1 
ATOM   389  C CA    . ALA A 1 46  ? 152.378 -30.761 41.719  1.00 38.12  ? 57  ALA A CA    1 
ATOM   390  C C     . ALA A 1 46  ? 151.232 -31.623 42.316  1.00 36.20  ? 57  ALA A C     1 
ATOM   391  O O     . ALA A 1 46  ? 151.486 -32.560 43.056  1.00 35.03  ? 57  ALA A O     1 
ATOM   392  C CB    . ALA A 1 46  ? 152.239 -29.311 42.166  1.00 38.21  ? 57  ALA A CB    1 
ATOM   393  N N     . SER A 1 47  ? 149.983 -31.313 41.964  1.00 36.35  ? 58  SER A N     1 
ATOM   394  C CA    . SER A 1 47  ? 148.806 -31.946 42.578  1.00 32.87  ? 58  SER A CA    1 
ATOM   395  C C     . SER A 1 47  ? 148.387 -33.249 41.937  1.00 34.56  ? 58  SER A C     1 
ATOM   396  O O     . SER A 1 47  ? 147.567 -33.969 42.525  1.00 31.66  ? 58  SER A O     1 
ATOM   397  C CB    . SER A 1 47  ? 147.615 -30.990 42.562  1.00 32.03  ? 58  SER A CB    1 
ATOM   398  O OG    . SER A 1 47  ? 147.593 -30.131 41.437  1.00 33.61  ? 58  SER A OG    1 
ATOM   399  N N     . LYS A 1 48  ? 148.911 -33.531 40.723  1.00 35.89  ? 59  LYS A N     1 
ATOM   400  C CA    . LYS A 1 48  ? 148.414 -34.603 39.839  1.00 34.49  ? 59  LYS A CA    1 
ATOM   401  C C     . LYS A 1 48  ? 146.925 -34.464 39.456  1.00 34.34  ? 59  LYS A C     1 
ATOM   402  O O     . LYS A 1 48  ? 146.328 -35.399 38.954  1.00 33.12  ? 59  LYS A O     1 
ATOM   403  C CB    . LYS A 1 48  ? 148.713 -35.981 40.419  1.00 36.27  ? 59  LYS A CB    1 
ATOM   404  C CG    . LYS A 1 48  ? 150.177 -36.260 40.642  1.00 42.23  ? 59  LYS A CG    1 
ATOM   405  C CD    . LYS A 1 48  ? 150.964 -36.293 39.335  1.00 49.56  ? 59  LYS A CD    1 
ATOM   406  C CE    . LYS A 1 48  ? 152.441 -36.519 39.628  1.00 55.80  ? 59  LYS A CE    1 
ATOM   407  N NZ    . LYS A 1 48  ? 153.258 -36.306 38.404  1.00 60.53  ? 59  LYS A NZ    1 
ATOM   408  N N     . ARG A 1 49  ? 146.340 -33.287 39.659  1.00 34.96  ? 60  ARG A N     1 
ATOM   409  C CA    . ARG A 1 49  ? 144.975 -33.021 39.239  1.00 35.63  ? 60  ARG A CA    1 
ATOM   410  C C     . ARG A 1 49  ? 144.931 -32.982 37.728  1.00 34.20  ? 60  ARG A C     1 
ATOM   411  O O     . ARG A 1 49  ? 145.814 -32.387 37.094  1.00 30.42  ? 60  ARG A O     1 
ATOM   412  C CB    . ARG A 1 49  ? 144.520 -31.637 39.698  1.00 38.15  ? 60  ARG A CB    1 
ATOM   413  C CG    . ARG A 1 49  ? 144.024 -31.538 41.120  1.00 40.64  ? 60  ARG A CG    1 
ATOM   414  C CD    . ARG A 1 49  ? 143.443 -30.158 41.392  1.00 40.88  ? 60  ARG A CD    1 
ATOM   415  N NE    . ARG A 1 49  ? 144.541 -29.280 41.759  1.00 42.37  ? 60  ARG A NE    1 
ATOM   416  C CZ    . ARG A 1 49  ? 144.617 -28.515 42.849  1.00 39.97  ? 60  ARG A CZ    1 
ATOM   417  N NH1   . ARG A 1 49  ? 143.617 -28.407 43.720  1.00 36.81  ? 60  ARG A NH1   1 
ATOM   418  N NH2   . ARG A 1 49  ? 145.729 -27.810 43.033  1.00 41.38  ? 60  ARG A NH2   1 
ATOM   419  N N     . SER A 1 50  ? 143.881 -33.580 37.173  1.00 33.79  ? 61  SER A N     1 
ATOM   420  C CA    . SER A 1 50  ? 143.583 -33.463 35.750  1.00 34.29  ? 61  SER A CA    1 
ATOM   421  C C     . SER A 1 50  ? 143.354 -32.000 35.435  1.00 34.17  ? 61  SER A C     1 
ATOM   422  O O     . SER A 1 50  ? 142.688 -31.288 36.212  1.00 30.00  ? 61  SER A O     1 
ATOM   423  C CB    . SER A 1 50  ? 142.344 -34.285 35.354  1.00 33.90  ? 61  SER A CB    1 
ATOM   424  O OG    . SER A 1 50  ? 141.948 -34.050 34.000  1.00 36.18  ? 61  SER A OG    1 
ATOM   425  N N     . ARG A 1 51  ? 143.928 -31.565 34.307  1.00 35.47  ? 62  ARG A N     1 
ATOM   426  C CA    . ARG A 1 51  ? 143.655 -30.240 33.747  1.00 36.95  ? 62  ARG A CA    1 
ATOM   427  C C     . ARG A 1 51  ? 142.263 -30.179 33.003  1.00 33.29  ? 62  ARG A C     1 
ATOM   428  O O     . ARG A 1 51  ? 141.871 -29.126 32.485  1.00 30.04  ? 62  ARG A O     1 
ATOM   429  C CB    . ARG A 1 51  ? 144.860 -29.760 32.886  1.00 42.27  ? 62  ARG A CB    1 
ATOM   430  C CG    . ARG A 1 51  ? 145.854 -28.841 33.619  1.00 47.88  ? 62  ARG A CG    1 
ATOM   431  C CD    . ARG A 1 51  ? 147.330 -29.085 33.293  1.00 54.84  ? 62  ARG A CD    1 
ATOM   432  N NE    . ARG A 1 51  ? 147.792 -28.492 32.026  1.00 66.34  ? 62  ARG A NE    1 
ATOM   433  C CZ    . ARG A 1 51  ? 149.030 -28.630 31.507  1.00 77.12  ? 62  ARG A CZ    1 
ATOM   434  N NH1   . ARG A 1 51  ? 149.969 -29.356 32.141  1.00 80.34  ? 62  ARG A NH1   1 
ATOM   435  N NH2   . ARG A 1 51  ? 149.342 -28.045 30.336  1.00 72.67  ? 62  ARG A NH2   1 
ATOM   436  N N     . GLY A 1 52  ? 141.493 -31.273 33.021  1.00 32.13  ? 63  GLY A N     1 
ATOM   437  C CA    . GLY A 1 52  ? 140.204 -31.342 32.307  1.00 34.13  ? 63  GLY A CA    1 
ATOM   438  C C     . GLY A 1 52  ? 140.279 -31.394 30.762  1.00 32.63  ? 63  GLY A C     1 
ATOM   439  O O     . GLY A 1 52  ? 139.271 -31.093 30.105  1.00 30.08  ? 63  GLY A O     1 
ATOM   440  N N     . PHE A 1 53  ? 141.454 -31.771 30.207  1.00 30.03  ? 64  PHE A N     1 
ATOM   441  C CA    . PHE A 1 53  ? 141.672 -31.952 28.763  1.00 29.33  ? 64  PHE A CA    1 
ATOM   442  C C     . PHE A 1 53  ? 142.717 -33.021 28.415  1.00 27.64  ? 64  PHE A C     1 
ATOM   443  O O     . PHE A 1 53  ? 143.493 -33.483 29.254  1.00 28.49  ? 64  PHE A O     1 
ATOM   444  C CB    . PHE A 1 53  ? 142.007 -30.614 28.039  1.00 29.36  ? 64  PHE A CB    1 
ATOM   445  C CG    . PHE A 1 53  ? 143.443 -30.149 28.183  1.00 29.22  ? 64  PHE A CG    1 
ATOM   446  C CD1   . PHE A 1 53  ? 143.832 -29.351 29.263  1.00 28.47  ? 64  PHE A CD1   1 
ATOM   447  C CD2   . PHE A 1 53  ? 144.403 -30.468 27.215  1.00 29.40  ? 64  PHE A CD2   1 
ATOM   448  C CE1   . PHE A 1 53  ? 145.147 -28.906 29.399  1.00 27.31  ? 64  PHE A CE1   1 
ATOM   449  C CE2   . PHE A 1 53  ? 145.721 -30.023 27.347  1.00 28.82  ? 64  PHE A CE2   1 
ATOM   450  C CZ    . PHE A 1 53  ? 146.093 -29.246 28.450  1.00 28.38  ? 64  PHE A CZ    1 
ATOM   451  N N     . GLY A 1 54  ? 142.705 -33.403 27.148  1.00 26.54  ? 65  GLY A N     1 
ATOM   452  C CA    . GLY A 1 54  ? 143.566 -34.476 26.634  1.00 26.70  ? 65  GLY A CA    1 
ATOM   453  C C     . GLY A 1 54  ? 143.605 -34.565 25.108  1.00 24.70  ? 65  GLY A C     1 
ATOM   454  O O     . GLY A 1 54  ? 142.945 -33.785 24.424  1.00 20.34  ? 65  GLY A O     1 
ATOM   455  N N     . PHE A 1 55  ? 144.381 -35.529 24.605  1.00 25.05  ? 66  PHE A N     1 
ATOM   456  C CA    . PHE A 1 55  ? 144.566 -35.747 23.159  1.00 26.55  ? 66  PHE A CA    1 
ATOM   457  C C     . PHE A 1 55  ? 144.519 -37.216 22.789  1.00 27.36  ? 66  PHE A C     1 
ATOM   458  O O     . PHE A 1 55  ? 145.235 -37.994 23.401  1.00 29.80  ? 66  PHE A O     1 
ATOM   459  C CB    . PHE A 1 55  ? 145.927 -35.200 22.710  1.00 25.82  ? 66  PHE A CB    1 
ATOM   460  C CG    . PHE A 1 55  ? 146.033 -33.707 22.803  1.00 25.58  ? 66  PHE A CG    1 
ATOM   461  C CD1   . PHE A 1 55  ? 145.534 -32.896 21.788  1.00 23.73  ? 66  PHE A CD1   1 
ATOM   462  C CD2   . PHE A 1 55  ? 146.611 -33.098 23.932  1.00 24.36  ? 66  PHE A CD2   1 
ATOM   463  C CE1   . PHE A 1 55  ? 145.626 -31.511 21.892  1.00 23.89  ? 66  PHE A CE1   1 
ATOM   464  C CE2   . PHE A 1 55  ? 146.695 -31.721 24.034  1.00 22.91  ? 66  PHE A CE2   1 
ATOM   465  C CZ    . PHE A 1 55  ? 146.212 -30.926 23.008  1.00 23.32  ? 66  PHE A CZ    1 
ATOM   466  N N     . VAL A 1 56  ? 143.715 -37.584 21.791  1.00 26.85  ? 67  VAL A N     1 
ATOM   467  C CA    . VAL A 1 56  ? 143.817 -38.910 21.190  1.00 29.01  ? 67  VAL A CA    1 
ATOM   468  C C     . VAL A 1 56  ? 144.341 -38.822 19.746  1.00 29.09  ? 67  VAL A C     1 
ATOM   469  O O     . VAL A 1 56  ? 143.923 -37.959 18.990  1.00 26.72  ? 67  VAL A O     1 
ATOM   470  C CB    . VAL A 1 56  ? 142.476 -39.670 21.224  1.00 31.32  ? 67  VAL A CB    1 
ATOM   471  C CG1   . VAL A 1 56  ? 141.807 -39.513 22.575  1.00 32.14  ? 67  VAL A CG1   1 
ATOM   472  C CG2   . VAL A 1 56  ? 141.523 -39.217 20.127  1.00 32.19  ? 67  VAL A CG2   1 
ATOM   473  N N     . THR A 1 57  ? 145.265 -39.718 19.392  1.00 30.02  ? 68  THR A N     1 
ATOM   474  C CA    . THR A 1 57  ? 145.800 -39.834 18.039  1.00 30.36  ? 68  THR A CA    1 
ATOM   475  C C     . THR A 1 57  ? 145.174 -41.075 17.373  1.00 30.90  ? 68  THR A C     1 
ATOM   476  O O     . THR A 1 57  ? 145.418 -42.205 17.769  1.00 31.25  ? 68  THR A O     1 
ATOM   477  C CB    . THR A 1 57  ? 147.358 -39.916 18.045  1.00 28.96  ? 68  THR A CB    1 
ATOM   478  O OG1   . THR A 1 57  ? 147.907 -38.994 19.002  1.00 28.64  ? 68  THR A OG1   1 
ATOM   479  C CG2   . THR A 1 57  ? 147.937 -39.563 16.684  1.00 27.69  ? 68  THR A CG2   1 
ATOM   480  N N     . PHE A 1 58  ? 144.337 -40.864 16.373  1.00 33.62  ? 69  PHE A N     1 
ATOM   481  C CA    . PHE A 1 58  ? 143.850 -41.992 15.558  1.00 35.68  ? 69  PHE A CA    1 
ATOM   482  C C     . PHE A 1 58  ? 144.910 -42.464 14.533  1.00 34.77  ? 69  PHE A C     1 
ATOM   483  O O     . PHE A 1 58  ? 145.912 -41.779 14.279  1.00 30.54  ? 69  PHE A O     1 
ATOM   484  C CB    . PHE A 1 58  ? 142.539 -41.621 14.865  1.00 36.26  ? 69  PHE A CB    1 
ATOM   485  C CG    . PHE A 1 58  ? 141.337 -41.637 15.788  1.00 38.45  ? 69  PHE A CG    1 
ATOM   486  C CD1   . PHE A 1 58  ? 140.663 -42.841 16.063  1.00 37.56  ? 69  PHE A CD1   1 
ATOM   487  C CD2   . PHE A 1 58  ? 140.860 -40.456 16.377  1.00 36.68  ? 69  PHE A CD2   1 
ATOM   488  C CE1   . PHE A 1 58  ? 139.548 -42.859 16.885  1.00 35.05  ? 69  PHE A CE1   1 
ATOM   489  C CE2   . PHE A 1 58  ? 139.740 -40.477 17.201  1.00 33.87  ? 69  PHE A CE2   1 
ATOM   490  C CZ    . PHE A 1 58  ? 139.087 -41.673 17.449  1.00 34.49  ? 69  PHE A CZ    1 
ATOM   491  N N     . SER A 1 59  ? 144.695 -43.655 13.969  1.00 36.75  ? 70  SER A N     1 
ATOM   492  C CA    . SER A 1 59  ? 145.608 -44.229 12.961  1.00 36.19  ? 70  SER A CA    1 
ATOM   493  C C     . SER A 1 59  ? 145.303 -43.706 11.528  1.00 36.96  ? 70  SER A C     1 
ATOM   494  O O     . SER A 1 59  ? 146.184 -43.733 10.658  1.00 36.15  ? 70  SER A O     1 
ATOM   495  C CB    . SER A 1 59  ? 145.632 -45.764 13.055  1.00 35.60  ? 70  SER A CB    1 
ATOM   496  O OG    . SER A 1 59  ? 144.408 -46.346 12.649  1.00 38.62  ? 70  SER A OG    1 
ATOM   497  N N     . SER A 1 60  ? 144.073 -43.224 11.295  1.00 38.67  ? 71  SER A N     1 
ATOM   498  C CA    . SER A 1 60  ? 143.718 -42.470 10.073  1.00 39.31  ? 71  SER A CA    1 
ATOM   499  C C     . SER A 1 60  ? 142.724 -41.348 10.345  1.00 39.76  ? 71  SER A C     1 
ATOM   500  O O     . SER A 1 60  ? 141.923 -41.418 11.259  1.00 43.26  ? 71  SER A O     1 
ATOM   501  C CB    . SER A 1 60  ? 143.176 -43.388 8.968   1.00 38.37  ? 71  SER A CB    1 
ATOM   502  O OG    . SER A 1 60  ? 141.922 -43.961 9.288   1.00 39.10  ? 71  SER A OG    1 
ATOM   503  N N     . MET A 1 61  ? 142.788 -40.316 9.519   1.00 42.72  ? 72  MET A N     1 
ATOM   504  C CA    . MET A 1 61  ? 141.876 -39.171 9.579   1.00 43.03  ? 72  MET A CA    1 
ATOM   505  C C     . MET A 1 61  ? 140.412 -39.608 9.405   1.00 41.53  ? 72  MET A C     1 
ATOM   506  O O     . MET A 1 61  ? 139.484 -39.018 9.964   1.00 43.77  ? 72  MET A O     1 
ATOM   507  C CB    . MET A 1 61  ? 142.279 -38.150 8.493   1.00 43.05  ? 72  MET A CB    1 
ATOM   508  C CG    . MET A 1 61  ? 141.480 -36.851 8.511   1.00 47.17  ? 72  MET A CG    1 
ATOM   509  S SD    . MET A 1 61  ? 142.152 -35.467 7.554   1.00 47.01  ? 72  MET A SD    1 
ATOM   510  C CE    . MET A 1 61  ? 142.613 -36.321 6.048   1.00 55.80  ? 72  MET A CE    1 
ATOM   511  N N     . ALA A 1 62  ? 140.216 -40.649 8.621   1.00 40.16  ? 73  ALA A N     1 
ATOM   512  C CA    . ALA A 1 62  ? 138.915 -41.273 8.468   1.00 40.94  ? 73  ALA A CA    1 
ATOM   513  C C     . ALA A 1 62  ? 138.260 -41.641 9.803   1.00 39.02  ? 73  ALA A C     1 
ATOM   514  O O     . ALA A 1 62  ? 137.040 -41.522 9.965   1.00 36.54  ? 73  ALA A O     1 
ATOM   515  C CB    . ALA A 1 62  ? 139.070 -42.522 7.605   1.00 43.43  ? 73  ALA A CB    1 
ATOM   516  N N     . GLU A 1 63  ? 139.077 -42.108 10.740  1.00 37.78  ? 74  GLU A N     1 
ATOM   517  C CA    . GLU A 1 63  ? 138.594 -42.495 12.058  1.00 39.71  ? 74  GLU A CA    1 
ATOM   518  C C     . GLU A 1 63  ? 138.155 -41.264 12.863  1.00 38.57  ? 74  GLU A C     1 
ATOM   519  O O     . GLU A 1 63  ? 137.133 -41.284 13.550  1.00 35.94  ? 74  GLU A O     1 
ATOM   520  C CB    . GLU A 1 63  ? 139.658 -43.336 12.779  1.00 41.22  ? 74  GLU A CB    1 
ATOM   521  C CG    . GLU A 1 63  ? 139.967 -44.665 12.070  1.00 39.97  ? 74  GLU A CG    1 
ATOM   522  C CD    . GLU A 1 63  ? 141.248 -45.326 12.553  1.00 41.79  ? 74  GLU A CD    1 
ATOM   523  O OE1   . GLU A 1 63  ? 142.278 -44.625 12.655  1.00 39.70  ? 74  GLU A OE1   1 
ATOM   524  O OE2   . GLU A 1 63  ? 141.232 -46.552 12.825  1.00 42.84  ? 74  GLU A OE2   1 
ATOM   525  N N     . VAL A 1 64  ? 138.904 -40.180 12.723  1.00 38.67  ? 75  VAL A N     1 
ATOM   526  C CA    . VAL A 1 64  ? 138.521 -38.879 13.301  1.00 40.60  ? 75  VAL A CA    1 
ATOM   527  C C     . VAL A 1 64  ? 137.152 -38.429 12.707  1.00 40.56  ? 75  VAL A C     1 
ATOM   528  O O     . VAL A 1 64  ? 136.233 -38.005 13.415  1.00 38.86  ? 75  VAL A O     1 
ATOM   529  C CB    . VAL A 1 64  ? 139.623 -37.791 13.050  1.00 39.38  ? 75  VAL A CB    1 
ATOM   530  C CG1   . VAL A 1 64  ? 139.217 -36.443 13.632  1.00 39.13  ? 75  VAL A CG1   1 
ATOM   531  C CG2   . VAL A 1 64  ? 140.988 -38.212 13.597  1.00 39.18  ? 75  VAL A CG2   1 
ATOM   532  N N     . ASP A 1 65  ? 137.035 -38.535 11.389  1.00 43.42  ? 76  ASP A N     1 
ATOM   533  C CA    . ASP A 1 65  ? 135.787 -38.237 10.693  1.00 42.01  ? 76  ASP A CA    1 
ATOM   534  C C     . ASP A 1 65  ? 134.623 -39.012 11.316  1.00 39.48  ? 76  ASP A C     1 
ATOM   535  O O     . ASP A 1 65  ? 133.597 -38.436 11.688  1.00 43.02  ? 76  ASP A O     1 
ATOM   536  C CB    . ASP A 1 65  ? 135.924 -38.560 9.193   1.00 42.35  ? 76  ASP A CB    1 
ATOM   537  C CG    . ASP A 1 65  ? 136.736 -37.511 8.423   1.00 43.75  ? 76  ASP A CG    1 
ATOM   538  O OD1   . ASP A 1 65  ? 137.088 -36.457 8.989   1.00 43.07  ? 76  ASP A OD1   1 
ATOM   539  O OD2   . ASP A 1 65  ? 137.006 -37.743 7.229   1.00 44.20  ? 76  ASP A OD2   1 
ATOM   540  N N     . ALA A 1 66  ? 134.821 -40.309 11.469  1.00 37.07  ? 77  ALA A N     1 
ATOM   541  C CA    . ALA A 1 66  ? 133.795 -41.198 12.009  1.00 37.17  ? 77  ALA A CA    1 
ATOM   542  C C     . ALA A 1 66  ? 133.397 -40.804 13.435  1.00 36.47  ? 77  ALA A C     1 
ATOM   543  O O     . ALA A 1 66  ? 132.216 -40.709 13.738  1.00 36.57  ? 77  ALA A O     1 
ATOM   544  C CB    . ALA A 1 66  ? 134.280 -42.655 11.959  1.00 35.11  ? 77  ALA A CB    1 
ATOM   545  N N     . ALA A 1 67  ? 134.398 -40.565 14.283  1.00 36.12  ? 78  ALA A N     1 
ATOM   546  C CA    . ALA A 1 67  ? 134.188 -40.191 15.675  1.00 34.40  ? 78  ALA A CA    1 
ATOM   547  C C     . ALA A 1 67  ? 133.474 -38.850 15.793  1.00 34.67  ? 78  ALA A C     1 
ATOM   548  O O     . ALA A 1 67  ? 132.595 -38.695 16.647  1.00 35.69  ? 78  ALA A O     1 
ATOM   549  C CB    . ALA A 1 67  ? 135.510 -40.150 16.423  1.00 33.38  ? 78  ALA A CB    1 
ATOM   550  N N     . MET A 1 68  ? 133.833 -37.897 14.935  1.00 33.86  ? 79  MET A N     1 
ATOM   551  C CA    . MET A 1 68  ? 133.194 -36.573 14.934  1.00 34.95  ? 79  MET A CA    1 
ATOM   552  C C     . MET A 1 68  ? 131.732 -36.642 14.466  1.00 36.28  ? 79  MET A C     1 
ATOM   553  O O     . MET A 1 68  ? 130.845 -36.015 15.060  1.00 34.63  ? 79  MET A O     1 
ATOM   554  C CB    . MET A 1 68  ? 134.008 -35.594 14.081  1.00 34.46  ? 79  MET A CB    1 
ATOM   555  C CG    . MET A 1 68  ? 135.354 -35.252 14.691  1.00 34.53  ? 79  MET A CG    1 
ATOM   556  S SD    . MET A 1 68  ? 135.303 -34.566 16.365  1.00 36.06  ? 79  MET A SD    1 
ATOM   557  C CE    . MET A 1 68  ? 134.831 -32.860 16.095  1.00 33.84  ? 79  MET A CE    1 
ATOM   558  N N     . ALA A 1 69  ? 131.492 -37.434 13.415  1.00 37.78  ? 80  ALA A N     1 
ATOM   559  C CA    . ALA A 1 69  ? 130.135 -37.841 13.020  1.00 36.99  ? 80  ALA A CA    1 
ATOM   560  C C     . ALA A 1 69  ? 129.277 -38.531 14.111  1.00 36.92  ? 80  ALA A C     1 
ATOM   561  O O     . ALA A 1 69  ? 128.060 -38.592 13.977  1.00 36.12  ? 80  ALA A O     1 
ATOM   562  C CB    . ALA A 1 69  ? 130.195 -38.741 11.792  1.00 35.67  ? 80  ALA A CB    1 
ATOM   563  N N     . ALA A 1 70  ? 129.896 -39.070 15.155  1.00 36.90  ? 81  ALA A N     1 
ATOM   564  C CA    . ALA A 1 70  ? 129.172 -39.767 16.213  1.00 39.87  ? 81  ALA A CA    1 
ATOM   565  C C     . ALA A 1 70  ? 128.736 -38.869 17.369  1.00 40.98  ? 81  ALA A C     1 
ATOM   566  O O     . ALA A 1 70  ? 128.034 -39.321 18.270  1.00 39.88  ? 81  ALA A O     1 
ATOM   567  C CB    . ALA A 1 70  ? 130.025 -40.901 16.739  1.00 42.17  ? 81  ALA A CB    1 
ATOM   568  N N     . ARG A 1 71  ? 129.160 -37.607 17.336  1.00 44.41  ? 82  ARG A N     1 
ATOM   569  C CA    . ARG A 1 71  ? 128.867 -36.642 18.393  1.00 44.13  ? 82  ARG A CA    1 
ATOM   570  C C     . ARG A 1 71  ? 127.385 -36.529 18.654  1.00 46.98  ? 82  ARG A C     1 
ATOM   571  O O     . ARG A 1 71  ? 126.586 -36.780 17.762  1.00 51.28  ? 82  ARG A O     1 
ATOM   572  C CB    . ARG A 1 71  ? 129.423 -35.264 18.044  1.00 41.51  ? 82  ARG A CB    1 
ATOM   573  C CG    . ARG A 1 71  ? 130.899 -35.112 18.346  1.00 39.91  ? 82  ARG A CG    1 
ATOM   574  C CD    . ARG A 1 71  ? 131.335 -33.722 17.956  1.00 40.32  ? 82  ARG A CD    1 
ATOM   575  N NE    . ARG A 1 71  ? 131.125 -33.483 16.523  1.00 39.33  ? 82  ARG A NE    1 
ATOM   576  C CZ    . ARG A 1 71  ? 131.029 -32.283 15.940  1.00 40.15  ? 82  ARG A CZ    1 
ATOM   577  N NH1   . ARG A 1 71  ? 131.104 -31.141 16.631  1.00 40.37  ? 82  ARG A NH1   1 
ATOM   578  N NH2   . ARG A 1 71  ? 130.848 -32.224 14.631  1.00 42.29  ? 82  ARG A NH2   1 
ATOM   579  N N     . PRO A 1 72  ? 127.007 -36.139 19.880  1.00 49.93  ? 83  PRO A N     1 
ATOM   580  C CA    . PRO A 1 72  ? 127.850 -35.691 20.981  1.00 47.72  ? 83  PRO A CA    1 
ATOM   581  C C     . PRO A 1 72  ? 128.427 -36.862 21.774  1.00 44.07  ? 83  PRO A C     1 
ATOM   582  O O     . PRO A 1 72  ? 127.887 -37.980 21.725  1.00 39.77  ? 83  PRO A O     1 
ATOM   583  C CB    . PRO A 1 72  ? 126.873 -34.899 21.838  1.00 50.48  ? 83  PRO A CB    1 
ATOM   584  C CG    . PRO A 1 72  ? 125.584 -35.632 21.671  1.00 51.19  ? 83  PRO A CG    1 
ATOM   585  C CD    . PRO A 1 72  ? 125.615 -36.321 20.326  1.00 51.20  ? 83  PRO A CD    1 
ATOM   586  N N     . HIS A 1 73  ? 129.510 -36.571 22.501  1.00 40.78  ? 84  HIS A N     1 
ATOM   587  C CA    . HIS A 1 73  ? 130.271 -37.556 23.261  1.00 37.09  ? 84  HIS A CA    1 
ATOM   588  C C     . HIS A 1 73  ? 130.157 -37.353 24.776  1.00 36.43  ? 84  HIS A C     1 
ATOM   589  O O     . HIS A 1 73  ? 130.506 -36.284 25.272  1.00 31.97  ? 84  HIS A O     1 
ATOM   590  C CB    . HIS A 1 73  ? 131.741 -37.478 22.857  1.00 36.99  ? 84  HIS A CB    1 
ATOM   591  C CG    . HIS A 1 73  ? 131.989 -37.759 21.410  1.00 36.79  ? 84  HIS A CG    1 
ATOM   592  N ND1   . HIS A 1 73  ? 133.189 -37.474 20.799  1.00 38.23  ? 84  HIS A ND1   1 
ATOM   593  C CD2   . HIS A 1 73  ? 131.201 -38.304 20.453  1.00 37.93  ? 84  HIS A CD2   1 
ATOM   594  C CE1   . HIS A 1 73  ? 133.134 -37.833 19.526  1.00 37.85  ? 84  HIS A CE1   1 
ATOM   595  N NE2   . HIS A 1 73  ? 131.936 -38.336 19.290  1.00 39.21  ? 84  HIS A NE2   1 
ATOM   596  N N     . SER A 1 74  ? 129.666 -38.387 25.479  1.00 38.92  ? 85  SER A N     1 
ATOM   597  C CA    . SER A 1 74  ? 129.566 -38.435 26.957  1.00 40.76  ? 85  SER A CA    1 
ATOM   598  C C     . SER A 1 74  ? 130.610 -39.407 27.529  1.00 40.48  ? 85  SER A C     1 
ATOM   599  O O     . SER A 1 74  ? 130.481 -40.634 27.395  1.00 40.87  ? 85  SER A O     1 
ATOM   600  C CB    . SER A 1 74  ? 128.156 -38.856 27.418  1.00 42.26  ? 85  SER A CB    1 
ATOM   601  O OG    . SER A 1 74  ? 127.341 -37.736 27.741  1.00 45.13  ? 85  SER A OG    1 
ATOM   602  N N     . ILE A 1 75  ? 131.648 -38.858 28.151  1.00 38.76  ? 86  ILE A N     1 
ATOM   603  C CA    . ILE A 1 75  ? 132.723 -39.656 28.699  1.00 38.51  ? 86  ILE A CA    1 
ATOM   604  C C     . ILE A 1 75  ? 132.723 -39.400 30.182  1.00 40.74  ? 86  ILE A C     1 
ATOM   605  O O     . ILE A 1 75  ? 133.030 -38.282 30.629  1.00 43.01  ? 86  ILE A O     1 
ATOM   606  C CB    . ILE A 1 75  ? 134.099 -39.292 28.107  1.00 40.90  ? 86  ILE A CB    1 
ATOM   607  C CG1   . ILE A 1 75  ? 134.057 -39.372 26.566  1.00 41.05  ? 86  ILE A CG1   1 
ATOM   608  C CG2   . ILE A 1 75  ? 135.186 -40.201 28.689  1.00 40.76  ? 86  ILE A CG2   1 
ATOM   609  C CD1   . ILE A 1 75  ? 135.363 -39.049 25.868  1.00 40.20  ? 86  ILE A CD1   1 
ATOM   610  N N     . ASP A 1 76  ? 132.390 -40.462 30.923  1.00 44.05  ? 87  ASP A N     1 
ATOM   611  C CA    . ASP A 1 76  ? 132.280 -40.467 32.380  1.00 42.93  ? 87  ASP A CA    1 
ATOM   612  C C     . ASP A 1 76  ? 131.154 -39.505 32.825  1.00 42.33  ? 87  ASP A C     1 
ATOM   613  O O     . ASP A 1 76  ? 131.346 -38.682 33.726  1.00 39.95  ? 87  ASP A O     1 
ATOM   614  C CB    . ASP A 1 76  ? 133.653 -40.167 33.045  1.00 45.15  ? 87  ASP A CB    1 
ATOM   615  C CG    . ASP A 1 76  ? 134.737 -41.233 32.724  1.00 46.69  ? 87  ASP A CG    1 
ATOM   616  O OD1   . ASP A 1 76  ? 134.438 -42.431 32.872  1.00 47.38  ? 87  ASP A OD1   1 
ATOM   617  O OD2   . ASP A 1 76  ? 135.894 -40.891 32.352  1.00 45.45  ? 87  ASP A OD2   1 
ATOM   618  N N     . GLY A 1 77  ? 129.995 -39.602 32.155  1.00 40.78  ? 88  GLY A N     1 
ATOM   619  C CA    . GLY A 1 77  ? 128.773 -38.862 32.535  1.00 39.75  ? 88  GLY A CA    1 
ATOM   620  C C     . GLY A 1 77  ? 128.736 -37.367 32.255  1.00 40.43  ? 88  GLY A C     1 
ATOM   621  O O     . GLY A 1 77  ? 127.962 -36.619 32.872  1.00 37.72  ? 88  GLY A O     1 
ATOM   622  N N     . ARG A 1 78  ? 129.552 -36.941 31.301  1.00 42.95  ? 89  ARG A N     1 
ATOM   623  C CA    . ARG A 1 78  ? 129.760 -35.530 31.019  1.00 45.11  ? 89  ARG A CA    1 
ATOM   624  C C     . ARG A 1 78  ? 129.989 -35.379 29.524  1.00 43.91  ? 89  ARG A C     1 
ATOM   625  O O     . ARG A 1 78  ? 130.863 -36.030 28.952  1.00 42.07  ? 89  ARG A O     1 
ATOM   626  C CB    . ARG A 1 78  ? 130.979 -35.015 31.794  1.00 48.10  ? 89  ARG A CB    1 
ATOM   627  C CG    . ARG A 1 78  ? 131.345 -33.567 31.518  1.00 50.46  ? 89  ARG A CG    1 
ATOM   628  C CD    . ARG A 1 78  ? 132.602 -33.123 32.264  1.00 56.09  ? 89  ARG A CD    1 
ATOM   629  N NE    . ARG A 1 78  ? 132.333 -32.535 33.583  1.00 55.64  ? 89  ARG A NE    1 
ATOM   630  C CZ    . ARG A 1 78  ? 133.159 -31.740 34.272  1.00 55.99  ? 89  ARG A CZ    1 
ATOM   631  N NH1   . ARG A 1 78  ? 134.359 -31.396 33.808  1.00 57.58  ? 89  ARG A NH1   1 
ATOM   632  N NH2   . ARG A 1 78  ? 132.774 -31.278 35.453  1.00 58.34  ? 89  ARG A NH2   1 
ATOM   633  N N     . VAL A 1 79  ? 129.229 -34.490 28.907  1.00 42.90  ? 90  VAL A N     1 
ATOM   634  C CA    . VAL A 1 79  ? 129.348 -34.279 27.479  1.00 42.82  ? 90  VAL A CA    1 
ATOM   635  C C     . VAL A 1 79  ? 130.653 -33.538 27.268  1.00 41.17  ? 90  VAL A C     1 
ATOM   636  O O     . VAL A 1 79  ? 130.828 -32.443 27.798  1.00 45.11  ? 90  VAL A O     1 
ATOM   637  C CB    . VAL A 1 79  ? 128.167 -33.460 26.901  1.00 41.65  ? 90  VAL A CB    1 
ATOM   638  C CG1   . VAL A 1 79  ? 128.319 -33.292 25.399  1.00 39.55  ? 90  VAL A CG1   1 
ATOM   639  C CG2   . VAL A 1 79  ? 126.844 -34.135 27.231  1.00 42.43  ? 90  VAL A CG2   1 
ATOM   640  N N     . VAL A 1 80  ? 131.569 -34.142 26.521  1.00 40.21  ? 91  VAL A N     1 
ATOM   641  C CA    . VAL A 1 80  ? 132.853 -33.492 26.207  1.00 40.60  ? 91  VAL A CA    1 
ATOM   642  C C     . VAL A 1 80  ? 132.844 -32.757 24.849  1.00 42.17  ? 91  VAL A C     1 
ATOM   643  O O     . VAL A 1 80  ? 132.017 -33.048 23.948  1.00 34.93  ? 91  VAL A O     1 
ATOM   644  C CB    . VAL A 1 80  ? 134.034 -34.484 26.252  1.00 41.20  ? 91  VAL A CB    1 
ATOM   645  C CG1   . VAL A 1 80  ? 134.378 -34.855 27.697  1.00 40.62  ? 91  VAL A CG1   1 
ATOM   646  C CG2   . VAL A 1 80  ? 133.761 -35.722 25.392  1.00 41.08  ? 91  VAL A CG2   1 
ATOM   647  N N     . GLU A 1 81  ? 133.782 -31.816 24.718  1.00 44.36  ? 92  GLU A N     1 
ATOM   648  C CA    . GLU A 1 81  ? 133.927 -30.994 23.510  1.00 51.31  ? 92  GLU A CA    1 
ATOM   649  C C     . GLU A 1 81  ? 135.192 -31.366 22.670  1.00 44.45  ? 92  GLU A C     1 
ATOM   650  O O     . GLU A 1 81  ? 136.296 -30.803 22.879  1.00 40.95  ? 92  GLU A O     1 
ATOM   651  C CB    . GLU A 1 81  ? 133.914 -29.508 23.901  1.00 61.97  ? 92  GLU A CB    1 
ATOM   652  C CG    . GLU A 1 81  ? 133.430 -28.575 22.782  1.00 72.09  ? 92  GLU A CG    1 
ATOM   653  C CD    . GLU A 1 81  ? 133.804 -27.105 23.002  1.00 82.72  ? 92  GLU A CD    1 
ATOM   654  O OE1   . GLU A 1 81  ? 134.813 -26.835 23.705  1.00 85.84  ? 92  GLU A OE1   1 
ATOM   655  O OE2   . GLU A 1 81  ? 133.100 -26.213 22.455  1.00 86.74  ? 92  GLU A OE2   1 
ATOM   656  N N     . PRO A 1 82  ? 135.038 -32.325 21.725  1.00 36.86  ? 93  PRO A N     1 
ATOM   657  C CA    . PRO A 1 82  ? 136.163 -32.763 20.916  1.00 35.47  ? 93  PRO A CA    1 
ATOM   658  C C     . PRO A 1 82  ? 136.355 -31.844 19.725  1.00 36.30  ? 93  PRO A C     1 
ATOM   659  O O     . PRO A 1 82  ? 135.365 -31.396 19.126  1.00 40.36  ? 93  PRO A O     1 
ATOM   660  C CB    . PRO A 1 82  ? 135.739 -34.144 20.459  1.00 34.98  ? 93  PRO A CB    1 
ATOM   661  C CG    . PRO A 1 82  ? 134.277 -34.031 20.312  1.00 35.79  ? 93  PRO A CG    1 
ATOM   662  C CD    . PRO A 1 82  ? 133.823 -33.084 21.391  1.00 36.36  ? 93  PRO A CD    1 
ATOM   663  N N     . LYS A 1 83  ? 137.611 -31.535 19.404  1.00 34.76  ? 94  LYS A N     1 
ATOM   664  C CA    . LYS A 1 83  ? 137.931 -30.669 18.266  1.00 35.85  ? 94  LYS A CA    1 
ATOM   665  C C     . LYS A 1 83  ? 139.172 -31.157 17.563  1.00 33.75  ? 94  LYS A C     1 
ATOM   666  O O     . LYS A 1 83  ? 140.053 -31.733 18.175  1.00 33.77  ? 94  LYS A O     1 
ATOM   667  C CB    . LYS A 1 83  ? 138.171 -29.224 18.712  1.00 36.63  ? 94  LYS A CB    1 
ATOM   668  C CG    . LYS A 1 83  ? 137.022 -28.547 19.445  1.00 39.33  ? 94  LYS A CG    1 
ATOM   669  C CD    . LYS A 1 83  ? 137.500 -27.206 19.979  1.00 40.15  ? 94  LYS A CD    1 
ATOM   670  C CE    . LYS A 1 83  ? 136.459 -26.539 20.850  1.00 41.40  ? 94  LYS A CE    1 
ATOM   671  N NZ    . LYS A 1 83  ? 136.823 -25.125 21.159  1.00 43.55  ? 94  LYS A NZ    1 
ATOM   672  N N     . ARG A 1 84  ? 139.275 -30.893 16.276  1.00 34.12  ? 95  ARG A N     1 
ATOM   673  C CA    . ARG A 1 84  ? 140.520 -31.225 15.582  1.00 34.34  ? 95  ARG A CA    1 
ATOM   674  C C     . ARG A 1 84  ? 141.600 -30.332 16.184  1.00 34.73  ? 95  ARG A C     1 
ATOM   675  O O     . ARG A 1 84  ? 141.353 -29.147 16.469  1.00 36.41  ? 95  ARG A O     1 
ATOM   676  C CB    . ARG A 1 84  ? 140.378 -31.093 14.072  1.00 32.48  ? 95  ARG A CB    1 
ATOM   677  C CG    . ARG A 1 84  ? 139.384 -32.121 13.540  1.00 32.96  ? 95  ARG A CG    1 
ATOM   678  C CD    . ARG A 1 84  ? 138.967 -31.825 12.121  1.00 33.98  ? 95  ARG A CD    1 
ATOM   679  N NE    . ARG A 1 84  ? 137.816 -32.625 11.672  1.00 34.81  ? 95  ARG A NE    1 
ATOM   680  C CZ    . ARG A 1 84  ? 137.875 -33.789 11.015  1.00 35.05  ? 95  ARG A CZ    1 
ATOM   681  N NH1   . ARG A 1 84  ? 139.039 -34.371 10.702  1.00 35.44  ? 95  ARG A NH1   1 
ATOM   682  N NH2   . ARG A 1 84  ? 136.738 -34.382 10.659  1.00 35.25  ? 95  ARG A NH2   1 
ATOM   683  N N     . ALA A 1 85  ? 142.761 -30.939 16.437  1.00 32.82  ? 96  ALA A N     1 
ATOM   684  C CA    . ALA A 1 85  ? 143.822 -30.318 17.208  1.00 30.98  ? 96  ALA A CA    1 
ATOM   685  C C     . ALA A 1 85  ? 144.601 -29.291 16.402  1.00 30.54  ? 96  ALA A C     1 
ATOM   686  O O     . ALA A 1 85  ? 144.620 -29.309 15.177  1.00 30.99  ? 96  ALA A O     1 
ATOM   687  C CB    . ALA A 1 85  ? 144.772 -31.367 17.811  1.00 30.18  ? 96  ALA A CB    1 
ATOM   688  N N     . VAL A 1 86  ? 145.328 -28.473 17.143  1.00 30.25  ? 97  VAL A N     1 
ATOM   689  C CA    . VAL A 1 86  ? 145.977 -27.278 16.693  1.00 31.20  ? 97  VAL A CA    1 
ATOM   690  C C     . VAL A 1 86  ? 147.396 -27.623 17.033  1.00 29.97  ? 97  VAL A C     1 
ATOM   691  O O     . VAL A 1 86  ? 147.661 -27.995 18.180  1.00 29.68  ? 97  VAL A O     1 
ATOM   692  C CB    . VAL A 1 86  ? 145.584 -26.047 17.534  1.00 30.89  ? 97  VAL A CB    1 
ATOM   693  C CG1   . VAL A 1 86  ? 146.509 -24.884 17.208  1.00 29.77  ? 97  VAL A CG1   1 
ATOM   694  C CG2   . VAL A 1 86  ? 144.116 -25.692 17.313  1.00 30.26  ? 97  VAL A CG2   1 
ATOM   695  N N     . ALA A 1 87  ? 148.287 -27.529 16.054  1.00 28.71  ? 98  ALA A N     1 
ATOM   696  C CA    . ALA A 1 87  ? 149.643 -28.050 16.203  1.00 28.74  ? 98  ALA A CA    1 
ATOM   697  C C     . ALA A 1 87  ? 150.332 -27.262 17.282  1.00 27.77  ? 98  ALA A C     1 
ATOM   698  O O     . ALA A 1 87  ? 149.965 -26.107 17.531  1.00 29.13  ? 98  ALA A O     1 
ATOM   699  C CB    . ALA A 1 87  ? 150.410 -27.957 14.883  1.00 28.93  ? 98  ALA A CB    1 
ATOM   700  N N     . ARG A 1 88  ? 151.326 -27.861 17.920  1.00 27.42  ? 99  ARG A N     1 
ATOM   701  C CA    . ARG A 1 88  ? 152.091 -27.116 18.927  1.00 29.13  ? 99  ARG A CA    1 
ATOM   702  C C     . ARG A 1 88  ? 152.746 -25.886 18.257  1.00 29.79  ? 99  ARG A C     1 
ATOM   703  O O     . ARG A 1 88  ? 152.807 -24.811 18.823  1.00 28.60  ? 99  ARG A O     1 
ATOM   704  C CB    . ARG A 1 88  ? 153.143 -28.017 19.573  1.00 29.11  ? 99  ARG A CB    1 
ATOM   705  C CG    . ARG A 1 88  ? 152.589 -29.177 20.411  1.00 29.95  ? 99  ARG A CG    1 
ATOM   706  C CD    . ARG A 1 88  ? 153.739 -30.030 20.956  1.00 30.50  ? 99  ARG A CD    1 
ATOM   707  N NE    . ARG A 1 88  ? 153.397 -31.368 21.456  1.00 28.65  ? 99  ARG A NE    1 
ATOM   708  C CZ    . ARG A 1 88  ? 152.994 -32.392 20.712  1.00 28.62  ? 99  ARG A CZ    1 
ATOM   709  N NH1   . ARG A 1 88  ? 152.781 -32.265 19.405  1.00 28.94  ? 99  ARG A NH1   1 
ATOM   710  N NH2   . ARG A 1 88  ? 152.759 -33.562 21.289  1.00 30.00  ? 99  ARG A NH2   1 
ATOM   711  N N     . GLU A 1 89  ? 153.160 -26.077 17.009  1.00 32.32  ? 100 GLU A N     1 
ATOM   712  C CA    . GLU A 1 89  ? 153.857 -25.090 16.188  1.00 32.98  ? 100 GLU A CA    1 
ATOM   713  C C     . GLU A 1 89  ? 152.972 -23.900 15.762  1.00 34.89  ? 100 GLU A C     1 
ATOM   714  O O     . GLU A 1 89  ? 153.519 -22.849 15.427  1.00 36.55  ? 100 GLU A O     1 
ATOM   715  C CB    . GLU A 1 89  ? 154.443 -25.779 14.932  1.00 33.44  ? 100 GLU A CB    1 
ATOM   716  C CG    . GLU A 1 89  ? 155.565 -26.818 15.180  1.00 35.22  ? 100 GLU A CG    1 
ATOM   717  C CD    . GLU A 1 89  ? 155.134 -28.117 15.921  1.00 35.13  ? 100 GLU A CD    1 
ATOM   718  O OE1   . GLU A 1 89  ? 154.009 -28.615 15.670  1.00 32.69  ? 100 GLU A OE1   1 
ATOM   719  O OE2   . GLU A 1 89  ? 155.924 -28.640 16.764  1.00 32.94  ? 100 GLU A OE2   1 
ATOM   720  N N     . GLU A 1 90  ? 151.637 -24.074 15.755  1.00 34.73  ? 101 GLU A N     1 
ATOM   721  C CA    . GLU A 1 90  ? 150.655 -23.006 15.447  1.00 35.59  ? 101 GLU A CA    1 
ATOM   722  C C     . GLU A 1 90  ? 149.793 -22.586 16.637  1.00 33.75  ? 101 GLU A C     1 
ATOM   723  O O     . GLU A 1 90  ? 148.938 -21.708 16.508  1.00 29.25  ? 101 GLU A O     1 
ATOM   724  C CB    . GLU A 1 90  ? 149.686 -23.467 14.350  1.00 40.33  ? 101 GLU A CB    1 
ATOM   725  C CG    . GLU A 1 90  ? 150.197 -23.370 12.921  1.00 43.93  ? 101 GLU A CG    1 
ATOM   726  C CD    . GLU A 1 90  ? 150.031 -24.687 12.182  1.00 51.13  ? 101 GLU A CD    1 
ATOM   727  O OE1   . GLU A 1 90  ? 148.891 -25.233 12.161  1.00 54.27  ? 101 GLU A OE1   1 
ATOM   728  O OE2   . GLU A 1 90  ? 151.057 -25.207 11.672  1.00 55.97  ? 101 GLU A OE2   1 
ATOM   729  N N     . SER A 1 91  ? 149.994 -23.211 17.793  1.00 35.26  ? 102 SER A N     1 
ATOM   730  C CA    . SER A 1 91  ? 149.214 -22.890 19.009  1.00 34.70  ? 102 SER A CA    1 
ATOM   731  C C     . SER A 1 91  ? 149.178 -21.424 19.383  1.00 33.06  ? 102 SER A C     1 
ATOM   732  O O     . SER A 1 91  ? 148.323 -21.035 20.143  1.00 35.37  ? 102 SER A O     1 
ATOM   733  C CB    . SER A 1 91  ? 149.729 -23.695 20.216  1.00 35.80  ? 102 SER A CB    1 
ATOM   734  O OG    . SER A 1 91  ? 151.134 -23.514 20.412  1.00 34.98  ? 102 SER A OG    1 
ATOM   735  N N     . GLY A 1 92  ? 150.100 -20.614 18.877  1.00 34.66  ? 103 GLY A N     1 
ATOM   736  C CA    . GLY A 1 92  ? 150.119 -19.183 19.199  1.00 37.82  ? 103 GLY A CA    1 
ATOM   737  C C     . GLY A 1 92  ? 149.832 -18.180 18.096  1.00 40.63  ? 103 GLY A C     1 
ATOM   738  O O     . GLY A 1 92  ? 150.154 -17.003 18.285  1.00 41.49  ? 103 GLY A O     1 
ATOM   739  N N     . LYS A 1 93  ? 149.248 -18.619 16.969  1.00 41.59  ? 104 LYS A N     1 
ATOM   740  C CA    . LYS A 1 93  ? 148.705 -17.690 15.972  1.00 46.10  ? 104 LYS A CA    1 
ATOM   741  C C     . LYS A 1 93  ? 147.509 -17.014 16.591  1.00 44.88  ? 104 LYS A C     1 
ATOM   742  O O     . LYS A 1 93  ? 146.747 -17.662 17.308  1.00 47.93  ? 104 LYS A O     1 
ATOM   743  C CB    . LYS A 1 93  ? 148.250 -18.370 14.672  1.00 50.31  ? 104 LYS A CB    1 
ATOM   744  C CG    . LYS A 1 93  ? 149.388 -18.676 13.733  1.00 56.41  ? 104 LYS A CG    1 
ATOM   745  C CD    . LYS A 1 93  ? 148.947 -19.361 12.445  1.00 64.49  ? 104 LYS A CD    1 
ATOM   746  C CE    . LYS A 1 93  ? 150.189 -19.917 11.741  1.00 70.43  ? 104 LYS A CE    1 
ATOM   747  N NZ    . LYS A 1 93  ? 149.906 -20.658 10.487  1.00 72.57  ? 104 LYS A NZ    1 
ATOM   748  N N     . PRO A 1 94  ? 147.337 -15.707 16.326  1.00 43.71  ? 105 PRO A N     1 
ATOM   749  C CA    . PRO A 1 94  ? 146.077 -15.120 16.756  1.00 43.52  ? 105 PRO A CA    1 
ATOM   750  C C     . PRO A 1 94  ? 144.848 -15.950 16.286  1.00 41.20  ? 105 PRO A C     1 
ATOM   751  O O     . PRO A 1 94  ? 144.786 -16.419 15.142  1.00 43.20  ? 105 PRO A O     1 
ATOM   752  C CB    . PRO A 1 94  ? 146.132 -13.720 16.138  1.00 43.93  ? 105 PRO A CB    1 
ATOM   753  C CG    . PRO A 1 94  ? 147.607 -13.409 16.092  1.00 42.60  ? 105 PRO A CG    1 
ATOM   754  C CD    . PRO A 1 94  ? 148.239 -14.705 15.711  1.00 42.21  ? 105 PRO A CD    1 
ATOM   755  N N     . GLY A 1 95  ? 143.907 -16.143 17.203  1.00 38.65  ? 106 GLY A N     1 
ATOM   756  C CA    . GLY A 1 95  ? 142.702 -16.945 16.967  1.00 36.93  ? 106 GLY A CA    1 
ATOM   757  C C     . GLY A 1 95  ? 142.823 -18.443 16.784  1.00 34.45  ? 106 GLY A C     1 
ATOM   758  O O     . GLY A 1 95  ? 141.879 -19.088 16.374  1.00 32.09  ? 106 GLY A O     1 
ATOM   759  N N     . ALA A 1 96  ? 143.972 -19.001 17.126  1.00 36.77  ? 107 ALA A N     1 
ATOM   760  C CA    . ALA A 1 96  ? 144.269 -20.423 16.887  1.00 36.39  ? 107 ALA A CA    1 
ATOM   761  C C     . ALA A 1 96  ? 143.253 -21.405 17.477  1.00 35.57  ? 107 ALA A C     1 
ATOM   762  O O     . ALA A 1 96  ? 142.912 -22.393 16.805  1.00 34.99  ? 107 ALA A O     1 
ATOM   763  C CB    . ALA A 1 96  ? 145.672 -20.747 17.405  1.00 37.84  ? 107 ALA A CB    1 
ATOM   764  N N     . HIS A 1 97  ? 142.793 -21.137 18.715  1.00 35.26  ? 108 HIS A N     1 
ATOM   765  C CA    . HIS A 1 97  ? 141.954 -22.084 19.480  1.00 34.84  ? 108 HIS A CA    1 
ATOM   766  C C     . HIS A 1 97  ? 140.471 -21.750 19.436  1.00 33.40  ? 108 HIS A C     1 
ATOM   767  O O     . HIS A 1 97  ? 139.679 -22.378 20.136  1.00 36.92  ? 108 HIS A O     1 
ATOM   768  C CB    . HIS A 1 97  ? 142.418 -22.187 20.960  1.00 36.10  ? 108 HIS A CB    1 
ATOM   769  C CG    . HIS A 1 97  ? 143.863 -22.556 21.115  1.00 36.73  ? 108 HIS A CG    1 
ATOM   770  N ND1   . HIS A 1 97  ? 144.760 -21.777 21.811  1.00 38.66  ? 108 HIS A ND1   1 
ATOM   771  C CD2   . HIS A 1 97  ? 144.582 -23.580 20.598  1.00 37.67  ? 108 HIS A CD2   1 
ATOM   772  C CE1   . HIS A 1 97  ? 145.965 -22.312 21.732  1.00 38.70  ? 108 HIS A CE1   1 
ATOM   773  N NE2   . HIS A 1 97  ? 145.884 -23.408 20.998  1.00 38.43  ? 108 HIS A NE2   1 
ATOM   774  N N     . VAL A 1 98  ? 140.079 -20.795 18.606  1.00 31.15  ? 109 VAL A N     1 
ATOM   775  C CA    . VAL A 1 98  ? 138.693 -20.357 18.577  1.00 30.76  ? 109 VAL A CA    1 
ATOM   776  C C     . VAL A 1 98  ? 137.862 -21.117 17.527  1.00 29.71  ? 109 VAL A C     1 
ATOM   777  O O     . VAL A 1 98  ? 138.128 -21.068 16.335  1.00 25.72  ? 109 VAL A O     1 
ATOM   778  C CB    . VAL A 1 98  ? 138.581 -18.852 18.330  1.00 32.78  ? 109 VAL A CB    1 
ATOM   779  C CG1   . VAL A 1 98  ? 137.142 -18.391 18.581  1.00 34.02  ? 109 VAL A CG1   1 
ATOM   780  C CG2   . VAL A 1 98  ? 139.577 -18.089 19.211  1.00 32.18  ? 109 VAL A CG2   1 
ATOM   781  N N     . THR A 1 99  ? 136.858 -21.818 18.036  1.00 30.17  ? 110 THR A N     1 
ATOM   782  C CA    . THR A 1 99  ? 135.886 -22.606 17.276  1.00 30.99  ? 110 THR A CA    1 
ATOM   783  C C     . THR A 1 99  ? 134.785 -21.741 16.626  1.00 29.96  ? 110 THR A C     1 
ATOM   784  O O     . THR A 1 99  ? 134.047 -21.052 17.328  1.00 26.19  ? 110 THR A O     1 
ATOM   785  C CB    . THR A 1 99  ? 135.278 -23.626 18.274  1.00 32.06  ? 110 THR A CB    1 
ATOM   786  O OG1   . THR A 1 99  ? 136.277 -24.611 18.554  1.00 33.84  ? 110 THR A OG1   1 
ATOM   787  C CG2   . THR A 1 99  ? 133.970 -24.271 17.805  1.00 31.53  ? 110 THR A CG2   1 
ATOM   788  N N     . VAL A 1 100 ? 134.685 -21.772 15.293  1.00 30.10  ? 111 VAL A N     1 
ATOM   789  C CA    . VAL A 1 100 ? 133.609 -21.047 14.581  1.00 29.54  ? 111 VAL A CA    1 
ATOM   790  C C     . VAL A 1 100 ? 132.993 -21.865 13.457  1.00 29.92  ? 111 VAL A C     1 
ATOM   791  O O     . VAL A 1 100 ? 133.632 -22.756 12.882  1.00 28.27  ? 111 VAL A O     1 
ATOM   792  C CB    . VAL A 1 100 ? 134.075 -19.710 13.942  1.00 29.62  ? 111 VAL A CB    1 
ATOM   793  C CG1   . VAL A 1 100 ? 134.712 -18.781 14.962  1.00 28.88  ? 111 VAL A CG1   1 
ATOM   794  C CG2   . VAL A 1 100 ? 135.009 -19.947 12.742  1.00 29.93  ? 111 VAL A CG2   1 
ATOM   795  N N     . LYS A 1 101 ? 131.764 -21.487 13.109  1.00 31.77  ? 112 LYS A N     1 
ATOM   796  C CA    . LYS A 1 101 ? 131.038 -22.074 11.968  1.00 32.46  ? 112 LYS A CA    1 
ATOM   797  C C     . LYS A 1 101 ? 131.247 -21.360 10.623  1.00 32.29  ? 112 LYS A C     1 
ATOM   798  O O     . LYS A 1 101 ? 130.899 -21.921 9.558   1.00 30.63  ? 112 LYS A O     1 
ATOM   799  C CB    . LYS A 1 101 ? 129.548 -22.098 12.275  1.00 33.44  ? 112 LYS A CB    1 
ATOM   800  C CG    . LYS A 1 101 ? 129.196 -23.015 13.408  1.00 33.67  ? 112 LYS A CG    1 
ATOM   801  C CD    . LYS A 1 101 ? 127.737 -22.909 13.749  1.00 35.93  ? 112 LYS A CD    1 
ATOM   802  C CE    . LYS A 1 101 ? 127.489 -23.654 15.048  1.00 38.40  ? 112 LYS A CE    1 
ATOM   803  N NZ    . LYS A 1 101 ? 126.054 -23.666 15.428  1.00 41.46  ? 112 LYS A NZ    1 
ATOM   804  N N     . LYS A 1 102 ? 131.790 -20.138 10.671  1.00 31.80  ? 113 LYS A N     1 
ATOM   805  C CA    . LYS A 1 102 ? 131.934 -19.327 9.481   1.00 32.97  ? 113 LYS A CA    1 
ATOM   806  C C     . LYS A 1 102 ? 133.306 -19.532 8.852   1.00 31.44  ? 113 LYS A C     1 
ATOM   807  O O     . LYS A 1 102 ? 134.334 -19.259 9.470   1.00 30.33  ? 113 LYS A O     1 
ATOM   808  C CB    . LYS A 1 102 ? 131.667 -17.858 9.805   1.00 35.67  ? 113 LYS A CB    1 
ATOM   809  C CG    . LYS A 1 102 ? 131.372 -16.980 8.585   1.00 37.84  ? 113 LYS A CG    1 
ATOM   810  C CD    . LYS A 1 102 ? 130.711 -15.671 8.998   1.00 40.57  ? 113 LYS A CD    1 
ATOM   811  C CE    . LYS A 1 102 ? 130.852 -14.580 7.947   1.00 43.88  ? 113 LYS A CE    1 
ATOM   812  N NZ    . LYS A 1 102 ? 130.329 -13.258 8.418   1.00 45.15  ? 113 LYS A NZ    1 
ATOM   813  N N     . LEU A 1 103 ? 133.292 -20.036 7.616   1.00 32.65  ? 114 LEU A N     1 
ATOM   814  C CA    . LEU A 1 103 ? 134.489 -20.213 6.758   1.00 32.56  ? 114 LEU A CA    1 
ATOM   815  C C     . LEU A 1 103 ? 134.770 -18.979 5.876   1.00 33.65  ? 114 LEU A C     1 
ATOM   816  O O     . LEU A 1 103 ? 133.854 -18.476 5.230   1.00 33.88  ? 114 LEU A O     1 
ATOM   817  C CB    . LEU A 1 103 ? 134.270 -21.414 5.853   1.00 31.40  ? 114 LEU A CB    1 
ATOM   818  C CG    . LEU A 1 103 ? 135.472 -21.901 5.036   1.00 33.59  ? 114 LEU A CG    1 
ATOM   819  C CD1   . LEU A 1 103 ? 136.528 -22.535 5.962   1.00 33.86  ? 114 LEU A CD1   1 
ATOM   820  C CD2   . LEU A 1 103 ? 135.021 -22.875 3.932   1.00 30.40  ? 114 LEU A CD2   1 
ATOM   821  N N     . PHE A 1 104 ? 136.016 -18.488 5.867   1.00 34.77  ? 115 PHE A N     1 
ATOM   822  C CA    . PHE A 1 104 ? 136.465 -17.494 4.865   1.00 37.30  ? 115 PHE A CA    1 
ATOM   823  C C     . PHE A 1 104 ? 136.939 -18.172 3.601   1.00 36.39  ? 115 PHE A C     1 
ATOM   824  O O     . PHE A 1 104 ? 137.666 -19.159 3.657   1.00 38.11  ? 115 PHE A O     1 
ATOM   825  C CB    . PHE A 1 104 ? 137.631 -16.640 5.349   1.00 37.72  ? 115 PHE A CB    1 
ATOM   826  C CG    . PHE A 1 104 ? 138.284 -15.845 4.239   1.00 38.20  ? 115 PHE A CG    1 
ATOM   827  C CD1   . PHE A 1 104 ? 137.707 -14.645 3.789   1.00 35.49  ? 115 PHE A CD1   1 
ATOM   828  C CD2   . PHE A 1 104 ? 139.466 -16.304 3.620   1.00 38.77  ? 115 PHE A CD2   1 
ATOM   829  C CE1   . PHE A 1 104 ? 138.289 -13.907 2.762   1.00 35.12  ? 115 PHE A CE1   1 
ATOM   830  C CE2   . PHE A 1 104 ? 140.049 -15.565 2.593   1.00 38.09  ? 115 PHE A CE2   1 
ATOM   831  C CZ    . PHE A 1 104 ? 139.447 -14.375 2.153   1.00 36.77  ? 115 PHE A CZ    1 
ATOM   832  N N     . VAL A 1 105 ? 136.567 -17.616 2.460   1.00 36.17  ? 116 VAL A N     1 
ATOM   833  C CA    . VAL A 1 105 ? 137.008 -18.159 1.179   1.00 35.96  ? 116 VAL A CA    1 
ATOM   834  C C     . VAL A 1 105 ? 137.379 -17.056 0.175   1.00 35.21  ? 116 VAL A C     1 
ATOM   835  O O     . VAL A 1 105 ? 136.502 -16.442 -0.419  1.00 33.96  ? 116 VAL A O     1 
ATOM   836  C CB    . VAL A 1 105 ? 135.917 -19.027 0.559   1.00 36.22  ? 116 VAL A CB    1 
ATOM   837  C CG1   . VAL A 1 105 ? 136.496 -19.808 -0.633  1.00 37.41  ? 116 VAL A CG1   1 
ATOM   838  C CG2   . VAL A 1 105 ? 135.275 -19.923 1.617   1.00 34.93  ? 116 VAL A CG2   1 
ATOM   839  N N     . GLY A 1 106 ? 138.681 -16.841 -0.021  1.00 33.77  ? 117 GLY A N     1 
ATOM   840  C CA    . GLY A 1 106 ? 139.201 -15.850 -0.970  1.00 31.67  ? 117 GLY A CA    1 
ATOM   841  C C     . GLY A 1 106 ? 139.946 -16.539 -2.080  1.00 29.86  ? 117 GLY A C     1 
ATOM   842  O O     . GLY A 1 106 ? 140.048 -17.753 -2.071  1.00 28.45  ? 117 GLY A O     1 
ATOM   843  N N     . GLY A 1 107 ? 140.457 -15.748 -3.028  1.00 30.22  ? 118 GLY A N     1 
ATOM   844  C CA    . GLY A 1 107 ? 141.112 -16.246 -4.246  1.00 30.76  ? 118 GLY A CA    1 
ATOM   845  C C     . GLY A 1 107 ? 140.179 -16.512 -5.432  1.00 33.82  ? 118 GLY A C     1 
ATOM   846  O O     . GLY A 1 107 ? 140.629 -16.990 -6.491  1.00 30.69  ? 118 GLY A O     1 
ATOM   847  N N     . ILE A 1 108 ? 138.902 -16.266 -5.239  1.00 33.82  ? 119 ILE A N     1 
ATOM   848  C CA    . ILE A 1 108 ? 137.887 -16.586 -6.206  1.00 34.97  ? 119 ILE A CA    1 
ATOM   849  C C     . ILE A 1 108 ? 137.551 -15.615 -7.331  1.00 36.02  ? 119 ILE A C     1 
ATOM   850  O O     . ILE A 1 108 ? 136.708 -15.883 -8.133  1.00 33.19  ? 119 ILE A O     1 
ATOM   851  C CB    . ILE A 1 108 ? 136.659 -17.160 -5.508  1.00 33.89  ? 119 ILE A CB    1 
ATOM   852  C CG1   . ILE A 1 108 ? 136.067 -16.167 -4.543  1.00 33.75  ? 119 ILE A CG1   1 
ATOM   853  C CG2   . ILE A 1 108 ? 137.054 -18.392 -4.747  1.00 34.27  ? 119 ILE A CG2   1 
ATOM   854  C CD1   . ILE A 1 108 ? 134.744 -16.568 -3.969  1.00 33.00  ? 119 ILE A CD1   1 
ATOM   855  N N     . LYS A 1 109 ? 138.268 -14.496 -7.374  1.00 36.34  ? 120 LYS A N     1 
ATOM   856  C CA    . LYS A 1 109 ? 138.080 -13.488 -8.414  1.00 38.54  ? 120 LYS A CA    1 
ATOM   857  C C     . LYS A 1 109 ? 136.736 -12.791 -8.596  1.00 39.25  ? 120 LYS A C     1 
ATOM   858  O O     . LYS A 1 109 ? 136.156 -12.279 -7.638  1.00 37.60  ? 120 LYS A O     1 
ATOM   859  C CB    . LYS A 1 109 ? 138.616 -14.000 -9.754  1.00 40.31  ? 120 LYS A CB    1 
ATOM   860  C CG    . LYS A 1 109 ? 139.935 -14.748 -9.649  1.00 42.65  ? 120 LYS A CG    1 
ATOM   861  C CD    . LYS A 1 109 ? 141.047 -13.839 -9.152  1.00 48.95  ? 120 LYS A CD    1 
ATOM   862  C CE    . LYS A 1 109 ? 142.404 -14.515 -9.263  1.00 51.24  ? 120 LYS A CE    1 
ATOM   863  N NZ    . LYS A 1 109 ? 143.034 -14.283 -10.592 1.00 52.40  ? 120 LYS A NZ    1 
ATOM   864  N N     . GLU A 1 110 ? 136.210 -12.834 -9.813  1.00 42.25  ? 121 GLU A N     1 
ATOM   865  C CA    . GLU A 1 110 ? 134.891 -12.318 -10.086 1.00 41.49  ? 121 GLU A CA    1 
ATOM   866  C C     . GLU A 1 110 ? 133.923 -13.259 -10.713 1.00 41.77  ? 121 GLU A C     1 
ATOM   867  O O     . GLU A 1 110 ? 132.780 -12.958 -10.770 1.00 41.81  ? 121 GLU A O     1 
ATOM   868  C CB    . GLU A 1 110 ? 134.968 -11.089 -10.948 1.00 44.21  ? 121 GLU A CB    1 
ATOM   869  C CG    . GLU A 1 110 ? 135.719 -9.984  -10.272 1.00 51.85  ? 121 GLU A CG    1 
ATOM   870  C CD    . GLU A 1 110 ? 135.969 -8.789  -11.142 1.00 59.13  ? 121 GLU A CD    1 
ATOM   871  O OE1   . GLU A 1 110 ? 135.030 -8.306  -11.768 1.00 71.89  ? 121 GLU A OE1   1 
ATOM   872  O OE2   . GLU A 1 110 ? 137.100 -8.307  -11.194 1.00 60.83  ? 121 GLU A OE2   1 
ATOM   873  N N     . ASP A 1 111 ? 134.376 -14.390 -11.197 1.00 43.88  ? 122 ASP A N     1 
ATOM   874  C CA    . ASP A 1 111 ? 133.504 -15.320 -11.866 1.00 44.11  ? 122 ASP A CA    1 
ATOM   875  C C     . ASP A 1 111 ? 132.902 -16.315 -10.945 1.00 44.26  ? 122 ASP A C     1 
ATOM   876  O O     . ASP A 1 111 ? 132.021 -17.025 -11.293 1.00 47.02  ? 122 ASP A O     1 
ATOM   877  C CB    . ASP A 1 111 ? 134.270 -16.044 -12.938 1.00 41.76  ? 122 ASP A CB    1 
ATOM   878  C CG    . ASP A 1 111 ? 135.596 -16.461 -12.483 1.00 41.60  ? 122 ASP A CG    1 
ATOM   879  O OD1   . ASP A 1 111 ? 136.481 -15.643 -12.455 1.00 45.79  ? 122 ASP A OD1   1 
ATOM   880  O OD2   . ASP A 1 111 ? 135.783 -17.598 -12.147 1.00 45.39  ? 122 ASP A OD2   1 
ATOM   881  N N     . THR A 1 112 ? 133.390 -16.360 -9.745  1.00 45.38  ? 123 THR A N     1 
ATOM   882  C CA    . THR A 1 112 ? 132.853 -17.317 -8.784  1.00 44.51  ? 123 THR A CA    1 
ATOM   883  C C     . THR A 1 112 ? 131.614 -16.740 -8.069  1.00 44.29  ? 123 THR A C     1 
ATOM   884  O O     . THR A 1 112 ? 131.545 -15.537 -7.771  1.00 46.28  ? 123 THR A O     1 
ATOM   885  C CB    . THR A 1 112 ? 133.936 -17.810 -7.813  1.00 41.83  ? 123 THR A CB    1 
ATOM   886  O OG1   . THR A 1 112 ? 135.154 -18.075 -8.535  1.00 37.40  ? 123 THR A OG1   1 
ATOM   887  C CG2   . THR A 1 112 ? 133.487 -19.094 -7.126  1.00 41.45  ? 123 THR A CG2   1 
ATOM   888  N N     . GLU A 1 113 ? 130.669 -17.645 -7.806  1.00 46.18  ? 124 GLU A N     1 
ATOM   889  C CA    . GLU A 1 113 ? 129.273 -17.370 -7.460  1.00 46.43  ? 124 GLU A CA    1 
ATOM   890  C C     . GLU A 1 113 ? 128.832 -18.431 -6.446  1.00 45.10  ? 124 GLU A C     1 
ATOM   891  O O     . GLU A 1 113 ? 129.448 -19.510 -6.328  1.00 42.12  ? 124 GLU A O     1 
ATOM   892  C CB    . GLU A 1 113 ? 128.352 -17.439 -8.688  1.00 51.01  ? 124 GLU A CB    1 
ATOM   893  C CG    . GLU A 1 113 ? 128.320 -16.174 -9.552  1.00 57.31  ? 124 GLU A CG    1 
ATOM   894  C CD    . GLU A 1 113 ? 127.127 -16.086 -10.520 1.00 62.88  ? 124 GLU A CD    1 
ATOM   895  O OE1   . GLU A 1 113 ? 126.066 -16.747 -10.334 1.00 60.45  ? 124 GLU A OE1   1 
ATOM   896  O OE2   . GLU A 1 113 ? 127.245 -15.308 -11.488 1.00 70.51  ? 124 GLU A OE2   1 
ATOM   897  N N     . GLU A 1 114 ? 127.756 -18.105 -5.735  1.00 41.43  ? 125 GLU A N     1 
ATOM   898  C CA    . GLU A 1 114 ? 127.212 -18.930 -4.655  1.00 39.86  ? 125 GLU A CA    1 
ATOM   899  C C     . GLU A 1 114 ? 127.018 -20.404 -4.997  1.00 37.45  ? 125 GLU A C     1 
ATOM   900  O O     . GLU A 1 114 ? 127.235 -21.265 -4.137  1.00 35.32  ? 125 GLU A O     1 
ATOM   901  C CB    . GLU A 1 114 ? 125.886 -18.315 -4.137  1.00 39.94  ? 125 GLU A CB    1 
ATOM   902  C CG    . GLU A 1 114 ? 125.037 -19.191 -3.201  1.00 38.01  ? 125 GLU A CG    1 
ATOM   903  C CD    . GLU A 1 114 ? 123.797 -18.473 -2.655  1.00 38.50  ? 125 GLU A CD    1 
ATOM   904  O OE1   . GLU A 1 114 ? 122.946 -19.165 -2.044  1.00 38.08  ? 125 GLU A OE1   1 
ATOM   905  O OE2   . GLU A 1 114 ? 123.653 -17.233 -2.832  1.00 37.42  ? 125 GLU A OE2   1 
ATOM   906  N N     . HIS A 1 115 ? 126.597 -20.691 -6.224  1.00 38.38  ? 126 HIS A N     1 
ATOM   907  C CA    . HIS A 1 115 ? 126.334 -22.075 -6.635  1.00 39.27  ? 126 HIS A CA    1 
ATOM   908  C C     . HIS A 1 115 ? 127.638 -22.889 -6.731  1.00 37.25  ? 126 HIS A C     1 
ATOM   909  O O     . HIS A 1 115 ? 127.626 -24.091 -6.495  1.00 34.54  ? 126 HIS A O     1 
ATOM   910  C CB    . HIS A 1 115 ? 125.516 -22.134 -7.948  1.00 41.18  ? 126 HIS A CB    1 
ATOM   911  C CG    . HIS A 1 115 ? 126.352 -22.024 -9.181  1.00 43.74  ? 126 HIS A CG    1 
ATOM   912  N ND1   . HIS A 1 115 ? 126.572 -20.824 -9.825  1.00 45.50  ? 126 HIS A ND1   1 
ATOM   913  C CD2   . HIS A 1 115 ? 127.057 -22.959 -9.864  1.00 46.66  ? 126 HIS A CD2   1 
ATOM   914  C CE1   . HIS A 1 115 ? 127.377 -21.025 -10.854 1.00 48.22  ? 126 HIS A CE1   1 
ATOM   915  N NE2   . HIS A 1 115 ? 127.688 -22.311 -10.898 1.00 49.87  ? 126 HIS A NE2   1 
ATOM   916  N N     . HIS A 1 116 ? 128.749 -22.233 -7.082  1.00 39.21  ? 127 HIS A N     1 
ATOM   917  C CA    . HIS A 1 116 ? 130.070 -22.900 -7.107  1.00 39.53  ? 127 HIS A CA    1 
ATOM   918  C C     . HIS A 1 116 ? 130.479 -23.304 -5.715  1.00 35.07  ? 127 HIS A C     1 
ATOM   919  O O     . HIS A 1 116 ? 130.990 -24.396 -5.499  1.00 33.68  ? 127 HIS A O     1 
ATOM   920  C CB    . HIS A 1 116 ? 131.179 -22.007 -7.683  1.00 40.06  ? 127 HIS A CB    1 
ATOM   921  C CG    . HIS A 1 116 ? 131.012 -21.689 -9.127  1.00 39.88  ? 127 HIS A CG    1 
ATOM   922  N ND1   . HIS A 1 116 ? 130.768 -20.413 -9.580  1.00 40.67  ? 127 HIS A ND1   1 
ATOM   923  C CD2   . HIS A 1 116 ? 131.065 -22.477 -10.227 1.00 41.24  ? 127 HIS A CD2   1 
ATOM   924  C CE1   . HIS A 1 116 ? 130.671 -20.429 -10.898 1.00 40.64  ? 127 HIS A CE1   1 
ATOM   925  N NE2   . HIS A 1 116 ? 130.846 -21.669 -11.315 1.00 38.62  ? 127 HIS A NE2   1 
ATOM   926  N N     . LEU A 1 117 ? 130.258 -22.404 -4.770  1.00 35.41  ? 128 LEU A N     1 
ATOM   927  C CA    . LEU A 1 117 ? 130.571 -22.685 -3.367  1.00 35.48  ? 128 LEU A CA    1 
ATOM   928  C C     . LEU A 1 117 ? 129.699 -23.764 -2.786  1.00 37.87  ? 128 LEU A C     1 
ATOM   929  O O     . LEU A 1 117 ? 130.228 -24.727 -2.239  1.00 41.06  ? 128 LEU A O     1 
ATOM   930  C CB    . LEU A 1 117 ? 130.481 -21.426 -2.520  1.00 34.68  ? 128 LEU A CB    1 
ATOM   931  C CG    . LEU A 1 117 ? 131.452 -20.303 -2.904  1.00 34.02  ? 128 LEU A CG    1 
ATOM   932  C CD1   . LEU A 1 117 ? 131.459 -19.252 -1.798  1.00 36.17  ? 128 LEU A CD1   1 
ATOM   933  C CD2   . LEU A 1 117 ? 132.867 -20.802 -3.187  1.00 32.63  ? 128 LEU A CD2   1 
ATOM   934  N N     . ARG A 1 118 ? 128.378 -23.625 -2.935  1.00 43.83  ? 129 ARG A N     1 
ATOM   935  C CA    . ARG A 1 118 ? 127.404 -24.654 -2.482  1.00 46.83  ? 129 ARG A CA    1 
ATOM   936  C C     . ARG A 1 118 ? 127.768 -26.054 -3.017  1.00 44.77  ? 129 ARG A C     1 
ATOM   937  O O     . ARG A 1 118 ? 127.965 -27.021 -2.259  1.00 45.20  ? 129 ARG A O     1 
ATOM   938  C CB    . ARG A 1 118 ? 125.980 -24.278 -2.922  1.00 50.61  ? 129 ARG A CB    1 
ATOM   939  C CG    . ARG A 1 118 ? 124.867 -25.136 -2.310  1.00 55.47  ? 129 ARG A CG    1 
ATOM   940  C CD    . ARG A 1 118 ? 123.818 -25.566 -3.340  1.00 57.65  ? 129 ARG A CD    1 
ATOM   941  N NE    . ARG A 1 118 ? 124.226 -26.713 -4.186  1.00 56.80  ? 129 ARG A NE    1 
ATOM   942  C CZ    . ARG A 1 118 ? 124.391 -26.716 -5.519  1.00 60.40  ? 129 ARG A CZ    1 
ATOM   943  N NH1   . ARG A 1 118 ? 124.214 -25.632 -6.281  1.00 58.05  ? 129 ARG A NH1   1 
ATOM   944  N NH2   . ARG A 1 118 ? 124.764 -27.849 -6.112  1.00 66.26  ? 129 ARG A NH2   1 
ATOM   945  N N     . ASP A 1 119 ? 127.900 -26.137 -4.327  1.00 40.21  ? 130 ASP A N     1 
ATOM   946  C CA    . ASP A 1 119 ? 128.252 -27.394 -4.972  1.00 41.86  ? 130 ASP A CA    1 
ATOM   947  C C     . ASP A 1 119 ? 129.568 -27.991 -4.424  1.00 39.65  ? 130 ASP A C     1 
ATOM   948  O O     . ASP A 1 119 ? 129.601 -29.153 -4.060  1.00 40.79  ? 130 ASP A O     1 
ATOM   949  C CB    . ASP A 1 119 ? 128.299 -27.168 -6.489  1.00 43.26  ? 130 ASP A CB    1 
ATOM   950  C CG    . ASP A 1 119 ? 128.552 -28.406 -7.237  1.00 41.56  ? 130 ASP A CG    1 
ATOM   951  O OD1   . ASP A 1 119 ? 127.686 -29.316 -7.192  1.00 42.62  ? 130 ASP A OD1   1 
ATOM   952  O OD2   . ASP A 1 119 ? 129.629 -28.462 -7.845  1.00 41.51  ? 130 ASP A OD2   1 
ATOM   953  N N     . TYR A 1 120 ? 130.611 -27.169 -4.305  1.00 39.45  ? 131 TYR A N     1 
ATOM   954  C CA    . TYR A 1 120 ? 131.918 -27.601 -3.764  1.00 38.62  ? 131 TYR A CA    1 
ATOM   955  C C     . TYR A 1 120 ? 131.886 -28.057 -2.312  1.00 39.55  ? 131 TYR A C     1 
ATOM   956  O O     . TYR A 1 120 ? 132.440 -29.113 -1.972  1.00 41.74  ? 131 TYR A O     1 
ATOM   957  C CB    . TYR A 1 120 ? 132.976 -26.490 -3.879  1.00 36.77  ? 131 TYR A CB    1 
ATOM   958  C CG    . TYR A 1 120 ? 134.348 -26.975 -3.458  1.00 37.86  ? 131 TYR A CG    1 
ATOM   959  C CD1   . TYR A 1 120 ? 135.189 -27.672 -4.355  1.00 38.51  ? 131 TYR A CD1   1 
ATOM   960  C CD2   . TYR A 1 120 ? 134.801 -26.797 -2.139  1.00 38.30  ? 131 TYR A CD2   1 
ATOM   961  C CE1   . TYR A 1 120 ? 136.443 -28.142 -3.952  1.00 36.66  ? 131 TYR A CE1   1 
ATOM   962  C CE2   . TYR A 1 120 ? 136.049 -27.262 -1.726  1.00 35.85  ? 131 TYR A CE2   1 
ATOM   963  C CZ    . TYR A 1 120 ? 136.857 -27.924 -2.630  1.00 35.90  ? 131 TYR A CZ    1 
ATOM   964  O OH    . TYR A 1 120 ? 138.060 -28.365 -2.202  1.00 33.89  ? 131 TYR A OH    1 
ATOM   965  N N     . PHE A 1 121 ? 131.268 -27.229 -1.468  1.00 40.51  ? 132 PHE A N     1 
ATOM   966  C CA    . PHE A 1 121 ? 131.297 -27.386 0.003   1.00 38.46  ? 132 PHE A CA    1 
ATOM   967  C C     . PHE A 1 121 ? 130.186 -28.210 0.653   1.00 39.34  ? 132 PHE A C     1 
ATOM   968  O O     . PHE A 1 121 ? 130.378 -28.683 1.758   1.00 39.05  ? 132 PHE A O     1 
ATOM   969  C CB    . PHE A 1 121 ? 131.343 -26.011 0.674   1.00 36.21  ? 132 PHE A CB    1 
ATOM   970  C CG    . PHE A 1 121 ? 132.699 -25.373 0.631   1.00 35.49  ? 132 PHE A CG    1 
ATOM   971  C CD1   . PHE A 1 121 ? 133.810 -26.037 1.161   1.00 33.58  ? 132 PHE A CD1   1 
ATOM   972  C CD2   . PHE A 1 121 ? 132.878 -24.112 0.072   1.00 37.51  ? 132 PHE A CD2   1 
ATOM   973  C CE1   . PHE A 1 121 ? 135.067 -25.475 1.126   1.00 33.79  ? 132 PHE A CE1   1 
ATOM   974  C CE2   . PHE A 1 121 ? 134.140 -23.531 0.044   1.00 38.39  ? 132 PHE A CE2   1 
ATOM   975  C CZ    . PHE A 1 121 ? 135.240 -24.217 0.578   1.00 35.88  ? 132 PHE A CZ    1 
ATOM   976  N N     . GLU A 1 122 ? 129.035 -28.343 -0.013  1.00 43.11  ? 133 GLU A N     1 
ATOM   977  C CA    . GLU A 1 122 ? 127.999 -29.349 0.316   1.00 44.85  ? 133 GLU A CA    1 
ATOM   978  C C     . GLU A 1 122 ? 128.545 -30.668 0.873   1.00 42.22  ? 133 GLU A C     1 
ATOM   979  O O     . GLU A 1 122 ? 128.041 -31.152 1.876   1.00 45.57  ? 133 GLU A O     1 
ATOM   980  C CB    . GLU A 1 122 ? 127.165 -29.704 -0.932  1.00 48.66  ? 133 GLU A CB    1 
ATOM   981  C CG    . GLU A 1 122 ? 125.828 -29.001 -1.115  1.00 50.14  ? 133 GLU A CG    1 
ATOM   982  C CD    . GLU A 1 122 ? 125.126 -29.435 -2.409  1.00 55.81  ? 133 GLU A CD    1 
ATOM   983  O OE1   . GLU A 1 122 ? 125.748 -30.171 -3.217  1.00 53.24  ? 133 GLU A OE1   1 
ATOM   984  O OE2   . GLU A 1 122 ? 123.948 -29.034 -2.640  1.00 60.15  ? 133 GLU A OE2   1 
ATOM   985  N N     . GLU A 1 123 ? 129.555 -31.232 0.211   1.00 39.80  ? 134 GLU A N     1 
ATOM   986  C CA    . GLU A 1 123 ? 130.105 -32.533 0.578   1.00 43.94  ? 134 GLU A CA    1 
ATOM   987  C C     . GLU A 1 123 ? 130.847 -32.582 1.946   1.00 44.43  ? 134 GLU A C     1 
ATOM   988  O O     . GLU A 1 123 ? 131.290 -33.657 2.352   1.00 43.28  ? 134 GLU A O     1 
ATOM   989  C CB    . GLU A 1 123 ? 131.057 -33.034 -0.527  1.00 47.13  ? 134 GLU A CB    1 
ATOM   990  C CG    . GLU A 1 123 ? 132.496 -32.541 -0.380  1.00 51.49  ? 134 GLU A CG    1 
ATOM   991  C CD    . GLU A 1 123 ? 133.383 -32.880 -1.560  1.00 56.69  ? 134 GLU A CD    1 
ATOM   992  O OE1   . GLU A 1 123 ? 133.563 -31.992 -2.448  1.00 57.82  ? 134 GLU A OE1   1 
ATOM   993  O OE2   . GLU A 1 123 ? 133.905 -34.026 -1.579  1.00 57.49  ? 134 GLU A OE2   1 
ATOM   994  N N     . TYR A 1 124 ? 131.041 -31.426 2.595   1.00 43.29  ? 135 TYR A N     1 
ATOM   995  C CA    . TYR A 1 124 ? 131.647 -31.324 3.936   1.00 43.93  ? 135 TYR A CA    1 
ATOM   996  C C     . TYR A 1 124 ? 130.648 -31.204 5.075   1.00 44.60  ? 135 TYR A C     1 
ATOM   997  O O     . TYR A 1 124 ? 130.992 -31.528 6.220   1.00 42.69  ? 135 TYR A O     1 
ATOM   998  C CB    . TYR A 1 124 ? 132.545 -30.093 4.023   1.00 42.70  ? 135 TYR A CB    1 
ATOM   999  C CG    . TYR A 1 124 ? 133.801 -30.233 3.246   1.00 40.71  ? 135 TYR A CG    1 
ATOM   1000 C CD1   . TYR A 1 124 ? 134.855 -30.962 3.748   1.00 39.45  ? 135 TYR A CD1   1 
ATOM   1001 C CD2   . TYR A 1 124 ? 133.941 -29.639 1.996   1.00 41.02  ? 135 TYR A CD2   1 
ATOM   1002 C CE1   . TYR A 1 124 ? 136.017 -31.099 3.026   1.00 39.52  ? 135 TYR A CE1   1 
ATOM   1003 C CE2   . TYR A 1 124 ? 135.104 -29.769 1.268   1.00 37.87  ? 135 TYR A CE2   1 
ATOM   1004 C CZ    . TYR A 1 124 ? 136.127 -30.500 1.792   1.00 36.50  ? 135 TYR A CZ    1 
ATOM   1005 O OH    . TYR A 1 124 ? 137.282 -30.630 1.109   1.00 37.50  ? 135 TYR A OH    1 
ATOM   1006 N N     . GLY A 1 125 ? 129.459 -30.667 4.786   1.00 42.82  ? 136 GLY A N     1 
ATOM   1007 C CA    . GLY A 1 125 ? 128.405 -30.600 5.788   1.00 44.78  ? 136 GLY A CA    1 
ATOM   1008 C C     . GLY A 1 125 ? 127.191 -29.815 5.373   1.00 46.90  ? 136 GLY A C     1 
ATOM   1009 O O     . GLY A 1 125 ? 127.060 -29.434 4.204   1.00 50.04  ? 136 GLY A O     1 
ATOM   1010 N N     . LYS A 1 126 ? 126.297 -29.608 6.342   1.00 49.22  ? 137 LYS A N     1 
ATOM   1011 C CA    . LYS A 1 126 ? 125.110 -28.766 6.175   1.00 48.77  ? 137 LYS A CA    1 
ATOM   1012 C C     . LYS A 1 126 ? 125.531 -27.307 6.200   1.00 47.98  ? 137 LYS A C     1 
ATOM   1013 O O     . LYS A 1 126 ? 126.055 -26.829 7.217   1.00 44.73  ? 137 LYS A O     1 
ATOM   1014 C CB    . LYS A 1 126 ? 124.093 -28.990 7.294   1.00 51.15  ? 137 LYS A CB    1 
ATOM   1015 C CG    . LYS A 1 126 ? 123.056 -30.053 7.029   1.00 56.73  ? 137 LYS A CG    1 
ATOM   1016 C CD    . LYS A 1 126 ? 122.194 -30.224 8.276   1.00 66.83  ? 137 LYS A CD    1 
ATOM   1017 C CE    . LYS A 1 126 ? 120.795 -30.766 7.987   1.00 74.19  ? 137 LYS A CE    1 
ATOM   1018 N NZ    . LYS A 1 126 ? 119.875 -30.471 9.128   1.00 77.12  ? 137 LYS A NZ    1 
ATOM   1019 N N     . ILE A 1 127 ? 125.275 -26.612 5.089   1.00 46.40  ? 138 ILE A N     1 
ATOM   1020 C CA    . ILE A 1 127 ? 125.573 -25.186 4.940   1.00 43.37  ? 138 ILE A CA    1 
ATOM   1021 C C     . ILE A 1 127 ? 124.374 -24.397 5.443   1.00 43.24  ? 138 ILE A C     1 
ATOM   1022 O O     . ILE A 1 127 ? 123.264 -24.768 5.133   1.00 47.62  ? 138 ILE A O     1 
ATOM   1023 C CB    . ILE A 1 127 ? 125.818 -24.830 3.456   1.00 40.75  ? 138 ILE A CB    1 
ATOM   1024 C CG1   . ILE A 1 127 ? 126.979 -25.663 2.911   1.00 40.52  ? 138 ILE A CG1   1 
ATOM   1025 C CG2   . ILE A 1 127 ? 126.112 -23.341 3.315   1.00 42.74  ? 138 ILE A CG2   1 
ATOM   1026 C CD1   . ILE A 1 127 ? 127.415 -25.345 1.496   1.00 40.69  ? 138 ILE A CD1   1 
ATOM   1027 N N     . ASP A 1 128 ? 124.571 -23.332 6.215   1.00 40.47  ? 139 ASP A N     1 
ATOM   1028 C CA    . ASP A 1 128 ? 123.446 -22.453 6.578   1.00 41.87  ? 139 ASP A CA    1 
ATOM   1029 C C     . ASP A 1 128 ? 123.311 -21.279 5.629   1.00 44.78  ? 139 ASP A C     1 
ATOM   1030 O O     . ASP A 1 128 ? 122.207 -20.923 5.209   1.00 46.11  ? 139 ASP A O     1 
ATOM   1031 C CB    . ASP A 1 128 ? 123.573 -21.926 8.008   1.00 39.62  ? 139 ASP A CB    1 
ATOM   1032 C CG    . ASP A 1 128 ? 123.114 -22.923 9.044   1.00 39.77  ? 139 ASP A CG    1 
ATOM   1033 O OD1   . ASP A 1 128 ? 122.587 -23.998 8.674   1.00 37.17  ? 139 ASP A OD1   1 
ATOM   1034 O OD2   . ASP A 1 128 ? 123.296 -22.626 10.251  1.00 43.19  ? 139 ASP A OD2   1 
ATOM   1035 N N     . THR A 1 129 ? 124.448 -20.684 5.302   1.00 47.05  ? 140 THR A N     1 
ATOM   1036 C CA    . THR A 1 129 ? 124.502 -19.410 4.618   1.00 45.17  ? 140 THR A CA    1 
ATOM   1037 C C     . THR A 1 129 ? 125.662 -19.416 3.665   1.00 43.85  ? 140 THR A C     1 
ATOM   1038 O O     . THR A 1 129 ? 126.692 -20.013 3.953   1.00 43.88  ? 140 THR A O     1 
ATOM   1039 C CB    . THR A 1 129 ? 124.665 -18.291 5.656   1.00 47.42  ? 140 THR A CB    1 
ATOM   1040 O OG1   . THR A 1 129 ? 123.478 -18.259 6.449   1.00 52.28  ? 140 THR A OG1   1 
ATOM   1041 C CG2   . THR A 1 129 ? 124.865 -16.919 5.029   1.00 48.38  ? 140 THR A CG2   1 
ATOM   1042 N N     . ILE A 1 130 ? 125.463 -18.782 2.509   1.00 46.18  ? 141 ILE A N     1 
ATOM   1043 C CA    . ILE A 1 130 ? 126.545 -18.423 1.582   1.00 42.15  ? 141 ILE A CA    1 
ATOM   1044 C C     . ILE A 1 130 ? 126.322 -16.974 1.172   1.00 43.68  ? 141 ILE A C     1 
ATOM   1045 O O     . ILE A 1 130 ? 125.220 -16.601 0.761   1.00 41.23  ? 141 ILE A O     1 
ATOM   1046 C CB    . ILE A 1 130 ? 126.585 -19.315 0.333   1.00 40.69  ? 141 ILE A CB    1 
ATOM   1047 C CG1   . ILE A 1 130 ? 126.419 -20.792 0.734   1.00 38.79  ? 141 ILE A CG1   1 
ATOM   1048 C CG2   . ILE A 1 130 ? 127.877 -19.057 -0.455  1.00 40.75  ? 141 ILE A CG2   1 
ATOM   1049 C CD1   . ILE A 1 130 ? 126.619 -21.799 -0.375  1.00 37.92  ? 141 ILE A CD1   1 
ATOM   1050 N N     . GLU A 1 131 ? 127.369 -16.164 1.319   1.00 47.32  ? 142 GLU A N     1 
ATOM   1051 C CA    . GLU A 1 131 ? 127.335 -14.765 0.914   1.00 49.47  ? 142 GLU A CA    1 
ATOM   1052 C C     . GLU A 1 131 ? 128.608 -14.446 0.094   1.00 48.34  ? 142 GLU A C     1 
ATOM   1053 O O     . GLU A 1 131 ? 129.726 -14.532 0.593   1.00 47.42  ? 142 GLU A O     1 
ATOM   1054 C CB    . GLU A 1 131 ? 127.075 -13.818 2.126   1.00 50.89  ? 142 GLU A CB    1 
ATOM   1055 C CG    . GLU A 1 131 ? 128.260 -13.468 3.034   1.00 54.70  ? 142 GLU A CG    1 
ATOM   1056 C CD    . GLU A 1 131 ? 127.865 -13.029 4.468   1.00 58.72  ? 142 GLU A CD    1 
ATOM   1057 O OE1   . GLU A 1 131 ? 127.039 -13.734 5.109   1.00 55.45  ? 142 GLU A OE1   1 
ATOM   1058 O OE2   . GLU A 1 131 ? 128.415 -12.005 4.974   1.00 54.08  ? 142 GLU A OE2   1 
ATOM   1059 N N     . ILE A 1 132 ? 128.403 -14.144 -1.189  1.00 46.86  ? 143 ILE A N     1 
ATOM   1060 C CA    . ILE A 1 132 ? 129.452 -13.653 -2.084  1.00 47.63  ? 143 ILE A CA    1 
ATOM   1061 C C     . ILE A 1 132 ? 129.555 -12.144 -1.897  1.00 43.29  ? 143 ILE A C     1 
ATOM   1062 O O     . ILE A 1 132 ? 128.590 -11.440 -2.126  1.00 45.23  ? 143 ILE A O     1 
ATOM   1063 C CB    . ILE A 1 132 ? 129.124 -14.000 -3.564  1.00 49.27  ? 143 ILE A CB    1 
ATOM   1064 C CG1   . ILE A 1 132 ? 129.234 -15.518 -3.794  1.00 50.20  ? 143 ILE A CG1   1 
ATOM   1065 C CG2   . ILE A 1 132 ? 130.021 -13.244 -4.542  1.00 50.00  ? 143 ILE A CG2   1 
ATOM   1066 C CD1   . ILE A 1 132 ? 130.644 -16.078 -3.722  1.00 50.43  ? 143 ILE A CD1   1 
ATOM   1067 N N     . ILE A 1 133 ? 130.725 -11.653 -1.501  1.00 43.73  ? 144 ILE A N     1 
ATOM   1068 C CA    . ILE A 1 133 ? 130.917 -10.221 -1.221  1.00 47.70  ? 144 ILE A CA    1 
ATOM   1069 C C     . ILE A 1 133 ? 131.068 -9.405  -2.488  1.00 50.76  ? 144 ILE A C     1 
ATOM   1070 O O     . ILE A 1 133 ? 131.962 -9.652  -3.322  1.00 56.34  ? 144 ILE A O     1 
ATOM   1071 C CB    . ILE A 1 133 ? 132.139 -9.951  -0.303  1.00 47.61  ? 144 ILE A CB    1 
ATOM   1072 C CG1   . ILE A 1 133 ? 131.946 -10.691 1.023   1.00 48.42  ? 144 ILE A CG1   1 
ATOM   1073 C CG2   . ILE A 1 133 ? 132.343 -8.448  -0.077  1.00 46.05  ? 144 ILE A CG2   1 
ATOM   1074 C CD1   . ILE A 1 133 ? 130.603 -10.425 1.696   1.00 48.41  ? 144 ILE A CD1   1 
ATOM   1075 N N     . THR A 1 134 ? 130.177 -8.434  -2.611  1.00 51.70  ? 145 THR A N     1 
ATOM   1076 C CA    . THR A 1 134 ? 130.237 -7.459  -3.661  1.00 57.08  ? 145 THR A CA    1 
ATOM   1077 C C     . THR A 1 134 ? 130.598 -6.151  -2.983  1.00 62.86  ? 145 THR A C     1 
ATOM   1078 O O     . THR A 1 134 ? 130.432 -5.995  -1.769  1.00 65.64  ? 145 THR A O     1 
ATOM   1079 C CB    . THR A 1 134 ? 128.884 -7.362  -4.378  1.00 57.11  ? 145 THR A CB    1 
ATOM   1080 O OG1   . THR A 1 134 ? 127.890 -6.907  -3.450  1.00 55.13  ? 145 THR A OG1   1 
ATOM   1081 C CG2   . THR A 1 134 ? 128.477 -8.734  -4.945  1.00 53.46  ? 145 THR A CG2   1 
ATOM   1082 N N     . ASP A 1 135 ? 131.103 -5.221  -3.779  1.00 71.40  ? 146 ASP A N     1 
ATOM   1083 C CA    . ASP A 1 135 ? 131.578 -3.928  -3.293  1.00 74.72  ? 146 ASP A CA    1 
ATOM   1084 C C     . ASP A 1 135 ? 130.400 -3.137  -2.738  1.00 84.81  ? 146 ASP A C     1 
ATOM   1085 O O     . ASP A 1 135 ? 129.304 -3.180  -3.312  1.00 92.80  ? 146 ASP A O     1 
ATOM   1086 C CB    . ASP A 1 135 ? 132.224 -3.173  -4.456  1.00 71.83  ? 146 ASP A CB    1 
ATOM   1087 C CG    . ASP A 1 135 ? 133.053 -2.009  -4.014  1.00 68.00  ? 146 ASP A CG    1 
ATOM   1088 O OD1   . ASP A 1 135 ? 134.040 -2.238  -3.294  1.00 70.46  ? 146 ASP A OD1   1 
ATOM   1089 O OD2   . ASP A 1 135 ? 132.743 -0.873  -4.414  1.00 66.72  ? 146 ASP A OD2   1 
ATOM   1090 N N     . ARG A 1 136 ? 130.609 -2.446  -1.618  1.00 94.26  ? 147 ARG A N     1 
ATOM   1091 C CA    . ARG A 1 136 ? 129.583 -1.553  -1.080  1.00 101.55 ? 147 ARG A CA    1 
ATOM   1092 C C     . ARG A 1 136 ? 129.362 -0.417  -2.093  1.00 104.13 ? 147 ARG A C     1 
ATOM   1093 O O     . ARG A 1 136 ? 130.271 0.377   -2.342  1.00 99.09  ? 147 ARG A O     1 
ATOM   1094 C CB    . ARG A 1 136 ? 129.979 -1.013  0.311   1.00 106.14 ? 147 ARG A CB    1 
ATOM   1095 C CG    . ARG A 1 136 ? 128.947 -0.105  0.993   1.00 110.62 ? 147 ARG A CG    1 
ATOM   1096 C CD    . ARG A 1 136 ? 127.650 -0.824  1.365   1.00 111.05 ? 147 ARG A CD    1 
ATOM   1097 N NE    . ARG A 1 136 ? 126.553 0.104   1.684   1.00 112.28 ? 147 ARG A NE    1 
ATOM   1098 C CZ    . ARG A 1 136 ? 125.682 0.631   0.813   1.00 112.27 ? 147 ARG A CZ    1 
ATOM   1099 N NH1   . ARG A 1 136 ? 124.735 1.458   1.256   1.00 117.48 ? 147 ARG A NH1   1 
ATOM   1100 N NH2   . ARG A 1 136 ? 125.730 0.355   -0.492  1.00 108.88 ? 147 ARG A NH2   1 
ATOM   1101 N N     . GLN A 1 137 ? 128.176 -0.406  -2.716  1.00 108.38 ? 148 GLN A N     1 
ATOM   1102 C CA    . GLN A 1 137 ? 127.699 0.680   -3.608  1.00 108.72 ? 148 GLN A CA    1 
ATOM   1103 C C     . GLN A 1 137 ? 128.162 0.606   -5.081  1.00 106.76 ? 148 GLN A C     1 
ATOM   1104 O O     . GLN A 1 137 ? 127.720 1.427   -5.886  1.00 104.10 ? 148 GLN A O     1 
ATOM   1105 C CB    . GLN A 1 137 ? 128.005 2.066   -3.005  1.00 112.88 ? 148 GLN A CB    1 
ATOM   1106 C CG    . GLN A 1 137 ? 127.005 3.170   -3.334  1.00 110.48 ? 148 GLN A CG    1 
ATOM   1107 C CD    . GLN A 1 137 ? 127.197 4.410   -2.469  1.00 107.81 ? 148 GLN A CD    1 
ATOM   1108 O OE1   . GLN A 1 137 ? 128.130 4.490   -1.659  1.00 100.23 ? 148 GLN A OE1   1 
ATOM   1109 N NE2   . GLN A 1 137 ? 126.305 5.381   -2.631  1.00 107.94 ? 148 GLN A NE2   1 
ATOM   1110 N N     . SER A 1 138 ? 129.041 -0.345  -5.429  1.00 105.73 ? 149 SER A N     1 
ATOM   1111 C CA    . SER A 1 138 ? 129.341 -0.679  -6.840  1.00 103.66 ? 149 SER A CA    1 
ATOM   1112 C C     . SER A 1 138 ? 128.620 -1.948  -7.316  1.00 101.44 ? 149 SER A C     1 
ATOM   1113 O O     . SER A 1 138 ? 128.135 -1.993  -8.456  1.00 100.50 ? 149 SER A O     1 
ATOM   1114 C CB    . SER A 1 138 ? 130.850 -0.860  -7.074  1.00 98.72  ? 149 SER A CB    1 
ATOM   1115 O OG    . SER A 1 138 ? 131.594 0.238   -6.598  1.00 96.80  ? 149 SER A OG    1 
ATOM   1116 N N     . GLY A 1 139 ? 128.574 -2.975  -6.458  1.00 95.95  ? 150 GLY A N     1 
ATOM   1117 C CA    . GLY A 1 139 ? 128.139 -4.323  -6.862  1.00 97.44  ? 150 GLY A CA    1 
ATOM   1118 C C     . GLY A 1 139 ? 129.222 -5.145  -7.563  1.00 94.94  ? 150 GLY A C     1 
ATOM   1119 O O     . GLY A 1 139 ? 128.979 -6.292  -7.945  1.00 90.31  ? 150 GLY A O     1 
ATOM   1120 N N     . LYS A 1 140 ? 130.406 -4.544  -7.736  1.00 92.05  ? 151 LYS A N     1 
ATOM   1121 C CA    . LYS A 1 140 ? 131.623 -5.195  -8.237  1.00 86.03  ? 151 LYS A CA    1 
ATOM   1122 C C     . LYS A 1 140 ? 132.036 -6.334  -7.281  1.00 78.37  ? 151 LYS A C     1 
ATOM   1123 O O     . LYS A 1 140 ? 132.141 -6.114  -6.068  1.00 72.06  ? 151 LYS A O     1 
ATOM   1124 C CB    . LYS A 1 140 ? 132.731 -4.116  -8.395  1.00 86.15  ? 151 LYS A CB    1 
ATOM   1125 C CG    . LYS A 1 140 ? 134.188 -4.537  -8.213  1.00 88.42  ? 151 LYS A CG    1 
ATOM   1126 C CD    . LYS A 1 140 ? 134.682 -5.526  -9.265  1.00 90.49  ? 151 LYS A CD    1 
ATOM   1127 C CE    . LYS A 1 140 ? 136.179 -5.801  -9.107  1.00 90.72  ? 151 LYS A CE    1 
ATOM   1128 N NZ    . LYS A 1 140 ? 137.052 -4.912  -9.928  1.00 89.24  ? 151 LYS A NZ    1 
ATOM   1129 N N     . LYS A 1 141 ? 132.255 -7.539  -7.819  1.00 68.84  ? 152 LYS A N     1 
ATOM   1130 C CA    . LYS A 1 141 ? 132.625 -8.698  -6.984  1.00 62.26  ? 152 LYS A CA    1 
ATOM   1131 C C     . LYS A 1 141 ? 134.053 -8.526  -6.471  1.00 56.75  ? 152 LYS A C     1 
ATOM   1132 O O     . LYS A 1 141 ? 134.923 -8.083  -7.202  1.00 52.33  ? 152 LYS A O     1 
ATOM   1133 C CB    . LYS A 1 141 ? 132.452 -10.028 -7.728  1.00 58.43  ? 152 LYS A CB    1 
ATOM   1134 C CG    . LYS A 1 141 ? 131.046 -10.234 -8.278  1.00 60.58  ? 152 LYS A CG    1 
ATOM   1135 C CD    . LYS A 1 141 ? 130.626 -11.703 -8.366  1.00 63.48  ? 152 LYS A CD    1 
ATOM   1136 C CE    . LYS A 1 141 ? 129.615 -11.958 -9.486  1.00 67.16  ? 152 LYS A CE    1 
ATOM   1137 N NZ    . LYS A 1 141 ? 128.504 -10.954 -9.546  1.00 69.29  ? 152 LYS A NZ    1 
ATOM   1138 N N     . ARG A 1 142 ? 134.272 -8.867  -5.205  1.00 58.09  ? 153 ARG A N     1 
ATOM   1139 C CA    . ARG A 1 142 ? 135.518 -8.532  -4.490  1.00 59.77  ? 153 ARG A CA    1 
ATOM   1140 C C     . ARG A 1 142 ? 136.582 -9.664  -4.395  1.00 54.36  ? 153 ARG A C     1 
ATOM   1141 O O     . ARG A 1 142 ? 137.684 -9.445  -3.869  1.00 43.67  ? 153 ARG A O     1 
ATOM   1142 C CB    . ARG A 1 142 ? 135.159 -7.989  -3.098  1.00 65.34  ? 153 ARG A CB    1 
ATOM   1143 C CG    . ARG A 1 142 ? 134.536 -6.592  -3.148  1.00 69.55  ? 153 ARG A CG    1 
ATOM   1144 C CD    . ARG A 1 142 ? 134.536 -5.890  -1.798  1.00 74.76  ? 153 ARG A CD    1 
ATOM   1145 N NE    . ARG A 1 142 ? 135.871 -5.812  -1.191  1.00 79.62  ? 153 ARG A NE    1 
ATOM   1146 C CZ    . ARG A 1 142 ? 136.121 -5.504  0.087   1.00 85.50  ? 153 ARG A CZ    1 
ATOM   1147 N NH1   . ARG A 1 142 ? 135.133 -5.231  0.945   1.00 94.00  ? 153 ARG A NH1   1 
ATOM   1148 N NH2   . ARG A 1 142 ? 137.378 -5.468  0.521   1.00 81.13  ? 153 ARG A NH2   1 
ATOM   1149 N N     . GLY A 1 143 ? 136.252 -10.849 -4.924  1.00 53.14  ? 154 GLY A N     1 
ATOM   1150 C CA    . GLY A 1 143 ? 137.168 -12.002 -4.939  1.00 50.17  ? 154 GLY A CA    1 
ATOM   1151 C C     . GLY A 1 143 ? 137.037 -12.967 -3.763  1.00 45.57  ? 154 GLY A C     1 
ATOM   1152 O O     . GLY A 1 143 ? 137.922 -13.803 -3.548  1.00 40.63  ? 154 GLY A O     1 
ATOM   1153 N N     . PHE A 1 144 ? 135.951 -12.848 -2.992  1.00 42.78  ? 155 PHE A N     1 
ATOM   1154 C CA    . PHE A 1 144 ? 135.819 -13.625 -1.766  1.00 39.85  ? 155 PHE A CA    1 
ATOM   1155 C C     . PHE A 1 144 ? 134.401 -13.626 -1.222  1.00 41.35  ? 155 PHE A C     1 
ATOM   1156 O O     . PHE A 1 144 ? 133.613 -12.743 -1.556  1.00 43.95  ? 155 PHE A O     1 
ATOM   1157 C CB    . PHE A 1 144 ? 136.816 -13.173 -0.673  1.00 37.42  ? 155 PHE A CB    1 
ATOM   1158 C CG    . PHE A 1 144 ? 136.509 -11.835 -0.063  1.00 33.69  ? 155 PHE A CG    1 
ATOM   1159 C CD1   . PHE A 1 144 ? 136.988 -10.676 -0.639  1.00 32.48  ? 155 PHE A CD1   1 
ATOM   1160 C CD2   . PHE A 1 144 ? 135.784 -11.749 1.117   1.00 32.14  ? 155 PHE A CD2   1 
ATOM   1161 C CE1   . PHE A 1 144 ? 136.728 -9.449  -0.080  1.00 32.85  ? 155 PHE A CE1   1 
ATOM   1162 C CE2   . PHE A 1 144 ? 135.517 -10.531 1.690   1.00 31.90  ? 155 PHE A CE2   1 
ATOM   1163 C CZ    . PHE A 1 144 ? 135.986 -9.374  1.091   1.00 33.47  ? 155 PHE A CZ    1 
ATOM   1164 N N     . GLY A 1 145 ? 134.120 -14.648 -0.401  1.00 39.85  ? 156 GLY A N     1 
ATOM   1165 C CA    . GLY A 1 145 ? 132.871 -14.810 0.317   1.00 38.46  ? 156 GLY A CA    1 
ATOM   1166 C C     . GLY A 1 145 ? 133.035 -15.669 1.570   1.00 38.19  ? 156 GLY A C     1 
ATOM   1167 O O     . GLY A 1 145 ? 134.136 -16.075 1.940   1.00 39.13  ? 156 GLY A O     1 
ATOM   1168 N N     . PHE A 1 146 ? 131.906 -15.931 2.219   1.00 38.96  ? 157 PHE A N     1 
ATOM   1169 C CA    . PHE A 1 146 ? 131.827 -16.591 3.515   1.00 36.97  ? 157 PHE A CA    1 
ATOM   1170 C C     . PHE A 1 146 ? 130.822 -17.708 3.420   1.00 36.60  ? 157 PHE A C     1 
ATOM   1171 O O     . PHE A 1 146 ? 129.708 -17.475 2.951   1.00 36.58  ? 157 PHE A O     1 
ATOM   1172 C CB    . PHE A 1 146 ? 131.384 -15.604 4.590   1.00 36.68  ? 157 PHE A CB    1 
ATOM   1173 C CG    . PHE A 1 146 ? 132.349 -14.472 4.784   1.00 39.70  ? 157 PHE A CG    1 
ATOM   1174 C CD1   . PHE A 1 146 ? 133.507 -14.651 5.545   1.00 40.36  ? 157 PHE A CD1   1 
ATOM   1175 C CD2   . PHE A 1 146 ? 132.129 -13.235 4.170   1.00 40.16  ? 157 PHE A CD2   1 
ATOM   1176 C CE1   . PHE A 1 146 ? 134.408 -13.614 5.706   1.00 40.68  ? 157 PHE A CE1   1 
ATOM   1177 C CE2   . PHE A 1 146 ? 133.025 -12.190 4.325   1.00 40.07  ? 157 PHE A CE2   1 
ATOM   1178 C CZ    . PHE A 1 146 ? 134.168 -12.380 5.092   1.00 41.85  ? 157 PHE A CZ    1 
ATOM   1179 N N     . VAL A 1 147 ? 131.232 -18.914 3.824   1.00 36.00  ? 158 VAL A N     1 
ATOM   1180 C CA    . VAL A 1 147 ? 130.322 -20.050 3.961   1.00 36.72  ? 158 VAL A CA    1 
ATOM   1181 C C     . VAL A 1 147 ? 130.139 -20.307 5.445   1.00 36.05  ? 158 VAL A C     1 
ATOM   1182 O O     . VAL A 1 147 ? 131.110 -20.355 6.190   1.00 35.70  ? 158 VAL A O     1 
ATOM   1183 C CB    . VAL A 1 147 ? 130.861 -21.316 3.292   1.00 36.92  ? 158 VAL A CB    1 
ATOM   1184 C CG1   . VAL A 1 147 ? 129.895 -22.479 3.480   1.00 37.19  ? 158 VAL A CG1   1 
ATOM   1185 C CG2   . VAL A 1 147 ? 131.094 -21.053 1.809   1.00 39.46  ? 158 VAL A CG2   1 
ATOM   1186 N N     . THR A 1 148 ? 128.888 -20.461 5.864   1.00 34.91  ? 159 THR A N     1 
ATOM   1187 C CA    . THR A 1 148 ? 128.572 -20.751 7.244   1.00 34.00  ? 159 THR A CA    1 
ATOM   1188 C C     . THR A 1 148 ? 127.851 -22.073 7.319   1.00 33.35  ? 159 THR A C     1 
ATOM   1189 O O     . THR A 1 148 ? 126.801 -22.254 6.704   1.00 32.97  ? 159 THR A O     1 
ATOM   1190 C CB    . THR A 1 148 ? 127.716 -19.648 7.852   1.00 33.18  ? 159 THR A CB    1 
ATOM   1191 O OG1   . THR A 1 148 ? 128.439 -18.408 7.780   1.00 33.71  ? 159 THR A OG1   1 
ATOM   1192 C CG2   . THR A 1 148 ? 127.374 -19.972 9.298   1.00 33.39  ? 159 THR A CG2   1 
ATOM   1193 N N     . PHE A 1 149 ? 128.425 -22.995 8.079   1.00 33.80  ? 160 PHE A N     1 
ATOM   1194 C CA    . PHE A 1 149 ? 127.824 -24.305 8.289   1.00 33.95  ? 160 PHE A CA    1 
ATOM   1195 C C     . PHE A 1 149 ? 127.052 -24.280 9.593   1.00 33.01  ? 160 PHE A C     1 
ATOM   1196 O O     . PHE A 1 149 ? 127.131 -23.325 10.355  1.00 31.25  ? 160 PHE A O     1 
ATOM   1197 C CB    . PHE A 1 149 ? 128.904 -25.400 8.335   1.00 34.38  ? 160 PHE A CB    1 
ATOM   1198 C CG    . PHE A 1 149 ? 129.743 -25.502 7.073   1.00 34.72  ? 160 PHE A CG    1 
ATOM   1199 C CD1   . PHE A 1 149 ? 130.806 -24.616 6.838   1.00 34.38  ? 160 PHE A CD1   1 
ATOM   1200 C CD2   . PHE A 1 149 ? 129.483 -26.481 6.128   1.00 33.77  ? 160 PHE A CD2   1 
ATOM   1201 C CE1   . PHE A 1 149 ? 131.584 -24.711 5.690   1.00 32.60  ? 160 PHE A CE1   1 
ATOM   1202 C CE2   . PHE A 1 149 ? 130.269 -26.583 4.984   1.00 34.83  ? 160 PHE A CE2   1 
ATOM   1203 C CZ    . PHE A 1 149 ? 131.323 -25.700 4.769   1.00 33.13  ? 160 PHE A CZ    1 
ATOM   1204 N N     . ASP A 1 150 ? 126.301 -25.344 9.830   1.00 35.36  ? 161 ASP A N     1 
ATOM   1205 C CA    . ASP A 1 150 ? 125.632 -25.549 11.110  1.00 38.62  ? 161 ASP A CA    1 
ATOM   1206 C C     . ASP A 1 150 ? 126.561 -26.077 12.201  1.00 38.57  ? 161 ASP A C     1 
ATOM   1207 O O     . ASP A 1 150 ? 126.161 -26.148 13.366  1.00 41.35  ? 161 ASP A O     1 
ATOM   1208 C CB    . ASP A 1 150 ? 124.387 -26.449 10.963  1.00 40.95  ? 161 ASP A CB    1 
ATOM   1209 C CG    . ASP A 1 150 ? 124.712 -27.942 10.745  1.00 43.42  ? 161 ASP A CG    1 
ATOM   1210 O OD1   . ASP A 1 150 ? 125.906 -28.337 10.630  1.00 47.32  ? 161 ASP A OD1   1 
ATOM   1211 O OD2   . ASP A 1 150 ? 123.726 -28.722 10.678  1.00 41.64  ? 161 ASP A OD2   1 
ATOM   1212 N N     . ASP A 1 151 ? 127.778 -26.466 11.831  1.00 37.66  ? 162 ASP A N     1 
ATOM   1213 C CA    . ASP A 1 151 ? 128.739 -26.957 12.806  1.00 36.30  ? 162 ASP A CA    1 
ATOM   1214 C C     . ASP A 1 151 ? 130.163 -26.493 12.505  1.00 32.49  ? 162 ASP A C     1 
ATOM   1215 O O     . ASP A 1 151 ? 130.537 -26.263 11.361  1.00 30.23  ? 162 ASP A O     1 
ATOM   1216 C CB    . ASP A 1 151 ? 128.659 -28.492 12.892  1.00 38.41  ? 162 ASP A CB    1 
ATOM   1217 C CG    . ASP A 1 151 ? 129.423 -29.057 14.096  1.00 40.32  ? 162 ASP A CG    1 
ATOM   1218 O OD1   . ASP A 1 151 ? 128.935 -28.856 15.240  1.00 42.06  ? 162 ASP A OD1   1 
ATOM   1219 O OD2   . ASP A 1 151 ? 130.506 -29.676 13.885  1.00 37.92  ? 162 ASP A OD2   1 
ATOM   1220 N N     . HIS A 1 152 ? 130.950 -26.351 13.567  1.00 32.41  ? 163 HIS A N     1 
ATOM   1221 C CA    . HIS A 1 152 ? 132.345 -25.929 13.438  1.00 31.20  ? 163 HIS A CA    1 
ATOM   1222 C C     . HIS A 1 152 ? 133.270 -26.923 12.715  1.00 30.31  ? 163 HIS A C     1 
ATOM   1223 O O     . HIS A 1 152 ? 134.258 -26.507 12.129  1.00 30.53  ? 163 HIS A O     1 
ATOM   1224 C CB    . HIS A 1 152 ? 132.931 -25.626 14.809  1.00 30.38  ? 163 HIS A CB    1 
ATOM   1225 C CG    . HIS A 1 152 ? 133.182 -26.843 15.652  1.00 30.45  ? 163 HIS A CG    1 
ATOM   1226 N ND1   . HIS A 1 152 ? 134.393 -27.501 15.666  1.00 30.00  ? 163 HIS A ND1   1 
ATOM   1227 C CD2   . HIS A 1 152 ? 132.379 -27.512 16.516  1.00 31.44  ? 163 HIS A CD2   1 
ATOM   1228 C CE1   . HIS A 1 152 ? 134.320 -28.537 16.483  1.00 31.08  ? 163 HIS A CE1   1 
ATOM   1229 N NE2   . HIS A 1 152 ? 133.108 -28.563 17.017  1.00 31.07  ? 163 HIS A NE2   1 
ATOM   1230 N N     . ASP A 1 153 ? 132.976 -28.219 12.788  1.00 29.19  ? 164 ASP A N     1 
ATOM   1231 C CA    . ASP A 1 153 ? 133.908 -29.252 12.288  1.00 29.32  ? 164 ASP A CA    1 
ATOM   1232 C C     . ASP A 1 153 ? 134.215 -29.267 10.773  1.00 29.09  ? 164 ASP A C     1 
ATOM   1233 O O     . ASP A 1 153 ? 135.392 -29.369 10.386  1.00 26.28  ? 164 ASP A O     1 
ATOM   1234 C CB    . ASP A 1 153 ? 133.463 -30.656 12.702  1.00 28.20  ? 164 ASP A CB    1 
ATOM   1235 C CG    . ASP A 1 153 ? 134.572 -31.655 12.533  1.00 29.09  ? 164 ASP A CG    1 
ATOM   1236 O OD1   . ASP A 1 153 ? 135.679 -31.367 13.044  1.00 28.94  ? 164 ASP A OD1   1 
ATOM   1237 O OD2   . ASP A 1 153 ? 134.376 -32.694 11.863  1.00 29.72  ? 164 ASP A OD2   1 
ATOM   1238 N N     . PRO A 1 154 ? 133.167 -29.199 9.920   1.00 30.55  ? 165 PRO A N     1 
ATOM   1239 C CA    . PRO A 1 154 ? 133.454 -29.005 8.486   1.00 31.47  ? 165 PRO A CA    1 
ATOM   1240 C C     . PRO A 1 154 ? 134.455 -27.885 8.246   1.00 30.47  ? 165 PRO A C     1 
ATOM   1241 O O     . PRO A 1 154 ? 135.338 -28.059 7.436   1.00 34.11  ? 165 PRO A O     1 
ATOM   1242 C CB    . PRO A 1 154 ? 132.088 -28.646 7.877   1.00 33.10  ? 165 PRO A CB    1 
ATOM   1243 C CG    . PRO A 1 154 ? 131.112 -28.569 9.037   1.00 32.18  ? 165 PRO A CG    1 
ATOM   1244 C CD    . PRO A 1 154 ? 131.715 -29.294 10.187  1.00 30.83  ? 165 PRO A CD    1 
ATOM   1245 N N     . VAL A 1 155 ? 134.354 -26.771 8.979   1.00 27.46  ? 166 VAL A N     1 
ATOM   1246 C CA    . VAL A 1 155 ? 135.324 -25.670 8.836   1.00 26.35  ? 166 VAL A CA    1 
ATOM   1247 C C     . VAL A 1 155 ? 136.727 -26.122 9.173   1.00 26.86  ? 166 VAL A C     1 
ATOM   1248 O O     . VAL A 1 155 ? 137.665 -25.924 8.401   1.00 27.44  ? 166 VAL A O     1 
ATOM   1249 C CB    . VAL A 1 155 ? 134.988 -24.442 9.711   1.00 24.84  ? 166 VAL A CB    1 
ATOM   1250 C CG1   . VAL A 1 155 ? 136.141 -23.430 9.719   1.00 24.46  ? 166 VAL A CG1   1 
ATOM   1251 C CG2   . VAL A 1 155 ? 133.696 -23.790 9.226   1.00 24.52  ? 166 VAL A CG2   1 
ATOM   1252 N N     . ASP A 1 156 ? 136.854 -26.738 10.339  1.00 28.04  ? 167 ASP A N     1 
ATOM   1253 C CA    . ASP A 1 156 ? 138.146 -27.190 10.814  1.00 27.41  ? 167 ASP A CA    1 
ATOM   1254 C C     . ASP A 1 156 ? 138.727 -28.198 9.834   1.00 27.76  ? 167 ASP A C     1 
ATOM   1255 O O     . ASP A 1 156 ? 139.902 -28.113 9.489   1.00 26.89  ? 167 ASP A O     1 
ATOM   1256 C CB    . ASP A 1 156 ? 138.037 -27.812 12.204  1.00 27.46  ? 167 ASP A CB    1 
ATOM   1257 C CG    . ASP A 1 156 ? 137.479 -26.857 13.237  1.00 28.23  ? 167 ASP A CG    1 
ATOM   1258 O OD1   . ASP A 1 156 ? 137.588 -25.605 13.049  1.00 30.60  ? 167 ASP A OD1   1 
ATOM   1259 O OD2   . ASP A 1 156 ? 136.947 -27.382 14.239  1.00 25.81  ? 167 ASP A OD2   1 
ATOM   1260 N N     . LYS A 1 157 ? 137.908 -29.145 9.388   1.00 28.64  ? 168 LYS A N     1 
ATOM   1261 C CA    . LYS A 1 157 ? 138.384 -30.143 8.443   1.00 31.08  ? 168 LYS A CA    1 
ATOM   1262 C C     . LYS A 1 157 ? 138.812 -29.484 7.117   1.00 31.24  ? 168 LYS A C     1 
ATOM   1263 O O     . LYS A 1 157 ? 139.808 -29.881 6.517   1.00 28.55  ? 168 LYS A O     1 
ATOM   1264 C CB    . LYS A 1 157 ? 137.316 -31.218 8.188   1.00 32.68  ? 168 LYS A CB    1 
ATOM   1265 C CG    . LYS A 1 157 ? 137.649 -32.161 7.034   1.00 34.08  ? 168 LYS A CG    1 
ATOM   1266 C CD    . LYS A 1 157 ? 136.708 -33.355 6.990   1.00 36.69  ? 168 LYS A CD    1 
ATOM   1267 C CE    . LYS A 1 157 ? 136.623 -33.891 5.566   1.00 39.09  ? 168 LYS A CE    1 
ATOM   1268 N NZ    . LYS A 1 157 ? 135.788 -35.113 5.453   1.00 40.99  ? 168 LYS A NZ    1 
ATOM   1269 N N     . ILE A 1 158 ? 138.047 -28.486 6.681   1.00 31.14  ? 169 ILE A N     1 
ATOM   1270 C CA    . ILE A 1 158 ? 138.298 -27.825 5.421   1.00 32.70  ? 169 ILE A CA    1 
ATOM   1271 C C     . ILE A 1 158 ? 139.637 -27.135 5.505   1.00 33.56  ? 169 ILE A C     1 
ATOM   1272 O O     . ILE A 1 158 ? 140.457 -27.327 4.626   1.00 33.12  ? 169 ILE A O     1 
ATOM   1273 C CB    . ILE A 1 158 ? 137.175 -26.809 5.076   1.00 35.41  ? 169 ILE A CB    1 
ATOM   1274 C CG1   . ILE A 1 158 ? 135.947 -27.537 4.491   1.00 35.40  ? 169 ILE A CG1   1 
ATOM   1275 C CG2   . ILE A 1 158 ? 137.662 -25.754 4.084   1.00 35.17  ? 169 ILE A CG2   1 
ATOM   1276 C CD1   . ILE A 1 158 ? 134.655 -26.744 4.600   1.00 35.87  ? 169 ILE A CD1   1 
ATOM   1277 N N     . VAL A 1 159 ? 139.858 -26.369 6.578   1.00 34.19  ? 170 VAL A N     1 
ATOM   1278 C CA    . VAL A 1 159 ? 141.077 -25.552 6.734   1.00 35.04  ? 170 VAL A CA    1 
ATOM   1279 C C     . VAL A 1 159 ? 142.351 -26.420 6.938   1.00 34.46  ? 170 VAL A C     1 
ATOM   1280 O O     . VAL A 1 159 ? 143.454 -26.064 6.517   1.00 33.36  ? 170 VAL A O     1 
ATOM   1281 C CB    . VAL A 1 159 ? 140.897 -24.482 7.850   1.00 35.83  ? 170 VAL A CB    1 
ATOM   1282 C CG1   . VAL A 1 159 ? 142.096 -23.547 7.922   1.00 35.95  ? 170 VAL A CG1   1 
ATOM   1283 C CG2   . VAL A 1 159 ? 139.675 -23.610 7.590   1.00 37.02  ? 170 VAL A CG2   1 
ATOM   1284 N N     . LEU A 1 160 ? 142.171 -27.579 7.545   1.00 36.54  ? 171 LEU A N     1 
ATOM   1285 C CA    . LEU A 1 160 ? 143.235 -28.582 7.710   1.00 39.18  ? 171 LEU A CA    1 
ATOM   1286 C C     . LEU A 1 160 ? 143.786 -29.149 6.405   1.00 37.55  ? 171 LEU A C     1 
ATOM   1287 O O     . LEU A 1 160 ? 144.947 -29.478 6.316   1.00 38.16  ? 171 LEU A O     1 
ATOM   1288 C CB    . LEU A 1 160 ? 142.690 -29.743 8.533   1.00 43.49  ? 171 LEU A CB    1 
ATOM   1289 C CG    . LEU A 1 160 ? 143.660 -30.415 9.479   1.00 47.05  ? 171 LEU A CG    1 
ATOM   1290 C CD1   . LEU A 1 160 ? 143.976 -29.529 10.691  1.00 51.33  ? 171 LEU A CD1   1 
ATOM   1291 C CD2   . LEU A 1 160 ? 143.011 -31.728 9.904   1.00 48.42  ? 171 LEU A CD2   1 
ATOM   1292 N N     . GLN A 1 161 ? 142.910 -29.314 5.423   1.00 39.31  ? 172 GLN A N     1 
ATOM   1293 C CA    . GLN A 1 161 ? 143.268 -29.586 4.036   1.00 38.01  ? 172 GLN A CA    1 
ATOM   1294 C C     . GLN A 1 161 ? 143.366 -28.182 3.518   1.00 41.88  ? 172 GLN A C     1 
ATOM   1295 O O     . GLN A 1 161 ? 142.347 -27.543 3.319   1.00 47.32  ? 172 GLN A O     1 
ATOM   1296 C CB    . GLN A 1 161 ? 142.102 -30.282 3.328   1.00 37.40  ? 172 GLN A CB    1 
ATOM   1297 C CG    . GLN A 1 161 ? 141.476 -31.474 4.052   1.00 36.69  ? 172 GLN A CG    1 
ATOM   1298 C CD    . GLN A 1 161 ? 140.156 -31.927 3.445   1.00 38.29  ? 172 GLN A CD    1 
ATOM   1299 O OE1   . GLN A 1 161 ? 139.453 -31.164 2.783   1.00 35.82  ? 172 GLN A OE1   1 
ATOM   1300 N NE2   . GLN A 1 161 ? 139.810 -33.195 3.675   1.00 42.83  ? 172 GLN A NE2   1 
ATOM   1301 N N     . LYS A 1 162 ? 144.539 -27.605 3.389   1.00 41.73  ? 173 LYS A N     1 
ATOM   1302 C CA    . LYS A 1 162 ? 144.528 -26.171 3.121   1.00 38.08  ? 173 LYS A CA    1 
ATOM   1303 C C     . LYS A 1 162 ? 144.335 -25.862 1.629   1.00 36.80  ? 173 LYS A C     1 
ATOM   1304 O O     . LYS A 1 162 ? 143.927 -24.736 1.279   1.00 33.23  ? 173 LYS A O     1 
ATOM   1305 C CB    . LYS A 1 162 ? 145.747 -25.499 3.738   1.00 39.95  ? 173 LYS A CB    1 
ATOM   1306 C CG    . LYS A 1 162 ? 147.052 -25.549 2.966   1.00 41.07  ? 173 LYS A CG    1 
ATOM   1307 C CD    . LYS A 1 162 ? 148.088 -24.744 3.738   1.00 42.21  ? 173 LYS A CD    1 
ATOM   1308 C CE    . LYS A 1 162 ? 149.427 -24.629 3.037   1.00 43.88  ? 173 LYS A CE    1 
ATOM   1309 N NZ    . LYS A 1 162 ? 150.218 -23.521 3.655   1.00 46.47  ? 173 LYS A NZ    1 
ATOM   1310 N N     . TYR A 1 163 ? 144.582 -26.882 0.781   1.00 38.38  ? 174 TYR A N     1 
ATOM   1311 C CA    . TYR A 1 163 ? 144.544 -26.769 -0.709  1.00 38.21  ? 174 TYR A CA    1 
ATOM   1312 C C     . TYR A 1 163 ? 143.164 -27.175 -1.242  1.00 38.03  ? 174 TYR A C     1 
ATOM   1313 O O     . TYR A 1 163 ? 142.762 -28.336 -1.128  1.00 38.43  ? 174 TYR A O     1 
ATOM   1314 C CB    . TYR A 1 163 ? 145.635 -27.635 -1.394  1.00 36.00  ? 174 TYR A CB    1 
ATOM   1315 C CG    . TYR A 1 163 ? 146.985 -27.544 -0.740  1.00 35.94  ? 174 TYR A CG    1 
ATOM   1316 C CD1   . TYR A 1 163 ? 147.849 -26.476 -0.999  1.00 37.18  ? 174 TYR A CD1   1 
ATOM   1317 C CD2   . TYR A 1 163 ? 147.381 -28.498 0.184   1.00 35.83  ? 174 TYR A CD2   1 
ATOM   1318 C CE1   . TYR A 1 163 ? 149.094 -26.384 -0.360  1.00 38.01  ? 174 TYR A CE1   1 
ATOM   1319 C CE2   . TYR A 1 163 ? 148.613 -28.417 0.820   1.00 37.11  ? 174 TYR A CE2   1 
ATOM   1320 C CZ    . TYR A 1 163 ? 149.463 -27.369 0.551   1.00 37.63  ? 174 TYR A CZ    1 
ATOM   1321 O OH    . TYR A 1 163 ? 150.651 -27.333 1.227   1.00 39.42  ? 174 TYR A OH    1 
ATOM   1322 N N     . HIS A 1 164 ? 142.450 -26.199 -1.795  1.00 37.55  ? 175 HIS A N     1 
ATOM   1323 C CA    . HIS A 1 164 ? 141.128 -26.392 -2.372  1.00 39.76  ? 175 HIS A CA    1 
ATOM   1324 C C     . HIS A 1 164 ? 141.076 -25.622 -3.689  1.00 40.95  ? 175 HIS A C     1 
ATOM   1325 O O     . HIS A 1 164 ? 141.497 -24.465 -3.756  1.00 40.84  ? 175 HIS A O     1 
ATOM   1326 C CB    . HIS A 1 164 ? 140.054 -25.841 -1.442  1.00 39.64  ? 175 HIS A CB    1 
ATOM   1327 C CG    . HIS A 1 164 ? 140.027 -26.489 -0.096  1.00 40.62  ? 175 HIS A CG    1 
ATOM   1328 N ND1   . HIS A 1 164 ? 139.168 -27.521 0.222   1.00 41.40  ? 175 HIS A ND1   1 
ATOM   1329 C CD2   . HIS A 1 164 ? 140.739 -26.238 1.025   1.00 39.28  ? 175 HIS A CD2   1 
ATOM   1330 C CE1   . HIS A 1 164 ? 139.364 -27.887 1.475   1.00 38.57  ? 175 HIS A CE1   1 
ATOM   1331 N NE2   . HIS A 1 164 ? 140.302 -27.115 1.988   1.00 37.56  ? 175 HIS A NE2   1 
ATOM   1332 N N     . THR A 1 165 ? 140.568 -26.252 -4.733  1.00 40.19  ? 176 THR A N     1 
ATOM   1333 C CA    . THR A 1 165 ? 140.501 -25.596 -6.024  1.00 41.20  ? 176 THR A CA    1 
ATOM   1334 C C     . THR A 1 165 ? 139.042 -25.378 -6.332  1.00 41.33  ? 176 THR A C     1 
ATOM   1335 O O     . THR A 1 165 ? 138.265 -26.334 -6.329  1.00 48.28  ? 176 THR A O     1 
ATOM   1336 C CB    . THR A 1 165 ? 141.173 -26.452 -7.110  1.00 40.96  ? 176 THR A CB    1 
ATOM   1337 O OG1   . THR A 1 165 ? 142.543 -26.700 -6.731  1.00 40.17  ? 176 THR A OG1   1 
ATOM   1338 C CG2   . THR A 1 165 ? 141.112 -25.756 -8.460  1.00 39.02  ? 176 THR A CG2   1 
ATOM   1339 N N     . ILE A 1 166 ? 138.655 -24.130 -6.569  1.00 39.64  ? 177 ILE A N     1 
ATOM   1340 C CA    . ILE A 1 166 ? 137.250 -23.811 -6.758  1.00 39.09  ? 177 ILE A CA    1 
ATOM   1341 C C     . ILE A 1 166 ? 137.033 -22.930 -7.980  1.00 39.87  ? 177 ILE A C     1 
ATOM   1342 O O     . ILE A 1 166 ? 137.574 -21.804 -8.060  1.00 35.93  ? 177 ILE A O     1 
ATOM   1343 C CB    . ILE A 1 166 ? 136.648 -23.103 -5.525  1.00 38.59  ? 177 ILE A CB    1 
ATOM   1344 C CG1   . ILE A 1 166 ? 136.906 -23.924 -4.244  1.00 37.44  ? 177 ILE A CG1   1 
ATOM   1345 C CG2   . ILE A 1 166 ? 135.155 -22.807 -5.764  1.00 38.06  ? 177 ILE A CG2   1 
ATOM   1346 C CD1   . ILE A 1 166 ? 136.444 -23.262 -2.957  1.00 36.48  ? 177 ILE A CD1   1 
ATOM   1347 N N     . ASN A 1 167 ? 136.200 -23.436 -8.902  1.00 41.14  ? 178 ASN A N     1 
ATOM   1348 C CA    . ASN A 1 167 ? 135.844 -22.730 -10.140 1.00 40.28  ? 178 ASN A CA    1 
ATOM   1349 C C     . ASN A 1 167 ? 137.126 -22.392 -10.904 1.00 37.03  ? 178 ASN A C     1 
ATOM   1350 O O     . ASN A 1 167 ? 137.267 -21.321 -11.477 1.00 34.33  ? 178 ASN A O     1 
ATOM   1351 C CB    . ASN A 1 167 ? 135.034 -21.464 -9.795  1.00 42.09  ? 178 ASN A CB    1 
ATOM   1352 C CG    . ASN A 1 167 ? 134.374 -20.828 -10.998 1.00 40.79  ? 178 ASN A CG    1 
ATOM   1353 O OD1   . ASN A 1 167 ? 134.194 -21.465 -12.028 1.00 39.72  ? 178 ASN A OD1   1 
ATOM   1354 N ND2   . ASN A 1 167 ? 134.012 -19.553 -10.866 1.00 40.17  ? 178 ASN A ND2   1 
ATOM   1355 N N     . GLY A 1 168 ? 138.073 -23.327 -10.852 1.00 38.02  ? 179 GLY A N     1 
ATOM   1356 C CA    . GLY A 1 168 ? 139.391 -23.149 -11.412 1.00 38.49  ? 179 GLY A CA    1 
ATOM   1357 C C     . GLY A 1 168 ? 140.400 -22.391 -10.575 1.00 39.63  ? 179 GLY A C     1 
ATOM   1358 O O     . GLY A 1 168 ? 141.560 -22.380 -10.931 1.00 40.53  ? 179 GLY A O     1 
ATOM   1359 N N     . HIS A 1 169 ? 139.986 -21.752 -9.482  1.00 44.42  ? 180 HIS A N     1 
ATOM   1360 C CA    . HIS A 1 169 ? 140.868 -20.873 -8.703  1.00 46.53  ? 180 HIS A CA    1 
ATOM   1361 C C     . HIS A 1 169 ? 141.467 -21.560 -7.464  1.00 46.56  ? 180 HIS A C     1 
ATOM   1362 O O     . HIS A 1 169 ? 140.814 -22.414 -6.847  1.00 45.88  ? 180 HIS A O     1 
ATOM   1363 C CB    . HIS A 1 169 ? 140.109 -19.620 -8.245  1.00 47.78  ? 180 HIS A CB    1 
ATOM   1364 C CG    . HIS A 1 169 ? 139.445 -18.856 -9.353  1.00 49.73  ? 180 HIS A CG    1 
ATOM   1365 N ND1   . HIS A 1 169 ? 140.122 -18.391 -10.461 1.00 49.93  ? 180 HIS A ND1   1 
ATOM   1366 C CD2   . HIS A 1 169 ? 138.162 -18.448 -9.500  1.00 51.39  ? 180 HIS A CD2   1 
ATOM   1367 C CE1   . HIS A 1 169 ? 139.281 -17.750 -11.253 1.00 48.87  ? 180 HIS A CE1   1 
ATOM   1368 N NE2   . HIS A 1 169 ? 138.084 -17.774 -10.694 1.00 48.95  ? 180 HIS A NE2   1 
ATOM   1369 N N     . ASN A 1 170 ? 142.694 -21.161 -7.100  1.00 44.81  ? 181 ASN A N     1 
ATOM   1370 C CA    . ASN A 1 170 ? 143.270 -21.517 -5.793  1.00 44.60  ? 181 ASN A CA    1 
ATOM   1371 C C     . ASN A 1 170 ? 142.684 -20.680 -4.689  1.00 41.94  ? 181 ASN A C     1 
ATOM   1372 O O     . ASN A 1 170 ? 143.034 -19.513 -4.531  1.00 39.38  ? 181 ASN A O     1 
ATOM   1373 C CB    . ASN A 1 170 ? 144.778 -21.361 -5.777  1.00 45.63  ? 181 ASN A CB    1 
ATOM   1374 C CG    . ASN A 1 170 ? 145.452 -22.321 -6.718  1.00 50.42  ? 181 ASN A CG    1 
ATOM   1375 O OD1   . ASN A 1 170 ? 146.232 -21.919 -7.586  1.00 50.52  ? 181 ASN A OD1   1 
ATOM   1376 N ND2   . ASN A 1 170 ? 145.133 -23.611 -6.573  1.00 53.79  ? 181 ASN A ND2   1 
ATOM   1377 N N     . ALA A 1 171 ? 141.818 -21.283 -3.919  1.00 42.94  ? 182 ALA A N     1 
ATOM   1378 C CA    . ALA A 1 171 ? 141.175 -20.611 -2.849  1.00 41.57  ? 182 ALA A CA    1 
ATOM   1379 C C     . ALA A 1 171 ? 141.916 -20.616 -1.529  1.00 43.03  ? 182 ALA A C     1 
ATOM   1380 O O     . ALA A 1 171 ? 142.423 -21.611 -1.099  1.00 43.37  ? 182 ALA A O     1 
ATOM   1381 C CB    . ALA A 1 171 ? 139.816 -21.215 -2.673  1.00 39.62  ? 182 ALA A CB    1 
ATOM   1382 N N     . GLU A 1 172 ? 141.894 -19.479 -0.895  1.00 43.62  ? 183 GLU A N     1 
ATOM   1383 C CA    . GLU A 1 172 ? 142.408 -19.239 0.397   1.00 52.08  ? 183 GLU A CA    1 
ATOM   1384 C C     . GLU A 1 172 ? 141.250 -19.591 1.311   1.00 48.40  ? 183 GLU A C     1 
ATOM   1385 O O     . GLU A 1 172 ? 140.257 -18.943 1.252   1.00 45.22  ? 183 GLU A O     1 
ATOM   1386 C CB    . GLU A 1 172 ? 142.545 -17.738 0.480   1.00 61.31  ? 183 GLU A CB    1 
ATOM   1387 C CG    . GLU A 1 172 ? 143.830 -17.098 0.914   1.00 68.00  ? 183 GLU A CG    1 
ATOM   1388 C CD    . GLU A 1 172 ? 143.668 -15.590 0.929   1.00 73.83  ? 183 GLU A CD    1 
ATOM   1389 O OE1   . GLU A 1 172 ? 143.046 -15.064 -0.012  1.00 79.45  ? 183 GLU A OE1   1 
ATOM   1390 O OE2   . GLU A 1 172 ? 144.156 -14.936 1.878   1.00 72.30  ? 183 GLU A OE2   1 
ATOM   1391 N N     . VAL A 1 173 ? 141.335 -20.602 2.151   1.00 46.60  ? 184 VAL A N     1 
ATOM   1392 C CA    . VAL A 1 173 ? 140.227 -20.866 3.026   1.00 45.04  ? 184 VAL A CA    1 
ATOM   1393 C C     . VAL A 1 173 ? 140.708 -20.809 4.448   1.00 42.66  ? 184 VAL A C     1 
ATOM   1394 O O     . VAL A 1 173 ? 141.541 -21.562 4.842   1.00 42.55  ? 184 VAL A O     1 
ATOM   1395 C CB    . VAL A 1 173 ? 139.584 -22.239 2.773   1.00 45.24  ? 184 VAL A CB    1 
ATOM   1396 C CG1   . VAL A 1 173 ? 138.835 -22.282 1.477   1.00 45.53  ? 184 VAL A CG1   1 
ATOM   1397 C CG2   . VAL A 1 173 ? 140.601 -23.336 2.851   1.00 44.92  ? 184 VAL A CG2   1 
ATOM   1398 N N     . ARG A 1 174 ? 140.164 -19.895 5.209   1.00 41.88  ? 185 ARG A N     1 
ATOM   1399 C CA    . ARG A 1 174 ? 140.503 -19.787 6.625   1.00 44.08  ? 185 ARG A CA    1 
ATOM   1400 C C     . ARG A 1 174 ? 139.222 -19.708 7.460   1.00 39.64  ? 185 ARG A C     1 
ATOM   1401 O O     . ARG A 1 174 ? 138.127 -19.750 6.912   1.00 36.55  ? 185 ARG A O     1 
ATOM   1402 C CB    . ARG A 1 174 ? 141.419 -18.578 6.850   1.00 50.15  ? 185 ARG A CB    1 
ATOM   1403 C CG    . ARG A 1 174 ? 142.525 -18.437 5.796   1.00 55.36  ? 185 ARG A CG    1 
ATOM   1404 C CD    . ARG A 1 174 ? 143.857 -17.923 6.330   1.00 61.98  ? 185 ARG A CD    1 
ATOM   1405 N NE    . ARG A 1 174 ? 144.594 -17.287 5.235   1.00 68.26  ? 185 ARG A NE    1 
ATOM   1406 C CZ    . ARG A 1 174 ? 144.701 -15.970 5.018   1.00 71.57  ? 185 ARG A CZ    1 
ATOM   1407 N NH1   . ARG A 1 174 ? 144.171 -15.067 5.845   1.00 70.70  ? 185 ARG A NH1   1 
ATOM   1408 N NH2   . ARG A 1 174 ? 145.373 -15.540 3.954   1.00 73.79  ? 185 ARG A NH2   1 
ATOM   1409 N N     . LYS A 1 175 ? 139.348 -19.637 8.779   1.00 37.56  ? 186 LYS A N     1 
ATOM   1410 C CA    . LYS A 1 175 ? 138.184 -19.364 9.628   1.00 37.08  ? 186 LYS A CA    1 
ATOM   1411 C C     . LYS A 1 175 ? 137.874 -17.869 9.492   1.00 35.13  ? 186 LYS A C     1 
ATOM   1412 O O     . LYS A 1 175 ? 138.798 -17.058 9.280   1.00 32.26  ? 186 LYS A O     1 
ATOM   1413 C CB    . LYS A 1 175 ? 138.441 -19.723 11.097  1.00 39.35  ? 186 LYS A CB    1 
ATOM   1414 C CG    . LYS A 1 175 ? 138.880 -21.164 11.349  1.00 42.20  ? 186 LYS A CG    1 
ATOM   1415 C CD    . LYS A 1 175 ? 139.071 -21.461 12.839  1.00 41.27  ? 186 LYS A CD    1 
ATOM   1416 C CE    . LYS A 1 175 ? 140.390 -20.949 13.395  1.00 42.89  ? 186 LYS A CE    1 
ATOM   1417 N NZ    . LYS A 1 175 ? 140.429 -21.255 14.857  1.00 43.76  ? 186 LYS A NZ    1 
ATOM   1418 N N     . ALA A 1 176 ? 136.581 -17.520 9.576   1.00 33.15  ? 187 ALA A N     1 
ATOM   1419 C CA    . ALA A 1 176 ? 136.135 -16.128 9.534   1.00 32.71  ? 187 ALA A CA    1 
ATOM   1420 C C     . ALA A 1 176 ? 135.991 -15.625 10.967  1.00 36.38  ? 187 ALA A C     1 
ATOM   1421 O O     . ALA A 1 176 ? 134.925 -15.720 11.586  1.00 37.49  ? 187 ALA A O     1 
ATOM   1422 C CB    . ALA A 1 176 ? 134.826 -15.997 8.782   1.00 33.16  ? 187 ALA A CB    1 
ATOM   1423 N N     . LEU A 1 177 ? 137.054 -15.068 11.489  1.00 38.43  ? 188 LEU A N     1 
ATOM   1424 C CA    . LEU A 1 177 ? 137.050 -14.591 12.824  1.00 39.73  ? 188 LEU A CA    1 
ATOM   1425 C C     . LEU A 1 177 ? 136.937 -13.118 12.880  1.00 40.44  ? 188 LEU A C     1 
ATOM   1426 O O     . LEU A 1 177 ? 137.472 -12.439 12.053  1.00 37.08  ? 188 LEU A O     1 
ATOM   1427 C CB    . LEU A 1 177 ? 138.338 -14.984 13.532  1.00 38.38  ? 188 LEU A CB    1 
ATOM   1428 C CG    . LEU A 1 177 ? 138.813 -16.422 13.565  1.00 38.56  ? 188 LEU A CG    1 
ATOM   1429 C CD1   . LEU A 1 177 ? 140.227 -16.496 14.059  1.00 38.73  ? 188 LEU A CD1   1 
ATOM   1430 C CD2   . LEU A 1 177 ? 137.924 -17.348 14.341  1.00 37.14  ? 188 LEU A CD2   1 
ATOM   1431 N N     . SER A 1 178 ? 136.240 -12.644 13.895  1.00 41.03  ? 189 SER A N     1 
ATOM   1432 C CA    . SER A 1 178 ? 136.093 -11.251 14.149  1.00 42.84  ? 189 SER A CA    1 
ATOM   1433 C C     . SER A 1 178 ? 137.341 -10.996 14.911  1.00 43.75  ? 189 SER A C     1 
ATOM   1434 O O     . SER A 1 178 ? 138.229 -11.776 14.854  1.00 40.11  ? 189 SER A O     1 
ATOM   1435 C CB    . SER A 1 178 ? 134.882 -10.999 15.027  1.00 42.99  ? 189 SER A CB    1 
ATOM   1436 O OG    . SER A 1 178 ? 135.114 -11.324 16.369  1.00 41.11  ? 189 SER A OG    1 
ATOM   1437 N N     . ARG A 1 179 ? 137.394 -9.918  15.652  1.00 52.03  ? 190 ARG A N     1 
ATOM   1438 C CA    . ARG A 1 179 ? 138.553 -9.647  16.469  1.00 60.12  ? 190 ARG A CA    1 
ATOM   1439 C C     . ARG A 1 179 ? 138.476 -10.445 17.769  1.00 59.68  ? 190 ARG A C     1 
ATOM   1440 O O     . ARG A 1 179 ? 138.888 -10.003 18.798  1.00 57.11  ? 190 ARG A O     1 
ATOM   1441 C CB    . ARG A 1 179 ? 138.756 -8.167  16.631  1.00 65.63  ? 190 ARG A CB    1 
ATOM   1442 C CG    . ARG A 1 179 ? 138.894 -7.529  15.263  1.00 70.38  ? 190 ARG A CG    1 
ATOM   1443 C CD    . ARG A 1 179 ? 138.987 -6.023  15.279  1.00 76.04  ? 190 ARG A CD    1 
ATOM   1444 N NE    . ARG A 1 179 ? 139.684 -5.538  16.453  1.00 81.15  ? 190 ARG A NE    1 
ATOM   1445 C CZ    . ARG A 1 179 ? 139.604 -4.301  16.902  1.00 77.03  ? 190 ARG A CZ    1 
ATOM   1446 N NH1   . ARG A 1 179 ? 140.262 -3.960  17.992  1.00 73.68  ? 190 ARG A NH1   1 
ATOM   1447 N NH2   . ARG A 1 179 ? 138.859 -3.431  16.257  1.00 75.38  ? 190 ARG A NH2   1 
ATOM   1448 N N     . GLN A 1 180 ? 137.937 -11.664 17.643  1.00 62.16  ? 191 GLN A N     1 
ATOM   1449 C CA    . GLN A 1 180 ? 137.823 -12.645 18.704  1.00 55.50  ? 191 GLN A CA    1 
ATOM   1450 C C     . GLN A 1 180 ? 139.175 -13.281 18.679  1.00 56.14  ? 191 GLN A C     1 
ATOM   1451 O O     . GLN A 1 180 ? 139.583 -13.984 19.562  1.00 60.15  ? 191 GLN A O     1 
ATOM   1452 C CB    . GLN A 1 180 ? 136.666 -13.621 18.506  1.00 52.21  ? 191 GLN A CB    1 
ATOM   1453 C CG    . GLN A 1 180 ? 136.674 -14.532 17.300  1.00 49.30  ? 191 GLN A CG    1 
ATOM   1454 C CD    . GLN A 1 180 ? 135.272 -14.923 16.842  1.00 47.70  ? 191 GLN A CD    1 
ATOM   1455 O OE1   . GLN A 1 180 ? 134.900 -14.646 15.731  1.00 44.55  ? 191 GLN A OE1   1 
ATOM   1456 N NE2   . GLN A 1 180 ? 134.515 -15.587 17.686  1.00 42.45  ? 191 GLN A NE2   1 
ATOM   1457 N N     . GLU A 1 181 ? 139.893 -13.007 17.626  1.00 53.31  ? 192 GLU A N     1 
ATOM   1458 C CA    . GLU A 1 181 ? 141.298 -13.384 17.592  1.00 54.93  ? 192 GLU A CA    1 
ATOM   1459 C C     . GLU A 1 181 ? 142.209 -12.509 18.467  1.00 59.80  ? 192 GLU A C     1 
ATOM   1460 O O     . GLU A 1 181 ? 143.437 -12.578 18.357  1.00 56.48  ? 192 GLU A O     1 
ATOM   1461 C CB    . GLU A 1 181 ? 141.802 -13.446 16.149  1.00 55.03  ? 192 GLU A CB    1 
ATOM   1462 C CG    . GLU A 1 181 ? 141.797 -12.172 15.332  1.00 50.68  ? 192 GLU A CG    1 
ATOM   1463 C CD    . GLU A 1 181 ? 142.026 -12.483 13.867  1.00 52.29  ? 192 GLU A CD    1 
ATOM   1464 O OE1   . GLU A 1 181 ? 142.861 -13.363 13.550  1.00 53.91  ? 192 GLU A OE1   1 
ATOM   1465 O OE2   . GLU A 1 181 ? 141.367 -11.859 13.020  1.00 55.58  ? 192 GLU A OE2   1 
ATOM   1466 N N     . MET A 1 182 ? 141.618 -11.714 19.356  1.00 71.98  ? 193 MET A N     1 
ATOM   1467 C CA    . MET A 1 182 ? 142.383 -10.927 20.301  1.00 80.08  ? 193 MET A CA    1 
ATOM   1468 C C     . MET A 1 182 ? 142.432 -11.732 21.585  1.00 80.98  ? 193 MET A C     1 
ATOM   1469 O O     . MET A 1 182 ? 141.438 -11.848 22.294  1.00 86.55  ? 193 MET A O     1 
ATOM   1470 C CB    . MET A 1 182 ? 141.748 -9.534  20.499  1.00 85.16  ? 193 MET A CB    1 
ATOM   1471 C CG    . MET A 1 182 ? 142.750 -8.386  20.570  1.00 90.47  ? 193 MET A CG    1 
ATOM   1472 S SD    . MET A 1 182 ? 143.792 -8.175  19.093  1.00 103.61 ? 193 MET A SD    1 
ATOM   1473 C CE    . MET A 1 182 ? 142.628 -7.700  17.811  1.00 100.50 ? 193 MET A CE    1 
ATOM   1474 N N     . GLN A 1 183 ? 143.581 -12.352 21.826  1.00 81.99  ? 194 GLN A N     1 
ATOM   1475 C CA    . GLN A 1 183 ? 143.928 -12.891 23.144  1.00 89.58  ? 194 GLN A CA    1 
ATOM   1476 C C     . GLN A 1 183 ? 145.452 -12.893 23.308  1.00 88.16  ? 194 GLN A C     1 
ATOM   1477 O O     . GLN A 1 183 ? 146.181 -13.211 22.363  1.00 96.55  ? 194 GLN A O     1 
ATOM   1478 C CB    . GLN A 1 183 ? 143.333 -14.298 23.363  1.00 94.72  ? 194 GLN A CB    1 
ATOM   1479 C CG    . GLN A 1 183 ? 143.879 -15.443 22.489  1.00 95.35  ? 194 GLN A CG    1 
ATOM   1480 C CD    . GLN A 1 183 ? 143.406 -15.448 21.026  1.00 89.40  ? 194 GLN A CD    1 
ATOM   1481 O OE1   . GLN A 1 183 ? 142.455 -14.749 20.639  1.00 85.14  ? 194 GLN A OE1   1 
ATOM   1482 N NE2   . GLN A 1 183 ? 144.063 -16.281 20.216  1.00 78.21  ? 194 GLN A NE2   1 
ATOM   1483 N N     . GLU A 1 184 ? 145.932 -12.522 24.490  1.00 83.21  ? 195 GLU A N     1 
ATOM   1484 C CA    . GLU A 1 184 ? 147.363 -12.559 24.792  1.00 79.86  ? 195 GLU A CA    1 
ATOM   1485 C C     . GLU A 1 184 ? 147.623 -13.588 25.893  1.00 74.20  ? 195 GLU A C     1 
ATOM   1486 O O     . GLU A 1 184 ? 148.391 -14.533 25.710  1.00 67.70  ? 195 GLU A O     1 
ATOM   1487 C CB    . GLU A 1 184 ? 147.874 -11.162 25.190  1.00 81.62  ? 195 GLU A CB    1 
ATOM   1488 C CG    . GLU A 1 184 ? 149.356 -11.162 25.537  1.00 83.60  ? 195 GLU A CG    1 
ATOM   1489 C CD    . GLU A 1 184 ? 149.988 -9.787  25.647  1.00 85.96  ? 195 GLU A CD    1 
ATOM   1490 O OE1   . GLU A 1 184 ? 150.037 -9.055  24.627  1.00 88.16  ? 195 GLU A OE1   1 
ATOM   1491 O OE2   . GLU A 1 184 ? 150.473 -9.458  26.757  1.00 85.71  ? 195 GLU A OE2   1 
ATOM   1492 O "O5'" . A   B 2 1   ? 144.168 -25.455 26.265  1.00 38.93  ? 1   A   B "O5'" 1 
ATOM   1493 C "C5'" . A   B 2 1   ? 145.205 -26.321 26.784  1.00 36.85  ? 1   A   B "C5'" 1 
ATOM   1494 C "C4'" . A   B 2 1   ? 146.275 -26.542 25.738  1.00 35.04  ? 1   A   B "C4'" 1 
ATOM   1495 O "O4'" . A   B 2 1   ? 145.860 -27.392 24.649  1.00 32.47  ? 1   A   B "O4'" 1 
ATOM   1496 C "C3'" . A   B 2 1   ? 147.109 -25.406 25.137  1.00 35.15  ? 1   A   B "C3'" 1 
ATOM   1497 O "O3'" . A   B 2 1   ? 148.504 -25.654 24.982  1.00 32.44  ? 1   A   B "O3'" 1 
ATOM   1498 C "C2'" . A   B 2 1   ? 146.525 -25.261 23.725  1.00 34.25  ? 1   A   B "C2'" 1 
ATOM   1499 O "O2'" . A   B 2 1   ? 147.461 -24.969 22.713  1.00 33.19  ? 1   A   B "O2'" 1 
ATOM   1500 C "C1'" . A   B 2 1   ? 145.880 -26.634 23.460  1.00 32.86  ? 1   A   B "C1'" 1 
ATOM   1501 N N9    . A   B 2 1   ? 144.508 -26.502 22.984  1.00 35.02  ? 1   A   B N9    1 
ATOM   1502 C C8    . A   B 2 1   ? 143.423 -25.827 23.501  1.00 35.14  ? 1   A   B C8    1 
ATOM   1503 N N7    . A   B 2 1   ? 142.350 -25.896 22.748  1.00 33.50  ? 1   A   B N7    1 
ATOM   1504 C C5    . A   B 2 1   ? 142.759 -26.655 21.660  1.00 35.96  ? 1   A   B C5    1 
ATOM   1505 C C6    . A   B 2 1   ? 142.087 -27.096 20.509  1.00 37.71  ? 1   A   B C6    1 
ATOM   1506 N N6    . A   B 2 1   ? 140.808 -26.824 20.246  1.00 39.88  ? 1   A   B N6    1 
ATOM   1507 N N1    . A   B 2 1   ? 142.782 -27.846 19.629  1.00 40.99  ? 1   A   B N1    1 
ATOM   1508 C C2    . A   B 2 1   ? 144.070 -28.123 19.896  1.00 39.99  ? 1   A   B C2    1 
ATOM   1509 N N3    . A   B 2 1   ? 144.810 -27.766 20.937  1.00 34.48  ? 1   A   B N3    1 
ATOM   1510 C C4    . A   B 2 1   ? 144.086 -27.032 21.795  1.00 34.89  ? 1   A   B C4    1 
ATOM   1511 P P     . G   B 2 2   ? 149.475 -25.842 26.244  1.00 32.96  ? 2   G   B P     1 
ATOM   1512 O OP1   . G   B 2 2   ? 148.662 -25.980 27.482  1.00 33.18  ? 2   G   B OP1   1 
ATOM   1513 O OP2   . G   B 2 2   ? 150.488 -24.775 26.204  1.00 32.74  ? 2   G   B OP2   1 
ATOM   1514 O "O5'" . G   B 2 2   ? 150.122 -27.252 25.898  1.00 32.22  ? 2   G   B "O5'" 1 
ATOM   1515 C "C5'" . G   B 2 2   ? 149.261 -28.389 25.698  1.00 30.60  ? 2   G   B "C5'" 1 
ATOM   1516 C "C4'" . G   B 2 2   ? 150.011 -29.662 25.973  1.00 31.05  ? 2   G   B "C4'" 1 
ATOM   1517 O "O4'" . G   B 2 2   ? 149.517 -30.707 25.082  1.00 31.87  ? 2   G   B "O4'" 1 
ATOM   1518 C "C3'" . G   B 2 2   ? 151.518 -29.614 25.741  1.00 30.45  ? 2   G   B "C3'" 1 
ATOM   1519 O "O3'" . G   B 2 2   ? 152.166 -30.552 26.588  1.00 29.63  ? 2   G   B "O3'" 1 
ATOM   1520 C "C2'" . G   B 2 2   ? 151.628 -30.097 24.308  1.00 29.60  ? 2   G   B "C2'" 1 
ATOM   1521 O "O2'" . G   B 2 2   ? 152.930 -30.514 23.997  1.00 28.29  ? 2   G   B "O2'" 1 
ATOM   1522 C "C1'" . G   B 2 2   ? 150.599 -31.227 24.331  1.00 30.59  ? 2   G   B "C1'" 1 
ATOM   1523 N N9    . G   B 2 2   ? 150.099 -31.644 23.030  1.00 30.64  ? 2   G   B N9    1 
ATOM   1524 C C8    . G   B 2 2   ? 149.978 -32.934 22.576  1.00 31.97  ? 2   G   B C8    1 
ATOM   1525 N N7    . G   B 2 2   ? 149.486 -33.007 21.370  1.00 31.40  ? 2   G   B N7    1 
ATOM   1526 C C5    . G   B 2 2   ? 149.257 -31.687 21.010  1.00 29.40  ? 2   G   B C5    1 
ATOM   1527 C C6    . G   B 2 2   ? 148.749 -31.137 19.804  1.00 29.79  ? 2   G   B C6    1 
ATOM   1528 O O6    . G   B 2 2   ? 148.369 -31.729 18.787  1.00 28.79  ? 2   G   B O6    1 
ATOM   1529 N N1    . G   B 2 2   ? 148.682 -29.749 19.864  1.00 30.21  ? 2   G   B N1    1 
ATOM   1530 C C2    . G   B 2 2   ? 149.052 -28.986 20.947  1.00 30.06  ? 2   G   B C2    1 
ATOM   1531 N N2    . G   B 2 2   ? 148.913 -27.659 20.815  1.00 30.35  ? 2   G   B N2    1 
ATOM   1532 N N3    . G   B 2 2   ? 149.544 -29.486 22.067  1.00 29.58  ? 2   G   B N3    1 
ATOM   1533 C C4    . G   B 2 2   ? 149.621 -30.833 22.028  1.00 29.25  ? 2   G   B C4    1 
ATOM   1534 P P     . G   B 2 3   ? 153.394 -30.096 27.470  1.00 29.89  ? 3   G   B P     1 
ATOM   1535 O OP1   . G   B 2 3   ? 152.850 -29.269 28.580  1.00 32.12  ? 3   G   B OP1   1 
ATOM   1536 O OP2   . G   B 2 3   ? 154.420 -29.540 26.575  1.00 31.89  ? 3   G   B OP2   1 
ATOM   1537 O "O5'" . G   B 2 3   ? 153.965 -31.479 28.010  1.00 32.69  ? 3   G   B "O5'" 1 
ATOM   1538 C "C5'" . G   B 2 3   ? 153.490 -31.997 29.273  1.00 35.00  ? 3   G   B "C5'" 1 
ATOM   1539 C "C4'" . G   B 2 3   ? 153.681 -33.490 29.354  1.00 34.70  ? 3   G   B "C4'" 1 
ATOM   1540 O "O4'" . G   B 2 3   ? 152.922 -34.155 28.318  1.00 36.58  ? 3   G   B "O4'" 1 
ATOM   1541 C "C3'" . G   B 2 3   ? 155.126 -33.941 29.186  1.00 36.31  ? 3   G   B "C3'" 1 
ATOM   1542 O "O3'" . G   B 2 3   ? 155.437 -34.913 30.175  1.00 39.33  ? 3   G   B "O3'" 1 
ATOM   1543 C "C2'" . G   B 2 3   ? 155.179 -34.434 27.749  1.00 34.96  ? 3   G   B "C2'" 1 
ATOM   1544 O "O2'" . G   B 2 3   ? 156.225 -35.368 27.592  1.00 34.20  ? 3   G   B "O2'" 1 
ATOM   1545 C "C1'" . G   B 2 3   ? 153.770 -35.002 27.570  1.00 35.84  ? 3   G   B "C1'" 1 
ATOM   1546 N N9    . G   B 2 3   ? 153.288 -34.997 26.192  1.00 37.12  ? 3   G   B N9    1 
ATOM   1547 C C8    . G   B 2 3   ? 153.288 -33.921 25.335  1.00 38.26  ? 3   G   B C8    1 
ATOM   1548 N N7    . G   B 2 3   ? 152.747 -34.187 24.177  1.00 37.98  ? 3   G   B N7    1 
ATOM   1549 C C5    . G   B 2 3   ? 152.374 -35.521 24.269  1.00 39.53  ? 3   G   B C5    1 
ATOM   1550 C C6    . G   B 2 3   ? 151.743 -36.371 23.313  1.00 40.08  ? 3   G   B C6    1 
ATOM   1551 O O6    . G   B 2 3   ? 151.401 -36.109 22.149  1.00 36.79  ? 3   G   B O6    1 
ATOM   1552 N N1    . G   B 2 3   ? 151.513 -37.642 23.836  1.00 39.61  ? 3   G   B N1    1 
ATOM   1553 C C2    . G   B 2 3   ? 151.874 -38.056 25.099  1.00 35.92  ? 3   G   B C2    1 
ATOM   1554 N N2    . G   B 2 3   ? 151.578 -39.326 25.410  1.00 32.99  ? 3   G   B N2    1 
ATOM   1555 N N3    . G   B 2 3   ? 152.467 -37.276 25.995  1.00 35.45  ? 3   G   B N3    1 
ATOM   1556 C C4    . G   B 2 3   ? 152.684 -36.031 25.516  1.00 37.52  ? 3   G   B C4    1 
ATOM   1557 P P     . A   B 2 4   ? 155.931 -34.428 31.621  1.00 40.36  ? 4   A   B P     1 
ATOM   1558 O OP1   . A   B 2 4   ? 155.968 -35.631 32.484  1.00 39.73  ? 4   A   B OP1   1 
ATOM   1559 O OP2   . A   B 2 4   ? 155.102 -33.256 32.013  1.00 41.99  ? 4   A   B OP2   1 
ATOM   1560 O "O5'" . A   B 2 4   ? 157.380 -33.810 31.342  1.00 40.05  ? 4   A   B "O5'" 1 
ATOM   1561 C "C5'" . A   B 2 4   ? 158.316 -34.506 30.485  1.00 44.10  ? 4   A   B "C5'" 1 
ATOM   1562 C "C4'" . A   B 2 4   ? 159.431 -33.618 29.982  1.00 44.66  ? 4   A   B "C4'" 1 
ATOM   1563 O "O4'" . A   B 2 4   ? 160.573 -34.466 29.661  1.00 44.64  ? 4   A   B "O4'" 1 
ATOM   1564 C "C3'" . A   B 2 4   ? 159.159 -32.836 28.696  1.00 47.89  ? 4   A   B "C3'" 1 
ATOM   1565 O "O3'" . A   B 2 4   ? 159.972 -31.661 28.665  1.00 55.44  ? 4   A   B "O3'" 1 
ATOM   1566 C "C2'" . A   B 2 4   ? 159.614 -33.817 27.624  1.00 45.14  ? 4   A   B "C2'" 1 
ATOM   1567 O "O2'" . A   B 2 4   ? 159.910 -33.260 26.358  1.00 44.83  ? 4   A   B "O2'" 1 
ATOM   1568 C "C1'" . A   B 2 4   ? 160.872 -34.371 28.282  1.00 42.76  ? 4   A   B "C1'" 1 
ATOM   1569 N N9    . A   B 2 4   ? 161.304 -35.682 27.813  1.00 41.02  ? 4   A   B N9    1 
ATOM   1570 C C8    . A   B 2 4   ? 162.558 -36.030 27.374  1.00 41.69  ? 4   A   B C8    1 
ATOM   1571 N N7    . A   B 2 4   ? 162.663 -37.288 27.019  1.00 41.62  ? 4   A   B N7    1 
ATOM   1572 C C5    . A   B 2 4   ? 161.396 -37.805 27.244  1.00 44.06  ? 4   A   B C5    1 
ATOM   1573 C C6    . A   B 2 4   ? 160.852 -39.092 27.068  1.00 48.05  ? 4   A   B C6    1 
ATOM   1574 N N6    . A   B 2 4   ? 161.549 -40.131 26.601  1.00 49.99  ? 4   A   B N6    1 
ATOM   1575 N N1    . A   B 2 4   ? 159.547 -39.273 27.378  1.00 46.54  ? 4   A   B N1    1 
ATOM   1576 C C2    . A   B 2 4   ? 158.848 -38.226 27.840  1.00 45.40  ? 4   A   B C2    1 
ATOM   1577 N N3    . A   B 2 4   ? 159.249 -36.970 28.048  1.00 43.27  ? 4   A   B N3    1 
ATOM   1578 C C4    . A   B 2 4   ? 160.548 -36.826 27.733  1.00 42.52  ? 4   A   B C4    1 
ATOM   1579 P P     . C   B 2 5   ? 159.332 -30.214 28.939  1.00 66.00  ? 5   C   B P     1 
ATOM   1580 O OP1   . C   B 2 5   ? 158.148 -30.363 29.833  1.00 67.43  ? 5   C   B OP1   1 
ATOM   1581 O OP2   . C   B 2 5   ? 159.186 -29.536 27.629  1.00 64.53  ? 5   C   B OP2   1 
ATOM   1582 O "O5'" . C   B 2 5   ? 160.438 -29.445 29.793  1.00 77.50  ? 5   C   B "O5'" 1 
ATOM   1583 C "C5'" . C   B 2 5   ? 161.646 -30.058 30.289  1.00 83.51  ? 5   C   B "C5'" 1 
ATOM   1584 C "C4'" . C   B 2 5   ? 161.787 -29.797 31.773  1.00 90.04  ? 5   C   B "C4'" 1 
ATOM   1585 O "O4'" . C   B 2 5   ? 161.454 -28.408 32.091  1.00 96.55  ? 5   C   B "O4'" 1 
ATOM   1586 C "C3'" . C   B 2 5   ? 160.882 -30.654 32.654  1.00 90.75  ? 5   C   B "C3'" 1 
ATOM   1587 O "O3'" . C   B 2 5   ? 161.548 -31.034 33.851  1.00 80.63  ? 5   C   B "O3'" 1 
ATOM   1588 C "C2'" . C   B 2 5   ? 159.728 -29.709 32.965  1.00 98.74  ? 5   C   B "C2'" 1 
ATOM   1589 O "O2'" . C   B 2 5   ? 158.936 -30.087 34.078  1.00 89.09  ? 5   C   B "O2'" 1 
ATOM   1590 C "C1'" . C   B 2 5   ? 160.483 -28.389 33.125  1.00 105.08 ? 5   C   B "C1'" 1 
ATOM   1591 N N1    . C   B 2 5   ? 159.624 -27.196 32.979  1.00 113.32 ? 5   C   B N1    1 
ATOM   1592 C C2    . C   B 2 5   ? 158.860 -26.777 34.081  1.00 118.59 ? 5   C   B C2    1 
ATOM   1593 O O2    . C   B 2 5   ? 158.950 -27.403 35.149  1.00 120.36 ? 5   C   B O2    1 
ATOM   1594 N N3    . C   B 2 5   ? 158.053 -25.698 33.954  1.00 113.60 ? 5   C   B N3    1 
ATOM   1595 C C4    . C   B 2 5   ? 157.984 -25.050 32.788  1.00 110.20 ? 5   C   B C4    1 
ATOM   1596 N N4    . C   B 2 5   ? 157.180 -23.988 32.711  1.00 109.78 ? 5   C   B N4    1 
ATOM   1597 C C5    . C   B 2 5   ? 158.740 -25.460 31.650  1.00 108.33 ? 5   C   B C5    1 
ATOM   1598 C C6    . C   B 2 5   ? 159.535 -26.530 31.786  1.00 109.17 ? 5   C   B C6    1 
ATOM   1599 P P     . U   B 2 6   ? 161.609 -32.566 34.297  1.00 72.01  ? 6   U   B P     1 
ATOM   1600 O OP1   . U   B 2 6   ? 160.393 -33.258 33.775  1.00 72.51  ? 6   U   B OP1   1 
ATOM   1601 O OP2   . U   B 2 6   ? 161.903 -32.606 35.756  1.00 79.07  ? 6   U   B OP2   1 
ATOM   1602 O "O5'" . U   B 2 6   ? 162.891 -33.113 33.526  1.00 67.32  ? 6   U   B "O5'" 1 
ATOM   1603 C "C5'" . U   B 2 6   ? 164.171 -32.459 33.587  1.00 61.34  ? 6   U   B "C5'" 1 
ATOM   1604 C "C4'" . U   B 2 6   ? 165.074 -32.993 32.497  1.00 63.46  ? 6   U   B "C4'" 1 
ATOM   1605 O "O4'" . U   B 2 6   ? 164.828 -34.416 32.315  1.00 59.43  ? 6   U   B "O4'" 1 
ATOM   1606 C "C3'" . U   B 2 6   ? 164.921 -32.363 31.112  1.00 64.22  ? 6   U   B "C3'" 1 
ATOM   1607 O "O3'" . U   B 2 6   ? 166.204 -32.222 30.505  1.00 74.51  ? 6   U   B "O3'" 1 
ATOM   1608 C "C2'" . U   B 2 6   ? 164.022 -33.357 30.379  1.00 56.82  ? 6   U   B "C2'" 1 
ATOM   1609 O "O2'" . U   B 2 6   ? 164.120 -33.322 28.966  1.00 51.46  ? 6   U   B "O2'" 1 
ATOM   1610 C "C1'" . U   B 2 6   ? 164.525 -34.678 30.958  1.00 54.30  ? 6   U   B "C1'" 1 
ATOM   1611 N N1    . U   B 2 6   ? 163.560 -35.789 30.908  1.00 50.61  ? 6   U   B N1    1 
ATOM   1612 C C2    . U   B 2 6   ? 163.910 -36.921 30.194  1.00 50.60  ? 6   U   B C2    1 
ATOM   1613 O O2    . U   B 2 6   ? 164.965 -37.025 29.590  1.00 54.52  ? 6   U   B O2    1 
ATOM   1614 N N3    . U   B 2 6   ? 162.971 -37.921 30.204  1.00 48.89  ? 6   U   B N3    1 
ATOM   1615 C C4    . U   B 2 6   ? 161.756 -37.919 30.854  1.00 49.51  ? 6   U   B C4    1 
ATOM   1616 O O4    . U   B 2 6   ? 161.026 -38.906 30.775  1.00 52.25  ? 6   U   B O4    1 
ATOM   1617 C C5    . U   B 2 6   ? 161.472 -36.720 31.581  1.00 48.99  ? 6   U   B C5    1 
ATOM   1618 C C6    . U   B 2 6   ? 162.364 -35.724 31.590  1.00 49.70  ? 6   U   B C6    1 
ATOM   1619 P P     . G   B 2 7   ? 166.905 -30.779 30.442  1.00 90.80  ? 7   G   B P     1 
ATOM   1620 O OP1   . G   B 2 7   ? 168.257 -30.958 29.858  1.00 96.76  ? 7   G   B OP1   1 
ATOM   1621 O OP2   . G   B 2 7   ? 166.765 -30.132 31.774  1.00 97.59  ? 7   G   B OP2   1 
ATOM   1622 O "O5'" . G   B 2 7   ? 165.989 -29.991 29.405  1.00 97.79  ? 7   G   B "O5'" 1 
ATOM   1623 C "C5'" . G   B 2 7   ? 165.809 -30.472 28.055  1.00 111.17 ? 7   G   B "C5'" 1 
ATOM   1624 C "C4'" . G   B 2 7   ? 165.819 -29.314 27.088  1.00 120.06 ? 7   G   B "C4'" 1 
ATOM   1625 O "O4'" . G   B 2 7   ? 164.837 -28.335 27.524  1.00 123.46 ? 7   G   B "O4'" 1 
ATOM   1626 C "C3'" . G   B 2 7   ? 167.144 -28.562 26.975  1.00 124.85 ? 7   G   B "C3'" 1 
ATOM   1627 O "O3'" . G   B 2 7   ? 167.366 -28.069 25.657  1.00 123.16 ? 7   G   B "O3'" 1 
ATOM   1628 C "C2'" . G   B 2 7   ? 166.975 -27.431 27.985  1.00 124.24 ? 7   G   B "C2'" 1 
ATOM   1629 O "O2'" . G   B 2 7   ? 167.806 -26.310 27.749  1.00 114.64 ? 7   G   B "O2'" 1 
ATOM   1630 C "C1'" . G   B 2 7   ? 165.488 -27.116 27.830  1.00 125.63 ? 7   G   B "C1'" 1 
ATOM   1631 N N9    . G   B 2 7   ? 164.870 -26.542 29.022  1.00 128.43 ? 7   G   B N9    1 
ATOM   1632 C C8    . G   B 2 7   ? 164.184 -27.194 30.019  1.00 125.92 ? 7   G   B C8    1 
ATOM   1633 N N7    . G   B 2 7   ? 163.743 -26.389 30.948  1.00 124.70 ? 7   G   B N7    1 
ATOM   1634 C C5    . G   B 2 7   ? 164.162 -25.131 30.539  1.00 131.75 ? 7   G   B C5    1 
ATOM   1635 C C6    . G   B 2 7   ? 163.980 -23.857 31.143  1.00 130.51 ? 7   G   B C6    1 
ATOM   1636 O O6    . G   B 2 7   ? 163.390 -23.580 32.195  1.00 119.73 ? 7   G   B O6    1 
ATOM   1637 N N1    . G   B 2 7   ? 164.568 -22.843 30.388  1.00 130.49 ? 7   G   B N1    1 
ATOM   1638 C C2    . G   B 2 7   ? 165.247 -23.030 29.205  1.00 124.24 ? 7   G   B C2    1 
ATOM   1639 N N2    . G   B 2 7   ? 165.749 -21.929 28.623  1.00 110.56 ? 7   G   B N2    1 
ATOM   1640 N N3    . G   B 2 7   ? 165.422 -24.211 28.634  1.00 131.90 ? 7   G   B N3    1 
ATOM   1641 C C4    . G   B 2 7   ? 164.859 -25.209 29.351  1.00 133.30 ? 7   G   B C4    1 
HETATM 1642 O O     . HOH C 3 .   ? 136.047 -23.452 13.590  1.00 23.99  ? 201 HOH A O     1 
HETATM 1643 O O     . HOH C 3 .   ? 151.046 -35.039 16.957  1.00 45.24  ? 202 HOH A O     1 
HETATM 1644 O O     . HOH C 3 .   ? 132.640 -30.567 18.797  1.00 34.73  ? 203 HOH A O     1 
HETATM 1645 O O     . HOH C 3 .   ? 147.429 -38.261 21.577  1.00 29.01  ? 204 HOH A O     1 
HETATM 1646 O O     . HOH C 3 .   ? 127.987 -17.271 5.094   1.00 37.67  ? 205 HOH A O     1 
HETATM 1647 O O     . HOH C 3 .   ? 144.265 -23.370 -2.155  1.00 21.76  ? 206 HOH A O     1 
HETATM 1648 O O     . HOH C 3 .   ? 142.013 -35.575 38.452  1.00 19.85  ? 207 HOH A O     1 
HETATM 1649 O O     . HOH C 3 .   ? 133.012 -15.418 13.632  1.00 15.28  ? 208 HOH A O     1 
HETATM 1650 O O     . HOH C 3 .   ? 141.888 -20.583 10.022  1.00 31.41  ? 209 HOH A O     1 
HETATM 1651 O O     . HOH C 3 .   ? 130.803 -10.599 6.427   1.00 31.97  ? 210 HOH A O     1 
HETATM 1652 O O     . HOH D 3 .   ? 150.008 -26.097 22.594  1.00 42.29  ? 101 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   12  12  ARG ARG A . n 
A 1 2   LYS 2   13  13  LYS LYS A . n 
A 1 3   LYS 3   14  14  LYS LYS A . n 
A 1 4   ARG 4   15  15  ARG ARG A . n 
A 1 5   GLU 5   16  16  GLU GLU A . n 
A 1 6   LYS 6   17  17  LYS LYS A . n 
A 1 7   GLU 7   18  18  GLU GLU A . n 
A 1 8   GLN 8   19  19  GLN GLN A . n 
A 1 9   PHE 9   20  20  PHE PHE A . n 
A 1 10  ARG 10  21  21  ARG ARG A . n 
A 1 11  LYS 11  22  22  LYS LYS A . n 
A 1 12  LEU 12  23  23  LEU LEU A . n 
A 1 13  PHE 13  24  24  PHE PHE A . n 
A 1 14  ILE 14  25  25  ILE ILE A . n 
A 1 15  GLY 15  26  26  GLY GLY A . n 
A 1 16  GLY 16  27  27  GLY GLY A . n 
A 1 17  LEU 17  28  28  LEU LEU A . n 
A 1 18  SER 18  29  29  SER SER A . n 
A 1 19  PHE 19  30  30  PHE PHE A . n 
A 1 20  GLU 20  31  31  GLU GLU A . n 
A 1 21  THR 21  32  32  THR THR A . n 
A 1 22  THR 22  33  33  THR THR A . n 
A 1 23  GLU 23  34  34  GLU GLU A . n 
A 1 24  GLU 24  35  35  GLU GLU A . n 
A 1 25  SER 25  36  36  SER SER A . n 
A 1 26  LEU 26  37  37  LEU LEU A . n 
A 1 27  ARG 27  38  38  ARG ARG A . n 
A 1 28  ASN 28  39  39  ASN ASN A . n 
A 1 29  TYR 29  40  40  TYR TYR A . n 
A 1 30  TYR 30  41  41  TYR TYR A . n 
A 1 31  GLU 31  42  42  GLU GLU A . n 
A 1 32  GLN 32  43  43  GLN GLN A . n 
A 1 33  TRP 33  44  44  TRP TRP A . n 
A 1 34  GLY 34  45  45  GLY GLY A . n 
A 1 35  LYS 35  46  46  LYS LYS A . n 
A 1 36  LEU 36  47  47  LEU LEU A . n 
A 1 37  THR 37  48  48  THR THR A . n 
A 1 38  ASP 38  49  49  ASP ASP A . n 
A 1 39  CYS 39  50  50  CYS CYS A . n 
A 1 40  VAL 40  51  51  VAL VAL A . n 
A 1 41  VAL 41  52  52  VAL VAL A . n 
A 1 42  MET 42  53  53  MET MET A . n 
A 1 43  ARG 43  54  54  ARG ARG A . n 
A 1 44  ASP 44  55  55  ASP ASP A . n 
A 1 45  PRO 45  56  56  PRO PRO A . n 
A 1 46  ALA 46  57  57  ALA ALA A . n 
A 1 47  SER 47  58  58  SER SER A . n 
A 1 48  LYS 48  59  59  LYS LYS A . n 
A 1 49  ARG 49  60  60  ARG ARG A . n 
A 1 50  SER 50  61  61  SER SER A . n 
A 1 51  ARG 51  62  62  ARG ARG A . n 
A 1 52  GLY 52  63  63  GLY GLY A . n 
A 1 53  PHE 53  64  64  PHE PHE A . n 
A 1 54  GLY 54  65  65  GLY GLY A . n 
A 1 55  PHE 55  66  66  PHE PHE A . n 
A 1 56  VAL 56  67  67  VAL VAL A . n 
A 1 57  THR 57  68  68  THR THR A . n 
A 1 58  PHE 58  69  69  PHE PHE A . n 
A 1 59  SER 59  70  70  SER SER A . n 
A 1 60  SER 60  71  71  SER SER A . n 
A 1 61  MET 61  72  72  MET MET A . n 
A 1 62  ALA 62  73  73  ALA ALA A . n 
A 1 63  GLU 63  74  74  GLU GLU A . n 
A 1 64  VAL 64  75  75  VAL VAL A . n 
A 1 65  ASP 65  76  76  ASP ASP A . n 
A 1 66  ALA 66  77  77  ALA ALA A . n 
A 1 67  ALA 67  78  78  ALA ALA A . n 
A 1 68  MET 68  79  79  MET MET A . n 
A 1 69  ALA 69  80  80  ALA ALA A . n 
A 1 70  ALA 70  81  81  ALA ALA A . n 
A 1 71  ARG 71  82  82  ARG ARG A . n 
A 1 72  PRO 72  83  83  PRO PRO A . n 
A 1 73  HIS 73  84  84  HIS HIS A . n 
A 1 74  SER 74  85  85  SER SER A . n 
A 1 75  ILE 75  86  86  ILE ILE A . n 
A 1 76  ASP 76  87  87  ASP ASP A . n 
A 1 77  GLY 77  88  88  GLY GLY A . n 
A 1 78  ARG 78  89  89  ARG ARG A . n 
A 1 79  VAL 79  90  90  VAL VAL A . n 
A 1 80  VAL 80  91  91  VAL VAL A . n 
A 1 81  GLU 81  92  92  GLU GLU A . n 
A 1 82  PRO 82  93  93  PRO PRO A . n 
A 1 83  LYS 83  94  94  LYS LYS A . n 
A 1 84  ARG 84  95  95  ARG ARG A . n 
A 1 85  ALA 85  96  96  ALA ALA A . n 
A 1 86  VAL 86  97  97  VAL VAL A . n 
A 1 87  ALA 87  98  98  ALA ALA A . n 
A 1 88  ARG 88  99  99  ARG ARG A . n 
A 1 89  GLU 89  100 100 GLU GLU A . n 
A 1 90  GLU 90  101 101 GLU GLU A . n 
A 1 91  SER 91  102 102 SER SER A . n 
A 1 92  GLY 92  103 103 GLY GLY A . n 
A 1 93  LYS 93  104 104 LYS LYS A . n 
A 1 94  PRO 94  105 105 PRO PRO A . n 
A 1 95  GLY 95  106 106 GLY GLY A . n 
A 1 96  ALA 96  107 107 ALA ALA A . n 
A 1 97  HIS 97  108 108 HIS HIS A . n 
A 1 98  VAL 98  109 109 VAL VAL A . n 
A 1 99  THR 99  110 110 THR THR A . n 
A 1 100 VAL 100 111 111 VAL VAL A . n 
A 1 101 LYS 101 112 112 LYS LYS A . n 
A 1 102 LYS 102 113 113 LYS LYS A . n 
A 1 103 LEU 103 114 114 LEU LEU A . n 
A 1 104 PHE 104 115 115 PHE PHE A . n 
A 1 105 VAL 105 116 116 VAL VAL A . n 
A 1 106 GLY 106 117 117 GLY GLY A . n 
A 1 107 GLY 107 118 118 GLY GLY A . n 
A 1 108 ILE 108 119 119 ILE ILE A . n 
A 1 109 LYS 109 120 120 LYS LYS A . n 
A 1 110 GLU 110 121 121 GLU GLU A . n 
A 1 111 ASP 111 122 122 ASP ASP A . n 
A 1 112 THR 112 123 123 THR THR A . n 
A 1 113 GLU 113 124 124 GLU GLU A . n 
A 1 114 GLU 114 125 125 GLU GLU A . n 
A 1 115 HIS 115 126 126 HIS HIS A . n 
A 1 116 HIS 116 127 127 HIS HIS A . n 
A 1 117 LEU 117 128 128 LEU LEU A . n 
A 1 118 ARG 118 129 129 ARG ARG A . n 
A 1 119 ASP 119 130 130 ASP ASP A . n 
A 1 120 TYR 120 131 131 TYR TYR A . n 
A 1 121 PHE 121 132 132 PHE PHE A . n 
A 1 122 GLU 122 133 133 GLU GLU A . n 
A 1 123 GLU 123 134 134 GLU GLU A . n 
A 1 124 TYR 124 135 135 TYR TYR A . n 
A 1 125 GLY 125 136 136 GLY GLY A . n 
A 1 126 LYS 126 137 137 LYS LYS A . n 
A 1 127 ILE 127 138 138 ILE ILE A . n 
A 1 128 ASP 128 139 139 ASP ASP A . n 
A 1 129 THR 129 140 140 THR THR A . n 
A 1 130 ILE 130 141 141 ILE ILE A . n 
A 1 131 GLU 131 142 142 GLU GLU A . n 
A 1 132 ILE 132 143 143 ILE ILE A . n 
A 1 133 ILE 133 144 144 ILE ILE A . n 
A 1 134 THR 134 145 145 THR THR A . n 
A 1 135 ASP 135 146 146 ASP ASP A . n 
A 1 136 ARG 136 147 147 ARG ARG A . n 
A 1 137 GLN 137 148 148 GLN GLN A . n 
A 1 138 SER 138 149 149 SER SER A . n 
A 1 139 GLY 139 150 150 GLY GLY A . n 
A 1 140 LYS 140 151 151 LYS LYS A . n 
A 1 141 LYS 141 152 152 LYS LYS A . n 
A 1 142 ARG 142 153 153 ARG ARG A . n 
A 1 143 GLY 143 154 154 GLY GLY A . n 
A 1 144 PHE 144 155 155 PHE PHE A . n 
A 1 145 GLY 145 156 156 GLY GLY A . n 
A 1 146 PHE 146 157 157 PHE PHE A . n 
A 1 147 VAL 147 158 158 VAL VAL A . n 
A 1 148 THR 148 159 159 THR THR A . n 
A 1 149 PHE 149 160 160 PHE PHE A . n 
A 1 150 ASP 150 161 161 ASP ASP A . n 
A 1 151 ASP 151 162 162 ASP ASP A . n 
A 1 152 HIS 152 163 163 HIS HIS A . n 
A 1 153 ASP 153 164 164 ASP ASP A . n 
A 1 154 PRO 154 165 165 PRO PRO A . n 
A 1 155 VAL 155 166 166 VAL VAL A . n 
A 1 156 ASP 156 167 167 ASP ASP A . n 
A 1 157 LYS 157 168 168 LYS LYS A . n 
A 1 158 ILE 158 169 169 ILE ILE A . n 
A 1 159 VAL 159 170 170 VAL VAL A . n 
A 1 160 LEU 160 171 171 LEU LEU A . n 
A 1 161 GLN 161 172 172 GLN GLN A . n 
A 1 162 LYS 162 173 173 LYS LYS A . n 
A 1 163 TYR 163 174 174 TYR TYR A . n 
A 1 164 HIS 164 175 175 HIS HIS A . n 
A 1 165 THR 165 176 176 THR THR A . n 
A 1 166 ILE 166 177 177 ILE ILE A . n 
A 1 167 ASN 167 178 178 ASN ASN A . n 
A 1 168 GLY 168 179 179 GLY GLY A . n 
A 1 169 HIS 169 180 180 HIS HIS A . n 
A 1 170 ASN 170 181 181 ASN ASN A . n 
A 1 171 ALA 171 182 182 ALA ALA A . n 
A 1 172 GLU 172 183 183 GLU GLU A . n 
A 1 173 VAL 173 184 184 VAL VAL A . n 
A 1 174 ARG 174 185 185 ARG ARG A . n 
A 1 175 LYS 175 186 186 LYS LYS A . n 
A 1 176 ALA 176 187 187 ALA ALA A . n 
A 1 177 LEU 177 188 188 LEU LEU A . n 
A 1 178 SER 178 189 189 SER SER A . n 
A 1 179 ARG 179 190 190 ARG ARG A . n 
A 1 180 GLN 180 191 191 GLN GLN A . n 
A 1 181 GLU 181 192 192 GLU GLU A . n 
A 1 182 MET 182 193 193 MET MET A . n 
A 1 183 GLN 183 194 194 GLN GLN A . n 
A 1 184 GLU 184 195 195 GLU GLU A . n 
B 2 1   A   1   1   1   A   A   B . n 
B 2 2   G   2   2   2   G   G   B . n 
B 2 3   G   3   3   3   G   G   B . n 
B 2 4   A   4   4   4   A   A   B . n 
B 2 5   C   5   5   5   C   C   B . n 
B 2 6   U   6   6   6   U   U   B . n 
B 2 7   G   7   7   7   G   G   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  201 2  HOH HOH A . 
C 3 HOH 2  202 7  HOH HOH A . 
C 3 HOH 3  203 9  HOH HOH A . 
C 3 HOH 4  204 4  HOH HOH A . 
C 3 HOH 5  205 10 HOH HOH A . 
C 3 HOH 6  206 8  HOH HOH A . 
C 3 HOH 7  207 6  HOH HOH A . 
C 3 HOH 8  208 5  HOH HOH A . 
C 3 HOH 9  209 3  HOH HOH A . 
C 3 HOH 10 210 1  HOH HOH A . 
D 3 HOH 1  101 11 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1100  ? 
1 MORE         -2    ? 
1 'SSA (A^2)'  12210 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-11-09 
2 'Structure model' 1 1 2018-02-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 2 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' citation_author       
3 2 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.country'                         
2 2 'Structure model' '_citation.journal_abbrev'                  
3 2 'Structure model' '_citation.journal_id_ISSN'                 
4 2 'Structure model' '_citation.pdbx_database_id_DOI'            
5 2 'Structure model' '_citation.title'                           
6 2 'Structure model' '_citation.year'                            
7 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC   ? ? ? 5.8.0103 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO    ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .        4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 59  ? ? 58.29  16.01   
2 1 LYS A 120 ? ? 60.10  -126.18 
3 1 GLN A 148 ? ? 84.24  -5.69   
4 1 ARG A 190 ? ? -81.14 36.11   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#