data_5EPG
# 
_entry.id   5EPG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5EPG         
WWPDB D_1000215308 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          4UHW 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5EPG 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Coelho, C.'       1 
'Romao, M.J.'      2 
'Santos-Silva, T.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Drug Metab.Dispos.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1521-009X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            44 
_citation.language                  ? 
_citation.page_first                1277 
_citation.page_last                 1285 
_citation.title                     
'Optimization of the Expression of Human Aldehyde Oxidase for Investigations of Single-Nucleotide Polymorphisms.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1124/dmd.115.068395 
_citation.pdbx_database_id_PubMed   26842593 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Foti, A.'         1 
primary 'Hartmann, T.'     2 
primary 'Coelho, C.'       3 
primary 'Santos-Silva, T.' 4 
primary 'Romao, M.J.'      5 
primary 'Leimkuhler, S.'   6 
# 
_cell.length_a           147.439 
_cell.length_b           147.439 
_cell.length_c           131.713 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5EPG 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.entry_id                         5EPG 
_symmetry.Int_Tables_number                94 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Aldehyde oxidase' 148122.578 1  1.2.3.1,1.17.3.- S1271L ? ? 
2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820    2  ?                ?      ? ? 
3 non-polymer syn 
'PHOSPHONIC ACIDMONO-(2-AMINO-5,6-DIMERCAPTO-4-OXO-3,7,8A,9,10,10A-HEXAHYDRO-4H-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-7-YLMETHYL)ESTER' 
395.352    1  ?                ?      ? ? 
4 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE' 785.550    1  ?                ?      ? ? 
5 non-polymer syn 'DIOXOTHIOMOLYBDENUM(VI) ION' 161.012    1  ?                ?      ? ? 
6 water       nat water 18.015     52 ?                ?      ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Aldehyde oxidase 1,Azaheterocycle hydroxylase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICS
LYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDA
CKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILA
DVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKC
PNADLKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVD
IMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHV
RRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASL
DESLFVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLV
THGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLGELGVFLGCSVF
FAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICS
LYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDA
CKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILA
DVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKC
PNADLKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVD
IMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHV
RRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASL
DESLFVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLV
THGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLGELGVFLGCSVF
FAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ASP n 
1 3    ARG n 
1 4    ALA n 
1 5    SER n 
1 6    GLU n 
1 7    LEU n 
1 8    LEU n 
1 9    PHE n 
1 10   TYR n 
1 11   VAL n 
1 12   ASN n 
1 13   GLY n 
1 14   ARG n 
1 15   LYS n 
1 16   VAL n 
1 17   ILE n 
1 18   GLU n 
1 19   LYS n 
1 20   ASN n 
1 21   VAL n 
1 22   ASP n 
1 23   PRO n 
1 24   GLU n 
1 25   THR n 
1 26   MET n 
1 27   LEU n 
1 28   LEU n 
1 29   PRO n 
1 30   TYR n 
1 31   LEU n 
1 32   ARG n 
1 33   LYS n 
1 34   LYS n 
1 35   LEU n 
1 36   ARG n 
1 37   LEU n 
1 38   THR n 
1 39   GLY n 
1 40   THR n 
1 41   LYS n 
1 42   TYR n 
1 43   GLY n 
1 44   CYS n 
1 45   GLY n 
1 46   GLY n 
1 47   GLY n 
1 48   GLY n 
1 49   CYS n 
1 50   GLY n 
1 51   ALA n 
1 52   CYS n 
1 53   THR n 
1 54   VAL n 
1 55   MET n 
1 56   ILE n 
1 57   SER n 
1 58   ARG n 
1 59   TYR n 
1 60   ASN n 
1 61   PRO n 
1 62   ILE n 
1 63   THR n 
1 64   LYS n 
1 65   ARG n 
1 66   ILE n 
1 67   ARG n 
1 68   HIS n 
1 69   HIS n 
1 70   PRO n 
1 71   ALA n 
1 72   ASN n 
1 73   ALA n 
1 74   CYS n 
1 75   LEU n 
1 76   ILE n 
1 77   PRO n 
1 78   ILE n 
1 79   CYS n 
1 80   SER n 
1 81   LEU n 
1 82   TYR n 
1 83   GLY n 
1 84   ALA n 
1 85   ALA n 
1 86   VAL n 
1 87   THR n 
1 88   THR n 
1 89   VAL n 
1 90   GLU n 
1 91   GLY n 
1 92   ILE n 
1 93   GLY n 
1 94   SER n 
1 95   THR n 
1 96   HIS n 
1 97   THR n 
1 98   ARG n 
1 99   ILE n 
1 100  HIS n 
1 101  PRO n 
1 102  VAL n 
1 103  GLN n 
1 104  GLU n 
1 105  ARG n 
1 106  ILE n 
1 107  ALA n 
1 108  LYS n 
1 109  CYS n 
1 110  HIS n 
1 111  GLY n 
1 112  THR n 
1 113  GLN n 
1 114  CYS n 
1 115  GLY n 
1 116  PHE n 
1 117  CYS n 
1 118  THR n 
1 119  PRO n 
1 120  GLY n 
1 121  MET n 
1 122  VAL n 
1 123  MET n 
1 124  SER n 
1 125  ILE n 
1 126  TYR n 
1 127  THR n 
1 128  LEU n 
1 129  LEU n 
1 130  ARG n 
1 131  ASN n 
1 132  HIS n 
1 133  PRO n 
1 134  GLU n 
1 135  PRO n 
1 136  THR n 
1 137  LEU n 
1 138  ASP n 
1 139  GLN n 
1 140  LEU n 
1 141  THR n 
1 142  ASP n 
1 143  ALA n 
1 144  LEU n 
1 145  GLY n 
1 146  GLY n 
1 147  ASN n 
1 148  LEU n 
1 149  CYS n 
1 150  ARG n 
1 151  CYS n 
1 152  THR n 
1 153  GLY n 
1 154  TYR n 
1 155  ARG n 
1 156  PRO n 
1 157  ILE n 
1 158  ILE n 
1 159  ASP n 
1 160  ALA n 
1 161  CYS n 
1 162  LYS n 
1 163  THR n 
1 164  PHE n 
1 165  CYS n 
1 166  LYS n 
1 167  THR n 
1 168  SER n 
1 169  GLY n 
1 170  CYS n 
1 171  CYS n 
1 172  GLN n 
1 173  SER n 
1 174  LYS n 
1 175  GLU n 
1 176  ASN n 
1 177  GLY n 
1 178  VAL n 
1 179  CYS n 
1 180  CYS n 
1 181  LEU n 
1 182  ASP n 
1 183  GLN n 
1 184  GLY n 
1 185  ILE n 
1 186  ASN n 
1 187  GLY n 
1 188  LEU n 
1 189  PRO n 
1 190  GLU n 
1 191  PHE n 
1 192  GLU n 
1 193  GLU n 
1 194  GLY n 
1 195  SER n 
1 196  LYS n 
1 197  THR n 
1 198  SER n 
1 199  PRO n 
1 200  LYS n 
1 201  LEU n 
1 202  PHE n 
1 203  ALA n 
1 204  GLU n 
1 205  GLU n 
1 206  GLU n 
1 207  PHE n 
1 208  LEU n 
1 209  PRO n 
1 210  LEU n 
1 211  ASP n 
1 212  PRO n 
1 213  THR n 
1 214  GLN n 
1 215  GLU n 
1 216  LEU n 
1 217  ILE n 
1 218  PHE n 
1 219  PRO n 
1 220  PRO n 
1 221  GLU n 
1 222  LEU n 
1 223  MET n 
1 224  ILE n 
1 225  MET n 
1 226  ALA n 
1 227  GLU n 
1 228  LYS n 
1 229  GLN n 
1 230  SER n 
1 231  GLN n 
1 232  ARG n 
1 233  THR n 
1 234  ARG n 
1 235  VAL n 
1 236  PHE n 
1 237  GLY n 
1 238  SER n 
1 239  GLU n 
1 240  ARG n 
1 241  MET n 
1 242  MET n 
1 243  TRP n 
1 244  PHE n 
1 245  SER n 
1 246  PRO n 
1 247  VAL n 
1 248  THR n 
1 249  LEU n 
1 250  LYS n 
1 251  GLU n 
1 252  LEU n 
1 253  LEU n 
1 254  GLU n 
1 255  PHE n 
1 256  LYS n 
1 257  PHE n 
1 258  LYS n 
1 259  TYR n 
1 260  PRO n 
1 261  GLN n 
1 262  ALA n 
1 263  PRO n 
1 264  VAL n 
1 265  ILE n 
1 266  MET n 
1 267  GLY n 
1 268  ASN n 
1 269  THR n 
1 270  SER n 
1 271  VAL n 
1 272  GLY n 
1 273  PRO n 
1 274  GLU n 
1 275  VAL n 
1 276  LYS n 
1 277  PHE n 
1 278  LYS n 
1 279  GLY n 
1 280  VAL n 
1 281  PHE n 
1 282  HIS n 
1 283  PRO n 
1 284  VAL n 
1 285  ILE n 
1 286  ILE n 
1 287  SER n 
1 288  PRO n 
1 289  ASP n 
1 290  ARG n 
1 291  ILE n 
1 292  GLU n 
1 293  GLU n 
1 294  LEU n 
1 295  SER n 
1 296  VAL n 
1 297  VAL n 
1 298  ASN n 
1 299  HIS n 
1 300  ALA n 
1 301  TYR n 
1 302  ASN n 
1 303  GLY n 
1 304  LEU n 
1 305  THR n 
1 306  LEU n 
1 307  GLY n 
1 308  ALA n 
1 309  GLY n 
1 310  LEU n 
1 311  SER n 
1 312  LEU n 
1 313  ALA n 
1 314  GLN n 
1 315  VAL n 
1 316  LYS n 
1 317  ASP n 
1 318  ILE n 
1 319  LEU n 
1 320  ALA n 
1 321  ASP n 
1 322  VAL n 
1 323  VAL n 
1 324  GLN n 
1 325  LYS n 
1 326  LEU n 
1 327  PRO n 
1 328  GLU n 
1 329  GLU n 
1 330  LYS n 
1 331  THR n 
1 332  GLN n 
1 333  MET n 
1 334  TYR n 
1 335  HIS n 
1 336  ALA n 
1 337  LEU n 
1 338  LEU n 
1 339  LYS n 
1 340  HIS n 
1 341  LEU n 
1 342  GLY n 
1 343  THR n 
1 344  LEU n 
1 345  ALA n 
1 346  GLY n 
1 347  SER n 
1 348  GLN n 
1 349  ILE n 
1 350  ARG n 
1 351  ASN n 
1 352  MET n 
1 353  ALA n 
1 354  SER n 
1 355  LEU n 
1 356  GLY n 
1 357  GLY n 
1 358  HIS n 
1 359  ILE n 
1 360  ILE n 
1 361  SER n 
1 362  ARG n 
1 363  HIS n 
1 364  PRO n 
1 365  ASP n 
1 366  SER n 
1 367  ASP n 
1 368  LEU n 
1 369  ASN n 
1 370  PRO n 
1 371  ILE n 
1 372  LEU n 
1 373  ALA n 
1 374  VAL n 
1 375  GLY n 
1 376  ASN n 
1 377  CYS n 
1 378  THR n 
1 379  LEU n 
1 380  ASN n 
1 381  LEU n 
1 382  LEU n 
1 383  SER n 
1 384  LYS n 
1 385  GLU n 
1 386  GLY n 
1 387  LYS n 
1 388  ARG n 
1 389  GLN n 
1 390  ILE n 
1 391  PRO n 
1 392  LEU n 
1 393  ASN n 
1 394  GLU n 
1 395  GLN n 
1 396  PHE n 
1 397  LEU n 
1 398  SER n 
1 399  LYS n 
1 400  CYS n 
1 401  PRO n 
1 402  ASN n 
1 403  ALA n 
1 404  ASP n 
1 405  LEU n 
1 406  LYS n 
1 407  PRO n 
1 408  GLN n 
1 409  GLU n 
1 410  ILE n 
1 411  LEU n 
1 412  VAL n 
1 413  SER n 
1 414  VAL n 
1 415  ASN n 
1 416  ILE n 
1 417  PRO n 
1 418  TYR n 
1 419  SER n 
1 420  ARG n 
1 421  LYS n 
1 422  TRP n 
1 423  GLU n 
1 424  PHE n 
1 425  VAL n 
1 426  SER n 
1 427  ALA n 
1 428  PHE n 
1 429  ARG n 
1 430  GLN n 
1 431  ALA n 
1 432  GLN n 
1 433  ARG n 
1 434  GLN n 
1 435  GLU n 
1 436  ASN n 
1 437  ALA n 
1 438  LEU n 
1 439  ALA n 
1 440  ILE n 
1 441  VAL n 
1 442  ASN n 
1 443  SER n 
1 444  GLY n 
1 445  MET n 
1 446  ARG n 
1 447  VAL n 
1 448  PHE n 
1 449  PHE n 
1 450  GLY n 
1 451  GLU n 
1 452  GLY n 
1 453  ASP n 
1 454  GLY n 
1 455  ILE n 
1 456  ILE n 
1 457  ARG n 
1 458  GLU n 
1 459  LEU n 
1 460  CYS n 
1 461  ILE n 
1 462  SER n 
1 463  TYR n 
1 464  GLY n 
1 465  GLY n 
1 466  VAL n 
1 467  GLY n 
1 468  PRO n 
1 469  ALA n 
1 470  THR n 
1 471  ILE n 
1 472  CYS n 
1 473  ALA n 
1 474  LYS n 
1 475  ASN n 
1 476  SER n 
1 477  CYS n 
1 478  GLN n 
1 479  LYS n 
1 480  LEU n 
1 481  ILE n 
1 482  GLY n 
1 483  ARG n 
1 484  HIS n 
1 485  TRP n 
1 486  ASN n 
1 487  GLU n 
1 488  GLN n 
1 489  MET n 
1 490  LEU n 
1 491  ASP n 
1 492  ILE n 
1 493  ALA n 
1 494  CYS n 
1 495  ARG n 
1 496  LEU n 
1 497  ILE n 
1 498  LEU n 
1 499  ASN n 
1 500  GLU n 
1 501  VAL n 
1 502  SER n 
1 503  LEU n 
1 504  LEU n 
1 505  GLY n 
1 506  SER n 
1 507  ALA n 
1 508  PRO n 
1 509  GLY n 
1 510  GLY n 
1 511  LYS n 
1 512  VAL n 
1 513  GLU n 
1 514  PHE n 
1 515  LYS n 
1 516  ARG n 
1 517  THR n 
1 518  LEU n 
1 519  ILE n 
1 520  ILE n 
1 521  SER n 
1 522  PHE n 
1 523  LEU n 
1 524  PHE n 
1 525  LYS n 
1 526  PHE n 
1 527  TYR n 
1 528  LEU n 
1 529  GLU n 
1 530  VAL n 
1 531  SER n 
1 532  GLN n 
1 533  ILE n 
1 534  LEU n 
1 535  LYS n 
1 536  LYS n 
1 537  MET n 
1 538  ASP n 
1 539  PRO n 
1 540  VAL n 
1 541  HIS n 
1 542  TYR n 
1 543  PRO n 
1 544  SER n 
1 545  LEU n 
1 546  ALA n 
1 547  ASP n 
1 548  LYS n 
1 549  TYR n 
1 550  GLU n 
1 551  SER n 
1 552  ALA n 
1 553  LEU n 
1 554  GLU n 
1 555  ASP n 
1 556  LEU n 
1 557  HIS n 
1 558  SER n 
1 559  LYS n 
1 560  HIS n 
1 561  HIS n 
1 562  CYS n 
1 563  SER n 
1 564  THR n 
1 565  LEU n 
1 566  LYS n 
1 567  TYR n 
1 568  GLN n 
1 569  ASN n 
1 570  ILE n 
1 571  GLY n 
1 572  PRO n 
1 573  LYS n 
1 574  GLN n 
1 575  HIS n 
1 576  PRO n 
1 577  GLU n 
1 578  ASP n 
1 579  PRO n 
1 580  ILE n 
1 581  GLY n 
1 582  HIS n 
1 583  PRO n 
1 584  ILE n 
1 585  MET n 
1 586  HIS n 
1 587  LEU n 
1 588  SER n 
1 589  GLY n 
1 590  VAL n 
1 591  LYS n 
1 592  HIS n 
1 593  ALA n 
1 594  THR n 
1 595  GLY n 
1 596  GLU n 
1 597  ALA n 
1 598  ILE n 
1 599  TYR n 
1 600  CYS n 
1 601  ASP n 
1 602  ASP n 
1 603  MET n 
1 604  PRO n 
1 605  LEU n 
1 606  VAL n 
1 607  ASP n 
1 608  GLN n 
1 609  GLU n 
1 610  LEU n 
1 611  PHE n 
1 612  LEU n 
1 613  THR n 
1 614  PHE n 
1 615  VAL n 
1 616  THR n 
1 617  SER n 
1 618  SER n 
1 619  ARG n 
1 620  ALA n 
1 621  HIS n 
1 622  ALA n 
1 623  LYS n 
1 624  ILE n 
1 625  VAL n 
1 626  SER n 
1 627  ILE n 
1 628  ASP n 
1 629  LEU n 
1 630  SER n 
1 631  GLU n 
1 632  ALA n 
1 633  LEU n 
1 634  SER n 
1 635  MET n 
1 636  PRO n 
1 637  GLY n 
1 638  VAL n 
1 639  VAL n 
1 640  ASP n 
1 641  ILE n 
1 642  MET n 
1 643  THR n 
1 644  ALA n 
1 645  GLU n 
1 646  HIS n 
1 647  LEU n 
1 648  SER n 
1 649  ASP n 
1 650  VAL n 
1 651  ASN n 
1 652  SER n 
1 653  PHE n 
1 654  CYS n 
1 655  PHE n 
1 656  PHE n 
1 657  THR n 
1 658  GLU n 
1 659  ALA n 
1 660  GLU n 
1 661  LYS n 
1 662  PHE n 
1 663  LEU n 
1 664  ALA n 
1 665  THR n 
1 666  ASP n 
1 667  LYS n 
1 668  VAL n 
1 669  PHE n 
1 670  CYS n 
1 671  VAL n 
1 672  GLY n 
1 673  GLN n 
1 674  LEU n 
1 675  VAL n 
1 676  CYS n 
1 677  ALA n 
1 678  VAL n 
1 679  LEU n 
1 680  ALA n 
1 681  ASP n 
1 682  SER n 
1 683  GLU n 
1 684  VAL n 
1 685  GLN n 
1 686  ALA n 
1 687  LYS n 
1 688  ARG n 
1 689  ALA n 
1 690  ALA n 
1 691  LYS n 
1 692  ARG n 
1 693  VAL n 
1 694  LYS n 
1 695  ILE n 
1 696  VAL n 
1 697  TYR n 
1 698  GLN n 
1 699  ASP n 
1 700  LEU n 
1 701  GLU n 
1 702  PRO n 
1 703  LEU n 
1 704  ILE n 
1 705  LEU n 
1 706  THR n 
1 707  ILE n 
1 708  GLU n 
1 709  GLU n 
1 710  SER n 
1 711  ILE n 
1 712  GLN n 
1 713  HIS n 
1 714  ASN n 
1 715  SER n 
1 716  SER n 
1 717  PHE n 
1 718  LYS n 
1 719  PRO n 
1 720  GLU n 
1 721  ARG n 
1 722  LYS n 
1 723  LEU n 
1 724  GLU n 
1 725  TYR n 
1 726  GLY n 
1 727  ASN n 
1 728  VAL n 
1 729  ASP n 
1 730  GLU n 
1 731  ALA n 
1 732  PHE n 
1 733  LYS n 
1 734  VAL n 
1 735  VAL n 
1 736  ASP n 
1 737  GLN n 
1 738  ILE n 
1 739  LEU n 
1 740  GLU n 
1 741  GLY n 
1 742  GLU n 
1 743  ILE n 
1 744  HIS n 
1 745  MET n 
1 746  GLY n 
1 747  GLY n 
1 748  GLN n 
1 749  GLU n 
1 750  HIS n 
1 751  PHE n 
1 752  TYR n 
1 753  MET n 
1 754  GLU n 
1 755  THR n 
1 756  GLN n 
1 757  SER n 
1 758  MET n 
1 759  LEU n 
1 760  VAL n 
1 761  VAL n 
1 762  PRO n 
1 763  LYS n 
1 764  GLY n 
1 765  GLU n 
1 766  ASP n 
1 767  GLN n 
1 768  GLU n 
1 769  MET n 
1 770  ASP n 
1 771  VAL n 
1 772  TYR n 
1 773  VAL n 
1 774  SER n 
1 775  THR n 
1 776  GLN n 
1 777  PHE n 
1 778  PRO n 
1 779  LYS n 
1 780  TYR n 
1 781  ILE n 
1 782  GLN n 
1 783  ASP n 
1 784  ILE n 
1 785  VAL n 
1 786  ALA n 
1 787  SER n 
1 788  THR n 
1 789  LEU n 
1 790  LYS n 
1 791  LEU n 
1 792  PRO n 
1 793  ALA n 
1 794  ASN n 
1 795  LYS n 
1 796  VAL n 
1 797  MET n 
1 798  CYS n 
1 799  HIS n 
1 800  VAL n 
1 801  ARG n 
1 802  ARG n 
1 803  VAL n 
1 804  GLY n 
1 805  GLY n 
1 806  ALA n 
1 807  PHE n 
1 808  GLY n 
1 809  GLY n 
1 810  LYS n 
1 811  VAL n 
1 812  LEU n 
1 813  LYS n 
1 814  THR n 
1 815  GLY n 
1 816  ILE n 
1 817  ILE n 
1 818  ALA n 
1 819  ALA n 
1 820  VAL n 
1 821  THR n 
1 822  ALA n 
1 823  PHE n 
1 824  ALA n 
1 825  ALA n 
1 826  ASN n 
1 827  LYS n 
1 828  HIS n 
1 829  GLY n 
1 830  ARG n 
1 831  ALA n 
1 832  VAL n 
1 833  ARG n 
1 834  CYS n 
1 835  VAL n 
1 836  LEU n 
1 837  GLU n 
1 838  ARG n 
1 839  GLY n 
1 840  GLU n 
1 841  ASP n 
1 842  MET n 
1 843  LEU n 
1 844  ILE n 
1 845  THR n 
1 846  GLY n 
1 847  GLY n 
1 848  ARG n 
1 849  HIS n 
1 850  PRO n 
1 851  TYR n 
1 852  LEU n 
1 853  GLY n 
1 854  LYS n 
1 855  TYR n 
1 856  LYS n 
1 857  ALA n 
1 858  GLY n 
1 859  PHE n 
1 860  MET n 
1 861  ASN n 
1 862  ASP n 
1 863  GLY n 
1 864  ARG n 
1 865  ILE n 
1 866  LEU n 
1 867  ALA n 
1 868  LEU n 
1 869  ASP n 
1 870  MET n 
1 871  GLU n 
1 872  HIS n 
1 873  TYR n 
1 874  SER n 
1 875  ASN n 
1 876  ALA n 
1 877  GLY n 
1 878  ALA n 
1 879  SER n 
1 880  LEU n 
1 881  ASP n 
1 882  GLU n 
1 883  SER n 
1 884  LEU n 
1 885  PHE n 
1 886  VAL n 
1 887  ILE n 
1 888  GLU n 
1 889  MET n 
1 890  GLY n 
1 891  LEU n 
1 892  LEU n 
1 893  LYS n 
1 894  MET n 
1 895  ASP n 
1 896  ASN n 
1 897  ALA n 
1 898  TYR n 
1 899  LYS n 
1 900  PHE n 
1 901  PRO n 
1 902  ASN n 
1 903  LEU n 
1 904  ARG n 
1 905  CYS n 
1 906  ARG n 
1 907  GLY n 
1 908  TRP n 
1 909  ALA n 
1 910  CYS n 
1 911  ARG n 
1 912  THR n 
1 913  ASN n 
1 914  LEU n 
1 915  PRO n 
1 916  SER n 
1 917  ASN n 
1 918  THR n 
1 919  ALA n 
1 920  PHE n 
1 921  ARG n 
1 922  GLY n 
1 923  PHE n 
1 924  GLY n 
1 925  PHE n 
1 926  PRO n 
1 927  GLN n 
1 928  ALA n 
1 929  ALA n 
1 930  LEU n 
1 931  ILE n 
1 932  THR n 
1 933  GLU n 
1 934  SER n 
1 935  CYS n 
1 936  ILE n 
1 937  THR n 
1 938  GLU n 
1 939  VAL n 
1 940  ALA n 
1 941  ALA n 
1 942  LYS n 
1 943  CYS n 
1 944  GLY n 
1 945  LEU n 
1 946  SER n 
1 947  PRO n 
1 948  GLU n 
1 949  LYS n 
1 950  VAL n 
1 951  ARG n 
1 952  ILE n 
1 953  ILE n 
1 954  ASN n 
1 955  MET n 
1 956  TYR n 
1 957  LYS n 
1 958  GLU n 
1 959  ILE n 
1 960  ASP n 
1 961  GLN n 
1 962  THR n 
1 963  PRO n 
1 964  TYR n 
1 965  LYS n 
1 966  GLN n 
1 967  GLU n 
1 968  ILE n 
1 969  ASN n 
1 970  ALA n 
1 971  LYS n 
1 972  ASN n 
1 973  LEU n 
1 974  ILE n 
1 975  GLN n 
1 976  CYS n 
1 977  TRP n 
1 978  ARG n 
1 979  GLU n 
1 980  CYS n 
1 981  MET n 
1 982  ALA n 
1 983  MET n 
1 984  SER n 
1 985  SER n 
1 986  TYR n 
1 987  SER n 
1 988  LEU n 
1 989  ARG n 
1 990  LYS n 
1 991  VAL n 
1 992  ALA n 
1 993  VAL n 
1 994  GLU n 
1 995  LYS n 
1 996  PHE n 
1 997  ASN n 
1 998  ALA n 
1 999  GLU n 
1 1000 ASN n 
1 1001 TYR n 
1 1002 TRP n 
1 1003 LYS n 
1 1004 LYS n 
1 1005 LYS n 
1 1006 GLY n 
1 1007 LEU n 
1 1008 ALA n 
1 1009 MET n 
1 1010 VAL n 
1 1011 PRO n 
1 1012 LEU n 
1 1013 LYS n 
1 1014 PHE n 
1 1015 PRO n 
1 1016 VAL n 
1 1017 GLY n 
1 1018 LEU n 
1 1019 GLY n 
1 1020 SER n 
1 1021 ARG n 
1 1022 ALA n 
1 1023 ALA n 
1 1024 GLY n 
1 1025 GLN n 
1 1026 ALA n 
1 1027 ALA n 
1 1028 ALA n 
1 1029 LEU n 
1 1030 VAL n 
1 1031 HIS n 
1 1032 ILE n 
1 1033 TYR n 
1 1034 LEU n 
1 1035 ASP n 
1 1036 GLY n 
1 1037 SER n 
1 1038 VAL n 
1 1039 LEU n 
1 1040 VAL n 
1 1041 THR n 
1 1042 HIS n 
1 1043 GLY n 
1 1044 GLY n 
1 1045 ILE n 
1 1046 GLU n 
1 1047 MET n 
1 1048 GLY n 
1 1049 GLN n 
1 1050 GLY n 
1 1051 VAL n 
1 1052 HIS n 
1 1053 THR n 
1 1054 LYS n 
1 1055 MET n 
1 1056 ILE n 
1 1057 GLN n 
1 1058 VAL n 
1 1059 VAL n 
1 1060 SER n 
1 1061 ARG n 
1 1062 GLU n 
1 1063 LEU n 
1 1064 ARG n 
1 1065 MET n 
1 1066 PRO n 
1 1067 MET n 
1 1068 SER n 
1 1069 ASN n 
1 1070 VAL n 
1 1071 HIS n 
1 1072 LEU n 
1 1073 ARG n 
1 1074 GLY n 
1 1075 THR n 
1 1076 SER n 
1 1077 THR n 
1 1078 GLU n 
1 1079 THR n 
1 1080 VAL n 
1 1081 PRO n 
1 1082 ASN n 
1 1083 ALA n 
1 1084 ASN n 
1 1085 ILE n 
1 1086 SER n 
1 1087 GLY n 
1 1088 GLY n 
1 1089 SER n 
1 1090 VAL n 
1 1091 VAL n 
1 1092 ALA n 
1 1093 ASP n 
1 1094 LEU n 
1 1095 ASN n 
1 1096 GLY n 
1 1097 LEU n 
1 1098 ALA n 
1 1099 VAL n 
1 1100 LYS n 
1 1101 ASP n 
1 1102 ALA n 
1 1103 CYS n 
1 1104 GLN n 
1 1105 THR n 
1 1106 LEU n 
1 1107 LEU n 
1 1108 LYS n 
1 1109 ARG n 
1 1110 LEU n 
1 1111 GLU n 
1 1112 PRO n 
1 1113 ILE n 
1 1114 ILE n 
1 1115 SER n 
1 1116 LYS n 
1 1117 ASN n 
1 1118 PRO n 
1 1119 LYS n 
1 1120 GLY n 
1 1121 THR n 
1 1122 TRP n 
1 1123 LYS n 
1 1124 ASP n 
1 1125 TRP n 
1 1126 ALA n 
1 1127 GLN n 
1 1128 THR n 
1 1129 ALA n 
1 1130 PHE n 
1 1131 ASP n 
1 1132 GLU n 
1 1133 SER n 
1 1134 ILE n 
1 1135 ASN n 
1 1136 LEU n 
1 1137 SER n 
1 1138 ALA n 
1 1139 VAL n 
1 1140 GLY n 
1 1141 TYR n 
1 1142 PHE n 
1 1143 ARG n 
1 1144 GLY n 
1 1145 TYR n 
1 1146 GLU n 
1 1147 SER n 
1 1148 ASP n 
1 1149 MET n 
1 1150 ASN n 
1 1151 TRP n 
1 1152 GLU n 
1 1153 LYS n 
1 1154 GLY n 
1 1155 GLU n 
1 1156 GLY n 
1 1157 GLN n 
1 1158 PRO n 
1 1159 PHE n 
1 1160 GLU n 
1 1161 TYR n 
1 1162 PHE n 
1 1163 VAL n 
1 1164 TYR n 
1 1165 GLY n 
1 1166 ALA n 
1 1167 ALA n 
1 1168 CYS n 
1 1169 SER n 
1 1170 GLU n 
1 1171 VAL n 
1 1172 GLU n 
1 1173 ILE n 
1 1174 ASP n 
1 1175 CYS n 
1 1176 LEU n 
1 1177 THR n 
1 1178 GLY n 
1 1179 ASP n 
1 1180 HIS n 
1 1181 LYS n 
1 1182 ASN n 
1 1183 ILE n 
1 1184 ARG n 
1 1185 THR n 
1 1186 ASP n 
1 1187 ILE n 
1 1188 VAL n 
1 1189 MET n 
1 1190 ASP n 
1 1191 VAL n 
1 1192 GLY n 
1 1193 CYS n 
1 1194 SER n 
1 1195 ILE n 
1 1196 ASN n 
1 1197 PRO n 
1 1198 ALA n 
1 1199 ILE n 
1 1200 ASP n 
1 1201 ILE n 
1 1202 GLY n 
1 1203 GLN n 
1 1204 ILE n 
1 1205 GLU n 
1 1206 GLY n 
1 1207 ALA n 
1 1208 PHE n 
1 1209 ILE n 
1 1210 GLN n 
1 1211 GLY n 
1 1212 MET n 
1 1213 GLY n 
1 1214 LEU n 
1 1215 TYR n 
1 1216 THR n 
1 1217 ILE n 
1 1218 GLU n 
1 1219 GLU n 
1 1220 LEU n 
1 1221 ASN n 
1 1222 TYR n 
1 1223 SER n 
1 1224 PRO n 
1 1225 GLN n 
1 1226 GLY n 
1 1227 ILE n 
1 1228 LEU n 
1 1229 HIS n 
1 1230 THR n 
1 1231 ARG n 
1 1232 GLY n 
1 1233 PRO n 
1 1234 ASP n 
1 1235 GLN n 
1 1236 TYR n 
1 1237 LYS n 
1 1238 ILE n 
1 1239 PRO n 
1 1240 ALA n 
1 1241 ILE n 
1 1242 CYS n 
1 1243 ASP n 
1 1244 MET n 
1 1245 PRO n 
1 1246 THR n 
1 1247 GLU n 
1 1248 LEU n 
1 1249 HIS n 
1 1250 ILE n 
1 1251 ALA n 
1 1252 LEU n 
1 1253 LEU n 
1 1254 PRO n 
1 1255 PRO n 
1 1256 SER n 
1 1257 GLN n 
1 1258 ASN n 
1 1259 SER n 
1 1260 ASN n 
1 1261 THR n 
1 1262 LEU n 
1 1263 TYR n 
1 1264 SER n 
1 1265 SER n 
1 1266 LYS n 
1 1267 GLY n 
1 1268 LEU n 
1 1269 GLY n 
1 1270 GLU n 
1 1271 LEU n 
1 1272 GLY n 
1 1273 VAL n 
1 1274 PHE n 
1 1275 LEU n 
1 1276 GLY n 
1 1277 CYS n 
1 1278 SER n 
1 1279 VAL n 
1 1280 PHE n 
1 1281 PHE n 
1 1282 ALA n 
1 1283 ILE n 
1 1284 HIS n 
1 1285 ASP n 
1 1286 ALA n 
1 1287 VAL n 
1 1288 SER n 
1 1289 ALA n 
1 1290 ALA n 
1 1291 ARG n 
1 1292 GLN n 
1 1293 GLU n 
1 1294 ARG n 
1 1295 GLY n 
1 1296 LEU n 
1 1297 HIS n 
1 1298 GLY n 
1 1299 PRO n 
1 1300 LEU n 
1 1301 THR n 
1 1302 LEU n 
1 1303 ASN n 
1 1304 SER n 
1 1305 PRO n 
1 1306 LEU n 
1 1307 THR n 
1 1308 PRO n 
1 1309 GLU n 
1 1310 LYS n 
1 1311 ILE n 
1 1312 ARG n 
1 1313 MET n 
1 1314 ALA n 
1 1315 CYS n 
1 1316 GLU n 
1 1317 ASP n 
1 1318 LYS n 
1 1319 PHE n 
1 1320 THR n 
1 1321 LYS n 
1 1322 MET n 
1 1323 ILE n 
1 1324 PRO n 
1 1325 ARG n 
1 1326 ASP n 
1 1327 GLU n 
1 1328 PRO n 
1 1329 GLY n 
1 1330 SER n 
1 1331 TYR n 
1 1332 VAL n 
1 1333 PRO n 
1 1334 TRP n 
1 1335 ASN n 
1 1336 VAL n 
1 1337 PRO n 
1 1338 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   1338 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AOX1, AO' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AOXA_HUMAN 
_struct_ref.pdbx_db_accession          Q06278 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICS
LYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDA
CKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILA
DVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKC
PNADLKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVD
IMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHV
RRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASL
DESLFVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLV
THGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLGESGVFLGCSVF
FAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5EPG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 1338 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q06278 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1338 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       1338 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             5EPG 
_struct_ref_seq_dif.mon_id                       LEU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1271 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q06278 
_struct_ref_seq_dif.db_mon_id                    SER 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          1271 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1271 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'       121.158 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE' ? 'C27 H33 N9 O15 P2'  785.550 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2'             175.820 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER ? 'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'      149.211 
MOS non-polymer         . 'DIOXOTHIOMOLYBDENUM(VI) ION' ? 'H Mo O2 S'          161.012 
MTE non-polymer         . 
'PHOSPHONIC ACIDMONO-(2-AMINO-5,6-DIMERCAPTO-4-OXO-3,7,8A,9,10,10A-HEXAHYDRO-4H-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-7-YLMETHYL)ESTER' 
? 'C10 H14 N5 O6 P S2' 395.352 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'        117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5EPG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.42 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.10 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           193 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 12M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-01-27 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.d_resolution_high            3.370 
_reflns.d_resolution_low             49.150 
_reflns.pdbx_number_measured_all     222236 
_reflns.number_obs                   20918 
_reflns.pdbx_scaling_rejects         8 
_reflns.pdbx_Rmerge_I_obs            0.310 
_reflns.pdbx_netI_over_sigmaI        9.300 
_reflns.pdbx_redundancy              10.600 
_reflns.percent_possible_obs         98.900 
_reflns.pdbx_Rpim_I_all              0.099 
_reflns.pdbx_CC_half                 0.989 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5EPG 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1 3.370 3.640  ? 41285 ? 0 2.025 1.900  ? ? 10.200 ? ? ? 4044 ? ? ? ? 94.700 ? 0.665 0.218 
1 2 8.910 49.150 ? 11967 ? 0 0.054 30.000 ? ? 9.400  ? ? ? 1274 ? ? ? ? 99.400 ? 0.018 0.998 
# 
_refine.entry_id                                 5EPG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            3.3900 
_refine.ls_d_res_low                             49.1600 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.7800 
_refine.ls_number_reflns_obs                     19531 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1666 
_refine.ls_R_factor_R_work                       0.1620 
_refine.ls_wR_factor_R_work                      0.1484 
_refine.ls_R_factor_R_free                       0.2531 
_refine.ls_wR_factor_R_free                      0.2327 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_number_reflns_R_free                  1046 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               102.1640 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.1800 
_refine.aniso_B[2][2]                            -0.1800 
_refine.aniso_B[3][3]                            0.3500 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9580 
_refine.correlation_coeff_Fo_to_Fc_free          0.8940 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        0.6307 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.6310 
_refine.overall_SU_ML                            0.4520 
_refine.overall_SU_B                             28.3950 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      4UHW 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8468 
_refine.B_iso_max                                201.470 
_refine.B_iso_min                                43.040 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.3900 
_refine_hist.d_res_low                        49.1600 
_refine_hist.pdbx_number_atoms_ligand         89 
_refine_hist.number_atoms_solvent             52 
_refine_hist.number_atoms_total               10131 
_refine_hist.pdbx_number_residues_total       1288 
_refine_hist.pdbx_B_iso_mean_ligand           93.50 
_refine_hist.pdbx_B_iso_mean_solvent          74.26 
_refine_hist.pdbx_number_atoms_protein        9990 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' r_bond_refined_d       10294 0.010  0.019  ? ? 
'X-RAY DIFFRACTION' r_bond_other_d         9928  0.001  0.020  ? ? 
'X-RAY DIFFRACTION' r_angle_refined_deg    13928 1.550  1.979  ? ? 
'X-RAY DIFFRACTION' r_angle_other_deg      22906 0.837  3.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 1281  6.383  5.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 428   39.107 24.182 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 1801  18.641 15.000 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 56    15.875 15.000 ? ? 
'X-RAY DIFFRACTION' r_chiral_restr         1555  0.092  0.200  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_refined   11503 0.007  0.021  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_other     2273  0.001  0.020  ? ? 
'X-RAY DIFFRACTION' r_mcbond_it            5145  7.155  10.045 ? ? 
'X-RAY DIFFRACTION' r_mcbond_other         5144  7.153  10.045 ? ? 
'X-RAY DIFFRACTION' r_mcangle_it           6419  10.833 15.075 ? ? 
# 
_refine_ls_shell.d_res_high                       3.3870 
_refine_ls_shell.d_res_low                        3.4750 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               86.6800 
_refine_ls_shell.number_reflns_R_work             1241 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2280 
_refine_ls_shell.R_factor_R_free                  0.3430 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             74 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1315 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_obs                     ? 
# 
_struct.entry_id                     5EPG 
_struct.title                        'Human aldehyde oxidase SNP S1271L' 
_struct.pdbx_descriptor              'Aldehyde oxidase (E.C.1.2.3.1,1.17.3.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5EPG 
_struct_keywords.text            'oxidoreductase, drug metabolism, SNP' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 MET A 26   ? LYS A 34   ? MET A 26   LYS A 34   1 ? 9  
HELX_P HELX_P2  AA2 CYS A 74   ? ILE A 76   ? CYS A 74   ILE A 76   5 ? 3  
HELX_P HELX_P3  AA3 PRO A 77   ? TYR A 82   ? PRO A 77   TYR A 82   5 ? 6  
HELX_P HELX_P4  AA4 THR A 88   ? GLY A 93   ? THR A 88   GLY A 93   1 ? 6  
HELX_P HELX_P5  AA5 HIS A 100  ? CYS A 109  ? HIS A 100  CYS A 109  1 ? 10 
HELX_P HELX_P6  AA6 CYS A 117  ? HIS A 132  ? CYS A 117  HIS A 132  1 ? 16 
HELX_P HELX_P7  AA7 THR A 136  ? LEU A 144  ? THR A 136  LEU A 144  1 ? 9  
HELX_P HELX_P8  AA8 GLY A 145  ? ASN A 147  ? GLY A 145  ASN A 147  5 ? 3  
HELX_P HELX_P9  AA9 TYR A 154  ? THR A 163  ? TYR A 154  THR A 163  1 ? 10 
HELX_P HELX_P10 AB1 ALA A 203  ? PHE A 207  ? ALA A 203  PHE A 207  5 ? 5  
HELX_P HELX_P11 AB2 PRO A 219  ? GLU A 227  ? PRO A 219  GLU A 227  1 ? 9  
HELX_P HELX_P12 AB3 THR A 248  ? TYR A 259  ? THR A 248  TYR A 259  1 ? 12 
HELX_P HELX_P13 AB4 SER A 270  ? LYS A 278  ? SER A 270  LYS A 278  1 ? 9  
HELX_P HELX_P14 AB5 ILE A 291  ? SER A 295  ? ILE A 291  SER A 295  5 ? 5  
HELX_P HELX_P15 AB6 SER A 311  ? LEU A 326  ? SER A 311  LEU A 326  1 ? 16 
HELX_P HELX_P16 AB7 THR A 331  ? LEU A 344  ? THR A 331  LEU A 344  1 ? 14 
HELX_P HELX_P17 AB8 GLY A 346  ? ALA A 353  ? GLY A 346  ALA A 353  1 ? 8  
HELX_P HELX_P18 AB9 SER A 354  ? ARG A 362  ? SER A 354  ARG A 362  1 ? 9  
HELX_P HELX_P19 AC1 LEU A 368  ? GLY A 375  ? LEU A 368  GLY A 375  1 ? 8  
HELX_P HELX_P20 AC2 ASN A 393  ? SER A 398  ? ASN A 393  SER A 398  1 ? 6  
HELX_P HELX_P21 AC3 ALA A 473  ? ILE A 481  ? ALA A 473  ILE A 481  1 ? 9  
HELX_P HELX_P22 AC4 ASN A 486  ? ASN A 499  ? ASN A 486  ASN A 499  1 ? 14 
HELX_P HELX_P23 AC5 LYS A 511  ? ASP A 538  ? LYS A 511  ASP A 538  1 ? 28 
HELX_P HELX_P24 AC6 TYR A 549  ? LEU A 553  ? TYR A 549  LEU A 553  5 ? 5  
HELX_P HELX_P25 AC7 SER A 588  ? THR A 594  ? SER A 588  THR A 594  1 ? 7  
HELX_P HELX_P26 AC8 TYR A 599  ? MET A 603  ? TYR A 599  MET A 603  5 ? 5  
HELX_P HELX_P27 AC9 LEU A 629  ? MET A 635  ? LEU A 629  MET A 635  1 ? 7  
HELX_P HELX_P28 AD1 THR A 643  ? ASN A 651  ? THR A 643  ASN A 651  5 ? 9  
HELX_P HELX_P29 AD2 SER A 682  ? LYS A 691  ? SER A 682  LYS A 691  1 ? 10 
HELX_P HELX_P30 AD3 GLU A 708  ? GLN A 712  ? GLU A 708  GLN A 712  5 ? 5  
HELX_P HELX_P31 AD4 ASN A 727  ? PHE A 732  ? ASN A 727  PHE A 732  1 ? 6  
HELX_P HELX_P32 AD5 PHE A 777  ? LYS A 790  ? PHE A 777  LYS A 790  1 ? 14 
HELX_P HELX_P33 AD6 PRO A 792  ? ASN A 794  ? PRO A 792  ASN A 794  5 ? 3  
HELX_P HELX_P34 AD7 VAL A 811  ? GLY A 829  ? VAL A 811  GLY A 829  1 ? 19 
HELX_P HELX_P35 AD8 GLU A 837  ? THR A 845  ? GLU A 837  THR A 845  1 ? 9  
HELX_P HELX_P36 AD9 LEU A 884  ? MET A 894  ? LEU A 884  MET A 894  1 ? 11 
HELX_P HELX_P37 AE1 GLY A 924  ? GLY A 944  ? GLY A 924  GLY A 944  1 ? 21 
HELX_P HELX_P38 AE2 SER A 946  ? MET A 955  ? SER A 946  MET A 955  1 ? 10 
HELX_P HELX_P39 AE3 ALA A 970  ? SER A 985  ? ALA A 970  SER A 985  1 ? 16 
HELX_P HELX_P40 AE4 SER A 985  ? ASN A 1000 ? SER A 985  ASN A 1000 1 ? 16 
HELX_P HELX_P41 AE5 ARG A 1021 ? GLN A 1025 ? ARG A 1021 GLN A 1025 5 ? 5  
HELX_P HELX_P42 AE6 GLY A 1050 ? LEU A 1063 ? GLY A 1050 LEU A 1063 1 ? 14 
HELX_P HELX_P43 AE7 PRO A 1066 ? SER A 1068 ? PRO A 1066 SER A 1068 5 ? 3  
HELX_P HELX_P44 AE8 VAL A 1090 ? LYS A 1116 ? VAL A 1090 LYS A 1116 1 ? 27 
HELX_P HELX_P45 AE9 THR A 1121 ? GLU A 1132 ? THR A 1121 GLU A 1132 1 ? 12 
HELX_P HELX_P46 AF1 ASN A 1196 ? THR A 1216 ? ASN A 1196 THR A 1216 1 ? 21 
HELX_P HELX_P47 AF2 ARG A 1231 ? GLN A 1235 ? ARG A 1231 GLN A 1235 5 ? 5  
HELX_P HELX_P48 AF3 ALA A 1240 ? MET A 1244 ? ALA A 1240 MET A 1244 5 ? 5  
HELX_P HELX_P49 AF4 THR A 1261 ? SER A 1265 ? THR A 1261 SER A 1265 5 ? 5  
HELX_P HELX_P50 AF5 GLU A 1270 ? LEU A 1275 ? GLU A 1270 LEU A 1275 5 ? 6  
HELX_P HELX_P51 AF6 GLY A 1276 ? ARG A 1294 ? GLY A 1276 ARG A 1294 1 ? 19 
HELX_P HELX_P52 AF7 THR A 1307 ? CYS A 1315 ? THR A 1307 CYS A 1315 1 ? 9  
HELX_P HELX_P53 AF8 ASP A 1317 ? ILE A 1323 ? ASP A 1317 ILE A 1323 1 ? 7  
HELX_P HELX_P54 AF9 GLU A 1327 ? TYR A 1331 ? GLU A 1327 TYR A 1331 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 49  SG ? ? ? 1_555 C FES . FE2 ? ? A CYS 49  A FES 3002 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc2 metalc ? ? A CYS 52  SG ? ? ? 1_555 C FES . FE1 ? ? A CYS 52  A FES 3002 1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc3 metalc ? ? A CYS 74  SG ? ? ? 1_555 C FES . FE1 ? ? A CYS 74  A FES 3002 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc4 metalc ? ? A CYS 114 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 114 A FES 3001 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc5 metalc ? ? A CYS 117 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 117 A FES 3001 1_555 ? ? ? ? ? ? ? 1.977 ? 
metalc6 metalc ? ? A CYS 149 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 149 A FES 3001 1_555 ? ? ? ? ? ? ? 2.118 ? 
metalc7 metalc ? ? A CYS 151 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 151 A FES 3001 1_555 ? ? ? ? ? ? ? 2.466 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 701  A . ? GLU 701  A PRO 702  A ? PRO 702  A 1 -0.12 
2 SER 1304 A . ? SER 1304 A PRO 1305 A ? PRO 1305 A 1 -1.01 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 5 ? 
AA4 ? 4 ? 
AA5 ? 5 ? 
AA6 ? 8 ? 
AA7 ? 3 ? 
AA8 ? 5 ? 
AA9 ? 2 ? 
AB1 ? 4 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA6 6 7 ? parallel      
AA6 7 8 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? parallel      
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 14   ? LYS A 19   ? ARG A 14   LYS A 19   
AA1 2 GLU A 6    ? VAL A 11   ? GLU A 6    VAL A 11   
AA1 3 ALA A 85   ? THR A 87   ? ALA A 85   THR A 87   
AA1 4 THR A 53   ? ASN A 60   ? THR A 53   ASN A 60   
AA1 5 ARG A 65   ? ASN A 72   ? ARG A 65   ASN A 72   
AA2 1 ARG A 234  ? GLY A 237  ? ARG A 234  GLY A 237  
AA2 2 MET A 242  ? SER A 245  ? MET A 242  SER A 245  
AA2 3 VAL A 284  ? ILE A 286  ? VAL A 284  ILE A 286  
AA3 1 VAL A 297  ? HIS A 299  ? VAL A 297  HIS A 299  
AA3 2 GLY A 303  ? GLY A 307  ? GLY A 303  GLY A 307  
AA3 3 ILE A 410  ? PRO A 417  ? ILE A 410  PRO A 417  
AA3 4 THR A 378  ? LEU A 382  ? THR A 378  LEU A 382  
AA3 5 LYS A 387  ? PRO A 391  ? LYS A 387  PRO A 391  
AA4 1 GLU A 423  ? GLN A 430  ? GLU A 423  GLN A 430  
AA4 2 VAL A 441  ? PHE A 448  ? VAL A 441  PHE A 448  
AA4 3 GLU A 458  ? GLY A 464  ? GLU A 458  GLY A 464  
AA4 4 ILE A 471  ? CYS A 472  ? ILE A 471  CYS A 472  
AA5 1 CYS A 562  ? LYS A 566  ? CYS A 562  LYS A 566  
AA5 2 GLU A 1247 ? LEU A 1252 ? GLU A 1247 LEU A 1252 
AA5 3 HIS A 1180 ? ASP A 1190 ? HIS A 1180 ASP A 1190 
AA5 4 TYR A 1161 ? ASP A 1174 ? TYR A 1161 ASP A 1174 
AA5 5 LYS A 1003 ? VAL A 1016 ? LYS A 1003 VAL A 1016 
AA6 1 VAL A 638  ? MET A 642  ? VAL A 638  MET A 642  
AA6 2 LEU A 674  ? ALA A 680  ? LEU A 674  ALA A 680  
AA6 3 LEU A 610  ? THR A 616  ? LEU A 610  THR A 616  
AA6 4 VAL A 832  ? VAL A 835  ? VAL A 832  VAL A 835  
AA6 5 SER A 757  ? PRO A 762  ? SER A 757  PRO A 762  
AA6 6 MET A 769  ? VAL A 773  ? MET A 769  VAL A 773  
AA6 7 VAL A 796  ? VAL A 800  ? VAL A 796  VAL A 800  
AA6 8 THR A 1075 ? SER A 1076 ? THR A 1075 SER A 1076 
AA7 1 LYS A 667  ? VAL A 668  ? LYS A 667  VAL A 668  
AA7 2 ALA A 622  ? ASP A 628  ? ALA A 622  ASP A 628  
AA7 3 LYS A 694  ? ASP A 699  ? LYS A 694  ASP A 699  
AA8 1 ARG A 721  ? TYR A 725  ? ARG A 721  TYR A 725  
AA8 2 ASN A 902  ? ARG A 911  ? ASN A 902  ARG A 911  
AA8 3 ILE A 865  ? GLY A 877  ? ILE A 865  GLY A 877  
AA8 4 TYR A 851  ? PHE A 859  ? TYR A 851  PHE A 859  
AA8 5 GLN A 737  ? MET A 745  ? GLN A 737  MET A 745  
AA9 1 ILE A 959  ? GLN A 961  ? ILE A 959  GLN A 961  
AA9 2 GLU A 967  ? ASN A 969  ? GLU A 967  ASN A 969  
AB1 1 VAL A 1070 ? HIS A 1071 ? VAL A 1070 HIS A 1071 
AB1 2 VAL A 1038 ? HIS A 1042 ? VAL A 1038 HIS A 1042 
AB1 3 ALA A 1026 ? ILE A 1032 ? ALA A 1026 ILE A 1032 
AB1 4 SER A 1137 ? PHE A 1142 ? SER A 1137 PHE A 1142 
AB2 1 ASP A 1148 ? ASN A 1150 ? ASP A 1148 ASN A 1150 
AB2 2 GLU A 1155 ? GLN A 1157 ? GLU A 1155 GLN A 1157 
AB3 1 ASN A 1221 ? TYR A 1222 ? ASN A 1221 TYR A 1222 
AB3 2 LEU A 1228 ? HIS A 1229 ? LEU A 1228 HIS A 1229 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLU A 18   ? O GLU A 18   N LEU A 7    ? N LEU A 7    
AA1 2 3 N TYR A 10   ? N TYR A 10   O VAL A 86   ? O VAL A 86   
AA1 3 4 O THR A 87   ? O THR A 87   N MET A 55   ? N MET A 55   
AA1 4 5 N ASN A 60   ? N ASN A 60   O ARG A 65   ? O ARG A 65   
AA2 1 2 N PHE A 236  ? N PHE A 236  O TRP A 243  ? O TRP A 243  
AA2 2 3 N MET A 242  ? N MET A 242  O ILE A 285  ? O ILE A 285  
AA3 1 2 N ASN A 298  ? N ASN A 298  O THR A 305  ? O THR A 305  
AA3 2 3 N LEU A 306  ? N LEU A 306  O VAL A 414  ? O VAL A 414  
AA3 3 4 O SER A 413  ? O SER A 413  N ASN A 380  ? N ASN A 380  
AA3 4 5 N LEU A 379  ? N LEU A 379  O ILE A 390  ? O ILE A 390  
AA4 1 2 N PHE A 428  ? N PHE A 428  O SER A 443  ? O SER A 443  
AA4 2 3 N GLY A 444  ? N GLY A 444  O SER A 462  ? O SER A 462  
AA4 3 4 N TYR A 463  ? N TYR A 463  O ILE A 471  ? O ILE A 471  
AA5 1 2 N THR A 564  ? N THR A 564  O ILE A 1250 ? O ILE A 1250 
AA5 2 3 O ALA A 1251 ? O ALA A 1251 N ILE A 1187 ? N ILE A 1187 
AA5 3 4 O ASP A 1190 ? O ASP A 1190 N TYR A 1164 ? N TYR A 1164 
AA5 4 5 O VAL A 1163 ? O VAL A 1163 N PHE A 1014 ? N PHE A 1014 
AA6 1 2 N VAL A 639  ? N VAL A 639  O LEU A 679  ? O LEU A 679  
AA6 2 3 O VAL A 678  ? O VAL A 678  N THR A 613  ? N THR A 613  
AA6 3 4 N LEU A 612  ? N LEU A 612  O ARG A 833  ? O ARG A 833  
AA6 4 5 O VAL A 832  ? O VAL A 832  N VAL A 760  ? N VAL A 760  
AA6 5 6 N LEU A 759  ? N LEU A 759  O TYR A 772  ? O TYR A 772  
AA6 6 7 N VAL A 771  ? N VAL A 771  O HIS A 799  ? O HIS A 799  
AA6 7 8 N VAL A 800  ? N VAL A 800  O THR A 1075 ? O THR A 1075 
AA7 1 2 O VAL A 668  ? O VAL A 668  N ALA A 622  ? N ALA A 622  
AA7 2 3 N LYS A 623  ? N LYS A 623  O GLN A 698  ? O GLN A 698  
AA8 1 2 N LEU A 723  ? N LEU A 723  O CYS A 905  ? O CYS A 905  
AA8 2 3 O ARG A 906  ? O ARG A 906  N HIS A 872  ? N HIS A 872  
AA8 3 4 O ASP A 869  ? O ASP A 869  N LYS A 856  ? N LYS A 856  
AA8 4 5 O TYR A 851  ? O TYR A 851  N MET A 745  ? N MET A 745  
AA9 1 2 N ASP A 960  ? N ASP A 960  O ILE A 968  ? O ILE A 968  
AB1 1 2 O HIS A 1071 ? O HIS A 1071 N VAL A 1038 ? N VAL A 1038 
AB1 2 3 O THR A 1041 ? O THR A 1041 N LEU A 1029 ? N LEU A 1029 
AB1 3 4 N ALA A 1026 ? N ALA A 1026 O PHE A 1142 ? O PHE A 1142 
AB2 1 2 N ASN A 1150 ? N ASN A 1150 O GLU A 1155 ? O GLU A 1155 
AB3 1 2 N ASN A 1221 ? N ASN A 1221 O HIS A 1229 ? O HIS A 1229 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FES 3001 ? 7  'binding site for residue FES A 3001' 
AC2 Software A FES 3002 ? 8  'binding site for residue FES A 3002' 
AC3 Software A MTE 3003 ? 19 'binding site for residue MTE A 3003' 
AC4 Software A FAD 3004 ? 21 'binding site for residue FAD A 3004' 
AC5 Software A MOS 3005 ? 6  'binding site for residue MOS A 3005' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  GLN A 113  ? GLN A 113  . ? 1_555 ? 
2  AC1 7  CYS A 114  ? CYS A 114  . ? 1_555 ? 
3  AC1 7  GLY A 115  ? GLY A 115  . ? 1_555 ? 
4  AC1 7  CYS A 117  ? CYS A 117  . ? 1_555 ? 
5  AC1 7  CYS A 149  ? CYS A 149  . ? 1_555 ? 
6  AC1 7  CYS A 151  ? CYS A 151  . ? 1_555 ? 
7  AC1 7  MET A 753  ? MET A 753  . ? 1_555 ? 
8  AC2 8  GLY A 43   ? GLY A 43   . ? 1_555 ? 
9  AC2 8  CYS A 44   ? CYS A 44   . ? 1_555 ? 
10 AC2 8  GLY A 45   ? GLY A 45   . ? 1_555 ? 
11 AC2 8  CYS A 49   ? CYS A 49   . ? 1_555 ? 
12 AC2 8  GLY A 50   ? GLY A 50   . ? 1_555 ? 
13 AC2 8  ALA A 51   ? ALA A 51   . ? 1_555 ? 
14 AC2 8  CYS A 52   ? CYS A 52   . ? 1_555 ? 
15 AC2 8  CYS A 74   ? CYS A 74   . ? 1_555 ? 
16 AC3 19 GLN A 113  ? GLN A 113  . ? 1_555 ? 
17 AC3 19 CYS A 151  ? CYS A 151  . ? 1_555 ? 
18 AC3 19 GLY A 805  ? GLY A 805  . ? 1_555 ? 
19 AC3 19 ALA A 806  ? ALA A 806  . ? 1_555 ? 
20 AC3 19 PHE A 807  ? PHE A 807  . ? 1_555 ? 
21 AC3 19 GLY A 808  ? GLY A 808  . ? 1_555 ? 
22 AC3 19 ARG A 921  ? ARG A 921  . ? 1_555 ? 
23 AC3 19 MET A 1047 ? MET A 1047 . ? 1_555 ? 
24 AC3 19 GLY A 1048 ? GLY A 1048 . ? 1_555 ? 
25 AC3 19 GLN A 1049 ? GLN A 1049 . ? 1_555 ? 
26 AC3 19 GLY A 1087 ? GLY A 1087 . ? 1_555 ? 
27 AC3 19 GLY A 1088 ? GLY A 1088 . ? 1_555 ? 
28 AC3 19 SER A 1089 ? SER A 1089 . ? 1_555 ? 
29 AC3 19 VAL A 1090 ? VAL A 1090 . ? 1_555 ? 
30 AC3 19 VAL A 1091 ? VAL A 1091 . ? 1_555 ? 
31 AC3 19 ALA A 1092 ? ALA A 1092 . ? 1_555 ? 
32 AC3 19 GLN A 1203 ? GLN A 1203 . ? 1_555 ? 
33 AC3 19 LEU A 1268 ? LEU A 1268 . ? 1_555 ? 
34 AC3 19 MOS F .    ? MOS A 3005 . ? 1_555 ? 
35 AC4 21 GLY A 46   ? GLY A 46   . ? 1_555 ? 
36 AC4 21 PRO A 263  ? PRO A 263  . ? 1_555 ? 
37 AC4 21 VAL A 264  ? VAL A 264  . ? 1_555 ? 
38 AC4 21 MET A 266  ? MET A 266  . ? 1_555 ? 
39 AC4 21 GLY A 267  ? GLY A 267  . ? 1_555 ? 
40 AC4 21 ASN A 268  ? ASN A 268  . ? 1_555 ? 
41 AC4 21 THR A 269  ? THR A 269  . ? 1_555 ? 
42 AC4 21 SER A 270  ? SER A 270  . ? 1_555 ? 
43 AC4 21 VAL A 271  ? VAL A 271  . ? 1_555 ? 
44 AC4 21 LEU A 344  ? LEU A 344  . ? 1_555 ? 
45 AC4 21 ALA A 345  ? ALA A 345  . ? 1_555 ? 
46 AC4 21 ALA A 353  ? ALA A 353  . ? 1_555 ? 
47 AC4 21 SER A 354  ? SER A 354  . ? 1_555 ? 
48 AC4 21 GLY A 357  ? GLY A 357  . ? 1_555 ? 
49 AC4 21 HIS A 358  ? HIS A 358  . ? 1_555 ? 
50 AC4 21 HIS A 363  ? HIS A 363  . ? 1_555 ? 
51 AC4 21 SER A 366  ? SER A 366  . ? 1_555 ? 
52 AC4 21 ASP A 367  ? ASP A 367  . ? 1_555 ? 
53 AC4 21 LEU A 411  ? LEU A 411  . ? 1_555 ? 
54 AC4 21 ARG A 429  ? ARG A 429  . ? 1_555 ? 
55 AC4 21 LEU A 438  ? LEU A 438  . ? 1_555 ? 
56 AC5 6  GLN A 776  ? GLN A 776  . ? 1_555 ? 
57 AC5 6  PHE A 923  ? PHE A 923  . ? 1_555 ? 
58 AC5 6  GLY A 1087 ? GLY A 1087 . ? 1_555 ? 
59 AC5 6  GLY A 1088 ? GLY A 1088 . ? 1_555 ? 
60 AC5 6  GLU A 1270 ? GLU A 1270 . ? 1_555 ? 
61 AC5 6  MTE D .    ? MTE A 3003 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5EPG 
_atom_sites.fract_transf_matrix[1][1]   0.006782 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006782 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007592 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
FE 
MO 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ALA A 1 4    ? -64.876 -52.387 -59.118 1.00 117.30 ? 4    ALA A N     1 
ATOM   2     C  CA    . ALA A 1 4    ? -65.396 -52.137 -60.485 1.00 120.14 ? 4    ALA A CA    1 
ATOM   3     C  C     . ALA A 1 4    ? -65.443 -50.649 -60.829 1.00 125.23 ? 4    ALA A C     1 
ATOM   4     O  O     . ALA A 1 4    ? -64.963 -50.307 -61.882 1.00 127.54 ? 4    ALA A O     1 
ATOM   5     C  CB    . ALA A 1 4    ? -66.757 -52.808 -60.695 1.00 110.83 ? 4    ALA A CB    1 
ATOM   6     N  N     . SER A 1 5    ? -65.986 -49.789 -59.956 1.00 119.99 ? 5    SER A N     1 
ATOM   7     C  CA    . SER A 1 5    ? -66.313 -48.416 -60.326 1.00 113.33 ? 5    SER A CA    1 
ATOM   8     C  C     . SER A 1 5    ? -65.116 -47.560 -60.749 1.00 104.40 ? 5    SER A C     1 
ATOM   9     O  O     . SER A 1 5    ? -63.962 -47.894 -60.462 1.00 92.84  ? 5    SER A O     1 
ATOM   10    C  CB    . SER A 1 5    ? -67.085 -47.703 -59.208 1.00 107.45 ? 5    SER A CB    1 
ATOM   11    O  OG    . SER A 1 5    ? -68.428 -48.145 -59.173 1.00 101.54 ? 5    SER A OG    1 
ATOM   12    N  N     . GLU A 1 6    ? -65.433 -46.471 -61.450 1.00 104.19 ? 6    GLU A N     1 
ATOM   13    C  CA    . GLU A 1 6    ? -64.468 -45.492 -61.910 1.00 114.81 ? 6    GLU A CA    1 
ATOM   14    C  C     . GLU A 1 6    ? -64.638 -44.201 -61.139 1.00 108.24 ? 6    GLU A C     1 
ATOM   15    O  O     . GLU A 1 6    ? -65.748 -43.789 -60.884 1.00 131.10 ? 6    GLU A O     1 
ATOM   16    C  CB    . GLU A 1 6    ? -64.710 -45.130 -63.378 1.00 127.58 ? 6    GLU A CB    1 
ATOM   17    C  CG    . GLU A 1 6    ? -64.654 -46.280 -64.367 1.00 148.95 ? 6    GLU A CG    1 
ATOM   18    C  CD    . GLU A 1 6    ? -64.575 -45.802 -65.817 1.00 164.28 ? 6    GLU A CD    1 
ATOM   19    O  OE1   . GLU A 1 6    ? -65.018 -44.668 -66.111 1.00 161.23 ? 6    GLU A OE1   1 
ATOM   20    O  OE2   . GLU A 1 6    ? -64.067 -46.562 -66.673 1.00 180.11 ? 6    GLU A OE2   1 
ATOM   21    N  N     . LEU A 1 7    ? -63.524 -43.572 -60.791 1.00 98.51  ? 7    LEU A N     1 
ATOM   22    C  CA    . LEU A 1 7    ? -63.537 -42.282 -60.114 1.00 94.65  ? 7    LEU A CA    1 
ATOM   23    C  C     . LEU A 1 7    ? -63.515 -41.207 -61.190 1.00 92.40  ? 7    LEU A C     1 
ATOM   24    O  O     . LEU A 1 7    ? -62.646 -41.230 -62.069 1.00 95.35  ? 7    LEU A O     1 
ATOM   25    C  CB    . LEU A 1 7    ? -62.317 -42.144 -59.214 1.00 91.08  ? 7    LEU A CB    1 
ATOM   26    C  CG    . LEU A 1 7    ? -62.067 -40.742 -58.670 1.00 92.93  ? 7    LEU A CG    1 
ATOM   27    C  CD1   . LEU A 1 7    ? -63.303 -40.152 -57.995 1.00 97.14  ? 7    LEU A CD1   1 
ATOM   28    C  CD2   . LEU A 1 7    ? -60.889 -40.798 -57.717 1.00 93.89  ? 7    LEU A CD2   1 
ATOM   29    N  N     . LEU A 1 8    ? -64.477 -40.294 -61.131 1.00 88.89  ? 8    LEU A N     1 
ATOM   30    C  CA    . LEU A 1 8    ? -64.600 -39.224 -62.123 1.00 99.50  ? 8    LEU A CA    1 
ATOM   31    C  C     . LEU A 1 8    ? -64.827 -37.903 -61.402 1.00 94.47  ? 8    LEU A C     1 
ATOM   32    O  O     . LEU A 1 8    ? -65.839 -37.710 -60.718 1.00 98.11  ? 8    LEU A O     1 
ATOM   33    C  CB    . LEU A 1 8    ? -65.743 -39.548 -63.100 1.00 107.37 ? 8    LEU A CB    1 
ATOM   34    C  CG    . LEU A 1 8    ? -66.306 -38.441 -64.015 1.00 111.36 ? 8    LEU A CG    1 
ATOM   35    C  CD1   . LEU A 1 8    ? -65.237 -37.751 -64.843 1.00 113.18 ? 8    LEU A CD1   1 
ATOM   36    C  CD2   . LEU A 1 8    ? -67.385 -38.998 -64.933 1.00 113.18 ? 8    LEU A CD2   1 
ATOM   37    N  N     . PHE A 1 9    ? -63.870 -36.996 -61.566 1.00 86.80  ? 9    PHE A N     1 
ATOM   38    C  CA    . PHE A 1 9    ? -64.017 -35.633 -61.093 1.00 83.66  ? 9    PHE A CA    1 
ATOM   39    C  C     . PHE A 1 9    ? -63.298 -34.681 -62.027 1.00 76.91  ? 9    PHE A C     1 
ATOM   40    O  O     . PHE A 1 9    ? -62.745 -35.113 -63.019 1.00 74.88  ? 9    PHE A O     1 
ATOM   41    C  CB    . PHE A 1 9    ? -63.530 -35.515 -59.646 1.00 87.70  ? 9    PHE A CB    1 
ATOM   42    C  CG    . PHE A 1 9    ? -62.093 -35.897 -59.451 1.00 86.07  ? 9    PHE A CG    1 
ATOM   43    C  CD1   . PHE A 1 9    ? -61.700 -37.221 -59.542 1.00 81.12  ? 9    PHE A CD1   1 
ATOM   44    C  CD2   . PHE A 1 9    ? -61.142 -34.925 -59.157 1.00 83.16  ? 9    PHE A CD2   1 
ATOM   45    C  CE1   . PHE A 1 9    ? -60.387 -37.572 -59.364 1.00 82.17  ? 9    PHE A CE1   1 
ATOM   46    C  CE2   . PHE A 1 9    ? -59.831 -35.271 -58.976 1.00 84.48  ? 9    PHE A CE2   1 
ATOM   47    C  CZ    . PHE A 1 9    ? -59.452 -36.600 -59.080 1.00 86.56  ? 9    PHE A CZ    1 
ATOM   48    N  N     . TYR A 1 10   ? -63.331 -33.400 -61.698 1.00 75.74  ? 10   TYR A N     1 
ATOM   49    C  CA    . TYR A 1 10   ? -62.664 -32.372 -62.481 1.00 85.19  ? 10   TYR A CA    1 
ATOM   50    C  C     . TYR A 1 10   ? -61.603 -31.689 -61.646 1.00 81.20  ? 10   TYR A C     1 
ATOM   51    O  O     . TYR A 1 10   ? -61.740 -31.576 -60.429 1.00 79.91  ? 10   TYR A O     1 
ATOM   52    C  CB    . TYR A 1 10   ? -63.683 -31.345 -62.986 1.00 93.90  ? 10   TYR A CB    1 
ATOM   53    C  CG    . TYR A 1 10   ? -64.299 -31.685 -64.352 1.00 102.80 ? 10   TYR A CG    1 
ATOM   54    C  CD1   . TYR A 1 10   ? -65.076 -32.846 -64.542 1.00 99.54  ? 10   TYR A CD1   1 
ATOM   55    C  CD2   . TYR A 1 10   ? -64.113 -30.835 -65.447 1.00 95.56  ? 10   TYR A CD2   1 
ATOM   56    C  CE1   . TYR A 1 10   ? -65.633 -33.136 -65.778 1.00 98.39  ? 10   TYR A CE1   1 
ATOM   57    C  CE2   . TYR A 1 10   ? -64.665 -31.122 -66.678 1.00 93.83  ? 10   TYR A CE2   1 
ATOM   58    C  CZ    . TYR A 1 10   ? -65.417 -32.266 -66.845 1.00 96.90  ? 10   TYR A CZ    1 
ATOM   59    O  OH    . TYR A 1 10   ? -65.947 -32.519 -68.094 1.00 101.24 ? 10   TYR A OH    1 
ATOM   60    N  N     . VAL A 1 11   ? -60.527 -31.281 -62.310 1.00 76.36  ? 11   VAL A N     1 
ATOM   61    C  CA    . VAL A 1 11   ? -59.460 -30.489 -61.708 1.00 73.53  ? 11   VAL A CA    1 
ATOM   62    C  C     . VAL A 1 11   ? -59.141 -29.387 -62.690 1.00 74.98  ? 11   VAL A C     1 
ATOM   63    O  O     . VAL A 1 11   ? -58.826 -29.658 -63.835 1.00 81.62  ? 11   VAL A O     1 
ATOM   64    C  CB    . VAL A 1 11   ? -58.212 -31.326 -61.417 1.00 75.49  ? 11   VAL A CB    1 
ATOM   65    C  CG1   . VAL A 1 11   ? -57.064 -30.448 -60.930 1.00 77.73  ? 11   VAL A CG1   1 
ATOM   66    C  CG2   . VAL A 1 11   ? -58.546 -32.383 -60.377 1.00 78.08  ? 11   VAL A CG2   1 
ATOM   67    N  N     . ASN A 1 12   ? -59.273 -28.141 -62.248 1.00 81.03  ? 12   ASN A N     1 
ATOM   68    C  CA    . ASN A 1 12   ? -59.055 -26.973 -63.099 1.00 83.14  ? 12   ASN A CA    1 
ATOM   69    C  C     . ASN A 1 12   ? -59.772 -27.038 -64.444 1.00 86.00  ? 12   ASN A C     1 
ATOM   70    O  O     . ASN A 1 12   ? -59.181 -26.780 -65.484 1.00 95.45  ? 12   ASN A O     1 
ATOM   71    C  CB    . ASN A 1 12   ? -57.553 -26.701 -63.275 1.00 83.57  ? 12   ASN A CB    1 
ATOM   72    C  CG    . ASN A 1 12   ? -56.840 -26.434 -61.949 1.00 85.93  ? 12   ASN A CG    1 
ATOM   73    O  OD1   . ASN A 1 12   ? -57.447 -26.002 -60.976 1.00 89.79  ? 12   ASN A OD1   1 
ATOM   74    N  ND2   . ASN A 1 12   ? -55.540 -26.679 -61.915 1.00 87.83  ? 12   ASN A ND2   1 
ATOM   75    N  N     . GLY A 1 13   ? -61.043 -27.426 -64.416 1.00 94.23  ? 13   GLY A N     1 
ATOM   76    C  CA    . GLY A 1 13   ? -61.850 -27.499 -65.634 1.00 103.13 ? 13   GLY A CA    1 
ATOM   77    C  C     . GLY A 1 13   ? -61.684 -28.739 -66.499 1.00 97.15  ? 13   GLY A C     1 
ATOM   78    O  O     . GLY A 1 13   ? -62.518 -28.983 -67.359 1.00 107.54 ? 13   GLY A O     1 
ATOM   79    N  N     . ARG A 1 14   ? -60.636 -29.526 -66.280 1.00 92.26  ? 14   ARG A N     1 
ATOM   80    C  CA    . ARG A 1 14   ? -60.388 -30.715 -67.096 1.00 94.37  ? 14   ARG A CA    1 
ATOM   81    C  C     . ARG A 1 14   ? -60.884 -31.968 -66.391 1.00 91.17  ? 14   ARG A C     1 
ATOM   82    O  O     . ARG A 1 14   ? -60.639 -32.172 -65.205 1.00 86.96  ? 14   ARG A O     1 
ATOM   83    C  CB    . ARG A 1 14   ? -58.908 -30.813 -67.450 1.00 103.70 ? 14   ARG A CB    1 
ATOM   84    C  CG    . ARG A 1 14   ? -58.606 -30.909 -68.946 1.00 113.03 ? 14   ARG A CG    1 
ATOM   85    C  CD    . ARG A 1 14   ? -57.111 -30.799 -69.230 1.00 110.80 ? 14   ARG A CD    1 
ATOM   86    N  NE    . ARG A 1 14   ? -56.679 -29.398 -69.183 1.00 124.39 ? 14   ARG A NE    1 
ATOM   87    C  CZ    . ARG A 1 14   ? -56.298 -28.718 -68.088 1.00 136.01 ? 14   ARG A CZ    1 
ATOM   88    N  NH1   . ARG A 1 14   ? -56.268 -29.276 -66.874 1.00 138.80 ? 14   ARG A NH1   1 
ATOM   89    N  NH2   . ARG A 1 14   ? -55.926 -27.444 -68.204 1.00 137.25 ? 14   ARG A NH2   1 
ATOM   90    N  N     . LYS A 1 15   ? -61.577 -32.814 -67.143 1.00 92.45  ? 15   LYS A N     1 
ATOM   91    C  CA    . LYS A 1 15   ? -62.045 -34.107 -66.649 1.00 96.43  ? 15   LYS A CA    1 
ATOM   92    C  C     . LYS A 1 15   ? -60.874 -35.020 -66.247 1.00 90.68  ? 15   LYS A C     1 
ATOM   93    O  O     . LYS A 1 15   ? -59.828 -35.003 -66.900 1.00 102.98 ? 15   LYS A O     1 
ATOM   94    C  CB    . LYS A 1 15   ? -62.941 -34.799 -67.693 1.00 99.92  ? 15   LYS A CB    1 
ATOM   95    C  CG    . LYS A 1 15   ? -63.487 -36.162 -67.266 1.00 99.92  ? 15   LYS A CG    1 
ATOM   96    C  CD    . LYS A 1 15   ? -64.732 -36.583 -68.041 1.00 100.55 ? 15   LYS A CD    1 
ATOM   97    C  CE    . LYS A 1 15   ? -64.401 -36.913 -69.487 1.00 106.73 ? 15   LYS A CE    1 
ATOM   98    N  NZ    . LYS A 1 15   ? -65.616 -37.191 -70.302 1.00 111.44 ? 15   LYS A NZ    1 
ATOM   99    N  N     . VAL A 1 16   ? -61.060 -35.770 -65.172 1.00 76.58  ? 16   VAL A N     1 
ATOM   100   C  CA    . VAL A 1 16   ? -60.051 -36.684 -64.661 1.00 74.92  ? 16   VAL A CA    1 
ATOM   101   C  C     . VAL A 1 16   ? -60.736 -38.013 -64.415 1.00 78.53  ? 16   VAL A C     1 
ATOM   102   O  O     . VAL A 1 16   ? -61.817 -38.049 -63.813 1.00 79.37  ? 16   VAL A O     1 
ATOM   103   C  CB    . VAL A 1 16   ? -59.485 -36.140 -63.336 1.00 82.12  ? 16   VAL A CB    1 
ATOM   104   C  CG1   . VAL A 1 16   ? -58.774 -37.221 -62.520 1.00 87.15  ? 16   VAL A CG1   1 
ATOM   105   C  CG2   . VAL A 1 16   ? -58.564 -34.969 -63.609 1.00 81.95  ? 16   VAL A CG2   1 
ATOM   106   N  N     . ILE A 1 17   ? -60.125 -39.094 -64.888 1.00 86.27  ? 17   ILE A N     1 
ATOM   107   C  CA    . ILE A 1 17   ? -60.695 -40.425 -64.742 1.00 91.86  ? 17   ILE A CA    1 
ATOM   108   C  C     . ILE A 1 17   ? -59.624 -41.335 -64.188 1.00 88.15  ? 17   ILE A C     1 
ATOM   109   O  O     . ILE A 1 17   ? -58.501 -41.352 -64.682 1.00 88.05  ? 17   ILE A O     1 
ATOM   110   C  CB    . ILE A 1 17   ? -61.268 -40.971 -66.058 1.00 95.84  ? 17   ILE A CB    1 
ATOM   111   C  CG1   . ILE A 1 17   ? -62.460 -40.114 -66.498 1.00 94.07  ? 17   ILE A CG1   1 
ATOM   112   C  CG2   . ILE A 1 17   ? -61.725 -42.414 -65.869 1.00 106.15 ? 17   ILE A CG2   1 
ATOM   113   C  CD1   . ILE A 1 17   ? -63.000 -40.466 -67.861 1.00 96.22  ? 17   ILE A CD1   1 
ATOM   114   N  N     . GLU A 1 18   ? -59.963 -42.064 -63.141 1.00 86.20  ? 18   GLU A N     1 
ATOM   115   C  CA    . GLU A 1 18   ? -59.123 -43.158 -62.668 1.00 96.06  ? 18   GLU A CA    1 
ATOM   116   C  C     . GLU A 1 18   ? -59.950 -44.401 -62.621 1.00 100.58 ? 18   GLU A C     1 
ATOM   117   O  O     . GLU A 1 18   ? -61.002 -44.425 -61.985 1.00 99.47  ? 18   GLU A O     1 
ATOM   118   C  CB    . GLU A 1 18   ? -58.446 -42.856 -61.324 1.00 99.23  ? 18   GLU A CB    1 
ATOM   119   C  CG    . GLU A 1 18   ? -57.121 -42.116 -61.441 1.00 96.77  ? 18   GLU A CG    1 
ATOM   120   C  CD    . GLU A 1 18   ? -56.117 -42.831 -62.328 1.00 103.54 ? 18   GLU A CD    1 
ATOM   121   O  OE1   . GLU A 1 18   ? -56.355 -44.010 -62.692 1.00 98.30  ? 18   GLU A OE1   1 
ATOM   122   O  OE2   . GLU A 1 18   ? -55.082 -42.211 -62.667 1.00 111.07 ? 18   GLU A OE2   1 
ATOM   123   N  N     . LYS A 1 19   ? -59.483 -45.437 -63.300 1.00 108.18 ? 19   LYS A N     1 
ATOM   124   C  CA    . LYS A 1 19   ? -60.087 -46.774 -63.211 1.00 111.22 ? 19   LYS A CA    1 
ATOM   125   C  C     . LYS A 1 19   ? -59.228 -47.566 -62.234 1.00 103.64 ? 19   LYS A C     1 
ATOM   126   O  O     . LYS A 1 19   ? -58.016 -47.353 -62.142 1.00 111.66 ? 19   LYS A O     1 
ATOM   127   C  CB    . LYS A 1 19   ? -60.144 -47.481 -64.564 1.00 124.63 ? 19   LYS A CB    1 
ATOM   128   C  CG    . LYS A 1 19   ? -61.101 -46.865 -65.572 1.00 124.45 ? 19   LYS A CG    1 
ATOM   129   C  CD    . LYS A 1 19   ? -61.054 -47.594 -66.916 1.00 121.03 ? 19   LYS A CD    1 
ATOM   130   C  CE    . LYS A 1 19   ? -60.909 -46.614 -68.078 1.00 121.86 ? 19   LYS A CE    1 
ATOM   131   N  NZ    . LYS A 1 19   ? -59.614 -45.862 -68.057 1.00 113.85 ? 19   LYS A NZ    1 
ATOM   132   N  N     . ASN A 1 20   ? -59.877 -48.433 -61.472 1.00 95.98  ? 20   ASN A N     1 
ATOM   133   C  CA    . ASN A 1 20   ? -59.224 -49.210 -60.413 1.00 101.06 ? 20   ASN A CA    1 
ATOM   134   C  C     . ASN A 1 20   ? -58.365 -48.371 -59.475 1.00 103.01 ? 20   ASN A C     1 
ATOM   135   O  O     . ASN A 1 20   ? -57.261 -48.769 -59.107 1.00 110.86 ? 20   ASN A O     1 
ATOM   136   C  CB    . ASN A 1 20   ? -58.394 -50.319 -61.016 1.00 103.09 ? 20   ASN A CB    1 
ATOM   137   C  CG    . ASN A 1 20   ? -59.250 -51.422 -61.552 1.00 118.59 ? 20   ASN A CG    1 
ATOM   138   O  OD1   . ASN A 1 20   ? -60.215 -51.840 -60.901 1.00 131.44 ? 20   ASN A OD1   1 
ATOM   139   N  ND2   . ASN A 1 20   ? -58.921 -51.902 -62.744 1.00 129.60 ? 20   ASN A ND2   1 
ATOM   140   N  N     . VAL A 1 21   ? -58.885 -47.208 -59.074 1.00 97.99  ? 21   VAL A N     1 
ATOM   141   C  CA    . VAL A 1 21   ? -58.144 -46.274 -58.213 1.00 97.86  ? 21   VAL A CA    1 
ATOM   142   C  C     . VAL A 1 21   ? -57.907 -46.857 -56.802 1.00 93.52  ? 21   VAL A C     1 
ATOM   143   O  O     . VAL A 1 21   ? -58.770 -47.541 -56.247 1.00 91.88  ? 21   VAL A O     1 
ATOM   144   C  CB    . VAL A 1 21   ? -58.876 -44.914 -58.086 1.00 102.83 ? 21   VAL A CB    1 
ATOM   145   C  CG1   . VAL A 1 21   ? -60.172 -45.042 -57.302 1.00 112.37 ? 21   VAL A CG1   1 
ATOM   146   C  CG2   . VAL A 1 21   ? -57.992 -43.878 -57.418 1.00 106.82 ? 21   VAL A CG2   1 
ATOM   147   N  N     . ASP A 1 22   ? -56.727 -46.582 -56.254 1.00 86.24  ? 22   ASP A N     1 
ATOM   148   C  CA    . ASP A 1 22   ? -56.391 -46.954 -54.889 1.00 99.86  ? 22   ASP A CA    1 
ATOM   149   C  C     . ASP A 1 22   ? -57.116 -45.978 -53.957 1.00 108.84 ? 22   ASP A C     1 
ATOM   150   O  O     . ASP A 1 22   ? -56.886 -44.768 -54.062 1.00 126.18 ? 22   ASP A O     1 
ATOM   151   C  CB    . ASP A 1 22   ? -54.866 -46.844 -54.708 1.00 101.54 ? 22   ASP A CB    1 
ATOM   152   C  CG    . ASP A 1 22   ? -54.331 -47.485 -53.401 1.00 103.34 ? 22   ASP A CG    1 
ATOM   153   O  OD1   . ASP A 1 22   ? -55.089 -47.882 -52.460 1.00 90.13  ? 22   ASP A OD1   1 
ATOM   154   O  OD2   . ASP A 1 22   ? -53.082 -47.578 -53.347 1.00 102.83 ? 22   ASP A OD2   1 
ATOM   155   N  N     . PRO A 1 23   ? -58.010 -46.488 -53.068 1.00 102.79 ? 23   PRO A N     1 
ATOM   156   C  CA    . PRO A 1 23   ? -58.762 -45.585 -52.158 1.00 93.45  ? 23   PRO A CA    1 
ATOM   157   C  C     . PRO A 1 23   ? -57.905 -44.768 -51.190 1.00 89.37  ? 23   PRO A C     1 
ATOM   158   O  O     . PRO A 1 23   ? -58.347 -43.696 -50.758 1.00 84.75  ? 23   PRO A O     1 
ATOM   159   C  CB    . PRO A 1 23   ? -59.642 -46.527 -51.348 1.00 92.09  ? 23   PRO A CB    1 
ATOM   160   C  CG    . PRO A 1 23   ? -59.673 -47.795 -52.115 1.00 96.09  ? 23   PRO A CG    1 
ATOM   161   C  CD    . PRO A 1 23   ? -58.353 -47.895 -52.805 1.00 99.33  ? 23   PRO A CD    1 
ATOM   162   N  N     . GLU A 1 24   ? -56.705 -45.273 -50.871 1.00 87.81  ? 24   GLU A N     1 
ATOM   163   C  CA    . GLU A 1 24   ? -55.744 -44.594 -49.996 1.00 88.10  ? 24   GLU A CA    1 
ATOM   164   C  C     . GLU A 1 24   ? -55.057 -43.366 -50.610 1.00 88.24  ? 24   GLU A C     1 
ATOM   165   O  O     . GLU A 1 24   ? -54.378 -42.641 -49.895 1.00 108.21 ? 24   GLU A O     1 
ATOM   166   C  CB    . GLU A 1 24   ? -54.685 -45.581 -49.521 1.00 87.71  ? 24   GLU A CB    1 
ATOM   167   C  CG    . GLU A 1 24   ? -55.224 -46.613 -48.553 1.00 87.46  ? 24   GLU A CG    1 
ATOM   168   C  CD    . GLU A 1 24   ? -54.258 -47.760 -48.334 1.00 89.69  ? 24   GLU A CD    1 
ATOM   169   O  OE1   . GLU A 1 24   ? -54.164 -48.653 -49.240 1.00 80.09  ? 24   GLU A OE1   1 
ATOM   170   O  OE2   . GLU A 1 24   ? -53.612 -47.756 -47.247 1.00 86.56  ? 24   GLU A OE2   1 
ATOM   171   N  N     . THR A 1 25   ? -55.242 -43.136 -51.902 1.00 80.77  ? 25   THR A N     1 
ATOM   172   C  CA    . THR A 1 25   ? -54.688 -41.956 -52.561 1.00 89.75  ? 25   THR A CA    1 
ATOM   173   C  C     . THR A 1 25   ? -55.292 -40.647 -52.027 1.00 89.07  ? 25   THR A C     1 
ATOM   174   O  O     . THR A 1 25   ? -56.509 -40.405 -52.174 1.00 93.34  ? 25   THR A O     1 
ATOM   175   C  CB    . THR A 1 25   ? -54.990 -41.964 -54.066 1.00 94.00  ? 25   THR A CB    1 
ATOM   176   O  OG1   . THR A 1 25   ? -54.915 -43.299 -54.571 1.00 97.17  ? 25   THR A OG1   1 
ATOM   177   C  CG2   . THR A 1 25   ? -54.025 -41.047 -54.816 1.00 100.98 ? 25   THR A CG2   1 
ATOM   178   N  N     . MET A 1 26   ? -54.447 -39.823 -51.417 1.00 84.24  ? 26   MET A N     1 
ATOM   179   C  CA    . MET A 1 26   ? -54.868 -38.480 -51.013 1.00 88.14  ? 26   MET A CA    1 
ATOM   180   C  C     . MET A 1 26   ? -54.702 -37.488 -52.174 1.00 78.23  ? 26   MET A C     1 
ATOM   181   O  O     . MET A 1 26   ? -53.887 -37.691 -53.052 1.00 72.14  ? 26   MET A O     1 
ATOM   182   C  CB    . MET A 1 26   ? -54.185 -38.043 -49.715 1.00 92.36  ? 26   MET A CB    1 
ATOM   183   C  CG    . MET A 1 26   ? -54.518 -38.954 -48.536 1.00 98.71  ? 26   MET A CG    1 
ATOM   184   S  SD    . MET A 1 26   ? -56.176 -38.817 -47.822 1.00 94.61  ? 26   MET A SD    1 
ATOM   185   C  CE    . MET A 1 26   ? -56.053 -40.047 -46.496 1.00 102.54 ? 26   MET A CE    1 
ATOM   186   N  N     . LEU A 1 27   ? -55.486 -36.417 -52.143 1.00 71.57  ? 27   LEU A N     1 
ATOM   187   C  CA    . LEU A 1 27   ? -55.548 -35.427 -53.228 1.00 77.30  ? 27   LEU A CA    1 
ATOM   188   C  C     . LEU A 1 27   ? -54.232 -34.684 -53.447 1.00 78.21  ? 27   LEU A C     1 
ATOM   189   O  O     . LEU A 1 27   ? -53.845 -34.430 -54.593 1.00 70.35  ? 27   LEU A O     1 
ATOM   190   C  CB    . LEU A 1 27   ? -56.710 -34.432 -52.972 1.00 72.42  ? 27   LEU A CB    1 
ATOM   191   C  CG    . LEU A 1 27   ? -56.826 -33.221 -53.911 1.00 73.67  ? 27   LEU A CG    1 
ATOM   192   C  CD1   . LEU A 1 27   ? -56.948 -33.652 -55.372 1.00 77.02  ? 27   LEU A CD1   1 
ATOM   193   C  CD2   . LEU A 1 27   ? -57.973 -32.308 -53.515 1.00 69.24  ? 27   LEU A CD2   1 
ATOM   194   N  N     . LEU A 1 28   ? -53.548 -34.329 -52.370 1.00 77.25  ? 28   LEU A N     1 
ATOM   195   C  CA    . LEU A 1 28   ? -52.311 -33.528 -52.502 1.00 76.05  ? 28   LEU A CA    1 
ATOM   196   C  C     . LEU A 1 28   ? -51.221 -34.249 -53.287 1.00 77.27  ? 28   LEU A C     1 
ATOM   197   O  O     . LEU A 1 28   ? -50.720 -33.688 -54.237 1.00 82.23  ? 28   LEU A O     1 
ATOM   198   C  CB    . LEU A 1 28   ? -51.746 -33.055 -51.175 1.00 80.05  ? 28   LEU A CB    1 
ATOM   199   C  CG    . LEU A 1 28   ? -50.533 -32.153 -51.403 1.00 79.57  ? 28   LEU A CG    1 
ATOM   200   C  CD1   . LEU A 1 28   ? -50.919 -30.879 -52.145 1.00 79.80  ? 28   LEU A CD1   1 
ATOM   201   C  CD2   . LEU A 1 28   ? -49.880 -31.852 -50.068 1.00 84.74  ? 28   LEU A CD2   1 
ATOM   202   N  N     . PRO A 1 29   ? -50.847 -35.484 -52.912 1.00 72.05  ? 29   PRO A N     1 
ATOM   203   C  CA    . PRO A 1 29   ? -49.890 -36.188 -53.774 1.00 71.36  ? 29   PRO A CA    1 
ATOM   204   C  C     . PRO A 1 29   ? -50.407 -36.488 -55.181 1.00 73.94  ? 29   PRO A C     1 
ATOM   205   O  O     . PRO A 1 29   ? -49.620 -36.545 -56.115 1.00 82.50  ? 29   PRO A O     1 
ATOM   206   C  CB    . PRO A 1 29   ? -49.676 -37.509 -53.051 1.00 74.72  ? 29   PRO A CB    1 
ATOM   207   C  CG    . PRO A 1 29   ? -50.937 -37.715 -52.294 1.00 75.64  ? 29   PRO A CG    1 
ATOM   208   C  CD    . PRO A 1 29   ? -51.287 -36.338 -51.799 1.00 73.04  ? 29   PRO A CD    1 
ATOM   209   N  N     . TYR A 1 30   ? -51.714 -36.672 -55.337 1.00 76.26  ? 30   TYR A N     1 
ATOM   210   C  CA    . TYR A 1 30   ? -52.310 -36.922 -56.658 1.00 74.99  ? 30   TYR A CA    1 
ATOM   211   C  C     . TYR A 1 30   ? -52.146 -35.718 -57.580 1.00 78.20  ? 30   TYR A C     1 
ATOM   212   O  O     . TYR A 1 30   ? -51.689 -35.872 -58.713 1.00 73.48  ? 30   TYR A O     1 
ATOM   213   C  CB    . TYR A 1 30   ? -53.801 -37.299 -56.535 1.00 74.76  ? 30   TYR A CB    1 
ATOM   214   C  CG    . TYR A 1 30   ? -54.412 -37.715 -57.864 1.00 72.68  ? 30   TYR A CG    1 
ATOM   215   C  CD1   . TYR A 1 30   ? -54.365 -39.034 -58.290 1.00 69.24  ? 30   TYR A CD1   1 
ATOM   216   C  CD2   . TYR A 1 30   ? -55.004 -36.773 -58.707 1.00 73.27  ? 30   TYR A CD2   1 
ATOM   217   C  CE1   . TYR A 1 30   ? -54.895 -39.407 -59.514 1.00 75.33  ? 30   TYR A CE1   1 
ATOM   218   C  CE2   . TYR A 1 30   ? -55.523 -37.131 -59.938 1.00 75.45  ? 30   TYR A CE2   1 
ATOM   219   C  CZ    . TYR A 1 30   ? -55.471 -38.449 -60.345 1.00 78.52  ? 30   TYR A CZ    1 
ATOM   220   O  OH    . TYR A 1 30   ? -55.996 -38.806 -61.583 1.00 82.01  ? 30   TYR A OH    1 
ATOM   221   N  N     . LEU A 1 31   ? -52.542 -34.537 -57.101 1.00 82.61  ? 31   LEU A N     1 
ATOM   222   C  CA    . LEU A 1 31   ? -52.325 -33.279 -57.828 1.00 80.43  ? 31   LEU A CA    1 
ATOM   223   C  C     . LEU A 1 31   ? -50.882 -33.088 -58.261 1.00 82.59  ? 31   LEU A C     1 
ATOM   224   O  O     . LEU A 1 31   ? -50.624 -32.771 -59.414 1.00 96.82  ? 31   LEU A O     1 
ATOM   225   C  CB    . LEU A 1 31   ? -52.712 -32.090 -56.978 1.00 80.33  ? 31   LEU A CB    1 
ATOM   226   C  CG    . LEU A 1 31   ? -54.207 -31.948 -56.902 1.00 86.07  ? 31   LEU A CG    1 
ATOM   227   C  CD1   . LEU A 1 31   ? -54.532 -31.119 -55.686 1.00 93.34  ? 31   LEU A CD1   1 
ATOM   228   C  CD2   . LEU A 1 31   ? -54.741 -31.310 -58.179 1.00 90.16  ? 31   LEU A CD2   1 
ATOM   229   N  N     . ARG A 1 32   ? -49.954 -33.291 -57.336 1.00 75.82  ? 32   ARG A N     1 
ATOM   230   C  CA    . ARG A 1 32   ? -48.535 -33.015 -57.565 1.00 73.87  ? 32   ARG A CA    1 
ATOM   231   C  C     . ARG A 1 32   ? -47.832 -34.056 -58.432 1.00 72.43  ? 32   ARG A C     1 
ATOM   232   O  O     . ARG A 1 32   ? -46.990 -33.693 -59.258 1.00 67.93  ? 32   ARG A O     1 
ATOM   233   C  CB    . ARG A 1 32   ? -47.824 -32.908 -56.209 1.00 79.47  ? 32   ARG A CB    1 
ATOM   234   C  CG    . ARG A 1 32   ? -48.143 -31.650 -55.398 1.00 81.00  ? 32   ARG A CG    1 
ATOM   235   C  CD    . ARG A 1 32   ? -47.498 -31.669 -54.006 1.00 75.59  ? 32   ARG A CD    1 
ATOM   236   N  NE    . ARG A 1 32   ? -46.060 -31.536 -54.099 1.00 76.72  ? 32   ARG A NE    1 
ATOM   237   C  CZ    . ARG A 1 32   ? -45.426 -30.403 -54.373 1.00 91.26  ? 32   ARG A CZ    1 
ATOM   238   N  NH1   . ARG A 1 32   ? -46.095 -29.277 -54.567 1.00 99.79  ? 32   ARG A NH1   1 
ATOM   239   N  NH2   . ARG A 1 32   ? -44.105 -30.393 -54.455 1.00 100.47 ? 32   ARG A NH2   1 
ATOM   240   N  N     . LYS A 1 33   ? -48.152 -35.336 -58.225 1.00 70.61  ? 33   LYS A N     1 
ATOM   241   C  CA    . LYS A 1 33   ? -47.439 -36.423 -58.884 1.00 68.25  ? 33   LYS A CA    1 
ATOM   242   C  C     . LYS A 1 33   ? -48.139 -36.925 -60.127 1.00 78.27  ? 33   LYS A C     1 
ATOM   243   O  O     . LYS A 1 33   ? -47.498 -37.086 -61.171 1.00 104.72 ? 33   LYS A O     1 
ATOM   244   C  CB    . LYS A 1 33   ? -47.230 -37.589 -57.961 1.00 76.77  ? 33   LYS A CB    1 
ATOM   245   C  CG    . LYS A 1 33   ? -46.301 -37.271 -56.796 1.00 93.91  ? 33   LYS A CG    1 
ATOM   246   C  CD    . LYS A 1 33   ? -46.192 -38.434 -55.805 1.00 99.77  ? 33   LYS A CD    1 
ATOM   247   C  CE    . LYS A 1 33   ? -45.816 -37.946 -54.409 1.00 105.94 ? 33   LYS A CE    1 
ATOM   248   N  NZ    . LYS A 1 33   ? -45.020 -38.957 -53.650 1.00 111.68 ? 33   LYS A NZ    1 
ATOM   249   N  N     . LYS A 1 34   ? -49.449 -37.158 -60.038 1.00 76.91  ? 34   LYS A N     1 
ATOM   250   C  CA    . LYS A 1 34   ? -50.193 -37.694 -61.184 1.00 74.84  ? 34   LYS A CA    1 
ATOM   251   C  C     . LYS A 1 34   ? -50.674 -36.625 -62.155 1.00 78.08  ? 34   LYS A C     1 
ATOM   252   O  O     . LYS A 1 34   ? -50.722 -36.878 -63.338 1.00 91.56  ? 34   LYS A O     1 
ATOM   253   C  CB    . LYS A 1 34   ? -51.353 -38.587 -60.796 1.00 79.25  ? 34   LYS A CB    1 
ATOM   254   C  CG    . LYS A 1 34   ? -52.140 -39.140 -61.996 1.00 90.71  ? 34   LYS A CG    1 
ATOM   255   C  CD    . LYS A 1 34   ? -51.260 -39.845 -63.046 1.00 103.54 ? 34   LYS A CD    1 
ATOM   256   C  CE    . LYS A 1 34   ? -52.010 -40.215 -64.327 1.00 107.62 ? 34   LYS A CE    1 
ATOM   257   N  NZ    . LYS A 1 34   ? -52.989 -41.324 -64.094 1.00 111.50 ? 34   LYS A NZ    1 
ATOM   258   N  N     . LEU A 1 35   ? -51.049 -35.447 -61.675 1.00 77.88  ? 35   LEU A N     1 
ATOM   259   C  CA    . LEU A 1 35   ? -51.452 -34.352 -62.571 1.00 84.63  ? 35   LEU A CA    1 
ATOM   260   C  C     . LEU A 1 35   ? -50.346 -33.325 -62.810 1.00 82.82  ? 35   LEU A C     1 
ATOM   261   O  O     . LEU A 1 35   ? -50.530 -32.446 -63.638 1.00 89.92  ? 35   LEU A O     1 
ATOM   262   C  CB    . LEU A 1 35   ? -52.740 -33.684 -62.083 1.00 88.12  ? 35   LEU A CB    1 
ATOM   263   C  CG    . LEU A 1 35   ? -54.006 -34.557 -62.140 1.00 90.44  ? 35   LEU A CG    1 
ATOM   264   C  CD1   . LEU A 1 35   ? -55.129 -33.960 -61.303 1.00 88.33  ? 35   LEU A CD1   1 
ATOM   265   C  CD2   . LEU A 1 35   ? -54.471 -34.770 -63.574 1.00 93.84  ? 35   LEU A CD2   1 
ATOM   266   N  N     . ARG A 1 36   ? -49.227 -33.411 -62.086 1.00 72.47  ? 36   ARG A N     1 
ATOM   267   C  CA    . ARG A 1 36   ? -48.119 -32.472 -62.250 1.00 80.03  ? 36   ARG A CA    1 
ATOM   268   C  C     . ARG A 1 36   ? -48.512 -31.016 -61.992 1.00 79.22  ? 36   ARG A C     1 
ATOM   269   O  O     . ARG A 1 36   ? -48.069 -30.095 -62.682 1.00 88.55  ? 36   ARG A O     1 
ATOM   270   C  CB    . ARG A 1 36   ? -47.452 -32.624 -63.623 1.00 87.45  ? 36   ARG A CB    1 
ATOM   271   C  CG    . ARG A 1 36   ? -46.586 -33.868 -63.738 1.00 90.49  ? 36   ARG A CG    1 
ATOM   272   C  CD    . ARG A 1 36   ? -47.443 -35.127 -63.835 1.00 85.51  ? 36   ARG A CD    1 
ATOM   273   N  NE    . ARG A 1 36   ? -46.641 -36.291 -64.197 1.00 86.37  ? 36   ARG A NE    1 
ATOM   274   C  CZ    . ARG A 1 36   ? -47.115 -37.519 -64.362 1.00 81.31  ? 36   ARG A CZ    1 
ATOM   275   N  NH1   . ARG A 1 36   ? -48.388 -37.786 -64.200 1.00 89.43  ? 36   ARG A NH1   1 
ATOM   276   N  NH2   . ARG A 1 36   ? -46.304 -38.495 -64.682 1.00 86.91  ? 36   ARG A NH2   1 
ATOM   277   N  N     . LEU A 1 37   ? -49.348 -30.816 -60.991 1.00 78.09  ? 37   LEU A N     1 
ATOM   278   C  CA    . LEU A 1 37   ? -49.712 -29.482 -60.523 1.00 83.60  ? 37   LEU A CA    1 
ATOM   279   C  C     . LEU A 1 37   ? -49.049 -29.299 -59.179 1.00 84.13  ? 37   LEU A C     1 
ATOM   280   O  O     . LEU A 1 37   ? -49.572 -29.719 -58.162 1.00 79.69  ? 37   LEU A O     1 
ATOM   281   C  CB    . LEU A 1 37   ? -51.228 -29.384 -60.429 1.00 85.62  ? 37   LEU A CB    1 
ATOM   282   C  CG    . LEU A 1 37   ? -51.918 -29.656 -61.773 1.00 83.15  ? 37   LEU A CG    1 
ATOM   283   C  CD1   . LEU A 1 37   ? -53.413 -29.785 -61.535 1.00 80.25  ? 37   LEU A CD1   1 
ATOM   284   C  CD2   . LEU A 1 37   ? -51.597 -28.567 -62.805 1.00 84.56  ? 37   LEU A CD2   1 
ATOM   285   N  N     . THR A 1 38   ? -47.864 -28.699 -59.178 1.00 94.23  ? 38   THR A N     1 
ATOM   286   C  CA    . THR A 1 38   ? -47.042 -28.612 -57.973 1.00 92.18  ? 38   THR A CA    1 
ATOM   287   C  C     . THR A 1 38   ? -47.231 -27.297 -57.191 1.00 83.25  ? 38   THR A C     1 
ATOM   288   O  O     . THR A 1 38   ? -46.522 -27.035 -56.237 1.00 81.97  ? 38   THR A O     1 
ATOM   289   C  CB    . THR A 1 38   ? -45.539 -28.686 -58.339 1.00 101.58 ? 38   THR A CB    1 
ATOM   290   O  OG1   . THR A 1 38   ? -45.156 -27.504 -59.071 1.00 101.78 ? 38   THR A OG1   1 
ATOM   291   C  CG2   . THR A 1 38   ? -45.238 -29.922 -59.182 1.00 108.62 ? 38   THR A CG2   1 
ATOM   292   N  N     . GLY A 1 39   ? -48.176 -26.474 -57.619 1.00 76.26  ? 39   GLY A N     1 
ATOM   293   C  CA    . GLY A 1 39   ? -48.519 -25.233 -56.922 1.00 72.94  ? 39   GLY A CA    1 
ATOM   294   C  C     . GLY A 1 39   ? -49.051 -25.464 -55.526 1.00 77.71  ? 39   GLY A C     1 
ATOM   295   O  O     . GLY A 1 39   ? -48.710 -24.747 -54.602 1.00 95.42  ? 39   GLY A O     1 
ATOM   296   N  N     . THR A 1 40   ? -49.897 -26.469 -55.372 1.00 82.48  ? 40   THR A N     1 
ATOM   297   C  CA    . THR A 1 40   ? -50.405 -26.895 -54.073 1.00 78.50  ? 40   THR A CA    1 
ATOM   298   C  C     . THR A 1 40   ? -49.285 -27.591 -53.267 1.00 74.02  ? 40   THR A C     1 
ATOM   299   O  O     . THR A 1 40   ? -48.775 -28.607 -53.712 1.00 86.45  ? 40   THR A O     1 
ATOM   300   C  CB    . THR A 1 40   ? -51.572 -27.860 -54.346 1.00 78.38  ? 40   THR A CB    1 
ATOM   301   O  OG1   . THR A 1 40   ? -52.204 -27.504 -55.593 1.00 67.93  ? 40   THR A OG1   1 
ATOM   302   C  CG2   . THR A 1 40   ? -52.566 -27.817 -53.212 1.00 86.45  ? 40   THR A CG2   1 
ATOM   303   N  N     . LYS A 1 41   ? -48.923 -27.058 -52.116 1.00 67.88  ? 41   LYS A N     1 
ATOM   304   C  CA    . LYS A 1 41   ? -47.685 -27.412 -51.424 1.00 74.52  ? 41   LYS A CA    1 
ATOM   305   C  C     . LYS A 1 41   ? -47.932 -28.232 -50.172 1.00 77.81  ? 41   LYS A C     1 
ATOM   306   O  O     . LYS A 1 41   ? -48.991 -28.120 -49.563 1.00 93.85  ? 41   LYS A O     1 
ATOM   307   C  CB    . LYS A 1 41   ? -46.937 -26.123 -51.073 1.00 76.88  ? 41   LYS A CB    1 
ATOM   308   C  CG    . LYS A 1 41   ? -46.774 -25.110 -52.200 1.00 74.12  ? 41   LYS A CG    1 
ATOM   309   C  CD    . LYS A 1 41   ? -46.027 -25.656 -53.415 1.00 82.79  ? 41   LYS A CD    1 
ATOM   310   C  CE    . LYS A 1 41   ? -45.328 -24.515 -54.161 1.00 101.13 ? 41   LYS A CE    1 
ATOM   311   N  NZ    . LYS A 1 41   ? -45.136 -24.638 -55.643 1.00 114.19 ? 41   LYS A NZ    1 
ATOM   312   N  N     . TYR A 1 42   ? -46.965 -29.083 -49.812 1.00 76.78  ? 42   TYR A N     1 
ATOM   313   C  CA    . TYR A 1 42   ? -46.953 -29.741 -48.521 1.00 83.15  ? 42   TYR A CA    1 
ATOM   314   C  C     . TYR A 1 42   ? -46.220 -28.846 -47.539 1.00 104.32 ? 42   TYR A C     1 
ATOM   315   O  O     . TYR A 1 42   ? -45.083 -28.484 -47.786 1.00 110.87 ? 42   TYR A O     1 
ATOM   316   C  CB    . TYR A 1 42   ? -46.236 -31.086 -48.583 1.00 84.83  ? 42   TYR A CB    1 
ATOM   317   C  CG    . TYR A 1 42   ? -46.068 -31.718 -47.227 1.00 92.14  ? 42   TYR A CG    1 
ATOM   318   C  CD1   . TYR A 1 42   ? -44.968 -31.416 -46.402 1.00 91.62  ? 42   TYR A CD1   1 
ATOM   319   C  CD2   . TYR A 1 42   ? -47.035 -32.594 -46.741 1.00 103.37 ? 42   TYR A CD2   1 
ATOM   320   C  CE1   . TYR A 1 42   ? -44.841 -31.993 -45.142 1.00 94.27  ? 42   TYR A CE1   1 
ATOM   321   C  CE2   . TYR A 1 42   ? -46.916 -33.173 -45.487 1.00 107.42 ? 42   TYR A CE2   1 
ATOM   322   C  CZ    . TYR A 1 42   ? -45.826 -32.875 -44.692 1.00 98.28  ? 42   TYR A CZ    1 
ATOM   323   O  OH    . TYR A 1 42   ? -45.775 -33.484 -43.464 1.00 92.30  ? 42   TYR A OH    1 
ATOM   324   N  N     . GLY A 1 43   ? -46.873 -28.506 -46.431 1.00 117.69 ? 43   GLY A N     1 
ATOM   325   C  CA    . GLY A 1 43   ? -46.257 -27.757 -45.336 1.00 108.09 ? 43   GLY A CA    1 
ATOM   326   C  C     . GLY A 1 43   ? -46.185 -28.556 -44.060 1.00 104.85 ? 43   GLY A C     1 
ATOM   327   O  O     . GLY A 1 43   ? -45.197 -28.527 -43.366 1.00 115.15 ? 43   GLY A O     1 
ATOM   328   N  N     . CYS A 1 44   ? -47.261 -29.262 -43.700 1.00 98.09  ? 44   CYS A N     1 
ATOM   329   C  CA    . CYS A 1 44   ? -47.444 -29.844 -42.367 1.00 98.39  ? 44   CYS A CA    1 
ATOM   330   C  C     . CYS A 1 44   ? -48.162 -31.233 -42.318 1.00 101.77 ? 44   CYS A C     1 
ATOM   331   O  O     . CYS A 1 44   ? -47.948 -32.027 -41.397 1.00 94.29  ? 44   CYS A O     1 
ATOM   332   C  CB    . CYS A 1 44   ? -48.174 -28.792 -41.493 1.00 95.81  ? 44   CYS A CB    1 
ATOM   333   S  SG    . CYS A 1 44   ? -49.361 -29.358 -40.238 1.00 97.84  ? 44   CYS A SG    1 
ATOM   334   N  N     . GLY A 1 45   ? -49.050 -31.511 -43.278 1.00 106.23 ? 45   GLY A N     1 
ATOM   335   C  CA    . GLY A 1 45   ? -49.725 -32.811 -43.347 1.00 108.04 ? 45   GLY A CA    1 
ATOM   336   C  C     . GLY A 1 45   ? -50.734 -33.148 -42.249 1.00 115.37 ? 45   GLY A C     1 
ATOM   337   O  O     . GLY A 1 45   ? -51.172 -34.296 -42.115 1.00 109.44 ? 45   GLY A O     1 
ATOM   338   N  N     . GLY A 1 46   ? -51.104 -32.161 -41.443 1.00 119.37 ? 46   GLY A N     1 
ATOM   339   C  CA    . GLY A 1 46   ? -52.193 -32.285 -40.478 1.00 108.82 ? 46   GLY A CA    1 
ATOM   340   C  C     . GLY A 1 46   ? -53.318 -31.298 -40.697 1.00 109.00 ? 46   GLY A C     1 
ATOM   341   O  O     . GLY A 1 46   ? -54.265 -31.299 -39.925 1.00 119.27 ? 46   GLY A O     1 
ATOM   342   N  N     . GLY A 1 47   ? -53.231 -30.450 -41.728 1.00 106.50 ? 47   GLY A N     1 
ATOM   343   C  CA    . GLY A 1 47   ? -54.254 -29.431 -41.998 1.00 104.81 ? 47   GLY A CA    1 
ATOM   344   C  C     . GLY A 1 47   ? -54.115 -28.109 -41.249 1.00 105.64 ? 47   GLY A C     1 
ATOM   345   O  O     . GLY A 1 47   ? -55.002 -27.256 -41.283 1.00 112.41 ? 47   GLY A O     1 
ATOM   346   N  N     . GLY A 1 48   ? -52.981 -27.942 -40.565 1.00 107.46 ? 48   GLY A N     1 
ATOM   347   C  CA    . GLY A 1 48   ? -52.738 -26.773 -39.707 1.00 98.64  ? 48   GLY A CA    1 
ATOM   348   C  C     . GLY A 1 48   ? -52.308 -25.508 -40.413 1.00 102.00 ? 48   GLY A C     1 
ATOM   349   O  O     . GLY A 1 48   ? -52.723 -24.408 -40.028 1.00 106.39 ? 48   GLY A O     1 
ATOM   350   N  N     . CYS A 1 49   ? -51.487 -25.654 -41.464 1.00 114.68 ? 49   CYS A N     1 
ATOM   351   C  CA    . CYS A 1 49   ? -50.795 -24.521 -42.078 1.00 106.27 ? 49   CYS A CA    1 
ATOM   352   C  C     . CYS A 1 49   ? -51.521 -23.912 -43.267 1.00 100.34 ? 49   CYS A C     1 
ATOM   353   O  O     . CYS A 1 49   ? -51.313 -22.756 -43.559 1.00 105.63 ? 49   CYS A O     1 
ATOM   354   C  CB    . CYS A 1 49   ? -49.374 -24.878 -42.502 1.00 110.96 ? 49   CYS A CB    1 
ATOM   355   S  SG    . CYS A 1 49   ? -49.301 -26.178 -43.737 1.00 111.26 ? 49   CYS A SG    1 
ATOM   356   N  N     . GLY A 1 50   ? -52.327 -24.696 -43.982 1.00 97.03  ? 50   GLY A N     1 
ATOM   357   C  CA    . GLY A 1 50   ? -53.083 -24.193 -45.116 1.00 87.45  ? 50   GLY A CA    1 
ATOM   358   C  C     . GLY A 1 50   ? -52.334 -24.009 -46.416 1.00 80.94  ? 50   GLY A C     1 
ATOM   359   O  O     . GLY A 1 50   ? -52.836 -23.410 -47.359 1.00 63.33  ? 50   GLY A O     1 
ATOM   360   N  N     . ALA A 1 51   ? -51.129 -24.564 -46.504 1.00 92.16  ? 51   ALA A N     1 
ATOM   361   C  CA    . ALA A 1 51   ? -50.331 -24.488 -47.743 1.00 85.54  ? 51   ALA A CA    1 
ATOM   362   C  C     . ALA A 1 51   ? -50.909 -25.338 -48.849 1.00 73.34  ? 51   ALA A C     1 
ATOM   363   O  O     . ALA A 1 51   ? -50.655 -25.071 -50.013 1.00 63.51  ? 51   ALA A O     1 
ATOM   364   C  CB    . ALA A 1 51   ? -48.897 -24.910 -47.484 1.00 91.72  ? 51   ALA A CB    1 
ATOM   365   N  N     . CYS A 1 52   ? -51.687 -26.363 -48.492 1.00 73.06  ? 52   CYS A N     1 
ATOM   366   C  CA    . CYS A 1 52   ? -52.346 -27.229 -49.462 1.00 75.17  ? 52   CYS A CA    1 
ATOM   367   C  C     . CYS A 1 52   ? -53.813 -26.877 -49.678 1.00 79.23  ? 52   CYS A C     1 
ATOM   368   O  O     . CYS A 1 52   ? -54.600 -27.744 -50.050 1.00 84.59  ? 52   CYS A O     1 
ATOM   369   C  CB    . CYS A 1 52   ? -52.300 -28.669 -48.989 1.00 76.96  ? 52   CYS A CB    1 
ATOM   370   S  SG    . CYS A 1 52   ? -53.196 -28.953 -47.449 1.00 72.58  ? 52   CYS A SG    1 
ATOM   371   N  N     . THR A 1 53   ? -54.182 -25.600 -49.518 1.00 81.60  ? 53   THR A N     1 
ATOM   372   C  CA    . THR A 1 53   ? -55.570 -25.166 -49.665 1.00 72.33  ? 53   THR A CA    1 
ATOM   373   C  C     . THR A 1 53   ? -55.994 -25.253 -51.148 1.00 67.42  ? 53   THR A C     1 
ATOM   374   O  O     . THR A 1 53   ? -55.263 -24.831 -52.048 1.00 61.49  ? 53   THR A O     1 
ATOM   375   C  CB    . THR A 1 53   ? -55.792 -23.690 -49.157 1.00 73.87  ? 53   THR A CB    1 
ATOM   376   O  OG1   . THR A 1 53   ? -55.653 -23.610 -47.740 1.00 74.63  ? 53   THR A OG1   1 
ATOM   377   C  CG2   . THR A 1 53   ? -57.186 -23.155 -49.484 1.00 73.65  ? 53   THR A CG2   1 
ATOM   378   N  N     . VAL A 1 54   ? -57.180 -25.820 -51.382 1.00 72.94  ? 54   VAL A N     1 
ATOM   379   C  CA    . VAL A 1 54   ? -57.818 -25.814 -52.698 1.00 73.14  ? 54   VAL A CA    1 
ATOM   380   C  C     . VAL A 1 54   ? -59.288 -25.433 -52.584 1.00 80.90  ? 54   VAL A C     1 
ATOM   381   O  O     . VAL A 1 54   ? -59.819 -25.374 -51.484 1.00 85.63  ? 54   VAL A O     1 
ATOM   382   C  CB    . VAL A 1 54   ? -57.713 -27.176 -53.386 1.00 70.09  ? 54   VAL A CB    1 
ATOM   383   C  CG1   . VAL A 1 54   ? -56.281 -27.431 -53.809 1.00 67.86  ? 54   VAL A CG1   1 
ATOM   384   C  CG2   . VAL A 1 54   ? -58.231 -28.276 -52.465 1.00 72.59  ? 54   VAL A CG2   1 
ATOM   385   N  N     . MET A 1 55   ? -59.937 -25.167 -53.714 1.00 85.29  ? 55   MET A N     1 
ATOM   386   C  CA    . MET A 1 55   ? -61.392 -24.990 -53.757 1.00 77.93  ? 55   MET A CA    1 
ATOM   387   C  C     . MET A 1 55   ? -62.069 -26.273 -54.212 1.00 80.44  ? 55   MET A C     1 
ATOM   388   O  O     . MET A 1 55   ? -61.585 -26.941 -55.106 1.00 82.46  ? 55   MET A O     1 
ATOM   389   C  CB    . MET A 1 55   ? -61.797 -23.879 -54.708 1.00 83.33  ? 55   MET A CB    1 
ATOM   390   C  CG    . MET A 1 55   ? -63.296 -23.602 -54.722 1.00 87.42  ? 55   MET A CG    1 
ATOM   391   S  SD    . MET A 1 55   ? -63.695 -21.970 -55.387 1.00 92.90  ? 55   MET A SD    1 
ATOM   392   C  CE    . MET A 1 55   ? -63.204 -22.232 -57.091 1.00 97.09  ? 55   MET A CE    1 
ATOM   393   N  N     . ILE A 1 56   ? -63.193 -26.611 -53.585 1.00 86.20  ? 56   ILE A N     1 
ATOM   394   C  CA    . ILE A 1 56   ? -64.035 -27.731 -54.002 1.00 82.62  ? 56   ILE A CA    1 
ATOM   395   C  C     . ILE A 1 56   ? -65.392 -27.144 -54.360 1.00 80.46  ? 56   ILE A C     1 
ATOM   396   O  O     . ILE A 1 56   ? -65.950 -26.378 -53.593 1.00 103.05 ? 56   ILE A O     1 
ATOM   397   C  CB    . ILE A 1 56   ? -64.283 -28.750 -52.866 1.00 82.93  ? 56   ILE A CB    1 
ATOM   398   C  CG1   . ILE A 1 56   ? -62.989 -29.122 -52.135 1.00 80.17  ? 56   ILE A CG1   1 
ATOM   399   C  CG2   . ILE A 1 56   ? -64.992 -29.988 -53.397 1.00 81.22  ? 56   ILE A CG2   1 
ATOM   400   C  CD1   . ILE A 1 56   ? -61.953 -29.787 -53.010 1.00 80.18  ? 56   ILE A CD1   1 
ATOM   401   N  N     . SER A 1 57   ? -65.913 -27.524 -55.516 1.00 78.90  ? 57   SER A N     1 
ATOM   402   C  CA    . SER A 1 57   ? -67.216 -27.071 -56.007 1.00 82.05  ? 57   SER A CA    1 
ATOM   403   C  C     . SER A 1 57   ? -68.116 -28.295 -56.197 1.00 85.25  ? 57   SER A C     1 
ATOM   404   O  O     . SER A 1 57   ? -67.639 -29.358 -56.564 1.00 85.88  ? 57   SER A O     1 
ATOM   405   C  CB    . SER A 1 57   ? -66.995 -26.317 -57.313 1.00 85.11  ? 57   SER A CB    1 
ATOM   406   O  OG    . SER A 1 57   ? -65.791 -25.557 -57.240 1.00 83.43  ? 57   SER A OG    1 
ATOM   407   N  N     . ARG A 1 58   ? -69.400 -28.144 -55.904 1.00 90.18  ? 58   ARG A N     1 
ATOM   408   C  CA    . ARG A 1 58   ? -70.371 -29.240 -55.948 1.00 95.89  ? 58   ARG A CA    1 
ATOM   409   C  C     . ARG A 1 58   ? -71.731 -28.699 -56.397 1.00 100.85 ? 58   ARG A C     1 
ATOM   410   O  O     . ARG A 1 58   ? -72.099 -27.601 -55.999 1.00 90.69  ? 58   ARG A O     1 
ATOM   411   C  CB    . ARG A 1 58   ? -70.485 -29.868 -54.556 1.00 91.85  ? 58   ARG A CB    1 
ATOM   412   C  CG    . ARG A 1 58   ? -69.349 -30.815 -54.214 1.00 91.12  ? 58   ARG A CG    1 
ATOM   413   C  CD    . ARG A 1 58   ? -69.496 -31.402 -52.811 1.00 99.57  ? 58   ARG A CD    1 
ATOM   414   N  NE    . ARG A 1 58   ? -68.258 -32.013 -52.314 1.00 98.05  ? 58   ARG A NE    1 
ATOM   415   C  CZ    . ARG A 1 58   ? -67.722 -33.141 -52.791 1.00 92.90  ? 58   ARG A CZ    1 
ATOM   416   N  NH1   . ARG A 1 58   ? -68.310 -33.798 -53.799 1.00 81.18  ? 58   ARG A NH1   1 
ATOM   417   N  NH2   . ARG A 1 58   ? -66.574 -33.602 -52.277 1.00 92.92  ? 58   ARG A NH2   1 
ATOM   418   N  N     . TYR A 1 59   ? -72.456 -29.462 -57.230 1.00 99.54  ? 59   TYR A N     1 
ATOM   419   C  CA    . TYR A 1 59   ? -73.771 -29.048 -57.645 1.00 99.97  ? 59   TYR A CA    1 
ATOM   420   C  C     . TYR A 1 59   ? -74.779 -29.740 -56.771 1.00 101.08 ? 59   TYR A C     1 
ATOM   421   O  O     . TYR A 1 59   ? -74.824 -30.976 -56.700 1.00 100.75 ? 59   TYR A O     1 
ATOM   422   C  CB    . TYR A 1 59   ? -74.074 -29.420 -59.079 1.00 108.37 ? 59   TYR A CB    1 
ATOM   423   C  CG    . TYR A 1 59   ? -75.315 -28.741 -59.604 1.00 114.25 ? 59   TYR A CG    1 
ATOM   424   C  CD1   . TYR A 1 59   ? -75.314 -27.373 -59.835 1.00 122.07 ? 59   TYR A CD1   1 
ATOM   425   C  CD2   . TYR A 1 59   ? -76.479 -29.455 -59.884 1.00 109.45 ? 59   TYR A CD2   1 
ATOM   426   C  CE1   . TYR A 1 59   ? -76.432 -26.724 -60.327 1.00 119.50 ? 59   TYR A CE1   1 
ATOM   427   C  CE2   . TYR A 1 59   ? -77.606 -28.809 -60.376 1.00 115.05 ? 59   TYR A CE2   1 
ATOM   428   C  CZ    . TYR A 1 59   ? -77.570 -27.438 -60.597 1.00 112.15 ? 59   TYR A CZ    1 
ATOM   429   O  OH    . TYR A 1 59   ? -78.650 -26.738 -61.080 1.00 108.13 ? 59   TYR A OH    1 
ATOM   430   N  N     . ASN A 1 60   ? -75.602 -28.947 -56.099 1.00 108.35 ? 60   ASN A N     1 
ATOM   431   C  CA    . ASN A 1 60   ? -76.785 -29.490 -55.432 1.00 119.60 ? 60   ASN A CA    1 
ATOM   432   C  C     . ASN A 1 60   ? -77.896 -29.691 -56.458 1.00 123.01 ? 60   ASN A C     1 
ATOM   433   O  O     . ASN A 1 60   ? -78.435 -28.702 -56.957 1.00 118.70 ? 60   ASN A O     1 
ATOM   434   C  CB    . ASN A 1 60   ? -77.262 -28.634 -54.281 1.00 123.33 ? 60   ASN A CB    1 
ATOM   435   C  CG    . ASN A 1 60   ? -78.247 -29.376 -53.406 1.00 122.10 ? 60   ASN A CG    1 
ATOM   436   O  OD1   . ASN A 1 60   ? -78.830 -30.373 -53.826 1.00 118.97 ? 60   ASN A OD1   1 
ATOM   437   N  ND2   . ASN A 1 60   ? -78.423 -28.910 -52.180 1.00 116.63 ? 60   ASN A ND2   1 
ATOM   438   N  N     . PRO A 1 61   ? -78.266 -30.953 -56.760 1.00 126.26 ? 61   PRO A N     1 
ATOM   439   C  CA    . PRO A 1 61   ? -79.259 -31.175 -57.824 1.00 119.33 ? 61   PRO A CA    1 
ATOM   440   C  C     . PRO A 1 61   ? -80.701 -30.813 -57.424 1.00 123.55 ? 61   PRO A C     1 
ATOM   441   O  O     . PRO A 1 61   ? -81.478 -30.424 -58.297 1.00 116.07 ? 61   PRO A O     1 
ATOM   442   C  CB    . PRO A 1 61   ? -79.102 -32.665 -58.157 1.00 123.29 ? 61   PRO A CB    1 
ATOM   443   C  CG    . PRO A 1 61   ? -78.460 -33.293 -56.959 1.00 127.42 ? 61   PRO A CG    1 
ATOM   444   C  CD    . PRO A 1 61   ? -77.960 -32.206 -56.037 1.00 129.71 ? 61   PRO A CD    1 
ATOM   445   N  N     . ILE A 1 62   ? -81.056 -30.930 -56.139 1.00 128.40 ? 62   ILE A N     1 
ATOM   446   C  CA    . ILE A 1 62   ? -82.396 -30.509 -55.680 1.00 118.83 ? 62   ILE A CA    1 
ATOM   447   C  C     . ILE A 1 62   ? -82.528 -28.969 -55.572 1.00 116.55 ? 62   ILE A C     1 
ATOM   448   O  O     . ILE A 1 62   ? -83.521 -28.420 -56.049 1.00 132.53 ? 62   ILE A O     1 
ATOM   449   C  CB    . ILE A 1 62   ? -82.882 -31.258 -54.396 1.00 116.67 ? 62   ILE A CB    1 
ATOM   450   C  CG1   . ILE A 1 62   ? -82.283 -30.670 -53.108 1.00 118.28 ? 62   ILE A CG1   1 
ATOM   451   C  CG2   . ILE A 1 62   ? -82.615 -32.764 -54.503 1.00 105.00 ? 62   ILE A CG2   1 
ATOM   452   C  CD1   . ILE A 1 62   ? -82.882 -31.254 -51.847 1.00 120.33 ? 62   ILE A CD1   1 
ATOM   453   N  N     . THR A 1 63   ? -81.545 -28.277 -54.987 1.00 100.82 ? 63   THR A N     1 
ATOM   454   C  CA    . THR A 1 63   ? -81.591 -26.815 -54.838 1.00 102.85 ? 63   THR A CA    1 
ATOM   455   C  C     . THR A 1 63   ? -81.090 -26.029 -56.072 1.00 100.76 ? 63   THR A C     1 
ATOM   456   O  O     . THR A 1 63   ? -81.244 -24.814 -56.138 1.00 92.02  ? 63   THR A O     1 
ATOM   457   C  CB    . THR A 1 63   ? -80.813 -26.316 -53.583 1.00 112.51 ? 63   THR A CB    1 
ATOM   458   O  OG1   . THR A 1 63   ? -79.400 -26.390 -53.792 1.00 118.77 ? 63   THR A OG1   1 
ATOM   459   C  CG2   . THR A 1 63   ? -81.175 -27.118 -52.341 1.00 117.60 ? 63   THR A CG2   1 
ATOM   460   N  N     . LYS A 1 64   ? -80.502 -26.737 -57.030 1.00 111.38 ? 64   LYS A N     1 
ATOM   461   C  CA    . LYS A 1 64   ? -80.014 -26.189 -58.308 1.00 118.10 ? 64   LYS A CA    1 
ATOM   462   C  C     . LYS A 1 64   ? -78.848 -25.193 -58.122 1.00 117.30 ? 64   LYS A C     1 
ATOM   463   O  O     . LYS A 1 64   ? -78.640 -24.313 -58.955 1.00 109.51 ? 64   LYS A O     1 
ATOM   464   C  CB    . LYS A 1 64   ? -81.151 -25.550 -59.143 1.00 125.67 ? 64   LYS A CB    1 
ATOM   465   C  CG    . LYS A 1 64   ? -82.581 -26.100 -58.958 1.00 131.21 ? 64   LYS A CG    1 
ATOM   466   C  CD    . LYS A 1 64   ? -82.767 -27.599 -59.184 1.00 122.54 ? 64   LYS A CD    1 
ATOM   467   C  CE    . LYS A 1 64   ? -82.952 -27.967 -60.650 1.00 119.65 ? 64   LYS A CE    1 
ATOM   468   N  NZ    . LYS A 1 64   ? -81.659 -28.048 -61.391 1.00 118.17 ? 64   LYS A NZ    1 
ATOM   469   N  N     . ARG A 1 65   ? -78.081 -25.354 -57.048 1.00 121.55 ? 65   ARG A N     1 
ATOM   470   C  CA    . ARG A 1 65   ? -77.054 -24.404 -56.649 1.00 112.73 ? 65   ARG A CA    1 
ATOM   471   C  C     . ARG A 1 65   ? -75.671 -25.053 -56.587 1.00 108.51 ? 65   ARG A C     1 
ATOM   472   O  O     . ARG A 1 65   ? -75.531 -26.198 -56.156 1.00 113.98 ? 65   ARG A O     1 
ATOM   473   C  CB    . ARG A 1 65   ? -77.389 -23.852 -55.266 1.00 119.47 ? 65   ARG A CB    1 
ATOM   474   C  CG    . ARG A 1 65   ? -78.873 -23.784 -54.946 1.00 120.56 ? 65   ARG A CG    1 
ATOM   475   C  CD    . ARG A 1 65   ? -79.152 -23.205 -53.575 1.00 124.27 ? 65   ARG A CD    1 
ATOM   476   N  NE    . ARG A 1 65   ? -78.820 -21.784 -53.583 1.00 139.29 ? 65   ARG A NE    1 
ATOM   477   C  CZ    . ARG A 1 65   ? -77.640 -21.260 -53.240 1.00 149.94 ? 65   ARG A CZ    1 
ATOM   478   N  NH1   . ARG A 1 65   ? -76.640 -22.026 -52.811 1.00 152.87 ? 65   ARG A NH1   1 
ATOM   479   N  NH2   . ARG A 1 65   ? -77.457 -19.944 -53.315 1.00 160.78 ? 65   ARG A NH2   1 
ATOM   480   N  N     . ILE A 1 66   ? -74.664 -24.274 -56.995 1.00 102.49 ? 66   ILE A N     1 
ATOM   481   C  CA    . ILE A 1 66   ? -73.263 -24.660 -56.915 1.00 101.39 ? 66   ILE A CA    1 
ATOM   482   C  C     . ILE A 1 66   ? -72.713 -24.092 -55.609 1.00 93.51  ? 66   ILE A C     1 
ATOM   483   O  O     . ILE A 1 66   ? -72.743 -22.889 -55.405 1.00 77.09  ? 66   ILE A O     1 
ATOM   484   C  CB    . ILE A 1 66   ? -72.374 -24.048 -58.063 1.00 105.40 ? 66   ILE A CB    1 
ATOM   485   C  CG1   . ILE A 1 66   ? -73.106 -23.834 -59.401 1.00 112.93 ? 66   ILE A CG1   1 
ATOM   486   C  CG2   . ILE A 1 66   ? -71.160 -24.921 -58.325 1.00 103.92 ? 66   ILE A CG2   1 
ATOM   487   C  CD1   . ILE A 1 66   ? -72.323 -22.983 -60.399 1.00 109.50 ? 66   ILE A CD1   1 
ATOM   488   N  N     . ARG A 1 67   ? -72.200 -24.962 -54.733 1.00 99.01  ? 67   ARG A N     1 
ATOM   489   C  CA    . ARG A 1 67   ? -71.563 -24.574 -53.458 1.00 104.92 ? 67   ARG A CA    1 
ATOM   490   C  C     . ARG A 1 67   ? -70.028 -24.665 -53.588 1.00 92.26  ? 67   ARG A C     1 
ATOM   491   O  O     . ARG A 1 67   ? -69.526 -25.694 -54.012 1.00 95.32  ? 67   ARG A O     1 
ATOM   492   C  CB    . ARG A 1 67   ? -72.030 -25.543 -52.341 1.00 119.62 ? 67   ARG A CB    1 
ATOM   493   C  CG    . ARG A 1 67   ? -71.277 -25.462 -50.996 1.00 133.79 ? 67   ARG A CG    1 
ATOM   494   C  CD    . ARG A 1 67   ? -71.204 -26.807 -50.254 1.00 140.91 ? 67   ARG A CD    1 
ATOM   495   N  NE    . ARG A 1 67   ? -70.448 -26.727 -48.986 1.00 148.69 ? 67   ARG A NE    1 
ATOM   496   C  CZ    . ARG A 1 67   ? -69.980 -27.777 -48.292 1.00 141.02 ? 67   ARG A CZ    1 
ATOM   497   N  NH1   . ARG A 1 67   ? -70.176 -29.024 -48.738 1.00 132.95 ? 67   ARG A NH1   1 
ATOM   498   N  NH2   . ARG A 1 67   ? -69.297 -27.583 -47.148 1.00 113.67 ? 67   ARG A NH2   1 
ATOM   499   N  N     . HIS A 1 68   ? -69.314 -23.602 -53.225 1.00 88.17  ? 68   HIS A N     1 
ATOM   500   C  CA    . HIS A 1 68   ? -67.839 -23.557 -53.258 1.00 91.83  ? 68   HIS A CA    1 
ATOM   501   C  C     . HIS A 1 68   ? -67.273 -23.476 -51.844 1.00 86.98  ? 68   HIS A C     1 
ATOM   502   O  O     . HIS A 1 68   ? -67.601 -22.555 -51.114 1.00 76.96  ? 68   HIS A O     1 
ATOM   503   C  CB    . HIS A 1 68   ? -67.345 -22.367 -54.063 1.00 98.00  ? 68   HIS A CB    1 
ATOM   504   C  CG    . HIS A 1 68   ? -67.824 -22.339 -55.479 1.00 96.02  ? 68   HIS A CG    1 
ATOM   505   N  ND1   . HIS A 1 68   ? -67.417 -23.262 -56.418 1.00 101.00 ? 68   HIS A ND1   1 
ATOM   506   C  CD2   . HIS A 1 68   ? -68.615 -21.457 -56.132 1.00 90.95  ? 68   HIS A CD2   1 
ATOM   507   C  CE1   . HIS A 1 68   ? -67.957 -22.966 -57.585 1.00 99.86  ? 68   HIS A CE1   1 
ATOM   508   N  NE2   . HIS A 1 68   ? -68.695 -21.880 -57.436 1.00 100.61 ? 68   HIS A NE2   1 
ATOM   509   N  N     . HIS A 1 69   ? -66.427 -24.411 -51.452 1.00 88.12  ? 69   HIS A N     1 
ATOM   510   C  CA    . HIS A 1 69   ? -65.820 -24.370 -50.124 1.00 100.89 ? 69   HIS A CA    1 
ATOM   511   C  C     . HIS A 1 69   ? -64.302 -24.626 -50.184 1.00 96.33  ? 69   HIS A C     1 
ATOM   512   O  O     . HIS A 1 69   ? -63.856 -25.412 -51.008 1.00 98.36  ? 69   HIS A O     1 
ATOM   513   C  CB    . HIS A 1 69   ? -66.555 -25.361 -49.195 1.00 107.02 ? 69   HIS A CB    1 
ATOM   514   C  CG    . HIS A 1 69   ? -66.277 -26.805 -49.474 1.00 108.37 ? 69   HIS A CG    1 
ATOM   515   N  ND1   . HIS A 1 69   ? -65.446 -27.562 -48.678 1.00 106.09 ? 69   HIS A ND1   1 
ATOM   516   C  CD2   . HIS A 1 69   ? -66.757 -27.644 -50.424 1.00 117.69 ? 69   HIS A CD2   1 
ATOM   517   C  CE1   . HIS A 1 69   ? -65.401 -28.798 -49.140 1.00 113.53 ? 69   HIS A CE1   1 
ATOM   518   N  NE2   . HIS A 1 69   ? -66.193 -28.877 -50.196 1.00 124.71 ? 69   HIS A NE2   1 
ATOM   519   N  N     . PRO A 1 70   ? -63.506 -23.949 -49.323 1.00 92.11  ? 70   PRO A N     1 
ATOM   520   C  CA    . PRO A 1 70   ? -62.091 -24.236 -49.256 1.00 90.71  ? 70   PRO A CA    1 
ATOM   521   C  C     . PRO A 1 70   ? -61.822 -25.517 -48.467 1.00 86.40  ? 70   PRO A C     1 
ATOM   522   O  O     . PRO A 1 70   ? -62.664 -25.911 -47.648 1.00 87.09  ? 70   PRO A O     1 
ATOM   523   C  CB    . PRO A 1 70   ? -61.539 -23.018 -48.524 1.00 101.17 ? 70   PRO A CB    1 
ATOM   524   C  CG    . PRO A 1 70   ? -62.628 -22.621 -47.602 1.00 100.30 ? 70   PRO A CG    1 
ATOM   525   C  CD    . PRO A 1 70   ? -63.898 -22.927 -48.340 1.00 98.68  ? 70   PRO A CD    1 
ATOM   526   N  N     . ALA A 1 71   ? -60.677 -26.154 -48.727 1.00 76.63  ? 71   ALA A N     1 
ATOM   527   C  CA    . ALA A 1 71   ? -60.309 -27.393 -48.049 1.00 84.48  ? 71   ALA A CA    1 
ATOM   528   C  C     . ALA A 1 71   ? -58.817 -27.653 -48.152 1.00 90.01  ? 71   ALA A C     1 
ATOM   529   O  O     . ALA A 1 71   ? -58.167 -27.117 -49.045 1.00 93.57  ? 71   ALA A O     1 
ATOM   530   C  CB    . ALA A 1 71   ? -61.055 -28.557 -48.642 1.00 91.09  ? 71   ALA A CB    1 
ATOM   531   N  N     . ASN A 1 72   ? -58.291 -28.441 -47.214 1.00 94.89  ? 72   ASN A N     1 
ATOM   532   C  CA    . ASN A 1 72   ? -56.878 -28.814 -47.193 1.00 91.75  ? 72   ASN A CA    1 
ATOM   533   C  C     . ASN A 1 72   ? -56.692 -30.121 -47.932 1.00 87.58  ? 72   ASN A C     1 
ATOM   534   O  O     . ASN A 1 72   ? -57.182 -31.148 -47.487 1.00 79.87  ? 72   ASN A O     1 
ATOM   535   C  CB    . ASN A 1 72   ? -56.392 -28.982 -45.757 1.00 92.60  ? 72   ASN A CB    1 
ATOM   536   C  CG    . ASN A 1 72   ? -56.187 -27.659 -45.063 1.00 105.89 ? 72   ASN A CG    1 
ATOM   537   O  OD1   . ASN A 1 72   ? -56.239 -27.576 -43.844 1.00 122.66 ? 72   ASN A OD1   1 
ATOM   538   N  ND2   . ASN A 1 72   ? -55.937 -26.612 -45.839 1.00 119.42 ? 72   ASN A ND2   1 
ATOM   539   N  N     . ALA A 1 73   ? -55.970 -30.080 -49.052 1.00 87.35  ? 73   ALA A N     1 
ATOM   540   C  CA    . ALA A 1 73   ? -55.866 -31.232 -49.937 1.00 84.84  ? 73   ALA A CA    1 
ATOM   541   C  C     . ALA A 1 73   ? -55.141 -32.438 -49.302 1.00 83.92  ? 73   ALA A C     1 
ATOM   542   O  O     . ALA A 1 73   ? -55.424 -33.591 -49.676 1.00 102.52 ? 73   ALA A O     1 
ATOM   543   C  CB    . ALA A 1 73   ? -55.200 -30.829 -51.249 1.00 77.02  ? 73   ALA A CB    1 
ATOM   544   N  N     . CYS A 1 74   ? -54.232 -32.179 -48.353 1.00 75.85  ? 74   CYS A N     1 
ATOM   545   C  CA    . CYS A 1 74   ? -53.490 -33.246 -47.681 1.00 78.65  ? 74   CYS A CA    1 
ATOM   546   C  C     . CYS A 1 74   ? -54.404 -34.273 -47.007 1.00 78.53  ? 74   CYS A C     1 
ATOM   547   O  O     . CYS A 1 74   ? -54.073 -35.463 -46.989 1.00 93.69  ? 74   CYS A O     1 
ATOM   548   C  CB    . CYS A 1 74   ? -52.484 -32.669 -46.675 1.00 89.19  ? 74   CYS A CB    1 
ATOM   549   S  SG    . CYS A 1 74   ? -53.175 -31.569 -45.411 1.00 95.95  ? 74   CYS A SG    1 
ATOM   550   N  N     . LEU A 1 75   ? -55.550 -33.824 -46.489 1.00 81.04  ? 75   LEU A N     1 
ATOM   551   C  CA    . LEU A 1 75   ? -56.501 -34.689 -45.779 1.00 87.36  ? 75   LEU A CA    1 
ATOM   552   C  C     . LEU A 1 75   ? -57.673 -35.238 -46.636 1.00 85.00  ? 75   LEU A C     1 
ATOM   553   O  O     . LEU A 1 75   ? -58.459 -36.025 -46.115 1.00 78.66  ? 75   LEU A O     1 
ATOM   554   C  CB    . LEU A 1 75   ? -57.082 -33.929 -44.598 1.00 96.66  ? 75   LEU A CB    1 
ATOM   555   C  CG    . LEU A 1 75   ? -56.097 -33.625 -43.478 1.00 105.87 ? 75   LEU A CG    1 
ATOM   556   C  CD1   . LEU A 1 75   ? -56.694 -32.590 -42.530 1.00 104.44 ? 75   LEU A CD1   1 
ATOM   557   C  CD2   . LEU A 1 75   ? -55.705 -34.913 -42.752 1.00 111.23 ? 75   LEU A CD2   1 
ATOM   558   N  N     . ILE A 1 76   ? -57.757 -34.856 -47.904 1.00 83.99  ? 76   ILE A N     1 
ATOM   559   C  CA    . ILE A 1 76   ? -58.859 -35.300 -48.761 1.00 77.97  ? 76   ILE A CA    1 
ATOM   560   C  C     . ILE A 1 76   ? -58.498 -36.556 -49.543 1.00 80.85  ? 76   ILE A C     1 
ATOM   561   O  O     . ILE A 1 76   ? -57.588 -36.511 -50.348 1.00 109.00 ? 76   ILE A O     1 
ATOM   562   C  CB    . ILE A 1 76   ? -59.247 -34.287 -49.828 1.00 74.58  ? 76   ILE A CB    1 
ATOM   563   C  CG1   . ILE A 1 76   ? -59.712 -32.989 -49.177 1.00 74.55  ? 76   ILE A CG1   1 
ATOM   564   C  CG2   . ILE A 1 76   ? -60.303 -34.906 -50.760 1.00 75.75  ? 76   ILE A CG2   1 
ATOM   565   C  CD1   . ILE A 1 76   ? -59.872 -31.852 -50.162 1.00 75.63  ? 76   ILE A CD1   1 
ATOM   566   N  N     . PRO A 1 77   ? -59.207 -37.661 -49.316 1.00 76.49  ? 77   PRO A N     1 
ATOM   567   C  CA    . PRO A 1 77   ? -59.016 -38.834 -50.185 1.00 76.94  ? 77   PRO A CA    1 
ATOM   568   C  C     . PRO A 1 77   ? -59.772 -38.630 -51.478 1.00 76.02  ? 77   PRO A C     1 
ATOM   569   O  O     . PRO A 1 77   ? -60.940 -38.241 -51.443 1.00 87.46  ? 77   PRO A O     1 
ATOM   570   C  CB    . PRO A 1 77   ? -59.544 -39.990 -49.351 1.00 76.15  ? 77   PRO A CB    1 
ATOM   571   C  CG    . PRO A 1 77   ? -60.537 -39.366 -48.458 1.00 78.77  ? 77   PRO A CG    1 
ATOM   572   C  CD    . PRO A 1 77   ? -60.263 -37.894 -48.334 1.00 80.18  ? 77   PRO A CD    1 
ATOM   573   N  N     . ILE A 1 78   ? -59.121 -38.890 -52.613 1.00 75.96  ? 78   ILE A N     1 
ATOM   574   C  CA    . ILE A 1 78   ? -59.729 -38.603 -53.932 1.00 81.85  ? 78   ILE A CA    1 
ATOM   575   C  C     . ILE A 1 78   ? -61.046 -39.334 -54.205 1.00 80.03  ? 78   ILE A C     1 
ATOM   576   O  O     . ILE A 1 78   ? -61.890 -38.828 -54.939 1.00 83.16  ? 78   ILE A O     1 
ATOM   577   C  CB    . ILE A 1 78   ? -58.853 -38.856 -55.181 1.00 84.96  ? 78   ILE A CB    1 
ATOM   578   C  CG1   . ILE A 1 78   ? -58.006 -40.115 -55.033 1.00 88.93  ? 78   ILE A CG1   1 
ATOM   579   C  CG2   . ILE A 1 78   ? -58.013 -37.630 -55.508 1.00 89.29  ? 78   ILE A CG2   1 
ATOM   580   C  CD1   . ILE A 1 78   ? -57.461 -40.639 -56.352 1.00 90.18  ? 78   ILE A CD1   1 
ATOM   581   N  N     . CYS A 1 79   ? -61.246 -40.489 -53.601 1.00 82.81  ? 79   CYS A N     1 
ATOM   582   C  CA    . CYS A 1 79   ? -62.527 -41.194 -53.702 1.00 87.95  ? 79   CYS A CA    1 
ATOM   583   C  C     . CYS A 1 79   ? -63.734 -40.382 -53.189 1.00 89.94  ? 79   CYS A C     1 
ATOM   584   O  O     . CYS A 1 79   ? -64.863 -40.670 -53.577 1.00 96.47  ? 79   CYS A O     1 
ATOM   585   C  CB    . CYS A 1 79   ? -62.409 -42.529 -52.990 1.00 95.40  ? 79   CYS A CB    1 
ATOM   586   S  SG    . CYS A 1 79   ? -61.174 -43.560 -53.797 1.00 105.56 ? 79   CYS A SG    1 
ATOM   587   N  N     . SER A 1 80   ? -63.497 -39.385 -52.335 1.00 91.25  ? 80   SER A N     1 
ATOM   588   C  CA    . SER A 1 80   ? -64.519 -38.404 -51.939 1.00 90.33  ? 80   SER A CA    1 
ATOM   589   C  C     . SER A 1 80   ? -64.884 -37.364 -52.987 1.00 86.19  ? 80   SER A C     1 
ATOM   590   O  O     . SER A 1 80   ? -65.900 -36.690 -52.843 1.00 78.91  ? 80   SER A O     1 
ATOM   591   C  CB    . SER A 1 80   ? -64.056 -37.633 -50.714 1.00 91.89  ? 80   SER A CB    1 
ATOM   592   O  OG    . SER A 1 80   ? -63.626 -38.550 -49.740 1.00 100.54 ? 80   SER A OG    1 
ATOM   593   N  N     . LEU A 1 81   ? -64.063 -37.201 -54.013 1.00 91.14  ? 81   LEU A N     1 
ATOM   594   C  CA    . LEU A 1 81   ? -64.260 -36.133 -54.989 1.00 91.56  ? 81   LEU A CA    1 
ATOM   595   C  C     . LEU A 1 81   ? -65.147 -36.524 -56.153 1.00 87.34  ? 81   LEU A C     1 
ATOM   596   O  O     . LEU A 1 81   ? -65.393 -35.696 -57.014 1.00 82.60  ? 81   LEU A O     1 
ATOM   597   C  CB    . LEU A 1 81   ? -62.905 -35.593 -55.442 1.00 100.33 ? 81   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1 81   ? -62.080 -35.132 -54.223 1.00 102.75 ? 81   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1 81   ? -60.665 -34.747 -54.612 1.00 103.17 ? 81   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1 81   ? -62.778 -33.981 -53.508 1.00 106.68 ? 81   LEU A CD2   1 
ATOM   601   N  N     . TYR A 1 82   ? -65.645 -37.762 -56.180 1.00 89.06  ? 82   TYR A N     1 
ATOM   602   C  CA    . TYR A 1 82   ? -66.511 -38.215 -57.268 1.00 79.96  ? 82   TYR A CA    1 
ATOM   603   C  C     . TYR A 1 82   ? -67.574 -37.178 -57.599 1.00 71.18  ? 82   TYR A C     1 
ATOM   604   O  O     . TYR A 1 82   ? -68.336 -36.785 -56.735 1.00 65.10  ? 82   TYR A O     1 
ATOM   605   C  CB    . TYR A 1 82   ? -67.192 -39.536 -56.950 1.00 83.74  ? 82   TYR A CB    1 
ATOM   606   C  CG    . TYR A 1 82   ? -67.943 -40.063 -58.138 1.00 87.73  ? 82   TYR A CG    1 
ATOM   607   C  CD1   . TYR A 1 82   ? -69.184 -39.540 -58.475 1.00 89.98  ? 82   TYR A CD1   1 
ATOM   608   C  CD2   . TYR A 1 82   ? -67.413 -41.065 -58.947 1.00 93.04  ? 82   TYR A CD2   1 
ATOM   609   C  CE1   . TYR A 1 82   ? -69.894 -39.995 -59.577 1.00 90.95  ? 82   TYR A CE1   1 
ATOM   610   C  CE2   . TYR A 1 82   ? -68.120 -41.530 -60.053 1.00 98.10  ? 82   TYR A CE2   1 
ATOM   611   C  CZ    . TYR A 1 82   ? -69.366 -40.987 -60.358 1.00 95.54  ? 82   TYR A CZ    1 
ATOM   612   O  OH    . TYR A 1 82   ? -70.099 -41.418 -61.439 1.00 99.66  ? 82   TYR A OH    1 
ATOM   613   N  N     . GLY A 1 83   ? -67.629 -36.754 -58.857 1.00 75.72  ? 83   GLY A N     1 
ATOM   614   C  CA    . GLY A 1 83   ? -68.632 -35.804 -59.309 1.00 82.88  ? 83   GLY A CA    1 
ATOM   615   C  C     . GLY A 1 83   ? -68.393 -34.356 -58.902 1.00 79.87  ? 83   GLY A C     1 
ATOM   616   O  O     . GLY A 1 83   ? -69.231 -33.522 -59.170 1.00 75.34  ? 83   GLY A O     1 
ATOM   617   N  N     . ALA A 1 84   ? -67.250 -34.047 -58.298 1.00 76.94  ? 84   ALA A N     1 
ATOM   618   C  CA    . ALA A 1 84   ? -66.935 -32.695 -57.836 1.00 76.43  ? 84   ALA A CA    1 
ATOM   619   C  C     . ALA A 1 84   ? -65.866 -32.051 -58.699 1.00 76.82  ? 84   ALA A C     1 
ATOM   620   O  O     . ALA A 1 84   ? -65.269 -32.716 -59.539 1.00 81.17  ? 84   ALA A O     1 
ATOM   621   C  CB    . ALA A 1 84   ? -66.441 -32.767 -56.418 1.00 79.47  ? 84   ALA A CB    1 
ATOM   622   N  N     . ALA A 1 85   ? -65.612 -30.769 -58.471 1.00 75.00  ? 85   ALA A N     1 
ATOM   623   C  CA    . ALA A 1 85   ? -64.636 -30.003 -59.267 1.00 77.91  ? 85   ALA A CA    1 
ATOM   624   C  C     . ALA A 1 85   ? -63.641 -29.357 -58.333 1.00 78.22  ? 85   ALA A C     1 
ATOM   625   O  O     . ALA A 1 85   ? -64.030 -28.529 -57.518 1.00 79.31  ? 85   ALA A O     1 
ATOM   626   C  CB    . ALA A 1 85   ? -65.349 -28.938 -60.077 1.00 74.29  ? 85   ALA A CB    1 
ATOM   627   N  N     . VAL A 1 86   ? -62.369 -29.754 -58.447 1.00 83.64  ? 86   VAL A N     1 
ATOM   628   C  CA    . VAL A 1 86   ? -61.302 -29.184 -57.643 1.00 76.05  ? 86   VAL A CA    1 
ATOM   629   C  C     . VAL A 1 86   ? -60.735 -28.017 -58.423 1.00 75.97  ? 86   VAL A C     1 
ATOM   630   O  O     . VAL A 1 86   ? -60.743 -28.030 -59.648 1.00 78.37  ? 86   VAL A O     1 
ATOM   631   C  CB    . VAL A 1 86   ? -60.180 -30.193 -57.332 1.00 74.24  ? 86   VAL A CB    1 
ATOM   632   C  CG1   . VAL A 1 86   ? -59.164 -29.574 -56.396 1.00 74.65  ? 86   VAL A CG1   1 
ATOM   633   C  CG2   . VAL A 1 86   ? -60.733 -31.480 -56.721 1.00 73.36  ? 86   VAL A CG2   1 
ATOM   634   N  N     . THR A 1 87   ? -60.295 -26.977 -57.719 1.00 77.63  ? 87   THR A N     1 
ATOM   635   C  CA    . THR A 1 87   ? -59.535 -25.885 -58.345 1.00 78.80  ? 87   THR A CA    1 
ATOM   636   C  C     . THR A 1 87   ? -58.289 -25.610 -57.518 1.00 74.82  ? 87   THR A C     1 
ATOM   637   O  O     . THR A 1 87   ? -58.385 -25.321 -56.338 1.00 73.05  ? 87   THR A O     1 
ATOM   638   C  CB    . THR A 1 87   ? -60.338 -24.572 -58.580 1.00 82.97  ? 87   THR A CB    1 
ATOM   639   O  OG1   . THR A 1 87   ? -61.540 -24.820 -59.321 1.00 79.04  ? 87   THR A OG1   1 
ATOM   640   C  CG2   . THR A 1 87   ? -59.523 -23.620 -59.407 1.00 89.40  ? 87   THR A CG2   1 
ATOM   641   N  N     . THR A 1 88   ? -57.123 -25.718 -58.159 1.00 79.66  ? 88   THR A N     1 
ATOM   642   C  CA    . THR A 1 88   ? -55.835 -25.400 -57.527 1.00 79.23  ? 88   THR A CA    1 
ATOM   643   C  C     . THR A 1 88   ? -55.453 -23.991 -57.950 1.00 75.78  ? 88   THR A C     1 
ATOM   644   O  O     . THR A 1 88   ? -56.189 -23.338 -58.719 1.00 60.41  ? 88   THR A O     1 
ATOM   645   C  CB    . THR A 1 88   ? -54.686 -26.272 -58.029 1.00 85.96  ? 88   THR A CB    1 
ATOM   646   O  OG1   . THR A 1 88   ? -54.364 -25.870 -59.366 1.00 93.76  ? 88   THR A OG1   1 
ATOM   647   C  CG2   . THR A 1 88   ? -55.061 -27.732 -58.008 1.00 94.28  ? 88   THR A CG2   1 
ATOM   648   N  N     . VAL A 1 89   ? -54.307 -23.529 -57.426 1.00 75.40  ? 89   VAL A N     1 
ATOM   649   C  CA    . VAL A 1 89   ? -53.790 -22.186 -57.758 1.00 79.68  ? 89   VAL A CA    1 
ATOM   650   C  C     . VAL A 1 89   ? -53.568 -21.995 -59.266 1.00 79.96  ? 89   VAL A C     1 
ATOM   651   O  O     . VAL A 1 89   ? -53.876 -20.932 -59.792 1.00 77.05  ? 89   VAL A O     1 
ATOM   652   C  CB    . VAL A 1 89   ? -52.527 -21.802 -56.938 1.00 83.77  ? 89   VAL A CB    1 
ATOM   653   C  CG1   . VAL A 1 89   ? -51.306 -22.633 -57.321 1.00 87.37  ? 89   VAL A CG1   1 
ATOM   654   C  CG2   . VAL A 1 89   ? -52.226 -20.324 -57.125 1.00 86.93  ? 89   VAL A CG2   1 
ATOM   655   N  N     . GLU A 1 90   ? -53.094 -23.040 -59.949 1.00 82.94  ? 90   GLU A N     1 
ATOM   656   C  CA    . GLU A 1 90   ? -52.874 -23.030 -61.393 1.00 84.14  ? 90   GLU A CA    1 
ATOM   657   C  C     . GLU A 1 90   ? -54.158 -22.791 -62.181 1.00 85.84  ? 90   GLU A C     1 
ATOM   658   O  O     . GLU A 1 90   ? -54.133 -22.181 -63.247 1.00 102.19 ? 90   GLU A O     1 
ATOM   659   C  CB    . GLU A 1 90   ? -52.197 -24.334 -61.821 1.00 89.87  ? 90   GLU A CB    1 
ATOM   660   C  CG    . GLU A 1 90   ? -50.804 -24.515 -61.209 1.00 96.06  ? 90   GLU A CG    1 
ATOM   661   C  CD    . GLU A 1 90   ? -50.659 -25.678 -60.208 1.00 96.30  ? 90   GLU A CD    1 
ATOM   662   O  OE1   . GLU A 1 90   ? -51.586 -25.991 -59.420 1.00 83.21  ? 90   GLU A OE1   1 
ATOM   663   O  OE2   . GLU A 1 90   ? -49.563 -26.292 -60.200 1.00 111.14 ? 90   GLU A OE2   1 
ATOM   664   N  N     . GLY A 1 91   ? -55.279 -23.273 -61.645 1.00 85.02  ? 91   GLY A N     1 
ATOM   665   C  CA    . GLY A 1 91   ? -56.582 -23.133 -62.288 1.00 78.84  ? 91   GLY A CA    1 
ATOM   666   C  C     . GLY A 1 91   ? -57.157 -21.729 -62.392 1.00 75.13  ? 91   GLY A C     1 
ATOM   667   O  O     . GLY A 1 91   ? -57.927 -21.449 -63.302 1.00 81.11  ? 91   GLY A O     1 
ATOM   668   N  N     . ILE A 1 92   ? -56.806 -20.841 -61.472 1.00 79.60  ? 92   ILE A N     1 
ATOM   669   C  CA    . ILE A 1 92   ? -57.410 -19.495 -61.451 1.00 75.53  ? 92   ILE A CA    1 
ATOM   670   C  C     . ILE A 1 92   ? -56.661 -18.493 -62.313 1.00 76.58  ? 92   ILE A C     1 
ATOM   671   O  O     . ILE A 1 92   ? -57.216 -17.480 -62.682 1.00 72.22  ? 92   ILE A O     1 
ATOM   672   C  CB    . ILE A 1 92   ? -57.662 -19.005 -60.022 1.00 76.81  ? 92   ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1 92   ? -56.365 -18.872 -59.219 1.00 78.47  ? 92   ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1 92   ? -58.558 -19.998 -59.321 1.00 76.45  ? 92   ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1 92   ? -56.562 -18.328 -57.827 1.00 72.95  ? 92   ILE A CD1   1 
ATOM   676   N  N     . GLY A 1 93   ? -55.416 -18.780 -62.663 1.00 86.96  ? 93   GLY A N     1 
ATOM   677   C  CA    . GLY A 1 93   ? -54.698 -17.977 -63.644 1.00 99.23  ? 93   GLY A CA    1 
ATOM   678   C  C     . GLY A 1 93   ? -53.236 -18.342 -63.720 1.00 100.05 ? 93   GLY A C     1 
ATOM   679   O  O     . GLY A 1 93   ? -52.727 -19.023 -62.841 1.00 85.44  ? 93   GLY A O     1 
ATOM   680   N  N     . SER A 1 94   ? -52.567 -17.898 -64.784 1.00 102.84 ? 94   SER A N     1 
ATOM   681   C  CA    . SER A 1 94   ? -51.134 -18.077 -64.940 1.00 96.20  ? 94   SER A CA    1 
ATOM   682   C  C     . SER A 1 94   ? -50.512 -16.991 -65.825 1.00 91.37  ? 94   SER A C     1 
ATOM   683   O  O     . SER A 1 94   ? -51.213 -16.186 -66.421 1.00 87.34  ? 94   SER A O     1 
ATOM   684   C  CB    . SER A 1 94   ? -50.829 -19.487 -65.475 1.00 94.82  ? 94   SER A CB    1 
ATOM   685   O  OG    . SER A 1 94   ? -51.067 -19.601 -66.871 1.00 87.99  ? 94   SER A OG    1 
ATOM   686   N  N     . THR A 1 95   ? -49.181 -16.960 -65.847 1.00 87.43  ? 95   THR A N     1 
ATOM   687   C  CA    . THR A 1 95   ? -48.413 -15.994 -66.630 1.00 87.54  ? 95   THR A CA    1 
ATOM   688   C  C     . THR A 1 95   ? -48.496 -16.249 -68.139 1.00 87.94  ? 95   THR A C     1 
ATOM   689   O  O     . THR A 1 95   ? -48.197 -15.356 -68.930 1.00 90.29  ? 95   THR A O     1 
ATOM   690   C  CB    . THR A 1 95   ? -46.949 -16.049 -66.250 1.00 88.23  ? 95   THR A CB    1 
ATOM   691   O  OG1   . THR A 1 95   ? -46.481 -17.379 -66.479 1.00 90.18  ? 95   THR A OG1   1 
ATOM   692   C  CG2   . THR A 1 95   ? -46.759 -15.642 -64.782 1.00 85.43  ? 95   THR A CG2   1 
ATOM   693   N  N     . HIS A 1 96   ? -48.878 -17.460 -68.539 1.00 88.30  ? 96   HIS A N     1 
ATOM   694   C  CA    . HIS A 1 96   ? -49.070 -17.794 -69.950 1.00 100.84 ? 96   HIS A CA    1 
ATOM   695   C  C     . HIS A 1 96   ? -50.568 -17.888 -70.348 1.00 109.23 ? 96   HIS A C     1 
ATOM   696   O  O     . HIS A 1 96   ? -50.899 -18.457 -71.382 1.00 118.21 ? 96   HIS A O     1 
ATOM   697   C  CB    . HIS A 1 96   ? -48.375 -19.123 -70.241 1.00 101.46 ? 96   HIS A CB    1 
ATOM   698   C  CG    . HIS A 1 96   ? -48.848 -20.240 -69.363 1.00 116.78 ? 96   HIS A CG    1 
ATOM   699   N  ND1   . HIS A 1 96   ? -48.175 -20.630 -68.226 1.00 123.85 ? 96   HIS A ND1   1 
ATOM   700   C  CD2   . HIS A 1 96   ? -49.951 -21.025 -69.433 1.00 122.86 ? 96   HIS A CD2   1 
ATOM   701   C  CE1   . HIS A 1 96   ? -48.828 -21.624 -67.648 1.00 120.07 ? 96   HIS A CE1   1 
ATOM   702   N  NE2   . HIS A 1 96   ? -49.912 -21.879 -68.357 1.00 113.85 ? 96   HIS A NE2   1 
ATOM   703   N  N     . THR A 1 97   ? -51.460 -17.293 -69.537 1.00 113.21 ? 97   THR A N     1 
ATOM   704   C  CA    . THR A 1 97   ? -52.856 -17.078 -69.907 1.00 108.77 ? 97   THR A CA    1 
ATOM   705   C  C     . THR A 1 97   ? -53.181 -15.644 -69.439 1.00 104.52 ? 97   THR A C     1 
ATOM   706   O  O     . THR A 1 97   ? -52.614 -14.680 -69.982 1.00 108.90 ? 97   THR A O     1 
ATOM   707   C  CB    . THR A 1 97   ? -53.803 -18.106 -69.230 1.00 104.95 ? 97   THR A CB    1 
ATOM   708   O  OG1   . THR A 1 97   ? -53.750 -17.966 -67.804 1.00 105.93 ? 97   THR A OG1   1 
ATOM   709   C  CG2   . THR A 1 97   ? -53.432 -19.524 -69.599 1.00 99.48  ? 97   THR A CG2   1 
ATOM   710   N  N     . ARG A 1 98   ? -54.047 -15.497 -68.437 1.00 109.19 ? 98   ARG A N     1 
ATOM   711   C  CA    . ARG A 1 98   ? -54.140 -14.240 -67.722 1.00 115.43 ? 98   ARG A CA    1 
ATOM   712   C  C     . ARG A 1 98   ? -53.996 -14.533 -66.231 1.00 113.89 ? 98   ARG A C     1 
ATOM   713   O  O     . ARG A 1 98   ? -54.452 -15.569 -65.742 1.00 110.24 ? 98   ARG A O     1 
ATOM   714   C  CB    . ARG A 1 98   ? -55.456 -13.508 -68.039 1.00 124.98 ? 98   ARG A CB    1 
ATOM   715   C  CG    . ARG A 1 98   ? -56.731 -14.289 -67.718 1.00 133.74 ? 98   ARG A CG    1 
ATOM   716   C  CD    . ARG A 1 98   ? -57.990 -13.481 -68.024 1.00 140.91 ? 98   ARG A CD    1 
ATOM   717   N  NE    . ARG A 1 98   ? -58.049 -12.208 -67.294 1.00 141.47 ? 98   ARG A NE    1 
ATOM   718   C  CZ    . ARG A 1 98   ? -58.434 -12.057 -66.024 1.00 133.82 ? 98   ARG A CZ    1 
ATOM   719   N  NH1   . ARG A 1 98   ? -58.805 -13.100 -65.276 1.00 129.74 ? 98   ARG A NH1   1 
ATOM   720   N  NH2   . ARG A 1 98   ? -58.432 -10.843 -65.488 1.00 125.37 ? 98   ARG A NH2   1 
ATOM   721   N  N     . ILE A 1 99   ? -53.336 -13.615 -65.524 1.00 102.76 ? 99   ILE A N     1 
ATOM   722   C  CA    . ILE A 1 99   ? -53.204 -13.678 -64.080 1.00 92.69  ? 99   ILE A CA    1 
ATOM   723   C  C     . ILE A 1 99   ? -54.539 -13.234 -63.454 1.00 95.59  ? 99   ILE A C     1 
ATOM   724   O  O     . ILE A 1 99   ? -55.180 -12.290 -63.936 1.00 108.37 ? 99   ILE A O     1 
ATOM   725   C  CB    . ILE A 1 99   ? -52.083 -12.740 -63.634 1.00 86.85  ? 99   ILE A CB    1 
ATOM   726   C  CG1   . ILE A 1 99   ? -50.767 -13.121 -64.296 1.00 84.06  ? 99   ILE A CG1   1 
ATOM   727   C  CG2   . ILE A 1 99   ? -51.918 -12.793 -62.131 1.00 99.79  ? 99   ILE A CG2   1 
ATOM   728   C  CD1   . ILE A 1 99   ? -49.775 -11.979 -64.350 1.00 82.72  ? 99   ILE A CD1   1 
ATOM   729   N  N     . HIS A 1 100  ? -54.970 -13.923 -62.401 1.00 86.89  ? 100  HIS A N     1 
ATOM   730   C  CA    . HIS A 1 100  ? -56.173 -13.530 -61.676 1.00 79.28  ? 100  HIS A CA    1 
ATOM   731   C  C     . HIS A 1 100  ? -55.869 -12.353 -60.754 1.00 83.14  ? 100  HIS A C     1 
ATOM   732   O  O     . HIS A 1 100  ? -54.743 -12.235 -60.294 1.00 81.73  ? 100  HIS A O     1 
ATOM   733   C  CB    . HIS A 1 100  ? -56.712 -14.680 -60.860 1.00 77.98  ? 100  HIS A CB    1 
ATOM   734   C  CG    . HIS A 1 100  ? -58.079 -14.417 -60.327 1.00 77.83  ? 100  HIS A CG    1 
ATOM   735   N  ND1   . HIS A 1 100  ? -58.298 -13.625 -59.225 1.00 80.80  ? 100  HIS A ND1   1 
ATOM   736   C  CD2   . HIS A 1 100  ? -59.300 -14.787 -60.770 1.00 81.85  ? 100  HIS A CD2   1 
ATOM   737   C  CE1   . HIS A 1 100  ? -59.591 -13.543 -58.989 1.00 83.53  ? 100  HIS A CE1   1 
ATOM   738   N  NE2   . HIS A 1 100  ? -60.224 -14.240 -59.913 1.00 85.49  ? 100  HIS A NE2   1 
ATOM   739   N  N     . PRO A 1 101  ? -56.855 -11.464 -60.485 1.00 90.36  ? 101  PRO A N     1 
ATOM   740   C  CA    . PRO A 1 101  ? -56.527 -10.293 -59.631 1.00 85.53  ? 101  PRO A CA    1 
ATOM   741   C  C     . PRO A 1 101  ? -56.013 -10.623 -58.228 1.00 74.15  ? 101  PRO A C     1 
ATOM   742   O  O     . PRO A 1 101  ? -55.101 -9.972  -57.751 1.00 68.35  ? 101  PRO A O     1 
ATOM   743   C  CB    . PRO A 1 101  ? -57.841 -9.538  -59.550 1.00 83.89  ? 101  PRO A CB    1 
ATOM   744   C  CG    . PRO A 1 101  ? -58.520 -9.869  -60.836 1.00 86.99  ? 101  PRO A CG    1 
ATOM   745   C  CD    . PRO A 1 101  ? -58.104 -11.254 -61.239 1.00 84.41  ? 101  PRO A CD    1 
ATOM   746   N  N     . VAL A 1 102  ? -56.595 -11.621 -57.583 1.00 70.63  ? 102  VAL A N     1 
ATOM   747   C  CA    . VAL A 1 102  ? -56.068 -12.160 -56.314 1.00 77.71  ? 102  VAL A CA    1 
ATOM   748   C  C     . VAL A 1 102  ? -54.571 -12.492 -56.393 1.00 76.48  ? 102  VAL A C     1 
ATOM   749   O  O     . VAL A 1 102  ? -53.814 -12.199 -55.468 1.00 76.12  ? 102  VAL A O     1 
ATOM   750   C  CB    . VAL A 1 102  ? -56.807 -13.458 -55.890 1.00 80.91  ? 102  VAL A CB    1 
ATOM   751   C  CG1   . VAL A 1 102  ? -56.091 -14.147 -54.744 1.00 80.57  ? 102  VAL A CG1   1 
ATOM   752   C  CG2   . VAL A 1 102  ? -58.247 -13.180 -55.502 1.00 82.72  ? 102  VAL A CG2   1 
ATOM   753   N  N     . GLN A 1 103  ? -54.162 -13.104 -57.506 1.00 75.92  ? 103  GLN A N     1 
ATOM   754   C  CA    . GLN A 1 103  ? -52.749 -13.430 -57.752 1.00 76.34  ? 103  GLN A CA    1 
ATOM   755   C  C     . GLN A 1 103  ? -51.897 -12.192 -58.013 1.00 82.14  ? 103  GLN A C     1 
ATOM   756   O  O     . GLN A 1 103  ? -50.798 -12.068 -57.482 1.00 79.07  ? 103  GLN A O     1 
ATOM   757   C  CB    . GLN A 1 103  ? -52.599 -14.367 -58.953 1.00 74.60  ? 103  GLN A CB    1 
ATOM   758   C  CG    . GLN A 1 103  ? -53.235 -15.714 -58.724 1.00 81.59  ? 103  GLN A CG    1 
ATOM   759   C  CD    . GLN A 1 103  ? -53.293 -16.569 -59.962 1.00 81.77  ? 103  GLN A CD    1 
ATOM   760   O  OE1   . GLN A 1 103  ? -53.632 -16.082 -61.045 1.00 77.71  ? 103  GLN A OE1   1 
ATOM   761   N  NE2   . GLN A 1 103  ? -52.986 -17.872 -59.804 1.00 79.86  ? 103  GLN A NE2   1 
ATOM   762   N  N     . GLU A 1 104  ? -52.390 -11.298 -58.862 1.00 88.98  ? 104  GLU A N     1 
ATOM   763   C  CA    . GLU A 1 104  ? -51.723 -10.019 -59.139 1.00 93.36  ? 104  GLU A CA    1 
ATOM   764   C  C     . GLU A 1 104  ? -51.427 -9.223  -57.865 1.00 84.36  ? 104  GLU A C     1 
ATOM   765   O  O     . GLU A 1 104  ? -50.311 -8.734  -57.687 1.00 87.95  ? 104  GLU A O     1 
ATOM   766   C  CB    . GLU A 1 104  ? -52.638 -9.196  -60.056 1.00 104.36 ? 104  GLU A CB    1 
ATOM   767   C  CG    . GLU A 1 104  ? -52.318 -7.720  -60.270 1.00 104.66 ? 104  GLU A CG    1 
ATOM   768   C  CD    . GLU A 1 104  ? -53.383 -7.070  -61.142 1.00 113.36 ? 104  GLU A CD    1 
ATOM   769   O  OE1   . GLU A 1 104  ? -54.585 -7.404  -60.968 1.00 121.14 ? 104  GLU A OE1   1 
ATOM   770   O  OE2   . GLU A 1 104  ? -53.030 -6.240  -62.008 1.00 118.67 ? 104  GLU A OE2   1 
ATOM   771   N  N     . ARG A 1 105  ? -52.424 -9.111  -56.988 1.00 77.84  ? 105  ARG A N     1 
ATOM   772   C  CA    . ARG A 1 105  ? -52.381 -8.159  -55.881 1.00 86.55  ? 105  ARG A CA    1 
ATOM   773   C  C     . ARG A 1 105  ? -51.604 -8.638  -54.683 1.00 86.40  ? 105  ARG A C     1 
ATOM   774   O  O     . ARG A 1 105  ? -50.837 -7.874  -54.101 1.00 87.82  ? 105  ARG A O     1 
ATOM   775   C  CB    . ARG A 1 105  ? -53.802 -7.836  -55.479 1.00 98.09  ? 105  ARG A CB    1 
ATOM   776   C  CG    . ARG A 1 105  ? -54.531 -7.100  -56.583 1.00 102.33 ? 105  ARG A CG    1 
ATOM   777   C  CD    . ARG A 1 105  ? -55.905 -6.672  -56.138 1.00 102.97 ? 105  ARG A CD    1 
ATOM   778   N  NE    . ARG A 1 105  ? -56.763 -6.422  -57.278 1.00 108.87 ? 105  ARG A NE    1 
ATOM   779   C  CZ    . ARG A 1 105  ? -58.016 -6.015  -57.176 1.00 110.74 ? 105  ARG A CZ    1 
ATOM   780   N  NH1   . ARG A 1 105  ? -58.552 -5.813  -55.975 1.00 99.05  ? 105  ARG A NH1   1 
ATOM   781   N  NH2   . ARG A 1 105  ? -58.729 -5.808  -58.278 1.00 119.47 ? 105  ARG A NH2   1 
ATOM   782   N  N     . ILE A 1 106  ? -51.809 -9.895  -54.298 1.00 83.07  ? 106  ILE A N     1 
ATOM   783   C  CA    . ILE A 1 106  ? -50.982 -10.490 -53.255 1.00 86.67  ? 106  ILE A CA    1 
ATOM   784   C  C     . ILE A 1 106  ? -49.492 -10.379 -53.573 1.00 82.59  ? 106  ILE A C     1 
ATOM   785   O  O     . ILE A 1 106  ? -48.699 -10.146 -52.677 1.00 89.65  ? 106  ILE A O     1 
ATOM   786   C  CB    . ILE A 1 106  ? -51.268 -11.988 -53.092 1.00 82.29  ? 106  ILE A CB    1 
ATOM   787   C  CG1   . ILE A 1 106  ? -51.216 -12.392 -51.629 1.00 88.35  ? 106  ILE A CG1   1 
ATOM   788   C  CG2   . ILE A 1 106  ? -50.253 -12.822 -53.858 1.00 81.92  ? 106  ILE A CG2   1 
ATOM   789   C  CD1   . ILE A 1 106  ? -51.763 -13.787 -51.360 1.00 92.47  ? 106  ILE A CD1   1 
ATOM   790   N  N     . ALA A 1 107  ? -49.134 -10.525 -54.852 1.00 82.24  ? 107  ALA A N     1 
ATOM   791   C  CA    . ALA A 1 107  ? -47.757 -10.357 -55.312 1.00 84.61  ? 107  ALA A CA    1 
ATOM   792   C  C     . ALA A 1 107  ? -47.334 -8.894  -55.321 1.00 81.63  ? 107  ALA A C     1 
ATOM   793   O  O     . ALA A 1 107  ? -46.325 -8.532  -54.711 1.00 90.44  ? 107  ALA A O     1 
ATOM   794   C  CB    . ALA A 1 107  ? -47.590 -10.929 -56.702 1.00 87.36  ? 107  ALA A CB    1 
ATOM   795   N  N     . LYS A 1 108  ? -48.092 -8.046  -56.009 1.00 88.61  ? 108  LYS A N     1 
ATOM   796   C  CA    . LYS A 1 108  ? -47.706 -6.632  -56.133 1.00 92.78  ? 108  LYS A CA    1 
ATOM   797   C  C     . LYS A 1 108  ? -47.808 -5.801  -54.846 1.00 94.03  ? 108  LYS A C     1 
ATOM   798   O  O     . LYS A 1 108  ? -47.143 -4.769  -54.742 1.00 86.93  ? 108  LYS A O     1 
ATOM   799   C  CB    . LYS A 1 108  ? -48.437 -5.953  -57.273 1.00 90.08  ? 108  LYS A CB    1 
ATOM   800   C  CG    . LYS A 1 108  ? -47.901 -6.354  -58.627 1.00 86.75  ? 108  LYS A CG    1 
ATOM   801   C  CD    . LYS A 1 108  ? -49.011 -6.216  -59.633 1.00 97.51  ? 108  LYS A CD    1 
ATOM   802   C  CE    . LYS A 1 108  ? -48.526 -6.514  -61.023 1.00 110.90 ? 108  LYS A CE    1 
ATOM   803   N  NZ    . LYS A 1 108  ? -49.466 -5.884  -61.984 1.00 123.47 ? 108  LYS A NZ    1 
ATOM   804   N  N     . CYS A 1 109  ? -48.575 -6.270  -53.856 1.00 95.72  ? 109  CYS A N     1 
ATOM   805   C  CA    . CYS A 1 109  ? -48.544 -5.688  -52.504 1.00 95.99  ? 109  CYS A CA    1 
ATOM   806   C  C     . CYS A 1 109  ? -47.409 -6.254  -51.622 1.00 92.57  ? 109  CYS A C     1 
ATOM   807   O  O     . CYS A 1 109  ? -47.384 -5.984  -50.423 1.00 89.99  ? 109  CYS A O     1 
ATOM   808   C  CB    . CYS A 1 109  ? -49.844 -5.983  -51.736 1.00 96.84  ? 109  CYS A CB    1 
ATOM   809   S  SG    . CYS A 1 109  ? -51.354 -5.220  -52.340 1.00 96.58  ? 109  CYS A SG    1 
ATOM   810   N  N     . HIS A 1 110  ? -46.502 -7.038  -52.215 1.00 85.51  ? 110  HIS A N     1 
ATOM   811   C  CA    . HIS A 1 110  ? -45.349 -7.631  -51.532 1.00 76.21  ? 110  HIS A CA    1 
ATOM   812   C  C     . HIS A 1 110  ? -45.770 -8.606  -50.447 1.00 76.95  ? 110  HIS A C     1 
ATOM   813   O  O     . HIS A 1 110  ? -45.133 -8.702  -49.392 1.00 84.53  ? 110  HIS A O     1 
ATOM   814   C  CB    . HIS A 1 110  ? -44.466 -6.517  -51.001 1.00 75.15  ? 110  HIS A CB    1 
ATOM   815   C  CG    . HIS A 1 110  ? -44.221 -5.441  -52.006 1.00 77.27  ? 110  HIS A CG    1 
ATOM   816   N  ND1   . HIS A 1 110  ? -43.347 -5.596  -53.060 1.00 77.05  ? 110  HIS A ND1   1 
ATOM   817   C  CD2   . HIS A 1 110  ? -44.766 -4.211  -52.146 1.00 82.78  ? 110  HIS A CD2   1 
ATOM   818   C  CE1   . HIS A 1 110  ? -43.347 -4.500  -53.796 1.00 81.84  ? 110  HIS A CE1   1 
ATOM   819   N  NE2   . HIS A 1 110  ? -44.202 -3.644  -53.264 1.00 89.79  ? 110  HIS A NE2   1 
ATOM   820   N  N     . GLY A 1 111  ? -46.832 -9.359  -50.737 1.00 88.52  ? 111  GLY A N     1 
ATOM   821   C  CA    . GLY A 1 111  ? -47.357 -10.354 -49.809 1.00 93.82  ? 111  GLY A CA    1 
ATOM   822   C  C     . GLY A 1 111  ? -46.742 -11.735 -49.935 1.00 91.04  ? 111  GLY A C     1 
ATOM   823   O  O     . GLY A 1 111  ? -47.315 -12.715 -49.461 1.00 94.51  ? 111  GLY A O     1 
ATOM   824   N  N     . THR A 1 112  ? -45.612 -11.822 -50.635 1.00 83.73  ? 112  THR A N     1 
ATOM   825   C  CA    . THR A 1 112  ? -44.850 -13.047 -50.829 1.00 85.74  ? 112  THR A CA    1 
ATOM   826   C  C     . THR A 1 112  ? -43.380 -12.757 -50.575 1.00 72.45  ? 112  THR A C     1 
ATOM   827   O  O     . THR A 1 112  ? -42.859 -11.759 -51.068 1.00 69.98  ? 112  THR A O     1 
ATOM   828   C  CB    . THR A 1 112  ? -44.946 -13.454 -52.296 1.00 89.10  ? 112  THR A CB    1 
ATOM   829   O  OG1   . THR A 1 112  ? -44.170 -12.535 -53.062 1.00 94.31  ? 112  THR A OG1   1 
ATOM   830   C  CG2   . THR A 1 112  ? -46.389 -13.394 -52.792 1.00 90.60  ? 112  THR A CG2   1 
ATOM   831   N  N     . GLN A 1 113  ? -42.720 -13.640 -49.829 1.00 71.32  ? 113  GLN A N     1 
ATOM   832   C  CA    . GLN A 1 113  ? -41.299 -13.530 -49.613 1.00 77.98  ? 113  GLN A CA    1 
ATOM   833   C  C     . GLN A 1 113  ? -40.673 -14.797 -50.169 1.00 75.39  ? 113  GLN A C     1 
ATOM   834   O  O     . GLN A 1 113  ? -40.269 -14.797 -51.337 1.00 66.76  ? 113  GLN A O     1 
ATOM   835   C  CB    . GLN A 1 113  ? -40.953 -13.246 -48.135 1.00 85.27  ? 113  GLN A CB    1 
ATOM   836   C  CG    . GLN A 1 113  ? -40.625 -11.767 -47.836 1.00 85.02  ? 113  GLN A CG    1 
ATOM   837   C  CD    . GLN A 1 113  ? -40.158 -11.519 -46.402 1.00 89.70  ? 113  GLN A CD    1 
ATOM   838   O  OE1   . GLN A 1 113  ? -38.986 -11.720 -46.056 1.00 105.11 ? 113  GLN A OE1   1 
ATOM   839   N  NE2   . GLN A 1 113  ? -41.074 -11.072 -45.562 1.00 84.83  ? 113  GLN A NE2   1 
ATOM   840   N  N     . CYS A 1 114  ? -40.632 -15.883 -49.392 1.00 75.98  ? 114  CYS A N     1 
ATOM   841   C  CA    . CYS A 1 114  ? -40.157 -17.171 -49.926 1.00 75.89  ? 114  CYS A CA    1 
ATOM   842   C  C     . CYS A 1 114  ? -41.143 -17.722 -50.925 1.00 75.97  ? 114  CYS A C     1 
ATOM   843   O  O     . CYS A 1 114  ? -40.764 -18.439 -51.854 1.00 71.93  ? 114  CYS A O     1 
ATOM   844   C  CB    . CYS A 1 114  ? -39.951 -18.239 -48.818 1.00 76.25  ? 114  CYS A CB    1 
ATOM   845   S  SG    . CYS A 1 114  ? -41.404 -19.176 -48.186 1.00 81.59  ? 114  CYS A SG    1 
ATOM   846   N  N     . GLY A 1 115  ? -42.421 -17.394 -50.707 1.00 80.53  ? 115  GLY A N     1 
ATOM   847   C  CA    . GLY A 1 115  ? -43.476 -17.714 -51.662 1.00 76.39  ? 115  GLY A CA    1 
ATOM   848   C  C     . GLY A 1 115  ? -44.135 -19.062 -51.481 1.00 74.20  ? 115  GLY A C     1 
ATOM   849   O  O     . GLY A 1 115  ? -45.101 -19.369 -52.168 1.00 79.87  ? 115  GLY A O     1 
ATOM   850   N  N     . PHE A 1 116  ? -43.668 -19.854 -50.533 1.00 72.70  ? 116  PHE A N     1 
ATOM   851   C  CA    . PHE A 1 116  ? -44.147 -21.210 -50.402 1.00 74.32  ? 116  PHE A CA    1 
ATOM   852   C  C     . PHE A 1 116  ? -45.579 -21.273 -49.874 1.00 75.42  ? 116  PHE A C     1 
ATOM   853   O  O     . PHE A 1 116  ? -46.331 -22.150 -50.247 1.00 78.11  ? 116  PHE A O     1 
ATOM   854   C  CB    . PHE A 1 116  ? -43.209 -21.998 -49.520 1.00 71.72  ? 116  PHE A CB    1 
ATOM   855   C  CG    . PHE A 1 116  ? -43.274 -23.459 -49.756 1.00 72.39  ? 116  PHE A CG    1 
ATOM   856   C  CD1   . PHE A 1 116  ? -42.725 -24.000 -50.909 1.00 74.42  ? 116  PHE A CD1   1 
ATOM   857   C  CD2   . PHE A 1 116  ? -43.878 -24.294 -48.829 1.00 66.57  ? 116  PHE A CD2   1 
ATOM   858   C  CE1   . PHE A 1 116  ? -42.761 -25.361 -51.117 1.00 76.15  ? 116  PHE A CE1   1 
ATOM   859   C  CE2   . PHE A 1 116  ? -43.933 -25.647 -49.029 1.00 63.52  ? 116  PHE A CE2   1 
ATOM   860   C  CZ    . PHE A 1 116  ? -43.369 -26.185 -50.168 1.00 74.27  ? 116  PHE A CZ    1 
ATOM   861   N  N     . CYS A 1 117  ? -45.943 -20.320 -49.025 1.00 75.52  ? 117  CYS A N     1 
ATOM   862   C  CA    . CYS A 1 117  ? -47.299 -20.176 -48.490 1.00 75.16  ? 117  CYS A CA    1 
ATOM   863   C  C     . CYS A 1 117  ? -48.297 -19.460 -49.430 1.00 72.48  ? 117  CYS A C     1 
ATOM   864   O  O     . CYS A 1 117  ? -49.485 -19.376 -49.127 1.00 81.50  ? 117  CYS A O     1 
ATOM   865   C  CB    . CYS A 1 117  ? -47.242 -19.336 -47.189 1.00 83.49  ? 117  CYS A CB    1 
ATOM   866   S  SG    . CYS A 1 117  ? -47.029 -17.525 -47.405 1.00 89.02  ? 117  CYS A SG    1 
ATOM   867   N  N     . THR A 1 118  ? -47.801 -18.933 -50.539 1.00 72.09  ? 118  THR A N     1 
ATOM   868   C  CA    . THR A 1 118  ? -48.593 -17.985 -51.325 1.00 72.64  ? 118  THR A CA    1 
ATOM   869   C  C     . THR A 1 118  ? -49.760 -18.682 -52.039 1.00 70.11  ? 118  THR A C     1 
ATOM   870   O  O     . THR A 1 118  ? -50.860 -18.157 -52.021 1.00 67.15  ? 118  THR A O     1 
ATOM   871   C  CB    . THR A 1 118  ? -47.652 -17.170 -52.229 1.00 69.98  ? 118  THR A CB    1 
ATOM   872   O  OG1   . THR A 1 118  ? -46.820 -16.322 -51.403 1.00 56.91  ? 118  THR A OG1   1 
ATOM   873   C  CG2   . THR A 1 118  ? -48.460 -16.372 -53.189 1.00 72.58  ? 118  THR A CG2   1 
ATOM   874   N  N     . PRO A 1 119  ? -49.544 -19.850 -52.651 1.00 75.61  ? 119  PRO A N     1 
ATOM   875   C  CA    . PRO A 1 119  ? -50.650 -20.526 -53.312 1.00 77.61  ? 119  PRO A CA    1 
ATOM   876   C  C     . PRO A 1 119  ? -51.829 -20.836 -52.389 1.00 84.30  ? 119  PRO A C     1 
ATOM   877   O  O     . PRO A 1 119  ? -52.978 -20.701 -52.786 1.00 93.55  ? 119  PRO A O     1 
ATOM   878   C  CB    . PRO A 1 119  ? -50.015 -21.820 -53.810 1.00 80.60  ? 119  PRO A CB    1 
ATOM   879   C  CG    . PRO A 1 119  ? -48.570 -21.488 -53.973 1.00 83.34  ? 119  PRO A CG    1 
ATOM   880   C  CD    . PRO A 1 119  ? -48.248 -20.511 -52.893 1.00 80.03  ? 119  PRO A CD    1 
ATOM   881   N  N     . GLY A 1 120  ? -51.533 -21.231 -51.165 1.00 90.53  ? 120  GLY A N     1 
ATOM   882   C  CA    . GLY A 1 120  ? -52.562 -21.478 -50.157 1.00 98.05  ? 120  GLY A CA    1 
ATOM   883   C  C     . GLY A 1 120  ? -53.329 -20.222 -49.812 1.00 96.36  ? 120  GLY A C     1 
ATOM   884   O  O     . GLY A 1 120  ? -54.550 -20.266 -49.717 1.00 101.93 ? 120  GLY A O     1 
ATOM   885   N  N     . MET A 1 121  ? -52.610 -19.109 -49.641 1.00 84.52  ? 121  MET A N     1 
ATOM   886   C  CA    . MET A 1 121  ? -53.220 -17.810 -49.338 1.00 81.09  ? 121  MET A CA    1 
ATOM   887   C  C     . MET A 1 121  ? -54.120 -17.385 -50.487 1.00 81.21  ? 121  MET A C     1 
ATOM   888   O  O     . MET A 1 121  ? -55.223 -16.893 -50.287 1.00 78.56  ? 121  MET A O     1 
ATOM   889   C  CB    . MET A 1 121  ? -52.170 -16.733 -49.105 1.00 81.41  ? 121  MET A CB    1 
ATOM   890   C  CG    . MET A 1 121  ? -51.254 -17.031 -47.942 1.00 86.61  ? 121  MET A CG    1 
ATOM   891   S  SD    . MET A 1 121  ? -51.807 -16.323 -46.399 1.00 89.49  ? 121  MET A SD    1 
ATOM   892   C  CE    . MET A 1 121  ? -50.708 -17.122 -45.224 1.00 88.97  ? 121  MET A CE    1 
ATOM   893   N  N     . VAL A 1 122  ? -53.635 -17.597 -51.698 1.00 86.87  ? 122  VAL A N     1 
ATOM   894   C  CA    . VAL A 1 122  ? -54.358 -17.232 -52.917 1.00 81.85  ? 122  VAL A CA    1 
ATOM   895   C  C     . VAL A 1 122  ? -55.682 -18.005 -53.034 1.00 84.40  ? 122  VAL A C     1 
ATOM   896   O  O     . VAL A 1 122  ? -56.738 -17.428 -53.322 1.00 95.57  ? 122  VAL A O     1 
ATOM   897   C  CB    . VAL A 1 122  ? -53.489 -17.494 -54.198 1.00 77.27  ? 122  VAL A CB    1 
ATOM   898   C  CG1   . VAL A 1 122  ? -54.329 -17.370 -55.453 1.00 76.27  ? 122  VAL A CG1   1 
ATOM   899   C  CG2   . VAL A 1 122  ? -52.263 -16.559 -54.293 1.00 73.08  ? 122  VAL A CG2   1 
ATOM   900   N  N     . MET A 1 123  ? -55.630 -19.305 -52.780 1.00 85.20  ? 123  MET A N     1 
ATOM   901   C  CA    . MET A 1 123  ? -56.826 -20.127 -52.885 1.00 90.23  ? 123  MET A CA    1 
ATOM   902   C  C     . MET A 1 123  ? -57.849 -19.884 -51.768 1.00 88.64  ? 123  MET A C     1 
ATOM   903   O  O     . MET A 1 123  ? -59.043 -20.007 -52.005 1.00 104.30 ? 123  MET A O     1 
ATOM   904   C  CB    . MET A 1 123  ? -56.482 -21.622 -52.924 1.00 91.60  ? 123  MET A CB    1 
ATOM   905   C  CG    . MET A 1 123  ? -55.882 -22.085 -54.232 1.00 84.25  ? 123  MET A CG    1 
ATOM   906   S  SD    . MET A 1 123  ? -56.800 -21.456 -55.647 1.00 87.71  ? 123  MET A SD    1 
ATOM   907   C  CE    . MET A 1 123  ? -58.335 -22.368 -55.497 1.00 81.15  ? 123  MET A CE    1 
ATOM   908   N  N     . SER A 1 124  ? -57.396 -19.533 -50.570 1.00 80.17  ? 124  SER A N     1 
ATOM   909   C  CA    . SER A 1 124  ? -58.296 -19.075 -49.508 1.00 82.23  ? 124  SER A CA    1 
ATOM   910   C  C     . SER A 1 124  ? -59.010 -17.762 -49.875 1.00 79.65  ? 124  SER A C     1 
ATOM   911   O  O     . SER A 1 124  ? -60.205 -17.638 -49.674 1.00 79.91  ? 124  SER A O     1 
ATOM   912   C  CB    . SER A 1 124  ? -57.517 -18.916 -48.188 1.00 82.79  ? 124  SER A CB    1 
ATOM   913   O  OG    . SER A 1 124  ? -57.220 -20.172 -47.595 1.00 80.51  ? 124  SER A OG    1 
ATOM   914   N  N     . ILE A 1 125  ? -58.267 -16.802 -50.420 1.00 70.20  ? 125  ILE A N     1 
ATOM   915   C  CA    . ILE A 1 125  ? -58.828 -15.521 -50.842 1.00 72.25  ? 125  ILE A CA    1 
ATOM   916   C  C     . ILE A 1 125  ? -59.710 -15.675 -52.078 1.00 73.05  ? 125  ILE A C     1 
ATOM   917   O  O     . ILE A 1 125  ? -60.789 -15.098 -52.134 1.00 79.82  ? 125  ILE A O     1 
ATOM   918   C  CB    . ILE A 1 125  ? -57.768 -14.448 -51.071 1.00 73.77  ? 125  ILE A CB    1 
ATOM   919   C  CG1   . ILE A 1 125  ? -56.991 -14.221 -49.786 1.00 78.15  ? 125  ILE A CG1   1 
ATOM   920   C  CG2   . ILE A 1 125  ? -58.407 -13.132 -51.509 1.00 69.63  ? 125  ILE A CG2   1 
ATOM   921   C  CD1   . ILE A 1 125  ? -55.637 -13.599 -50.022 1.00 87.91  ? 125  ILE A CD1   1 
ATOM   922   N  N     . TYR A 1 126  ? -59.249 -16.446 -53.057 1.00 78.79  ? 126  TYR A N     1 
ATOM   923   C  CA    . TYR A 1 126  ? -60.051 -16.742 -54.243 1.00 84.38  ? 126  TYR A CA    1 
ATOM   924   C  C     . TYR A 1 126  ? -61.412 -17.325 -53.856 1.00 80.16  ? 126  TYR A C     1 
ATOM   925   O  O     . TYR A 1 126  ? -62.454 -16.806 -54.248 1.00 73.38  ? 126  TYR A O     1 
ATOM   926   C  CB    . TYR A 1 126  ? -59.379 -17.745 -55.191 1.00 84.44  ? 126  TYR A CB    1 
ATOM   927   C  CG    . TYR A 1 126  ? -60.210 -17.990 -56.439 1.00 80.46  ? 126  TYR A CG    1 
ATOM   928   C  CD1   . TYR A 1 126  ? -60.341 -16.986 -57.398 1.00 83.11  ? 126  TYR A CD1   1 
ATOM   929   C  CD2   . TYR A 1 126  ? -60.894 -19.203 -56.650 1.00 75.16  ? 126  TYR A CD2   1 
ATOM   930   C  CE1   . TYR A 1 126  ? -61.110 -17.178 -58.544 1.00 88.77  ? 126  TYR A CE1   1 
ATOM   931   C  CE2   . TYR A 1 126  ? -61.664 -19.410 -57.803 1.00 76.56  ? 126  TYR A CE2   1 
ATOM   932   C  CZ    . TYR A 1 126  ? -61.774 -18.393 -58.754 1.00 84.20  ? 126  TYR A CZ    1 
ATOM   933   O  OH    . TYR A 1 126  ? -62.526 -18.533 -59.921 1.00 67.02  ? 126  TYR A OH    1 
ATOM   934   N  N     . THR A 1 127  ? -61.375 -18.397 -53.072 1.00 78.60  ? 127  THR A N     1 
ATOM   935   C  CA    . THR A 1 127  ? -62.584 -19.121 -52.684 1.00 81.88  ? 127  THR A CA    1 
ATOM   936   C  C     . THR A 1 127  ? -63.576 -18.224 -51.955 1.00 86.22  ? 127  THR A C     1 
ATOM   937   O  O     . THR A 1 127  ? -64.778 -18.306 -52.192 1.00 89.74  ? 127  THR A O     1 
ATOM   938   C  CB    . THR A 1 127  ? -62.236 -20.356 -51.830 1.00 84.29  ? 127  THR A CB    1 
ATOM   939   O  OG1   . THR A 1 127  ? -61.570 -21.319 -52.658 1.00 79.95  ? 127  THR A OG1   1 
ATOM   940   C  CG2   . THR A 1 127  ? -63.490 -21.001 -51.206 1.00 85.66  ? 127  THR A CG2   1 
ATOM   941   N  N     . LEU A 1 128  ? -63.073 -17.356 -51.084 1.00 84.17  ? 128  LEU A N     1 
ATOM   942   C  CA    . LEU A 1 128  ? -63.948 -16.440 -50.363 1.00 88.40  ? 128  LEU A CA    1 
ATOM   943   C  C     . LEU A 1 128  ? -64.555 -15.412 -51.295 1.00 86.63  ? 128  LEU A C     1 
ATOM   944   O  O     . LEU A 1 128  ? -65.744 -15.127 -51.176 1.00 102.22 ? 128  LEU A O     1 
ATOM   945   C  CB    . LEU A 1 128  ? -63.267 -15.741 -49.169 1.00 90.06  ? 128  LEU A CB    1 
ATOM   946   C  CG    . LEU A 1 128  ? -64.208 -14.716 -48.475 1.00 91.23  ? 128  LEU A CG    1 
ATOM   947   C  CD1   . LEU A 1 128  ? -64.365 -14.932 -46.977 1.00 91.78  ? 128  LEU A CD1   1 
ATOM   948   C  CD2   . LEU A 1 128  ? -63.805 -13.278 -48.772 1.00 90.05  ? 128  LEU A CD2   1 
ATOM   949   N  N     . LEU A 1 129  ? -63.773 -14.853 -52.209 1.00 81.57  ? 129  LEU A N     1 
ATOM   950   C  CA    . LEU A 1 129  ? -64.326 -13.925 -53.200 1.00 87.51  ? 129  LEU A CA    1 
ATOM   951   C  C     . LEU A 1 129  ? -65.351 -14.578 -54.160 1.00 90.66  ? 129  LEU A C     1 
ATOM   952   O  O     . LEU A 1 129  ? -66.230 -13.896 -54.683 1.00 92.27  ? 129  LEU A O     1 
ATOM   953   C  CB    . LEU A 1 129  ? -63.194 -13.376 -54.033 1.00 89.53  ? 129  LEU A CB    1 
ATOM   954   C  CG    . LEU A 1 129  ? -62.382 -12.347 -53.309 1.00 86.45  ? 129  LEU A CG    1 
ATOM   955   C  CD1   . LEU A 1 129  ? -61.048 -12.249 -54.010 1.00 92.63  ? 129  LEU A CD1   1 
ATOM   956   C  CD2   . LEU A 1 129  ? -63.126 -11.032 -53.339 1.00 89.66  ? 129  LEU A CD2   1 
ATOM   957   N  N     . ARG A 1 130  ? -65.235 -15.878 -54.395 1.00 92.27  ? 130  ARG A N     1 
ATOM   958   C  CA    . ARG A 1 130  ? -66.249 -16.605 -55.164 1.00 98.32  ? 130  ARG A CA    1 
ATOM   959   C  C     . ARG A 1 130  ? -67.590 -16.744 -54.414 1.00 92.85  ? 130  ARG A C     1 
ATOM   960   O  O     . ARG A 1 130  ? -68.627 -16.871 -55.054 1.00 120.12 ? 130  ARG A O     1 
ATOM   961   C  CB    . ARG A 1 130  ? -65.711 -17.957 -55.670 1.00 102.34 ? 130  ARG A CB    1 
ATOM   962   C  CG    . ARG A 1 130  ? -64.713 -17.828 -56.821 1.00 99.68  ? 130  ARG A CG    1 
ATOM   963   C  CD    . ARG A 1 130  ? -65.383 -17.344 -58.101 1.00 109.53 ? 130  ARG A CD    1 
ATOM   964   N  NE    . ARG A 1 130  ? -66.543 -18.172 -58.439 1.00 117.50 ? 130  ARG A NE    1 
ATOM   965   C  CZ    . ARG A 1 130  ? -66.514 -19.293 -59.163 1.00 127.19 ? 130  ARG A CZ    1 
ATOM   966   N  NH1   . ARG A 1 130  ? -65.384 -19.764 -59.682 1.00 137.60 ? 130  ARG A NH1   1 
ATOM   967   N  NH2   . ARG A 1 130  ? -67.640 -19.954 -59.383 1.00 128.92 ? 130  ARG A NH2   1 
ATOM   968   N  N     . ASN A 1 131  ? -67.553 -16.745 -53.081 1.00 83.44  ? 131  ASN A N     1 
ATOM   969   C  CA    . ASN A 1 131  ? -68.765 -16.788 -52.240 1.00 80.59  ? 131  ASN A CA    1 
ATOM   970   C  C     . ASN A 1 131  ? -69.279 -15.411 -51.835 1.00 86.92  ? 131  ASN A C     1 
ATOM   971   O  O     . ASN A 1 131  ? -70.480 -15.230 -51.711 1.00 105.65 ? 131  ASN A O     1 
ATOM   972   C  CB    . ASN A 1 131  ? -68.581 -17.626 -50.965 1.00 81.67  ? 131  ASN A CB    1 
ATOM   973   C  CG    . ASN A 1 131  ? -68.404 -19.118 -51.232 1.00 82.12  ? 131  ASN A CG    1 
ATOM   974   O  OD1   . ASN A 1 131  ? -67.570 -19.772 -50.594 1.00 78.68  ? 131  ASN A OD1   1 
ATOM   975   N  ND2   . ASN A 1 131  ? -69.204 -19.671 -52.142 1.00 81.87  ? 131  ASN A ND2   1 
ATOM   976   N  N     . HIS A 1 132  ? -68.368 -14.469 -51.613 1.00 89.58  ? 132  HIS A N     1 
ATOM   977   C  CA    . HIS A 1 132  ? -68.695 -13.082 -51.260 1.00 92.90  ? 132  HIS A CA    1 
ATOM   978   C  C     . HIS A 1 132  ? -67.918 -12.113 -52.140 1.00 88.52  ? 132  HIS A C     1 
ATOM   979   O  O     . HIS A 1 132  ? -66.893 -11.589 -51.716 1.00 92.38  ? 132  HIS A O     1 
ATOM   980   C  CB    . HIS A 1 132  ? -68.382 -12.825 -49.797 1.00 98.35  ? 132  HIS A CB    1 
ATOM   981   C  CG    . HIS A 1 132  ? -69.070 -13.777 -48.882 1.00 102.28 ? 132  HIS A CG    1 
ATOM   982   N  ND1   . HIS A 1 132  ? -70.441 -13.904 -48.845 1.00 101.07 ? 132  HIS A ND1   1 
ATOM   983   C  CD2   . HIS A 1 132  ? -68.582 -14.669 -47.990 1.00 107.85 ? 132  HIS A CD2   1 
ATOM   984   C  CE1   . HIS A 1 132  ? -70.769 -14.830 -47.964 1.00 106.92 ? 132  HIS A CE1   1 
ATOM   985   N  NE2   . HIS A 1 132  ? -69.661 -15.303 -47.423 1.00 111.83 ? 132  HIS A NE2   1 
ATOM   986   N  N     . PRO A 1 133  ? -68.400 -11.869 -53.363 1.00 87.04  ? 133  PRO A N     1 
ATOM   987   C  CA    . PRO A 1 133  ? -67.724 -10.980 -54.345 1.00 93.67  ? 133  PRO A CA    1 
ATOM   988   C  C     . PRO A 1 133  ? -67.398 -9.570  -53.852 1.00 100.42 ? 133  PRO A C     1 
ATOM   989   O  O     . PRO A 1 133  ? -66.438 -8.960  -54.323 1.00 82.79  ? 133  PRO A O     1 
ATOM   990   C  CB    . PRO A 1 133  ? -68.703 -10.950 -55.514 1.00 102.14 ? 133  PRO A CB    1 
ATOM   991   C  CG    . PRO A 1 133  ? -69.544 -12.189 -55.349 1.00 101.12 ? 133  PRO A CG    1 
ATOM   992   C  CD    . PRO A 1 133  ? -69.671 -12.401 -53.878 1.00 90.67  ? 133  PRO A CD    1 
ATOM   993   N  N     . GLU A 1 134  ? -68.206 -9.056  -52.925 1.00 118.80 ? 134  GLU A N     1 
ATOM   994   C  CA    . GLU A 1 134  ? -67.991 -7.739  -52.308 1.00 117.27 ? 134  GLU A CA    1 
ATOM   995   C  C     . GLU A 1 134  ? -67.930 -7.934  -50.799 1.00 111.08 ? 134  GLU A C     1 
ATOM   996   O  O     . GLU A 1 134  ? -68.887 -7.633  -50.094 1.00 114.89 ? 134  GLU A O     1 
ATOM   997   C  CB    . GLU A 1 134  ? -69.121 -6.754  -52.656 1.00 124.33 ? 134  GLU A CB    1 
ATOM   998   C  CG    . GLU A 1 134  ? -68.950 -6.056  -54.003 1.00 140.13 ? 134  GLU A CG    1 
ATOM   999   C  CD    . GLU A 1 134  ? -69.488 -4.625  -54.034 1.00 148.09 ? 134  GLU A CD    1 
ATOM   1000  O  OE1   . GLU A 1 134  ? -70.697 -4.443  -54.316 1.00 148.74 ? 134  GLU A OE1   1 
ATOM   1001  O  OE2   . GLU A 1 134  ? -68.691 -3.678  -53.808 1.00 143.97 ? 134  GLU A OE2   1 
ATOM   1002  N  N     . PRO A 1 135  ? -66.789 -8.432  -50.295 1.00 107.26 ? 135  PRO A N     1 
ATOM   1003  C  CA    . PRO A 1 135  ? -66.641 -8.837  -48.891 1.00 103.07 ? 135  PRO A CA    1 
ATOM   1004  C  C     . PRO A 1 135  ? -66.308 -7.682  -47.952 1.00 104.73 ? 135  PRO A C     1 
ATOM   1005  O  O     . PRO A 1 135  ? -66.026 -6.549  -48.397 1.00 105.05 ? 135  PRO A O     1 
ATOM   1006  C  CB    . PRO A 1 135  ? -65.462 -9.784  -48.958 1.00 98.97  ? 135  PRO A CB    1 
ATOM   1007  C  CG    . PRO A 1 135  ? -64.593 -9.163  -50.009 1.00 101.91 ? 135  PRO A CG    1 
ATOM   1008  C  CD    . PRO A 1 135  ? -65.485 -8.422  -50.974 1.00 101.95 ? 135  PRO A CD    1 
ATOM   1009  N  N     . THR A 1 136  ? -66.348 -7.995  -46.654 1.00 103.02 ? 136  THR A N     1 
ATOM   1010  C  CA    . THR A 1 136  ? -65.739 -7.176  -45.607 1.00 104.86 ? 136  THR A CA    1 
ATOM   1011  C  C     . THR A 1 136  ? -64.407 -7.819  -45.197 1.00 110.90 ? 136  THR A C     1 
ATOM   1012  O  O     . THR A 1 136  ? -64.209 -9.033  -45.365 1.00 113.11 ? 136  THR A O     1 
ATOM   1013  C  CB    . THR A 1 136  ? -66.665 -7.039  -44.381 1.00 103.41 ? 136  THR A CB    1 
ATOM   1014  O  OG1   . THR A 1 136  ? -66.583 -8.209  -43.550 1.00 94.98  ? 136  THR A OG1   1 
ATOM   1015  C  CG2   . THR A 1 136  ? -68.107 -6.832  -44.826 1.00 105.22 ? 136  THR A CG2   1 
ATOM   1016  N  N     . LEU A 1 137  ? -63.503 -7.011  -44.643 1.00 107.74 ? 137  LEU A N     1 
ATOM   1017  C  CA    . LEU A 1 137  ? -62.187 -7.499  -44.199 1.00 96.86  ? 137  LEU A CA    1 
ATOM   1018  C  C     . LEU A 1 137  ? -62.286 -8.595  -43.129 1.00 97.26  ? 137  LEU A C     1 
ATOM   1019  O  O     . LEU A 1 137  ? -61.447 -9.490  -43.093 1.00 103.74 ? 137  LEU A O     1 
ATOM   1020  C  CB    . LEU A 1 137  ? -61.352 -6.343  -43.688 1.00 97.85  ? 137  LEU A CB    1 
ATOM   1021  C  CG    . LEU A 1 137  ? -59.883 -6.627  -43.456 1.00 99.16  ? 137  LEU A CG    1 
ATOM   1022  C  CD1   . LEU A 1 137  ? -59.333 -7.416  -44.631 1.00 112.82 ? 137  LEU A CD1   1 
ATOM   1023  C  CD2   . LEU A 1 137  ? -59.113 -5.323  -43.279 1.00 95.13  ? 137  LEU A CD2   1 
ATOM   1024  N  N     . ASP A 1 138  ? -63.312 -8.530  -42.285 1.00 101.63 ? 138  ASP A N     1 
ATOM   1025  C  CA    . ASP A 1 138  ? -63.631 -9.559  -41.277 1.00 104.14 ? 138  ASP A CA    1 
ATOM   1026  C  C     . ASP A 1 138  ? -63.653 -10.954 -41.906 1.00 99.27  ? 138  ASP A C     1 
ATOM   1027  O  O     . ASP A 1 138  ? -63.042 -11.899 -41.409 1.00 113.37 ? 138  ASP A O     1 
ATOM   1028  C  CB    . ASP A 1 138  ? -65.044 -9.311  -40.735 1.00 117.69 ? 138  ASP A CB    1 
ATOM   1029  C  CG    . ASP A 1 138  ? -65.049 -8.824  -39.318 1.00 123.21 ? 138  ASP A CG    1 
ATOM   1030  O  OD1   . ASP A 1 138  ? -64.318 -7.852  -39.015 1.00 127.52 ? 138  ASP A OD1   1 
ATOM   1031  O  OD2   . ASP A 1 138  ? -65.799 -9.421  -38.516 1.00 112.42 ? 138  ASP A OD2   1 
ATOM   1032  N  N     . GLN A 1 139  ? -64.379 -11.048 -43.016 1.00 88.29  ? 139  GLN A N     1 
ATOM   1033  C  CA    . GLN A 1 139  ? -64.590 -12.308 -43.731 1.00 94.95  ? 139  GLN A CA    1 
ATOM   1034  C  C     . GLN A 1 139  ? -63.292 -12.837 -44.339 1.00 97.60  ? 139  GLN A C     1 
ATOM   1035  O  O     . GLN A 1 139  ? -62.997 -14.034 -44.248 1.00 95.82  ? 139  GLN A O     1 
ATOM   1036  C  CB    . GLN A 1 139  ? -65.663 -12.141 -44.830 1.00 99.23  ? 139  GLN A CB    1 
ATOM   1037  C  CG    . GLN A 1 139  ? -66.965 -11.438 -44.416 1.00 98.99  ? 139  GLN A CG    1 
ATOM   1038  C  CD    . GLN A 1 139  ? -67.865 -11.071 -45.596 1.00 96.20  ? 139  GLN A CD    1 
ATOM   1039  O  OE1   . GLN A 1 139  ? -67.940 -9.911  -46.019 1.00 92.39  ? 139  GLN A OE1   1 
ATOM   1040  N  NE2   . GLN A 1 139  ? -68.551 -12.063 -46.131 1.00 97.76  ? 139  GLN A NE2   1 
ATOM   1041  N  N     . LEU A 1 140  ? -62.529 -11.932 -44.955 1.00 101.56 ? 140  LEU A N     1 
ATOM   1042  C  CA    . LEU A 1 140  ? -61.219 -12.252 -45.523 1.00 102.00 ? 140  LEU A CA    1 
ATOM   1043  C  C     . LEU A 1 140  ? -60.212 -12.741 -44.482 1.00 96.98  ? 140  LEU A C     1 
ATOM   1044  O  O     . LEU A 1 140  ? -59.553 -13.742 -44.695 1.00 96.81  ? 140  LEU A O     1 
ATOM   1045  C  CB    . LEU A 1 140  ? -60.619 -11.017 -46.210 1.00 100.35 ? 140  LEU A CB    1 
ATOM   1046  C  CG    . LEU A 1 140  ? -61.175 -10.715 -47.602 1.00 107.25 ? 140  LEU A CG    1 
ATOM   1047  C  CD1   . LEU A 1 140  ? -60.735 -9.347  -48.105 1.00 104.43 ? 140  LEU A CD1   1 
ATOM   1048  C  CD2   . LEU A 1 140  ? -60.771 -11.800 -48.601 1.00 114.17 ? 140  LEU A CD2   1 
ATOM   1049  N  N     . THR A 1 141  ? -60.092 -12.038 -43.364 1.00 90.61  ? 141  THR A N     1 
ATOM   1050  C  CA    . THR A 1 141  ? -59.153 -12.447 -42.313 1.00 90.68  ? 141  THR A CA    1 
ATOM   1051  C  C     . THR A 1 141  ? -59.637 -13.703 -41.578 1.00 96.50  ? 141  THR A C     1 
ATOM   1052  O  O     . THR A 1 141  ? -58.816 -14.443 -41.032 1.00 93.89  ? 141  THR A O     1 
ATOM   1053  C  CB    . THR A 1 141  ? -58.888 -11.366 -41.263 1.00 88.49  ? 141  THR A CB    1 
ATOM   1054  O  OG1   . THR A 1 141  ? -60.043 -11.217 -40.427 1.00 89.90  ? 141  THR A OG1   1 
ATOM   1055  C  CG2   . THR A 1 141  ? -58.515 -10.068 -41.920 1.00 89.64  ? 141  THR A CG2   1 
ATOM   1056  N  N     . ASP A 1 142  ? -60.952 -13.939 -41.552 1.00 100.41 ? 142  ASP A N     1 
ATOM   1057  C  CA    . ASP A 1 142  ? -61.510 -15.218 -41.092 1.00 108.30 ? 142  ASP A CA    1 
ATOM   1058  C  C     . ASP A 1 142  ? -61.100 -16.370 -42.028 1.00 109.66 ? 142  ASP A C     1 
ATOM   1059  O  O     . ASP A 1 142  ? -60.716 -17.448 -41.558 1.00 112.54 ? 142  ASP A O     1 
ATOM   1060  C  CB    . ASP A 1 142  ? -63.055 -15.196 -41.147 1.00 116.00 ? 142  ASP A CB    1 
ATOM   1061  C  CG    . ASP A 1 142  ? -63.711 -14.478 -39.965 1.00 125.48 ? 142  ASP A CG    1 
ATOM   1062  O  OD1   . ASP A 1 142  ? -63.287 -14.681 -38.807 1.00 133.75 ? 142  ASP A OD1   1 
ATOM   1063  O  OD2   . ASP A 1 142  ? -64.698 -13.738 -40.198 1.00 123.71 ? 142  ASP A OD2   1 
ATOM   1064  N  N     . ALA A 1 143  ? -61.182 -16.135 -43.338 1.00 107.30 ? 143  ALA A N     1 
ATOM   1065  C  CA    . ALA A 1 143  ? -60.759 -17.128 -44.331 1.00 106.98 ? 143  ALA A CA    1 
ATOM   1066  C  C     . ALA A 1 143  ? -59.287 -17.533 -44.214 1.00 98.26  ? 143  ALA A C     1 
ATOM   1067  O  O     . ALA A 1 143  ? -58.925 -18.691 -44.460 1.00 104.52 ? 143  ALA A O     1 
ATOM   1068  C  CB    . ALA A 1 143  ? -61.009 -16.579 -45.721 1.00 110.10 ? 143  ALA A CB    1 
ATOM   1069  N  N     . LEU A 1 144  ? -58.457 -16.564 -43.829 1.00 82.66  ? 144  LEU A N     1 
ATOM   1070  C  CA    . LEU A 1 144  ? -57.019 -16.767 -43.621 1.00 79.01  ? 144  LEU A CA    1 
ATOM   1071  C  C     . LEU A 1 144  ? -56.631 -17.177 -42.210 1.00 80.99  ? 144  LEU A C     1 
ATOM   1072  O  O     . LEU A 1 144  ? -55.435 -17.257 -41.904 1.00 85.90  ? 144  LEU A O     1 
ATOM   1073  C  CB    . LEU A 1 144  ? -56.244 -15.506 -43.970 1.00 76.66  ? 144  LEU A CB    1 
ATOM   1074  C  CG    . LEU A 1 144  ? -56.305 -15.097 -45.430 1.00 76.55  ? 144  LEU A CG    1 
ATOM   1075  C  CD1   . LEU A 1 144  ? -55.617 -13.754 -45.680 1.00 73.55  ? 144  LEU A CD1   1 
ATOM   1076  C  CD2   . LEU A 1 144  ? -55.706 -16.209 -46.266 1.00 75.41  ? 144  LEU A CD2   1 
ATOM   1077  N  N     . GLY A 1 145  ? -57.605 -17.477 -41.346 1.00 99.35  ? 145  GLY A N     1 
ATOM   1078  C  CA    . GLY A 1 145  ? -57.321 -18.037 -40.022 1.00 109.21 ? 145  GLY A CA    1 
ATOM   1079  C  C     . GLY A 1 145  ? -56.559 -19.363 -40.082 1.00 106.59 ? 145  GLY A C     1 
ATOM   1080  O  O     . GLY A 1 145  ? -55.755 -19.663 -39.199 1.00 101.68 ? 145  GLY A O     1 
ATOM   1081  N  N     . GLY A 1 146  ? -56.818 -20.142 -41.131 1.00 102.53 ? 146  GLY A N     1 
ATOM   1082  C  CA    . GLY A 1 146  ? -56.116 -21.394 -41.348 1.00 100.83 ? 146  GLY A CA    1 
ATOM   1083  C  C     . GLY A 1 146  ? -54.752 -21.341 -42.044 1.00 86.12  ? 146  GLY A C     1 
ATOM   1084  O  O     . GLY A 1 146  ? -54.098 -22.361 -42.156 1.00 82.70  ? 146  GLY A O     1 
ATOM   1085  N  N     . ASN A 1 147  ? -54.359 -20.167 -42.512 1.00 82.73  ? 147  ASN A N     1 
ATOM   1086  C  CA    . ASN A 1 147  ? -53.190 -19.988 -43.403 1.00 78.11  ? 147  ASN A CA    1 
ATOM   1087  C  C     . ASN A 1 147  ? -52.023 -19.351 -42.671 1.00 81.00  ? 147  ASN A C     1 
ATOM   1088  O  O     . ASN A 1 147  ? -52.150 -18.231 -42.212 1.00 97.13  ? 147  ASN A O     1 
ATOM   1089  C  CB    . ASN A 1 147  ? -53.572 -19.097 -44.593 1.00 79.27  ? 147  ASN A CB    1 
ATOM   1090  C  CG    . ASN A 1 147  ? -54.454 -19.806 -45.629 1.00 79.74  ? 147  ASN A CG    1 
ATOM   1091  O  OD1   . ASN A 1 147  ? -54.095 -19.879 -46.806 1.00 83.71  ? 147  ASN A OD1   1 
ATOM   1092  N  ND2   . ASN A 1 147  ? -55.607 -20.304 -45.208 1.00 77.04  ? 147  ASN A ND2   1 
ATOM   1093  N  N     . LEU A 1 148  ? -50.887 -20.049 -42.587 1.00 84.44  ? 148  LEU A N     1 
ATOM   1094  C  CA    . LEU A 1 148  ? -49.702 -19.578 -41.861 1.00 80.63  ? 148  LEU A CA    1 
ATOM   1095  C  C     . LEU A 1 148  ? -48.627 -19.051 -42.822 1.00 83.30  ? 148  LEU A C     1 
ATOM   1096  O  O     . LEU A 1 148  ? -48.519 -19.489 -43.985 1.00 83.18  ? 148  LEU A O     1 
ATOM   1097  C  CB    . LEU A 1 148  ? -49.057 -20.716 -41.087 1.00 81.25  ? 148  LEU A CB    1 
ATOM   1098  C  CG    . LEU A 1 148  ? -49.866 -21.523 -40.096 1.00 84.23  ? 148  LEU A CG    1 
ATOM   1099  C  CD1   . LEU A 1 148  ? -48.939 -22.549 -39.473 1.00 92.26  ? 148  LEU A CD1   1 
ATOM   1100  C  CD2   . LEU A 1 148  ? -50.455 -20.644 -39.018 1.00 86.83  ? 148  LEU A CD2   1 
ATOM   1101  N  N     . CYS A 1 149  ? -47.797 -18.152 -42.301 1.00 81.47  ? 149  CYS A N     1 
ATOM   1102  C  CA    . CYS A 1 149  ? -46.651 -17.615 -43.042 1.00 86.91  ? 149  CYS A CA    1 
ATOM   1103  C  C     . CYS A 1 149  ? -45.542 -17.234 -42.091 1.00 87.61  ? 149  CYS A C     1 
ATOM   1104  O  O     . CYS A 1 149  ? -45.769 -16.493 -41.138 1.00 87.33  ? 149  CYS A O     1 
ATOM   1105  C  CB    . CYS A 1 149  ? -47.059 -16.424 -43.881 1.00 86.74  ? 149  CYS A CB    1 
ATOM   1106  S  SG    . CYS A 1 149  ? -45.739 -15.940 -45.002 1.00 90.85  ? 149  CYS A SG    1 
ATOM   1107  N  N     . ARG A 1 150  ? -44.337 -17.718 -42.382 1.00 83.92  ? 150  ARG A N     1 
ATOM   1108  C  CA    . ARG A 1 150  ? -43.169 -17.510 -41.521 1.00 81.15  ? 150  ARG A CA    1 
ATOM   1109  C  C     . ARG A 1 150  ? -42.286 -16.346 -41.959 1.00 78.55  ? 150  ARG A C     1 
ATOM   1110  O  O     . ARG A 1 150  ? -41.389 -15.956 -41.225 1.00 80.76  ? 150  ARG A O     1 
ATOM   1111  C  CB    . ARG A 1 150  ? -42.361 -18.791 -41.483 1.00 79.22  ? 150  ARG A CB    1 
ATOM   1112  C  CG    . ARG A 1 150  ? -41.284 -18.781 -40.435 1.00 76.83  ? 150  ARG A CG    1 
ATOM   1113  C  CD    . ARG A 1 150  ? -41.838 -18.564 -39.056 1.00 73.09  ? 150  ARG A CD    1 
ATOM   1114  N  NE    . ARG A 1 150  ? -41.014 -19.259 -38.078 1.00 76.42  ? 150  ARG A NE    1 
ATOM   1115  C  CZ    . ARG A 1 150  ? -41.063 -19.054 -36.769 1.00 78.89  ? 150  ARG A CZ    1 
ATOM   1116  N  NH1   . ARG A 1 150  ? -41.908 -18.157 -36.252 1.00 81.41  ? 150  ARG A NH1   1 
ATOM   1117  N  NH2   . ARG A 1 150  ? -40.261 -19.756 -35.976 1.00 75.36  ? 150  ARG A NH2   1 
ATOM   1118  N  N     . CYS A 1 151  ? -42.560 -15.774 -43.133 1.00 80.89  ? 151  CYS A N     1 
ATOM   1119  C  CA    . CYS A 1 151  ? -41.710 -14.725 -43.706 1.00 90.40  ? 151  CYS A CA    1 
ATOM   1120  C  C     . CYS A 1 151  ? -42.335 -13.333 -43.634 1.00 92.67  ? 151  CYS A C     1 
ATOM   1121  O  O     . CYS A 1 151  ? -41.702 -12.435 -43.120 1.00 96.47  ? 151  CYS A O     1 
ATOM   1122  C  CB    . CYS A 1 151  ? -41.370 -15.036 -45.174 1.00 90.51  ? 151  CYS A CB    1 
ATOM   1123  S  SG    . CYS A 1 151  ? -40.332 -16.473 -45.508 1.00 87.14  ? 151  CYS A SG    1 
ATOM   1124  N  N     . THR A 1 152  ? -43.580 -13.157 -44.092 1.00 98.81  ? 152  THR A N     1 
ATOM   1125  C  CA    . THR A 1 152  ? -44.138 -11.829 -44.390 1.00 100.42 ? 152  THR A CA    1 
ATOM   1126  C  C     . THR A 1 152  ? -44.594 -10.973 -43.210 1.00 97.54  ? 152  THR A C     1 
ATOM   1127  O  O     . THR A 1 152  ? -44.676 -9.735  -43.332 1.00 103.24 ? 152  THR A O     1 
ATOM   1128  C  CB    . THR A 1 152  ? -45.361 -11.902 -45.370 1.00 102.14 ? 152  THR A CB    1 
ATOM   1129  O  OG1   . THR A 1 152  ? -46.323 -12.855 -44.911 1.00 86.13  ? 152  THR A OG1   1 
ATOM   1130  C  CG2   . THR A 1 152  ? -44.939 -12.306 -46.769 1.00 109.27 ? 152  THR A CG2   1 
ATOM   1131  N  N     . GLY A 1 153  ? -44.933 -11.625 -42.099 1.00 96.29  ? 153  GLY A N     1 
ATOM   1132  C  CA    . GLY A 1 153  ? -45.626 -10.957 -41.004 1.00 100.21 ? 153  GLY A CA    1 
ATOM   1133  C  C     . GLY A 1 153  ? -47.096 -10.658 -41.286 1.00 94.46  ? 153  GLY A C     1 
ATOM   1134  O  O     . GLY A 1 153  ? -47.717 -9.925  -40.537 1.00 106.51 ? 153  GLY A O     1 
ATOM   1135  N  N     . TYR A 1 154  ? -47.642 -11.213 -42.371 1.00 80.88  ? 154  TYR A N     1 
ATOM   1136  C  CA    . TYR A 1 154  ? -49.068 -11.088 -42.742 1.00 69.79  ? 154  TYR A CA    1 
ATOM   1137  C  C     . TYR A 1 154  ? -49.541 -9.719  -43.241 1.00 71.61  ? 154  TYR A C     1 
ATOM   1138  O  O     . TYR A 1 154  ? -50.482 -9.665  -44.039 1.00 76.96  ? 154  TYR A O     1 
ATOM   1139  C  CB    . TYR A 1 154  ? -49.997 -11.551 -41.620 1.00 64.59  ? 154  TYR A CB    1 
ATOM   1140  C  CG    . TYR A 1 154  ? -49.735 -12.959 -41.198 1.00 62.54  ? 154  TYR A CG    1 
ATOM   1141  C  CD1   . TYR A 1 154  ? -50.123 -14.017 -41.998 1.00 63.15  ? 154  TYR A CD1   1 
ATOM   1142  C  CD2   . TYR A 1 154  ? -49.061 -13.241 -40.021 1.00 62.94  ? 154  TYR A CD2   1 
ATOM   1143  C  CE1   . TYR A 1 154  ? -49.864 -15.324 -41.633 1.00 63.99  ? 154  TYR A CE1   1 
ATOM   1144  C  CE2   . TYR A 1 154  ? -48.818 -14.548 -39.640 1.00 65.20  ? 154  TYR A CE2   1 
ATOM   1145  C  CZ    . TYR A 1 154  ? -49.225 -15.585 -40.452 1.00 63.91  ? 154  TYR A CZ    1 
ATOM   1146  O  OH    . TYR A 1 154  ? -48.979 -16.887 -40.096 1.00 70.79  ? 154  TYR A OH    1 
ATOM   1147  N  N     . ARG A 1 155  ? -48.911 -8.629  -42.795 1.00 73.10  ? 155  ARG A N     1 
ATOM   1148  C  CA    . ARG A 1 155  ? -49.310 -7.250  -43.155 1.00 79.95  ? 155  ARG A CA    1 
ATOM   1149  C  C     . ARG A 1 155  ? -49.548 -7.050  -44.669 1.00 78.98  ? 155  ARG A C     1 
ATOM   1150  O  O     . ARG A 1 155  ? -50.579 -6.498  -45.049 1.00 86.43  ? 155  ARG A O     1 
ATOM   1151  C  CB    . ARG A 1 155  ? -48.246 -6.238  -42.634 1.00 83.77  ? 155  ARG A CB    1 
ATOM   1152  C  CG    . ARG A 1 155  ? -48.575 -4.735  -42.720 1.00 89.53  ? 155  ARG A CG    1 
ATOM   1153  C  CD    . ARG A 1 155  ? -48.360 -4.040  -44.090 1.00 93.42  ? 155  ARG A CD    1 
ATOM   1154  N  NE    . ARG A 1 155  ? -46.992 -4.093  -44.628 1.00 102.08 ? 155  ARG A NE    1 
ATOM   1155  C  CZ    . ARG A 1 155  ? -46.635 -3.759  -45.881 1.00 113.27 ? 155  ARG A CZ    1 
ATOM   1156  N  NH1   . ARG A 1 155  ? -47.518 -3.306  -46.779 1.00 113.82 ? 155  ARG A NH1   1 
ATOM   1157  N  NH2   . ARG A 1 155  ? -45.361 -3.870  -46.249 1.00 111.69 ? 155  ARG A NH2   1 
ATOM   1158  N  N     . PRO A 1 156  ? -48.610 -7.487  -45.533 1.00 77.55  ? 156  PRO A N     1 
ATOM   1159  C  CA    . PRO A 1 156  ? -48.835 -7.262  -46.968 1.00 73.87  ? 156  PRO A CA    1 
ATOM   1160  C  C     . PRO A 1 156  ? -49.960 -8.105  -47.593 1.00 78.46  ? 156  PRO A C     1 
ATOM   1161  O  O     . PRO A 1 156  ? -50.592 -7.667  -48.566 1.00 79.04  ? 156  PRO A O     1 
ATOM   1162  C  CB    . PRO A 1 156  ? -47.488 -7.614  -47.573 1.00 79.88  ? 156  PRO A CB    1 
ATOM   1163  C  CG    . PRO A 1 156  ? -46.891 -8.615  -46.626 1.00 81.69  ? 156  PRO A CG    1 
ATOM   1164  C  CD    . PRO A 1 156  ? -47.292 -8.110  -45.282 1.00 85.36  ? 156  PRO A CD    1 
ATOM   1165  N  N     . ILE A 1 157  ? -50.196 -9.298  -47.035 1.00 79.86  ? 157  ILE A N     1 
ATOM   1166  C  CA    . ILE A 1 157  ? -51.322 -10.137 -47.430 1.00 83.46  ? 157  ILE A CA    1 
ATOM   1167  C  C     . ILE A 1 157  ? -52.636 -9.459  -46.983 1.00 84.34  ? 157  ILE A C     1 
ATOM   1168  O  O     . ILE A 1 157  ? -53.618 -9.466  -47.738 1.00 98.70  ? 157  ILE A O     1 
ATOM   1169  C  CB    . ILE A 1 157  ? -51.226 -11.579 -46.866 1.00 86.52  ? 157  ILE A CB    1 
ATOM   1170  C  CG1   . ILE A 1 157  ? -49.851 -12.208 -47.194 1.00 87.36  ? 157  ILE A CG1   1 
ATOM   1171  C  CG2   . ILE A 1 157  ? -52.341 -12.441 -47.445 1.00 91.23  ? 157  ILE A CG2   1 
ATOM   1172  C  CD1   . ILE A 1 157  ? -49.731 -13.717 -47.024 1.00 82.03  ? 157  ILE A CD1   1 
ATOM   1173  N  N     . ILE A 1 158  ? -52.641 -8.858  -45.785 1.00 84.53  ? 158  ILE A N     1 
ATOM   1174  C  CA    . ILE A 1 158  ? -53.802 -8.071  -45.307 1.00 84.37  ? 158  ILE A CA    1 
ATOM   1175  C  C     . ILE A 1 158  ? -54.089 -6.863  -46.207 1.00 91.57  ? 158  ILE A C     1 
ATOM   1176  O  O     . ILE A 1 158  ? -55.246 -6.564  -46.492 1.00 98.13  ? 158  ILE A O     1 
ATOM   1177  C  CB    . ILE A 1 158  ? -53.684 -7.696  -43.836 1.00 87.25  ? 158  ILE A CB    1 
ATOM   1178  C  CG1   . ILE A 1 158  ? -53.779 -8.955  -42.972 1.00 85.87  ? 158  ILE A CG1   1 
ATOM   1179  C  CG2   . ILE A 1 158  ? -54.781 -6.727  -43.448 1.00 96.74  ? 158  ILE A CG2   1 
ATOM   1180  C  CD1   . ILE A 1 158  ? -54.966 -9.841  -43.278 1.00 86.63  ? 158  ILE A CD1   1 
ATOM   1181  N  N     . ASP A 1 159  ? -53.046 -6.171  -46.654 1.00 107.17 ? 159  ASP A N     1 
ATOM   1182  C  CA    . ASP A 1 159  ? -53.193 -5.044  -47.597 1.00 113.84 ? 159  ASP A CA    1 
ATOM   1183  C  C     . ASP A 1 159  ? -53.809 -5.495  -48.907 1.00 109.10 ? 159  ASP A C     1 
ATOM   1184  O  O     . ASP A 1 159  ? -54.652 -4.796  -49.459 1.00 107.33 ? 159  ASP A O     1 
ATOM   1185  C  CB    . ASP A 1 159  ? -51.857 -4.342  -47.867 1.00 113.81 ? 159  ASP A CB    1 
ATOM   1186  C  CG    . ASP A 1 159  ? -51.482 -3.370  -46.775 1.00 107.72 ? 159  ASP A CG    1 
ATOM   1187  O  OD1   . ASP A 1 159  ? -52.406 -2.749  -46.207 1.00 108.54 ? 159  ASP A OD1   1 
ATOM   1188  O  OD2   . ASP A 1 159  ? -50.272 -3.226  -46.489 1.00 105.64 ? 159  ASP A OD2   1 
ATOM   1189  N  N     . ALA A 1 160  ? -53.390 -6.658  -49.405 1.00 106.73 ? 160  ALA A N     1 
ATOM   1190  C  CA    . ALA A 1 160  ? -53.960 -7.212  -50.642 1.00 111.70 ? 160  ALA A CA    1 
ATOM   1191  C  C     . ALA A 1 160  ? -55.461 -7.473  -50.494 1.00 103.26 ? 160  ALA A C     1 
ATOM   1192  O  O     . ALA A 1 160  ? -56.252 -7.115  -51.371 1.00 96.10  ? 160  ALA A O     1 
ATOM   1193  C  CB    . ALA A 1 160  ? -53.274 -8.517  -51.029 1.00 113.25 ? 160  ALA A CB    1 
ATOM   1194  N  N     . CYS A 1 161  ? -55.837 -8.084  -49.374 1.00 100.24 ? 161  CYS A N     1 
ATOM   1195  C  CA    . CYS A 1 161  ? -57.238 -8.288  -49.014 1.00 105.87 ? 161  CYS A CA    1 
ATOM   1196  C  C     . CYS A 1 161  ? -58.056 -6.986  -48.953 1.00 108.96 ? 161  CYS A C     1 
ATOM   1197  O  O     . CYS A 1 161  ? -59.182 -6.941  -49.444 1.00 103.84 ? 161  CYS A O     1 
ATOM   1198  C  CB    . CYS A 1 161  ? -57.332 -8.970  -47.642 1.00 103.53 ? 161  CYS A CB    1 
ATOM   1199  S  SG    . CYS A 1 161  ? -56.659 -10.644 -47.553 1.00 110.15 ? 161  CYS A SG    1 
ATOM   1200  N  N     . LYS A 1 162  ? -57.495 -5.937  -48.359 1.00 107.51 ? 162  LYS A N     1 
ATOM   1201  C  CA    . LYS A 1 162  ? -58.192 -4.648  -48.257 1.00 106.67 ? 162  LYS A CA    1 
ATOM   1202  C  C     . LYS A 1 162  ? -58.583 -4.052  -49.602 1.00 107.70 ? 162  LYS A C     1 
ATOM   1203  O  O     . LYS A 1 162  ? -59.641 -3.427  -49.701 1.00 118.80 ? 162  LYS A O     1 
ATOM   1204  C  CB    . LYS A 1 162  ? -57.319 -3.636  -47.522 1.00 107.80 ? 162  LYS A CB    1 
ATOM   1205  C  CG    . LYS A 1 162  ? -57.289 -3.832  -46.026 1.00 110.46 ? 162  LYS A CG    1 
ATOM   1206  C  CD    . LYS A 1 162  ? -56.770 -2.599  -45.314 1.00 112.16 ? 162  LYS A CD    1 
ATOM   1207  C  CE    . LYS A 1 162  ? -56.873 -2.793  -43.813 1.00 115.93 ? 162  LYS A CE    1 
ATOM   1208  N  NZ    . LYS A 1 162  ? -56.262 -1.660  -43.074 1.00 120.73 ? 162  LYS A NZ    1 
ATOM   1209  N  N     . THR A 1 163  ? -57.761 -4.271  -50.633 1.00 103.16 ? 163  THR A N     1 
ATOM   1210  C  CA    . THR A 1 163  ? -58.044 -3.761  -51.982 1.00 96.47  ? 163  THR A CA    1 
ATOM   1211  C  C     . THR A 1 163  ? -59.322 -4.363  -52.601 1.00 100.22 ? 163  THR A C     1 
ATOM   1212  O  O     . THR A 1 163  ? -59.876 -3.795  -53.546 1.00 98.35  ? 163  THR A O     1 
ATOM   1213  C  CB    . THR A 1 163  ? -56.858 -3.990  -52.922 1.00 93.54  ? 163  THR A CB    1 
ATOM   1214  O  OG1   . THR A 1 163  ? -56.892 -5.329  -53.418 1.00 113.58 ? 163  THR A OG1   1 
ATOM   1215  C  CG2   . THR A 1 163  ? -55.549 -3.785  -52.199 1.00 92.20  ? 163  THR A CG2   1 
ATOM   1216  N  N     . PHE A 1 164  ? -59.764 -5.511  -52.076 1.00 99.00  ? 164  PHE A N     1 
ATOM   1217  C  CA    . PHE A 1 164  ? -61.052 -6.120  -52.448 1.00 104.43 ? 164  PHE A CA    1 
ATOM   1218  C  C     . PHE A 1 164  ? -62.277 -5.624  -51.635 1.00 100.25 ? 164  PHE A C     1 
ATOM   1219  O  O     . PHE A 1 164  ? -63.396 -5.972  -51.977 1.00 115.34 ? 164  PHE A O     1 
ATOM   1220  C  CB    . PHE A 1 164  ? -60.967 -7.660  -52.338 1.00 114.34 ? 164  PHE A CB    1 
ATOM   1221  C  CG    . PHE A 1 164  ? -60.013 -8.299  -53.329 1.00 109.98 ? 164  PHE A CG    1 
ATOM   1222  C  CD1   . PHE A 1 164  ? -60.251 -8.223  -54.685 1.00 108.93 ? 164  PHE A CD1   1 
ATOM   1223  C  CD2   . PHE A 1 164  ? -58.891 -8.977  -52.899 1.00 106.14 ? 164  PHE A CD2   1 
ATOM   1224  C  CE1   . PHE A 1 164  ? -59.383 -8.788  -55.586 1.00 107.04 ? 164  PHE A CE1   1 
ATOM   1225  C  CE2   . PHE A 1 164  ? -58.023 -9.552  -53.799 1.00 101.45 ? 164  PHE A CE2   1 
ATOM   1226  C  CZ    . PHE A 1 164  ? -58.268 -9.453  -55.141 1.00 106.35 ? 164  PHE A CZ    1 
ATOM   1227  N  N     . CYS A 1 165  ? -62.063 -4.864  -50.576 1.00 104.45 ? 165  CYS A N     1 
ATOM   1228  C  CA    . CYS A 1 165  ? -63.135 -4.508  -49.625 1.00 113.52 ? 165  CYS A CA    1 
ATOM   1229  C  C     . CYS A 1 165  ? -63.658 -3.088  -49.940 1.00 120.30 ? 165  CYS A C     1 
ATOM   1230  O  O     . CYS A 1 165  ? -62.869 -2.136  -50.125 1.00 102.25 ? 165  CYS A O     1 
ATOM   1231  C  CB    . CYS A 1 165  ? -62.634 -4.569  -48.176 1.00 120.11 ? 165  CYS A CB    1 
ATOM   1232  S  SG    . CYS A 1 165  ? -62.657 -6.204  -47.394 1.00 119.28 ? 165  CYS A SG    1 
ATOM   1233  N  N     . LYS A 1 166  ? -64.981 -2.967  -50.018 1.00 132.60 ? 166  LYS A N     1 
ATOM   1234  C  CA    . LYS A 1 166  ? -65.608 -1.698  -50.333 1.00 135.24 ? 166  LYS A CA    1 
ATOM   1235  C  C     . LYS A 1 166  ? -65.693 -0.835  -49.088 1.00 146.06 ? 166  LYS A C     1 
ATOM   1236  O  O     . LYS A 1 166  ? -66.760 -0.668  -48.528 1.00 159.23 ? 166  LYS A O     1 
ATOM   1237  C  CB    . LYS A 1 166  ? -67.009 -1.968  -50.875 1.00 132.88 ? 166  LYS A CB    1 
ATOM   1238  C  CG    . LYS A 1 166  ? -67.543 -0.860  -51.753 1.00 139.86 ? 166  LYS A CG    1 
ATOM   1239  C  CD    . LYS A 1 166  ? -66.785 -0.792  -53.075 1.00 140.25 ? 166  LYS A CD    1 
ATOM   1240  C  CE    . LYS A 1 166  ? -67.711 -0.497  -54.247 1.00 136.72 ? 166  LYS A CE    1 
ATOM   1241  N  NZ    . LYS A 1 166  ? -68.607 0.662   -53.980 1.00 133.78 ? 166  LYS A NZ    1 
ATOM   1242  N  N     . THR A 1 167  ? -64.549 -0.274  -48.679 1.00 165.62 ? 167  THR A N     1 
ATOM   1243  C  CA    . THR A 1 167  ? -64.422 0.551   -47.478 1.00 166.14 ? 167  THR A CA    1 
ATOM   1244  C  C     . THR A 1 167  ? -64.638 2.032   -47.800 1.00 153.86 ? 167  THR A C     1 
ATOM   1245  O  O     . THR A 1 167  ? -65.770 2.510   -47.780 1.00 146.53 ? 167  THR A O     1 
ATOM   1246  C  CB    . THR A 1 167  ? -63.072 0.399   -46.755 1.00 160.60 ? 167  THR A CB    1 
ATOM   1247  O  OG1   . THR A 1 167  ? -62.012 0.800   -47.633 1.00 159.99 ? 167  THR A OG1   1 
ATOM   1248  C  CG2   . THR A 1 167  ? -62.871 -1.044  -46.261 1.00 150.30 ? 167  THR A CG2   1 
ATOM   1249  N  N     . PRO A 1 199  ? -46.778 8.253   -49.602 1.00 138.74 ? 199  PRO A N     1 
ATOM   1250  C  CA    . PRO A 1 199  ? -46.016 7.323   -50.431 1.00 141.01 ? 199  PRO A CA    1 
ATOM   1251  C  C     . PRO A 1 199  ? -46.232 5.854   -50.074 1.00 146.28 ? 199  PRO A C     1 
ATOM   1252  O  O     . PRO A 1 199  ? -45.579 5.337   -49.166 1.00 152.21 ? 199  PRO A O     1 
ATOM   1253  C  CB    . PRO A 1 199  ? -44.552 7.733   -50.165 1.00 132.25 ? 199  PRO A CB    1 
ATOM   1254  C  CG    . PRO A 1 199  ? -44.617 9.154   -49.699 1.00 136.63 ? 199  PRO A CG    1 
ATOM   1255  C  CD    . PRO A 1 199  ? -46.053 9.516   -49.396 1.00 135.20 ? 199  PRO A CD    1 
ATOM   1256  N  N     . LYS A 1 200  ? -47.091 5.159   -50.840 1.00 147.69 ? 200  LYS A N     1 
ATOM   1257  C  CA    . LYS A 1 200  ? -47.308 3.693   -50.710 1.00 143.79 ? 200  LYS A CA    1 
ATOM   1258  C  C     . LYS A 1 200  ? -46.282 2.858   -51.499 1.00 134.40 ? 200  LYS A C     1 
ATOM   1259  O  O     . LYS A 1 200  ? -45.567 3.372   -52.378 1.00 141.29 ? 200  LYS A O     1 
ATOM   1260  C  CB    . LYS A 1 200  ? -48.718 3.258   -51.155 1.00 141.96 ? 200  LYS A CB    1 
ATOM   1261  C  CG    . LYS A 1 200  ? -49.841 4.256   -50.912 1.00 147.05 ? 200  LYS A CG    1 
ATOM   1262  C  CD    . LYS A 1 200  ? -49.891 4.769   -49.486 1.00 146.85 ? 200  LYS A CD    1 
ATOM   1263  C  CE    . LYS A 1 200  ? -50.678 6.067   -49.434 1.00 149.83 ? 200  LYS A CE    1 
ATOM   1264  N  NZ    . LYS A 1 200  ? -50.956 6.493   -48.035 1.00 155.47 ? 200  LYS A NZ    1 
ATOM   1265  N  N     . LEU A 1 201  ? -46.236 1.571   -51.173 1.00 118.88 ? 201  LEU A N     1 
ATOM   1266  C  CA    . LEU A 1 201  ? -45.291 0.607   -51.799 1.00 110.08 ? 201  LEU A CA    1 
ATOM   1267  C  C     . LEU A 1 201  ? -45.787 -0.022  -53.110 1.00 105.04 ? 201  LEU A C     1 
ATOM   1268  O  O     . LEU A 1 201  ? -45.030 -0.734  -53.770 1.00 100.69 ? 201  LEU A O     1 
ATOM   1269  C  CB    . LEU A 1 201  ? -45.011 -0.542  -50.855 1.00 112.17 ? 201  LEU A CB    1 
ATOM   1270  C  CG    . LEU A 1 201  ? -44.527 -0.182  -49.465 1.00 119.57 ? 201  LEU A CG    1 
ATOM   1271  C  CD1   . LEU A 1 201  ? -44.676 -1.401  -48.564 1.00 125.34 ? 201  LEU A CD1   1 
ATOM   1272  C  CD2   . LEU A 1 201  ? -43.091 0.313   -49.537 1.00 118.03 ? 201  LEU A CD2   1 
ATOM   1273  N  N     . PHE A 1 202  ? -47.041 0.261   -53.476 1.00 103.74 ? 202  PHE A N     1 
ATOM   1274  C  CA    . PHE A 1 202  ? -47.688 -0.335  -54.650 1.00 101.57 ? 202  PHE A CA    1 
ATOM   1275  C  C     . PHE A 1 202  ? -48.793 0.555   -55.176 1.00 99.57  ? 202  PHE A C     1 
ATOM   1276  O  O     . PHE A 1 202  ? -49.401 1.267   -54.387 1.00 101.98 ? 202  PHE A O     1 
ATOM   1277  C  CB    . PHE A 1 202  ? -48.279 -1.695  -54.286 1.00 103.92 ? 202  PHE A CB    1 
ATOM   1278  C  CG    . PHE A 1 202  ? -49.115 -1.714  -53.013 1.00 91.57  ? 202  PHE A CG    1 
ATOM   1279  C  CD1   . PHE A 1 202  ? -48.515 -1.888  -51.770 1.00 92.75  ? 202  PHE A CD1   1 
ATOM   1280  C  CD2   . PHE A 1 202  ? -50.506 -1.654  -53.070 1.00 82.85  ? 202  PHE A CD2   1 
ATOM   1281  C  CE1   . PHE A 1 202  ? -49.277 -1.945  -50.605 1.00 91.46  ? 202  PHE A CE1   1 
ATOM   1282  C  CE2   . PHE A 1 202  ? -51.275 -1.712  -51.913 1.00 81.76  ? 202  PHE A CE2   1 
ATOM   1283  C  CZ    . PHE A 1 202  ? -50.661 -1.853  -50.678 1.00 86.78  ? 202  PHE A CZ    1 
ATOM   1284  N  N     . ALA A 1 203  ? -49.062 0.500   -56.480 1.00 106.56 ? 203  ALA A N     1 
ATOM   1285  C  CA    . ALA A 1 203  ? -50.115 1.325   -57.113 1.00 110.66 ? 203  ALA A CA    1 
ATOM   1286  C  C     . ALA A 1 203  ? -51.448 0.576   -57.172 1.00 115.26 ? 203  ALA A C     1 
ATOM   1287  O  O     . ALA A 1 203  ? -51.691 -0.185  -58.099 1.00 117.24 ? 203  ALA A O     1 
ATOM   1288  C  CB    . ALA A 1 203  ? -49.678 1.755   -58.514 1.00 112.35 ? 203  ALA A CB    1 
ATOM   1289  N  N     . GLU A 1 204  ? -52.318 0.802   -56.173 1.00 108.28 ? 204  GLU A N     1 
ATOM   1290  C  CA    . GLU A 1 204  ? -53.631 0.146   -56.102 1.00 106.41 ? 204  GLU A CA    1 
ATOM   1291  C  C     . GLU A 1 204  ? -54.500 0.539   -57.303 1.00 109.91 ? 204  GLU A C     1 
ATOM   1292  O  O     . GLU A 1 204  ? -55.156 -0.325  -57.903 1.00 109.07 ? 204  GLU A O     1 
ATOM   1293  C  CB    . GLU A 1 204  ? -54.337 0.430   -54.753 1.00 113.08 ? 204  GLU A CB    1 
ATOM   1294  C  CG    . GLU A 1 204  ? -55.693 -0.283  -54.572 1.00 127.03 ? 204  GLU A CG    1 
ATOM   1295  C  CD    . GLU A 1 204  ? -56.356 -0.122  -53.183 1.00 134.18 ? 204  GLU A CD    1 
ATOM   1296  O  OE1   . GLU A 1 204  ? -55.696 0.325   -52.207 1.00 136.41 ? 204  GLU A OE1   1 
ATOM   1297  O  OE2   . GLU A 1 204  ? -57.558 -0.474  -53.059 1.00 123.71 ? 204  GLU A OE2   1 
ATOM   1298  N  N     . GLU A 1 205  ? -54.486 1.824   -57.660 1.00 108.53 ? 205  GLU A N     1 
ATOM   1299  C  CA    . GLU A 1 205  ? -55.199 2.356   -58.822 1.00 106.64 ? 205  GLU A CA    1 
ATOM   1300  C  C     . GLU A 1 205  ? -54.839 1.717   -60.174 1.00 105.16 ? 205  GLU A C     1 
ATOM   1301  O  O     . GLU A 1 205  ? -55.383 2.114   -61.189 1.00 104.63 ? 205  GLU A O     1 
ATOM   1302  C  CB    . GLU A 1 205  ? -54.964 3.860   -58.952 1.00 114.59 ? 205  GLU A CB    1 
ATOM   1303  C  CG    . GLU A 1 205  ? -53.538 4.260   -59.327 1.00 118.49 ? 205  GLU A CG    1 
ATOM   1304  C  CD    . GLU A 1 205  ? -52.567 4.190   -58.155 1.00 132.96 ? 205  GLU A CD    1 
ATOM   1305  O  OE1   . GLU A 1 205  ? -53.013 3.978   -57.001 1.00 133.69 ? 205  GLU A OE1   1 
ATOM   1306  O  OE2   . GLU A 1 205  ? -51.349 4.346   -58.385 1.00 144.04 ? 205  GLU A OE2   1 
ATOM   1307  N  N     . GLU A 1 206  ? -53.872 0.813   -60.217 1.00 108.13 ? 206  GLU A N     1 
ATOM   1308  C  CA    . GLU A 1 206  ? -53.543 0.069   -61.432 1.00 108.03 ? 206  GLU A CA    1 
ATOM   1309  C  C     . GLU A 1 206  ? -53.899 -1.431  -61.387 1.00 97.91  ? 206  GLU A C     1 
ATOM   1310  O  O     . GLU A 1 206  ? -53.715 -2.130  -62.374 1.00 95.54  ? 206  GLU A O     1 
ATOM   1311  C  CB    . GLU A 1 206  ? -52.063 0.262   -61.773 1.00 121.20 ? 206  GLU A CB    1 
ATOM   1312  C  CG    . GLU A 1 206  ? -51.717 1.651   -62.299 1.00 130.24 ? 206  GLU A CG    1 
ATOM   1313  C  CD    . GLU A 1 206  ? -50.252 2.017   -62.073 1.00 136.33 ? 206  GLU A CD    1 
ATOM   1314  O  OE1   . GLU A 1 206  ? -49.353 1.251   -62.489 1.00 121.49 ? 206  GLU A OE1   1 
ATOM   1315  O  OE2   . GLU A 1 206  ? -49.993 3.081   -61.472 1.00 141.06 ? 206  GLU A OE2   1 
ATOM   1316  N  N     . PHE A 1 207  ? -54.378 -1.933  -60.251 1.00 100.17 ? 207  PHE A N     1 
ATOM   1317  C  CA    . PHE A 1 207  ? -54.796 -3.334  -60.112 1.00 110.32 ? 207  PHE A CA    1 
ATOM   1318  C  C     . PHE A 1 207  ? -56.095 -3.575  -60.829 1.00 110.64 ? 207  PHE A C     1 
ATOM   1319  O  O     . PHE A 1 207  ? -57.070 -2.882  -60.562 1.00 117.06 ? 207  PHE A O     1 
ATOM   1320  C  CB    . PHE A 1 207  ? -54.999 -3.748  -58.640 1.00 112.47 ? 207  PHE A CB    1 
ATOM   1321  C  CG    . PHE A 1 207  ? -53.740 -3.748  -57.804 1.00 109.61 ? 207  PHE A CG    1 
ATOM   1322  C  CD1   . PHE A 1 207  ? -52.463 -3.705  -58.385 1.00 107.52 ? 207  PHE A CD1   1 
ATOM   1323  C  CD2   . PHE A 1 207  ? -53.835 -3.818  -56.423 1.00 101.31 ? 207  PHE A CD2   1 
ATOM   1324  C  CE1   . PHE A 1 207  ? -51.323 -3.707  -57.600 1.00 102.05 ? 207  PHE A CE1   1 
ATOM   1325  C  CE2   . PHE A 1 207  ? -52.695 -3.828  -55.638 1.00 103.44 ? 207  PHE A CE2   1 
ATOM   1326  C  CZ    . PHE A 1 207  ? -51.437 -3.778  -56.225 1.00 99.16  ? 207  PHE A CZ    1 
ATOM   1327  N  N     . LEU A 1 208  ? -56.122 -4.575  -61.712 1.00 120.53 ? 208  LEU A N     1 
ATOM   1328  C  CA    . LEU A 1 208  ? -57.311 -4.822  -62.553 1.00 137.60 ? 208  LEU A CA    1 
ATOM   1329  C  C     . LEU A 1 208  ? -58.464 -5.296  -61.675 1.00 133.65 ? 208  LEU A C     1 
ATOM   1330  O  O     . LEU A 1 208  ? -58.254 -6.133  -60.795 1.00 133.56 ? 208  LEU A O     1 
ATOM   1331  C  CB    . LEU A 1 208  ? -57.005 -5.822  -63.689 1.00 147.96 ? 208  LEU A CB    1 
ATOM   1332  C  CG    . LEU A 1 208  ? -57.002 -7.343  -63.409 1.00 160.93 ? 208  LEU A CG    1 
ATOM   1333  C  CD1   . LEU A 1 208  ? -58.333 -7.951  -63.822 1.00 158.65 ? 208  LEU A CD1   1 
ATOM   1334  C  CD2   . LEU A 1 208  ? -55.860 -8.078  -64.107 1.00 163.92 ? 208  LEU A CD2   1 
ATOM   1335  N  N     . PRO A 1 209  ? -59.698 -4.806  -61.938 1.00 125.56 ? 209  PRO A N     1 
ATOM   1336  C  CA    . PRO A 1 209  ? -60.843 -5.059  -61.064 1.00 124.05 ? 209  PRO A CA    1 
ATOM   1337  C  C     . PRO A 1 209  ? -61.374 -6.489  -61.127 1.00 117.45 ? 209  PRO A C     1 
ATOM   1338  O  O     . PRO A 1 209  ? -61.270 -7.135  -62.193 1.00 130.17 ? 209  PRO A O     1 
ATOM   1339  C  CB    . PRO A 1 209  ? -61.904 -4.145  -61.646 1.00 136.78 ? 209  PRO A CB    1 
ATOM   1340  C  CG    . PRO A 1 209  ? -61.636 -4.217  -63.115 1.00 137.77 ? 209  PRO A CG    1 
ATOM   1341  C  CD    . PRO A 1 209  ? -60.139 -4.340  -63.263 1.00 127.53 ? 209  PRO A CD    1 
ATOM   1342  N  N     . LEU A 1 210  ? -61.932 -6.966  -60.011 1.00 108.87 ? 210  LEU A N     1 
ATOM   1343  C  CA    . LEU A 1 210  ? -62.483 -8.316  -59.952 1.00 112.10 ? 210  LEU A CA    1 
ATOM   1344  C  C     . LEU A 1 210  ? -63.776 -8.345  -60.740 1.00 126.92 ? 210  LEU A C     1 
ATOM   1345  O  O     . LEU A 1 210  ? -64.795 -7.807  -60.322 1.00 144.85 ? 210  LEU A O     1 
ATOM   1346  C  CB    . LEU A 1 210  ? -62.734 -8.791  -58.528 1.00 109.82 ? 210  LEU A CB    1 
ATOM   1347  C  CG    . LEU A 1 210  ? -63.152 -10.270 -58.485 1.00 115.64 ? 210  LEU A CG    1 
ATOM   1348  C  CD1   . LEU A 1 210  ? -61.927 -11.139 -58.253 1.00 110.82 ? 210  LEU A CD1   1 
ATOM   1349  C  CD2   . LEU A 1 210  ? -64.236 -10.555 -57.445 1.00 120.63 ? 210  LEU A CD2   1 
ATOM   1350  N  N     . ASP A 1 211  ? -63.726 -8.987  -61.903 1.00 137.55 ? 211  ASP A N     1 
ATOM   1351  C  CA    . ASP A 1 211  ? -64.911 -9.248  -62.704 1.00 139.79 ? 211  ASP A CA    1 
ATOM   1352  C  C     . ASP A 1 211  ? -65.611 -10.495 -62.184 1.00 145.09 ? 211  ASP A C     1 
ATOM   1353  O  O     . ASP A 1 211  ? -65.160 -11.594 -62.496 1.00 138.27 ? 211  ASP A O     1 
ATOM   1354  C  CB    . ASP A 1 211  ? -64.494 -9.473  -64.158 1.00 137.17 ? 211  ASP A CB    1 
ATOM   1355  C  CG    . ASP A 1 211  ? -65.677 -9.689  -65.074 1.00 142.95 ? 211  ASP A CG    1 
ATOM   1356  O  OD1   . ASP A 1 211  ? -66.761 -10.089 -64.583 1.00 126.44 ? 211  ASP A OD1   1 
ATOM   1357  O  OD2   . ASP A 1 211  ? -65.516 -9.456  -66.292 1.00 153.35 ? 211  ASP A OD2   1 
ATOM   1358  N  N     . PRO A 1 212  ? -66.738 -10.346 -61.438 1.00 144.51 ? 212  PRO A N     1 
ATOM   1359  C  CA    . PRO A 1 212  ? -67.369 -11.562 -60.882 1.00 134.84 ? 212  PRO A CA    1 
ATOM   1360  C  C     . PRO A 1 212  ? -68.087 -12.442 -61.923 1.00 127.90 ? 212  PRO A C     1 
ATOM   1361  O  O     . PRO A 1 212  ? -68.349 -13.612 -61.647 1.00 110.66 ? 212  PRO A O     1 
ATOM   1362  C  CB    . PRO A 1 212  ? -68.368 -11.015 -59.838 1.00 130.99 ? 212  PRO A CB    1 
ATOM   1363  C  CG    . PRO A 1 212  ? -68.220 -9.522  -59.854 1.00 133.38 ? 212  PRO A CG    1 
ATOM   1364  C  CD    . PRO A 1 212  ? -67.559 -9.156  -61.154 1.00 136.05 ? 212  PRO A CD    1 
ATOM   1365  N  N     . THR A 1 213  ? -68.395 -11.883 -63.094 1.00 134.97 ? 213  THR A N     1 
ATOM   1366  C  CA    . THR A 1 213  ? -69.071 -12.621 -64.168 1.00 144.79 ? 213  THR A CA    1 
ATOM   1367  C  C     . THR A 1 213  ? -68.125 -13.396 -65.096 1.00 145.09 ? 213  THR A C     1 
ATOM   1368  O  O     . THR A 1 213  ? -68.559 -14.354 -65.727 1.00 167.27 ? 213  THR A O     1 
ATOM   1369  C  CB    . THR A 1 213  ? -70.026 -11.710 -64.974 1.00 142.47 ? 213  THR A CB    1 
ATOM   1370  O  OG1   . THR A 1 213  ? -69.517 -10.373 -64.968 1.00 143.63 ? 213  THR A OG1   1 
ATOM   1371  C  CG2   . THR A 1 213  ? -71.448 -11.723 -64.363 1.00 134.06 ? 213  THR A CG2   1 
ATOM   1372  N  N     . GLN A 1 214  ? -66.849 -13.010 -65.181 1.00 133.38 ? 214  GLN A N     1 
ATOM   1373  C  CA    . GLN A 1 214  ? -65.849 -13.761 -65.988 1.00 130.22 ? 214  GLN A CA    1 
ATOM   1374  C  C     . GLN A 1 214  ? -65.064 -14.802 -65.177 1.00 120.20 ? 214  GLN A C     1 
ATOM   1375  O  O     . GLN A 1 214  ? -63.937 -15.158 -65.542 1.00 115.32 ? 214  GLN A O     1 
ATOM   1376  C  CB    . GLN A 1 214  ? -64.808 -12.817 -66.606 1.00 132.37 ? 214  GLN A CB    1 
ATOM   1377  C  CG    . GLN A 1 214  ? -64.923 -12.663 -68.105 1.00 142.22 ? 214  GLN A CG    1 
ATOM   1378  C  CD    . GLN A 1 214  ? -66.065 -11.745 -68.486 1.00 147.76 ? 214  GLN A CD    1 
ATOM   1379  O  OE1   . GLN A 1 214  ? -65.950 -10.952 -69.424 1.00 155.74 ? 214  GLN A OE1   1 
ATOM   1380  N  NE2   . GLN A 1 214  ? -67.167 -11.826 -67.742 1.00 130.66 ? 214  GLN A NE2   1 
ATOM   1381  N  N     . GLU A 1 215  ? -65.664 -15.315 -64.101 1.00 110.65 ? 215  GLU A N     1 
ATOM   1382  C  CA    . GLU A 1 215  ? -65.026 -16.340 -63.273 1.00 106.84 ? 215  GLU A CA    1 
ATOM   1383  C  C     . GLU A 1 215  ? -65.119 -17.720 -63.944 1.00 96.26  ? 215  GLU A C     1 
ATOM   1384  O  O     . GLU A 1 215  ? -65.707 -17.878 -65.010 1.00 77.60  ? 215  GLU A O     1 
ATOM   1385  C  CB    . GLU A 1 215  ? -65.583 -16.359 -61.821 1.00 111.67 ? 215  GLU A CB    1 
ATOM   1386  C  CG    . GLU A 1 215  ? -65.306 -15.112 -60.943 1.00 120.60 ? 215  GLU A CG    1 
ATOM   1387  C  CD    . GLU A 1 215  ? -63.827 -14.651 -60.805 1.00 117.56 ? 215  GLU A CD    1 
ATOM   1388  O  OE1   . GLU A 1 215  ? -62.934 -15.074 -61.581 1.00 108.08 ? 215  GLU A OE1   1 
ATOM   1389  O  OE2   . GLU A 1 215  ? -63.553 -13.812 -59.905 1.00 96.71  ? 215  GLU A OE2   1 
ATOM   1390  N  N     . LEU A 1 216  ? -64.489 -18.712 -63.319 1.00 100.97 ? 216  LEU A N     1 
ATOM   1391  C  CA    . LEU A 1 216  ? -64.425 -20.076 -63.836 1.00 93.41  ? 216  LEU A CA    1 
ATOM   1392  C  C     . LEU A 1 216  ? -65.794 -20.759 -63.843 1.00 91.48  ? 216  LEU A C     1 
ATOM   1393  O  O     . LEU A 1 216  ? -66.467 -20.762 -62.798 1.00 91.58  ? 216  LEU A O     1 
ATOM   1394  C  CB    . LEU A 1 216  ? -63.512 -20.922 -62.945 1.00 100.04 ? 216  LEU A CB    1 
ATOM   1395  C  CG    . LEU A 1 216  ? -62.098 -20.475 -62.559 1.00 105.58 ? 216  LEU A CG    1 
ATOM   1396  C  CD1   . LEU A 1 216  ? -61.539 -21.506 -61.578 1.00 107.09 ? 216  LEU A CD1   1 
ATOM   1397  C  CD2   . LEU A 1 216  ? -61.177 -20.281 -63.764 1.00 102.89 ? 216  LEU A CD2   1 
ATOM   1398  N  N     . ILE A 1 217  ? -66.170 -21.343 -64.979 1.00 87.92  ? 217  ILE A N     1 
ATOM   1399  C  CA    . ILE A 1 217  ? -67.484 -21.935 -65.134 1.00 89.27  ? 217  ILE A CA    1 
ATOM   1400  C  C     . ILE A 1 217  ? -67.477 -23.320 -64.497 1.00 81.70  ? 217  ILE A C     1 
ATOM   1401  O  O     . ILE A 1 217  ? -66.548 -24.089 -64.748 1.00 78.34  ? 217  ILE A O     1 
ATOM   1402  C  CB    . ILE A 1 217  ? -67.865 -21.943 -66.631 1.00 97.22  ? 217  ILE A CB    1 
ATOM   1403  C  CG1   . ILE A 1 217  ? -68.239 -20.503 -67.077 1.00 99.05  ? 217  ILE A CG1   1 
ATOM   1404  C  CG2   . ILE A 1 217  ? -68.959 -22.965 -66.947 1.00 106.77 ? 217  ILE A CG2   1 
ATOM   1405  C  CD1   . ILE A 1 217  ? -69.040 -19.654 -66.084 1.00 98.26  ? 217  ILE A CD1   1 
ATOM   1406  N  N     . PHE A 1 218  ? -68.473 -23.607 -63.652 1.00 79.20  ? 218  PHE A N     1 
ATOM   1407  C  CA    . PHE A 1 218  ? -68.606 -24.921 -63.076 1.00 81.61  ? 218  PHE A CA    1 
ATOM   1408  C  C     . PHE A 1 218  ? -68.808 -25.944 -64.203 1.00 87.00  ? 218  PHE A C     1 
ATOM   1409  O  O     . PHE A 1 218  ? -69.693 -25.752 -65.028 1.00 92.20  ? 218  PHE A O     1 
ATOM   1410  C  CB    . PHE A 1 218  ? -69.798 -24.957 -62.123 1.00 78.28  ? 218  PHE A CB    1 
ATOM   1411  C  CG    . PHE A 1 218  ? -69.966 -26.274 -61.458 1.00 78.79  ? 218  PHE A CG    1 
ATOM   1412  C  CD1   . PHE A 1 218  ? -69.191 -26.606 -60.360 1.00 87.08  ? 218  PHE A CD1   1 
ATOM   1413  C  CD2   . PHE A 1 218  ? -70.842 -27.208 -61.957 1.00 83.41  ? 218  PHE A CD2   1 
ATOM   1414  C  CE1   . PHE A 1 218  ? -69.311 -27.844 -59.746 1.00 88.81  ? 218  PHE A CE1   1 
ATOM   1415  C  CE2   . PHE A 1 218  ? -70.971 -28.454 -61.359 1.00 89.35  ? 218  PHE A CE2   1 
ATOM   1416  C  CZ    . PHE A 1 218  ? -70.206 -28.774 -60.248 1.00 88.98  ? 218  PHE A CZ    1 
ATOM   1417  N  N     . PRO A 1 219  ? -67.991 -27.018 -64.248 1.00 89.70  ? 219  PRO A N     1 
ATOM   1418  C  CA    . PRO A 1 219  ? -68.059 -27.922 -65.414 1.00 92.60  ? 219  PRO A CA    1 
ATOM   1419  C  C     . PRO A 1 219  ? -69.484 -28.457 -65.638 1.00 94.95  ? 219  PRO A C     1 
ATOM   1420  O  O     . PRO A 1 219  ? -70.068 -29.031 -64.710 1.00 86.60  ? 219  PRO A O     1 
ATOM   1421  C  CB    . PRO A 1 219  ? -67.096 -29.054 -65.046 1.00 99.31  ? 219  PRO A CB    1 
ATOM   1422  C  CG    . PRO A 1 219  ? -66.416 -28.633 -63.781 1.00 94.98  ? 219  PRO A CG    1 
ATOM   1423  C  CD    . PRO A 1 219  ? -67.292 -27.636 -63.115 1.00 89.44  ? 219  PRO A CD    1 
ATOM   1424  N  N     . PRO A 1 220  ? -70.055 -28.239 -66.847 1.00 98.22  ? 220  PRO A N     1 
ATOM   1425  C  CA    . PRO A 1 220  ? -71.427 -28.689 -67.150 1.00 96.54  ? 220  PRO A CA    1 
ATOM   1426  C  C     . PRO A 1 220  ? -71.694 -30.197 -66.985 1.00 90.89  ? 220  PRO A C     1 
ATOM   1427  O  O     . PRO A 1 220  ? -72.792 -30.563 -66.617 1.00 91.07  ? 220  PRO A O     1 
ATOM   1428  C  CB    . PRO A 1 220  ? -71.648 -28.261 -68.614 1.00 94.14  ? 220  PRO A CB    1 
ATOM   1429  C  CG    . PRO A 1 220  ? -70.444 -27.499 -69.045 1.00 91.73  ? 220  PRO A CG    1 
ATOM   1430  C  CD    . PRO A 1 220  ? -69.433 -27.473 -67.945 1.00 94.51  ? 220  PRO A CD    1 
ATOM   1431  N  N     . GLU A 1 221  ? -70.715 -31.047 -67.271 1.00 86.87  ? 221  GLU A N     1 
ATOM   1432  C  CA    . GLU A 1 221  ? -70.855 -32.488 -67.145 1.00 99.08  ? 221  GLU A CA    1 
ATOM   1433  C  C     . GLU A 1 221  ? -71.305 -32.913 -65.738 1.00 104.40 ? 221  GLU A C     1 
ATOM   1434  O  O     . GLU A 1 221  ? -72.172 -33.783 -65.579 1.00 116.75 ? 221  GLU A O     1 
ATOM   1435  C  CB    . GLU A 1 221  ? -69.496 -33.147 -67.448 1.00 108.49 ? 221  GLU A CB    1 
ATOM   1436  C  CG    . GLU A 1 221  ? -69.548 -34.608 -67.874 1.00 124.06 ? 221  GLU A CG    1 
ATOM   1437  C  CD    . GLU A 1 221  ? -68.691 -34.889 -69.116 1.00 140.26 ? 221  GLU A CD    1 
ATOM   1438  O  OE1   . GLU A 1 221  ? -67.488 -34.547 -69.097 1.00 161.49 ? 221  GLU A OE1   1 
ATOM   1439  O  OE2   . GLU A 1 221  ? -69.213 -35.445 -70.119 1.00 130.72 ? 221  GLU A OE2   1 
ATOM   1440  N  N     . LEU A 1 222  ? -70.694 -32.277 -64.734 1.00 105.24 ? 222  LEU A N     1 
ATOM   1441  C  CA    . LEU A 1 222  ? -70.999 -32.528 -63.327 1.00 103.83 ? 222  LEU A CA    1 
ATOM   1442  C  C     . LEU A 1 222  ? -72.425 -32.120 -62.937 1.00 108.65 ? 222  LEU A C     1 
ATOM   1443  O  O     . LEU A 1 222  ? -73.038 -32.745 -62.066 1.00 119.91 ? 222  LEU A O     1 
ATOM   1444  C  CB    . LEU A 1 222  ? -70.010 -31.757 -62.468 1.00 94.28  ? 222  LEU A CB    1 
ATOM   1445  C  CG    . LEU A 1 222  ? -68.590 -32.299 -62.513 1.00 91.60  ? 222  LEU A CG    1 
ATOM   1446  C  CD1   . LEU A 1 222  ? -67.742 -31.441 -61.601 1.00 97.34  ? 222  LEU A CD1   1 
ATOM   1447  C  CD2   . LEU A 1 222  ? -68.510 -33.767 -62.106 1.00 86.61  ? 222  LEU A CD2   1 
ATOM   1448  N  N     . MET A 1 223  ? -72.932 -31.052 -63.564 1.00 104.63 ? 223  MET A N     1 
ATOM   1449  C  CA    . MET A 1 223  ? -74.344 -30.682 -63.443 1.00 105.93 ? 223  MET A CA    1 
ATOM   1450  C  C     . MET A 1 223  ? -75.239 -31.772 -64.023 1.00 113.42 ? 223  MET A C     1 
ATOM   1451  O  O     . MET A 1 223  ? -76.238 -32.147 -63.403 1.00 118.29 ? 223  MET A O     1 
ATOM   1452  C  CB    . MET A 1 223  ? -74.603 -29.347 -64.152 1.00 107.79 ? 223  MET A CB    1 
ATOM   1453  C  CG    . MET A 1 223  ? -74.709 -28.133 -63.252 1.00 108.74 ? 223  MET A CG    1 
ATOM   1454  S  SD    . MET A 1 223  ? -75.197 -26.656 -64.193 1.00 127.17 ? 223  MET A SD    1 
ATOM   1455  C  CE    . MET A 1 223  ? -76.881 -27.011 -64.715 1.00 128.48 ? 223  MET A CE    1 
ATOM   1456  N  N     . ILE A 1 224  ? -74.868 -32.275 -65.203 1.00 113.08 ? 224  ILE A N     1 
ATOM   1457  C  CA    . ILE A 1 224  ? -75.630 -33.327 -65.873 1.00 103.16 ? 224  ILE A CA    1 
ATOM   1458  C  C     . ILE A 1 224  ? -75.588 -34.633 -65.084 1.00 98.34  ? 224  ILE A C     1 
ATOM   1459  O  O     . ILE A 1 224  ? -76.603 -35.311 -64.999 1.00 100.52 ? 224  ILE A O     1 
ATOM   1460  C  CB    . ILE A 1 224  ? -75.097 -33.602 -67.302 1.00 100.82 ? 224  ILE A CB    1 
ATOM   1461  C  CG1   . ILE A 1 224  ? -75.261 -32.376 -68.223 1.00 98.39  ? 224  ILE A CG1   1 
ATOM   1462  C  CG2   . ILE A 1 224  ? -75.786 -34.809 -67.910 1.00 103.69 ? 224  ILE A CG2   1 
ATOM   1463  C  CD1   . ILE A 1 224  ? -76.658 -31.801 -68.288 1.00 102.21 ? 224  ILE A CD1   1 
ATOM   1464  N  N     . MET A 1 225  ? -74.442 -34.981 -64.503 1.00 103.86 ? 225  MET A N     1 
ATOM   1465  C  CA    . MET A 1 225  ? -74.354 -36.174 -63.649 1.00 108.27 ? 225  MET A CA    1 
ATOM   1466  C  C     . MET A 1 225  ? -75.213 -36.035 -62.403 1.00 105.82 ? 225  MET A C     1 
ATOM   1467  O  O     . MET A 1 225  ? -75.938 -36.971 -62.041 1.00 90.10  ? 225  MET A O     1 
ATOM   1468  C  CB    . MET A 1 225  ? -72.912 -36.423 -63.251 1.00 115.84 ? 225  MET A CB    1 
ATOM   1469  C  CG    . MET A 1 225  ? -72.074 -36.956 -64.398 1.00 120.62 ? 225  MET A CG    1 
ATOM   1470  S  SD    . MET A 1 225  ? -70.360 -37.177 -63.924 1.00 119.33 ? 225  MET A SD    1 
ATOM   1471  C  CE    . MET A 1 225  ? -70.519 -38.064 -62.363 1.00 107.15 ? 225  MET A CE    1 
ATOM   1472  N  N     . ALA A 1 226  ? -75.118 -34.873 -61.757 1.00 112.26 ? 226  ALA A N     1 
ATOM   1473  C  CA    . ALA A 1 226  ? -75.917 -34.574 -60.575 1.00 128.26 ? 226  ALA A CA    1 
ATOM   1474  C  C     . ALA A 1 226  ? -77.431 -34.598 -60.871 1.00 139.05 ? 226  ALA A C     1 
ATOM   1475  O  O     . ALA A 1 226  ? -78.215 -35.157 -60.072 1.00 138.44 ? 226  ALA A O     1 
ATOM   1476  C  CB    . ALA A 1 226  ? -75.517 -33.240 -59.970 1.00 130.48 ? 226  ALA A CB    1 
ATOM   1477  N  N     . GLU A 1 227  ? -77.820 -34.033 -62.019 1.00 139.18 ? 227  GLU A N     1 
ATOM   1478  C  CA    . GLU A 1 227  ? -79.223 -34.030 -62.474 1.00 134.22 ? 227  GLU A CA    1 
ATOM   1479  C  C     . GLU A 1 227  ? -79.634 -35.405 -63.006 1.00 137.84 ? 227  GLU A C     1 
ATOM   1480  O  O     . GLU A 1 227  ? -79.910 -35.567 -64.197 1.00 149.67 ? 227  GLU A O     1 
ATOM   1481  C  CB    . GLU A 1 227  ? -79.472 -32.889 -63.482 1.00 134.60 ? 227  GLU A CB    1 
ATOM   1482  C  CG    . GLU A 1 227  ? -79.573 -31.497 -62.846 1.00 129.43 ? 227  GLU A CG    1 
ATOM   1483  C  CD    . GLU A 1 227  ? -79.248 -30.337 -63.797 1.00 126.79 ? 227  GLU A CD    1 
ATOM   1484  O  OE1   . GLU A 1 227  ? -79.148 -30.528 -65.034 1.00 128.04 ? 227  GLU A OE1   1 
ATOM   1485  O  OE2   . GLU A 1 227  ? -79.083 -29.206 -63.296 1.00 118.24 ? 227  GLU A OE2   1 
ATOM   1486  N  N     . LYS A 1 228  ? -79.685 -36.376 -62.098 1.00 137.70 ? 228  LYS A N     1 
ATOM   1487  C  CA    . LYS A 1 228  ? -79.987 -37.805 -62.362 1.00 133.38 ? 228  LYS A CA    1 
ATOM   1488  C  C     . LYS A 1 228  ? -79.370 -38.573 -61.217 1.00 126.61 ? 228  LYS A C     1 
ATOM   1489  O  O     . LYS A 1 228  ? -78.253 -39.086 -61.323 1.00 129.91 ? 228  LYS A O     1 
ATOM   1490  C  CB    . LYS A 1 228  ? -79.446 -38.332 -63.708 1.00 136.04 ? 228  LYS A CB    1 
ATOM   1491  C  CG    . LYS A 1 228  ? -77.946 -38.158 -63.967 1.00 132.88 ? 228  LYS A CG    1 
ATOM   1492  C  CD    . LYS A 1 228  ? -77.494 -38.710 -65.317 1.00 126.02 ? 228  LYS A CD    1 
ATOM   1493  C  CE    . LYS A 1 228  ? -78.301 -38.113 -66.465 1.00 132.75 ? 228  LYS A CE    1 
ATOM   1494  N  NZ    . LYS A 1 228  ? -77.629 -38.219 -67.790 1.00 134.34 ? 228  LYS A NZ    1 
ATOM   1495  N  N     . GLN A 1 229  ? -80.094 -38.624 -60.104 1.00 127.33 ? 229  GLN A N     1 
ATOM   1496  C  CA    . GLN A 1 229  ? -79.589 -39.224 -58.876 1.00 138.18 ? 229  GLN A CA    1 
ATOM   1497  C  C     . GLN A 1 229  ? -79.435 -40.731 -59.050 1.00 133.56 ? 229  GLN A C     1 
ATOM   1498  O  O     . GLN A 1 229  ? -80.388 -41.481 -58.916 1.00 145.17 ? 229  GLN A O     1 
ATOM   1499  C  CB    . GLN A 1 229  ? -80.501 -38.899 -57.678 1.00 143.12 ? 229  GLN A CB    1 
ATOM   1500  C  CG    . GLN A 1 229  ? -80.399 -37.467 -57.147 1.00 147.19 ? 229  GLN A CG    1 
ATOM   1501  C  CD    . GLN A 1 229  ? -81.264 -36.472 -57.911 1.00 141.74 ? 229  GLN A CD    1 
ATOM   1502  O  OE1   . GLN A 1 229  ? -80.764 -35.718 -58.749 1.00 134.55 ? 229  GLN A OE1   1 
ATOM   1503  N  NE2   . GLN A 1 229  ? -82.569 -36.466 -57.626 1.00 135.13 ? 229  GLN A NE2   1 
ATOM   1504  N  N     . SER A 1 230  ? -78.214 -41.150 -59.377 1.00 124.06 ? 230  SER A N     1 
ATOM   1505  C  CA    . SER A 1 230  ? -77.844 -42.554 -59.381 1.00 115.11 ? 230  SER A CA    1 
ATOM   1506  C  C     . SER A 1 230  ? -77.958 -43.069 -57.940 1.00 117.22 ? 230  SER A C     1 
ATOM   1507  O  O     . SER A 1 230  ? -77.534 -42.394 -56.987 1.00 122.84 ? 230  SER A O     1 
ATOM   1508  C  CB    . SER A 1 230  ? -76.439 -42.685 -59.975 1.00 106.88 ? 230  SER A CB    1 
ATOM   1509  O  OG    . SER A 1 230  ? -76.062 -44.035 -60.099 1.00 109.09 ? 230  SER A OG    1 
ATOM   1510  N  N     . GLN A 1 231  ? -78.586 -44.235 -57.786 1.00 132.37 ? 231  GLN A N     1 
ATOM   1511  C  CA    . GLN A 1 231  ? -78.665 -44.925 -56.501 1.00 144.26 ? 231  GLN A CA    1 
ATOM   1512  C  C     . GLN A 1 231  ? -77.512 -45.927 -56.322 1.00 141.59 ? 231  GLN A C     1 
ATOM   1513  O  O     . GLN A 1 231  ? -77.244 -46.359 -55.204 1.00 150.94 ? 231  GLN A O     1 
ATOM   1514  C  CB    . GLN A 1 231  ? -79.990 -45.722 -56.332 1.00 150.12 ? 231  GLN A CB    1 
ATOM   1515  C  CG    . GLN A 1 231  ? -81.290 -45.044 -56.754 1.00 146.47 ? 231  GLN A CG    1 
ATOM   1516  C  CD    . GLN A 1 231  ? -81.569 -43.752 -56.007 1.00 140.74 ? 231  GLN A CD    1 
ATOM   1517  O  OE1   . GLN A 1 231  ? -82.522 -43.667 -55.227 1.00 141.25 ? 231  GLN A OE1   1 
ATOM   1518  N  NE2   . GLN A 1 231  ? -80.742 -42.733 -56.251 1.00 124.68 ? 231  GLN A NE2   1 
ATOM   1519  N  N     . ARG A 1 232  ? -76.856 -46.280 -57.429 1.00 131.38 ? 232  ARG A N     1 
ATOM   1520  C  CA    . ARG A 1 232  ? -75.754 -47.246 -57.442 1.00 138.00 ? 232  ARG A CA    1 
ATOM   1521  C  C     . ARG A 1 232  ? -74.627 -46.800 -56.546 1.00 125.08 ? 232  ARG A C     1 
ATOM   1522  O  O     . ARG A 1 232  ? -74.102 -45.722 -56.753 1.00 128.26 ? 232  ARG A O     1 
ATOM   1523  C  CB    . ARG A 1 232  ? -75.232 -47.386 -58.885 1.00 144.86 ? 232  ARG A CB    1 
ATOM   1524  C  CG    . ARG A 1 232  ? -73.910 -48.140 -59.049 1.00 152.72 ? 232  ARG A CG    1 
ATOM   1525  C  CD    . ARG A 1 232  ? -73.739 -48.733 -60.446 1.00 146.09 ? 232  ARG A CD    1 
ATOM   1526  N  NE    . ARG A 1 232  ? -74.984 -49.353 -60.898 1.00 162.38 ? 232  ARG A NE    1 
ATOM   1527  C  CZ    . ARG A 1 232  ? -75.496 -50.495 -60.428 1.00 176.37 ? 232  ARG A CZ    1 
ATOM   1528  N  NH1   . ARG A 1 232  ? -74.872 -51.200 -59.483 1.00 183.15 ? 232  ARG A NH1   1 
ATOM   1529  N  NH2   . ARG A 1 232  ? -76.651 -50.944 -60.916 1.00 168.15 ? 232  ARG A NH2   1 
ATOM   1530  N  N     . THR A 1 233  ? -74.266 -47.621 -55.565 1.00 111.04 ? 233  THR A N     1 
ATOM   1531  C  CA    . THR A 1 233  ? -73.209 -47.275 -54.610 1.00 109.38 ? 233  THR A CA    1 
ATOM   1532  C  C     . THR A 1 233  ? -71.874 -47.718 -55.175 1.00 108.16 ? 233  THR A C     1 
ATOM   1533  O  O     . THR A 1 233  ? -71.747 -48.825 -55.695 1.00 126.24 ? 233  THR A O     1 
ATOM   1534  C  CB    . THR A 1 233  ? -73.465 -47.934 -53.257 1.00 116.04 ? 233  THR A CB    1 
ATOM   1535  O  OG1   . THR A 1 233  ? -73.191 -49.336 -53.330 1.00 120.85 ? 233  THR A OG1   1 
ATOM   1536  C  CG2   . THR A 1 233  ? -74.918 -47.708 -52.863 1.00 119.73 ? 233  THR A CG2   1 
ATOM   1537  N  N     . ARG A 1 234  ? -70.884 -46.837 -55.071 1.00 102.12 ? 234  ARG A N     1 
ATOM   1538  C  CA    . ARG A 1 234  ? -69.624 -46.988 -55.769 1.00 93.68  ? 234  ARG A CA    1 
ATOM   1539  C  C     . ARG A 1 234  ? -68.642 -47.751 -54.905 1.00 89.76  ? 234  ARG A C     1 
ATOM   1540  O  O     . ARG A 1 234  ? -68.666 -47.666 -53.677 1.00 93.19  ? 234  ARG A O     1 
ATOM   1541  C  CB    . ARG A 1 234  ? -69.081 -45.635 -56.173 1.00 89.79  ? 234  ARG A CB    1 
ATOM   1542  C  CG    . ARG A 1 234  ? -70.047 -44.842 -57.039 1.00 93.26  ? 234  ARG A CG    1 
ATOM   1543  C  CD    . ARG A 1 234  ? -69.515 -43.439 -57.288 1.00 108.84 ? 234  ARG A CD    1 
ATOM   1544  N  NE    . ARG A 1 234  ? -69.192 -42.743 -56.034 1.00 111.31 ? 234  ARG A NE    1 
ATOM   1545  C  CZ    . ARG A 1 234  ? -69.832 -41.684 -55.541 1.00 99.81  ? 234  ARG A CZ    1 
ATOM   1546  N  NH1   . ARG A 1 234  ? -70.847 -41.119 -56.188 1.00 85.52  ? 234  ARG A NH1   1 
ATOM   1547  N  NH2   . ARG A 1 234  ? -69.429 -41.179 -54.385 1.00 109.19 ? 234  ARG A NH2   1 
ATOM   1548  N  N     . VAL A 1 235  ? -67.792 -48.522 -55.582 1.00 89.75  ? 235  VAL A N     1 
ATOM   1549  C  CA    . VAL A 1 235  ? -66.868 -49.420 -54.925 1.00 91.25  ? 235  VAL A CA    1 
ATOM   1550  C  C     . VAL A 1 235  ? -65.502 -49.230 -55.543 1.00 92.58  ? 235  VAL A C     1 
ATOM   1551  O  O     . VAL A 1 235  ? -65.370 -49.209 -56.763 1.00 85.23  ? 235  VAL A O     1 
ATOM   1552  C  CB    . VAL A 1 235  ? -67.313 -50.880 -55.005 1.00 87.18  ? 235  VAL A CB    1 
ATOM   1553  C  CG1   . VAL A 1 235  ? -66.493 -51.750 -54.043 1.00 85.30  ? 235  VAL A CG1   1 
ATOM   1554  C  CG2   . VAL A 1 235  ? -68.791 -50.961 -54.685 1.00 85.27  ? 235  VAL A CG2   1 
ATOM   1555  N  N     . PHE A 1 236  ? -64.504 -49.065 -54.678 1.00 95.06  ? 236  PHE A N     1 
ATOM   1556  C  CA    . PHE A 1 236  ? -63.114 -48.903 -55.074 1.00 98.39  ? 236  PHE A CA    1 
ATOM   1557  C  C     . PHE A 1 236  ? -62.311 -49.817 -54.171 1.00 95.73  ? 236  PHE A C     1 
ATOM   1558  O  O     . PHE A 1 236  ? -62.521 -49.850 -52.954 1.00 104.15 ? 236  PHE A O     1 
ATOM   1559  C  CB    . PHE A 1 236  ? -62.653 -47.453 -54.876 1.00 97.28  ? 236  PHE A CB    1 
ATOM   1560  C  CG    . PHE A 1 236  ? -63.536 -46.441 -55.559 1.00 98.86  ? 236  PHE A CG    1 
ATOM   1561  C  CD1   . PHE A 1 236  ? -63.426 -46.212 -56.915 1.00 95.57  ? 236  PHE A CD1   1 
ATOM   1562  C  CD2   . PHE A 1 236  ? -64.486 -45.741 -54.849 1.00 102.48 ? 236  PHE A CD2   1 
ATOM   1563  C  CE1   . PHE A 1 236  ? -64.238 -45.296 -57.547 1.00 99.36  ? 236  PHE A CE1   1 
ATOM   1564  C  CE2   . PHE A 1 236  ? -65.303 -44.820 -55.474 1.00 105.55 ? 236  PHE A CE2   1 
ATOM   1565  C  CZ    . PHE A 1 236  ? -65.179 -44.595 -56.827 1.00 102.97 ? 236  PHE A CZ    1 
ATOM   1566  N  N     . GLY A 1 237  ? -61.374 -50.539 -54.768 1.00 96.97  ? 237  GLY A N     1 
ATOM   1567  C  CA    . GLY A 1 237  ? -60.598 -51.542 -54.049 1.00 99.85  ? 237  GLY A CA    1 
ATOM   1568  C  C     . GLY A 1 237  ? -59.116 -51.407 -54.317 1.00 97.07  ? 237  GLY A C     1 
ATOM   1569  O  O     . GLY A 1 237  ? -58.696 -50.761 -55.266 1.00 104.25 ? 237  GLY A O     1 
ATOM   1570  N  N     . SER A 1 238  ? -58.338 -52.000 -53.426 1.00 85.88  ? 238  SER A N     1 
ATOM   1571  C  CA    . SER A 1 238  ? -56.926 -52.266 -53.654 1.00 91.11  ? 238  SER A CA    1 
ATOM   1572  C  C     . SER A 1 238  ? -56.651 -53.572 -52.910 1.00 96.63  ? 238  SER A C     1 
ATOM   1573  O  O     . SER A 1 238  ? -57.573 -54.220 -52.439 1.00 94.91  ? 238  SER A O     1 
ATOM   1574  C  CB    . SER A 1 238  ? -56.060 -51.123 -53.101 1.00 104.52 ? 238  SER A CB    1 
ATOM   1575  O  OG    . SER A 1 238  ? -56.162 -50.962 -51.680 1.00 105.93 ? 238  SER A OG    1 
ATOM   1576  N  N     . GLU A 1 239  ? -55.387 -53.943 -52.789 1.00 112.41 ? 239  GLU A N     1 
ATOM   1577  C  CA    . GLU A 1 239  ? -55.003 -55.119 -52.035 1.00 116.79 ? 239  GLU A CA    1 
ATOM   1578  C  C     . GLU A 1 239  ? -55.181 -54.917 -50.509 1.00 108.65 ? 239  GLU A C     1 
ATOM   1579  O  O     . GLU A 1 239  ? -55.424 -55.880 -49.782 1.00 127.75 ? 239  GLU A O     1 
ATOM   1580  C  CB    . GLU A 1 239  ? -53.526 -55.430 -52.344 1.00 130.62 ? 239  GLU A CB    1 
ATOM   1581  C  CG    . GLU A 1 239  ? -53.079 -56.838 -51.992 1.00 139.68 ? 239  GLU A CG    1 
ATOM   1582  C  CD    . GLU A 1 239  ? -53.733 -57.876 -52.877 1.00 152.62 ? 239  GLU A CD    1 
ATOM   1583  O  OE1   . GLU A 1 239  ? -53.444 -57.878 -54.095 1.00 174.15 ? 239  GLU A OE1   1 
ATOM   1584  O  OE2   . GLU A 1 239  ? -54.537 -58.681 -52.357 1.00 143.43 ? 239  GLU A OE2   1 
ATOM   1585  N  N     . ARG A 1 240  ? -55.072 -53.671 -50.046 1.00 91.85  ? 240  ARG A N     1 
ATOM   1586  C  CA    . ARG A 1 240  ? -55.075 -53.327 -48.640 1.00 100.09 ? 240  ARG A CA    1 
ATOM   1587  C  C     . ARG A 1 240  ? -56.436 -52.852 -48.096 1.00 108.67 ? 240  ARG A C     1 
ATOM   1588  O  O     . ARG A 1 240  ? -56.729 -53.035 -46.903 1.00 96.08  ? 240  ARG A O     1 
ATOM   1589  C  CB    . ARG A 1 240  ? -54.025 -52.234 -48.445 1.00 101.55 ? 240  ARG A CB    1 
ATOM   1590  C  CG    . ARG A 1 240  ? -52.709 -52.476 -49.169 1.00 97.02  ? 240  ARG A CG    1 
ATOM   1591  C  CD    . ARG A 1 240  ? -51.759 -51.292 -49.061 1.00 97.49  ? 240  ARG A CD    1 
ATOM   1592  N  NE    . ARG A 1 240  ? -51.936 -50.478 -47.849 1.00 93.36  ? 240  ARG A NE    1 
ATOM   1593  C  CZ    . ARG A 1 240  ? -51.286 -50.625 -46.691 1.00 85.55  ? 240  ARG A CZ    1 
ATOM   1594  N  NH1   . ARG A 1 240  ? -50.385 -51.581 -46.521 1.00 88.52  ? 240  ARG A NH1   1 
ATOM   1595  N  NH2   . ARG A 1 240  ? -51.551 -49.797 -45.686 1.00 81.66  ? 240  ARG A NH2   1 
ATOM   1596  N  N     . MET A 1 241  ? -57.248 -52.237 -48.963 1.00 113.65 ? 241  MET A N     1 
ATOM   1597  C  CA    . MET A 1 241  ? -58.442 -51.495 -48.544 1.00 116.40 ? 241  MET A CA    1 
ATOM   1598  C  C     . MET A 1 241  ? -59.638 -51.628 -49.498 1.00 115.92 ? 241  MET A C     1 
ATOM   1599  O  O     . MET A 1 241  ? -59.471 -51.669 -50.721 1.00 116.19 ? 241  MET A O     1 
ATOM   1600  C  CB    . MET A 1 241  ? -58.075 -50.011 -48.387 1.00 123.02 ? 241  MET A CB    1 
ATOM   1601  C  CG    . MET A 1 241  ? -59.185 -49.103 -47.863 1.00 124.62 ? 241  MET A CG    1 
ATOM   1602  S  SD    . MET A 1 241  ? -58.690 -47.366 -47.706 1.00 120.00 ? 241  MET A SD    1 
ATOM   1603  C  CE    . MET A 1 241  ? -57.714 -47.414 -46.202 1.00 119.22 ? 241  MET A CE    1 
ATOM   1604  N  N     . MET A 1 242  ? -60.839 -51.702 -48.907 1.00 120.01 ? 242  MET A N     1 
ATOM   1605  C  CA    . MET A 1 242  ? -62.126 -51.611 -49.619 1.00 111.40 ? 242  MET A CA    1 
ATOM   1606  C  C     . MET A 1 242  ? -62.825 -50.296 -49.235 1.00 97.04  ? 242  MET A C     1 
ATOM   1607  O  O     . MET A 1 242  ? -62.904 -49.953 -48.055 1.00 111.14 ? 242  MET A O     1 
ATOM   1608  C  CB    . MET A 1 242  ? -63.045 -52.808 -49.300 1.00 116.60 ? 242  MET A CB    1 
ATOM   1609  C  CG    . MET A 1 242  ? -62.798 -54.077 -50.119 1.00 120.15 ? 242  MET A CG    1 
ATOM   1610  S  SD    . MET A 1 242  ? -63.649 -54.133 -51.723 1.00 136.61 ? 242  MET A SD    1 
ATOM   1611  C  CE    . MET A 1 242  ? -63.941 -55.900 -51.966 1.00 116.90 ? 242  MET A CE    1 
ATOM   1612  N  N     . TRP A 1 243  ? -63.327 -49.579 -50.232 1.00 82.30  ? 243  TRP A N     1 
ATOM   1613  C  CA    . TRP A 1 243  ? -63.948 -48.276 -50.018 1.00 90.05  ? 243  TRP A CA    1 
ATOM   1614  C  C     . TRP A 1 243  ? -65.324 -48.258 -50.675 1.00 93.82  ? 243  TRP A C     1 
ATOM   1615  O  O     . TRP A 1 243  ? -65.430 -48.390 -51.894 1.00 83.96  ? 243  TRP A O     1 
ATOM   1616  C  CB    . TRP A 1 243  ? -63.062 -47.165 -50.556 1.00 93.84  ? 243  TRP A CB    1 
ATOM   1617  C  CG    . TRP A 1 243  ? -63.654 -45.778 -50.573 1.00 91.20  ? 243  TRP A CG    1 
ATOM   1618  C  CD1   . TRP A 1 243  ? -64.718 -45.343 -51.312 1.00 90.20  ? 243  TRP A CD1   1 
ATOM   1619  C  CD2   . TRP A 1 243  ? -63.151 -44.630 -49.881 1.00 97.14  ? 243  TRP A CD2   1 
ATOM   1620  N  NE1   . TRP A 1 243  ? -64.928 -44.010 -51.101 1.00 95.59  ? 243  TRP A NE1   1 
ATOM   1621  C  CE2   . TRP A 1 243  ? -63.982 -43.540 -50.227 1.00 98.65  ? 243  TRP A CE2   1 
ATOM   1622  C  CE3   . TRP A 1 243  ? -62.081 -44.416 -48.992 1.00 97.97  ? 243  TRP A CE3   1 
ATOM   1623  C  CZ2   . TRP A 1 243  ? -63.779 -42.243 -49.717 1.00 94.91  ? 243  TRP A CZ2   1 
ATOM   1624  C  CZ3   . TRP A 1 243  ? -61.887 -43.132 -48.478 1.00 92.18  ? 243  TRP A CZ3   1 
ATOM   1625  C  CH2   . TRP A 1 243  ? -62.736 -42.063 -48.845 1.00 92.29  ? 243  TRP A CH2   1 
ATOM   1626  N  N     . PHE A 1 244  ? -66.366 -48.101 -49.866 1.00 90.84  ? 244  PHE A N     1 
ATOM   1627  C  CA    . PHE A 1 244  ? -67.760 -48.068 -50.337 1.00 79.75  ? 244  PHE A CA    1 
ATOM   1628  C  C     . PHE A 1 244  ? -68.308 -46.661 -50.181 1.00 72.04  ? 244  PHE A C     1 
ATOM   1629  O  O     . PHE A 1 244  ? -68.284 -46.137 -49.081 1.00 76.67  ? 244  PHE A O     1 
ATOM   1630  C  CB    . PHE A 1 244  ? -68.565 -49.012 -49.453 1.00 80.82  ? 244  PHE A CB    1 
ATOM   1631  C  CG    . PHE A 1 244  ? -68.075 -50.424 -49.483 1.00 85.44  ? 244  PHE A CG    1 
ATOM   1632  C  CD1   . PHE A 1 244  ? -68.271 -51.208 -50.608 1.00 89.36  ? 244  PHE A CD1   1 
ATOM   1633  C  CD2   . PHE A 1 244  ? -67.402 -50.971 -48.397 1.00 93.57  ? 244  PHE A CD2   1 
ATOM   1634  C  CE1   . PHE A 1 244  ? -67.801 -52.518 -50.652 1.00 98.72  ? 244  PHE A CE1   1 
ATOM   1635  C  CE2   . PHE A 1 244  ? -66.929 -52.280 -48.439 1.00 96.29  ? 244  PHE A CE2   1 
ATOM   1636  C  CZ    . PHE A 1 244  ? -67.131 -53.055 -49.563 1.00 92.26  ? 244  PHE A CZ    1 
ATOM   1637  N  N     . SER A 1 245  ? -68.798 -46.067 -51.269 1.00 71.30  ? 245  SER A N     1 
ATOM   1638  C  CA    . SER A 1 245  ? -69.497 -44.806 -51.184 1.00 81.50  ? 245  SER A CA    1 
ATOM   1639  C  C     . SER A 1 245  ? -70.978 -45.027 -51.432 1.00 91.86  ? 245  SER A C     1 
ATOM   1640  O  O     . SER A 1 245  ? -71.409 -45.028 -52.592 1.00 106.47 ? 245  SER A O     1 
ATOM   1641  C  CB    . SER A 1 245  ? -68.965 -43.787 -52.188 1.00 91.25  ? 245  SER A CB    1 
ATOM   1642  O  OG    . SER A 1 245  ? -67.706 -43.287 -51.784 1.00 103.52 ? 245  SER A OG    1 
ATOM   1643  N  N     . PRO A 1 246  ? -71.767 -45.246 -50.358 1.00 96.05  ? 246  PRO A N     1 
ATOM   1644  C  CA    . PRO A 1 246  ? -73.201 -45.335 -50.571 1.00 90.65  ? 246  PRO A CA    1 
ATOM   1645  C  C     . PRO A 1 246  ? -73.785 -43.967 -50.878 1.00 93.17  ? 246  PRO A C     1 
ATOM   1646  O  O     . PRO A 1 246  ? -73.362 -42.969 -50.314 1.00 91.16  ? 246  PRO A O     1 
ATOM   1647  C  CB    . PRO A 1 246  ? -73.752 -45.893 -49.258 1.00 89.14  ? 246  PRO A CB    1 
ATOM   1648  C  CG    . PRO A 1 246  ? -72.662 -45.768 -48.266 1.00 98.66  ? 246  PRO A CG    1 
ATOM   1649  C  CD    . PRO A 1 246  ? -71.387 -45.801 -49.050 1.00 104.80 ? 246  PRO A CD    1 
ATOM   1650  N  N     . VAL A 1 247  ? -74.733 -43.944 -51.806 1.00 103.72 ? 247  VAL A N     1 
ATOM   1651  C  CA    . VAL A 1 247  ? -75.346 -42.718 -52.292 1.00 111.28 ? 247  VAL A CA    1 
ATOM   1652  C  C     . VAL A 1 247  ? -76.845 -42.622 -51.929 1.00 110.57 ? 247  VAL A C     1 
ATOM   1653  O  O     . VAL A 1 247  ? -77.519 -41.655 -52.290 1.00 93.78  ? 247  VAL A O     1 
ATOM   1654  C  CB    . VAL A 1 247  ? -75.172 -42.674 -53.823 1.00 110.42 ? 247  VAL A CB    1 
ATOM   1655  C  CG1   . VAL A 1 247  ? -76.176 -43.611 -54.486 1.00 112.87 ? 247  VAL A CG1   1 
ATOM   1656  C  CG2   . VAL A 1 247  ? -75.265 -41.249 -54.376 1.00 110.59 ? 247  VAL A CG2   1 
ATOM   1657  N  N     . THR A 1 248  ? -77.378 -43.644 -51.246 1.00 112.11 ? 248  THR A N     1 
ATOM   1658  C  CA    . THR A 1 248  ? -78.707 -43.612 -50.624 1.00 108.53 ? 248  THR A CA    1 
ATOM   1659  C  C     . THR A 1 248  ? -78.558 -43.911 -49.119 1.00 105.00 ? 248  THR A C     1 
ATOM   1660  O  O     . THR A 1 248  ? -77.544 -44.489 -48.677 1.00 93.61  ? 248  THR A O     1 
ATOM   1661  C  CB    . THR A 1 248  ? -79.677 -44.640 -51.290 1.00 106.30 ? 248  THR A CB    1 
ATOM   1662  O  OG1   . THR A 1 248  ? -79.150 -45.973 -51.211 1.00 107.69 ? 248  THR A OG1   1 
ATOM   1663  C  CG2   . THR A 1 248  ? -79.885 -44.320 -52.745 1.00 102.30 ? 248  THR A CG2   1 
ATOM   1664  N  N     . LEU A 1 249  ? -79.565 -43.506 -48.349 1.00 108.18 ? 249  LEU A N     1 
ATOM   1665  C  CA    . LEU A 1 249  ? -79.607 -43.807 -46.927 1.00 107.31 ? 249  LEU A CA    1 
ATOM   1666  C  C     . LEU A 1 249  ? -79.778 -45.303 -46.681 1.00 109.06 ? 249  LEU A C     1 
ATOM   1667  O  O     . LEU A 1 249  ? -79.118 -45.860 -45.805 1.00 96.66  ? 249  LEU A O     1 
ATOM   1668  C  CB    . LEU A 1 249  ? -80.690 -42.991 -46.231 1.00 99.23  ? 249  LEU A CB    1 
ATOM   1669  C  CG    . LEU A 1 249  ? -80.782 -43.241 -44.730 1.00 91.40  ? 249  LEU A CG    1 
ATOM   1670  C  CD1   . LEU A 1 249  ? -79.412 -43.339 -44.088 1.00 90.17  ? 249  LEU A CD1   1 
ATOM   1671  C  CD2   . LEU A 1 249  ? -81.605 -42.141 -44.084 1.00 92.78  ? 249  LEU A CD2   1 
ATOM   1672  N  N     . LYS A 1 250  ? -80.657 -45.945 -47.459 1.00 118.90 ? 250  LYS A N     1 
ATOM   1673  C  CA    . LYS A 1 250  ? -80.845 -47.412 -47.384 1.00 118.12 ? 250  LYS A CA    1 
ATOM   1674  C  C     . LYS A 1 250  ? -79.510 -48.120 -47.433 1.00 113.70 ? 250  LYS A C     1 
ATOM   1675  O  O     . LYS A 1 250  ? -79.209 -48.941 -46.584 1.00 115.07 ? 250  LYS A O     1 
ATOM   1676  C  CB    . LYS A 1 250  ? -81.670 -47.958 -48.552 1.00 128.50 ? 250  LYS A CB    1 
ATOM   1677  C  CG    . LYS A 1 250  ? -83.166 -47.917 -48.349 1.00 139.66 ? 250  LYS A CG    1 
ATOM   1678  C  CD    . LYS A 1 250  ? -83.886 -47.482 -49.619 1.00 151.71 ? 250  LYS A CD    1 
ATOM   1679  C  CE    . LYS A 1 250  ? -83.799 -45.971 -49.822 1.00 145.39 ? 250  LYS A CE    1 
ATOM   1680  N  NZ    . LYS A 1 250  ? -84.470 -45.549 -51.082 1.00 137.19 ? 250  LYS A NZ    1 
ATOM   1681  N  N     . GLU A 1 251  ? -78.705 -47.769 -48.430 1.00 108.98 ? 251  GLU A N     1 
ATOM   1682  C  CA    . GLU A 1 251  ? -77.411 -48.399 -48.665 1.00 105.32 ? 251  GLU A CA    1 
ATOM   1683  C  C     . GLU A 1 251  ? -76.410 -48.148 -47.539 1.00 96.27  ? 251  GLU A C     1 
ATOM   1684  O  O     . GLU A 1 251  ? -75.725 -49.070 -47.107 1.00 84.37  ? 251  GLU A O     1 
ATOM   1685  C  CB    . GLU A 1 251  ? -76.847 -47.893 -49.988 1.00 117.51 ? 251  GLU A CB    1 
ATOM   1686  C  CG    . GLU A 1 251  ? -77.559 -48.475 -51.190 1.00 125.82 ? 251  GLU A CG    1 
ATOM   1687  C  CD    . GLU A 1 251  ? -77.176 -49.923 -51.400 1.00 139.90 ? 251  GLU A CD    1 
ATOM   1688  O  OE1   . GLU A 1 251  ? -75.997 -50.208 -51.706 1.00 136.92 ? 251  GLU A OE1   1 
ATOM   1689  O  OE2   . GLU A 1 251  ? -78.059 -50.783 -51.229 1.00 156.27 ? 251  GLU A OE2   1 
ATOM   1690  N  N     . LEU A 1 252  ? -76.337 -46.905 -47.066 1.00 87.96  ? 252  LEU A N     1 
ATOM   1691  C  CA    . LEU A 1 252  ? -75.454 -46.542 -45.957 1.00 89.99  ? 252  LEU A CA    1 
ATOM   1692  C  C     . LEU A 1 252  ? -75.646 -47.453 -44.728 1.00 100.01 ? 252  LEU A C     1 
ATOM   1693  O  O     . LEU A 1 252  ? -74.664 -47.933 -44.146 1.00 116.62 ? 252  LEU A O     1 
ATOM   1694  C  CB    . LEU A 1 252  ? -75.670 -45.068 -45.599 1.00 89.12  ? 252  LEU A CB    1 
ATOM   1695  C  CG    . LEU A 1 252  ? -75.121 -44.516 -44.272 1.00 97.27  ? 252  LEU A CG    1 
ATOM   1696  C  CD1   . LEU A 1 252  ? -73.671 -44.881 -43.997 1.00 99.36  ? 252  LEU A CD1   1 
ATOM   1697  C  CD2   . LEU A 1 252  ? -75.265 -43.002 -44.285 1.00 108.43 ? 252  LEU A CD2   1 
ATOM   1698  N  N     . LEU A 1 253  ? -76.906 -47.692 -44.360 1.00 96.79  ? 253  LEU A N     1 
ATOM   1699  C  CA    . LEU A 1 253  ? -77.260 -48.572 -43.235 1.00 88.10  ? 253  LEU A CA    1 
ATOM   1700  C  C     . LEU A 1 253  ? -76.965 -50.029 -43.543 1.00 89.36  ? 253  LEU A C     1 
ATOM   1701  O  O     . LEU A 1 253  ? -76.623 -50.802 -42.649 1.00 100.24 ? 253  LEU A O     1 
ATOM   1702  C  CB    . LEU A 1 253  ? -78.720 -48.387 -42.900 1.00 95.78  ? 253  LEU A CB    1 
ATOM   1703  C  CG    . LEU A 1 253  ? -79.014 -46.938 -42.505 1.00 106.19 ? 253  LEU A CG    1 
ATOM   1704  C  CD1   . LEU A 1 253  ? -80.351 -46.479 -43.060 1.00 112.90 ? 253  LEU A CD1   1 
ATOM   1705  C  CD2   . LEU A 1 253  ? -78.956 -46.785 -40.988 1.00 113.59 ? 253  LEU A CD2   1 
ATOM   1706  N  N     . GLU A 1 254  ? -77.122 -50.401 -44.809 1.00 100.32 ? 254  GLU A N     1 
ATOM   1707  C  CA    . GLU A 1 254  ? -76.737 -51.727 -45.283 1.00 122.60 ? 254  GLU A CA    1 
ATOM   1708  C  C     . GLU A 1 254  ? -75.241 -51.956 -45.105 1.00 130.15 ? 254  GLU A C     1 
ATOM   1709  O  O     . GLU A 1 254  ? -74.842 -53.008 -44.629 1.00 130.00 ? 254  GLU A O     1 
ATOM   1710  C  CB    . GLU A 1 254  ? -77.176 -51.950 -46.750 1.00 131.80 ? 254  GLU A CB    1 
ATOM   1711  C  CG    . GLU A 1 254  ? -77.066 -53.395 -47.232 1.00 133.99 ? 254  GLU A CG    1 
ATOM   1712  C  CD    . GLU A 1 254  ? -77.704 -54.391 -46.270 1.00 143.71 ? 254  GLU A CD    1 
ATOM   1713  O  OE1   . GLU A 1 254  ? -78.834 -54.133 -45.809 1.00 150.70 ? 254  GLU A OE1   1 
ATOM   1714  O  OE2   . GLU A 1 254  ? -77.083 -55.434 -45.965 1.00 152.62 ? 254  GLU A OE2   1 
ATOM   1715  N  N     . PHE A 1 255  ? -74.421 -50.971 -45.473 1.00 127.84 ? 255  PHE A N     1 
ATOM   1716  C  CA    . PHE A 1 255  ? -72.963 -51.077 -45.302 1.00 117.09 ? 255  PHE A CA    1 
ATOM   1717  C  C     . PHE A 1 255  ? -72.532 -50.982 -43.843 1.00 111.75 ? 255  PHE A C     1 
ATOM   1718  O  O     . PHE A 1 255  ? -71.632 -51.709 -43.420 1.00 112.18 ? 255  PHE A O     1 
ATOM   1719  C  CB    . PHE A 1 255  ? -72.209 -50.065 -46.163 1.00 111.21 ? 255  PHE A CB    1 
ATOM   1720  C  CG    . PHE A 1 255  ? -72.219 -50.427 -47.607 1.00 102.65 ? 255  PHE A CG    1 
ATOM   1721  C  CD1   . PHE A 1 255  ? -71.707 -51.651 -48.013 1.00 91.20  ? 255  PHE A CD1   1 
ATOM   1722  C  CD2   . PHE A 1 255  ? -72.784 -49.583 -48.550 1.00 104.48 ? 255  PHE A CD2   1 
ATOM   1723  C  CE1   . PHE A 1 255  ? -71.739 -52.021 -49.330 1.00 92.66  ? 255  PHE A CE1   1 
ATOM   1724  C  CE2   . PHE A 1 255  ? -72.820 -49.949 -49.883 1.00 107.97 ? 255  PHE A CE2   1 
ATOM   1725  C  CZ    . PHE A 1 255  ? -72.292 -51.171 -50.272 1.00 103.53 ? 255  PHE A CZ    1 
ATOM   1726  N  N     . LYS A 1 256  ? -73.189 -50.127 -43.063 1.00 99.44  ? 256  LYS A N     1 
ATOM   1727  C  CA    . LYS A 1 256  ? -72.906 -50.048 -41.633 1.00 106.66 ? 256  LYS A CA    1 
ATOM   1728  C  C     . LYS A 1 256  ? -73.228 -51.360 -40.886 1.00 106.35 ? 256  LYS A C     1 
ATOM   1729  O  O     . LYS A 1 256  ? -72.588 -51.664 -39.883 1.00 109.17 ? 256  LYS A O     1 
ATOM   1730  C  CB    . LYS A 1 256  ? -73.636 -48.861 -41.002 1.00 111.08 ? 256  LYS A CB    1 
ATOM   1731  C  CG    . LYS A 1 256  ? -73.142 -48.496 -39.603 1.00 115.48 ? 256  LYS A CG    1 
ATOM   1732  C  CD    . LYS A 1 256  ? -71.668 -48.095 -39.593 1.00 110.63 ? 256  LYS A CD    1 
ATOM   1733  C  CE    . LYS A 1 256  ? -71.252 -47.577 -38.234 1.00 100.84 ? 256  LYS A CE    1 
ATOM   1734  N  NZ    . LYS A 1 256  ? -69.915 -48.101 -37.900 1.00 98.95  ? 256  LYS A NZ    1 
ATOM   1735  N  N     . PHE A 1 257  ? -74.190 -52.139 -41.377 1.00 103.74 ? 257  PHE A N     1 
ATOM   1736  C  CA    . PHE A 1 257  ? -74.444 -53.466 -40.811 1.00 117.73 ? 257  PHE A CA    1 
ATOM   1737  C  C     . PHE A 1 257  ? -73.356 -54.498 -41.157 1.00 119.65 ? 257  PHE A C     1 
ATOM   1738  O  O     . PHE A 1 257  ? -72.880 -55.205 -40.282 1.00 134.23 ? 257  PHE A O     1 
ATOM   1739  C  CB    . PHE A 1 257  ? -75.830 -54.029 -41.180 1.00 136.00 ? 257  PHE A CB    1 
ATOM   1740  C  CG    . PHE A 1 257  ? -76.301 -55.129 -40.236 1.00 156.50 ? 257  PHE A CG    1 
ATOM   1741  C  CD1   . PHE A 1 257  ? -75.767 -56.426 -40.313 1.00 159.90 ? 257  PHE A CD1   1 
ATOM   1742  C  CD2   . PHE A 1 257  ? -77.250 -54.863 -39.247 1.00 159.61 ? 257  PHE A CD2   1 
ATOM   1743  C  CE1   . PHE A 1 257  ? -76.175 -57.426 -39.438 1.00 153.82 ? 257  PHE A CE1   1 
ATOM   1744  C  CE2   . PHE A 1 257  ? -77.663 -55.863 -38.374 1.00 160.47 ? 257  PHE A CE2   1 
ATOM   1745  C  CZ    . PHE A 1 257  ? -77.125 -57.143 -38.470 1.00 160.95 ? 257  PHE A CZ    1 
ATOM   1746  N  N     . LYS A 1 258  ? -72.995 -54.599 -42.434 1.00 111.75 ? 258  LYS A N     1 
ATOM   1747  C  CA    . LYS A 1 258  ? -72.020 -55.591 -42.912 1.00 119.69 ? 258  LYS A CA    1 
ATOM   1748  C  C     . LYS A 1 258  ? -70.640 -55.394 -42.309 1.00 121.02 ? 258  LYS A C     1 
ATOM   1749  O  O     . LYS A 1 258  ? -69.954 -56.356 -41.946 1.00 130.96 ? 258  LYS A O     1 
ATOM   1750  C  CB    . LYS A 1 258  ? -71.873 -55.492 -44.436 1.00 122.00 ? 258  LYS A CB    1 
ATOM   1751  C  CG    . LYS A 1 258  ? -73.043 -56.039 -45.225 1.00 127.40 ? 258  LYS A CG    1 
ATOM   1752  C  CD    . LYS A 1 258  ? -72.738 -56.131 -46.709 1.00 127.94 ? 258  LYS A CD    1 
ATOM   1753  C  CE    . LYS A 1 258  ? -73.946 -56.672 -47.459 1.00 135.06 ? 258  LYS A CE    1 
ATOM   1754  N  NZ    . LYS A 1 258  ? -74.215 -55.910 -48.710 1.00 138.88 ? 258  LYS A NZ    1 
ATOM   1755  N  N     . TYR A 1 259  ? -70.234 -54.131 -42.233 1.00 115.12 ? 259  TYR A N     1 
ATOM   1756  C  CA    . TYR A 1 259  ? -68.907 -53.777 -41.789 1.00 116.44 ? 259  TYR A CA    1 
ATOM   1757  C  C     . TYR A 1 259  ? -69.054 -52.853 -40.585 1.00 119.98 ? 259  TYR A C     1 
ATOM   1758  O  O     . TYR A 1 259  ? -68.723 -51.671 -40.658 1.00 115.65 ? 259  TYR A O     1 
ATOM   1759  C  CB    . TYR A 1 259  ? -68.103 -53.106 -42.908 1.00 114.28 ? 259  TYR A CB    1 
ATOM   1760  C  CG    . TYR A 1 259  ? -68.185 -53.858 -44.212 1.00 102.87 ? 259  TYR A CG    1 
ATOM   1761  C  CD1   . TYR A 1 259  ? -67.399 -54.991 -44.455 1.00 89.36  ? 259  TYR A CD1   1 
ATOM   1762  C  CD2   . TYR A 1 259  ? -69.075 -53.448 -45.194 1.00 106.60 ? 259  TYR A CD2   1 
ATOM   1763  C  CE1   . TYR A 1 259  ? -67.503 -55.685 -45.648 1.00 85.85  ? 259  TYR A CE1   1 
ATOM   1764  C  CE2   . TYR A 1 259  ? -69.186 -54.131 -46.387 1.00 102.45 ? 259  TYR A CE2   1 
ATOM   1765  C  CZ    . TYR A 1 259  ? -68.409 -55.239 -46.609 1.00 96.28  ? 259  TYR A CZ    1 
ATOM   1766  O  OH    . TYR A 1 259  ? -68.582 -55.863 -47.816 1.00 106.72 ? 259  TYR A OH    1 
ATOM   1767  N  N     . PRO A 1 260  ? -69.546 -53.391 -39.460 1.00 122.31 ? 260  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1 260  ? -69.879 -52.557 -38.305 1.00 119.15 ? 260  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1 260  ? -68.694 -51.746 -37.780 1.00 115.92 ? 260  PRO A C     1 
ATOM   1770  O  O     . PRO A 1 260  ? -68.896 -50.630 -37.317 1.00 118.08 ? 260  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1 260  ? -70.329 -53.577 -37.261 1.00 129.49 ? 260  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1 260  ? -69.611 -54.833 -37.632 1.00 132.65 ? 260  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1 260  ? -69.596 -54.827 -39.131 1.00 129.87 ? 260  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1 261  ? -67.477 -52.297 -37.887 1.00 105.96 ? 261  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1 261  ? -66.271 -51.658 -37.377 1.00 103.67 ? 261  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1 261  ? -65.604 -50.706 -38.372 1.00 97.44  ? 261  GLN A C     1 
ATOM   1777  O  O     . GLN A 1 261  ? -64.588 -50.100 -38.044 1.00 105.27 ? 261  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1 261  ? -65.221 -52.715 -36.973 1.00 117.89 ? 261  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1 261  ? -65.726 -53.897 -36.151 1.00 133.27 ? 261  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1 261  ? -66.614 -53.487 -34.981 1.00 148.11 ? 261  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1 261  ? -66.549 -52.355 -34.499 1.00 156.20 ? 261  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1 261  ? -67.457 -54.412 -34.523 1.00 152.51 ? 261  GLN A NE2   1 
ATOM   1783  N  N     . ALA A 1 262  ? -66.151 -50.573 -39.578 1.00 96.07  ? 262  ALA A N     1 
ATOM   1784  C  CA    . ALA A 1 262  ? -65.622 -49.617 -40.566 1.00 101.12 ? 262  ALA A CA    1 
ATOM   1785  C  C     . ALA A 1 262  ? -66.000 -48.186 -40.175 1.00 96.80  ? 262  ALA A C     1 
ATOM   1786  O  O     . ALA A 1 262  ? -67.144 -47.944 -39.781 1.00 95.91  ? 262  ALA A O     1 
ATOM   1787  C  CB    . ALA A 1 262  ? -66.165 -49.939 -41.952 1.00 101.03 ? 262  ALA A CB    1 
ATOM   1788  N  N     . PRO A 1 263  ? -65.049 -47.240 -40.274 1.00 98.11  ? 263  PRO A N     1 
ATOM   1789  C  CA    . PRO A 1 263  ? -65.388 -45.847 -39.998 1.00 97.75  ? 263  PRO A CA    1 
ATOM   1790  C  C     . PRO A 1 263  ? -66.230 -45.278 -41.127 1.00 86.26  ? 263  PRO A C     1 
ATOM   1791  O  O     . PRO A 1 263  ? -66.118 -45.720 -42.284 1.00 82.77  ? 263  PRO A O     1 
ATOM   1792  C  CB    . PRO A 1 263  ? -64.028 -45.157 -39.890 1.00 103.61 ? 263  PRO A CB    1 
ATOM   1793  C  CG    . PRO A 1 263  ? -63.123 -45.992 -40.722 1.00 105.15 ? 263  PRO A CG    1 
ATOM   1794  C  CD    . PRO A 1 263  ? -63.634 -47.402 -40.647 1.00 102.70 ? 263  PRO A CD    1 
ATOM   1795  N  N     . VAL A 1 264  ? -67.091 -44.331 -40.767 1.00 87.05  ? 264  VAL A N     1 
ATOM   1796  C  CA    . VAL A 1 264  ? -67.895 -43.611 -41.727 1.00 88.96  ? 264  VAL A CA    1 
ATOM   1797  C  C     . VAL A 1 264  ? -67.185 -42.275 -41.926 1.00 88.70  ? 264  VAL A C     1 
ATOM   1798  O  O     . VAL A 1 264  ? -67.267 -41.398 -41.064 1.00 93.94  ? 264  VAL A O     1 
ATOM   1799  C  CB    . VAL A 1 264  ? -69.342 -43.355 -41.241 1.00 87.70  ? 264  VAL A CB    1 
ATOM   1800  C  CG1   . VAL A 1 264  ? -70.136 -42.622 -42.320 1.00 88.03  ? 264  VAL A CG1   1 
ATOM   1801  C  CG2   . VAL A 1 264  ? -70.035 -44.667 -40.865 1.00 86.97  ? 264  VAL A CG2   1 
ATOM   1802  N  N     . ILE A 1 265  ? -66.477 -42.129 -43.040 1.00 84.70  ? 265  ILE A N     1 
ATOM   1803  C  CA    . ILE A 1 265  ? -65.682 -40.926 -43.295 1.00 82.93  ? 265  ILE A CA    1 
ATOM   1804  C  C     . ILE A 1 265  ? -66.564 -39.831 -43.874 1.00 84.27  ? 265  ILE A C     1 
ATOM   1805  O  O     . ILE A 1 265  ? -67.272 -40.052 -44.872 1.00 82.26  ? 265  ILE A O     1 
ATOM   1806  C  CB    . ILE A 1 265  ? -64.585 -41.247 -44.311 1.00 83.92  ? 265  ILE A CB    1 
ATOM   1807  C  CG1   . ILE A 1 265  ? -63.742 -42.410 -43.788 1.00 82.31  ? 265  ILE A CG1   1 
ATOM   1808  C  CG2   . ILE A 1 265  ? -63.737 -40.023 -44.606 1.00 86.01  ? 265  ILE A CG2   1 
ATOM   1809  C  CD1   . ILE A 1 265  ? -63.358 -42.299 -42.329 1.00 82.33  ? 265  ILE A CD1   1 
ATOM   1810  N  N     . MET A 1 266  ? -66.522 -38.657 -43.234 1.00 85.60  ? 266  MET A N     1 
ATOM   1811  C  CA    . MET A 1 266  ? -67.162 -37.457 -43.764 1.00 95.99  ? 266  MET A CA    1 
ATOM   1812  C  C     . MET A 1 266  ? -66.082 -36.484 -44.217 1.00 99.05  ? 266  MET A C     1 
ATOM   1813  O  O     . MET A 1 266  ? -65.885 -36.331 -45.408 1.00 104.06 ? 266  MET A O     1 
ATOM   1814  C  CB    . MET A 1 266  ? -68.116 -36.829 -42.744 1.00 95.25  ? 266  MET A CB    1 
ATOM   1815  C  CG    . MET A 1 266  ? -69.352 -37.671 -42.408 1.00 105.11 ? 266  MET A CG    1 
ATOM   1816  S  SD    . MET A 1 266  ? -70.377 -38.252 -43.784 1.00 114.30 ? 266  MET A SD    1 
ATOM   1817  C  CE    . MET A 1 266  ? -70.917 -36.731 -44.591 1.00 108.07 ? 266  MET A CE    1 
ATOM   1818  N  N     . GLY A 1 267  ? -65.371 -35.859 -43.282 1.00 99.41  ? 267  GLY A N     1 
ATOM   1819  C  CA    . GLY A 1 267  ? -64.348 -34.868 -43.623 1.00 96.29  ? 267  GLY A CA    1 
ATOM   1820  C  C     . GLY A 1 267  ? -62.940 -35.431 -43.647 1.00 94.04  ? 267  GLY A C     1 
ATOM   1821  O  O     . GLY A 1 267  ? -62.013 -34.802 -44.149 1.00 83.18  ? 267  GLY A O     1 
ATOM   1822  N  N     . ASN A 1 268  ? -62.771 -36.594 -43.017 1.00 95.76  ? 268  ASN A N     1 
ATOM   1823  C  CA    . ASN A 1 268  ? -61.464 -37.223 -42.794 1.00 88.18  ? 268  ASN A CA    1 
ATOM   1824  C  C     . ASN A 1 268  ? -60.474 -36.381 -41.974 1.00 89.74  ? 268  ASN A C     1 
ATOM   1825  O  O     . ASN A 1 268  ? -59.271 -36.644 -42.023 1.00 95.42  ? 268  ASN A O     1 
ATOM   1826  C  CB    . ASN A 1 268  ? -60.825 -37.606 -44.141 1.00 82.25  ? 268  ASN A CB    1 
ATOM   1827  C  CG    . ASN A 1 268  ? -59.727 -38.654 -44.008 1.00 81.26  ? 268  ASN A CG    1 
ATOM   1828  O  OD1   . ASN A 1 268  ? -59.797 -39.561 -43.193 1.00 86.30  ? 268  ASN A OD1   1 
ATOM   1829  N  ND2   . ASN A 1 268  ? -58.711 -38.533 -44.830 1.00 90.96  ? 268  ASN A ND2   1 
ATOM   1830  N  N     . THR A 1 269  ? -60.967 -35.413 -41.200 1.00 85.59  ? 269  THR A N     1 
ATOM   1831  C  CA    . THR A 1 269  ? -60.115 -34.560 -40.368 1.00 80.03  ? 269  THR A CA    1 
ATOM   1832  C  C     . THR A 1 269  ? -59.918 -35.136 -38.958 1.00 80.31  ? 269  THR A C     1 
ATOM   1833  O  O     . THR A 1 269  ? -59.234 -34.533 -38.139 1.00 88.18  ? 269  THR A O     1 
ATOM   1834  C  CB    . THR A 1 269  ? -60.671 -33.120 -40.243 1.00 79.64  ? 269  THR A CB    1 
ATOM   1835  O  OG1   . THR A 1 269  ? -61.753 -33.067 -39.296 1.00 74.08  ? 269  THR A OG1   1 
ATOM   1836  C  CG2   . THR A 1 269  ? -61.127 -32.594 -41.606 1.00 79.36  ? 269  THR A CG2   1 
ATOM   1837  N  N     . SER A 1 270  ? -60.556 -36.263 -38.655 1.00 79.30  ? 270  SER A N     1 
ATOM   1838  C  CA    . SER A 1 270  ? -60.237 -37.019 -37.440 1.00 82.10  ? 270  SER A CA    1 
ATOM   1839  C  C     . SER A 1 270  ? -59.524 -38.309 -37.772 1.00 87.58  ? 270  SER A C     1 
ATOM   1840  O  O     . SER A 1 270  ? -58.501 -38.608 -37.192 1.00 85.28  ? 270  SER A O     1 
ATOM   1841  C  CB    . SER A 1 270  ? -61.469 -37.363 -36.637 1.00 84.44  ? 270  SER A CB    1 
ATOM   1842  O  OG    . SER A 1 270  ? -61.284 -38.645 -36.054 1.00 86.07  ? 270  SER A OG    1 
ATOM   1843  N  N     . VAL A 1 271  ? -60.099 -39.091 -38.682 1.00 90.38  ? 271  VAL A N     1 
ATOM   1844  C  CA    . VAL A 1 271  ? -59.517 -40.376 -39.100 1.00 86.48  ? 271  VAL A CA    1 
ATOM   1845  C  C     . VAL A 1 271  ? -58.208 -40.178 -39.851 1.00 97.30  ? 271  VAL A C     1 
ATOM   1846  O  O     . VAL A 1 271  ? -57.243 -40.893 -39.604 1.00 99.09  ? 271  VAL A O     1 
ATOM   1847  C  CB    . VAL A 1 271  ? -60.485 -41.140 -39.973 1.00 85.50  ? 271  VAL A CB    1 
ATOM   1848  C  CG1   . VAL A 1 271  ? -59.907 -42.503 -40.329 1.00 90.13  ? 271  VAL A CG1   1 
ATOM   1849  C  CG2   . VAL A 1 271  ? -61.812 -41.249 -39.253 1.00 86.04  ? 271  VAL A CG2   1 
ATOM   1850  N  N     . GLY A 1 272  ? -58.178 -39.212 -40.764 1.00 103.14 ? 272  GLY A N     1 
ATOM   1851  C  CA    . GLY A 1 272  ? -56.988 -38.919 -41.578 1.00 101.10 ? 272  GLY A CA    1 
ATOM   1852  C  C     . GLY A 1 272  ? -55.732 -38.675 -40.769 1.00 96.03  ? 272  GLY A C     1 
ATOM   1853  O  O     . GLY A 1 272  ? -54.770 -39.416 -40.908 1.00 91.29  ? 272  GLY A O     1 
ATOM   1854  N  N     . PRO A 1 273  ? -55.731 -37.643 -39.904 1.00 94.40  ? 273  PRO A N     1 
ATOM   1855  C  CA    . PRO A 1 273  ? -54.542 -37.335 -39.110 1.00 97.27  ? 273  PRO A CA    1 
ATOM   1856  C  C     . PRO A 1 273  ? -54.023 -38.451 -38.205 1.00 100.65 ? 273  PRO A C     1 
ATOM   1857  O  O     . PRO A 1 273  ? -52.830 -38.473 -37.909 1.00 115.26 ? 273  PRO A O     1 
ATOM   1858  C  CB    . PRO A 1 273  ? -54.976 -36.141 -38.246 1.00 92.54  ? 273  PRO A CB    1 
ATOM   1859  C  CG    . PRO A 1 273  ? -56.114 -35.557 -38.955 1.00 96.93  ? 273  PRO A CG    1 
ATOM   1860  C  CD    . PRO A 1 273  ? -56.829 -36.723 -39.581 1.00 99.02  ? 273  PRO A CD    1 
ATOM   1861  N  N     . GLU A 1 274  ? -54.881 -39.358 -37.764 1.00 94.92  ? 274  GLU A N     1 
ATOM   1862  C  CA    . GLU A 1 274  ? -54.456 -40.442 -36.871 1.00 103.40 ? 274  GLU A CA    1 
ATOM   1863  C  C     . GLU A 1 274  ? -53.894 -41.668 -37.596 1.00 100.82 ? 274  GLU A C     1 
ATOM   1864  O  O     . GLU A 1 274  ? -53.062 -42.376 -37.040 1.00 117.05 ? 274  GLU A O     1 
ATOM   1865  C  CB    . GLU A 1 274  ? -55.586 -40.857 -35.932 1.00 110.25 ? 274  GLU A CB    1 
ATOM   1866  C  CG    . GLU A 1 274  ? -56.695 -41.678 -36.563 1.00 124.57 ? 274  GLU A CG    1 
ATOM   1867  C  CD    . GLU A 1 274  ? -57.690 -42.206 -35.530 1.00 138.80 ? 274  GLU A CD    1 
ATOM   1868  O  OE1   . GLU A 1 274  ? -57.350 -42.283 -34.325 1.00 128.59 ? 274  GLU A OE1   1 
ATOM   1869  O  OE2   . GLU A 1 274  ? -58.824 -42.552 -35.926 1.00 155.93 ? 274  GLU A OE2   1 
ATOM   1870  N  N     . VAL A 1 275  ? -54.323 -41.920 -38.825 1.00 101.32 ? 275  VAL A N     1 
ATOM   1871  C  CA    . VAL A 1 275  ? -53.657 -42.936 -39.656 1.00 110.18 ? 275  VAL A CA    1 
ATOM   1872  C  C     . VAL A 1 275  ? -52.265 -42.455 -40.110 1.00 111.47 ? 275  VAL A C     1 
ATOM   1873  O  O     . VAL A 1 275  ? -51.357 -43.267 -40.279 1.00 113.42 ? 275  VAL A O     1 
ATOM   1874  C  CB    . VAL A 1 275  ? -54.489 -43.306 -40.902 1.00 112.50 ? 275  VAL A CB    1 
ATOM   1875  C  CG1   . VAL A 1 275  ? -55.840 -43.853 -40.455 1.00 119.85 ? 275  VAL A CG1   1 
ATOM   1876  C  CG2   . VAL A 1 275  ? -54.664 -42.131 -41.878 1.00 107.52 ? 275  VAL A CG2   1 
ATOM   1877  N  N     . LYS A 1 276  ? -52.106 -41.142 -40.282 1.00 114.75 ? 276  LYS A N     1 
ATOM   1878  C  CA    . LYS A 1 276  ? -50.829 -40.552 -40.711 1.00 113.57 ? 276  LYS A CA    1 
ATOM   1879  C  C     . LYS A 1 276  ? -49.727 -40.675 -39.665 1.00 118.29 ? 276  LYS A C     1 
ATOM   1880  O  O     . LYS A 1 276  ? -48.607 -41.057 -40.002 1.00 131.45 ? 276  LYS A O     1 
ATOM   1881  C  CB    . LYS A 1 276  ? -51.022 -39.111 -41.179 1.00 121.31 ? 276  LYS A CB    1 
ATOM   1882  C  CG    . LYS A 1 276  ? -51.801 -39.023 -42.486 1.00 132.86 ? 276  LYS A CG    1 
ATOM   1883  C  CD    . LYS A 1 276  ? -52.066 -37.582 -42.897 1.00 142.77 ? 276  LYS A CD    1 
ATOM   1884  C  CE    . LYS A 1 276  ? -52.709 -37.487 -44.277 1.00 138.90 ? 276  LYS A CE    1 
ATOM   1885  N  NZ    . LYS A 1 276  ? -52.427 -36.165 -44.915 1.00 131.74 ? 276  LYS A NZ    1 
ATOM   1886  N  N     . PHE A 1 277  ? -50.035 -40.358 -38.411 1.00 121.75 ? 277  PHE A N     1 
ATOM   1887  C  CA    . PHE A 1 277  ? -49.054 -40.408 -37.330 1.00 128.52 ? 277  PHE A CA    1 
ATOM   1888  C  C     . PHE A 1 277  ? -49.626 -40.878 -35.983 1.00 117.96 ? 277  PHE A C     1 
ATOM   1889  O  O     . PHE A 1 277  ? -49.321 -40.291 -34.931 1.00 122.51 ? 277  PHE A O     1 
ATOM   1890  C  CB    . PHE A 1 277  ? -48.265 -39.068 -37.195 1.00 136.95 ? 277  PHE A CB    1 
ATOM   1891  C  CG    . PHE A 1 277  ? -49.045 -37.824 -37.576 1.00 133.91 ? 277  PHE A CG    1 
ATOM   1892  C  CD1   . PHE A 1 277  ? -50.016 -37.300 -36.729 1.00 132.31 ? 277  PHE A CD1   1 
ATOM   1893  C  CD2   . PHE A 1 277  ? -48.766 -37.152 -38.770 1.00 121.48 ? 277  PHE A CD2   1 
ATOM   1894  C  CE1   . PHE A 1 277  ? -50.706 -36.151 -37.079 1.00 130.46 ? 277  PHE A CE1   1 
ATOM   1895  C  CE2   . PHE A 1 277  ? -49.461 -36.012 -39.128 1.00 113.11 ? 277  PHE A CE2   1 
ATOM   1896  C  CZ    . PHE A 1 277  ? -50.426 -35.509 -38.282 1.00 120.91 ? 277  PHE A CZ    1 
ATOM   1897  N  N     . LYS A 1 278  ? -50.501 -41.882 -36.025 1.00 112.69 ? 278  LYS A N     1 
ATOM   1898  C  CA    . LYS A 1 278  ? -50.795 -42.707 -34.840 1.00 120.87 ? 278  LYS A CA    1 
ATOM   1899  C  C     . LYS A 1 278  ? -50.942 -44.203 -35.184 1.00 120.58 ? 278  LYS A C     1 
ATOM   1900  O  O     . LYS A 1 278  ? -51.599 -44.957 -34.453 1.00 112.41 ? 278  LYS A O     1 
ATOM   1901  C  CB    . LYS A 1 278  ? -52.017 -42.163 -34.065 1.00 135.46 ? 278  LYS A CB    1 
ATOM   1902  C  CG    . LYS A 1 278  ? -51.928 -40.658 -33.762 1.00 156.20 ? 278  LYS A CG    1 
ATOM   1903  C  CD    . LYS A 1 278  ? -53.169 -40.013 -33.139 1.00 156.59 ? 278  LYS A CD    1 
ATOM   1904  C  CE    . LYS A 1 278  ? -53.277 -38.547 -33.567 1.00 157.06 ? 278  LYS A CE    1 
ATOM   1905  N  NZ    . LYS A 1 278  ? -53.883 -37.673 -32.532 1.00 160.58 ? 278  LYS A NZ    1 
ATOM   1906  N  N     . GLY A 1 279  ? -50.315 -44.626 -36.286 1.00 132.36 ? 279  GLY A N     1 
ATOM   1907  C  CA    . GLY A 1 279  ? -50.260 -46.042 -36.686 1.00 137.88 ? 279  GLY A CA    1 
ATOM   1908  C  C     . GLY A 1 279  ? -51.582 -46.796 -36.842 1.00 136.96 ? 279  GLY A C     1 
ATOM   1909  O  O     . GLY A 1 279  ? -51.622 -48.015 -36.681 1.00 112.22 ? 279  GLY A O     1 
ATOM   1910  N  N     . VAL A 1 280  ? -52.653 -46.077 -37.167 1.00 145.90 ? 280  VAL A N     1 
ATOM   1911  C  CA    . VAL A 1 280  ? -53.996 -46.642 -37.357 1.00 132.59 ? 280  VAL A CA    1 
ATOM   1912  C  C     . VAL A 1 280  ? -54.206 -47.051 -38.816 1.00 124.86 ? 280  VAL A C     1 
ATOM   1913  O  O     . VAL A 1 280  ? -53.696 -46.411 -39.718 1.00 125.22 ? 280  VAL A O     1 
ATOM   1914  C  CB    . VAL A 1 280  ? -55.084 -45.621 -36.961 1.00 127.49 ? 280  VAL A CB    1 
ATOM   1915  C  CG1   . VAL A 1 280  ? -56.470 -46.114 -37.345 1.00 127.03 ? 280  VAL A CG1   1 
ATOM   1916  C  CG2   . VAL A 1 280  ? -55.015 -45.349 -35.467 1.00 133.32 ? 280  VAL A CG2   1 
ATOM   1917  N  N     . PHE A 1 281  ? -54.967 -48.123 -39.040 1.00 117.10 ? 281  PHE A N     1 
ATOM   1918  C  CA    . PHE A 1 281  ? -55.317 -48.585 -40.395 1.00 101.14 ? 281  PHE A CA    1 
ATOM   1919  C  C     . PHE A 1 281  ? -56.707 -49.225 -40.447 1.00 98.62  ? 281  PHE A C     1 
ATOM   1920  O  O     . PHE A 1 281  ? -57.083 -50.008 -39.565 1.00 105.90 ? 281  PHE A O     1 
ATOM   1921  C  CB    . PHE A 1 281  ? -54.275 -49.590 -40.869 1.00 103.62 ? 281  PHE A CB    1 
ATOM   1922  C  CG    . PHE A 1 281  ? -54.507 -50.120 -42.257 1.00 104.87 ? 281  PHE A CG    1 
ATOM   1923  C  CD1   . PHE A 1 281  ? -54.651 -49.250 -43.342 1.00 103.92 ? 281  PHE A CD1   1 
ATOM   1924  C  CD2   . PHE A 1 281  ? -54.519 -51.496 -42.492 1.00 103.71 ? 281  PHE A CD2   1 
ATOM   1925  C  CE1   . PHE A 1 281  ? -54.838 -49.742 -44.627 1.00 103.98 ? 281  PHE A CE1   1 
ATOM   1926  C  CE2   . PHE A 1 281  ? -54.702 -51.991 -43.771 1.00 108.35 ? 281  PHE A CE2   1 
ATOM   1927  C  CZ    . PHE A 1 281  ? -54.871 -51.112 -44.838 1.00 109.67 ? 281  PHE A CZ    1 
ATOM   1928  N  N     . HIS A 1 282  ? -57.456 -48.913 -41.505 1.00 100.75 ? 282  HIS A N     1 
ATOM   1929  C  CA    . HIS A 1 282  ? -58.827 -49.416 -41.690 1.00 100.95 ? 282  HIS A CA    1 
ATOM   1930  C  C     . HIS A 1 282  ? -58.974 -50.155 -43.005 1.00 102.58 ? 282  HIS A C     1 
ATOM   1931  O  O     . HIS A 1 282  ? -58.915 -49.532 -44.053 1.00 118.97 ? 282  HIS A O     1 
ATOM   1932  C  CB    . HIS A 1 282  ? -59.791 -48.244 -41.641 1.00 99.86  ? 282  HIS A CB    1 
ATOM   1933  C  CG    . HIS A 1 282  ? -59.919 -47.652 -40.274 1.00 108.76 ? 282  HIS A CG    1 
ATOM   1934  N  ND1   . HIS A 1 282  ? -59.610 -46.337 -39.996 1.00 107.00 ? 282  HIS A ND1   1 
ATOM   1935  C  CD2   . HIS A 1 282  ? -60.288 -48.211 -39.096 1.00 110.43 ? 282  HIS A CD2   1 
ATOM   1936  C  CE1   . HIS A 1 282  ? -59.807 -46.102 -38.711 1.00 102.46 ? 282  HIS A CE1   1 
ATOM   1937  N  NE2   . HIS A 1 282  ? -60.211 -47.225 -38.142 1.00 111.85 ? 282  HIS A NE2   1 
ATOM   1938  N  N     . PRO A 1 283  ? -59.163 -51.486 -42.965 1.00 94.46  ? 283  PRO A N     1 
ATOM   1939  C  CA    . PRO A 1 283  ? -59.293 -52.202 -44.227 1.00 96.28  ? 283  PRO A CA    1 
ATOM   1940  C  C     . PRO A 1 283  ? -60.568 -51.809 -44.978 1.00 102.68 ? 283  PRO A C     1 
ATOM   1941  O  O     . PRO A 1 283  ? -60.538 -51.688 -46.195 1.00 104.44 ? 283  PRO A O     1 
ATOM   1942  C  CB    . PRO A 1 283  ? -59.354 -53.654 -43.792 1.00 93.92  ? 283  PRO A CB    1 
ATOM   1943  C  CG    . PRO A 1 283  ? -59.980 -53.603 -42.444 1.00 99.63  ? 283  PRO A CG    1 
ATOM   1944  C  CD    . PRO A 1 283  ? -59.585 -52.294 -41.818 1.00 94.95  ? 283  PRO A CD    1 
ATOM   1945  N  N     . VAL A 1 284  ? -61.678 -51.593 -44.259 1.00 111.98 ? 284  VAL A N     1 
ATOM   1946  C  CA    . VAL A 1 284  ? -62.912 -51.148 -44.876 1.00 113.17 ? 284  VAL A CA    1 
ATOM   1947  C  C     . VAL A 1 284  ? -63.190 -49.691 -44.485 1.00 105.93 ? 284  VAL A C     1 
ATOM   1948  O  O     . VAL A 1 284  ? -63.055 -49.335 -43.314 1.00 102.31 ? 284  VAL A O     1 
ATOM   1949  C  CB    . VAL A 1 284  ? -64.137 -51.978 -44.403 1.00 112.52 ? 284  VAL A CB    1 
ATOM   1950  C  CG1   . VAL A 1 284  ? -65.276 -51.823 -45.402 1.00 105.90 ? 284  VAL A CG1   1 
ATOM   1951  C  CG2   . VAL A 1 284  ? -63.778 -53.449 -44.163 1.00 106.87 ? 284  VAL A CG2   1 
ATOM   1952  N  N     . ILE A 1 285  ? -63.548 -48.878 -45.473 1.00 104.02 ? 285  ILE A N     1 
ATOM   1953  C  CA    . ILE A 1 285  ? -64.019 -47.499 -45.265 1.00 108.71 ? 285  ILE A CA    1 
ATOM   1954  C  C     . ILE A 1 285  ? -65.406 -47.358 -45.858 1.00 115.86 ? 285  ILE A C     1 
ATOM   1955  O  O     . ILE A 1 285  ? -65.658 -47.908 -46.928 1.00 117.89 ? 285  ILE A O     1 
ATOM   1956  C  CB    . ILE A 1 285  ? -63.116 -46.538 -46.051 1.00 112.69 ? 285  ILE A CB    1 
ATOM   1957  C  CG1   . ILE A 1 285  ? -61.698 -46.549 -45.482 1.00 113.05 ? 285  ILE A CG1   1 
ATOM   1958  C  CG2   . ILE A 1 285  ? -63.707 -45.139 -46.076 1.00 120.85 ? 285  ILE A CG2   1 
ATOM   1959  C  CD1   . ILE A 1 285  ? -61.631 -46.356 -43.980 1.00 116.16 ? 285  ILE A CD1   1 
ATOM   1960  N  N     . ILE A 1 286  ? -66.294 -46.635 -45.175 1.00 113.59 ? 286  ILE A N     1 
ATOM   1961  C  CA    . ILE A 1 286  ? -67.599 -46.240 -45.744 1.00 102.62 ? 286  ILE A CA    1 
ATOM   1962  C  C     . ILE A 1 286  ? -67.622 -44.708 -45.822 1.00 92.64  ? 286  ILE A C     1 
ATOM   1963  O  O     . ILE A 1 286  ? -67.367 -44.036 -44.829 1.00 88.61  ? 286  ILE A O     1 
ATOM   1964  C  CB    . ILE A 1 286  ? -68.751 -46.795 -44.870 1.00 102.59 ? 286  ILE A CB    1 
ATOM   1965  C  CG1   . ILE A 1 286  ? -68.467 -48.269 -44.515 1.00 106.59 ? 286  ILE A CG1   1 
ATOM   1966  C  CG2   . ILE A 1 286  ? -70.102 -46.647 -45.580 1.00 98.82  ? 286  ILE A CG2   1 
ATOM   1967  C  CD1   . ILE A 1 286  ? -69.339 -48.852 -43.422 1.00 114.82 ? 286  ILE A CD1   1 
ATOM   1968  N  N     . SER A 1 287  ? -67.907 -44.166 -47.006 1.00 88.10  ? 287  SER A N     1 
ATOM   1969  C  CA    . SER A 1 287  ? -67.780 -42.740 -47.262 1.00 92.40  ? 287  SER A CA    1 
ATOM   1970  C  C     . SER A 1 287  ? -68.953 -42.280 -48.089 1.00 87.94  ? 287  SER A C     1 
ATOM   1971  O  O     . SER A 1 287  ? -68.850 -42.185 -49.320 1.00 83.28  ? 287  SER A O     1 
ATOM   1972  C  CB    . SER A 1 287  ? -66.498 -42.455 -48.033 1.00 103.58 ? 287  SER A CB    1 
ATOM   1973  O  OG    . SER A 1 287  ? -66.430 -41.087 -48.420 1.00 111.43 ? 287  SER A OG    1 
ATOM   1974  N  N     . PRO A 1 288  ? -70.068 -41.975 -47.416 1.00 91.22  ? 288  PRO A N     1 
ATOM   1975  C  CA    . PRO A 1 288  ? -71.326 -41.706 -48.122 1.00 98.36  ? 288  PRO A CA    1 
ATOM   1976  C  C     . PRO A 1 288  ? -71.288 -40.384 -48.862 1.00 103.33 ? 288  PRO A C     1 
ATOM   1977  O  O     . PRO A 1 288  ? -70.629 -39.433 -48.404 1.00 117.65 ? 288  PRO A O     1 
ATOM   1978  C  CB    . PRO A 1 288  ? -72.332 -41.603 -46.983 1.00 92.87  ? 288  PRO A CB    1 
ATOM   1979  C  CG    . PRO A 1 288  ? -71.528 -41.057 -45.846 1.00 93.47  ? 288  PRO A CG    1 
ATOM   1980  C  CD    . PRO A 1 288  ? -70.120 -41.543 -46.009 1.00 87.92  ? 288  PRO A CD    1 
ATOM   1981  N  N     . ASP A 1 289  ? -71.988 -40.310 -49.985 1.00 114.30 ? 289  ASP A N     1 
ATOM   1982  C  CA    . ASP A 1 289  ? -72.125 -39.051 -50.723 1.00 124.09 ? 289  ASP A CA    1 
ATOM   1983  C  C     . ASP A 1 289  ? -73.197 -38.212 -50.023 1.00 121.27 ? 289  ASP A C     1 
ATOM   1984  O  O     . ASP A 1 289  ? -73.600 -38.544 -48.909 1.00 126.30 ? 289  ASP A O     1 
ATOM   1985  C  CB    . ASP A 1 289  ? -72.497 -39.354 -52.186 1.00 124.61 ? 289  ASP A CB    1 
ATOM   1986  C  CG    . ASP A 1 289  ? -72.033 -38.275 -53.145 1.00 124.30 ? 289  ASP A CG    1 
ATOM   1987  O  OD1   . ASP A 1 289  ? -72.609 -37.167 -53.097 1.00 127.84 ? 289  ASP A OD1   1 
ATOM   1988  O  OD2   . ASP A 1 289  ? -71.100 -38.528 -53.941 1.00 113.05 ? 289  ASP A OD2   1 
ATOM   1989  N  N     . ARG A 1 290  ? -73.666 -37.139 -50.647 1.00 117.00 ? 290  ARG A N     1 
ATOM   1990  C  CA    . ARG A 1 290  ? -74.662 -36.293 -50.009 1.00 131.19 ? 290  ARG A CA    1 
ATOM   1991  C  C     . ARG A 1 290  ? -75.989 -37.033 -49.845 1.00 133.66 ? 290  ARG A C     1 
ATOM   1992  O  O     . ARG A 1 290  ? -76.765 -37.122 -50.789 1.00 133.26 ? 290  ARG A O     1 
ATOM   1993  C  CB    . ARG A 1 290  ? -74.869 -35.023 -50.822 1.00 143.80 ? 290  ARG A CB    1 
ATOM   1994  C  CG    . ARG A 1 290  ? -75.833 -34.031 -50.204 1.00 142.11 ? 290  ARG A CG    1 
ATOM   1995  C  CD    . ARG A 1 290  ? -75.881 -32.753 -51.028 1.00 147.73 ? 290  ARG A CD    1 
ATOM   1996  N  NE    . ARG A 1 290  ? -75.632 -31.609 -50.165 1.00 150.93 ? 290  ARG A NE    1 
ATOM   1997  C  CZ    . ARG A 1 290  ? -76.489 -31.153 -49.255 1.00 149.03 ? 290  ARG A CZ    1 
ATOM   1998  N  NH1   . ARG A 1 290  ? -77.679 -31.730 -49.098 1.00 154.90 ? 290  ARG A NH1   1 
ATOM   1999  N  NH2   . ARG A 1 290  ? -76.158 -30.108 -48.499 1.00 136.46 ? 290  ARG A NH2   1 
ATOM   2000  N  N     . ILE A 1 291  ? -76.204 -37.598 -48.659 1.00 130.56 ? 291  ILE A N     1 
ATOM   2001  C  CA    . ILE A 1 291  ? -77.481 -38.197 -48.269 1.00 120.24 ? 291  ILE A CA    1 
ATOM   2002  C  C     . ILE A 1 291  ? -78.314 -37.074 -47.664 1.00 121.53 ? 291  ILE A C     1 
ATOM   2003  O  O     . ILE A 1 291  ? -77.873 -36.450 -46.701 1.00 134.30 ? 291  ILE A O     1 
ATOM   2004  C  CB    . ILE A 1 291  ? -77.305 -39.327 -47.227 1.00 112.36 ? 291  ILE A CB    1 
ATOM   2005  C  CG1   . ILE A 1 291  ? -76.192 -40.313 -47.634 1.00 111.54 ? 291  ILE A CG1   1 
ATOM   2006  C  CG2   . ILE A 1 291  ? -78.622 -40.066 -47.016 1.00 115.58 ? 291  ILE A CG2   1 
ATOM   2007  C  CD1   . ILE A 1 291  ? -76.318 -40.895 -49.027 1.00 105.52 ? 291  ILE A CD1   1 
ATOM   2008  N  N     . GLU A 1 292  ? -79.507 -36.818 -48.213 1.00 121.95 ? 292  GLU A N     1 
ATOM   2009  C  CA    . GLU A 1 292  ? -80.327 -35.661 -47.801 1.00 124.88 ? 292  GLU A CA    1 
ATOM   2010  C  C     . GLU A 1 292  ? -80.689 -35.683 -46.305 1.00 115.10 ? 292  GLU A C     1 
ATOM   2011  O  O     . GLU A 1 292  ? -80.631 -34.648 -45.643 1.00 104.04 ? 292  GLU A O     1 
ATOM   2012  C  CB    . GLU A 1 292  ? -81.586 -35.544 -48.688 1.00 128.70 ? 292  GLU A CB    1 
ATOM   2013  C  CG    . GLU A 1 292  ? -82.183 -34.141 -48.783 1.00 132.38 ? 292  GLU A CG    1 
ATOM   2014  C  CD    . GLU A 1 292  ? -81.319 -33.152 -49.566 1.00 134.30 ? 292  GLU A CD    1 
ATOM   2015  O  OE1   . GLU A 1 292  ? -80.838 -33.485 -50.676 1.00 135.37 ? 292  GLU A OE1   1 
ATOM   2016  O  OE2   . GLU A 1 292  ? -81.132 -32.017 -49.080 1.00 121.90 ? 292  GLU A OE2   1 
ATOM   2017  N  N     . GLU A 1 293  ? -81.015 -36.865 -45.780 1.00 110.33 ? 293  GLU A N     1 
ATOM   2018  C  CA    . GLU A 1 293  ? -81.361 -37.037 -44.368 1.00 107.39 ? 293  GLU A CA    1 
ATOM   2019  C  C     . GLU A 1 293  ? -80.225 -36.688 -43.403 1.00 104.55 ? 293  GLU A C     1 
ATOM   2020  O  O     . GLU A 1 293  ? -80.480 -36.304 -42.265 1.00 116.09 ? 293  GLU A O     1 
ATOM   2021  C  CB    . GLU A 1 293  ? -81.743 -38.499 -44.070 1.00 111.40 ? 293  GLU A CB    1 
ATOM   2022  C  CG    . GLU A 1 293  ? -83.164 -38.919 -44.441 1.00 119.21 ? 293  GLU A CG    1 
ATOM   2023  C  CD    . GLU A 1 293  ? -83.338 -39.344 -45.895 1.00 124.74 ? 293  GLU A CD    1 
ATOM   2024  O  OE1   . GLU A 1 293  ? -82.323 -39.508 -46.625 1.00 113.96 ? 293  GLU A OE1   1 
ATOM   2025  O  OE2   . GLU A 1 293  ? -84.515 -39.511 -46.303 1.00 131.75 ? 293  GLU A OE2   1 
ATOM   2026  N  N     . LEU A 1 294  ? -78.982 -36.843 -43.867 1.00 104.36 ? 294  LEU A N     1 
ATOM   2027  C  CA    . LEU A 1 294  ? -77.770 -36.463 -43.102 1.00 102.51 ? 294  LEU A CA    1 
ATOM   2028  C  C     . LEU A 1 294  ? -77.443 -34.956 -43.128 1.00 106.19 ? 294  LEU A C     1 
ATOM   2029  O  O     . LEU A 1 294  ? -76.520 -34.514 -42.443 1.00 110.78 ? 294  LEU A O     1 
ATOM   2030  C  CB    . LEU A 1 294  ? -76.544 -37.240 -43.603 1.00 101.04 ? 294  LEU A CB    1 
ATOM   2031  C  CG    . LEU A 1 294  ? -75.985 -38.394 -42.766 1.00 97.60  ? 294  LEU A CG    1 
ATOM   2032  C  CD1   . LEU A 1 294  ? -76.813 -39.648 -42.939 1.00 93.69  ? 294  LEU A CD1   1 
ATOM   2033  C  CD2   . LEU A 1 294  ? -74.536 -38.675 -43.161 1.00 100.46 ? 294  LEU A CD2   1 
ATOM   2034  N  N     . SER A 1 295  ? -78.176 -34.172 -43.914 1.00 104.65 ? 295  SER A N     1 
ATOM   2035  C  CA    . SER A 1 295  ? -77.901 -32.747 -44.056 1.00 103.91 ? 295  SER A CA    1 
ATOM   2036  C  C     . SER A 1 295  ? -79.163 -31.916 -43.823 1.00 96.06  ? 295  SER A C     1 
ATOM   2037  O  O     . SER A 1 295  ? -79.357 -30.872 -44.443 1.00 85.60  ? 295  SER A O     1 
ATOM   2038  C  CB    . SER A 1 295  ? -77.325 -32.479 -45.437 1.00 106.25 ? 295  SER A CB    1 
ATOM   2039  O  OG    . SER A 1 295  ? -78.111 -33.128 -46.410 1.00 121.57 ? 295  SER A OG    1 
ATOM   2040  N  N     . VAL A 1 296  ? -80.001 -32.378 -42.892 1.00 97.74  ? 296  VAL A N     1 
ATOM   2041  C  CA    . VAL A 1 296  ? -81.277 -31.714 -42.606 1.00 103.02 ? 296  VAL A CA    1 
ATOM   2042  C  C     . VAL A 1 296  ? -81.050 -30.469 -41.729 1.00 110.18 ? 296  VAL A C     1 
ATOM   2043  O  O     . VAL A 1 296  ? -80.100 -30.404 -40.939 1.00 123.21 ? 296  VAL A O     1 
ATOM   2044  C  CB    . VAL A 1 296  ? -82.335 -32.718 -42.055 1.00 104.35 ? 296  VAL A CB    1 
ATOM   2045  C  CG1   . VAL A 1 296  ? -81.859 -33.440 -40.801 1.00 100.54 ? 296  VAL A CG1   1 
ATOM   2046  C  CG2   . VAL A 1 296  ? -83.679 -32.031 -41.829 1.00 114.00 ? 296  VAL A CG2   1 
ATOM   2047  N  N     . VAL A 1 297  ? -81.919 -29.466 -41.916 1.00 112.44 ? 297  VAL A N     1 
ATOM   2048  C  CA    . VAL A 1 297  ? -81.965 -28.244 -41.088 1.00 105.31 ? 297  VAL A CA    1 
ATOM   2049  C  C     . VAL A 1 297  ? -83.422 -27.938 -40.746 1.00 101.72 ? 297  VAL A C     1 
ATOM   2050  O  O     . VAL A 1 297  ? -84.060 -27.156 -41.440 1.00 96.65  ? 297  VAL A O     1 
ATOM   2051  C  CB    . VAL A 1 297  ? -81.430 -26.997 -41.855 1.00 100.30 ? 297  VAL A CB    1 
ATOM   2052  C  CG1   . VAL A 1 297  ? -81.357 -25.772 -40.944 1.00 98.21  ? 297  VAL A CG1   1 
ATOM   2053  C  CG2   . VAL A 1 297  ? -80.080 -27.283 -42.493 1.00 100.07 ? 297  VAL A CG2   1 
ATOM   2054  N  N     . ASN A 1 298  ? -83.930 -28.560 -39.682 1.00 104.87 ? 298  ASN A N     1 
ATOM   2055  C  CA    . ASN A 1 298  ? -85.298 -28.336 -39.233 1.00 112.07 ? 298  ASN A CA    1 
ATOM   2056  C  C     . ASN A 1 298  ? -85.373 -27.256 -38.151 1.00 105.24 ? 298  ASN A C     1 
ATOM   2057  O  O     . ASN A 1 298  ? -84.698 -27.371 -37.137 1.00 98.82  ? 298  ASN A O     1 
ATOM   2058  C  CB    . ASN A 1 298  ? -85.920 -29.616 -38.701 1.00 115.25 ? 298  ASN A CB    1 
ATOM   2059  C  CG    . ASN A 1 298  ? -87.400 -29.450 -38.420 1.00 136.40 ? 298  ASN A CG    1 
ATOM   2060  O  OD1   . ASN A 1 298  ? -88.125 -28.800 -39.187 1.00 142.40 ? 298  ASN A OD1   1 
ATOM   2061  N  ND2   . ASN A 1 298  ? -87.858 -30.014 -37.309 1.00 148.42 ? 298  ASN A ND2   1 
ATOM   2062  N  N     . HIS A 1 299  ? -86.184 -26.223 -38.391 1.00 103.61 ? 299  HIS A N     1 
ATOM   2063  C  CA    . HIS A 1 299  ? -86.502 -25.207 -37.389 1.00 105.07 ? 299  HIS A CA    1 
ATOM   2064  C  C     . HIS A 1 299  ? -87.766 -25.638 -36.640 1.00 108.22 ? 299  HIS A C     1 
ATOM   2065  O  O     . HIS A 1 299  ? -88.882 -25.314 -37.031 1.00 118.89 ? 299  HIS A O     1 
ATOM   2066  C  CB    . HIS A 1 299  ? -86.692 -23.842 -38.034 1.00 112.90 ? 299  HIS A CB    1 
ATOM   2067  C  CG    . HIS A 1 299  ? -85.471 -23.345 -38.740 1.00 125.90 ? 299  HIS A CG    1 
ATOM   2068  N  ND1   . HIS A 1 299  ? -84.204 -23.457 -38.205 1.00 124.32 ? 299  HIS A ND1   1 
ATOM   2069  C  CD2   . HIS A 1 299  ? -85.319 -22.732 -39.939 1.00 133.43 ? 299  HIS A CD2   1 
ATOM   2070  C  CE1   . HIS A 1 299  ? -83.325 -22.933 -39.041 1.00 121.57 ? 299  HIS A CE1   1 
ATOM   2071  N  NE2   . HIS A 1 299  ? -83.975 -22.489 -40.103 1.00 129.34 ? 299  HIS A NE2   1 
ATOM   2072  N  N     . ALA A 1 300  ? -87.574 -26.394 -35.567 1.00 108.19 ? 300  ALA A N     1 
ATOM   2073  C  CA    . ALA A 1 300  ? -88.677 -26.918 -34.778 1.00 112.54 ? 300  ALA A CA    1 
ATOM   2074  C  C     . ALA A 1 300  ? -89.249 -25.854 -33.829 1.00 117.98 ? 300  ALA A C     1 
ATOM   2075  O  O     . ALA A 1 300  ? -88.695 -24.751 -33.660 1.00 108.92 ? 300  ALA A O     1 
ATOM   2076  C  CB    . ALA A 1 300  ? -88.252 -28.165 -34.003 1.00 117.92 ? 300  ALA A CB    1 
ATOM   2077  N  N     . TYR A 1 301  ? -90.384 -26.207 -33.226 1.00 118.82 ? 301  TYR A N     1 
ATOM   2078  C  CA    . TYR A 1 301  ? -91.020 -25.400 -32.201 1.00 121.06 ? 301  TYR A CA    1 
ATOM   2079  C  C     . TYR A 1 301  ? -90.193 -25.380 -30.905 1.00 129.92 ? 301  TYR A C     1 
ATOM   2080  O  O     . TYR A 1 301  ? -90.078 -24.329 -30.270 1.00 160.05 ? 301  TYR A O     1 
ATOM   2081  C  CB    . TYR A 1 301  ? -92.441 -25.894 -31.955 1.00 115.81 ? 301  TYR A CB    1 
ATOM   2082  C  CG    . TYR A 1 301  ? -93.214 -24.966 -31.069 1.00 129.73 ? 301  TYR A CG    1 
ATOM   2083  C  CD1   . TYR A 1 301  ? -93.932 -23.901 -31.604 1.00 137.83 ? 301  TYR A CD1   1 
ATOM   2084  C  CD2   . TYR A 1 301  ? -93.192 -25.119 -29.679 1.00 134.46 ? 301  TYR A CD2   1 
ATOM   2085  C  CE1   . TYR A 1 301  ? -94.628 -23.028 -30.780 1.00 140.18 ? 301  TYR A CE1   1 
ATOM   2086  C  CE2   . TYR A 1 301  ? -93.881 -24.252 -28.849 1.00 132.40 ? 301  TYR A CE2   1 
ATOM   2087  C  CZ    . TYR A 1 301  ? -94.598 -23.214 -29.405 1.00 134.56 ? 301  TYR A CZ    1 
ATOM   2088  O  OH    . TYR A 1 301  ? -95.277 -22.359 -28.583 1.00 135.82 ? 301  TYR A OH    1 
ATOM   2089  N  N     . ASN A 1 302  ? -89.648 -26.533 -30.521 1.00 121.65 ? 302  ASN A N     1 
ATOM   2090  C  CA    . ASN A 1 302  ? -88.834 -26.680 -29.315 1.00 133.84 ? 302  ASN A CA    1 
ATOM   2091  C  C     . ASN A 1 302  ? -87.328 -26.321 -29.480 1.00 139.92 ? 302  ASN A C     1 
ATOM   2092  O  O     . ASN A 1 302  ? -86.612 -26.107 -28.506 1.00 153.63 ? 302  ASN A O     1 
ATOM   2093  C  CB    . ASN A 1 302  ? -88.896 -28.132 -28.869 1.00 138.39 ? 302  ASN A CB    1 
ATOM   2094  C  CG    . ASN A 1 302  ? -88.027 -29.028 -29.736 1.00 146.64 ? 302  ASN A CG    1 
ATOM   2095  O  OD1   . ASN A 1 302  ? -88.444 -29.459 -30.817 1.00 149.50 ? 302  ASN A OD1   1 
ATOM   2096  N  ND2   . ASN A 1 302  ? -86.795 -29.280 -29.286 1.00 144.50 ? 302  ASN A ND2   1 
ATOM   2097  N  N     . GLY A 1 303  ? -86.874 -26.248 -30.734 1.00 129.43 ? 303  GLY A N     1 
ATOM   2098  C  CA    . GLY A 1 303  ? -85.447 -26.079 -31.042 1.00 120.95 ? 303  GLY A CA    1 
ATOM   2099  C  C     . GLY A 1 303  ? -85.120 -26.282 -32.504 1.00 118.58 ? 303  GLY A C     1 
ATOM   2100  O  O     . GLY A 1 303  ? -85.943 -26.000 -33.368 1.00 142.82 ? 303  GLY A O     1 
ATOM   2101  N  N     . LEU A 1 304  ? -83.914 -26.771 -32.790 1.00 115.44 ? 304  LEU A N     1 
ATOM   2102  C  CA    . LEU A 1 304  ? -83.575 -27.216 -34.142 1.00 108.79 ? 304  LEU A CA    1 
ATOM   2103  C  C     . LEU A 1 304  ? -82.791 -28.512 -34.159 1.00 99.13  ? 304  LEU A C     1 
ATOM   2104  O  O     . LEU A 1 304  ? -82.027 -28.812 -33.243 1.00 77.06  ? 304  LEU A O     1 
ATOM   2105  C  CB    . LEU A 1 304  ? -82.854 -26.137 -34.944 1.00 111.55 ? 304  LEU A CB    1 
ATOM   2106  C  CG    . LEU A 1 304  ? -81.814 -25.248 -34.284 1.00 114.52 ? 304  LEU A CG    1 
ATOM   2107  C  CD1   . LEU A 1 304  ? -80.810 -26.036 -33.456 1.00 120.62 ? 304  LEU A CD1   1 
ATOM   2108  C  CD2   . LEU A 1 304  ? -81.113 -24.467 -35.387 1.00 113.96 ? 304  LEU A CD2   1 
ATOM   2109  N  N     . THR A 1 305  ? -83.010 -29.267 -35.220 1.00 104.76 ? 305  THR A N     1 
ATOM   2110  C  CA    . THR A 1 305  ? -82.364 -30.543 -35.423 1.00 118.13 ? 305  THR A CA    1 
ATOM   2111  C  C     . THR A 1 305  ? -81.419 -30.335 -36.625 1.00 129.72 ? 305  THR A C     1 
ATOM   2112  O  O     . THR A 1 305  ? -81.858 -29.884 -37.687 1.00 137.59 ? 305  THR A O     1 
ATOM   2113  C  CB    . THR A 1 305  ? -83.465 -31.592 -35.656 1.00 120.93 ? 305  THR A CB    1 
ATOM   2114  O  OG1   . THR A 1 305  ? -84.033 -31.398 -36.947 1.00 134.11 ? 305  THR A OG1   1 
ATOM   2115  C  CG2   . THR A 1 305  ? -84.620 -31.409 -34.650 1.00 117.39 ? 305  THR A CG2   1 
ATOM   2116  N  N     . LEU A 1 306  ? -80.126 -30.591 -36.425 1.00 128.51 ? 306  LEU A N     1 
ATOM   2117  C  CA    . LEU A 1 306  ? -79.100 -30.355 -37.438 1.00 109.26 ? 306  LEU A CA    1 
ATOM   2118  C  C     . LEU A 1 306  ? -78.515 -31.685 -37.930 1.00 111.90 ? 306  LEU A C     1 
ATOM   2119  O  O     . LEU A 1 306  ? -78.144 -32.543 -37.123 1.00 99.39  ? 306  LEU A O     1 
ATOM   2120  C  CB    . LEU A 1 306  ? -78.003 -29.475 -36.874 1.00 93.85  ? 306  LEU A CB    1 
ATOM   2121  C  CG    . LEU A 1 306  ? -78.463 -28.064 -36.584 1.00 86.48  ? 306  LEU A CG    1 
ATOM   2122  C  CD1   . LEU A 1 306  ? -77.337 -27.358 -35.875 1.00 85.35  ? 306  LEU A CD1   1 
ATOM   2123  C  CD2   . LEU A 1 306  ? -78.848 -27.328 -37.859 1.00 90.50  ? 306  LEU A CD2   1 
ATOM   2124  N  N     . GLY A 1 307  ? -78.415 -31.816 -39.258 1.00 113.61 ? 307  GLY A N     1 
ATOM   2125  C  CA    . GLY A 1 307  ? -77.844 -33.001 -39.882 1.00 106.00 ? 307  GLY A CA    1 
ATOM   2126  C  C     . GLY A 1 307  ? -76.404 -33.292 -39.493 1.00 106.62 ? 307  GLY A C     1 
ATOM   2127  O  O     . GLY A 1 307  ? -75.581 -32.389 -39.362 1.00 103.14 ? 307  GLY A O     1 
ATOM   2128  N  N     . ALA A 1 308  ? -76.102 -34.573 -39.320 1.00 107.74 ? 308  ALA A N     1 
ATOM   2129  C  CA    . ALA A 1 308  ? -74.772 -35.031 -38.933 1.00 96.95  ? 308  ALA A CA    1 
ATOM   2130  C  C     . ALA A 1 308  ? -73.727 -34.813 -40.026 1.00 90.68  ? 308  ALA A C     1 
ATOM   2131  O  O     . ALA A 1 308  ? -72.539 -34.727 -39.732 1.00 93.94  ? 308  ALA A O     1 
ATOM   2132  C  CB    . ALA A 1 308  ? -74.834 -36.493 -38.545 1.00 101.79 ? 308  ALA A CB    1 
ATOM   2133  N  N     . GLY A 1 309  ? -74.171 -34.748 -41.280 1.00 96.15  ? 309  GLY A N     1 
ATOM   2134  C  CA    . GLY A 1 309  ? -73.299 -34.478 -42.429 1.00 97.28  ? 309  GLY A CA    1 
ATOM   2135  C  C     . GLY A 1 309  ? -73.142 -33.017 -42.835 1.00 87.56  ? 309  GLY A C     1 
ATOM   2136  O  O     . GLY A 1 309  ? -72.572 -32.729 -43.882 1.00 91.67  ? 309  GLY A O     1 
ATOM   2137  N  N     . LEU A 1 310  ? -73.666 -32.089 -42.043 1.00 80.58  ? 310  LEU A N     1 
ATOM   2138  C  CA    . LEU A 1 310  ? -73.401 -30.669 -42.252 1.00 82.69  ? 310  LEU A CA    1 
ATOM   2139  C  C     . LEU A 1 310  ? -71.967 -30.409 -41.823 1.00 80.92  ? 310  LEU A C     1 
ATOM   2140  O  O     . LEU A 1 310  ? -71.492 -30.999 -40.863 1.00 66.39  ? 310  LEU A O     1 
ATOM   2141  C  CB    . LEU A 1 310  ? -74.310 -29.790 -41.399 1.00 91.77  ? 310  LEU A CB    1 
ATOM   2142  C  CG    . LEU A 1 310  ? -75.811 -29.857 -41.632 1.00 92.36  ? 310  LEU A CG    1 
ATOM   2143  C  CD1   . LEU A 1 310  ? -76.511 -29.442 -40.349 1.00 95.39  ? 310  LEU A CD1   1 
ATOM   2144  C  CD2   . LEU A 1 310  ? -76.222 -28.970 -42.800 1.00 91.45  ? 310  LEU A CD2   1 
ATOM   2145  N  N     . SER A 1 311  ? -71.284 -29.522 -42.527 1.00 83.30  ? 311  SER A N     1 
ATOM   2146  C  CA    . SER A 1 311  ? -69.945 -29.105 -42.136 1.00 78.40  ? 311  SER A CA    1 
ATOM   2147  C  C     . SER A 1 311  ? -70.065 -28.189 -40.933 1.00 73.68  ? 311  SER A C     1 
ATOM   2148  O  O     . SER A 1 311  ? -71.138 -27.606 -40.702 1.00 63.60  ? 311  SER A O     1 
ATOM   2149  C  CB    . SER A 1 311  ? -69.309 -28.319 -43.282 1.00 82.47  ? 311  SER A CB    1 
ATOM   2150  O  OG    . SER A 1 311  ? -70.038 -27.129 -43.544 1.00 79.33  ? 311  SER A OG    1 
ATOM   2151  N  N     . LEU A 1 312  ? -68.970 -28.053 -40.185 1.00 85.65  ? 312  LEU A N     1 
ATOM   2152  C  CA    . LEU A 1 312  ? -68.944 -27.135 -39.050 1.00 84.74  ? 312  LEU A CA    1 
ATOM   2153  C  C     . LEU A 1 312  ? -69.089 -25.692 -39.504 1.00 81.87  ? 312  LEU A C     1 
ATOM   2154  O  O     . LEU A 1 312  ? -69.644 -24.863 -38.786 1.00 81.86  ? 312  LEU A O     1 
ATOM   2155  C  CB    . LEU A 1 312  ? -67.701 -27.282 -38.190 1.00 82.83  ? 312  LEU A CB    1 
ATOM   2156  C  CG    . LEU A 1 312  ? -67.396 -28.704 -37.776 1.00 83.56  ? 312  LEU A CG    1 
ATOM   2157  C  CD1   . LEU A 1 312  ? -66.279 -28.690 -36.745 1.00 91.96  ? 312  LEU A CD1   1 
ATOM   2158  C  CD2   . LEU A 1 312  ? -68.653 -29.362 -37.251 1.00 84.90  ? 312  LEU A CD2   1 
ATOM   2159  N  N     . ALA A 1 313  ? -68.604 -25.386 -40.696 1.00 80.09  ? 313  ALA A N     1 
ATOM   2160  C  CA    . ALA A 1 313  ? -68.740 -24.049 -41.300 1.00 88.29  ? 313  ALA A CA    1 
ATOM   2161  C  C     . ALA A 1 313  ? -70.188 -23.734 -41.586 1.00 89.17  ? 313  ALA A C     1 
ATOM   2162  O  O     . ALA A 1 313  ? -70.647 -22.664 -41.227 1.00 105.35 ? 313  ALA A O     1 
ATOM   2163  C  CB    . ALA A 1 313  ? -67.920 -23.955 -42.579 1.00 94.12  ? 313  ALA A CB    1 
ATOM   2164  N  N     . GLN A 1 314  ? -70.911 -24.655 -42.219 1.00 89.00  ? 314  GLN A N     1 
ATOM   2165  C  CA    . GLN A 1 314  ? -72.356 -24.527 -42.455 1.00 95.87  ? 314  GLN A CA    1 
ATOM   2166  C  C     . GLN A 1 314  ? -73.186 -24.397 -41.164 1.00 93.08  ? 314  GLN A C     1 
ATOM   2167  O  O     . GLN A 1 314  ? -74.222 -23.727 -41.166 1.00 94.34  ? 314  GLN A O     1 
ATOM   2168  C  CB    . GLN A 1 314  ? -72.869 -25.816 -43.114 1.00 99.65  ? 314  GLN A CB    1 
ATOM   2169  C  CG    . GLN A 1 314  ? -72.638 -25.962 -44.606 1.00 97.34  ? 314  GLN A CG    1 
ATOM   2170  C  CD    . GLN A 1 314  ? -72.907 -27.379 -45.090 1.00 91.20  ? 314  GLN A CD    1 
ATOM   2171  O  OE1   . GLN A 1 314  ? -73.197 -28.282 -44.303 1.00 76.43  ? 314  GLN A OE1   1 
ATOM   2172  N  NE2   . GLN A 1 314  ? -72.800 -27.580 -46.397 1.00 101.08 ? 314  GLN A NE2   1 
ATOM   2173  N  N     . VAL A 1 315  ? -72.755 -25.081 -40.103 1.00 85.33  ? 315  VAL A N     1 
ATOM   2174  C  CA    . VAL A 1 315  ? -73.408 -24.971 -38.814 1.00 86.26  ? 315  VAL A CA    1 
ATOM   2175  C  C     . VAL A 1 315  ? -73.172 -23.579 -38.237 1.00 88.09  ? 315  VAL A C     1 
ATOM   2176  O  O     . VAL A 1 315  ? -74.070 -23.003 -37.649 1.00 89.64  ? 315  VAL A O     1 
ATOM   2177  C  CB    . VAL A 1 315  ? -73.016 -26.117 -37.864 1.00 96.02  ? 315  VAL A CB    1 
ATOM   2178  C  CG1   . VAL A 1 315  ? -73.378 -25.789 -36.418 1.00 97.57  ? 315  VAL A CG1   1 
ATOM   2179  C  CG2   . VAL A 1 315  ? -73.698 -27.415 -38.311 1.00 94.89  ? 315  VAL A CG2   1 
ATOM   2180  N  N     . LYS A 1 316  ? -71.978 -23.037 -38.424 1.00 99.19  ? 316  LYS A N     1 
ATOM   2181  C  CA    . LYS A 1 316  ? -71.684 -21.678 -37.970 1.00 99.78  ? 316  LYS A CA    1 
ATOM   2182  C  C     . LYS A 1 316  ? -72.587 -20.656 -38.656 1.00 94.74  ? 316  LYS A C     1 
ATOM   2183  O  O     . LYS A 1 316  ? -73.059 -19.724 -38.015 1.00 110.17 ? 316  LYS A O     1 
ATOM   2184  C  CB    . LYS A 1 316  ? -70.207 -21.317 -38.198 1.00 105.82 ? 316  LYS A CB    1 
ATOM   2185  C  CG    . LYS A 1 316  ? -69.796 -19.956 -37.651 1.00 114.13 ? 316  LYS A CG    1 
ATOM   2186  C  CD    . LYS A 1 316  ? -68.276 -19.830 -37.514 1.00 123.73 ? 316  LYS A CD    1 
ATOM   2187  C  CE    . LYS A 1 316  ? -67.651 -18.798 -38.447 1.00 126.17 ? 316  LYS A CE    1 
ATOM   2188  N  NZ    . LYS A 1 316  ? -67.581 -17.447 -37.813 1.00 128.30 ? 316  LYS A NZ    1 
ATOM   2189  N  N     . ASP A 1 317  ? -72.870 -20.864 -39.939 1.00 91.80  ? 317  ASP A N     1 
ATOM   2190  C  CA    . ASP A 1 317  ? -73.770 -19.974 -40.703 1.00 105.09 ? 317  ASP A CA    1 
ATOM   2191  C  C     . ASP A 1 317  ? -75.242 -20.078 -40.340 1.00 111.36 ? 317  ASP A C     1 
ATOM   2192  O  O     . ASP A 1 317  ? -75.925 -19.068 -40.222 1.00 121.52 ? 317  ASP A O     1 
ATOM   2193  C  CB    . ASP A 1 317  ? -73.648 -20.260 -42.191 1.00 120.81 ? 317  ASP A CB    1 
ATOM   2194  C  CG    . ASP A 1 317  ? -72.226 -20.292 -42.653 1.00 132.23 ? 317  ASP A CG    1 
ATOM   2195  O  OD1   . ASP A 1 317  ? -71.348 -19.876 -41.861 1.00 154.84 ? 317  ASP A OD1   1 
ATOM   2196  O  OD2   . ASP A 1 317  ? -71.991 -20.744 -43.796 1.00 138.53 ? 317  ASP A OD2   1 
ATOM   2197  N  N     . ILE A 1 318  ? -75.731 -21.308 -40.211 1.00 114.64 ? 318  ILE A N     1 
ATOM   2198  C  CA    . ILE A 1 318  ? -77.106 -21.576 -39.772 1.00 108.49 ? 318  ILE A CA    1 
ATOM   2199  C  C     . ILE A 1 318  ? -77.376 -20.889 -38.421 1.00 107.37 ? 318  ILE A C     1 
ATOM   2200  O  O     . ILE A 1 318  ? -78.393 -20.210 -38.268 1.00 121.13 ? 318  ILE A O     1 
ATOM   2201  C  CB    . ILE A 1 318  ? -77.406 -23.094 -39.752 1.00 105.63 ? 318  ILE A CB    1 
ATOM   2202  C  CG1   . ILE A 1 318  ? -77.367 -23.626 -41.179 1.00 104.76 ? 318  ILE A CG1   1 
ATOM   2203  C  CG2   . ILE A 1 318  ? -78.759 -23.413 -39.124 1.00 103.74 ? 318  ILE A CG2   1 
ATOM   2204  C  CD1   . ILE A 1 318  ? -77.034 -25.098 -41.267 1.00 109.88 ? 318  ILE A CD1   1 
ATOM   2205  N  N     . LEU A 1 319  ? -76.461 -21.053 -37.466 1.00 91.01  ? 319  LEU A N     1 
ATOM   2206  C  CA    . LEU A 1 319  ? -76.614 -20.500 -36.127 1.00 81.97  ? 319  LEU A CA    1 
ATOM   2207  C  C     . LEU A 1 319  ? -76.416 -18.978 -36.076 1.00 86.42  ? 319  LEU A C     1 
ATOM   2208  O  O     . LEU A 1 319  ? -76.937 -18.331 -35.179 1.00 94.03  ? 319  LEU A O     1 
ATOM   2209  C  CB    . LEU A 1 319  ? -75.659 -21.189 -35.154 1.00 79.05  ? 319  LEU A CB    1 
ATOM   2210  C  CG    . LEU A 1 319  ? -75.585 -22.717 -34.992 1.00 86.13  ? 319  LEU A CG    1 
ATOM   2211  C  CD1   . LEU A 1 319  ? -75.327 -23.136 -33.540 1.00 80.91  ? 319  LEU A CD1   1 
ATOM   2212  C  CD2   . LEU A 1 319  ? -76.826 -23.421 -35.531 1.00 95.64  ? 319  LEU A CD2   1 
ATOM   2213  N  N     . ALA A 1 320  ? -75.629 -18.420 -36.991 1.00 87.09  ? 320  ALA A N     1 
ATOM   2214  C  CA    . ALA A 1 320  ? -75.455 -16.967 -37.059 1.00 92.00  ? 320  ALA A CA    1 
ATOM   2215  C  C     . ALA A 1 320  ? -76.759 -16.288 -37.477 1.00 100.16 ? 320  ALA A C     1 
ATOM   2216  O  O     . ALA A 1 320  ? -77.129 -15.251 -36.936 1.00 115.76 ? 320  ALA A O     1 
ATOM   2217  C  CB    . ALA A 1 320  ? -74.324 -16.590 -38.000 1.00 95.96  ? 320  ALA A CB    1 
ATOM   2218  N  N     . ASP A 1 321  ? -77.447 -16.905 -38.433 1.00 98.87  ? 321  ASP A N     1 
ATOM   2219  C  CA    . ASP A 1 321  ? -78.739 -16.446 -38.934 1.00 101.57 ? 321  ASP A CA    1 
ATOM   2220  C  C     . ASP A 1 321  ? -79.834 -16.594 -37.870 1.00 112.97 ? 321  ASP A C     1 
ATOM   2221  O  O     . ASP A 1 321  ? -80.604 -15.669 -37.628 1.00 130.70 ? 321  ASP A O     1 
ATOM   2222  C  CB    . ASP A 1 321  ? -79.068 -17.317 -40.144 1.00 108.33 ? 321  ASP A CB    1 
ATOM   2223  C  CG    . ASP A 1 321  ? -80.256 -16.830 -40.923 1.00 127.72 ? 321  ASP A CG    1 
ATOM   2224  O  OD1   . ASP A 1 321  ? -80.417 -15.596 -41.061 1.00 150.38 ? 321  ASP A OD1   1 
ATOM   2225  O  OD2   . ASP A 1 321  ? -81.020 -17.693 -41.417 1.00 126.52 ? 321  ASP A OD2   1 
ATOM   2226  N  N     . VAL A 1 322  ? -79.898 -17.763 -37.243 1.00 110.37 ? 322  VAL A N     1 
ATOM   2227  C  CA    . VAL A 1 322  ? -80.866 -18.051 -36.173 1.00 101.25 ? 322  VAL A CA    1 
ATOM   2228  C  C     . VAL A 1 322  ? -80.720 -17.071 -35.016 1.00 101.65 ? 322  VAL A C     1 
ATOM   2229  O  O     . VAL A 1 322  ? -81.704 -16.550 -34.527 1.00 106.52 ? 322  VAL A O     1 
ATOM   2230  C  CB    . VAL A 1 322  ? -80.638 -19.480 -35.646 1.00 106.33 ? 322  VAL A CB    1 
ATOM   2231  C  CG1   . VAL A 1 322  ? -81.318 -19.714 -34.303 1.00 100.05 ? 322  VAL A CG1   1 
ATOM   2232  C  CG2   . VAL A 1 322  ? -81.099 -20.492 -36.691 1.00 110.76 ? 322  VAL A CG2   1 
ATOM   2233  N  N     . VAL A 1 323  ? -79.487 -16.830 -34.586 1.00 105.99 ? 323  VAL A N     1 
ATOM   2234  C  CA    . VAL A 1 323  ? -79.175 -15.825 -33.552 1.00 111.72 ? 323  VAL A CA    1 
ATOM   2235  C  C     . VAL A 1 323  ? -79.730 -14.418 -33.857 1.00 113.11 ? 323  VAL A C     1 
ATOM   2236  O  O     . VAL A 1 323  ? -80.179 -13.736 -32.944 1.00 122.14 ? 323  VAL A O     1 
ATOM   2237  C  CB    . VAL A 1 323  ? -77.665 -15.778 -33.249 1.00 112.92 ? 323  VAL A CB    1 
ATOM   2238  C  CG1   . VAL A 1 323  ? -77.295 -14.509 -32.478 1.00 111.21 ? 323  VAL A CG1   1 
ATOM   2239  C  CG2   . VAL A 1 323  ? -77.263 -17.032 -32.473 1.00 109.69 ? 323  VAL A CG2   1 
ATOM   2240  N  N     . GLN A 1 324  ? -79.696 -13.991 -35.119 1.00 115.49 ? 324  GLN A N     1 
ATOM   2241  C  CA    . GLN A 1 324  ? -80.246 -12.685 -35.527 1.00 129.04 ? 324  GLN A CA    1 
ATOM   2242  C  C     . GLN A 1 324  ? -81.770 -12.681 -35.747 1.00 138.89 ? 324  GLN A C     1 
ATOM   2243  O  O     . GLN A 1 324  ? -82.403 -11.640 -35.623 1.00 161.34 ? 324  GLN A O     1 
ATOM   2244  C  CB    . GLN A 1 324  ? -79.556 -12.197 -36.824 1.00 126.71 ? 324  GLN A CB    1 
ATOM   2245  C  CG    . GLN A 1 324  ? -78.269 -11.423 -36.592 1.00 130.45 ? 324  GLN A CG    1 
ATOM   2246  C  CD    . GLN A 1 324  ? -78.372 -10.488 -35.387 1.00 136.55 ? 324  GLN A CD    1 
ATOM   2247  O  OE1   . GLN A 1 324  ? -79.271 -9.646  -35.304 1.00 143.77 ? 324  GLN A OE1   1 
ATOM   2248  N  NE2   . GLN A 1 324  ? -77.468 -10.654 -34.434 1.00 125.45 ? 324  GLN A NE2   1 
ATOM   2249  N  N     . LYS A 1 325  ? -82.339 -13.836 -36.087 1.00 137.42 ? 325  LYS A N     1 
ATOM   2250  C  CA    . LYS A 1 325  ? -83.775 -13.978 -36.386 1.00 139.45 ? 325  LYS A CA    1 
ATOM   2251  C  C     . LYS A 1 325  ? -84.643 -14.270 -35.143 1.00 120.99 ? 325  LYS A C     1 
ATOM   2252  O  O     . LYS A 1 325  ? -85.857 -14.093 -35.204 1.00 118.15 ? 325  LYS A O     1 
ATOM   2253  C  CB    . LYS A 1 325  ? -83.977 -15.167 -37.356 1.00 147.55 ? 325  LYS A CB    1 
ATOM   2254  C  CG    . LYS A 1 325  ? -84.700 -14.868 -38.665 1.00 153.22 ? 325  LYS A CG    1 
ATOM   2255  C  CD    . LYS A 1 325  ? -83.726 -14.509 -39.786 1.00 149.72 ? 325  LYS A CD    1 
ATOM   2256  C  CE    . LYS A 1 325  ? -84.396 -14.608 -41.147 1.00 151.39 ? 325  LYS A CE    1 
ATOM   2257  N  NZ    . LYS A 1 325  ? -83.433 -14.368 -42.252 1.00 149.06 ? 325  LYS A NZ    1 
ATOM   2258  N  N     . LEU A 1 326  ? -84.026 -14.726 -34.066 1.00 119.45 ? 326  LEU A N     1 
ATOM   2259  C  CA    . LEU A 1 326  ? -84.746 -15.100 -32.834 1.00 124.41 ? 326  LEU A CA    1 
ATOM   2260  C  C     . LEU A 1 326  ? -84.316 -14.221 -31.653 1.00 131.53 ? 326  LEU A C     1 
ATOM   2261  O  O     . LEU A 1 326  ? -83.235 -13.624 -31.695 1.00 137.25 ? 326  LEU A O     1 
ATOM   2262  C  CB    . LEU A 1 326  ? -84.466 -16.569 -32.489 1.00 115.98 ? 326  LEU A CB    1 
ATOM   2263  C  CG    . LEU A 1 326  ? -85.574 -17.574 -32.769 1.00 104.96 ? 326  LEU A CG    1 
ATOM   2264  C  CD1   . LEU A 1 326  ? -85.991 -17.516 -34.237 1.00 98.29  ? 326  LEU A CD1   1 
ATOM   2265  C  CD2   . LEU A 1 326  ? -85.113 -18.960 -32.314 1.00 98.35  ? 326  LEU A CD2   1 
ATOM   2266  N  N     . PRO A 1 327  ? -85.156 -14.151 -30.599 1.00 125.65 ? 327  PRO A N     1 
ATOM   2267  C  CA    . PRO A 1 327  ? -84.857 -13.315 -29.426 1.00 118.86 ? 327  PRO A CA    1 
ATOM   2268  C  C     . PRO A 1 327  ? -83.810 -13.974 -28.530 1.00 120.63 ? 327  PRO A C     1 
ATOM   2269  O  O     . PRO A 1 327  ? -83.696 -15.218 -28.507 1.00 105.89 ? 327  PRO A O     1 
ATOM   2270  C  CB    . PRO A 1 327  ? -86.208 -13.242 -28.728 1.00 118.30 ? 327  PRO A CB    1 
ATOM   2271  C  CG    . PRO A 1 327  ? -86.838 -14.576 -29.022 1.00 111.49 ? 327  PRO A CG    1 
ATOM   2272  C  CD    . PRO A 1 327  ? -86.333 -15.017 -30.358 1.00 110.21 ? 327  PRO A CD    1 
ATOM   2273  N  N     . GLU A 1 328  ? -83.082 -13.153 -27.766 1.00 125.38 ? 328  GLU A N     1 
ATOM   2274  C  CA    . GLU A 1 328  ? -81.794 -13.577 -27.199 1.00 124.51 ? 328  GLU A CA    1 
ATOM   2275  C  C     . GLU A 1 328  ? -81.843 -14.349 -25.856 1.00 121.35 ? 328  GLU A C     1 
ATOM   2276  O  O     . GLU A 1 328  ? -80.853 -14.342 -25.117 1.00 131.45 ? 328  GLU A O     1 
ATOM   2277  C  CB    . GLU A 1 328  ? -80.826 -12.377 -27.102 1.00 124.47 ? 328  GLU A CB    1 
ATOM   2278  C  CG    . GLU A 1 328  ? -79.438 -12.667 -27.672 1.00 129.37 ? 328  GLU A CG    1 
ATOM   2279  C  CD    . GLU A 1 328  ? -78.626 -11.405 -27.942 1.00 138.61 ? 328  GLU A CD    1 
ATOM   2280  O  OE1   . GLU A 1 328  ? -78.571 -10.546 -27.040 1.00 158.02 ? 328  GLU A OE1   1 
ATOM   2281  O  OE2   . GLU A 1 328  ? -78.035 -11.266 -29.043 1.00 121.68 ? 328  GLU A OE2   1 
ATOM   2282  N  N     . GLU A 1 329  ? -82.966 -15.005 -25.552 1.00 108.64 ? 329  GLU A N     1 
ATOM   2283  C  CA    . GLU A 1 329  ? -82.968 -16.011 -24.482 1.00 124.69 ? 329  GLU A CA    1 
ATOM   2284  C  C     . GLU A 1 329  ? -83.462 -17.386 -24.921 1.00 123.43 ? 329  GLU A C     1 
ATOM   2285  O  O     . GLU A 1 329  ? -83.527 -18.294 -24.093 1.00 129.09 ? 329  GLU A O     1 
ATOM   2286  C  CB    . GLU A 1 329  ? -83.720 -15.554 -23.239 1.00 147.46 ? 329  GLU A CB    1 
ATOM   2287  C  CG    . GLU A 1 329  ? -83.407 -16.448 -22.034 1.00 158.25 ? 329  GLU A CG    1 
ATOM   2288  C  CD    . GLU A 1 329  ? -83.493 -15.740 -20.694 1.00 167.34 ? 329  GLU A CD    1 
ATOM   2289  O  OE1   . GLU A 1 329  ? -84.293 -14.782 -20.552 1.00 160.11 ? 329  GLU A OE1   1 
ATOM   2290  O  OE2   . GLU A 1 329  ? -82.765 -16.170 -19.769 1.00 162.71 ? 329  GLU A OE2   1 
ATOM   2291  N  N     . LYS A 1 330  ? -83.790 -17.532 -26.209 1.00 119.66 ? 330  LYS A N     1 
ATOM   2292  C  CA    . LYS A 1 330  ? -83.919 -18.841 -26.870 1.00 124.08 ? 330  LYS A CA    1 
ATOM   2293  C  C     . LYS A 1 330  ? -82.673 -19.210 -27.689 1.00 127.96 ? 330  LYS A C     1 
ATOM   2294  O  O     . LYS A 1 330  ? -82.567 -20.331 -28.172 1.00 131.91 ? 330  LYS A O     1 
ATOM   2295  C  CB    . LYS A 1 330  ? -85.215 -18.909 -27.708 1.00 136.87 ? 330  LYS A CB    1 
ATOM   2296  C  CG    . LYS A 1 330  ? -86.467 -19.238 -26.881 1.00 136.08 ? 330  LYS A CG    1 
ATOM   2297  C  CD    . LYS A 1 330  ? -87.749 -19.352 -27.694 1.00 127.14 ? 330  LYS A CD    1 
ATOM   2298  C  CE    . LYS A 1 330  ? -88.179 -17.998 -28.233 1.00 128.94 ? 330  LYS A CE    1 
ATOM   2299  N  NZ    . LYS A 1 330  ? -89.505 -18.068 -28.902 1.00 132.66 ? 330  LYS A NZ    1 
ATOM   2300  N  N     . THR A 1 331  ? -81.723 -18.290 -27.813 1.00 129.47 ? 331  THR A N     1 
ATOM   2301  C  CA    . THR A 1 331  ? -80.495 -18.469 -28.586 1.00 115.03 ? 331  THR A CA    1 
ATOM   2302  C  C     . THR A 1 331  ? -79.300 -18.537 -27.636 1.00 116.75 ? 331  THR A C     1 
ATOM   2303  O  O     . THR A 1 331  ? -78.258 -17.947 -27.911 1.00 133.38 ? 331  THR A O     1 
ATOM   2304  C  CB    . THR A 1 331  ? -80.325 -17.267 -29.543 1.00 106.73 ? 331  THR A CB    1 
ATOM   2305  O  OG1   . THR A 1 331  ? -80.258 -16.043 -28.793 1.00 92.04  ? 331  THR A OG1   1 
ATOM   2306  C  CG2   . THR A 1 331  ? -81.493 -17.188 -30.493 1.00 104.25 ? 331  THR A CG2   1 
ATOM   2307  N  N     . GLN A 1 332  ? -79.436 -19.280 -26.538 1.00 115.94 ? 332  GLN A N     1 
ATOM   2308  C  CA    . GLN A 1 332  ? -78.391 -19.316 -25.531 1.00 119.80 ? 332  GLN A CA    1 
ATOM   2309  C  C     . GLN A 1 332  ? -77.318 -20.343 -25.884 1.00 114.96 ? 332  GLN A C     1 
ATOM   2310  O  O     . GLN A 1 332  ? -76.119 -20.054 -25.826 1.00 115.33 ? 332  GLN A O     1 
ATOM   2311  C  CB    . GLN A 1 332  ? -78.954 -19.592 -24.137 1.00 115.35 ? 332  GLN A CB    1 
ATOM   2312  C  CG    . GLN A 1 332  ? -78.179 -18.888 -23.036 1.00 110.34 ? 332  GLN A CG    1 
ATOM   2313  C  CD    . GLN A 1 332  ? -78.408 -17.391 -23.043 1.00 103.45 ? 332  GLN A CD    1 
ATOM   2314  O  OE1   . GLN A 1 332  ? -79.557 -16.921 -23.011 1.00 103.15 ? 332  GLN A OE1   1 
ATOM   2315  N  NE2   . GLN A 1 332  ? -77.319 -16.630 -23.107 1.00 96.02  ? 332  GLN A NE2   1 
ATOM   2316  N  N     . MET A 1 333  ? -77.768 -21.543 -26.232 1.00 104.49 ? 333  MET A N     1 
ATOM   2317  C  CA    . MET A 1 333  ? -76.881 -22.591 -26.729 1.00 98.89  ? 333  MET A CA    1 
ATOM   2318  C  C     . MET A 1 333  ? -76.199 -22.164 -28.022 1.00 96.26  ? 333  MET A C     1 
ATOM   2319  O  O     . MET A 1 333  ? -75.003 -22.375 -28.192 1.00 96.10  ? 333  MET A O     1 
ATOM   2320  C  CB    . MET A 1 333  ? -77.669 -23.869 -26.991 1.00 102.95 ? 333  MET A CB    1 
ATOM   2321  C  CG    . MET A 1 333  ? -78.088 -24.614 -25.738 1.00 108.83 ? 333  MET A CG    1 
ATOM   2322  S  SD    . MET A 1 333  ? -76.660 -25.331 -24.897 1.00 117.53 ? 333  MET A SD    1 
ATOM   2323  C  CE    . MET A 1 333  ? -76.103 -26.518 -26.109 1.00 115.07 ? 333  MET A CE    1 
ATOM   2324  N  N     . TYR A 1 334  ? -76.964 -21.544 -28.913 1.00 95.75  ? 334  TYR A N     1 
ATOM   2325  C  CA    . TYR A 1 334  ? -76.468 -21.173 -30.228 1.00 103.15 ? 334  TYR A CA    1 
ATOM   2326  C  C     . TYR A 1 334  ? -75.413 -20.068 -30.171 1.00 93.20  ? 334  TYR A C     1 
ATOM   2327  O  O     . TYR A 1 334  ? -74.586 -19.974 -31.071 1.00 79.45  ? 334  TYR A O     1 
ATOM   2328  C  CB    . TYR A 1 334  ? -77.620 -20.830 -31.197 1.00 106.11 ? 334  TYR A CB    1 
ATOM   2329  C  CG    . TYR A 1 334  ? -78.807 -21.783 -31.136 1.00 102.87 ? 334  TYR A CG    1 
ATOM   2330  C  CD1   . TYR A 1 334  ? -78.727 -23.023 -30.489 1.00 90.60  ? 334  TYR A CD1   1 
ATOM   2331  C  CD2   . TYR A 1 334  ? -80.012 -21.441 -31.738 1.00 103.69 ? 334  TYR A CD2   1 
ATOM   2332  C  CE1   . TYR A 1 334  ? -79.822 -23.863 -30.426 1.00 92.39  ? 334  TYR A CE1   1 
ATOM   2333  C  CE2   . TYR A 1 334  ? -81.106 -22.291 -31.687 1.00 99.89  ? 334  TYR A CE2   1 
ATOM   2334  C  CZ    . TYR A 1 334  ? -81.004 -23.499 -31.024 1.00 92.05  ? 334  TYR A CZ    1 
ATOM   2335  O  OH    . TYR A 1 334  ? -82.082 -24.350 -30.966 1.00 88.52  ? 334  TYR A OH    1 
ATOM   2336  N  N     . HIS A 1 335  ? -75.421 -19.252 -29.125 1.00 88.66  ? 335  HIS A N     1 
ATOM   2337  C  CA    . HIS A 1 335  ? -74.341 -18.278 -28.909 1.00 94.31  ? 335  HIS A CA    1 
ATOM   2338  C  C     . HIS A 1 335  ? -73.029 -18.897 -28.467 1.00 89.23  ? 335  HIS A C     1 
ATOM   2339  O  O     . HIS A 1 335  ? -71.966 -18.478 -28.923 1.00 90.45  ? 335  HIS A O     1 
ATOM   2340  C  CB    . HIS A 1 335  ? -74.758 -17.194 -27.909 1.00 108.35 ? 335  HIS A CB    1 
ATOM   2341  C  CG    . HIS A 1 335  ? -75.229 -15.930 -28.559 1.00 124.19 ? 335  HIS A CG    1 
ATOM   2342  N  ND1   . HIS A 1 335  ? -76.555 -15.549 -28.581 1.00 126.40 ? 335  HIS A ND1   1 
ATOM   2343  C  CD2   . HIS A 1 335  ? -74.548 -14.960 -29.216 1.00 132.96 ? 335  HIS A CD2   1 
ATOM   2344  C  CE1   . HIS A 1 335  ? -76.669 -14.398 -29.221 1.00 129.48 ? 335  HIS A CE1   1 
ATOM   2345  N  NE2   . HIS A 1 335  ? -75.466 -14.017 -29.613 1.00 131.50 ? 335  HIS A NE2   1 
ATOM   2346  N  N     . ALA A 1 336  ? -73.101 -19.870 -27.565 1.00 86.10  ? 336  ALA A N     1 
ATOM   2347  C  CA    . ALA A 1 336  ? -71.904 -20.564 -27.082 1.00 84.52  ? 336  ALA A CA    1 
ATOM   2348  C  C     . ALA A 1 336  ? -71.235 -21.379 -28.183 1.00 90.17  ? 336  ALA A C     1 
ATOM   2349  O  O     . ALA A 1 336  ? -70.007 -21.437 -28.248 1.00 100.81 ? 336  ALA A O     1 
ATOM   2350  C  CB    . ALA A 1 336  ? -72.253 -21.509 -25.953 1.00 82.70  ? 336  ALA A CB    1 
ATOM   2351  N  N     . LEU A 1 337  ? -72.043 -22.011 -29.033 1.00 91.31  ? 337  LEU A N     1 
ATOM   2352  C  CA    . LEU A 1 337  ? -71.541 -22.727 -30.216 1.00 91.39  ? 337  LEU A CA    1 
ATOM   2353  C  C     . LEU A 1 337  ? -70.887 -21.771 -31.229 1.00 103.35 ? 337  LEU A C     1 
ATOM   2354  O  O     . LEU A 1 337  ? -69.800 -22.061 -31.718 1.00 125.44 ? 337  LEU A O     1 
ATOM   2355  C  CB    . LEU A 1 337  ? -72.666 -23.517 -30.868 1.00 87.87  ? 337  LEU A CB    1 
ATOM   2356  C  CG    . LEU A 1 337  ? -73.274 -24.644 -30.012 1.00 89.95  ? 337  LEU A CG    1 
ATOM   2357  C  CD1   . LEU A 1 337  ? -74.500 -25.213 -30.702 1.00 92.75  ? 337  LEU A CD1   1 
ATOM   2358  C  CD2   . LEU A 1 337  ? -72.316 -25.784 -29.702 1.00 88.13  ? 337  LEU A CD2   1 
ATOM   2359  N  N     . LEU A 1 338  ? -71.534 -20.643 -31.532 1.00 106.60 ? 338  LEU A N     1 
ATOM   2360  C  CA    . LEU A 1 338  ? -70.925 -19.615 -32.398 1.00 102.06 ? 338  LEU A CA    1 
ATOM   2361  C  C     . LEU A 1 338  ? -69.589 -19.101 -31.872 1.00 102.93 ? 338  LEU A C     1 
ATOM   2362  O  O     . LEU A 1 338  ? -68.667 -18.852 -32.662 1.00 110.74 ? 338  LEU A O     1 
ATOM   2363  C  CB    . LEU A 1 338  ? -71.863 -18.430 -32.670 1.00 109.10 ? 338  LEU A CB    1 
ATOM   2364  C  CG    . LEU A 1 338  ? -72.376 -18.337 -34.114 1.00 103.06 ? 338  LEU A CG    1 
ATOM   2365  C  CD1   . LEU A 1 338  ? -73.494 -19.318 -34.291 1.00 95.71  ? 338  LEU A CD1   1 
ATOM   2366  C  CD2   . LEU A 1 338  ? -72.866 -16.949 -34.510 1.00 106.67 ? 338  LEU A CD2   1 
ATOM   2367  N  N     . LYS A 1 339  ? -69.513 -18.912 -30.551 1.00 97.88  ? 339  LYS A N     1 
ATOM   2368  C  CA    . LYS A 1 339  ? -68.294 -18.418 -29.909 1.00 97.88  ? 339  LYS A CA    1 
ATOM   2369  C  C     . LYS A 1 339  ? -67.128 -19.343 -30.173 1.00 98.74  ? 339  LYS A C     1 
ATOM   2370  O  O     . LYS A 1 339  ? -66.074 -18.916 -30.619 1.00 102.16 ? 339  LYS A O     1 
ATOM   2371  C  CB    . LYS A 1 339  ? -68.487 -18.285 -28.405 1.00 100.30 ? 339  LYS A CB    1 
ATOM   2372  C  CG    . LYS A 1 339  ? -67.365 -17.526 -27.711 1.00 104.07 ? 339  LYS A CG    1 
ATOM   2373  C  CD    . LYS A 1 339  ? -67.310 -17.821 -26.214 1.00 103.42 ? 339  LYS A CD    1 
ATOM   2374  C  CE    . LYS A 1 339  ? -66.367 -16.861 -25.499 1.00 104.56 ? 339  LYS A CE    1 
ATOM   2375  N  NZ    . LYS A 1 339  ? -65.643 -17.522 -24.372 1.00 111.91 ? 339  LYS A NZ    1 
ATOM   2376  N  N     . HIS A 1 340  ? -67.328 -20.621 -29.904 1.00 100.03 ? 340  HIS A N     1 
ATOM   2377  C  CA    . HIS A 1 340  ? -66.266 -21.610 -30.078 1.00 97.63  ? 340  HIS A CA    1 
ATOM   2378  C  C     . HIS A 1 340  ? -66.015 -22.016 -31.510 1.00 94.40  ? 340  HIS A C     1 
ATOM   2379  O  O     . HIS A 1 340  ? -64.933 -22.496 -31.794 1.00 101.44 ? 340  HIS A O     1 
ATOM   2380  C  CB    . HIS A 1 340  ? -66.563 -22.824 -29.217 1.00 87.28  ? 340  HIS A CB    1 
ATOM   2381  C  CG    . HIS A 1 340  ? -66.150 -22.622 -27.815 1.00 83.11  ? 340  HIS A CG    1 
ATOM   2382  N  ND1   . HIS A 1 340  ? -66.101 -23.645 -26.900 1.00 87.23  ? 340  HIS A ND1   1 
ATOM   2383  C  CD2   . HIS A 1 340  ? -65.707 -21.512 -27.180 1.00 83.99  ? 340  HIS A CD2   1 
ATOM   2384  C  CE1   . HIS A 1 340  ? -65.665 -23.168 -25.747 1.00 93.57  ? 340  HIS A CE1   1 
ATOM   2385  N  NE2   . HIS A 1 340  ? -65.420 -21.876 -25.891 1.00 93.48  ? 340  HIS A NE2   1 
ATOM   2386  N  N     . LEU A 1 341  ? -66.992 -21.826 -32.398 1.00 85.99  ? 341  LEU A N     1 
ATOM   2387  C  CA    . LEU A 1 341  ? -66.806 -22.043 -33.850 1.00 93.13  ? 341  LEU A CA    1 
ATOM   2388  C  C     . LEU A 1 341  ? -65.999 -20.919 -34.514 1.00 92.23  ? 341  LEU A C     1 
ATOM   2389  O  O     . LEU A 1 341  ? -65.332 -21.147 -35.530 1.00 89.03  ? 341  LEU A O     1 
ATOM   2390  C  CB    . LEU A 1 341  ? -68.142 -22.199 -34.600 1.00 102.26 ? 341  LEU A CB    1 
ATOM   2391  C  CG    . LEU A 1 341  ? -68.974 -23.494 -34.498 1.00 106.25 ? 341  LEU A CG    1 
ATOM   2392  C  CD1   . LEU A 1 341  ? -70.176 -23.414 -35.441 1.00 102.74 ? 341  LEU A CD1   1 
ATOM   2393  C  CD2   . LEU A 1 341  ? -68.146 -24.743 -34.775 1.00 105.93 ? 341  LEU A CD2   1 
ATOM   2394  N  N     . GLY A 1 342  ? -66.063 -19.711 -33.962 1.00 96.27  ? 342  GLY A N     1 
ATOM   2395  C  CA    . GLY A 1 342  ? -65.234 -18.609 -34.442 1.00 96.95  ? 342  GLY A CA    1 
ATOM   2396  C  C     . GLY A 1 342  ? -63.735 -18.868 -34.319 1.00 94.26  ? 342  GLY A C     1 
ATOM   2397  O  O     . GLY A 1 342  ? -62.967 -18.407 -35.159 1.00 108.33 ? 342  GLY A O     1 
ATOM   2398  N  N     . THR A 1 343  ? -63.338 -19.593 -33.277 1.00 84.53  ? 343  THR A N     1 
ATOM   2399  C  CA    . THR A 1 343  ? -61.938 -19.953 -33.015 1.00 85.99  ? 343  THR A CA    1 
ATOM   2400  C  C     . THR A 1 343  ? -61.513 -21.335 -33.494 1.00 87.40  ? 343  THR A C     1 
ATOM   2401  O  O     . THR A 1 343  ? -60.318 -21.595 -33.624 1.00 82.85  ? 343  THR A O     1 
ATOM   2402  C  CB    . THR A 1 343  ? -61.634 -19.934 -31.518 1.00 89.96  ? 343  THR A CB    1 
ATOM   2403  O  OG1   . THR A 1 343  ? -62.398 -20.960 -30.863 1.00 97.55  ? 343  THR A OG1   1 
ATOM   2404  C  CG2   . THR A 1 343  ? -61.936 -18.567 -30.940 1.00 85.27  ? 343  THR A CG2   1 
ATOM   2405  N  N     . LEU A 1 344  ? -62.476 -22.202 -33.746 1.00 92.50  ? 344  LEU A N     1 
ATOM   2406  C  CA    . LEU A 1 344  ? -62.200 -23.648 -34.015 1.00 91.40  ? 344  LEU A CA    1 
ATOM   2407  C  C     . LEU A 1 344  ? -61.429 -23.836 -35.316 1.00 88.51  ? 344  LEU A C     1 
ATOM   2408  O  O     . LEU A 1 344  ? -61.962 -23.592 -36.390 1.00 86.09  ? 344  LEU A O     1 
ATOM   2409  C  CB    . LEU A 1 344  ? -63.492 -24.464 -34.086 1.00 90.78  ? 344  LEU A CB    1 
ATOM   2410  C  CG    . LEU A 1 344  ? -63.348 -25.979 -33.940 1.00 88.83  ? 344  LEU A CG    1 
ATOM   2411  C  CD1   . LEU A 1 344  ? -64.679 -26.589 -33.564 1.00 90.68  ? 344  LEU A CD1   1 
ATOM   2412  C  CD2   . LEU A 1 344  ? -62.822 -26.663 -35.186 1.00 92.96  ? 344  LEU A CD2   1 
ATOM   2413  N  N     . ALA A 1 345  ? -60.178 -24.278 -35.210 1.00 90.36  ? 345  ALA A N     1 
ATOM   2414  C  CA    . ALA A 1 345  ? -59.291 -24.537 -36.378 1.00 95.22  ? 345  ALA A CA    1 
ATOM   2415  C  C     . ALA A 1 345  ? -59.220 -23.292 -37.268 1.00 92.50  ? 345  ALA A C     1 
ATOM   2416  O  O     . ALA A 1 345  ? -59.104 -22.197 -36.742 1.00 101.15 ? 345  ALA A O     1 
ATOM   2417  C  CB    . ALA A 1 345  ? -59.773 -25.737 -37.168 1.00 100.45 ? 345  ALA A CB    1 
ATOM   2418  N  N     . GLY A 1 346  ? -59.272 -23.460 -38.590 1.00 89.69  ? 346  GLY A N     1 
ATOM   2419  C  CA    . GLY A 1 346  ? -59.479 -22.358 -39.520 1.00 97.08  ? 346  GLY A CA    1 
ATOM   2420  C  C     . GLY A 1 346  ? -60.598 -22.703 -40.491 1.00 102.57 ? 346  GLY A C     1 
ATOM   2421  O  O     . GLY A 1 346  ? -61.328 -23.691 -40.296 1.00 115.42 ? 346  GLY A O     1 
ATOM   2422  N  N     . SER A 1 347  ? -60.701 -21.920 -41.566 1.00 93.92  ? 347  SER A N     1 
ATOM   2423  C  CA    . SER A 1 347  ? -61.818 -22.017 -42.514 1.00 87.67  ? 347  SER A CA    1 
ATOM   2424  C  C     . SER A 1 347  ? -61.858 -23.331 -43.299 1.00 88.76  ? 347  SER A C     1 
ATOM   2425  O  O     . SER A 1 347  ? -62.939 -23.852 -43.575 1.00 91.77  ? 347  SER A O     1 
ATOM   2426  C  CB    . SER A 1 347  ? -61.781 -20.850 -43.511 1.00 95.02  ? 347  SER A CB    1 
ATOM   2427  O  OG    . SER A 1 347  ? -62.910 -20.850 -44.395 1.00 89.02  ? 347  SER A OG    1 
ATOM   2428  N  N     . GLN A 1 348  ? -60.681 -23.881 -43.609 1.00 93.65  ? 348  GLN A N     1 
ATOM   2429  C  CA    . GLN A 1 348  ? -60.553 -25.086 -44.428 1.00 90.63  ? 348  GLN A CA    1 
ATOM   2430  C  C     . GLN A 1 348  ? -61.047 -26.323 -43.673 1.00 81.44  ? 348  GLN A C     1 
ATOM   2431  O  O     . GLN A 1 348  ? -61.862 -27.099 -44.195 1.00 87.75  ? 348  GLN A O     1 
ATOM   2432  C  CB    . GLN A 1 348  ? -59.108 -25.225 -44.966 1.00 90.33  ? 348  GLN A CB    1 
ATOM   2433  C  CG    . GLN A 1 348  ? -58.557 -23.956 -45.628 1.00 84.46  ? 348  GLN A CG    1 
ATOM   2434  C  CD    . GLN A 1 348  ? -57.934 -23.017 -44.608 1.00 96.69  ? 348  GLN A CD    1 
ATOM   2435  O  OE1   . GLN A 1 348  ? -58.502 -21.974 -44.248 1.00 104.62 ? 348  GLN A OE1   1 
ATOM   2436  N  NE2   . GLN A 1 348  ? -56.781 -23.410 -44.094 1.00 98.96  ? 348  GLN A NE2   1 
ATOM   2437  N  N     . ILE A 1 349  ? -60.567 -26.491 -42.450 1.00 77.62  ? 349  ILE A N     1 
ATOM   2438  C  CA    . ILE A 1 349  ? -60.982 -27.601 -41.603 1.00 83.92  ? 349  ILE A CA    1 
ATOM   2439  C  C     . ILE A 1 349  ? -62.455 -27.504 -41.213 1.00 76.90  ? 349  ILE A C     1 
ATOM   2440  O  O     . ILE A 1 349  ? -63.156 -28.520 -41.203 1.00 75.91  ? 349  ILE A O     1 
ATOM   2441  C  CB    . ILE A 1 349  ? -60.159 -27.682 -40.299 1.00 88.45  ? 349  ILE A CB    1 
ATOM   2442  C  CG1   . ILE A 1 349  ? -58.667 -27.813 -40.620 1.00 94.01  ? 349  ILE A CG1   1 
ATOM   2443  C  CG2   . ILE A 1 349  ? -60.625 -28.858 -39.443 1.00 80.18  ? 349  ILE A CG2   1 
ATOM   2444  C  CD1   . ILE A 1 349  ? -58.379 -28.961 -41.575 1.00 96.70  ? 349  ILE A CD1   1 
ATOM   2445  N  N     . ARG A 1 350  ? -62.938 -26.301 -40.901 1.00 74.11  ? 350  ARG A N     1 
ATOM   2446  C  CA    . ARG A 1 350  ? -64.371 -26.130 -40.618 1.00 78.11  ? 350  ARG A CA    1 
ATOM   2447  C  C     . ARG A 1 350  ? -65.249 -26.553 -41.800 1.00 80.84  ? 350  ARG A C     1 
ATOM   2448  O  O     . ARG A 1 350  ? -66.304 -27.141 -41.598 1.00 93.79  ? 350  ARG A O     1 
ATOM   2449  C  CB    . ARG A 1 350  ? -64.690 -24.670 -40.333 1.00 76.40  ? 350  ARG A CB    1 
ATOM   2450  C  CG    . ARG A 1 350  ? -64.308 -24.187 -38.957 1.00 79.44  ? 350  ARG A CG    1 
ATOM   2451  C  CD    . ARG A 1 350  ? -65.111 -22.950 -38.586 1.00 84.82  ? 350  ARG A CD    1 
ATOM   2452  N  NE    . ARG A 1 350  ? -64.751 -21.755 -39.344 1.00 78.66  ? 350  ARG A NE    1 
ATOM   2453  C  CZ    . ARG A 1 350  ? -63.675 -21.023 -39.104 1.00 79.15  ? 350  ARG A CZ    1 
ATOM   2454  N  NH1   . ARG A 1 350  ? -62.820 -21.351 -38.143 1.00 78.30  ? 350  ARG A NH1   1 
ATOM   2455  N  NH2   . ARG A 1 350  ? -63.444 -19.958 -39.844 1.00 91.06  ? 350  ARG A NH2   1 
ATOM   2456  N  N     . ASN A 1 351  ? -64.817 -26.243 -43.021 1.00 77.85  ? 351  ASN A N     1 
ATOM   2457  C  CA    . ASN A 1 351  ? -65.571 -26.609 -44.220 1.00 76.07  ? 351  ASN A CA    1 
ATOM   2458  C  C     . ASN A 1 351  ? -65.470 -28.069 -44.600 1.00 77.22  ? 351  ASN A C     1 
ATOM   2459  O  O     . ASN A 1 351  ? -66.293 -28.550 -45.375 1.00 76.85  ? 351  ASN A O     1 
ATOM   2460  C  CB    . ASN A 1 351  ? -65.149 -25.772 -45.404 1.00 78.05  ? 351  ASN A CB    1 
ATOM   2461  C  CG    . ASN A 1 351  ? -65.813 -24.444 -45.398 1.00 77.58  ? 351  ASN A CG    1 
ATOM   2462  O  OD1   . ASN A 1 351  ? -66.935 -24.308 -45.838 1.00 85.77  ? 351  ASN A OD1   1 
ATOM   2463  N  ND2   . ASN A 1 351  ? -65.137 -23.461 -44.876 1.00 85.29  ? 351  ASN A ND2   1 
ATOM   2464  N  N     . MET A 1 352  ? -64.455 -28.761 -44.090 1.00 77.99  ? 352  MET A N     1 
ATOM   2465  C  CA    . MET A 1 352  ? -64.302 -30.205 -44.299 1.00 82.78  ? 352  MET A CA    1 
ATOM   2466  C  C     . MET A 1 352  ? -64.960 -31.020 -43.201 1.00 81.09  ? 352  MET A C     1 
ATOM   2467  O  O     . MET A 1 352  ? -65.672 -31.977 -43.490 1.00 74.40  ? 352  MET A O     1 
ATOM   2468  C  CB    . MET A 1 352  ? -62.825 -30.569 -44.324 1.00 91.06  ? 352  MET A CB    1 
ATOM   2469  C  CG    . MET A 1 352  ? -62.072 -29.992 -45.503 1.00 96.72  ? 352  MET A CG    1 
ATOM   2470  S  SD    . MET A 1 352  ? -60.308 -30.179 -45.265 1.00 99.53  ? 352  MET A SD    1 
ATOM   2471  C  CE    . MET A 1 352  ? -60.200 -31.938 -45.579 1.00 104.56 ? 352  MET A CE    1 
ATOM   2472  N  N     . ALA A 1 353  ? -64.729 -30.622 -41.943 1.00 82.77  ? 353  ALA A N     1 
ATOM   2473  C  CA    . ALA A 1 353  ? -65.227 -31.348 -40.777 1.00 91.66  ? 353  ALA A CA    1 
ATOM   2474  C  C     . ALA A 1 353  ? -66.744 -31.346 -40.657 1.00 102.22 ? 353  ALA A C     1 
ATOM   2475  O  O     . ALA A 1 353  ? -67.367 -30.302 -40.801 1.00 110.26 ? 353  ALA A O     1 
ATOM   2476  C  CB    . ALA A 1 353  ? -64.647 -30.770 -39.510 1.00 94.33  ? 353  ALA A CB    1 
ATOM   2477  N  N     . SER A 1 354  ? -67.315 -32.517 -40.364 1.00 102.52 ? 354  SER A N     1 
ATOM   2478  C  CA    . SER A 1 354  ? -68.758 -32.672 -40.159 1.00 89.68  ? 354  SER A CA    1 
ATOM   2479  C  C     . SER A 1 354  ? -69.096 -32.625 -38.684 1.00 84.00  ? 354  SER A C     1 
ATOM   2480  O  O     . SER A 1 354  ? -68.227 -32.852 -37.829 1.00 85.56  ? 354  SER A O     1 
ATOM   2481  C  CB    . SER A 1 354  ? -69.205 -34.052 -40.682 1.00 87.04  ? 354  SER A CB    1 
ATOM   2482  O  OG    . SER A 1 354  ? -69.251 -35.039 -39.650 1.00 78.46  ? 354  SER A OG    1 
ATOM   2483  N  N     . LEU A 1 355  ? -70.367 -32.337 -38.408 1.00 78.60  ? 355  LEU A N     1 
ATOM   2484  C  CA    . LEU A 1 355  ? -70.869 -32.244 -37.047 1.00 84.10  ? 355  LEU A CA    1 
ATOM   2485  C  C     . LEU A 1 355  ? -70.933 -33.612 -36.393 1.00 86.32  ? 355  LEU A C     1 
ATOM   2486  O  O     . LEU A 1 355  ? -70.562 -33.748 -35.237 1.00 86.21  ? 355  LEU A O     1 
ATOM   2487  C  CB    . LEU A 1 355  ? -72.262 -31.628 -37.071 1.00 92.34  ? 355  LEU A CB    1 
ATOM   2488  C  CG    . LEU A 1 355  ? -72.908 -31.387 -35.700 1.00 100.77 ? 355  LEU A CG    1 
ATOM   2489  C  CD1   . LEU A 1 355  ? -72.263 -30.205 -34.984 1.00 93.80  ? 355  LEU A CD1   1 
ATOM   2490  C  CD2   . LEU A 1 355  ? -74.404 -31.187 -35.875 1.00 105.33 ? 355  LEU A CD2   1 
ATOM   2491  N  N     . GLY A 1 356  ? -71.428 -34.608 -37.128 1.00 87.13  ? 356  GLY A N     1 
ATOM   2492  C  CA    . GLY A 1 356  ? -71.451 -35.991 -36.669 1.00 89.00  ? 356  GLY A CA    1 
ATOM   2493  C  C     . GLY A 1 356  ? -70.060 -36.543 -36.392 1.00 93.07  ? 356  GLY A C     1 
ATOM   2494  O  O     . GLY A 1 356  ? -69.833 -37.224 -35.385 1.00 90.20  ? 356  GLY A O     1 
ATOM   2495  N  N     . GLY A 1 357  ? -69.125 -36.245 -37.296 1.00 94.82  ? 357  GLY A N     1 
ATOM   2496  C  CA    . GLY A 1 357  ? -67.715 -36.593 -37.095 1.00 91.01  ? 357  GLY A CA    1 
ATOM   2497  C  C     . GLY A 1 357  ? -67.189 -36.018 -35.802 1.00 96.00  ? 357  GLY A C     1 
ATOM   2498  O  O     . GLY A 1 357  ? -66.577 -36.722 -35.008 1.00 105.70 ? 357  GLY A O     1 
ATOM   2499  N  N     . HIS A 1 358  ? -67.452 -34.737 -35.574 1.00 95.30  ? 358  HIS A N     1 
ATOM   2500  C  CA    . HIS A 1 358  ? -66.995 -34.072 -34.364 1.00 88.91  ? 358  HIS A CA    1 
ATOM   2501  C  C     . HIS A 1 358  ? -67.482 -34.774 -33.104 1.00 89.00  ? 358  HIS A C     1 
ATOM   2502  O  O     . HIS A 1 358  ? -66.692 -35.099 -32.211 1.00 94.17  ? 358  HIS A O     1 
ATOM   2503  C  CB    . HIS A 1 358  ? -67.500 -32.637 -34.323 1.00 84.24  ? 358  HIS A CB    1 
ATOM   2504  C  CG    . HIS A 1 358  ? -66.815 -31.811 -33.284 1.00 93.05  ? 358  HIS A CG    1 
ATOM   2505  N  ND1   . HIS A 1 358  ? -65.790 -30.939 -33.583 1.00 93.63  ? 358  HIS A ND1   1 
ATOM   2506  C  CD2   . HIS A 1 358  ? -66.970 -31.764 -31.940 1.00 98.10  ? 358  HIS A CD2   1 
ATOM   2507  C  CE1   . HIS A 1 358  ? -65.360 -30.372 -32.471 1.00 96.08  ? 358  HIS A CE1   1 
ATOM   2508  N  NE2   . HIS A 1 358  ? -66.061 -30.853 -31.459 1.00 97.80  ? 358  HIS A NE2   1 
ATOM   2509  N  N     . ILE A 1 359  ? -68.788 -35.000 -33.047 1.00 79.58  ? 359  ILE A N     1 
ATOM   2510  C  CA    . ILE A 1 359  ? -69.435 -35.599 -31.885 1.00 84.60  ? 359  ILE A CA    1 
ATOM   2511  C  C     . ILE A 1 359  ? -68.939 -37.025 -31.639 1.00 83.22  ? 359  ILE A C     1 
ATOM   2512  O  O     . ILE A 1 359  ? -68.646 -37.379 -30.502 1.00 79.50  ? 359  ILE A O     1 
ATOM   2513  C  CB    . ILE A 1 359  ? -70.961 -35.587 -32.127 1.00 90.48  ? 359  ILE A CB    1 
ATOM   2514  C  CG1   . ILE A 1 359  ? -71.532 -34.190 -31.846 1.00 90.69  ? 359  ILE A CG1   1 
ATOM   2515  C  CG2   . ILE A 1 359  ? -71.674 -36.655 -31.305 1.00 95.98  ? 359  ILE A CG2   1 
ATOM   2516  C  CD1   . ILE A 1 359  ? -72.920 -33.979 -32.424 1.00 90.20  ? 359  ILE A CD1   1 
ATOM   2517  N  N     . ILE A 1 360  ? -68.843 -37.834 -32.694 1.00 78.40  ? 360  ILE A N     1 
ATOM   2518  C  CA    . ILE A 1 360  ? -68.462 -39.245 -32.554 1.00 79.02  ? 360  ILE A CA    1 
ATOM   2519  C  C     . ILE A 1 360  ? -66.969 -39.419 -32.254 1.00 81.42  ? 360  ILE A C     1 
ATOM   2520  O  O     . ILE A 1 360  ? -66.594 -40.338 -31.511 1.00 81.55  ? 360  ILE A O     1 
ATOM   2521  C  CB    . ILE A 1 360  ? -68.826 -40.038 -33.826 1.00 84.58  ? 360  ILE A CB    1 
ATOM   2522  C  CG1   . ILE A 1 360  ? -70.341 -40.058 -34.014 1.00 87.66  ? 360  ILE A CG1   1 
ATOM   2523  C  CG2   . ILE A 1 360  ? -68.267 -41.469 -33.792 1.00 88.43  ? 360  ILE A CG2   1 
ATOM   2524  C  CD1   . ILE A 1 360  ? -71.111 -40.763 -32.911 1.00 89.24  ? 360  ILE A CD1   1 
ATOM   2525  N  N     . SER A 1 361  ? -66.129 -38.550 -32.832 1.00 83.26  ? 361  SER A N     1 
ATOM   2526  C  CA    . SER A 1 361  ? -64.680 -38.527 -32.571 1.00 85.30  ? 361  SER A CA    1 
ATOM   2527  C  C     . SER A 1 361  ? -64.363 -38.520 -31.084 1.00 98.37  ? 361  SER A C     1 
ATOM   2528  O  O     . SER A 1 361  ? -63.490 -39.259 -30.625 1.00 92.86  ? 361  SER A O     1 
ATOM   2529  C  CB    . SER A 1 361  ? -64.014 -37.298 -33.172 1.00 82.25  ? 361  SER A CB    1 
ATOM   2530  O  OG    . SER A 1 361  ? -64.441 -37.064 -34.480 1.00 84.14  ? 361  SER A OG    1 
ATOM   2531  N  N     . ARG A 1 362  ? -65.074 -37.674 -30.340 1.00 101.91 ? 362  ARG A N     1 
ATOM   2532  C  CA    . ARG A 1 362  ? -64.916 -37.542 -28.908 1.00 109.97 ? 362  ARG A CA    1 
ATOM   2533  C  C     . ARG A 1 362  ? -63.476 -37.240 -28.498 1.00 101.60 ? 362  ARG A C     1 
ATOM   2534  O  O     . ARG A 1 362  ? -62.899 -37.890 -27.619 1.00 106.72 ? 362  ARG A O     1 
ATOM   2535  C  CB    . ARG A 1 362  ? -65.497 -38.744 -28.171 1.00 113.44 ? 362  ARG A CB    1 
ATOM   2536  C  CG    . ARG A 1 362  ? -66.997 -38.610 -28.067 1.00 113.30 ? 362  ARG A CG    1 
ATOM   2537  C  CD    . ARG A 1 362  ? -67.661 -39.912 -27.710 1.00 117.01 ? 362  ARG A CD    1 
ATOM   2538  N  NE    . ARG A 1 362  ? -67.880 -40.773 -28.866 1.00 115.55 ? 362  ARG A NE    1 
ATOM   2539  C  CZ    . ARG A 1 362  ? -68.549 -41.922 -28.811 1.00 117.61 ? 362  ARG A CZ    1 
ATOM   2540  N  NH1   . ARG A 1 362  ? -69.068 -42.352 -27.656 1.00 110.47 ? 362  ARG A NH1   1 
ATOM   2541  N  NH2   . ARG A 1 362  ? -68.698 -42.647 -29.915 1.00 126.68 ? 362  ARG A NH2   1 
ATOM   2542  N  N     . HIS A 1 363  ? -62.912 -36.223 -29.147 1.00 89.09  ? 363  HIS A N     1 
ATOM   2543  C  CA    . HIS A 1 363  ? -61.607 -35.684 -28.776 1.00 99.64  ? 363  HIS A CA    1 
ATOM   2544  C  C     . HIS A 1 363  ? -61.677 -35.051 -27.400 1.00 97.59  ? 363  HIS A C     1 
ATOM   2545  O  O     . HIS A 1 363  ? -62.624 -34.304 -27.151 1.00 124.14 ? 363  HIS A O     1 
ATOM   2546  C  CB    . HIS A 1 363  ? -61.238 -34.544 -29.728 1.00 110.22 ? 363  HIS A CB    1 
ATOM   2547  C  CG    . HIS A 1 363  ? -60.925 -34.985 -31.120 1.00 104.73 ? 363  HIS A CG    1 
ATOM   2548  N  ND1   . HIS A 1 363  ? -60.932 -34.115 -32.186 1.00 98.25  ? 363  HIS A ND1   1 
ATOM   2549  C  CD2   . HIS A 1 363  ? -60.579 -36.197 -31.617 1.00 97.81  ? 363  HIS A CD2   1 
ATOM   2550  C  CE1   . HIS A 1 363  ? -60.621 -34.781 -33.285 1.00 97.96  ? 363  HIS A CE1   1 
ATOM   2551  N  NE2   . HIS A 1 363  ? -60.409 -36.045 -32.968 1.00 89.51  ? 363  HIS A NE2   1 
ATOM   2552  N  N     . PRO A 1 364  ? -60.696 -35.313 -26.502 1.00 92.70  ? 364  PRO A N     1 
ATOM   2553  C  CA    . PRO A 1 364  ? -60.793 -34.726 -25.137 1.00 94.42  ? 364  PRO A CA    1 
ATOM   2554  C  C     . PRO A 1 364  ? -60.782 -33.189 -25.122 1.00 89.58  ? 364  PRO A C     1 
ATOM   2555  O  O     . PRO A 1 364  ? -61.391 -32.582 -24.232 1.00 96.79  ? 364  PRO A O     1 
ATOM   2556  C  CB    . PRO A 1 364  ? -59.546 -35.249 -24.403 1.00 96.34  ? 364  PRO A CB    1 
ATOM   2557  C  CG    . PRO A 1 364  ? -58.701 -35.918 -25.427 1.00 98.13  ? 364  PRO A CG    1 
ATOM   2558  C  CD    . PRO A 1 364  ? -59.542 -36.212 -26.643 1.00 96.65  ? 364  PRO A CD    1 
ATOM   2559  N  N     . ASP A 1 365  ? -60.096 -32.601 -26.110 1.00 83.67  ? 365  ASP A N     1 
ATOM   2560  C  CA    . ASP A 1 365  ? -59.977 -31.149 -26.312 1.00 96.57  ? 365  ASP A CA    1 
ATOM   2561  C  C     . ASP A 1 365  ? -61.068 -30.528 -27.206 1.00 100.35 ? 365  ASP A C     1 
ATOM   2562  O  O     . ASP A 1 365  ? -61.033 -29.319 -27.465 1.00 106.14 ? 365  ASP A O     1 
ATOM   2563  C  CB    . ASP A 1 365  ? -58.636 -30.856 -26.977 1.00 101.75 ? 365  ASP A CB    1 
ATOM   2564  C  CG    . ASP A 1 365  ? -58.476 -31.578 -28.298 1.00 110.23 ? 365  ASP A CG    1 
ATOM   2565  O  OD1   . ASP A 1 365  ? -58.357 -32.811 -28.259 1.00 123.56 ? 365  ASP A OD1   1 
ATOM   2566  O  OD2   . ASP A 1 365  ? -58.487 -30.937 -29.370 1.00 117.29 ? 365  ASP A OD2   1 
ATOM   2567  N  N     . SER A 1 366  ? -62.005 -31.346 -27.697 1.00 94.89  ? 366  SER A N     1 
ATOM   2568  C  CA    . SER A 1 366  ? -63.177 -30.869 -28.444 1.00 92.60  ? 366  SER A CA    1 
ATOM   2569  C  C     . SER A 1 366  ? -63.815 -29.608 -27.853 1.00 89.13  ? 366  SER A C     1 
ATOM   2570  O  O     . SER A 1 366  ? -64.121 -29.571 -26.666 1.00 82.72  ? 366  SER A O     1 
ATOM   2571  C  CB    . SER A 1 366  ? -64.224 -31.966 -28.506 1.00 98.84  ? 366  SER A CB    1 
ATOM   2572  O  OG    . SER A 1 366  ? -65.160 -31.676 -29.517 1.00 102.36 ? 366  SER A OG    1 
ATOM   2573  N  N     . ASP A 1 367  ? -64.015 -28.586 -28.692 1.00 88.16  ? 367  ASP A N     1 
ATOM   2574  C  CA    . ASP A 1 367  ? -64.581 -27.294 -28.263 1.00 87.02  ? 367  ASP A CA    1 
ATOM   2575  C  C     . ASP A 1 367  ? -66.106 -27.242 -28.246 1.00 91.91  ? 367  ASP A C     1 
ATOM   2576  O  O     . ASP A 1 367  ? -66.687 -26.330 -27.650 1.00 96.39  ? 367  ASP A O     1 
ATOM   2577  C  CB    . ASP A 1 367  ? -64.143 -26.152 -29.204 1.00 89.35  ? 367  ASP A CB    1 
ATOM   2578  C  CG    . ASP A 1 367  ? -62.701 -25.666 -28.987 1.00 97.54  ? 367  ASP A CG    1 
ATOM   2579  O  OD1   . ASP A 1 367  ? -61.898 -26.269 -28.231 1.00 109.74 ? 367  ASP A OD1   1 
ATOM   2580  O  OD2   . ASP A 1 367  ? -62.362 -24.652 -29.646 1.00 98.16  ? 367  ASP A OD2   1 
ATOM   2581  N  N     . LEU A 1 368  ? -66.752 -28.174 -28.936 1.00 91.77  ? 368  LEU A N     1 
ATOM   2582  C  CA    . LEU A 1 368  ? -68.197 -28.166 -29.076 1.00 91.95  ? 368  LEU A CA    1 
ATOM   2583  C  C     . LEU A 1 368  ? -68.889 -29.191 -28.175 1.00 95.57  ? 368  LEU A C     1 
ATOM   2584  O  O     . LEU A 1 368  ? -70.005 -28.954 -27.724 1.00 99.77  ? 368  LEU A O     1 
ATOM   2585  C  CB    . LEU A 1 368  ? -68.579 -28.411 -30.525 1.00 91.03  ? 368  LEU A CB    1 
ATOM   2586  C  CG    . LEU A 1 368  ? -67.987 -27.413 -31.519 1.00 92.44  ? 368  LEU A CG    1 
ATOM   2587  C  CD1   . LEU A 1 368  ? -68.062 -27.994 -32.924 1.00 98.30  ? 368  LEU A CD1   1 
ATOM   2588  C  CD2   . LEU A 1 368  ? -68.674 -26.059 -31.463 1.00 87.25  ? 368  LEU A CD2   1 
ATOM   2589  N  N     . ASN A 1 369  ? -68.245 -30.331 -27.942 1.00 97.76  ? 369  ASN A N     1 
ATOM   2590  C  CA    . ASN A 1 369  ? -68.812 -31.402 -27.120 1.00 104.50 ? 369  ASN A CA    1 
ATOM   2591  C  C     . ASN A 1 369  ? -69.119 -31.019 -25.664 1.00 110.96 ? 369  ASN A C     1 
ATOM   2592  O  O     . ASN A 1 369  ? -70.183 -31.382 -25.154 1.00 118.28 ? 369  ASN A O     1 
ATOM   2593  C  CB    . ASN A 1 369  ? -67.868 -32.612 -27.099 1.00 106.57 ? 369  ASN A CB    1 
ATOM   2594  C  CG    . ASN A 1 369  ? -67.931 -33.441 -28.362 1.00 107.54 ? 369  ASN A CG    1 
ATOM   2595  O  OD1   . ASN A 1 369  ? -68.810 -33.252 -29.228 1.00 90.08  ? 369  ASN A OD1   1 
ATOM   2596  N  ND2   . ASN A 1 369  ? -66.990 -34.391 -28.470 1.00 115.04 ? 369  ASN A ND2   1 
ATOM   2597  N  N     . PRO A 1 370  ? -68.191 -30.294 -24.992 1.00 113.72 ? 370  PRO A N     1 
ATOM   2598  C  CA    . PRO A 1 370  ? -68.502 -29.858 -23.635 1.00 106.75 ? 370  PRO A CA    1 
ATOM   2599  C  C     . PRO A 1 370  ? -69.685 -28.902 -23.572 1.00 102.83 ? 370  PRO A C     1 
ATOM   2600  O  O     . PRO A 1 370  ? -70.400 -28.897 -22.579 1.00 98.15  ? 370  PRO A O     1 
ATOM   2601  C  CB    . PRO A 1 370  ? -67.229 -29.126 -23.215 1.00 114.28 ? 370  PRO A CB    1 
ATOM   2602  C  CG    . PRO A 1 370  ? -66.668 -28.609 -24.494 1.00 112.49 ? 370  PRO A CG    1 
ATOM   2603  C  CD    . PRO A 1 370  ? -66.886 -29.757 -25.428 1.00 114.41 ? 370  PRO A CD    1 
ATOM   2604  N  N     . ILE A 1 371  ? -69.893 -28.117 -24.627 1.00 96.39  ? 371  ILE A N     1 
ATOM   2605  C  CA    . ILE A 1 371  ? -71.040 -27.222 -24.697 1.00 90.92  ? 371  ILE A CA    1 
ATOM   2606  C  C     . ILE A 1 371  ? -72.320 -27.999 -24.983 1.00 87.93  ? 371  ILE A C     1 
ATOM   2607  O  O     . ILE A 1 371  ? -73.339 -27.769 -24.341 1.00 94.17  ? 371  ILE A O     1 
ATOM   2608  C  CB    . ILE A 1 371  ? -70.901 -26.201 -25.853 1.00 87.84  ? 371  ILE A CB    1 
ATOM   2609  C  CG1   . ILE A 1 371  ? -69.722 -25.267 -25.637 1.00 86.90  ? 371  ILE A CG1   1 
ATOM   2610  C  CG2   . ILE A 1 371  ? -72.160 -25.351 -26.022 1.00 88.42  ? 371  ILE A CG2   1 
ATOM   2611  C  CD1   . ILE A 1 371  ? -69.712 -24.148 -26.661 1.00 84.35  ? 371  ILE A CD1   1 
ATOM   2612  N  N     . LEU A 1 372  ? -72.277 -28.904 -25.954 1.00 96.18  ? 372  LEU A N     1 
ATOM   2613  C  CA    . LEU A 1 372  ? -73.439 -29.756 -26.255 1.00 98.64  ? 372  LEU A CA    1 
ATOM   2614  C  C     . LEU A 1 372  ? -73.806 -30.618 -25.052 1.00 97.43  ? 372  LEU A C     1 
ATOM   2615  O  O     . LEU A 1 372  ? -74.991 -30.833 -24.787 1.00 106.78 ? 372  LEU A O     1 
ATOM   2616  C  CB    . LEU A 1 372  ? -73.212 -30.642 -27.495 1.00 97.84  ? 372  LEU A CB    1 
ATOM   2617  C  CG    . LEU A 1 372  ? -72.887 -29.943 -28.833 1.00 95.60  ? 372  LEU A CG    1 
ATOM   2618  C  CD1   . LEU A 1 372  ? -72.604 -30.977 -29.920 1.00 92.06  ? 372  LEU A CD1   1 
ATOM   2619  C  CD2   . LEU A 1 372  ? -73.984 -28.974 -29.266 1.00 94.37  ? 372  LEU A CD2   1 
ATOM   2620  N  N     . ALA A 1 373  ? -72.787 -31.077 -24.318 1.00 96.78  ? 373  ALA A N     1 
ATOM   2621  C  CA    . ALA A 1 373  ? -72.972 -31.933 -23.146 1.00 92.44  ? 373  ALA A CA    1 
ATOM   2622  C  C     . ALA A 1 373  ? -73.904 -31.325 -22.128 1.00 90.43  ? 373  ALA A C     1 
ATOM   2623  O  O     . ALA A 1 373  ? -74.803 -32.003 -21.631 1.00 86.73  ? 373  ALA A O     1 
ATOM   2624  C  CB    . ALA A 1 373  ? -71.655 -32.264 -22.480 1.00 94.64  ? 373  ALA A CB    1 
ATOM   2625  N  N     . VAL A 1 374  ? -73.691 -30.038 -21.835 1.00 93.29  ? 374  VAL A N     1 
ATOM   2626  C  CA    . VAL A 1 374  ? -74.501 -29.328 -20.819 1.00 90.70  ? 374  VAL A CA    1 
ATOM   2627  C  C     . VAL A 1 374  ? -75.894 -28.882 -21.254 1.00 96.06  ? 374  VAL A C     1 
ATOM   2628  O  O     . VAL A 1 374  ? -76.691 -28.478 -20.404 1.00 126.70 ? 374  VAL A O     1 
ATOM   2629  C  CB    . VAL A 1 374  ? -73.826 -28.068 -20.204 1.00 83.33  ? 374  VAL A CB    1 
ATOM   2630  C  CG1   . VAL A 1 374  ? -72.490 -28.417 -19.557 1.00 80.21  ? 374  VAL A CG1   1 
ATOM   2631  C  CG2   . VAL A 1 374  ? -73.705 -26.932 -21.223 1.00 83.27  ? 374  VAL A CG2   1 
ATOM   2632  N  N     . GLY A 1 375  ? -76.204 -28.957 -22.553 1.00 98.73  ? 375  GLY A N     1 
ATOM   2633  C  CA    . GLY A 1 375  ? -77.406 -28.320 -23.136 1.00 101.82 ? 375  GLY A CA    1 
ATOM   2634  C  C     . GLY A 1 375  ? -78.603 -29.210 -23.453 1.00 99.14  ? 375  GLY A C     1 
ATOM   2635  O  O     . GLY A 1 375  ? -79.444 -28.811 -24.267 1.00 100.22 ? 375  GLY A O     1 
ATOM   2636  N  N     . ASN A 1 376  ? -78.703 -30.375 -22.795 1.00 92.53  ? 376  ASN A N     1 
ATOM   2637  C  CA    . ASN A 1 376  ? -79.772 -31.333 -23.013 1.00 99.66  ? 376  ASN A CA    1 
ATOM   2638  C  C     . ASN A 1 376  ? -79.943 -31.710 -24.482 1.00 109.16 ? 376  ASN A C     1 
ATOM   2639  O  O     . ASN A 1 376  ? -81.052 -31.689 -25.023 1.00 127.44 ? 376  ASN A O     1 
ATOM   2640  C  CB    . ASN A 1 376  ? -81.072 -30.797 -22.456 1.00 102.89 ? 376  ASN A CB    1 
ATOM   2641  C  CG    . ASN A 1 376  ? -80.988 -30.578 -20.981 1.00 108.44 ? 376  ASN A CG    1 
ATOM   2642  O  OD1   . ASN A 1 376  ? -81.039 -29.445 -20.507 1.00 121.90 ? 376  ASN A OD1   1 
ATOM   2643  N  ND2   . ASN A 1 376  ? -80.789 -31.660 -20.243 1.00 109.35 ? 376  ASN A ND2   1 
ATOM   2644  N  N     . CYS A 1 377  ? -78.829 -32.038 -25.138 1.00 108.81 ? 377  CYS A N     1 
ATOM   2645  C  CA    . CYS A 1 377  ? -78.862 -32.413 -26.554 1.00 109.24 ? 377  CYS A CA    1 
ATOM   2646  C  C     . CYS A 1 377  ? -79.061 -33.892 -26.729 1.00 112.61 ? 377  CYS A C     1 
ATOM   2647  O  O     . CYS A 1 377  ? -78.549 -34.688 -25.957 1.00 115.13 ? 377  CYS A O     1 
ATOM   2648  C  CB    . CYS A 1 377  ? -77.631 -31.918 -27.273 1.00 111.55 ? 377  CYS A CB    1 
ATOM   2649  S  SG    . CYS A 1 377  ? -77.685 -30.122 -27.327 1.00 129.30 ? 377  CYS A SG    1 
ATOM   2650  N  N     . THR A 1 378  ? -79.831 -34.250 -27.756 1.00 119.05 ? 378  THR A N     1 
ATOM   2651  C  CA    . THR A 1 378  ? -80.134 -35.656 -28.041 1.00 113.61 ? 378  THR A CA    1 
ATOM   2652  C  C     . THR A 1 378  ? -79.696 -36.001 -29.468 1.00 98.89  ? 378  THR A C     1 
ATOM   2653  O  O     . THR A 1 378  ? -79.621 -35.125 -30.333 1.00 82.49  ? 378  THR A O     1 
ATOM   2654  C  CB    . THR A 1 378  ? -81.638 -36.001 -27.835 1.00 115.68 ? 378  THR A CB    1 
ATOM   2655  O  OG1   . THR A 1 378  ? -82.443 -35.322 -28.802 1.00 111.88 ? 378  THR A OG1   1 
ATOM   2656  C  CG2   . THR A 1 378  ? -82.112 -35.607 -26.433 1.00 123.02 ? 378  THR A CG2   1 
ATOM   2657  N  N     . LEU A 1 379  ? -79.356 -37.274 -29.650 1.00 100.08 ? 379  LEU A N     1 
ATOM   2658  C  CA    . LEU A 1 379  ? -78.794 -37.770 -30.887 1.00 89.74  ? 379  LEU A CA    1 
ATOM   2659  C  C     . LEU A 1 379  ? -79.805 -38.666 -31.557 1.00 81.04  ? 379  LEU A C     1 
ATOM   2660  O  O     . LEU A 1 379  ? -80.387 -39.523 -30.908 1.00 90.21  ? 379  LEU A O     1 
ATOM   2661  C  CB    . LEU A 1 379  ? -77.538 -38.583 -30.605 1.00 92.74  ? 379  LEU A CB    1 
ATOM   2662  C  CG    . LEU A 1 379  ? -76.493 -37.876 -29.740 1.00 99.71  ? 379  LEU A CG    1 
ATOM   2663  C  CD1   . LEU A 1 379  ? -75.396 -38.864 -29.362 1.00 97.18  ? 379  LEU A CD1   1 
ATOM   2664  C  CD2   . LEU A 1 379  ? -75.940 -36.636 -30.449 1.00 99.41  ? 379  LEU A CD2   1 
ATOM   2665  N  N     . ASN A 1 380  ? -80.039 -38.431 -32.843 1.00 88.79  ? 380  ASN A N     1 
ATOM   2666  C  CA    . ASN A 1 380  ? -80.973 -39.221 -33.619 1.00 89.74  ? 380  ASN A CA    1 
ATOM   2667  C  C     . ASN A 1 380  ? -80.202 -40.315 -34.346 1.00 90.13  ? 380  ASN A C     1 
ATOM   2668  O  O     . ASN A 1 380  ? -79.537 -40.064 -35.350 1.00 91.69  ? 380  ASN A O     1 
ATOM   2669  C  CB    . ASN A 1 380  ? -81.800 -38.351 -34.569 1.00 88.93  ? 380  ASN A CB    1 
ATOM   2670  C  CG    . ASN A 1 380  ? -82.565 -37.269 -33.837 1.00 86.65  ? 380  ASN A CG    1 
ATOM   2671  O  OD1   . ASN A 1 380  ? -83.176 -37.511 -32.794 1.00 82.31  ? 380  ASN A OD1   1 
ATOM   2672  N  ND2   . ASN A 1 380  ? -82.515 -36.060 -34.368 1.00 89.64  ? 380  ASN A ND2   1 
ATOM   2673  N  N     . LEU A 1 381  ? -80.263 -41.516 -33.785 1.00 87.20  ? 381  LEU A N     1 
ATOM   2674  C  CA    . LEU A 1 381  ? -79.578 -42.691 -34.320 1.00 93.77  ? 381  LEU A CA    1 
ATOM   2675  C  C     . LEU A 1 381  ? -80.503 -43.388 -35.305 1.00 97.31  ? 381  LEU A C     1 
ATOM   2676  O  O     . LEU A 1 381  ? -81.733 -43.280 -35.199 1.00 112.84 ? 381  LEU A O     1 
ATOM   2677  C  CB    . LEU A 1 381  ? -79.184 -43.666 -33.178 1.00 90.67  ? 381  LEU A CB    1 
ATOM   2678  C  CG    . LEU A 1 381  ? -77.854 -43.391 -32.433 1.00 93.00  ? 381  LEU A CG    1 
ATOM   2679  C  CD1   . LEU A 1 381  ? -77.711 -41.913 -32.084 1.00 99.98  ? 381  LEU A CD1   1 
ATOM   2680  C  CD2   . LEU A 1 381  ? -77.667 -44.239 -31.180 1.00 87.45  ? 381  LEU A CD2   1 
ATOM   2681  N  N     . LEU A 1 382  ? -79.907 -44.088 -36.264 1.00 92.29  ? 382  LEU A N     1 
ATOM   2682  C  CA    . LEU A 1 382  ? -80.673 -44.849 -37.228 1.00 92.50  ? 382  LEU A CA    1 
ATOM   2683  C  C     . LEU A 1 382  ? -79.897 -46.081 -37.650 1.00 98.48  ? 382  LEU A C     1 
ATOM   2684  O  O     . LEU A 1 382  ? -78.712 -46.003 -37.995 1.00 106.69 ? 382  LEU A O     1 
ATOM   2685  C  CB    . LEU A 1 382  ? -81.137 -43.973 -38.402 1.00 94.98  ? 382  LEU A CB    1 
ATOM   2686  C  CG    . LEU A 1 382  ? -81.993 -44.612 -39.512 1.00 93.51  ? 382  LEU A CG    1 
ATOM   2687  C  CD1   . LEU A 1 382  ? -83.299 -45.132 -38.919 1.00 98.41  ? 382  LEU A CD1   1 
ATOM   2688  C  CD2   . LEU A 1 382  ? -82.250 -43.666 -40.700 1.00 80.11  ? 382  LEU A CD2   1 
ATOM   2689  N  N     . SER A 1 383  ? -80.561 -47.230 -37.559 1.00 101.84 ? 383  SER A N     1 
ATOM   2690  C  CA    . SER A 1 383  ? -79.992 -48.541 -37.880 1.00 104.44 ? 383  SER A CA    1 
ATOM   2691  C  C     . SER A 1 383  ? -80.850 -49.133 -39.002 1.00 113.32 ? 383  SER A C     1 
ATOM   2692  O  O     . SER A 1 383  ? -81.886 -48.562 -39.408 1.00 105.50 ? 383  SER A O     1 
ATOM   2693  C  CB    . SER A 1 383  ? -80.064 -49.390 -36.581 1.00 99.31  ? 383  SER A CB    1 
ATOM   2694  O  OG    . SER A 1 383  ? -79.654 -50.738 -36.728 1.00 97.39  ? 383  SER A OG    1 
ATOM   2695  N  N     . LYS A 1 384  ? -80.427 -50.292 -39.495 1.00 130.23 ? 384  LYS A N     1 
ATOM   2696  C  CA    . LYS A 1 384  ? -81.254 -51.073 -40.396 1.00 124.88 ? 384  LYS A CA    1 
ATOM   2697  C  C     . LYS A 1 384  ? -82.488 -51.602 -39.652 1.00 127.67 ? 384  LYS A C     1 
ATOM   2698  O  O     . LYS A 1 384  ? -83.540 -51.779 -40.252 1.00 131.13 ? 384  LYS A O     1 
ATOM   2699  C  CB    . LYS A 1 384  ? -80.431 -52.205 -40.989 1.00 120.87 ? 384  LYS A CB    1 
ATOM   2700  C  CG    . LYS A 1 384  ? -81.086 -52.918 -42.147 1.00 116.00 ? 384  LYS A CG    1 
ATOM   2701  C  CD    . LYS A 1 384  ? -80.228 -54.107 -42.537 1.00 128.47 ? 384  LYS A CD    1 
ATOM   2702  C  CE    . LYS A 1 384  ? -80.960 -55.054 -43.466 1.00 134.18 ? 384  LYS A CE    1 
ATOM   2703  N  NZ    . LYS A 1 384  ? -80.010 -56.041 -44.048 1.00 138.04 ? 384  LYS A NZ    1 
ATOM   2704  N  N     . GLU A 1 385  ? -82.344 -51.811 -38.339 1.00 131.35 ? 385  GLU A N     1 
ATOM   2705  C  CA    . GLU A 1 385  ? -83.405 -52.303 -37.457 1.00 138.79 ? 385  GLU A CA    1 
ATOM   2706  C  C     . GLU A 1 385  ? -84.428 -51.202 -37.106 1.00 133.25 ? 385  GLU A C     1 
ATOM   2707  O  O     . GLU A 1 385  ? -85.623 -51.471 -36.973 1.00 138.78 ? 385  GLU A O     1 
ATOM   2708  C  CB    . GLU A 1 385  ? -82.828 -52.846 -36.120 1.00 137.59 ? 385  GLU A CB    1 
ATOM   2709  C  CG    . GLU A 1 385  ? -81.528 -53.663 -36.181 1.00 151.77 ? 385  GLU A CG    1 
ATOM   2710  C  CD    . GLU A 1 385  ? -81.700 -55.096 -36.691 1.00 162.01 ? 385  GLU A CD    1 
ATOM   2711  O  OE1   . GLU A 1 385  ? -82.776 -55.419 -37.233 1.00 169.44 ? 385  GLU A OE1   1 
ATOM   2712  O  OE2   . GLU A 1 385  ? -80.752 -55.912 -36.553 1.00 150.22 ? 385  GLU A OE2   1 
ATOM   2713  N  N     . GLY A 1 386  ? -83.956 -49.968 -36.938 1.00 123.85 ? 386  GLY A N     1 
ATOM   2714  C  CA    . GLY A 1 386  ? -84.862 -48.835 -36.718 1.00 115.69 ? 386  GLY A CA    1 
ATOM   2715  C  C     . GLY A 1 386  ? -84.246 -47.499 -36.308 1.00 109.80 ? 386  GLY A C     1 
ATOM   2716  O  O     . GLY A 1 386  ? -83.016 -47.339 -36.202 1.00 101.73 ? 386  GLY A O     1 
ATOM   2717  N  N     . LYS A 1 387  ? -85.148 -46.537 -36.107 1.00 103.83 ? 387  LYS A N     1 
ATOM   2718  C  CA    . LYS A 1 387  ? -84.858 -45.229 -35.525 1.00 95.40  ? 387  LYS A CA    1 
ATOM   2719  C  C     . LYS A 1 387  ? -84.663 -45.423 -34.016 1.00 97.44  ? 387  LYS A C     1 
ATOM   2720  O  O     . LYS A 1 387  ? -85.185 -46.373 -33.433 1.00 113.16 ? 387  LYS A O     1 
ATOM   2721  C  CB    . LYS A 1 387  ? -86.033 -44.276 -35.839 1.00 93.83  ? 387  LYS A CB    1 
ATOM   2722  C  CG    . LYS A 1 387  ? -85.937 -42.859 -35.301 1.00 109.31 ? 387  LYS A CG    1 
ATOM   2723  C  CD    . LYS A 1 387  ? -84.782 -42.078 -35.926 1.00 132.63 ? 387  LYS A CD    1 
ATOM   2724  C  CE    . LYS A 1 387  ? -84.762 -40.597 -35.536 1.00 138.24 ? 387  LYS A CE    1 
ATOM   2725  N  NZ    . LYS A 1 387  ? -84.358 -40.350 -34.119 1.00 137.07 ? 387  LYS A NZ    1 
ATOM   2726  N  N     . ARG A 1 388  ? -83.891 -44.541 -33.396 1.00 100.21 ? 388  ARG A N     1 
ATOM   2727  C  CA    . ARG A 1 388  ? -83.577 -44.621 -31.959 1.00 107.33 ? 388  ARG A CA    1 
ATOM   2728  C  C     . ARG A 1 388  ? -82.888 -43.332 -31.504 1.00 114.67 ? 388  ARG A C     1 
ATOM   2729  O  O     . ARG A 1 388  ? -82.156 -42.712 -32.274 1.00 125.70 ? 388  ARG A O     1 
ATOM   2730  C  CB    . ARG A 1 388  ? -82.707 -45.845 -31.654 1.00 98.93  ? 388  ARG A CB    1 
ATOM   2731  C  CG    . ARG A 1 388  ? -81.999 -45.824 -30.310 1.00 94.71  ? 388  ARG A CG    1 
ATOM   2732  C  CD    . ARG A 1 388  ? -80.950 -46.923 -30.260 1.00 97.20  ? 388  ARG A CD    1 
ATOM   2733  N  NE    . ARG A 1 388  ? -80.093 -46.807 -29.077 1.00 98.52  ? 388  ARG A NE    1 
ATOM   2734  C  CZ    . ARG A 1 388  ? -78.856 -47.295 -28.967 1.00 95.26  ? 388  ARG A CZ    1 
ATOM   2735  N  NH1   . ARG A 1 388  ? -78.285 -47.936 -29.974 1.00 95.62  ? 388  ARG A NH1   1 
ATOM   2736  N  NH2   . ARG A 1 388  ? -78.172 -47.126 -27.839 1.00 98.28  ? 388  ARG A NH2   1 
ATOM   2737  N  N     . GLN A 1 389  ? -83.123 -42.932 -30.260 1.00 113.89 ? 389  GLN A N     1 
ATOM   2738  C  CA    . GLN A 1 389  ? -82.662 -41.636 -29.758 1.00 106.90 ? 389  GLN A CA    1 
ATOM   2739  C  C     . GLN A 1 389  ? -81.994 -41.779 -28.404 1.00 103.17 ? 389  GLN A C     1 
ATOM   2740  O  O     . GLN A 1 389  ? -82.579 -42.337 -27.471 1.00 120.51 ? 389  GLN A O     1 
ATOM   2741  C  CB    . GLN A 1 389  ? -83.825 -40.663 -29.706 1.00 100.39 ? 389  GLN A CB    1 
ATOM   2742  C  CG    . GLN A 1 389  ? -83.532 -39.419 -28.903 1.00 105.13 ? 389  GLN A CG    1 
ATOM   2743  C  CD    . GLN A 1 389  ? -84.594 -38.374 -29.108 1.00 111.89 ? 389  GLN A CD    1 
ATOM   2744  O  OE1   . GLN A 1 389  ? -85.605 -38.622 -29.778 1.00 98.00  ? 389  GLN A OE1   1 
ATOM   2745  N  NE2   . GLN A 1 389  ? -84.382 -37.195 -28.524 1.00 121.12 ? 389  GLN A NE2   1 
ATOM   2746  N  N     . ILE A 1 390  ? -80.777 -41.267 -28.274 1.00 92.99  ? 390  ILE A N     1 
ATOM   2747  C  CA    . ILE A 1 390  ? -80.081 -41.267 -26.983 1.00 101.62 ? 390  ILE A CA    1 
ATOM   2748  C  C     . ILE A 1 390  ? -79.650 -39.861 -26.618 1.00 94.63  ? 390  ILE A C     1 
ATOM   2749  O  O     . ILE A 1 390  ? -79.456 -39.012 -27.490 1.00 82.15  ? 390  ILE A O     1 
ATOM   2750  C  CB    . ILE A 1 390  ? -78.916 -42.277 -26.936 1.00 114.16 ? 390  ILE A CB    1 
ATOM   2751  C  CG1   . ILE A 1 390  ? -77.812 -41.869 -27.911 1.00 133.88 ? 390  ILE A CG1   1 
ATOM   2752  C  CG2   . ILE A 1 390  ? -79.434 -43.681 -27.236 1.00 107.35 ? 390  ILE A CG2   1 
ATOM   2753  C  CD1   . ILE A 1 390  ? -76.490 -42.561 -27.663 1.00 142.84 ? 390  ILE A CD1   1 
ATOM   2754  N  N     . PRO A 1 391  ? -79.505 -39.597 -25.305 1.00 101.50 ? 391  PRO A N     1 
ATOM   2755  C  CA    . PRO A 1 391  ? -79.030 -38.285 -24.858 1.00 100.46 ? 391  PRO A CA    1 
ATOM   2756  C  C     . PRO A 1 391  ? -77.513 -38.176 -24.968 1.00 106.66 ? 391  PRO A C     1 
ATOM   2757  O  O     . PRO A 1 391  ? -76.809 -39.165 -24.784 1.00 116.47 ? 391  PRO A O     1 
ATOM   2758  C  CB    . PRO A 1 391  ? -79.456 -38.249 -23.405 1.00 97.19  ? 391  PRO A CB    1 
ATOM   2759  C  CG    . PRO A 1 391  ? -79.297 -39.676 -22.973 1.00 97.62  ? 391  PRO A CG    1 
ATOM   2760  C  CD    . PRO A 1 391  ? -79.638 -40.531 -24.167 1.00 94.37  ? 391  PRO A CD    1 
ATOM   2761  N  N     . LEU A 1 392  ? -77.031 -36.963 -25.274 1.00 106.19 ? 392  LEU A N     1 
ATOM   2762  C  CA    . LEU A 1 392  ? -75.595 -36.656 -25.355 1.00 101.49 ? 392  LEU A CA    1 
ATOM   2763  C  C     . LEU A 1 392  ? -75.130 -36.155 -23.980 1.00 97.86  ? 392  LEU A C     1 
ATOM   2764  O  O     . LEU A 1 392  ? -75.214 -34.971 -23.622 1.00 91.14  ? 392  LEU A O     1 
ATOM   2765  C  CB    . LEU A 1 392  ? -75.274 -35.666 -26.487 1.00 100.47 ? 392  LEU A CB    1 
ATOM   2766  C  CG    . LEU A 1 392  ? -73.947 -34.885 -26.592 1.00 94.35  ? 392  LEU A CG    1 
ATOM   2767  C  CD1   . LEU A 1 392  ? -72.710 -35.593 -26.077 1.00 91.07  ? 392  LEU A CD1   1 
ATOM   2768  C  CD2   . LEU A 1 392  ? -73.722 -34.490 -28.046 1.00 96.31  ? 392  LEU A CD2   1 
ATOM   2769  N  N     . ASN A 1 393  ? -74.611 -37.117 -23.218 1.00 95.79  ? 393  ASN A N     1 
ATOM   2770  C  CA    . ASN A 1 393  ? -74.230 -36.953 -21.813 1.00 102.97 ? 393  ASN A CA    1 
ATOM   2771  C  C     . ASN A 1 393  ? -72.772 -37.359 -21.583 1.00 103.52 ? 393  ASN A C     1 
ATOM   2772  O  O     . ASN A 1 393  ? -72.064 -37.671 -22.543 1.00 105.34 ? 393  ASN A O     1 
ATOM   2773  C  CB    . ASN A 1 393  ? -75.150 -37.853 -20.987 1.00 109.80 ? 393  ASN A CB    1 
ATOM   2774  C  CG    . ASN A 1 393  ? -75.225 -39.270 -21.547 1.00 110.77 ? 393  ASN A CG    1 
ATOM   2775  O  OD1   . ASN A 1 393  ? -74.280 -39.749 -22.182 1.00 119.44 ? 393  ASN A OD1   1 
ATOM   2776  N  ND2   . ASN A 1 393  ? -76.353 -39.937 -21.332 1.00 106.09 ? 393  ASN A ND2   1 
ATOM   2777  N  N     . GLU A 1 394  ? -72.329 -37.352 -20.320 1.00 108.76 ? 394  GLU A N     1 
ATOM   2778  C  CA    . GLU A 1 394  ? -70.939 -37.730 -19.996 1.00 117.58 ? 394  GLU A CA    1 
ATOM   2779  C  C     . GLU A 1 394  ? -70.635 -39.157 -20.365 1.00 121.07 ? 394  GLU A C     1 
ATOM   2780  O  O     . GLU A 1 394  ? -69.570 -39.391 -20.927 1.00 148.22 ? 394  GLU A O     1 
ATOM   2781  C  CB    . GLU A 1 394  ? -70.525 -37.554 -18.532 1.00 140.33 ? 394  GLU A CB    1 
ATOM   2782  C  CG    . GLU A 1 394  ? -68.986 -37.647 -18.373 1.00 157.40 ? 394  GLU A CG    1 
ATOM   2783  C  CD    . GLU A 1 394  ? -68.486 -38.239 -17.054 1.00 157.70 ? 394  GLU A CD    1 
ATOM   2784  O  OE1   . GLU A 1 394  ? -69.120 -39.175 -16.521 1.00 159.17 ? 394  GLU A OE1   1 
ATOM   2785  O  OE2   . GLU A 1 394  ? -67.429 -37.785 -16.560 1.00 145.32 ? 394  GLU A OE2   1 
ATOM   2786  N  N     . GLN A 1 395  ? -71.526 -40.098 -20.037 1.00 114.70 ? 395  GLN A N     1 
ATOM   2787  C  CA    . GLN A 1 395  ? -71.333 -41.509 -20.361 1.00 115.06 ? 395  GLN A CA    1 
ATOM   2788  C  C     . GLN A 1 395  ? -71.043 -41.711 -21.846 1.00 110.29 ? 395  GLN A C     1 
ATOM   2789  O  O     . GLN A 1 395  ? -70.136 -42.469 -22.221 1.00 106.53 ? 395  GLN A O     1 
ATOM   2790  C  CB    . GLN A 1 395  ? -72.574 -42.340 -19.960 1.00 114.46 ? 395  GLN A CB    1 
ATOM   2791  C  CG    . GLN A 1 395  ? -72.513 -42.960 -18.559 1.00 116.84 ? 395  GLN A CG    1 
ATOM   2792  C  CD    . GLN A 1 395  ? -73.837 -42.916 -17.801 1.00 123.50 ? 395  GLN A CD    1 
ATOM   2793  O  OE1   . GLN A 1 395  ? -74.622 -41.974 -17.943 1.00 124.54 ? 395  GLN A OE1   1 
ATOM   2794  N  NE2   . GLN A 1 395  ? -74.078 -43.928 -16.969 1.00 129.57 ? 395  GLN A NE2   1 
ATOM   2795  N  N     . PHE A 1 396  ? -71.833 -41.022 -22.671 1.00 112.42 ? 396  PHE A N     1 
ATOM   2796  C  CA    . PHE A 1 396  ? -71.639 -41.046 -24.118 1.00 119.83 ? 396  PHE A CA    1 
ATOM   2797  C  C     . PHE A 1 396  ? -70.252 -40.525 -24.489 1.00 120.69 ? 396  PHE A C     1 
ATOM   2798  O  O     . PHE A 1 396  ? -69.545 -41.161 -25.269 1.00 124.60 ? 396  PHE A O     1 
ATOM   2799  C  CB    . PHE A 1 396  ? -72.712 -40.257 -24.843 1.00 117.71 ? 396  PHE A CB    1 
ATOM   2800  C  CG    . PHE A 1 396  ? -72.446 -40.094 -26.309 1.00 109.45 ? 396  PHE A CG    1 
ATOM   2801  C  CD1   . PHE A 1 396  ? -72.596 -41.148 -27.174 1.00 106.58 ? 396  PHE A CD1   1 
ATOM   2802  C  CD2   . PHE A 1 396  ? -72.056 -38.873 -26.819 1.00 109.33 ? 396  PHE A CD2   1 
ATOM   2803  C  CE1   . PHE A 1 396  ? -72.368 -40.979 -28.525 1.00 109.46 ? 396  PHE A CE1   1 
ATOM   2804  C  CE2   . PHE A 1 396  ? -71.824 -38.697 -28.170 1.00 101.86 ? 396  PHE A CE2   1 
ATOM   2805  C  CZ    . PHE A 1 396  ? -71.979 -39.751 -29.026 1.00 99.05  ? 396  PHE A CZ    1 
ATOM   2806  N  N     . LEU A 1 397  ? -69.863 -39.388 -23.909 1.00 110.41 ? 397  LEU A N     1 
ATOM   2807  C  CA    . LEU A 1 397  ? -68.542 -38.793 -24.164 1.00 93.81  ? 397  LEU A CA    1 
ATOM   2808  C  C     . LEU A 1 397  ? -67.391 -39.626 -23.573 1.00 98.04  ? 397  LEU A C     1 
ATOM   2809  O  O     . LEU A 1 397  ? -66.264 -39.543 -24.060 1.00 110.38 ? 397  LEU A O     1 
ATOM   2810  C  CB    . LEU A 1 397  ? -68.528 -37.345 -23.687 1.00 84.69  ? 397  LEU A CB    1 
ATOM   2811  C  CG    . LEU A 1 397  ? -69.635 -36.542 -24.396 1.00 80.70  ? 397  LEU A CG    1 
ATOM   2812  C  CD1   . LEU A 1 397  ? -69.652 -35.073 -24.018 1.00 76.09  ? 397  LEU A CD1   1 
ATOM   2813  C  CD2   . LEU A 1 397  ? -69.490 -36.662 -25.898 1.00 87.02  ? 397  LEU A CD2   1 
ATOM   2814  N  N     . SER A 1 398  ? -67.685 -40.435 -22.553 1.00 102.70 ? 398  SER A N     1 
ATOM   2815  C  CA    . SER A 1 398  ? -66.735 -41.412 -21.995 1.00 105.01 ? 398  SER A CA    1 
ATOM   2816  C  C     . SER A 1 398  ? -66.674 -42.756 -22.754 1.00 108.45 ? 398  SER A C     1 
ATOM   2817  O  O     . SER A 1 398  ? -65.841 -43.601 -22.417 1.00 110.25 ? 398  SER A O     1 
ATOM   2818  C  CB    . SER A 1 398  ? -67.001 -41.554 -20.487 1.00 107.50 ? 398  SER A CB    1 
ATOM   2819  O  OG    . SER A 1 398  ? -66.963 -40.261 -19.859 1.00 109.35 ? 398  SER A OG    1 
ATOM   2820  N  N     . LYS A 1 399  ? -67.537 -42.943 -23.761 1.00 110.78 ? 399  LYS A N     1 
ATOM   2821  C  CA    . LYS A 1 399  ? -67.612 -44.163 -24.573 1.00 113.10 ? 399  LYS A CA    1 
ATOM   2822  C  C     . LYS A 1 399  ? -67.986 -45.407 -23.778 1.00 126.12 ? 399  LYS A C     1 
ATOM   2823  O  O     . LYS A 1 399  ? -67.485 -46.507 -24.043 1.00 141.93 ? 399  LYS A O     1 
ATOM   2824  C  CB    . LYS A 1 399  ? -66.291 -44.408 -25.314 1.00 112.61 ? 399  LYS A CB    1 
ATOM   2825  C  CG    . LYS A 1 399  ? -66.145 -43.669 -26.631 1.00 116.24 ? 399  LYS A CG    1 
ATOM   2826  C  CD    . LYS A 1 399  ? -64.766 -43.919 -27.244 1.00 115.44 ? 399  LYS A CD    1 
ATOM   2827  C  CE    . LYS A 1 399  ? -64.722 -43.532 -28.714 1.00 110.43 ? 399  LYS A CE    1 
ATOM   2828  N  NZ    . LYS A 1 399  ? -63.327 -43.465 -29.215 1.00 106.10 ? 399  LYS A NZ    1 
ATOM   2829  N  N     . CYS A 1 400  ? -68.869 -45.230 -22.801 1.00 138.34 ? 400  CYS A N     1 
ATOM   2830  C  CA    . CYS A 1 400  ? -69.513 -46.359 -22.133 1.00 137.46 ? 400  CYS A CA    1 
ATOM   2831  C  C     . CYS A 1 400  ? -70.483 -46.967 -23.154 1.00 138.86 ? 400  CYS A C     1 
ATOM   2832  O  O     . CYS A 1 400  ? -71.349 -46.259 -23.676 1.00 130.75 ? 400  CYS A O     1 
ATOM   2833  C  CB    . CYS A 1 400  ? -70.266 -45.911 -20.867 1.00 137.38 ? 400  CYS A CB    1 
ATOM   2834  S  SG    . CYS A 1 400  ? -69.228 -45.455 -19.442 1.00 143.75 ? 400  CYS A SG    1 
ATOM   2835  N  N     . PRO A 1 401  ? -70.357 -48.277 -23.423 1.00 144.79 ? 401  PRO A N     1 
ATOM   2836  C  CA    . PRO A 1 401  ? -71.111 -48.908 -24.499 1.00 141.80 ? 401  PRO A CA    1 
ATOM   2837  C  C     . PRO A 1 401  ? -72.641 -48.857 -24.307 1.00 139.75 ? 401  PRO A C     1 
ATOM   2838  O  O     . PRO A 1 401  ? -73.398 -48.996 -25.272 1.00 141.04 ? 401  PRO A O     1 
ATOM   2839  C  CB    . PRO A 1 401  ? -70.653 -50.361 -24.403 1.00 143.66 ? 401  PRO A CB    1 
ATOM   2840  C  CG    . PRO A 1 401  ? -70.430 -50.566 -22.935 1.00 144.69 ? 401  PRO A CG    1 
ATOM   2841  C  CD    . PRO A 1 401  ? -69.850 -49.270 -22.449 1.00 141.75 ? 401  PRO A CD    1 
ATOM   2842  N  N     . ASN A 1 402  ? -73.073 -48.650 -23.063 1.00 135.37 ? 402  ASN A N     1 
ATOM   2843  C  CA    . ASN A 1 402  ? -74.493 -48.507 -22.744 1.00 124.55 ? 402  ASN A CA    1 
ATOM   2844  C  C     . ASN A 1 402  ? -75.068 -47.209 -23.303 1.00 122.04 ? 402  ASN A C     1 
ATOM   2845  O  O     . ASN A 1 402  ? -76.200 -47.197 -23.779 1.00 120.83 ? 402  ASN A O     1 
ATOM   2846  C  CB    . ASN A 1 402  ? -74.721 -48.594 -21.229 1.00 130.75 ? 402  ASN A CB    1 
ATOM   2847  C  CG    . ASN A 1 402  ? -73.952 -49.744 -20.579 1.00 139.14 ? 402  ASN A CG    1 
ATOM   2848  O  OD1   . ASN A 1 402  ? -73.335 -49.579 -19.511 1.00 130.39 ? 402  ASN A OD1   1 
ATOM   2849  N  ND2   . ASN A 1 402  ? -73.968 -50.911 -21.231 1.00 135.25 ? 402  ASN A ND2   1 
ATOM   2850  N  N     . ALA A 1 403  ? -74.288 -46.126 -23.245 1.00 126.18 ? 403  ALA A N     1 
ATOM   2851  C  CA    . ALA A 1 403  ? -74.694 -44.814 -23.783 1.00 121.52 ? 403  ALA A CA    1 
ATOM   2852  C  C     . ALA A 1 403  ? -74.152 -44.535 -25.178 1.00 117.86 ? 403  ALA A C     1 
ATOM   2853  O  O     . ALA A 1 403  ? -74.539 -43.559 -25.806 1.00 126.69 ? 403  ALA A O     1 
ATOM   2854  C  CB    . ALA A 1 403  ? -74.269 -43.698 -22.842 1.00 123.31 ? 403  ALA A CB    1 
ATOM   2855  N  N     . ASP A 1 404  ? -73.237 -45.379 -25.659 1.00 113.22 ? 404  ASP A N     1 
ATOM   2856  C  CA    . ASP A 1 404  ? -72.673 -45.270 -27.006 1.00 115.90 ? 404  ASP A CA    1 
ATOM   2857  C  C     . ASP A 1 404  ? -73.690 -45.732 -28.061 1.00 116.86 ? 404  ASP A C     1 
ATOM   2858  O  O     . ASP A 1 404  ? -74.714 -46.335 -27.727 1.00 112.10 ? 404  ASP A O     1 
ATOM   2859  C  CB    . ASP A 1 404  ? -71.353 -46.089 -27.098 1.00 114.67 ? 404  ASP A CB    1 
ATOM   2860  C  CG    . ASP A 1 404  ? -70.359 -45.551 -28.165 1.00 112.03 ? 404  ASP A CG    1 
ATOM   2861  O  OD1   . ASP A 1 404  ? -70.765 -44.830 -29.110 1.00 103.12 ? 404  ASP A OD1   1 
ATOM   2862  O  OD2   . ASP A 1 404  ? -69.152 -45.869 -28.062 1.00 105.13 ? 404  ASP A OD2   1 
ATOM   2863  N  N     . LEU A 1 405  ? -73.401 -45.408 -29.322 1.00 115.23 ? 405  LEU A N     1 
ATOM   2864  C  CA    . LEU A 1 405  ? -74.053 -46.040 -30.467 1.00 110.40 ? 405  LEU A CA    1 
ATOM   2865  C  C     . LEU A 1 405  ? -73.700 -47.504 -30.465 1.00 111.12 ? 405  LEU A C     1 
ATOM   2866  O  O     . LEU A 1 405  ? -72.576 -47.869 -30.091 1.00 121.91 ? 405  LEU A O     1 
ATOM   2867  C  CB    . LEU A 1 405  ? -73.514 -45.470 -31.783 1.00 113.49 ? 405  LEU A CB    1 
ATOM   2868  C  CG    . LEU A 1 405  ? -73.882 -44.066 -32.265 1.00 120.98 ? 405  LEU A CG    1 
ATOM   2869  C  CD1   . LEU A 1 405  ? -73.318 -43.014 -31.338 1.00 125.83 ? 405  LEU A CD1   1 
ATOM   2870  C  CD2   . LEU A 1 405  ? -73.384 -43.829 -33.688 1.00 119.81 ? 405  LEU A CD2   1 
ATOM   2871  N  N     . LYS A 1 406  ? -74.639 -48.346 -30.874 1.00 108.53 ? 406  LYS A N     1 
ATOM   2872  C  CA    . LYS A 1 406  ? -74.340 -49.770 -31.089 1.00 120.72 ? 406  LYS A CA    1 
ATOM   2873  C  C     . LYS A 1 406  ? -73.591 -49.881 -32.424 1.00 114.33 ? 406  LYS A C     1 
ATOM   2874  O  O     . LYS A 1 406  ? -73.787 -49.014 -33.292 1.00 99.51  ? 406  LYS A O     1 
ATOM   2875  C  CB    . LYS A 1 406  ? -75.621 -50.618 -31.120 1.00 124.01 ? 406  LYS A CB    1 
ATOM   2876  C  CG    . LYS A 1 406  ? -76.671 -50.113 -32.101 1.00 131.48 ? 406  LYS A CG    1 
ATOM   2877  C  CD    . LYS A 1 406  ? -77.798 -51.099 -32.398 1.00 136.45 ? 406  LYS A CD    1 
ATOM   2878  C  CE    . LYS A 1 406  ? -79.113 -50.749 -31.729 1.00 136.27 ? 406  LYS A CE    1 
ATOM   2879  N  NZ    . LYS A 1 406  ? -79.030 -50.955 -30.262 1.00 142.75 ? 406  LYS A NZ    1 
ATOM   2880  N  N     . PRO A 1 407  ? -72.741 -50.924 -32.604 1.00 115.55 ? 407  PRO A N     1 
ATOM   2881  C  CA    . PRO A 1 407  ? -71.791 -50.913 -33.739 1.00 118.70 ? 407  PRO A CA    1 
ATOM   2882  C  C     . PRO A 1 407  ? -72.420 -50.802 -35.154 1.00 118.55 ? 407  PRO A C     1 
ATOM   2883  O  O     . PRO A 1 407  ? -71.758 -50.323 -36.087 1.00 133.66 ? 407  PRO A O     1 
ATOM   2884  C  CB    . PRO A 1 407  ? -71.043 -52.249 -33.591 1.00 117.45 ? 407  PRO A CB    1 
ATOM   2885  C  CG    . PRO A 1 407  ? -71.358 -52.738 -32.218 1.00 123.68 ? 407  PRO A CG    1 
ATOM   2886  C  CD    . PRO A 1 407  ? -72.732 -52.224 -31.915 1.00 122.60 ? 407  PRO A CD    1 
ATOM   2887  N  N     . GLN A 1 408  ? -73.684 -51.228 -35.295 1.00 108.31 ? 408  GLN A N     1 
ATOM   2888  C  CA    . GLN A 1 408  ? -74.346 -51.279 -36.587 1.00 108.90 ? 408  GLN A CA    1 
ATOM   2889  C  C     . GLN A 1 408  ? -75.205 -50.049 -36.945 1.00 109.48 ? 408  GLN A C     1 
ATOM   2890  O  O     . GLN A 1 408  ? -75.936 -50.091 -37.949 1.00 114.62 ? 408  GLN A O     1 
ATOM   2891  C  CB    . GLN A 1 408  ? -75.112 -52.598 -36.777 1.00 108.08 ? 408  GLN A CB    1 
ATOM   2892  C  CG    . GLN A 1 408  ? -76.492 -52.658 -36.182 1.00 103.40 ? 408  GLN A CG    1 
ATOM   2893  C  CD    . GLN A 1 408  ? -76.469 -53.121 -34.761 1.00 109.48 ? 408  GLN A CD    1 
ATOM   2894  O  OE1   . GLN A 1 408  ? -75.398 -53.274 -34.157 1.00 106.00 ? 408  GLN A OE1   1 
ATOM   2895  N  NE2   . GLN A 1 408  ? -77.662 -53.363 -34.207 1.00 118.57 ? 408  GLN A NE2   1 
ATOM   2896  N  N     . GLU A 1 409  ? -75.105 -48.947 -36.187 1.00 105.37 ? 409  GLU A N     1 
ATOM   2897  C  CA    . GLU A 1 409  ? -75.889 -47.746 -36.491 1.00 109.72 ? 409  GLU A CA    1 
ATOM   2898  C  C     . GLU A 1 409  ? -75.076 -46.483 -36.685 1.00 108.11 ? 409  GLU A C     1 
ATOM   2899  O  O     . GLU A 1 409  ? -73.889 -46.429 -36.362 1.00 119.61 ? 409  GLU A O     1 
ATOM   2900  C  CB    . GLU A 1 409  ? -77.038 -47.555 -35.511 1.00 115.09 ? 409  GLU A CB    1 
ATOM   2901  C  CG    . GLU A 1 409  ? -76.669 -47.197 -34.095 1.00 122.55 ? 409  GLU A CG    1 
ATOM   2902  C  CD    . GLU A 1 409  ? -77.873 -47.258 -33.160 1.00 125.41 ? 409  GLU A CD    1 
ATOM   2903  O  OE1   . GLU A 1 409  ? -79.042 -47.329 -33.642 1.00 108.11 ? 409  GLU A OE1   1 
ATOM   2904  O  OE2   . GLU A 1 409  ? -77.630 -47.247 -31.931 1.00 120.34 ? 409  GLU A OE2   1 
ATOM   2905  N  N     . ILE A 1 410  ? -75.745 -45.468 -37.236 1.00 100.79 ? 410  ILE A N     1 
ATOM   2906  C  CA    . ILE A 1 410  ? -75.127 -44.188 -37.634 1.00 94.37  ? 410  ILE A CA    1 
ATOM   2907  C  C     . ILE A 1 410  ? -75.891 -42.992 -37.082 1.00 86.62  ? 410  ILE A C     1 
ATOM   2908  O  O     . ILE A 1 410  ? -77.101 -43.041 -36.892 1.00 84.07  ? 410  ILE A O     1 
ATOM   2909  C  CB    . ILE A 1 410  ? -75.071 -44.056 -39.182 1.00 100.08 ? 410  ILE A CB    1 
ATOM   2910  C  CG1   . ILE A 1 410  ? -76.473 -44.029 -39.835 1.00 101.65 ? 410  ILE A CG1   1 
ATOM   2911  C  CG2   . ILE A 1 410  ? -74.316 -45.226 -39.785 1.00 106.96 ? 410  ILE A CG2   1 
ATOM   2912  C  CD1   . ILE A 1 410  ? -76.962 -42.660 -40.265 1.00 98.66  ? 410  ILE A CD1   1 
ATOM   2913  N  N     . LEU A 1 411  ? -75.161 -41.911 -36.855 1.00 93.77  ? 411  LEU A N     1 
ATOM   2914  C  CA    . LEU A 1 411  ? -75.718 -40.654 -36.357 1.00 94.01  ? 411  LEU A CA    1 
ATOM   2915  C  C     . LEU A 1 411  ? -76.354 -39.865 -37.499 1.00 88.67  ? 411  LEU A C     1 
ATOM   2916  O  O     . LEU A 1 411  ? -75.667 -39.480 -38.428 1.00 81.84  ? 411  LEU A O     1 
ATOM   2917  C  CB    . LEU A 1 411  ? -74.608 -39.799 -35.738 1.00 100.34 ? 411  LEU A CB    1 
ATOM   2918  C  CG    . LEU A 1 411  ? -74.993 -38.447 -35.143 1.00 98.72  ? 411  LEU A CG    1 
ATOM   2919  C  CD1   . LEU A 1 411  ? -75.974 -38.649 -34.005 1.00 100.64 ? 411  LEU A CD1   1 
ATOM   2920  C  CD2   . LEU A 1 411  ? -73.752 -37.712 -34.660 1.00 97.48  ? 411  LEU A CD2   1 
ATOM   2921  N  N     . VAL A 1 412  ? -77.663 -39.630 -37.424 1.00 91.11  ? 412  VAL A N     1 
ATOM   2922  C  CA    . VAL A 1 412  ? -78.397 -38.916 -38.485 1.00 100.24 ? 412  VAL A CA    1 
ATOM   2923  C  C     . VAL A 1 412  ? -78.389 -37.407 -38.243 1.00 99.67  ? 412  VAL A C     1 
ATOM   2924  O  O     . VAL A 1 412  ? -78.136 -36.631 -39.166 1.00 101.96 ? 412  VAL A O     1 
ATOM   2925  C  CB    . VAL A 1 412  ? -79.863 -39.336 -38.663 1.00 104.11 ? 412  VAL A CB    1 
ATOM   2926  C  CG1   . VAL A 1 412  ? -80.296 -39.030 -40.095 1.00 104.41 ? 412  VAL A CG1   1 
ATOM   2927  C  CG2   . VAL A 1 412  ? -80.076 -40.811 -38.368 1.00 112.66 ? 412  VAL A CG2   1 
ATOM   2928  N  N     . SER A 1 413  ? -78.692 -37.013 -37.008 1.00 99.84  ? 413  SER A N     1 
ATOM   2929  C  CA    . SER A 1 413  ? -78.775 -35.623 -36.634 1.00 112.99 ? 413  SER A CA    1 
ATOM   2930  C  C     . SER A 1 413  ? -78.755 -35.437 -35.123 1.00 106.81 ? 413  SER A C     1 
ATOM   2931  O  O     . SER A 1 413  ? -79.008 -36.376 -34.368 1.00 105.92 ? 413  SER A O     1 
ATOM   2932  C  CB    . SER A 1 413  ? -80.021 -34.996 -37.259 1.00 121.18 ? 413  SER A CB    1 
ATOM   2933  O  OG    . SER A 1 413  ? -81.088 -35.924 -37.281 1.00 126.65 ? 413  SER A OG    1 
ATOM   2934  N  N     . VAL A 1 414  ? -78.494 -34.197 -34.704 1.00 102.92 ? 414  VAL A N     1 
ATOM   2935  C  CA    . VAL A 1 414  ? -78.522 -33.811 -33.285 1.00 99.48  ? 414  VAL A CA    1 
ATOM   2936  C  C     . VAL A 1 414  ? -79.591 -32.744 -33.066 1.00 103.18 ? 414  VAL A C     1 
ATOM   2937  O  O     . VAL A 1 414  ? -79.772 -31.863 -33.897 1.00 89.44  ? 414  VAL A O     1 
ATOM   2938  C  CB    . VAL A 1 414  ? -77.130 -33.327 -32.819 1.00 100.26 ? 414  VAL A CB    1 
ATOM   2939  C  CG1   . VAL A 1 414  ? -76.682 -32.085 -33.576 1.00 93.71  ? 414  VAL A CG1   1 
ATOM   2940  C  CG2   . VAL A 1 414  ? -77.116 -33.061 -31.319 1.00 107.52 ? 414  VAL A CG2   1 
ATOM   2941  N  N     . ASN A 1 415  ? -80.300 -32.835 -31.941 1.00 109.11 ? 415  ASN A N     1 
ATOM   2942  C  CA    . ASN A 1 415  ? -81.270 -31.818 -31.525 1.00 98.07  ? 415  ASN A CA    1 
ATOM   2943  C  C     . ASN A 1 415  ? -80.629 -30.914 -30.494 1.00 93.79  ? 415  ASN A C     1 
ATOM   2944  O  O     . ASN A 1 415  ? -80.190 -31.397 -29.454 1.00 94.29  ? 415  ASN A O     1 
ATOM   2945  C  CB    . ASN A 1 415  ? -82.521 -32.448 -30.971 1.00 94.33  ? 415  ASN A CB    1 
ATOM   2946  C  CG    . ASN A 1 415  ? -83.084 -33.446 -31.924 1.00 98.96  ? 415  ASN A CG    1 
ATOM   2947  O  OD1   . ASN A 1 415  ? -83.528 -33.082 -33.007 1.00 104.04 ? 415  ASN A OD1   1 
ATOM   2948  N  ND2   . ASN A 1 415  ? -82.994 -34.724 -31.572 1.00 101.19 ? 415  ASN A ND2   1 
ATOM   2949  N  N     . ILE A 1 416  ? -80.538 -29.619 -30.801 1.00 83.63  ? 416  ILE A N     1 
ATOM   2950  C  CA    . ILE A 1 416  ? -80.118 -28.615 -29.830 1.00 92.82  ? 416  ILE A CA    1 
ATOM   2951  C  C     . ILE A 1 416  ? -81.367 -27.789 -29.517 1.00 94.11  ? 416  ILE A C     1 
ATOM   2952  O  O     . ILE A 1 416  ? -81.876 -27.090 -30.392 1.00 104.74 ? 416  ILE A O     1 
ATOM   2953  C  CB    . ILE A 1 416  ? -78.980 -27.719 -30.350 1.00 96.80  ? 416  ILE A CB    1 
ATOM   2954  C  CG1   . ILE A 1 416  ? -77.790 -28.543 -30.850 1.00 93.86  ? 416  ILE A CG1   1 
ATOM   2955  C  CG2   . ILE A 1 416  ? -78.469 -26.836 -29.223 1.00 106.15 ? 416  ILE A CG2   1 
ATOM   2956  C  CD1   . ILE A 1 416  ? -77.724 -28.678 -32.344 1.00 93.86  ? 416  ILE A CD1   1 
ATOM   2957  N  N     . PRO A 1 417  ? -81.884 -27.884 -28.278 1.00 95.22  ? 417  PRO A N     1 
ATOM   2958  C  CA    . PRO A 1 417  ? -83.125 -27.191 -27.949 1.00 98.22  ? 417  PRO A CA    1 
ATOM   2959  C  C     . PRO A 1 417  ? -82.915 -25.696 -27.693 1.00 102.11 ? 417  PRO A C     1 
ATOM   2960  O  O     . PRO A 1 417  ? -81.794 -25.265 -27.381 1.00 101.15 ? 417  PRO A O     1 
ATOM   2961  C  CB    . PRO A 1 417  ? -83.596 -27.906 -26.683 1.00 103.29 ? 417  PRO A CB    1 
ATOM   2962  C  CG    . PRO A 1 417  ? -82.346 -28.401 -26.035 1.00 101.80 ? 417  PRO A CG    1 
ATOM   2963  C  CD    . PRO A 1 417  ? -81.355 -28.652 -27.135 1.00 100.69 ? 417  PRO A CD    1 
ATOM   2964  N  N     . TYR A 1 418  ? -83.991 -24.919 -27.831 1.00 107.62 ? 418  TYR A N     1 
ATOM   2965  C  CA    . TYR A 1 418  ? -83.975 -23.500 -27.476 1.00 106.14 ? 418  TYR A CA    1 
ATOM   2966  C  C     . TYR A 1 418  ? -83.803 -23.377 -25.964 1.00 103.19 ? 418  TYR A C     1 
ATOM   2967  O  O     . TYR A 1 418  ? -84.249 -24.234 -25.209 1.00 96.05  ? 418  TYR A O     1 
ATOM   2968  C  CB    . TYR A 1 418  ? -85.274 -22.800 -27.929 1.00 110.52 ? 418  TYR A CB    1 
ATOM   2969  C  CG    . TYR A 1 418  ? -85.583 -22.801 -29.440 1.00 116.98 ? 418  TYR A CG    1 
ATOM   2970  C  CD1   . TYR A 1 418  ? -84.662 -22.340 -30.377 1.00 114.83 ? 418  TYR A CD1   1 
ATOM   2971  C  CD2   . TYR A 1 418  ? -86.827 -23.217 -29.919 1.00 129.33 ? 418  TYR A CD2   1 
ATOM   2972  C  CE1   . TYR A 1 418  ? -84.953 -22.329 -31.738 1.00 111.32 ? 418  TYR A CE1   1 
ATOM   2973  C  CE2   . TYR A 1 418  ? -87.123 -23.210 -31.282 1.00 126.11 ? 418  TYR A CE2   1 
ATOM   2974  C  CZ    . TYR A 1 418  ? -86.182 -22.763 -32.188 1.00 117.83 ? 418  TYR A CZ    1 
ATOM   2975  O  OH    . TYR A 1 418  ? -86.474 -22.751 -33.541 1.00 112.49 ? 418  TYR A OH    1 
ATOM   2976  N  N     . SER A 1 419  ? -83.159 -22.307 -25.526 1.00 108.82 ? 419  SER A N     1 
ATOM   2977  C  CA    . SER A 1 419  ? -83.058 -22.003 -24.111 1.00 118.11 ? 419  SER A CA    1 
ATOM   2978  C  C     . SER A 1 419  ? -84.393 -21.478 -23.578 1.00 120.04 ? 419  SER A C     1 
ATOM   2979  O  O     . SER A 1 419  ? -85.128 -20.793 -24.293 1.00 129.15 ? 419  SER A O     1 
ATOM   2980  C  CB    . SER A 1 419  ? -81.935 -21.002 -23.932 1.00 127.54 ? 419  SER A CB    1 
ATOM   2981  O  OG    . SER A 1 419  ? -81.603 -20.468 -25.207 1.00 134.28 ? 419  SER A OG    1 
ATOM   2982  N  N     . ARG A 1 420  ? -84.721 -21.831 -22.339 1.00 121.33 ? 420  ARG A N     1 
ATOM   2983  C  CA    . ARG A 1 420  ? -85.873 -21.280 -21.661 1.00 113.38 ? 420  ARG A CA    1 
ATOM   2984  C  C     . ARG A 1 420  ? -85.512 -19.941 -21.055 1.00 113.59 ? 420  ARG A C     1 
ATOM   2985  O  O     . ARG A 1 420  ? -84.338 -19.653 -20.854 1.00 119.29 ? 420  ARG A O     1 
ATOM   2986  C  CB    . ARG A 1 420  ? -86.260 -22.196 -20.495 1.00 105.86 ? 420  ARG A CB    1 
ATOM   2987  C  CG    . ARG A 1 420  ? -86.699 -23.582 -20.919 1.00 109.39 ? 420  ARG A CG    1 
ATOM   2988  C  CD    . ARG A 1 420  ? -86.667 -24.533 -19.745 1.00 110.95 ? 420  ARG A CD    1 
ATOM   2989  N  NE    . ARG A 1 420  ? -85.311 -24.996 -19.471 1.00 114.44 ? 420  ARG A NE    1 
ATOM   2990  C  CZ    . ARG A 1 420  ? -84.941 -25.655 -18.372 1.00 120.20 ? 420  ARG A CZ    1 
ATOM   2991  N  NH1   . ARG A 1 420  ? -85.818 -25.951 -17.414 1.00 112.85 ? 420  ARG A NH1   1 
ATOM   2992  N  NH2   . ARG A 1 420  ? -83.673 -26.021 -18.225 1.00 129.61 ? 420  ARG A NH2   1 
ATOM   2993  N  N     . LYS A 1 421  ? -86.513 -19.132 -20.732 1.00 113.58 ? 421  LYS A N     1 
ATOM   2994  C  CA    . LYS A 1 421  ? -86.274 -17.891 -19.983 1.00 103.83 ? 421  LYS A CA    1 
ATOM   2995  C  C     . LYS A 1 421  ? -85.804 -18.238 -18.544 1.00 99.44  ? 421  LYS A C     1 
ATOM   2996  O  O     . LYS A 1 421  ? -86.308 -19.179 -17.901 1.00 83.96  ? 421  LYS A O     1 
ATOM   2997  C  CB    . LYS A 1 421  ? -87.489 -16.960 -20.028 1.00 106.72 ? 421  LYS A CB    1 
ATOM   2998  C  CG    . LYS A 1 421  ? -87.265 -15.568 -19.444 1.00 110.05 ? 421  LYS A CG    1 
ATOM   2999  C  CD    . LYS A 1 421  ? -88.577 -14.796 -19.322 1.00 115.30 ? 421  LYS A CD    1 
ATOM   3000  C  CE    . LYS A 1 421  ? -88.573 -13.789 -18.186 1.00 120.09 ? 421  LYS A CE    1 
ATOM   3001  N  NZ    . LYS A 1 421  ? -89.045 -12.457 -18.664 1.00 137.06 ? 421  LYS A NZ    1 
ATOM   3002  N  N     . TRP A 1 422  ? -84.816 -17.464 -18.082 1.00 101.33 ? 422  TRP A N     1 
ATOM   3003  C  CA    . TRP A 1 422  ? -84.018 -17.745 -16.872 1.00 94.28  ? 422  TRP A CA    1 
ATOM   3004  C  C     . TRP A 1 422  ? -83.048 -18.919 -17.030 1.00 98.87  ? 422  TRP A C     1 
ATOM   3005  O  O     . TRP A 1 422  ? -82.592 -19.496 -16.041 1.00 105.38 ? 422  TRP A O     1 
ATOM   3006  C  CB    . TRP A 1 422  ? -84.898 -17.869 -15.617 1.00 98.75  ? 422  TRP A CB    1 
ATOM   3007  C  CG    . TRP A 1 422  ? -85.713 -16.623 -15.438 1.00 106.03 ? 422  TRP A CG    1 
ATOM   3008  C  CD1   . TRP A 1 422  ? -86.980 -16.386 -15.913 1.00 108.73 ? 422  TRP A CD1   1 
ATOM   3009  C  CD2   . TRP A 1 422  ? -85.289 -15.410 -14.812 1.00 105.46 ? 422  TRP A CD2   1 
ATOM   3010  N  NE1   . TRP A 1 422  ? -87.370 -15.108 -15.604 1.00 110.16 ? 422  TRP A NE1   1 
ATOM   3011  C  CE2   . TRP A 1 422  ? -86.352 -14.487 -14.924 1.00 111.10 ? 422  TRP A CE2   1 
ATOM   3012  C  CE3   . TRP A 1 422  ? -84.119 -15.016 -14.154 1.00 107.94 ? 422  TRP A CE3   1 
ATOM   3013  C  CZ2   . TRP A 1 422  ? -86.282 -13.193 -14.388 1.00 113.15 ? 422  TRP A CZ2   1 
ATOM   3014  C  CZ3   . TRP A 1 422  ? -84.051 -13.734 -13.630 1.00 113.56 ? 422  TRP A CZ3   1 
ATOM   3015  C  CH2   . TRP A 1 422  ? -85.128 -12.836 -13.751 1.00 108.97 ? 422  TRP A CH2   1 
ATOM   3016  N  N     . GLU A 1 423  ? -82.712 -19.247 -18.274 1.00 107.04 ? 423  GLU A N     1 
ATOM   3017  C  CA    . GLU A 1 423  ? -81.687 -20.220 -18.569 1.00 102.15 ? 423  GLU A CA    1 
ATOM   3018  C  C     . GLU A 1 423  ? -80.561 -19.490 -19.290 1.00 103.53 ? 423  GLU A C     1 
ATOM   3019  O  O     . GLU A 1 423  ? -80.805 -18.698 -20.217 1.00 110.03 ? 423  GLU A O     1 
ATOM   3020  C  CB    . GLU A 1 423  ? -82.252 -21.307 -19.464 1.00 103.32 ? 423  GLU A CB    1 
ATOM   3021  C  CG    . GLU A 1 423  ? -81.507 -22.623 -19.428 1.00 105.61 ? 423  GLU A CG    1 
ATOM   3022  C  CD    . GLU A 1 423  ? -82.072 -23.615 -20.430 1.00 109.06 ? 423  GLU A CD    1 
ATOM   3023  O  OE1   . GLU A 1 423  ? -82.469 -23.182 -21.538 1.00 93.55  ? 423  GLU A OE1   1 
ATOM   3024  O  OE2   . GLU A 1 423  ? -82.121 -24.827 -20.112 1.00 117.94 ? 423  GLU A OE2   1 
ATOM   3025  N  N     . PHE A 1 424  ? -79.335 -19.784 -18.858 1.00 100.57 ? 424  PHE A N     1 
ATOM   3026  C  CA    . PHE A 1 424  ? -78.133 -19.107 -19.336 1.00 107.00 ? 424  PHE A CA    1 
ATOM   3027  C  C     . PHE A 1 424  ? -77.026 -20.130 -19.606 1.00 107.03 ? 424  PHE A C     1 
ATOM   3028  O  O     . PHE A 1 424  ? -76.871 -21.116 -18.887 1.00 106.90 ? 424  PHE A O     1 
ATOM   3029  C  CB    . PHE A 1 424  ? -77.650 -18.060 -18.331 1.00 112.13 ? 424  PHE A CB    1 
ATOM   3030  C  CG    . PHE A 1 424  ? -78.737 -17.155 -17.834 1.00 111.10 ? 424  PHE A CG    1 
ATOM   3031  C  CD1   . PHE A 1 424  ? -79.303 -16.215 -18.674 1.00 112.72 ? 424  PHE A CD1   1 
ATOM   3032  C  CD2   . PHE A 1 424  ? -79.197 -17.254 -16.532 1.00 107.41 ? 424  PHE A CD2   1 
ATOM   3033  C  CE1   . PHE A 1 424  ? -80.308 -15.387 -18.224 1.00 116.43 ? 424  PHE A CE1   1 
ATOM   3034  C  CE2   . PHE A 1 424  ? -80.199 -16.426 -16.076 1.00 113.30 ? 424  PHE A CE2   1 
ATOM   3035  C  CZ    . PHE A 1 424  ? -80.758 -15.492 -16.923 1.00 117.86 ? 424  PHE A CZ    1 
ATOM   3036  N  N     . VAL A 1 425  ? -76.245 -19.864 -20.650 1.00 106.94 ? 425  VAL A N     1 
ATOM   3037  C  CA    . VAL A 1 425  ? -75.232 -20.790 -21.115 1.00 104.06 ? 425  VAL A CA    1 
ATOM   3038  C  C     . VAL A 1 425  ? -73.970 -20.010 -21.437 1.00 104.50 ? 425  VAL A C     1 
ATOM   3039  O  O     . VAL A 1 425  ? -74.011 -18.911 -22.011 1.00 96.92  ? 425  VAL A O     1 
ATOM   3040  C  CB    . VAL A 1 425  ? -75.723 -21.650 -22.297 1.00 109.06 ? 425  VAL A CB    1 
ATOM   3041  C  CG1   . VAL A 1 425  ? -74.585 -22.462 -22.901 1.00 116.36 ? 425  VAL A CG1   1 
ATOM   3042  C  CG2   . VAL A 1 425  ? -76.812 -22.594 -21.816 1.00 112.37 ? 425  VAL A CG2   1 
ATOM   3043  N  N     . SER A 1 426  ? -72.840 -20.585 -21.045 1.00 107.39 ? 426  SER A N     1 
ATOM   3044  C  CA    . SER A 1 426  ? -71.536 -19.960 -21.268 1.00 110.38 ? 426  SER A CA    1 
ATOM   3045  C  C     . SER A 1 426  ? -70.466 -20.993 -21.616 1.00 103.87 ? 426  SER A C     1 
ATOM   3046  O  O     . SER A 1 426  ? -70.433 -22.076 -21.042 1.00 99.10  ? 426  SER A O     1 
ATOM   3047  C  CB    . SER A 1 426  ? -71.160 -19.153 -20.025 1.00 124.35 ? 426  SER A CB    1 
ATOM   3048  O  OG    . SER A 1 426  ? -70.458 -17.973 -20.369 1.00 140.38 ? 426  SER A OG    1 
ATOM   3049  N  N     . ALA A 1 427  ? -69.599 -20.643 -22.573 1.00 100.89 ? 427  ALA A N     1 
ATOM   3050  C  CA    . ALA A 1 427  ? -68.495 -21.497 -22.985 1.00 86.89  ? 427  ALA A CA    1 
ATOM   3051  C  C     . ALA A 1 427  ? -67.183 -20.714 -22.996 1.00 91.98  ? 427  ALA A C     1 
ATOM   3052  O  O     . ALA A 1 427  ? -67.133 -19.577 -23.473 1.00 92.63  ? 427  ALA A O     1 
ATOM   3053  C  CB    . ALA A 1 427  ? -68.777 -22.062 -24.351 1.00 78.87  ? 427  ALA A CB    1 
ATOM   3054  N  N     . PHE A 1 428  ? -66.124 -21.317 -22.463 1.00 92.97  ? 428  PHE A N     1 
ATOM   3055  C  CA    . PHE A 1 428  ? -64.823 -20.701 -22.390 1.00 93.36  ? 428  PHE A CA    1 
ATOM   3056  C  C     . PHE A 1 428  ? -63.759 -21.622 -22.974 1.00 85.16  ? 428  PHE A C     1 
ATOM   3057  O  O     . PHE A 1 428  ? -63.955 -22.821 -22.996 1.00 76.67  ? 428  PHE A O     1 
ATOM   3058  C  CB    . PHE A 1 428  ? -64.487 -20.476 -20.930 1.00 100.11 ? 428  PHE A CB    1 
ATOM   3059  C  CG    . PHE A 1 428  ? -65.560 -19.779 -20.190 1.00 104.20 ? 428  PHE A CG    1 
ATOM   3060  C  CD1   . PHE A 1 428  ? -65.733 -18.398 -20.341 1.00 112.31 ? 428  PHE A CD1   1 
ATOM   3061  C  CD2   . PHE A 1 428  ? -66.423 -20.489 -19.380 1.00 102.49 ? 428  PHE A CD2   1 
ATOM   3062  C  CE1   . PHE A 1 428  ? -66.744 -17.729 -19.673 1.00 109.83 ? 428  PHE A CE1   1 
ATOM   3063  C  CE2   . PHE A 1 428  ? -67.434 -19.829 -18.704 1.00 113.97 ? 428  PHE A CE2   1 
ATOM   3064  C  CZ    . PHE A 1 428  ? -67.596 -18.445 -18.850 1.00 116.53 ? 428  PHE A CZ    1 
ATOM   3065  N  N     . ARG A 1 429  ? -62.633 -21.061 -23.421 1.00 85.42  ? 429  ARG A N     1 
ATOM   3066  C  CA    . ARG A 1 429  ? -61.475 -21.861 -23.785 1.00 86.15  ? 429  ARG A CA    1 
ATOM   3067  C  C     . ARG A 1 429  ? -60.169 -21.078 -23.661 1.00 81.04  ? 429  ARG A C     1 
ATOM   3068  O  O     . ARG A 1 429  ? -60.139 -19.861 -23.855 1.00 75.09  ? 429  ARG A O     1 
ATOM   3069  C  CB    . ARG A 1 429  ? -61.614 -22.379 -25.214 1.00 92.33  ? 429  ARG A CB    1 
ATOM   3070  C  CG    . ARG A 1 429  ? -61.265 -21.367 -26.290 1.00 94.16  ? 429  ARG A CG    1 
ATOM   3071  C  CD    . ARG A 1 429  ? -61.791 -21.827 -27.624 1.00 100.26 ? 429  ARG A CD    1 
ATOM   3072  N  NE    . ARG A 1 429  ? -61.146 -23.067 -28.024 1.00 108.19 ? 429  ARG A NE    1 
ATOM   3073  C  CZ    . ARG A 1 429  ? -60.056 -23.145 -28.780 1.00 121.05 ? 429  ARG A CZ    1 
ATOM   3074  N  NH1   . ARG A 1 429  ? -59.460 -22.040 -29.238 1.00 116.89 ? 429  ARG A NH1   1 
ATOM   3075  N  NH2   . ARG A 1 429  ? -59.566 -24.347 -29.088 1.00 131.82 ? 429  ARG A NH2   1 
ATOM   3076  N  N     . GLN A 1 430  ? -59.079 -21.804 -23.402 1.00 77.21  ? 430  GLN A N     1 
ATOM   3077  C  CA    . GLN A 1 430  ? -57.756 -21.245 -23.525 1.00 80.01  ? 430  GLN A CA    1 
ATOM   3078  C  C     . GLN A 1 430  ? -56.822 -22.190 -24.268 1.00 86.58  ? 430  GLN A C     1 
ATOM   3079  O  O     . GLN A 1 430  ? -56.699 -23.366 -23.927 1.00 88.57  ? 430  GLN A O     1 
ATOM   3080  C  CB    . GLN A 1 430  ? -57.183 -20.855 -22.172 1.00 83.87  ? 430  GLN A CB    1 
ATOM   3081  C  CG    . GLN A 1 430  ? -56.015 -19.880 -22.282 1.00 87.44  ? 430  GLN A CG    1 
ATOM   3082  C  CD    . GLN A 1 430  ? -56.373 -18.639 -23.085 1.00 95.27  ? 430  GLN A CD    1 
ATOM   3083  O  OE1   . GLN A 1 430  ? -57.315 -17.911 -22.752 1.00 96.12  ? 430  GLN A OE1   1 
ATOM   3084  N  NE2   . GLN A 1 430  ? -55.640 -18.404 -24.165 1.00 103.68 ? 430  GLN A NE2   1 
ATOM   3085  N  N     . ALA A 1 431  ? -56.188 -21.634 -25.304 1.00 90.27  ? 431  ALA A N     1 
ATOM   3086  C  CA    . ALA A 1 431  ? -55.214 -22.359 -26.129 1.00 99.15  ? 431  ALA A CA    1 
ATOM   3087  C  C     . ALA A 1 431  ? -53.852 -21.639 -26.054 1.00 104.59 ? 431  ALA A C     1 
ATOM   3088  O  O     . ALA A 1 431  ? -53.654 -20.811 -25.175 1.00 104.06 ? 431  ALA A O     1 
ATOM   3089  C  CB    . ALA A 1 431  ? -55.715 -22.502 -27.561 1.00 96.70  ? 431  ALA A CB    1 
ATOM   3090  N  N     . GLN A 1 432  ? -52.947 -21.967 -26.965 1.00 110.31 ? 432  GLN A N     1 
ATOM   3091  C  CA    . GLN A 1 432  ? -51.594 -21.381 -27.029 1.00 101.79 ? 432  GLN A CA    1 
ATOM   3092  C  C     . GLN A 1 432  ? -51.584 -20.035 -27.758 1.00 85.89  ? 432  GLN A C     1 
ATOM   3093  O  O     . GLN A 1 432  ? -50.777 -19.148 -27.432 1.00 67.76  ? 432  GLN A O     1 
ATOM   3094  C  CB    . GLN A 1 432  ? -50.669 -22.432 -27.676 1.00 107.01 ? 432  GLN A CB    1 
ATOM   3095  C  CG    . GLN A 1 432  ? -49.175 -22.254 -27.468 1.00 108.29 ? 432  GLN A CG    1 
ATOM   3096  C  CD    . GLN A 1 432  ? -48.760 -22.010 -26.026 1.00 111.42 ? 432  GLN A CD    1 
ATOM   3097  O  OE1   . GLN A 1 432  ? -49.377 -22.510 -25.056 1.00 106.80 ? 432  GLN A OE1   1 
ATOM   3098  N  NE2   . GLN A 1 432  ? -47.683 -21.238 -25.876 1.00 110.50 ? 432  GLN A NE2   1 
ATOM   3099  N  N     . ARG A 1 433  ? -52.446 -19.926 -28.774 1.00 88.70  ? 433  ARG A N     1 
ATOM   3100  C  CA    . ARG A 1 433  ? -52.777 -18.656 -29.422 1.00 97.01  ? 433  ARG A CA    1 
ATOM   3101  C  C     . ARG A 1 433  ? -54.305 -18.617 -29.598 1.00 99.73  ? 433  ARG A C     1 
ATOM   3102  O  O     . ARG A 1 433  ? -54.979 -19.576 -29.273 1.00 90.88  ? 433  ARG A O     1 
ATOM   3103  C  CB    . ARG A 1 433  ? -52.022 -18.457 -30.757 1.00 92.05  ? 433  ARG A CB    1 
ATOM   3104  C  CG    . ARG A 1 433  ? -52.668 -19.047 -32.000 1.00 90.17  ? 433  ARG A CG    1 
ATOM   3105  C  CD    . ARG A 1 433  ? -51.661 -19.285 -33.127 1.00 93.10  ? 433  ARG A CD    1 
ATOM   3106  N  NE    . ARG A 1 433  ? -51.994 -20.494 -33.892 1.00 98.66  ? 433  ARG A NE    1 
ATOM   3107  C  CZ    . ARG A 1 433  ? -51.168 -21.136 -34.718 1.00 109.14 ? 433  ARG A CZ    1 
ATOM   3108  N  NH1   . ARG A 1 433  ? -49.930 -20.702 -34.925 1.00 115.33 ? 433  ARG A NH1   1 
ATOM   3109  N  NH2   . ARG A 1 433  ? -51.585 -22.232 -35.347 1.00 113.53 ? 433  ARG A NH2   1 
ATOM   3110  N  N     . GLN A 1 434  ? -54.833 -17.502 -30.092 1.00 108.08 ? 434  GLN A N     1 
ATOM   3111  C  CA    . GLN A 1 434  ? -56.274 -17.204 -29.997 1.00 112.97 ? 434  GLN A CA    1 
ATOM   3112  C  C     . GLN A 1 434  ? -57.173 -18.026 -30.935 1.00 104.38 ? 434  GLN A C     1 
ATOM   3113  O  O     . GLN A 1 434  ? -58.342 -18.260 -30.654 1.00 103.27 ? 434  GLN A O     1 
ATOM   3114  C  CB    . GLN A 1 434  ? -56.515 -15.709 -30.262 1.00 117.97 ? 434  GLN A CB    1 
ATOM   3115  C  CG    . GLN A 1 434  ? -57.381 -15.011 -29.220 1.00 116.88 ? 434  GLN A CG    1 
ATOM   3116  C  CD    . GLN A 1 434  ? -56.995 -13.558 -29.031 1.00 119.73 ? 434  GLN A CD    1 
ATOM   3117  O  OE1   . GLN A 1 434  ? -56.508 -12.893 -29.959 1.00 126.13 ? 434  GLN A OE1   1 
ATOM   3118  N  NE2   . GLN A 1 434  ? -57.207 -13.052 -27.823 1.00 114.09 ? 434  GLN A NE2   1 
ATOM   3119  N  N     . GLU A 1 435  ? -56.620 -18.467 -32.068 1.00 104.11 ? 435  GLU A N     1 
ATOM   3120  C  CA    . GLU A 1 435  ? -57.288 -19.438 -32.935 1.00 107.46 ? 435  GLU A CA    1 
ATOM   3121  C  C     . GLU A 1 435  ? -56.334 -20.372 -33.670 1.00 98.86  ? 435  GLU A C     1 
ATOM   3122  O  O     . GLU A 1 435  ? -55.107 -20.244 -33.617 1.00 105.22 ? 435  GLU A O     1 
ATOM   3123  C  CB    . GLU A 1 435  ? -58.238 -18.738 -33.918 1.00 109.75 ? 435  GLU A CB    1 
ATOM   3124  C  CG    . GLU A 1 435  ? -57.616 -18.135 -35.163 1.00 111.14 ? 435  GLU A CG    1 
ATOM   3125  C  CD    . GLU A 1 435  ? -58.678 -17.780 -36.185 1.00 127.36 ? 435  GLU A CD    1 
ATOM   3126  O  OE1   . GLU A 1 435  ? -59.274 -18.704 -36.796 1.00 136.95 ? 435  GLU A OE1   1 
ATOM   3127  O  OE2   . GLU A 1 435  ? -58.927 -16.573 -36.372 1.00 131.03 ? 435  GLU A OE2   1 
ATOM   3128  N  N     . ASN A 1 436  ? -56.919 -21.332 -34.375 1.00 94.74  ? 436  ASN A N     1 
ATOM   3129  C  CA    . ASN A 1 436  ? -56.192 -22.408 -35.028 1.00 99.20  ? 436  ASN A CA    1 
ATOM   3130  C  C     . ASN A 1 436  ? -55.199 -23.067 -34.062 1.00 102.73 ? 436  ASN A C     1 
ATOM   3131  O  O     . ASN A 1 436  ? -54.011 -23.244 -34.362 1.00 114.38 ? 436  ASN A O     1 
ATOM   3132  C  CB    . ASN A 1 436  ? -55.505 -21.852 -36.262 1.00 105.94 ? 436  ASN A CB    1 
ATOM   3133  C  CG    . ASN A 1 436  ? -55.107 -22.926 -37.248 1.00 108.61 ? 436  ASN A CG    1 
ATOM   3134  O  OD1   . ASN A 1 436  ? -55.117 -24.125 -36.932 1.00 100.59 ? 436  ASN A OD1   1 
ATOM   3135  N  ND2   . ASN A 1 436  ? -54.726 -22.496 -38.456 1.00 106.68 ? 436  ASN A ND2   1 
ATOM   3136  N  N     . ALA A 1 437  ? -55.708 -23.412 -32.890 1.00 95.10  ? 437  ALA A N     1 
ATOM   3137  C  CA    . ALA A 1 437  ? -54.897 -23.965 -31.799 1.00 86.73  ? 437  ALA A CA    1 
ATOM   3138  C  C     . ALA A 1 437  ? -55.774 -24.754 -30.864 1.00 81.12  ? 437  ALA A C     1 
ATOM   3139  O  O     . ALA A 1 437  ? -56.846 -24.288 -30.532 1.00 83.43  ? 437  ALA A O     1 
ATOM   3140  C  CB    . ALA A 1 437  ? -54.222 -22.854 -31.037 1.00 85.85  ? 437  ALA A CB    1 
ATOM   3141  N  N     . LEU A 1 438  ? -55.326 -25.942 -30.450 1.00 88.47  ? 438  LEU A N     1 
ATOM   3142  C  CA    . LEU A 1 438  ? -56.159 -26.840 -29.666 1.00 92.53  ? 438  LEU A CA    1 
ATOM   3143  C  C     . LEU A 1 438  ? -56.187 -26.397 -28.216 1.00 93.56  ? 438  LEU A C     1 
ATOM   3144  O  O     . LEU A 1 438  ? -55.207 -25.852 -27.708 1.00 102.58 ? 438  LEU A O     1 
ATOM   3145  C  CB    . LEU A 1 438  ? -55.719 -28.308 -29.800 1.00 91.45  ? 438  LEU A CB    1 
ATOM   3146  C  CG    . LEU A 1 438  ? -56.148 -29.034 -31.091 1.00 88.32  ? 438  LEU A CG    1 
ATOM   3147  C  CD1   . LEU A 1 438  ? -55.905 -30.544 -30.997 1.00 89.45  ? 438  LEU A CD1   1 
ATOM   3148  C  CD2   . LEU A 1 438  ? -57.602 -28.738 -31.432 1.00 87.74  ? 438  LEU A CD2   1 
ATOM   3149  N  N     . ALA A 1 439  ? -57.321 -26.625 -27.564 1.00 95.14  ? 439  ALA A N     1 
ATOM   3150  C  CA    . ALA A 1 439  ? -57.584 -26.081 -26.243 1.00 96.56  ? 439  ALA A CA    1 
ATOM   3151  C  C     . ALA A 1 439  ? -56.772 -26.804 -25.168 1.00 99.75  ? 439  ALA A C     1 
ATOM   3152  O  O     . ALA A 1 439  ? -56.645 -28.027 -25.197 1.00 95.45  ? 439  ALA A O     1 
ATOM   3153  C  CB    . ALA A 1 439  ? -59.071 -26.237 -25.968 1.00 94.14  ? 439  ALA A CB    1 
ATOM   3154  N  N     . ILE A 1 440  ? -56.219 -26.032 -24.232 1.00 98.55  ? 440  ILE A N     1 
ATOM   3155  C  CA    . ILE A 1 440  ? -55.535 -26.587 -23.078 1.00 96.48  ? 440  ILE A CA    1 
ATOM   3156  C  C     . ILE A 1 440  ? -56.636 -27.026 -22.104 1.00 97.19  ? 440  ILE A C     1 
ATOM   3157  O  O     . ILE A 1 440  ? -56.613 -28.140 -21.575 1.00 96.64  ? 440  ILE A O     1 
ATOM   3158  C  CB    . ILE A 1 440  ? -54.610 -25.510 -22.501 1.00 86.90  ? 440  ILE A CB    1 
ATOM   3159  C  CG1   . ILE A 1 440  ? -53.702 -24.993 -23.614 1.00 82.28  ? 440  ILE A CG1   1 
ATOM   3160  C  CG2   . ILE A 1 440  ? -53.773 -26.073 -21.371 1.00 87.43  ? 440  ILE A CG2   1 
ATOM   3161  C  CD1   . ILE A 1 440  ? -53.357 -23.538 -23.485 1.00 87.19  ? 440  ILE A CD1   1 
ATOM   3162  N  N     . VAL A 1 441  ? -57.577 -26.122 -21.870 1.00 91.21  ? 441  VAL A N     1 
ATOM   3163  C  CA    . VAL A 1 441  ? -58.816 -26.420 -21.160 1.00 88.80  ? 441  VAL A CA    1 
ATOM   3164  C  C     . VAL A 1 441  ? -59.932 -25.629 -21.798 1.00 93.14  ? 441  VAL A C     1 
ATOM   3165  O  O     . VAL A 1 441  ? -59.728 -24.463 -22.181 1.00 94.76  ? 441  VAL A O     1 
ATOM   3166  C  CB    . VAL A 1 441  ? -58.799 -25.984 -19.707 1.00 93.17  ? 441  VAL A CB    1 
ATOM   3167  C  CG1   . VAL A 1 441  ? -59.971 -26.633 -18.982 1.00 97.84  ? 441  VAL A CG1   1 
ATOM   3168  C  CG2   . VAL A 1 441  ? -57.485 -26.343 -19.042 1.00 96.40  ? 441  VAL A CG2   1 
ATOM   3169  N  N     . ASN A 1 442  ? -61.108 -26.243 -21.912 1.00 95.89  ? 442  ASN A N     1 
ATOM   3170  C  CA    . ASN A 1 442  ? -62.307 -25.501 -22.300 1.00 99.56  ? 442  ASN A CA    1 
ATOM   3171  C  C     . ASN A 1 442  ? -63.488 -25.927 -21.457 1.00 96.88  ? 442  ASN A C     1 
ATOM   3172  O  O     . ASN A 1 442  ? -63.358 -26.809 -20.616 1.00 98.88  ? 442  ASN A O     1 
ATOM   3173  C  CB    . ASN A 1 442  ? -62.635 -25.651 -23.785 1.00 90.62  ? 442  ASN A CB    1 
ATOM   3174  C  CG    . ASN A 1 442  ? -62.583 -27.067 -24.235 1.00 86.93  ? 442  ASN A CG    1 
ATOM   3175  O  OD1   . ASN A 1 442  ? -62.727 -27.988 -23.435 1.00 90.22  ? 442  ASN A OD1   1 
ATOM   3176  N  ND2   . ASN A 1 442  ? -62.349 -27.258 -25.514 1.00 91.35  ? 442  ASN A ND2   1 
ATOM   3177  N  N     . SER A 1 443  ? -64.628 -25.276 -21.649 1.00 97.31  ? 443  SER A N     1 
ATOM   3178  C  CA    . SER A 1 443  ? -65.812 -25.603 -20.872 1.00 104.31 ? 443  SER A CA    1 
ATOM   3179  C  C     . SER A 1 443  ? -67.128 -25.172 -21.498 1.00 110.01 ? 443  SER A C     1 
ATOM   3180  O  O     . SER A 1 443  ? -67.181 -24.281 -22.330 1.00 116.69 ? 443  SER A O     1 
ATOM   3181  C  CB    . SER A 1 443  ? -65.705 -24.978 -19.493 1.00 107.17 ? 443  SER A CB    1 
ATOM   3182  O  OG    . SER A 1 443  ? -66.779 -25.441 -18.699 1.00 121.54 ? 443  SER A OG    1 
ATOM   3183  N  N     . GLY A 1 444  ? -68.173 -25.853 -21.079 1.00 107.07 ? 444  GLY A N     1 
ATOM   3184  C  CA    . GLY A 1 444  ? -69.559 -25.465 -21.304 1.00 113.49 ? 444  GLY A CA    1 
ATOM   3185  C  C     . GLY A 1 444  ? -70.196 -25.512 -19.923 1.00 115.87 ? 444  GLY A C     1 
ATOM   3186  O  O     . GLY A 1 444  ? -69.876 -26.398 -19.124 1.00 96.80  ? 444  GLY A O     1 
ATOM   3187  N  N     . MET A 1 445  ? -71.058 -24.540 -19.629 1.00 110.23 ? 445  MET A N     1 
ATOM   3188  C  CA    . MET A 1 445  ? -71.750 -24.462 -18.342 1.00 105.38 ? 445  MET A CA    1 
ATOM   3189  C  C     . MET A 1 445  ? -73.148 -23.927 -18.546 1.00 101.21 ? 445  MET A C     1 
ATOM   3190  O  O     . MET A 1 445  ? -73.323 -23.002 -19.332 1.00 103.43 ? 445  MET A O     1 
ATOM   3191  C  CB    . MET A 1 445  ? -70.992 -23.537 -17.427 1.00 116.15 ? 445  MET A CB    1 
ATOM   3192  C  CG    . MET A 1 445  ? -69.576 -23.982 -17.169 1.00 113.02 ? 445  MET A CG    1 
ATOM   3193  S  SD    . MET A 1 445  ? -68.887 -22.815 -16.011 1.00 112.82 ? 445  MET A SD    1 
ATOM   3194  C  CE    . MET A 1 445  ? -67.141 -22.967 -16.405 1.00 116.45 ? 445  MET A CE    1 
ATOM   3195  N  N     . ARG A 1 446  ? -74.126 -24.500 -17.825 1.00 109.77 ? 446  ARG A N     1 
ATOM   3196  C  CA    . ARG A 1 446  ? -75.519 -24.049 -17.870 1.00 108.58 ? 446  ARG A CA    1 
ATOM   3197  C  C     . ARG A 1 446  ? -76.073 -23.861 -16.466 1.00 113.16 ? 446  ARG A C     1 
ATOM   3198  O  O     . ARG A 1 446  ? -75.714 -24.605 -15.561 1.00 117.50 ? 446  ARG A O     1 
ATOM   3199  C  CB    . ARG A 1 446  ? -76.427 -25.043 -18.602 1.00 102.24 ? 446  ARG A CB    1 
ATOM   3200  C  CG    . ARG A 1 446  ? -77.851 -24.525 -18.805 1.00 101.16 ? 446  ARG A CG    1 
ATOM   3201  C  CD    . ARG A 1 446  ? -78.671 -25.403 -19.735 1.00 101.43 ? 446  ARG A CD    1 
ATOM   3202  N  NE    . ARG A 1 446  ? -78.656 -26.776 -19.250 1.00 108.37 ? 446  ARG A NE    1 
ATOM   3203  C  CZ    . ARG A 1 446  ? -79.382 -27.236 -18.237 1.00 110.84 ? 446  ARG A CZ    1 
ATOM   3204  N  NH1   . ARG A 1 446  ? -80.235 -26.436 -17.598 1.00 118.05 ? 446  ARG A NH1   1 
ATOM   3205  N  NH2   . ARG A 1 446  ? -79.261 -28.510 -17.868 1.00 98.96  ? 446  ARG A NH2   1 
ATOM   3206  N  N     . VAL A 1 447  ? -76.938 -22.849 -16.304 1.00 114.89 ? 447  VAL A N     1 
ATOM   3207  C  CA    . VAL A 1 447  ? -77.761 -22.671 -15.101 1.00 114.74 ? 447  VAL A CA    1 
ATOM   3208  C  C     . VAL A 1 447  ? -79.211 -22.453 -15.478 1.00 119.92 ? 447  VAL A C     1 
ATOM   3209  O  O     . VAL A 1 447  ? -79.489 -21.839 -16.508 1.00 108.52 ? 447  VAL A O     1 
ATOM   3210  C  CB    . VAL A 1 447  ? -77.348 -21.508 -14.192 1.00 107.35 ? 447  VAL A CB    1 
ATOM   3211  C  CG1   . VAL A 1 447  ? -76.189 -21.942 -13.320 1.00 107.64 ? 447  VAL A CG1   1 
ATOM   3212  C  CG2   . VAL A 1 447  ? -77.068 -20.239 -14.991 1.00 103.06 ? 447  VAL A CG2   1 
ATOM   3213  N  N     . PHE A 1 448  ? -80.121 -22.957 -14.644 1.00 119.42 ? 448  PHE A N     1 
ATOM   3214  C  CA    . PHE A 1 448  ? -81.533 -22.650 -14.793 1.00 113.10 ? 448  PHE A CA    1 
ATOM   3215  C  C     . PHE A 1 448  ? -82.039 -22.187 -13.438 1.00 111.89 ? 448  PHE A C     1 
ATOM   3216  O  O     . PHE A 1 448  ? -81.753 -22.806 -12.408 1.00 111.13 ? 448  PHE A O     1 
ATOM   3217  C  CB    . PHE A 1 448  ? -82.347 -23.852 -15.258 1.00 112.25 ? 448  PHE A CB    1 
ATOM   3218  C  CG    . PHE A 1 448  ? -83.769 -23.503 -15.623 1.00 114.03 ? 448  PHE A CG    1 
ATOM   3219  C  CD1   . PHE A 1 448  ? -84.031 -22.548 -16.607 1.00 118.84 ? 448  PHE A CD1   1 
ATOM   3220  C  CD2   . PHE A 1 448  ? -84.843 -24.108 -14.985 1.00 114.18 ? 448  PHE A CD2   1 
ATOM   3221  C  CE1   . PHE A 1 448  ? -85.333 -22.211 -16.956 1.00 121.74 ? 448  PHE A CE1   1 
ATOM   3222  C  CE2   . PHE A 1 448  ? -86.145 -23.769 -15.324 1.00 120.79 ? 448  PHE A CE2   1 
ATOM   3223  C  CZ    . PHE A 1 448  ? -86.393 -22.822 -16.314 1.00 121.13 ? 448  PHE A CZ    1 
ATOM   3224  N  N     . PHE A 1 449  ? -82.770 -21.084 -13.445 1.00 114.63 ? 449  PHE A N     1 
ATOM   3225  C  CA    . PHE A 1 449  ? -83.356 -20.509 -12.224 1.00 119.56 ? 449  PHE A CA    1 
ATOM   3226  C  C     . PHE A 1 449  ? -84.844 -20.758 -12.082 1.00 122.85 ? 449  PHE A C     1 
ATOM   3227  O  O     . PHE A 1 449  ? -85.316 -20.972 -10.971 1.00 119.92 ? 449  PHE A O     1 
ATOM   3228  C  CB    . PHE A 1 449  ? -83.000 -19.048 -12.171 1.00 112.59 ? 449  PHE A CB    1 
ATOM   3229  C  CG    . PHE A 1 449  ? -81.551 -18.827 -11.925 1.00 100.73 ? 449  PHE A CG    1 
ATOM   3230  C  CD1   . PHE A 1 449  ? -81.020 -19.057 -10.669 1.00 97.13  ? 449  PHE A CD1   1 
ATOM   3231  C  CD2   . PHE A 1 449  ? -80.714 -18.429 -12.939 1.00 103.30 ? 449  PHE A CD2   1 
ATOM   3232  C  CE1   . PHE A 1 449  ? -79.684 -18.850 -10.410 1.00 96.06  ? 449  PHE A CE1   1 
ATOM   3233  C  CE2   . PHE A 1 449  ? -79.366 -18.226 -12.694 1.00 108.79 ? 449  PHE A CE2   1 
ATOM   3234  C  CZ    . PHE A 1 449  ? -78.850 -18.437 -11.425 1.00 103.31 ? 449  PHE A CZ    1 
ATOM   3235  N  N     . GLY A 1 450  ? -85.597 -20.699 -13.182 1.00 122.58 ? 450  GLY A N     1 
ATOM   3236  C  CA    . GLY A 1 450  ? -87.055 -20.853 -13.139 1.00 126.86 ? 450  GLY A CA    1 
ATOM   3237  C  C     . GLY A 1 450  ? -87.728 -19.666 -12.461 1.00 138.16 ? 450  GLY A C     1 
ATOM   3238  O  O     . GLY A 1 450  ? -87.801 -19.625 -11.223 1.00 134.84 ? 450  GLY A O     1 
ATOM   3239  N  N     . GLU A 1 451  ? -88.222 -18.721 -13.279 1.00 148.84 ? 451  GLU A N     1 
ATOM   3240  C  CA    . GLU A 1 451  ? -88.958 -17.526 -12.838 1.00 155.55 ? 451  GLU A CA    1 
ATOM   3241  C  C     . GLU A 1 451  ? -88.466 -16.799 -11.571 1.00 150.41 ? 451  GLU A C     1 
ATOM   3242  O  O     . GLU A 1 451  ? -88.777 -17.201 -10.443 1.00 156.55 ? 451  GLU A O     1 
ATOM   3243  C  CB    . GLU A 1 451  ? -90.465 -17.830 -12.719 1.00 152.28 ? 451  GLU A CB    1 
ATOM   3244  C  CG    . GLU A 1 451  ? -90.817 -19.065 -11.897 1.00 153.83 ? 451  GLU A CG    1 
ATOM   3245  C  CD    . GLU A 1 451  ? -92.217 -19.011 -11.314 1.00 155.24 ? 451  GLU A CD    1 
ATOM   3246  O  OE1   . GLU A 1 451  ? -93.099 -18.377 -11.925 1.00 162.81 ? 451  GLU A OE1   1 
ATOM   3247  O  OE2   . GLU A 1 451  ? -92.439 -19.603 -10.238 1.00 150.22 ? 451  GLU A OE2   1 
ATOM   3248  N  N     . GLY A 1 452  ? -87.699 -15.735 -11.761 1.00 140.72 ? 452  GLY A N     1 
ATOM   3249  C  CA    . GLY A 1 452  ? -87.495 -14.721 -10.699 1.00 134.93 ? 452  GLY A CA    1 
ATOM   3250  C  C     . GLY A 1 452  ? -86.391 -15.027 -9.715  1.00 137.65 ? 452  GLY A C     1 
ATOM   3251  O  O     . GLY A 1 452  ? -85.236 -14.925 -10.071 1.00 140.72 ? 452  GLY A O     1 
ATOM   3252  N  N     . ASP A 1 453  ? -86.749 -15.380 -8.474  1.00 133.44 ? 453  ASP A N     1 
ATOM   3253  C  CA    . ASP A 1 453  ? -85.839 -15.768 -7.397  1.00 141.46 ? 453  ASP A CA    1 
ATOM   3254  C  C     . ASP A 1 453  ? -84.553 -16.420 -7.795  1.00 138.07 ? 453  ASP A C     1 
ATOM   3255  O  O     . ASP A 1 453  ? -84.627 -17.365 -8.567  1.00 137.83 ? 453  ASP A O     1 
ATOM   3256  C  CB    . ASP A 1 453  ? -86.516 -16.857 -6.538  1.00 152.38 ? 453  ASP A CB    1 
ATOM   3257  C  CG    . ASP A 1 453  ? -87.646 -16.336 -5.671  1.00 169.83 ? 453  ASP A CG    1 
ATOM   3258  O  OD1   . ASP A 1 453  ? -87.737 -15.112 -5.439  1.00 191.05 ? 453  ASP A OD1   1 
ATOM   3259  O  OD2   . ASP A 1 453  ? -88.443 -17.174 -5.198  1.00 167.84 ? 453  ASP A OD2   1 
ATOM   3260  N  N     . GLY A 1 454  ? -83.410 -16.006 -7.226  1.00 132.70 ? 454  GLY A N     1 
ATOM   3261  C  CA    . GLY A 1 454  ? -82.103 -16.507 -7.659  1.00 127.42 ? 454  GLY A CA    1 
ATOM   3262  C  C     . GLY A 1 454  ? -81.651 -17.877 -7.162  1.00 129.29 ? 454  GLY A C     1 
ATOM   3263  O  O     . GLY A 1 454  ? -80.472 -18.085 -7.035  1.00 111.91 ? 454  GLY A O     1 
ATOM   3264  N  N     . ILE A 1 455  ? -82.603 -18.764 -6.885  1.00 142.42 ? 455  ILE A N     1 
ATOM   3265  C  CA    . ILE A 1 455  ? -82.332 -20.125 -6.448  1.00 143.52 ? 455  ILE A CA    1 
ATOM   3266  C  C     . ILE A 1 455  ? -81.989 -20.968 -7.678  1.00 126.18 ? 455  ILE A C     1 
ATOM   3267  O  O     . ILE A 1 455  ? -82.787 -21.014 -8.622  1.00 106.48 ? 455  ILE A O     1 
ATOM   3268  C  CB    . ILE A 1 455  ? -83.614 -20.740 -5.798  1.00 155.06 ? 455  ILE A CB    1 
ATOM   3269  C  CG1   . ILE A 1 455  ? -84.064 -19.946 -4.553  1.00 156.90 ? 455  ILE A CG1   1 
ATOM   3270  C  CG2   . ILE A 1 455  ? -83.435 -22.227 -5.485  1.00 153.65 ? 455  ILE A CG2   1 
ATOM   3271  C  CD1   . ILE A 1 455  ? -83.494 -20.425 -3.231  1.00 155.32 ? 455  ILE A CD1   1 
ATOM   3272  N  N     . ILE A 1 456  ? -80.834 -21.640 -7.653  1.00 115.64 ? 456  ILE A N     1 
ATOM   3273  C  CA    . ILE A 1 456  ? -80.401 -22.413 -8.803  1.00 115.64 ? 456  ILE A CA    1 
ATOM   3274  C  C     . ILE A 1 456  ? -81.137 -23.767 -8.793  1.00 118.37 ? 456  ILE A C     1 
ATOM   3275  O  O     . ILE A 1 456  ? -81.043 -24.527 -7.829  1.00 111.68 ? 456  ILE A O     1 
ATOM   3276  C  CB    . ILE A 1 456  ? -78.835 -22.541 -8.917  1.00 114.41 ? 456  ILE A CB    1 
ATOM   3277  C  CG1   . ILE A 1 456  ? -78.236 -23.569 -7.966  1.00 114.74 ? 456  ILE A CG1   1 
ATOM   3278  C  CG2   . ILE A 1 456  ? -78.113 -21.221 -8.706  1.00 114.37 ? 456  ILE A CG2   1 
ATOM   3279  C  CD1   . ILE A 1 456  ? -77.897 -24.835 -8.708  1.00 129.81 ? 456  ILE A CD1   1 
ATOM   3280  N  N     . ARG A 1 457  ? -81.908 -24.030 -9.849  1.00 129.00 ? 457  ARG A N     1 
ATOM   3281  C  CA    . ARG A 1 457  ? -82.730 -25.253 -9.972  1.00 131.49 ? 457  ARG A CA    1 
ATOM   3282  C  C     . ARG A 1 457  ? -82.048 -26.347 -10.790 1.00 124.21 ? 457  ARG A C     1 
ATOM   3283  O  O     . ARG A 1 457  ? -82.366 -27.510 -10.606 1.00 113.05 ? 457  ARG A O     1 
ATOM   3284  C  CB    . ARG A 1 457  ? -84.075 -24.936 -10.663 1.00 134.42 ? 457  ARG A CB    1 
ATOM   3285  C  CG    . ARG A 1 457  ? -85.056 -24.060 -9.888  1.00 139.54 ? 457  ARG A CG    1 
ATOM   3286  C  CD    . ARG A 1 457  ? -86.068 -24.873 -9.079  1.00 142.90 ? 457  ARG A CD    1 
ATOM   3287  N  NE    . ARG A 1 457  ? -87.328 -24.145 -8.866  1.00 151.52 ? 457  ARG A NE    1 
ATOM   3288  C  CZ    . ARG A 1 457  ? -87.550 -23.229 -7.917  1.00 139.05 ? 457  ARG A CZ    1 
ATOM   3289  N  NH1   . ARG A 1 457  ? -86.592 -22.886 -7.048  1.00 121.49 ? 457  ARG A NH1   1 
ATOM   3290  N  NH2   . ARG A 1 457  ? -88.750 -22.649 -7.843  1.00 132.22 ? 457  ARG A NH2   1 
ATOM   3291  N  N     . GLU A 1 458  ? -81.180 -25.961 -11.727 1.00 129.56 ? 458  GLU A N     1 
ATOM   3292  C  CA    . GLU A 1 458  ? -80.353 -26.904 -12.474 1.00 125.50 ? 458  GLU A CA    1 
ATOM   3293  C  C     . GLU A 1 458  ? -78.959 -26.332 -12.711 1.00 122.02 ? 458  GLU A C     1 
ATOM   3294  O  O     . GLU A 1 458  ? -78.778 -25.095 -12.701 1.00 115.31 ? 458  GLU A O     1 
ATOM   3295  C  CB    . GLU A 1 458  ? -80.944 -27.225 -13.850 1.00 127.08 ? 458  GLU A CB    1 
ATOM   3296  C  CG    . GLU A 1 458  ? -82.389 -27.707 -13.883 1.00 127.80 ? 458  GLU A CG    1 
ATOM   3297  C  CD    . GLU A 1 458  ? -82.920 -27.829 -15.314 1.00 120.36 ? 458  GLU A CD    1 
ATOM   3298  O  OE1   . GLU A 1 458  ? -82.287 -28.551 -16.123 1.00 105.09 ? 458  GLU A OE1   1 
ATOM   3299  O  OE2   . GLU A 1 458  ? -83.960 -27.200 -15.637 1.00 103.05 ? 458  GLU A OE2   1 
ATOM   3300  N  N     . LEU A 1 459  ? -78.009 -27.228 -12.973 1.00 113.54 ? 459  LEU A N     1 
ATOM   3301  C  CA    . LEU A 1 459  ? -76.622 -26.841 -13.168 1.00 118.37 ? 459  LEU A CA    1 
ATOM   3302  C  C     . LEU A 1 459  ? -75.835 -27.973 -13.860 1.00 120.83 ? 459  LEU A C     1 
ATOM   3303  O  O     . LEU A 1 459  ? -75.813 -29.100 -13.369 1.00 118.34 ? 459  LEU A O     1 
ATOM   3304  C  CB    . LEU A 1 459  ? -75.971 -26.464 -11.826 1.00 108.80 ? 459  LEU A CB    1 
ATOM   3305  C  CG    . LEU A 1 459  ? -74.561 -25.838 -11.873 1.00 102.03 ? 459  LEU A CG    1 
ATOM   3306  C  CD1   . LEU A 1 459  ? -74.566 -24.336 -12.139 1.00 95.15  ? 459  LEU A CD1   1 
ATOM   3307  C  CD2   . LEU A 1 459  ? -73.828 -26.111 -10.578 1.00 95.03  ? 459  LEU A CD2   1 
ATOM   3308  N  N     . CYS A 1 460  ? -75.220 -27.677 -15.003 1.00 119.88 ? 460  CYS A N     1 
ATOM   3309  C  CA    . CYS A 1 460  ? -74.324 -28.621 -15.698 1.00 120.93 ? 460  CYS A CA    1 
ATOM   3310  C  C     . CYS A 1 460  ? -73.001 -27.922 -15.967 1.00 112.78 ? 460  CYS A C     1 
ATOM   3311  O  O     . CYS A 1 460  ? -72.998 -26.835 -16.527 1.00 111.25 ? 460  CYS A O     1 
ATOM   3312  C  CB    . CYS A 1 460  ? -74.944 -29.083 -17.017 1.00 126.20 ? 460  CYS A CB    1 
ATOM   3313  S  SG    . CYS A 1 460  ? -75.854 -30.637 -16.916 1.00 126.20 ? 460  CYS A SG    1 
ATOM   3314  N  N     . ILE A 1 461  ? -71.897 -28.555 -15.579 1.00 106.67 ? 461  ILE A N     1 
ATOM   3315  C  CA    . ILE A 1 461  ? -70.566 -28.016 -15.771 1.00 101.93 ? 461  ILE A CA    1 
ATOM   3316  C  C     . ILE A 1 461  ? -69.683 -29.073 -16.408 1.00 104.41 ? 461  ILE A C     1 
ATOM   3317  O  O     . ILE A 1 461  ? -69.329 -30.049 -15.774 1.00 104.83 ? 461  ILE A O     1 
ATOM   3318  C  CB    . ILE A 1 461  ? -69.974 -27.521 -14.468 1.00 103.79 ? 461  ILE A CB    1 
ATOM   3319  C  CG1   . ILE A 1 461  ? -70.636 -26.208 -14.091 1.00 100.99 ? 461  ILE A CG1   1 
ATOM   3320  C  CG2   . ILE A 1 461  ? -68.476 -27.313 -14.611 1.00 110.81 ? 461  ILE A CG2   1 
ATOM   3321  C  CD1   . ILE A 1 461  ? -70.263 -25.744 -12.705 1.00 103.46 ? 461  ILE A CD1   1 
ATOM   3322  N  N     . SER A 1 462  ? -69.352 -28.863 -17.672 1.00 106.54 ? 462  SER A N     1 
ATOM   3323  C  CA    . SER A 1 462  ? -68.531 -29.796 -18.458 1.00 110.99 ? 462  SER A CA    1 
ATOM   3324  C  C     . SER A 1 462  ? -67.191 -29.169 -18.806 1.00 109.35 ? 462  SER A C     1 
ATOM   3325  O  O     . SER A 1 462  ? -67.129 -27.972 -19.073 1.00 105.76 ? 462  SER A O     1 
ATOM   3326  C  CB    . SER A 1 462  ? -69.277 -30.171 -19.740 1.00 112.76 ? 462  SER A CB    1 
ATOM   3327  O  OG    . SER A 1 462  ? -68.451 -30.889 -20.645 1.00 111.77 ? 462  SER A OG    1 
ATOM   3328  N  N     . TYR A 1 463  ? -66.138 -29.986 -18.786 1.00 99.20  ? 463  TYR A N     1 
ATOM   3329  C  CA    . TYR A 1 463  ? -64.768 -29.538 -19.060 1.00 96.17  ? 463  TYR A CA    1 
ATOM   3330  C  C     . TYR A 1 463  ? -64.090 -30.434 -20.091 1.00 98.44  ? 463  TYR A C     1 
ATOM   3331  O  O     . TYR A 1 463  ? -64.408 -31.621 -20.188 1.00 105.81 ? 463  TYR A O     1 
ATOM   3332  C  CB    . TYR A 1 463  ? -63.934 -29.563 -17.766 1.00 92.17  ? 463  TYR A CB    1 
ATOM   3333  C  CG    . TYR A 1 463  ? -64.190 -28.393 -16.854 1.00 88.68  ? 463  TYR A CG    1 
ATOM   3334  C  CD1   . TYR A 1 463  ? -63.842 -27.102 -17.236 1.00 95.58  ? 463  TYR A CD1   1 
ATOM   3335  C  CD2   . TYR A 1 463  ? -64.787 -28.570 -15.617 1.00 87.64  ? 463  TYR A CD2   1 
ATOM   3336  C  CE1   . TYR A 1 463  ? -64.089 -26.015 -16.413 1.00 97.89  ? 463  TYR A CE1   1 
ATOM   3337  C  CE2   . TYR A 1 463  ? -65.037 -27.496 -14.780 1.00 90.70  ? 463  TYR A CE2   1 
ATOM   3338  C  CZ    . TYR A 1 463  ? -64.683 -26.216 -15.178 1.00 94.63  ? 463  TYR A CZ    1 
ATOM   3339  O  OH    . TYR A 1 463  ? -64.932 -25.138 -14.345 1.00 88.61  ? 463  TYR A OH    1 
ATOM   3340  N  N     . GLY A 1 464  ? -63.159 -29.858 -20.856 1.00 106.25 ? 464  GLY A N     1 
ATOM   3341  C  CA    . GLY A 1 464  ? -62.298 -30.623 -21.754 1.00 109.48 ? 464  GLY A CA    1 
ATOM   3342  C  C     . GLY A 1 464  ? -60.836 -30.303 -21.526 1.00 111.30 ? 464  GLY A C     1 
ATOM   3343  O  O     . GLY A 1 464  ? -60.504 -29.328 -20.883 1.00 120.15 ? 464  GLY A O     1 
ATOM   3344  N  N     . GLY A 1 465  ? -59.972 -31.160 -22.059 1.00 104.96 ? 465  GLY A N     1 
ATOM   3345  C  CA    . GLY A 1 465  ? -58.533 -31.070 -21.825 1.00 105.08 ? 465  GLY A CA    1 
ATOM   3346  C  C     . GLY A 1 465  ? -58.090 -31.481 -20.429 1.00 102.61 ? 465  GLY A C     1 
ATOM   3347  O  O     . GLY A 1 465  ? -56.930 -31.267 -20.073 1.00 106.70 ? 465  GLY A O     1 
ATOM   3348  N  N     . VAL A 1 466  ? -58.978 -32.110 -19.654 1.00 99.25  ? 466  VAL A N     1 
ATOM   3349  C  CA    . VAL A 1 466  ? -58.685 -32.459 -18.263 1.00 105.55 ? 466  VAL A CA    1 
ATOM   3350  C  C     . VAL A 1 466  ? -58.782 -33.972 -18.001 1.00 103.93 ? 466  VAL A C     1 
ATOM   3351  O  O     . VAL A 1 466  ? -59.212 -34.399 -16.951 1.00 114.88 ? 466  VAL A O     1 
ATOM   3352  C  CB    . VAL A 1 466  ? -59.603 -31.641 -17.330 1.00 109.38 ? 466  VAL A CB    1 
ATOM   3353  C  CG1   . VAL A 1 466  ? -59.157 -30.180 -17.297 1.00 105.46 ? 466  VAL A CG1   1 
ATOM   3354  C  CG2   . VAL A 1 466  ? -61.059 -31.754 -17.784 1.00 117.23 ? 466  VAL A CG2   1 
ATOM   3355  N  N     . GLY A 1 467  ? -58.301 -34.751 -18.959 1.00 100.49 ? 467  GLY A N     1 
ATOM   3356  C  CA    . GLY A 1 467  ? -58.437 -36.205 -18.944 1.00 103.05 ? 467  GLY A CA    1 
ATOM   3357  C  C     . GLY A 1 467  ? -58.764 -36.730 -20.315 1.00 97.25  ? 467  GLY A C     1 
ATOM   3358  O  O     . GLY A 1 467  ? -58.880 -35.951 -21.255 1.00 101.19 ? 467  GLY A O     1 
ATOM   3359  N  N     . PRO A 1 468  ? -58.841 -38.069 -20.437 1.00 90.28  ? 468  PRO A N     1 
ATOM   3360  C  CA    . PRO A 1 468  ? -59.093 -38.840 -21.637 1.00 88.65  ? 468  PRO A CA    1 
ATOM   3361  C  C     . PRO A 1 468  ? -60.318 -38.409 -22.480 1.00 87.28  ? 468  PRO A C     1 
ATOM   3362  O  O     . PRO A 1 468  ? -60.351 -38.636 -23.713 1.00 85.83  ? 468  PRO A O     1 
ATOM   3363  C  CB    . PRO A 1 468  ? -59.339 -40.243 -21.081 1.00 97.28  ? 468  PRO A CB    1 
ATOM   3364  C  CG    . PRO A 1 468  ? -58.523 -40.315 -19.816 1.00 99.02  ? 468  PRO A CG    1 
ATOM   3365  C  CD    . PRO A 1 468  ? -58.200 -38.907 -19.401 1.00 95.11  ? 468  PRO A CD    1 
ATOM   3366  N  N     . ALA A 1 469  ? -61.339 -37.862 -21.818 1.00 94.99  ? 469  ALA A N     1 
ATOM   3367  C  CA    . ALA A 1 469  ? -62.569 -37.430 -22.508 1.00 97.39  ? 469  ALA A CA    1 
ATOM   3368  C  C     . ALA A 1 469  ? -63.135 -36.139 -21.906 1.00 103.44 ? 469  ALA A C     1 
ATOM   3369  O  O     . ALA A 1 469  ? -62.714 -35.698 -20.839 1.00 98.40  ? 469  ALA A O     1 
ATOM   3370  C  CB    . ALA A 1 469  ? -63.612 -38.541 -22.464 1.00 90.53  ? 469  ALA A CB    1 
ATOM   3371  N  N     . THR A 1 470  ? -64.125 -35.573 -22.589 1.00 102.84 ? 470  THR A N     1 
ATOM   3372  C  CA    . THR A 1 470  ? -64.950 -34.482 -22.063 1.00 103.32 ? 470  THR A CA    1 
ATOM   3373  C  C     . THR A 1 470  ? -65.734 -34.970 -20.845 1.00 112.63 ? 470  THR A C     1 
ATOM   3374  O  O     . THR A 1 470  ? -66.514 -35.912 -20.961 1.00 128.39 ? 470  THR A O     1 
ATOM   3375  C  CB    . THR A 1 470  ? -65.946 -34.080 -23.162 1.00 109.65 ? 470  THR A CB    1 
ATOM   3376  O  OG1   . THR A 1 470  ? -65.604 -34.753 -24.395 1.00 116.63 ? 470  THR A OG1   1 
ATOM   3377  C  CG2   . THR A 1 470  ? -65.938 -32.569 -23.370 1.00 120.44 ? 470  THR A CG2   1 
ATOM   3378  N  N     . ILE A 1 471  ? -65.544 -34.352 -19.684 1.00 121.68 ? 471  ILE A N     1 
ATOM   3379  C  CA    . ILE A 1 471  ? -66.144 -34.833 -18.425 1.00 121.28 ? 471  ILE A CA    1 
ATOM   3380  C  C     . ILE A 1 471  ? -67.024 -33.774 -17.774 1.00 131.46 ? 471  ILE A C     1 
ATOM   3381  O  O     . ILE A 1 471  ? -66.664 -32.588 -17.764 1.00 137.70 ? 471  ILE A O     1 
ATOM   3382  C  CB    . ILE A 1 471  ? -65.057 -35.339 -17.469 1.00 115.21 ? 471  ILE A CB    1 
ATOM   3383  C  CG1   . ILE A 1 471  ? -64.182 -34.191 -16.941 1.00 99.22  ? 471  ILE A CG1   1 
ATOM   3384  C  CG2   . ILE A 1 471  ? -64.214 -36.400 -18.184 1.00 124.60 ? 471  ILE A CG2   1 
ATOM   3385  C  CD1   . ILE A 1 471  ? -63.039 -34.687 -16.075 1.00 95.86  ? 471  ILE A CD1   1 
ATOM   3386  N  N     . CYS A 1 472  ? -68.157 -34.219 -17.215 1.00 133.18 ? 472  CYS A N     1 
ATOM   3387  C  CA    . CYS A 1 472  ? -69.124 -33.350 -16.561 1.00 133.03 ? 472  CYS A CA    1 
ATOM   3388  C  C     . CYS A 1 472  ? -69.049 -33.516 -15.053 1.00 129.45 ? 472  CYS A C     1 
ATOM   3389  O  O     . CYS A 1 472  ? -69.062 -34.624 -14.558 1.00 133.45 ? 472  CYS A O     1 
ATOM   3390  C  CB    . CYS A 1 472  ? -70.542 -33.663 -17.057 1.00 139.05 ? 472  CYS A CB    1 
ATOM   3391  S  SG    . CYS A 1 472  ? -70.770 -33.574 -18.858 1.00 137.70 ? 472  CYS A SG    1 
ATOM   3392  N  N     . ALA A 1 473  ? -68.955 -32.396 -14.339 1.00 122.01 ? 473  ALA A N     1 
ATOM   3393  C  CA    . ALA A 1 473  ? -68.874 -32.375 -12.892 1.00 124.08 ? 473  ALA A CA    1 
ATOM   3394  C  C     . ALA A 1 473  ? -70.285 -32.460 -12.312 1.00 129.61 ? 473  ALA A C     1 
ATOM   3395  O  O     . ALA A 1 473  ? -70.830 -31.463 -11.832 1.00 136.76 ? 473  ALA A O     1 
ATOM   3396  C  CB    . ALA A 1 473  ? -68.219 -31.065 -12.451 1.00 122.82 ? 473  ALA A CB    1 
ATOM   3397  N  N     . LYS A 1 474  ? -70.866 -33.658 -12.349 1.00 129.56 ? 474  LYS A N     1 
ATOM   3398  C  CA    . LYS A 1 474  ? -72.243 -33.877 -11.897 1.00 133.03 ? 474  LYS A CA    1 
ATOM   3399  C  C     . LYS A 1 474  ? -72.417 -33.880 -10.376 1.00 130.99 ? 474  LYS A C     1 
ATOM   3400  O  O     . LYS A 1 474  ? -73.467 -33.468 -9.885  1.00 131.68 ? 474  LYS A O     1 
ATOM   3401  C  CB    . LYS A 1 474  ? -72.731 -35.202 -12.452 1.00 136.45 ? 474  LYS A CB    1 
ATOM   3402  C  CG    . LYS A 1 474  ? -71.925 -36.392 -11.949 1.00 138.54 ? 474  LYS A CG    1 
ATOM   3403  C  CD    . LYS A 1 474  ? -71.946 -37.549 -12.932 1.00 142.00 ? 474  LYS A CD    1 
ATOM   3404  C  CE    . LYS A 1 474  ? -71.054 -37.321 -14.140 1.00 134.26 ? 474  LYS A CE    1 
ATOM   3405  N  NZ    . LYS A 1 474  ? -71.146 -38.509 -15.025 1.00 132.41 ? 474  LYS A NZ    1 
ATOM   3406  N  N     . ASN A 1 475  ? -71.407 -34.355 -9.649  1.00 125.24 ? 475  ASN A N     1 
ATOM   3407  C  CA    . ASN A 1 475  ? -71.484 -34.490 -8.181  1.00 126.93 ? 475  ASN A CA    1 
ATOM   3408  C  C     . ASN A 1 475  ? -71.383 -33.148 -7.477  1.00 115.09 ? 475  ASN A C     1 
ATOM   3409  O  O     . ASN A 1 475  ? -72.116 -32.873 -6.527  1.00 115.50 ? 475  ASN A O     1 
ATOM   3410  C  CB    . ASN A 1 475  ? -70.371 -35.384 -7.685  1.00 130.21 ? 475  ASN A CB    1 
ATOM   3411  C  CG    . ASN A 1 475  ? -70.265 -36.631 -8.505  1.00 139.67 ? 475  ASN A CG    1 
ATOM   3412  O  OD1   . ASN A 1 475  ? -71.263 -37.322 -8.719  1.00 140.00 ? 475  ASN A OD1   1 
ATOM   3413  N  ND2   . ASN A 1 475  ? -69.073 -36.903 -9.018  1.00 147.95 ? 475  ASN A ND2   1 
ATOM   3414  N  N     . SER A 1 476  ? -70.441 -32.339 -7.938  1.00 103.50 ? 476  SER A N     1 
ATOM   3415  C  CA    . SER A 1 476  ? -70.353 -30.939 -7.577  1.00 108.72 ? 476  SER A CA    1 
ATOM   3416  C  C     . SER A 1 476  ? -71.651 -30.206 -7.905  1.00 102.27 ? 476  SER A C     1 
ATOM   3417  O  O     . SER A 1 476  ? -72.162 -29.445 -7.081  1.00 92.37  ? 476  SER A O     1 
ATOM   3418  C  CB    . SER A 1 476  ? -69.185 -30.325 -8.328  1.00 125.93 ? 476  SER A CB    1 
ATOM   3419  O  OG    . SER A 1 476  ? -67.972 -30.895 -7.864  1.00 121.10 ? 476  SER A OG    1 
ATOM   3420  N  N     . CYS A 1 477  ? -72.175 -30.444 -9.103  1.00 105.82 ? 477  CYS A N     1 
ATOM   3421  C  CA    . CYS A 1 477  ? -73.421 -29.818 -9.548  1.00 121.18 ? 477  CYS A CA    1 
ATOM   3422  C  C     . CYS A 1 477  ? -74.648 -30.209 -8.704  1.00 115.86 ? 477  CYS A C     1 
ATOM   3423  O  O     . CYS A 1 477  ? -75.524 -29.377 -8.475  1.00 105.91 ? 477  CYS A O     1 
ATOM   3424  C  CB    . CYS A 1 477  ? -73.646 -30.075 -11.067 1.00 130.40 ? 477  CYS A CB    1 
ATOM   3425  S  SG    . CYS A 1 477  ? -72.575 -29.171 -12.252 1.00 122.01 ? 477  CYS A SG    1 
ATOM   3426  N  N     . GLN A 1 478  ? -74.708 -31.460 -8.253  1.00 111.99 ? 478  GLN A N     1 
ATOM   3427  C  CA    . GLN A 1 478  ? -75.738 -31.891 -7.305  1.00 107.85 ? 478  GLN A CA    1 
ATOM   3428  C  C     . GLN A 1 478  ? -75.663 -31.084 -6.026  1.00 97.39  ? 478  GLN A C     1 
ATOM   3429  O  O     . GLN A 1 478  ? -76.668 -30.550 -5.566  1.00 105.47 ? 478  GLN A O     1 
ATOM   3430  C  CB    . GLN A 1 478  ? -75.436 -33.348 -6.883  1.00 116.00 ? 478  GLN A CB    1 
ATOM   3431  C  CG    . GLN A 1 478  ? -76.096 -34.395 -7.734  1.00 115.66 ? 478  GLN A CG    1 
ATOM   3432  C  CD    . GLN A 1 478  ? -77.576 -34.165 -7.737  1.00 119.39 ? 478  GLN A CD    1 
ATOM   3433  O  OE1   . GLN A 1 478  ? -78.207 -34.220 -6.684  1.00 129.09 ? 478  GLN A OE1   1 
ATOM   3434  N  NE2   . GLN A 1 478  ? -78.135 -33.840 -8.898  1.00 118.22 ? 478  GLN A NE2   1 
ATOM   3435  N  N     . LYS A 1 479  ? -74.459 -30.983 -5.461  1.00 94.51  ? 479  LYS A N     1 
ATOM   3436  C  CA    . LYS A 1 479  ? -74.266 -30.279 -4.176  1.00 99.04  ? 479  LYS A CA    1 
ATOM   3437  C  C     . LYS A 1 479  ? -74.568 -28.774 -4.204  1.00 101.72 ? 479  LYS A C     1 
ATOM   3438  O  O     . LYS A 1 479  ? -74.762 -28.183 -3.144  1.00 115.71 ? 479  LYS A O     1 
ATOM   3439  C  CB    . LYS A 1 479  ? -72.898 -30.539 -3.538  1.00 100.11 ? 479  LYS A CB    1 
ATOM   3440  C  CG    . LYS A 1 479  ? -72.754 -31.943 -2.970  1.00 111.58 ? 479  LYS A CG    1 
ATOM   3441  C  CD    . LYS A 1 479  ? -71.618 -32.014 -1.953  1.00 119.08 ? 479  LYS A CD    1 
ATOM   3442  C  CE    . LYS A 1 479  ? -71.169 -33.440 -1.654  1.00 112.49 ? 479  LYS A CE    1 
ATOM   3443  N  NZ    . LYS A 1 479  ? -70.717 -34.152 -2.882  1.00 107.11 ? 479  LYS A NZ    1 
ATOM   3444  N  N     . LEU A 1 480  ? -74.608 -28.163 -5.391  1.00 104.33 ? 480  LEU A N     1 
ATOM   3445  C  CA    . LEU A 1 480  ? -74.891 -26.728 -5.532  1.00 103.28 ? 480  LEU A CA    1 
ATOM   3446  C  C     . LEU A 1 480  ? -76.372 -26.379 -5.773  1.00 104.18 ? 480  LEU A C     1 
ATOM   3447  O  O     . LEU A 1 480  ? -76.734 -25.198 -5.667  1.00 110.03 ? 480  LEU A O     1 
ATOM   3448  C  CB    . LEU A 1 480  ? -74.043 -26.145 -6.646  1.00 106.03 ? 480  LEU A CB    1 
ATOM   3449  C  CG    . LEU A 1 480  ? -72.561 -26.262 -6.338  1.00 114.22 ? 480  LEU A CG    1 
ATOM   3450  C  CD1   . LEU A 1 480  ? -71.731 -26.239 -7.612  1.00 111.76 ? 480  LEU A CD1   1 
ATOM   3451  C  CD2   . LEU A 1 480  ? -72.164 -25.151 -5.375  1.00 126.26 ? 480  LEU A CD2   1 
ATOM   3452  N  N     . ILE A 1 481  ? -77.218 -27.373 -6.054  1.00 101.16 ? 481  ILE A N     1 
ATOM   3453  C  CA    . ILE A 1 481  ? -78.650 -27.123 -6.329  1.00 105.16 ? 481  ILE A CA    1 
ATOM   3454  C  C     . ILE A 1 481  ? -79.322 -26.656 -5.039  1.00 115.59 ? 481  ILE A C     1 
ATOM   3455  O  O     . ILE A 1 481  ? -79.096 -27.230 -3.961  1.00 115.10 ? 481  ILE A O     1 
ATOM   3456  C  CB    . ILE A 1 481  ? -79.414 -28.337 -6.930  1.00 103.30 ? 481  ILE A CB    1 
ATOM   3457  C  CG1   . ILE A 1 481  ? -78.735 -28.860 -8.210  1.00 101.71 ? 481  ILE A CG1   1 
ATOM   3458  C  CG2   . ILE A 1 481  ? -80.887 -27.985 -7.174  1.00 98.23  ? 481  ILE A CG2   1 
ATOM   3459  C  CD1   . ILE A 1 481  ? -79.363 -28.431 -9.523  1.00 104.47 ? 481  ILE A CD1   1 
ATOM   3460  N  N     . GLY A 1 482  ? -80.124 -25.597 -5.154  1.00 122.46 ? 482  GLY A N     1 
ATOM   3461  C  CA    . GLY A 1 482  ? -80.785 -24.964 -4.000  1.00 119.67 ? 482  GLY A CA    1 
ATOM   3462  C  C     . GLY A 1 482  ? -80.183 -23.606 -3.634  1.00 118.17 ? 482  GLY A C     1 
ATOM   3463  O  O     . GLY A 1 482  ? -80.915 -22.710 -3.161  1.00 111.96 ? 482  GLY A O     1 
ATOM   3464  N  N     . ARG A 1 483  ? -78.871 -23.438 -3.840  1.00 119.21 ? 483  ARG A N     1 
ATOM   3465  C  CA    . ARG A 1 483  ? -78.174 -22.228 -3.416  1.00 118.30 ? 483  ARG A CA    1 
ATOM   3466  C  C     . ARG A 1 483  ? -78.443 -21.002 -4.283  1.00 119.89 ? 483  ARG A C     1 
ATOM   3467  O  O     . ARG A 1 483  ? -78.857 -21.124 -5.451  1.00 108.80 ? 483  ARG A O     1 
ATOM   3468  C  CB    . ARG A 1 483  ? -76.661 -22.388 -3.430  1.00 109.84 ? 483  ARG A CB    1 
ATOM   3469  C  CG    . ARG A 1 483  ? -76.186 -23.338 -2.399  1.00 115.96 ? 483  ARG A CG    1 
ATOM   3470  C  CD    . ARG A 1 483  ? -75.063 -22.790 -1.541  1.00 129.80 ? 483  ARG A CD    1 
ATOM   3471  N  NE    . ARG A 1 483  ? -74.925 -23.709 -0.420  1.00 139.56 ? 483  ARG A NE    1 
ATOM   3472  C  CZ    . ARG A 1 483  ? -74.559 -24.989 -0.532  1.00 130.10 ? 483  ARG A CZ    1 
ATOM   3473  N  NH1   . ARG A 1 483  ? -74.231 -25.526 -1.709  1.00 121.79 ? 483  ARG A NH1   1 
ATOM   3474  N  NH2   . ARG A 1 483  ? -74.504 -25.742 0.553   1.00 133.33 ? 483  ARG A NH2   1 
ATOM   3475  N  N     . HIS A 1 484  ? -78.183 -19.835 -3.687  1.00 120.75 ? 484  HIS A N     1 
ATOM   3476  C  CA    . HIS A 1 484  ? -78.235 -18.550 -4.385  1.00 121.35 ? 484  HIS A CA    1 
ATOM   3477  C  C     . HIS A 1 484  ? -76.967 -18.324 -5.163  1.00 115.23 ? 484  HIS A C     1 
ATOM   3478  O  O     . HIS A 1 484  ? -75.999 -19.057 -5.022  1.00 109.73 ? 484  HIS A O     1 
ATOM   3479  C  CB    . HIS A 1 484  ? -78.554 -17.422 -3.398  1.00 125.66 ? 484  HIS A CB    1 
ATOM   3480  C  CG    . HIS A 1 484  ? -79.959 -17.497 -2.889  1.00 130.41 ? 484  HIS A CG    1 
ATOM   3481  N  ND1   . HIS A 1 484  ? -80.307 -18.198 -1.752  1.00 122.54 ? 484  HIS A ND1   1 
ATOM   3482  C  CD2   . HIS A 1 484  ? -81.119 -17.044 -3.421  1.00 133.38 ? 484  HIS A CD2   1 
ATOM   3483  C  CE1   . HIS A 1 484  ? -81.617 -18.138 -1.585  1.00 119.93 ? 484  HIS A CE1   1 
ATOM   3484  N  NE2   . HIS A 1 484  ? -82.133 -17.445 -2.584  1.00 127.91 ? 484  HIS A NE2   1 
ATOM   3485  N  N     . TRP A 1 485  ? -76.976 -17.289 -5.996  1.00 121.82 ? 485  TRP A N     1 
ATOM   3486  C  CA    . TRP A 1 485  ? -75.817 -16.918 -6.803  1.00 117.04 ? 485  TRP A CA    1 
ATOM   3487  C  C     . TRP A 1 485  ? -75.077 -15.772 -6.111  1.00 118.75 ? 485  TRP A C     1 
ATOM   3488  O  O     . TRP A 1 485  ? -75.390 -14.615 -6.274  1.00 134.98 ? 485  TRP A O     1 
ATOM   3489  C  CB    . TRP A 1 485  ? -76.304 -16.545 -8.212  1.00 120.09 ? 485  TRP A CB    1 
ATOM   3490  C  CG    . TRP A 1 485  ? -75.319 -16.766 -9.332  1.00 129.17 ? 485  TRP A CG    1 
ATOM   3491  C  CD1   . TRP A 1 485  ? -74.616 -15.810 -9.992  1.00 130.45 ? 485  TRP A CD1   1 
ATOM   3492  C  CD2   . TRP A 1 485  ? -74.966 -18.013 -9.949  1.00 122.89 ? 485  TRP A CD2   1 
ATOM   3493  N  NE1   . TRP A 1 485  ? -73.833 -16.376 -10.969 1.00 118.04 ? 485  TRP A NE1   1 
ATOM   3494  C  CE2   . TRP A 1 485  ? -74.027 -17.728 -10.962 1.00 110.58 ? 485  TRP A CE2   1 
ATOM   3495  C  CE3   . TRP A 1 485  ? -75.338 -19.337 -9.732  1.00 122.23 ? 485  TRP A CE3   1 
ATOM   3496  C  CZ2   . TRP A 1 485  ? -73.456 -18.713 -11.749 1.00 109.31 ? 485  TRP A CZ2   1 
ATOM   3497  C  CZ3   . TRP A 1 485  ? -74.765 -20.317 -10.517 1.00 129.20 ? 485  TRP A CZ3   1 
ATOM   3498  C  CH2   . TRP A 1 485  ? -73.834 -19.998 -11.516 1.00 118.41 ? 485  TRP A CH2   1 
ATOM   3499  N  N     . ASN A 1 486  ? -74.089 -16.126 -5.299  1.00 116.59 ? 486  ASN A N     1 
ATOM   3500  C  CA    . ASN A 1 486  ? -73.206 -15.185 -4.614  1.00 131.46 ? 486  ASN A CA    1 
ATOM   3501  C  C     . ASN A 1 486  ? -71.916 -15.870 -4.116  1.00 127.63 ? 486  ASN A C     1 
ATOM   3502  O  O     . ASN A 1 486  ? -71.783 -17.079 -4.222  1.00 118.84 ? 486  ASN A O     1 
ATOM   3503  C  CB    . ASN A 1 486  ? -73.913 -14.484 -3.442  1.00 142.53 ? 486  ASN A CB    1 
ATOM   3504  C  CG    . ASN A 1 486  ? -73.207 -13.190 -3.020  1.00 153.98 ? 486  ASN A CG    1 
ATOM   3505  O  OD1   . ASN A 1 486  ? -73.015 -12.280 -3.834  1.00 150.01 ? 486  ASN A OD1   1 
ATOM   3506  N  ND2   . ASN A 1 486  ? -72.801 -13.112 -1.750  1.00 149.24 ? 486  ASN A ND2   1 
ATOM   3507  N  N     . GLU A 1 487  ? -70.972 -15.084 -3.587  1.00 124.84 ? 487  GLU A N     1 
ATOM   3508  C  CA    . GLU A 1 487  ? -69.612 -15.552 -3.353  1.00 125.13 ? 487  GLU A CA    1 
ATOM   3509  C  C     . GLU A 1 487  ? -69.449 -16.665 -2.309  1.00 135.10 ? 487  GLU A C     1 
ATOM   3510  O  O     . GLU A 1 487  ? -68.445 -17.377 -2.331  1.00 136.13 ? 487  GLU A O     1 
ATOM   3511  C  CB    . GLU A 1 487  ? -68.697 -14.368 -3.044  1.00 120.13 ? 487  GLU A CB    1 
ATOM   3512  C  CG    . GLU A 1 487  ? -68.570 -13.401 -4.216  1.00 120.70 ? 487  GLU A CG    1 
ATOM   3513  C  CD    . GLU A 1 487  ? -67.583 -12.270 -3.959  1.00 125.53 ? 487  GLU A CD    1 
ATOM   3514  O  OE1   . GLU A 1 487  ? -66.926 -12.265 -2.899  1.00 128.66 ? 487  GLU A OE1   1 
ATOM   3515  O  OE2   . GLU A 1 487  ? -67.463 -11.373 -4.816  1.00 121.12 ? 487  GLU A OE2   1 
ATOM   3516  N  N     . GLN A 1 488  ? -70.425 -16.812 -1.411  1.00 152.26 ? 488  GLN A N     1 
ATOM   3517  C  CA    . GLN A 1 488  ? -70.467 -17.960 -0.488  1.00 166.73 ? 488  GLN A CA    1 
ATOM   3518  C  C     . GLN A 1 488  ? -70.404 -19.307 -1.235  1.00 165.30 ? 488  GLN A C     1 
ATOM   3519  O  O     . GLN A 1 488  ? -69.692 -20.229 -0.816  1.00 162.62 ? 488  GLN A O     1 
ATOM   3520  C  CB    . GLN A 1 488  ? -71.710 -17.896 0.457   1.00 167.55 ? 488  GLN A CB    1 
ATOM   3521  C  CG    . GLN A 1 488  ? -72.979 -18.674 0.057   1.00 173.73 ? 488  GLN A CG    1 
ATOM   3522  C  CD    . GLN A 1 488  ? -73.782 -18.070 -1.106  1.00 176.71 ? 488  GLN A CD    1 
ATOM   3523  O  OE1   . GLN A 1 488  ? -73.553 -16.934 -1.525  1.00 166.13 ? 488  GLN A OE1   1 
ATOM   3524  N  NE2   . GLN A 1 488  ? -74.738 -18.845 -1.627  1.00 171.34 ? 488  GLN A NE2   1 
ATOM   3525  N  N     . MET A 1 489  ? -71.129 -19.390 -2.352  1.00 159.41 ? 489  MET A N     1 
ATOM   3526  C  CA    . MET A 1 489  ? -71.253 -20.633 -3.109  1.00 145.96 ? 489  MET A CA    1 
ATOM   3527  C  C     . MET A 1 489  ? -70.057 -20.867 -4.052  1.00 144.22 ? 489  MET A C     1 
ATOM   3528  O  O     . MET A 1 489  ? -69.753 -22.011 -4.383  1.00 151.21 ? 489  MET A O     1 
ATOM   3529  C  CB    . MET A 1 489  ? -72.587 -20.681 -3.857  1.00 138.42 ? 489  MET A CB    1 
ATOM   3530  C  CG    . MET A 1 489  ? -72.601 -19.936 -5.175  1.00 142.25 ? 489  MET A CG    1 
ATOM   3531  S  SD    . MET A 1 489  ? -72.100 -20.974 -6.553  1.00 133.42 ? 489  MET A SD    1 
ATOM   3532  C  CE    . MET A 1 489  ? -72.353 -19.846 -7.935  1.00 116.13 ? 489  MET A CE    1 
ATOM   3533  N  N     . LEU A 1 490  ? -69.387 -19.783 -4.470  1.00 139.75 ? 490  LEU A N     1 
ATOM   3534  C  CA    . LEU A 1 490  ? -68.200 -19.875 -5.328  1.00 124.28 ? 490  LEU A CA    1 
ATOM   3535  C  C     . LEU A 1 490  ? -67.054 -20.588 -4.643  1.00 120.84 ? 490  LEU A C     1 
ATOM   3536  O  O     . LEU A 1 490  ? -66.473 -21.511 -5.208  1.00 119.03 ? 490  LEU A O     1 
ATOM   3537  C  CB    . LEU A 1 490  ? -67.736 -18.500 -5.789  1.00 120.85 ? 490  LEU A CB    1 
ATOM   3538  C  CG    . LEU A 1 490  ? -67.032 -18.572 -7.137  1.00 122.10 ? 490  LEU A CG    1 
ATOM   3539  C  CD1   . LEU A 1 490  ? -68.075 -18.571 -8.240  1.00 119.25 ? 490  LEU A CD1   1 
ATOM   3540  C  CD2   . LEU A 1 490  ? -66.066 -17.415 -7.311  1.00 119.16 ? 490  LEU A CD2   1 
ATOM   3541  N  N     . ASP A 1 491  ? -66.719 -20.134 -3.436  1.00 134.50 ? 491  ASP A N     1 
ATOM   3542  C  CA    . ASP A 1 491  ? -65.615 -20.718 -2.668  1.00 144.87 ? 491  ASP A CA    1 
ATOM   3543  C  C     . ASP A 1 491  ? -65.806 -22.211 -2.473  1.00 140.76 ? 491  ASP A C     1 
ATOM   3544  O  O     . ASP A 1 491  ? -64.861 -22.960 -2.666  1.00 152.90 ? 491  ASP A O     1 
ATOM   3545  C  CB    . ASP A 1 491  ? -65.384 -20.007 -1.324  1.00 147.02 ? 491  ASP A CB    1 
ATOM   3546  C  CG    . ASP A 1 491  ? -64.291 -18.937 -1.399  1.00 146.80 ? 491  ASP A CG    1 
ATOM   3547  O  OD1   . ASP A 1 491  ? -63.611 -18.807 -2.449  1.00 138.48 ? 491  ASP A OD1   1 
ATOM   3548  O  OD2   . ASP A 1 491  ? -64.107 -18.227 -0.386  1.00 150.74 ? 491  ASP A OD2   1 
ATOM   3549  N  N     . ILE A 1 492  ? -67.014 -22.640 -2.113  1.00 143.28 ? 492  ILE A N     1 
ATOM   3550  C  CA    . ILE A 1 492  ? -67.325 -24.086 -1.985  1.00 146.26 ? 492  ILE A CA    1 
ATOM   3551  C  C     . ILE A 1 492  ? -67.406 -24.788 -3.355  1.00 134.76 ? 492  ILE A C     1 
ATOM   3552  O  O     . ILE A 1 492  ? -66.870 -25.887 -3.500  1.00 129.48 ? 492  ILE A O     1 
ATOM   3553  C  CB    . ILE A 1 492  ? -68.590 -24.405 -1.130  1.00 139.90 ? 492  ILE A CB    1 
ATOM   3554  C  CG1   . ILE A 1 492  ? -69.882 -24.080 -1.886  1.00 124.58 ? 492  ILE A CG1   1 
ATOM   3555  C  CG2   . ILE A 1 492  ? -68.520 -23.714 0.240   1.00 144.40 ? 492  ILE A CG2   1 
ATOM   3556  C  CD1   . ILE A 1 492  ? -71.130 -24.209 -1.040  1.00 117.96 ? 492  ILE A CD1   1 
ATOM   3557  N  N     . ALA A 1 493  ? -68.041 -24.159 -4.348  1.00 129.72 ? 493  ALA A N     1 
ATOM   3558  C  CA    . ALA A 1 493  ? -68.122 -24.734 -5.697  1.00 123.52 ? 493  ALA A CA    1 
ATOM   3559  C  C     . ALA A 1 493  ? -66.728 -25.022 -6.263  1.00 120.10 ? 493  ALA A C     1 
ATOM   3560  O  O     . ALA A 1 493  ? -66.483 -26.102 -6.799  1.00 123.92 ? 493  ALA A O     1 
ATOM   3561  C  CB    . ALA A 1 493  ? -68.893 -23.828 -6.637  1.00 118.16 ? 493  ALA A CB    1 
ATOM   3562  N  N     . CYS A 1 494  ? -65.821 -24.057 -6.106  1.00 113.54 ? 494  CYS A N     1 
ATOM   3563  C  CA    . CYS A 1 494  ? -64.437 -24.219 -6.525  1.00 106.93 ? 494  CYS A CA    1 
ATOM   3564  C  C     . CYS A 1 494  ? -63.762 -25.396 -5.836  1.00 109.45 ? 494  CYS A C     1 
ATOM   3565  O  O     . CYS A 1 494  ? -63.125 -26.210 -6.496  1.00 130.38 ? 494  CYS A O     1 
ATOM   3566  C  CB    . CYS A 1 494  ? -63.650 -22.928 -6.258  1.00 108.24 ? 494  CYS A CB    1 
ATOM   3567  S  SG    . CYS A 1 494  ? -64.059 -21.498 -7.301  1.00 98.87  ? 494  CYS A SG    1 
ATOM   3568  N  N     . ARG A 1 495  ? -63.899 -25.493 -4.519  1.00 108.61 ? 495  ARG A N     1 
ATOM   3569  C  CA    . ARG A 1 495  ? -63.354 -26.637 -3.770  1.00 122.71 ? 495  ARG A CA    1 
ATOM   3570  C  C     . ARG A 1 495  ? -63.878 -27.937 -4.344  1.00 114.57 ? 495  ARG A C     1 
ATOM   3571  O  O     . ARG A 1 495  ? -63.093 -28.801 -4.743  1.00 114.59 ? 495  ARG A O     1 
ATOM   3572  C  CB    . ARG A 1 495  ? -63.791 -26.593 -2.293  1.00 134.06 ? 495  ARG A CB    1 
ATOM   3573  C  CG    . ARG A 1 495  ? -62.990 -25.661 -1.408  1.00 146.90 ? 495  ARG A CG    1 
ATOM   3574  C  CD    . ARG A 1 495  ? -61.601 -26.220 -1.165  1.00 152.31 ? 495  ARG A CD    1 
ATOM   3575  N  NE    . ARG A 1 495  ? -60.734 -25.252 -0.507  1.00 154.56 ? 495  ARG A NE    1 
ATOM   3576  C  CZ    . ARG A 1 495  ? -59.432 -25.427 -0.303  1.00 148.17 ? 495  ARG A CZ    1 
ATOM   3577  N  NH1   . ARG A 1 495  ? -58.833 -26.541 -0.708  1.00 151.65 ? 495  ARG A NH1   1 
ATOM   3578  N  NH2   . ARG A 1 495  ? -58.723 -24.485 0.305   1.00 145.16 ? 495  ARG A NH2   1 
ATOM   3579  N  N     . LEU A 1 496  ? -65.204 -28.063 -4.408  1.00 110.68 ? 496  LEU A N     1 
ATOM   3580  C  CA    . LEU A 1 496  ? -65.811 -29.349 -4.754  1.00 119.47 ? 496  LEU A CA    1 
ATOM   3581  C  C     . LEU A 1 496  ? -65.753 -29.723 -6.245  1.00 117.23 ? 496  LEU A C     1 
ATOM   3582  O  O     . LEU A 1 496  ? -66.011 -30.882 -6.565  1.00 120.83 ? 496  LEU A O     1 
ATOM   3583  C  CB    . LEU A 1 496  ? -67.188 -29.577 -4.105  1.00 118.02 ? 496  LEU A CB    1 
ATOM   3584  C  CG    . LEU A 1 496  ? -68.368 -28.631 -4.243  1.00 122.01 ? 496  LEU A CG    1 
ATOM   3585  C  CD1   . LEU A 1 496  ? -68.549 -28.213 -5.685  1.00 129.50 ? 496  LEU A CD1   1 
ATOM   3586  C  CD2   . LEU A 1 496  ? -69.612 -29.338 -3.728  1.00 114.58 ? 496  LEU A CD2   1 
ATOM   3587  N  N     . ILE A 1 497  ? -65.404 -28.792 -7.144  1.00 115.20 ? 497  ILE A N     1 
ATOM   3588  C  CA    . ILE A 1 497  ? -65.010 -29.204 -8.512  1.00 112.11 ? 497  ILE A CA    1 
ATOM   3589  C  C     . ILE A 1 497  ? -63.518 -29.586 -8.586  1.00 108.94 ? 497  ILE A C     1 
ATOM   3590  O  O     . ILE A 1 497  ? -63.155 -30.548 -9.265  1.00 118.22 ? 497  ILE A O     1 
ATOM   3591  C  CB    . ILE A 1 497  ? -65.359 -28.260 -9.688  1.00 100.22 ? 497  ILE A CB    1 
ATOM   3592  C  CG1   . ILE A 1 497  ? -64.304 -27.168 -9.831  1.00 97.75  ? 497  ILE A CG1   1 
ATOM   3593  C  CG2   . ILE A 1 497  ? -66.798 -27.756 -9.588  1.00 97.32  ? 497  ILE A CG2   1 
ATOM   3594  C  CD1   . ILE A 1 497  ? -64.541 -26.322 -11.047 1.00 106.83 ? 497  ILE A CD1   1 
ATOM   3595  N  N     . LEU A 1 498  ? -62.678 -28.848 -7.869  1.00 95.03  ? 498  LEU A N     1 
ATOM   3596  C  CA    . LEU A 1 498  ? -61.223 -29.065 -7.922  1.00 100.77 ? 498  LEU A CA    1 
ATOM   3597  C  C     . LEU A 1 498  ? -60.750 -30.454 -7.491  1.00 114.69 ? 498  LEU A C     1 
ATOM   3598  O  O     . LEU A 1 498  ? -59.664 -30.882 -7.869  1.00 127.03 ? 498  LEU A O     1 
ATOM   3599  C  CB    . LEU A 1 498  ? -60.489 -28.023 -7.078  1.00 99.08  ? 498  LEU A CB    1 
ATOM   3600  C  CG    . LEU A 1 498  ? -60.319 -26.612 -7.666  1.00 103.09 ? 498  LEU A CG    1 
ATOM   3601  C  CD1   . LEU A 1 498  ? -59.884 -25.606 -6.600  1.00 102.44 ? 498  LEU A CD1   1 
ATOM   3602  C  CD2   . LEU A 1 498  ? -59.329 -26.583 -8.821  1.00 107.73 ? 498  LEU A CD2   1 
ATOM   3603  N  N     . ASN A 1 499  ? -61.539 -31.156 -6.698  1.00 120.59 ? 499  ASN A N     1 
ATOM   3604  C  CA    . ASN A 1 499  ? -61.256 -32.557 -6.333  1.00 127.95 ? 499  ASN A CA    1 
ATOM   3605  C  C     . ASN A 1 499  ? -62.083 -33.569 -7.116  1.00 126.57 ? 499  ASN A C     1 
ATOM   3606  O  O     . ASN A 1 499  ? -61.663 -34.722 -7.245  1.00 133.53 ? 499  ASN A O     1 
ATOM   3607  C  CB    . ASN A 1 499  ? -61.480 -32.758 -4.848  1.00 132.64 ? 499  ASN A CB    1 
ATOM   3608  C  CG    . ASN A 1 499  ? -62.630 -31.938 -4.350  1.00 142.50 ? 499  ASN A CG    1 
ATOM   3609  O  OD1   . ASN A 1 499  ? -63.472 -31.523 -5.142  1.00 132.28 ? 499  ASN A OD1   1 
ATOM   3610  N  ND2   . ASN A 1 499  ? -62.657 -31.659 -3.055  1.00 163.88 ? 499  ASN A ND2   1 
ATOM   3611  N  N     . GLU A 1 500  ? -63.260 -33.176 -7.634  1.00 120.15 ? 500  GLU A N     1 
ATOM   3612  C  CA    . GLU A 1 500  ? -64.027 -34.029 -8.560  1.00 117.21 ? 500  GLU A CA    1 
ATOM   3613  C  C     . GLU A 1 500  ? -63.343 -34.141 -9.930  1.00 130.40 ? 500  GLU A C     1 
ATOM   3614  O  O     . GLU A 1 500  ? -63.067 -35.256 -10.403 1.00 135.70 ? 500  GLU A O     1 
ATOM   3615  C  CB    . GLU A 1 500  ? -65.432 -33.510 -8.787  1.00 109.26 ? 500  GLU A CB    1 
ATOM   3616  C  CG    . GLU A 1 500  ? -66.191 -34.401 -9.756  1.00 114.04 ? 500  GLU A CG    1 
ATOM   3617  C  CD    . GLU A 1 500  ? -67.615 -33.960 -10.000 1.00 119.23 ? 500  GLU A CD    1 
ATOM   3618  O  OE1   . GLU A 1 500  ? -67.965 -32.828 -9.612  1.00 122.64 ? 500  GLU A OE1   1 
ATOM   3619  O  OE2   . GLU A 1 500  ? -68.389 -34.751 -10.586 1.00 119.13 ? 500  GLU A OE2   1 
ATOM   3620  N  N     . VAL A 1 501  ? -63.072 -32.984 -10.555 1.00 125.86 ? 501  VAL A N     1 
ATOM   3621  C  CA    . VAL A 1 501  ? -62.356 -32.906 -11.832 1.00 109.86 ? 501  VAL A CA    1 
ATOM   3622  C  C     . VAL A 1 501  ? -60.888 -32.578 -11.561 1.00 107.95 ? 501  VAL A C     1 
ATOM   3623  O  O     . VAL A 1 501  ? -60.387 -31.505 -11.888 1.00 100.75 ? 501  VAL A O     1 
ATOM   3624  C  CB    . VAL A 1 501  ? -63.011 -31.913 -12.801 1.00 114.02 ? 501  VAL A CB    1 
ATOM   3625  C  CG1   . VAL A 1 501  ? -63.224 -30.546 -12.158 1.00 123.74 ? 501  VAL A CG1   1 
ATOM   3626  C  CG2   . VAL A 1 501  ? -62.196 -31.802 -14.082 1.00 124.27 ? 501  VAL A CG2   1 
ATOM   3627  N  N     . SER A 1 502  ? -60.198 -33.538 -10.958 1.00 112.55 ? 502  SER A N     1 
ATOM   3628  C  CA    . SER A 1 502  ? -58.770 -33.394 -10.631 1.00 114.37 ? 502  SER A CA    1 
ATOM   3629  C  C     . SER A 1 502  ? -57.904 -34.004 -11.717 1.00 106.54 ? 502  SER A C     1 
ATOM   3630  O  O     . SER A 1 502  ? -58.336 -34.856 -12.449 1.00 96.54  ? 502  SER A O     1 
ATOM   3631  C  CB    . SER A 1 502  ? -58.425 -34.089 -9.303  1.00 120.09 ? 502  SER A CB    1 
ATOM   3632  O  OG    . SER A 1 502  ? -57.819 -35.364 -9.520  1.00 112.37 ? 502  SER A OG    1 
ATOM   3633  N  N     . LEU A 1 503  ? -56.664 -33.518 -11.789 1.00 114.91 ? 503  LEU A N     1 
ATOM   3634  C  CA    . LEU A 1 503  ? -55.619 -34.085 -12.634 1.00 110.61 ? 503  LEU A CA    1 
ATOM   3635  C  C     . LEU A 1 503  ? -54.466 -34.462 -11.726 1.00 108.10 ? 503  LEU A C     1 
ATOM   3636  O  O     . LEU A 1 503  ? -54.148 -33.734 -10.753 1.00 104.30 ? 503  LEU A O     1 
ATOM   3637  C  CB    . LEU A 1 503  ? -55.105 -33.092 -13.667 1.00 109.98 ? 503  LEU A CB    1 
ATOM   3638  C  CG    . LEU A 1 503  ? -56.140 -32.346 -14.498 1.00 110.02 ? 503  LEU A CG    1 
ATOM   3639  C  CD1   . LEU A 1 503  ? -56.722 -31.172 -13.732 1.00 113.66 ? 503  LEU A CD1   1 
ATOM   3640  C  CD2   . LEU A 1 503  ? -55.513 -31.844 -15.782 1.00 114.74 ? 503  LEU A CD2   1 
ATOM   3641  N  N     . LEU A 1 504  ? -53.828 -35.582 -12.050 1.00 105.46 ? 504  LEU A N     1 
ATOM   3642  C  CA    . LEU A 1 504  ? -52.595 -35.953 -11.356 1.00 116.60 ? 504  LEU A CA    1 
ATOM   3643  C  C     . LEU A 1 504  ? -51.482 -35.097 -11.930 1.00 123.12 ? 504  LEU A C     1 
ATOM   3644  O  O     . LEU A 1 504  ? -51.521 -34.703 -13.095 1.00 146.90 ? 504  LEU A O     1 
ATOM   3645  C  CB    . LEU A 1 504  ? -52.264 -37.428 -11.489 1.00 119.27 ? 504  LEU A CB    1 
ATOM   3646  C  CG    . LEU A 1 504  ? -53.064 -38.310 -10.522 1.00 121.24 ? 504  LEU A CG    1 
ATOM   3647  C  CD1   . LEU A 1 504  ? -52.677 -39.763 -10.747 1.00 119.76 ? 504  LEU A CD1   1 
ATOM   3648  C  CD2   . LEU A 1 504  ? -52.904 -37.922 -9.048  1.00 114.83 ? 504  LEU A CD2   1 
ATOM   3649  N  N     . GLY A 1 505  ? -50.492 -34.793 -11.098 1.00 128.92 ? 505  GLY A N     1 
ATOM   3650  C  CA    . GLY A 1 505  ? -49.306 -34.003 -11.519 1.00 148.51 ? 505  GLY A CA    1 
ATOM   3651  C  C     . GLY A 1 505  ? -48.578 -34.559 -12.729 1.00 146.92 ? 505  GLY A C     1 
ATOM   3652  O  O     . GLY A 1 505  ? -47.940 -33.808 -13.469 1.00 138.50 ? 505  GLY A O     1 
ATOM   3653  N  N     . SER A 1 506  ? -48.680 -35.874 -12.921 1.00 139.08 ? 506  SER A N     1 
ATOM   3654  C  CA    . SER A 1 506  ? -48.130 -36.563 -14.076 1.00 130.10 ? 506  SER A CA    1 
ATOM   3655  C  C     . SER A 1 506  ? -49.107 -36.682 -15.246 1.00 128.68 ? 506  SER A C     1 
ATOM   3656  O  O     . SER A 1 506  ? -48.974 -37.592 -16.065 1.00 144.14 ? 506  SER A O     1 
ATOM   3657  C  CB    . SER A 1 506  ? -47.794 -37.978 -13.650 1.00 117.01 ? 506  SER A CB    1 
ATOM   3658  O  OG    . SER A 1 506  ? -49.007 -38.674 -13.462 1.00 109.44 ? 506  SER A OG    1 
ATOM   3659  N  N     . ALA A 1 507  ? -50.113 -35.811 -15.322 1.00 124.68 ? 507  ALA A N     1 
ATOM   3660  C  CA    . ALA A 1 507  ? -51.133 -35.906 -16.369 1.00 126.20 ? 507  ALA A CA    1 
ATOM   3661  C  C     . ALA A 1 507  ? -50.560 -35.736 -17.760 1.00 110.24 ? 507  ALA A C     1 
ATOM   3662  O  O     . ALA A 1 507  ? -49.750 -34.876 -17.964 1.00 111.53 ? 507  ALA A O     1 
ATOM   3663  C  CB    . ALA A 1 507  ? -52.201 -34.837 -16.157 1.00 131.64 ? 507  ALA A CB    1 
ATOM   3664  N  N     . PRO A 1 508  ? -51.018 -36.524 -18.746 1.00 98.83  ? 508  PRO A N     1 
ATOM   3665  C  CA    . PRO A 1 508  ? -50.700 -36.222 -20.150 1.00 97.24  ? 508  PRO A CA    1 
ATOM   3666  C  C     . PRO A 1 508  ? -51.222 -34.843 -20.531 1.00 92.70  ? 508  PRO A C     1 
ATOM   3667  O  O     . PRO A 1 508  ? -52.264 -34.427 -20.021 1.00 101.08 ? 508  PRO A O     1 
ATOM   3668  C  CB    . PRO A 1 508  ? -51.464 -37.306 -20.925 1.00 96.99  ? 508  PRO A CB    1 
ATOM   3669  C  CG    . PRO A 1 508  ? -52.560 -37.738 -20.008 1.00 99.45  ? 508  PRO A CG    1 
ATOM   3670  C  CD    . PRO A 1 508  ? -51.930 -37.679 -18.641 1.00 98.39  ? 508  PRO A CD    1 
ATOM   3671  N  N     . GLY A 1 509  ? -50.492 -34.146 -21.400 1.00 87.38  ? 509  GLY A N     1 
ATOM   3672  C  CA    . GLY A 1 509  ? -50.757 -32.743 -21.707 1.00 92.33  ? 509  GLY A CA    1 
ATOM   3673  C  C     . GLY A 1 509  ? -49.904 -31.763 -20.916 1.00 97.51  ? 509  GLY A C     1 
ATOM   3674  O  O     . GLY A 1 509  ? -49.636 -30.647 -21.392 1.00 103.91 ? 509  GLY A O     1 
ATOM   3675  N  N     . GLY A 1 510  ? -49.465 -32.161 -19.716 1.00 91.80  ? 510  GLY A N     1 
ATOM   3676  C  CA    . GLY A 1 510  ? -48.683 -31.301 -18.843 1.00 89.53  ? 510  GLY A CA    1 
ATOM   3677  C  C     . GLY A 1 510  ? -49.524 -30.144 -18.344 1.00 87.86  ? 510  GLY A C     1 
ATOM   3678  O  O     . GLY A 1 510  ? -50.753 -30.203 -18.372 1.00 84.37  ? 510  GLY A O     1 
ATOM   3679  N  N     . LYS A 1 511  ? -48.840 -29.092 -17.900 1.00 91.42  ? 511  LYS A N     1 
ATOM   3680  C  CA    . LYS A 1 511  ? -49.466 -27.830 -17.470 1.00 97.33  ? 511  LYS A CA    1 
ATOM   3681  C  C     . LYS A 1 511  ? -50.463 -27.978 -16.316 1.00 105.33 ? 511  LYS A C     1 
ATOM   3682  O  O     . LYS A 1 511  ? -51.427 -27.221 -16.232 1.00 111.88 ? 511  LYS A O     1 
ATOM   3683  C  CB    . LYS A 1 511  ? -50.145 -27.155 -18.668 1.00 92.41  ? 511  LYS A CB    1 
ATOM   3684  C  CG    . LYS A 1 511  ? -49.293 -27.043 -19.934 1.00 90.19  ? 511  LYS A CG    1 
ATOM   3685  C  CD    . LYS A 1 511  ? -50.044 -26.295 -21.030 1.00 90.66  ? 511  LYS A CD    1 
ATOM   3686  C  CE    . LYS A 1 511  ? -49.190 -25.238 -21.698 1.00 97.13  ? 511  LYS A CE    1 
ATOM   3687  N  NZ    . LYS A 1 511  ? -48.074 -25.886 -22.423 1.00 104.33 ? 511  LYS A NZ    1 
ATOM   3688  N  N     . VAL A 1 512  ? -50.235 -28.939 -15.425 1.00 106.20 ? 512  VAL A N     1 
ATOM   3689  C  CA    . VAL A 1 512  ? -51.278 -29.329 -14.464 1.00 105.96 ? 512  VAL A CA    1 
ATOM   3690  C  C     . VAL A 1 512  ? -51.809 -28.195 -13.594 1.00 110.95 ? 512  VAL A C     1 
ATOM   3691  O  O     . VAL A 1 512  ? -53.019 -28.052 -13.412 1.00 128.94 ? 512  VAL A O     1 
ATOM   3692  C  CB    . VAL A 1 512  ? -50.822 -30.462 -13.512 1.00 113.27 ? 512  VAL A CB    1 
ATOM   3693  C  CG1   . VAL A 1 512  ? -51.008 -31.810 -14.187 1.00 121.01 ? 512  VAL A CG1   1 
ATOM   3694  C  CG2   . VAL A 1 512  ? -49.379 -30.268 -13.026 1.00 112.43 ? 512  VAL A CG2   1 
ATOM   3695  N  N     . GLU A 1 513  ? -50.905 -27.356 -13.103 1.00 116.47 ? 513  GLU A N     1 
ATOM   3696  C  CA    . GLU A 1 513  ? -51.278 -26.244 -12.206 1.00 110.86 ? 513  GLU A CA    1 
ATOM   3697  C  C     . GLU A 1 513  ? -51.963 -25.105 -12.962 1.00 110.80 ? 513  GLU A C     1 
ATOM   3698  O  O     . GLU A 1 513  ? -52.766 -24.367 -12.382 1.00 127.02 ? 513  GLU A O     1 
ATOM   3699  C  CB    . GLU A 1 513  ? -50.029 -25.729 -11.476 1.00 111.74 ? 513  GLU A CB    1 
ATOM   3700  C  CG    . GLU A 1 513  ? -49.159 -26.856 -10.910 1.00 113.93 ? 513  GLU A CG    1 
ATOM   3701  C  CD    . GLU A 1 513  ? -48.121 -26.402 -9.900  1.00 111.40 ? 513  GLU A CD    1 
ATOM   3702  O  OE1   . GLU A 1 513  ? -47.471 -25.354 -10.116 1.00 119.69 ? 513  GLU A OE1   1 
ATOM   3703  O  OE2   . GLU A 1 513  ? -47.944 -27.119 -8.894  1.00 105.69 ? 513  GLU A OE2   1 
ATOM   3704  N  N     . PHE A 1 514  ? -51.648 -24.969 -14.255 1.00 108.59 ? 514  PHE A N     1 
ATOM   3705  C  CA    . PHE A 1 514  ? -52.344 -24.004 -15.117 1.00 106.56 ? 514  PHE A CA    1 
ATOM   3706  C  C     . PHE A 1 514  ? -53.751 -24.502 -15.423 1.00 110.39 ? 514  PHE A C     1 
ATOM   3707  O  O     . PHE A 1 514  ? -54.719 -23.748 -15.297 1.00 102.54 ? 514  PHE A O     1 
ATOM   3708  C  CB    . PHE A 1 514  ? -51.553 -23.747 -16.402 1.00 101.46 ? 514  PHE A CB    1 
ATOM   3709  C  CG    . PHE A 1 514  ? -52.167 -22.729 -17.323 1.00 92.58  ? 514  PHE A CG    1 
ATOM   3710  C  CD1   . PHE A 1 514  ? -52.895 -21.652 -16.844 1.00 96.56  ? 514  PHE A CD1   1 
ATOM   3711  C  CD2   . PHE A 1 514  ? -51.970 -22.833 -18.684 1.00 94.71  ? 514  PHE A CD2   1 
ATOM   3712  C  CE1   . PHE A 1 514  ? -53.443 -20.715 -17.715 1.00 99.82  ? 514  PHE A CE1   1 
ATOM   3713  C  CE2   . PHE A 1 514  ? -52.507 -21.902 -19.556 1.00 102.53 ? 514  PHE A CE2   1 
ATOM   3714  C  CZ    . PHE A 1 514  ? -53.244 -20.838 -19.072 1.00 101.98 ? 514  PHE A CZ    1 
ATOM   3715  N  N     . LYS A 1 515  ? -53.864 -25.777 -15.795 1.00 118.70 ? 515  LYS A N     1 
ATOM   3716  C  CA    . LYS A 1 515  ? -55.169 -26.415 -16.059 1.00 113.63 ? 515  LYS A CA    1 
ATOM   3717  C  C     . LYS A 1 515  ? -56.064 -26.362 -14.826 1.00 109.52 ? 515  LYS A C     1 
ATOM   3718  O  O     . LYS A 1 515  ? -57.248 -26.054 -14.939 1.00 112.40 ? 515  LYS A O     1 
ATOM   3719  C  CB    . LYS A 1 515  ? -55.006 -27.899 -16.470 1.00 112.28 ? 515  LYS A CB    1 
ATOM   3720  C  CG    . LYS A 1 515  ? -54.436 -28.197 -17.858 1.00 103.50 ? 515  LYS A CG    1 
ATOM   3721  C  CD    . LYS A 1 515  ? -54.433 -29.704 -18.054 1.00 99.97  ? 515  LYS A CD    1 
ATOM   3722  C  CE    . LYS A 1 515  ? -53.838 -30.173 -19.367 1.00 102.79 ? 515  LYS A CE    1 
ATOM   3723  N  NZ    . LYS A 1 515  ? -53.439 -31.611 -19.234 1.00 105.40 ? 515  LYS A NZ    1 
ATOM   3724  N  N     . ARG A 1 516  ? -55.495 -26.674 -13.657 1.00 108.47 ? 516  ARG A N     1 
ATOM   3725  C  CA    . ARG A 1 516  ? -56.200 -26.536 -12.368 1.00 102.02 ? 516  ARG A CA    1 
ATOM   3726  C  C     . ARG A 1 516  ? -56.804 -25.148 -12.186 1.00 108.92 ? 516  ARG A C     1 
ATOM   3727  O  O     . ARG A 1 516  ? -57.968 -25.012 -11.792 1.00 108.16 ? 516  ARG A O     1 
ATOM   3728  C  CB    . ARG A 1 516  ? -55.245 -26.859 -11.212 1.00 93.67  ? 516  ARG A CB    1 
ATOM   3729  C  CG    . ARG A 1 516  ? -55.093 -28.351 -10.981 1.00 92.25  ? 516  ARG A CG    1 
ATOM   3730  C  CD    . ARG A 1 516  ? -53.835 -28.713 -10.221 1.00 95.46  ? 516  ARG A CD    1 
ATOM   3731  N  NE    . ARG A 1 516  ? -53.787 -30.141 -9.932  1.00 99.27  ? 516  ARG A NE    1 
ATOM   3732  C  CZ    . ARG A 1 516  ? -52.713 -30.785 -9.489  1.00 108.62 ? 516  ARG A CZ    1 
ATOM   3733  N  NH1   . ARG A 1 516  ? -51.568 -30.149 -9.262  1.00 105.25 ? 516  ARG A NH1   1 
ATOM   3734  N  NH2   . ARG A 1 516  ? -52.786 -32.085 -9.269  1.00 124.12 ? 516  ARG A NH2   1 
ATOM   3735  N  N     . THR A 1 517  ? -56.001 -24.131 -12.488 1.00 103.36 ? 517  THR A N     1 
ATOM   3736  C  CA    . THR A 1 517  ? -56.406 -22.745 -12.346 1.00 91.49  ? 517  THR A CA    1 
ATOM   3737  C  C     . THR A 1 517  ? -57.491 -22.346 -13.333 1.00 90.97  ? 517  THR A C     1 
ATOM   3738  O  O     . THR A 1 517  ? -58.484 -21.740 -12.940 1.00 97.00  ? 517  THR A O     1 
ATOM   3739  C  CB    . THR A 1 517  ? -55.189 -21.856 -12.511 1.00 87.81  ? 517  THR A CB    1 
ATOM   3740  O  OG1   . THR A 1 517  ? -54.335 -22.079 -11.385 1.00 93.79  ? 517  THR A OG1   1 
ATOM   3741  C  CG2   . THR A 1 517  ? -55.588 -20.397 -12.593 1.00 88.28  ? 517  THR A CG2   1 
ATOM   3742  N  N     . LEU A 1 518  ? -57.306 -22.690 -14.605 1.00 88.90  ? 518  LEU A N     1 
ATOM   3743  C  CA    . LEU A 1 518  ? -58.304 -22.392 -15.656 1.00 89.19  ? 518  LEU A CA    1 
ATOM   3744  C  C     . LEU A 1 518  ? -59.694 -22.953 -15.337 1.00 85.68  ? 518  LEU A C     1 
ATOM   3745  O  O     . LEU A 1 518  ? -60.703 -22.295 -15.606 1.00 81.20  ? 518  LEU A O     1 
ATOM   3746  C  CB    . LEU A 1 518  ? -57.857 -22.892 -17.034 1.00 91.71  ? 518  LEU A CB    1 
ATOM   3747  C  CG    . LEU A 1 518  ? -56.808 -22.076 -17.793 1.00 90.78  ? 518  LEU A CG    1 
ATOM   3748  C  CD1   . LEU A 1 518  ? -56.530 -22.733 -19.135 1.00 95.79  ? 518  LEU A CD1   1 
ATOM   3749  C  CD2   . LEU A 1 518  ? -57.277 -20.651 -17.990 1.00 90.76  ? 518  LEU A CD2   1 
ATOM   3750  N  N     . ILE A 1 519  ? -59.727 -24.158 -14.753 1.00 82.58  ? 519  ILE A N     1 
ATOM   3751  C  CA    . ILE A 1 519  ? -60.970 -24.821 -14.332 1.00 86.57  ? 519  ILE A CA    1 
ATOM   3752  C  C     . ILE A 1 519  ? -61.796 -23.924 -13.411 1.00 93.48  ? 519  ILE A C     1 
ATOM   3753  O  O     . ILE A 1 519  ? -62.986 -23.704 -13.648 1.00 109.72 ? 519  ILE A O     1 
ATOM   3754  C  CB    . ILE A 1 519  ? -60.640 -26.139 -13.613 1.00 94.11  ? 519  ILE A CB    1 
ATOM   3755  C  CG1   . ILE A 1 519  ? -60.366 -27.237 -14.639 1.00 101.37 ? 519  ILE A CG1   1 
ATOM   3756  C  CG2   . ILE A 1 519  ? -61.773 -26.590 -12.712 1.00 99.10  ? 519  ILE A CG2   1 
ATOM   3757  C  CD1   . ILE A 1 519  ? -59.672 -28.455 -14.059 1.00 100.45 ? 519  ILE A CD1   1 
ATOM   3758  N  N     . ILE A 1 520  ? -61.162 -23.405 -12.371 1.00 93.91  ? 520  ILE A N     1 
ATOM   3759  C  CA    . ILE A 1 520  ? -61.847 -22.503 -11.449 1.00 93.08  ? 520  ILE A CA    1 
ATOM   3760  C  C     . ILE A 1 520  ? -61.931 -21.061 -11.958 1.00 93.62  ? 520  ILE A C     1 
ATOM   3761  O  O     . ILE A 1 520  ? -62.860 -20.344 -11.590 1.00 123.37 ? 520  ILE A O     1 
ATOM   3762  C  CB    . ILE A 1 520  ? -61.290 -22.631 -10.024 1.00 98.18  ? 520  ILE A CB    1 
ATOM   3763  C  CG1   . ILE A 1 520  ? -59.832 -22.166 -9.928  1.00 103.33 ? 520  ILE A CG1   1 
ATOM   3764  C  CG2   . ILE A 1 520  ? -61.418 -24.076 -9.587  1.00 100.64 ? 520  ILE A CG2   1 
ATOM   3765  C  CD1   . ILE A 1 520  ? -59.197 -22.469 -8.589  1.00 101.96 ? 520  ILE A CD1   1 
ATOM   3766  N  N     . SER A 1 521  ? -60.991 -20.628 -12.795 1.00 86.32  ? 521  SER A N     1 
ATOM   3767  C  CA    . SER A 1 521  ? -61.034 -19.277 -13.370 1.00 93.06  ? 521  SER A CA    1 
ATOM   3768  C  C     . SER A 1 521  ? -62.194 -19.109 -14.360 1.00 94.95  ? 521  SER A C     1 
ATOM   3769  O  O     . SER A 1 521  ? -62.809 -18.037 -14.403 1.00 92.88  ? 521  SER A O     1 
ATOM   3770  C  CB    . SER A 1 521  ? -59.709 -18.961 -14.057 1.00 95.10  ? 521  SER A CB    1 
ATOM   3771  O  OG    . SER A 1 521  ? -58.623 -19.193 -13.173 1.00 96.32  ? 521  SER A OG    1 
ATOM   3772  N  N     . PHE A 1 522  ? -62.491 -20.157 -15.143 1.00 95.20  ? 522  PHE A N     1 
ATOM   3773  C  CA    . PHE A 1 522  ? -63.667 -20.168 -16.032 1.00 102.05 ? 522  PHE A CA    1 
ATOM   3774  C  C     . PHE A 1 522  ? -64.973 -20.189 -15.237 1.00 101.76 ? 522  PHE A C     1 
ATOM   3775  O  O     . PHE A 1 522  ? -65.977 -19.612 -15.655 1.00 108.19 ? 522  PHE A O     1 
ATOM   3776  C  CB    . PHE A 1 522  ? -63.654 -21.429 -16.942 1.00 98.40  ? 522  PHE A CB    1 
ATOM   3777  C  CG    . PHE A 1 522  ? -62.599 -21.428 -18.030 1.00 96.62  ? 522  PHE A CG    1 
ATOM   3778  C  CD1   . PHE A 1 522  ? -61.967 -20.254 -18.462 1.00 101.66 ? 522  PHE A CD1   1 
ATOM   3779  C  CD2   . PHE A 1 522  ? -62.280 -22.609 -18.667 1.00 96.91  ? 522  PHE A CD2   1 
ATOM   3780  C  CE1   . PHE A 1 522  ? -61.015 -20.276 -19.473 1.00 97.17  ? 522  PHE A CE1   1 
ATOM   3781  C  CE2   . PHE A 1 522  ? -61.333 -22.636 -19.683 1.00 101.21 ? 522  PHE A CE2   1 
ATOM   3782  C  CZ    . PHE A 1 522  ? -60.698 -21.469 -20.086 1.00 98.63  ? 522  PHE A CZ    1 
ATOM   3783  N  N     . LEU A 1 523  ? -64.946 -20.898 -14.110 1.00 98.41  ? 523  LEU A N     1 
ATOM   3784  C  CA    . LEU A 1 523  ? -66.041 -20.892 -13.136 1.00 94.61  ? 523  LEU A CA    1 
ATOM   3785  C  C     . LEU A 1 523  ? -66.329 -19.481 -12.612 1.00 95.22  ? 523  LEU A C     1 
ATOM   3786  O  O     . LEU A 1 523  ? -67.485 -19.082 -12.514 1.00 98.83  ? 523  LEU A O     1 
ATOM   3787  C  CB    . LEU A 1 523  ? -65.716 -21.856 -12.002 1.00 86.21  ? 523  LEU A CB    1 
ATOM   3788  C  CG    . LEU A 1 523  ? -66.861 -22.310 -11.106 1.00 87.44  ? 523  LEU A CG    1 
ATOM   3789  C  CD1   . LEU A 1 523  ? -68.046 -22.849 -11.901 1.00 78.96  ? 523  LEU A CD1   1 
ATOM   3790  C  CD2   . LEU A 1 523  ? -66.332 -23.350 -10.116 1.00 94.99  ? 523  LEU A CD2   1 
ATOM   3791  N  N     . PHE A 1 524  ? -65.275 -18.738 -12.288 1.00 92.34  ? 524  PHE A N     1 
ATOM   3792  C  CA    . PHE A 1 524  ? -65.389 -17.333 -11.884 1.00 90.97  ? 524  PHE A CA    1 
ATOM   3793  C  C     . PHE A 1 524  ? -65.993 -16.472 -12.977 1.00 80.22  ? 524  PHE A C     1 
ATOM   3794  O  O     . PHE A 1 524  ? -66.900 -15.685 -12.722 1.00 78.15  ? 524  PHE A O     1 
ATOM   3795  C  CB    . PHE A 1 524  ? -64.019 -16.742 -11.527 1.00 96.57  ? 524  PHE A CB    1 
ATOM   3796  C  CG    . PHE A 1 524  ? -64.082 -15.304 -11.060 1.00 100.35 ? 524  PHE A CG    1 
ATOM   3797  C  CD1   . PHE A 1 524  ? -64.654 -14.977 -9.829  1.00 105.17 ? 524  PHE A CD1   1 
ATOM   3798  C  CD2   . PHE A 1 524  ? -63.583 -14.279 -11.844 1.00 101.06 ? 524  PHE A CD2   1 
ATOM   3799  C  CE1   . PHE A 1 524  ? -64.714 -13.663 -9.392  1.00 102.35 ? 524  PHE A CE1   1 
ATOM   3800  C  CE2   . PHE A 1 524  ? -63.640 -12.962 -11.414 1.00 101.27 ? 524  PHE A CE2   1 
ATOM   3801  C  CZ    . PHE A 1 524  ? -64.209 -12.655 -10.190 1.00 105.76 ? 524  PHE A CZ    1 
ATOM   3802  N  N     . LYS A 1 525  ? -65.488 -16.613 -14.194 1.00 89.29  ? 525  LYS A N     1 
ATOM   3803  C  CA    . LYS A 1 525  ? -65.990 -15.818 -15.317 1.00 96.09  ? 525  LYS A CA    1 
ATOM   3804  C  C     . LYS A 1 525  ? -67.475 -16.089 -15.591 1.00 100.77 ? 525  LYS A C     1 
ATOM   3805  O  O     . LYS A 1 525  ? -68.228 -15.167 -15.909 1.00 93.88  ? 525  LYS A O     1 
ATOM   3806  C  CB    . LYS A 1 525  ? -65.149 -16.044 -16.591 1.00 96.36  ? 525  LYS A CB    1 
ATOM   3807  C  CG    . LYS A 1 525  ? -63.840 -15.271 -16.618 1.00 93.07  ? 525  LYS A CG    1 
ATOM   3808  C  CD    . LYS A 1 525  ? -62.808 -15.915 -17.533 1.00 97.29  ? 525  LYS A CD    1 
ATOM   3809  C  CE    . LYS A 1 525  ? -62.846 -15.375 -18.965 1.00 104.28 ? 525  LYS A CE    1 
ATOM   3810  N  NZ    . LYS A 1 525  ? -62.254 -14.010 -19.163 1.00 98.00  ? 525  LYS A NZ    1 
ATOM   3811  N  N     . PHE A 1 526  ? -67.887 -17.349 -15.455 1.00 105.45 ? 526  PHE A N     1 
ATOM   3812  C  CA    . PHE A 1 526  ? -69.298 -17.728 -15.574 1.00 108.14 ? 526  PHE A CA    1 
ATOM   3813  C  C     . PHE A 1 526  ? -70.162 -17.100 -14.480 1.00 103.72 ? 526  PHE A C     1 
ATOM   3814  O  O     . PHE A 1 526  ? -71.247 -16.605 -14.758 1.00 110.93 ? 526  PHE A O     1 
ATOM   3815  C  CB    . PHE A 1 526  ? -69.416 -19.250 -15.467 1.00 110.97 ? 526  PHE A CB    1 
ATOM   3816  C  CG    . PHE A 1 526  ? -70.800 -19.777 -15.736 1.00 115.45 ? 526  PHE A CG    1 
ATOM   3817  C  CD1   . PHE A 1 526  ? -71.577 -19.254 -16.778 1.00 115.69 ? 526  PHE A CD1   1 
ATOM   3818  C  CD2   . PHE A 1 526  ? -71.324 -20.804 -14.960 1.00 105.48 ? 526  PHE A CD2   1 
ATOM   3819  C  CE1   . PHE A 1 526  ? -72.846 -19.736 -17.018 1.00 113.52 ? 526  PHE A CE1   1 
ATOM   3820  C  CE2   . PHE A 1 526  ? -72.591 -21.292 -15.202 1.00 100.38 ? 526  PHE A CE2   1 
ATOM   3821  C  CZ    . PHE A 1 526  ? -73.350 -20.761 -16.232 1.00 106.57 ? 526  PHE A CZ    1 
ATOM   3822  N  N     . TYR A 1 527  ? -69.679 -17.132 -13.240 1.00 93.45  ? 527  TYR A N     1 
ATOM   3823  C  CA    . TYR A 1 527  ? -70.354 -16.447 -12.134 1.00 99.50  ? 527  TYR A CA    1 
ATOM   3824  C  C     . TYR A 1 527  ? -70.639 -14.980 -12.507 1.00 95.60  ? 527  TYR A C     1 
ATOM   3825  O  O     . TYR A 1 527  ? -71.800 -14.551 -12.471 1.00 108.93 ? 527  TYR A O     1 
ATOM   3826  C  CB    . TYR A 1 527  ? -69.617 -16.644 -10.780 1.00 106.96 ? 527  TYR A CB    1 
ATOM   3827  C  CG    . TYR A 1 527  ? -69.985 -15.663 -9.664  1.00 116.42 ? 527  TYR A CG    1 
ATOM   3828  C  CD1   . TYR A 1 527  ? -71.269 -15.612 -9.108  1.00 109.34 ? 527  TYR A CD1   1 
ATOM   3829  C  CD2   . TYR A 1 527  ? -69.028 -14.793 -9.158  1.00 130.84 ? 527  TYR A CD2   1 
ATOM   3830  C  CE1   . TYR A 1 527  ? -71.578 -14.698 -8.104  1.00 111.51 ? 527  TYR A CE1   1 
ATOM   3831  C  CE2   . TYR A 1 527  ? -69.324 -13.886 -8.154  1.00 131.60 ? 527  TYR A CE2   1 
ATOM   3832  C  CZ    . TYR A 1 527  ? -70.588 -13.832 -7.629  1.00 121.75 ? 527  TYR A CZ    1 
ATOM   3833  O  OH    . TYR A 1 527  ? -70.787 -12.905 -6.630  1.00 115.23 ? 527  TYR A OH    1 
ATOM   3834  N  N     . LEU A 1 528  ? -69.588 -14.251 -12.881 1.00 87.12  ? 528  LEU A N     1 
ATOM   3835  C  CA    . LEU A 1 528  ? -69.687 -12.852 -13.290 1.00 89.02  ? 528  LEU A CA    1 
ATOM   3836  C  C     . LEU A 1 528  ? -70.675 -12.625 -14.432 1.00 94.73  ? 528  LEU A C     1 
ATOM   3837  O  O     . LEU A 1 528  ? -71.549 -11.749 -14.356 1.00 79.65  ? 528  LEU A O     1 
ATOM   3838  C  CB    . LEU A 1 528  ? -68.317 -12.333 -13.705 1.00 86.68  ? 528  LEU A CB    1 
ATOM   3839  C  CG    . LEU A 1 528  ? -67.404 -11.803 -12.619 1.00 89.70  ? 528  LEU A CG    1 
ATOM   3840  C  CD1   . LEU A 1 528  ? -67.386 -12.714 -11.410 1.00 92.76  ? 528  LEU A CD1   1 
ATOM   3841  C  CD2   . LEU A 1 528  ? -66.007 -11.632 -13.183 1.00 94.64  ? 528  LEU A CD2   1 
ATOM   3842  N  N     . GLU A 1 529  ? -70.518 -13.420 -15.483 1.00 103.53 ? 529  GLU A N     1 
ATOM   3843  C  CA    . GLU A 1 529  ? -71.277 -13.242 -16.719 1.00 112.98 ? 529  GLU A CA    1 
ATOM   3844  C  C     . GLU A 1 529  ? -72.764 -13.347 -16.472 1.00 113.38 ? 529  GLU A C     1 
ATOM   3845  O  O     . GLU A 1 529  ? -73.542 -12.462 -16.820 1.00 105.66 ? 529  GLU A O     1 
ATOM   3846  C  CB    . GLU A 1 529  ? -70.837 -14.327 -17.720 1.00 114.50 ? 529  GLU A CB    1 
ATOM   3847  C  CG    . GLU A 1 529  ? -71.204 -14.070 -19.169 1.00 116.15 ? 529  GLU A CG    1 
ATOM   3848  C  CD    . GLU A 1 529  ? -70.533 -15.053 -20.112 1.00 127.19 ? 529  GLU A CD    1 
ATOM   3849  O  OE1   . GLU A 1 529  ? -69.298 -15.256 -20.008 1.00 132.39 ? 529  GLU A OE1   1 
ATOM   3850  O  OE2   . GLU A 1 529  ? -71.244 -15.628 -20.967 1.00 136.89 ? 529  GLU A OE2   1 
ATOM   3851  N  N     . VAL A 1 530  ? -73.145 -14.445 -15.835 1.00 110.31 ? 530  VAL A N     1 
ATOM   3852  C  CA    . VAL A 1 530  ? -74.553 -14.738 -15.588 1.00 102.35 ? 530  VAL A CA    1 
ATOM   3853  C  C     . VAL A 1 530  ? -75.115 -13.929 -14.417 1.00 87.97  ? 530  VAL A C     1 
ATOM   3854  O  O     . VAL A 1 530  ? -76.313 -13.702 -14.356 1.00 93.39  ? 530  VAL A O     1 
ATOM   3855  C  CB    . VAL A 1 530  ? -74.801 -16.240 -15.299 1.00 108.67 ? 530  VAL A CB    1 
ATOM   3856  C  CG1   . VAL A 1 530  ? -74.463 -16.579 -13.863 1.00 112.83 ? 530  VAL A CG1   1 
ATOM   3857  C  CG2   . VAL A 1 530  ? -76.246 -16.633 -15.591 1.00 107.64 ? 530  VAL A CG2   1 
ATOM   3858  N  N     . SER A 1 531  ? -74.254 -13.490 -13.493 1.00 84.98  ? 531  SER A N     1 
ATOM   3859  C  CA    . SER A 1 531  ? -74.646 -12.475 -12.498 1.00 87.36  ? 531  SER A CA    1 
ATOM   3860  C  C     . SER A 1 531  ? -74.502 -11.097 -13.117 1.00 86.97  ? 531  SER A C     1 
ATOM   3861  O  O     . SER A 1 531  ? -73.809 -10.247 -12.596 1.00 95.79  ? 531  SER A O     1 
ATOM   3862  C  CB    . SER A 1 531  ? -73.903 -12.617 -11.149 1.00 88.15  ? 531  SER A CB    1 
ATOM   3863  O  OG    . SER A 1 531  ? -72.840 -11.715 -10.947 1.00 89.22  ? 531  SER A OG    1 
ATOM   3864  N  N     . GLN A 1 532  ? -75.181 -10.897 -14.236 1.00 92.87  ? 532  GLN A N     1 
ATOM   3865  C  CA    . GLN A 1 532  ? -75.202 -9.622  -14.941 1.00 101.51 ? 532  GLN A CA    1 
ATOM   3866  C  C     . GLN A 1 532  ? -76.369 -9.565  -15.921 1.00 114.58 ? 532  GLN A C     1 
ATOM   3867  O  O     . GLN A 1 532  ? -77.041 -8.540  -16.032 1.00 133.18 ? 532  GLN A O     1 
ATOM   3868  C  CB    . GLN A 1 532  ? -73.916 -9.379  -15.668 1.00 104.46 ? 532  GLN A CB    1 
ATOM   3869  C  CG    . GLN A 1 532  ? -73.729 -7.916  -15.983 1.00 105.56 ? 532  GLN A CG    1 
ATOM   3870  C  CD    . GLN A 1 532  ? -72.588 -7.718  -16.947 1.00 110.29 ? 532  GLN A CD    1 
ATOM   3871  O  OE1   . GLN A 1 532  ? -72.253 -8.621  -17.730 1.00 101.94 ? 532  GLN A OE1   1 
ATOM   3872  N  NE2   . GLN A 1 532  ? -71.983 -6.537  -16.907 1.00 106.30 ? 532  GLN A NE2   1 
ATOM   3873  N  N     . ILE A 1 533  ? -76.577 -10.649 -16.665 1.00 122.16 ? 533  ILE A N     1 
ATOM   3874  C  CA    . ILE A 1 533  ? -77.851 -10.908 -17.345 1.00 124.38 ? 533  ILE A CA    1 
ATOM   3875  C  C     . ILE A 1 533  ? -79.015 -10.946 -16.329 1.00 130.94 ? 533  ILE A C     1 
ATOM   3876  O  O     . ILE A 1 533  ? -80.120 -10.492 -16.628 1.00 135.98 ? 533  ILE A O     1 
ATOM   3877  C  CB    . ILE A 1 533  ? -77.726 -12.182 -18.221 1.00 121.28 ? 533  ILE A CB    1 
ATOM   3878  C  CG1   . ILE A 1 533  ? -78.795 -12.190 -19.312 1.00 137.72 ? 533  ILE A CG1   1 
ATOM   3879  C  CG2   . ILE A 1 533  ? -77.748 -13.443 -17.376 1.00 111.77 ? 533  ILE A CG2   1 
ATOM   3880  C  CD1   . ILE A 1 533  ? -78.659 -11.052 -20.311 1.00 149.28 ? 533  ILE A CD1   1 
ATOM   3881  N  N     . LEU A 1 534  ? -78.764 -11.479 -15.137 1.00 121.98 ? 534  LEU A N     1 
ATOM   3882  C  CA    . LEU A 1 534  ? -79.687 -11.367 -14.004 1.00 110.12 ? 534  LEU A CA    1 
ATOM   3883  C  C     . LEU A 1 534  ? -79.918 -9.913  -13.595 1.00 108.98 ? 534  LEU A C     1 
ATOM   3884  O  O     . LEU A 1 534  ? -81.061 -9.489  -13.420 1.00 118.35 ? 534  LEU A O     1 
ATOM   3885  C  CB    . LEU A 1 534  ? -79.129 -12.110 -12.758 1.00 99.38  ? 534  LEU A CB    1 
ATOM   3886  C  CG    . LEU A 1 534  ? -79.212 -13.649 -12.562 1.00 95.19  ? 534  LEU A CG    1 
ATOM   3887  C  CD1   . LEU A 1 534  ? -78.622 -14.049 -11.214 1.00 83.89  ? 534  LEU A CD1   1 
ATOM   3888  C  CD2   . LEU A 1 534  ? -80.617 -14.242 -12.695 1.00 94.03  ? 534  LEU A CD2   1 
ATOM   3889  N  N     . LYS A 1 535  ? -78.835 -9.162  -13.424 1.00 106.24 ? 535  LYS A N     1 
ATOM   3890  C  CA    . LYS A 1 535  ? -78.907 -7.729  -13.107 1.00 111.86 ? 535  LYS A CA    1 
ATOM   3891  C  C     . LYS A 1 535  ? -79.676 -6.975  -14.197 1.00 111.95 ? 535  LYS A C     1 
ATOM   3892  O  O     . LYS A 1 535  ? -80.543 -6.147  -13.899 1.00 134.22 ? 535  LYS A O     1 
ATOM   3893  C  CB    . LYS A 1 535  ? -77.468 -7.178  -13.017 1.00 114.48 ? 535  LYS A CB    1 
ATOM   3894  C  CG    . LYS A 1 535  ? -77.318 -5.664  -12.946 1.00 113.99 ? 535  LYS A CG    1 
ATOM   3895  C  CD    . LYS A 1 535  ? -77.660 -5.178  -11.555 1.00 124.96 ? 535  LYS A CD    1 
ATOM   3896  C  CE    . LYS A 1 535  ? -78.027 -3.706  -11.534 1.00 131.13 ? 535  LYS A CE    1 
ATOM   3897  N  NZ    . LYS A 1 535  ? -78.637 -3.332  -10.221 1.00 129.93 ? 535  LYS A NZ    1 
ATOM   3898  N  N     . LYS A 1 536  ? -79.348 -7.278  -15.448 1.00 108.37 ? 536  LYS A N     1 
ATOM   3899  C  CA    . LYS A 1 536  ? -80.011 -6.707  -16.616 1.00 115.16 ? 536  LYS A CA    1 
ATOM   3900  C  C     . LYS A 1 536  ? -81.521 -6.967  -16.591 1.00 115.68 ? 536  LYS A C     1 
ATOM   3901  O  O     . LYS A 1 536  ? -82.325 -6.040  -16.665 1.00 115.85 ? 536  LYS A O     1 
ATOM   3902  C  CB    . LYS A 1 536  ? -79.396 -7.327  -17.899 1.00 126.34 ? 536  LYS A CB    1 
ATOM   3903  C  CG    . LYS A 1 536  ? -79.996 -6.901  -19.243 1.00 133.43 ? 536  LYS A CG    1 
ATOM   3904  C  CD    . LYS A 1 536  ? -79.556 -5.493  -19.637 1.00 144.20 ? 536  LYS A CD    1 
ATOM   3905  C  CE    . LYS A 1 536  ? -80.618 -4.747  -20.439 1.00 142.95 ? 536  LYS A CE    1 
ATOM   3906  N  NZ    . LYS A 1 536  ? -80.684 -5.224  -21.845 1.00 140.43 ? 536  LYS A NZ    1 
ATOM   3907  N  N     . MET A 1 537  ? -81.883 -8.240  -16.467 1.00 121.19 ? 537  MET A N     1 
ATOM   3908  C  CA    . MET A 1 537  ? -83.284 -8.673  -16.472 1.00 118.85 ? 537  MET A CA    1 
ATOM   3909  C  C     . MET A 1 537  ? -84.085 -8.306  -15.232 1.00 107.79 ? 537  MET A C     1 
ATOM   3910  O  O     . MET A 1 537  ? -85.292 -8.115  -15.333 1.00 113.95 ? 537  MET A O     1 
ATOM   3911  C  CB    . MET A 1 537  ? -83.369 -10.185 -16.619 1.00 122.04 ? 537  MET A CB    1 
ATOM   3912  C  CG    . MET A 1 537  ? -82.865 -10.710 -17.945 1.00 118.57 ? 537  MET A CG    1 
ATOM   3913  S  SD    . MET A 1 537  ? -82.716 -12.473 -17.737 1.00 113.77 ? 537  MET A SD    1 
ATOM   3914  C  CE    . MET A 1 537  ? -84.454 -12.916 -17.791 1.00 124.01 ? 537  MET A CE    1 
ATOM   3915  N  N     . ASP A 1 538  ? -83.434 -8.241  -14.074 1.00 113.90 ? 538  ASP A N     1 
ATOM   3916  C  CA    . ASP A 1 538  ? -84.119 -8.028  -12.787 1.00 126.36 ? 538  ASP A CA    1 
ATOM   3917  C  C     . ASP A 1 538  ? -83.297 -7.052  -11.910 1.00 125.49 ? 538  ASP A C     1 
ATOM   3918  O  O     . ASP A 1 538  ? -82.681 -7.482  -10.934 1.00 128.93 ? 538  ASP A O     1 
ATOM   3919  C  CB    . ASP A 1 538  ? -84.257 -9.407  -12.107 1.00 136.65 ? 538  ASP A CB    1 
ATOM   3920  C  CG    . ASP A 1 538  ? -85.286 -9.438  -10.974 1.00 145.83 ? 538  ASP A CG    1 
ATOM   3921  O  OD1   . ASP A 1 538  ? -85.714 -8.361  -10.501 1.00 145.59 ? 538  ASP A OD1   1 
ATOM   3922  O  OD2   . ASP A 1 538  ? -85.663 -10.563 -10.552 1.00 144.17 ? 538  ASP A OD2   1 
ATOM   3923  N  N     . PRO A 1 539  ? -83.298 -5.742  -12.248 1.00 118.70 ? 539  PRO A N     1 
ATOM   3924  C  CA    . PRO A 1 539  ? -82.315 -4.789  -11.697 1.00 122.49 ? 539  PRO A CA    1 
ATOM   3925  C  C     . PRO A 1 539  ? -82.423 -4.582  -10.170 1.00 131.76 ? 539  PRO A C     1 
ATOM   3926  O  O     . PRO A 1 539  ? -81.400 -4.561  -9.465  1.00 128.17 ? 539  PRO A O     1 
ATOM   3927  C  CB    . PRO A 1 539  ? -82.617 -3.479  -12.449 1.00 117.23 ? 539  PRO A CB    1 
ATOM   3928  C  CG    . PRO A 1 539  ? -83.784 -3.758  -13.341 1.00 119.99 ? 539  PRO A CG    1 
ATOM   3929  C  CD    . PRO A 1 539  ? -84.419 -5.035  -12.883 1.00 114.86 ? 539  PRO A CD    1 
ATOM   3930  N  N     . VAL A 1 540  ? -83.644 -4.438  -9.677  1.00 134.10 ? 540  VAL A N     1 
ATOM   3931  C  CA    . VAL A 1 540  ? -83.877 -4.160  -8.264  1.00 129.42 ? 540  VAL A CA    1 
ATOM   3932  C  C     . VAL A 1 540  ? -83.525 -5.331  -7.322  1.00 125.01 ? 540  VAL A C     1 
ATOM   3933  O  O     . VAL A 1 540  ? -83.010 -5.103  -6.220  1.00 108.90 ? 540  VAL A O     1 
ATOM   3934  C  CB    . VAL A 1 540  ? -85.318 -3.631  -8.107  1.00 127.75 ? 540  VAL A CB    1 
ATOM   3935  C  CG1   . VAL A 1 540  ? -85.431 -2.283  -8.822  1.00 123.89 ? 540  VAL A CG1   1 
ATOM   3936  C  CG2   . VAL A 1 540  ? -86.349 -4.614  -8.664  1.00 118.24 ? 540  VAL A CG2   1 
ATOM   3937  N  N     . HIS A 1 541  ? -83.768 -6.566  -7.765  1.00 140.32 ? 541  HIS A N     1 
ATOM   3938  C  CA    . HIS A 1 541  ? -83.569 -7.763  -6.926  1.00 145.28 ? 541  HIS A CA    1 
ATOM   3939  C  C     . HIS A 1 541  ? -82.142 -8.359  -6.917  1.00 130.76 ? 541  HIS A C     1 
ATOM   3940  O  O     . HIS A 1 541  ? -81.847 -9.195  -6.047  1.00 105.41 ? 541  HIS A O     1 
ATOM   3941  C  CB    . HIS A 1 541  ? -84.545 -8.886  -7.343  1.00 148.60 ? 541  HIS A CB    1 
ATOM   3942  C  CG    . HIS A 1 541  ? -85.990 -8.571  -7.099  1.00 149.58 ? 541  HIS A CG    1 
ATOM   3943  N  ND1   . HIS A 1 541  ? -86.804 -8.015  -8.063  1.00 150.27 ? 541  HIS A ND1   1 
ATOM   3944  C  CD2   . HIS A 1 541  ? -86.770 -8.753  -6.006  1.00 147.18 ? 541  HIS A CD2   1 
ATOM   3945  C  CE1   . HIS A 1 541  ? -88.020 -7.853  -7.571  1.00 148.43 ? 541  HIS A CE1   1 
ATOM   3946  N  NE2   . HIS A 1 541  ? -88.027 -8.293  -6.325  1.00 150.75 ? 541  HIS A NE2   1 
ATOM   3947  N  N     . TYR A 1 542  ? -81.276 -7.905  -7.814  1.00 126.59 ? 542  TYR A N     1 
ATOM   3948  C  CA    . TYR A 1 542  ? -79.901 -8.446  -7.885  1.00 120.49 ? 542  TYR A CA    1 
ATOM   3949  C  C     . TYR A 1 542  ? -78.858 -7.338  -7.899  1.00 122.88 ? 542  TYR A C     1 
ATOM   3950  O  O     . TYR A 1 542  ? -79.129 -6.228  -8.361  1.00 119.91 ? 542  TYR A O     1 
ATOM   3951  C  CB    . TYR A 1 542  ? -79.682 -9.377  -9.076  1.00 118.12 ? 542  TYR A CB    1 
ATOM   3952  C  CG    . TYR A 1 542  ? -80.489 -10.650 -9.002  1.00 115.37 ? 542  TYR A CG    1 
ATOM   3953  C  CD1   . TYR A 1 542  ? -80.246 -11.619 -8.007  1.00 106.54 ? 542  TYR A CD1   1 
ATOM   3954  C  CD2   . TYR A 1 542  ? -81.509 -10.885 -9.928  1.00 109.28 ? 542  TYR A CD2   1 
ATOM   3955  C  CE1   . TYR A 1 542  ? -81.012 -12.783 -7.945  1.00 110.00 ? 542  TYR A CE1   1 
ATOM   3956  C  CE2   . TYR A 1 542  ? -82.271 -12.040 -9.883  1.00 110.95 ? 542  TYR A CE2   1 
ATOM   3957  C  CZ    . TYR A 1 542  ? -82.026 -12.986 -8.903  1.00 117.12 ? 542  TYR A CZ    1 
ATOM   3958  O  OH    . TYR A 1 542  ? -82.818 -14.109 -8.919  1.00 119.11 ? 542  TYR A OH    1 
ATOM   3959  N  N     . PRO A 1 543  ? -77.665 -7.631  -7.347  1.00 125.61 ? 543  PRO A N     1 
ATOM   3960  C  CA    . PRO A 1 543  ? -76.619 -6.609  -7.186  1.00 121.94 ? 543  PRO A CA    1 
ATOM   3961  C  C     . PRO A 1 543  ? -75.803 -6.387  -8.449  1.00 119.13 ? 543  PRO A C     1 
ATOM   3962  O  O     . PRO A 1 543  ? -75.655 -7.304  -9.272  1.00 134.14 ? 543  PRO A O     1 
ATOM   3963  C  CB    . PRO A 1 543  ? -75.732 -7.199  -6.086  1.00 121.70 ? 543  PRO A CB    1 
ATOM   3964  C  CG    . PRO A 1 543  ? -75.887 -8.685  -6.236  1.00 123.13 ? 543  PRO A CG    1 
ATOM   3965  C  CD    . PRO A 1 543  ? -77.268 -8.936  -6.777  1.00 120.07 ? 543  PRO A CD    1 
ATOM   3966  N  N     . SER A 1 544  ? -75.262 -5.177  -8.586  1.00 113.29 ? 544  SER A N     1 
ATOM   3967  C  CA    . SER A 1 544  ? -74.398 -4.841  -9.730  1.00 111.67 ? 544  SER A CA    1 
ATOM   3968  C  C     . SER A 1 544  ? -72.988 -5.382  -9.463  1.00 113.36 ? 544  SER A C     1 
ATOM   3969  O  O     . SER A 1 544  ? -72.578 -5.578  -8.306  1.00 122.06 ? 544  SER A O     1 
ATOM   3970  C  CB    . SER A 1 544  ? -74.378 -3.331  -10.001 1.00 107.98 ? 544  SER A CB    1 
ATOM   3971  O  OG    . SER A 1 544  ? -74.664 -3.056  -11.367 1.00 99.26  ? 544  SER A OG    1 
ATOM   3972  N  N     . LEU A 1 545  ? -72.240 -5.618  -10.538 1.00 118.88 ? 545  LEU A N     1 
ATOM   3973  C  CA    . LEU A 1 545  ? -70.847 -6.096  -10.420 1.00 131.15 ? 545  LEU A CA    1 
ATOM   3974  C  C     . LEU A 1 545  ? -69.945 -4.967  -9.886  1.00 130.51 ? 545  LEU A C     1 
ATOM   3975  O  O     . LEU A 1 545  ? -70.208 -3.776  -10.108 1.00 140.61 ? 545  LEU A O     1 
ATOM   3976  C  CB    . LEU A 1 545  ? -70.286 -6.634  -11.733 1.00 134.48 ? 545  LEU A CB    1 
ATOM   3977  C  CG    . LEU A 1 545  ? -70.793 -8.010  -12.154 1.00 125.32 ? 545  LEU A CG    1 
ATOM   3978  C  CD1   . LEU A 1 545  ? -72.089 -7.862  -12.936 1.00 127.14 ? 545  LEU A CD1   1 
ATOM   3979  C  CD2   . LEU A 1 545  ? -69.724 -8.707  -12.980 1.00 126.59 ? 545  LEU A CD2   1 
ATOM   3980  N  N     . ALA A 1 546  ? -68.888 -5.361  -9.188  1.00 127.55 ? 546  ALA A N     1 
ATOM   3981  C  CA    . ALA A 1 546  ? -67.866 -4.427  -8.689  1.00 136.26 ? 546  ALA A CA    1 
ATOM   3982  C  C     . ALA A 1 546  ? -67.225 -3.710  -9.874  1.00 137.69 ? 546  ALA A C     1 
ATOM   3983  O  O     . ALA A 1 546  ? -66.953 -4.328  -10.889 1.00 130.77 ? 546  ALA A O     1 
ATOM   3984  C  CB    . ALA A 1 546  ? -66.822 -5.184  -7.866  1.00 134.16 ? 546  ALA A CB    1 
ATOM   3985  N  N     . ASP A 1 547  ? -66.994 -2.410  -9.732  1.00 150.71 ? 547  ASP A N     1 
ATOM   3986  C  CA    . ASP A 1 547  ? -66.583 -1.530  -10.839 1.00 153.32 ? 547  ASP A CA    1 
ATOM   3987  C  C     . ASP A 1 547  ? -65.303 -1.942  -11.572 1.00 147.34 ? 547  ASP A C     1 
ATOM   3988  O  O     . ASP A 1 547  ? -65.191 -1.777  -12.798 1.00 140.17 ? 547  ASP A O     1 
ATOM   3989  C  CB    . ASP A 1 547  ? -66.293 -0.090  -10.348 1.00 157.78 ? 547  ASP A CB    1 
ATOM   3990  C  CG    . ASP A 1 547  ? -67.234 0.383   -9.261  1.00 159.76 ? 547  ASP A CG    1 
ATOM   3991  O  OD1   . ASP A 1 547  ? -68.465 0.309   -9.466  1.00 162.50 ? 547  ASP A OD1   1 
ATOM   3992  O  OD2   . ASP A 1 547  ? -66.729 0.851   -8.212  1.00 150.85 ? 547  ASP A OD2   1 
ATOM   3993  N  N     . LYS A 1 548  ? -64.342 -2.486  -10.814 1.00 136.04 ? 548  LYS A N     1 
ATOM   3994  C  CA    . LYS A 1 548  ? -63.067 -2.964  -11.399 1.00 124.31 ? 548  LYS A CA    1 
ATOM   3995  C  C     . LYS A 1 548  ? -63.111 -4.414  -11.907 1.00 115.92 ? 548  LYS A C     1 
ATOM   3996  O  O     . LYS A 1 548  ? -62.062 -5.004  -12.153 1.00 134.58 ? 548  LYS A O     1 
ATOM   3997  C  CB    . LYS A 1 548  ? -61.855 -2.735  -10.464 1.00 130.60 ? 548  LYS A CB    1 
ATOM   3998  C  CG    . LYS A 1 548  ? -62.008 -1.666  -9.372  1.00 139.37 ? 548  LYS A CG    1 
ATOM   3999  C  CD    . LYS A 1 548  ? -60.670 -1.087  -8.893  1.00 142.69 ? 548  LYS A CD    1 
ATOM   4000  C  CE    . LYS A 1 548  ? -59.671 -2.143  -8.438  1.00 145.15 ? 548  LYS A CE    1 
ATOM   4001  N  NZ    . LYS A 1 548  ? -60.251 -3.109  -7.460  1.00 151.03 ? 548  LYS A NZ    1 
ATOM   4002  N  N     . TYR A 1 549  ? -64.302 -4.982  -12.068 1.00 105.06 ? 549  TYR A N     1 
ATOM   4003  C  CA    . TYR A 1 549  ? -64.490 -6.380  -12.500 1.00 106.92 ? 549  TYR A CA    1 
ATOM   4004  C  C     . TYR A 1 549  ? -65.052 -6.547  -13.924 1.00 99.91  ? 549  TYR A C     1 
ATOM   4005  O  O     . TYR A 1 549  ? -64.781 -7.575  -14.537 1.00 99.03  ? 549  TYR A O     1 
ATOM   4006  C  CB    . TYR A 1 549  ? -65.430 -7.114  -11.511 1.00 113.96 ? 549  TYR A CB    1 
ATOM   4007  C  CG    . TYR A 1 549  ? -64.771 -7.661  -10.238 1.00 115.77 ? 549  TYR A CG    1 
ATOM   4008  C  CD1   . TYR A 1 549  ? -63.661 -7.025  -9.665  1.00 109.71 ? 549  TYR A CD1   1 
ATOM   4009  C  CD2   . TYR A 1 549  ? -65.274 -8.809  -9.590  1.00 105.28 ? 549  TYR A CD2   1 
ATOM   4010  C  CE1   . TYR A 1 549  ? -63.063 -7.516  -8.517  1.00 97.84  ? 549  TYR A CE1   1 
ATOM   4011  C  CE2   . TYR A 1 549  ? -64.673 -9.295  -8.430  1.00 93.49  ? 549  TYR A CE2   1 
ATOM   4012  C  CZ    . TYR A 1 549  ? -63.567 -8.635  -7.911  1.00 88.20  ? 549  TYR A CZ    1 
ATOM   4013  O  OH    . TYR A 1 549  ? -62.921 -9.061  -6.790  1.00 83.37  ? 549  TYR A OH    1 
ATOM   4014  N  N     . GLU A 1 550  ? -65.805 -5.568  -14.439 1.00 102.92 ? 550  GLU A N     1 
ATOM   4015  C  CA    . GLU A 1 550  ? -66.549 -5.738  -15.730 1.00 103.56 ? 550  GLU A CA    1 
ATOM   4016  C  C     . GLU A 1 550  ? -65.721 -6.206  -16.932 1.00 95.70  ? 550  GLU A C     1 
ATOM   4017  O  O     . GLU A 1 550  ? -66.205 -6.955  -17.776 1.00 101.31 ? 550  GLU A O     1 
ATOM   4018  C  CB    . GLU A 1 550  ? -67.224 -4.424  -16.174 1.00 114.37 ? 550  GLU A CB    1 
ATOM   4019  C  CG    . GLU A 1 550  ? -68.568 -4.104  -15.521 1.00 130.54 ? 550  GLU A CG    1 
ATOM   4020  C  CD    . GLU A 1 550  ? -68.460 -3.236  -14.264 1.00 151.08 ? 550  GLU A CD    1 
ATOM   4021  O  OE1   . GLU A 1 550  ? -67.803 -2.164  -14.309 1.00 168.69 ? 550  GLU A OE1   1 
ATOM   4022  O  OE2   . GLU A 1 550  ? -69.054 -3.618  -13.226 1.00 149.25 ? 550  GLU A OE2   1 
ATOM   4023  N  N     . SER A 1 551  ? -64.480 -5.747  -17.016 1.00 100.00 ? 551  SER A N     1 
ATOM   4024  C  CA    . SER A 1 551  ? -63.597 -6.040  -18.151 1.00 95.42  ? 551  SER A CA    1 
ATOM   4025  C  C     . SER A 1 551  ? -63.243 -7.539  -18.302 1.00 97.43  ? 551  SER A C     1 
ATOM   4026  O  O     . SER A 1 551  ? -62.833 -7.982  -19.391 1.00 111.59 ? 551  SER A O     1 
ATOM   4027  C  CB    . SER A 1 551  ? -62.296 -5.276  -17.940 1.00 93.48  ? 551  SER A CB    1 
ATOM   4028  O  OG    . SER A 1 551  ? -61.796 -5.537  -16.620 1.00 97.56  ? 551  SER A OG    1 
ATOM   4029  N  N     . ALA A 1 552  ? -63.402 -8.307  -17.220 1.00 91.56  ? 552  ALA A N     1 
ATOM   4030  C  CA    . ALA A 1 552  ? -63.231 -9.762  -17.258 1.00 91.93  ? 552  ALA A CA    1 
ATOM   4031  C  C     . ALA A 1 552  ? -64.187 -10.495 -18.214 1.00 104.20 ? 552  ALA A C     1 
ATOM   4032  O  O     . ALA A 1 552  ? -63.845 -11.583 -18.675 1.00 104.69 ? 552  ALA A O     1 
ATOM   4033  C  CB    . ALA A 1 552  ? -63.355 -10.350 -15.868 1.00 83.43  ? 552  ALA A CB    1 
ATOM   4034  N  N     . LEU A 1 553  ? -65.349 -9.907  -18.519 1.00 111.84 ? 553  LEU A N     1 
ATOM   4035  C  CA    . LEU A 1 553  ? -66.371 -10.570 -19.338 1.00 120.45 ? 553  LEU A CA    1 
ATOM   4036  C  C     . LEU A 1 553  ? -66.130 -10.518 -20.843 1.00 122.97 ? 553  LEU A C     1 
ATOM   4037  O  O     . LEU A 1 553  ? -66.057 -11.571 -21.487 1.00 124.13 ? 553  LEU A O     1 
ATOM   4038  C  CB    . LEU A 1 553  ? -67.760 -10.059 -18.986 1.00 128.48 ? 553  LEU A CB    1 
ATOM   4039  C  CG    . LEU A 1 553  ? -68.393 -10.842 -17.843 1.00 127.18 ? 553  LEU A CG    1 
ATOM   4040  C  CD1   . LEU A 1 553  ? -67.384 -11.229 -16.774 1.00 122.96 ? 553  LEU A CD1   1 
ATOM   4041  C  CD2   . LEU A 1 553  ? -69.521 -10.013 -17.247 1.00 140.61 ? 553  LEU A CD2   1 
ATOM   4042  N  N     . GLU A 1 554  ? -66.022 -9.314  -21.418 1.00 132.12 ? 554  GLU A N     1 
ATOM   4043  C  CA    . GLU A 1 554  ? -65.658 -9.176  -22.850 1.00 140.98 ? 554  GLU A CA    1 
ATOM   4044  C  C     . GLU A 1 554  ? -64.168 -9.550  -23.031 1.00 138.75 ? 554  GLU A C     1 
ATOM   4045  O  O     . GLU A 1 554  ? -63.335 -9.255  -22.169 1.00 130.66 ? 554  GLU A O     1 
ATOM   4046  C  CB    . GLU A 1 554  ? -66.006 -7.786  -23.430 1.00 138.30 ? 554  GLU A CB    1 
ATOM   4047  C  CG    . GLU A 1 554  ? -64.964 -6.692  -23.246 1.00 131.10 ? 554  GLU A CG    1 
ATOM   4048  C  CD    . GLU A 1 554  ? -64.745 -6.343  -21.792 1.00 139.47 ? 554  GLU A CD    1 
ATOM   4049  O  OE1   . GLU A 1 554  ? -65.040 -7.193  -20.930 1.00 144.24 ? 554  GLU A OE1   1 
ATOM   4050  O  OE2   . GLU A 1 554  ? -64.274 -5.222  -21.503 1.00 147.97 ? 554  GLU A OE2   1 
ATOM   4051  N  N     . ASP A 1 555  ? -63.867 -10.232 -24.134 1.00 138.57 ? 555  ASP A N     1 
ATOM   4052  C  CA    . ASP A 1 555  ? -62.543 -10.798 -24.349 1.00 140.51 ? 555  ASP A CA    1 
ATOM   4053  C  C     . ASP A 1 555  ? -61.850 -10.076 -25.514 1.00 144.21 ? 555  ASP A C     1 
ATOM   4054  O  O     . ASP A 1 555  ? -62.404 -9.112  -26.066 1.00 148.95 ? 555  ASP A O     1 
ATOM   4055  C  CB    . ASP A 1 555  ? -62.656 -12.319 -24.542 1.00 137.43 ? 555  ASP A CB    1 
ATOM   4056  C  CG    . ASP A 1 555  ? -62.908 -13.065 -23.225 1.00 141.90 ? 555  ASP A CG    1 
ATOM   4057  O  OD1   . ASP A 1 555  ? -62.534 -12.548 -22.144 1.00 139.12 ? 555  ASP A OD1   1 
ATOM   4058  O  OD2   . ASP A 1 555  ? -63.474 -14.181 -23.270 1.00 142.68 ? 555  ASP A OD2   1 
ATOM   4059  N  N     . LEU A 1 556  ? -60.640 -10.533 -25.855 1.00 137.64 ? 556  LEU A N     1 
ATOM   4060  C  CA    . LEU A 1 556  ? -59.673 -9.778  -26.645 1.00 126.86 ? 556  LEU A CA    1 
ATOM   4061  C  C     . LEU A 1 556  ? -59.659 -10.316 -28.092 1.00 132.26 ? 556  LEU A C     1 
ATOM   4062  O  O     . LEU A 1 556  ? -59.126 -11.410 -28.338 1.00 126.88 ? 556  LEU A O     1 
ATOM   4063  C  CB    . LEU A 1 556  ? -58.287 -9.888  -25.952 1.00 118.87 ? 556  LEU A CB    1 
ATOM   4064  C  CG    . LEU A 1 556  ? -58.208 -9.997  -24.400 1.00 105.41 ? 556  LEU A CG    1 
ATOM   4065  C  CD1   . LEU A 1 556  ? -56.783 -9.974  -23.865 1.00 96.50  ? 556  LEU A CD1   1 
ATOM   4066  C  CD2   . LEU A 1 556  ? -58.984 -8.892  -23.713 1.00 103.66 ? 556  LEU A CD2   1 
ATOM   4067  N  N     . HIS A 1 557  ? -60.255 -9.573  -29.020 1.00 137.94 ? 557  HIS A N     1 
ATOM   4068  C  CA    . HIS A 1 557  ? -60.538 -10.089 -30.369 1.00 145.10 ? 557  HIS A CA    1 
ATOM   4069  C  C     . HIS A 1 557  ? -60.416 -9.044  -31.479 1.00 146.42 ? 557  HIS A C     1 
ATOM   4070  O  O     . HIS A 1 557  ? -61.390 -8.703  -32.161 1.00 160.27 ? 557  HIS A O     1 
ATOM   4071  C  CB    . HIS A 1 557  ? -61.939 -10.742 -30.385 1.00 159.54 ? 557  HIS A CB    1 
ATOM   4072  C  CG    . HIS A 1 557  ? -62.999 -9.932  -29.689 1.00 181.93 ? 557  HIS A CG    1 
ATOM   4073  N  ND1   . HIS A 1 557  ? -63.422 -8.700  -30.147 1.00 201.47 ? 557  HIS A ND1   1 
ATOM   4074  C  CD2   . HIS A 1 557  ? -63.719 -10.180 -28.568 1.00 179.45 ? 557  HIS A CD2   1 
ATOM   4075  C  CE1   . HIS A 1 557  ? -64.352 -8.223  -29.337 1.00 188.56 ? 557  HIS A CE1   1 
ATOM   4076  N  NE2   . HIS A 1 557  ? -64.548 -9.100  -28.369 1.00 184.98 ? 557  HIS A NE2   1 
ATOM   4077  N  N     . SER A 1 558  ? -59.210 -8.498  -31.631 1.00 142.33 ? 558  SER A N     1 
ATOM   4078  C  CA    . SER A 1 558  ? -58.861 -7.632  -32.776 1.00 139.21 ? 558  SER A CA    1 
ATOM   4079  C  C     . SER A 1 558  ? -59.738 -6.372  -32.895 1.00 140.50 ? 558  SER A C     1 
ATOM   4080  O  O     . SER A 1 558  ? -59.298 -5.245  -32.564 1.00 140.92 ? 558  SER A O     1 
ATOM   4081  C  CB    . SER A 1 558  ? -58.884 -8.433  -34.094 1.00 132.63 ? 558  SER A CB    1 
ATOM   4082  O  OG    . SER A 1 558  ? -60.196 -8.570  -34.634 1.00 124.29 ? 558  SER A OG    1 
ATOM   4083  N  N     . HIS A 1 560  ? -59.498 -6.442  -36.489 1.00 123.74 ? 560  HIS A N     1 
ATOM   4084  C  CA    . HIS A 1 560  ? -59.055 -5.204  -37.168 1.00 132.91 ? 560  HIS A CA    1 
ATOM   4085  C  C     . HIS A 1 560  ? -57.534 -5.085  -37.205 1.00 133.22 ? 560  HIS A C     1 
ATOM   4086  O  O     . HIS A 1 560  ? -56.892 -5.455  -36.215 1.00 157.70 ? 560  HIS A O     1 
ATOM   4087  C  CB    . HIS A 1 560  ? -59.669 -3.996  -36.486 1.00 133.72 ? 560  HIS A CB    1 
ATOM   4088  C  CG    . HIS A 1 560  ? -61.158 -4.051  -36.466 1.00 146.42 ? 560  HIS A CG    1 
ATOM   4089  N  ND1   . HIS A 1 560  ? -61.883 -4.234  -35.309 1.00 150.62 ? 560  HIS A ND1   1 
ATOM   4090  C  CD2   . HIS A 1 560  ? -62.058 -4.025  -37.478 1.00 146.02 ? 560  HIS A CD2   1 
ATOM   4091  C  CE1   . HIS A 1 560  ? -63.171 -4.275  -35.604 1.00 149.76 ? 560  HIS A CE1   1 
ATOM   4092  N  NE2   . HIS A 1 560  ? -63.303 -4.152  -36.914 1.00 151.65 ? 560  HIS A NE2   1 
ATOM   4093  N  N     . HIS A 1 561  ? -56.986 -4.599  -38.324 1.00 122.98 ? 561  HIS A N     1 
ATOM   4094  C  CA    . HIS A 1 561  ? -55.557 -4.690  -38.604 1.00 117.26 ? 561  HIS A CA    1 
ATOM   4095  C  C     . HIS A 1 561  ? -55.105 -3.480  -39.416 1.00 124.81 ? 561  HIS A C     1 
ATOM   4096  O  O     . HIS A 1 561  ? -55.249 -3.465  -40.635 1.00 135.11 ? 561  HIS A O     1 
ATOM   4097  C  CB    . HIS A 1 561  ? -55.249 -5.986  -39.333 1.00 105.98 ? 561  HIS A CB    1 
ATOM   4098  C  CG    . HIS A 1 561  ? -55.651 -7.208  -38.569 1.00 110.03 ? 561  HIS A CG    1 
ATOM   4099  N  ND1   . HIS A 1 561  ? -54.889 -7.730  -37.543 1.00 113.02 ? 561  HIS A ND1   1 
ATOM   4100  C  CD2   . HIS A 1 561  ? -56.741 -8.007  -38.674 1.00 112.84 ? 561  HIS A CD2   1 
ATOM   4101  C  CE1   . HIS A 1 561  ? -55.489 -8.801  -37.053 1.00 116.09 ? 561  HIS A CE1   1 
ATOM   4102  N  NE2   . HIS A 1 561  ? -56.612 -8.993  -37.725 1.00 122.62 ? 561  HIS A NE2   1 
ATOM   4103  N  N     . CYS A 1 562  ? -54.557 -2.481  -38.718 1.00 122.49 ? 562  CYS A N     1 
ATOM   4104  C  CA    . CYS A 1 562  ? -54.138 -1.193  -39.295 1.00 108.46 ? 562  CYS A CA    1 
ATOM   4105  C  C     . CYS A 1 562  ? -52.604 -1.097  -39.392 1.00 98.05  ? 562  CYS A C     1 
ATOM   4106  O  O     . CYS A 1 562  ? -51.880 -1.693  -38.583 1.00 91.62  ? 562  CYS A O     1 
ATOM   4107  C  CB    . CYS A 1 562  ? -54.794 -0.036  -38.490 1.00 113.51 ? 562  CYS A CB    1 
ATOM   4108  S  SG    . CYS A 1 562  ? -54.124 1.655   -38.608 1.00 124.60 ? 562  CYS A SG    1 
ATOM   4109  N  N     . SER A 1 563  ? -52.107 -0.372  -40.387 1.00 97.77  ? 563  SER A N     1 
ATOM   4110  C  CA    . SER A 1 563  ? -50.654 -0.171  -40.564 1.00 99.81  ? 563  SER A CA    1 
ATOM   4111  C  C     . SER A 1 563  ? -50.297 1.051   -41.430 1.00 109.01 ? 563  SER A C     1 
ATOM   4112  O  O     . SER A 1 563  ? -51.017 1.329   -42.384 1.00 111.09 ? 563  SER A O     1 
ATOM   4113  C  CB    . SER A 1 563  ? -50.038 -1.416  -41.212 1.00 98.33  ? 563  SER A CB    1 
ATOM   4114  O  OG    . SER A 1 563  ? -49.690 -1.161  -42.569 1.00 105.01 ? 563  SER A OG    1 
ATOM   4115  N  N     . THR A 1 564  ? -49.181 1.733   -41.087 1.00 116.80 ? 564  THR A N     1 
ATOM   4116  C  CA    . THR A 1 564  ? -48.629 2.794   -41.922 1.00 114.44 ? 564  THR A CA    1 
ATOM   4117  C  C     . THR A 1 564  ? -47.099 2.673   -42.017 1.00 101.49 ? 564  THR A C     1 
ATOM   4118  O  O     . THR A 1 564  ? -46.458 2.064   -41.178 1.00 91.41  ? 564  THR A O     1 
ATOM   4119  C  CB    . THR A 1 564  ? -49.014 4.189   -41.436 1.00 108.76 ? 564  THR A CB    1 
ATOM   4120  O  OG1   . THR A 1 564  ? -49.381 4.095   -40.050 1.00 100.37 ? 564  THR A OG1   1 
ATOM   4121  C  CG2   . THR A 1 564  ? -50.170 4.766   -42.325 1.00 99.05  ? 564  THR A CG2   1 
ATOM   4122  N  N     . LEU A 1 565  ? -46.541 3.276   -43.059 1.00 103.15 ? 565  LEU A N     1 
ATOM   4123  C  CA    . LEU A 1 565  ? -45.148 3.067   -43.457 1.00 111.85 ? 565  LEU A CA    1 
ATOM   4124  C  C     . LEU A 1 565  ? -44.526 4.355   -43.986 1.00 105.90 ? 565  LEU A C     1 
ATOM   4125  O  O     . LEU A 1 565  ? -44.865 4.808   -45.081 1.00 99.60  ? 565  LEU A O     1 
ATOM   4126  C  CB    . LEU A 1 565  ? -45.051 2.010   -44.562 1.00 119.88 ? 565  LEU A CB    1 
ATOM   4127  C  CG    . LEU A 1 565  ? -45.694 0.650   -44.302 1.00 126.64 ? 565  LEU A CG    1 
ATOM   4128  C  CD1   . LEU A 1 565  ? -45.707 -0.153  -45.591 1.00 128.43 ? 565  LEU A CD1   1 
ATOM   4129  C  CD2   . LEU A 1 565  ? -44.964 -0.101  -43.201 1.00 132.25 ? 565  LEU A CD2   1 
ATOM   4130  N  N     . LYS A 1 566  ? -43.587 4.928   -43.242 1.00 100.76 ? 566  LYS A N     1 
ATOM   4131  C  CA    . LYS A 1 566  ? -42.810 6.075   -43.729 1.00 108.63 ? 566  LYS A CA    1 
ATOM   4132  C  C     . LYS A 1 566  ? -41.464 5.632   -44.308 1.00 115.41 ? 566  LYS A C     1 
ATOM   4133  O  O     . LYS A 1 566  ? -40.780 4.796   -43.707 1.00 127.58 ? 566  LYS A O     1 
ATOM   4134  C  CB    . LYS A 1 566  ? -42.540 7.034   -42.564 1.00 115.24 ? 566  LYS A CB    1 
ATOM   4135  C  CG    . LYS A 1 566  ? -43.566 8.142   -42.379 1.00 122.58 ? 566  LYS A CG    1 
ATOM   4136  C  CD    . LYS A 1 566  ? -43.030 9.234   -41.448 1.00 128.02 ? 566  LYS A CD    1 
ATOM   4137  C  CE    . LYS A 1 566  ? -43.630 10.607  -41.743 1.00 129.33 ? 566  LYS A CE    1 
ATOM   4138  N  NZ    . LYS A 1 566  ? -45.061 10.689  -41.340 1.00 132.29 ? 566  LYS A NZ    1 
ATOM   4139  N  N     . TYR A 1 567  ? -41.108 6.201   -45.453 1.00 105.20 ? 567  TYR A N     1 
ATOM   4140  C  CA    . TYR A 1 567  ? -39.803 5.996   -46.082 1.00 107.49 ? 567  TYR A CA    1 
ATOM   4141  C  C     . TYR A 1 567  ? -39.567 7.056   -47.173 1.00 123.11 ? 567  TYR A C     1 
ATOM   4142  O  O     . TYR A 1 567  ? -40.535 7.671   -47.610 1.00 114.87 ? 567  TYR A O     1 
ATOM   4143  C  CB    . TYR A 1 567  ? -39.718 4.583   -46.664 1.00 104.86 ? 567  TYR A CB    1 
ATOM   4144  C  CG    . TYR A 1 567  ? -40.633 4.340   -47.852 1.00 113.87 ? 567  TYR A CG    1 
ATOM   4145  C  CD1   . TYR A 1 567  ? -41.981 3.996   -47.684 1.00 110.45 ? 567  TYR A CD1   1 
ATOM   4146  C  CD2   . TYR A 1 567  ? -40.138 4.454   -49.160 1.00 122.64 ? 567  TYR A CD2   1 
ATOM   4147  C  CE1   . TYR A 1 567  ? -42.799 3.772   -48.787 1.00 113.18 ? 567  TYR A CE1   1 
ATOM   4148  C  CE2   . TYR A 1 567  ? -40.944 4.239   -50.268 1.00 115.29 ? 567  TYR A CE2   1 
ATOM   4149  C  CZ    . TYR A 1 567  ? -42.264 3.896   -50.083 1.00 118.33 ? 567  TYR A CZ    1 
ATOM   4150  O  OH    . TYR A 1 567  ? -43.018 3.692   -51.213 1.00 120.08 ? 567  TYR A OH    1 
ATOM   4151  N  N     . GLN A 1 568  ? -38.315 7.253   -47.609 1.00 138.75 ? 568  GLN A N     1 
ATOM   4152  C  CA    . GLN A 1 568  ? -37.957 8.357   -48.510 1.00 147.08 ? 568  GLN A CA    1 
ATOM   4153  C  C     . GLN A 1 568  ? -37.760 7.920   -49.980 1.00 144.09 ? 568  GLN A C     1 
ATOM   4154  O  O     . GLN A 1 568  ? -37.604 6.729   -50.268 1.00 149.89 ? 568  GLN A O     1 
ATOM   4155  C  CB    . GLN A 1 568  ? -36.678 9.022   -47.981 1.00 149.29 ? 568  GLN A CB    1 
ATOM   4156  C  CG    . GLN A 1 568  ? -36.718 10.544  -47.915 1.00 148.65 ? 568  GLN A CG    1 
ATOM   4157  C  CD    . GLN A 1 568  ? -35.573 11.114  -47.093 1.00 151.51 ? 568  GLN A CD    1 
ATOM   4158  O  OE1   . GLN A 1 568  ? -34.620 10.404  -46.766 1.00 164.48 ? 568  GLN A OE1   1 
ATOM   4159  N  NE2   . GLN A 1 568  ? -35.660 12.397  -46.754 1.00 135.38 ? 568  GLN A NE2   1 
ATOM   4160  N  N     . ASN A 1 569  ? -37.753 8.894   -50.892 1.00 131.06 ? 569  ASN A N     1 
ATOM   4161  C  CA    . ASN A 1 569  ? -37.674 8.640   -52.327 1.00 129.10 ? 569  ASN A CA    1 
ATOM   4162  C  C     . ASN A 1 569  ? -37.681 9.948   -53.089 1.00 125.84 ? 569  ASN A C     1 
ATOM   4163  O  O     . ASN A 1 569  ? -36.771 10.232  -53.851 1.00 115.58 ? 569  ASN A O     1 
ATOM   4164  C  CB    . ASN A 1 569  ? -38.848 7.778   -52.813 1.00 140.15 ? 569  ASN A CB    1 
ATOM   4165  C  CG    . ASN A 1 569  ? -40.194 8.240   -52.260 1.00 152.08 ? 569  ASN A CG    1 
ATOM   4166  O  OD1   . ASN A 1 569  ? -40.275 9.202   -51.492 1.00 139.65 ? 569  ASN A OD1   1 
ATOM   4167  N  ND2   . ASN A 1 569  ? -41.259 7.540   -52.644 1.00 163.54 ? 569  ASN A ND2   1 
ATOM   4168  N  N     . PRO A 1 572  ? -35.192 12.578  -56.553 1.00 172.41 ? 572  PRO A N     1 
ATOM   4169  C  CA    . PRO A 1 572  ? -35.012 13.677  -57.475 1.00 163.14 ? 572  PRO A CA    1 
ATOM   4170  C  C     . PRO A 1 572  ? -33.808 13.481  -58.423 1.00 163.38 ? 572  PRO A C     1 
ATOM   4171  O  O     . PRO A 1 572  ? -34.007 13.469  -59.608 1.00 159.01 ? 572  PRO A O     1 
ATOM   4172  C  CB    . PRO A 1 572  ? -34.758 14.876  -56.542 1.00 167.05 ? 572  PRO A CB    1 
ATOM   4173  C  CG    . PRO A 1 572  ? -34.198 14.289  -55.274 1.00 168.83 ? 572  PRO A CG    1 
ATOM   4174  C  CD    . PRO A 1 572  ? -34.438 12.794  -55.302 1.00 176.26 ? 572  PRO A CD    1 
ATOM   4175  N  N     . LYS A 1 573  ? -32.589 13.494  -57.881 1.00 171.26 ? 573  LYS A N     1 
ATOM   4176  C  CA    . LYS A 1 573  ? -31.355 13.518  -58.669 1.00 170.47 ? 573  LYS A CA    1 
ATOM   4177  C  C     . LYS A 1 573  ? -31.127 12.248  -59.516 1.00 172.23 ? 573  LYS A C     1 
ATOM   4178  O  O     . LYS A 1 573  ? -30.492 12.312  -60.586 1.00 192.92 ? 573  LYS A O     1 
ATOM   4179  C  CB    . LYS A 1 573  ? -30.150 13.691  -57.720 1.00 168.47 ? 573  LYS A CB    1 
ATOM   4180  C  CG    . LYS A 1 573  ? -29.632 15.116  -57.583 1.00 162.36 ? 573  LYS A CG    1 
ATOM   4181  C  CD    . LYS A 1 573  ? -28.705 15.491  -58.735 1.00 149.78 ? 573  LYS A CD    1 
ATOM   4182  C  CE    . LYS A 1 573  ? -27.965 16.787  -58.466 1.00 139.99 ? 573  LYS A CE    1 
ATOM   4183  N  NZ    . LYS A 1 573  ? -28.907 17.911  -58.241 1.00 138.96 ? 573  LYS A NZ    1 
ATOM   4184  N  N     . GLN A 1 574  ? -31.634 11.108  -59.034 1.00 158.01 ? 574  GLN A N     1 
ATOM   4185  C  CA    . GLN A 1 574  ? -31.474 9.815   -59.726 1.00 145.25 ? 574  GLN A CA    1 
ATOM   4186  C  C     . GLN A 1 574  ? -32.391 9.727   -60.954 1.00 135.23 ? 574  GLN A C     1 
ATOM   4187  O  O     . GLN A 1 574  ? -33.514 10.231  -60.954 1.00 118.83 ? 574  GLN A O     1 
ATOM   4188  C  CB    . GLN A 1 574  ? -31.775 8.695   -58.743 1.00 142.88 ? 574  GLN A CB    1 
ATOM   4189  C  CG    . GLN A 1 574  ? -31.424 7.307   -59.223 1.00 142.68 ? 574  GLN A CG    1 
ATOM   4190  C  CD    . GLN A 1 574  ? -32.034 6.257   -58.324 1.00 143.09 ? 574  GLN A CD    1 
ATOM   4191  O  OE1   . GLN A 1 574  ? -31.837 6.287   -57.111 1.00 145.58 ? 574  GLN A OE1   1 
ATOM   4192  N  NE2   . GLN A 1 574  ? -32.800 5.339   -58.907 1.00 136.43 ? 574  GLN A NE2   1 
ATOM   4193  N  N     . HIS A 1 575  ? -31.912 9.055   -61.999 1.00 132.26 ? 575  HIS A N     1 
ATOM   4194  C  CA    . HIS A 1 575  ? -32.713 8.742   -63.196 1.00 125.56 ? 575  HIS A CA    1 
ATOM   4195  C  C     . HIS A 1 575  ? -33.983 7.959   -62.862 1.00 117.70 ? 575  HIS A C     1 
ATOM   4196  O  O     . HIS A 1 575  ? -33.940 7.110   -61.994 1.00 133.00 ? 575  HIS A O     1 
ATOM   4197  C  CB    . HIS A 1 575  ? -31.927 7.807   -64.145 1.00 132.54 ? 575  HIS A CB    1 
ATOM   4198  C  CG    . HIS A 1 575  ? -30.918 8.489   -65.021 1.00 145.58 ? 575  HIS A CG    1 
ATOM   4199  N  ND1   . HIS A 1 575  ? -29.598 8.086   -65.081 1.00 155.62 ? 575  HIS A ND1   1 
ATOM   4200  C  CD2   . HIS A 1 575  ? -31.038 9.510   -65.903 1.00 141.25 ? 575  HIS A CD2   1 
ATOM   4201  C  CE1   . HIS A 1 575  ? -28.945 8.842   -65.944 1.00 150.78 ? 575  HIS A CE1   1 
ATOM   4202  N  NE2   . HIS A 1 575  ? -29.796 9.715   -66.456 1.00 151.27 ? 575  HIS A NE2   1 
ATOM   4203  N  N     . PRO A 1 576  ? -35.086 8.188   -63.587 1.00 117.47 ? 576  PRO A N     1 
ATOM   4204  C  CA    . PRO A 1 576  ? -36.297 7.342   -63.422 1.00 115.72 ? 576  PRO A CA    1 
ATOM   4205  C  C     . PRO A 1 576  ? -36.124 5.873   -63.895 1.00 112.65 ? 576  PRO A C     1 
ATOM   4206  O  O     . PRO A 1 576  ? -36.857 5.010   -63.446 1.00 109.02 ? 576  PRO A O     1 
ATOM   4207  C  CB    . PRO A 1 576  ? -37.364 8.078   -64.247 1.00 111.39 ? 576  PRO A CB    1 
ATOM   4208  C  CG    . PRO A 1 576  ? -36.605 8.899   -65.240 1.00 108.46 ? 576  PRO A CG    1 
ATOM   4209  C  CD    . PRO A 1 576  ? -35.223 9.149   -64.701 1.00 109.85 ? 576  PRO A CD    1 
ATOM   4210  N  N     . GLU A 1 577  ? -35.161 5.610   -64.775 1.00 115.50 ? 577  GLU A N     1 
ATOM   4211  C  CA    . GLU A 1 577  ? -34.826 4.262   -65.242 1.00 113.93 ? 577  GLU A CA    1 
ATOM   4212  C  C     . GLU A 1 577  ? -33.842 3.488   -64.324 1.00 110.68 ? 577  GLU A C     1 
ATOM   4213  O  O     . GLU A 1 577  ? -33.620 2.288   -64.519 1.00 121.45 ? 577  GLU A O     1 
ATOM   4214  C  CB    . GLU A 1 577  ? -34.223 4.341   -66.654 1.00 124.30 ? 577  GLU A CB    1 
ATOM   4215  C  CG    . GLU A 1 577  ? -34.661 5.533   -67.516 1.00 128.09 ? 577  GLU A CG    1 
ATOM   4216  C  CD    . GLU A 1 577  ? -33.715 6.736   -67.429 1.00 138.05 ? 577  GLU A CD    1 
ATOM   4217  O  OE1   . GLU A 1 577  ? -32.488 6.559   -67.210 1.00 124.47 ? 577  GLU A OE1   1 
ATOM   4218  O  OE2   . GLU A 1 577  ? -34.200 7.878   -67.588 1.00 152.97 ? 577  GLU A OE2   1 
ATOM   4219  N  N     . ASP A 1 578  ? -33.274 4.164   -63.313 1.00 101.31 ? 578  ASP A N     1 
ATOM   4220  C  CA    . ASP A 1 578  ? -32.440 3.537   -62.301 1.00 97.89  ? 578  ASP A CA    1 
ATOM   4221  C  C     . ASP A 1 578  ? -33.367 2.950   -61.218 1.00 99.37  ? 578  ASP A C     1 
ATOM   4222  O  O     . ASP A 1 578  ? -34.093 3.684   -60.550 1.00 99.51  ? 578  ASP A O     1 
ATOM   4223  C  CB    . ASP A 1 578  ? -31.455 4.582   -61.762 1.00 99.95  ? 578  ASP A CB    1 
ATOM   4224  C  CG    . ASP A 1 578  ? -30.455 4.015   -60.757 1.00 99.99  ? 578  ASP A CG    1 
ATOM   4225  O  OD1   . ASP A 1 578  ? -30.851 3.366   -59.770 1.00 97.85  ? 578  ASP A OD1   1 
ATOM   4226  O  OD2   . ASP A 1 578  ? -29.249 4.262   -60.933 1.00 95.78  ? 578  ASP A OD2   1 
ATOM   4227  N  N     . PRO A 1 579  ? -33.350 1.618   -61.035 1.00 92.57  ? 579  PRO A N     1 
ATOM   4228  C  CA    . PRO A 1 579  ? -34.260 0.986   -60.076 1.00 84.80  ? 579  PRO A CA    1 
ATOM   4229  C  C     . PRO A 1 579  ? -33.807 0.959   -58.596 1.00 77.38  ? 579  PRO A C     1 
ATOM   4230  O  O     . PRO A 1 579  ? -34.577 0.561   -57.733 1.00 78.68  ? 579  PRO A O     1 
ATOM   4231  C  CB    . PRO A 1 579  ? -34.347 -0.448  -60.588 1.00 89.40  ? 579  PRO A CB    1 
ATOM   4232  C  CG    . PRO A 1 579  ? -33.040 -0.698  -61.247 1.00 92.25  ? 579  PRO A CG    1 
ATOM   4233  C  CD    . PRO A 1 579  ? -32.549 0.627   -61.779 1.00 94.07  ? 579  PRO A CD    1 
ATOM   4234  N  N     . ILE A 1 580  ? -32.595 1.430   -58.320 1.00 76.78  ? 580  ILE A N     1 
ATOM   4235  C  CA    . ILE A 1 580  ? -32.048 1.381   -56.974 1.00 87.27  ? 580  ILE A CA    1 
ATOM   4236  C  C     . ILE A 1 580  ? -32.805 2.402   -56.102 1.00 88.84  ? 580  ILE A C     1 
ATOM   4237  O  O     . ILE A 1 580  ? -32.916 3.576   -56.445 1.00 96.65  ? 580  ILE A O     1 
ATOM   4238  C  CB    . ILE A 1 580  ? -30.516 1.631   -56.939 1.00 98.02  ? 580  ILE A CB    1 
ATOM   4239  C  CG1   . ILE A 1 580  ? -29.767 0.628   -57.829 1.00 95.69  ? 580  ILE A CG1   1 
ATOM   4240  C  CG2   . ILE A 1 580  ? -29.980 1.552   -55.511 1.00 99.67  ? 580  ILE A CG2   1 
ATOM   4241  C  CD1   . ILE A 1 580  ? -29.666 -0.755  -57.243 1.00 95.88  ? 580  ILE A CD1   1 
ATOM   4242  N  N     . GLY A 1 581  ? -33.325 1.902   -54.975 1.00 91.12  ? 581  GLY A N     1 
ATOM   4243  C  CA    . GLY A 1 581  ? -34.148 2.668   -54.063 1.00 91.16  ? 581  GLY A CA    1 
ATOM   4244  C  C     . GLY A 1 581  ? -35.653 2.512   -54.268 1.00 94.26  ? 581  GLY A C     1 
ATOM   4245  O  O     . GLY A 1 581  ? -36.425 2.883   -53.364 1.00 91.75  ? 581  GLY A O     1 
ATOM   4246  N  N     . HIS A 1 582  ? -36.078 1.959   -55.416 1.00 93.52  ? 582  HIS A N     1 
ATOM   4247  C  CA    . HIS A 1 582  ? -37.494 1.794   -55.704 1.00 95.49  ? 582  HIS A CA    1 
ATOM   4248  C  C     . HIS A 1 582  ? -38.023 0.512   -55.080 1.00 94.68  ? 582  HIS A C     1 
ATOM   4249  O  O     . HIS A 1 582  ? -37.320 -0.503  -55.072 1.00 104.49 ? 582  HIS A O     1 
ATOM   4250  C  CB    . HIS A 1 582  ? -37.758 1.697   -57.194 1.00 102.34 ? 582  HIS A CB    1 
ATOM   4251  C  CG    . HIS A 1 582  ? -37.628 2.988   -57.916 1.00 100.43 ? 582  HIS A CG    1 
ATOM   4252  N  ND1   . HIS A 1 582  ? -36.457 3.708   -57.939 1.00 103.17 ? 582  HIS A ND1   1 
ATOM   4253  C  CD2   . HIS A 1 582  ? -38.514 3.673   -58.670 1.00 100.86 ? 582  HIS A CD2   1 
ATOM   4254  C  CE1   . HIS A 1 582  ? -36.629 4.790   -58.672 1.00 109.92 ? 582  HIS A CE1   1 
ATOM   4255  N  NE2   . HIS A 1 582  ? -37.869 4.791   -59.128 1.00 108.80 ? 582  HIS A NE2   1 
ATOM   4256  N  N     . PRO A 1 583  ? -39.287 0.508   -54.618 1.00 89.50  ? 583  PRO A N     1 
ATOM   4257  C  CA    . PRO A 1 583  ? -39.917 -0.709  -54.110 1.00 89.07  ? 583  PRO A CA    1 
ATOM   4258  C  C     . PRO A 1 583  ? -40.346 -1.639  -55.256 1.00 91.73  ? 583  PRO A C     1 
ATOM   4259  O  O     . PRO A 1 583  ? -41.522 -1.865  -55.483 1.00 91.78  ? 583  PRO A O     1 
ATOM   4260  C  CB    . PRO A 1 583  ? -41.114 -0.161  -53.346 1.00 87.83  ? 583  PRO A CB    1 
ATOM   4261  C  CG    . PRO A 1 583  ? -41.540 0.990   -54.178 1.00 92.88  ? 583  PRO A CG    1 
ATOM   4262  C  CD    . PRO A 1 583  ? -40.302 1.544   -54.857 1.00 92.53  ? 583  PRO A CD    1 
ATOM   4263  N  N     . ILE A 1 584  ? -39.355 -2.234  -55.933 1.00 85.90  ? 584  ILE A N     1 
ATOM   4264  C  CA    . ILE A 1 584  ? -39.580 -3.192  -56.998 1.00 82.27  ? 584  ILE A CA    1 
ATOM   4265  C  C     . ILE A 1 584  ? -40.096 -4.506  -56.418 1.00 83.77  ? 584  ILE A C     1 
ATOM   4266  O  O     . ILE A 1 584  ? -39.531 -5.006  -55.452 1.00 78.23  ? 584  ILE A O     1 
ATOM   4267  C  CB    . ILE A 1 584  ? -38.288 -3.525  -57.796 1.00 88.00  ? 584  ILE A CB    1 
ATOM   4268  C  CG1   . ILE A 1 584  ? -37.530 -2.259  -58.222 1.00 85.53  ? 584  ILE A CG1   1 
ATOM   4269  C  CG2   . ILE A 1 584  ? -38.600 -4.428  -59.005 1.00 93.23  ? 584  ILE A CG2   1 
ATOM   4270  C  CD1   . ILE A 1 584  ? -38.264 -1.379  -59.207 1.00 85.99  ? 584  ILE A CD1   1 
ATOM   4271  N  N     . MET A 1 585  ? -41.164 -5.047  -56.997 1.00 91.23  ? 585  MET A N     1 
ATOM   4272  C  CA    . MET A 1 585  ? -41.699 -6.345  -56.598 1.00 87.42  ? 585  MET A CA    1 
ATOM   4273  C  C     . MET A 1 585  ? -40.690 -7.458  -56.779 1.00 82.79  ? 585  MET A C     1 
ATOM   4274  O  O     . MET A 1 585  ? -39.955 -7.437  -57.743 1.00 73.69  ? 585  MET A O     1 
ATOM   4275  C  CB    . MET A 1 585  ? -42.949 -6.700  -57.414 1.00 87.39  ? 585  MET A CB    1 
ATOM   4276  C  CG    . MET A 1 585  ? -43.634 -7.970  -56.933 1.00 93.22  ? 585  MET A CG    1 
ATOM   4277  S  SD    . MET A 1 585  ? -45.002 -8.558  -57.937 1.00 101.88 ? 585  MET A SD    1 
ATOM   4278  C  CE    . MET A 1 585  ? -44.307 -8.359  -59.586 1.00 104.62 ? 585  MET A CE    1 
ATOM   4279  N  N     . HIS A 1 586  ? -40.668 -8.416  -55.840 1.00 85.73  ? 586  HIS A N     1 
ATOM   4280  C  CA    . HIS A 1 586  ? -39.833 -9.623  -55.928 1.00 83.03  ? 586  HIS A CA    1 
ATOM   4281  C  C     . HIS A 1 586  ? -40.050 -10.224 -57.328 1.00 85.07  ? 586  HIS A C     1 
ATOM   4282  O  O     . HIS A 1 586  ? -41.194 -10.337 -57.771 1.00 90.02  ? 586  HIS A O     1 
ATOM   4283  C  CB    . HIS A 1 586  ? -40.295 -10.588 -54.826 1.00 88.52  ? 586  HIS A CB    1 
ATOM   4284  C  CG    . HIS A 1 586  ? -39.381 -11.752 -54.544 1.00 93.98  ? 586  HIS A CG    1 
ATOM   4285  N  ND1   . HIS A 1 586  ? -38.765 -12.498 -55.526 1.00 100.12 ? 586  HIS A ND1   1 
ATOM   4286  C  CD2   . HIS A 1 586  ? -39.072 -12.360 -53.372 1.00 93.72  ? 586  HIS A CD2   1 
ATOM   4287  C  CE1   . HIS A 1 586  ? -38.075 -13.479 -54.973 1.00 99.41  ? 586  HIS A CE1   1 
ATOM   4288  N  NE2   . HIS A 1 586  ? -38.250 -13.420 -53.666 1.00 99.97  ? 586  HIS A NE2   1 
ATOM   4289  N  N     . LEU A 1 587  ? -38.984 -10.608 -58.023 1.00 81.40  ? 587  LEU A N     1 
ATOM   4290  C  CA    . LEU A 1 587  ? -39.083 -11.103 -59.404 1.00 76.51  ? 587  LEU A CA    1 
ATOM   4291  C  C     . LEU A 1 587  ? -39.948 -12.352 -59.545 1.00 84.34  ? 587  LEU A C     1 
ATOM   4292  O  O     . LEU A 1 587  ? -40.654 -12.492 -60.547 1.00 109.97 ? 587  LEU A O     1 
ATOM   4293  C  CB    . LEU A 1 587  ? -37.689 -11.303 -59.947 1.00 71.21  ? 587  LEU A CB    1 
ATOM   4294  C  CG    . LEU A 1 587  ? -36.918 -9.993  -59.836 1.00 66.76  ? 587  LEU A CG    1 
ATOM   4295  C  CD1   . LEU A 1 587  ? -35.509 -10.112 -60.375 1.00 68.64  ? 587  LEU A CD1   1 
ATOM   4296  C  CD2   . LEU A 1 587  ? -37.686 -8.914  -60.583 1.00 71.11  ? 587  LEU A CD2   1 
ATOM   4297  N  N     . SER A 1 588  ? -39.849 -13.261 -58.580 1.00 88.35  ? 588  SER A N     1 
ATOM   4298  C  CA    . SER A 1 588  ? -40.750 -14.415 -58.457 1.00 95.96  ? 588  SER A CA    1 
ATOM   4299  C  C     . SER A 1 588  ? -42.113 -14.194 -57.767 1.00 99.00  ? 588  SER A C     1 
ATOM   4300  O  O     . SER A 1 588  ? -42.918 -15.133 -57.700 1.00 111.84 ? 588  SER A O     1 
ATOM   4301  C  CB    . SER A 1 588  ? -40.015 -15.605 -57.792 1.00 100.74 ? 588  SER A CB    1 
ATOM   4302  O  OG    . SER A 1 588  ? -38.617 -15.369 -57.628 1.00 106.37 ? 588  SER A OG    1 
ATOM   4303  N  N     . GLY A 1 589  ? -42.403 -12.973 -57.328 1.00 90.24  ? 589  GLY A N     1 
ATOM   4304  C  CA    . GLY A 1 589  ? -43.658 -12.664 -56.642 1.00 88.73  ? 589  GLY A CA    1 
ATOM   4305  C  C     . GLY A 1 589  ? -44.910 -13.190 -57.324 1.00 84.75  ? 589  GLY A C     1 
ATOM   4306  O  O     . GLY A 1 589  ? -45.727 -13.843 -56.683 1.00 85.50  ? 589  GLY A O     1 
ATOM   4307  N  N     . VAL A 1 590  ? -45.048 -12.932 -58.625 1.00 80.43  ? 590  VAL A N     1 
ATOM   4308  C  CA    . VAL A 1 590  ? -46.193 -13.435 -59.386 1.00 81.93  ? 590  VAL A CA    1 
ATOM   4309  C  C     . VAL A 1 590  ? -46.120 -14.959 -59.559 1.00 84.95  ? 590  VAL A C     1 
ATOM   4310  O  O     . VAL A 1 590  ? -47.128 -15.649 -59.386 1.00 87.17  ? 590  VAL A O     1 
ATOM   4311  C  CB    . VAL A 1 590  ? -46.393 -12.670 -60.728 1.00 79.20  ? 590  VAL A CB    1 
ATOM   4312  C  CG1   . VAL A 1 590  ? -47.597 -13.218 -61.501 1.00 76.50  ? 590  VAL A CG1   1 
ATOM   4313  C  CG2   . VAL A 1 590  ? -46.590 -11.178 -60.463 1.00 73.49  ? 590  VAL A CG2   1 
ATOM   4314  N  N     . LYS A 1 591  ? -44.939 -15.486 -59.869 1.00 87.33  ? 591  LYS A N     1 
ATOM   4315  C  CA    . LYS A 1 591  ? -44.751 -16.931 -59.913 1.00 83.36  ? 591  LYS A CA    1 
ATOM   4316  C  C     . LYS A 1 591  ? -45.082 -17.614 -58.588 1.00 83.16  ? 591  LYS A C     1 
ATOM   4317  O  O     . LYS A 1 591  ? -45.531 -18.756 -58.599 1.00 91.48  ? 591  LYS A O     1 
ATOM   4318  C  CB    . LYS A 1 591  ? -43.352 -17.279 -60.410 1.00 89.79  ? 591  LYS A CB    1 
ATOM   4319  C  CG    . LYS A 1 591  ? -43.117 -16.823 -61.848 1.00 92.73  ? 591  LYS A CG    1 
ATOM   4320  C  CD    . LYS A 1 591  ? -41.918 -17.491 -62.502 1.00 91.99  ? 591  LYS A CD    1 
ATOM   4321  C  CE    . LYS A 1 591  ? -40.661 -17.326 -61.671 1.00 91.04  ? 591  LYS A CE    1 
ATOM   4322  N  NZ    . LYS A 1 591  ? -40.227 -15.908 -61.639 1.00 96.94  ? 591  LYS A NZ    1 
ATOM   4323  N  N     . HIS A 1 592  ? -44.850 -16.941 -57.464 1.00 87.38  ? 592  HIS A N     1 
ATOM   4324  C  CA    . HIS A 1 592  ? -45.313 -17.453 -56.174 1.00 90.13  ? 592  HIS A CA    1 
ATOM   4325  C  C     . HIS A 1 592  ? -46.835 -17.507 -56.184 1.00 87.45  ? 592  HIS A C     1 
ATOM   4326  O  O     . HIS A 1 592  ? -47.427 -18.531 -55.897 1.00 87.20  ? 592  HIS A O     1 
ATOM   4327  C  CB    . HIS A 1 592  ? -44.800 -16.628 -54.975 1.00 96.27  ? 592  HIS A CB    1 
ATOM   4328  C  CG    . HIS A 1 592  ? -43.304 -16.465 -54.916 1.00 92.28  ? 592  HIS A CG    1 
ATOM   4329  N  ND1   . HIS A 1 592  ? -42.697 -15.257 -54.638 1.00 88.27  ? 592  HIS A ND1   1 
ATOM   4330  C  CD2   . HIS A 1 592  ? -42.299 -17.356 -55.081 1.00 89.72  ? 592  HIS A CD2   1 
ATOM   4331  C  CE1   . HIS A 1 592  ? -41.387 -15.409 -54.633 1.00 88.26  ? 592  HIS A CE1   1 
ATOM   4332  N  NE2   . HIS A 1 592  ? -41.118 -16.674 -54.905 1.00 91.39  ? 592  HIS A NE2   1 
ATOM   4333  N  N     . ALA A 1 593  ? -47.453 -16.395 -56.551 1.00 89.82  ? 593  ALA A N     1 
ATOM   4334  C  CA    . ALA A 1 593  ? -48.900 -16.297 -56.584 1.00 94.82  ? 593  ALA A CA    1 
ATOM   4335  C  C     . ALA A 1 593  ? -49.577 -17.299 -57.525 1.00 89.97  ? 593  ALA A C     1 
ATOM   4336  O  O     . ALA A 1 593  ? -50.651 -17.778 -57.215 1.00 110.22 ? 593  ALA A O     1 
ATOM   4337  C  CB    . ALA A 1 593  ? -49.309 -14.886 -56.961 1.00 104.35 ? 593  ALA A CB    1 
ATOM   4338  N  N     . THR A 1 594  ? -48.961 -17.610 -58.658 1.00 79.26  ? 594  THR A N     1 
ATOM   4339  C  CA    . THR A 1 594  ? -49.553 -18.550 -59.640 1.00 71.84  ? 594  THR A CA    1 
ATOM   4340  C  C     . THR A 1 594  ? -49.138 -20.014 -59.472 1.00 64.48  ? 594  THR A C     1 
ATOM   4341  O  O     . THR A 1 594  ? -49.635 -20.870 -60.187 1.00 65.16  ? 594  THR A O     1 
ATOM   4342  C  CB    . THR A 1 594  ? -49.261 -18.156 -61.106 1.00 79.44  ? 594  THR A CB    1 
ATOM   4343  O  OG1   . THR A 1 594  ? -47.853 -18.130 -61.344 1.00 72.93  ? 594  THR A OG1   1 
ATOM   4344  C  CG2   . THR A 1 594  ? -49.845 -16.776 -61.421 1.00 90.57  ? 594  THR A CG2   1 
ATOM   4345  N  N     . GLY A 1 595  ? -48.213 -20.282 -58.563 1.00 65.20  ? 595  GLY A N     1 
ATOM   4346  C  CA    . GLY A 1 595  ? -47.689 -21.631 -58.361 1.00 66.42  ? 595  GLY A CA    1 
ATOM   4347  C  C     . GLY A 1 595  ? -46.729 -22.111 -59.434 1.00 72.78  ? 595  GLY A C     1 
ATOM   4348  O  O     . GLY A 1 595  ? -46.480 -23.298 -59.558 1.00 79.68  ? 595  GLY A O     1 
ATOM   4349  N  N     . GLU A 1 596  ? -46.196 -21.190 -60.227 1.00 77.14  ? 596  GLU A N     1 
ATOM   4350  C  CA    . GLU A 1 596  ? -45.261 -21.510 -61.312 1.00 75.45  ? 596  GLU A CA    1 
ATOM   4351  C  C     . GLU A 1 596  ? -43.815 -21.513 -60.825 1.00 74.74  ? 596  GLU A C     1 
ATOM   4352  O  O     . GLU A 1 596  ? -42.938 -21.991 -61.534 1.00 92.97  ? 596  GLU A O     1 
ATOM   4353  C  CB    . GLU A 1 596  ? -45.403 -20.494 -62.464 1.00 78.83  ? 596  GLU A CB    1 
ATOM   4354  C  CG    . GLU A 1 596  ? -46.769 -20.545 -63.173 1.00 84.64  ? 596  GLU A CG    1 
ATOM   4355  C  CD    . GLU A 1 596  ? -46.987 -19.465 -64.230 1.00 80.41  ? 596  GLU A CD    1 
ATOM   4356  O  OE1   . GLU A 1 596  ? -46.974 -19.805 -65.437 1.00 79.79  ? 596  GLU A OE1   1 
ATOM   4357  O  OE2   . GLU A 1 596  ? -47.190 -18.287 -63.860 1.00 78.18  ? 596  GLU A OE2   1 
ATOM   4358  N  N     . ALA A 1 597  ? -43.569 -20.998 -59.626 1.00 70.18  ? 597  ALA A N     1 
ATOM   4359  C  CA    . ALA A 1 597  ? -42.254 -21.072 -58.989 1.00 73.25  ? 597  ALA A CA    1 
ATOM   4360  C  C     . ALA A 1 597  ? -41.936 -22.518 -58.613 1.00 80.43  ? 597  ALA A C     1 
ATOM   4361  O  O     . ALA A 1 597  ? -42.707 -23.154 -57.871 1.00 96.38  ? 597  ALA A O     1 
ATOM   4362  C  CB    . ALA A 1 597  ? -42.249 -20.228 -57.736 1.00 75.21  ? 597  ALA A CB    1 
ATOM   4363  N  N     . ILE A 1 598  ? -40.826 -23.041 -59.133 1.00 75.94  ? 598  ILE A N     1 
ATOM   4364  C  CA    . ILE A 1 598  ? -40.396 -24.408 -58.863 1.00 77.75  ? 598  ILE A CA    1 
ATOM   4365  C  C     . ILE A 1 598  ? -39.517 -24.418 -57.616 1.00 76.33  ? 598  ILE A C     1 
ATOM   4366  O  O     . ILE A 1 598  ? -38.477 -23.779 -57.610 1.00 77.57  ? 598  ILE A O     1 
ATOM   4367  C  CB    . ILE A 1 598  ? -39.604 -24.939 -60.057 1.00 79.20  ? 598  ILE A CB    1 
ATOM   4368  C  CG1   . ILE A 1 598  ? -40.501 -25.033 -61.306 1.00 85.05  ? 598  ILE A CG1   1 
ATOM   4369  C  CG2   . ILE A 1 598  ? -38.997 -26.287 -59.722 1.00 85.79  ? 598  ILE A CG2   1 
ATOM   4370  C  CD1   . ILE A 1 598  ? -41.251 -26.351 -61.492 1.00 88.00  ? 598  ILE A CD1   1 
ATOM   4371  N  N     . TYR A 1 599  ? -39.964 -25.098 -56.565 1.00 72.86  ? 599  TYR A N     1 
ATOM   4372  C  CA    . TYR A 1 599  ? -39.147 -25.397 -55.412 1.00 76.56  ? 599  TYR A CA    1 
ATOM   4373  C  C     . TYR A 1 599  ? -38.662 -26.838 -55.552 1.00 79.93  ? 599  TYR A C     1 
ATOM   4374  O  O     . TYR A 1 599  ? -39.189 -27.603 -56.345 1.00 68.55  ? 599  TYR A O     1 
ATOM   4375  C  CB    . TYR A 1 599  ? -39.958 -25.212 -54.129 1.00 80.51  ? 599  TYR A CB    1 
ATOM   4376  C  CG    . TYR A 1 599  ? -40.435 -23.791 -53.911 1.00 82.91  ? 599  TYR A CG    1 
ATOM   4377  C  CD1   . TYR A 1 599  ? -41.480 -23.268 -54.660 1.00 92.11  ? 599  TYR A CD1   1 
ATOM   4378  C  CD2   . TYR A 1 599  ? -39.843 -22.967 -52.968 1.00 78.67  ? 599  TYR A CD2   1 
ATOM   4379  C  CE1   . TYR A 1 599  ? -41.933 -21.970 -54.469 1.00 90.74  ? 599  TYR A CE1   1 
ATOM   4380  C  CE2   . TYR A 1 599  ? -40.284 -21.669 -52.780 1.00 78.38  ? 599  TYR A CE2   1 
ATOM   4381  C  CZ    . TYR A 1 599  ? -41.335 -21.177 -53.526 1.00 80.64  ? 599  TYR A CZ    1 
ATOM   4382  O  OH    . TYR A 1 599  ? -41.797 -19.886 -53.351 1.00 80.77  ? 599  TYR A OH    1 
ATOM   4383  N  N     . CYS A 1 600  ? -37.660 -27.203 -54.766 1.00 87.36  ? 600  CYS A N     1 
ATOM   4384  C  CA    . CYS A 1 600  ? -36.960 -28.456 -54.926 1.00 84.93  ? 600  CYS A CA    1 
ATOM   4385  C  C     . CYS A 1 600  ? -37.831 -29.709 -55.189 1.00 73.32  ? 600  CYS A C     1 
ATOM   4386  O  O     . CYS A 1 600  ? -37.572 -30.454 -56.127 1.00 65.61  ? 600  CYS A O     1 
ATOM   4387  C  CB    . CYS A 1 600  ? -36.128 -28.707 -53.688 1.00 84.45  ? 600  CYS A CB    1 
ATOM   4388  S  SG    . CYS A 1 600  ? -34.812 -29.855 -54.046 1.00 98.02  ? 600  CYS A SG    1 
ATOM   4389  N  N     . ASP A 1 601  ? -38.857 -29.927 -54.368 1.00 70.39  ? 601  ASP A N     1 
ATOM   4390  C  CA    . ASP A 1 601  ? -39.748 -31.092 -54.562 1.00 78.92  ? 601  ASP A CA    1 
ATOM   4391  C  C     . ASP A 1 601  ? -40.745 -30.927 -55.728 1.00 81.38  ? 601  ASP A C     1 
ATOM   4392  O  O     . ASP A 1 601  ? -41.372 -31.909 -56.146 1.00 84.40  ? 601  ASP A O     1 
ATOM   4393  C  CB    . ASP A 1 601  ? -40.451 -31.507 -53.279 1.00 75.03  ? 601  ASP A CB    1 
ATOM   4394  C  CG    . ASP A 1 601  ? -41.416 -32.663 -53.504 1.00 73.30  ? 601  ASP A CG    1 
ATOM   4395  O  OD1   . ASP A 1 601  ? -41.035 -33.651 -54.190 1.00 65.58  ? 601  ASP A OD1   1 
ATOM   4396  O  OD2   . ASP A 1 601  ? -42.563 -32.557 -53.002 1.00 74.99  ? 601  ASP A OD2   1 
ATOM   4397  N  N     . ASP A 1 602  ? -40.877 -29.716 -56.266 1.00 77.05  ? 602  ASP A N     1 
ATOM   4398  C  CA    . ASP A 1 602  ? -41.738 -29.477 -57.418 1.00 84.64  ? 602  ASP A CA    1 
ATOM   4399  C  C     . ASP A 1 602  ? -41.098 -29.938 -58.718 1.00 85.98  ? 602  ASP A C     1 
ATOM   4400  O  O     . ASP A 1 602  ? -41.763 -30.005 -59.748 1.00 99.01  ? 602  ASP A O     1 
ATOM   4401  C  CB    . ASP A 1 602  ? -42.097 -27.986 -57.554 1.00 94.22  ? 602  ASP A CB    1 
ATOM   4402  C  CG    . ASP A 1 602  ? -42.841 -27.425 -56.339 1.00 96.34  ? 602  ASP A CG    1 
ATOM   4403  O  OD1   . ASP A 1 602  ? -43.428 -28.217 -55.562 1.00 97.65  ? 602  ASP A OD1   1 
ATOM   4404  O  OD2   . ASP A 1 602  ? -42.841 -26.177 -56.182 1.00 84.22  ? 602  ASP A OD2   1 
ATOM   4405  N  N     . MET A 1 603  ? -39.800 -30.219 -58.690 1.00 86.05  ? 603  MET A N     1 
ATOM   4406  C  CA    . MET A 1 603  ? -39.128 -30.732 -59.867 1.00 82.97  ? 603  MET A CA    1 
ATOM   4407  C  C     . MET A 1 603  ? -39.786 -32.027 -60.301 1.00 77.12  ? 603  MET A C     1 
ATOM   4408  O  O     . MET A 1 603  ? -40.114 -32.853 -59.457 1.00 78.60  ? 603  MET A O     1 
ATOM   4409  C  CB    . MET A 1 603  ? -37.665 -30.995 -59.547 1.00 88.46  ? 603  MET A CB    1 
ATOM   4410  C  CG    . MET A 1 603  ? -36.803 -29.739 -59.587 1.00 96.77  ? 603  MET A CG    1 
ATOM   4411  S  SD    . MET A 1 603  ? -35.052 -30.105 -59.372 1.00 96.00  ? 603  MET A SD    1 
ATOM   4412  C  CE    . MET A 1 603  ? -35.116 -30.525 -57.640 1.00 100.82 ? 603  MET A CE    1 
ATOM   4413  N  N     . PRO A 1 604  ? -40.001 -32.207 -61.614 1.00 73.34  ? 604  PRO A N     1 
ATOM   4414  C  CA    . PRO A 1 604  ? -40.655 -33.441 -62.067 1.00 68.97  ? 604  PRO A CA    1 
ATOM   4415  C  C     . PRO A 1 604  ? -39.917 -34.723 -61.689 1.00 65.97  ? 604  PRO A C     1 
ATOM   4416  O  O     . PRO A 1 604  ? -38.687 -34.686 -61.494 1.00 75.59  ? 604  PRO A O     1 
ATOM   4417  C  CB    . PRO A 1 604  ? -40.676 -33.292 -63.597 1.00 73.82  ? 604  PRO A CB    1 
ATOM   4418  C  CG    . PRO A 1 604  ? -40.470 -31.840 -63.883 1.00 75.93  ? 604  PRO A CG    1 
ATOM   4419  C  CD    . PRO A 1 604  ? -39.613 -31.338 -62.741 1.00 78.23  ? 604  PRO A CD    1 
ATOM   4420  N  N     . LEU A 1 605  ? -40.668 -35.823 -61.581 1.00 62.92  ? 605  LEU A N     1 
ATOM   4421  C  CA    . LEU A 1 605  ? -40.086 -37.137 -61.284 1.00 72.22  ? 605  LEU A CA    1 
ATOM   4422  C  C     . LEU A 1 605  ? -39.095 -37.472 -62.408 1.00 70.73  ? 605  LEU A C     1 
ATOM   4423  O  O     . LEU A 1 605  ? -39.429 -37.412 -63.609 1.00 63.91  ? 605  LEU A O     1 
ATOM   4424  C  CB    . LEU A 1 605  ? -41.161 -38.200 -61.092 1.00 80.71  ? 605  LEU A CB    1 
ATOM   4425  C  CG    . LEU A 1 605  ? -40.632 -39.645 -61.151 1.00 91.53  ? 605  LEU A CG    1 
ATOM   4426  C  CD1   . LEU A 1 605  ? -41.360 -40.491 -60.115 1.00 88.53  ? 605  LEU A CD1   1 
ATOM   4427  C  CD2   . LEU A 1 605  ? -40.705 -40.279 -62.562 1.00 94.70  ? 605  LEU A CD2   1 
ATOM   4428  N  N     . VAL A 1 606  ? -37.860 -37.780 -62.006 1.00 69.19  ? 606  VAL A N     1 
ATOM   4429  C  CA    . VAL A 1 606  ? -36.850 -38.163 -62.995 1.00 67.31  ? 606  VAL A CA    1 
ATOM   4430  C  C     . VAL A 1 606  ? -36.907 -39.665 -63.110 1.00 65.76  ? 606  VAL A C     1 
ATOM   4431  O  O     . VAL A 1 606  ? -37.148 -40.363 -62.132 1.00 65.00  ? 606  VAL A O     1 
ATOM   4432  C  CB    . VAL A 1 606  ? -35.409 -37.659 -62.750 1.00 63.85  ? 606  VAL A CB    1 
ATOM   4433  C  CG1   . VAL A 1 606  ? -35.442 -36.227 -62.237 1.00 71.47  ? 606  VAL A CG1   1 
ATOM   4434  C  CG2   . VAL A 1 606  ? -34.638 -38.548 -61.814 1.00 56.79  ? 606  VAL A CG2   1 
ATOM   4435  N  N     . ASP A 1 607  ? -36.698 -40.145 -64.330 1.00 73.08  ? 607  ASP A N     1 
ATOM   4436  C  CA    . ASP A 1 607  ? -36.863 -41.576 -64.694 1.00 78.47  ? 607  ASP A CA    1 
ATOM   4437  C  C     . ASP A 1 607  ? -36.293 -42.530 -63.651 1.00 78.21  ? 607  ASP A C     1 
ATOM   4438  O  O     . ASP A 1 607  ? -35.110 -42.444 -63.320 1.00 78.62  ? 607  ASP A O     1 
ATOM   4439  C  CB    . ASP A 1 607  ? -36.185 -41.862 -66.046 1.00 81.92  ? 607  ASP A CB    1 
ATOM   4440  C  CG    . ASP A 1 607  ? -36.739 -43.090 -66.734 1.00 79.05  ? 607  ASP A CG    1 
ATOM   4441  O  OD1   . ASP A 1 607  ? -37.721 -43.619 -66.209 1.00 84.87  ? 607  ASP A OD1   1 
ATOM   4442  O  OD2   . ASP A 1 607  ? -36.212 -43.526 -67.789 1.00 76.66  ? 607  ASP A OD2   1 
ATOM   4443  N  N     . GLN A 1 608  ? -37.152 -43.399 -63.110 1.00 83.54  ? 608  GLN A N     1 
ATOM   4444  C  CA    . GLN A 1 608  ? -36.771 -44.436 -62.123 1.00 90.69  ? 608  GLN A CA    1 
ATOM   4445  C  C     . GLN A 1 608  ? -36.186 -43.951 -60.802 1.00 81.38  ? 608  GLN A C     1 
ATOM   4446  O  O     . GLN A 1 608  ? -35.434 -44.698 -60.166 1.00 84.28  ? 608  GLN A O     1 
ATOM   4447  C  CB    . GLN A 1 608  ? -35.750 -45.410 -62.707 1.00 94.03  ? 608  GLN A CB    1 
ATOM   4448  C  CG    . GLN A 1 608  ? -36.124 -46.026 -64.035 1.00 93.16  ? 608  GLN A CG    1 
ATOM   4449  C  CD    . GLN A 1 608  ? -35.025 -46.930 -64.486 1.00 90.87  ? 608  GLN A CD    1 
ATOM   4450  O  OE1   . GLN A 1 608  ? -33.948 -46.467 -64.884 1.00 84.53  ? 608  GLN A OE1   1 
ATOM   4451  N  NE2   . GLN A 1 608  ? -35.258 -48.228 -64.375 1.00 92.69  ? 608  GLN A NE2   1 
ATOM   4452  N  N     . GLU A 1 609  ? -36.518 -42.732 -60.373 1.00 80.72  ? 609  GLU A N     1 
ATOM   4453  C  CA    . GLU A 1 609  ? -35.995 -42.253 -59.093 1.00 82.34  ? 609  GLU A CA    1 
ATOM   4454  C  C     . GLU A 1 609  ? -36.598 -43.037 -57.938 1.00 78.84  ? 609  GLU A C     1 
ATOM   4455  O  O     . GLU A 1 609  ? -37.723 -43.546 -58.019 1.00 76.47  ? 609  GLU A O     1 
ATOM   4456  C  CB    . GLU A 1 609  ? -36.112 -40.737 -58.838 1.00 85.16  ? 609  GLU A CB    1 
ATOM   4457  C  CG    . GLU A 1 609  ? -37.529 -40.187 -58.865 1.00 95.69  ? 609  GLU A CG    1 
ATOM   4458  C  CD    . GLU A 1 609  ? -37.625 -38.738 -58.429 1.00 101.70 ? 609  GLU A CD    1 
ATOM   4459  O  OE1   . GLU A 1 609  ? -37.328 -37.804 -59.245 1.00 98.18  ? 609  GLU A OE1   1 
ATOM   4460  O  OE2   . GLU A 1 609  ? -38.028 -38.560 -57.253 1.00 100.13 ? 609  GLU A OE2   1 
ATOM   4461  N  N     . LEU A 1 610  ? -35.805 -43.131 -56.881 1.00 79.33  ? 610  LEU A N     1 
ATOM   4462  C  CA    . LEU A 1 610  ? -36.175 -43.781 -55.647 1.00 83.73  ? 610  LEU A CA    1 
ATOM   4463  C  C     . LEU A 1 610  ? -36.442 -42.717 -54.607 1.00 76.07  ? 610  LEU A C     1 
ATOM   4464  O  O     . LEU A 1 610  ? -36.094 -41.567 -54.788 1.00 92.33  ? 610  LEU A O     1 
ATOM   4465  C  CB    . LEU A 1 610  ? -35.035 -44.672 -55.151 1.00 89.24  ? 610  LEU A CB    1 
ATOM   4466  C  CG    . LEU A 1 610  ? -34.499 -45.737 -56.116 1.00 92.82  ? 610  LEU A CG    1 
ATOM   4467  C  CD1   . LEU A 1 610  ? -33.673 -46.741 -55.320 1.00 91.54  ? 610  LEU A CD1   1 
ATOM   4468  C  CD2   . LEU A 1 610  ? -35.605 -46.451 -56.892 1.00 93.82  ? 610  LEU A CD2   1 
ATOM   4469  N  N     . PHE A 1 611  ? -37.058 -43.125 -53.516 1.00 69.37  ? 611  PHE A N     1 
ATOM   4470  C  CA    . PHE A 1 611  ? -37.284 -42.261 -52.371 1.00 66.98  ? 611  PHE A CA    1 
ATOM   4471  C  C     . PHE A 1 611  ? -36.524 -42.780 -51.157 1.00 63.50  ? 611  PHE A C     1 
ATOM   4472  O  O     . PHE A 1 611  ? -36.447 -43.992 -50.910 1.00 58.37  ? 611  PHE A O     1 
ATOM   4473  C  CB    . PHE A 1 611  ? -38.765 -42.123 -52.013 1.00 67.43  ? 611  PHE A CB    1 
ATOM   4474  C  CG    . PHE A 1 611  ? -39.077 -40.924 -51.150 1.00 68.50  ? 611  PHE A CG    1 
ATOM   4475  C  CD1   . PHE A 1 611  ? -39.285 -39.672 -51.721 1.00 69.75  ? 611  PHE A CD1   1 
ATOM   4476  C  CD2   . PHE A 1 611  ? -39.175 -41.043 -49.766 1.00 73.33  ? 611  PHE A CD2   1 
ATOM   4477  C  CE1   . PHE A 1 611  ? -39.583 -38.562 -50.932 1.00 69.34  ? 611  PHE A CE1   1 
ATOM   4478  C  CE2   . PHE A 1 611  ? -39.476 -39.937 -48.971 1.00 72.89  ? 611  PHE A CE2   1 
ATOM   4479  C  CZ    . PHE A 1 611  ? -39.688 -38.696 -49.557 1.00 68.69  ? 611  PHE A CZ    1 
ATOM   4480  N  N     . LEU A 1 612  ? -35.980 -41.846 -50.398 1.00 60.39  ? 612  LEU A N     1 
ATOM   4481  C  CA    . LEU A 1 612  ? -35.265 -42.149 -49.168 1.00 65.58  ? 612  LEU A CA    1 
ATOM   4482  C  C     . LEU A 1 612  ? -36.014 -41.561 -47.981 1.00 65.65  ? 612  LEU A C     1 
ATOM   4483  O  O     . LEU A 1 612  ? -36.405 -40.391 -48.000 1.00 63.14  ? 612  LEU A O     1 
ATOM   4484  C  CB    . LEU A 1 612  ? -33.893 -41.491 -49.208 1.00 72.03  ? 612  LEU A CB    1 
ATOM   4485  C  CG    . LEU A 1 612  ? -33.036 -41.832 -47.985 1.00 79.90  ? 612  LEU A CG    1 
ATOM   4486  C  CD1   . LEU A 1 612  ? -32.501 -43.262 -48.092 1.00 82.45  ? 612  LEU A CD1   1 
ATOM   4487  C  CD2   . LEU A 1 612  ? -31.910 -40.822 -47.818 1.00 79.74  ? 612  LEU A CD2   1 
ATOM   4488  N  N     . THR A 1 613  ? -36.157 -42.382 -46.936 1.00 73.27  ? 613  THR A N     1 
ATOM   4489  C  CA    . THR A 1 613  ? -36.702 -41.959 -45.644 1.00 84.20  ? 613  THR A CA    1 
ATOM   4490  C  C     . THR A 1 613  ? -35.868 -42.577 -44.496 1.00 80.53  ? 613  THR A C     1 
ATOM   4491  O  O     . THR A 1 613  ? -35.262 -43.648 -44.642 1.00 82.80  ? 613  THR A O     1 
ATOM   4492  C  CB    . THR A 1 613  ? -38.189 -42.363 -45.483 1.00 94.62  ? 613  THR A CB    1 
ATOM   4493  O  OG1   . THR A 1 613  ? -38.864 -41.451 -44.595 1.00 104.51 ? 613  THR A OG1   1 
ATOM   4494  C  CG2   . THR A 1 613  ? -38.318 -43.797 -44.940 1.00 95.22  ? 613  THR A CG2   1 
ATOM   4495  N  N     . PHE A 1 614  ? -35.876 -41.902 -43.350 1.00 81.70  ? 614  PHE A N     1 
ATOM   4496  C  CA    . PHE A 1 614  ? -34.974 -42.224 -42.242 1.00 80.62  ? 614  PHE A CA    1 
ATOM   4497  C  C     . PHE A 1 614  ? -35.739 -42.932 -41.104 1.00 81.21  ? 614  PHE A C     1 
ATOM   4498  O  O     . PHE A 1 614  ? -36.889 -42.621 -40.832 1.00 83.14  ? 614  PHE A O     1 
ATOM   4499  C  CB    . PHE A 1 614  ? -34.275 -40.931 -41.769 1.00 74.67  ? 614  PHE A CB    1 
ATOM   4500  C  CG    . PHE A 1 614  ? -33.257 -40.397 -42.751 1.00 78.77  ? 614  PHE A CG    1 
ATOM   4501  C  CD1   . PHE A 1 614  ? -31.986 -40.973 -42.856 1.00 81.49  ? 614  PHE A CD1   1 
ATOM   4502  C  CD2   . PHE A 1 614  ? -33.559 -39.324 -43.590 1.00 82.33  ? 614  PHE A CD2   1 
ATOM   4503  C  CE1   . PHE A 1 614  ? -31.044 -40.481 -43.759 1.00 77.60  ? 614  PHE A CE1   1 
ATOM   4504  C  CE2   . PHE A 1 614  ? -32.620 -38.834 -44.508 1.00 75.08  ? 614  PHE A CE2   1 
ATOM   4505  C  CZ    . PHE A 1 614  ? -31.366 -39.415 -44.593 1.00 75.03  ? 614  PHE A CZ    1 
ATOM   4506  N  N     . VAL A 1 615  ? -35.087 -43.891 -40.453 1.00 76.10  ? 615  VAL A N     1 
ATOM   4507  C  CA    . VAL A 1 615  ? -35.481 -44.309 -39.122 1.00 82.41  ? 615  VAL A CA    1 
ATOM   4508  C  C     . VAL A 1 615  ? -34.660 -43.452 -38.158 1.00 88.73  ? 615  VAL A C     1 
ATOM   4509  O  O     . VAL A 1 615  ? -33.429 -43.380 -38.269 1.00 95.20  ? 615  VAL A O     1 
ATOM   4510  C  CB    . VAL A 1 615  ? -35.316 -45.815 -38.888 1.00 90.70  ? 615  VAL A CB    1 
ATOM   4511  C  CG1   . VAL A 1 615  ? -35.805 -46.180 -37.489 1.00 90.39  ? 615  VAL A CG1   1 
ATOM   4512  C  CG2   . VAL A 1 615  ? -36.077 -46.598 -39.956 1.00 90.11  ? 615  VAL A CG2   1 
ATOM   4513  N  N     . THR A 1 616  ? -35.344 -42.771 -37.229 1.00 96.90  ? 616  THR A N     1 
ATOM   4514  C  CA    . THR A 1 616  ? -34.665 -41.892 -36.263 1.00 90.68  ? 616  THR A CA    1 
ATOM   4515  C  C     . THR A 1 616  ? -34.695 -42.480 -34.851 1.00 87.48  ? 616  THR A C     1 
ATOM   4516  O  O     . THR A 1 616  ? -35.567 -43.295 -34.528 1.00 70.65  ? 616  THR A O     1 
ATOM   4517  C  CB    . THR A 1 616  ? -35.285 -40.498 -36.155 1.00 82.60  ? 616  THR A CB    1 
ATOM   4518  O  OG1   . THR A 1 616  ? -36.573 -40.601 -35.531 1.00 86.42  ? 616  THR A OG1   1 
ATOM   4519  C  CG2   . THR A 1 616  ? -35.383 -39.860 -37.507 1.00 77.19  ? 616  THR A CG2   1 
ATOM   4520  N  N     . SER A 1 617  ? -33.747 -42.057 -34.020 1.00 88.34  ? 617  SER A N     1 
ATOM   4521  C  CA    . SER A 1 617  ? -33.669 -42.547 -32.655 1.00 87.96  ? 617  SER A CA    1 
ATOM   4522  C  C     . SER A 1 617  ? -34.909 -42.144 -31.865 1.00 91.93  ? 617  SER A C     1 
ATOM   4523  O  O     . SER A 1 617  ? -35.426 -41.024 -32.036 1.00 88.85  ? 617  SER A O     1 
ATOM   4524  C  CB    . SER A 1 617  ? -32.451 -42.045 -31.917 1.00 91.49  ? 617  SER A CB    1 
ATOM   4525  O  OG    . SER A 1 617  ? -32.545 -42.496 -30.575 1.00 96.82  ? 617  SER A OG    1 
ATOM   4526  N  N     . SER A 1 618  ? -35.388 -43.079 -31.041 1.00 96.42  ? 618  SER A N     1 
ATOM   4527  C  CA    . SER A 1 618  ? -36.534 -42.848 -30.161 1.00 90.41  ? 618  SER A CA    1 
ATOM   4528  C  C     . SER A 1 618  ? -36.126 -42.687 -28.689 1.00 87.16  ? 618  SER A C     1 
ATOM   4529  O  O     . SER A 1 618  ? -36.976 -42.419 -27.836 1.00 88.21  ? 618  SER A O     1 
ATOM   4530  C  CB    . SER A 1 618  ? -37.500 -44.024 -30.277 1.00 85.75  ? 618  SER A CB    1 
ATOM   4531  O  OG    . SER A 1 618  ? -36.781 -45.246 -30.284 1.00 80.84  ? 618  SER A OG    1 
ATOM   4532  N  N     . ARG A 1 619  ? -34.830 -42.825 -28.404 1.00 83.52  ? 619  ARG A N     1 
ATOM   4533  C  CA    . ARG A 1 619  ? -34.287 -42.627 -27.053 1.00 86.21  ? 619  ARG A CA    1 
ATOM   4534  C  C     . ARG A 1 619  ? -33.308 -41.465 -27.065 1.00 82.22  ? 619  ARG A C     1 
ATOM   4535  O  O     . ARG A 1 619  ? -32.664 -41.194 -28.084 1.00 79.08  ? 619  ARG A O     1 
ATOM   4536  C  CB    . ARG A 1 619  ? -33.604 -43.895 -26.584 1.00 91.06  ? 619  ARG A CB    1 
ATOM   4537  C  CG    . ARG A 1 619  ? -34.425 -45.155 -26.817 1.00 88.68  ? 619  ARG A CG    1 
ATOM   4538  C  CD    . ARG A 1 619  ? -35.743 -45.134 -26.063 1.00 82.91  ? 619  ARG A CD    1 
ATOM   4539  N  NE    . ARG A 1 619  ? -36.137 -46.488 -25.683 1.00 83.78  ? 619  ARG A NE    1 
ATOM   4540  C  CZ    . ARG A 1 619  ? -35.587 -47.186 -24.689 1.00 87.80  ? 619  ARG A CZ    1 
ATOM   4541  N  NH1   . ARG A 1 619  ? -34.608 -46.667 -23.962 1.00 88.63  ? 619  ARG A NH1   1 
ATOM   4542  N  NH2   . ARG A 1 619  ? -36.010 -48.421 -24.419 1.00 91.61  ? 619  ARG A NH2   1 
ATOM   4543  N  N     . ALA A 1 620  ? -33.180 -40.796 -25.919 1.00 84.34  ? 620  ALA A N     1 
ATOM   4544  C  CA    . ALA A 1 620  ? -32.294 -39.620 -25.772 1.00 94.75  ? 620  ALA A CA    1 
ATOM   4545  C  C     . ALA A 1 620  ? -30.824 -39.972 -25.478 1.00 99.74  ? 620  ALA A C     1 
ATOM   4546  O  O     . ALA A 1 620  ? -29.918 -39.282 -25.927 1.00 86.24  ? 620  ALA A O     1 
ATOM   4547  C  CB    . ALA A 1 620  ? -32.820 -38.681 -24.704 1.00 93.18  ? 620  ALA A CB    1 
ATOM   4548  N  N     . HIS A 1 621  ? -30.590 -41.034 -24.703 1.00 100.85 ? 621  HIS A N     1 
ATOM   4549  C  CA    . HIS A 1 621  ? -29.235 -41.539 -24.499 1.00 102.35 ? 621  HIS A CA    1 
ATOM   4550  C  C     . HIS A 1 621  ? -29.310 -43.033 -24.162 1.00 96.51  ? 621  HIS A C     1 
ATOM   4551  O  O     . HIS A 1 621  ? -29.576 -43.427 -23.007 1.00 101.76 ? 621  HIS A O     1 
ATOM   4552  C  CB    . HIS A 1 621  ? -28.550 -40.706 -23.396 1.00 109.09 ? 621  HIS A CB    1 
ATOM   4553  C  CG    . HIS A 1 621  ? -27.070 -40.938 -23.246 1.00 113.65 ? 621  HIS A CG    1 
ATOM   4554  N  ND1   . HIS A 1 621  ? -26.340 -41.779 -24.063 1.00 108.38 ? 621  HIS A ND1   1 
ATOM   4555  C  CD2   . HIS A 1 621  ? -26.180 -40.399 -22.376 1.00 114.27 ? 621  HIS A CD2   1 
ATOM   4556  C  CE1   . HIS A 1 621  ? -25.072 -41.760 -23.693 1.00 109.78 ? 621  HIS A CE1   1 
ATOM   4557  N  NE2   . HIS A 1 621  ? -24.948 -40.926 -22.676 1.00 121.46 ? 621  HIS A NE2   1 
ATOM   4558  N  N     . ALA A 1 622  ? -29.077 -43.867 -25.187 1.00 84.06  ? 622  ALA A N     1 
ATOM   4559  C  CA    . ALA A 1 622  ? -29.167 -45.301 -25.047 1.00 82.61  ? 622  ALA A CA    1 
ATOM   4560  C  C     . ALA A 1 622  ? -28.175 -46.046 -25.946 1.00 89.56  ? 622  ALA A C     1 
ATOM   4561  O  O     . ALA A 1 622  ? -27.724 -45.542 -26.976 1.00 93.90  ? 622  ALA A O     1 
ATOM   4562  C  CB    . ALA A 1 622  ? -30.583 -45.749 -25.345 1.00 77.38  ? 622  ALA A CB    1 
ATOM   4563  N  N     . LYS A 1 623  ? -27.836 -47.255 -25.510 1.00 96.46  ? 623  LYS A N     1 
ATOM   4564  C  CA    . LYS A 1 623  ? -27.034 -48.184 -26.294 1.00 100.37 ? 623  LYS A CA    1 
ATOM   4565  C  C     . LYS A 1 623  ? -27.963 -48.841 -27.340 1.00 98.06  ? 623  LYS A C     1 
ATOM   4566  O  O     . LYS A 1 623  ? -29.141 -49.110 -27.072 1.00 97.27  ? 623  LYS A O     1 
ATOM   4567  C  CB    . LYS A 1 623  ? -26.303 -49.140 -25.310 1.00 105.86 ? 623  LYS A CB    1 
ATOM   4568  C  CG    . LYS A 1 623  ? -25.774 -50.468 -25.833 1.00 111.96 ? 623  LYS A CG    1 
ATOM   4569  C  CD    . LYS A 1 623  ? -24.391 -50.373 -26.448 1.00 113.44 ? 623  LYS A CD    1 
ATOM   4570  C  CE    . LYS A 1 623  ? -23.976 -51.725 -27.014 1.00 115.38 ? 623  LYS A CE    1 
ATOM   4571  N  NZ    . LYS A 1 623  ? -23.261 -51.580 -28.310 1.00 117.05 ? 623  LYS A NZ    1 
ATOM   4572  N  N     . ILE A 1 624  ? -27.440 -49.022 -28.553 1.00 98.46  ? 624  ILE A N     1 
ATOM   4573  C  CA    . ILE A 1 624  ? -28.141 -49.746 -29.608 1.00 92.96  ? 624  ILE A CA    1 
ATOM   4574  C  C     . ILE A 1 624  ? -27.704 -51.180 -29.495 1.00 91.81  ? 624  ILE A C     1 
ATOM   4575  O  O     . ILE A 1 624  ? -26.599 -51.521 -29.913 1.00 97.57  ? 624  ILE A O     1 
ATOM   4576  C  CB    . ILE A 1 624  ? -27.759 -49.251 -31.039 1.00 94.19  ? 624  ILE A CB    1 
ATOM   4577  C  CG1   . ILE A 1 624  ? -28.304 -47.841 -31.310 1.00 86.24  ? 624  ILE A CG1   1 
ATOM   4578  C  CG2   . ILE A 1 624  ? -28.269 -50.214 -32.111 1.00 94.34  ? 624  ILE A CG2   1 
ATOM   4579  C  CD1   . ILE A 1 624  ? -27.748 -47.203 -32.555 1.00 78.92  ? 624  ILE A CD1   1 
ATOM   4580  N  N     . VAL A 1 625  ? -28.544 -52.023 -28.916 1.00 99.25  ? 625  VAL A N     1 
ATOM   4581  C  CA    . VAL A 1 625  ? -28.166 -53.448 -28.743 1.00 109.12 ? 625  VAL A CA    1 
ATOM   4582  C  C     . VAL A 1 625  ? -28.264 -54.172 -30.085 1.00 107.00 ? 625  VAL A C     1 
ATOM   4583  O  O     . VAL A 1 625  ? -27.415 -54.972 -30.416 1.00 107.19 ? 625  VAL A O     1 
ATOM   4584  C  CB    . VAL A 1 625  ? -28.939 -54.221 -27.629 1.00 105.97 ? 625  VAL A CB    1 
ATOM   4585  C  CG1   . VAL A 1 625  ? -28.836 -53.509 -26.287 1.00 111.16 ? 625  VAL A CG1   1 
ATOM   4586  C  CG2   . VAL A 1 625  ? -30.394 -54.435 -27.990 1.00 110.14 ? 625  VAL A CG2   1 
ATOM   4587  N  N     . SER A 1 626  ? -29.297 -53.868 -30.873 1.00 100.17 ? 626  SER A N     1 
ATOM   4588  C  CA    . SER A 1 626  ? -29.597 -54.613 -32.112 1.00 98.51  ? 626  SER A CA    1 
ATOM   4589  C  C     . SER A 1 626  ? -30.477 -53.837 -33.087 1.00 101.08 ? 626  SER A C     1 
ATOM   4590  O  O     . SER A 1 626  ? -31.305 -53.014 -32.640 1.00 119.18 ? 626  SER A O     1 
ATOM   4591  C  CB    . SER A 1 626  ? -30.376 -55.901 -31.774 1.00 103.43 ? 626  SER A CB    1 
ATOM   4592  O  OG    . SER A 1 626  ? -31.796 -55.692 -31.693 1.00 88.64  ? 626  SER A OG    1 
ATOM   4593  N  N     . ILE A 1 627  ? -30.339 -54.130 -34.379 1.00 90.10  ? 627  ILE A N     1 
ATOM   4594  C  CA    . ILE A 1 627  ? -31.258 -53.633 -35.397 1.00 86.49  ? 627  ILE A CA    1 
ATOM   4595  C  C     . ILE A 1 627  ? -31.695 -54.818 -36.253 1.00 94.89  ? 627  ILE A C     1 
ATOM   4596  O  O     . ILE A 1 627  ? -30.849 -55.528 -36.802 1.00 99.56  ? 627  ILE A O     1 
ATOM   4597  C  CB    . ILE A 1 627  ? -30.610 -52.489 -36.205 1.00 90.14  ? 627  ILE A CB    1 
ATOM   4598  C  CG1   . ILE A 1 627  ? -30.182 -51.353 -35.266 1.00 84.19  ? 627  ILE A CG1   1 
ATOM   4599  C  CG2   . ILE A 1 627  ? -31.569 -51.941 -37.259 1.00 87.93  ? 627  ILE A CG2   1 
ATOM   4600  C  CD1   . ILE A 1 627  ? -29.250 -50.351 -35.897 1.00 79.65  ? 627  ILE A CD1   1 
ATOM   4601  N  N     . ASP A 1 628  ? -33.007 -55.049 -36.333 1.00 97.09  ? 628  ASP A N     1 
ATOM   4602  C  CA    . ASP A 1 628  ? -33.585 -56.080 -37.193 1.00 96.81  ? 628  ASP A CA    1 
ATOM   4603  C  C     . ASP A 1 628  ? -34.220 -55.428 -38.423 1.00 93.02  ? 628  ASP A C     1 
ATOM   4604  O  O     . ASP A 1 628  ? -35.172 -54.645 -38.305 1.00 91.50  ? 628  ASP A O     1 
ATOM   4605  C  CB    . ASP A 1 628  ? -34.631 -56.886 -36.400 1.00 106.20 ? 628  ASP A CB    1 
ATOM   4606  C  CG    . ASP A 1 628  ? -34.838 -58.302 -36.937 1.00 114.78 ? 628  ASP A CG    1 
ATOM   4607  O  OD1   . ASP A 1 628  ? -33.901 -58.870 -37.542 1.00 135.61 ? 628  ASP A OD1   1 
ATOM   4608  O  OD2   . ASP A 1 628  ? -35.942 -58.856 -36.736 1.00 105.51 ? 628  ASP A OD2   1 
ATOM   4609  N  N     . LEU A 1 629  ? -33.677 -55.732 -39.599 1.00 93.09  ? 629  LEU A N     1 
ATOM   4610  C  CA    . LEU A 1 629  ? -34.157 -55.178 -40.858 1.00 93.74  ? 629  LEU A CA    1 
ATOM   4611  C  C     . LEU A 1 629  ? -34.898 -56.200 -41.723 1.00 96.29  ? 629  LEU A C     1 
ATOM   4612  O  O     . LEU A 1 629  ? -35.388 -55.866 -42.797 1.00 93.52  ? 629  LEU A O     1 
ATOM   4613  C  CB    . LEU A 1 629  ? -32.966 -54.652 -41.654 1.00 88.66  ? 629  LEU A CB    1 
ATOM   4614  C  CG    . LEU A 1 629  ? -32.136 -53.589 -40.936 1.00 89.38  ? 629  LEU A CG    1 
ATOM   4615  C  CD1   . LEU A 1 629  ? -31.079 -53.006 -41.858 1.00 84.72  ? 629  LEU A CD1   1 
ATOM   4616  C  CD2   . LEU A 1 629  ? -33.040 -52.483 -40.409 1.00 93.84  ? 629  LEU A CD2   1 
ATOM   4617  N  N     . SER A 1 630  ? -34.981 -57.443 -41.242 1.00 92.72  ? 630  SER A N     1 
ATOM   4618  C  CA    . SER A 1 630  ? -35.417 -58.579 -42.054 1.00 91.11  ? 630  SER A CA    1 
ATOM   4619  C  C     . SER A 1 630  ? -36.855 -58.445 -42.552 1.00 85.79  ? 630  SER A C     1 
ATOM   4620  O  O     . SER A 1 630  ? -37.134 -58.758 -43.701 1.00 77.14  ? 630  SER A O     1 
ATOM   4621  C  CB    . SER A 1 630  ? -35.378 -59.804 -41.172 1.00 102.29 ? 630  SER A CB    1 
ATOM   4622  O  OG    . SER A 1 630  ? -36.297 -59.616 -40.101 1.00 118.34 ? 630  SER A OG    1 
ATOM   4623  N  N     . GLU A 1 631  ? -37.757 -57.988 -41.680 1.00 84.59  ? 631  GLU A N     1 
ATOM   4624  C  CA    . GLU A 1 631  ? -39.136 -57.726 -42.049 1.00 94.39  ? 631  GLU A CA    1 
ATOM   4625  C  C     . GLU A 1 631  ? -39.248 -56.534 -43.009 1.00 91.67  ? 631  GLU A C     1 
ATOM   4626  O  O     . GLU A 1 631  ? -39.900 -56.606 -44.057 1.00 91.66  ? 631  GLU A O     1 
ATOM   4627  C  CB    . GLU A 1 631  ? -39.937 -57.466 -40.770 1.00 94.85  ? 631  GLU A CB    1 
ATOM   4628  C  CG    . GLU A 1 631  ? -41.428 -57.268 -41.026 1.00 108.22 ? 631  GLU A CG    1 
ATOM   4629  C  CD    . GLU A 1 631  ? -42.287 -57.499 -39.799 1.00 114.80 ? 631  GLU A CD    1 
ATOM   4630  O  OE1   . GLU A 1 631  ? -41.705 -57.829 -38.744 1.00 127.58 ? 631  GLU A OE1   1 
ATOM   4631  O  OE2   . GLU A 1 631  ? -43.535 -57.353 -39.896 1.00 112.47 ? 631  GLU A OE2   1 
ATOM   4632  N  N     . ALA A 1 632  ? -38.598 -55.440 -42.631 1.00 97.84  ? 632  ALA A N     1 
ATOM   4633  C  CA    . ALA A 1 632  ? -38.570 -54.225 -43.462 1.00 92.70  ? 632  ALA A CA    1 
ATOM   4634  C  C     . ALA A 1 632  ? -38.004 -54.488 -44.851 1.00 87.05  ? 632  ALA A C     1 
ATOM   4635  O  O     . ALA A 1 632  ? -38.558 -54.019 -45.838 1.00 83.74  ? 632  ALA A O     1 
ATOM   4636  C  CB    . ALA A 1 632  ? -37.767 -53.120 -42.785 1.00 95.69  ? 632  ALA A CB    1 
ATOM   4637  N  N     . LEU A 1 633  ? -36.913 -55.244 -44.927 1.00 89.87  ? 633  LEU A N     1 
ATOM   4638  C  CA    . LEU A 1 633  ? -36.250 -55.532 -46.210 1.00 90.15  ? 633  LEU A CA    1 
ATOM   4639  C  C     . LEU A 1 633  ? -37.063 -56.369 -47.186 1.00 86.22  ? 633  LEU A C     1 
ATOM   4640  O  O     . LEU A 1 633  ? -36.837 -56.309 -48.390 1.00 88.51  ? 633  LEU A O     1 
ATOM   4641  C  CB    . LEU A 1 633  ? -34.965 -56.316 -45.944 1.00 86.49  ? 633  LEU A CB    1 
ATOM   4642  C  CG    . LEU A 1 633  ? -33.659 -55.558 -45.909 1.00 80.76  ? 633  LEU A CG    1 
ATOM   4643  C  CD1   . LEU A 1 633  ? -32.600 -56.527 -45.413 1.00 79.30  ? 633  LEU A CD1   1 
ATOM   4644  C  CD2   . LEU A 1 633  ? -33.332 -55.010 -47.295 1.00 84.07  ? 633  LEU A CD2   1 
ATOM   4645  N  N     . SER A 1 634  ? -37.986 -57.166 -46.661 1.00 91.20  ? 634  SER A N     1 
ATOM   4646  C  CA    . SER A 1 634  ? -38.798 -58.070 -47.479 1.00 98.14  ? 634  SER A CA    1 
ATOM   4647  C  C     . SER A 1 634  ? -40.049 -57.415 -48.049 1.00 100.12 ? 634  SER A C     1 
ATOM   4648  O  O     . SER A 1 634  ? -40.728 -58.009 -48.886 1.00 96.83  ? 634  SER A O     1 
ATOM   4649  C  CB    . SER A 1 634  ? -39.216 -59.283 -46.657 1.00 100.31 ? 634  SER A CB    1 
ATOM   4650  O  OG    . SER A 1 634  ? -40.296 -58.947 -45.787 1.00 105.18 ? 634  SER A OG    1 
ATOM   4651  N  N     . MET A 1 635  ? -40.349 -56.184 -47.621 1.00 99.29  ? 635  MET A N     1 
ATOM   4652  C  CA    . MET A 1 635  ? -41.617 -55.539 -47.955 1.00 96.86  ? 635  MET A CA    1 
ATOM   4653  C  C     . MET A 1 635  ? -41.639 -54.917 -49.347 1.00 88.12  ? 635  MET A C     1 
ATOM   4654  O  O     . MET A 1 635  ? -40.577 -54.660 -49.917 1.00 86.70  ? 635  MET A O     1 
ATOM   4655  C  CB    . MET A 1 635  ? -41.914 -54.432 -46.946 1.00 98.32  ? 635  MET A CB    1 
ATOM   4656  C  CG    . MET A 1 635  ? -42.534 -54.959 -45.675 1.00 105.51 ? 635  MET A CG    1 
ATOM   4657  S  SD    . MET A 1 635  ? -42.807 -53.634 -44.504 1.00 120.36 ? 635  MET A SD    1 
ATOM   4658  C  CE    . MET A 1 635  ? -43.984 -52.658 -45.435 1.00 120.31 ? 635  MET A CE    1 
ATOM   4659  N  N     . PRO A 1 636  ? -42.849 -54.647 -49.886 1.00 87.70  ? 636  PRO A N     1 
ATOM   4660  C  CA    . PRO A 1 636  ? -42.989 -54.149 -51.261 1.00 90.33  ? 636  PRO A CA    1 
ATOM   4661  C  C     . PRO A 1 636  ? -42.244 -52.827 -51.514 1.00 87.11  ? 636  PRO A C     1 
ATOM   4662  O  O     . PRO A 1 636  ? -42.355 -51.864 -50.744 1.00 78.06  ? 636  PRO A O     1 
ATOM   4663  C  CB    . PRO A 1 636  ? -44.508 -53.988 -51.437 1.00 94.04  ? 636  PRO A CB    1 
ATOM   4664  C  CG    . PRO A 1 636  ? -45.113 -54.838 -50.383 1.00 93.22  ? 636  PRO A CG    1 
ATOM   4665  C  CD    . PRO A 1 636  ? -44.162 -54.777 -49.230 1.00 92.97  ? 636  PRO A CD    1 
ATOM   4666  N  N     . GLY A 1 637  ? -41.464 -52.824 -52.590 1.00 89.15  ? 637  GLY A N     1 
ATOM   4667  C  CA    . GLY A 1 637  ? -40.794 -51.615 -53.065 1.00 86.88  ? 637  GLY A CA    1 
ATOM   4668  C  C     . GLY A 1 637  ? -39.387 -51.424 -52.501 1.00 85.79  ? 637  GLY A C     1 
ATOM   4669  O  O     . GLY A 1 637  ? -38.598 -50.661 -53.095 1.00 83.62  ? 637  GLY A O     1 
ATOM   4670  N  N     . VAL A 1 638  ? -39.048 -52.084 -51.405 1.00 77.30  ? 638  VAL A N     1 
ATOM   4671  C  CA    . VAL A 1 638  ? -37.838 -51.759 -50.699 1.00 76.14  ? 638  VAL A CA    1 
ATOM   4672  C  C     . VAL A 1 638  ? -36.663 -52.263 -51.519 1.00 72.73  ? 638  VAL A C     1 
ATOM   4673  O  O     . VAL A 1 638  ? -36.666 -53.395 -52.028 1.00 63.10  ? 638  VAL A O     1 
ATOM   4674  C  CB    . VAL A 1 638  ? -37.813 -52.338 -49.292 1.00 82.03  ? 638  VAL A CB    1 
ATOM   4675  C  CG1   . VAL A 1 638  ? -36.459 -52.074 -48.640 1.00 88.82  ? 638  VAL A CG1   1 
ATOM   4676  C  CG2   . VAL A 1 638  ? -38.936 -51.743 -48.475 1.00 80.96  ? 638  VAL A CG2   1 
ATOM   4677  N  N     . VAL A 1 639  ? -35.692 -51.377 -51.682 1.00 78.53  ? 639  VAL A N     1 
ATOM   4678  C  CA    . VAL A 1 639  ? -34.466 -51.667 -52.411 1.00 81.97  ? 639  VAL A CA    1 
ATOM   4679  C  C     . VAL A 1 639  ? -33.298 -51.922 -51.470 1.00 79.87  ? 639  VAL A C     1 
ATOM   4680  O  O     . VAL A 1 639  ? -32.516 -52.849 -51.690 1.00 92.28  ? 639  VAL A O     1 
ATOM   4681  C  CB    . VAL A 1 639  ? -34.078 -50.494 -53.295 1.00 76.87  ? 639  VAL A CB    1 
ATOM   4682  C  CG1   . VAL A 1 639  ? -32.920 -50.907 -54.188 1.00 76.00  ? 639  VAL A CG1   1 
ATOM   4683  C  CG2   . VAL A 1 639  ? -35.292 -50.056 -54.093 1.00 80.93  ? 639  VAL A CG2   1 
ATOM   4684  N  N     . ASP A 1 640  ? -33.184 -51.118 -50.424 1.00 71.97  ? 640  ASP A N     1 
ATOM   4685  C  CA    . ASP A 1 640  ? -31.982 -51.162 -49.566 1.00 73.76  ? 640  ASP A CA    1 
ATOM   4686  C  C     . ASP A 1 640  ? -32.265 -50.459 -48.256 1.00 74.20  ? 640  ASP A C     1 
ATOM   4687  O  O     . ASP A 1 640  ? -33.045 -49.522 -48.208 1.00 73.72  ? 640  ASP A O     1 
ATOM   4688  C  CB    . ASP A 1 640  ? -30.798 -50.508 -50.287 1.00 76.61  ? 640  ASP A CB    1 
ATOM   4689  C  CG    . ASP A 1 640  ? -29.439 -50.795 -49.630 1.00 85.73  ? 640  ASP A CG    1 
ATOM   4690  O  OD1   . ASP A 1 640  ? -29.346 -51.015 -48.399 1.00 95.19  ? 640  ASP A OD1   1 
ATOM   4691  O  OD2   . ASP A 1 640  ? -28.430 -50.766 -50.366 1.00 92.56  ? 640  ASP A OD2   1 
ATOM   4692  N  N     . ILE A 1 641  ? -31.670 -50.968 -47.181 1.00 74.35  ? 641  ILE A N     1 
ATOM   4693  C  CA    . ILE A 1 641  ? -31.677 -50.281 -45.902 1.00 75.28  ? 641  ILE A CA    1 
ATOM   4694  C  C     . ILE A 1 641  ? -30.241 -50.187 -45.350 1.00 80.03  ? 641  ILE A C     1 
ATOM   4695  O  O     . ILE A 1 641  ? -29.575 -51.199 -45.103 1.00 80.22  ? 641  ILE A O     1 
ATOM   4696  C  CB    . ILE A 1 641  ? -32.670 -50.911 -44.891 1.00 76.00  ? 641  ILE A CB    1 
ATOM   4697  C  CG1   . ILE A 1 641  ? -33.992 -51.264 -45.607 1.00 75.92  ? 641  ILE A CG1   1 
ATOM   4698  C  CG2   . ILE A 1 641  ? -32.915 -49.966 -43.706 1.00 71.28  ? 641  ILE A CG2   1 
ATOM   4699  C  CD1   . ILE A 1 641  ? -35.193 -51.504 -44.706 1.00 76.34  ? 641  ILE A CD1   1 
ATOM   4700  N  N     . MET A 1 642  ? -29.761 -48.956 -45.197 1.00 87.11  ? 642  MET A N     1 
ATOM   4701  C  CA    . MET A 1 642  ? -28.402 -48.673 -44.755 1.00 95.61  ? 642  MET A CA    1 
ATOM   4702  C  C     . MET A 1 642  ? -28.371 -48.290 -43.270 1.00 93.37  ? 642  MET A C     1 
ATOM   4703  O  O     . MET A 1 642  ? -29.097 -47.381 -42.838 1.00 88.64  ? 642  MET A O     1 
ATOM   4704  C  CB    . MET A 1 642  ? -27.838 -47.497 -45.555 1.00 99.65  ? 642  MET A CB    1 
ATOM   4705  C  CG    . MET A 1 642  ? -27.394 -47.845 -46.962 1.00 107.15 ? 642  MET A CG    1 
ATOM   4706  S  SD    . MET A 1 642  ? -27.651 -46.469 -48.093 1.00 109.94 ? 642  MET A SD    1 
ATOM   4707  C  CE    . MET A 1 642  ? -29.381 -46.706 -48.486 1.00 110.93 ? 642  MET A CE    1 
ATOM   4708  N  N     . THR A 1 643  ? -27.527 -49.005 -42.522 1.00 90.49  ? 643  THR A N     1 
ATOM   4709  C  CA    . THR A 1 643  ? -27.101 -48.574 -41.177 1.00 99.04  ? 643  THR A CA    1 
ATOM   4710  C  C     . THR A 1 643  ? -25.682 -48.012 -41.310 1.00 95.70  ? 643  THR A C     1 
ATOM   4711  O  O     . THR A 1 643  ? -25.146 -47.889 -42.413 1.00 90.59  ? 643  THR A O     1 
ATOM   4712  C  CB    . THR A 1 643  ? -27.163 -49.711 -40.125 1.00 100.94 ? 643  THR A CB    1 
ATOM   4713  O  OG1   . THR A 1 643  ? -25.865 -50.291 -39.917 1.00 97.23  ? 643  THR A OG1   1 
ATOM   4714  C  CG2   . THR A 1 643  ? -28.175 -50.775 -40.544 1.00 104.65 ? 643  THR A CG2   1 
ATOM   4715  N  N     . ALA A 1 644  ? -25.071 -47.673 -40.172 1.00 94.33  ? 644  ALA A N     1 
ATOM   4716  C  CA    . ALA A 1 644  ? -23.704 -47.117 -40.158 1.00 95.17  ? 644  ALA A CA    1 
ATOM   4717  C  C     . ALA A 1 644  ? -22.628 -48.046 -40.720 1.00 93.87  ? 644  ALA A C     1 
ATOM   4718  O  O     . ALA A 1 644  ? -21.607 -47.582 -41.216 1.00 109.79 ? 644  ALA A O     1 
ATOM   4719  C  CB    . ALA A 1 644  ? -23.319 -46.702 -38.749 1.00 98.69  ? 644  ALA A CB    1 
ATOM   4720  N  N     . GLU A 1 645  ? -22.852 -49.350 -40.637 1.00 92.54  ? 645  GLU A N     1 
ATOM   4721  C  CA    . GLU A 1 645  ? -21.978 -50.359 -41.229 1.00 109.86 ? 645  GLU A CA    1 
ATOM   4722  C  C     . GLU A 1 645  ? -21.827 -50.210 -42.760 1.00 104.20 ? 645  GLU A C     1 
ATOM   4723  O  O     . GLU A 1 645  ? -20.742 -50.435 -43.324 1.00 105.69 ? 645  GLU A O     1 
ATOM   4724  C  CB    . GLU A 1 645  ? -22.608 -51.743 -40.938 1.00 119.87 ? 645  GLU A CB    1 
ATOM   4725  C  CG    . GLU A 1 645  ? -21.717 -52.753 -40.216 1.00 129.13 ? 645  GLU A CG    1 
ATOM   4726  C  CD    . GLU A 1 645  ? -22.484 -53.606 -39.205 1.00 127.20 ? 645  GLU A CD    1 
ATOM   4727  O  OE1   . GLU A 1 645  ? -23.739 -53.595 -39.232 1.00 110.43 ? 645  GLU A OE1   1 
ATOM   4728  O  OE2   . GLU A 1 645  ? -21.826 -54.276 -38.369 1.00 133.52 ? 645  GLU A OE2   1 
ATOM   4729  N  N     . HIS A 1 646  ? -22.923 -49.813 -43.411 1.00 100.91 ? 646  HIS A N     1 
ATOM   4730  C  CA    . HIS A 1 646  ? -23.005 -49.748 -44.873 1.00 102.84 ? 646  HIS A CA    1 
ATOM   4731  C  C     . HIS A 1 646  ? -22.416 -48.456 -45.415 1.00 92.70  ? 646  HIS A C     1 
ATOM   4732  O  O     . HIS A 1 646  ? -22.241 -48.324 -46.617 1.00 102.83 ? 646  HIS A O     1 
ATOM   4733  C  CB    . HIS A 1 646  ? -24.451 -49.836 -45.379 1.00 108.92 ? 646  HIS A CB    1 
ATOM   4734  C  CG    . HIS A 1 646  ? -25.238 -50.981 -44.819 1.00 110.95 ? 646  HIS A CG    1 
ATOM   4735  N  ND1   . HIS A 1 646  ? -25.476 -51.152 -43.469 1.00 101.50 ? 646  HIS A ND1   1 
ATOM   4736  C  CD2   . HIS A 1 646  ? -25.890 -51.986 -45.442 1.00 111.81 ? 646  HIS A CD2   1 
ATOM   4737  C  CE1   . HIS A 1 646  ? -26.216 -52.225 -43.285 1.00 99.89  ? 646  HIS A CE1   1 
ATOM   4738  N  NE2   . HIS A 1 646  ? -26.485 -52.748 -44.466 1.00 112.84 ? 646  HIS A NE2   1 
ATOM   4739  N  N     . LEU A 1 647  ? -22.155 -47.495 -44.535 1.00 93.26  ? 647  LEU A N     1 
ATOM   4740  C  CA    . LEU A 1 647  ? -21.387 -46.293 -44.879 1.00 105.33 ? 647  LEU A CA    1 
ATOM   4741  C  C     . LEU A 1 647  ? -19.900 -46.393 -44.523 1.00 109.97 ? 647  LEU A C     1 
ATOM   4742  O  O     . LEU A 1 647  ? -19.101 -45.626 -45.060 1.00 115.30 ? 647  LEU A O     1 
ATOM   4743  C  CB    . LEU A 1 647  ? -22.012 -45.062 -44.220 1.00 106.90 ? 647  LEU A CB    1 
ATOM   4744  C  CG    . LEU A 1 647  ? -23.118 -44.445 -45.069 1.00 105.80 ? 647  LEU A CG    1 
ATOM   4745  C  CD1   . LEU A 1 647  ? -24.362 -45.311 -45.081 1.00 106.57 ? 647  LEU A CD1   1 
ATOM   4746  C  CD2   . LEU A 1 647  ? -23.431 -43.062 -44.550 1.00 112.30 ? 647  LEU A CD2   1 
ATOM   4747  N  N     . SER A 1 648  ? -19.533 -47.347 -43.663 1.00 110.54 ? 648  SER A N     1 
ATOM   4748  C  CA    . SER A 1 648  ? -18.131 -47.620 -43.259 1.00 103.83 ? 648  SER A CA    1 
ATOM   4749  C  C     . SER A 1 648  ? -17.278 -46.353 -43.063 1.00 108.46 ? 648  SER A C     1 
ATOM   4750  O  O     . SER A 1 648  ? -17.628 -45.543 -42.231 1.00 114.16 ? 648  SER A O     1 
ATOM   4751  C  CB    . SER A 1 648  ? -17.452 -48.692 -44.131 1.00 97.67  ? 648  SER A CB    1 
ATOM   4752  O  OG    . SER A 1 648  ? -17.475 -48.343 -45.498 1.00 95.77  ? 648  SER A OG    1 
ATOM   4753  N  N     . ASP A 1 649  ? -16.208 -46.159 -43.831 1.00 112.20 ? 649  ASP A N     1 
ATOM   4754  C  CA    . ASP A 1 649  ? -15.265 -45.052 -43.634 1.00 116.92 ? 649  ASP A CA    1 
ATOM   4755  C  C     . ASP A 1 649  ? -15.746 -43.657 -44.097 1.00 109.22 ? 649  ASP A C     1 
ATOM   4756  O  O     . ASP A 1 649  ? -15.008 -42.687 -43.949 1.00 100.25 ? 649  ASP A O     1 
ATOM   4757  C  CB    . ASP A 1 649  ? -13.975 -45.383 -44.395 1.00 124.00 ? 649  ASP A CB    1 
ATOM   4758  C  CG    . ASP A 1 649  ? -14.203 -45.548 -45.904 1.00 134.27 ? 649  ASP A CG    1 
ATOM   4759  O  OD1   . ASP A 1 649  ? -15.337 -45.343 -46.397 1.00 136.79 ? 649  ASP A OD1   1 
ATOM   4760  O  OD2   . ASP A 1 649  ? -13.238 -45.896 -46.607 1.00 151.33 ? 649  ASP A OD2   1 
ATOM   4761  N  N     . VAL A 1 650  ? -16.941 -43.583 -44.682 1.00 114.00 ? 650  VAL A N     1 
ATOM   4762  C  CA    . VAL A 1 650  ? -17.538 -42.308 -45.074 1.00 116.01 ? 650  VAL A CA    1 
ATOM   4763  C  C     . VAL A 1 650  ? -18.828 -42.028 -44.284 1.00 122.84 ? 650  VAL A C     1 
ATOM   4764  O  O     . VAL A 1 650  ? -19.814 -41.503 -44.829 1.00 125.43 ? 650  VAL A O     1 
ATOM   4765  C  CB    . VAL A 1 650  ? -17.738 -42.179 -46.602 1.00 111.05 ? 650  VAL A CB    1 
ATOM   4766  C  CG1   . VAL A 1 650  ? -16.458 -41.657 -47.230 1.00 109.34 ? 650  VAL A CG1   1 
ATOM   4767  C  CG2   . VAL A 1 650  ? -18.191 -43.494 -47.242 1.00 109.96 ? 650  VAL A CG2   1 
ATOM   4768  N  N     . ASN A 1 651  ? -18.795 -42.358 -42.995 1.00 117.59 ? 651  ASN A N     1 
ATOM   4769  C  CA    . ASN A 1 651  ? -19.894 -42.062 -42.074 1.00 112.38 ? 651  ASN A CA    1 
ATOM   4770  C  C     . ASN A 1 651  ? -19.628 -40.852 -41.171 1.00 118.31 ? 651  ASN A C     1 
ATOM   4771  O  O     . ASN A 1 651  ? -20.221 -40.788 -40.090 1.00 136.52 ? 651  ASN A O     1 
ATOM   4772  C  CB    . ASN A 1 651  ? -20.117 -43.354 -41.258 1.00 116.04 ? 651  ASN A CB    1 
ATOM   4773  C  CG    . ASN A 1 651  ? -21.164 -43.220 -40.168 1.00 118.95 ? 651  ASN A CG    1 
ATOM   4774  O  OD1   . ASN A 1 651  ? -22.364 -43.157 -40.430 1.00 114.33 ? 651  ASN A OD1   1 
ATOM   4775  N  ND2   . ASN A 1 651  ? -20.705 -43.223 -38.927 1.00 123.09 ? 651  ASN A ND2   1 
ATOM   4776  N  N     . SER A 1 652  ? -18.776 -39.929 -41.602 1.00 114.08 ? 652  SER A N     1 
ATOM   4777  C  CA    . SER A 1 652  ? -18.578 -38.667 -40.833 1.00 112.28 ? 652  SER A CA    1 
ATOM   4778  C  C     . SER A 1 652  ? -17.768 -37.666 -41.597 1.00 102.94 ? 652  SER A C     1 
ATOM   4779  O  O     . SER A 1 652  ? -16.990 -38.070 -42.423 1.00 99.04  ? 652  SER A O     1 
ATOM   4780  C  CB    . SER A 1 652  ? -17.886 -38.934 -39.481 1.00 120.14 ? 652  SER A CB    1 
ATOM   4781  O  OG    . SER A 1 652  ? -16.635 -39.560 -39.659 1.00 126.38 ? 652  SER A OG    1 
ATOM   4782  N  N     . PHE A 1 653  ? -17.911 -36.365 -41.294 1.00 103.87 ? 653  PHE A N     1 
ATOM   4783  C  CA    . PHE A 1 653  ? -17.253 -35.292 -42.063 1.00 109.05 ? 653  PHE A CA    1 
ATOM   4784  C  C     . PHE A 1 653  ? -16.951 -34.078 -41.182 1.00 116.19 ? 653  PHE A C     1 
ATOM   4785  O  O     . PHE A 1 653  ? -17.872 -33.589 -40.529 1.00 140.56 ? 653  PHE A O     1 
ATOM   4786  C  CB    . PHE A 1 653  ? -18.188 -34.824 -43.202 1.00 101.34 ? 653  PHE A CB    1 
ATOM   4787  C  CG    . PHE A 1 653  ? -17.676 -33.635 -44.003 1.00 107.92 ? 653  PHE A CG    1 
ATOM   4788  C  CD1   . PHE A 1 653  ? -16.777 -33.814 -45.068 1.00 113.26 ? 653  PHE A CD1   1 
ATOM   4789  C  CD2   . PHE A 1 653  ? -18.128 -32.339 -43.738 1.00 103.00 ? 653  PHE A CD2   1 
ATOM   4790  C  CE1   . PHE A 1 653  ? -16.320 -32.727 -45.825 1.00 106.85 ? 653  PHE A CE1   1 
ATOM   4791  C  CE2   . PHE A 1 653  ? -17.672 -31.252 -44.493 1.00 103.86 ? 653  PHE A CE2   1 
ATOM   4792  C  CZ    . PHE A 1 653  ? -16.767 -31.445 -45.534 1.00 104.38 ? 653  PHE A CZ    1 
ATOM   4793  N  N     . CYS A 1 654  ? -15.692 -33.607 -41.176 1.00 115.84 ? 654  CYS A N     1 
ATOM   4794  C  CA    . CYS A 1 654  ? -15.259 -32.404 -40.446 1.00 126.19 ? 654  CYS A CA    1 
ATOM   4795  C  C     . CYS A 1 654  ? -15.711 -32.365 -38.979 1.00 130.68 ? 654  CYS A C     1 
ATOM   4796  O  O     . CYS A 1 654  ? -14.897 -32.303 -38.070 1.00 136.12 ? 654  CYS A O     1 
ATOM   4797  C  CB    . CYS A 1 654  ? -15.749 -31.131 -41.154 1.00 138.79 ? 654  CYS A CB    1 
ATOM   4798  S  SG    . CYS A 1 654  ? -15.895 -29.648 -40.103 1.00 159.87 ? 654  CYS A SG    1 
ATOM   4799  N  N     . LYS A 1 661  ? -20.471 -37.920 -36.810 1.00 104.09 ? 661  LYS A N     1 
ATOM   4800  C  CA    . LYS A 1 661  ? -20.938 -38.991 -37.688 1.00 114.31 ? 661  LYS A CA    1 
ATOM   4801  C  C     . LYS A 1 661  ? -22.393 -38.846 -38.150 1.00 116.15 ? 661  LYS A C     1 
ATOM   4802  O  O     . LYS A 1 661  ? -23.241 -38.325 -37.436 1.00 134.60 ? 661  LYS A O     1 
ATOM   4803  C  CB    . LYS A 1 661  ? -20.709 -40.379 -37.060 1.00 115.15 ? 661  LYS A CB    1 
ATOM   4804  C  CG    . LYS A 1 661  ? -20.933 -40.495 -35.553 1.00 125.70 ? 661  LYS A CG    1 
ATOM   4805  C  CD    . LYS A 1 661  ? -20.705 -41.931 -35.067 1.00 127.94 ? 661  LYS A CD    1 
ATOM   4806  C  CE    . LYS A 1 661  ? -19.729 -42.025 -33.896 1.00 130.77 ? 661  LYS A CE    1 
ATOM   4807  N  NZ    . LYS A 1 661  ? -20.329 -41.552 -32.617 1.00 137.90 ? 661  LYS A NZ    1 
ATOM   4808  N  N     . PHE A 1 662  ? -22.676 -39.343 -39.350 1.00 107.31 ? 662  PHE A N     1 
ATOM   4809  C  CA    . PHE A 1 662  ? -23.975 -39.147 -40.003 1.00 102.54 ? 662  PHE A CA    1 
ATOM   4810  C  C     . PHE A 1 662  ? -25.029 -40.052 -39.371 1.00 94.00  ? 662  PHE A C     1 
ATOM   4811  O  O     . PHE A 1 662  ? -26.053 -39.582 -38.882 1.00 95.39  ? 662  PHE A O     1 
ATOM   4812  C  CB    . PHE A 1 662  ? -23.931 -39.496 -41.513 1.00 100.11 ? 662  PHE A CB    1 
ATOM   4813  C  CG    . PHE A 1 662  ? -22.922 -38.711 -42.331 1.00 102.52 ? 662  PHE A CG    1 
ATOM   4814  C  CD1   . PHE A 1 662  ? -22.626 -37.376 -42.053 1.00 103.11 ? 662  PHE A CD1   1 
ATOM   4815  C  CD2   . PHE A 1 662  ? -22.302 -39.307 -43.425 1.00 101.66 ? 662  PHE A CD2   1 
ATOM   4816  C  CE1   . PHE A 1 662  ? -21.716 -36.667 -42.824 1.00 98.25  ? 662  PHE A CE1   1 
ATOM   4817  C  CE2   . PHE A 1 662  ? -21.393 -38.600 -44.200 1.00 105.11 ? 662  PHE A CE2   1 
ATOM   4818  C  CZ    . PHE A 1 662  ? -21.104 -37.277 -43.901 1.00 101.43 ? 662  PHE A CZ    1 
ATOM   4819  N  N     . LEU A 1 663  ? -24.752 -41.355 -39.409 1.00 85.60  ? 663  LEU A N     1 
ATOM   4820  C  CA    . LEU A 1 663  ? -25.652 -42.385 -38.916 1.00 86.97  ? 663  LEU A CA    1 
ATOM   4821  C  C     . LEU A 1 663  ? -25.131 -42.998 -37.613 1.00 82.24  ? 663  LEU A C     1 
ATOM   4822  O  O     . LEU A 1 663  ? -23.924 -43.238 -37.479 1.00 77.51  ? 663  LEU A O     1 
ATOM   4823  C  CB    . LEU A 1 663  ? -25.833 -43.493 -39.962 1.00 94.04  ? 663  LEU A CB    1 
ATOM   4824  C  CG    . LEU A 1 663  ? -26.545 -43.198 -41.293 1.00 89.05  ? 663  LEU A CG    1 
ATOM   4825  C  CD1   . LEU A 1 663  ? -26.481 -44.417 -42.194 1.00 80.25  ? 663  LEU A CD1   1 
ATOM   4826  C  CD2   . LEU A 1 663  ? -27.990 -42.786 -41.072 1.00 96.51  ? 663  LEU A CD2   1 
ATOM   4827  N  N     . ALA A 1 664  ? -26.041 -43.207 -36.668 1.00 87.57  ? 664  ALA A N     1 
ATOM   4828  C  CA    . ALA A 1 664  ? -25.668 -43.686 -35.349 1.00 94.29  ? 664  ALA A CA    1 
ATOM   4829  C  C     . ALA A 1 664  ? -24.963 -45.011 -35.459 1.00 93.37  ? 664  ALA A C     1 
ATOM   4830  O  O     . ALA A 1 664  ? -25.370 -45.844 -36.253 1.00 99.13  ? 664  ALA A O     1 
ATOM   4831  C  CB    . ALA A 1 664  ? -26.899 -43.854 -34.471 1.00 99.78  ? 664  ALA A CB    1 
ATOM   4832  N  N     . THR A 1 665  ? -23.912 -45.178 -34.678 1.00 96.33  ? 665  THR A N     1 
ATOM   4833  C  CA    . THR A 1 665  ? -23.092 -46.372 -34.754 1.00 97.76  ? 665  THR A CA    1 
ATOM   4834  C  C     . THR A 1 665  ? -23.637 -47.359 -33.723 1.00 99.77  ? 665  THR A C     1 
ATOM   4835  O  O     . THR A 1 665  ? -24.481 -48.193 -34.069 1.00 94.74  ? 665  THR A O     1 
ATOM   4836  C  CB    . THR A 1 665  ? -21.590 -46.035 -34.571 1.00 94.66  ? 665  THR A CB    1 
ATOM   4837  O  OG1   . THR A 1 665  ? -21.437 -44.817 -33.827 1.00 103.45 ? 665  THR A OG1   1 
ATOM   4838  C  CG2   . THR A 1 665  ? -20.936 -45.825 -35.903 1.00 95.09  ? 665  THR A CG2   1 
ATOM   4839  N  N     . ASP A 1 666  ? -23.210 -47.230 -32.461 1.00 93.67  ? 666  ASP A N     1 
ATOM   4840  C  CA    . ASP A 1 666  ? -23.636 -48.148 -31.390 1.00 100.75 ? 666  ASP A CA    1 
ATOM   4841  C  C     . ASP A 1 666  ? -24.372 -47.504 -30.201 1.00 98.99  ? 666  ASP A C     1 
ATOM   4842  O  O     . ASP A 1 666  ? -24.875 -48.203 -29.325 1.00 95.10  ? 666  ASP A O     1 
ATOM   4843  C  CB    . ASP A 1 666  ? -22.452 -49.016 -30.904 1.00 110.15 ? 666  ASP A CB    1 
ATOM   4844  C  CG    . ASP A 1 666  ? -21.482 -48.259 -30.012 1.00 115.02 ? 666  ASP A CG    1 
ATOM   4845  O  OD1   . ASP A 1 666  ? -20.897 -47.274 -30.511 1.00 128.06 ? 666  ASP A OD1   1 
ATOM   4846  O  OD2   . ASP A 1 666  ? -21.297 -48.659 -28.828 1.00 100.77 ? 666  ASP A OD2   1 
ATOM   4847  N  N     . LYS A 1 667  ? -24.414 -46.174 -30.157 1.00 98.80  ? 667  LYS A N     1 
ATOM   4848  C  CA    . LYS A 1 667  ? -25.219 -45.428 -29.191 1.00 97.63  ? 667  LYS A CA    1 
ATOM   4849  C  C     . LYS A 1 667  ? -25.975 -44.320 -29.914 1.00 97.09  ? 667  LYS A C     1 
ATOM   4850  O  O     . LYS A 1 667  ? -25.559 -43.854 -30.981 1.00 101.27 ? 667  LYS A O     1 
ATOM   4851  C  CB    . LYS A 1 667  ? -24.296 -44.845 -28.116 1.00 106.56 ? 667  LYS A CB    1 
ATOM   4852  C  CG    . LYS A 1 667  ? -23.193 -45.825 -27.685 1.00 115.40 ? 667  LYS A CG    1 
ATOM   4853  C  CD    . LYS A 1 667  ? -22.598 -45.560 -26.304 1.00 116.26 ? 667  LYS A CD    1 
ATOM   4854  C  CE    . LYS A 1 667  ? -21.144 -45.108 -26.355 1.00 116.00 ? 667  LYS A CE    1 
ATOM   4855  N  NZ    . LYS A 1 667  ? -20.568 -44.951 -24.985 1.00 114.52 ? 667  LYS A NZ    1 
ATOM   4856  N  N     . VAL A 1 668  ? -27.098 -43.906 -29.334 1.00 93.35  ? 668  VAL A N     1 
ATOM   4857  C  CA    . VAL A 1 668  ? -27.811 -42.706 -29.791 1.00 92.27  ? 668  VAL A CA    1 
ATOM   4858  C  C     . VAL A 1 668  ? -27.675 -41.657 -28.667 1.00 95.08  ? 668  VAL A C     1 
ATOM   4859  O  O     . VAL A 1 668  ? -27.676 -42.007 -27.475 1.00 96.12  ? 668  VAL A O     1 
ATOM   4860  C  CB    . VAL A 1 668  ? -29.278 -43.040 -30.137 1.00 94.43  ? 668  VAL A CB    1 
ATOM   4861  C  CG1   . VAL A 1 668  ? -29.346 -44.250 -31.061 1.00 88.43  ? 668  VAL A CG1   1 
ATOM   4862  C  CG2   . VAL A 1 668  ? -30.090 -43.311 -28.876 1.00 107.28 ? 668  VAL A CG2   1 
ATOM   4863  N  N     . PHE A 1 669  ? -27.489 -40.393 -29.048 1.00 95.16  ? 669  PHE A N     1 
ATOM   4864  C  CA    . PHE A 1 669  ? -27.213 -39.332 -28.087 1.00 96.39  ? 669  PHE A CA    1 
ATOM   4865  C  C     . PHE A 1 669  ? -28.288 -38.240 -28.020 1.00 95.11  ? 669  PHE A C     1 
ATOM   4866  O  O     . PHE A 1 669  ? -28.130 -37.261 -27.309 1.00 102.99 ? 669  PHE A O     1 
ATOM   4867  C  CB    . PHE A 1 669  ? -25.812 -38.755 -28.376 1.00 100.72 ? 669  PHE A CB    1 
ATOM   4868  C  CG    . PHE A 1 669  ? -24.704 -39.734 -28.069 1.00 106.19 ? 669  PHE A CG    1 
ATOM   4869  C  CD1   . PHE A 1 669  ? -24.304 -39.961 -26.749 1.00 110.59 ? 669  PHE A CD1   1 
ATOM   4870  C  CD2   . PHE A 1 669  ? -24.118 -40.491 -29.079 1.00 103.95 ? 669  PHE A CD2   1 
ATOM   4871  C  CE1   . PHE A 1 669  ? -23.326 -40.900 -26.455 1.00 108.27 ? 669  PHE A CE1   1 
ATOM   4872  C  CE2   . PHE A 1 669  ? -23.140 -41.433 -28.791 1.00 100.46 ? 669  PHE A CE2   1 
ATOM   4873  C  CZ    . PHE A 1 669  ? -22.745 -41.637 -27.479 1.00 102.63 ? 669  PHE A CZ    1 
ATOM   4874  N  N     . CYS A 1 670  ? -29.399 -38.432 -28.734 1.00 98.34  ? 670  CYS A N     1 
ATOM   4875  C  CA    . CYS A 1 670  ? -30.614 -37.641 -28.615 1.00 93.78  ? 670  CYS A CA    1 
ATOM   4876  C  C     . CYS A 1 670  ? -31.734 -38.357 -29.375 1.00 89.41  ? 670  CYS A C     1 
ATOM   4877  O  O     . CYS A 1 670  ? -31.449 -39.254 -30.174 1.00 86.35  ? 670  CYS A O     1 
ATOM   4878  C  CB    . CYS A 1 670  ? -30.411 -36.267 -29.234 1.00 90.67  ? 670  CYS A CB    1 
ATOM   4879  S  SG    . CYS A 1 670  ? -30.127 -36.364 -31.002 1.00 96.21  ? 670  CYS A SG    1 
ATOM   4880  N  N     . VAL A 1 671  ? -32.991 -37.965 -29.151 1.00 91.29  ? 671  VAL A N     1 
ATOM   4881  C  CA    . VAL A 1 671  ? -34.074 -38.451 -29.993 1.00 94.57  ? 671  VAL A CA    1 
ATOM   4882  C  C     . VAL A 1 671  ? -33.969 -37.710 -31.314 1.00 95.44  ? 671  VAL A C     1 
ATOM   4883  O  O     . VAL A 1 671  ? -33.500 -36.562 -31.339 1.00 95.05  ? 671  VAL A O     1 
ATOM   4884  C  CB    . VAL A 1 671  ? -35.476 -38.241 -29.394 1.00 98.52  ? 671  VAL A CB    1 
ATOM   4885  C  CG1   . VAL A 1 671  ? -35.598 -38.995 -28.068 1.00 96.77  ? 671  VAL A CG1   1 
ATOM   4886  C  CG2   . VAL A 1 671  ? -35.828 -36.745 -29.288 1.00 95.98  ? 671  VAL A CG2   1 
ATOM   4887  N  N     . GLY A 1 672  ? -34.373 -38.374 -32.403 1.00 90.56  ? 672  GLY A N     1 
ATOM   4888  C  CA    . GLY A 1 672  ? -34.340 -37.758 -33.710 1.00 93.56  ? 672  GLY A CA    1 
ATOM   4889  C  C     . GLY A 1 672  ? -33.040 -37.922 -34.471 1.00 98.08  ? 672  GLY A C     1 
ATOM   4890  O  O     . GLY A 1 672  ? -32.953 -37.545 -35.631 1.00 95.19  ? 672  GLY A O     1 
ATOM   4891  N  N     . GLN A 1 673  ? -32.022 -38.485 -33.818 1.00 102.23 ? 673  GLN A N     1 
ATOM   4892  C  CA    . GLN A 1 673  ? -30.755 -38.764 -34.477 1.00 100.43 ? 673  GLN A CA    1 
ATOM   4893  C  C     . GLN A 1 673  ? -30.994 -39.819 -35.559 1.00 93.19  ? 673  GLN A C     1 
ATOM   4894  O  O     . GLN A 1 673  ? -31.828 -40.719 -35.378 1.00 91.74  ? 673  GLN A O     1 
ATOM   4895  C  CB    . GLN A 1 673  ? -29.730 -39.247 -33.453 1.00 97.18  ? 673  GLN A CB    1 
ATOM   4896  C  CG    . GLN A 1 673  ? -28.309 -38.909 -33.828 1.00 95.70  ? 673  GLN A CG    1 
ATOM   4897  C  CD    . GLN A 1 673  ? -27.328 -39.933 -33.307 1.00 98.27  ? 673  GLN A CD    1 
ATOM   4898  O  OE1   . GLN A 1 673  ? -27.319 -40.258 -32.114 1.00 91.02  ? 673  GLN A OE1   1 
ATOM   4899  N  NE2   . GLN A 1 673  ? -26.486 -40.452 -34.201 1.00 101.82 ? 673  GLN A NE2   1 
ATOM   4900  N  N     . LEU A 1 674  ? -30.272 -39.712 -36.676 1.00 88.72  ? 674  LEU A N     1 
ATOM   4901  C  CA    . LEU A 1 674  ? -30.422 -40.663 -37.784 1.00 83.56  ? 674  LEU A CA    1 
ATOM   4902  C  C     . LEU A 1 674  ? -29.850 -42.014 -37.379 1.00 80.65  ? 674  LEU A C     1 
ATOM   4903  O  O     . LEU A 1 674  ? -28.802 -42.068 -36.718 1.00 94.03  ? 674  LEU A O     1 
ATOM   4904  C  CB    . LEU A 1 674  ? -29.656 -40.195 -39.022 1.00 82.96  ? 674  LEU A CB    1 
ATOM   4905  C  CG    . LEU A 1 674  ? -29.943 -38.815 -39.621 1.00 78.09  ? 674  LEU A CG    1 
ATOM   4906  C  CD1   . LEU A 1 674  ? -28.903 -38.482 -40.688 1.00 77.64  ? 674  LEU A CD1   1 
ATOM   4907  C  CD2   . LEU A 1 674  ? -31.358 -38.742 -40.180 1.00 71.07  ? 674  LEU A CD2   1 
ATOM   4908  N  N     . VAL A 1 675  ? -30.551 -43.084 -37.755 1.00 80.34  ? 675  VAL A N     1 
ATOM   4909  C  CA    . VAL A 1 675  ? -30.146 -44.456 -37.392 1.00 88.90  ? 675  VAL A CA    1 
ATOM   4910  C  C     . VAL A 1 675  ? -30.078 -45.341 -38.629 1.00 91.54  ? 675  VAL A C     1 
ATOM   4911  O  O     . VAL A 1 675  ? -29.045 -45.948 -38.897 1.00 92.24  ? 675  VAL A O     1 
ATOM   4912  C  CB    . VAL A 1 675  ? -31.075 -45.069 -36.339 1.00 89.23  ? 675  VAL A CB    1 
ATOM   4913  C  CG1   . VAL A 1 675  ? -30.639 -46.500 -36.035 1.00 90.81  ? 675  VAL A CG1   1 
ATOM   4914  C  CG2   . VAL A 1 675  ? -31.104 -44.198 -35.086 1.00 82.52  ? 675  VAL A CG2   1 
ATOM   4915  N  N     . CYS A 1 676  ? -31.193 -45.453 -39.364 1.00 94.79  ? 676  CYS A N     1 
ATOM   4916  C  CA    . CYS A 1 676  ? -31.260 -46.157 -40.648 1.00 98.50  ? 676  CYS A CA    1 
ATOM   4917  C  C     . CYS A 1 676  ? -31.707 -45.223 -41.779 1.00 94.08  ? 676  CYS A C     1 
ATOM   4918  O  O     . CYS A 1 676  ? -32.289 -44.162 -41.534 1.00 88.16  ? 676  CYS A O     1 
ATOM   4919  C  CB    . CYS A 1 676  ? -32.319 -47.246 -40.589 1.00 97.66  ? 676  CYS A CB    1 
ATOM   4920  S  SG    . CYS A 1 676  ? -31.690 -48.763 -39.913 1.00 110.38 ? 676  CYS A SG    1 
ATOM   4921  N  N     . ALA A 1 677  ? -31.470 -45.684 -43.008 1.00 86.92  ? 677  ALA A N     1 
ATOM   4922  C  CA    . ALA A 1 677  ? -31.934 -45.024 -44.204 1.00 91.31  ? 677  ALA A CA    1 
ATOM   4923  C  C     . ALA A 1 677  ? -32.638 -46.060 -45.071 1.00 90.02  ? 677  ALA A C     1 
ATOM   4924  O  O     . ALA A 1 677  ? -32.032 -47.056 -45.441 1.00 97.64  ? 677  ALA A O     1 
ATOM   4925  C  CB    . ALA A 1 677  ? -30.773 -44.382 -44.945 1.00 95.75  ? 677  ALA A CB    1 
ATOM   4926  N  N     . VAL A 1 678  ? -33.917 -45.834 -45.362 1.00 84.31  ? 678  VAL A N     1 
ATOM   4927  C  CA    . VAL A 1 678  ? -34.708 -46.806 -46.111 1.00 80.91  ? 678  VAL A CA    1 
ATOM   4928  C  C     . VAL A 1 678  ? -34.921 -46.274 -47.525 1.00 78.62  ? 678  VAL A C     1 
ATOM   4929  O  O     . VAL A 1 678  ? -35.520 -45.212 -47.701 1.00 78.21  ? 678  VAL A O     1 
ATOM   4930  C  CB    . VAL A 1 678  ? -36.066 -47.106 -45.420 1.00 80.96  ? 678  VAL A CB    1 
ATOM   4931  C  CG1   . VAL A 1 678  ? -36.649 -48.416 -45.913 1.00 80.57  ? 678  VAL A CG1   1 
ATOM   4932  C  CG2   . VAL A 1 678  ? -35.904 -47.194 -43.916 1.00 83.05  ? 678  VAL A CG2   1 
ATOM   4933  N  N     . LEU A 1 679  ? -34.441 -47.036 -48.513 1.00 74.16  ? 679  LEU A N     1 
ATOM   4934  C  CA    . LEU A 1 679  ? -34.510 -46.667 -49.913 1.00 75.32  ? 679  LEU A CA    1 
ATOM   4935  C  C     . LEU A 1 679  ? -35.567 -47.522 -50.651 1.00 73.90  ? 679  LEU A C     1 
ATOM   4936  O  O     . LEU A 1 679  ? -35.472 -48.747 -50.668 1.00 76.39  ? 679  LEU A O     1 
ATOM   4937  C  CB    . LEU A 1 679  ? -33.134 -46.894 -50.475 1.00 78.45  ? 679  LEU A CB    1 
ATOM   4938  C  CG    . LEU A 1 679  ? -32.946 -46.307 -51.857 1.00 90.03  ? 679  LEU A CG    1 
ATOM   4939  C  CD1   . LEU A 1 679  ? -33.075 -44.783 -51.837 1.00 88.33  ? 679  LEU A CD1   1 
ATOM   4940  C  CD2   . LEU A 1 679  ? -31.598 -46.780 -52.381 1.00 97.02  ? 679  LEU A CD2   1 
ATOM   4941  N  N     . ALA A 1 680  ? -36.564 -46.883 -51.269 1.00 66.32  ? 680  ALA A N     1 
ATOM   4942  C  CA    . ALA A 1 680  ? -37.606 -47.637 -51.925 1.00 63.71  ? 680  ALA A CA    1 
ATOM   4943  C  C     . ALA A 1 680  ? -38.104 -47.030 -53.205 1.00 66.93  ? 680  ALA A C     1 
ATOM   4944  O  O     . ALA A 1 680  ? -37.783 -45.904 -53.530 1.00 68.55  ? 680  ALA A O     1 
ATOM   4945  C  CB    . ALA A 1 680  ? -38.732 -47.894 -50.955 1.00 66.18  ? 680  ALA A CB    1 
ATOM   4946  N  N     . ASP A 1 681  ? -38.899 -47.792 -53.933 1.00 78.98  ? 681  ASP A N     1 
ATOM   4947  C  CA    . ASP A 1 681  ? -39.492 -47.347 -55.199 1.00 86.97  ? 681  ASP A CA    1 
ATOM   4948  C  C     . ASP A 1 681  ? -40.457 -46.191 -55.011 1.00 81.12  ? 681  ASP A C     1 
ATOM   4949  O  O     . ASP A 1 681  ? -40.703 -45.454 -55.961 1.00 86.55  ? 681  ASP A O     1 
ATOM   4950  C  CB    . ASP A 1 681  ? -40.241 -48.502 -55.863 1.00 94.98  ? 681  ASP A CB    1 
ATOM   4951  C  CG    . ASP A 1 681  ? -39.319 -49.533 -56.444 1.00 98.02  ? 681  ASP A CG    1 
ATOM   4952  O  OD1   . ASP A 1 681  ? -38.153 -49.190 -56.750 1.00 103.50 ? 681  ASP A OD1   1 
ATOM   4953  O  OD2   . ASP A 1 681  ? -39.774 -50.686 -56.596 1.00 102.76 ? 681  ASP A OD2   1 
ATOM   4954  N  N     . SER A 1 682  ? -41.024 -46.033 -53.814 1.00 79.98  ? 682  SER A N     1 
ATOM   4955  C  CA    . SER A 1 682  ? -41.889 -44.897 -53.551 1.00 82.96  ? 682  SER A CA    1 
ATOM   4956  C  C     . SER A 1 682  ? -41.701 -44.410 -52.125 1.00 77.29  ? 682  SER A C     1 
ATOM   4957  O  O     . SER A 1 682  ? -41.227 -45.159 -51.261 1.00 81.67  ? 682  SER A O     1 
ATOM   4958  C  CB    . SER A 1 682  ? -43.353 -45.283 -53.759 1.00 88.48  ? 682  SER A CB    1 
ATOM   4959  O  OG    . SER A 1 682  ? -43.689 -46.421 -52.974 1.00 96.01  ? 682  SER A OG    1 
ATOM   4960  N  N     . GLU A 1 683  ? -42.187 -43.203 -51.895 1.00 74.05  ? 683  GLU A N     1 
ATOM   4961  C  CA    . GLU A 1 683  ? -42.292 -42.608 -50.568 1.00 76.54  ? 683  GLU A CA    1 
ATOM   4962  C  C     . GLU A 1 683  ? -43.188 -43.423 -49.627 1.00 84.36  ? 683  GLU A C     1 
ATOM   4963  O  O     . GLU A 1 683  ? -42.862 -43.600 -48.453 1.00 87.87  ? 683  GLU A O     1 
ATOM   4964  C  CB    . GLU A 1 683  ? -42.856 -41.219 -50.697 1.00 76.55  ? 683  GLU A CB    1 
ATOM   4965  C  CG    . GLU A 1 683  ? -42.984 -40.509 -49.379 1.00 73.27  ? 683  GLU A CG    1 
ATOM   4966  C  CD    . GLU A 1 683  ? -43.274 -39.057 -49.577 1.00 84.92  ? 683  GLU A CD    1 
ATOM   4967  O  OE1   . GLU A 1 683  ? -43.691 -38.701 -50.698 1.00 104.92 ? 683  GLU A OE1   1 
ATOM   4968  O  OE2   . GLU A 1 683  ? -43.101 -38.269 -48.628 1.00 99.94  ? 683  GLU A OE2   1 
ATOM   4969  N  N     . VAL A 1 684  ? -44.315 -43.910 -50.151 1.00 89.93  ? 684  VAL A N     1 
ATOM   4970  C  CA    . VAL A 1 684  ? -45.262 -44.723 -49.391 1.00 86.96  ? 684  VAL A CA    1 
ATOM   4971  C  C     . VAL A 1 684  ? -44.587 -45.985 -48.889 1.00 79.81  ? 684  VAL A C     1 
ATOM   4972  O  O     . VAL A 1 684  ? -44.662 -46.322 -47.703 1.00 85.65  ? 684  VAL A O     1 
ATOM   4973  C  CB    . VAL A 1 684  ? -46.413 -45.233 -50.277 1.00 86.12  ? 684  VAL A CB    1 
ATOM   4974  C  CG1   . VAL A 1 684  ? -47.535 -45.762 -49.396 1.00 84.06  ? 684  VAL A CG1   1 
ATOM   4975  C  CG2   . VAL A 1 684  ? -46.884 -44.143 -51.242 1.00 93.42  ? 684  VAL A CG2   1 
ATOM   4976  N  N     . GLN A 1 685  ? -43.930 -46.673 -49.813 1.00 71.02  ? 685  GLN A N     1 
ATOM   4977  C  CA    . GLN A 1 685  ? -43.231 -47.915 -49.523 1.00 71.11  ? 685  GLN A CA    1 
ATOM   4978  C  C     . GLN A 1 685  ? -42.074 -47.707 -48.570 1.00 69.09  ? 685  GLN A C     1 
ATOM   4979  O  O     . GLN A 1 685  ? -41.845 -48.536 -47.679 1.00 63.69  ? 685  GLN A O     1 
ATOM   4980  C  CB    . GLN A 1 685  ? -42.777 -48.532 -50.829 1.00 70.51  ? 685  GLN A CB    1 
ATOM   4981  C  CG    . GLN A 1 685  ? -44.003 -49.133 -51.492 1.00 82.76  ? 685  GLN A CG    1 
ATOM   4982  C  CD    . GLN A 1 685  ? -43.857 -49.543 -52.938 1.00 85.98  ? 685  GLN A CD    1 
ATOM   4983  O  OE1   . GLN A 1 685  ? -44.473 -50.535 -53.359 1.00 79.85  ? 685  GLN A OE1   1 
ATOM   4984  N  NE2   . GLN A 1 685  ? -43.088 -48.780 -53.715 1.00 85.71  ? 685  GLN A NE2   1 
ATOM   4985  N  N     . ALA A 1 686  ? -41.369 -46.594 -48.737 1.00 74.00  ? 686  ALA A N     1 
ATOM   4986  C  CA    . ALA A 1 686  ? -40.283 -46.244 -47.830 1.00 78.41  ? 686  ALA A CA    1 
ATOM   4987  C  C     . ALA A 1 686  ? -40.745 -46.111 -46.377 1.00 88.82  ? 686  ALA A C     1 
ATOM   4988  O  O     . ALA A 1 686  ? -40.100 -46.624 -45.457 1.00 106.08 ? 686  ALA A O     1 
ATOM   4989  C  CB    . ALA A 1 686  ? -39.654 -44.938 -48.242 1.00 82.56  ? 686  ALA A CB    1 
ATOM   4990  N  N     . LYS A 1 687  ? -41.867 -45.429 -46.165 1.00 86.36  ? 687  LYS A N     1 
ATOM   4991  C  CA    . LYS A 1 687  ? -42.336 -45.161 -44.802 1.00 89.95  ? 687  LYS A CA    1 
ATOM   4992  C  C     . LYS A 1 687  ? -42.981 -46.351 -44.165 1.00 84.63  ? 687  LYS A C     1 
ATOM   4993  O  O     . LYS A 1 687  ? -42.809 -46.576 -42.972 1.00 83.52  ? 687  LYS A O     1 
ATOM   4994  C  CB    . LYS A 1 687  ? -43.294 -43.999 -44.793 1.00 89.86  ? 687  LYS A CB    1 
ATOM   4995  C  CG    . LYS A 1 687  ? -42.559 -42.699 -44.621 1.00 94.08  ? 687  LYS A CG    1 
ATOM   4996  C  CD    . LYS A 1 687  ? -43.206 -41.637 -45.455 1.00 94.14  ? 687  LYS A CD    1 
ATOM   4997  C  CE    . LYS A 1 687  ? -42.397 -40.369 -45.398 1.00 95.45  ? 687  LYS A CE    1 
ATOM   4998  N  NZ    . LYS A 1 687  ? -43.178 -39.361 -46.151 1.00 98.16  ? 687  LYS A NZ    1 
ATOM   4999  N  N     . ARG A 1 688  ? -43.715 -47.126 -44.962 1.00 78.78  ? 688  ARG A N     1 
ATOM   5000  C  CA    . ARG A 1 688  ? -44.201 -48.433 -44.523 1.00 75.79  ? 688  ARG A CA    1 
ATOM   5001  C  C     . ARG A 1 688  ? -43.079 -49.306 -44.037 1.00 74.43  ? 688  ARG A C     1 
ATOM   5002  O  O     . ARG A 1 688  ? -43.164 -49.860 -42.949 1.00 80.07  ? 688  ARG A O     1 
ATOM   5003  C  CB    . ARG A 1 688  ? -44.925 -49.193 -45.602 1.00 75.27  ? 688  ARG A CB    1 
ATOM   5004  C  CG    . ARG A 1 688  ? -46.381 -48.860 -45.676 1.00 78.36  ? 688  ARG A CG    1 
ATOM   5005  C  CD    . ARG A 1 688  ? -46.887 -49.174 -47.057 1.00 77.23  ? 688  ARG A CD    1 
ATOM   5006  N  NE    . ARG A 1 688  ? -48.167 -48.547 -47.307 1.00 75.74  ? 688  ARG A NE    1 
ATOM   5007  C  CZ    . ARG A 1 688  ? -48.871 -48.770 -48.403 1.00 85.59  ? 688  ARG A CZ    1 
ATOM   5008  N  NH1   . ARG A 1 688  ? -48.402 -49.588 -49.350 1.00 92.79  ? 688  ARG A NH1   1 
ATOM   5009  N  NH2   . ARG A 1 688  ? -50.042 -48.176 -48.564 1.00 89.38  ? 688  ARG A NH2   1 
ATOM   5010  N  N     . ALA A 1 689  ? -42.028 -49.443 -44.837 1.00 72.04  ? 689  ALA A N     1 
ATOM   5011  C  CA    . ALA A 1 689  ? -40.926 -50.341 -44.481 1.00 77.76  ? 689  ALA A CA    1 
ATOM   5012  C  C     . ALA A 1 689  ? -40.149 -49.839 -43.274 1.00 80.16  ? 689  ALA A C     1 
ATOM   5013  O  O     . ALA A 1 689  ? -39.700 -50.642 -42.460 1.00 77.31  ? 689  ALA A O     1 
ATOM   5014  C  CB    . ALA A 1 689  ? -39.999 -50.557 -45.662 1.00 76.78  ? 689  ALA A CB    1 
ATOM   5015  N  N     . ALA A 1 690  ? -40.013 -48.516 -43.161 1.00 83.09  ? 690  ALA A N     1 
ATOM   5016  C  CA    . ALA A 1 690  ? -39.299 -47.872 -42.059 1.00 86.43  ? 690  ALA A CA    1 
ATOM   5017  C  C     . ALA A 1 690  ? -39.940 -48.173 -40.704 1.00 85.39  ? 690  ALA A C     1 
ATOM   5018  O  O     . ALA A 1 690  ? -39.234 -48.391 -39.700 1.00 86.67  ? 690  ALA A O     1 
ATOM   5019  C  CB    . ALA A 1 690  ? -39.313 -46.368 -42.298 1.00 91.88  ? 690  ALA A CB    1 
ATOM   5020  N  N     . LYS A 1 691  ? -41.271 -48.212 -40.689 1.00 84.70  ? 691  LYS A N     1 
ATOM   5021  C  CA    . LYS A 1 691  ? -42.015 -48.491 -39.457 1.00 87.25  ? 691  LYS A CA    1 
ATOM   5022  C  C     . LYS A 1 691  ? -41.969 -49.944 -39.001 1.00 86.22  ? 691  LYS A C     1 
ATOM   5023  O  O     . LYS A 1 691  ? -42.467 -50.249 -37.931 1.00 87.48  ? 691  LYS A O     1 
ATOM   5024  C  CB    . LYS A 1 691  ? -43.471 -48.035 -39.564 1.00 94.93  ? 691  LYS A CB    1 
ATOM   5025  C  CG    . LYS A 1 691  ? -43.651 -46.535 -39.317 1.00 105.18 ? 691  LYS A CG    1 
ATOM   5026  C  CD    . LYS A 1 691  ? -45.073 -46.050 -39.591 1.00 105.26 ? 691  LYS A CD    1 
ATOM   5027  C  CE    . LYS A 1 691  ? -45.614 -46.578 -40.919 1.00 112.16 ? 691  LYS A CE    1 
ATOM   5028  N  NZ    . LYS A 1 691  ? -46.552 -45.642 -41.599 1.00 118.77 ? 691  LYS A NZ    1 
ATOM   5029  N  N     . ARG A 1 692  ? -41.392 -50.828 -39.814 1.00 95.84  ? 692  ARG A N     1 
ATOM   5030  C  CA    . ARG A 1 692  ? -41.188 -52.238 -39.484 1.00 96.27  ? 692  ARG A CA    1 
ATOM   5031  C  C     . ARG A 1 692  ? -39.730 -52.576 -39.106 1.00 90.89  ? 692  ARG A C     1 
ATOM   5032  O  O     . ARG A 1 692  ? -39.397 -53.743 -38.926 1.00 82.90  ? 692  ARG A O     1 
ATOM   5033  C  CB    . ARG A 1 692  ? -41.676 -53.066 -40.678 1.00 102.80 ? 692  ARG A CB    1 
ATOM   5034  C  CG    . ARG A 1 692  ? -43.192 -53.209 -40.691 1.00 110.42 ? 692  ARG A CG    1 
ATOM   5035  C  CD    . ARG A 1 692  ? -43.604 -54.337 -39.747 1.00 121.10 ? 692  ARG A CD    1 
ATOM   5036  N  NE    . ARG A 1 692  ? -44.908 -54.159 -39.117 1.00 133.11 ? 692  ARG A NE    1 
ATOM   5037  C  CZ    . ARG A 1 692  ? -46.079 -54.271 -39.744 1.00 144.58 ? 692  ARG A CZ    1 
ATOM   5038  N  NH1   . ARG A 1 692  ? -46.131 -54.546 -41.044 1.00 157.22 ? 692  ARG A NH1   1 
ATOM   5039  N  NH2   . ARG A 1 692  ? -47.212 -54.091 -39.071 1.00 140.23 ? 692  ARG A NH2   1 
ATOM   5040  N  N     . VAL A 1 693  ? -38.861 -51.557 -39.015 1.00 94.45  ? 693  VAL A N     1 
ATOM   5041  C  CA    . VAL A 1 693  ? -37.489 -51.760 -38.570 1.00 99.84  ? 693  VAL A CA    1 
ATOM   5042  C  C     . VAL A 1 693  ? -37.473 -51.835 -37.056 1.00 96.20  ? 693  VAL A C     1 
ATOM   5043  O  O     . VAL A 1 693  ? -37.947 -50.920 -36.390 1.00 101.71 ? 693  VAL A O     1 
ATOM   5044  C  CB    . VAL A 1 693  ? -36.599 -50.596 -38.996 1.00 106.71 ? 693  VAL A CB    1 
ATOM   5045  C  CG1   . VAL A 1 693  ? -35.203 -50.788 -38.436 1.00 111.70 ? 693  VAL A CG1   1 
ATOM   5046  C  CG2   . VAL A 1 693  ? -36.576 -50.481 -40.513 1.00 113.17 ? 693  VAL A CG2   1 
ATOM   5047  N  N     . LYS A 1 694  ? -36.927 -52.916 -36.501 1.00 100.61 ? 694  LYS A N     1 
ATOM   5048  C  CA    . LYS A 1 694  ? -36.948 -53.142 -35.051 1.00 109.12 ? 694  LYS A CA    1 
ATOM   5049  C  C     . LYS A 1 694  ? -35.590 -52.818 -34.464 1.00 96.80  ? 694  LYS A C     1 
ATOM   5050  O  O     . LYS A 1 694  ? -34.604 -53.472 -34.800 1.00 102.21 ? 694  LYS A O     1 
ATOM   5051  C  CB    . LYS A 1 694  ? -37.301 -54.620 -34.742 1.00 127.63 ? 694  LYS A CB    1 
ATOM   5052  C  CG    . LYS A 1 694  ? -38.761 -54.916 -34.356 1.00 139.44 ? 694  LYS A CG    1 
ATOM   5053  C  CD    . LYS A 1 694  ? -39.003 -54.946 -32.835 1.00 141.94 ? 694  LYS A CD    1 
ATOM   5054  C  CE    . LYS A 1 694  ? -39.295 -53.572 -32.236 1.00 138.04 ? 694  LYS A CE    1 
ATOM   5055  N  NZ    . LYS A 1 694  ? -40.470 -52.918 -32.886 1.00 137.84 ? 694  LYS A NZ    1 
ATOM   5056  N  N     . ILE A 1 695  ? -35.548 -51.817 -33.583 1.00 94.82  ? 695  ILE A N     1 
ATOM   5057  C  CA    . ILE A 1 695  ? -34.323 -51.425 -32.891 1.00 94.67  ? 695  ILE A CA    1 
ATOM   5058  C  C     . ILE A 1 695  ? -34.529 -51.634 -31.403 1.00 92.32  ? 695  ILE A C     1 
ATOM   5059  O  O     . ILE A 1 695  ? -35.468 -51.101 -30.821 1.00 104.21 ? 695  ILE A O     1 
ATOM   5060  C  CB    . ILE A 1 695  ? -33.937 -49.959 -33.188 1.00 92.38  ? 695  ILE A CB    1 
ATOM   5061  C  CG1   . ILE A 1 695  ? -34.050 -49.673 -34.699 1.00 83.85  ? 695  ILE A CG1   1 
ATOM   5062  C  CG2   . ILE A 1 695  ? -32.537 -49.679 -32.661 1.00 95.24  ? 695  ILE A CG2   1 
ATOM   5063  C  CD1   . ILE A 1 695  ? -33.412 -48.383 -35.172 1.00 73.58  ? 695  ILE A CD1   1 
ATOM   5064  N  N     . VAL A 1 696  ? -33.667 -52.430 -30.788 1.00 92.07  ? 696  VAL A N     1 
ATOM   5065  C  CA    . VAL A 1 696  ? -33.740 -52.687 -29.355 1.00 99.36  ? 696  VAL A CA    1 
ATOM   5066  C  C     . VAL A 1 696  ? -32.668 -51.829 -28.664 1.00 93.78  ? 696  VAL A C     1 
ATOM   5067  O  O     . VAL A 1 696  ? -31.523 -51.773 -29.122 1.00 82.48  ? 696  VAL A O     1 
ATOM   5068  C  CB    . VAL A 1 696  ? -33.581 -54.200 -29.074 1.00 100.48 ? 696  VAL A CB    1 
ATOM   5069  C  CG1   . VAL A 1 696  ? -34.037 -54.541 -27.655 1.00 98.20  ? 696  VAL A CG1   1 
ATOM   5070  C  CG2   . VAL A 1 696  ? -34.387 -55.015 -30.092 1.00 104.28 ? 696  VAL A CG2   1 
ATOM   5071  N  N     . TYR A 1 697  ? -33.071 -51.156 -27.584 1.00 95.57  ? 697  TYR A N     1 
ATOM   5072  C  CA    . TYR A 1 697  ? -32.239 -50.174 -26.896 1.00 103.29 ? 697  TYR A CA    1 
ATOM   5073  C  C     . TYR A 1 697  ? -31.917 -50.614 -25.459 1.00 112.35 ? 697  TYR A C     1 
ATOM   5074  O  O     . TYR A 1 697  ? -32.555 -51.509 -24.908 1.00 133.64 ? 697  TYR A O     1 
ATOM   5075  C  CB    . TYR A 1 697  ? -33.005 -48.847 -26.815 1.00 91.97  ? 697  TYR A CB    1 
ATOM   5076  C  CG    . TYR A 1 697  ? -33.220 -48.154 -28.128 1.00 84.07  ? 697  TYR A CG    1 
ATOM   5077  C  CD1   . TYR A 1 697  ? -32.260 -47.302 -28.662 1.00 86.94  ? 697  TYR A CD1   1 
ATOM   5078  C  CD2   . TYR A 1 697  ? -34.390 -48.317 -28.820 1.00 90.74  ? 697  TYR A CD2   1 
ATOM   5079  C  CE1   . TYR A 1 697  ? -32.461 -46.643 -29.877 1.00 96.38  ? 697  TYR A CE1   1 
ATOM   5080  C  CE2   . TYR A 1 697  ? -34.614 -47.666 -30.037 1.00 99.27  ? 697  TYR A CE2   1 
ATOM   5081  C  CZ    . TYR A 1 697  ? -33.656 -46.828 -30.578 1.00 99.01  ? 697  TYR A CZ    1 
ATOM   5082  O  OH    . TYR A 1 697  ? -33.915 -46.194 -31.802 1.00 83.92  ? 697  TYR A OH    1 
ATOM   5083  N  N     . GLN A 1 698  ? -30.910 -49.964 -24.877 1.00 104.36 ? 698  GLN A N     1 
ATOM   5084  C  CA    . GLN A 1 698  ? -30.625 -50.033 -23.435 1.00 112.10 ? 698  GLN A CA    1 
ATOM   5085  C  C     . GLN A 1 698  ? -30.246 -48.633 -22.957 1.00 104.86 ? 698  GLN A C     1 
ATOM   5086  O  O     . GLN A 1 698  ? -29.202 -48.108 -23.354 1.00 109.81 ? 698  GLN A O     1 
ATOM   5087  C  CB    . GLN A 1 698  ? -29.484 -51.005 -23.193 1.00 119.74 ? 698  GLN A CB    1 
ATOM   5088  C  CG    . GLN A 1 698  ? -29.290 -51.443 -21.758 1.00 118.06 ? 698  GLN A CG    1 
ATOM   5089  C  CD    . GLN A 1 698  ? -28.392 -52.655 -21.709 1.00 123.81 ? 698  GLN A CD    1 
ATOM   5090  O  OE1   . GLN A 1 698  ? -27.415 -52.745 -22.466 1.00 115.67 ? 698  GLN A OE1   1 
ATOM   5091  N  NE2   . GLN A 1 698  ? -28.729 -53.613 -20.850 1.00 128.42 ? 698  GLN A NE2   1 
ATOM   5092  N  N     . ASP A 1 699  ? -31.084 -48.030 -22.110 1.00 95.95  ? 699  ASP A N     1 
ATOM   5093  C  CA    . ASP A 1 699  ? -30.870 -46.644 -21.656 1.00 94.22  ? 699  ASP A CA    1 
ATOM   5094  C  C     . ASP A 1 699  ? -29.543 -46.469 -20.927 1.00 89.42  ? 699  ASP A C     1 
ATOM   5095  O  O     . ASP A 1 699  ? -29.078 -47.394 -20.252 1.00 83.29  ? 699  ASP A O     1 
ATOM   5096  C  CB    . ASP A 1 699  ? -32.000 -46.199 -20.730 1.00 99.80  ? 699  ASP A CB    1 
ATOM   5097  C  CG    . ASP A 1 699  ? -33.240 -45.793 -21.487 1.00 104.33 ? 699  ASP A CG    1 
ATOM   5098  O  OD1   . ASP A 1 699  ? -33.125 -45.000 -22.451 1.00 106.34 ? 699  ASP A OD1   1 
ATOM   5099  O  OD2   . ASP A 1 699  ? -34.335 -46.278 -21.131 1.00 104.76 ? 699  ASP A OD2   1 
ATOM   5100  N  N     . LEU A 1 700  ? -28.952 -45.284 -21.082 1.00 94.41  ? 700  LEU A N     1 
ATOM   5101  C  CA    . LEU A 1 700  ? -27.646 -44.947 -20.495 1.00 98.06  ? 700  LEU A CA    1 
ATOM   5102  C  C     . LEU A 1 700  ? -27.763 -43.741 -19.576 1.00 100.88 ? 700  LEU A C     1 
ATOM   5103  O  O     . LEU A 1 700  ? -28.588 -42.861 -19.814 1.00 104.37 ? 700  LEU A O     1 
ATOM   5104  C  CB    . LEU A 1 700  ? -26.661 -44.590 -21.597 1.00 99.82  ? 700  LEU A CB    1 
ATOM   5105  C  CG    . LEU A 1 700  ? -26.166 -45.738 -22.467 1.00 104.50 ? 700  LEU A CG    1 
ATOM   5106  C  CD1   . LEU A 1 700  ? -25.227 -45.174 -23.526 1.00 103.63 ? 700  LEU A CD1   1 
ATOM   5107  C  CD2   . LEU A 1 700  ? -25.472 -46.798 -21.621 1.00 105.21 ? 700  LEU A CD2   1 
ATOM   5108  N  N     . GLU A 1 701  ? -26.945 -43.739 -18.513 1.00 108.98 ? 701  GLU A N     1 
ATOM   5109  C  CA    . GLU A 1 701  ? -26.883 -42.623 -17.560 1.00 112.55 ? 701  GLU A CA    1 
ATOM   5110  C  C     . GLU A 1 701  ? -25.556 -41.878 -17.727 1.00 102.41 ? 701  GLU A C     1 
ATOM   5111  O  O     . GLU A 1 701  ? -24.557 -42.514 -18.028 1.00 87.99  ? 701  GLU A O     1 
ATOM   5112  C  CB    . GLU A 1 701  ? -26.956 -43.160 -16.133 1.00 125.90 ? 701  GLU A CB    1 
ATOM   5113  C  CG    . GLU A 1 701  ? -28.006 -44.238 -15.905 1.00 143.83 ? 701  GLU A CG    1 
ATOM   5114  C  CD    . GLU A 1 701  ? -29.416 -43.769 -16.223 1.00 159.35 ? 701  GLU A CD    1 
ATOM   5115  O  OE1   . GLU A 1 701  ? -29.860 -42.774 -15.609 1.00 156.50 ? 701  GLU A OE1   1 
ATOM   5116  O  OE2   . GLU A 1 701  ? -30.081 -44.401 -17.079 1.00 177.11 ? 701  GLU A OE2   1 
ATOM   5117  N  N     . PRO A 1 702  ? -25.546 -40.541 -17.553 1.00 100.85 ? 702  PRO A N     1 
ATOM   5118  C  CA    . PRO A 1 702  ? -26.702 -39.716 -17.216 1.00 99.03  ? 702  PRO A CA    1 
ATOM   5119  C  C     . PRO A 1 702  ? -27.486 -39.255 -18.444 1.00 102.02 ? 702  PRO A C     1 
ATOM   5120  O  O     . PRO A 1 702  ? -26.900 -39.018 -19.511 1.00 111.34 ? 702  PRO A O     1 
ATOM   5121  C  CB    . PRO A 1 702  ? -26.056 -38.540 -16.494 1.00 105.16 ? 702  PRO A CB    1 
ATOM   5122  C  CG    . PRO A 1 702  ? -24.610 -38.503 -16.989 1.00 110.02 ? 702  PRO A CG    1 
ATOM   5123  C  CD    . PRO A 1 702  ? -24.346 -39.724 -17.807 1.00 99.05  ? 702  PRO A CD    1 
ATOM   5124  N  N     . LEU A 1 703  ? -28.806 -39.127 -18.300 1.00 95.23  ? 703  LEU A N     1 
ATOM   5125  C  CA    . LEU A 1 703  ? -29.638 -38.513 -19.336 1.00 89.59  ? 703  LEU A CA    1 
ATOM   5126  C  C     . LEU A 1 703  ? -29.711 -36.997 -19.067 1.00 83.73  ? 703  LEU A C     1 
ATOM   5127  O  O     . LEU A 1 703  ? -30.491 -36.539 -18.248 1.00 69.03  ? 703  LEU A O     1 
ATOM   5128  C  CB    . LEU A 1 703  ? -31.054 -39.135 -19.419 1.00 90.55  ? 703  LEU A CB    1 
ATOM   5129  C  CG    . LEU A 1 703  ? -32.172 -38.280 -20.091 1.00 105.93 ? 703  LEU A CG    1 
ATOM   5130  C  CD1   . LEU A 1 703  ? -31.807 -37.860 -21.514 1.00 113.31 ? 703  LEU A CD1   1 
ATOM   5131  C  CD2   . LEU A 1 703  ? -33.553 -38.938 -20.084 1.00 105.06 ? 703  LEU A CD2   1 
ATOM   5132  N  N     . ILE A 1 704  ? -28.898 -36.245 -19.800 1.00 88.46  ? 704  ILE A N     1 
ATOM   5133  C  CA    . ILE A 1 704  ? -28.724 -34.807 -19.594 1.00 97.59  ? 704  ILE A CA    1 
ATOM   5134  C  C     . ILE A 1 704  ? -29.687 -34.047 -20.522 1.00 91.59  ? 704  ILE A C     1 
ATOM   5135  O  O     . ILE A 1 704  ? -29.627 -34.206 -21.740 1.00 97.44  ? 704  ILE A O     1 
ATOM   5136  C  CB    . ILE A 1 704  ? -27.236 -34.430 -19.848 1.00 101.69 ? 704  ILE A CB    1 
ATOM   5137  C  CG1   . ILE A 1 704  ? -26.275 -35.484 -19.227 1.00 101.43 ? 704  ILE A CG1   1 
ATOM   5138  C  CG2   . ILE A 1 704  ? -26.939 -33.033 -19.313 1.00 99.61  ? 704  ILE A CG2   1 
ATOM   5139  C  CD1   . ILE A 1 704  ? -25.297 -36.145 -20.206 1.00 107.13 ? 704  ILE A CD1   1 
ATOM   5140  N  N     . LEU A 1 705  ? -30.588 -33.245 -19.949 1.00 87.02  ? 705  LEU A N     1 
ATOM   5141  C  CA    . LEU A 1 705  ? -31.553 -32.465 -20.751 1.00 88.31  ? 705  LEU A CA    1 
ATOM   5142  C  C     . LEU A 1 705  ? -31.480 -30.959 -20.571 1.00 90.77  ? 705  LEU A C     1 
ATOM   5143  O  O     . LEU A 1 705  ? -31.661 -30.229 -21.533 1.00 95.11  ? 705  LEU A O     1 
ATOM   5144  C  CB    . LEU A 1 705  ? -32.993 -32.939 -20.520 1.00 94.58  ? 705  LEU A CB    1 
ATOM   5145  C  CG    . LEU A 1 705  ? -33.327 -34.409 -20.855 1.00 100.78 ? 705  LEU A CG    1 
ATOM   5146  C  CD1   . LEU A 1 705  ? -34.726 -34.775 -20.365 1.00 103.20 ? 705  LEU A CD1   1 
ATOM   5147  C  CD2   . LEU A 1 705  ? -33.201 -34.722 -22.338 1.00 94.91  ? 705  LEU A CD2   1 
ATOM   5148  N  N     . THR A 1 706  ? -31.273 -30.489 -19.348 1.00 103.85 ? 706  THR A N     1 
ATOM   5149  C  CA    . THR A 1 706  ? -31.208 -29.046 -19.074 1.00 103.43 ? 706  THR A CA    1 
ATOM   5150  C  C     . THR A 1 706  ? -29.766 -28.535 -19.167 1.00 107.31 ? 706  THR A C     1 
ATOM   5151  O  O     . THR A 1 706  ? -28.798 -29.311 -19.282 1.00 110.16 ? 706  THR A O     1 
ATOM   5152  C  CB    . THR A 1 706  ? -31.778 -28.711 -17.682 1.00 98.30  ? 706  THR A CB    1 
ATOM   5153  O  OG1   . THR A 1 706  ? -31.071 -29.464 -16.686 1.00 95.97  ? 706  THR A OG1   1 
ATOM   5154  C  CG2   . THR A 1 706  ? -33.281 -29.027 -17.611 1.00 102.29 ? 706  THR A CG2   1 
ATOM   5155  N  N     . ILE A 1 707  ? -29.635 -27.213 -19.057 1.00 101.95 ? 707  ILE A N     1 
ATOM   5156  C  CA    . ILE A 1 707  ? -28.336 -26.544 -18.961 1.00 99.49  ? 707  ILE A CA    1 
ATOM   5157  C  C     . ILE A 1 707  ? -27.677 -26.814 -17.604 1.00 110.28 ? 707  ILE A C     1 
ATOM   5158  O  O     . ILE A 1 707  ? -26.459 -26.915 -17.524 1.00 127.57 ? 707  ILE A O     1 
ATOM   5159  C  CB    . ILE A 1 707  ? -28.479 -25.027 -19.165 1.00 95.27  ? 707  ILE A CB    1 
ATOM   5160  C  CG1   . ILE A 1 707  ? -28.765 -24.711 -20.627 1.00 99.66  ? 707  ILE A CG1   1 
ATOM   5161  C  CG2   . ILE A 1 707  ? -27.220 -24.295 -18.736 1.00 97.36  ? 707  ILE A CG2   1 
ATOM   5162  C  CD1   . ILE A 1 707  ? -29.154 -23.264 -20.866 1.00 102.95 ? 707  ILE A CD1   1 
ATOM   5163  N  N     . GLU A 1 708  ? -28.476 -26.954 -16.545 1.00 123.01 ? 708  GLU A N     1 
ATOM   5164  C  CA    . GLU A 1 708  ? -27.944 -27.159 -15.179 1.00 123.09 ? 708  GLU A CA    1 
ATOM   5165  C  C     . GLU A 1 708  ? -27.394 -28.563 -14.988 1.00 117.44 ? 708  GLU A C     1 
ATOM   5166  O  O     . GLU A 1 708  ? -26.372 -28.740 -14.322 1.00 124.16 ? 708  GLU A O     1 
ATOM   5167  C  CB    . GLU A 1 708  ? -29.004 -26.938 -14.095 1.00 124.10 ? 708  GLU A CB    1 
ATOM   5168  C  CG    . GLU A 1 708  ? -29.049 -25.532 -13.526 1.00 131.13 ? 708  GLU A CG    1 
ATOM   5169  C  CD    . GLU A 1 708  ? -30.184 -24.710 -14.108 1.00 128.14 ? 708  GLU A CD    1 
ATOM   5170  O  OE1   . GLU A 1 708  ? -30.008 -24.167 -15.218 1.00 112.36 ? 708  GLU A OE1   1 
ATOM   5171  O  OE2   . GLU A 1 708  ? -31.245 -24.598 -13.444 1.00 131.27 ? 708  GLU A OE2   1 
ATOM   5172  N  N     . GLU A 1 709  ? -28.085 -29.551 -15.554 1.00 107.45 ? 709  GLU A N     1 
ATOM   5173  C  CA    . GLU A 1 709  ? -27.595 -30.932 -15.609 1.00 110.02 ? 709  GLU A CA    1 
ATOM   5174  C  C     . GLU A 1 709  ? -26.288 -31.034 -16.383 1.00 118.21 ? 709  GLU A C     1 
ATOM   5175  O  O     . GLU A 1 709  ? -25.402 -31.796 -16.005 1.00 136.35 ? 709  GLU A O     1 
ATOM   5176  C  CB    . GLU A 1 709  ? -28.654 -31.817 -16.231 1.00 100.36 ? 709  GLU A CB    1 
ATOM   5177  C  CG    . GLU A 1 709  ? -29.828 -32.016 -15.299 1.00 102.02 ? 709  GLU A CG    1 
ATOM   5178  C  CD    . GLU A 1 709  ? -31.075 -32.463 -16.016 1.00 107.81 ? 709  GLU A CD    1 
ATOM   5179  O  OE1   . GLU A 1 709  ? -31.095 -32.423 -17.260 1.00 122.25 ? 709  GLU A OE1   1 
ATOM   5180  O  OE2   . GLU A 1 709  ? -32.046 -32.844 -15.337 1.00 113.83 ? 709  GLU A OE2   1 
ATOM   5181  N  N     . SER A 1 710  ? -26.166 -30.254 -17.451 1.00 114.70 ? 710  SER A N     1 
ATOM   5182  C  CA    . SER A 1 710  ? -24.953 -30.227 -18.273 1.00 107.80 ? 710  SER A CA    1 
ATOM   5183  C  C     . SER A 1 710  ? -23.685 -29.708 -17.571 1.00 101.35 ? 710  SER A C     1 
ATOM   5184  O  O     . SER A 1 710  ? -22.588 -29.908 -18.077 1.00 104.67 ? 710  SER A O     1 
ATOM   5185  C  CB    . SER A 1 710  ? -25.213 -29.371 -19.517 1.00 112.47 ? 710  SER A CB    1 
ATOM   5186  O  OG    . SER A 1 710  ? -24.313 -29.668 -20.571 1.00 117.73 ? 710  SER A OG    1 
ATOM   5187  N  N     . ILE A 1 711  ? -23.817 -29.075 -16.411 1.00 105.74 ? 711  ILE A N     1 
ATOM   5188  C  CA    . ILE A 1 711  ? -22.630 -28.640 -15.634 1.00 107.54 ? 711  ILE A CA    1 
ATOM   5189  C  C     . ILE A 1 711  ? -22.105 -29.769 -14.717 1.00 112.42 ? 711  ILE A C     1 
ATOM   5190  O  O     . ILE A 1 711  ? -21.478 -29.511 -13.682 1.00 104.94 ? 711  ILE A O     1 
ATOM   5191  C  CB    . ILE A 1 711  ? -22.880 -27.316 -14.846 1.00 97.93  ? 711  ILE A CB    1 
ATOM   5192  C  CG1   . ILE A 1 711  ? -23.867 -26.400 -15.576 1.00 88.38  ? 711  ILE A CG1   1 
ATOM   5193  C  CG2   . ILE A 1 711  ? -21.576 -26.541 -14.636 1.00 97.01  ? 711  ILE A CG2   1 
ATOM   5194  C  CD1   . ILE A 1 711  ? -23.528 -26.151 -17.028 1.00 82.68  ? 711  ILE A CD1   1 
ATOM   5195  N  N     . GLN A 1 712  ? -22.424 -31.031 -15.038 1.00 119.96 ? 712  GLN A N     1 
ATOM   5196  C  CA    . GLN A 1 712  ? -21.801 -32.205 -14.395 1.00 114.64 ? 712  GLN A CA    1 
ATOM   5197  C  C     . GLN A 1 712  ? -21.971 -33.440 -15.276 1.00 107.76 ? 712  GLN A C     1 
ATOM   5198  O  O     . GLN A 1 712  ? -21.017 -33.826 -15.932 1.00 95.64  ? 712  GLN A O     1 
ATOM   5199  C  CB    . GLN A 1 712  ? -22.434 -32.517 -13.046 1.00 110.80 ? 712  GLN A CB    1 
ATOM   5200  C  CG    . GLN A 1 712  ? -23.952 -32.440 -13.036 1.00 108.18 ? 712  GLN A CG    1 
ATOM   5201  C  CD    . GLN A 1 712  ? -24.446 -31.127 -12.439 1.00 106.48 ? 712  GLN A CD    1 
ATOM   5202  O  OE1   . GLN A 1 712  ? -24.967 -31.117 -11.321 1.00 104.70 ? 712  GLN A OE1   1 
ATOM   5203  N  NE2   . GLN A 1 712  ? -24.263 -30.012 -13.160 1.00 90.35  ? 712  GLN A NE2   1 
ATOM   5204  N  N     . SER A 1 716  ? -15.696 -32.081 -17.286 1.00 139.87 ? 716  SER A N     1 
ATOM   5205  C  CA    . SER A 1 716  ? -14.320 -32.236 -17.744 1.00 138.88 ? 716  SER A CA    1 
ATOM   5206  C  C     . SER A 1 716  ? -13.699 -30.902 -18.193 1.00 142.92 ? 716  SER A C     1 
ATOM   5207  O  O     . SER A 1 716  ? -13.051 -30.238 -17.362 1.00 156.82 ? 716  SER A O     1 
ATOM   5208  C  CB    . SER A 1 716  ? -14.260 -33.287 -18.848 1.00 139.80 ? 716  SER A CB    1 
ATOM   5209  O  OG    . SER A 1 716  ? -15.165 -32.953 -19.882 1.00 142.96 ? 716  SER A OG    1 
ATOM   5210  N  N     . PHE A 1 717  ? -13.873 -30.506 -19.471 1.00 133.30 ? 717  PHE A N     1 
ATOM   5211  C  CA    . PHE A 1 717  ? -13.359 -29.196 -19.943 1.00 125.03 ? 717  PHE A CA    1 
ATOM   5212  C  C     . PHE A 1 717  ? -14.146 -28.606 -21.103 1.00 121.63 ? 717  PHE A C     1 
ATOM   5213  O  O     . PHE A 1 717  ? -14.157 -29.183 -22.163 1.00 113.01 ? 717  PHE A O     1 
ATOM   5214  C  CB    . PHE A 1 717  ? -11.873 -29.299 -20.343 1.00 121.05 ? 717  PHE A CB    1 
ATOM   5215  C  CG    . PHE A 1 717  ? -11.372 -28.130 -21.177 1.00 118.00 ? 717  PHE A CG    1 
ATOM   5216  C  CD1   . PHE A 1 717  ? -11.023 -26.922 -20.581 1.00 117.56 ? 717  PHE A CD1   1 
ATOM   5217  C  CD2   . PHE A 1 717  ? -11.249 -28.238 -22.565 1.00 114.69 ? 717  PHE A CD2   1 
ATOM   5218  C  CE1   . PHE A 1 717  ? -10.566 -25.847 -21.346 1.00 111.26 ? 717  PHE A CE1   1 
ATOM   5219  C  CE2   . PHE A 1 717  ? -10.792 -27.166 -23.333 1.00 109.55 ? 717  PHE A CE2   1 
ATOM   5220  C  CZ    . PHE A 1 717  ? -10.447 -25.970 -22.724 1.00 105.01 ? 717  PHE A CZ    1 
ATOM   5221  N  N     . LYS A 1 718  ? -14.769 -27.445 -20.868 1.00 111.04 ? 718  LYS A N     1 
ATOM   5222  C  CA    . LYS A 1 718  ? -15.435 -26.658 -21.903 1.00 110.50 ? 718  LYS A CA    1 
ATOM   5223  C  C     . LYS A 1 718  ? -14.595 -25.395 -22.197 1.00 108.10 ? 718  LYS A C     1 
ATOM   5224  O  O     . LYS A 1 718  ? -14.015 -24.810 -21.249 1.00 121.73 ? 718  LYS A O     1 
ATOM   5225  C  CB    . LYS A 1 718  ? -16.880 -26.281 -21.478 1.00 116.36 ? 718  LYS A CB    1 
ATOM   5226  C  CG    . LYS A 1 718  ? -17.865 -27.456 -21.316 1.00 115.30 ? 718  LYS A CG    1 
ATOM   5227  C  CD    . LYS A 1 718  ? -18.196 -28.118 -22.657 1.00 118.52 ? 718  LYS A CD    1 
ATOM   5228  C  CE    . LYS A 1 718  ? -18.339 -29.636 -22.579 1.00 119.58 ? 718  LYS A CE    1 
ATOM   5229  N  NZ    . LYS A 1 718  ? -19.720 -30.103 -22.875 1.00 119.44 ? 718  LYS A NZ    1 
ATOM   5230  N  N     . PRO A 1 719  ? -14.448 -25.045 -23.492 1.00 114.94 ? 719  PRO A N     1 
ATOM   5231  C  CA    . PRO A 1 719  ? -13.709 -23.813 -23.763 1.00 116.03 ? 719  PRO A CA    1 
ATOM   5232  C  C     . PRO A 1 719  ? -14.542 -22.571 -23.388 1.00 108.97 ? 719  PRO A C     1 
ATOM   5233  O  O     . PRO A 1 719  ? -15.720 -22.492 -23.706 1.00 118.06 ? 719  PRO A O     1 
ATOM   5234  C  CB    . PRO A 1 719  ? -13.401 -23.872 -25.275 1.00 118.47 ? 719  PRO A CB    1 
ATOM   5235  C  CG    . PRO A 1 719  ? -14.156 -25.040 -25.823 1.00 122.23 ? 719  PRO A CG    1 
ATOM   5236  C  CD    . PRO A 1 719  ? -14.598 -25.910 -24.682 1.00 117.20 ? 719  PRO A CD    1 
ATOM   5237  N  N     . GLU A 1 720  ? -13.919 -21.632 -22.697 1.00 106.48 ? 720  GLU A N     1 
ATOM   5238  C  CA    . GLU A 1 720  ? -14.568 -20.395 -22.299 1.00 116.94 ? 720  GLU A CA    1 
ATOM   5239  C  C     . GLU A 1 720  ? -14.438 -19.381 -23.438 1.00 112.35 ? 720  GLU A C     1 
ATOM   5240  O  O     . GLU A 1 720  ? -13.508 -19.447 -24.235 1.00 122.19 ? 720  GLU A O     1 
ATOM   5241  C  CB    . GLU A 1 720  ? -13.883 -19.895 -21.038 1.00 125.78 ? 720  GLU A CB    1 
ATOM   5242  C  CG    . GLU A 1 720  ? -14.541 -18.722 -20.360 1.00 130.70 ? 720  GLU A CG    1 
ATOM   5243  C  CD    . GLU A 1 720  ? -13.670 -18.210 -19.241 1.00 139.81 ? 720  GLU A CD    1 
ATOM   5244  O  OE1   . GLU A 1 720  ? -13.344 -19.018 -18.338 1.00 130.69 ? 720  GLU A OE1   1 
ATOM   5245  O  OE2   . GLU A 1 720  ? -13.303 -17.011 -19.282 1.00 145.38 ? 720  GLU A OE2   1 
ATOM   5246  N  N     . ARG A 1 721  ? -15.386 -18.456 -23.530 1.00 101.81 ? 721  ARG A N     1 
ATOM   5247  C  CA    . ARG A 1 721  ? -15.118 -17.133 -24.159 1.00 105.27 ? 721  ARG A CA    1 
ATOM   5248  C  C     . ARG A 1 721  ? -15.307 -16.001 -23.167 1.00 110.20 ? 721  ARG A C     1 
ATOM   5249  O  O     . ARG A 1 721  ? -16.108 -16.134 -22.237 1.00 108.89 ? 721  ARG A O     1 
ATOM   5250  C  CB    . ARG A 1 721  ? -16.023 -16.894 -25.349 1.00 110.23 ? 721  ARG A CB    1 
ATOM   5251  C  CG    . ARG A 1 721  ? -15.638 -17.684 -26.578 1.00 119.60 ? 721  ARG A CG    1 
ATOM   5252  C  CD    . ARG A 1 721  ? -14.515 -17.030 -27.371 1.00 125.89 ? 721  ARG A CD    1 
ATOM   5253  N  NE    . ARG A 1 721  ? -14.213 -17.793 -28.583 1.00 129.47 ? 721  ARG A NE    1 
ATOM   5254  C  CZ    . ARG A 1 721  ? -13.608 -18.984 -28.602 1.00 138.49 ? 721  ARG A CZ    1 
ATOM   5255  N  NH1   . ARG A 1 721  ? -13.191 -19.579 -27.483 1.00 139.00 ? 721  ARG A NH1   1 
ATOM   5256  N  NH2   . ARG A 1 721  ? -13.405 -19.591 -29.763 1.00 140.95 ? 721  ARG A NH2   1 
ATOM   5257  N  N     . LYS A 1 722  ? -14.582 -14.898 -23.368 1.00 107.53 ? 722  LYS A N     1 
ATOM   5258  C  CA    . LYS A 1 722  ? -14.632 -13.784 -22.405 1.00 103.38 ? 722  LYS A CA    1 
ATOM   5259  C  C     . LYS A 1 722  ? -14.362 -12.416 -22.998 1.00 96.09  ? 722  LYS A C     1 
ATOM   5260  O  O     . LYS A 1 722  ? -13.473 -12.266 -23.840 1.00 92.88  ? 722  LYS A O     1 
ATOM   5261  C  CB    . LYS A 1 722  ? -13.631 -14.050 -21.291 1.00 108.73 ? 722  LYS A CB    1 
ATOM   5262  C  CG    . LYS A 1 722  ? -13.855 -13.202 -20.054 1.00 114.42 ? 722  LYS A CG    1 
ATOM   5263  C  CD    . LYS A 1 722  ? -12.761 -13.405 -19.032 1.00 117.69 ? 722  LYS A CD    1 
ATOM   5264  C  CE    . LYS A 1 722  ? -11.507 -12.657 -19.457 1.00 124.59 ? 722  LYS A CE    1 
ATOM   5265  N  NZ    . LYS A 1 722  ? -10.337 -13.056 -18.633 1.00 139.66 ? 722  LYS A NZ    1 
ATOM   5266  N  N     . LEU A 1 723  ? -15.148 -11.433 -22.548 1.00 104.21 ? 723  LEU A N     1 
ATOM   5267  C  CA    . LEU A 1 723  ? -14.930 -10.027 -22.850 1.00 113.59 ? 723  LEU A CA    1 
ATOM   5268  C  C     . LEU A 1 723  ? -14.789 -9.321  -21.513 1.00 120.22 ? 723  LEU A C     1 
ATOM   5269  O  O     . LEU A 1 723  ? -15.535 -9.638  -20.579 1.00 102.46 ? 723  LEU A O     1 
ATOM   5270  C  CB    . LEU A 1 723  ? -16.161 -9.443  -23.544 1.00 116.63 ? 723  LEU A CB    1 
ATOM   5271  C  CG    . LEU A 1 723  ? -16.245 -9.435  -25.060 1.00 121.18 ? 723  LEU A CG    1 
ATOM   5272  C  CD1   . LEU A 1 723  ? -17.596 -8.898  -25.507 1.00 128.82 ? 723  LEU A CD1   1 
ATOM   5273  C  CD2   . LEU A 1 723  ? -15.136 -8.562  -25.602 1.00 127.89 ? 723  LEU A CD2   1 
ATOM   5274  N  N     . GLU A 1 724  ? -13.818 -8.412  -21.423 1.00 125.48 ? 724  GLU A N     1 
ATOM   5275  C  CA    . GLU A 1 724  ? -13.665 -7.572  -20.252 1.00 113.42 ? 724  GLU A CA    1 
ATOM   5276  C  C     . GLU A 1 724  ? -13.471 -6.131  -20.642 1.00 110.96 ? 724  GLU A C     1 
ATOM   5277  O  O     . GLU A 1 724  ? -12.638 -5.833  -21.488 1.00 109.13 ? 724  GLU A O     1 
ATOM   5278  C  CB    . GLU A 1 724  ? -12.535 -8.026  -19.357 1.00 110.52 ? 724  GLU A CB    1 
ATOM   5279  C  CG    . GLU A 1 724  ? -13.056 -8.667  -18.093 1.00 113.32 ? 724  GLU A CG    1 
ATOM   5280  C  CD    . GLU A 1 724  ? -12.083 -9.669  -17.567 1.00 117.83 ? 724  GLU A CD    1 
ATOM   5281  O  OE1   . GLU A 1 724  ? -10.875 -9.419  -17.752 1.00 130.31 ? 724  GLU A OE1   1 
ATOM   5282  O  OE2   . GLU A 1 724  ? -12.521 -10.698 -17.007 1.00 115.28 ? 724  GLU A OE2   1 
ATOM   5283  N  N     . TYR A 1 725  ? -14.274 -5.258  -20.052 1.00 105.99 ? 725  TYR A N     1 
ATOM   5284  C  CA    . TYR A 1 725  ? -14.142 -3.812  -20.222 1.00 105.32 ? 725  TYR A CA    1 
ATOM   5285  C  C     . TYR A 1 725  ? -13.961 -3.214  -18.843 1.00 102.96 ? 725  TYR A C     1 
ATOM   5286  O  O     . TYR A 1 725  ? -14.568 -3.693  -17.892 1.00 108.79 ? 725  TYR A O     1 
ATOM   5287  C  CB    . TYR A 1 725  ? -15.393 -3.271  -20.880 1.00 103.42 ? 725  TYR A CB    1 
ATOM   5288  C  CG    . TYR A 1 725  ? -15.208 -1.952  -21.550 1.00 100.60 ? 725  TYR A CG    1 
ATOM   5289  C  CD1   . TYR A 1 725  ? -14.181 -1.753  -22.444 1.00 103.13 ? 725  TYR A CD1   1 
ATOM   5290  C  CD2   . TYR A 1 725  ? -16.086 -0.913  -21.320 1.00 109.55 ? 725  TYR A CD2   1 
ATOM   5291  C  CE1   . TYR A 1 725  ? -14.013 -0.543  -23.082 1.00 107.84 ? 725  TYR A CE1   1 
ATOM   5292  C  CE2   . TYR A 1 725  ? -15.928 0.297   -21.949 1.00 112.29 ? 725  TYR A CE2   1 
ATOM   5293  C  CZ    . TYR A 1 725  ? -14.886 0.475   -22.833 1.00 109.35 ? 725  TYR A CZ    1 
ATOM   5294  O  OH    . TYR A 1 725  ? -14.706 1.668   -23.475 1.00 109.60 ? 725  TYR A OH    1 
ATOM   5295  N  N     . GLY A 1 726  ? -13.107 -2.194  -18.727 1.00 102.93 ? 726  GLY A N     1 
ATOM   5296  C  CA    . GLY A 1 726  ? -12.829 -1.555  -17.446 1.00 117.04 ? 726  GLY A CA    1 
ATOM   5297  C  C     . GLY A 1 726  ? -12.331 -2.547  -16.401 1.00 119.77 ? 726  GLY A C     1 
ATOM   5298  O  O     . GLY A 1 726  ? -11.607 -3.493  -16.723 1.00 127.22 ? 726  GLY A O     1 
ATOM   5299  N  N     . ASN A 1 727  ? -12.754 -2.335  -15.148 1.00 119.26 ? 727  ASN A N     1 
ATOM   5300  C  CA    . ASN A 1 727  ? -12.417 -3.213  -14.031 1.00 121.42 ? 727  ASN A CA    1 
ATOM   5301  C  C     . ASN A 1 727  ? -13.653 -3.350  -13.152 1.00 116.73 ? 727  ASN A C     1 
ATOM   5302  O  O     . ASN A 1 727  ? -13.952 -2.513  -12.280 1.00 120.54 ? 727  ASN A O     1 
ATOM   5303  C  CB    . ASN A 1 727  ? -11.213 -2.712  -13.228 1.00 129.95 ? 727  ASN A CB    1 
ATOM   5304  C  CG    . ASN A 1 727  ? -10.744 -3.719  -12.171 1.00 129.04 ? 727  ASN A CG    1 
ATOM   5305  O  OD1   . ASN A 1 727  ? -11.321 -4.811  -11.993 1.00 109.91 ? 727  ASN A OD1   1 
ATOM   5306  N  ND2   . ASN A 1 727  ? -9.685  -3.349  -11.459 1.00 127.75 ? 727  ASN A ND2   1 
ATOM   5307  N  N     . VAL A 1 728  ? -14.348 -4.463  -13.346 1.00 118.09 ? 728  VAL A N     1 
ATOM   5308  C  CA    . VAL A 1 728  ? -15.626 -4.733  -12.666 1.00 124.00 ? 728  VAL A CA    1 
ATOM   5309  C  C     . VAL A 1 728  ? -15.471 -5.046  -11.178 1.00 119.78 ? 728  VAL A C     1 
ATOM   5310  O  O     . VAL A 1 728  ? -16.388 -4.779  -10.409 1.00 115.71 ? 728  VAL A O     1 
ATOM   5311  C  CB    . VAL A 1 728  ? -16.383 -5.893  -13.355 1.00 126.48 ? 728  VAL A CB    1 
ATOM   5312  C  CG1   . VAL A 1 728  ? -15.640 -7.213  -13.163 1.00 132.28 ? 728  VAL A CG1   1 
ATOM   5313  C  CG2   . VAL A 1 728  ? -17.822 -5.993  -12.845 1.00 124.68 ? 728  VAL A CG2   1 
ATOM   5314  N  N     . ASP A 1 729  ? -14.320 -5.595  -10.778 1.00 125.73 ? 729  ASP A N     1 
ATOM   5315  C  CA    . ASP A 1 729  ? -14.080 -5.932  -9.356  1.00 126.29 ? 729  ASP A CA    1 
ATOM   5316  C  C     . ASP A 1 729  ? -13.918 -4.691  -8.474  1.00 119.06 ? 729  ASP A C     1 
ATOM   5317  O  O     . ASP A 1 729  ? -14.398 -4.677  -7.344  1.00 97.66  ? 729  ASP A O     1 
ATOM   5318  C  CB    . ASP A 1 729  ? -12.932 -6.935  -9.207  1.00 125.93 ? 729  ASP A CB    1 
ATOM   5319  C  CG    . ASP A 1 729  ? -13.382 -8.380  -9.470  1.00 129.58 ? 729  ASP A CG    1 
ATOM   5320  O  OD1   . ASP A 1 729  ? -14.531 -8.602  -9.913  1.00 122.20 ? 729  ASP A OD1   1 
ATOM   5321  O  OD2   . ASP A 1 729  ? -12.587 -9.307  -9.226  1.00 134.02 ? 729  ASP A OD2   1 
ATOM   5322  N  N     . GLU A 1 730  ? -13.255 -3.653  -8.987  1.00 127.55 ? 730  GLU A N     1 
ATOM   5323  C  CA    . GLU A 1 730  ? -13.179 -2.364  -8.297  1.00 127.18 ? 730  GLU A CA    1 
ATOM   5324  C  C     . GLU A 1 730  ? -14.547 -1.653  -8.271  1.00 132.04 ? 730  GLU A C     1 
ATOM   5325  O  O     . GLU A 1 730  ? -14.940 -1.093  -7.232  1.00 139.41 ? 730  GLU A O     1 
ATOM   5326  C  CB    . GLU A 1 730  ? -12.106 -1.429  -8.923  1.00 122.24 ? 730  GLU A CB    1 
ATOM   5327  C  CG    . GLU A 1 730  ? -10.637 -1.713  -8.559  1.00 119.31 ? 730  GLU A CG    1 
ATOM   5328  C  CD    . GLU A 1 730  ? -10.363 -1.866  -7.056  1.00 128.39 ? 730  GLU A CD    1 
ATOM   5329  O  OE1   . GLU A 1 730  ? -9.911  -0.886  -6.413  1.00 126.75 ? 730  GLU A OE1   1 
ATOM   5330  O  OE2   . GLU A 1 730  ? -10.587 -2.978  -6.506  1.00 123.90 ? 730  GLU A OE2   1 
ATOM   5331  N  N     . ALA A 1 731  ? -15.271 -1.704  -9.389  1.00 140.36 ? 731  ALA A N     1 
ATOM   5332  C  CA    . ALA A 1 731  ? -16.570 -1.041  -9.515  1.00 149.05 ? 731  ALA A CA    1 
ATOM   5333  C  C     . ALA A 1 731  ? -17.640 -1.526  -8.520  1.00 141.02 ? 731  ALA A C     1 
ATOM   5334  O  O     . ALA A 1 731  ? -18.462 -0.725  -8.072  1.00 122.15 ? 731  ALA A O     1 
ATOM   5335  C  CB    . ALA A 1 731  ? -17.080 -1.151  -10.949 1.00 153.44 ? 731  ALA A CB    1 
ATOM   5336  N  N     . PHE A 1 732  ? -17.622 -2.821  -8.185  1.00 138.61 ? 732  PHE A N     1 
ATOM   5337  C  CA    . PHE A 1 732  ? -18.540 -3.385  -7.180  1.00 139.70 ? 732  PHE A CA    1 
ATOM   5338  C  C     . PHE A 1 732  ? -18.374 -2.802  -5.758  1.00 144.93 ? 732  PHE A C     1 
ATOM   5339  O  O     . PHE A 1 732  ? -19.094 -3.228  -4.874  1.00 130.84 ? 732  PHE A O     1 
ATOM   5340  C  CB    . PHE A 1 732  ? -18.394 -4.950  -7.121  1.00 141.37 ? 732  PHE A CB    1 
ATOM   5341  C  CG    . PHE A 1 732  ? -19.433 -5.756  -7.935  1.00 138.02 ? 732  PHE A CG    1 
ATOM   5342  C  CD1   . PHE A 1 732  ? -20.108 -5.224  -9.036  1.00 128.49 ? 732  PHE A CD1   1 
ATOM   5343  C  CD2   . PHE A 1 732  ? -19.688 -7.097  -7.609  1.00 139.97 ? 732  PHE A CD2   1 
ATOM   5344  C  CE1   . PHE A 1 732  ? -21.032 -5.981  -9.756  1.00 114.19 ? 732  PHE A CE1   1 
ATOM   5345  C  CE2   . PHE A 1 732  ? -20.607 -7.858  -8.333  1.00 128.33 ? 732  PHE A CE2   1 
ATOM   5346  C  CZ    . PHE A 1 732  ? -21.280 -7.293  -9.402  1.00 120.31 ? 732  PHE A CZ    1 
ATOM   5347  N  N     . LYS A 1 733  ? -17.449 -1.845  -5.544  1.00 150.91 ? 733  LYS A N     1 
ATOM   5348  C  CA    . LYS A 1 733  ? -17.310 -1.183  -4.257  1.00 141.62 ? 733  LYS A CA    1 
ATOM   5349  C  C     . LYS A 1 733  ? -17.824 0.238   -4.186  1.00 134.01 ? 733  LYS A C     1 
ATOM   5350  O  O     . LYS A 1 733  ? -18.171 0.677   -3.096  1.00 130.00 ? 733  LYS A O     1 
ATOM   5351  C  CB    . LYS A 1 733  ? -15.867 -1.275  -3.755  1.00 139.63 ? 733  LYS A CB    1 
ATOM   5352  C  CG    . LYS A 1 733  ? -15.592 -2.571  -3.002  1.00 137.78 ? 733  LYS A CG    1 
ATOM   5353  C  CD    . LYS A 1 733  ? -16.513 -2.719  -1.795  1.00 135.84 ? 733  LYS A CD    1 
ATOM   5354  C  CE    . LYS A 1 733  ? -15.954 -3.695  -0.773  1.00 137.46 ? 733  LYS A CE    1 
ATOM   5355  N  NZ    . LYS A 1 733  ? -16.370 -3.335  0.610   1.00 136.22 ? 733  LYS A NZ    1 
ATOM   5356  N  N     . VAL A 1 734  ? -17.959 0.929   -5.335  1.00 127.06 ? 734  VAL A N     1 
ATOM   5357  C  CA    . VAL A 1 734  ? -18.518 2.301   -5.392  1.00 123.92 ? 734  VAL A CA    1 
ATOM   5358  C  C     . VAL A 1 734  ? -19.980 2.403   -5.891  1.00 124.15 ? 734  VAL A C     1 
ATOM   5359  O  O     . VAL A 1 734  ? -20.435 3.491   -6.235  1.00 110.38 ? 734  VAL A O     1 
ATOM   5360  C  CB    . VAL A 1 734  ? -17.577 3.287   -6.160  1.00 117.67 ? 734  VAL A CB    1 
ATOM   5361  C  CG1   . VAL A 1 734  ? -16.119 2.834   -6.053  1.00 114.81 ? 734  VAL A CG1   1 
ATOM   5362  C  CG2   . VAL A 1 734  ? -17.990 3.486   -7.622  1.00 111.68 ? 734  VAL A CG2   1 
ATOM   5363  N  N     . VAL A 1 735  ? -20.705 1.286   -5.928  1.00 127.03 ? 735  VAL A N     1 
ATOM   5364  C  CA    . VAL A 1 735  ? -22.114 1.282   -6.386  1.00 125.58 ? 735  VAL A CA    1 
ATOM   5365  C  C     . VAL A 1 735  ? -23.075 1.397   -5.189  1.00 128.27 ? 735  VAL A C     1 
ATOM   5366  O  O     . VAL A 1 735  ? -22.729 1.022   -4.084  1.00 116.72 ? 735  VAL A O     1 
ATOM   5367  C  CB    . VAL A 1 735  ? -22.456 0.079   -7.357  1.00 114.58 ? 735  VAL A CB    1 
ATOM   5368  C  CG1   . VAL A 1 735  ? -22.267 0.471   -8.820  1.00 102.66 ? 735  VAL A CG1   1 
ATOM   5369  C  CG2   . VAL A 1 735  ? -21.658 -1.190  -7.044  1.00 105.27 ? 735  VAL A CG2   1 
ATOM   5370  N  N     . ASP A 1 736  ? -24.271 1.948   -5.430  1.00 120.65 ? 736  ASP A N     1 
ATOM   5371  C  CA    . ASP A 1 736  ? -25.287 2.099   -4.408  1.00 108.35 ? 736  ASP A CA    1 
ATOM   5372  C  C     . ASP A 1 736  ? -25.920 0.763   -4.037  1.00 113.63 ? 736  ASP A C     1 
ATOM   5373  O  O     . ASP A 1 736  ? -26.108 0.482   -2.853  1.00 133.89 ? 736  ASP A O     1 
ATOM   5374  C  CB    . ASP A 1 736  ? -26.388 3.102   -4.807  1.00 113.87 ? 736  ASP A CB    1 
ATOM   5375  C  CG    . ASP A 1 736  ? -25.839 4.485   -5.197  1.00 116.80 ? 736  ASP A CG    1 
ATOM   5376  O  OD1   . ASP A 1 736  ? -24.822 4.541   -5.914  1.00 119.97 ? 736  ASP A OD1   1 
ATOM   5377  O  OD2   . ASP A 1 736  ? -26.439 5.520   -4.814  1.00 109.54 ? 736  ASP A OD2   1 
ATOM   5378  N  N     . GLN A 1 737  ? -26.252 -0.045  -5.037  1.00 121.36 ? 737  GLN A N     1 
ATOM   5379  C  CA    . GLN A 1 737  ? -26.909 -1.345  -4.814  1.00 120.77 ? 737  GLN A CA    1 
ATOM   5380  C  C     . GLN A 1 737  ? -26.348 -2.430  -5.730  1.00 116.43 ? 737  GLN A C     1 
ATOM   5381  O  O     . GLN A 1 737  ? -25.713 -2.148  -6.754  1.00 107.10 ? 737  GLN A O     1 
ATOM   5382  C  CB    . GLN A 1 737  ? -28.414 -1.225  -5.027  1.00 118.72 ? 737  GLN A CB    1 
ATOM   5383  C  CG    . GLN A 1 737  ? -29.087 -0.179  -4.160  1.00 120.09 ? 737  GLN A CG    1 
ATOM   5384  C  CD    . GLN A 1 737  ? -30.501 0.111   -4.604  1.00 120.12 ? 737  GLN A CD    1 
ATOM   5385  O  OE1   . GLN A 1 737  ? -31.274 -0.799  -4.931  1.00 113.01 ? 737  GLN A OE1   1 
ATOM   5386  N  NE2   . GLN A 1 737  ? -30.852 1.387   -4.616  1.00 121.47 ? 737  GLN A NE2   1 
ATOM   5387  N  N     . ILE A 1 738  ? -26.562 -3.674  -5.316  1.00 112.83 ? 738  ILE A N     1 
ATOM   5388  C  CA    . ILE A 1 738  ? -26.175 -4.862  -6.082  1.00 114.22 ? 738  ILE A CA    1 
ATOM   5389  C  C     . ILE A 1 738  ? -27.397 -5.777  -6.214  1.00 111.40 ? 738  ILE A C     1 
ATOM   5390  O  O     . ILE A 1 738  ? -28.259 -5.823  -5.336  1.00 106.77 ? 738  ILE A O     1 
ATOM   5391  C  CB    . ILE A 1 738  ? -24.886 -5.535  -5.511  1.00 119.68 ? 738  ILE A CB    1 
ATOM   5392  C  CG1   . ILE A 1 738  ? -23.657 -4.667  -5.869  1.00 114.26 ? 738  ILE A CG1   1 
ATOM   5393  C  CG2   . ILE A 1 738  ? -24.699 -6.969  -6.027  1.00 121.86 ? 738  ILE A CG2   1 
ATOM   5394  C  CD1   . ILE A 1 738  ? -22.332 -5.127  -5.275  1.00 109.83 ? 738  ILE A CD1   1 
ATOM   5395  N  N     . LEU A 1 739  ? -27.456 -6.492  -7.334  1.00 123.51 ? 739  LEU A N     1 
ATOM   5396  C  CA    . LEU A 1 739  ? -28.622 -7.261  -7.741  1.00 120.60 ? 739  LEU A CA    1 
ATOM   5397  C  C     . LEU A 1 739  ? -28.128 -8.487  -8.493  1.00 115.99 ? 739  LEU A C     1 
ATOM   5398  O  O     . LEU A 1 739  ? -27.330 -8.365  -9.412  1.00 102.73 ? 739  LEU A O     1 
ATOM   5399  C  CB    . LEU A 1 739  ? -29.478 -6.370  -8.647  1.00 123.83 ? 739  LEU A CB    1 
ATOM   5400  C  CG    . LEU A 1 739  ? -30.663 -6.888  -9.467  1.00 126.02 ? 739  LEU A CG    1 
ATOM   5401  C  CD1   . LEU A 1 739  ? -31.371 -5.704  -10.122 1.00 124.81 ? 739  LEU A CD1   1 
ATOM   5402  C  CD2   . LEU A 1 739  ? -30.245 -7.894  -10.530 1.00 131.49 ? 739  LEU A CD2   1 
ATOM   5403  N  N     . GLU A 1 740  ? -28.606 -9.654  -8.077  1.00 113.89 ? 740  GLU A N     1 
ATOM   5404  C  CA    . GLU A 1 740  ? -28.361 -10.910 -8.767  1.00 118.78 ? 740  GLU A CA    1 
ATOM   5405  C  C     . GLU A 1 740  ? -29.671 -11.389 -9.394  1.00 114.18 ? 740  GLU A C     1 
ATOM   5406  O  O     . GLU A 1 740  ? -30.771 -11.097 -8.898  1.00 127.62 ? 740  GLU A O     1 
ATOM   5407  C  CB    . GLU A 1 740  ? -27.891 -11.968 -7.770  1.00 123.27 ? 740  GLU A CB    1 
ATOM   5408  C  CG    . GLU A 1 740  ? -26.418 -11.906 -7.417  1.00 128.05 ? 740  GLU A CG    1 
ATOM   5409  C  CD    . GLU A 1 740  ? -25.941 -13.192 -6.770  1.00 135.90 ? 740  GLU A CD    1 
ATOM   5410  O  OE1   . GLU A 1 740  ? -26.488 -13.555 -5.706  1.00 134.98 ? 740  GLU A OE1   1 
ATOM   5411  O  OE2   . GLU A 1 740  ? -25.032 -13.844 -7.331  1.00 148.41 ? 740  GLU A OE2   1 
ATOM   5412  N  N     . GLY A 1 741  ? -29.553 -12.140 -10.474 1.00 122.46 ? 741  GLY A N     1 
ATOM   5413  C  CA    . GLY A 1 741  ? -30.720 -12.774 -11.048 1.00 125.83 ? 741  GLY A CA    1 
ATOM   5414  C  C     . GLY A 1 741  ? -30.351 -13.632 -12.228 1.00 112.97 ? 741  GLY A C     1 
ATOM   5415  O  O     . GLY A 1 741  ? -29.195 -13.714 -12.601 1.00 107.32 ? 741  GLY A O     1 
ATOM   5416  N  N     . GLU A 1 742  ? -31.365 -14.268 -12.806 1.00 107.74 ? 742  GLU A N     1 
ATOM   5417  C  CA    . GLU A 1 742  ? -31.182 -15.053 -13.988 1.00 107.92 ? 742  GLU A CA    1 
ATOM   5418  C  C     . GLU A 1 742  ? -32.447 -15.159 -14.818 1.00 116.83 ? 742  GLU A C     1 
ATOM   5419  O  O     . GLU A 1 742  ? -33.542 -14.892 -14.337 1.00 125.25 ? 742  GLU A O     1 
ATOM   5420  C  CB    . GLU A 1 742  ? -30.586 -16.435 -13.658 1.00 121.54 ? 742  GLU A CB    1 
ATOM   5421  C  CG    . GLU A 1 742  ? -31.304 -17.278 -12.606 1.00 129.70 ? 742  GLU A CG    1 
ATOM   5422  C  CD    . GLU A 1 742  ? -30.806 -18.730 -12.593 1.00 129.95 ? 742  GLU A CD    1 
ATOM   5423  O  OE1   . GLU A 1 742  ? -29.635 -18.967 -12.226 1.00 128.75 ? 742  GLU A OE1   1 
ATOM   5424  O  OE2   . GLU A 1 742  ? -31.577 -19.646 -12.954 1.00 129.20 ? 742  GLU A OE2   1 
ATOM   5425  N  N     . ILE A 1 743  ? -32.270 -15.532 -16.077 1.00 115.22 ? 743  ILE A N     1 
ATOM   5426  C  CA    . ILE A 1 743  ? -33.384 -15.754 -17.010 1.00 106.52 ? 743  ILE A CA    1 
ATOM   5427  C  C     . ILE A 1 743  ? -33.108 -16.934 -17.934 1.00 101.36 ? 743  ILE A C     1 
ATOM   5428  O  O     . ILE A 1 743  ? -32.077 -16.962 -18.601 1.00 110.03 ? 743  ILE A O     1 
ATOM   5429  C  CB    . ILE A 1 743  ? -33.655 -14.507 -17.863 1.00 107.48 ? 743  ILE A CB    1 
ATOM   5430  C  CG1   . ILE A 1 743  ? -34.867 -14.727 -18.763 1.00 108.86 ? 743  ILE A CG1   1 
ATOM   5431  C  CG2   . ILE A 1 743  ? -32.435 -14.123 -18.698 1.00 106.62 ? 743  ILE A CG2   1 
ATOM   5432  C  CD1   . ILE A 1 743  ? -35.291 -13.473 -19.505 1.00 113.13 ? 743  ILE A CD1   1 
ATOM   5433  N  N     . HIS A 1 744  ? -34.012 -17.914 -17.939 1.00 100.63 ? 744  HIS A N     1 
ATOM   5434  C  CA    . HIS A 1 744  ? -33.980 -18.980 -18.941 1.00 100.83 ? 744  HIS A CA    1 
ATOM   5435  C  C     . HIS A 1 744  ? -34.695 -18.518 -20.187 1.00 99.83  ? 744  HIS A C     1 
ATOM   5436  O  O     . HIS A 1 744  ? -35.677 -17.799 -20.116 1.00 103.53 ? 744  HIS A O     1 
ATOM   5437  C  CB    . HIS A 1 744  ? -34.651 -20.242 -18.443 1.00 97.71  ? 744  HIS A CB    1 
ATOM   5438  C  CG    . HIS A 1 744  ? -33.848 -20.944 -17.413 1.00 110.00 ? 744  HIS A CG    1 
ATOM   5439  N  ND1   . HIS A 1 744  ? -33.805 -20.525 -16.101 1.00 118.50 ? 744  HIS A ND1   1 
ATOM   5440  C  CD2   . HIS A 1 744  ? -33.009 -21.999 -17.503 1.00 114.84 ? 744  HIS A CD2   1 
ATOM   5441  C  CE1   . HIS A 1 744  ? -32.999 -21.314 -15.417 1.00 121.87 ? 744  HIS A CE1   1 
ATOM   5442  N  NE2   . HIS A 1 744  ? -32.501 -22.215 -16.246 1.00 128.00 ? 744  HIS A NE2   1 
ATOM   5443  N  N     . MET A 1 745  ? -34.202 -18.959 -21.333 1.00 98.48  ? 745  MET A N     1 
ATOM   5444  C  CA    . MET A 1 745  ? -34.843 -18.677 -22.619 1.00 95.59  ? 745  MET A CA    1 
ATOM   5445  C  C     . MET A 1 745  ? -34.941 -19.958 -23.435 1.00 99.04  ? 745  MET A C     1 
ATOM   5446  O  O     . MET A 1 745  ? -33.955 -20.657 -23.610 1.00 98.24  ? 745  MET A O     1 
ATOM   5447  C  CB    . MET A 1 745  ? -33.981 -17.659 -23.303 1.00 89.78  ? 745  MET A CB    1 
ATOM   5448  C  CG    . MET A 1 745  ? -34.563 -17.181 -24.584 1.00 98.32  ? 745  MET A CG    1 
ATOM   5449  S  SD    . MET A 1 745  ? -33.619 -15.746 -25.072 1.00 121.96 ? 745  MET A SD    1 
ATOM   5450  C  CE    . MET A 1 745  ? -34.411 -15.451 -26.658 1.00 119.43 ? 745  MET A CE    1 
ATOM   5451  N  N     . GLY A 1 746  ? -36.128 -20.249 -23.942 1.00 98.02  ? 746  GLY A N     1 
ATOM   5452  C  CA    . GLY A 1 746  ? -36.382 -21.440 -24.726 1.00 90.44  ? 746  GLY A CA    1 
ATOM   5453  C  C     . GLY A 1 746  ? -35.883 -21.359 -26.154 1.00 87.32  ? 746  GLY A C     1 
ATOM   5454  O  O     . GLY A 1 746  ? -35.551 -20.290 -26.663 1.00 82.51  ? 746  GLY A O     1 
ATOM   5455  N  N     . GLY A 1 747  ? -35.845 -22.520 -26.803 1.00 94.37  ? 747  GLY A N     1 
ATOM   5456  C  CA    . GLY A 1 747  ? -35.396 -22.643 -28.172 1.00 97.90  ? 747  GLY A CA    1 
ATOM   5457  C  C     . GLY A 1 747  ? -36.479 -22.195 -29.129 1.00 98.15  ? 747  GLY A C     1 
ATOM   5458  O  O     . GLY A 1 747  ? -37.393 -21.446 -28.748 1.00 108.56 ? 747  GLY A O     1 
ATOM   5459  N  N     . GLN A 1 748  ? -36.362 -22.631 -30.379 1.00 88.42  ? 748  GLN A N     1 
ATOM   5460  C  CA    . GLN A 1 748  ? -37.284 -22.184 -31.420 1.00 87.22  ? 748  GLN A CA    1 
ATOM   5461  C  C     . GLN A 1 748  ? -37.074 -23.001 -32.681 1.00 89.33  ? 748  GLN A C     1 
ATOM   5462  O  O     . GLN A 1 748  ? -35.948 -23.184 -33.117 1.00 93.84  ? 748  GLN A O     1 
ATOM   5463  C  CB    . GLN A 1 748  ? -37.059 -20.703 -31.706 1.00 85.01  ? 748  GLN A CB    1 
ATOM   5464  C  CG    . GLN A 1 748  ? -38.165 -20.035 -32.501 1.00 84.81  ? 748  GLN A CG    1 
ATOM   5465  C  CD    . GLN A 1 748  ? -37.726 -18.708 -33.090 1.00 89.55  ? 748  GLN A CD    1 
ATOM   5466  O  OE1   . GLN A 1 748  ? -36.574 -18.310 -32.953 1.00 94.42  ? 748  GLN A OE1   1 
ATOM   5467  N  NE2   . GLN A 1 748  ? -38.641 -18.017 -33.755 1.00 93.54  ? 748  GLN A NE2   1 
ATOM   5468  N  N     . GLU A 1 749  ? -38.153 -23.522 -33.243 1.00 88.19  ? 749  GLU A N     1 
ATOM   5469  C  CA    . GLU A 1 749  ? -38.089 -24.208 -34.547 1.00 87.66  ? 749  GLU A CA    1 
ATOM   5470  C  C     . GLU A 1 749  ? -38.025 -23.189 -35.661 1.00 77.25  ? 749  GLU A C     1 
ATOM   5471  O  O     . GLU A 1 749  ? -38.714 -22.170 -35.621 1.00 78.35  ? 749  GLU A O     1 
ATOM   5472  C  CB    . GLU A 1 749  ? -39.290 -25.154 -34.713 1.00 96.18  ? 749  GLU A CB    1 
ATOM   5473  C  CG    . GLU A 1 749  ? -38.920 -26.618 -34.598 1.00 104.22 ? 749  GLU A CG    1 
ATOM   5474  C  CD    . GLU A 1 749  ? -37.870 -27.013 -35.639 1.00 125.00 ? 749  GLU A CD    1 
ATOM   5475  O  OE1   . GLU A 1 749  ? -37.773 -26.332 -36.706 1.00 126.91 ? 749  GLU A OE1   1 
ATOM   5476  O  OE2   . GLU A 1 749  ? -37.128 -27.995 -35.384 1.00 126.62 ? 749  GLU A OE2   1 
ATOM   5477  N  N     . HIS A 1 750  ? -37.181 -23.454 -36.658 1.00 79.72  ? 750  HIS A N     1 
ATOM   5478  C  CA    . HIS A 1 750  ? -37.064 -22.573 -37.840 1.00 86.88  ? 750  HIS A CA    1 
ATOM   5479  C  C     . HIS A 1 750  ? -38.407 -22.410 -38.500 1.00 91.62  ? 750  HIS A C     1 
ATOM   5480  O  O     . HIS A 1 750  ? -38.780 -21.304 -38.840 1.00 79.85  ? 750  HIS A O     1 
ATOM   5481  C  CB    . HIS A 1 750  ? -36.068 -23.094 -38.877 1.00 87.66  ? 750  HIS A CB    1 
ATOM   5482  C  CG    . HIS A 1 750  ? -34.691 -23.288 -38.343 1.00 90.51  ? 750  HIS A CG    1 
ATOM   5483  N  ND1   . HIS A 1 750  ? -33.701 -22.346 -38.495 1.00 87.78  ? 750  HIS A ND1   1 
ATOM   5484  C  CD2   . HIS A 1 750  ? -34.139 -24.317 -37.653 1.00 104.83 ? 750  HIS A CD2   1 
ATOM   5485  C  CE1   . HIS A 1 750  ? -32.599 -22.778 -37.908 1.00 101.56 ? 750  HIS A CE1   1 
ATOM   5486  N  NE2   . HIS A 1 750  ? -32.836 -23.973 -37.392 1.00 109.09 ? 750  HIS A NE2   1 
ATOM   5487  N  N     . PHE A 1 751  ? -39.119 -23.531 -38.672 1.00 93.31  ? 751  PHE A N     1 
ATOM   5488  C  CA    . PHE A 1 751  ? -40.428 -23.557 -39.287 1.00 84.18  ? 751  PHE A CA    1 
ATOM   5489  C  C     . PHE A 1 751  ? -40.511 -22.779 -40.614 1.00 82.67  ? 751  PHE A C     1 
ATOM   5490  O  O     . PHE A 1 751  ? -41.446 -22.013 -40.872 1.00 90.16  ? 751  PHE A O     1 
ATOM   5491  C  CB    . PHE A 1 751  ? -41.525 -23.186 -38.289 1.00 84.84  ? 751  PHE A CB    1 
ATOM   5492  C  CG    . PHE A 1 751  ? -42.723 -24.088 -38.374 1.00 84.06  ? 751  PHE A CG    1 
ATOM   5493  C  CD1   . PHE A 1 751  ? -43.640 -23.958 -39.422 1.00 85.87  ? 751  PHE A CD1   1 
ATOM   5494  C  CD2   . PHE A 1 751  ? -42.915 -25.099 -37.444 1.00 77.79  ? 751  PHE A CD2   1 
ATOM   5495  C  CE1   . PHE A 1 751  ? -44.734 -24.806 -39.529 1.00 83.85  ? 751  PHE A CE1   1 
ATOM   5496  C  CE2   . PHE A 1 751  ? -44.008 -25.943 -37.542 1.00 78.36  ? 751  PHE A CE2   1 
ATOM   5497  C  CZ    . PHE A 1 751  ? -44.920 -25.799 -38.580 1.00 82.73  ? 751  PHE A CZ    1 
ATOM   5498  N  N     . TYR A 1 752  ? -39.487 -22.968 -41.444 1.00 82.07  ? 752  TYR A N     1 
ATOM   5499  C  CA    . TYR A 1 752  ? -39.595 -22.731 -42.884 1.00 89.33  ? 752  TYR A CA    1 
ATOM   5500  C  C     . TYR A 1 752  ? -40.800 -23.532 -43.415 1.00 95.77  ? 752  TYR A C     1 
ATOM   5501  O  O     . TYR A 1 752  ? -41.035 -24.661 -42.978 1.00 90.24  ? 752  TYR A O     1 
ATOM   5502  C  CB    . TYR A 1 752  ? -38.304 -23.197 -43.638 1.00 83.61  ? 752  TYR A CB    1 
ATOM   5503  C  CG    . TYR A 1 752  ? -37.540 -24.341 -42.965 1.00 76.89  ? 752  TYR A CG    1 
ATOM   5504  C  CD1   . TYR A 1 752  ? -38.060 -25.620 -42.886 1.00 78.75  ? 752  TYR A CD1   1 
ATOM   5505  C  CD2   . TYR A 1 752  ? -36.314 -24.127 -42.389 1.00 79.39  ? 752  TYR A CD2   1 
ATOM   5506  C  CE1   . TYR A 1 752  ? -37.380 -26.651 -42.242 1.00 79.73  ? 752  TYR A CE1   1 
ATOM   5507  C  CE2   . TYR A 1 752  ? -35.623 -25.149 -41.746 1.00 85.49  ? 752  TYR A CE2   1 
ATOM   5508  C  CZ    . TYR A 1 752  ? -36.157 -26.411 -41.665 1.00 81.74  ? 752  TYR A CZ    1 
ATOM   5509  O  OH    . TYR A 1 752  ? -35.448 -27.403 -41.009 1.00 76.06  ? 752  TYR A OH    1 
ATOM   5510  N  N     . MET A 1 753  ? -41.580 -22.967 -44.318 1.00 93.10  ? 753  MET A N     1 
ATOM   5511  C  CA    . MET A 1 753  ? -42.766 -23.665 -44.829 1.00 87.12  ? 753  MET A CA    1 
ATOM   5512  C  C     . MET A 1 753  ? -42.403 -24.830 -45.771 1.00 86.34  ? 753  MET A C     1 
ATOM   5513  O  O     . MET A 1 753  ? -43.111 -25.835 -45.807 1.00 114.17 ? 753  MET A O     1 
ATOM   5514  C  CB    . MET A 1 753  ? -43.706 -22.684 -45.525 1.00 90.32  ? 753  MET A CB    1 
ATOM   5515  C  CG    . MET A 1 753  ? -44.406 -21.715 -44.591 1.00 89.56  ? 753  MET A CG    1 
ATOM   5516  S  SD    . MET A 1 753  ? -45.346 -22.511 -43.290 1.00 84.83  ? 753  MET A SD    1 
ATOM   5517  C  CE    . MET A 1 753  ? -46.381 -23.602 -44.266 1.00 90.16  ? 753  MET A CE    1 
ATOM   5518  N  N     . GLU A 1 754  ? -41.315 -24.693 -46.526 1.00 80.67  ? 754  GLU A N     1 
ATOM   5519  C  CA    . GLU A 1 754  ? -40.734 -25.805 -47.306 1.00 74.06  ? 754  GLU A CA    1 
ATOM   5520  C  C     . GLU A 1 754  ? -39.867 -26.661 -46.400 1.00 75.25  ? 754  GLU A C     1 
ATOM   5521  O  O     . GLU A 1 754  ? -38.839 -26.185 -45.930 1.00 82.82  ? 754  GLU A O     1 
ATOM   5522  C  CB    . GLU A 1 754  ? -39.879 -25.295 -48.465 1.00 71.51  ? 754  GLU A CB    1 
ATOM   5523  C  CG    . GLU A 1 754  ? -38.979 -26.374 -49.060 1.00 75.49  ? 754  GLU A CG    1 
ATOM   5524  C  CD    . GLU A 1 754  ? -38.098 -25.882 -50.192 1.00 80.86  ? 754  GLU A CD    1 
ATOM   5525  O  OE1   . GLU A 1 754  ? -37.431 -24.843 -50.011 1.00 92.84  ? 754  GLU A OE1   1 
ATOM   5526  O  OE2   . GLU A 1 754  ? -38.054 -26.537 -51.259 1.00 73.10  ? 754  GLU A OE2   1 
ATOM   5527  N  N     . THR A 1 755  ? -40.248 -27.914 -46.143 1.00 69.79  ? 755  THR A N     1 
ATOM   5528  C  CA    . THR A 1 755  ? -39.405 -28.808 -45.338 1.00 67.68  ? 755  THR A CA    1 
ATOM   5529  C  C     . THR A 1 755  ? -38.111 -29.132 -46.057 1.00 67.20  ? 755  THR A C     1 
ATOM   5530  O  O     . THR A 1 755  ? -37.952 -28.821 -47.217 1.00 64.32  ? 755  THR A O     1 
ATOM   5531  C  CB    . THR A 1 755  ? -40.093 -30.163 -45.101 1.00 67.88  ? 755  THR A CB    1 
ATOM   5532  O  OG1   . THR A 1 755  ? -40.922 -30.463 -46.232 1.00 69.01  ? 755  THR A OG1   1 
ATOM   5533  C  CG2   . THR A 1 755  ? -40.921 -30.141 -43.826 1.00 68.09  ? 755  THR A CG2   1 
ATOM   5534  N  N     . GLN A 1 756  ? -37.193 -29.787 -45.374 1.00 74.69  ? 756  GLN A N     1 
ATOM   5535  C  CA    . GLN A 1 756  ? -35.955 -30.288 -45.971 1.00 78.49  ? 756  GLN A CA    1 
ATOM   5536  C  C     . GLN A 1 756  ? -36.282 -31.104 -47.207 1.00 78.73  ? 756  GLN A C     1 
ATOM   5537  O  O     . GLN A 1 756  ? -37.129 -31.985 -47.123 1.00 94.03  ? 756  GLN A O     1 
ATOM   5538  C  CB    . GLN A 1 756  ? -35.207 -31.216 -45.001 1.00 81.30  ? 756  GLN A CB    1 
ATOM   5539  C  CG    . GLN A 1 756  ? -34.602 -30.547 -43.778 1.00 82.47  ? 756  GLN A CG    1 
ATOM   5540  C  CD    . GLN A 1 756  ? -33.663 -29.422 -44.135 1.00 86.56  ? 756  GLN A CD    1 
ATOM   5541  O  OE1   . GLN A 1 756  ? -33.131 -29.351 -45.254 1.00 83.76  ? 756  GLN A OE1   1 
ATOM   5542  N  NE2   . GLN A 1 756  ? -33.455 -28.525 -43.183 1.00 92.94  ? 756  GLN A NE2   1 
ATOM   5543  N  N     . SER A 1 757  ? -35.643 -30.794 -48.330 1.00 80.45  ? 757  SER A N     1 
ATOM   5544  C  CA    . SER A 1 757  ? -35.994 -31.407 -49.620 1.00 81.42  ? 757  SER A CA    1 
ATOM   5545  C  C     . SER A 1 757  ? -34.794 -31.411 -50.536 1.00 84.67  ? 757  SER A C     1 
ATOM   5546  O  O     . SER A 1 757  ? -34.060 -30.390 -50.643 1.00 87.16  ? 757  SER A O     1 
ATOM   5547  C  CB    . SER A 1 757  ? -37.180 -30.679 -50.226 1.00 90.43  ? 757  SER A CB    1 
ATOM   5548  O  OG    . SER A 1 757  ? -38.186 -30.464 -49.244 1.00 96.24  ? 757  SER A OG    1 
ATOM   5549  N  N     . MET A 1 758  ? -34.551 -32.549 -51.186 1.00 85.95  ? 758  MET A N     1 
ATOM   5550  C  CA    . MET A 1 758  ? -33.480 -32.636 -52.185 1.00 83.99  ? 758  MET A CA    1 
ATOM   5551  C  C     . MET A 1 758  ? -33.679 -33.788 -53.147 1.00 83.22  ? 758  MET A C     1 
ATOM   5552  O  O     . MET A 1 758  ? -34.389 -34.760 -52.859 1.00 77.66  ? 758  MET A O     1 
ATOM   5553  C  CB    . MET A 1 758  ? -32.119 -32.771 -51.542 1.00 80.07  ? 758  MET A CB    1 
ATOM   5554  C  CG    . MET A 1 758  ? -31.909 -34.089 -50.839 1.00 80.90  ? 758  MET A CG    1 
ATOM   5555  S  SD    . MET A 1 758  ? -30.555 -33.880 -49.686 1.00 89.20  ? 758  MET A SD    1 
ATOM   5556  C  CE    . MET A 1 758  ? -31.323 -32.884 -48.399 1.00 92.15  ? 758  MET A CE    1 
ATOM   5557  N  N     . LEU A 1 759  ? -33.043 -33.629 -54.303 1.00 75.75  ? 759  LEU A N     1 
ATOM   5558  C  CA    . LEU A 1 759  ? -32.977 -34.638 -55.335 1.00 71.66  ? 759  LEU A CA    1 
ATOM   5559  C  C     . LEU A 1 759  ? -31.515 -34.773 -55.751 1.00 68.39  ? 759  LEU A C     1 
ATOM   5560  O  O     . LEU A 1 759  ? -30.883 -33.788 -56.125 1.00 68.11  ? 759  LEU A O     1 
ATOM   5561  C  CB    . LEU A 1 759  ? -33.796 -34.222 -56.533 1.00 72.21  ? 759  LEU A CB    1 
ATOM   5562  C  CG    . LEU A 1 759  ? -33.763 -35.239 -57.664 1.00 73.97  ? 759  LEU A CG    1 
ATOM   5563  C  CD1   . LEU A 1 759  ? -34.592 -36.445 -57.286 1.00 79.83  ? 759  LEU A CD1   1 
ATOM   5564  C  CD2   . LEU A 1 759  ? -34.300 -34.619 -58.932 1.00 78.03  ? 759  LEU A CD2   1 
ATOM   5565  N  N     . VAL A 1 760  ? -30.991 -35.989 -55.643 1.00 69.79  ? 760  VAL A N     1 
ATOM   5566  C  CA    . VAL A 1 760  ? -29.635 -36.277 -56.037 1.00 68.40  ? 760  VAL A CA    1 
ATOM   5567  C  C     . VAL A 1 760  ? -29.694 -37.147 -57.276 1.00 70.25  ? 760  VAL A C     1 
ATOM   5568  O  O     . VAL A 1 760  ? -30.344 -38.178 -57.262 1.00 69.92  ? 760  VAL A O     1 
ATOM   5569  C  CB    . VAL A 1 760  ? -28.878 -37.004 -54.930 1.00 66.67  ? 760  VAL A CB    1 
ATOM   5570  C  CG1   . VAL A 1 760  ? -27.439 -37.208 -55.332 1.00 65.97  ? 760  VAL A CG1   1 
ATOM   5571  C  CG2   . VAL A 1 760  ? -28.935 -36.194 -53.648 1.00 72.22  ? 760  VAL A CG2   1 
ATOM   5572  N  N     . VAL A 1 761  ? -29.032 -36.712 -58.345 1.00 78.03  ? 761  VAL A N     1 
ATOM   5573  C  CA    . VAL A 1 761  ? -29.117 -37.360 -59.659 1.00 83.59  ? 761  VAL A CA    1 
ATOM   5574  C  C     . VAL A 1 761  ? -27.698 -37.691 -60.169 1.00 86.88  ? 761  VAL A C     1 
ATOM   5575  O  O     . VAL A 1 761  ? -26.958 -36.762 -60.548 1.00 90.20  ? 761  VAL A O     1 
ATOM   5576  C  CB    . VAL A 1 761  ? -29.864 -36.388 -60.616 1.00 81.46  ? 761  VAL A CB    1 
ATOM   5577  C  CG1   . VAL A 1 761  ? -29.590 -36.692 -62.080 1.00 88.73  ? 761  VAL A CG1   1 
ATOM   5578  C  CG2   . VAL A 1 761  ? -31.351 -36.416 -60.330 1.00 74.48  ? 761  VAL A CG2   1 
ATOM   5579  N  N     . PRO A 1 762  ? -27.291 -38.989 -60.164 1.00 80.98  ? 762  PRO A N     1 
ATOM   5580  C  CA    . PRO A 1 762  ? -26.029 -39.355 -60.806 1.00 80.67  ? 762  PRO A CA    1 
ATOM   5581  C  C     . PRO A 1 762  ? -26.152 -39.324 -62.316 1.00 79.33  ? 762  PRO A C     1 
ATOM   5582  O  O     . PRO A 1 762  ? -27.161 -39.802 -62.847 1.00 93.79  ? 762  PRO A O     1 
ATOM   5583  C  CB    . PRO A 1 762  ? -25.787 -40.790 -60.340 1.00 82.22  ? 762  PRO A CB    1 
ATOM   5584  C  CG    . PRO A 1 762  ? -27.139 -41.330 -60.079 1.00 85.88  ? 762  PRO A CG    1 
ATOM   5585  C  CD    . PRO A 1 762  ? -27.967 -40.162 -59.593 1.00 89.21  ? 762  PRO A CD    1 
ATOM   5586  N  N     . LYS A 1 763  ? -25.145 -38.764 -62.989 1.00 84.02  ? 763  LYS A N     1 
ATOM   5587  C  CA    . LYS A 1 763  ? -25.171 -38.615 -64.444 1.00 86.52  ? 763  LYS A CA    1 
ATOM   5588  C  C     . LYS A 1 763  ? -24.957 -39.934 -65.170 1.00 82.10  ? 763  LYS A C     1 
ATOM   5589  O  O     . LYS A 1 763  ? -25.513 -40.146 -66.238 1.00 85.15  ? 763  LYS A O     1 
ATOM   5590  C  CB    . LYS A 1 763  ? -24.084 -37.646 -64.924 1.00 91.35  ? 763  LYS A CB    1 
ATOM   5591  C  CG    . LYS A 1 763  ? -24.420 -36.933 -66.229 1.00 91.97  ? 763  LYS A CG    1 
ATOM   5592  C  CD    . LYS A 1 763  ? -25.443 -35.830 -65.946 1.00 106.83 ? 763  LYS A CD    1 
ATOM   5593  C  CE    . LYS A 1 763  ? -25.354 -34.656 -66.911 1.00 105.28 ? 763  LYS A CE    1 
ATOM   5594  N  NZ    . LYS A 1 763  ? -25.904 -35.004 -68.247 1.00 109.72 ? 763  LYS A NZ    1 
ATOM   5595  N  N     . GLY A 1 764  ? -24.108 -40.793 -64.592 1.00 78.24  ? 764  GLY A N     1 
ATOM   5596  C  CA    . GLY A 1 764  ? -23.701 -42.051 -65.233 1.00 79.84  ? 764  GLY A CA    1 
ATOM   5597  C  C     . GLY A 1 764  ? -22.383 -41.984 -65.994 1.00 74.14  ? 764  GLY A C     1 
ATOM   5598  O  O     . GLY A 1 764  ? -22.089 -42.863 -66.775 1.00 75.10  ? 764  GLY A O     1 
ATOM   5599  N  N     . GLU A 1 765  ? -21.652 -40.895 -65.809 1.00 73.10  ? 765  GLU A N     1 
ATOM   5600  C  CA    . GLU A 1 765  ? -20.339 -40.683 -66.411 1.00 79.05  ? 765  GLU A CA    1 
ATOM   5601  C  C     . GLU A 1 765  ? -19.396 -40.155 -65.362 1.00 85.07  ? 765  GLU A C     1 
ATOM   5602  O  O     . GLU A 1 765  ? -19.766 -39.203 -64.684 1.00 103.49 ? 765  GLU A O     1 
ATOM   5603  C  CB    . GLU A 1 765  ? -20.418 -39.593 -67.471 1.00 80.46  ? 765  GLU A CB    1 
ATOM   5604  C  CG    . GLU A 1 765  ? -21.253 -39.912 -68.697 1.00 90.56  ? 765  GLU A CG    1 
ATOM   5605  C  CD    . GLU A 1 765  ? -20.787 -39.166 -69.970 1.00 100.60 ? 765  GLU A CD    1 
ATOM   5606  O  OE1   . GLU A 1 765  ? -19.808 -38.381 -69.926 1.00 87.16  ? 765  GLU A OE1   1 
ATOM   5607  O  OE2   . GLU A 1 765  ? -21.411 -39.358 -71.044 1.00 118.07 ? 765  GLU A OE2   1 
ATOM   5608  N  N     . ASP A 1 766  ? -18.207 -40.752 -65.224 1.00 90.01  ? 766  ASP A N     1 
ATOM   5609  C  CA    . ASP A 1 766  ? -17.136 -40.263 -64.338 1.00 92.10  ? 766  ASP A CA    1 
ATOM   5610  C  C     . ASP A 1 766  ? -17.550 -40.023 -62.880 1.00 84.69  ? 766  ASP A C     1 
ATOM   5611  O  O     . ASP A 1 766  ? -16.959 -39.208 -62.183 1.00 85.16  ? 766  ASP A O     1 
ATOM   5612  C  CB    . ASP A 1 766  ? -16.469 -39.000 -64.924 1.00 100.46 ? 766  ASP A CB    1 
ATOM   5613  C  CG    . ASP A 1 766  ? -15.874 -39.231 -66.319 1.00 99.21  ? 766  ASP A CG    1 
ATOM   5614  O  OD1   . ASP A 1 766  ? -15.066 -40.172 -66.489 1.00 104.96 ? 766  ASP A OD1   1 
ATOM   5615  O  OD2   . ASP A 1 766  ? -16.210 -38.458 -67.239 1.00 82.66  ? 766  ASP A OD2   1 
ATOM   5616  N  N     . GLN A 1 767  ? -18.556 -40.762 -62.420 1.00 85.90  ? 767  GLN A N     1 
ATOM   5617  C  CA    . GLN A 1 767  ? -19.193 -40.536 -61.116 1.00 92.06  ? 767  GLN A CA    1 
ATOM   5618  C  C     . GLN A 1 767  ? -19.645 -39.088 -60.870 1.00 92.07  ? 767  GLN A C     1 
ATOM   5619  O  O     . GLN A 1 767  ? -19.596 -38.595 -59.751 1.00 84.73  ? 767  GLN A O     1 
ATOM   5620  C  CB    . GLN A 1 767  ? -18.296 -40.990 -59.982 1.00 99.35  ? 767  GLN A CB    1 
ATOM   5621  C  CG    . GLN A 1 767  ? -17.810 -42.414 -60.097 1.00 103.54 ? 767  GLN A CG    1 
ATOM   5622  C  CD    . GLN A 1 767  ? -16.630 -42.625 -59.195 1.00 109.58 ? 767  GLN A CD    1 
ATOM   5623  O  OE1   . GLN A 1 767  ? -15.517 -42.169 -59.495 1.00 97.29  ? 767  GLN A OE1   1 
ATOM   5624  N  NE2   . GLN A 1 767  ? -16.870 -43.268 -58.051 1.00 111.86 ? 767  GLN A NE2   1 
ATOM   5625  N  N     . GLU A 1 768  ? -20.107 -38.405 -61.920 1.00 92.29  ? 768  GLU A N     1 
ATOM   5626  C  CA    . GLU A 1 768  ? -20.687 -37.081 -61.782 1.00 81.65  ? 768  GLU A CA    1 
ATOM   5627  C  C     . GLU A 1 768  ? -22.030 -37.148 -61.057 1.00 84.64  ? 768  GLU A C     1 
ATOM   5628  O  O     . GLU A 1 768  ? -22.894 -37.918 -61.457 1.00 94.84  ? 768  GLU A O     1 
ATOM   5629  C  CB    . GLU A 1 768  ? -20.964 -36.425 -63.136 1.00 82.49  ? 768  GLU A CB    1 
ATOM   5630  C  CG    . GLU A 1 768  ? -19.751 -35.967 -63.942 1.00 94.79  ? 768  GLU A CG    1 
ATOM   5631  C  CD    . GLU A 1 768  ? -20.131 -35.378 -65.320 1.00 98.36  ? 768  GLU A CD    1 
ATOM   5632  O  OE1   . GLU A 1 768  ? -21.212 -34.752 -65.413 1.00 95.56  ? 768  GLU A OE1   1 
ATOM   5633  O  OE2   . GLU A 1 768  ? -19.365 -35.530 -66.319 1.00 87.57  ? 768  GLU A OE2   1 
ATOM   5634  N  N     . MET A 1 769  ? -22.173 -36.343 -59.997 1.00 88.44  ? 769  MET A N     1 
ATOM   5635  C  CA    . MET A 1 769  ? -23.463 -36.159 -59.348 1.00 80.91  ? 769  MET A CA    1 
ATOM   5636  C  C     . MET A 1 769  ? -23.921 -34.730 -59.522 1.00 82.02  ? 769  MET A C     1 
ATOM   5637  O  O     . MET A 1 769  ? -23.114 -33.786 -59.488 1.00 77.09  ? 769  MET A O     1 
ATOM   5638  C  CB    . MET A 1 769  ? -23.457 -36.576 -57.889 1.00 82.99  ? 769  MET A CB    1 
ATOM   5639  C  CG    . MET A 1 769  ? -22.805 -37.925 -57.592 1.00 95.11  ? 769  MET A CG    1 
ATOM   5640  S  SD    . MET A 1 769  ? -23.767 -39.469 -57.643 1.00 106.90 ? 769  MET A SD    1 
ATOM   5641  C  CE    . MET A 1 769  ? -25.329 -39.000 -56.945 1.00 99.25  ? 769  MET A CE    1 
ATOM   5642  N  N     . ASP A 1 770  ? -25.213 -34.568 -59.755 1.00 83.29  ? 770  ASP A N     1 
ATOM   5643  C  CA    . ASP A 1 770  ? -25.879 -33.274 -59.641 1.00 82.53  ? 770  ASP A CA    1 
ATOM   5644  C  C     . ASP A 1 770  ? -26.791 -33.339 -58.436 1.00 78.12  ? 770  ASP A C     1 
ATOM   5645  O  O     . ASP A 1 770  ? -27.541 -34.300 -58.260 1.00 67.28  ? 770  ASP A O     1 
ATOM   5646  C  CB    . ASP A 1 770  ? -26.654 -32.950 -60.891 1.00 87.63  ? 770  ASP A CB    1 
ATOM   5647  C  CG    . ASP A 1 770  ? -25.763 -32.733 -62.045 1.00 86.54  ? 770  ASP A CG    1 
ATOM   5648  O  OD1   . ASP A 1 770  ? -25.014 -31.725 -61.978 1.00 79.17  ? 770  ASP A OD1   1 
ATOM   5649  O  OD2   . ASP A 1 770  ? -25.802 -33.591 -62.973 1.00 82.82  ? 770  ASP A OD2   1 
ATOM   5650  N  N     . VAL A 1 771  ? -26.699 -32.315 -57.596 1.00 77.64  ? 771  VAL A N     1 
ATOM   5651  C  CA    . VAL A 1 771  ? -27.472 -32.243 -56.361 1.00 76.76  ? 771  VAL A CA    1 
ATOM   5652  C  C     . VAL A 1 771  ? -28.380 -31.003 -56.400 1.00 78.39  ? 771  VAL A C     1 
ATOM   5653  O  O     . VAL A 1 771  ? -27.906 -29.877 -56.405 1.00 79.21  ? 771  VAL A O     1 
ATOM   5654  C  CB    . VAL A 1 771  ? -26.541 -32.289 -55.149 1.00 75.58  ? 771  VAL A CB    1 
ATOM   5655  C  CG1   . VAL A 1 771  ? -27.339 -32.309 -53.853 1.00 76.10  ? 771  VAL A CG1   1 
ATOM   5656  C  CG2   . VAL A 1 771  ? -25.654 -33.525 -55.248 1.00 73.74  ? 771  VAL A CG2   1 
ATOM   5657  N  N     . TYR A 1 772  ? -29.688 -31.243 -56.468 1.00 77.65  ? 772  TYR A N     1 
ATOM   5658  C  CA    . TYR A 1 772  ? -30.706 -30.190 -56.380 1.00 74.79  ? 772  TYR A CA    1 
ATOM   5659  C  C     . TYR A 1 772  ? -31.236 -30.227 -54.966 1.00 75.66  ? 772  TYR A C     1 
ATOM   5660  O  O     . TYR A 1 772  ? -31.839 -31.216 -54.558 1.00 68.42  ? 772  TYR A O     1 
ATOM   5661  C  CB    . TYR A 1 772  ? -31.775 -30.432 -57.414 1.00 73.48  ? 772  TYR A CB    1 
ATOM   5662  C  CG    . TYR A 1 772  ? -31.174 -30.730 -58.754 1.00 74.80  ? 772  TYR A CG    1 
ATOM   5663  C  CD1   . TYR A 1 772  ? -30.837 -29.712 -59.633 1.00 81.11  ? 772  TYR A CD1   1 
ATOM   5664  C  CD2   . TYR A 1 772  ? -30.904 -32.026 -59.130 1.00 81.92  ? 772  TYR A CD2   1 
ATOM   5665  C  CE1   . TYR A 1 772  ? -30.267 -29.980 -60.870 1.00 78.04  ? 772  TYR A CE1   1 
ATOM   5666  C  CE2   . TYR A 1 772  ? -30.323 -32.311 -60.356 1.00 87.48  ? 772  TYR A CE2   1 
ATOM   5667  C  CZ    . TYR A 1 772  ? -30.008 -31.280 -61.221 1.00 79.83  ? 772  TYR A CZ    1 
ATOM   5668  O  OH    . TYR A 1 772  ? -29.438 -31.579 -62.424 1.00 72.32  ? 772  TYR A OH    1 
ATOM   5669  N  N     . VAL A 1 773  ? -30.975 -29.171 -54.202 1.00 77.52  ? 773  VAL A N     1 
ATOM   5670  C  CA    . VAL A 1 773  ? -31.269 -29.190 -52.772 1.00 79.25  ? 773  VAL A CA    1 
ATOM   5671  C  C     . VAL A 1 773  ? -31.677 -27.792 -52.298 1.00 79.74  ? 773  VAL A C     1 
ATOM   5672  O  O     . VAL A 1 773  ? -31.087 -26.791 -52.718 1.00 80.46  ? 773  VAL A O     1 
ATOM   5673  C  CB    . VAL A 1 773  ? -30.047 -29.699 -51.966 1.00 73.93  ? 773  VAL A CB    1 
ATOM   5674  C  CG1   . VAL A 1 773  ? -28.788 -29.011 -52.419 1.00 74.02  ? 773  VAL A CG1   1 
ATOM   5675  C  CG2   . VAL A 1 773  ? -30.227 -29.479 -50.469 1.00 75.46  ? 773  VAL A CG2   1 
ATOM   5676  N  N     . SER A 1 774  ? -32.668 -27.746 -51.400 1.00 66.80  ? 774  SER A N     1 
ATOM   5677  C  CA    . SER A 1 774  ? -33.012 -26.539 -50.690 1.00 65.56  ? 774  SER A CA    1 
ATOM   5678  C  C     . SER A 1 774  ? -31.986 -26.373 -49.547 1.00 71.12  ? 774  SER A C     1 
ATOM   5679  O  O     . SER A 1 774  ? -32.095 -27.016 -48.484 1.00 72.73  ? 774  SER A O     1 
ATOM   5680  C  CB    . SER A 1 774  ? -34.452 -26.572 -50.202 1.00 68.30  ? 774  SER A CB    1 
ATOM   5681  O  OG    . SER A 1 774  ? -34.739 -25.478 -49.347 1.00 72.53  ? 774  SER A OG    1 
ATOM   5682  N  N     . THR A 1 775  ? -30.964 -25.529 -49.809 1.00 69.35  ? 775  THR A N     1 
ATOM   5683  C  CA    . THR A 1 775  ? -29.934 -25.168 -48.822 1.00 67.56  ? 775  THR A CA    1 
ATOM   5684  C  C     . THR A 1 775  ? -29.496 -23.703 -48.930 1.00 70.11  ? 775  THR A C     1 
ATOM   5685  O  O     . THR A 1 775  ? -29.746 -23.028 -49.939 1.00 61.18  ? 775  THR A O     1 
ATOM   5686  C  CB    . THR A 1 775  ? -28.665 -26.021 -48.985 1.00 67.89  ? 775  THR A CB    1 
ATOM   5687  O  OG1   . THR A 1 775  ? -27.732 -25.709 -47.934 1.00 69.73  ? 775  THR A OG1   1 
ATOM   5688  C  CG2   . THR A 1 775  ? -28.016 -25.768 -50.341 1.00 63.89  ? 775  THR A CG2   1 
ATOM   5689  N  N     . GLN A 1 776  ? -28.810 -23.242 -47.887 1.00 74.28  ? 776  GLN A N     1 
ATOM   5690  C  CA    . GLN A 1 776  ? -28.201 -21.919 -47.853 1.00 80.53  ? 776  GLN A CA    1 
ATOM   5691  C  C     . GLN A 1 776  ? -26.714 -21.914 -48.202 1.00 83.21  ? 776  GLN A C     1 
ATOM   5692  O  O     . GLN A 1 776  ? -26.091 -20.854 -48.196 1.00 94.44  ? 776  GLN A O     1 
ATOM   5693  C  CB    . GLN A 1 776  ? -28.283 -21.320 -46.453 1.00 79.11  ? 776  GLN A CB    1 
ATOM   5694  C  CG    . GLN A 1 776  ? -29.613 -21.373 -45.757 1.00 81.41  ? 776  GLN A CG    1 
ATOM   5695  C  CD    . GLN A 1 776  ? -29.470 -20.863 -44.337 1.00 88.70  ? 776  GLN A CD    1 
ATOM   5696  O  OE1   . GLN A 1 776  ? -29.933 -21.490 -43.399 1.00 92.24  ? 776  GLN A OE1   1 
ATOM   5697  N  NE2   . GLN A 1 776  ? -28.788 -19.740 -44.174 1.00 89.46  ? 776  GLN A NE2   1 
ATOM   5698  N  N     . PHE A 1 777  ? -26.134 -23.087 -48.470 1.00 78.93  ? 777  PHE A N     1 
ATOM   5699  C  CA    . PHE A 1 777  ? -24.693 -23.215 -48.616 1.00 75.70  ? 777  PHE A CA    1 
ATOM   5700  C  C     . PHE A 1 777  ? -24.303 -24.321 -49.621 1.00 75.90  ? 777  PHE A C     1 
ATOM   5701  O  O     . PHE A 1 777  ? -23.842 -25.401 -49.217 1.00 84.72  ? 777  PHE A O     1 
ATOM   5702  C  CB    . PHE A 1 777  ? -24.094 -23.574 -47.264 1.00 75.14  ? 777  PHE A CB    1 
ATOM   5703  C  CG    . PHE A 1 777  ? -22.672 -23.158 -47.100 1.00 80.83  ? 777  PHE A CG    1 
ATOM   5704  C  CD1   . PHE A 1 777  ? -21.922 -22.660 -48.177 1.00 85.37  ? 777  PHE A CD1   1 
ATOM   5705  C  CD2   . PHE A 1 777  ? -22.066 -23.272 -45.857 1.00 82.00  ? 777  PHE A CD2   1 
ATOM   5706  C  CE1   . PHE A 1 777  ? -20.612 -22.263 -47.992 1.00 87.65  ? 777  PHE A CE1   1 
ATOM   5707  C  CE2   . PHE A 1 777  ? -20.751 -22.889 -45.670 1.00 83.32  ? 777  PHE A CE2   1 
ATOM   5708  C  CZ    . PHE A 1 777  ? -20.025 -22.379 -46.736 1.00 87.94  ? 777  PHE A CZ    1 
ATOM   5709  N  N     . PRO A 1 778  ? -24.479 -24.070 -50.933 1.00 75.54  ? 778  PRO A N     1 
ATOM   5710  C  CA    . PRO A 1 778  ? -24.169 -25.062 -51.955 1.00 79.70  ? 778  PRO A CA    1 
ATOM   5711  C  C     . PRO A 1 778  ? -22.732 -25.605 -51.893 1.00 83.71  ? 778  PRO A C     1 
ATOM   5712  O  O     . PRO A 1 778  ? -22.535 -26.818 -51.967 1.00 85.41  ? 778  PRO A O     1 
ATOM   5713  C  CB    . PRO A 1 778  ? -24.401 -24.299 -53.272 1.00 77.01  ? 778  PRO A CB    1 
ATOM   5714  C  CG    . PRO A 1 778  ? -25.374 -23.242 -52.938 1.00 73.79  ? 778  PRO A CG    1 
ATOM   5715  C  CD    . PRO A 1 778  ? -25.061 -22.851 -51.523 1.00 76.79  ? 778  PRO A CD    1 
ATOM   5716  N  N     . LYS A 1 779  ? -21.751 -24.712 -51.745 1.00 79.47  ? 779  LYS A N     1 
ATOM   5717  C  CA    . LYS A 1 779  ? -20.361 -25.125 -51.656 1.00 80.49  ? 779  LYS A CA    1 
ATOM   5718  C  C     . LYS A 1 779  ? -20.139 -26.169 -50.550 1.00 78.22  ? 779  LYS A C     1 
ATOM   5719  O  O     . LYS A 1 779  ? -19.362 -27.108 -50.729 1.00 90.35  ? 779  LYS A O     1 
ATOM   5720  C  CB    . LYS A 1 779  ? -19.498 -23.914 -51.448 1.00 79.12  ? 779  LYS A CB    1 
ATOM   5721  C  CG    . LYS A 1 779  ? -18.074 -24.184 -51.037 1.00 84.70  ? 779  LYS A CG    1 
ATOM   5722  C  CD    . LYS A 1 779  ? -17.548 -22.904 -50.380 1.00 103.45 ? 779  LYS A CD    1 
ATOM   5723  C  CE    . LYS A 1 779  ? -16.162 -23.012 -49.767 1.00 107.73 ? 779  LYS A CE    1 
ATOM   5724  N  NZ    . LYS A 1 779  ? -15.860 -24.374 -49.253 1.00 104.78 ? 779  LYS A NZ    1 
ATOM   5725  N  N     . TYR A 1 780  ? -20.824 -26.017 -49.423 1.00 71.44  ? 780  TYR A N     1 
ATOM   5726  C  CA    . TYR A 1 780  ? -20.732 -27.017 -48.359 1.00 75.27  ? 780  TYR A CA    1 
ATOM   5727  C  C     . TYR A 1 780  ? -21.393 -28.342 -48.742 1.00 79.40  ? 780  TYR A C     1 
ATOM   5728  O  O     . TYR A 1 780  ? -20.867 -29.402 -48.378 1.00 85.36  ? 780  TYR A O     1 
ATOM   5729  C  CB    . TYR A 1 780  ? -21.346 -26.506 -47.066 1.00 79.82  ? 780  TYR A CB    1 
ATOM   5730  C  CG    . TYR A 1 780  ? -21.665 -27.597 -46.075 1.00 75.10  ? 780  TYR A CG    1 
ATOM   5731  C  CD1   . TYR A 1 780  ? -20.644 -28.311 -45.432 1.00 73.13  ? 780  TYR A CD1   1 
ATOM   5732  C  CD2   . TYR A 1 780  ? -22.987 -27.909 -45.777 1.00 74.17  ? 780  TYR A CD2   1 
ATOM   5733  C  CE1   . TYR A 1 780  ? -20.937 -29.301 -44.510 1.00 75.90  ? 780  TYR A CE1   1 
ATOM   5734  C  CE2   . TYR A 1 780  ? -23.300 -28.902 -44.863 1.00 76.00  ? 780  TYR A CE2   1 
ATOM   5735  C  CZ    . TYR A 1 780  ? -22.284 -29.595 -44.231 1.00 78.73  ? 780  TYR A CZ    1 
ATOM   5736  O  OH    . TYR A 1 780  ? -22.635 -30.577 -43.333 1.00 73.13  ? 780  TYR A OH    1 
ATOM   5737  N  N     . ILE A 1 781  ? -22.517 -28.285 -49.470 1.00 81.85  ? 781  ILE A N     1 
ATOM   5738  C  CA    . ILE A 1 781  ? -23.184 -29.499 -49.992 1.00 79.36  ? 781  ILE A CA    1 
ATOM   5739  C  C     . ILE A 1 781  ? -22.239 -30.248 -50.933 1.00 80.73  ? 781  ILE A C     1 
ATOM   5740  O  O     . ILE A 1 781  ? -22.067 -31.458 -50.815 1.00 68.63  ? 781  ILE A O     1 
ATOM   5741  C  CB    . ILE A 1 781  ? -24.509 -29.159 -50.702 1.00 74.04  ? 781  ILE A CB    1 
ATOM   5742  C  CG1   . ILE A 1 781  ? -25.511 -28.588 -49.696 1.00 75.17  ? 781  ILE A CG1   1 
ATOM   5743  C  CG2   . ILE A 1 781  ? -25.087 -30.378 -51.400 1.00 70.43  ? 781  ILE A CG2   1 
ATOM   5744  C  CD1   . ILE A 1 781  ? -25.792 -29.480 -48.510 1.00 73.91  ? 781  ILE A CD1   1 
ATOM   5745  N  N     . GLN A 1 782  ? -21.640 -29.506 -51.862 1.00 78.86  ? 782  GLN A N     1 
ATOM   5746  C  CA    . GLN A 1 782  ? -20.647 -30.051 -52.783 1.00 82.07  ? 782  GLN A CA    1 
ATOM   5747  C  C     . GLN A 1 782  ? -19.506 -30.754 -52.044 1.00 86.77  ? 782  GLN A C     1 
ATOM   5748  O  O     . GLN A 1 782  ? -19.095 -31.849 -52.438 1.00 95.17  ? 782  GLN A O     1 
ATOM   5749  C  CB    . GLN A 1 782  ? -20.127 -28.909 -53.645 1.00 83.09  ? 782  GLN A CB    1 
ATOM   5750  C  CG    . GLN A 1 782  ? -18.889 -29.172 -54.470 1.00 80.67  ? 782  GLN A CG    1 
ATOM   5751  C  CD    . GLN A 1 782  ? -18.405 -27.881 -55.088 1.00 82.06  ? 782  GLN A CD    1 
ATOM   5752  O  OE1   . GLN A 1 782  ? -17.891 -26.999 -54.395 1.00 76.80  ? 782  GLN A OE1   1 
ATOM   5753  N  NE2   . GLN A 1 782  ? -18.593 -27.749 -56.387 1.00 86.74  ? 782  GLN A NE2   1 
ATOM   5754  N  N     . ASP A 1 783  ? -19.024 -30.149 -50.961 1.00 88.12  ? 783  ASP A N     1 
ATOM   5755  C  CA    . ASP A 1 783  ? -17.922 -30.730 -50.195 1.00 101.61 ? 783  ASP A CA    1 
ATOM   5756  C  C     . ASP A 1 783  ? -18.289 -32.032 -49.501 1.00 99.34  ? 783  ASP A C     1 
ATOM   5757  O  O     . ASP A 1 783  ? -17.557 -33.018 -49.606 1.00 100.24 ? 783  ASP A O     1 
ATOM   5758  C  CB    . ASP A 1 783  ? -17.389 -29.754 -49.159 1.00 108.20 ? 783  ASP A CB    1 
ATOM   5759  C  CG    . ASP A 1 783  ? -16.729 -28.578 -49.778 1.00 108.65 ? 783  ASP A CG    1 
ATOM   5760  O  OD1   . ASP A 1 783  ? -16.317 -28.648 -50.966 1.00 105.01 ? 783  ASP A OD1   1 
ATOM   5761  O  OD2   . ASP A 1 783  ? -16.637 -27.574 -49.054 1.00 118.80 ? 783  ASP A OD2   1 
ATOM   5762  N  N     . ILE A 1 784  ? -19.398 -32.028 -48.775 1.00 85.57  ? 784  ILE A N     1 
ATOM   5763  C  CA    . ILE A 1 784  ? -19.772 -33.197 -47.980 1.00 80.26  ? 784  ILE A CA    1 
ATOM   5764  C  C     . ILE A 1 784  ? -20.217 -34.367 -48.881 1.00 78.91  ? 784  ILE A C     1 
ATOM   5765  O  O     . ILE A 1 784  ? -19.948 -35.519 -48.559 1.00 65.03  ? 784  ILE A O     1 
ATOM   5766  C  CB    . ILE A 1 784  ? -20.801 -32.803 -46.919 1.00 65.28  ? 784  ILE A CB    1 
ATOM   5767  C  CG1   . ILE A 1 784  ? -21.094 -33.996 -46.021 1.00 56.96  ? 784  ILE A CG1   1 
ATOM   5768  C  CG2   . ILE A 1 784  ? -22.041 -32.263 -47.592 1.00 72.09  ? 784  ILE A CG2   1 
ATOM   5769  C  CD1   . ILE A 1 784  ? -22.292 -33.809 -45.165 1.00 55.05  ? 784  ILE A CD1   1 
ATOM   5770  N  N     . VAL A 1 785  ? -20.848 -34.075 -50.017 1.00 78.59  ? 785  VAL A N     1 
ATOM   5771  C  CA    . VAL A 1 785  ? -21.222 -35.125 -50.978 1.00 78.38  ? 785  VAL A CA    1 
ATOM   5772  C  C     . VAL A 1 785  ? -19.981 -35.722 -51.666 1.00 75.57  ? 785  VAL A C     1 
ATOM   5773  O  O     . VAL A 1 785  ? -19.862 -36.942 -51.765 1.00 79.70  ? 785  VAL A O     1 
ATOM   5774  C  CB    . VAL A 1 785  ? -22.284 -34.627 -52.001 1.00 82.31  ? 785  VAL A CB    1 
ATOM   5775  C  CG1   . VAL A 1 785  ? -22.501 -35.621 -53.137 1.00 74.30  ? 785  VAL A CG1   1 
ATOM   5776  C  CG2   . VAL A 1 785  ? -23.604 -34.359 -51.283 1.00 83.60  ? 785  VAL A CG2   1 
ATOM   5777  N  N     . ALA A 1 786  ? -19.064 -34.861 -52.118 1.00 80.40  ? 786  ALA A N     1 
ATOM   5778  C  CA    . ALA A 1 786  ? -17.810 -35.303 -52.761 1.00 86.56  ? 786  ALA A CA    1 
ATOM   5779  C  C     . ALA A 1 786  ? -16.947 -36.141 -51.810 1.00 91.98  ? 786  ALA A C     1 
ATOM   5780  O  O     . ALA A 1 786  ? -16.487 -37.228 -52.175 1.00 101.36 ? 786  ALA A O     1 
ATOM   5781  C  CB    . ALA A 1 786  ? -17.035 -34.131 -53.320 1.00 85.98  ? 786  ALA A CB    1 
ATOM   5782  N  N     . SER A 1 787  ? -16.737 -35.629 -50.606 1.00 85.65  ? 787  SER A N     1 
ATOM   5783  C  CA    . SER A 1 787  ? -16.075 -36.361 -49.535 1.00 82.98  ? 787  SER A CA    1 
ATOM   5784  C  C     . SER A 1 787  ? -16.701 -37.754 -49.291 1.00 81.60  ? 787  SER A C     1 
ATOM   5785  O  O     . SER A 1 787  ? -15.999 -38.766 -49.234 1.00 80.28  ? 787  SER A O     1 
ATOM   5786  C  CB    . SER A 1 787  ? -16.170 -35.520 -48.261 1.00 87.57  ? 787  SER A CB    1 
ATOM   5787  O  OG    . SER A 1 787  ? -16.038 -36.327 -47.107 1.00 103.36 ? 787  SER A OG    1 
ATOM   5788  N  N     . THR A 1 788  ? -18.025 -37.793 -49.173 1.00 81.25  ? 788  THR A N     1 
ATOM   5789  C  CA    . THR A 1 788  ? -18.763 -39.038 -48.948 1.00 78.44  ? 788  THR A CA    1 
ATOM   5790  C  C     . THR A 1 788  ? -18.571 -40.045 -50.081 1.00 74.47  ? 788  THR A C     1 
ATOM   5791  O  O     . THR A 1 788  ? -18.470 -41.243 -49.830 1.00 75.07  ? 788  THR A O     1 
ATOM   5792  C  CB    . THR A 1 788  ? -20.236 -38.686 -48.700 1.00 84.10  ? 788  THR A CB    1 
ATOM   5793  O  OG1   . THR A 1 788  ? -20.334 -37.995 -47.445 1.00 79.86  ? 788  THR A OG1   1 
ATOM   5794  C  CG2   . THR A 1 788  ? -21.135 -39.929 -48.692 1.00 87.97  ? 788  THR A CG2   1 
ATOM   5795  N  N     . LEU A 1 789  ? -18.505 -39.553 -51.313 1.00 77.08  ? 789  LEU A N     1 
ATOM   5796  C  CA    . LEU A 1 789  ? -18.272 -40.391 -52.494 1.00 81.83  ? 789  LEU A CA    1 
ATOM   5797  C  C     . LEU A 1 789  ? -16.779 -40.590 -52.835 1.00 76.01  ? 789  LEU A C     1 
ATOM   5798  O  O     . LEU A 1 789  ? -16.470 -41.296 -53.792 1.00 71.01  ? 789  LEU A O     1 
ATOM   5799  C  CB    . LEU A 1 789  ? -19.006 -39.758 -53.681 1.00 82.94  ? 789  LEU A CB    1 
ATOM   5800  C  CG    . LEU A 1 789  ? -20.516 -39.631 -53.457 1.00 83.76  ? 789  LEU A CG    1 
ATOM   5801  C  CD1   . LEU A 1 789  ? -21.156 -38.751 -54.525 1.00 79.04  ? 789  LEU A CD1   1 
ATOM   5802  C  CD2   . LEU A 1 789  ? -21.168 -41.012 -53.389 1.00 83.26  ? 789  LEU A CD2   1 
ATOM   5803  N  N     . LYS A 1 790  ? -15.882 -39.992 -52.050 1.00 73.66  ? 790  LYS A N     1 
ATOM   5804  C  CA    . LYS A 1 790  ? -14.452 -39.984 -52.312 1.00 80.02  ? 790  LYS A CA    1 
ATOM   5805  C  C     . LYS A 1 790  ? -14.131 -39.454 -53.715 1.00 77.83  ? 790  LYS A C     1 
ATOM   5806  O  O     . LYS A 1 790  ? -13.281 -40.016 -54.420 1.00 87.13  ? 790  LYS A O     1 
ATOM   5807  C  CB    . LYS A 1 790  ? -13.868 -41.371 -52.115 1.00 88.87  ? 790  LYS A CB    1 
ATOM   5808  C  CG    . LYS A 1 790  ? -14.277 -42.087 -50.850 1.00 94.48  ? 790  LYS A CG    1 
ATOM   5809  C  CD    . LYS A 1 790  ? -14.337 -43.582 -51.157 1.00 114.18 ? 790  LYS A CD    1 
ATOM   5810  C  CE    . LYS A 1 790  ? -14.559 -44.443 -49.920 1.00 127.56 ? 790  LYS A CE    1 
ATOM   5811  N  NZ    . LYS A 1 790  ? -13.346 -44.508 -49.053 1.00 133.13 ? 790  LYS A NZ    1 
ATOM   5812  N  N     . LEU A 1 791  ? -14.821 -38.378 -54.113 1.00 72.18  ? 791  LEU A N     1 
ATOM   5813  C  CA    . LEU A 1 791  ? -14.636 -37.780 -55.427 1.00 68.85  ? 791  LEU A CA    1 
ATOM   5814  C  C     . LEU A 1 791  ? -14.019 -36.394 -55.315 1.00 71.84  ? 791  LEU A C     1 
ATOM   5815  O  O     . LEU A 1 791  ? -14.209 -35.727 -54.306 1.00 78.65  ? 791  LEU A O     1 
ATOM   5816  C  CB    . LEU A 1 791  ? -15.975 -37.578 -56.094 1.00 69.22  ? 791  LEU A CB    1 
ATOM   5817  C  CG    . LEU A 1 791  ? -16.832 -38.810 -56.276 1.00 71.24  ? 791  LEU A CG    1 
ATOM   5818  C  CD1   . LEU A 1 791  ? -17.988 -38.427 -57.169 1.00 68.48  ? 791  LEU A CD1   1 
ATOM   5819  C  CD2   . LEU A 1 791  ? -16.043 -39.948 -56.888 1.00 78.21  ? 791  LEU A CD2   1 
ATOM   5820  N  N     . PRO A 1 792  ? -13.318 -35.943 -56.367 1.00 74.04  ? 792  PRO A N     1 
ATOM   5821  C  CA    . PRO A 1 792  ? -12.949 -34.530 -56.382 1.00 74.72  ? 792  PRO A CA    1 
ATOM   5822  C  C     . PRO A 1 792  ? -14.197 -33.620 -56.495 1.00 69.62  ? 792  PRO A C     1 
ATOM   5823  O  O     . PRO A 1 792  ? -15.259 -34.062 -56.919 1.00 71.83  ? 792  PRO A O     1 
ATOM   5824  C  CB    . PRO A 1 792  ? -11.986 -34.427 -57.597 1.00 79.69  ? 792  PRO A CB    1 
ATOM   5825  C  CG    . PRO A 1 792  ? -12.255 -35.624 -58.459 1.00 72.48  ? 792  PRO A CG    1 
ATOM   5826  C  CD    . PRO A 1 792  ? -12.858 -36.676 -57.571 1.00 74.19  ? 792  PRO A CD    1 
ATOM   5827  N  N     . ALA A 1 793  ? -14.040 -32.371 -56.093 1.00 65.92  ? 793  ALA A N     1 
ATOM   5828  C  CA    . ALA A 1 793  ? -15.128 -31.431 -56.077 1.00 73.40  ? 793  ALA A CA    1 
ATOM   5829  C  C     . ALA A 1 793  ? -15.660 -31.124 -57.486 1.00 82.68  ? 793  ALA A C     1 
ATOM   5830  O  O     . ALA A 1 793  ? -16.838 -30.801 -57.638 1.00 92.01  ? 793  ALA A O     1 
ATOM   5831  C  CB    . ALA A 1 793  ? -14.696 -30.156 -55.378 1.00 75.38  ? 793  ALA A CB    1 
ATOM   5832  N  N     . ASN A 1 794  ? -14.806 -31.240 -58.507 1.00 85.49  ? 794  ASN A N     1 
ATOM   5833  C  CA    . ASN A 1 794  ? -15.221 -31.002 -59.906 1.00 85.88  ? 794  ASN A CA    1 
ATOM   5834  C  C     . ASN A 1 794  ? -16.206 -32.052 -60.475 1.00 90.15  ? 794  ASN A C     1 
ATOM   5835  O  O     . ASN A 1 794  ? -16.844 -31.821 -61.515 1.00 111.26 ? 794  ASN A O     1 
ATOM   5836  C  CB    . ASN A 1 794  ? -13.983 -30.884 -60.800 1.00 84.39  ? 794  ASN A CB    1 
ATOM   5837  C  CG    . ASN A 1 794  ? -13.112 -32.118 -60.740 1.00 85.94  ? 794  ASN A CG    1 
ATOM   5838  O  OD1   . ASN A 1 794  ? -13.480 -33.092 -60.104 1.00 94.37  ? 794  ASN A OD1   1 
ATOM   5839  N  ND2   . ASN A 1 794  ? -11.962 -32.084 -61.395 1.00 85.98  ? 794  ASN A ND2   1 
ATOM   5840  N  N     . LYS A 1 795  ? -16.336 -33.186 -59.790 1.00 80.08  ? 795  LYS A N     1 
ATOM   5841  C  CA    . LYS A 1 795  ? -17.321 -34.202 -60.124 1.00 84.17  ? 795  LYS A CA    1 
ATOM   5842  C  C     . LYS A 1 795  ? -18.714 -33.932 -59.520 1.00 84.00  ? 795  LYS A C     1 
ATOM   5843  O  O     . LYS A 1 795  ? -19.712 -34.408 -60.069 1.00 79.71  ? 795  LYS A O     1 
ATOM   5844  C  CB    . LYS A 1 795  ? -16.792 -35.561 -59.682 1.00 81.84  ? 795  LYS A CB    1 
ATOM   5845  C  CG    . LYS A 1 795  ? -16.148 -36.352 -60.817 1.00 93.79  ? 795  LYS A CG    1 
ATOM   5846  C  CD    . LYS A 1 795  ? -14.933 -35.693 -61.461 1.00 95.37  ? 795  LYS A CD    1 
ATOM   5847  C  CE    . LYS A 1 795  ? -14.001 -36.746 -62.058 1.00 99.66  ? 795  LYS A CE    1 
ATOM   5848  N  NZ    . LYS A 1 795  ? -12.762 -36.139 -62.622 1.00 105.99 ? 795  LYS A NZ    1 
ATOM   5849  N  N     . VAL A 1 796  ? -18.793 -33.191 -58.414 1.00 83.63  ? 796  VAL A N     1 
ATOM   5850  C  CA    . VAL A 1 796  ? -20.087 -32.941 -57.750 1.00 76.25  ? 796  VAL A CA    1 
ATOM   5851  C  C     . VAL A 1 796  ? -20.507 -31.469 -57.839 1.00 74.99  ? 796  VAL A C     1 
ATOM   5852  O  O     . VAL A 1 796  ? -19.775 -30.602 -57.400 1.00 74.38  ? 796  VAL A O     1 
ATOM   5853  C  CB    . VAL A 1 796  ? -20.031 -33.323 -56.269 1.00 73.98  ? 796  VAL A CB    1 
ATOM   5854  C  CG1   . VAL A 1 796  ? -21.366 -33.046 -55.603 1.00 77.42  ? 796  VAL A CG1   1 
ATOM   5855  C  CG2   . VAL A 1 796  ? -19.665 -34.780 -56.125 1.00 73.13  ? 796  VAL A CG2   1 
ATOM   5856  N  N     . MET A 1 797  ? -21.674 -31.212 -58.395 1.00 71.67  ? 797  MET A N     1 
ATOM   5857  C  CA    . MET A 1 797  ? -22.201 -29.851 -58.523 1.00 74.82  ? 797  MET A CA    1 
ATOM   5858  C  C     . MET A 1 797  ? -23.529 -29.716 -57.781 1.00 78.09  ? 797  MET A C     1 
ATOM   5859  O  O     . MET A 1 797  ? -24.398 -30.584 -57.900 1.00 84.46  ? 797  MET A O     1 
ATOM   5860  C  CB    . MET A 1 797  ? -22.373 -29.509 -59.993 1.00 79.77  ? 797  MET A CB    1 
ATOM   5861  C  CG    . MET A 1 797  ? -21.084 -29.643 -60.772 1.00 77.23  ? 797  MET A CG    1 
ATOM   5862  S  SD    . MET A 1 797  ? -19.986 -28.288 -60.359 1.00 78.97  ? 797  MET A SD    1 
ATOM   5863  C  CE    . MET A 1 797  ? -18.446 -29.176 -60.158 1.00 89.73  ? 797  MET A CE    1 
ATOM   5864  N  N     . CYS A 1 798  ? -23.680 -28.630 -57.036 1.00 78.78  ? 798  CYS A N     1 
ATOM   5865  C  CA    . CYS A 1 798  ? -24.906 -28.329 -56.321 1.00 77.18  ? 798  CYS A CA    1 
ATOM   5866  C  C     . CYS A 1 798  ? -25.613 -27.149 -56.983 1.00 81.08  ? 798  CYS A C     1 
ATOM   5867  O  O     . CYS A 1 798  ? -24.988 -26.126 -57.196 1.00 75.11  ? 798  CYS A O     1 
ATOM   5868  C  CB    . CYS A 1 798  ? -24.561 -28.031 -54.899 1.00 76.74  ? 798  CYS A CB    1 
ATOM   5869  S  SG    . CYS A 1 798  ? -26.049 -27.716 -53.995 1.00 86.46  ? 798  CYS A SG    1 
ATOM   5870  N  N     . HIS A 1 799  ? -26.910 -27.311 -57.291 1.00 83.98  ? 799  HIS A N     1 
ATOM   5871  C  CA    . HIS A 1 799  ? -27.729 -26.285 -57.958 1.00 81.04  ? 799  HIS A CA    1 
ATOM   5872  C  C     . HIS A 1 799  ? -28.933 -25.912 -57.109 1.00 84.17  ? 799  HIS A C     1 
ATOM   5873  O  O     . HIS A 1 799  ? -29.632 -26.796 -56.639 1.00 77.08  ? 799  HIS A O     1 
ATOM   5874  C  CB    . HIS A 1 799  ? -28.223 -26.780 -59.311 1.00 79.12  ? 799  HIS A CB    1 
ATOM   5875  C  CG    . HIS A 1 799  ? -27.201 -27.568 -60.058 1.00 85.48  ? 799  HIS A CG    1 
ATOM   5876  N  ND1   . HIS A 1 799  ? -26.250 -26.978 -60.860 1.00 91.46  ? 799  HIS A ND1   1 
ATOM   5877  C  CD2   . HIS A 1 799  ? -26.953 -28.900 -60.092 1.00 90.82  ? 799  HIS A CD2   1 
ATOM   5878  C  CE1   . HIS A 1 799  ? -25.465 -27.915 -61.366 1.00 95.83  ? 799  HIS A CE1   1 
ATOM   5879  N  NE2   . HIS A 1 799  ? -25.873 -29.091 -60.919 1.00 93.66  ? 799  HIS A NE2   1 
ATOM   5880  N  N     . VAL A 1 800  ? -29.165 -24.614 -56.911 1.00 87.00  ? 800  VAL A N     1 
ATOM   5881  C  CA    . VAL A 1 800  ? -30.278 -24.124 -56.068 1.00 83.74  ? 800  VAL A CA    1 
ATOM   5882  C  C     . VAL A 1 800  ? -30.951 -22.933 -56.730 1.00 82.60  ? 800  VAL A C     1 
ATOM   5883  O  O     . VAL A 1 800  ? -30.325 -21.888 -56.894 1.00 79.75  ? 800  VAL A O     1 
ATOM   5884  C  CB    . VAL A 1 800  ? -29.775 -23.666 -54.692 1.00 75.20  ? 800  VAL A CB    1 
ATOM   5885  C  CG1   . VAL A 1 800  ? -30.913 -23.073 -53.875 1.00 76.56  ? 800  VAL A CG1   1 
ATOM   5886  C  CG2   . VAL A 1 800  ? -29.138 -24.835 -53.974 1.00 79.39  ? 800  VAL A CG2   1 
ATOM   5887  N  N     . ARG A 1 801  ? -32.224 -23.075 -57.098 1.00 82.86  ? 801  ARG A N     1 
ATOM   5888  C  CA    . ARG A 1 801  ? -32.960 -21.981 -57.742 1.00 78.18  ? 801  ARG A CA    1 
ATOM   5889  C  C     . ARG A 1 801  ? -33.548 -21.086 -56.646 1.00 76.41  ? 801  ARG A C     1 
ATOM   5890  O  O     . ARG A 1 801  ? -33.292 -19.867 -56.565 1.00 84.36  ? 801  ARG A O     1 
ATOM   5891  C  CB    . ARG A 1 801  ? -34.078 -22.545 -58.594 1.00 80.79  ? 801  ARG A CB    1 
ATOM   5892  C  CG    . ARG A 1 801  ? -34.910 -21.493 -59.301 1.00 84.88  ? 801  ARG A CG    1 
ATOM   5893  C  CD    . ARG A 1 801  ? -35.650 -22.103 -60.478 1.00 83.38  ? 801  ARG A CD    1 
ATOM   5894  N  NE    . ARG A 1 801  ? -34.736 -22.326 -61.591 1.00 80.11  ? 801  ARG A NE    1 
ATOM   5895  C  CZ    . ARG A 1 801  ? -34.797 -21.708 -62.767 1.00 90.81  ? 801  ARG A CZ    1 
ATOM   5896  N  NH1   . ARG A 1 801  ? -35.740 -20.804 -63.051 1.00 87.74  ? 801  ARG A NH1   1 
ATOM   5897  N  NH2   . ARG A 1 801  ? -33.894 -22.012 -63.683 1.00 110.96 ? 801  ARG A NH2   1 
ATOM   5898  N  N     . ARG A 1 802  ? -34.317 -21.722 -55.772 1.00 74.31  ? 802  ARG A N     1 
ATOM   5899  C  CA    . ARG A 1 802  ? -34.940 -21.023 -54.661 1.00 71.09  ? 802  ARG A CA    1 
ATOM   5900  C  C     . ARG A 1 802  ? -35.147 -21.962 -53.486 1.00 71.09  ? 802  ARG A C     1 
ATOM   5901  O  O     . ARG A 1 802  ? -35.251 -23.154 -53.666 1.00 72.25  ? 802  ARG A O     1 
ATOM   5902  C  CB    . ARG A 1 802  ? -36.273 -20.437 -55.084 1.00 67.67  ? 802  ARG A CB    1 
ATOM   5903  C  CG    . ARG A 1 802  ? -37.292 -21.475 -55.463 1.00 73.67  ? 802  ARG A CG    1 
ATOM   5904  C  CD    . ARG A 1 802  ? -38.662 -20.846 -55.645 1.00 79.55  ? 802  ARG A CD    1 
ATOM   5905  N  NE    . ARG A 1 802  ? -38.671 -19.793 -56.653 1.00 79.25  ? 802  ARG A NE    1 
ATOM   5906  C  CZ    . ARG A 1 802  ? -38.621 -20.002 -57.959 1.00 80.20  ? 802  ARG A CZ    1 
ATOM   5907  N  NH1   . ARG A 1 802  ? -38.551 -21.233 -58.449 1.00 80.13  ? 802  ARG A NH1   1 
ATOM   5908  N  NH2   . ARG A 1 802  ? -38.651 -18.967 -58.779 1.00 83.43  ? 802  ARG A NH2   1 
ATOM   5909  N  N     . VAL A 1 803  ? -35.213 -21.361 -52.300 1.00 74.01  ? 803  VAL A N     1 
ATOM   5910  C  CA    . VAL A 1 803  ? -35.525 -22.044 -51.075 1.00 73.92  ? 803  VAL A CA    1 
ATOM   5911  C  C     . VAL A 1 803  ? -36.799 -21.404 -50.507 1.00 74.01  ? 803  VAL A C     1 
ATOM   5912  O  O     . VAL A 1 803  ? -36.959 -20.181 -50.536 1.00 66.77  ? 803  VAL A O     1 
ATOM   5913  C  CB    . VAL A 1 803  ? -34.338 -21.923 -50.097 1.00 70.41  ? 803  VAL A CB    1 
ATOM   5914  C  CG1   . VAL A 1 803  ? -34.676 -22.476 -48.718 1.00 68.94  ? 803  VAL A CG1   1 
ATOM   5915  C  CG2   . VAL A 1 803  ? -33.135 -22.642 -50.678 1.00 69.49  ? 803  VAL A CG2   1 
ATOM   5916  N  N     . GLY A 1 804  ? -37.706 -22.246 -50.016 1.00 75.34  ? 804  GLY A N     1 
ATOM   5917  C  CA    . GLY A 1 804  ? -38.939 -21.808 -49.373 1.00 80.82  ? 804  GLY A CA    1 
ATOM   5918  C  C     . GLY A 1 804  ? -38.727 -21.507 -47.903 1.00 86.50  ? 804  GLY A C     1 
ATOM   5919  O  O     . GLY A 1 804  ? -39.292 -22.144 -47.048 1.00 100.98 ? 804  GLY A O     1 
ATOM   5920  N  N     . GLY A 1 805  ? -37.881 -20.523 -47.627 1.00 86.35  ? 805  GLY A N     1 
ATOM   5921  C  CA    . GLY A 1 805  ? -37.416 -20.202 -46.280 1.00 85.10  ? 805  GLY A CA    1 
ATOM   5922  C  C     . GLY A 1 805  ? -36.347 -21.149 -45.785 1.00 81.37  ? 805  GLY A C     1 
ATOM   5923  O  O     . GLY A 1 805  ? -36.386 -22.327 -46.067 1.00 77.96  ? 805  GLY A O     1 
ATOM   5924  N  N     . ALA A 1 806  ? -35.398 -20.617 -45.008 1.00 83.92  ? 806  ALA A N     1 
ATOM   5925  C  CA    . ALA A 1 806  ? -34.339 -21.407 -44.364 1.00 89.49  ? 806  ALA A CA    1 
ATOM   5926  C  C     . ALA A 1 806  ? -33.976 -20.875 -42.965 1.00 84.55  ? 806  ALA A C     1 
ATOM   5927  O  O     . ALA A 1 806  ? -33.904 -21.632 -42.009 1.00 87.86  ? 806  ALA A O     1 
ATOM   5928  C  CB    . ALA A 1 806  ? -33.086 -21.430 -45.236 1.00 94.47  ? 806  ALA A CB    1 
ATOM   5929  N  N     . PHE A 1 807  ? -33.746 -19.567 -42.867 1.00 87.77  ? 807  PHE A N     1 
ATOM   5930  C  CA    . PHE A 1 807  ? -33.494 -18.904 -41.585 1.00 84.88  ? 807  PHE A CA    1 
ATOM   5931  C  C     . PHE A 1 807  ? -32.374 -19.564 -40.782 1.00 84.04  ? 807  PHE A C     1 
ATOM   5932  O  O     . PHE A 1 807  ? -32.472 -19.664 -39.554 1.00 74.94  ? 807  PHE A O     1 
ATOM   5933  C  CB    . PHE A 1 807  ? -34.754 -18.886 -40.714 1.00 81.75  ? 807  PHE A CB    1 
ATOM   5934  C  CG    . PHE A 1 807  ? -35.998 -18.493 -41.437 1.00 71.35  ? 807  PHE A CG    1 
ATOM   5935  C  CD1   . PHE A 1 807  ? -36.178 -17.197 -41.859 1.00 68.48  ? 807  PHE A CD1   1 
ATOM   5936  C  CD2   . PHE A 1 807  ? -36.997 -19.415 -41.653 1.00 69.71  ? 807  PHE A CD2   1 
ATOM   5937  C  CE1   . PHE A 1 807  ? -37.330 -16.822 -42.511 1.00 70.09  ? 807  PHE A CE1   1 
ATOM   5938  C  CE2   . PHE A 1 807  ? -38.158 -19.051 -42.301 1.00 74.86  ? 807  PHE A CE2   1 
ATOM   5939  C  CZ    . PHE A 1 807  ? -38.326 -17.749 -42.734 1.00 71.24  ? 807  PHE A CZ    1 
ATOM   5940  N  N     . GLY A 1 808  ? -31.339 -20.033 -41.476 1.00 93.09  ? 808  GLY A N     1 
ATOM   5941  C  CA    . GLY A 1 808  ? -30.215 -20.726 -40.831 1.00 100.30 ? 808  GLY A CA    1 
ATOM   5942  C  C     . GLY A 1 808  ? -30.337 -22.241 -40.689 1.00 97.52  ? 808  GLY A C     1 
ATOM   5943  O  O     . GLY A 1 808  ? -29.320 -22.941 -40.611 1.00 102.33 ? 808  GLY A O     1 
ATOM   5944  N  N     . GLY A 1 809  ? -31.551 -22.786 -40.743 1.00 95.97  ? 809  GLY A N     1 
ATOM   5945  C  CA    . GLY A 1 809  ? -31.764 -24.211 -40.452 1.00 89.28  ? 809  GLY A CA    1 
ATOM   5946  C  C     . GLY A 1 809  ? -31.707 -25.171 -41.638 1.00 81.30  ? 809  GLY A C     1 
ATOM   5947  O  O     . GLY A 1 809  ? -32.197 -26.291 -41.569 1.00 75.18  ? 809  GLY A O     1 
ATOM   5948  N  N     . LYS A 1 810  ? -31.081 -24.743 -42.735 1.00 77.06  ? 810  LYS A N     1 
ATOM   5949  C  CA    . LYS A 1 810  ? -30.839 -25.581 -43.904 1.00 79.25  ? 810  LYS A CA    1 
ATOM   5950  C  C     . LYS A 1 810  ? -29.364 -25.480 -44.328 1.00 83.72  ? 810  LYS A C     1 
ATOM   5951  O  O     . LYS A 1 810  ? -28.998 -25.146 -45.470 1.00 92.53  ? 810  LYS A O     1 
ATOM   5952  C  CB    . LYS A 1 810  ? -31.818 -25.207 -45.027 1.00 84.40  ? 810  LYS A CB    1 
ATOM   5953  C  CG    . LYS A 1 810  ? -33.303 -25.344 -44.648 1.00 80.96  ? 810  LYS A CG    1 
ATOM   5954  C  CD    . LYS A 1 810  ? -34.199 -25.448 -45.881 1.00 75.92  ? 810  LYS A CD    1 
ATOM   5955  C  CE    . LYS A 1 810  ? -35.667 -25.268 -45.543 1.00 75.45  ? 810  LYS A CE    1 
ATOM   5956  N  NZ    . LYS A 1 810  ? -36.466 -24.942 -46.763 1.00 75.78  ? 810  LYS A NZ    1 
ATOM   5957  N  N     . VAL A 1 811  ? -28.481 -25.841 -43.398 1.00 80.34  ? 811  VAL A N     1 
ATOM   5958  C  CA    . VAL A 1 811  ? -27.032 -25.908 -43.637 1.00 75.94  ? 811  VAL A CA    1 
ATOM   5959  C  C     . VAL A 1 811  ? -26.479 -27.283 -43.215 1.00 80.86  ? 811  VAL A C     1 
ATOM   5960  O  O     . VAL A 1 811  ? -26.575 -28.223 -43.988 1.00 77.54  ? 811  VAL A O     1 
ATOM   5961  C  CB    . VAL A 1 811  ? -26.321 -24.756 -42.905 1.00 77.08  ? 811  VAL A CB    1 
ATOM   5962  C  CG1   . VAL A 1 811  ? -24.810 -24.880 -42.979 1.00 76.97  ? 811  VAL A CG1   1 
ATOM   5963  C  CG2   . VAL A 1 811  ? -26.781 -23.423 -43.475 1.00 80.49  ? 811  VAL A CG2   1 
ATOM   5964  N  N     . LEU A 1 812  ? -25.945 -27.417 -41.993 1.00 91.87  ? 812  LEU A N     1 
ATOM   5965  C  CA    . LEU A 1 812  ? -25.205 -28.632 -41.584 1.00 96.19  ? 812  LEU A CA    1 
ATOM   5966  C  C     . LEU A 1 812  ? -26.048 -29.896 -41.761 1.00 90.84  ? 812  LEU A C     1 
ATOM   5967  O  O     . LEU A 1 812  ? -25.603 -30.862 -42.385 1.00 101.44 ? 812  LEU A O     1 
ATOM   5968  C  CB    . LEU A 1 812  ? -24.638 -28.491 -40.142 1.00 102.65 ? 812  LEU A CB    1 
ATOM   5969  C  CG    . LEU A 1 812  ? -24.280 -29.720 -39.272 1.00 113.18 ? 812  LEU A CG    1 
ATOM   5970  C  CD1   . LEU A 1 812  ? -22.828 -30.149 -39.422 1.00 117.54 ? 812  LEU A CD1   1 
ATOM   5971  C  CD2   . LEU A 1 812  ? -24.570 -29.449 -37.802 1.00 122.05 ? 812  LEU A CD2   1 
ATOM   5972  N  N     . LYS A 1 813  ? -27.257 -29.865 -41.223 1.00 90.11  ? 813  LYS A N     1 
ATOM   5973  C  CA    . LYS A 1 813  ? -28.130 -31.026 -41.197 1.00 94.10  ? 813  LYS A CA    1 
ATOM   5974  C  C     . LYS A 1 813  ? -28.625 -31.399 -42.593 1.00 82.74  ? 813  LYS A C     1 
ATOM   5975  O  O     . LYS A 1 813  ? -28.770 -32.582 -42.913 1.00 73.60  ? 813  LYS A O     1 
ATOM   5976  C  CB    . LYS A 1 813  ? -29.351 -30.753 -40.320 1.00 102.75 ? 813  LYS A CB    1 
ATOM   5977  C  CG    . LYS A 1 813  ? -29.687 -31.911 -39.411 1.00 111.57 ? 813  LYS A CG    1 
ATOM   5978  C  CD    . LYS A 1 813  ? -28.961 -31.763 -38.088 1.00 119.23 ? 813  LYS A CD    1 
ATOM   5979  C  CE    . LYS A 1 813  ? -28.911 -33.086 -37.350 1.00 122.06 ? 813  LYS A CE    1 
ATOM   5980  N  NZ    . LYS A 1 813  ? -28.557 -32.894 -35.915 1.00 130.09 ? 813  LYS A NZ    1 
ATOM   5981  N  N     . THR A 1 814  ? -28.887 -30.375 -43.405 1.00 82.49  ? 814  THR A N     1 
ATOM   5982  C  CA    . THR A 1 814  ? -29.192 -30.538 -44.829 1.00 75.88  ? 814  THR A CA    1 
ATOM   5983  C  C     . THR A 1 814  ? -28.112 -31.326 -45.538 1.00 68.22  ? 814  THR A C     1 
ATOM   5984  O  O     . THR A 1 814  ? -28.407 -32.281 -46.251 1.00 66.22  ? 814  THR A O     1 
ATOM   5985  C  CB    . THR A 1 814  ? -29.364 -29.178 -45.508 1.00 79.99  ? 814  THR A CB    1 
ATOM   5986  O  OG1   . THR A 1 814  ? -30.349 -28.432 -44.790 1.00 84.17  ? 814  THR A OG1   1 
ATOM   5987  C  CG2   . THR A 1 814  ? -29.830 -29.331 -46.937 1.00 87.13  ? 814  THR A CG2   1 
ATOM   5988  N  N     . GLY A 1 815  ? -26.862 -30.914 -45.340 1.00 71.45  ? 815  GLY A N     1 
ATOM   5989  C  CA    . GLY A 1 815  ? -25.687 -31.561 -45.943 1.00 69.46  ? 815  GLY A CA    1 
ATOM   5990  C  C     . GLY A 1 815  ? -25.502 -33.013 -45.571 1.00 68.62  ? 815  GLY A C     1 
ATOM   5991  O  O     . GLY A 1 815  ? -25.131 -33.814 -46.425 1.00 71.34  ? 815  GLY A O     1 
ATOM   5992  N  N     . ILE A 1 816  ? -25.749 -33.355 -44.308 1.00 67.51  ? 816  ILE A N     1 
ATOM   5993  C  CA    . ILE A 1 816  ? -25.715 -34.751 -43.852 1.00 72.11  ? 816  ILE A CA    1 
ATOM   5994  C  C     . ILE A 1 816  ? -26.710 -35.607 -44.610 1.00 77.60  ? 816  ILE A C     1 
ATOM   5995  O  O     . ILE A 1 816  ? -26.379 -36.697 -45.071 1.00 76.82  ? 816  ILE A O     1 
ATOM   5996  C  CB    . ILE A 1 816  ? -25.937 -34.872 -42.345 1.00 73.62  ? 816  ILE A CB    1 
ATOM   5997  C  CG1   . ILE A 1 816  ? -24.615 -34.510 -41.628 1.00 74.61  ? 816  ILE A CG1   1 
ATOM   5998  C  CG2   . ILE A 1 816  ? -26.395 -36.301 -41.981 1.00 71.86  ? 816  ILE A CG2   1 
ATOM   5999  C  CD1   . ILE A 1 816  ? -24.709 -33.414 -40.586 1.00 78.73  ? 816  ILE A CD1   1 
ATOM   6000  N  N     . ILE A 1 817  ? -27.929 -35.107 -44.730 1.00 85.82  ? 817  ILE A N     1 
ATOM   6001  C  CA    . ILE A 1 817  ? -28.984 -35.821 -45.423 1.00 80.24  ? 817  ILE A CA    1 
ATOM   6002  C  C     . ILE A 1 817  ? -28.638 -35.957 -46.907 1.00 81.29  ? 817  ILE A C     1 
ATOM   6003  O  O     . ILE A 1 817  ? -28.834 -37.025 -47.491 1.00 88.32  ? 817  ILE A O     1 
ATOM   6004  C  CB    . ILE A 1 817  ? -30.347 -35.086 -45.303 1.00 75.44  ? 817  ILE A CB    1 
ATOM   6005  C  CG1   . ILE A 1 817  ? -30.916 -35.254 -43.906 1.00 74.98  ? 817  ILE A CG1   1 
ATOM   6006  C  CG2   . ILE A 1 817  ? -31.381 -35.600 -46.291 1.00 75.06  ? 817  ILE A CG2   1 
ATOM   6007  C  CD1   . ILE A 1 817  ? -31.929 -34.182 -43.571 1.00 78.73  ? 817  ILE A CD1   1 
ATOM   6008  N  N     . ALA A 1 818  ? -28.125 -34.880 -47.508 1.00 88.93  ? 818  ALA A N     1 
ATOM   6009  C  CA    . ALA A 1 818  ? -27.636 -34.914 -48.904 1.00 90.81  ? 818  ALA A CA    1 
ATOM   6010  C  C     . ALA A 1 818  ? -26.517 -35.910 -49.116 1.00 84.76  ? 818  ALA A C     1 
ATOM   6011  O  O     . ALA A 1 818  ? -26.507 -36.610 -50.118 1.00 83.64  ? 818  ALA A O     1 
ATOM   6012  C  CB    . ALA A 1 818  ? -27.175 -33.548 -49.370 1.00 96.64  ? 818  ALA A CB    1 
ATOM   6013  N  N     . ALA A 1 819  ? -25.587 -35.983 -48.164 1.00 79.52  ? 819  ALA A N     1 
ATOM   6014  C  CA    . ALA A 1 819  ? -24.453 -36.923 -48.229 1.00 79.12  ? 819  ALA A CA    1 
ATOM   6015  C  C     . ALA A 1 819  ? -24.914 -38.360 -48.200 1.00 77.36  ? 819  ALA A C     1 
ATOM   6016  O  O     . ALA A 1 819  ? -24.483 -39.176 -49.022 1.00 78.85  ? 819  ALA A O     1 
ATOM   6017  C  CB    . ALA A 1 819  ? -23.498 -36.681 -47.074 1.00 76.59  ? 819  ALA A CB    1 
ATOM   6018  N  N     . VAL A 1 820  ? -25.784 -38.665 -47.242 1.00 76.05  ? 820  VAL A N     1 
ATOM   6019  C  CA    . VAL A 1 820  ? -26.387 -39.990 -47.128 1.00 74.48  ? 820  VAL A CA    1 
ATOM   6020  C  C     . VAL A 1 820  ? -27.210 -40.297 -48.379 1.00 75.77  ? 820  VAL A C     1 
ATOM   6021  O  O     . VAL A 1 820  ? -27.102 -41.386 -48.927 1.00 81.15  ? 820  VAL A O     1 
ATOM   6022  C  CB    . VAL A 1 820  ? -27.302 -40.149 -45.902 1.00 70.56  ? 820  VAL A CB    1 
ATOM   6023  C  CG1   . VAL A 1 820  ? -28.093 -41.447 -45.976 1.00 70.93  ? 820  VAL A CG1   1 
ATOM   6024  C  CG2   . VAL A 1 820  ? -26.478 -40.135 -44.633 1.00 73.94  ? 820  VAL A CG2   1 
ATOM   6025  N  N     . THR A 1 821  ? -28.010 -39.337 -48.834 1.00 69.30  ? 821  THR A N     1 
ATOM   6026  C  CA    . THR A 1 821  ? -28.832 -39.508 -50.026 1.00 70.34  ? 821  THR A CA    1 
ATOM   6027  C  C     . THR A 1 821  ? -27.981 -39.806 -51.270 1.00 74.52  ? 821  THR A C     1 
ATOM   6028  O  O     . THR A 1 821  ? -28.327 -40.687 -52.063 1.00 81.80  ? 821  THR A O     1 
ATOM   6029  C  CB    . THR A 1 821  ? -29.683 -38.226 -50.265 1.00 70.50  ? 821  THR A CB    1 
ATOM   6030  O  OG1   . THR A 1 821  ? -30.710 -38.144 -49.276 1.00 74.72  ? 821  THR A OG1   1 
ATOM   6031  C  CG2   . THR A 1 821  ? -30.376 -38.223 -51.610 1.00 72.01  ? 821  THR A CG2   1 
ATOM   6032  N  N     . ALA A 1 822  ? -26.885 -39.058 -51.426 1.00 74.64  ? 822  ALA A N     1 
ATOM   6033  C  CA    . ALA A 1 822  ? -25.984 -39.187 -52.575 1.00 71.59  ? 822  ALA A CA    1 
ATOM   6034  C  C     . ALA A 1 822  ? -25.217 -40.486 -52.559 1.00 77.62  ? 822  ALA A C     1 
ATOM   6035  O  O     . ALA A 1 822  ? -24.926 -41.039 -53.613 1.00 76.61  ? 822  ALA A O     1 
ATOM   6036  C  CB    . ALA A 1 822  ? -25.015 -38.018 -52.607 1.00 71.49  ? 822  ALA A CB    1 
ATOM   6037  N  N     . PHE A 1 823  ? -24.873 -40.962 -51.364 1.00 79.06  ? 823  PHE A N     1 
ATOM   6038  C  CA    . PHE A 1 823  ? -24.275 -42.292 -51.202 1.00 75.45  ? 823  PHE A CA    1 
ATOM   6039  C  C     . PHE A 1 823  ? -25.168 -43.411 -51.730 1.00 77.61  ? 823  PHE A C     1 
ATOM   6040  O  O     . PHE A 1 823  ? -24.702 -44.289 -52.433 1.00 89.64  ? 823  PHE A O     1 
ATOM   6041  C  CB    . PHE A 1 823  ? -23.968 -42.537 -49.751 1.00 75.47  ? 823  PHE A CB    1 
ATOM   6042  C  CG    . PHE A 1 823  ? -23.236 -43.808 -49.516 1.00 80.58  ? 823  PHE A CG    1 
ATOM   6043  C  CD1   . PHE A 1 823  ? -21.865 -43.859 -49.679 1.00 84.15  ? 823  PHE A CD1   1 
ATOM   6044  C  CD2   . PHE A 1 823  ? -23.917 -44.959 -49.151 1.00 82.54  ? 823  PHE A CD2   1 
ATOM   6045  C  CE1   . PHE A 1 823  ? -21.180 -45.031 -49.478 1.00 87.24  ? 823  PHE A CE1   1 
ATOM   6046  C  CE2   . PHE A 1 823  ? -23.241 -46.134 -48.942 1.00 79.05  ? 823  PHE A CE2   1 
ATOM   6047  C  CZ    . PHE A 1 823  ? -21.871 -46.169 -49.108 1.00 86.31  ? 823  PHE A CZ    1 
ATOM   6048  N  N     . ALA A 1 824  ? -26.451 -43.377 -51.377 1.00 81.36  ? 824  ALA A N     1 
ATOM   6049  C  CA    . ALA A 1 824  ? -27.450 -44.318 -51.902 1.00 78.99  ? 824  ALA A CA    1 
ATOM   6050  C  C     . ALA A 1 824  ? -27.592 -44.186 -53.418 1.00 77.25  ? 824  ALA A C     1 
ATOM   6051  O  O     . ALA A 1 824  ? -27.630 -45.190 -54.127 1.00 79.28  ? 824  ALA A O     1 
ATOM   6052  C  CB    . ALA A 1 824  ? -28.792 -44.089 -51.223 1.00 76.15  ? 824  ALA A CB    1 
ATOM   6053  N  N     . ALA A 1 825  ? -27.659 -42.954 -53.914 1.00 72.33  ? 825  ALA A N     1 
ATOM   6054  C  CA    . ALA A 1 825  ? -27.886 -42.722 -55.339 1.00 72.26  ? 825  ALA A CA    1 
ATOM   6055  C  C     . ALA A 1 825  ? -26.781 -43.349 -56.151 1.00 74.94  ? 825  ALA A C     1 
ATOM   6056  O  O     . ALA A 1 825  ? -27.021 -44.136 -57.072 1.00 87.34  ? 825  ALA A O     1 
ATOM   6057  C  CB    . ALA A 1 825  ? -27.962 -41.253 -55.631 1.00 78.06  ? 825  ALA A CB    1 
ATOM   6058  N  N     . ASN A 1 826  ? -25.566 -42.998 -55.779 1.00 77.39  ? 826  ASN A N     1 
ATOM   6059  C  CA    . ASN A 1 826  ? -24.371 -43.546 -56.382 1.00 79.66  ? 826  ASN A CA    1 
ATOM   6060  C  C     . ASN A 1 826  ? -24.285 -45.056 -56.285 1.00 77.00  ? 826  ASN A C     1 
ATOM   6061  O  O     . ASN A 1 826  ? -23.930 -45.710 -57.246 1.00 80.04  ? 826  ASN A O     1 
ATOM   6062  C  CB    . ASN A 1 826  ? -23.198 -42.905 -55.663 1.00 84.84  ? 826  ASN A CB    1 
ATOM   6063  C  CG    . ASN A 1 826  ? -21.931 -43.657 -55.835 1.00 75.75  ? 826  ASN A CG    1 
ATOM   6064  O  OD1   . ASN A 1 826  ? -21.231 -43.516 -56.841 1.00 73.66  ? 826  ASN A OD1   1 
ATOM   6065  N  ND2   . ASN A 1 826  ? -21.595 -44.430 -54.824 1.00 75.23  ? 826  ASN A ND2   1 
ATOM   6066  N  N     . LYS A 1 827  ? -24.608 -45.609 -55.123 1.00 87.15  ? 827  LYS A N     1 
ATOM   6067  C  CA    . LYS A 1 827  ? -24.537 -47.063 -54.900 1.00 86.79  ? 827  LYS A CA    1 
ATOM   6068  C  C     . LYS A 1 827  ? -25.431 -47.837 -55.842 1.00 78.17  ? 827  LYS A C     1 
ATOM   6069  O  O     . LYS A 1 827  ? -25.049 -48.899 -56.314 1.00 81.58  ? 827  LYS A O     1 
ATOM   6070  C  CB    . LYS A 1 827  ? -24.917 -47.406 -53.452 1.00 94.17  ? 827  LYS A CB    1 
ATOM   6071  C  CG    . LYS A 1 827  ? -24.983 -48.893 -53.096 1.00 108.44 ? 827  LYS A CG    1 
ATOM   6072  C  CD    . LYS A 1 827  ? -25.361 -49.078 -51.626 1.00 120.07 ? 827  LYS A CD    1 
ATOM   6073  C  CE    . LYS A 1 827  ? -25.220 -50.510 -51.120 1.00 125.69 ? 827  LYS A CE    1 
ATOM   6074  N  NZ    . LYS A 1 827  ? -25.248 -50.582 -49.620 1.00 131.89 ? 827  LYS A NZ    1 
ATOM   6075  N  N     . HIS A 1 828  ? -26.619 -47.307 -56.107 1.00 75.55  ? 828  HIS A N     1 
ATOM   6076  C  CA    . HIS A 1 828  ? -27.635 -47.995 -56.914 1.00 74.47  ? 828  HIS A CA    1 
ATOM   6077  C  C     . HIS A 1 828  ? -27.816 -47.421 -58.315 1.00 67.76  ? 828  HIS A C     1 
ATOM   6078  O  O     . HIS A 1 828  ? -28.622 -47.912 -59.073 1.00 77.66  ? 828  HIS A O     1 
ATOM   6079  C  CB    . HIS A 1 828  ? -28.975 -47.971 -56.140 1.00 75.63  ? 828  HIS A CB    1 
ATOM   6080  C  CG    . HIS A 1 828  ? -28.919 -48.704 -54.831 1.00 78.90  ? 828  HIS A CG    1 
ATOM   6081  N  ND1   . HIS A 1 828  ? -29.095 -50.068 -54.731 1.00 87.04  ? 828  HIS A ND1   1 
ATOM   6082  C  CD2   . HIS A 1 828  ? -28.653 -48.274 -53.576 1.00 80.12  ? 828  HIS A CD2   1 
ATOM   6083  C  CE1   . HIS A 1 828  ? -28.945 -50.444 -53.473 1.00 81.89  ? 828  HIS A CE1   1 
ATOM   6084  N  NE2   . HIS A 1 828  ? -28.684 -49.373 -52.750 1.00 77.63  ? 828  HIS A NE2   1 
ATOM   6085  N  N     . GLY A 1 829  ? -27.049 -46.408 -58.671 1.00 64.46  ? 829  GLY A N     1 
ATOM   6086  C  CA    . GLY A 1 829  ? -27.134 -45.801 -59.999 1.00 68.99  ? 829  GLY A CA    1 
ATOM   6087  C  C     . GLY A 1 829  ? -28.524 -45.278 -60.272 1.00 67.98  ? 829  GLY A C     1 
ATOM   6088  O  O     . GLY A 1 829  ? -29.097 -45.538 -61.320 1.00 71.92  ? 829  GLY A O     1 
ATOM   6089  N  N     . ARG A 1 830  ? -29.080 -44.556 -59.312 1.00 76.61  ? 830  ARG A N     1 
ATOM   6090  C  CA    . ARG A 1 830  ? -30.442 -44.056 -59.414 1.00 77.97  ? 830  ARG A CA    1 
ATOM   6091  C  C     . ARG A 1 830  ? -30.533 -42.670 -58.861 1.00 72.87  ? 830  ARG A C     1 
ATOM   6092  O  O     . ARG A 1 830  ? -29.846 -42.357 -57.887 1.00 68.85  ? 830  ARG A O     1 
ATOM   6093  C  CB    . ARG A 1 830  ? -31.332 -44.957 -58.580 1.00 80.47  ? 830  ARG A CB    1 
ATOM   6094  C  CG    . ARG A 1 830  ? -31.551 -46.306 -59.207 1.00 84.10  ? 830  ARG A CG    1 
ATOM   6095  C  CD    . ARG A 1 830  ? -32.203 -46.128 -60.560 1.00 92.28  ? 830  ARG A CD    1 
ATOM   6096  N  NE    . ARG A 1 830  ? -32.671 -47.388 -61.109 1.00 96.26  ? 830  ARG A NE    1 
ATOM   6097  C  CZ    . ARG A 1 830  ? -33.780 -48.013 -60.746 1.00 97.63  ? 830  ARG A CZ    1 
ATOM   6098  N  NH1   . ARG A 1 830  ? -34.578 -47.521 -59.791 1.00 84.95  ? 830  ARG A NH1   1 
ATOM   6099  N  NH2   . ARG A 1 830  ? -34.070 -49.157 -61.354 1.00 116.37 ? 830  ARG A NH2   1 
ATOM   6100  N  N     . ALA A 1 831  ? -31.388 -41.843 -59.445 1.00 65.69  ? 831  ALA A N     1 
ATOM   6101  C  CA    . ALA A 1 831  ? -31.708 -40.592 -58.771 1.00 70.74  ? 831  ALA A CA    1 
ATOM   6102  C  C     . ALA A 1 831  ? -32.493 -40.943 -57.504 1.00 70.54  ? 831  ALA A C     1 
ATOM   6103  O  O     . ALA A 1 831  ? -33.275 -41.876 -57.486 1.00 68.69  ? 831  ALA A O     1 
ATOM   6104  C  CB    . ALA A 1 831  ? -32.511 -39.666 -59.654 1.00 77.37  ? 831  ALA A CB    1 
ATOM   6105  N  N     . VAL A 1 832  ? -32.213 -40.245 -56.421 1.00 77.73  ? 832  VAL A N     1 
ATOM   6106  C  CA    . VAL A 1 832  ? -32.852 -40.487 -55.119 1.00 72.35  ? 832  VAL A CA    1 
ATOM   6107  C  C     . VAL A 1 832  ? -33.359 -39.125 -54.619 1.00 69.09  ? 832  VAL A C     1 
ATOM   6108  O  O     . VAL A 1 832  ? -32.622 -38.142 -54.658 1.00 60.76  ? 832  VAL A O     1 
ATOM   6109  C  CB    . VAL A 1 832  ? -31.857 -41.104 -54.125 1.00 68.73  ? 832  VAL A CB    1 
ATOM   6110  C  CG1   . VAL A 1 832  ? -32.466 -41.216 -52.739 1.00 72.24  ? 832  VAL A CG1   1 
ATOM   6111  C  CG2   . VAL A 1 832  ? -31.450 -42.470 -54.625 1.00 70.43  ? 832  VAL A CG2   1 
ATOM   6112  N  N     . ARG A 1 833  ? -34.618 -39.107 -54.167 1.00 70.72  ? 833  ARG A N     1 
ATOM   6113  C  CA    . ARG A 1 833  ? -35.254 -37.936 -53.621 1.00 72.13  ? 833  ARG A CA    1 
ATOM   6114  C  C     . ARG A 1 833  ? -35.504 -38.174 -52.134 1.00 76.73  ? 833  ARG A C     1 
ATOM   6115  O  O     . ARG A 1 833  ? -35.956 -39.236 -51.742 1.00 80.85  ? 833  ARG A O     1 
ATOM   6116  C  CB    . ARG A 1 833  ? -36.567 -37.702 -54.353 1.00 77.92  ? 833  ARG A CB    1 
ATOM   6117  C  CG    . ARG A 1 833  ? -37.307 -36.426 -54.014 1.00 80.21  ? 833  ARG A CG    1 
ATOM   6118  C  CD    . ARG A 1 833  ? -38.742 -36.505 -54.525 1.00 80.94  ? 833  ARG A CD    1 
ATOM   6119  N  NE    . ARG A 1 833  ? -38.815 -36.301 -55.973 1.00 81.88  ? 833  ARG A NE    1 
ATOM   6120  C  CZ    . ARG A 1 833  ? -38.800 -35.116 -56.581 1.00 75.77  ? 833  ARG A CZ    1 
ATOM   6121  N  NH1   . ARG A 1 833  ? -38.699 -34.012 -55.868 1.00 87.23  ? 833  ARG A NH1   1 
ATOM   6122  N  NH2   . ARG A 1 833  ? -38.878 -35.033 -57.905 1.00 66.92  ? 833  ARG A NH2   1 
ATOM   6123  N  N     . CYS A 1 834  ? -35.142 -37.181 -51.316 1.00 80.85  ? 834  CYS A N     1 
ATOM   6124  C  CA    . CYS A 1 834  ? -35.410 -37.229 -49.894 1.00 76.57  ? 834  CYS A CA    1 
ATOM   6125  C  C     . CYS A 1 834  ? -36.095 -35.922 -49.496 1.00 73.67  ? 834  CYS A C     1 
ATOM   6126  O  O     . CYS A 1 834  ? -35.551 -34.828 -49.682 1.00 73.08  ? 834  CYS A O     1 
ATOM   6127  C  CB    . CYS A 1 834  ? -34.155 -37.410 -49.078 1.00 74.07  ? 834  CYS A CB    1 
ATOM   6128  S  SG    . CYS A 1 834  ? -34.649 -37.470 -47.373 1.00 76.88  ? 834  CYS A SG    1 
ATOM   6129  N  N     . VAL A 1 835  ? -37.322 -36.044 -49.015 1.00 73.04  ? 835  VAL A N     1 
ATOM   6130  C  CA    . VAL A 1 835  ? -38.131 -34.911 -48.551 1.00 73.93  ? 835  VAL A CA    1 
ATOM   6131  C  C     . VAL A 1 835  ? -38.683 -35.314 -47.201 1.00 77.15  ? 835  VAL A C     1 
ATOM   6132  O  O     . VAL A 1 835  ? -39.295 -36.398 -47.069 1.00 81.33  ? 835  VAL A O     1 
ATOM   6133  C  CB    . VAL A 1 835  ? -39.339 -34.657 -49.449 1.00 69.34  ? 835  VAL A CB    1 
ATOM   6134  C  CG1   . VAL A 1 835  ? -40.240 -33.599 -48.818 1.00 67.04  ? 835  VAL A CG1   1 
ATOM   6135  C  CG2   . VAL A 1 835  ? -38.871 -34.239 -50.829 1.00 72.87  ? 835  VAL A CG2   1 
ATOM   6136  N  N     . LEU A 1 836  ? -38.515 -34.442 -46.212 1.00 75.89  ? 836  LEU A N     1 
ATOM   6137  C  CA    . LEU A 1 836  ? -38.983 -34.707 -44.866 1.00 78.06  ? 836  LEU A CA    1 
ATOM   6138  C  C     . LEU A 1 836  ? -40.415 -34.222 -44.628 1.00 73.87  ? 836  LEU A C     1 
ATOM   6139  O  O     . LEU A 1 836  ? -40.792 -33.175 -45.104 1.00 62.59  ? 836  LEU A O     1 
ATOM   6140  C  CB    . LEU A 1 836  ? -38.043 -34.057 -43.869 1.00 81.04  ? 836  LEU A CB    1 
ATOM   6141  C  CG    . LEU A 1 836  ? -36.616 -34.549 -44.058 1.00 82.06  ? 836  LEU A CG    1 
ATOM   6142  C  CD1   . LEU A 1 836  ? -35.862 -34.218 -42.790 1.00 85.00  ? 836  LEU A CD1   1 
ATOM   6143  C  CD2   . LEU A 1 836  ? -36.530 -36.047 -44.363 1.00 82.58  ? 836  LEU A CD2   1 
ATOM   6144  N  N     . GLU A 1 837  ? -41.204 -35.000 -43.885 1.00 70.26  ? 837  GLU A N     1 
ATOM   6145  C  CA    . GLU A 1 837  ? -42.481 -34.548 -43.357 1.00 76.64  ? 837  GLU A CA    1 
ATOM   6146  C  C     . GLU A 1 837  ? -42.233 -33.677 -42.121 1.00 78.40  ? 837  GLU A C     1 
ATOM   6147  O  O     . GLU A 1 837  ? -41.208 -33.824 -41.453 1.00 92.60  ? 837  GLU A O     1 
ATOM   6148  C  CB    . GLU A 1 837  ? -43.331 -35.736 -42.914 1.00 85.09  ? 837  GLU A CB    1 
ATOM   6149  C  CG    . GLU A 1 837  ? -43.851 -36.652 -44.007 1.00 90.13  ? 837  GLU A CG    1 
ATOM   6150  C  CD    . GLU A 1 837  ? -44.691 -37.814 -43.459 1.00 92.14  ? 837  GLU A CD    1 
ATOM   6151  O  OE1   . GLU A 1 837  ? -44.300 -38.414 -42.433 1.00 91.86  ? 837  GLU A OE1   1 
ATOM   6152  O  OE2   . GLU A 1 837  ? -45.735 -38.151 -44.067 1.00 97.41  ? 837  GLU A OE2   1 
ATOM   6153  N  N     . ARG A 1 838  ? -43.180 -32.793 -41.831 1.00 74.11  ? 838  ARG A N     1 
ATOM   6154  C  CA    . ARG A 1 838  ? -43.009 -31.755 -40.845 1.00 73.14  ? 838  ARG A CA    1 
ATOM   6155  C  C     . ARG A 1 838  ? -42.599 -32.281 -39.467 1.00 75.66  ? 838  ARG A C     1 
ATOM   6156  O  O     . ARG A 1 838  ? -41.709 -31.719 -38.834 1.00 74.85  ? 838  ARG A O     1 
ATOM   6157  C  CB    . ARG A 1 838  ? -44.323 -30.975 -40.773 1.00 81.62  ? 838  ARG A CB    1 
ATOM   6158  C  CG    . ARG A 1 838  ? -44.378 -29.860 -39.757 1.00 86.23  ? 838  ARG A CG    1 
ATOM   6159  C  CD    . ARG A 1 838  ? -43.284 -28.852 -40.025 1.00 86.24  ? 838  ARG A CD    1 
ATOM   6160  N  NE    . ARG A 1 838  ? -43.504 -28.116 -41.257 1.00 78.99  ? 838  ARG A NE    1 
ATOM   6161  C  CZ    . ARG A 1 838  ? -42.629 -27.253 -41.752 1.00 84.58  ? 838  ARG A CZ    1 
ATOM   6162  N  NH1   . ARG A 1 838  ? -41.472 -27.033 -41.135 1.00 88.66  ? 838  ARG A NH1   1 
ATOM   6163  N  NH2   . ARG A 1 838  ? -42.901 -26.605 -42.868 1.00 92.69  ? 838  ARG A NH2   1 
ATOM   6164  N  N     . GLY A 1 839  ? -43.264 -33.352 -39.018 1.00 88.19  ? 839  GLY A N     1 
ATOM   6165  C  CA    . GLY A 1 839  ? -42.976 -33.977 -37.727 1.00 106.14 ? 839  GLY A CA    1 
ATOM   6166  C  C     . GLY A 1 839  ? -41.541 -34.492 -37.598 1.00 99.75  ? 839  GLY A C     1 
ATOM   6167  O  O     . GLY A 1 839  ? -40.851 -34.190 -36.609 1.00 90.10  ? 839  GLY A O     1 
ATOM   6168  N  N     . GLU A 1 840  ? -41.098 -35.258 -38.608 1.00 89.67  ? 840  GLU A N     1 
ATOM   6169  C  CA    . GLU A 1 840  ? -39.712 -35.733 -38.702 1.00 83.50  ? 840  GLU A CA    1 
ATOM   6170  C  C     . GLU A 1 840  ? -38.716 -34.575 -38.787 1.00 80.66  ? 840  GLU A C     1 
ATOM   6171  O  O     . GLU A 1 840  ? -37.619 -34.646 -38.241 1.00 77.09  ? 840  GLU A O     1 
ATOM   6172  C  CB    . GLU A 1 840  ? -39.438 -36.503 -40.016 1.00 80.91  ? 840  GLU A CB    1 
ATOM   6173  C  CG    . GLU A 1 840  ? -40.444 -37.490 -40.587 1.00 90.16  ? 840  GLU A CG    1 
ATOM   6174  C  CD    . GLU A 1 840  ? -39.896 -38.142 -41.874 1.00 102.05 ? 840  GLU A CD    1 
ATOM   6175  O  OE1   . GLU A 1 840  ? -38.734 -37.838 -42.224 1.00 106.66 ? 840  GLU A OE1   1 
ATOM   6176  O  OE2   . GLU A 1 840  ? -40.588 -38.966 -42.541 1.00 106.41 ? 840  GLU A OE2   1 
ATOM   6177  N  N     . ASP A 1 841  ? -39.098 -33.546 -39.547 1.00 78.72  ? 841  ASP A N     1 
ATOM   6178  C  CA    . ASP A 1 841  ? -38.233 -32.406 -39.829 1.00 79.49  ? 841  ASP A CA    1 
ATOM   6179  C  C     . ASP A 1 841  ? -37.885 -31.682 -38.549 1.00 83.12  ? 841  ASP A C     1 
ATOM   6180  O  O     . ASP A 1 841  ? -36.707 -31.479 -38.279 1.00 86.33  ? 841  ASP A O     1 
ATOM   6181  C  CB    . ASP A 1 841  ? -38.872 -31.424 -40.809 1.00 80.90  ? 841  ASP A CB    1 
ATOM   6182  C  CG    . ASP A 1 841  ? -37.885 -30.365 -41.314 1.00 77.28  ? 841  ASP A CG    1 
ATOM   6183  O  OD1   . ASP A 1 841  ? -37.537 -29.409 -40.578 1.00 77.53  ? 841  ASP A OD1   1 
ATOM   6184  O  OD2   . ASP A 1 841  ? -37.474 -30.491 -42.474 1.00 75.05  ? 841  ASP A OD2   1 
ATOM   6185  N  N     . MET A 1 842  ? -38.902 -31.326 -37.760 1.00 89.78  ? 842  MET A N     1 
ATOM   6186  C  CA    . MET A 1 842  ? -38.715 -30.644 -36.475 1.00 97.93  ? 842  MET A CA    1 
ATOM   6187  C  C     . MET A 1 842  ? -37.843 -31.435 -35.489 1.00 99.10  ? 842  MET A C     1 
ATOM   6188  O  O     . MET A 1 842  ? -37.080 -30.853 -34.716 1.00 95.98  ? 842  MET A O     1 
ATOM   6189  C  CB    . MET A 1 842  ? -40.080 -30.374 -35.840 1.00 99.18  ? 842  MET A CB    1 
ATOM   6190  C  CG    . MET A 1 842  ? -40.944 -29.388 -36.622 1.00 97.49  ? 842  MET A CG    1 
ATOM   6191  S  SD    . MET A 1 842  ? -42.177 -28.631 -35.554 1.00 98.92  ? 842  MET A SD    1 
ATOM   6192  C  CE    . MET A 1 842  ? -42.934 -30.086 -34.810 1.00 101.23 ? 842  MET A CE    1 
ATOM   6193  N  N     . LEU A 1 843  ? -37.971 -32.766 -35.548 1.00 96.13  ? 843  LEU A N     1 
ATOM   6194  C  CA    . LEU A 1 843  ? -37.248 -33.677 -34.669 1.00 94.96  ? 843  LEU A CA    1 
ATOM   6195  C  C     . LEU A 1 843  ? -35.770 -33.873 -35.071 1.00 88.73  ? 843  LEU A C     1 
ATOM   6196  O  O     . LEU A 1 843  ? -34.871 -33.856 -34.225 1.00 86.68  ? 843  LEU A O     1 
ATOM   6197  C  CB    . LEU A 1 843  ? -37.968 -35.018 -34.735 1.00 99.90  ? 843  LEU A CB    1 
ATOM   6198  C  CG    . LEU A 1 843  ? -37.604 -36.058 -33.688 1.00 102.42 ? 843  LEU A CG    1 
ATOM   6199  C  CD1   . LEU A 1 843  ? -38.018 -35.573 -32.305 1.00 102.25 ? 843  LEU A CD1   1 
ATOM   6200  C  CD2   . LEU A 1 843  ? -38.258 -37.386 -34.047 1.00 103.94 ? 843  LEU A CD2   1 
ATOM   6201  N  N     . ILE A 1 844  ? -35.544 -34.066 -36.369 1.00 81.06  ? 844  ILE A N     1 
ATOM   6202  C  CA    . ILE A 1 844  ? -34.207 -34.328 -36.927 1.00 79.90  ? 844  ILE A CA    1 
ATOM   6203  C  C     . ILE A 1 844  ? -33.355 -33.061 -37.000 1.00 86.61  ? 844  ILE A C     1 
ATOM   6204  O  O     . ILE A 1 844  ? -32.183 -33.079 -36.606 1.00 84.81  ? 844  ILE A O     1 
ATOM   6205  C  CB    . ILE A 1 844  ? -34.296 -34.896 -38.342 1.00 78.56  ? 844  ILE A CB    1 
ATOM   6206  C  CG1   . ILE A 1 844  ? -34.906 -36.286 -38.299 1.00 80.92  ? 844  ILE A CG1   1 
ATOM   6207  C  CG2   . ILE A 1 844  ? -32.929 -34.939 -39.008 1.00 75.77  ? 844  ILE A CG2   1 
ATOM   6208  C  CD1   . ILE A 1 844  ? -35.269 -36.815 -39.673 1.00 85.29  ? 844  ILE A CD1   1 
ATOM   6209  N  N     . THR A 1 845  ? -33.932 -31.982 -37.538 1.00 89.03  ? 845  THR A N     1 
ATOM   6210  C  CA    . THR A 1 845  ? -33.279 -30.681 -37.565 1.00 101.34 ? 845  THR A CA    1 
ATOM   6211  C  C     . THR A 1 845  ? -33.286 -30.145 -36.129 1.00 104.02 ? 845  THR A C     1 
ATOM   6212  O  O     . THR A 1 845  ? -34.124 -30.534 -35.297 1.00 110.42 ? 845  THR A O     1 
ATOM   6213  C  CB    . THR A 1 845  ? -33.997 -29.675 -38.514 1.00 114.43 ? 845  THR A CB    1 
ATOM   6214  O  OG1   . THR A 1 845  ? -33.173 -28.517 -38.697 1.00 148.04 ? 845  THR A OG1   1 
ATOM   6215  C  CG2   . THR A 1 845  ? -35.326 -29.180 -37.947 1.00 120.77 ? 845  THR A CG2   1 
ATOM   6216  N  N     . GLY A 1 846  ? -32.352 -29.247 -35.836 1.00 102.59 ? 846  GLY A N     1 
ATOM   6217  C  CA    . GLY A 1 846  ? -32.346 -28.583 -34.548 1.00 100.59 ? 846  GLY A CA    1 
ATOM   6218  C  C     . GLY A 1 846  ? -33.286 -27.386 -34.543 1.00 104.34 ? 846  GLY A C     1 
ATOM   6219  O  O     . GLY A 1 846  ? -34.333 -27.370 -35.204 1.00 118.64 ? 846  GLY A O     1 
ATOM   6220  N  N     . GLY A 1 847  ? -32.909 -26.402 -33.751 1.00 93.09  ? 847  GLY A N     1 
ATOM   6221  C  CA    . GLY A 1 847  ? -33.593 -25.133 -33.680 1.00 85.22  ? 847  GLY A CA    1 
ATOM   6222  C  C     . GLY A 1 847  ? -32.651 -24.085 -33.138 1.00 81.54  ? 847  GLY A C     1 
ATOM   6223  O  O     . GLY A 1 847  ? -31.438 -24.250 -33.168 1.00 83.07  ? 847  GLY A O     1 
ATOM   6224  N  N     . ARG A 1 848  ? -33.224 -23.013 -32.618 1.00 85.32  ? 848  ARG A N     1 
ATOM   6225  C  CA    . ARG A 1 848  ? -32.432 -21.979 -31.962 1.00 87.39  ? 848  ARG A CA    1 
ATOM   6226  C  C     . ARG A 1 848  ? -31.896 -22.533 -30.644 1.00 87.39  ? 848  ARG A C     1 
ATOM   6227  O  O     . ARG A 1 848  ? -32.524 -23.404 -30.026 1.00 92.01  ? 848  ARG A O     1 
ATOM   6228  C  CB    . ARG A 1 848  ? -33.284 -20.747 -31.732 1.00 88.45  ? 848  ARG A CB    1 
ATOM   6229  C  CG    . ARG A 1 848  ? -32.465 -19.498 -31.586 1.00 88.27  ? 848  ARG A CG    1 
ATOM   6230  C  CD    . ARG A 1 848  ? -33.351 -18.332 -31.221 1.00 86.72  ? 848  ARG A CD    1 
ATOM   6231  N  NE    . ARG A 1 848  ? -33.902 -17.658 -32.393 1.00 86.71  ? 848  ARG A NE    1 
ATOM   6232  C  CZ    . ARG A 1 848  ? -33.231 -16.810 -33.177 1.00 88.66  ? 848  ARG A CZ    1 
ATOM   6233  N  NH1   . ARG A 1 848  ? -31.942 -16.548 -32.961 1.00 99.10  ? 848  ARG A NH1   1 
ATOM   6234  N  NH2   . ARG A 1 848  ? -33.848 -16.226 -34.200 1.00 86.39  ? 848  ARG A NH2   1 
ATOM   6235  N  N     . HIS A 1 849  ? -30.739 -22.028 -30.221 1.00 94.81  ? 849  HIS A N     1 
ATOM   6236  C  CA    . HIS A 1 849  ? -30.149 -22.411 -28.931 1.00 104.98 ? 849  HIS A CA    1 
ATOM   6237  C  C     . HIS A 1 849  ? -30.962 -21.832 -27.777 1.00 105.87 ? 849  HIS A C     1 
ATOM   6238  O  O     . HIS A 1 849  ? -31.170 -20.617 -27.719 1.00 107.14 ? 849  HIS A O     1 
ATOM   6239  C  CB    . HIS A 1 849  ? -28.728 -21.854 -28.821 1.00 111.97 ? 849  HIS A CB    1 
ATOM   6240  C  CG    . HIS A 1 849  ? -27.800 -22.320 -29.902 1.00 111.93 ? 849  HIS A CG    1 
ATOM   6241  N  ND1   . HIS A 1 849  ? -26.755 -23.193 -29.666 1.00 103.41 ? 849  HIS A ND1   1 
ATOM   6242  C  CD2   . HIS A 1 849  ? -27.754 -22.020 -31.222 1.00 104.24 ? 849  HIS A CD2   1 
ATOM   6243  C  CE1   . HIS A 1 849  ? -26.112 -23.412 -30.796 1.00 99.94  ? 849  HIS A CE1   1 
ATOM   6244  N  NE2   . HIS A 1 849  ? -26.702 -22.721 -31.754 1.00 106.35 ? 849  HIS A NE2   1 
ATOM   6245  N  N     . PRO A 1 850  ? -31.449 -22.694 -26.867 1.00 99.47  ? 850  PRO A N     1 
ATOM   6246  C  CA    . PRO A 1 850  ? -31.924 -22.195 -25.582 1.00 99.47  ? 850  PRO A CA    1 
ATOM   6247  C  C     . PRO A 1 850  ? -30.770 -21.602 -24.780 1.00 106.85 ? 850  PRO A C     1 
ATOM   6248  O  O     . PRO A 1 850  ? -29.664 -22.121 -24.877 1.00 118.19 ? 850  PRO A O     1 
ATOM   6249  C  CB    . PRO A 1 850  ? -32.386 -23.470 -24.855 1.00 97.20  ? 850  PRO A CB    1 
ATOM   6250  C  CG    . PRO A 1 850  ? -32.581 -24.504 -25.905 1.00 94.27  ? 850  PRO A CG    1 
ATOM   6251  C  CD    . PRO A 1 850  ? -31.710 -24.130 -27.056 1.00 92.06  ? 850  PRO A CD    1 
ATOM   6252  N  N     . TYR A 1 851  ? -31.041 -20.568 -23.991 1.00 108.19 ? 851  TYR A N     1 
ATOM   6253  C  CA    . TYR A 1 851  ? -30.019 -19.815 -23.267 1.00 96.29  ? 851  TYR A CA    1 
ATOM   6254  C  C     . TYR A 1 851  ? -30.354 -19.723 -21.794 1.00 95.87  ? 851  TYR A C     1 
ATOM   6255  O  O     . TYR A 1 851  ? -31.528 -19.706 -21.408 1.00 88.30  ? 851  TYR A O     1 
ATOM   6256  C  CB    . TYR A 1 851  ? -29.890 -18.411 -23.828 1.00 89.81  ? 851  TYR A CB    1 
ATOM   6257  C  CG    . TYR A 1 851  ? -28.621 -18.114 -24.594 1.00 90.86  ? 851  TYR A CG    1 
ATOM   6258  C  CD1   . TYR A 1 851  ? -28.224 -18.873 -25.686 1.00 94.15  ? 851  TYR A CD1   1 
ATOM   6259  C  CD2   . TYR A 1 851  ? -27.852 -17.011 -24.263 1.00 95.45  ? 851  TYR A CD2   1 
ATOM   6260  C  CE1   . TYR A 1 851  ? -27.068 -18.549 -26.407 1.00 98.46  ? 851  TYR A CE1   1 
ATOM   6261  C  CE2   . TYR A 1 851  ? -26.706 -16.681 -24.969 1.00 99.80  ? 851  TYR A CE2   1 
ATOM   6262  C  CZ    . TYR A 1 851  ? -26.305 -17.442 -26.041 1.00 97.08  ? 851  TYR A CZ    1 
ATOM   6263  O  OH    . TYR A 1 851  ? -25.135 -17.067 -26.700 1.00 93.46  ? 851  TYR A OH    1 
ATOM   6264  N  N     . LEU A 1 852  ? -29.310 -19.685 -20.975 1.00 97.80  ? 852  LEU A N     1 
ATOM   6265  C  CA    . LEU A 1 852  ? -29.416 -19.324 -19.571 1.00 96.95  ? 852  LEU A CA    1 
ATOM   6266  C  C     . LEU A 1 852  ? -28.498 -18.134 -19.313 1.00 92.92  ? 852  LEU A C     1 
ATOM   6267  O  O     . LEU A 1 852  ? -27.309 -18.183 -19.619 1.00 102.01 ? 852  LEU A O     1 
ATOM   6268  C  CB    . LEU A 1 852  ? -29.039 -20.494 -18.674 1.00 96.51  ? 852  LEU A CB    1 
ATOM   6269  C  CG    . LEU A 1 852  ? -28.796 -20.103 -17.222 1.00 94.84  ? 852  LEU A CG    1 
ATOM   6270  C  CD1   . LEU A 1 852  ? -30.034 -19.426 -16.628 1.00 95.62  ? 852  LEU A CD1   1 
ATOM   6271  C  CD2   . LEU A 1 852  ? -28.377 -21.339 -16.449 1.00 89.80  ? 852  LEU A CD2   1 
ATOM   6272  N  N     . GLY A 1 853  ? -29.060 -17.069 -18.743 1.00 95.32  ? 853  GLY A N     1 
ATOM   6273  C  CA    . GLY A 1 853  ? -28.295 -15.875 -18.392 1.00 105.13 ? 853  GLY A CA    1 
ATOM   6274  C  C     . GLY A 1 853  ? -28.265 -15.735 -16.883 1.00 105.09 ? 853  GLY A C     1 
ATOM   6275  O  O     . GLY A 1 853  ? -29.315 -15.797 -16.252 1.00 122.75 ? 853  GLY A O     1 
ATOM   6276  N  N     . LYS A 1 854  ? -27.079 -15.576 -16.303 1.00 89.43  ? 854  LYS A N     1 
ATOM   6277  C  CA    . LYS A 1 854  ? -26.936 -15.169 -14.904 1.00 94.54  ? 854  LYS A CA    1 
ATOM   6278  C  C     . LYS A 1 854  ? -26.186 -13.854 -14.870 1.00 93.44  ? 854  LYS A C     1 
ATOM   6279  O  O     . LYS A 1 854  ? -25.197 -13.704 -15.584 1.00 91.10  ? 854  LYS A O     1 
ATOM   6280  C  CB    . LYS A 1 854  ? -26.104 -16.178 -14.136 1.00 94.91  ? 854  LYS A CB    1 
ATOM   6281  C  CG    . LYS A 1 854  ? -26.594 -17.605 -14.233 1.00 104.65 ? 854  LYS A CG    1 
ATOM   6282  C  CD    . LYS A 1 854  ? -26.056 -18.436 -13.070 1.00 111.84 ? 854  LYS A CD    1 
ATOM   6283  C  CE    . LYS A 1 854  ? -26.130 -19.931 -13.349 1.00 108.64 ? 854  LYS A CE    1 
ATOM   6284  N  NZ    . LYS A 1 854  ? -26.384 -20.702 -12.098 1.00 108.29 ? 854  LYS A NZ    1 
ATOM   6285  N  N     . TYR A 1 855  ? -26.627 -12.931 -14.026 1.00 93.59  ? 855  TYR A N     1 
ATOM   6286  C  CA    . TYR A 1 855  ? -25.988 -11.623 -13.935 1.00 100.29 ? 855  TYR A CA    1 
ATOM   6287  C  C     . TYR A 1 855  ? -25.895 -11.121 -12.502 1.00 108.73 ? 855  TYR A C     1 
ATOM   6288  O  O     . TYR A 1 855  ? -26.764 -11.417 -11.674 1.00 110.67 ? 855  TYR A O     1 
ATOM   6289  C  CB    . TYR A 1 855  ? -26.722 -10.586 -14.811 1.00 95.64  ? 855  TYR A CB    1 
ATOM   6290  C  CG    . TYR A 1 855  ? -28.227 -10.616 -14.704 1.00 94.05  ? 855  TYR A CG    1 
ATOM   6291  C  CD1   . TYR A 1 855  ? -28.949 -11.611 -15.337 1.00 95.82  ? 855  TYR A CD1   1 
ATOM   6292  C  CD2   . TYR A 1 855  ? -28.931 -9.645  -13.990 1.00 84.69  ? 855  TYR A CD2   1 
ATOM   6293  C  CE1   . TYR A 1 855  ? -30.322 -11.662 -15.250 1.00 93.34  ? 855  TYR A CE1   1 
ATOM   6294  C  CE2   . TYR A 1 855  ? -30.312 -9.688  -13.906 1.00 80.54  ? 855  TYR A CE2   1 
ATOM   6295  C  CZ    . TYR A 1 855  ? -30.997 -10.705 -14.546 1.00 84.96  ? 855  TYR A CZ    1 
ATOM   6296  O  OH    . TYR A 1 855  ? -32.362 -10.815 -14.511 1.00 84.11  ? 855  TYR A OH    1 
ATOM   6297  N  N     . LYS A 1 856  ? -24.808 -10.387 -12.228 1.00 115.81 ? 856  LYS A N     1 
ATOM   6298  C  CA    . LYS A 1 856  ? -24.664 -9.555  -11.036 1.00 109.76 ? 856  LYS A CA    1 
ATOM   6299  C  C     . LYS A 1 856  ? -24.465 -8.112  -11.540 1.00 101.70 ? 856  LYS A C     1 
ATOM   6300  O  O     . LYS A 1 856  ? -23.513 -7.835  -12.275 1.00 96.40  ? 856  LYS A O     1 
ATOM   6301  C  CB    . LYS A 1 856  ? -23.517 -10.051 -10.131 1.00 108.21 ? 856  LYS A CB    1 
ATOM   6302  C  CG    . LYS A 1 856  ? -23.562 -11.562 -9.818  1.00 114.39 ? 856  LYS A CG    1 
ATOM   6303  C  CD    . LYS A 1 856  ? -22.449 -12.402 -10.492 1.00 115.20 ? 856  LYS A CD    1 
ATOM   6304  C  CE    . LYS A 1 856  ? -22.834 -13.172 -11.764 1.00 99.15  ? 856  LYS A CE    1 
ATOM   6305  N  NZ    . LYS A 1 856  ? -22.933 -14.640 -11.558 1.00 87.48  ? 856  LYS A NZ    1 
ATOM   6306  N  N     . ALA A 1 857  ? -25.384 -7.220  -11.177 1.00 103.19 ? 857  ALA A N     1 
ATOM   6307  C  CA    . ALA A 1 857  ? -25.397 -5.838  -11.664 1.00 110.97 ? 857  ALA A CA    1 
ATOM   6308  C  C     . ALA A 1 857  ? -25.237 -4.866  -10.500 1.00 117.14 ? 857  ALA A C     1 
ATOM   6309  O  O     . ALA A 1 857  ? -26.063 -4.859  -9.592  1.00 114.55 ? 857  ALA A O     1 
ATOM   6310  C  CB    . ALA A 1 857  ? -26.696 -5.552  -12.377 1.00 117.82 ? 857  ALA A CB    1 
ATOM   6311  N  N     . GLY A 1 858  ? -24.171 -4.062  -10.545 1.00 119.14 ? 858  GLY A N     1 
ATOM   6312  C  CA    . GLY A 1 858  ? -23.980 -2.956  -9.614  1.00 116.24 ? 858  GLY A CA    1 
ATOM   6313  C  C     . GLY A 1 858  ? -24.429 -1.653  -10.258 1.00 106.22 ? 858  GLY A C     1 
ATOM   6314  O  O     . GLY A 1 858  ? -23.952 -1.290  -11.325 1.00 96.03  ? 858  GLY A O     1 
ATOM   6315  N  N     . PHE A 1 859  ? -25.337 -0.941  -9.596  1.00 99.55  ? 859  PHE A N     1 
ATOM   6316  C  CA    . PHE A 1 859  ? -25.925 0.269   -10.158 1.00 110.22 ? 859  PHE A CA    1 
ATOM   6317  C  C     . PHE A 1 859  ? -26.107 1.413   -9.167  1.00 116.33 ? 859  PHE A C     1 
ATOM   6318  O  O     . PHE A 1 859  ? -26.055 1.228   -7.969  1.00 116.20 ? 859  PHE A O     1 
ATOM   6319  C  CB    . PHE A 1 859  ? -27.259 -0.077  -10.834 1.00 115.39 ? 859  PHE A CB    1 
ATOM   6320  C  CG    . PHE A 1 859  ? -28.281 -0.670  -9.897  1.00 110.46 ? 859  PHE A CG    1 
ATOM   6321  C  CD1   . PHE A 1 859  ? -28.138 -1.968  -9.426  1.00 105.43 ? 859  PHE A CD1   1 
ATOM   6322  C  CD2   . PHE A 1 859  ? -29.383 0.077   -9.482  1.00 105.52 ? 859  PHE A CD2   1 
ATOM   6323  C  CE1   . PHE A 1 859  ? -29.073 -2.505  -8.564  1.00 110.02 ? 859  PHE A CE1   1 
ATOM   6324  C  CE2   . PHE A 1 859  ? -30.321 -0.456  -8.622  1.00 103.67 ? 859  PHE A CE2   1 
ATOM   6325  C  CZ    . PHE A 1 859  ? -30.167 -1.748  -8.163  1.00 111.18 ? 859  PHE A CZ    1 
ATOM   6326  N  N     . MET A 1 860  ? -26.313 2.602   -9.724  1.00 120.12 ? 860  MET A N     1 
ATOM   6327  C  CA    . MET A 1 860  ? -26.582 3.832   -8.970  1.00 116.84 ? 860  MET A CA    1 
ATOM   6328  C  C     . MET A 1 860  ? -28.074 3.947   -8.738  1.00 121.26 ? 860  MET A C     1 
ATOM   6329  O  O     . MET A 1 860  ? -28.864 3.331   -9.451  1.00 137.79 ? 860  MET A O     1 
ATOM   6330  C  CB    . MET A 1 860  ? -26.136 5.076   -9.730  1.00 126.44 ? 860  MET A CB    1 
ATOM   6331  C  CG    . MET A 1 860  ? -24.666 5.121   -10.101 1.00 128.55 ? 860  MET A CG    1 
ATOM   6332  S  SD    . MET A 1 860  ? -23.619 5.355   -8.668  1.00 129.82 ? 860  MET A SD    1 
ATOM   6333  C  CE    . MET A 1 860  ? -23.243 3.683   -8.187  1.00 119.18 ? 860  MET A CE    1 
ATOM   6334  N  N     . ASN A 1 861  ? -28.469 4.763   -7.769  1.00 121.66 ? 861  ASN A N     1 
ATOM   6335  C  CA    . ASN A 1 861  ? -29.905 4.928   -7.466  1.00 116.75 ? 861  ASN A CA    1 
ATOM   6336  C  C     . ASN A 1 861  ? -30.698 5.659   -8.576  1.00 115.07 ? 861  ASN A C     1 
ATOM   6337  O  O     . ASN A 1 861  ? -31.933 5.525   -8.631  1.00 116.87 ? 861  ASN A O     1 
ATOM   6338  C  CB    . ASN A 1 861  ? -30.102 5.486   -6.049  1.00 117.67 ? 861  ASN A CB    1 
ATOM   6339  C  CG    . ASN A 1 861  ? -29.759 4.448   -4.961  1.00 120.11 ? 861  ASN A CG    1 
ATOM   6340  O  OD1   . ASN A 1 861  ? -30.015 3.251   -5.123  1.00 107.33 ? 861  ASN A OD1   1 
ATOM   6341  N  ND2   . ASN A 1 861  ? -29.166 4.904   -3.857  1.00 115.68 ? 861  ASN A ND2   1 
ATOM   6342  N  N     . ASP A 1 862  ? -30.007 6.376   -9.465  1.00 112.81 ? 862  ASP A N     1 
ATOM   6343  C  CA    . ASP A 1 862  ? -30.663 6.884   -10.691 1.00 121.38 ? 862  ASP A CA    1 
ATOM   6344  C  C     . ASP A 1 862  ? -30.747 5.842   -11.836 1.00 124.74 ? 862  ASP A C     1 
ATOM   6345  O  O     . ASP A 1 862  ? -31.134 6.186   -12.955 1.00 131.05 ? 862  ASP A O     1 
ATOM   6346  C  CB    . ASP A 1 862  ? -30.037 8.196   -11.179 1.00 120.29 ? 862  ASP A CB    1 
ATOM   6347  C  CG    . ASP A 1 862  ? -28.599 8.033   -11.586 1.00 123.90 ? 862  ASP A CG    1 
ATOM   6348  O  OD1   . ASP A 1 862  ? -27.920 7.170   -10.979 1.00 127.48 ? 862  ASP A OD1   1 
ATOM   6349  O  OD2   . ASP A 1 862  ? -28.153 8.764   -12.500 1.00 107.90 ? 862  ASP A OD2   1 
ATOM   6350  N  N     . GLY A 1 863  ? -30.409 4.587   -11.550 1.00 121.42 ? 863  GLY A N     1 
ATOM   6351  C  CA    . GLY A 1 863  ? -30.581 3.493   -12.496 1.00 134.29 ? 863  GLY A CA    1 
ATOM   6352  C  C     . GLY A 1 863  ? -29.410 3.233   -13.429 1.00 147.92 ? 863  GLY A C     1 
ATOM   6353  O  O     . GLY A 1 863  ? -29.492 2.298   -14.237 1.00 169.04 ? 863  GLY A O     1 
ATOM   6354  N  N     . ARG A 1 864  ? -28.323 4.006   -13.317 1.00 151.51 ? 864  ARG A N     1 
ATOM   6355  C  CA    . ARG A 1 864  ? -27.151 3.787   -14.188 1.00 152.45 ? 864  ARG A CA    1 
ATOM   6356  C  C     . ARG A 1 864  ? -26.338 2.600   -13.675 1.00 152.67 ? 864  ARG A C     1 
ATOM   6357  O  O     . ARG A 1 864  ? -26.106 2.472   -12.480 1.00 153.39 ? 864  ARG A O     1 
ATOM   6358  C  CB    . ARG A 1 864  ? -26.241 4.996   -14.300 1.00 147.52 ? 864  ARG A CB    1 
ATOM   6359  C  CG    . ARG A 1 864  ? -25.124 4.822   -15.332 1.00 151.27 ? 864  ARG A CG    1 
ATOM   6360  C  CD    . ARG A 1 864  ? -24.398 6.132   -15.578 1.00 163.75 ? 864  ARG A CD    1 
ATOM   6361  N  NE    . ARG A 1 864  ? -24.021 6.760   -14.305 1.00 175.29 ? 864  ARG A NE    1 
ATOM   6362  C  CZ    . ARG A 1 864  ? -24.749 7.646   -13.610 1.00 155.32 ? 864  ARG A CZ    1 
ATOM   6363  N  NH1   . ARG A 1 864  ? -25.938 8.077   -14.032 1.00 146.77 ? 864  ARG A NH1   1 
ATOM   6364  N  NH2   . ARG A 1 864  ? -24.274 8.109   -12.461 1.00 138.66 ? 864  ARG A NH2   1 
ATOM   6365  N  N     . ILE A 1 865  ? -25.898 1.766   -14.608 1.00 152.20 ? 865  ILE A N     1 
ATOM   6366  C  CA    . ILE A 1 865  ? -25.246 0.503   -14.323 1.00 143.71 ? 865  ILE A CA    1 
ATOM   6367  C  C     . ILE A 1 865  ? -23.758 0.630   -14.598 1.00 145.36 ? 865  ILE A C     1 
ATOM   6368  O  O     . ILE A 1 865  ? -23.301 0.559   -15.729 1.00 162.08 ? 865  ILE A O     1 
ATOM   6369  C  CB    . ILE A 1 865  ? -25.838 -0.652  -15.167 1.00 139.14 ? 865  ILE A CB    1 
ATOM   6370  C  CG1   . ILE A 1 865  ? -27.369 -0.684  -15.055 1.00 144.56 ? 865  ILE A CG1   1 
ATOM   6371  C  CG2   . ILE A 1 865  ? -25.269 -1.987  -14.706 1.00 133.22 ? 865  ILE A CG2   1 
ATOM   6372  C  CD1   . ILE A 1 865  ? -28.048 -1.609  -16.044 1.00 143.78 ? 865  ILE A CD1   1 
ATOM   6373  N  N     . LEU A 1 866  ? -23.009 0.855   -13.533 1.00 137.93 ? 866  LEU A N     1 
ATOM   6374  C  CA    . LEU A 1 866  ? -21.550 1.025   -13.593 1.00 124.31 ? 866  LEU A CA    1 
ATOM   6375  C  C     . LEU A 1 866  ? -20.798 -0.306  -13.620 1.00 113.18 ? 866  LEU A C     1 
ATOM   6376  O  O     . LEU A 1 866  ? -19.715 -0.371  -14.179 1.00 109.96 ? 866  LEU A O     1 
ATOM   6377  C  CB    . LEU A 1 866  ? -21.062 1.754   -12.335 1.00 117.80 ? 866  LEU A CB    1 
ATOM   6378  C  CG    . LEU A 1 866  ? -21.480 3.217   -12.157 1.00 126.61 ? 866  LEU A CG    1 
ATOM   6379  C  CD1   . LEU A 1 866  ? -20.924 3.776   -10.855 1.00 125.20 ? 866  LEU A CD1   1 
ATOM   6380  C  CD2   . LEU A 1 866  ? -21.039 4.075   -13.347 1.00 130.93 ? 866  LEU A CD2   1 
ATOM   6381  N  N     . ALA A 1 867  ? -21.356 -1.325  -12.977 1.00 114.29 ? 867  ALA A N     1 
ATOM   6382  C  CA    . ALA A 1 867  ? -20.742 -2.668  -12.921 1.00 122.71 ? 867  ALA A CA    1 
ATOM   6383  C  C     . ALA A 1 867  ? -21.696 -3.750  -13.419 1.00 123.85 ? 867  ALA A C     1 
ATOM   6384  O  O     . ALA A 1 867  ? -22.883 -3.715  -13.116 1.00 137.37 ? 867  ALA A O     1 
ATOM   6385  C  CB    . ALA A 1 867  ? -20.314 -2.983  -11.515 1.00 133.78 ? 867  ALA A CB    1 
ATOM   6386  N  N     . LEU A 1 868  ? -21.175 -4.716  -14.178 1.00 111.73 ? 868  LEU A N     1 
ATOM   6387  C  CA    . LEU A 1 868  ? -21.993 -5.828  -14.672 1.00 103.33 ? 868  LEU A CA    1 
ATOM   6388  C  C     . LEU A 1 868  ? -21.181 -7.096  -14.900 1.00 102.41 ? 868  LEU A C     1 
ATOM   6389  O  O     . LEU A 1 868  ? -20.417 -7.187  -15.846 1.00 95.85  ? 868  LEU A O     1 
ATOM   6390  C  CB    . LEU A 1 868  ? -22.773 -5.489  -15.947 1.00 107.06 ? 868  LEU A CB    1 
ATOM   6391  C  CG    . LEU A 1 868  ? -23.682 -6.620  -16.493 1.00 105.34 ? 868  LEU A CG    1 
ATOM   6392  C  CD1   . LEU A 1 868  ? -24.422 -7.376  -15.396 1.00 111.37 ? 868  LEU A CD1   1 
ATOM   6393  C  CD2   . LEU A 1 868  ? -24.697 -6.104  -17.494 1.00 98.43  ? 868  LEU A CD2   1 
ATOM   6394  N  N     . ASP A 1 869  ? -21.372 -8.069  -14.028 1.00 116.75 ? 869  ASP A N     1 
ATOM   6395  C  CA    . ASP A 1 869  ? -20.824 -9.429  -14.217 1.00 121.25 ? 869  ASP A CA    1 
ATOM   6396  C  C     . ASP A 1 869  ? -21.915 -10.286 -14.855 1.00 117.28 ? 869  ASP A C     1 
ATOM   6397  O  O     . ASP A 1 869  ? -23.059 -10.276 -14.396 1.00 109.23 ? 869  ASP A O     1 
ATOM   6398  C  CB    . ASP A 1 869  ? -20.375 -10.034 -12.880 1.00 145.23 ? 869  ASP A CB    1 
ATOM   6399  C  CG    . ASP A 1 869  ? -19.752 -11.428 -13.019 1.00 165.67 ? 869  ASP A CG    1 
ATOM   6400  O  OD1   . ASP A 1 869  ? -20.251 -12.262 -13.816 1.00 185.74 ? 869  ASP A OD1   1 
ATOM   6401  O  OD2   . ASP A 1 869  ? -18.770 -11.696 -12.287 1.00 168.33 ? 869  ASP A OD2   1 
ATOM   6402  N  N     . MET A 1 870  ? -21.545 -11.043 -15.894 1.00 135.96 ? 870  MET A N     1 
ATOM   6403  C  CA    . MET A 1 870  ? -22.507 -11.699 -16.788 1.00 131.27 ? 870  MET A CA    1 
ATOM   6404  C  C     . MET A 1 870  ? -22.046 -13.110 -17.168 1.00 121.92 ? 870  MET A C     1 
ATOM   6405  O  O     . MET A 1 870  ? -20.878 -13.322 -17.500 1.00 127.19 ? 870  MET A O     1 
ATOM   6406  C  CB    . MET A 1 870  ? -22.677 -10.894 -18.078 1.00 126.16 ? 870  MET A CB    1 
ATOM   6407  C  CG    . MET A 1 870  ? -23.671 -11.504 -19.039 1.00 120.13 ? 870  MET A CG    1 
ATOM   6408  S  SD    . MET A 1 870  ? -25.321 -11.331 -18.368 1.00 116.40 ? 870  MET A SD    1 
ATOM   6409  C  CE    . MET A 1 870  ? -25.768 -9.825  -19.241 1.00 113.74 ? 870  MET A CE    1 
ATOM   6410  N  N     . GLU A 1 871  ? -22.980 -14.052 -17.151 1.00 105.79 ? 871  GLU A N     1 
ATOM   6411  C  CA    . GLU A 1 871  ? -22.730 -15.418 -17.597 1.00 100.11 ? 871  GLU A CA    1 
ATOM   6412  C  C     . GLU A 1 871  ? -23.775 -15.849 -18.613 1.00 99.68  ? 871  GLU A C     1 
ATOM   6413  O  O     . GLU A 1 871  ? -24.966 -15.706 -18.358 1.00 118.61 ? 871  GLU A O     1 
ATOM   6414  C  CB    . GLU A 1 871  ? -22.686 -16.358 -16.402 1.00 97.62  ? 871  GLU A CB    1 
ATOM   6415  C  CG    . GLU A 1 871  ? -21.600 -15.963 -15.418 1.00 101.48 ? 871  GLU A CG    1 
ATOM   6416  C  CD    . GLU A 1 871  ? -21.285 -17.037 -14.394 1.00 104.00 ? 871  GLU A CD    1 
ATOM   6417  O  OE1   . GLU A 1 871  ? -22.144 -17.912 -14.124 1.00 97.17  ? 871  GLU A OE1   1 
ATOM   6418  O  OE2   . GLU A 1 871  ? -20.163 -16.986 -13.846 1.00 105.07 ? 871  GLU A OE2   1 
ATOM   6419  N  N     . HIS A 1 872  ? -23.335 -16.354 -19.766 1.00 97.08  ? 872  HIS A N     1 
ATOM   6420  C  CA    . HIS A 1 872  ? -24.216 -16.920 -20.776 1.00 87.51  ? 872  HIS A CA    1 
ATOM   6421  C  C     . HIS A 1 872  ? -24.005 -18.422 -20.855 1.00 93.37  ? 872  HIS A C     1 
ATOM   6422  O  O     . HIS A 1 872  ? -22.874 -18.887 -20.728 1.00 102.58 ? 872  HIS A O     1 
ATOM   6423  C  CB    . HIS A 1 872  ? -23.902 -16.355 -22.159 1.00 86.59  ? 872  HIS A CB    1 
ATOM   6424  C  CG    . HIS A 1 872  ? -24.285 -14.918 -22.348 1.00 89.73  ? 872  HIS A CG    1 
ATOM   6425  N  ND1   . HIS A 1 872  ? -24.060 -14.239 -23.530 1.00 92.06  ? 872  HIS A ND1   1 
ATOM   6426  C  CD2   . HIS A 1 872  ? -24.865 -14.026 -21.514 1.00 90.65  ? 872  HIS A CD2   1 
ATOM   6427  C  CE1   . HIS A 1 872  ? -24.486 -12.994 -23.416 1.00 86.14  ? 872  HIS A CE1   1 
ATOM   6428  N  NE2   . HIS A 1 872  ? -24.977 -12.838 -22.203 1.00 95.08  ? 872  HIS A NE2   1 
ATOM   6429  N  N     . TYR A 1 873  ? -25.080 -19.172 -21.072 1.00 99.62  ? 873  TYR A N     1 
ATOM   6430  C  CA    . TYR A 1 873  ? -25.010 -20.621 -21.325 1.00 101.06 ? 873  TYR A CA    1 
ATOM   6431  C  C     . TYR A 1 873  ? -25.950 -20.989 -22.450 1.00 98.11  ? 873  TYR A C     1 
ATOM   6432  O  O     . TYR A 1 873  ? -27.153 -20.869 -22.293 1.00 99.48  ? 873  TYR A O     1 
ATOM   6433  C  CB    . TYR A 1 873  ? -25.394 -21.476 -20.109 1.00 99.73  ? 873  TYR A CB    1 
ATOM   6434  C  CG    . TYR A 1 873  ? -24.604 -21.202 -18.883 1.00 99.83  ? 873  TYR A CG    1 
ATOM   6435  C  CD1   . TYR A 1 873  ? -24.807 -20.031 -18.180 1.00 112.32 ? 873  TYR A CD1   1 
ATOM   6436  C  CD2   . TYR A 1 873  ? -23.671 -22.106 -18.409 1.00 100.33 ? 873  TYR A CD2   1 
ATOM   6437  C  CE1   . TYR A 1 873  ? -24.091 -19.738 -17.043 1.00 125.71 ? 873  TYR A CE1   1 
ATOM   6438  C  CE2   . TYR A 1 873  ? -22.939 -21.826 -17.265 1.00 118.83 ? 873  TYR A CE2   1 
ATOM   6439  C  CZ    . TYR A 1 873  ? -23.159 -20.630 -16.585 1.00 127.92 ? 873  TYR A CZ    1 
ATOM   6440  O  OH    . TYR A 1 873  ? -22.473 -20.282 -15.442 1.00 126.94 ? 873  TYR A OH    1 
ATOM   6441  N  N     . SER A 1 874  ? -25.418 -21.455 -23.574 1.00 98.73  ? 874  SER A N     1 
ATOM   6442  C  CA    . SER A 1 874  ? -26.270 -22.031 -24.629 1.00 91.53  ? 874  SER A CA    1 
ATOM   6443  C  C     . SER A 1 874  ? -26.433 -23.525 -24.381 1.00 83.39  ? 874  SER A C     1 
ATOM   6444  O  O     . SER A 1 874  ? -25.526 -24.187 -23.858 1.00 84.21  ? 874  SER A O     1 
ATOM   6445  C  CB    . SER A 1 874  ? -25.747 -21.724 -26.046 1.00 88.74  ? 874  SER A CB    1 
ATOM   6446  O  OG    . SER A 1 874  ? -25.123 -22.835 -26.658 1.00 87.63  ? 874  SER A OG    1 
ATOM   6447  N  N     . ASN A 1 875  ? -27.597 -24.054 -24.733 1.00 80.33  ? 875  ASN A N     1 
ATOM   6448  C  CA    . ASN A 1 875  ? -27.839 -25.495 -24.789 1.00 83.78  ? 875  ASN A CA    1 
ATOM   6449  C  C     . ASN A 1 875  ? -27.559 -25.938 -26.231 1.00 84.40  ? 875  ASN A C     1 
ATOM   6450  O  O     . ASN A 1 875  ? -28.297 -25.560 -27.162 1.00 74.71  ? 875  ASN A O     1 
ATOM   6451  C  CB    . ASN A 1 875  ? -29.292 -25.793 -24.431 1.00 83.19  ? 875  ASN A CB    1 
ATOM   6452  C  CG    . ASN A 1 875  ? -29.567 -27.281 -24.249 1.00 86.08  ? 875  ASN A CG    1 
ATOM   6453  O  OD1   . ASN A 1 875  ? -29.057 -28.133 -24.974 1.00 81.84  ? 875  ASN A OD1   1 
ATOM   6454  N  ND2   . ASN A 1 875  ? -30.402 -27.595 -23.280 1.00 97.51  ? 875  ASN A ND2   1 
ATOM   6455  N  N     . ALA A 1 876  ? -26.493 -26.722 -26.424 1.00 82.60  ? 876  ALA A N     1 
ATOM   6456  C  CA    . ALA A 1 876  ? -26.033 -27.060 -27.761 1.00 80.91  ? 876  ALA A CA    1 
ATOM   6457  C  C     . ALA A 1 876  ? -26.731 -28.283 -28.381 1.00 74.03  ? 876  ALA A C     1 
ATOM   6458  O  O     . ALA A 1 876  ? -26.680 -28.464 -29.595 1.00 87.72  ? 876  ALA A O     1 
ATOM   6459  C  CB    . ALA A 1 876  ? -24.531 -27.248 -27.749 1.00 89.26  ? 876  ALA A CB    1 
ATOM   6460  N  N     . GLY A 1 877  ? -27.351 -29.118 -27.551 1.00 69.38  ? 877  GLY A N     1 
ATOM   6461  C  CA    . GLY A 1 877  ? -27.833 -30.413 -27.994 1.00 78.41  ? 877  GLY A CA    1 
ATOM   6462  C  C     . GLY A 1 877  ? -26.689 -31.399 -28.063 1.00 86.32  ? 877  GLY A C     1 
ATOM   6463  O  O     . GLY A 1 877  ? -25.614 -31.119 -27.546 1.00 96.73  ? 877  GLY A O     1 
ATOM   6464  N  N     . ALA A 1 878  ? -26.929 -32.548 -28.700 1.00 101.84 ? 878  ALA A N     1 
ATOM   6465  C  CA    . ALA A 1 878  ? -25.969 -33.661 -28.780 1.00 113.48 ? 878  ALA A CA    1 
ATOM   6466  C  C     . ALA A 1 878  ? -24.564 -33.275 -29.250 1.00 112.39 ? 878  ALA A C     1 
ATOM   6467  O  O     . ALA A 1 878  ? -23.575 -33.808 -28.727 1.00 117.53 ? 878  ALA A O     1 
ATOM   6468  C  CB    . ALA A 1 878  ? -26.528 -34.760 -29.667 1.00 125.25 ? 878  ALA A CB    1 
ATOM   6469  N  N     . SER A 1 879  ? -24.484 -32.356 -30.215 1.00 107.07 ? 879  SER A N     1 
ATOM   6470  C  CA    . SER A 1 879  ? -23.210 -31.938 -30.791 1.00 123.50 ? 879  SER A CA    1 
ATOM   6471  C  C     . SER A 1 879  ? -23.003 -30.434 -30.622 1.00 129.16 ? 879  SER A C     1 
ATOM   6472  O  O     . SER A 1 879  ? -23.944 -29.674 -30.423 1.00 128.81 ? 879  SER A O     1 
ATOM   6473  C  CB    . SER A 1 879  ? -23.124 -32.285 -32.281 1.00 138.98 ? 879  SER A CB    1 
ATOM   6474  O  OG    . SER A 1 879  ? -21.950 -31.732 -32.883 1.00 148.42 ? 879  SER A OG    1 
ATOM   6475  N  N     . LEU A 1 880  ? -21.750 -30.006 -30.749 1.00 142.07 ? 880  LEU A N     1 
ATOM   6476  C  CA    . LEU A 1 880  ? -21.398 -28.601 -31.055 1.00 130.52 ? 880  LEU A CA    1 
ATOM   6477  C  C     . LEU A 1 880  ? -21.437 -28.451 -32.582 1.00 126.52 ? 880  LEU A C     1 
ATOM   6478  O  O     . LEU A 1 880  ? -21.653 -27.358 -33.107 1.00 113.44 ? 880  LEU A O     1 
ATOM   6479  C  CB    . LEU A 1 880  ? -20.010 -28.228 -30.506 1.00 116.68 ? 880  LEU A CB    1 
ATOM   6480  C  CG    . LEU A 1 880  ? -19.367 -26.984 -31.147 1.00 119.89 ? 880  LEU A CG    1 
ATOM   6481  C  CD1   . LEU A 1 880  ? -18.640 -26.132 -30.115 1.00 114.95 ? 880  LEU A CD1   1 
ATOM   6482  C  CD2   . LEU A 1 880  ? -18.450 -27.348 -32.323 1.00 122.28 ? 880  LEU A CD2   1 
ATOM   6483  N  N     . SER A 1 883  ? -21.968 -23.413 -32.706 1.00 142.25 ? 883  SER A N     1 
ATOM   6484  C  CA    . SER A 1 883  ? -22.421 -23.410 -31.316 1.00 144.46 ? 883  SER A CA    1 
ATOM   6485  C  C     . SER A 1 883  ? -21.547 -22.519 -30.434 1.00 144.13 ? 883  SER A C     1 
ATOM   6486  O  O     . SER A 1 883  ? -22.045 -21.735 -29.624 1.00 147.66 ? 883  SER A O     1 
ATOM   6487  C  CB    . SER A 1 883  ? -22.407 -24.843 -30.752 1.00 141.44 ? 883  SER A CB    1 
ATOM   6488  O  OG    . SER A 1 883  ? -22.987 -24.915 -29.459 1.00 123.32 ? 883  SER A OG    1 
ATOM   6489  N  N     . LEU A 1 884  ? -20.237 -22.691 -30.567 1.00 139.55 ? 884  LEU A N     1 
ATOM   6490  C  CA    . LEU A 1 884  ? -19.273 -21.745 -29.992 1.00 134.60 ? 884  LEU A CA    1 
ATOM   6491  C  C     . LEU A 1 884  ? -19.304 -20.397 -30.697 1.00 126.41 ? 884  LEU A C     1 
ATOM   6492  O  O     . LEU A 1 884  ? -19.105 -19.359 -30.057 1.00 120.03 ? 884  LEU A O     1 
ATOM   6493  C  CB    . LEU A 1 884  ? -17.870 -22.350 -30.055 1.00 134.81 ? 884  LEU A CB    1 
ATOM   6494  C  CG    . LEU A 1 884  ? -16.868 -21.892 -29.002 1.00 131.31 ? 884  LEU A CG    1 
ATOM   6495  C  CD1   . LEU A 1 884  ? -17.428 -22.102 -27.597 1.00 119.67 ? 884  LEU A CD1   1 
ATOM   6496  C  CD2   . LEU A 1 884  ? -15.560 -22.651 -29.209 1.00 135.04 ? 884  LEU A CD2   1 
ATOM   6497  N  N     . PHE A 1 885  ? -19.563 -20.416 -32.020 1.00 126.79 ? 885  PHE A N     1 
ATOM   6498  C  CA    . PHE A 1 885  ? -19.757 -19.207 -32.847 1.00 126.70 ? 885  PHE A CA    1 
ATOM   6499  C  C     . PHE A 1 885  ? -20.901 -18.346 -32.267 1.00 131.11 ? 885  PHE A C     1 
ATOM   6500  O  O     . PHE A 1 885  ? -20.842 -17.113 -32.241 1.00 128.03 ? 885  PHE A O     1 
ATOM   6501  C  CB    . PHE A 1 885  ? -20.206 -19.560 -34.307 1.00 137.24 ? 885  PHE A CB    1 
ATOM   6502  C  CG    . PHE A 1 885  ? -19.086 -19.761 -35.343 1.00 146.21 ? 885  PHE A CG    1 
ATOM   6503  C  CD1   . PHE A 1 885  ? -18.023 -18.859 -35.484 1.00 148.49 ? 885  PHE A CD1   1 
ATOM   6504  C  CD2   . PHE A 1 885  ? -19.164 -20.829 -36.263 1.00 140.07 ? 885  PHE A CD2   1 
ATOM   6505  C  CE1   . PHE A 1 885  ? -17.034 -19.061 -36.459 1.00 144.21 ? 885  PHE A CE1   1 
ATOM   6506  C  CE2   . PHE A 1 885  ? -18.183 -21.024 -37.237 1.00 132.98 ? 885  PHE A CE2   1 
ATOM   6507  C  CZ    . PHE A 1 885  ? -17.116 -20.140 -37.336 1.00 135.30 ? 885  PHE A CZ    1 
ATOM   6508  N  N     . VAL A 1 886  ? -21.971 -19.039 -31.865 1.00 135.54 ? 886  VAL A N     1 
ATOM   6509  C  CA    . VAL A 1 886  ? -23.183 -18.398 -31.337 1.00 136.39 ? 886  VAL A CA    1 
ATOM   6510  C  C     . VAL A 1 886  ? -22.908 -17.713 -30.003 1.00 139.00 ? 886  VAL A C     1 
ATOM   6511  O  O     . VAL A 1 886  ? -23.483 -16.664 -29.725 1.00 162.46 ? 886  VAL A O     1 
ATOM   6512  C  CB    . VAL A 1 886  ? -24.368 -19.398 -31.168 1.00 128.55 ? 886  VAL A CB    1 
ATOM   6513  C  CG1   . VAL A 1 886  ? -25.150 -19.169 -29.866 1.00 113.11 ? 886  VAL A CG1   1 
ATOM   6514  C  CG2   . VAL A 1 886  ? -25.299 -19.333 -32.378 1.00 126.75 ? 886  VAL A CG2   1 
ATOM   6515  N  N     . ILE A 1 887  ? -22.043 -18.314 -29.185 1.00 132.00 ? 887  ILE A N     1 
ATOM   6516  C  CA    . ILE A 1 887  ? -21.607 -17.699 -27.933 1.00 116.95 ? 887  ILE A CA    1 
ATOM   6517  C  C     . ILE A 1 887  ? -20.776 -16.444 -28.219 1.00 110.04 ? 887  ILE A C     1 
ATOM   6518  O  O     . ILE A 1 887  ? -20.995 -15.421 -27.576 1.00 117.47 ? 887  ILE A O     1 
ATOM   6519  C  CB    . ILE A 1 887  ? -20.876 -18.695 -26.993 1.00 113.09 ? 887  ILE A CB    1 
ATOM   6520  C  CG1   . ILE A 1 887  ? -21.814 -19.851 -26.549 1.00 107.30 ? 887  ILE A CG1   1 
ATOM   6521  C  CG2   . ILE A 1 887  ? -20.290 -17.966 -25.791 1.00 112.73 ? 887  ILE A CG2   1 
ATOM   6522  C  CD1   . ILE A 1 887  ? -22.562 -19.662 -25.241 1.00 99.60  ? 887  ILE A CD1   1 
ATOM   6523  N  N     . GLU A 1 888  ? -19.854 -16.529 -29.180 1.00 106.34 ? 888  GLU A N     1 
ATOM   6524  C  CA    . GLU A 1 888  ? -19.006 -15.396 -29.559 1.00 105.06 ? 888  GLU A CA    1 
ATOM   6525  C  C     . GLU A 1 888  ? -19.814 -14.191 -30.019 1.00 109.63 ? 888  GLU A C     1 
ATOM   6526  O  O     . GLU A 1 888  ? -19.574 -13.063 -29.552 1.00 125.10 ? 888  GLU A O     1 
ATOM   6527  C  CB    . GLU A 1 888  ? -17.988 -15.801 -30.627 1.00 114.96 ? 888  GLU A CB    1 
ATOM   6528  C  CG    . GLU A 1 888  ? -16.852 -16.646 -30.068 1.00 126.70 ? 888  GLU A CG    1 
ATOM   6529  C  CD    . GLU A 1 888  ? -16.080 -17.414 -31.125 1.00 132.13 ? 888  GLU A CD    1 
ATOM   6530  O  OE1   . GLU A 1 888  ? -15.679 -16.814 -32.149 1.00 134.85 ? 888  GLU A OE1   1 
ATOM   6531  O  OE2   . GLU A 1 888  ? -15.850 -18.625 -30.908 1.00 137.42 ? 888  GLU A OE2   1 
ATOM   6532  N  N     . MET A 1 889  ? -20.771 -14.418 -30.919 1.00 114.06 ? 889  MET A N     1 
ATOM   6533  C  CA    . MET A 1 889  ? -21.628 -13.324 -31.388 1.00 117.96 ? 889  MET A CA    1 
ATOM   6534  C  C     . MET A 1 889  ? -22.544 -12.818 -30.281 1.00 119.19 ? 889  MET A C     1 
ATOM   6535  O  O     . MET A 1 889  ? -22.821 -11.627 -30.209 1.00 129.59 ? 889  MET A O     1 
ATOM   6536  C  CB    . MET A 1 889  ? -22.405 -13.704 -32.650 1.00 126.66 ? 889  MET A CB    1 
ATOM   6537  C  CG    . MET A 1 889  ? -21.514 -13.986 -33.864 1.00 132.75 ? 889  MET A CG    1 
ATOM   6538  S  SD    . MET A 1 889  ? -20.603 -12.576 -34.565 1.00 134.30 ? 889  MET A SD    1 
ATOM   6539  C  CE    . MET A 1 889  ? -21.529 -12.206 -36.071 1.00 113.18 ? 889  MET A CE    1 
ATOM   6540  N  N     . GLY A 1 890  ? -23.000 -13.724 -29.417 1.00 117.76 ? 890  GLY A N     1 
ATOM   6541  C  CA    . GLY A 1 890  ? -23.749 -13.354 -28.225 1.00 116.08 ? 890  GLY A CA    1 
ATOM   6542  C  C     . GLY A 1 890  ? -23.005 -12.313 -27.436 1.00 116.11 ? 890  GLY A C     1 
ATOM   6543  O  O     . GLY A 1 890  ? -23.530 -11.225 -27.199 1.00 121.34 ? 890  GLY A O     1 
ATOM   6544  N  N     . LEU A 1 891  ? -21.758 -12.621 -27.075 1.00 104.40 ? 891  LEU A N     1 
ATOM   6545  C  CA    . LEU A 1 891  ? -20.960 -11.743 -26.221 1.00 95.67  ? 891  LEU A CA    1 
ATOM   6546  C  C     . LEU A 1 891  ? -20.627 -10.404 -26.889 1.00 94.15  ? 891  LEU A C     1 
ATOM   6547  O  O     . LEU A 1 891  ? -20.622 -9.371  -26.218 1.00 105.66 ? 891  LEU A O     1 
ATOM   6548  C  CB    . LEU A 1 891  ? -19.635 -12.404 -25.851 1.00 94.61  ? 891  LEU A CB    1 
ATOM   6549  C  CG    . LEU A 1 891  ? -19.579 -13.778 -25.176 1.00 101.99 ? 891  LEU A CG    1 
ATOM   6550  C  CD1   . LEU A 1 891  ? -18.152 -14.059 -24.703 1.00 109.81 ? 891  LEU A CD1   1 
ATOM   6551  C  CD2   . LEU A 1 891  ? -20.548 -13.923 -24.010 1.00 104.06 ? 891  LEU A CD2   1 
ATOM   6552  N  N     . LEU A 1 892  ? -20.357 -10.423 -28.191 1.00 91.81  ? 892  LEU A N     1 
ATOM   6553  C  CA    . LEU A 1 892  ? -20.008 -9.210  -28.912 1.00 100.82 ? 892  LEU A CA    1 
ATOM   6554  C  C     . LEU A 1 892  ? -21.216 -8.279  -29.089 1.00 103.31 ? 892  LEU A C     1 
ATOM   6555  O  O     . LEU A 1 892  ? -21.067 -7.053  -29.082 1.00 84.67  ? 892  LEU A O     1 
ATOM   6556  C  CB    . LEU A 1 892  ? -19.400 -9.565  -30.270 1.00 104.60 ? 892  LEU A CB    1 
ATOM   6557  C  CG    . LEU A 1 892  ? -18.117 -10.394 -30.269 1.00 104.01 ? 892  LEU A CG    1 
ATOM   6558  C  CD1   . LEU A 1 892  ? -17.993 -11.144 -31.583 1.00 110.84 ? 892  LEU A CD1   1 
ATOM   6559  C  CD2   . LEU A 1 892  ? -16.907 -9.514  -30.053 1.00 111.31 ? 892  LEU A CD2   1 
ATOM   6560  N  N     . LYS A 1 893  ? -22.403 -8.861  -29.220 1.00 107.04 ? 893  LYS A N     1 
ATOM   6561  C  CA    . LYS A 1 893  ? -23.611 -8.083  -29.437 1.00 122.82 ? 893  LYS A CA    1 
ATOM   6562  C  C     . LYS A 1 893  ? -24.460 -7.872  -28.160 1.00 126.50 ? 893  LYS A C     1 
ATOM   6563  O  O     . LYS A 1 893  ? -25.500 -7.210  -28.195 1.00 130.73 ? 893  LYS A O     1 
ATOM   6564  C  CB    . LYS A 1 893  ? -24.426 -8.767  -30.530 1.00 130.08 ? 893  LYS A CB    1 
ATOM   6565  C  CG    . LYS A 1 893  ? -23.668 -8.919  -31.848 1.00 135.02 ? 893  LYS A CG    1 
ATOM   6566  C  CD    . LYS A 1 893  ? -24.566 -9.468  -32.939 1.00 138.05 ? 893  LYS A CD    1 
ATOM   6567  C  CE    . LYS A 1 893  ? -23.832 -9.665  -34.245 1.00 132.24 ? 893  LYS A CE    1 
ATOM   6568  N  NZ    . LYS A 1 893  ? -24.585 -10.654 -35.061 1.00 141.93 ? 893  LYS A NZ    1 
ATOM   6569  N  N     . MET A 1 894  ? -23.958 -8.388  -27.042 1.00 122.04 ? 894  MET A N     1 
ATOM   6570  C  CA    . MET A 1 894  ? -24.620 -8.340  -25.727 1.00 121.51 ? 894  MET A CA    1 
ATOM   6571  C  C     . MET A 1 894  ? -24.870 -6.898  -25.247 1.00 115.03 ? 894  MET A C     1 
ATOM   6572  O  O     . MET A 1 894  ? -25.923 -6.643  -24.694 1.00 126.54 ? 894  MET A O     1 
ATOM   6573  C  CB    . MET A 1 894  ? -23.846 -9.213  -24.749 1.00 124.01 ? 894  MET A CB    1 
ATOM   6574  C  CG    . MET A 1 894  ? -24.300 -9.180  -23.318 1.00 120.53 ? 894  MET A CG    1 
ATOM   6575  S  SD    . MET A 1 894  ? -22.809 -8.801  -22.423 1.00 118.16 ? 894  MET A SD    1 
ATOM   6576  C  CE    . MET A 1 894  ? -22.439 -7.160  -23.055 1.00 112.73 ? 894  MET A CE    1 
ATOM   6577  N  N     . ASP A 1 895  ? -23.919 -5.981  -25.443 1.00 96.84  ? 895  ASP A N     1 
ATOM   6578  C  CA    . ASP A 1 895  ? -24.073 -4.595  -25.105 1.00 91.85  ? 895  ASP A CA    1 
ATOM   6579  C  C     . ASP A 1 895  ? -25.369 -3.923  -25.603 1.00 98.92  ? 895  ASP A C     1 
ATOM   6580  O  O     . ASP A 1 895  ? -26.009 -3.120  -24.898 1.00 97.41  ? 895  ASP A O     1 
ATOM   6581  C  CB    . ASP A 1 895  ? -22.817 -3.795  -25.561 1.00 92.64  ? 895  ASP A CB    1 
ATOM   6582  C  CG    . ASP A 1 895  ? -22.512 -3.898  -27.079 1.00 98.32  ? 895  ASP A CG    1 
ATOM   6583  O  OD1   . ASP A 1 895  ? -23.169 -3.180  -27.859 1.00 96.09  ? 895  ASP A OD1   1 
ATOM   6584  O  OD2   . ASP A 1 895  ? -21.569 -4.636  -27.487 1.00 94.40  ? 895  ASP A OD2   1 
ATOM   6585  N  N     . ASN A 1 896  ? -25.751 -4.296  -26.820 1.00 110.59 ? 896  ASN A N     1 
ATOM   6586  C  CA    . ASN A 1 896  ? -26.933 -3.715  -27.500 1.00 119.51 ? 896  ASN A CA    1 
ATOM   6587  C  C     . ASN A 1 896  ? -26.771 -2.179  -27.566 1.00 112.62 ? 896  ASN A C     1 
ATOM   6588  O  O     . ASN A 1 896  ? -25.841 -1.698  -28.203 1.00 96.72  ? 896  ASN A O     1 
ATOM   6589  C  CB    . ASN A 1 896  ? -28.235 -4.154  -26.769 1.00 110.98 ? 896  ASN A CB    1 
ATOM   6590  C  CG    . ASN A 1 896  ? -29.510 -3.791  -27.533 1.00 111.82 ? 896  ASN A CG    1 
ATOM   6591  O  OD1   . ASN A 1 896  ? -29.541 -3.739  -28.770 1.00 107.20 ? 896  ASN A OD1   1 
ATOM   6592  N  ND2   . ASN A 1 896  ? -30.578 -3.546  -26.787 1.00 116.38 ? 896  ASN A ND2   1 
ATOM   6593  N  N     . ALA A 1 897  ? -27.615 -1.424  -26.869 1.00 115.53 ? 897  ALA A N     1 
ATOM   6594  C  CA    . ALA A 1 897  ? -27.648 0.038   -27.010 1.00 112.87 ? 897  ALA A CA    1 
ATOM   6595  C  C     . ALA A 1 897  ? -26.887 0.768   -25.900 1.00 116.45 ? 897  ALA A C     1 
ATOM   6596  O  O     . ALA A 1 897  ? -26.753 1.981   -25.960 1.00 124.25 ? 897  ALA A O     1 
ATOM   6597  C  CB    . ALA A 1 897  ? -29.085 0.530   -27.066 1.00 102.54 ? 897  ALA A CB    1 
ATOM   6598  N  N     . TYR A 1 898  ? -26.368 0.029   -24.921 1.00 112.99 ? 898  TYR A N     1 
ATOM   6599  C  CA    . TYR A 1 898  ? -25.956 0.613   -23.629 1.00 110.96 ? 898  TYR A CA    1 
ATOM   6600  C  C     . TYR A 1 898  ? -24.445 0.608   -23.434 1.00 116.78 ? 898  TYR A C     1 
ATOM   6601  O  O     . TYR A 1 898  ? -23.748 -0.299  -23.900 1.00 127.73 ? 898  TYR A O     1 
ATOM   6602  C  CB    . TYR A 1 898  ? -26.611 -0.146  -22.457 1.00 103.57 ? 898  TYR A CB    1 
ATOM   6603  C  CG    . TYR A 1 898  ? -28.049 -0.527  -22.704 1.00 103.50 ? 898  TYR A CG    1 
ATOM   6604  C  CD1   . TYR A 1 898  ? -28.956 0.415   -23.164 1.00 109.05 ? 898  TYR A CD1   1 
ATOM   6605  C  CD2   . TYR A 1 898  ? -28.500 -1.827  -22.500 1.00 101.98 ? 898  TYR A CD2   1 
ATOM   6606  C  CE1   . TYR A 1 898  ? -30.270 0.080   -23.414 1.00 110.56 ? 898  TYR A CE1   1 
ATOM   6607  C  CE2   . TYR A 1 898  ? -29.816 -2.175  -22.750 1.00 103.00 ? 898  TYR A CE2   1 
ATOM   6608  C  CZ    . TYR A 1 898  ? -30.694 -1.209  -23.204 1.00 105.19 ? 898  TYR A CZ    1 
ATOM   6609  O  OH    . TYR A 1 898  ? -32.002 -1.500  -23.470 1.00 107.00 ? 898  TYR A OH    1 
ATOM   6610  N  N     . LYS A 1 899  ? -23.947 1.636   -22.741 1.00 123.81 ? 899  LYS A N     1 
ATOM   6611  C  CA    . LYS A 1 899  ? -22.533 1.758   -22.397 1.00 111.08 ? 899  LYS A CA    1 
ATOM   6612  C  C     . LYS A 1 899  ? -22.325 1.291   -20.973 1.00 100.56 ? 899  LYS A C     1 
ATOM   6613  O  O     . LYS A 1 899  ? -22.567 2.038   -20.040 1.00 104.05 ? 899  LYS A O     1 
ATOM   6614  C  CB    . LYS A 1 899  ? -22.053 3.216   -22.539 1.00 103.51 ? 899  LYS A CB    1 
ATOM   6615  C  CG    . LYS A 1 899  ? -20.617 3.470   -22.084 1.00 108.97 ? 899  LYS A CG    1 
ATOM   6616  C  CD    . LYS A 1 899  ? -19.619 2.591   -22.825 1.00 121.89 ? 899  LYS A CD    1 
ATOM   6617  C  CE    . LYS A 1 899  ? -18.229 2.676   -22.238 1.00 126.99 ? 899  LYS A CE    1 
ATOM   6618  N  NZ    . LYS A 1 899  ? -17.688 4.060   -22.210 1.00 129.50 ? 899  LYS A NZ    1 
ATOM   6619  N  N     . PHE A 1 900  ? -21.868 0.053   -20.821 1.00 105.32 ? 900  PHE A N     1 
ATOM   6620  C  CA    . PHE A 1 900  ? -21.479 -0.488  -19.517 1.00 115.66 ? 900  PHE A CA    1 
ATOM   6621  C  C     . PHE A 1 900  ? -20.000 -0.179  -19.288 1.00 132.05 ? 900  PHE A C     1 
ATOM   6622  O  O     . PHE A 1 900  ? -19.131 -0.820  -19.885 1.00 123.05 ? 900  PHE A O     1 
ATOM   6623  C  CB    . PHE A 1 900  ? -21.689 -1.987  -19.462 1.00 120.39 ? 900  PHE A CB    1 
ATOM   6624  C  CG    . PHE A 1 900  ? -23.109 -2.405  -19.690 1.00 118.17 ? 900  PHE A CG    1 
ATOM   6625  C  CD1   . PHE A 1 900  ? -23.688 -2.285  -20.938 1.00 111.99 ? 900  PHE A CD1   1 
ATOM   6626  C  CD2   . PHE A 1 900  ? -23.866 -2.928  -18.653 1.00 120.07 ? 900  PHE A CD2   1 
ATOM   6627  C  CE1   . PHE A 1 900  ? -24.987 -2.682  -21.143 1.00 116.04 ? 900  PHE A CE1   1 
ATOM   6628  C  CE2   . PHE A 1 900  ? -25.177 -3.314  -18.854 1.00 114.91 ? 900  PHE A CE2   1 
ATOM   6629  C  CZ    . PHE A 1 900  ? -25.735 -3.197  -20.104 1.00 118.36 ? 900  PHE A CZ    1 
ATOM   6630  N  N     . PRO A 1 901  ? -19.691 0.803   -18.401 1.00 146.09 ? 901  PRO A N     1 
ATOM   6631  C  CA    . PRO A 1 901  ? -18.268 1.186   -18.234 1.00 135.78 ? 901  PRO A CA    1 
ATOM   6632  C  C     . PRO A 1 901  ? -17.368 0.043   -17.703 1.00 125.67 ? 901  PRO A C     1 
ATOM   6633  O  O     . PRO A 1 901  ? -16.208 0.001   -18.070 1.00 104.79 ? 901  PRO A O     1 
ATOM   6634  C  CB    . PRO A 1 901  ? -18.318 2.360   -17.239 1.00 134.85 ? 901  PRO A CB    1 
ATOM   6635  C  CG    . PRO A 1 901  ? -19.756 2.767   -17.149 1.00 142.20 ? 901  PRO A CG    1 
ATOM   6636  C  CD    . PRO A 1 901  ? -20.572 1.557   -17.488 1.00 147.33 ? 901  PRO A CD    1 
ATOM   6637  N  N     . ASN A 1 902  ? -17.901 -0.820  -16.844 1.00 126.61 ? 902  ASN A N     1 
ATOM   6638  C  CA    . ASN A 1 902  ? -17.213 -1.979  -16.344 1.00 118.00 ? 902  ASN A CA    1 
ATOM   6639  C  C     . ASN A 1 902  ? -18.055 -3.213  -16.519 1.00 123.23 ? 902  ASN A C     1 
ATOM   6640  O  O     . ASN A 1 902  ? -19.196 -3.289  -16.020 1.00 139.74 ? 902  ASN A O     1 
ATOM   6641  C  CB    . ASN A 1 902  ? -16.862 -1.792  -14.885 1.00 117.22 ? 902  ASN A CB    1 
ATOM   6642  C  CG    . ASN A 1 902  ? -16.206 -0.465  -14.638 1.00 119.07 ? 902  ASN A CG    1 
ATOM   6643  O  OD1   . ASN A 1 902  ? -15.064 -0.242  -15.050 1.00 117.34 ? 902  ASN A OD1   1 
ATOM   6644  N  ND2   . ASN A 1 902  ? -16.941 0.449   -14.009 1.00 119.53 ? 902  ASN A ND2   1 
ATOM   6645  N  N     . LEU A 1 903  ? -17.472 -4.208  -17.178 1.00 130.59 ? 903  LEU A N     1 
ATOM   6646  C  CA    . LEU A 1 903  ? -18.207 -5.365  -17.682 1.00 134.36 ? 903  LEU A CA    1 
ATOM   6647  C  C     . LEU A 1 903  ? -17.300 -6.574  -17.740 1.00 134.27 ? 903  LEU A C     1 
ATOM   6648  O  O     . LEU A 1 903  ? -16.231 -6.507  -18.336 1.00 132.35 ? 903  LEU A O     1 
ATOM   6649  C  CB    . LEU A 1 903  ? -18.739 -5.015  -19.072 1.00 139.11 ? 903  LEU A CB    1 
ATOM   6650  C  CG    . LEU A 1 903  ? -19.200 -6.141  -19.996 1.00 139.38 ? 903  LEU A CG    1 
ATOM   6651  C  CD1   . LEU A 1 903  ? -20.385 -6.844  -19.361 1.00 132.72 ? 903  LEU A CD1   1 
ATOM   6652  C  CD2   . LEU A 1 903  ? -19.531 -5.610  -21.392 1.00 143.57 ? 903  LEU A CD2   1 
ATOM   6653  N  N     . ARG A 1 904  ? -17.708 -7.671  -17.114 1.00 128.16 ? 904  ARG A N     1 
ATOM   6654  C  CA    . ARG A 1 904  ? -17.116 -8.995  -17.355 1.00 127.27 ? 904  ARG A CA    1 
ATOM   6655  C  C     . ARG A 1 904  ? -18.211 -9.855  -17.950 1.00 128.85 ? 904  ARG A C     1 
ATOM   6656  O  O     . ARG A 1 904  ? -19.276 -9.968  -17.358 1.00 128.53 ? 904  ARG A O     1 
ATOM   6657  C  CB    . ARG A 1 904  ? -16.601 -9.608  -16.046 1.00 124.39 ? 904  ARG A CB    1 
ATOM   6658  C  CG    . ARG A 1 904  ? -16.178 -11.066 -16.168 1.00 130.77 ? 904  ARG A CG    1 
ATOM   6659  C  CD    . ARG A 1 904  ? -15.197 -11.518 -15.093 1.00 131.56 ? 904  ARG A CD    1 
ATOM   6660  N  NE    . ARG A 1 904  ? -15.862 -11.749 -13.812 1.00 136.58 ? 904  ARG A NE    1 
ATOM   6661  C  CZ    . ARG A 1 904  ? -15.610 -11.104 -12.669 1.00 144.19 ? 904  ARG A CZ    1 
ATOM   6662  N  NH1   . ARG A 1 904  ? -14.674 -10.160 -12.587 1.00 139.49 ? 904  ARG A NH1   1 
ATOM   6663  N  NH2   . ARG A 1 904  ? -16.303 -11.419 -11.578 1.00 152.17 ? 904  ARG A NH2   1 
ATOM   6664  N  N     . CYS A 1 905  ? -17.948 -10.448 -19.125 1.00 131.58 ? 905  CYS A N     1 
ATOM   6665  C  CA    . CYS A 1 905  ? -18.907 -11.252 -19.827 1.00 117.93 ? 905  CYS A CA    1 
ATOM   6666  C  C     . CYS A 1 905  ? -18.269 -12.582 -20.206 1.00 107.62 ? 905  CYS A C     1 
ATOM   6667  O  O     . CYS A 1 905  ? -17.187 -12.611 -20.791 1.00 108.53 ? 905  CYS A O     1 
ATOM   6668  C  CB    . CYS A 1 905  ? -19.487 -10.593 -21.071 1.00 130.13 ? 905  CYS A CB    1 
ATOM   6669  S  SG    . CYS A 1 905  ? -20.959 -11.494 -21.639 1.00 142.21 ? 905  CYS A SG    1 
ATOM   6670  N  N     . ARG A 1 906  ? -18.928 -13.673 -19.840 1.00 101.62 ? 906  ARG A N     1 
ATOM   6671  C  CA    . ARG A 1 906  ? -18.398 -15.026 -20.058 1.00 110.63 ? 906  ARG A CA    1 
ATOM   6672  C  C     . ARG A 1 906  ? -19.482 -15.984 -20.540 1.00 113.92 ? 906  ARG A C     1 
ATOM   6673  O  O     . ARG A 1 906  ? -20.611 -15.875 -20.075 1.00 125.51 ? 906  ARG A O     1 
ATOM   6674  C  CB    . ARG A 1 906  ? -17.741 -15.525 -18.770 1.00 106.95 ? 906  ARG A CB    1 
ATOM   6675  C  CG    . ARG A 1 906  ? -16.756 -14.517 -18.183 1.00 105.00 ? 906  ARG A CG    1 
ATOM   6676  C  CD    . ARG A 1 906  ? -15.668 -15.150 -17.335 1.00 101.41 ? 906  ARG A CD    1 
ATOM   6677  N  NE    . ARG A 1 906  ? -16.247 -16.091 -16.386 1.00 103.04 ? 906  ARG A NE    1 
ATOM   6678  C  CZ    . ARG A 1 906  ? -15.605 -17.129 -15.849 1.00 112.69 ? 906  ARG A CZ    1 
ATOM   6679  N  NH1   . ARG A 1 906  ? -14.323 -17.382 -16.140 1.00 110.63 ? 906  ARG A NH1   1 
ATOM   6680  N  NH2   . ARG A 1 906  ? -16.256 -17.924 -15.002 1.00 116.70 ? 906  ARG A NH2   1 
ATOM   6681  N  N     . GLY A 1 907  ? -19.143 -16.865 -21.490 1.00 109.27 ? 907  GLY A N     1 
ATOM   6682  C  CA    . GLY A 1 907  ? -20.110 -17.795 -22.090 1.00 93.74  ? 907  GLY A CA    1 
ATOM   6683  C  C     . GLY A 1 907  ? -19.612 -19.208 -22.295 1.00 95.02  ? 907  GLY A C     1 
ATOM   6684  O  O     . GLY A 1 907  ? -18.435 -19.409 -22.472 1.00 99.10  ? 907  GLY A O     1 
ATOM   6685  N  N     . TRP A 1 908  ? -20.519 -20.185 -22.267 1.00 98.37  ? 908  TRP A N     1 
ATOM   6686  C  CA    . TRP A 1 908  ? -20.205 -21.617 -22.431 1.00 104.41 ? 908  TRP A CA    1 
ATOM   6687  C  C     . TRP A 1 908  ? -21.348 -22.335 -23.138 1.00 96.69  ? 908  TRP A C     1 
ATOM   6688  O  O     . TRP A 1 908  ? -22.477 -22.216 -22.697 1.00 101.34 ? 908  TRP A O     1 
ATOM   6689  C  CB    . TRP A 1 908  ? -20.020 -22.310 -21.065 1.00 115.37 ? 908  TRP A CB    1 
ATOM   6690  C  CG    . TRP A 1 908  ? -18.979 -21.718 -20.153 1.00 123.98 ? 908  TRP A CG    1 
ATOM   6691  C  CD1   . TRP A 1 908  ? -17.664 -22.083 -20.050 1.00 130.69 ? 908  TRP A CD1   1 
ATOM   6692  C  CD2   . TRP A 1 908  ? -19.179 -20.675 -19.203 1.00 126.59 ? 908  TRP A CD2   1 
ATOM   6693  N  NE1   . TRP A 1 908  ? -17.032 -21.313 -19.108 1.00 131.38 ? 908  TRP A NE1   1 
ATOM   6694  C  CE2   . TRP A 1 908  ? -17.942 -20.440 -18.573 1.00 133.24 ? 908  TRP A CE2   1 
ATOM   6695  C  CE3   . TRP A 1 908  ? -20.282 -19.903 -18.834 1.00 130.34 ? 908  TRP A CE3   1 
ATOM   6696  C  CZ2   . TRP A 1 908  ? -17.781 -19.469 -17.591 1.00 138.37 ? 908  TRP A CZ2   1 
ATOM   6697  C  CZ3   . TRP A 1 908  ? -20.121 -18.939 -17.858 1.00 134.51 ? 908  TRP A CZ3   1 
ATOM   6698  C  CH2   . TRP A 1 908  ? -18.881 -18.728 -17.249 1.00 137.45 ? 908  TRP A CH2   1 
ATOM   6699  N  N     . ALA A 1 909  ? -21.059 -23.090 -24.201 1.00 93.86  ? 909  ALA A N     1 
ATOM   6700  C  CA    . ALA A 1 909  ? -22.053 -23.948 -24.851 1.00 85.02  ? 909  ALA A CA    1 
ATOM   6701  C  C     . ALA A 1 909  ? -22.090 -25.302 -24.156 1.00 81.61  ? 909  ALA A C     1 
ATOM   6702  O  O     . ALA A 1 909  ? -21.041 -25.815 -23.802 1.00 97.93  ? 909  ALA A O     1 
ATOM   6703  C  CB    . ALA A 1 909  ? -21.742 -24.129 -26.329 1.00 87.51  ? 909  ALA A CB    1 
ATOM   6704  N  N     . CYS A 1 910  ? -23.277 -25.874 -23.969 1.00 82.16  ? 910  CYS A N     1 
ATOM   6705  C  CA    . CYS A 1 910  ? -23.460 -27.021 -23.050 1.00 83.89  ? 910  CYS A CA    1 
ATOM   6706  C  C     . CYS A 1 910  ? -24.168 -28.184 -23.746 1.00 83.04  ? 910  CYS A C     1 
ATOM   6707  O  O     . CYS A 1 910  ? -25.349 -28.070 -24.140 1.00 81.95  ? 910  CYS A O     1 
ATOM   6708  C  CB    . CYS A 1 910  ? -24.256 -26.613 -21.806 1.00 86.17  ? 910  CYS A CB    1 
ATOM   6709  S  SG    . CYS A 1 910  ? -23.697 -25.087 -20.992 1.00 89.26  ? 910  CYS A SG    1 
ATOM   6710  N  N     . ARG A 1 911  ? -23.441 -29.292 -23.914 1.00 88.78  ? 911  ARG A N     1 
ATOM   6711  C  CA    . ARG A 1 911  ? -23.983 -30.422 -24.664 1.00 96.98  ? 911  ARG A CA    1 
ATOM   6712  C  C     . ARG A 1 911  ? -25.003 -31.170 -23.786 1.00 96.48  ? 911  ARG A C     1 
ATOM   6713  O  O     . ARG A 1 911  ? -24.799 -31.368 -22.585 1.00 96.24  ? 911  ARG A O     1 
ATOM   6714  C  CB    . ARG A 1 911  ? -22.883 -31.368 -25.203 1.00 97.34  ? 911  ARG A CB    1 
ATOM   6715  C  CG    . ARG A 1 911  ? -22.587 -32.570 -24.323 1.00 104.84 ? 911  ARG A CG    1 
ATOM   6716  C  CD    . ARG A 1 911  ? -21.757 -33.654 -25.006 1.00 111.40 ? 911  ARG A CD    1 
ATOM   6717  N  NE    . ARG A 1 911  ? -22.571 -34.587 -25.790 1.00 126.29 ? 911  ARG A NE    1 
ATOM   6718  C  CZ    . ARG A 1 911  ? -23.509 -35.416 -25.306 1.00 141.90 ? 911  ARG A CZ    1 
ATOM   6719  N  NH1   . ARG A 1 911  ? -23.815 -35.459 -23.998 1.00 148.69 ? 911  ARG A NH1   1 
ATOM   6720  N  NH2   . ARG A 1 911  ? -24.168 -36.207 -26.157 1.00 130.59 ? 911  ARG A NH2   1 
ATOM   6721  N  N     . THR A 1 912  ? -26.117 -31.538 -24.406 1.00 96.88  ? 912  THR A N     1 
ATOM   6722  C  CA    . THR A 1 912  ? -27.202 -32.260 -23.772 1.00 91.71  ? 912  THR A CA    1 
ATOM   6723  C  C     . THR A 1 912  ? -27.646 -33.398 -24.696 1.00 87.94  ? 912  THR A C     1 
ATOM   6724  O  O     . THR A 1 912  ? -27.180 -33.489 -25.825 1.00 81.40  ? 912  THR A O     1 
ATOM   6725  C  CB    . THR A 1 912  ? -28.391 -31.322 -23.547 1.00 93.14  ? 912  THR A CB    1 
ATOM   6726  O  OG1   . THR A 1 912  ? -28.878 -30.848 -24.813 1.00 91.60  ? 912  THR A OG1   1 
ATOM   6727  C  CG2   . THR A 1 912  ? -27.972 -30.135 -22.690 1.00 94.17  ? 912  THR A CG2   1 
ATOM   6728  N  N     . ASN A 1 913  ? -28.582 -34.219 -24.239 1.00 84.80  ? 913  ASN A N     1 
ATOM   6729  C  CA    . ASN A 1 913  ? -29.147 -35.294 -25.050 1.00 83.99  ? 913  ASN A CA    1 
ATOM   6730  C  C     . ASN A 1 913  ? -30.460 -34.849 -25.734 1.00 90.66  ? 913  ASN A C     1 
ATOM   6731  O  O     . ASN A 1 913  ? -31.539 -35.455 -25.594 1.00 94.66  ? 913  ASN A O     1 
ATOM   6732  C  CB    . ASN A 1 913  ? -29.229 -36.572 -24.214 1.00 78.56  ? 913  ASN A CB    1 
ATOM   6733  C  CG    . ASN A 1 913  ? -27.842 -37.052 -23.768 1.00 77.83  ? 913  ASN A CG    1 
ATOM   6734  O  OD1   . ASN A 1 913  ? -27.569 -37.249 -22.576 1.00 70.51  ? 913  ASN A OD1   1 
ATOM   6735  N  ND2   . ASN A 1 913  ? -26.946 -37.224 -24.733 1.00 79.28  ? 913  ASN A ND2   1 
ATOM   6736  N  N     . LEU A 1 914  ? -30.341 -33.771 -26.501 1.00 95.49  ? 914  LEU A N     1 
ATOM   6737  C  CA    . LEU A 1 914  ? -31.429 -33.234 -27.300 1.00 92.48  ? 914  LEU A CA    1 
ATOM   6738  C  C     . LEU A 1 914  ? -30.911 -33.096 -28.711 1.00 90.96  ? 914  LEU A C     1 
ATOM   6739  O  O     . LEU A 1 914  ? -29.690 -33.098 -28.899 1.00 88.80  ? 914  LEU A O     1 
ATOM   6740  C  CB    . LEU A 1 914  ? -31.804 -31.872 -26.750 1.00 95.16  ? 914  LEU A CB    1 
ATOM   6741  C  CG    . LEU A 1 914  ? -32.462 -31.992 -25.378 1.00 100.20 ? 914  LEU A CG    1 
ATOM   6742  C  CD1   . LEU A 1 914  ? -32.543 -30.635 -24.685 1.00 99.61  ? 914  LEU A CD1   1 
ATOM   6743  C  CD2   . LEU A 1 914  ? -33.834 -32.648 -25.520 1.00 98.30  ? 914  LEU A CD2   1 
ATOM   6744  N  N     . PRO A 1 915  ? -31.807 -32.926 -29.701 1.00 93.03  ? 915  PRO A N     1 
ATOM   6745  C  CA    . PRO A 1 915  ? -31.331 -32.653 -31.055 1.00 90.95  ? 915  PRO A CA    1 
ATOM   6746  C  C     . PRO A 1 915  ? -30.350 -31.494 -31.089 1.00 89.43  ? 915  PRO A C     1 
ATOM   6747  O  O     . PRO A 1 915  ? -30.528 -30.507 -30.369 1.00 81.68  ? 915  PRO A O     1 
ATOM   6748  C  CB    . PRO A 1 915  ? -32.599 -32.269 -31.813 1.00 99.76  ? 915  PRO A CB    1 
ATOM   6749  C  CG    . PRO A 1 915  ? -33.714 -32.864 -31.039 1.00 108.15 ? 915  PRO A CG    1 
ATOM   6750  C  CD    . PRO A 1 915  ? -33.271 -32.811 -29.606 1.00 106.57 ? 915  PRO A CD    1 
ATOM   6751  N  N     . SER A 1 916  ? -29.321 -31.637 -31.921 1.00 89.08  ? 916  SER A N     1 
ATOM   6752  C  CA    . SER A 1 916  ? -28.253 -30.646 -32.029 1.00 84.81  ? 916  SER A CA    1 
ATOM   6753  C  C     . SER A 1 916  ? -28.739 -29.326 -32.617 1.00 84.79  ? 916  SER A C     1 
ATOM   6754  O  O     . SER A 1 916  ? -29.158 -29.277 -33.769 1.00 96.15  ? 916  SER A O     1 
ATOM   6755  C  CB    . SER A 1 916  ? -27.138 -31.196 -32.892 1.00 90.44  ? 916  SER A CB    1 
ATOM   6756  O  OG    . SER A 1 916  ? -26.379 -30.133 -33.432 1.00 116.22 ? 916  SER A OG    1 
ATOM   6757  N  N     . ASN A 1 917  ? -28.680 -28.256 -31.829 1.00 92.14  ? 917  ASN A N     1 
ATOM   6758  C  CA    . ASN A 1 917  ? -29.179 -26.953 -32.263 1.00 93.87  ? 917  ASN A CA    1 
ATOM   6759  C  C     . ASN A 1 917  ? -28.263 -26.278 -33.252 1.00 90.25  ? 917  ASN A C     1 
ATOM   6760  O  O     . ASN A 1 917  ? -27.083 -26.540 -33.274 1.00 91.84  ? 917  ASN A O     1 
ATOM   6761  C  CB    . ASN A 1 917  ? -29.446 -26.033 -31.077 1.00 95.76  ? 917  ASN A CB    1 
ATOM   6762  C  CG    . ASN A 1 917  ? -30.619 -26.499 -30.241 1.00 94.20  ? 917  ASN A CG    1 
ATOM   6763  O  OD1   . ASN A 1 917  ? -31.487 -27.218 -30.716 1.00 86.05  ? 917  ASN A OD1   1 
ATOM   6764  N  ND2   . ASN A 1 917  ? -30.636 -26.110 -28.987 1.00 99.77  ? 917  ASN A ND2   1 
ATOM   6765  N  N     . THR A 1 918  ? -28.852 -25.405 -34.065 1.00 101.55 ? 918  THR A N     1 
ATOM   6766  C  CA    . THR A 1 918  ? -28.196 -24.768 -35.213 1.00 112.74 ? 918  THR A CA    1 
ATOM   6767  C  C     . THR A 1 918  ? -28.332 -23.238 -35.092 1.00 116.41 ? 918  THR A C     1 
ATOM   6768  O  O     . THR A 1 918  ? -29.019 -22.719 -34.191 1.00 117.00 ? 918  THR A O     1 
ATOM   6769  C  CB    . THR A 1 918  ? -28.756 -25.311 -36.585 1.00 121.35 ? 918  THR A CB    1 
ATOM   6770  O  OG1   . THR A 1 918  ? -29.921 -24.581 -36.995 1.00 123.94 ? 918  THR A OG1   1 
ATOM   6771  C  CG2   . THR A 1 918  ? -29.104 -26.845 -36.538 1.00 117.75 ? 918  THR A CG2   1 
ATOM   6772  N  N     . ALA A 1 919  ? -27.672 -22.528 -36.006 1.00 128.04 ? 919  ALA A N     1 
ATOM   6773  C  CA    . ALA A 1 919  ? -27.793 -21.084 -36.099 1.00 126.21 ? 919  ALA A CA    1 
ATOM   6774  C  C     . ALA A 1 919  ? -29.148 -20.713 -36.643 1.00 123.21 ? 919  ALA A C     1 
ATOM   6775  O  O     . ALA A 1 919  ? -29.779 -21.509 -37.333 1.00 108.61 ? 919  ALA A O     1 
ATOM   6776  C  CB    . ALA A 1 919  ? -26.701 -20.519 -37.012 1.00 125.46 ? 919  ALA A CB    1 
ATOM   6777  N  N     . PHE A 1 920  ? -29.561 -19.494 -36.332 1.00 122.34 ? 920  PHE A N     1 
ATOM   6778  C  CA    . PHE A 1 920  ? -30.910 -19.019 -36.604 1.00 112.44 ? 920  PHE A CA    1 
ATOM   6779  C  C     . PHE A 1 920  ? -30.789 -17.521 -36.878 1.00 103.30 ? 920  PHE A C     1 
ATOM   6780  O  O     . PHE A 1 920  ? -29.861 -16.887 -36.397 1.00 107.62 ? 920  PHE A O     1 
ATOM   6781  C  CB    . PHE A 1 920  ? -31.785 -19.262 -35.352 1.00 106.98 ? 920  PHE A CB    1 
ATOM   6782  C  CG    . PHE A 1 920  ? -33.260 -19.432 -35.636 1.00 102.88 ? 920  PHE A CG    1 
ATOM   6783  C  CD1   . PHE A 1 920  ? -34.001 -18.427 -36.266 1.00 107.46 ? 920  PHE A CD1   1 
ATOM   6784  C  CD2   . PHE A 1 920  ? -33.917 -20.582 -35.253 1.00 99.53  ? 920  PHE A CD2   1 
ATOM   6785  C  CE1   . PHE A 1 920  ? -35.354 -18.575 -36.516 1.00 98.61  ? 920  PHE A CE1   1 
ATOM   6786  C  CE2   . PHE A 1 920  ? -35.275 -20.736 -35.503 1.00 103.41 ? 920  PHE A CE2   1 
ATOM   6787  C  CZ    . PHE A 1 920  ? -35.991 -19.734 -36.134 1.00 101.02 ? 920  PHE A CZ    1 
ATOM   6788  N  N     . ARG A 1 921  ? -31.679 -17.002 -37.708 1.00 95.51  ? 921  ARG A N     1 
ATOM   6789  C  CA    . ARG A 1 921  ? -31.877 -15.557 -37.925 1.00 96.60  ? 921  ARG A CA    1 
ATOM   6790  C  C     . ARG A 1 921  ? -31.642 -14.678 -36.688 1.00 96.66  ? 921  ARG A C     1 
ATOM   6791  O  O     . ARG A 1 921  ? -32.543 -14.528 -35.850 1.00 109.12 ? 921  ARG A O     1 
ATOM   6792  C  CB    . ARG A 1 921  ? -33.314 -15.355 -38.440 1.00 100.19 ? 921  ARG A CB    1 
ATOM   6793  C  CG    . ARG A 1 921  ? -33.655 -13.975 -38.984 1.00 103.47 ? 921  ARG A CG    1 
ATOM   6794  C  CD    . ARG A 1 921  ? -35.074 -13.929 -39.565 1.00 107.34 ? 921  ARG A CD    1 
ATOM   6795  N  NE    . ARG A 1 921  ? -35.272 -12.793 -40.476 1.00 113.43 ? 921  ARG A NE    1 
ATOM   6796  C  CZ    . ARG A 1 921  ? -36.322 -12.618 -41.287 1.00 125.21 ? 921  ARG A CZ    1 
ATOM   6797  N  NH1   . ARG A 1 921  ? -37.329 -13.499 -41.336 1.00 124.24 ? 921  ARG A NH1   1 
ATOM   6798  N  NH2   . ARG A 1 921  ? -36.363 -11.538 -42.065 1.00 130.00 ? 921  ARG A NH2   1 
ATOM   6799  N  N     . GLY A 1 922  ? -30.434 -14.121 -36.584 1.00 96.10  ? 922  GLY A N     1 
ATOM   6800  C  CA    . GLY A 1 922  ? -30.030 -13.298 -35.437 1.00 97.60  ? 922  GLY A CA    1 
ATOM   6801  C  C     . GLY A 1 922  ? -28.675 -13.701 -34.886 1.00 112.31 ? 922  GLY A C     1 
ATOM   6802  O  O     . GLY A 1 922  ? -27.895 -12.838 -34.514 1.00 106.41 ? 922  GLY A O     1 
ATOM   6803  N  N     . PHE A 1 923  ? -28.416 -15.003 -34.826 1.00 131.10 ? 923  PHE A N     1 
ATOM   6804  C  CA    . PHE A 1 923  ? -27.104 -15.573 -34.488 1.00 135.17 ? 923  PHE A CA    1 
ATOM   6805  C  C     . PHE A 1 923  ? -26.671 -15.185 -33.065 1.00 128.23 ? 923  PHE A C     1 
ATOM   6806  O  O     . PHE A 1 923  ? -25.630 -14.529 -32.855 1.00 117.83 ? 923  PHE A O     1 
ATOM   6807  C  CB    . PHE A 1 923  ? -26.034 -15.206 -35.542 1.00 138.22 ? 923  PHE A CB    1 
ATOM   6808  C  CG    . PHE A 1 923  ? -25.204 -16.376 -35.994 1.00 136.98 ? 923  PHE A CG    1 
ATOM   6809  C  CD1   . PHE A 1 923  ? -24.594 -17.206 -35.071 1.00 138.07 ? 923  PHE A CD1   1 
ATOM   6810  C  CD2   . PHE A 1 923  ? -25.035 -16.649 -37.348 1.00 148.86 ? 923  PHE A CD2   1 
ATOM   6811  C  CE1   . PHE A 1 923  ? -23.832 -18.286 -35.482 1.00 149.32 ? 923  PHE A CE1   1 
ATOM   6812  C  CE2   . PHE A 1 923  ? -24.271 -17.730 -37.766 1.00 158.37 ? 923  PHE A CE2   1 
ATOM   6813  C  CZ    . PHE A 1 923  ? -23.668 -18.550 -36.831 1.00 158.30 ? 923  PHE A CZ    1 
ATOM   6814  N  N     . GLY A 1 924  ? -27.485 -15.584 -32.087 1.00 112.25 ? 924  GLY A N     1 
ATOM   6815  C  CA    . GLY A 1 924  ? -27.162 -15.350 -30.673 1.00 104.95 ? 924  GLY A CA    1 
ATOM   6816  C  C     . GLY A 1 924  ? -27.623 -14.014 -30.113 1.00 106.95 ? 924  GLY A C     1 
ATOM   6817  O  O     . GLY A 1 924  ? -27.626 -13.839 -28.900 1.00 108.69 ? 924  GLY A O     1 
ATOM   6818  N  N     . PHE A 1 925  ? -27.981 -13.071 -30.983 1.00 110.57 ? 925  PHE A N     1 
ATOM   6819  C  CA    . PHE A 1 925  ? -28.350 -11.723 -30.551 1.00 102.01 ? 925  PHE A CA    1 
ATOM   6820  C  C     . PHE A 1 925  ? -29.708 -11.691 -29.810 1.00 100.50 ? 925  PHE A C     1 
ATOM   6821  O  O     . PHE A 1 925  ? -29.792 -11.129 -28.725 1.00 103.59 ? 925  PHE A O     1 
ATOM   6822  C  CB    . PHE A 1 925  ? -28.297 -10.762 -31.759 1.00 92.36  ? 925  PHE A CB    1 
ATOM   6823  C  CG    . PHE A 1 925  ? -28.764 -9.366  -31.469 1.00 90.12  ? 925  PHE A CG    1 
ATOM   6824  C  CD1   . PHE A 1 925  ? -28.154 -8.595  -30.494 1.00 93.63  ? 925  PHE A CD1   1 
ATOM   6825  C  CD2   . PHE A 1 925  ? -29.792 -8.802  -32.195 1.00 102.25 ? 925  PHE A CD2   1 
ATOM   6826  C  CE1   . PHE A 1 925  ? -28.567 -7.288  -30.227 1.00 89.82  ? 925  PHE A CE1   1 
ATOM   6827  C  CE2   . PHE A 1 925  ? -30.202 -7.493  -31.940 1.00 106.92 ? 925  PHE A CE2   1 
ATOM   6828  C  CZ    . PHE A 1 925  ? -29.589 -6.734  -30.953 1.00 90.47  ? 925  PHE A CZ    1 
ATOM   6829  N  N     . PRO A 1 926  ? -30.759 -12.305 -30.380 1.00 94.58  ? 926  PRO A N     1 
ATOM   6830  C  CA    . PRO A 1 926  ? -32.041 -12.356 -29.702 1.00 100.07 ? 926  PRO A CA    1 
ATOM   6831  C  C     . PRO A 1 926  ? -31.976 -12.934 -28.283 1.00 99.84  ? 926  PRO A C     1 
ATOM   6832  O  O     . PRO A 1 926  ? -32.742 -12.528 -27.417 1.00 88.65  ? 926  PRO A O     1 
ATOM   6833  C  CB    . PRO A 1 926  ? -32.847 -13.276 -30.609 1.00 96.82  ? 926  PRO A CB    1 
ATOM   6834  C  CG    . PRO A 1 926  ? -32.377 -12.874 -31.957 1.00 99.77  ? 926  PRO A CG    1 
ATOM   6835  C  CD    . PRO A 1 926  ? -30.898 -12.693 -31.793 1.00 97.30  ? 926  PRO A CD    1 
ATOM   6836  N  N     . GLN A 1 927  ? -31.065 -13.874 -28.076 1.00 103.68 ? 927  GLN A N     1 
ATOM   6837  C  CA    . GLN A 1 927  ? -30.796 -14.461 -26.764 1.00 100.71 ? 927  GLN A CA    1 
ATOM   6838  C  C     . GLN A 1 927  ? -29.979 -13.524 -25.883 1.00 97.07  ? 927  GLN A C     1 
ATOM   6839  O  O     . GLN A 1 927  ? -30.361 -13.244 -24.755 1.00 91.23  ? 927  GLN A O     1 
ATOM   6840  C  CB    . GLN A 1 927  ? -30.020 -15.780 -26.952 1.00 98.99  ? 927  GLN A CB    1 
ATOM   6841  C  CG    . GLN A 1 927  ? -30.765 -16.874 -27.721 1.00 101.02 ? 927  GLN A CG    1 
ATOM   6842  C  CD    . GLN A 1 927  ? -30.293 -17.085 -29.155 1.00 102.59 ? 927  GLN A CD    1 
ATOM   6843  O  OE1   . GLN A 1 927  ? -30.029 -16.126 -29.893 1.00 113.45 ? 927  GLN A OE1   1 
ATOM   6844  N  NE2   . GLN A 1 927  ? -30.207 -18.355 -29.565 1.00 96.37  ? 927  GLN A NE2   1 
ATOM   6845  N  N     . ALA A 1 928  ? -28.850 -13.061 -26.413 1.00 98.30  ? 928  ALA A N     1 
ATOM   6846  C  CA    . ALA A 1 928  ? -27.898 -12.243 -25.664 1.00 100.41 ? 928  ALA A CA    1 
ATOM   6847  C  C     . ALA A 1 928  ? -28.477 -10.892 -25.238 1.00 103.07 ? 928  ALA A C     1 
ATOM   6848  O  O     . ALA A 1 928  ? -28.291 -10.463 -24.089 1.00 110.55 ? 928  ALA A O     1 
ATOM   6849  C  CB    . ALA A 1 928  ? -26.641 -12.033 -26.486 1.00 104.04 ? 928  ALA A CB    1 
ATOM   6850  N  N     . ALA A 1 929  ? -29.179 -10.231 -26.156 1.00 98.74  ? 929  ALA A N     1 
ATOM   6851  C  CA    . ALA A 1 929  ? -29.801 -8.943  -25.866 1.00 99.47  ? 929  ALA A CA    1 
ATOM   6852  C  C     . ALA A 1 929  ? -30.973 -9.052  -24.882 1.00 98.73  ? 929  ALA A C     1 
ATOM   6853  O  O     . ALA A 1 929  ? -31.183 -8.147  -24.080 1.00 100.86 ? 929  ALA A O     1 
ATOM   6854  C  CB    . ALA A 1 929  ? -30.226 -8.263  -27.154 1.00 96.28  ? 929  ALA A CB    1 
ATOM   6855  N  N     . LEU A 1 930  ? -31.720 -10.157 -24.929 1.00 108.67 ? 930  LEU A N     1 
ATOM   6856  C  CA    . LEU A 1 930  ? -32.762 -10.426 -23.913 1.00 105.91 ? 930  LEU A CA    1 
ATOM   6857  C  C     . LEU A 1 930  ? -32.189 -10.577 -22.516 1.00 113.11 ? 930  LEU A C     1 
ATOM   6858  O  O     . LEU A 1 930  ? -32.860 -10.201 -21.557 1.00 119.11 ? 930  LEU A O     1 
ATOM   6859  C  CB    . LEU A 1 930  ? -33.624 -11.664 -24.220 1.00 97.24  ? 930  LEU A CB    1 
ATOM   6860  C  CG    . LEU A 1 930  ? -34.718 -11.970 -23.175 1.00 82.47  ? 930  LEU A CG    1 
ATOM   6861  C  CD1   . LEU A 1 930  ? -35.975 -11.175 -23.426 1.00 83.82  ? 930  LEU A CD1   1 
ATOM   6862  C  CD2   . LEU A 1 930  ? -35.073 -13.429 -23.147 1.00 82.86  ? 930  LEU A CD2   1 
ATOM   6863  N  N     . ILE A 1 931  ? -30.986 -11.142 -22.388 1.00 113.76 ? 931  ILE A N     1 
ATOM   6864  C  CA    . ILE A 1 931  ? -30.329 -11.267 -21.079 1.00 117.25 ? 931  ILE A CA    1 
ATOM   6865  C  C     . ILE A 1 931  ? -30.120 -9.861  -20.520 1.00 119.37 ? 931  ILE A C     1 
ATOM   6866  O  O     . ILE A 1 931  ? -30.480 -9.602  -19.359 1.00 123.65 ? 931  ILE A O     1 
ATOM   6867  C  CB    . ILE A 1 931  ? -28.973 -12.030 -21.080 1.00 115.57 ? 931  ILE A CB    1 
ATOM   6868  C  CG1   . ILE A 1 931  ? -29.083 -13.424 -21.704 1.00 117.15 ? 931  ILE A CG1   1 
ATOM   6869  C  CG2   . ILE A 1 931  ? -28.454 -12.211 -19.658 1.00 113.42 ? 931  ILE A CG2   1 
ATOM   6870  C  CD1   . ILE A 1 931  ? -30.044 -14.364 -21.016 1.00 115.50 ? 931  ILE A CD1   1 
ATOM   6871  N  N     . THR A 1 932  ? -29.574 -8.959  -21.339 1.00 107.18 ? 932  THR A N     1 
ATOM   6872  C  CA    . THR A 1 932  ? -29.281 -7.610  -20.864 1.00 108.22 ? 932  THR A CA    1 
ATOM   6873  C  C     . THR A 1 932  ? -30.523 -6.764  -20.596 1.00 111.82 ? 932  THR A C     1 
ATOM   6874  O  O     . THR A 1 932  ? -30.511 -5.955  -19.678 1.00 141.52 ? 932  THR A O     1 
ATOM   6875  C  CB    . THR A 1 932  ? -28.366 -6.817  -21.806 1.00 109.57 ? 932  THR A CB    1 
ATOM   6876  O  OG1   . THR A 1 932  ? -29.078 -6.465  -23.000 1.00 124.41 ? 932  THR A OG1   1 
ATOM   6877  C  CG2   . THR A 1 932  ? -27.141 -7.615  -22.139 1.00 110.34 ? 932  THR A CG2   1 
ATOM   6878  N  N     . GLU A 1 933  ? -31.590 -6.945  -21.365 1.00 98.89  ? 933  GLU A N     1 
ATOM   6879  C  CA    . GLU A 1 933  ? -32.856 -6.242  -21.079 1.00 91.20  ? 933  GLU A CA    1 
ATOM   6880  C  C     . GLU A 1 933  ? -33.530 -6.728  -19.807 1.00 90.75  ? 933  GLU A C     1 
ATOM   6881  O  O     . GLU A 1 933  ? -34.127 -5.941  -19.088 1.00 94.26  ? 933  GLU A O     1 
ATOM   6882  C  CB    . GLU A 1 933  ? -33.822 -6.391  -22.227 1.00 92.81  ? 933  GLU A CB    1 
ATOM   6883  C  CG    . GLU A 1 933  ? -33.341 -5.698  -23.475 1.00 99.77  ? 933  GLU A CG    1 
ATOM   6884  C  CD    . GLU A 1 933  ? -33.411 -4.208  -23.356 1.00 98.68  ? 933  GLU A CD    1 
ATOM   6885  O  OE1   . GLU A 1 933  ? -34.111 -3.741  -22.440 1.00 99.01  ? 933  GLU A OE1   1 
ATOM   6886  O  OE2   . GLU A 1 933  ? -32.775 -3.518  -24.182 1.00 106.91 ? 933  GLU A OE2   1 
ATOM   6887  N  N     . SER A 1 934  ? -33.457 -8.023  -19.539 1.00 93.83  ? 934  SER A N     1 
ATOM   6888  C  CA    . SER A 1 934  ? -33.947 -8.599  -18.279 1.00 100.85 ? 934  SER A CA    1 
ATOM   6889  C  C     . SER A 1 934  ? -33.196 -7.973  -17.102 1.00 104.98 ? 934  SER A C     1 
ATOM   6890  O  O     . SER A 1 934  ? -33.809 -7.584  -16.107 1.00 107.49 ? 934  SER A O     1 
ATOM   6891  C  CB    . SER A 1 934  ? -33.799 -10.133 -18.260 1.00 99.50  ? 934  SER A CB    1 
ATOM   6892  O  OG    . SER A 1 934  ? -34.258 -10.698 -17.031 1.00 94.54  ? 934  SER A OG    1 
ATOM   6893  N  N     . CYS A 1 935  ? -31.873 -7.873  -17.240 1.00 94.82  ? 935  CYS A N     1 
ATOM   6894  C  CA    . CYS A 1 935  ? -31.033 -7.234  -16.237 1.00 104.98 ? 935  CYS A CA    1 
ATOM   6895  C  C     . CYS A 1 935  ? -31.391 -5.756  -16.018 1.00 102.60 ? 935  CYS A C     1 
ATOM   6896  O  O     . CYS A 1 935  ? -31.365 -5.278  -14.878 1.00 119.28 ? 935  CYS A O     1 
ATOM   6897  C  CB    . CYS A 1 935  ? -29.560 -7.373  -16.545 1.00 110.73 ? 935  CYS A CB    1 
ATOM   6898  S  SG    . CYS A 1 935  ? -28.637 -6.717  -15.150 1.00 104.04 ? 935  CYS A SG    1 
ATOM   6899  N  N     . ILE A 1 936  ? -31.730 -5.050  -17.096 1.00 89.56  ? 936  ILE A N     1 
ATOM   6900  C  CA    . ILE A 1 936  ? -32.204 -3.673  -16.999 1.00 85.83  ? 936  ILE A CA    1 
ATOM   6901  C  C     . ILE A 1 936  ? -33.540 -3.577  -16.270 1.00 90.61  ? 936  ILE A C     1 
ATOM   6902  O  O     . ILE A 1 936  ? -33.646 -2.835  -15.304 1.00 110.88 ? 936  ILE A O     1 
ATOM   6903  C  CB    . ILE A 1 936  ? -32.259 -2.960  -18.357 1.00 82.91  ? 936  ILE A CB    1 
ATOM   6904  C  CG1   . ILE A 1 936  ? -30.844 -2.571  -18.756 1.00 86.51  ? 936  ILE A CG1   1 
ATOM   6905  C  CG2   . ILE A 1 936  ? -33.183 -1.737  -18.303 1.00 82.41  ? 936  ILE A CG2   1 
ATOM   6906  C  CD1   . ILE A 1 936  ? -30.782 -1.486  -19.813 1.00 94.94  ? 936  ILE A CD1   1 
ATOM   6907  N  N     . THR A 1 937  ? -34.555 -4.320  -16.698 1.00 94.52  ? 937  THR A N     1 
ATOM   6908  C  CA    . THR A 1 937  ? -35.898 -4.180  -16.087 1.00 100.53 ? 937  THR A CA    1 
ATOM   6909  C  C     . THR A 1 937  ? -35.931 -4.585  -14.608 1.00 108.14 ? 937  THR A C     1 
ATOM   6910  O  O     . THR A 1 937  ? -36.778 -4.090  -13.861 1.00 114.94 ? 937  THR A O     1 
ATOM   6911  C  CB    . THR A 1 937  ? -37.021 -4.931  -16.834 1.00 98.15  ? 937  THR A CB    1 
ATOM   6912  O  OG1   . THR A 1 937  ? -36.859 -6.348  -16.676 1.00 94.23  ? 937  THR A OG1   1 
ATOM   6913  C  CG2   . THR A 1 937  ? -37.051 -4.539  -18.314 1.00 97.03  ? 937  THR A CG2   1 
ATOM   6914  N  N     . GLU A 1 938  ? -35.012 -5.459  -14.188 1.00 106.44 ? 938  GLU A N     1 
ATOM   6915  C  CA    . GLU A 1 938  ? -34.787 -5.760  -12.760 1.00 105.83 ? 938  GLU A CA    1 
ATOM   6916  C  C     . GLU A 1 938  ? -34.175 -4.595  -11.964 1.00 102.63 ? 938  GLU A C     1 
ATOM   6917  O  O     . GLU A 1 938  ? -34.589 -4.323  -10.833 1.00 115.62 ? 938  GLU A O     1 
ATOM   6918  C  CB    . GLU A 1 938  ? -33.908 -6.995  -12.607 1.00 105.46 ? 938  GLU A CB    1 
ATOM   6919  C  CG    . GLU A 1 938  ? -34.657 -8.309  -12.779 1.00 120.33 ? 938  GLU A CG    1 
ATOM   6920  C  CD    . GLU A 1 938  ? -34.097 -9.453  -11.925 1.00 134.21 ? 938  GLU A CD    1 
ATOM   6921  O  OE1   . GLU A 1 938  ? -33.351 -9.176  -10.958 1.00 132.70 ? 938  GLU A OE1   1 
ATOM   6922  O  OE2   . GLU A 1 938  ? -34.410 -10.641 -12.207 1.00 139.20 ? 938  GLU A OE2   1 
ATOM   6923  N  N     . VAL A 1 939  ? -33.166 -3.948  -12.544 1.00 94.46  ? 939  VAL A N     1 
ATOM   6924  C  CA    . VAL A 1 939  ? -32.550 -2.749  -11.965 1.00 90.23  ? 939  VAL A CA    1 
ATOM   6925  C  C     . VAL A 1 939  ? -33.575 -1.606  -11.909 1.00 93.45  ? 939  VAL A C     1 
ATOM   6926  O  O     . VAL A 1 939  ? -33.666 -0.883  -10.918 1.00 102.70 ? 939  VAL A O     1 
ATOM   6927  C  CB    . VAL A 1 939  ? -31.356 -2.273  -12.832 1.00 90.36  ? 939  VAL A CB    1 
ATOM   6928  C  CG1   . VAL A 1 939  ? -31.209 -0.750  -12.866 1.00 84.40  ? 939  VAL A CG1   1 
ATOM   6929  C  CG2   . VAL A 1 939  ? -30.077 -2.958  -12.386 1.00 94.17  ? 939  VAL A CG2   1 
ATOM   6930  N  N     . ALA A 1 940  ? -34.330 -1.455  -12.990 1.00 104.99 ? 940  ALA A N     1 
ATOM   6931  C  CA    . ALA A 1 940  ? -35.453 -0.509  -13.053 1.00 102.45 ? 940  ALA A CA    1 
ATOM   6932  C  C     . ALA A 1 940  ? -36.438 -0.720  -11.915 1.00 98.29  ? 940  ALA A C     1 
ATOM   6933  O  O     . ALA A 1 940  ? -36.840 0.224   -11.269 1.00 101.27 ? 940  ALA A O     1 
ATOM   6934  C  CB    . ALA A 1 940  ? -36.151 -0.605  -14.399 1.00 113.72 ? 940  ALA A CB    1 
ATOM   6935  N  N     . ALA A 1 941  ? -36.809 -1.973  -11.672 1.00 101.15 ? 941  ALA A N     1 
ATOM   6936  C  CA    . ALA A 1 941  ? -37.675 -2.344  -10.540 1.00 104.40 ? 941  ALA A CA    1 
ATOM   6937  C  C     . ALA A 1 941  ? -37.097 -1.880  -9.206  1.00 101.70 ? 941  ALA A C     1 
ATOM   6938  O  O     . ALA A 1 941  ? -37.809 -1.277  -8.413  1.00 103.32 ? 941  ALA A O     1 
ATOM   6939  C  CB    . ALA A 1 941  ? -37.880 -3.859  -10.500 1.00 104.85 ? 941  ALA A CB    1 
ATOM   6940  N  N     . LYS A 1 942  ? -35.810 -2.138  -8.979  1.00 94.97  ? 942  LYS A N     1 
ATOM   6941  C  CA    . LYS A 1 942  ? -35.140 -1.774  -7.717  1.00 92.64  ? 942  LYS A CA    1 
ATOM   6942  C  C     . LYS A 1 942  ? -34.897 -0.266  -7.526  1.00 91.74  ? 942  LYS A C     1 
ATOM   6943  O  O     . LYS A 1 942  ? -34.581 0.159   -6.431  1.00 98.11  ? 942  LYS A O     1 
ATOM   6944  C  CB    . LYS A 1 942  ? -33.798 -2.487  -7.637  1.00 89.54  ? 942  LYS A CB    1 
ATOM   6945  C  CG    . LYS A 1 942  ? -33.916 -3.977  -7.443  1.00 84.74  ? 942  LYS A CG    1 
ATOM   6946  C  CD    . LYS A 1 942  ? -33.631 -4.322  -6.005  1.00 89.40  ? 942  LYS A CD    1 
ATOM   6947  C  CE    . LYS A 1 942  ? -34.586 -5.388  -5.494  1.00 102.15 ? 942  LYS A CE    1 
ATOM   6948  N  NZ    . LYS A 1 942  ? -34.145 -6.760  -5.852  1.00 104.88 ? 942  LYS A NZ    1 
ATOM   6949  N  N     . CYS A 1 943  ? -35.015 0.520   -8.593  1.00 88.59  ? 943  CYS A N     1 
ATOM   6950  C  CA    . CYS A 1 943  ? -34.921 1.979   -8.529  1.00 91.72  ? 943  CYS A CA    1 
ATOM   6951  C  C     . CYS A 1 943  ? -36.269 2.697   -8.559  1.00 94.63  ? 943  CYS A C     1 
ATOM   6952  O  O     . CYS A 1 943  ? -36.312 3.916   -8.413  1.00 107.67 ? 943  CYS A O     1 
ATOM   6953  C  CB    . CYS A 1 943  ? -34.140 2.496   -9.736  1.00 99.18  ? 943  CYS A CB    1 
ATOM   6954  S  SG    . CYS A 1 943  ? -32.387 2.091   -9.755  1.00 103.50 ? 943  CYS A SG    1 
ATOM   6955  N  N     . GLY A 1 944  ? -37.352 1.960   -8.762  1.00 103.09 ? 944  GLY A N     1 
ATOM   6956  C  CA    . GLY A 1 944  ? -38.691 2.554   -8.913  1.00 111.96 ? 944  GLY A CA    1 
ATOM   6957  C  C     . GLY A 1 944  ? -38.843 3.421   -10.150 1.00 114.52 ? 944  GLY A C     1 
ATOM   6958  O  O     . GLY A 1 944  ? -39.657 4.335   -10.170 1.00 143.57 ? 944  GLY A O     1 
ATOM   6959  N  N     . LEU A 1 945  ? -38.059 3.121   -11.175 1.00 123.89 ? 945  LEU A N     1 
ATOM   6960  C  CA    . LEU A 1 945  ? -38.030 3.877   -12.420 1.00 132.17 ? 945  LEU A CA    1 
ATOM   6961  C  C     . LEU A 1 945  ? -38.530 2.938   -13.500 1.00 122.06 ? 945  LEU A C     1 
ATOM   6962  O  O     . LEU A 1 945  ? -38.343 1.729   -13.395 1.00 112.95 ? 945  LEU A O     1 
ATOM   6963  C  CB    . LEU A 1 945  ? -36.589 4.274   -12.743 1.00 129.52 ? 945  LEU A CB    1 
ATOM   6964  C  CG    . LEU A 1 945  ? -35.919 5.227   -11.756 1.00 116.40 ? 945  LEU A CG    1 
ATOM   6965  C  CD1   . LEU A 1 945  ? -34.399 5.125   -11.812 1.00 107.21 ? 945  LEU A CD1   1 
ATOM   6966  C  CD2   . LEU A 1 945  ? -36.400 6.644   -12.051 1.00 120.19 ? 945  LEU A CD2   1 
ATOM   6967  N  N     . SER A 1 946  ? -39.170 3.488   -14.531 1.00 112.98 ? 946  SER A N     1 
ATOM   6968  C  CA    . SER A 1 946  ? -39.593 2.678   -15.669 1.00 116.69 ? 946  SER A CA    1 
ATOM   6969  C  C     . SER A 1 946  ? -38.338 2.141   -16.338 1.00 117.89 ? 946  SER A C     1 
ATOM   6970  O  O     . SER A 1 946  ? -37.303 2.820   -16.342 1.00 123.19 ? 946  SER A O     1 
ATOM   6971  C  CB    . SER A 1 946  ? -40.403 3.493   -16.671 1.00 123.86 ? 946  SER A CB    1 
ATOM   6972  O  OG    . SER A 1 946  ? -39.587 4.405   -17.387 1.00 132.05 ? 946  SER A OG    1 
ATOM   6973  N  N     . PRO A 1 947  ? -38.403 0.911   -16.895 1.00 108.07 ? 947  PRO A N     1 
ATOM   6974  C  CA    . PRO A 1 947  ? -37.222 0.452   -17.623 1.00 101.13 ? 947  PRO A CA    1 
ATOM   6975  C  C     . PRO A 1 947  ? -36.752 1.414   -18.718 1.00 103.73 ? 947  PRO A C     1 
ATOM   6976  O  O     . PRO A 1 947  ? -35.565 1.461   -19.000 1.00 117.16 ? 947  PRO A O     1 
ATOM   6977  C  CB    . PRO A 1 947  ? -37.683 -0.883  -18.194 1.00 95.84  ? 947  PRO A CB    1 
ATOM   6978  C  CG    . PRO A 1 947  ? -38.585 -1.412  -17.124 1.00 99.33  ? 947  PRO A CG    1 
ATOM   6979  C  CD    . PRO A 1 947  ? -39.285 -0.216  -16.533 1.00 99.52  ? 947  PRO A CD    1 
ATOM   6980  N  N     . GLU A 1 948  ? -37.660 2.202   -19.281 1.00 98.65  ? 948  GLU A N     1 
ATOM   6981  C  CA    . GLU A 1 948  ? -37.340 3.078   -20.398 1.00 109.31 ? 948  GLU A CA    1 
ATOM   6982  C  C     . GLU A 1 948  ? -36.536 4.310   -19.951 1.00 113.42 ? 948  GLU A C     1 
ATOM   6983  O  O     . GLU A 1 948  ? -35.798 4.887   -20.754 1.00 115.29 ? 948  GLU A O     1 
ATOM   6984  C  CB    . GLU A 1 948  ? -38.632 3.485   -21.136 1.00 127.16 ? 948  GLU A CB    1 
ATOM   6985  C  CG    . GLU A 1 948  ? -39.352 2.335   -21.874 1.00 134.36 ? 948  GLU A CG    1 
ATOM   6986  C  CD    . GLU A 1 948  ? -40.090 1.332   -20.969 1.00 135.04 ? 948  GLU A CD    1 
ATOM   6987  O  OE1   . GLU A 1 948  ? -40.387 1.649   -19.793 1.00 142.73 ? 948  GLU A OE1   1 
ATOM   6988  O  OE2   . GLU A 1 948  ? -40.385 0.211   -21.439 1.00 121.00 ? 948  GLU A OE2   1 
ATOM   6989  N  N     . LYS A 1 949  ? -36.674 4.706   -18.681 1.00 119.58 ? 949  LYS A N     1 
ATOM   6990  C  CA    . LYS A 1 949  ? -35.784 5.711   -18.077 1.00 116.86 ? 949  LYS A CA    1 
ATOM   6991  C  C     . LYS A 1 949  ? -34.369 5.153   -17.852 1.00 117.35 ? 949  LYS A C     1 
ATOM   6992  O  O     . LYS A 1 949  ? -33.382 5.861   -18.040 1.00 110.66 ? 949  LYS A O     1 
ATOM   6993  C  CB    . LYS A 1 949  ? -36.369 6.262   -16.773 1.00 129.59 ? 949  LYS A CB    1 
ATOM   6994  C  CG    . LYS A 1 949  ? -37.307 7.452   -16.958 1.00 138.64 ? 949  LYS A CG    1 
ATOM   6995  C  CD    . LYS A 1 949  ? -37.171 8.453   -15.813 1.00 144.46 ? 949  LYS A CD    1 
ATOM   6996  C  CE    . LYS A 1 949  ? -38.113 9.638   -15.968 1.00 148.73 ? 949  LYS A CE    1 
ATOM   6997  N  NZ    . LYS A 1 949  ? -39.550 9.242   -15.888 1.00 153.73 ? 949  LYS A NZ    1 
ATOM   6998  N  N     . VAL A 1 950  ? -34.284 3.898   -17.419 1.00 109.39 ? 950  VAL A N     1 
ATOM   6999  C  CA    . VAL A 1 950  ? -33.003 3.231   -17.182 1.00 105.85 ? 950  VAL A CA    1 
ATOM   7000  C  C     . VAL A 1 950  ? -32.262 2.956   -18.508 1.00 116.12 ? 950  VAL A C     1 
ATOM   7001  O  O     . VAL A 1 950  ? -31.042 3.094   -18.585 1.00 125.23 ? 950  VAL A O     1 
ATOM   7002  C  CB    . VAL A 1 950  ? -33.221 1.919   -16.393 1.00 93.72  ? 950  VAL A CB    1 
ATOM   7003  C  CG1   . VAL A 1 950  ? -31.902 1.222   -16.108 1.00 87.83  ? 950  VAL A CG1   1 
ATOM   7004  C  CG2   . VAL A 1 950  ? -33.966 2.212   -15.105 1.00 93.59  ? 950  VAL A CG2   1 
ATOM   7005  N  N     . ARG A 1 951  ? -33.001 2.576   -19.543 1.00 110.86 ? 951  ARG A N     1 
ATOM   7006  C  CA    . ARG A 1 951  ? -32.422 2.401   -20.863 1.00 104.81 ? 951  ARG A CA    1 
ATOM   7007  C  C     . ARG A 1 951  ? -31.839 3.691   -21.395 1.00 97.99  ? 951  ARG A C     1 
ATOM   7008  O  O     . ARG A 1 951  ? -30.691 3.721   -21.825 1.00 94.86  ? 951  ARG A O     1 
ATOM   7009  C  CB    . ARG A 1 951  ? -33.489 1.849   -21.811 1.00 108.21 ? 951  ARG A CB    1 
ATOM   7010  C  CG    . ARG A 1 951  ? -33.784 0.387   -21.490 1.00 114.48 ? 951  ARG A CG    1 
ATOM   7011  C  CD    . ARG A 1 951  ? -34.802 -0.294  -22.398 1.00 110.75 ? 951  ARG A CD    1 
ATOM   7012  N  NE    . ARG A 1 951  ? -35.134 -1.617  -21.851 1.00 99.37  ? 951  ARG A NE    1 
ATOM   7013  C  CZ    . ARG A 1 951  ? -36.361 -2.110  -21.669 1.00 95.52  ? 951  ARG A CZ    1 
ATOM   7014  N  NH1   . ARG A 1 951  ? -37.454 -1.432  -22.021 1.00 91.80  ? 951  ARG A NH1   1 
ATOM   7015  N  NH2   . ARG A 1 951  ? -36.493 -3.321  -21.142 1.00 96.21  ? 951  ARG A NH2   1 
ATOM   7016  N  N     . ILE A 1 952  ? -32.629 4.761   -21.348 1.00 108.68 ? 952  ILE A N     1 
ATOM   7017  C  CA    . ILE A 1 952  ? -32.239 6.036   -21.977 1.00 116.15 ? 952  ILE A CA    1 
ATOM   7018  C  C     . ILE A 1 952  ? -31.007 6.685   -21.323 1.00 117.81 ? 952  ILE A C     1 
ATOM   7019  O  O     . ILE A 1 952  ? -30.220 7.321   -22.022 1.00 112.45 ? 952  ILE A O     1 
ATOM   7020  C  CB    . ILE A 1 952  ? -33.386 7.061   -22.115 1.00 122.93 ? 952  ILE A CB    1 
ATOM   7021  C  CG1   . ILE A 1 952  ? -33.027 8.098   -23.193 1.00 122.92 ? 952  ILE A CG1   1 
ATOM   7022  C  CG2   . ILE A 1 952  ? -33.695 7.730   -20.782 1.00 129.15 ? 952  ILE A CG2   1 
ATOM   7023  C  CD1   . ILE A 1 952  ? -34.123 9.112   -23.461 1.00 138.39 ? 952  ILE A CD1   1 
ATOM   7024  N  N     . ILE A 1 953  ? -30.818 6.507   -20.013 1.00 124.13 ? 953  ILE A N     1 
ATOM   7025  C  CA    . ILE A 1 953  ? -29.616 7.030   -19.313 1.00 130.76 ? 953  ILE A CA    1 
ATOM   7026  C  C     . ILE A 1 953  ? -28.391 6.089   -19.292 1.00 114.97 ? 953  ILE A C     1 
ATOM   7027  O  O     . ILE A 1 953  ? -27.303 6.516   -18.903 1.00 123.35 ? 953  ILE A O     1 
ATOM   7028  C  CB    . ILE A 1 953  ? -29.936 7.483   -17.853 1.00 146.97 ? 953  ILE A CB    1 
ATOM   7029  C  CG1   . ILE A 1 953  ? -30.095 6.290   -16.893 1.00 139.93 ? 953  ILE A CG1   1 
ATOM   7030  C  CG2   . ILE A 1 953  ? -31.163 8.406   -17.810 1.00 152.37 ? 953  ILE A CG2   1 
ATOM   7031  C  CD1   . ILE A 1 953  ? -28.919 6.094   -15.960 1.00 127.87 ? 953  ILE A CD1   1 
ATOM   7032  N  N     . ASN A 1 954  ? -28.569 4.822   -19.678 1.00 96.63  ? 954  ASN A N     1 
ATOM   7033  C  CA    . ASN A 1 954  ? -27.439 3.906   -19.904 1.00 86.01  ? 954  ASN A CA    1 
ATOM   7034  C  C     . ASN A 1 954  ? -27.006 3.782   -21.371 1.00 84.87  ? 954  ASN A C     1 
ATOM   7035  O  O     . ASN A 1 954  ? -26.052 3.079   -21.673 1.00 99.26  ? 954  ASN A O     1 
ATOM   7036  C  CB    . ASN A 1 954  ? -27.766 2.530   -19.379 1.00 91.29  ? 954  ASN A CB    1 
ATOM   7037  C  CG    . ASN A 1 954  ? -27.554 2.419   -17.906 1.00 91.74  ? 954  ASN A CG    1 
ATOM   7038  O  OD1   . ASN A 1 954  ? -26.427 2.260   -17.446 1.00 99.51  ? 954  ASN A OD1   1 
ATOM   7039  N  ND2   . ASN A 1 954  ? -28.637 2.473   -17.154 1.00 90.58  ? 954  ASN A ND2   1 
ATOM   7040  N  N     . MET A 1 955  ? -27.698 4.459   -22.280 1.00 88.69  ? 955  MET A N     1 
ATOM   7041  C  CA    . MET A 1 955  ? -27.368 4.429   -23.716 1.00 90.28  ? 955  MET A CA    1 
ATOM   7042  C  C     . MET A 1 955  ? -26.005 5.003   -24.057 1.00 87.27  ? 955  MET A C     1 
ATOM   7043  O  O     . MET A 1 955  ? -25.491 5.850   -23.339 1.00 100.29 ? 955  MET A O     1 
ATOM   7044  C  CB    . MET A 1 955  ? -28.431 5.138   -24.571 1.00 97.37  ? 955  MET A CB    1 
ATOM   7045  C  CG    . MET A 1 955  ? -29.571 4.209   -25.005 1.00 103.65 ? 955  MET A CG    1 
ATOM   7046  S  SD    . MET A 1 955  ? -30.893 4.952   -25.992 1.00 112.97 ? 955  MET A SD    1 
ATOM   7047  C  CE    . MET A 1 955  ? -29.982 6.004   -27.148 1.00 100.58 ? 955  MET A CE    1 
ATOM   7048  N  N     . TYR A 1 956  ? -25.435 4.527   -25.158 1.00 92.12  ? 956  TYR A N     1 
ATOM   7049  C  CA    . TYR A 1 956  ? -24.225 5.111   -25.734 1.00 109.90 ? 956  TYR A CA    1 
ATOM   7050  C  C     . TYR A 1 956  ? -24.500 6.560   -26.118 1.00 108.57 ? 956  TYR A C     1 
ATOM   7051  O  O     . TYR A 1 956  ? -25.602 6.912   -26.536 1.00 102.13 ? 956  TYR A O     1 
ATOM   7052  C  CB    . TYR A 1 956  ? -23.754 4.304   -26.959 1.00 124.96 ? 956  TYR A CB    1 
ATOM   7053  C  CG    . TYR A 1 956  ? -23.122 2.938   -26.655 1.00 127.17 ? 956  TYR A CG    1 
ATOM   7054  C  CD1   . TYR A 1 956  ? -21.995 2.833   -25.855 1.00 130.90 ? 956  TYR A CD1   1 
ATOM   7055  C  CD2   . TYR A 1 956  ? -23.620 1.765   -27.212 1.00 117.77 ? 956  TYR A CD2   1 
ATOM   7056  C  CE1   . TYR A 1 956  ? -21.401 1.603   -25.597 1.00 124.38 ? 956  TYR A CE1   1 
ATOM   7057  C  CE2   . TYR A 1 956  ? -23.022 0.536   -26.959 1.00 112.00 ? 956  TYR A CE2   1 
ATOM   7058  C  CZ    . TYR A 1 956  ? -21.913 0.463   -26.150 1.00 109.48 ? 956  TYR A CZ    1 
ATOM   7059  O  OH    . TYR A 1 956  ? -21.307 -0.739  -25.865 1.00 100.30 ? 956  TYR A OH    1 
ATOM   7060  N  N     . LYS A 1 957  ? -23.482 7.401   -25.966 1.00 117.68 ? 957  LYS A N     1 
ATOM   7061  C  CA    . LYS A 1 957  ? -23.549 8.783   -26.447 1.00 120.94 ? 957  LYS A CA    1 
ATOM   7062  C  C     . LYS A 1 957  ? -23.314 8.773   -27.948 1.00 115.69 ? 957  LYS A C     1 
ATOM   7063  O  O     . LYS A 1 957  ? -23.074 7.712   -28.527 1.00 113.66 ? 957  LYS A O     1 
ATOM   7064  C  CB    . LYS A 1 957  ? -22.455 9.651   -25.809 1.00 133.02 ? 957  LYS A CB    1 
ATOM   7065  C  CG    . LYS A 1 957  ? -22.140 9.379   -24.340 1.00 143.55 ? 957  LYS A CG    1 
ATOM   7066  C  CD    . LYS A 1 957  ? -23.365 9.583   -23.466 1.00 147.51 ? 957  LYS A CD    1 
ATOM   7067  C  CE    . LYS A 1 957  ? -22.996 9.663   -21.995 1.00 144.07 ? 957  LYS A CE    1 
ATOM   7068  N  NZ    . LYS A 1 957  ? -24.111 10.272  -21.224 1.00 141.61 ? 957  LYS A NZ    1 
ATOM   7069  N  N     . GLU A 1 958  ? -23.391 9.951   -28.570 1.00 108.14 ? 958  GLU A N     1 
ATOM   7070  C  CA    . GLU A 1 958  ? -23.190 10.081  -30.012 1.00 113.64 ? 958  GLU A CA    1 
ATOM   7071  C  C     . GLU A 1 958  ? -21.908 9.371   -30.443 1.00 116.68 ? 958  GLU A C     1 
ATOM   7072  O  O     . GLU A 1 958  ? -21.940 8.493   -31.311 1.00 131.05 ? 958  GLU A O     1 
ATOM   7073  C  CB    . GLU A 1 958  ? -23.196 11.562  -30.454 1.00 113.23 ? 958  GLU A CB    1 
ATOM   7074  C  CG    . GLU A 1 958  ? -23.221 11.803  -31.970 1.00 120.04 ? 958  GLU A CG    1 
ATOM   7075  C  CD    . GLU A 1 958  ? -23.581 13.245  -32.375 1.00 129.75 ? 958  GLU A CD    1 
ATOM   7076  O  OE1   . GLU A 1 958  ? -24.411 13.877  -31.680 1.00 143.74 ? 958  GLU A OE1   1 
ATOM   7077  O  OE2   . GLU A 1 958  ? -23.057 13.753  -33.405 1.00 115.98 ? 958  GLU A OE2   1 
ATOM   7078  N  N     . ILE A 1 959  ? -20.797 9.738   -29.804 1.00 113.41 ? 959  ILE A N     1 
ATOM   7079  C  CA    . ILE A 1 959  ? -19.503 9.042   -29.974 1.00 103.72 ? 959  ILE A CA    1 
ATOM   7080  C  C     . ILE A 1 959  ? -19.243 8.245   -28.706 1.00 106.31 ? 959  ILE A C     1 
ATOM   7081  O  O     . ILE A 1 959  ? -19.437 8.746   -27.591 1.00 125.66 ? 959  ILE A O     1 
ATOM   7082  C  CB    . ILE A 1 959  ? -18.313 9.943   -30.319 1.00 101.17 ? 959  ILE A CB    1 
ATOM   7083  C  CG1   . ILE A 1 959  ? -18.598 10.755  -31.595 1.00 100.26 ? 959  ILE A CG1   1 
ATOM   7084  C  CG2   . ILE A 1 959  ? -17.063 9.080   -30.501 1.00 104.79 ? 959  ILE A CG2   1 
ATOM   7085  C  CD1   . ILE A 1 959  ? -18.616 9.965   -32.892 1.00 95.86  ? 959  ILE A CD1   1 
ATOM   7086  N  N     . ASP A 1 960  ? -18.807 7.001   -28.877 1.00 99.08  ? 960  ASP A N     1 
ATOM   7087  C  CA    . ASP A 1 960  ? -18.504 6.117   -27.739 1.00 107.96 ? 960  ASP A CA    1 
ATOM   7088  C  C     . ASP A 1 960  ? -17.804 4.836   -28.221 1.00 107.79 ? 960  ASP A C     1 
ATOM   7089  O  O     . ASP A 1 960  ? -17.593 4.652   -29.407 1.00 103.95 ? 960  ASP A O     1 
ATOM   7090  C  CB    . ASP A 1 960  ? -19.782 5.784   -26.940 1.00 119.18 ? 960  ASP A CB    1 
ATOM   7091  C  CG    . ASP A 1 960  ? -19.534 5.672   -25.424 1.00 126.68 ? 960  ASP A CG    1 
ATOM   7092  O  OD1   . ASP A 1 960  ? -18.538 5.019   -25.022 1.00 117.23 ? 960  ASP A OD1   1 
ATOM   7093  O  OD2   . ASP A 1 960  ? -20.353 6.220   -24.639 1.00 130.97 ? 960  ASP A OD2   1 
ATOM   7094  N  N     . GLN A 1 961  ? -17.423 3.985   -27.272 1.00 118.00 ? 961  GLN A N     1 
ATOM   7095  C  CA    . GLN A 1 961  ? -16.585 2.809   -27.548 1.00 120.48 ? 961  GLN A CA    1 
ATOM   7096  C  C     . GLN A 1 961  ? -17.236 1.546   -26.981 1.00 121.23 ? 961  GLN A C     1 
ATOM   7097  O  O     . GLN A 1 961  ? -17.801 1.579   -25.866 1.00 121.22 ? 961  GLN A O     1 
ATOM   7098  C  CB    . GLN A 1 961  ? -15.177 3.083   -27.015 1.00 123.51 ? 961  GLN A CB    1 
ATOM   7099  C  CG    . GLN A 1 961  ? -14.377 1.896   -26.522 1.00 126.64 ? 961  GLN A CG    1 
ATOM   7100  C  CD    . GLN A 1 961  ? -13.048 2.335   -25.933 1.00 124.02 ? 961  GLN A CD    1 
ATOM   7101  O  OE1   . GLN A 1 961  ? -12.975 2.870   -24.822 1.00 101.39 ? 961  GLN A OE1   1 
ATOM   7102  N  NE2   . GLN A 1 961  ? -11.986 2.125   -26.691 1.00 132.96 ? 961  GLN A NE2   1 
ATOM   7103  N  N     . THR A 1 962  ? -17.189 0.454   -27.752 1.00 114.47 ? 962  THR A N     1 
ATOM   7104  C  CA    . THR A 1 962  ? -17.811 -0.818  -27.360 1.00 119.80 ? 962  THR A CA    1 
ATOM   7105  C  C     . THR A 1 962  ? -16.945 -1.563  -26.342 1.00 124.66 ? 962  THR A C     1 
ATOM   7106  O  O     . THR A 1 962  ? -15.771 -1.235  -26.182 1.00 142.11 ? 962  THR A O     1 
ATOM   7107  C  CB    . THR A 1 962  ? -17.951 -1.776  -28.548 1.00 115.11 ? 962  THR A CB    1 
ATOM   7108  O  OG1   . THR A 1 962  ? -16.648 -2.071  -29.051 1.00 112.17 ? 962  THR A OG1   1 
ATOM   7109  C  CG2   . THR A 1 962  ? -18.806 -1.174  -29.656 1.00 119.27 ? 962  THR A CG2   1 
ATOM   7110  N  N     . PRO A 1 963  ? -17.497 -2.606  -25.680 1.00 117.94 ? 963  PRO A N     1 
ATOM   7111  C  CA    . PRO A 1 963  ? -16.699 -3.485  -24.804 1.00 112.82 ? 963  PRO A CA    1 
ATOM   7112  C  C     . PRO A 1 963  ? -15.486 -4.160  -25.464 1.00 108.49 ? 963  PRO A C     1 
ATOM   7113  O  O     . PRO A 1 963  ? -14.517 -4.484  -24.773 1.00 109.46 ? 963  PRO A O     1 
ATOM   7114  C  CB    . PRO A 1 963  ? -17.718 -4.540  -24.365 1.00 116.68 ? 963  PRO A CB    1 
ATOM   7115  C  CG    . PRO A 1 963  ? -18.999 -3.799  -24.323 1.00 122.82 ? 963  PRO A CG    1 
ATOM   7116  C  CD    . PRO A 1 963  ? -18.940 -2.844  -25.490 1.00 125.74 ? 963  PRO A CD    1 
ATOM   7117  N  N     . TYR A 1 964  ? -15.546 -4.334  -26.788 1.00 106.78 ? 964  TYR A N     1 
ATOM   7118  C  CA    . TYR A 1 964  ? -14.441 -4.892  -27.595 1.00 104.48 ? 964  TYR A CA    1 
ATOM   7119  C  C     . TYR A 1 964  ? -13.599 -3.792  -28.269 1.00 94.64  ? 964  TYR A C     1 
ATOM   7120  O  O     . TYR A 1 964  ? -12.919 -4.041  -29.250 1.00 86.64  ? 964  TYR A O     1 
ATOM   7121  C  CB    . TYR A 1 964  ? -14.964 -5.969  -28.614 1.00 103.43 ? 964  TYR A CB    1 
ATOM   7122  C  CG    . TYR A 1 964  ? -16.215 -5.540  -29.351 1.00 91.08  ? 964  TYR A CG    1 
ATOM   7123  C  CD1   . TYR A 1 964  ? -17.461 -5.832  -28.857 1.00 85.72  ? 964  TYR A CD1   1 
ATOM   7124  C  CD2   . TYR A 1 964  ? -16.129 -4.774  -30.511 1.00 86.18  ? 964  TYR A CD2   1 
ATOM   7125  C  CE1   . TYR A 1 964  ? -18.595 -5.375  -29.508 1.00 97.77  ? 964  TYR A CE1   1 
ATOM   7126  C  CE2   . TYR A 1 964  ? -17.253 -4.314  -31.162 1.00 81.06  ? 964  TYR A CE2   1 
ATOM   7127  C  CZ    . TYR A 1 964  ? -18.484 -4.614  -30.667 1.00 85.79  ? 964  TYR A CZ    1 
ATOM   7128  O  OH    . TYR A 1 964  ? -19.599 -4.147  -31.331 1.00 79.24  ? 964  TYR A OH    1 
ATOM   7129  N  N     . LYS A 1 965  ? -13.671 -2.572  -27.729 1.00 94.82  ? 965  LYS A N     1 
ATOM   7130  C  CA    . LYS A 1 965  ? -12.851 -1.428  -28.163 1.00 111.66 ? 965  LYS A CA    1 
ATOM   7131  C  C     . LYS A 1 965  ? -13.021 -1.009  -29.642 1.00 111.23 ? 965  LYS A C     1 
ATOM   7132  O  O     . LYS A 1 965  ? -12.095 -0.474  -30.250 1.00 112.17 ? 965  LYS A O     1 
ATOM   7133  C  CB    . LYS A 1 965  ? -11.352 -1.636  -27.832 1.00 119.66 ? 965  LYS A CB    1 
ATOM   7134  C  CG    . LYS A 1 965  ? -10.950 -1.408  -26.373 1.00 123.17 ? 965  LYS A CG    1 
ATOM   7135  C  CD    . LYS A 1 965  ? -11.312 -2.601  -25.499 1.00 135.61 ? 965  LYS A CD    1 
ATOM   7136  C  CE    . LYS A 1 965  ? -10.624 -2.563  -24.138 1.00 135.61 ? 965  LYS A CE    1 
ATOM   7137  N  NZ    . LYS A 1 965  ? -11.179 -3.573  -23.180 1.00 131.12 ? 965  LYS A NZ    1 
ATOM   7138  N  N     . GLN A 1 966  ? -14.203 -1.233  -30.206 1.00 100.07 ? 966  GLN A N     1 
ATOM   7139  C  CA    . GLN A 1 966  ? -14.551 -0.650  -31.489 1.00 104.75 ? 966  GLN A CA    1 
ATOM   7140  C  C     . GLN A 1 966  ? -15.247 0.691   -31.258 1.00 108.87 ? 966  GLN A C     1 
ATOM   7141  O  O     . GLN A 1 966  ? -16.162 0.769   -30.434 1.00 112.12 ? 966  GLN A O     1 
ATOM   7142  C  CB    . GLN A 1 966  ? -15.460 -1.634  -32.251 1.00 106.90 ? 966  GLN A CB    1 
ATOM   7143  C  CG    . GLN A 1 966  ? -16.003 -1.161  -33.605 1.00 103.62 ? 966  GLN A CG    1 
ATOM   7144  C  CD    . GLN A 1 966  ? -15.989 -2.243  -34.687 1.00 107.21 ? 966  GLN A CD    1 
ATOM   7145  O  OE1   . GLN A 1 966  ? -16.023 -3.452  -34.406 1.00 100.18 ? 966  GLN A OE1   1 
ATOM   7146  N  NE2   . GLN A 1 966  ? -15.920 -1.803  -35.940 1.00 113.90 ? 966  GLN A NE2   1 
ATOM   7147  N  N     . GLU A 1 967  ? -14.810 1.738   -31.956 1.00 115.51 ? 967  GLU A N     1 
ATOM   7148  C  CA    . GLU A 1 967  ? -15.486 3.038   -31.934 1.00 127.87 ? 967  GLU A CA    1 
ATOM   7149  C  C     . GLU A 1 967  ? -16.815 2.926   -32.659 1.00 121.37 ? 967  GLU A C     1 
ATOM   7150  O  O     . GLU A 1 967  ? -16.930 2.173   -33.609 1.00 134.99 ? 967  GLU A O     1 
ATOM   7151  C  CB    . GLU A 1 967  ? -14.622 4.160   -32.561 1.00 141.31 ? 967  GLU A CB    1 
ATOM   7152  C  CG    . GLU A 1 967  ? -13.600 4.814   -31.613 1.00 155.39 ? 967  GLU A CG    1 
ATOM   7153  C  CD    . GLU A 1 967  ? -14.106 6.068   -30.873 1.00 157.57 ? 967  GLU A CD    1 
ATOM   7154  O  OE1   . GLU A 1 967  ? -13.361 7.077   -30.838 1.00 148.26 ? 967  GLU A OE1   1 
ATOM   7155  O  OE2   . GLU A 1 967  ? -15.230 6.062   -30.313 1.00 152.46 ? 967  GLU A OE2   1 
ATOM   7156  N  N     . ILE A 1 968  ? -17.812 3.678   -32.200 1.00 124.06 ? 968  ILE A N     1 
ATOM   7157  C  CA    . ILE A 1 968  ? -19.107 3.758   -32.874 1.00 114.84 ? 968  ILE A CA    1 
ATOM   7158  C  C     . ILE A 1 968  ? -19.653 5.167   -32.857 1.00 117.46 ? 968  ILE A C     1 
ATOM   7159  O  O     . ILE A 1 968  ? -19.418 5.928   -31.900 1.00 136.82 ? 968  ILE A O     1 
ATOM   7160  C  CB    . ILE A 1 968  ? -20.163 2.837   -32.230 1.00 112.54 ? 968  ILE A CB    1 
ATOM   7161  C  CG1   . ILE A 1 968  ? -20.301 3.108   -30.728 1.00 121.92 ? 968  ILE A CG1   1 
ATOM   7162  C  CG2   . ILE A 1 968  ? -19.778 1.385   -32.429 1.00 112.55 ? 968  ILE A CG2   1 
ATOM   7163  C  CD1   . ILE A 1 968  ? -21.514 2.464   -30.090 1.00 124.75 ? 968  ILE A CD1   1 
ATOM   7164  N  N     . ASN A 1 969  ? -20.329 5.528   -33.939 1.00 119.62 ? 969  ASN A N     1 
ATOM   7165  C  CA    . ASN A 1 969  ? -21.132 6.739   -33.971 1.00 121.27 ? 969  ASN A CA    1 
ATOM   7166  C  C     . ASN A 1 969  ? -22.580 6.314   -33.750 1.00 125.22 ? 969  ASN A C     1 
ATOM   7167  O  O     . ASN A 1 969  ? -23.213 5.781   -34.654 1.00 143.48 ? 969  ASN A O     1 
ATOM   7168  C  CB    . ASN A 1 969  ? -21.012 7.561   -35.255 1.00 118.55 ? 969  ASN A CB    1 
ATOM   7169  C  CG    . ASN A 1 969  ? -22.009 8.718   -35.289 1.00 123.10 ? 969  ASN A CG    1 
ATOM   7170  O  OD1   . ASN A 1 969  ? -22.872 8.798   -36.166 1.00 127.88 ? 969  ASN A OD1   1 
ATOM   7171  N  ND2   . ASN A 1 969  ? -21.916 9.603   -34.307 1.00 125.11 ? 969  ASN A ND2   1 
ATOM   7172  N  N     . ALA A 1 970  ? -23.075 6.535   -32.537 1.00 115.89 ? 970  ALA A N     1 
ATOM   7173  C  CA    . ALA A 1 970  ? -24.436 6.155   -32.155 1.00 118.10 ? 970  ALA A CA    1 
ATOM   7174  C  C     . ALA A 1 970  ? -25.423 7.320   -32.221 1.00 111.17 ? 970  ALA A C     1 
ATOM   7175  O  O     . ALA A 1 970  ? -26.348 7.360   -31.423 1.00 90.57  ? 970  ALA A O     1 
ATOM   7176  C  CB    . ALA A 1 970  ? -24.426 5.552   -30.754 1.00 122.88 ? 970  ALA A CB    1 
ATOM   7177  N  N     . LYS A 1 971  ? -25.243 8.236   -33.180 1.00 110.66 ? 971  LYS A N     1 
ATOM   7178  C  CA    . LYS A 1 971  ? -26.163 9.373   -33.348 1.00 110.92 ? 971  LYS A CA    1 
ATOM   7179  C  C     . LYS A 1 971  ? -27.548 8.854   -33.739 1.00 113.85 ? 971  LYS A C     1 
ATOM   7180  O  O     . LYS A 1 971  ? -28.566 9.228   -33.147 1.00 105.24 ? 971  LYS A O     1 
ATOM   7181  C  CB    . LYS A 1 971  ? -25.641 10.330  -34.421 1.00 114.15 ? 971  LYS A CB    1 
ATOM   7182  C  CG    . LYS A 1 971  ? -26.325 11.691  -34.418 1.00 123.54 ? 971  LYS A CG    1 
ATOM   7183  C  CD    . LYS A 1 971  ? -25.618 12.718  -35.311 1.00 128.23 ? 971  LYS A CD    1 
ATOM   7184  C  CE    . LYS A 1 971  ? -25.587 12.302  -36.773 1.00 131.22 ? 971  LYS A CE    1 
ATOM   7185  N  NZ    . LYS A 1 971  ? -26.927 11.861  -37.261 1.00 137.44 ? 971  LYS A NZ    1 
ATOM   7186  N  N     . ASN A 1 972  ? -27.557 7.974   -34.739 1.00 112.80 ? 972  ASN A N     1 
ATOM   7187  C  CA    . ASN A 1 972  ? -28.788 7.400   -35.264 1.00 110.53 ? 972  ASN A CA    1 
ATOM   7188  C  C     . ASN A 1 972  ? -29.501 6.456   -34.293 1.00 107.75 ? 972  ASN A C     1 
ATOM   7189  O  O     . ASN A 1 972  ? -30.703 6.208   -34.440 1.00 115.96 ? 972  ASN A O     1 
ATOM   7190  C  CB    . ASN A 1 972  ? -28.503 6.686   -36.594 1.00 114.35 ? 972  ASN A CB    1 
ATOM   7191  C  CG    . ASN A 1 972  ? -28.245 7.652   -37.745 1.00 122.30 ? 972  ASN A CG    1 
ATOM   7192  O  OD1   . ASN A 1 972  ? -28.357 8.877   -37.610 1.00 118.12 ? 972  ASN A OD1   1 
ATOM   7193  N  ND2   . ASN A 1 972  ? -27.916 7.094   -38.898 1.00 131.14 ? 972  ASN A ND2   1 
ATOM   7194  N  N     . LEU A 1 973  ? -28.765 5.924   -33.320 1.00 100.68 ? 973  LEU A N     1 
ATOM   7195  C  CA    . LEU A 1 973  ? -29.372 5.215   -32.201 1.00 105.01 ? 973  LEU A CA    1 
ATOM   7196  C  C     . LEU A 1 973  ? -30.242 6.173   -31.385 1.00 104.36 ? 973  LEU A C     1 
ATOM   7197  O  O     . LEU A 1 973  ? -31.378 5.832   -31.046 1.00 97.53  ? 973  LEU A O     1 
ATOM   7198  C  CB    . LEU A 1 973  ? -28.313 4.592   -31.294 1.00 110.40 ? 973  LEU A CB    1 
ATOM   7199  C  CG    . LEU A 1 973  ? -28.874 3.851   -30.073 1.00 107.34 ? 973  LEU A CG    1 
ATOM   7200  C  CD1   . LEU A 1 973  ? -29.969 2.857   -30.475 1.00 111.41 ? 973  LEU A CD1   1 
ATOM   7201  C  CD2   . LEU A 1 973  ? -27.743 3.179   -29.312 1.00 95.66  ? 973  LEU A CD2   1 
ATOM   7202  N  N     . ILE A 1 974  ? -29.717 7.369   -31.093 1.00 109.11 ? 974  ILE A N     1 
ATOM   7203  C  CA    . ILE A 1 974  ? -30.474 8.380   -30.336 1.00 108.57 ? 974  ILE A CA    1 
ATOM   7204  C  C     . ILE A 1 974  ? -31.722 8.783   -31.134 1.00 101.52 ? 974  ILE A C     1 
ATOM   7205  O  O     . ILE A 1 974  ? -32.825 8.752   -30.603 1.00 99.04  ? 974  ILE A O     1 
ATOM   7206  C  CB    . ILE A 1 974  ? -29.636 9.605   -29.864 1.00 112.43 ? 974  ILE A CB    1 
ATOM   7207  C  CG1   . ILE A 1 974  ? -28.127 9.314   -29.747 1.00 113.81 ? 974  ILE A CG1   1 
ATOM   7208  C  CG2   . ILE A 1 974  ? -30.148 10.087  -28.510 1.00 113.26 ? 974  ILE A CG2   1 
ATOM   7209  C  CD1   . ILE A 1 974  ? -27.726 8.248   -28.744 1.00 106.77 ? 974  ILE A CD1   1 
ATOM   7210  N  N     . GLN A 1 975  ? -31.543 9.137   -32.404 1.00 103.14 ? 975  GLN A N     1 
ATOM   7211  C  CA    . GLN A 1 975  ? -32.649 9.561   -33.281 1.00 116.35 ? 975  GLN A CA    1 
ATOM   7212  C  C     . GLN A 1 975  ? -33.745 8.501   -33.390 1.00 123.44 ? 975  GLN A C     1 
ATOM   7213  O  O     . GLN A 1 975  ? -34.928 8.822   -33.310 1.00 133.20 ? 975  GLN A O     1 
ATOM   7214  C  CB    . GLN A 1 975  ? -32.152 9.829   -34.709 1.00 126.86 ? 975  GLN A CB    1 
ATOM   7215  C  CG    . GLN A 1 975  ? -31.458 11.153  -34.982 1.00 134.42 ? 975  GLN A CG    1 
ATOM   7216  C  CD    . GLN A 1 975  ? -31.259 11.372  -36.489 1.00 142.74 ? 975  GLN A CD    1 
ATOM   7217  O  OE1   . GLN A 1 975  ? -30.124 11.384  -36.996 1.00 145.34 ? 975  GLN A OE1   1 
ATOM   7218  N  NE2   . GLN A 1 975  ? -32.372 11.516  -37.217 1.00 124.06 ? 975  GLN A NE2   1 
ATOM   7219  N  N     . CYS A 1 976  ? -33.342 7.251   -33.607 1.00 126.72 ? 976  CYS A N     1 
ATOM   7220  C  CA    . CYS A 1 976  ? -34.272 6.117   -33.656 1.00 116.11 ? 976  CYS A CA    1 
ATOM   7221  C  C     . CYS A 1 976  ? -35.136 6.037   -32.394 1.00 106.30 ? 976  CYS A C     1 
ATOM   7222  O  O     . CYS A 1 976  ? -36.327 5.762   -32.475 1.00 109.82 ? 976  CYS A O     1 
ATOM   7223  C  CB    . CYS A 1 976  ? -33.506 4.782   -33.775 1.00 113.88 ? 976  CYS A CB    1 
ATOM   7224  S  SG    . CYS A 1 976  ? -33.350 4.119   -35.454 1.00 114.28 ? 976  CYS A SG    1 
ATOM   7225  N  N     . TRP A 1 977  ? -34.519 6.283   -31.241 1.00 103.44 ? 977  TRP A N     1 
ATOM   7226  C  CA    . TRP A 1 977  ? -35.224 6.315   -29.964 1.00 101.95 ? 977  TRP A CA    1 
ATOM   7227  C  C     . TRP A 1 977  ? -36.095 7.561   -29.833 1.00 107.08 ? 977  TRP A C     1 
ATOM   7228  O  O     . TRP A 1 977  ? -37.227 7.455   -29.372 1.00 108.61 ? 977  TRP A O     1 
ATOM   7229  C  CB    . TRP A 1 977  ? -34.216 6.285   -28.815 1.00 101.74 ? 977  TRP A CB    1 
ATOM   7230  C  CG    . TRP A 1 977  ? -34.819 6.219   -27.449 1.00 101.20 ? 977  TRP A CG    1 
ATOM   7231  C  CD1   . TRP A 1 977  ? -35.152 7.276   -26.642 1.00 103.45 ? 977  TRP A CD1   1 
ATOM   7232  C  CD2   . TRP A 1 977  ? -35.132 5.035   -26.708 1.00 100.51 ? 977  TRP A CD2   1 
ATOM   7233  N  NE1   . TRP A 1 977  ? -35.668 6.816   -25.451 1.00 104.77 ? 977  TRP A NE1   1 
ATOM   7234  C  CE2   . TRP A 1 977  ? -35.668 5.445   -25.467 1.00 102.98 ? 977  TRP A CE2   1 
ATOM   7235  C  CE3   . TRP A 1 977  ? -35.023 3.670   -26.976 1.00 104.67 ? 977  TRP A CE3   1 
ATOM   7236  C  CZ2   . TRP A 1 977  ? -36.098 4.535   -24.503 1.00 103.82 ? 977  TRP A CZ2   1 
ATOM   7237  C  CZ3   . TRP A 1 977  ? -35.446 2.767   -26.014 1.00 106.53 ? 977  TRP A CZ3   1 
ATOM   7238  C  CH2   . TRP A 1 977  ? -35.974 3.202   -24.794 1.00 103.85 ? 977  TRP A CH2   1 
ATOM   7239  N  N     . ARG A 1 978  ? -35.580 8.731   -30.226 1.00 105.64 ? 978  ARG A N     1 
ATOM   7240  C  CA    . ARG A 1 978  ? -36.366 9.981   -30.189 1.00 101.38 ? 978  ARG A CA    1 
ATOM   7241  C  C     . ARG A 1 978  ? -37.614 9.853   -31.037 1.00 106.99 ? 978  ARG A C     1 
ATOM   7242  O  O     . ARG A 1 978  ? -38.725 10.054  -30.557 1.00 116.36 ? 978  ARG A O     1 
ATOM   7243  C  CB    . ARG A 1 978  ? -35.604 11.185  -30.770 1.00 102.20 ? 978  ARG A CB    1 
ATOM   7244  C  CG    . ARG A 1 978  ? -34.374 11.658  -30.028 1.00 106.21 ? 978  ARG A CG    1 
ATOM   7245  C  CD    . ARG A 1 978  ? -34.654 12.127  -28.620 1.00 112.38 ? 978  ARG A CD    1 
ATOM   7246  N  NE    . ARG A 1 978  ? -33.395 12.220  -27.896 1.00 121.46 ? 978  ARG A NE    1 
ATOM   7247  C  CZ    . ARG A 1 978  ? -33.265 12.098  -26.579 1.00 136.18 ? 978  ARG A CZ    1 
ATOM   7248  N  NH1   . ARG A 1 978  ? -34.326 11.887  -25.794 1.00 142.12 ? 978  ARG A NH1   1 
ATOM   7249  N  NH2   . ARG A 1 978  ? -32.054 12.193  -26.041 1.00 132.65 ? 978  ARG A NH2   1 
ATOM   7250  N  N     . GLU A 1 979  ? -37.424 9.514   -32.306 1.00 113.83 ? 979  GLU A N     1 
ATOM   7251  C  CA    . GLU A 1 979  ? -38.522 9.433   -33.266 1.00 118.94 ? 979  GLU A CA    1 
ATOM   7252  C  C     . GLU A 1 979  ? -39.561 8.389   -32.860 1.00 117.40 ? 979  GLU A C     1 
ATOM   7253  O  O     . GLU A 1 979  ? -40.756 8.630   -33.016 1.00 130.75 ? 979  GLU A O     1 
ATOM   7254  C  CB    . GLU A 1 979  ? -38.021 9.193   -34.695 1.00 119.36 ? 979  GLU A CB    1 
ATOM   7255  C  CG    . GLU A 1 979  ? -38.981 9.753   -35.745 1.00 127.57 ? 979  GLU A CG    1 
ATOM   7256  C  CD    . GLU A 1 979  ? -38.416 9.755   -37.161 1.00 135.22 ? 979  GLU A CD    1 
ATOM   7257  O  OE1   . GLU A 1 979  ? -38.565 10.780  -37.866 1.00 123.96 ? 979  GLU A OE1   1 
ATOM   7258  O  OE2   . GLU A 1 979  ? -37.827 8.733   -37.584 1.00 156.30 ? 979  GLU A OE2   1 
ATOM   7259  N  N     . CYS A 1 980  ? -39.118 7.248   -32.332 1.00 116.30 ? 980  CYS A N     1 
ATOM   7260  C  CA    . CYS A 1 980  ? -40.047 6.212   -31.879 1.00 122.50 ? 980  CYS A CA    1 
ATOM   7261  C  C     . CYS A 1 980  ? -40.870 6.670   -30.676 1.00 116.54 ? 980  CYS A C     1 
ATOM   7262  O  O     . CYS A 1 980  ? -42.051 6.357   -30.597 1.00 121.58 ? 980  CYS A O     1 
ATOM   7263  C  CB    . CYS A 1 980  ? -39.334 4.916   -31.491 1.00 125.46 ? 980  CYS A CB    1 
ATOM   7264  S  SG    . CYS A 1 980  ? -40.500 3.641   -30.946 1.00 121.64 ? 980  CYS A SG    1 
ATOM   7265  N  N     . MET A 1 981  ? -40.255 7.406   -29.751 1.00 113.11 ? 981  MET A N     1 
ATOM   7266  C  CA    . MET A 1 981  ? -41.009 8.023   -28.639 1.00 110.87 ? 981  MET A CA    1 
ATOM   7267  C  C     . MET A 1 981  ? -42.050 9.035   -29.139 1.00 106.97 ? 981  MET A C     1 
ATOM   7268  O  O     . MET A 1 981  ? -43.142 9.101   -28.603 1.00 109.29 ? 981  MET A O     1 
ATOM   7269  C  CB    . MET A 1 981  ? -40.087 8.642   -27.576 1.00 105.70 ? 981  MET A CB    1 
ATOM   7270  C  CG    . MET A 1 981  ? -39.333 7.615   -26.736 1.00 109.85 ? 981  MET A CG    1 
ATOM   7271  S  SD    . MET A 1 981  ? -40.092 7.012   -25.200 1.00 108.04 ? 981  MET A SD    1 
ATOM   7272  C  CE    . MET A 1 981  ? -39.771 8.430   -24.141 1.00 110.11 ? 981  MET A CE    1 
ATOM   7273  N  N     . ALA A 1 982  ? -41.692 9.809   -30.165 1.00 102.95 ? 982  ALA A N     1 
ATOM   7274  C  CA    . ALA A 1 982  ? -42.577 10.820  -30.773 1.00 105.76 ? 982  ALA A CA    1 
ATOM   7275  C  C     . ALA A 1 982  ? -43.682 10.174  -31.604 1.00 117.89 ? 982  ALA A C     1 
ATOM   7276  O  O     . ALA A 1 982  ? -44.870 10.390  -31.340 1.00 125.37 ? 982  ALA A O     1 
ATOM   7277  C  CB    . ALA A 1 982  ? -41.750 11.788  -31.621 1.00 103.60 ? 982  ALA A CB    1 
ATOM   7278  N  N     . MET A 1 983  ? -43.287 9.380   -32.601 1.00 124.59 ? 983  MET A N     1 
ATOM   7279  C  CA    . MET A 1 983  ? -44.221 8.653   -33.459 1.00 117.92 ? 983  MET A CA    1 
ATOM   7280  C  C     . MET A 1 983  ? -45.268 7.883   -32.665 1.00 107.05 ? 983  MET A C     1 
ATOM   7281  O  O     . MET A 1 983  ? -46.458 7.974   -32.953 1.00 117.63 ? 983  MET A O     1 
ATOM   7282  C  CB    . MET A 1 983  ? -43.460 7.659   -34.370 1.00 125.46 ? 983  MET A CB    1 
ATOM   7283  C  CG    . MET A 1 983  ? -44.332 6.642   -35.129 1.00 124.00 ? 983  MET A CG    1 
ATOM   7284  S  SD    . MET A 1 983  ? -43.433 5.557   -36.272 1.00 107.26 ? 983  MET A SD    1 
ATOM   7285  C  CE    . MET A 1 983  ? -42.822 4.284   -35.166 1.00 104.72 ? 983  MET A CE    1 
ATOM   7286  N  N     . SER A 1 984  ? -44.811 7.124   -31.671 1.00 101.66 ? 984  SER A N     1 
ATOM   7287  C  CA    . SER A 1 984  ? -45.705 6.272   -30.882 1.00 99.37  ? 984  SER A CA    1 
ATOM   7288  C  C     . SER A 1 984  ? -46.605 7.035   -29.906 1.00 93.73  ? 984  SER A C     1 
ATOM   7289  O  O     . SER A 1 984  ? -47.620 6.501   -29.478 1.00 89.87  ? 984  SER A O     1 
ATOM   7290  C  CB    . SER A 1 984  ? -44.924 5.122   -30.178 1.00 101.75 ? 984  SER A CB    1 
ATOM   7291  O  OG    . SER A 1 984  ? -43.957 5.556   -29.231 1.00 93.37  ? 984  SER A OG    1 
ATOM   7292  N  N     . SER A 1 985  ? -46.235 8.270   -29.563 1.00 96.24  ? 985  SER A N     1 
ATOM   7293  C  CA    . SER A 1 985  ? -46.877 9.033   -28.491 1.00 104.83 ? 985  SER A CA    1 
ATOM   7294  C  C     . SER A 1 985  ? -46.807 8.232   -27.194 1.00 111.04 ? 985  SER A C     1 
ATOM   7295  O  O     . SER A 1 985  ? -47.810 7.958   -26.536 1.00 107.71 ? 985  SER A O     1 
ATOM   7296  C  CB    . SER A 1 985  ? -48.298 9.442   -28.852 1.00 107.72 ? 985  SER A CB    1 
ATOM   7297  O  OG    . SER A 1 985  ? -48.237 10.664  -29.550 1.00 117.95 ? 985  SER A OG    1 
ATOM   7298  N  N     . TYR A 1 986  ? -45.577 7.864   -26.851 1.00 117.06 ? 986  TYR A N     1 
ATOM   7299  C  CA    . TYR A 1 986  ? -45.275 6.991   -25.718 1.00 117.72 ? 986  TYR A CA    1 
ATOM   7300  C  C     . TYR A 1 986  ? -45.766 7.550   -24.381 1.00 124.04 ? 986  TYR A C     1 
ATOM   7301  O  O     . TYR A 1 986  ? -46.448 6.855   -23.623 1.00 120.99 ? 986  TYR A O     1 
ATOM   7302  C  CB    . TYR A 1 986  ? -43.760 6.794   -25.652 1.00 114.55 ? 986  TYR A CB    1 
ATOM   7303  C  CG    . TYR A 1 986  ? -43.354 5.863   -24.552 1.00 116.44 ? 986  TYR A CG    1 
ATOM   7304  C  CD1   . TYR A 1 986  ? -43.322 4.494   -24.767 1.00 115.30 ? 986  TYR A CD1   1 
ATOM   7305  C  CD2   . TYR A 1 986  ? -43.039 6.340   -23.276 1.00 121.78 ? 986  TYR A CD2   1 
ATOM   7306  C  CE1   . TYR A 1 986  ? -42.965 3.617   -23.757 1.00 113.74 ? 986  TYR A CE1   1 
ATOM   7307  C  CE2   . TYR A 1 986  ? -42.678 5.471   -22.260 1.00 118.40 ? 986  TYR A CE2   1 
ATOM   7308  C  CZ    . TYR A 1 986  ? -42.642 4.109   -22.515 1.00 111.59 ? 986  TYR A CZ    1 
ATOM   7309  O  OH    . TYR A 1 986  ? -42.294 3.219   -21.540 1.00 108.45 ? 986  TYR A OH    1 
ATOM   7310  N  N     . SER A 1 987  ? -45.416 8.803   -24.104 1.00 131.32 ? 987  SER A N     1 
ATOM   7311  C  CA    . SER A 1 987  ? -45.716 9.444   -22.817 1.00 121.42 ? 987  SER A CA    1 
ATOM   7312  C  C     . SER A 1 987  ? -47.215 9.527   -22.535 1.00 123.18 ? 987  SER A C     1 
ATOM   7313  O  O     . SER A 1 987  ? -47.642 9.245   -21.420 1.00 100.37 ? 987  SER A O     1 
ATOM   7314  C  CB    . SER A 1 987  ? -45.111 10.845  -22.785 1.00 117.23 ? 987  SER A CB    1 
ATOM   7315  O  OG    . SER A 1 987  ? -44.234 11.013  -23.878 1.00 111.93 ? 987  SER A OG    1 
ATOM   7316  N  N     . LEU A 1 988  ? -48.005 9.903   -23.543 1.00 124.16 ? 988  LEU A N     1 
ATOM   7317  C  CA    . LEU A 1 988  ? -49.467 9.972   -23.409 1.00 118.66 ? 988  LEU A CA    1 
ATOM   7318  C  C     . LEU A 1 988  ? -50.096 8.586   -23.207 1.00 121.59 ? 988  LEU A C     1 
ATOM   7319  O  O     . LEU A 1 988  ? -50.960 8.402   -22.349 1.00 131.47 ? 988  LEU A O     1 
ATOM   7320  C  CB    . LEU A 1 988  ? -50.072 10.593  -24.677 1.00 114.06 ? 988  LEU A CB    1 
ATOM   7321  C  CG    . LEU A 1 988  ? -49.830 12.084  -24.956 1.00 112.59 ? 988  LEU A CG    1 
ATOM   7322  C  CD1   . LEU A 1 988  ? -49.176 12.344  -26.309 1.00 107.59 ? 988  LEU A CD1   1 
ATOM   7323  C  CD2   . LEU A 1 988  ? -51.135 12.857  -24.840 1.00 107.37 ? 988  LEU A CD2   1 
ATOM   7324  N  N     . ARG A 1 989  ? -49.655 7.618   -24.000 1.00 120.69 ? 989  ARG A N     1 
ATOM   7325  C  CA    . ARG A 1 989  ? -50.125 6.245   -23.859 1.00 113.53 ? 989  ARG A CA    1 
ATOM   7326  C  C     . ARG A 1 989  ? -49.659 5.564   -22.576 1.00 110.69 ? 989  ARG A C     1 
ATOM   7327  O  O     . ARG A 1 989  ? -50.294 4.614   -22.124 1.00 101.96 ? 989  ARG A O     1 
ATOM   7328  C  CB    . ARG A 1 989  ? -49.708 5.414   -25.043 1.00 113.62 ? 989  ARG A CB    1 
ATOM   7329  C  CG    . ARG A 1 989  ? -50.341 5.859   -26.335 1.00 106.88 ? 989  ARG A CG    1 
ATOM   7330  C  CD    . ARG A 1 989  ? -49.616 5.169   -27.464 1.00 109.91 ? 989  ARG A CD    1 
ATOM   7331  N  NE    . ARG A 1 989  ? -49.599 3.718   -27.288 1.00 109.02 ? 989  ARG A NE    1 
ATOM   7332  C  CZ    . ARG A 1 989  ? -48.793 2.890   -27.950 1.00 123.34 ? 989  ARG A CZ    1 
ATOM   7333  N  NH1   . ARG A 1 989  ? -47.922 3.340   -28.853 1.00 131.20 ? 989  ARG A NH1   1 
ATOM   7334  N  NH2   . ARG A 1 989  ? -48.862 1.595   -27.710 1.00 127.51 ? 989  ARG A NH2   1 
ATOM   7335  N  N     . LYS A 1 990  ? -48.552 6.024   -21.996 1.00 106.00 ? 990  LYS A N     1 
ATOM   7336  C  CA    . LYS A 1 990  ? -48.082 5.476   -20.717 1.00 109.21 ? 990  LYS A CA    1 
ATOM   7337  C  C     . LYS A 1 990  ? -49.104 5.736   -19.604 1.00 115.70 ? 990  LYS A C     1 
ATOM   7338  O  O     . LYS A 1 990  ? -49.459 4.816   -18.867 1.00 117.45 ? 990  LYS A O     1 
ATOM   7339  C  CB    . LYS A 1 990  ? -46.695 5.998   -20.307 1.00 113.12 ? 990  LYS A CB    1 
ATOM   7340  C  CG    . LYS A 1 990  ? -46.158 5.431   -18.983 1.00 107.60 ? 990  LYS A CG    1 
ATOM   7341  C  CD    . LYS A 1 990  ? -45.673 3.990   -19.142 1.00 116.80 ? 990  LYS A CD    1 
ATOM   7342  C  CE    . LYS A 1 990  ? -45.799 3.148   -17.868 1.00 118.15 ? 990  LYS A CE    1 
ATOM   7343  N  NZ    . LYS A 1 990  ? -45.817 1.677   -18.156 1.00 111.05 ? 990  LYS A NZ    1 
ATOM   7344  N  N     . VAL A 1 991  ? -49.590 6.967   -19.493 1.00 120.43 ? 991  VAL A N     1 
ATOM   7345  C  CA    . VAL A 1 991  ? -50.615 7.307   -18.494 1.00 120.77 ? 991  VAL A CA    1 
ATOM   7346  C  C     . VAL A 1 991  ? -51.969 6.665   -18.808 1.00 121.50 ? 991  VAL A C     1 
ATOM   7347  O  O     . VAL A 1 991  ? -52.723 6.353   -17.895 1.00 132.81 ? 991  VAL A O     1 
ATOM   7348  C  CB    . VAL A 1 991  ? -50.745 8.830   -18.276 1.00 118.50 ? 991  VAL A CB    1 
ATOM   7349  C  CG1   . VAL A 1 991  ? -49.429 9.391   -17.750 1.00 125.08 ? 991  VAL A CG1   1 
ATOM   7350  C  CG2   . VAL A 1 991  ? -51.159 9.539   -19.554 1.00 120.28 ? 991  VAL A CG2   1 
ATOM   7351  N  N     . ALA A 1 992  ? -52.264 6.461   -20.089 1.00 116.68 ? 992  ALA A N     1 
ATOM   7352  C  CA    . ALA A 1 992  ? -53.458 5.725   -20.508 1.00 113.01 ? 992  ALA A CA    1 
ATOM   7353  C  C     . ALA A 1 992  ? -53.453 4.278   -19.982 1.00 111.99 ? 992  ALA A C     1 
ATOM   7354  O  O     . ALA A 1 992  ? -54.490 3.772   -19.542 1.00 104.95 ? 992  ALA A O     1 
ATOM   7355  C  CB    . ALA A 1 992  ? -53.582 5.752   -22.019 1.00 116.58 ? 992  ALA A CB    1 
ATOM   7356  N  N     . VAL A 1 993  ? -52.284 3.635   -20.016 1.00 109.71 ? 993  VAL A N     1 
ATOM   7357  C  CA    . VAL A 1 993  ? -52.110 2.269   -19.510 1.00 112.02 ? 993  VAL A CA    1 
ATOM   7358  C  C     . VAL A 1 993  ? -52.132 2.207   -17.976 1.00 105.30 ? 993  VAL A C     1 
ATOM   7359  O  O     . VAL A 1 993  ? -52.696 1.280   -17.400 1.00 90.21  ? 993  VAL A O     1 
ATOM   7360  C  CB    . VAL A 1 993  ? -50.783 1.670   -20.044 1.00 109.71 ? 993  VAL A CB    1 
ATOM   7361  C  CG1   . VAL A 1 993  ? -50.379 0.392   -19.310 1.00 105.97 ? 993  VAL A CG1   1 
ATOM   7362  C  CG2   . VAL A 1 993  ? -50.927 1.398   -21.527 1.00 109.62 ? 993  VAL A CG2   1 
ATOM   7363  N  N     . GLU A 1 994  ? -51.507 3.178   -17.321 1.00 107.85 ? 994  GLU A N     1 
ATOM   7364  C  CA    . GLU A 1 994  ? -51.564 3.295   -15.852 1.00 119.56 ? 994  GLU A CA    1 
ATOM   7365  C  C     . GLU A 1 994  ? -52.993 3.556   -15.376 1.00 109.93 ? 994  GLU A C     1 
ATOM   7366  O  O     . GLU A 1 994  ? -53.422 3.010   -14.366 1.00 91.01  ? 994  GLU A O     1 
ATOM   7367  C  CB    . GLU A 1 994  ? -50.643 4.410   -15.336 1.00 135.25 ? 994  GLU A CB    1 
ATOM   7368  C  CG    . GLU A 1 994  ? -49.150 4.076   -15.350 1.00 143.00 ? 994  GLU A CG    1 
ATOM   7369  C  CD    . GLU A 1 994  ? -48.260 5.316   -15.274 1.00 139.83 ? 994  GLU A CD    1 
ATOM   7370  O  OE1   . GLU A 1 994  ? -48.649 6.300   -14.602 1.00 115.32 ? 994  GLU A OE1   1 
ATOM   7371  O  OE2   . GLU A 1 994  ? -47.171 5.310   -15.895 1.00 143.64 ? 994  GLU A OE2   1 
ATOM   7372  N  N     . LYS A 1 995  ? -53.706 4.406   -16.117 1.00 114.38 ? 995  LYS A N     1 
ATOM   7373  C  CA    . LYS A 1 995  ? -55.124 4.742   -15.884 1.00 118.39 ? 995  LYS A CA    1 
ATOM   7374  C  C     . LYS A 1 995  ? -56.015 3.513   -15.992 1.00 118.73 ? 995  LYS A C     1 
ATOM   7375  O  O     . LYS A 1 995  ? -56.867 3.267   -15.127 1.00 110.13 ? 995  LYS A O     1 
ATOM   7376  C  CB    . LYS A 1 995  ? -55.580 5.758   -16.959 1.00 108.83 ? 995  LYS A CB    1 
ATOM   7377  C  CG    . LYS A 1 995  ? -57.041 6.189   -16.953 1.00 110.80 ? 995  LYS A CG    1 
ATOM   7378  C  CD    . LYS A 1 995  ? -57.304 7.190   -18.083 1.00 118.84 ? 995  LYS A CD    1 
ATOM   7379  C  CE    . LYS A 1 995  ? -58.555 8.046   -17.862 1.00 120.95 ? 995  LYS A CE    1 
ATOM   7380  N  NZ    . LYS A 1 995  ? -59.813 7.257   -17.696 1.00 116.34 ? 995  LYS A NZ    1 
ATOM   7381  N  N     . PHE A 1 996  ? -55.823 2.774   -17.085 1.00 118.03 ? 996  PHE A N     1 
ATOM   7382  C  CA    . PHE A 1 996  ? -56.530 1.523   -17.337 1.00 109.14 ? 996  PHE A CA    1 
ATOM   7383  C  C     . PHE A 1 996  ? -56.318 0.560   -16.167 1.00 102.58 ? 996  PHE A C     1 
ATOM   7384  O  O     . PHE A 1 996  ? -57.278 0.096   -15.560 1.00 98.45  ? 996  PHE A O     1 
ATOM   7385  C  CB    . PHE A 1 996  ? -56.070 0.923   -18.684 1.00 108.41 ? 996  PHE A CB    1 
ATOM   7386  C  CG    . PHE A 1 996  ? -56.735 -0.389  -19.043 1.00 100.82 ? 996  PHE A CG    1 
ATOM   7387  C  CD1   . PHE A 1 996  ? -56.218 -1.605  -18.584 1.00 101.21 ? 996  PHE A CD1   1 
ATOM   7388  C  CD2   . PHE A 1 996  ? -57.856 -0.413  -19.855 1.00 92.82  ? 996  PHE A CD2   1 
ATOM   7389  C  CE1   . PHE A 1 996  ? -56.818 -2.807  -18.911 1.00 92.95  ? 996  PHE A CE1   1 
ATOM   7390  C  CE2   . PHE A 1 996  ? -58.453 -1.606  -20.193 1.00 89.29  ? 996  PHE A CE2   1 
ATOM   7391  C  CZ    . PHE A 1 996  ? -57.937 -2.804  -19.713 1.00 94.76  ? 996  PHE A CZ    1 
ATOM   7392  N  N     . ASN A 1 997  ? -55.059 0.310   -15.826 1.00 101.08 ? 997  ASN A N     1 
ATOM   7393  C  CA    . ASN A 1 997  ? -54.711 -0.675  -14.784 1.00 97.39  ? 997  ASN A CA    1 
ATOM   7394  C  C     . ASN A 1 997  ? -55.208 -0.328  -13.389 1.00 107.75 ? 997  ASN A C     1 
ATOM   7395  O  O     . ASN A 1 997  ? -55.411 -1.221  -12.580 1.00 95.86  ? 997  ASN A O     1 
ATOM   7396  C  CB    . ASN A 1 997  ? -53.208 -0.913  -14.708 1.00 95.41  ? 997  ASN A CB    1 
ATOM   7397  C  CG    . ASN A 1 997  ? -52.643 -1.482  -15.986 1.00 93.90  ? 997  ASN A CG    1 
ATOM   7398  O  OD1   . ASN A 1 997  ? -53.314 -2.233  -16.683 1.00 92.79  ? 997  ASN A OD1   1 
ATOM   7399  N  ND2   . ASN A 1 997  ? -51.397 -1.119  -16.305 1.00 93.14  ? 997  ASN A ND2   1 
ATOM   7400  N  N     . ALA A 1 998  ? -55.403 0.957   -13.117 1.00 119.55 ? 998  ALA A N     1 
ATOM   7401  C  CA    . ALA A 1 998  ? -56.049 1.413   -11.887 1.00 126.40 ? 998  ALA A CA    1 
ATOM   7402  C  C     . ALA A 1 998  ? -57.570 1.129   -11.867 1.00 133.57 ? 998  ALA A C     1 
ATOM   7403  O  O     . ALA A 1 998  ? -58.174 1.066   -10.790 1.00 122.67 ? 998  ALA A O     1 
ATOM   7404  C  CB    . ALA A 1 998  ? -55.796 2.901   -11.711 1.00 123.02 ? 998  ALA A CB    1 
ATOM   7405  N  N     . GLU A 1 999  ? -58.179 0.970   -13.044 1.00 138.15 ? 999  GLU A N     1 
ATOM   7406  C  CA    . GLU A 1 999  ? -59.623 0.769   -13.199 1.00 128.27 ? 999  GLU A CA    1 
ATOM   7407  C  C     . GLU A 1 999  ? -60.010 -0.688  -13.553 1.00 129.99 ? 999  GLU A C     1 
ATOM   7408  O  O     . GLU A 1 999  ? -61.196 -0.995  -13.651 1.00 157.94 ? 999  GLU A O     1 
ATOM   7409  C  CB    . GLU A 1 999  ? -60.141 1.650   -14.355 1.00 112.30 ? 999  GLU A CB    1 
ATOM   7410  C  CG    . GLU A 1 999  ? -59.996 3.158   -14.204 1.00 112.83 ? 999  GLU A CG    1 
ATOM   7411  C  CD    . GLU A 1 999  ? -60.339 3.930   -15.488 1.00 113.66 ? 999  GLU A CD    1 
ATOM   7412  O  OE1   . GLU A 1 999  ? -60.125 3.406   -16.598 1.00 131.51 ? 999  GLU A OE1   1 
ATOM   7413  O  OE2   . GLU A 1 999  ? -60.805 5.084   -15.411 1.00 106.66 ? 999  GLU A OE2   1 
ATOM   7414  N  N     . ASN A 1 1000 ? -59.028 -1.568  -13.741 1.00 111.25 ? 1000 ASN A N     1 
ATOM   7415  C  CA    . ASN A 1 1000 ? -59.284 -2.925  -14.151 1.00 103.30 ? 1000 ASN A CA    1 
ATOM   7416  C  C     . ASN A 1 1000 ? -58.439 -3.916  -13.384 1.00 102.27 ? 1000 ASN A C     1 
ATOM   7417  O  O     . ASN A 1 1000 ? -57.225 -3.834  -13.411 1.00 101.42 ? 1000 ASN A O     1 
ATOM   7418  C  CB    . ASN A 1 1000 ? -59.002 -3.050  -15.639 1.00 113.60 ? 1000 ASN A CB    1 
ATOM   7419  C  CG    . ASN A 1 1000 ? -60.125 -2.478  -16.494 1.00 129.07 ? 1000 ASN A CG    1 
ATOM   7420  O  OD1   . ASN A 1 1000 ? -61.253 -2.965  -16.441 1.00 141.70 ? 1000 ASN A OD1   1 
ATOM   7421  N  ND2   . ASN A 1 1000 ? -59.826 -1.450  -17.287 1.00 128.20 ? 1000 ASN A ND2   1 
ATOM   7422  N  N     . TYR A 1 1001 ? -59.093 -4.835  -12.691 1.00 104.99 ? 1001 TYR A N     1 
ATOM   7423  C  CA    . TYR A 1 1001 ? -58.441 -5.778  -11.774 1.00 101.11 ? 1001 TYR A CA    1 
ATOM   7424  C  C     . TYR A 1 1001 ? -58.083 -7.092  -12.449 1.00 104.28 ? 1001 TYR A C     1 
ATOM   7425  O  O     . TYR A 1 1001 ? -57.021 -7.647  -12.162 1.00 107.66 ? 1001 TYR A O     1 
ATOM   7426  C  CB    . TYR A 1 1001 ? -59.329 -6.099  -10.575 1.00 98.49  ? 1001 TYR A CB    1 
ATOM   7427  C  CG    . TYR A 1 1001 ? -58.618 -6.769  -9.398  1.00 96.65  ? 1001 TYR A CG    1 
ATOM   7428  C  CD1   . TYR A 1 1001 ? -57.735 -6.051  -8.586  1.00 98.53  ? 1001 TYR A CD1   1 
ATOM   7429  C  CD2   . TYR A 1 1001 ? -58.857 -8.103  -9.075  1.00 92.92  ? 1001 TYR A CD2   1 
ATOM   7430  C  CE1   . TYR A 1 1001 ? -57.095 -6.646  -7.501  1.00 96.73  ? 1001 TYR A CE1   1 
ATOM   7431  C  CE2   . TYR A 1 1001 ? -58.225 -8.709  -7.995  1.00 95.37  ? 1001 TYR A CE2   1 
ATOM   7432  C  CZ    . TYR A 1 1001 ? -57.346 -7.980  -7.204  1.00 98.66  ? 1001 TYR A CZ    1 
ATOM   7433  O  OH    . TYR A 1 1001 ? -56.718 -8.578  -6.117  1.00 98.82  ? 1001 TYR A OH    1 
ATOM   7434  N  N     . TRP A 1 1002 ? -58.950 -7.583  -13.349 1.00 106.25 ? 1002 TRP A N     1 
ATOM   7435  C  CA    . TRP A 1 1002 ? -58.726 -8.849  -14.053 1.00 111.42 ? 1002 TRP A CA    1 
ATOM   7436  C  C     . TRP A 1 1002 ? -58.135 -8.747  -15.485 1.00 116.96 ? 1002 TRP A C     1 
ATOM   7437  O  O     . TRP A 1 1002 ? -57.828 -9.780  -16.090 1.00 112.97 ? 1002 TRP A O     1 
ATOM   7438  C  CB    . TRP A 1 1002 ? -60.042 -9.577  -14.105 1.00 112.77 ? 1002 TRP A CB    1 
ATOM   7439  C  CG    . TRP A 1 1002 ? -60.615 -9.886  -12.765 1.00 108.58 ? 1002 TRP A CG    1 
ATOM   7440  C  CD1   . TRP A 1 1002 ? -61.841 -9.517  -12.312 1.00 101.47 ? 1002 TRP A CD1   1 
ATOM   7441  C  CD2   . TRP A 1 1002 ? -60.009 -10.663 -11.712 1.00 107.90 ? 1002 TRP A CD2   1 
ATOM   7442  N  NE1   . TRP A 1 1002 ? -62.045 -10.011 -11.049 1.00 101.76 ? 1002 TRP A NE1   1 
ATOM   7443  C  CE2   . TRP A 1 1002 ? -60.940 -10.717 -10.651 1.00 99.46  ? 1002 TRP A CE2   1 
ATOM   7444  C  CE3   . TRP A 1 1002 ? -58.776 -11.319 -11.565 1.00 109.70 ? 1002 TRP A CE3   1 
ATOM   7445  C  CZ2   . TRP A 1 1002 ? -60.683 -11.397 -9.445  1.00 89.13  ? 1002 TRP A CZ2   1 
ATOM   7446  C  CZ3   . TRP A 1 1002 ? -58.520 -11.993 -10.365 1.00 110.77 ? 1002 TRP A CZ3   1 
ATOM   7447  C  CH2   . TRP A 1 1002 ? -59.478 -12.019 -9.317  1.00 96.14  ? 1002 TRP A CH2   1 
ATOM   7448  N  N     . LYS A 1 1003 ? -58.020 -7.523  -16.001 1.00 117.77 ? 1003 LYS A N     1 
ATOM   7449  C  CA    . LYS A 1 1003 ? -57.397 -7.248  -17.299 1.00 108.75 ? 1003 LYS A CA    1 
ATOM   7450  C  C     . LYS A 1 1003 ? -56.426 -6.079  -17.151 1.00 113.46 ? 1003 LYS A C     1 
ATOM   7451  O  O     . LYS A 1 1003 ? -56.852 -5.031  -16.751 1.00 126.96 ? 1003 LYS A O     1 
ATOM   7452  C  CB    . LYS A 1 1003 ? -58.481 -6.907  -18.321 1.00 104.85 ? 1003 LYS A CB    1 
ATOM   7453  C  CG    . LYS A 1 1003 ? -59.435 -8.057  -18.625 1.00 98.06  ? 1003 LYS A CG    1 
ATOM   7454  C  CD    . LYS A 1 1003 ? -59.384 -8.486  -20.081 1.00 89.92  ? 1003 LYS A CD    1 
ATOM   7455  C  CE    . LYS A 1 1003 ? -59.802 -9.933  -20.262 1.00 89.23  ? 1003 LYS A CE    1 
ATOM   7456  N  NZ    . LYS A 1 1003 ? -61.247 -10.083 -20.562 1.00 92.04  ? 1003 LYS A NZ    1 
ATOM   7457  N  N     . LYS A 1 1004 ? -55.154 -6.282  -17.507 1.00 105.06 ? 1004 LYS A N     1 
ATOM   7458  C  CA    . LYS A 1 1004 ? -54.149 -5.232  -17.410 1.00 105.82 ? 1004 LYS A CA    1 
ATOM   7459  C  C     . LYS A 1 1004 ? -53.512 -4.946  -18.762 1.00 104.51 ? 1004 LYS A C     1 
ATOM   7460  O  O     . LYS A 1 1004 ? -53.424 -5.834  -19.608 1.00 123.92 ? 1004 LYS A O     1 
ATOM   7461  C  CB    . LYS A 1 1004 ? -53.069 -5.678  -16.439 1.00 108.06 ? 1004 LYS A CB    1 
ATOM   7462  C  CG    . LYS A 1 1004 ? -53.558 -5.805  -15.014 1.00 113.83 ? 1004 LYS A CG    1 
ATOM   7463  C  CD    . LYS A 1 1004 ? -53.711 -4.443  -14.343 1.00 120.12 ? 1004 LYS A CD    1 
ATOM   7464  C  CE    . LYS A 1 1004 ? -54.109 -4.605  -12.886 1.00 119.39 ? 1004 LYS A CE    1 
ATOM   7465  N  NZ    . LYS A 1 1004 ? -53.948 -3.360  -12.096 1.00 123.81 ? 1004 LYS A NZ    1 
ATOM   7466  N  N     . LYS A 1 1005 ? -53.096 -3.702  -18.957 1.00 93.98  ? 1005 LYS A N     1 
ATOM   7467  C  CA    . LYS A 1 1005 ? -52.288 -3.337  -20.097 1.00 93.08  ? 1005 LYS A CA    1 
ATOM   7468  C  C     . LYS A 1 1005 ? -50.856 -3.099  -19.686 1.00 98.17  ? 1005 LYS A C     1 
ATOM   7469  O  O     . LYS A 1 1005 ? -50.568 -2.880  -18.514 1.00 100.84 ? 1005 LYS A O     1 
ATOM   7470  C  CB    . LYS A 1 1005 ? -52.815 -2.085  -20.768 1.00 89.88  ? 1005 LYS A CB    1 
ATOM   7471  C  CG    . LYS A 1 1005 ? -54.097 -2.295  -21.523 1.00 86.02  ? 1005 LYS A CG    1 
ATOM   7472  C  CD    . LYS A 1 1005 ? -54.441 -1.046  -22.315 1.00 84.84  ? 1005 LYS A CD    1 
ATOM   7473  C  CE    . LYS A 1 1005 ? -55.938 -0.809  -22.394 1.00 84.71  ? 1005 LYS A CE    1 
ATOM   7474  N  NZ    . LYS A 1 1005 ? -56.295 -0.113  -23.654 1.00 89.12  ? 1005 LYS A NZ    1 
ATOM   7475  N  N     . GLY A 1 1006 ? -49.957 -3.187  -20.657 1.00 102.60 ? 1006 GLY A N     1 
ATOM   7476  C  CA    . GLY A 1 1006 ? -48.552 -2.890  -20.461 1.00 96.61  ? 1006 GLY A CA    1 
ATOM   7477  C  C     . GLY A 1 1006 ? -47.950 -2.288  -21.723 1.00 93.16  ? 1006 GLY A C     1 
ATOM   7478  O  O     . GLY A 1 1006 ? -48.444 -2.497  -22.829 1.00 84.20  ? 1006 GLY A O     1 
ATOM   7479  N  N     . LEU A 1 1007 ? -46.869 -1.515  -21.530 1.00 95.74  ? 1007 LEU A N     1 
ATOM   7480  C  CA    . LEU A 1 1007 ? -46.134 -0.905  -22.609 1.00 95.34  ? 1007 LEU A CA    1 
ATOM   7481  C  C     . LEU A 1 1007 ? -44.647 -1.078  -22.329 1.00 94.71  ? 1007 LEU A C     1 
ATOM   7482  O  O     . LEU A 1 1007 ? -44.202 -1.080  -21.182 1.00 89.92  ? 1007 LEU A O     1 
ATOM   7483  C  CB    . LEU A 1 1007 ? -46.434 0.582   -22.607 1.00 97.73  ? 1007 LEU A CB    1 
ATOM   7484  C  CG    . LEU A 1 1007 ? -46.099 1.329   -23.887 1.00 104.15 ? 1007 LEU A CG    1 
ATOM   7485  C  CD1   . LEU A 1 1007 ? -47.064 0.933   -24.993 1.00 109.69 ? 1007 LEU A CD1   1 
ATOM   7486  C  CD2   . LEU A 1 1007 ? -46.184 2.818   -23.642 1.00 109.93 ? 1007 LEU A CD2   1 
ATOM   7487  N  N     . ALA A 1 1008 ? -43.882 -1.236  -23.399 1.00 93.39  ? 1008 ALA A N     1 
ATOM   7488  C  CA    . ALA A 1 1008 ? -42.428 -1.338  -23.307 1.00 93.35  ? 1008 ALA A CA    1 
ATOM   7489  C  C     . ALA A 1 1008 ? -41.784 -0.707  -24.524 1.00 95.85  ? 1008 ALA A C     1 
ATOM   7490  O  O     . ALA A 1 1008 ? -42.391 -0.653  -25.575 1.00 94.97  ? 1008 ALA A O     1 
ATOM   7491  C  CB    . ALA A 1 1008 ? -41.994 -2.789  -23.234 1.00 87.39  ? 1008 ALA A CB    1 
ATOM   7492  N  N     . MET A 1 1009 ? -40.543 -0.249  -24.366 1.00 101.56 ? 1009 MET A N     1 
ATOM   7493  C  CA    . MET A 1 1009 ? -39.733 0.174   -25.496 1.00 104.45 ? 1009 MET A CA    1 
ATOM   7494  C  C     . MET A 1 1009 ? -38.283 -0.303  -25.317 1.00 106.13 ? 1009 MET A C     1 
ATOM   7495  O  O     . MET A 1 1009 ? -37.664 -0.101  -24.260 1.00 103.27 ? 1009 MET A O     1 
ATOM   7496  C  CB    . MET A 1 1009 ? -39.775 1.694   -25.654 1.00 98.23  ? 1009 MET A CB    1 
ATOM   7497  C  CG    . MET A 1 1009 ? -39.052 2.148   -26.914 1.00 100.71 ? 1009 MET A CG    1 
ATOM   7498  S  SD    . MET A 1 1009 ? -38.983 3.911   -27.198 1.00 90.83  ? 1009 MET A SD    1 
ATOM   7499  C  CE    . MET A 1 1009 ? -40.721 4.265   -27.396 1.00 90.71  ? 1009 MET A CE    1 
ATOM   7500  N  N     . VAL A 1 1010 ? -37.766 -0.939  -26.374 1.00 93.07  ? 1010 VAL A N     1 
ATOM   7501  C  CA    . VAL A 1 1010 ? -36.401 -1.442  -26.401 1.00 94.72  ? 1010 VAL A CA    1 
ATOM   7502  C  C     . VAL A 1 1010 ? -35.688 -0.813  -27.602 1.00 95.84  ? 1010 VAL A C     1 
ATOM   7503  O  O     . VAL A 1 1010 ? -36.317 -0.590  -28.637 1.00 90.50  ? 1010 VAL A O     1 
ATOM   7504  C  CB    . VAL A 1 1010 ? -36.342 -2.986  -26.518 1.00 95.51  ? 1010 VAL A CB    1 
ATOM   7505  C  CG1   . VAL A 1 1010 ? -37.049 -3.633  -25.346 1.00 96.40  ? 1010 VAL A CG1   1 
ATOM   7506  C  CG2   . VAL A 1 1010 ? -36.953 -3.484  -27.820 1.00 99.30  ? 1010 VAL A CG2   1 
ATOM   7507  N  N     . PRO A 1 1011 ? -34.383 -0.505  -27.452 1.00 100.57 ? 1011 PRO A N     1 
ATOM   7508  C  CA    . PRO A 1 1011 ? -33.554 -0.004  -28.556 1.00 101.56 ? 1011 PRO A CA    1 
ATOM   7509  C  C     . PRO A 1 1011 ? -32.738 -1.145  -29.210 1.00 109.02 ? 1011 PRO A C     1 
ATOM   7510  O  O     . PRO A 1 1011 ? -32.613 -2.253  -28.645 1.00 103.34 ? 1011 PRO A O     1 
ATOM   7511  C  CB    . PRO A 1 1011 ? -32.639 0.971   -27.845 1.00 98.45  ? 1011 PRO A CB    1 
ATOM   7512  C  CG    . PRO A 1 1011 ? -32.403 0.293   -26.516 1.00 98.67  ? 1011 PRO A CG    1 
ATOM   7513  C  CD    . PRO A 1 1011 ? -33.589 -0.576  -26.211 1.00 96.34  ? 1011 PRO A CD    1 
ATOM   7514  N  N     . LEU A 1 1012 ? -32.171 -0.853  -30.378 1.00 105.23 ? 1012 LEU A N     1 
ATOM   7515  C  CA    . LEU A 1 1012 ? -31.407 -1.820  -31.147 1.00 97.66  ? 1012 LEU A CA    1 
ATOM   7516  C  C     . LEU A 1 1012 ? -30.097 -1.208  -31.617 1.00 99.16  ? 1012 LEU A C     1 
ATOM   7517  O  O     . LEU A 1 1012 ? -30.105 -0.187  -32.312 1.00 92.71  ? 1012 LEU A O     1 
ATOM   7518  C  CB    . LEU A 1 1012 ? -32.270 -2.229  -32.322 1.00 100.33 ? 1012 LEU A CB    1 
ATOM   7519  C  CG    . LEU A 1 1012 ? -31.819 -3.410  -33.159 1.00 102.83 ? 1012 LEU A CG    1 
ATOM   7520  C  CD1   . LEU A 1 1012 ? -32.338 -4.713  -32.575 1.00 95.29  ? 1012 LEU A CD1   1 
ATOM   7521  C  CD2   . LEU A 1 1012 ? -32.305 -3.195  -34.586 1.00 107.63 ? 1012 LEU A CD2   1 
ATOM   7522  N  N     . LYS A 1 1013 ? -28.974 -1.825  -31.232 1.00 93.76  ? 1013 LYS A N     1 
ATOM   7523  C  CA    . LYS A 1 1013 ? -27.739 -1.734  -32.012 1.00 97.59  ? 1013 LYS A CA    1 
ATOM   7524  C  C     . LYS A 1 1013 ? -27.421 -3.155  -32.460 1.00 106.74 ? 1013 LYS A C     1 
ATOM   7525  O  O     . LYS A 1 1013 ? -27.112 -4.016  -31.613 1.00 110.55 ? 1013 LYS A O     1 
ATOM   7526  C  CB    . LYS A 1 1013 ? -26.582 -1.160  -31.185 1.00 99.99  ? 1013 LYS A CB    1 
ATOM   7527  C  CG    . LYS A 1 1013 ? -25.249 -1.092  -31.940 1.00 101.62 ? 1013 LYS A CG    1 
ATOM   7528  C  CD    . LYS A 1 1013 ? -24.123 -0.370  -31.192 1.00 91.86  ? 1013 LYS A CD    1 
ATOM   7529  C  CE    . LYS A 1 1013 ? -23.544 -1.162  -30.013 1.00 88.83  ? 1013 LYS A CE    1 
ATOM   7530  N  NZ    . LYS A 1 1013 ? -23.214 -2.602  -30.242 1.00 88.41  ? 1013 LYS A NZ    1 
ATOM   7531  N  N     . PHE A 1 1014 ? -27.561 -3.411  -33.763 1.00 110.01 ? 1014 PHE A N     1 
ATOM   7532  C  CA    . PHE A 1 1014 ? -27.275 -4.722  -34.322 1.00 104.73 ? 1014 PHE A CA    1 
ATOM   7533  C  C     . PHE A 1 1014 ? -26.054 -4.606  -35.233 1.00 101.69 ? 1014 PHE A C     1 
ATOM   7534  O  O     . PHE A 1 1014 ? -26.151 -4.079  -36.354 1.00 101.54 ? 1014 PHE A O     1 
ATOM   7535  C  CB    . PHE A 1 1014 ? -28.447 -5.279  -35.122 1.00 103.78 ? 1014 PHE A CB    1 
ATOM   7536  C  CG    . PHE A 1 1014 ? -28.199 -6.665  -35.656 1.00 99.92  ? 1014 PHE A CG    1 
ATOM   7537  C  CD1   . PHE A 1 1014 ? -28.104 -7.737  -34.792 1.00 100.76 ? 1014 PHE A CD1   1 
ATOM   7538  C  CD2   . PHE A 1 1014 ? -28.053 -6.895  -37.012 1.00 97.31  ? 1014 PHE A CD2   1 
ATOM   7539  C  CE1   . PHE A 1 1014 ? -27.874 -9.013  -35.264 1.00 98.83  ? 1014 PHE A CE1   1 
ATOM   7540  C  CE2   . PHE A 1 1014 ? -27.825 -8.169  -37.495 1.00 94.21  ? 1014 PHE A CE2   1 
ATOM   7541  C  CZ    . PHE A 1 1014 ? -27.736 -9.230  -36.619 1.00 94.69  ? 1014 PHE A CZ    1 
ATOM   7542  N  N     . PRO A 1 1015 ? -24.888 -5.093  -34.750 1.00 98.00  ? 1015 PRO A N     1 
ATOM   7543  C  CA    . PRO A 1 1015 ? -23.679 -5.053  -35.576 1.00 92.61  ? 1015 PRO A CA    1 
ATOM   7544  C  C     . PRO A 1 1015 ? -23.709 -6.123  -36.633 1.00 88.47  ? 1015 PRO A C     1 
ATOM   7545  O  O     . PRO A 1 1015 ? -24.301 -7.176  -36.432 1.00 88.26  ? 1015 PRO A O     1 
ATOM   7546  C  CB    . PRO A 1 1015 ? -22.559 -5.398  -34.588 1.00 93.77  ? 1015 PRO A CB    1 
ATOM   7547  C  CG    . PRO A 1 1015 ? -23.190 -5.472  -33.230 1.00 97.55  ? 1015 PRO A CG    1 
ATOM   7548  C  CD    . PRO A 1 1015 ? -24.638 -5.746  -33.454 1.00 93.53  ? 1015 PRO A CD    1 
ATOM   7549  N  N     . VAL A 1 1016 ? -23.035 -5.837  -37.742 1.00 93.84  ? 1016 VAL A N     1 
ATOM   7550  C  CA    . VAL A 1 1016 ? -23.017 -6.709  -38.919 1.00 98.99  ? 1016 VAL A CA    1 
ATOM   7551  C  C     . VAL A 1 1016 ? -21.568 -6.917  -39.368 1.00 97.21  ? 1016 VAL A C     1 
ATOM   7552  O  O     . VAL A 1 1016 ? -20.790 -5.968  -39.461 1.00 91.14  ? 1016 VAL A O     1 
ATOM   7553  C  CB    . VAL A 1 1016 ? -23.854 -6.049  -40.050 1.00 97.22  ? 1016 VAL A CB    1 
ATOM   7554  C  CG1   . VAL A 1 1016 ? -23.666 -6.747  -41.385 1.00 92.84  ? 1016 VAL A CG1   1 
ATOM   7555  C  CG2   . VAL A 1 1016 ? -25.327 -6.018  -39.668 1.00 97.25  ? 1016 VAL A CG2   1 
ATOM   7556  N  N     . GLY A 1 1017 ? -21.232 -8.167  -39.646 1.00 99.37  ? 1017 GLY A N     1 
ATOM   7557  C  CA    . GLY A 1 1017 ? -19.865 -8.534  -39.993 1.00 101.22 ? 1017 GLY A CA    1 
ATOM   7558  C  C     . GLY A 1 1017 ? -19.601 -9.973  -39.638 1.00 101.05 ? 1017 GLY A C     1 
ATOM   7559  O  O     . GLY A 1 1017 ? -20.171 -10.484 -38.672 1.00 100.06 ? 1017 GLY A O     1 
ATOM   7560  N  N     . LEU A 1 1018 ? -18.686 -10.592 -40.387 1.00 101.59 ? 1018 LEU A N     1 
ATOM   7561  C  CA    . LEU A 1 1018 ? -18.324 -11.980 -40.191 1.00 107.43 ? 1018 LEU A CA    1 
ATOM   7562  C  C     . LEU A 1 1018 ? -16.893 -12.005 -39.634 1.00 112.10 ? 1018 LEU A C     1 
ATOM   7563  O  O     . LEU A 1 1018 ? -16.301 -10.960 -39.428 1.00 120.59 ? 1018 LEU A O     1 
ATOM   7564  C  CB    . LEU A 1 1018 ? -18.472 -12.727 -41.509 1.00 106.73 ? 1018 LEU A CB    1 
ATOM   7565  C  CG    . LEU A 1 1018 ? -19.792 -12.355 -42.224 1.00 99.47  ? 1018 LEU A CG    1 
ATOM   7566  C  CD1   . LEU A 1 1018 ? -19.607 -12.384 -43.747 1.00 91.58  ? 1018 LEU A CD1   1 
ATOM   7567  C  CD2   . LEU A 1 1018 ? -20.975 -13.197 -41.706 1.00 92.55  ? 1018 LEU A CD2   1 
ATOM   7568  N  N     . GLY A 1 1019 ? -16.369 -13.192 -39.357 1.00 117.61 ? 1019 GLY A N     1 
ATOM   7569  C  CA    . GLY A 1 1019 ? -15.125 -13.304 -38.575 1.00 128.33 ? 1019 GLY A CA    1 
ATOM   7570  C  C     . GLY A 1 1019 ? -13.879 -12.798 -39.266 1.00 128.15 ? 1019 GLY A C     1 
ATOM   7571  O  O     . GLY A 1 1019 ? -13.004 -12.148 -38.651 1.00 119.99 ? 1019 GLY A O     1 
ATOM   7572  N  N     . SER A 1 1020 ? -13.792 -13.068 -40.579 1.00 122.45 ? 1020 SER A N     1 
ATOM   7573  C  CA    . SER A 1 1020 ? -12.642 -12.672 -41.381 1.00 120.54 ? 1020 SER A CA    1 
ATOM   7574  C  C     . SER A 1 1020 ? -13.050 -12.018 -42.693 1.00 107.33 ? 1020 SER A C     1 
ATOM   7575  O  O     . SER A 1 1020 ? -14.225 -12.007 -43.084 1.00 93.25  ? 1020 SER A O     1 
ATOM   7576  C  CB    . SER A 1 1020 ? -11.736 -13.873 -41.664 1.00 127.31 ? 1020 SER A CB    1 
ATOM   7577  O  OG    . SER A 1 1020 ? -12.239 -14.665 -42.724 1.00 130.01 ? 1020 SER A OG    1 
ATOM   7578  N  N     . ARG A 1 1021 ? -12.055 -11.437 -43.350 1.00 105.60 ? 1021 ARG A N     1 
ATOM   7579  C  CA    . ARG A 1 1021 ? -12.232 -10.889 -44.694 1.00 108.82 ? 1021 ARG A CA    1 
ATOM   7580  C  C     . ARG A 1 1021 ? -12.622 -11.985 -45.683 1.00 109.08 ? 1021 ARG A C     1 
ATOM   7581  O  O     . ARG A 1 1021 ? -13.484 -11.770 -46.523 1.00 112.98 ? 1021 ARG A O     1 
ATOM   7582  C  CB    . ARG A 1 1021 ? -10.954 -10.235 -45.189 1.00 107.90 ? 1021 ARG A CB    1 
ATOM   7583  C  CG    . ARG A 1 1021 ? -11.162 -9.335  -46.394 1.00 107.24 ? 1021 ARG A CG    1 
ATOM   7584  C  CD    . ARG A 1 1021 ? -9.887  -9.279  -47.209 1.00 119.62 ? 1021 ARG A CD    1 
ATOM   7585  N  NE    . ARG A 1 1021 ? -9.846  -8.205  -48.210 1.00 133.92 ? 1021 ARG A NE    1 
ATOM   7586  C  CZ    . ARG A 1 1021 ? -8.881  -8.061  -49.130 1.00 129.79 ? 1021 ARG A CZ    1 
ATOM   7587  N  NH1   . ARG A 1 1021 ? -7.857  -8.913  -49.194 1.00 122.19 ? 1021 ARG A NH1   1 
ATOM   7588  N  NH2   . ARG A 1 1021 ? -8.933  -7.058  -49.997 1.00 123.65 ? 1021 ARG A NH2   1 
ATOM   7589  N  N     . ALA A 1 1022 ? -11.990 -13.150 -45.580 1.00 108.97 ? 1022 ALA A N     1 
ATOM   7590  C  CA    . ALA A 1 1022 ? -12.254 -14.280 -46.465 1.00 108.18 ? 1022 ALA A CA    1 
ATOM   7591  C  C     . ALA A 1 1022 ? -13.698 -14.795 -46.395 1.00 100.94 ? 1022 ALA A C     1 
ATOM   7592  O  O     . ALA A 1 1022 ? -14.250 -15.226 -47.410 1.00 105.11 ? 1022 ALA A O     1 
ATOM   7593  C  CB    . ALA A 1 1022 ? -11.290 -15.403 -46.131 1.00 116.89 ? 1022 ALA A CB    1 
ATOM   7594  N  N     . ALA A 1 1023 ? -14.297 -14.747 -45.210 1.00 90.41  ? 1023 ALA A N     1 
ATOM   7595  C  CA    . ALA A 1 1023 ? -15.707 -15.148 -45.037 1.00 91.14  ? 1023 ALA A CA    1 
ATOM   7596  C  C     . ALA A 1 1023 ? -16.686 -14.225 -45.753 1.00 84.60  ? 1023 ALA A C     1 
ATOM   7597  O  O     . ALA A 1 1023 ? -17.792 -14.646 -46.080 1.00 90.89  ? 1023 ALA A O     1 
ATOM   7598  C  CB    . ALA A 1 1023 ? -16.073 -15.270 -43.568 1.00 95.43  ? 1023 ALA A CB    1 
ATOM   7599  N  N     . GLY A 1 1024 ? -16.284 -12.979 -45.980 1.00 85.63  ? 1024 GLY A N     1 
ATOM   7600  C  CA    . GLY A 1 1024 ? -17.105 -12.000 -46.684 1.00 86.63  ? 1024 GLY A CA    1 
ATOM   7601  C  C     . GLY A 1 1024 ? -16.873 -11.875 -48.179 1.00 89.84  ? 1024 GLY A C     1 
ATOM   7602  O  O     . GLY A 1 1024 ? -17.491 -11.020 -48.814 1.00 93.49  ? 1024 GLY A O     1 
ATOM   7603  N  N     . GLN A 1 1025 ? -15.994 -12.704 -48.753 1.00 90.50  ? 1025 GLN A N     1 
ATOM   7604  C  CA    . GLN A 1 1025 ? -15.738 -12.666 -50.204 1.00 87.46  ? 1025 GLN A CA    1 
ATOM   7605  C  C     . GLN A 1 1025 ? -16.924 -13.207 -50.992 1.00 84.91  ? 1025 GLN A C     1 
ATOM   7606  O  O     . GLN A 1 1025 ? -17.689 -14.039 -50.509 1.00 93.69  ? 1025 GLN A O     1 
ATOM   7607  C  CB    . GLN A 1 1025 ? -14.410 -13.367 -50.567 1.00 85.40  ? 1025 GLN A CB    1 
ATOM   7608  C  CG    . GLN A 1 1025 ? -14.477 -14.812 -51.050 1.00 84.03  ? 1025 GLN A CG    1 
ATOM   7609  C  CD    . GLN A 1 1025 ? -13.125 -15.531 -50.953 1.00 84.24  ? 1025 GLN A CD    1 
ATOM   7610  O  OE1   . GLN A 1 1025 ? -12.533 -15.949 -51.967 1.00 79.27  ? 1025 GLN A OE1   1 
ATOM   7611  N  NE2   . GLN A 1 1025 ? -12.631 -15.689 -49.719 1.00 80.59  ? 1025 GLN A NE2   1 
ATOM   7612  N  N     . ALA A 1 1026 ? -17.080 -12.719 -52.211 1.00 78.59  ? 1026 ALA A N     1 
ATOM   7613  C  CA    . ALA A 1 1026 ? -18.295 -12.981 -52.979 1.00 72.46  ? 1026 ALA A CA    1 
ATOM   7614  C  C     . ALA A 1 1026 ? -17.979 -12.805 -54.446 1.00 67.31  ? 1026 ALA A C     1 
ATOM   7615  O  O     . ALA A 1 1026 ? -17.166 -11.958 -54.799 1.00 71.79  ? 1026 ALA A O     1 
ATOM   7616  C  CB    . ALA A 1 1026 ? -19.395 -12.012 -52.566 1.00 68.94  ? 1026 ALA A CB    1 
ATOM   7617  N  N     . ALA A 1 1027 ? -18.650 -13.617 -55.273 1.00 71.25  ? 1027 ALA A N     1 
ATOM   7618  C  CA    . ALA A 1 1027 ? -18.382 -13.675 -56.696 1.00 77.04  ? 1027 ALA A CA    1 
ATOM   7619  C  C     . ALA A 1 1027 ? -19.651 -13.791 -57.543 1.00 74.67  ? 1027 ALA A C     1 
ATOM   7620  O  O     . ALA A 1 1027 ? -20.715 -14.218 -57.067 1.00 70.78  ? 1027 ALA A O     1 
ATOM   7621  C  CB    . ALA A 1 1027 ? -17.397 -14.792 -57.026 1.00 78.46  ? 1027 ALA A CB    1 
ATOM   7622  N  N     . ALA A 1 1028 ? -19.505 -13.389 -58.797 1.00 71.85  ? 1028 ALA A N     1 
ATOM   7623  C  CA    . ALA A 1 1028 ? -20.605 -13.347 -59.764 1.00 79.60  ? 1028 ALA A CA    1 
ATOM   7624  C  C     . ALA A 1 1028 ? -20.068 -13.681 -61.166 1.00 78.42  ? 1028 ALA A C     1 
ATOM   7625  O  O     . ALA A 1 1028 ? -18.856 -13.661 -61.402 1.00 79.92  ? 1028 ALA A O     1 
ATOM   7626  C  CB    . ALA A 1 1028 ? -21.202 -11.954 -59.761 1.00 83.52  ? 1028 ALA A CB    1 
ATOM   7627  N  N     . LEU A 1 1029 ? -20.970 -14.003 -62.083 1.00 77.02  ? 1029 LEU A N     1 
ATOM   7628  C  CA    . LEU A 1 1029 ? -20.610 -14.287 -63.456 1.00 73.97  ? 1029 LEU A CA    1 
ATOM   7629  C  C     . LEU A 1 1029 ? -21.662 -13.641 -64.347 1.00 79.82  ? 1029 LEU A C     1 
ATOM   7630  O  O     . LEU A 1 1029 ? -22.858 -13.909 -64.173 1.00 82.34  ? 1029 LEU A O     1 
ATOM   7631  C  CB    . LEU A 1 1029 ? -20.556 -15.788 -63.682 1.00 74.74  ? 1029 LEU A CB    1 
ATOM   7632  C  CG    . LEU A 1 1029 ? -20.076 -16.275 -65.050 1.00 79.58  ? 1029 LEU A CG    1 
ATOM   7633  C  CD1   . LEU A 1 1029 ? -18.708 -15.720 -65.375 1.00 86.54  ? 1029 LEU A CD1   1 
ATOM   7634  C  CD2   . LEU A 1 1029 ? -20.036 -17.789 -65.101 1.00 83.60  ? 1029 LEU A CD2   1 
ATOM   7635  N  N     . VAL A 1 1030 ? -21.223 -12.793 -65.284 1.00 67.82  ? 1030 VAL A N     1 
ATOM   7636  C  CA    . VAL A 1 1030 ? -22.125 -12.061 -66.165 1.00 68.78  ? 1030 VAL A CA    1 
ATOM   7637  C  C     . VAL A 1 1030 ? -21.798 -12.311 -67.646 1.00 74.52  ? 1030 VAL A C     1 
ATOM   7638  O  O     . VAL A 1 1030 ? -20.663 -12.114 -68.090 1.00 79.65  ? 1030 VAL A O     1 
ATOM   7639  C  CB    . VAL A 1 1030 ? -22.053 -10.587 -65.786 1.00 69.92  ? 1030 VAL A CB    1 
ATOM   7640  C  CG1   . VAL A 1 1030 ? -23.056 -9.754  -66.586 1.00 74.51  ? 1030 VAL A CG1   1 
ATOM   7641  C  CG2   . VAL A 1 1030 ? -22.323 -10.464 -64.295 1.00 68.87  ? 1030 VAL A CG2   1 
ATOM   7642  N  N     . HIS A 1 1031 ? -22.811 -12.764 -68.391 1.00 81.00  ? 1031 HIS A N     1 
ATOM   7643  C  CA    . HIS A 1 1031 ? -22.782 -12.865 -69.865 1.00 79.38  ? 1031 HIS A CA    1 
ATOM   7644  C  C     . HIS A 1 1031 ? -23.655 -11.810 -70.507 1.00 77.43  ? 1031 HIS A C     1 
ATOM   7645  O  O     . HIS A 1 1031 ? -24.726 -11.506 -69.999 1.00 83.29  ? 1031 HIS A O     1 
ATOM   7646  C  CB    . HIS A 1 1031 ? -23.259 -14.243 -70.332 1.00 82.15  ? 1031 HIS A CB    1 
ATOM   7647  C  CG    . HIS A 1 1031 ? -22.685 -15.362 -69.533 1.00 85.41  ? 1031 HIS A CG    1 
ATOM   7648  N  ND1   . HIS A 1 1031 ? -21.335 -15.627 -69.494 1.00 88.00  ? 1031 HIS A ND1   1 
ATOM   7649  C  CD2   . HIS A 1 1031 ? -23.268 -16.242 -68.689 1.00 91.74  ? 1031 HIS A CD2   1 
ATOM   7650  C  CE1   . HIS A 1 1031 ? -21.111 -16.640 -68.678 1.00 94.20  ? 1031 HIS A CE1   1 
ATOM   7651  N  NE2   . HIS A 1 1031 ? -22.269 -17.029 -68.174 1.00 99.35  ? 1031 HIS A NE2   1 
ATOM   7652  N  N     . ILE A 1 1032 ? -23.203 -11.259 -71.623 1.00 79.68  ? 1032 ILE A N     1 
ATOM   7653  C  CA    . ILE A 1 1032 ? -24.032 -10.436 -72.500 1.00 76.44  ? 1032 ILE A CA    1 
ATOM   7654  C  C     . ILE A 1 1032 ? -24.132 -11.159 -73.828 1.00 80.91  ? 1032 ILE A C     1 
ATOM   7655  O  O     . ILE A 1 1032 ? -23.130 -11.363 -74.493 1.00 77.89  ? 1032 ILE A O     1 
ATOM   7656  C  CB    . ILE A 1 1032 ? -23.401 -9.063  -72.697 1.00 69.31  ? 1032 ILE A CB    1 
ATOM   7657  C  CG1   . ILE A 1 1032 ? -23.027 -8.484  -71.318 1.00 72.14  ? 1032 ILE A CG1   1 
ATOM   7658  C  CG2   . ILE A 1 1032 ? -24.357 -8.189  -73.488 1.00 71.85  ? 1032 ILE A CG2   1 
ATOM   7659  C  CD1   . ILE A 1 1032 ? -23.101 -6.970  -71.183 1.00 74.15  ? 1032 ILE A CD1   1 
ATOM   7660  N  N     . TYR A 1 1033 ? -25.341 -11.585 -74.182 1.00 87.29  ? 1033 TYR A N     1 
ATOM   7661  C  CA    . TYR A 1 1033 ? -25.585 -12.238 -75.458 1.00 86.68  ? 1033 TYR A CA    1 
ATOM   7662  C  C     . TYR A 1 1033 ? -25.711 -11.193 -76.577 1.00 84.22  ? 1033 TYR A C     1 
ATOM   7663  O  O     . TYR A 1 1033 ? -25.903 -10.011 -76.308 1.00 84.65  ? 1033 TYR A O     1 
ATOM   7664  C  CB    . TYR A 1 1033 ? -26.819 -13.168 -75.376 1.00 88.76  ? 1033 TYR A CB    1 
ATOM   7665  C  CG    . TYR A 1 1033 ? -26.605 -14.298 -74.384 1.00 84.78  ? 1033 TYR A CG    1 
ATOM   7666  C  CD1   . TYR A 1 1033 ? -25.646 -15.272 -74.607 1.00 78.73  ? 1033 TYR A CD1   1 
ATOM   7667  C  CD2   . TYR A 1 1033 ? -27.323 -14.353 -73.209 1.00 90.95  ? 1033 TYR A CD2   1 
ATOM   7668  C  CE1   . TYR A 1 1033 ? -25.416 -16.268 -73.691 1.00 80.25  ? 1033 TYR A CE1   1 
ATOM   7669  C  CE2   . TYR A 1 1033 ? -27.106 -15.353 -72.287 1.00 94.89  ? 1033 TYR A CE2   1 
ATOM   7670  C  CZ    . TYR A 1 1033 ? -26.144 -16.302 -72.529 1.00 88.83  ? 1033 TYR A CZ    1 
ATOM   7671  O  OH    . TYR A 1 1033 ? -25.936 -17.287 -71.586 1.00 96.86  ? 1033 TYR A OH    1 
ATOM   7672  N  N     . LEU A 1 1034 ? -25.599 -11.650 -77.826 1.00 87.10  ? 1034 LEU A N     1 
ATOM   7673  C  CA    . LEU A 1 1034 ? -25.564 -10.787 -79.007 1.00 82.57  ? 1034 LEU A CA    1 
ATOM   7674  C  C     . LEU A 1 1034 ? -26.867 -10.043 -79.332 1.00 80.66  ? 1034 LEU A C     1 
ATOM   7675  O  O     . LEU A 1 1034 ? -26.861 -9.071  -80.096 1.00 81.47  ? 1034 LEU A O     1 
ATOM   7676  C  CB    . LEU A 1 1034 ? -25.178 -11.627 -80.208 1.00 83.02  ? 1034 LEU A CB    1 
ATOM   7677  C  CG    . LEU A 1 1034 ? -23.672 -11.594 -80.379 1.00 87.81  ? 1034 LEU A CG    1 
ATOM   7678  C  CD1   . LEU A 1 1034 ? -22.945 -12.153 -79.162 1.00 86.77  ? 1034 LEU A CD1   1 
ATOM   7679  C  CD2   . LEU A 1 1034 ? -23.318 -12.314 -81.668 1.00 91.90  ? 1034 LEU A CD2   1 
ATOM   7680  N  N     . ASP A 1 1035 ? -27.979 -10.506 -78.770 1.00 83.27  ? 1035 ASP A N     1 
ATOM   7681  C  CA    . ASP A 1 1035 ? -29.228 -9.731  -78.770 1.00 85.70  ? 1035 ASP A CA    1 
ATOM   7682  C  C     . ASP A 1 1035 ? -29.281 -8.627  -77.672 1.00 86.85  ? 1035 ASP A C     1 
ATOM   7683  O  O     . ASP A 1 1035 ? -30.301 -7.943  -77.539 1.00 97.76  ? 1035 ASP A O     1 
ATOM   7684  C  CB    . ASP A 1 1035 ? -30.423 -10.698 -78.673 1.00 87.33  ? 1035 ASP A CB    1 
ATOM   7685  C  CG    . ASP A 1 1035 ? -30.703 -11.184 -77.232 1.00 93.08  ? 1035 ASP A CG    1 
ATOM   7686  O  OD1   . ASP A 1 1035 ? -29.820 -11.084 -76.337 1.00 86.59  ? 1035 ASP A OD1   1 
ATOM   7687  O  OD2   . ASP A 1 1035 ? -31.836 -11.677 -77.005 1.00 96.08  ? 1035 ASP A OD2   1 
ATOM   7688  N  N     . GLY A 1 1036 ? -28.215 -8.491  -76.882 1.00 82.80  ? 1036 GLY A N     1 
ATOM   7689  C  CA    . GLY A 1 1036 ? -28.131 -7.472  -75.850 1.00 73.63  ? 1036 GLY A CA    1 
ATOM   7690  C  C     . GLY A 1 1036 ? -28.633 -7.865  -74.498 1.00 74.74  ? 1036 GLY A C     1 
ATOM   7691  O  O     . GLY A 1 1036 ? -28.401 -7.138  -73.543 1.00 80.68  ? 1036 GLY A O     1 
ATOM   7692  N  N     . SER A 1 1037 ? -29.338 -8.998  -74.395 1.00 84.82  ? 1037 SER A N     1 
ATOM   7693  C  CA    . SER A 1 1037 ? -29.856 -9.508  -73.098 1.00 85.40  ? 1037 SER A CA    1 
ATOM   7694  C  C     . SER A 1 1037 ? -28.716 -10.032 -72.240 1.00 80.99  ? 1037 SER A C     1 
ATOM   7695  O  O     . SER A 1 1037 ? -27.677 -10.476 -72.745 1.00 78.75  ? 1037 SER A O     1 
ATOM   7696  C  CB    . SER A 1 1037 ? -30.910 -10.609 -73.304 1.00 81.54  ? 1037 SER A CB    1 
ATOM   7697  O  OG    . SER A 1 1037 ? -30.338 -11.776 -73.875 1.00 74.24  ? 1037 SER A OG    1 
ATOM   7698  N  N     . VAL A 1 1038 ? -28.942 -10.006 -70.930 1.00 79.45  ? 1038 VAL A N     1 
ATOM   7699  C  CA    . VAL A 1 1038 ? -27.929 -10.366 -69.965 1.00 80.81  ? 1038 VAL A CA    1 
ATOM   7700  C  C     . VAL A 1 1038 ? -28.365 -11.496 -69.061 1.00 85.71  ? 1038 VAL A C     1 
ATOM   7701  O  O     . VAL A 1 1038 ? -29.494 -11.519 -68.563 1.00 98.39  ? 1038 VAL A O     1 
ATOM   7702  C  CB    . VAL A 1 1038 ? -27.495 -9.176  -69.107 1.00 84.76  ? 1038 VAL A CB    1 
ATOM   7703  C  CG1   . VAL A 1 1038 ? -26.504 -9.637  -68.035 1.00 84.25  ? 1038 VAL A CG1   1 
ATOM   7704  C  CG2   . VAL A 1 1038 ? -26.910 -8.078  -69.993 1.00 86.10  ? 1038 VAL A CG2   1 
ATOM   7705  N  N     . LEU A 1 1039 ? -27.444 -12.428 -68.838 1.00 81.84  ? 1039 LEU A N     1 
ATOM   7706  C  CA    . LEU A 1 1039 ? -27.609 -13.475 -67.844 1.00 76.68  ? 1039 LEU A CA    1 
ATOM   7707  C  C     . LEU A 1 1039 ? -26.580 -13.264 -66.733 1.00 71.03  ? 1039 LEU A C     1 
ATOM   7708  O  O     . LEU A 1 1039 ? -25.389 -13.188 -67.015 1.00 71.88  ? 1039 LEU A O     1 
ATOM   7709  C  CB    . LEU A 1 1039 ? -27.412 -14.867 -68.452 1.00 70.48  ? 1039 LEU A CB    1 
ATOM   7710  C  CG    . LEU A 1 1039 ? -27.810 -15.911 -67.413 1.00 72.34  ? 1039 LEU A CG    1 
ATOM   7711  C  CD1   . LEU A 1 1039 ? -29.096 -16.598 -67.843 1.00 71.09  ? 1039 LEU A CD1   1 
ATOM   7712  C  CD2   . LEU A 1 1039 ? -26.664 -16.885 -67.121 1.00 76.34  ? 1039 LEU A CD2   1 
ATOM   7713  N  N     . VAL A 1 1040 ? -27.072 -13.186 -65.495 1.00 70.44  ? 1040 VAL A N     1 
ATOM   7714  C  CA    . VAL A 1 1040 ? -26.231 -13.027 -64.337 1.00 72.50  ? 1040 VAL A CA    1 
ATOM   7715  C  C     . VAL A 1 1040 ? -26.484 -14.142 -63.335 1.00 70.43  ? 1040 VAL A C     1 
ATOM   7716  O  O     . VAL A 1 1040 ? -27.599 -14.628 -63.204 1.00 58.32  ? 1040 VAL A O     1 
ATOM   7717  C  CB    . VAL A 1 1040 ? -26.409 -11.622 -63.701 1.00 82.81  ? 1040 VAL A CB    1 
ATOM   7718  C  CG1   . VAL A 1 1040 ? -27.866 -11.203 -63.651 1.00 79.90  ? 1040 VAL A CG1   1 
ATOM   7719  C  CG2   . VAL A 1 1040 ? -25.767 -11.544 -62.310 1.00 94.01  ? 1040 VAL A CG2   1 
ATOM   7720  N  N     . THR A 1 1041 ? -25.416 -14.566 -62.656 1.00 76.80  ? 1041 THR A N     1 
ATOM   7721  C  CA    . THR A 1 1041 ? -25.526 -15.430 -61.497 1.00 84.30  ? 1041 THR A CA    1 
ATOM   7722  C  C     . THR A 1 1041 ? -24.452 -15.016 -60.485 1.00 87.98  ? 1041 THR A C     1 
ATOM   7723  O  O     . THR A 1 1041 ? -23.493 -14.319 -60.827 1.00 90.42  ? 1041 THR A O     1 
ATOM   7724  C  CB    . THR A 1 1041 ? -25.254 -16.894 -61.817 1.00 90.37  ? 1041 THR A CB    1 
ATOM   7725  O  OG1   . THR A 1 1041 ? -25.178 -17.641 -60.585 1.00 89.51  ? 1041 THR A OG1   1 
ATOM   7726  C  CG2   . THR A 1 1041 ? -23.942 -17.019 -62.625 1.00 87.85  ? 1041 THR A CG2   1 
ATOM   7727  N  N     . HIS A 1 1042 ? -24.639 -15.486 -59.256 1.00 87.21  ? 1042 HIS A N     1 
ATOM   7728  C  CA    . HIS A 1 1042 ? -23.742 -15.199 -58.144 1.00 81.94  ? 1042 HIS A CA    1 
ATOM   7729  C  C     . HIS A 1 1042 ? -23.953 -16.266 -57.076 1.00 81.52  ? 1042 HIS A C     1 
ATOM   7730  O  O     . HIS A 1 1042 ? -24.908 -17.067 -57.176 1.00 90.10  ? 1042 HIS A O     1 
ATOM   7731  C  CB    . HIS A 1 1042 ? -24.051 -13.841 -57.549 1.00 82.06  ? 1042 HIS A CB    1 
ATOM   7732  C  CG    . HIS A 1 1042 ? -25.474 -13.714 -57.141 1.00 85.66  ? 1042 HIS A CG    1 
ATOM   7733  N  ND1   . HIS A 1 1042 ? -25.941 -14.168 -55.932 1.00 82.65  ? 1042 HIS A ND1   1 
ATOM   7734  C  CD2   . HIS A 1 1042 ? -26.554 -13.284 -57.828 1.00 89.72  ? 1042 HIS A CD2   1 
ATOM   7735  C  CE1   . HIS A 1 1042 ? -27.242 -13.972 -55.869 1.00 89.27  ? 1042 HIS A CE1   1 
ATOM   7736  N  NE2   . HIS A 1 1042 ? -27.640 -13.447 -57.015 1.00 86.51  ? 1042 HIS A NE2   1 
ATOM   7737  N  N     . GLY A 1 1043 ? -23.086 -16.257 -56.059 1.00 72.28  ? 1043 GLY A N     1 
ATOM   7738  C  CA    . GLY A 1 1043 ? -23.068 -17.314 -55.056 1.00 68.34  ? 1043 GLY A CA    1 
ATOM   7739  C  C     . GLY A 1 1043 ? -24.151 -17.284 -53.986 1.00 67.02  ? 1043 GLY A C     1 
ATOM   7740  O  O     . GLY A 1 1043 ? -24.339 -18.264 -53.270 1.00 57.49  ? 1043 GLY A O     1 
ATOM   7741  N  N     . GLY A 1 1044 ? -24.830 -16.150 -53.844 1.00 69.38  ? 1044 GLY A N     1 
ATOM   7742  C  CA    . GLY A 1 1044 ? -25.994 -16.047 -52.993 1.00 79.73  ? 1044 GLY A CA    1 
ATOM   7743  C  C     . GLY A 1 1044 ? -27.225 -16.866 -53.369 1.00 81.93  ? 1044 GLY A C     1 
ATOM   7744  O  O     . GLY A 1 1044 ? -27.511 -17.068 -54.548 1.00 77.29  ? 1044 GLY A O     1 
ATOM   7745  N  N     . ILE A 1 1045 ? -27.944 -17.306 -52.333 1.00 82.14  ? 1045 ILE A N     1 
ATOM   7746  C  CA    . ILE A 1 1045 ? -29.149 -18.125 -52.433 1.00 80.14  ? 1045 ILE A CA    1 
ATOM   7747  C  C     . ILE A 1 1045 ? -30.388 -17.317 -52.076 1.00 86.22  ? 1045 ILE A C     1 
ATOM   7748  O  O     . ILE A 1 1045 ? -30.412 -16.675 -51.024 1.00 90.88  ? 1045 ILE A O     1 
ATOM   7749  C  CB    . ILE A 1 1045 ? -29.097 -19.259 -51.398 1.00 78.04  ? 1045 ILE A CB    1 
ATOM   7750  C  CG1   . ILE A 1 1045 ? -28.087 -20.323 -51.821 1.00 84.39  ? 1045 ILE A CG1   1 
ATOM   7751  C  CG2   . ILE A 1 1045 ? -30.471 -19.857 -51.164 1.00 77.19  ? 1045 ILE A CG2   1 
ATOM   7752  C  CD1   . ILE A 1 1045 ? -28.175 -20.745 -53.274 1.00 85.35  ? 1045 ILE A CD1   1 
ATOM   7753  N  N     . GLU A 1 1046 ? -31.404 -17.368 -52.945 1.00 88.79  ? 1046 GLU A N     1 
ATOM   7754  C  CA    . GLU A 1 1046 ? -32.694 -16.727 -52.677 1.00 80.23  ? 1046 GLU A CA    1 
ATOM   7755  C  C     . GLU A 1 1046 ? -33.545 -17.633 -51.779 1.00 85.79  ? 1046 GLU A C     1 
ATOM   7756  O  O     . GLU A 1 1046 ? -34.013 -18.695 -52.190 1.00 88.07  ? 1046 GLU A O     1 
ATOM   7757  C  CB    . GLU A 1 1046 ? -33.393 -16.394 -53.990 1.00 78.62  ? 1046 GLU A CB    1 
ATOM   7758  C  CG    . GLU A 1 1046 ? -34.824 -15.892 -53.857 1.00 85.02  ? 1046 GLU A CG    1 
ATOM   7759  C  CD    . GLU A 1 1046 ? -34.950 -14.403 -53.569 1.00 86.95  ? 1046 GLU A CD    1 
ATOM   7760  O  OE1   . GLU A 1 1046 ? -34.876 -13.556 -54.522 1.00 72.27  ? 1046 GLU A OE1   1 
ATOM   7761  O  OE2   . GLU A 1 1046 ? -35.183 -14.103 -52.372 1.00 95.82  ? 1046 GLU A OE2   1 
ATOM   7762  N  N     . MET A 1 1047 ? -33.727 -17.198 -50.537 1.00 98.89  ? 1047 MET A N     1 
ATOM   7763  C  CA    . MET A 1 1047 ? -34.574 -17.856 -49.537 1.00 101.12 ? 1047 MET A CA    1 
ATOM   7764  C  C     . MET A 1 1047 ? -35.875 -17.080 -49.279 1.00 94.13  ? 1047 MET A C     1 
ATOM   7765  O  O     . MET A 1 1047 ? -36.585 -17.394 -48.311 1.00 94.01  ? 1047 MET A O     1 
ATOM   7766  C  CB    . MET A 1 1047 ? -33.809 -17.919 -48.187 1.00 105.42 ? 1047 MET A CB    1 
ATOM   7767  C  CG    . MET A 1 1047 ? -32.312 -18.257 -48.240 1.00 104.63 ? 1047 MET A CG    1 
ATOM   7768  S  SD    . MET A 1 1047 ? -31.447 -18.161 -46.646 1.00 95.58  ? 1047 MET A SD    1 
ATOM   7769  C  CE    . MET A 1 1047 ? -30.532 -16.649 -46.880 1.00 102.27 ? 1047 MET A CE    1 
ATOM   7770  N  N     . GLY A 1 1048 ? -36.189 -16.083 -50.117 1.00 81.52  ? 1048 GLY A N     1 
ATOM   7771  C  CA    . GLY A 1 1048 ? -37.353 -15.241 -49.902 1.00 88.55  ? 1048 GLY A CA    1 
ATOM   7772  C  C     . GLY A 1 1048 ? -37.038 -13.820 -49.473 1.00 92.01  ? 1048 GLY A C     1 
ATOM   7773  O  O     . GLY A 1 1048 ? -37.930 -12.971 -49.436 1.00 94.28  ? 1048 GLY A O     1 
ATOM   7774  N  N     . GLN A 1 1049 ? -35.762 -13.559 -49.186 1.00 95.89  ? 1049 GLN A N     1 
ATOM   7775  C  CA    . GLN A 1 1049 ? -35.274 -12.222 -48.854 1.00 96.87  ? 1049 GLN A CA    1 
ATOM   7776  C  C     . GLN A 1 1049 ? -35.067 -11.319 -50.083 1.00 89.93  ? 1049 GLN A C     1 
ATOM   7777  O  O     . GLN A 1 1049 ? -34.698 -10.155 -49.926 1.00 94.25  ? 1049 GLN A O     1 
ATOM   7778  C  CB    . GLN A 1 1049 ? -33.987 -12.310 -48.004 1.00 102.44 ? 1049 GLN A CB    1 
ATOM   7779  C  CG    . GLN A 1 1049 ? -32.662 -12.396 -48.756 1.00 103.72 ? 1049 GLN A CG    1 
ATOM   7780  C  CD    . GLN A 1 1049 ? -32.434 -13.730 -49.408 1.00 95.63  ? 1049 GLN A CD    1 
ATOM   7781  O  OE1   . GLN A 1 1049 ? -33.372 -14.430 -49.749 1.00 104.31 ? 1049 GLN A OE1   1 
ATOM   7782  N  NE2   . GLN A 1 1049 ? -31.182 -14.090 -49.580 1.00 94.02  ? 1049 GLN A NE2   1 
ATOM   7783  N  N     . GLY A 1 1050 ? -35.288 -11.818 -51.287 1.00 87.02  ? 1050 GLY A N     1 
ATOM   7784  C  CA    . GLY A 1 1050 ? -35.196 -10.985 -52.489 1.00 91.41  ? 1050 GLY A CA    1 
ATOM   7785  C  C     . GLY A 1 1050 ? -33.797 -10.630 -52.972 1.00 89.60  ? 1050 GLY A C     1 
ATOM   7786  O  O     . GLY A 1 1050 ? -33.608 -9.560  -53.567 1.00 81.99  ? 1050 GLY A O     1 
ATOM   7787  N  N     . VAL A 1 1051 ? -32.811 -11.499 -52.712 1.00 89.05  ? 1051 VAL A N     1 
ATOM   7788  C  CA    . VAL A 1 1051 ? -31.440 -11.196 -53.124 1.00 80.75  ? 1051 VAL A CA    1 
ATOM   7789  C  C     . VAL A 1 1051 ? -31.326 -11.124 -54.645 1.00 77.71  ? 1051 VAL A C     1 
ATOM   7790  O  O     . VAL A 1 1051 ? -30.705 -10.214 -55.146 1.00 69.88  ? 1051 VAL A O     1 
ATOM   7791  C  CB    . VAL A 1 1051 ? -30.382 -12.135 -52.530 1.00 75.53  ? 1051 VAL A CB    1 
ATOM   7792  C  CG1   . VAL A 1 1051 ? -30.560 -13.572 -53.002 1.00 75.84  ? 1051 VAL A CG1   1 
ATOM   7793  C  CG2   . VAL A 1 1051 ? -29.000 -11.627 -52.910 1.00 76.01  ? 1051 VAL A CG2   1 
ATOM   7794  N  N     . HIS A 1 1052 ? -31.964 -12.038 -55.370 1.00 80.87  ? 1052 HIS A N     1 
ATOM   7795  C  CA    . HIS A 1 1052 ? -31.875 -12.022 -56.834 1.00 82.87  ? 1052 HIS A CA    1 
ATOM   7796  C  C     . HIS A 1 1052 ? -32.557 -10.770 -57.440 1.00 86.36  ? 1052 HIS A C     1 
ATOM   7797  O  O     . HIS A 1 1052 ? -32.041 -10.195 -58.395 1.00 84.76  ? 1052 HIS A O     1 
ATOM   7798  C  CB    . HIS A 1 1052 ? -32.344 -13.338 -57.468 1.00 82.68  ? 1052 HIS A CB    1 
ATOM   7799  C  CG    . HIS A 1 1052 ? -31.507 -14.519 -57.080 1.00 88.22  ? 1052 HIS A CG    1 
ATOM   7800  N  ND1   . HIS A 1 1052 ? -31.814 -15.811 -57.439 1.00 101.20 ? 1052 HIS A ND1   1 
ATOM   7801  C  CD2   . HIS A 1 1052 ? -30.396 -14.605 -56.316 1.00 102.33 ? 1052 HIS A CD2   1 
ATOM   7802  C  CE1   . HIS A 1 1052 ? -30.920 -16.640 -56.930 1.00 109.13 ? 1052 HIS A CE1   1 
ATOM   7803  N  NE2   . HIS A 1 1052 ? -30.044 -15.931 -56.246 1.00 113.08 ? 1052 HIS A NE2   1 
ATOM   7804  N  N     . THR A 1 1053 ? -33.682 -10.337 -56.873 1.00 88.07  ? 1053 THR A N     1 
ATOM   7805  C  CA    . THR A 1 1053 ? -34.309 -9.089  -57.256 1.00 88.25  ? 1053 THR A CA    1 
ATOM   7806  C  C     . THR A 1 1053 ? -33.360 -7.886  -57.142 1.00 92.95  ? 1053 THR A C     1 
ATOM   7807  O  O     . THR A 1 1053 ? -33.256 -7.052  -58.029 1.00 95.60  ? 1053 THR A O     1 
ATOM   7808  C  CB    . THR A 1 1053 ? -35.433 -8.806  -56.243 1.00 85.81  ? 1053 THR A CB    1 
ATOM   7809  O  OG1   . THR A 1 1053 ? -36.101 -10.025 -55.888 1.00 89.08  ? 1053 THR A OG1   1 
ATOM   7810  C  CG2   . THR A 1 1053 ? -36.400 -7.805  -56.786 1.00 83.01  ? 1053 THR A CG2   1 
ATOM   7811  N  N     . LYS A 1 1054 ? -32.658 -7.820  -56.018 1.00 89.18  ? 1054 LYS A N     1 
ATOM   7812  C  CA    . LYS A 1 1054 ? -31.678 -6.745  -55.773 1.00 88.50  ? 1054 LYS A CA    1 
ATOM   7813  C  C     . LYS A 1 1054 ? -30.469 -6.757  -56.708 1.00 87.87  ? 1054 LYS A C     1 
ATOM   7814  O  O     . LYS A 1 1054 ? -29.966 -5.702  -57.053 1.00 92.45  ? 1054 LYS A O     1 
ATOM   7815  C  CB    . LYS A 1 1054 ? -31.191 -6.784  -54.317 1.00 91.17  ? 1054 LYS A CB    1 
ATOM   7816  C  CG    . LYS A 1 1054 ? -32.163 -6.221  -53.299 1.00 88.91  ? 1054 LYS A CG    1 
ATOM   7817  C  CD    . LYS A 1 1054 ? -31.635 -6.416  -51.890 1.00 87.25  ? 1054 LYS A CD    1 
ATOM   7818  C  CE    . LYS A 1 1054 ? -32.468 -5.632  -50.895 1.00 91.80  ? 1054 LYS A CE    1 
ATOM   7819  N  NZ    . LYS A 1 1054 ? -31.986 -5.904  -49.518 1.00 100.65 ? 1054 LYS A NZ    1 
ATOM   7820  N  N     . MET A 1 1055 ? -30.003 -7.937  -57.116 1.00 82.03  ? 1055 MET A N     1 
ATOM   7821  C  CA    . MET A 1 1055 ? -28.860 -8.046  -58.028 1.00 80.04  ? 1055 MET A CA    1 
ATOM   7822  C  C     . MET A 1 1055 ? -29.204 -7.561  -59.437 1.00 81.47  ? 1055 MET A C     1 
ATOM   7823  O  O     . MET A 1 1055 ? -28.370 -6.963  -60.109 1.00 89.52  ? 1055 MET A O     1 
ATOM   7824  C  CB    . MET A 1 1055 ? -28.363 -9.471  -58.061 1.00 86.74  ? 1055 MET A CB    1 
ATOM   7825  C  CG    . MET A 1 1055 ? -27.899 -10.010 -56.722 1.00 85.82  ? 1055 MET A CG    1 
ATOM   7826  S  SD    . MET A 1 1055 ? -26.524 -9.063  -56.085 1.00 86.77  ? 1055 MET A SD    1 
ATOM   7827  C  CE    . MET A 1 1055 ? -27.379 -7.992  -54.942 1.00 89.13  ? 1055 MET A CE    1 
ATOM   7828  N  N     . ILE A 1 1056 ? -30.432 -7.806  -59.872 1.00 79.31  ? 1056 ILE A N     1 
ATOM   7829  C  CA    . ILE A 1 1056 ? -30.903 -7.313  -61.163 1.00 79.21  ? 1056 ILE A CA    1 
ATOM   7830  C  C     . ILE A 1 1056 ? -31.090 -5.788  -61.104 1.00 81.01  ? 1056 ILE A C     1 
ATOM   7831  O  O     . ILE A 1 1056 ? -30.897 -5.099  -62.101 1.00 87.53  ? 1056 ILE A O     1 
ATOM   7832  C  CB    . ILE A 1 1056 ? -32.239 -7.935  -61.556 1.00 80.88  ? 1056 ILE A CB    1 
ATOM   7833  C  CG1   . ILE A 1 1056 ? -32.125 -9.465  -61.669 1.00 82.98  ? 1056 ILE A CG1   1 
ATOM   7834  C  CG2   . ILE A 1 1056 ? -32.737 -7.305  -62.843 1.00 79.18  ? 1056 ILE A CG2   1 
ATOM   7835  C  CD1   . ILE A 1 1056 ? -31.607 -9.976  -62.999 1.00 86.30  ? 1056 ILE A CD1   1 
ATOM   7836  N  N     . GLN A 1 1057 ? -31.492 -5.272  -59.942 1.00 80.73  ? 1057 GLN A N     1 
ATOM   7837  C  CA    . GLN A 1 1057 ? -31.544 -3.823  -59.701 1.00 76.83  ? 1057 GLN A CA    1 
ATOM   7838  C  C     . GLN A 1 1057 ? -30.156 -3.215  -59.801 1.00 85.14  ? 1057 GLN A C     1 
ATOM   7839  O  O     . GLN A 1 1057 ? -30.000 -2.146  -60.362 1.00 105.73 ? 1057 GLN A O     1 
ATOM   7840  C  CB    . GLN A 1 1057 ? -32.093 -3.537  -58.298 1.00 66.67  ? 1057 GLN A CB    1 
ATOM   7841  C  CG    . GLN A 1 1057 ? -33.592 -3.697  -58.163 1.00 67.80  ? 1057 GLN A CG    1 
ATOM   7842  C  CD    . GLN A 1 1057 ? -34.145 -3.269  -56.805 1.00 69.75  ? 1057 GLN A CD    1 
ATOM   7843  O  OE1   . GLN A 1 1057 ? -34.797 -4.040  -56.118 1.00 69.24  ? 1057 GLN A OE1   1 
ATOM   7844  N  NE2   . GLN A 1 1057 ? -33.907 -2.029  -56.430 1.00 77.68  ? 1057 GLN A NE2   1 
ATOM   7845  N  N     . VAL A 1 1058 ? -29.159 -3.901  -59.248 1.00 83.09  ? 1058 VAL A N     1 
ATOM   7846  C  CA    . VAL A 1 1058 ? -27.758 -3.487  -59.377 1.00 88.54  ? 1058 VAL A CA    1 
ATOM   7847  C  C     . VAL A 1 1058 ? -27.340 -3.517  -60.856 1.00 87.17  ? 1058 VAL A C     1 
ATOM   7848  O  O     . VAL A 1 1058 ? -26.818 -2.527  -61.372 1.00 78.22  ? 1058 VAL A O     1 
ATOM   7849  C  CB    . VAL A 1 1058 ? -26.838 -4.368  -58.491 1.00 88.04  ? 1058 VAL A CB    1 
ATOM   7850  C  CG1   . VAL A 1 1058 ? -25.372 -4.024  -58.704 1.00 90.22  ? 1058 VAL A CG1   1 
ATOM   7851  C  CG2   . VAL A 1 1058 ? -27.204 -4.223  -57.024 1.00 86.77  ? 1058 VAL A CG2   1 
ATOM   7852  N  N     . VAL A 1 1059 ? -27.585 -4.637  -61.535 1.00 83.77  ? 1059 VAL A N     1 
ATOM   7853  C  CA    . VAL A 1 1059 ? -27.206 -4.769  -62.942 1.00 78.08  ? 1059 VAL A CA    1 
ATOM   7854  C  C     . VAL A 1 1059 ? -27.878 -3.670  -63.771 1.00 74.43  ? 1059 VAL A C     1 
ATOM   7855  O  O     . VAL A 1 1059 ? -27.237 -3.041  -64.603 1.00 72.99  ? 1059 VAL A O     1 
ATOM   7856  C  CB    . VAL A 1 1059 ? -27.620 -6.166  -63.485 1.00 84.25  ? 1059 VAL A CB    1 
ATOM   7857  C  CG1   . VAL A 1 1059 ? -27.517 -6.223  -65.006 1.00 84.58  ? 1059 VAL A CG1   1 
ATOM   7858  C  CG2   . VAL A 1 1059 ? -26.791 -7.282  -62.838 1.00 81.50  ? 1059 VAL A CG2   1 
ATOM   7859  N  N     . SER A 1 1060 ? -29.160 -3.438  -63.515 1.00 76.37  ? 1060 SER A N     1 
ATOM   7860  C  CA    . SER A 1 1060 ? -29.922 -2.423  -64.234 1.00 81.72  ? 1060 SER A CA    1 
ATOM   7861  C  C     . SER A 1 1060 ? -29.339 -1.014  -64.098 1.00 86.89  ? 1060 SER A C     1 
ATOM   7862  O  O     . SER A 1 1060 ? -29.301 -0.269  -65.069 1.00 87.41  ? 1060 SER A O     1 
ATOM   7863  C  CB    . SER A 1 1060 ? -31.366 -2.412  -63.815 1.00 81.57  ? 1060 SER A CB    1 
ATOM   7864  O  OG    . SER A 1 1060 ? -32.109 -1.694  -64.782 1.00 92.89  ? 1060 SER A OG    1 
ATOM   7865  N  N     . ARG A 1 1061 ? -28.904 -0.656  -62.894 1.00 86.67  ? 1061 ARG A N     1 
ATOM   7866  C  CA    . ARG A 1 1061 ? -28.226 0.626   -62.668 1.00 88.06  ? 1061 ARG A CA    1 
ATOM   7867  C  C     . ARG A 1 1061 ? -26.861 0.667   -63.336 1.00 86.45  ? 1061 ARG A C     1 
ATOM   7868  O  O     . ARG A 1 1061 ? -26.539 1.639   -64.007 1.00 102.39 ? 1061 ARG A O     1 
ATOM   7869  C  CB    . ARG A 1 1061 ? -28.028 0.944   -61.191 1.00 93.20  ? 1061 ARG A CB    1 
ATOM   7870  C  CG    . ARG A 1 1061 ? -26.868 1.912   -60.967 1.00 99.44  ? 1061 ARG A CG    1 
ATOM   7871  C  CD    . ARG A 1 1061 ? -26.756 2.389   -59.527 1.00 109.90 ? 1061 ARG A CD    1 
ATOM   7872  N  NE    . ARG A 1 1061 ? -27.725 3.427   -59.196 1.00 109.92 ? 1061 ARG A NE    1 
ATOM   7873  C  CZ    . ARG A 1 1061 ? -27.796 4.034   -58.017 1.00 111.23 ? 1061 ARG A CZ    1 
ATOM   7874  N  NH1   . ARG A 1 1061 ? -26.938 3.736   -57.043 1.00 109.92 ? 1061 ARG A NH1   1 
ATOM   7875  N  NH2   . ARG A 1 1061 ? -28.726 4.955   -57.820 1.00 114.17 ? 1061 ARG A NH2   1 
ATOM   7876  N  N     . GLU A 1 1062 ? -26.052 -0.371  -63.141 1.00 85.54  ? 1062 GLU A N     1 
ATOM   7877  C  CA    . GLU A 1 1062 ? -24.648 -0.315  -63.543 1.00 85.46  ? 1062 GLU A CA    1 
ATOM   7878  C  C     . GLU A 1 1062 ? -24.442 -0.341  -65.063 1.00 84.90  ? 1062 GLU A C     1 
ATOM   7879  O  O     . GLU A 1 1062 ? -23.598 0.387   -65.580 1.00 89.96  ? 1062 GLU A O     1 
ATOM   7880  C  CB    . GLU A 1 1062 ? -23.837 -1.396  -62.849 1.00 94.11  ? 1062 GLU A CB    1 
ATOM   7881  C  CG    . GLU A 1 1062 ? -23.597 -1.110  -61.373 1.00 99.89  ? 1062 GLU A CG    1 
ATOM   7882  C  CD    . GLU A 1 1062 ? -22.698 0.093   -61.118 1.00 106.41 ? 1062 GLU A CD    1 
ATOM   7883  O  OE1   . GLU A 1 1062 ? -21.946 0.491   -62.044 1.00 116.40 ? 1062 GLU A OE1   1 
ATOM   7884  O  OE2   . GLU A 1 1062 ? -22.739 0.635   -59.981 1.00 104.01 ? 1062 GLU A OE2   1 
ATOM   7885  N  N     . LEU A 1 1063 ? -25.208 -1.170  -65.766 1.00 87.08  ? 1063 LEU A N     1 
ATOM   7886  C  CA    . LEU A 1 1063 ? -25.186 -1.199  -67.222 1.00 95.80  ? 1063 LEU A CA    1 
ATOM   7887  C  C     . LEU A 1 1063 ? -26.203 -0.256  -67.886 1.00 98.00  ? 1063 LEU A C     1 
ATOM   7888  O  O     . LEU A 1 1063 ? -26.263 -0.179  -69.100 1.00 88.24  ? 1063 LEU A O     1 
ATOM   7889  C  CB    . LEU A 1 1063 ? -25.444 -2.629  -67.692 1.00 96.77  ? 1063 LEU A CB    1 
ATOM   7890  C  CG    . LEU A 1 1063 ? -24.590 -3.707  -67.039 1.00 91.52  ? 1063 LEU A CG    1 
ATOM   7891  C  CD1   . LEU A 1 1063 ? -24.826 -5.023  -67.769 1.00 93.18  ? 1063 LEU A CD1   1 
ATOM   7892  C  CD2   . LEU A 1 1063 ? -23.127 -3.308  -67.058 1.00 86.64  ? 1063 LEU A CD2   1 
ATOM   7893  N  N     . ARG A 1 1064 ? -27.015 0.436   -67.088 1.00 101.21 ? 1064 ARG A N     1 
ATOM   7894  C  CA    . ARG A 1 1064 ? -27.957 1.442   -67.596 1.00 104.84 ? 1064 ARG A CA    1 
ATOM   7895  C  C     . ARG A 1 1064 ? -28.904 0.816   -68.620 1.00 99.79  ? 1064 ARG A C     1 
ATOM   7896  O  O     . ARG A 1 1064 ? -28.973 1.219   -69.773 1.00 103.28 ? 1064 ARG A O     1 
ATOM   7897  C  CB    . ARG A 1 1064 ? -27.312 2.780   -68.022 1.00 119.28 ? 1064 ARG A CB    1 
ATOM   7898  C  CG    . ARG A 1 1064 ? -26.548 2.844   -69.341 1.00 129.98 ? 1064 ARG A CG    1 
ATOM   7899  C  CD    . ARG A 1 1064 ? -25.815 4.178   -69.491 1.00 131.18 ? 1064 ARG A CD    1 
ATOM   7900  N  NE    . ARG A 1 1064 ? -24.370 4.098   -69.230 1.00 130.51 ? 1064 ARG A NE    1 
ATOM   7901  C  CZ    . ARG A 1 1064 ? -23.772 4.320   -68.054 1.00 124.78 ? 1064 ARG A CZ    1 
ATOM   7902  N  NH1   . ARG A 1 1064 ? -24.474 4.639   -66.969 1.00 124.14 ? 1064 ARG A NH1   1 
ATOM   7903  N  NH2   . ARG A 1 1064 ? -22.448 4.224   -67.959 1.00 115.26 ? 1064 ARG A NH2   1 
ATOM   7904  N  N     . MET A 1 1065 ? -29.614 -0.207  -68.156 1.00 100.47 ? 1065 MET A N     1 
ATOM   7905  C  CA    . MET A 1 1065 ? -30.586 -0.955  -68.970 1.00 88.11  ? 1065 MET A CA    1 
ATOM   7906  C  C     . MET A 1 1065 ? -31.742 -1.381  -68.081 1.00 83.59  ? 1065 MET A C     1 
ATOM   7907  O  O     . MET A 1 1065 ? -31.572 -1.490  -66.869 1.00 75.85  ? 1065 MET A O     1 
ATOM   7908  C  CB    . MET A 1 1065 ? -29.942 -2.194  -69.612 1.00 84.24  ? 1065 MET A CB    1 
ATOM   7909  C  CG    . MET A 1 1065 ? -29.778 -3.357  -68.640 1.00 85.90  ? 1065 MET A CG    1 
ATOM   7910  S  SD    . MET A 1 1065 ? -28.972 -4.849  -69.251 1.00 85.51  ? 1065 MET A SD    1 
ATOM   7911  C  CE    . MET A 1 1065 ? -27.572 -4.217  -70.156 1.00 82.01  ? 1065 MET A CE    1 
ATOM   7912  N  N     . PRO A 1 1066 ? -32.918 -1.618  -68.665 1.00 79.22  ? 1066 PRO A N     1 
ATOM   7913  C  CA    . PRO A 1 1066 ? -34.081 -2.022  -67.863 1.00 77.64  ? 1066 PRO A CA    1 
ATOM   7914  C  C     . PRO A 1 1066 ? -33.930 -3.436  -67.288 1.00 84.19  ? 1066 PRO A C     1 
ATOM   7915  O  O     . PRO A 1 1066 ? -33.237 -4.305  -67.875 1.00 101.22 ? 1066 PRO A O     1 
ATOM   7916  C  CB    . PRO A 1 1066 ? -35.225 -1.948  -68.856 1.00 71.91  ? 1066 PRO A CB    1 
ATOM   7917  C  CG    . PRO A 1 1066 ? -34.581 -2.225  -70.164 1.00 72.55  ? 1066 PRO A CG    1 
ATOM   7918  C  CD    . PRO A 1 1066 ? -33.204 -1.658  -70.106 1.00 74.68  ? 1066 PRO A CD    1 
ATOM   7919  N  N     . MET A 1 1067 ? -34.575 -3.665  -66.133 1.00 85.96  ? 1067 MET A N     1 
ATOM   7920  C  CA    . MET A 1 1067 ? -34.454 -4.966  -65.449 1.00 75.66  ? 1067 MET A CA    1 
ATOM   7921  C  C     . MET A 1 1067 ? -35.037 -6.111  -66.273 1.00 70.77  ? 1067 MET A C     1 
ATOM   7922  O  O     . MET A 1 1067 ? -34.591 -7.244  -66.151 1.00 66.68  ? 1067 MET A O     1 
ATOM   7923  C  CB    . MET A 1 1067 ? -35.075 -4.910  -64.070 1.00 77.96  ? 1067 MET A CB    1 
ATOM   7924  C  CG    . MET A 1 1067 ? -34.298 -4.034  -63.123 1.00 79.25  ? 1067 MET A CG    1 
ATOM   7925  S  SD    . MET A 1 1067 ? -35.329 -3.618  -61.746 1.00 90.50  ? 1067 MET A SD    1 
ATOM   7926  C  CE    . MET A 1 1067 ? -35.881 -5.245  -61.226 1.00 92.29  ? 1067 MET A CE    1 
ATOM   7927  N  N     . SER A 1 1068 ? -35.996 -5.799  -67.135 1.00 72.53  ? 1068 SER A N     1 
ATOM   7928  C  CA    . SER A 1 1068 ? -36.561 -6.720  -68.115 1.00 74.00  ? 1068 SER A CA    1 
ATOM   7929  C  C     . SER A 1 1068 ? -35.534 -7.320  -69.088 1.00 73.84  ? 1068 SER A C     1 
ATOM   7930  O  O     . SER A 1 1068 ? -35.793 -8.362  -69.702 1.00 78.88  ? 1068 SER A O     1 
ATOM   7931  C  CB    . SER A 1 1068 ? -37.560 -5.930  -68.950 1.00 76.61  ? 1068 SER A CB    1 
ATOM   7932  O  OG    . SER A 1 1068 ? -36.894 -5.091  -69.883 1.00 70.49  ? 1068 SER A OG    1 
ATOM   7933  N  N     . ASN A 1 1069 ? -34.405 -6.639  -69.266 1.00 77.50  ? 1069 ASN A N     1 
ATOM   7934  C  CA    . ASN A 1 1069 ? -33.333 -7.117  -70.128 1.00 76.74  ? 1069 ASN A CA    1 
ATOM   7935  C  C     . ASN A 1 1069 ? -32.321 -8.052  -69.443 1.00 76.01  ? 1069 ASN A C     1 
ATOM   7936  O  O     . ASN A 1 1069 ? -31.489 -8.647  -70.119 1.00 85.51  ? 1069 ASN A O     1 
ATOM   7937  C  CB    . ASN A 1 1069 ? -32.601 -5.934  -70.742 1.00 70.54  ? 1069 ASN A CB    1 
ATOM   7938  C  CG    . ASN A 1 1069 ? -31.781 -6.340  -71.921 1.00 65.16  ? 1069 ASN A CG    1 
ATOM   7939  O  OD1   . ASN A 1 1069 ? -32.314 -6.743  -72.942 1.00 68.61  ? 1069 ASN A OD1   1 
ATOM   7940  N  ND2   . ASN A 1 1069 ? -30.482 -6.273  -71.777 1.00 62.44  ? 1069 ASN A ND2   1 
ATOM   7941  N  N     . VAL A 1 1070 ? -32.390 -8.157  -68.121 1.00 71.84  ? 1070 VAL A N     1 
ATOM   7942  C  CA    . VAL A 1 1070 ? -31.482 -8.995  -67.321 1.00 79.58  ? 1070 VAL A CA    1 
ATOM   7943  C  C     . VAL A 1 1070 ? -32.241 -10.213 -66.827 1.00 74.74  ? 1070 VAL A C     1 
ATOM   7944  O  O     . VAL A 1 1070 ? -33.428 -10.106 -66.533 1.00 81.63  ? 1070 VAL A O     1 
ATOM   7945  C  CB    . VAL A 1 1070 ? -30.983 -8.184  -66.107 1.00 88.70  ? 1070 VAL A CB    1 
ATOM   7946  C  CG1   . VAL A 1 1070 ? -29.769 -8.836  -65.469 1.00 92.95  ? 1070 VAL A CG1   1 
ATOM   7947  C  CG2   . VAL A 1 1070 ? -30.629 -6.764  -66.526 1.00 87.55  ? 1070 VAL A CG2   1 
ATOM   7948  N  N     . HIS A 1 1071 ? -31.585 -11.356 -66.743 1.00 70.85  ? 1071 HIS A N     1 
ATOM   7949  C  CA    . HIS A 1 1071 ? -32.248 -12.581 -66.252 1.00 80.73  ? 1071 HIS A CA    1 
ATOM   7950  C  C     . HIS A 1 1071 ? -31.302 -13.431 -65.466 1.00 74.07  ? 1071 HIS A C     1 
ATOM   7951  O  O     . HIS A 1 1071 ? -30.106 -13.383 -65.669 1.00 75.28  ? 1071 HIS A O     1 
ATOM   7952  C  CB    . HIS A 1 1071 ? -32.918 -13.398 -67.372 1.00 88.66  ? 1071 HIS A CB    1 
ATOM   7953  C  CG    . HIS A 1 1071 ? -33.653 -14.612 -66.879 1.00 84.26  ? 1071 HIS A CG    1 
ATOM   7954  N  ND1   . HIS A 1 1071 ? -34.774 -14.531 -66.082 1.00 83.81  ? 1071 HIS A ND1   1 
ATOM   7955  C  CD2   . HIS A 1 1071 ? -33.420 -15.931 -67.064 1.00 81.44  ? 1071 HIS A CD2   1 
ATOM   7956  C  CE1   . HIS A 1 1071 ? -35.211 -15.746 -65.815 1.00 80.96  ? 1071 HIS A CE1   1 
ATOM   7957  N  NE2   . HIS A 1 1071 ? -34.406 -16.613 -66.399 1.00 81.01  ? 1071 HIS A NE2   1 
ATOM   7958  N  N     . LEU A 1 1072 ? -31.851 -14.178 -64.539 1.00 73.80  ? 1072 LEU A N     1 
ATOM   7959  C  CA    . LEU A 1 1072 ? -31.077 -14.993 -63.596 1.00 79.62  ? 1072 LEU A CA    1 
ATOM   7960  C  C     . LEU A 1 1072 ? -31.887 -16.259 -63.442 1.00 82.35  ? 1072 LEU A C     1 
ATOM   7961  O  O     . LEU A 1 1072 ? -33.116 -16.202 -63.375 1.00 96.79  ? 1072 LEU A O     1 
ATOM   7962  C  CB    . LEU A 1 1072 ? -30.926 -14.231 -62.286 1.00 78.52  ? 1072 LEU A CB    1 
ATOM   7963  C  CG    . LEU A 1 1072 ? -30.028 -14.854 -61.232 1.00 97.08  ? 1072 LEU A CG    1 
ATOM   7964  C  CD1   . LEU A 1 1072 ? -29.356 -13.773 -60.394 1.00 100.49 ? 1072 LEU A CD1   1 
ATOM   7965  C  CD2   . LEU A 1 1072 ? -30.806 -15.823 -60.351 1.00 103.28 ? 1072 LEU A CD2   1 
ATOM   7966  N  N     . ARG A 1 1073 ? -31.218 -17.411 -63.424 1.00 86.61  ? 1073 ARG A N     1 
ATOM   7967  C  CA    . ARG A 1 1073 ? -31.873 -18.727 -63.310 1.00 80.78  ? 1073 ARG A CA    1 
ATOM   7968  C  C     . ARG A 1 1073 ? -31.774 -19.236 -61.872 1.00 79.14  ? 1073 ARG A C     1 
ATOM   7969  O  O     . ARG A 1 1073 ? -32.752 -19.718 -61.304 1.00 79.09  ? 1073 ARG A O     1 
ATOM   7970  C  CB    . ARG A 1 1073 ? -31.220 -19.738 -64.260 1.00 83.38  ? 1073 ARG A CB    1 
ATOM   7971  C  CG    . ARG A 1 1073 ? -31.413 -19.465 -65.748 1.00 87.96  ? 1073 ARG A CG    1 
ATOM   7972  C  CD    . ARG A 1 1073 ? -30.714 -20.537 -66.592 1.00 95.66  ? 1073 ARG A CD    1 
ATOM   7973  N  NE    . ARG A 1 1073 ? -31.427 -21.826 -66.588 1.00 97.25  ? 1073 ARG A NE    1 
ATOM   7974  C  CZ    . ARG A 1 1073 ? -32.197 -22.315 -67.571 1.00 95.53  ? 1073 ARG A CZ    1 
ATOM   7975  N  NH1   . ARG A 1 1073 ? -32.388 -21.669 -68.722 1.00 105.95 ? 1073 ARG A NH1   1 
ATOM   7976  N  NH2   . ARG A 1 1073 ? -32.792 -23.484 -67.399 1.00 90.81  ? 1073 ARG A NH2   1 
ATOM   7977  N  N     . GLY A 1 1074 ? -30.574 -19.169 -61.302 1.00 78.49  ? 1074 GLY A N     1 
ATOM   7978  C  CA    . GLY A 1 1074 ? -30.312 -19.754 -60.011 1.00 73.69  ? 1074 GLY A CA    1 
ATOM   7979  C  C     . GLY A 1 1074 ? -28.894 -19.581 -59.527 1.00 69.59  ? 1074 GLY A C     1 
ATOM   7980  O  O     . GLY A 1 1074 ? -28.186 -18.650 -59.911 1.00 80.21  ? 1074 GLY A O     1 
ATOM   7981  N  N     . THR A 1 1075 ? -28.496 -20.487 -58.647 1.00 67.58  ? 1075 THR A N     1 
ATOM   7982  C  CA    . THR A 1 1075 ? -27.156 -20.510 -58.045 1.00 75.05  ? 1075 THR A CA    1 
ATOM   7983  C  C     . THR A 1 1075 ? -26.594 -21.901 -58.243 1.00 83.82  ? 1075 THR A C     1 
ATOM   7984  O  O     . THR A 1 1075 ? -27.305 -22.892 -58.126 1.00 92.40  ? 1075 THR A O     1 
ATOM   7985  C  CB    . THR A 1 1075 ? -27.213 -20.140 -56.557 1.00 77.72  ? 1075 THR A CB    1 
ATOM   7986  O  OG1   . THR A 1 1075 ? -27.712 -18.805 -56.397 1.00 81.30  ? 1075 THR A OG1   1 
ATOM   7987  C  CG2   . THR A 1 1075 ? -25.843 -20.243 -55.923 1.00 85.42  ? 1075 THR A CG2   1 
ATOM   7988  N  N     . SER A 1 1076 ? -25.311 -21.986 -58.530 1.00 85.96  ? 1076 SER A N     1 
ATOM   7989  C  CA    . SER A 1 1076 ? -24.670 -23.264 -58.912 1.00 80.04  ? 1076 SER A CA    1 
ATOM   7990  C  C     . SER A 1 1076 ? -23.181 -23.226 -58.717 1.00 79.59  ? 1076 SER A C     1 
ATOM   7991  O  O     . SER A 1 1076 ? -22.530 -22.293 -59.162 1.00 87.26  ? 1076 SER A O     1 
ATOM   7992  C  CB    . SER A 1 1076 ? -24.982 -23.545 -60.387 1.00 79.57  ? 1076 SER A CB    1 
ATOM   7993  O  OG    . SER A 1 1076 ? -24.644 -24.871 -60.764 1.00 87.33  ? 1076 SER A OG    1 
ATOM   7994  N  N     . THR A 1 1077 ? -22.633 -24.260 -58.075 1.00 74.61  ? 1077 THR A N     1 
ATOM   7995  C  CA    . THR A 1 1077 ? -21.181 -24.438 -57.964 1.00 72.46  ? 1077 THR A CA    1 
ATOM   7996  C  C     . THR A 1 1077 ? -20.482 -24.550 -59.333 1.00 78.89  ? 1077 THR A C     1 
ATOM   7997  O  O     . THR A 1 1077 ? -19.281 -24.294 -59.458 1.00 97.02  ? 1077 THR A O     1 
ATOM   7998  C  CB    . THR A 1 1077 ? -20.829 -25.735 -57.194 1.00 70.29  ? 1077 THR A CB    1 
ATOM   7999  O  OG1   . THR A 1 1077 ? -21.427 -26.840 -57.864 1.00 77.90  ? 1077 THR A OG1   1 
ATOM   8000  C  CG2   . THR A 1 1077 ? -21.327 -25.750 -55.741 1.00 67.66  ? 1077 THR A CG2   1 
ATOM   8001  N  N     . GLU A 1 1078 ? -21.251 -24.949 -60.348 1.00 88.25  ? 1078 GLU A N     1 
ATOM   8002  C  CA    . GLU A 1 1078 ? -20.776 -25.011 -61.730 1.00 82.89  ? 1078 GLU A CA    1 
ATOM   8003  C  C     . GLU A 1 1078 ? -20.526 -23.635 -62.350 1.00 86.36  ? 1078 GLU A C     1 
ATOM   8004  O  O     . GLU A 1 1078 ? -19.642 -23.505 -63.167 1.00 96.45  ? 1078 GLU A O     1 
ATOM   8005  C  CB    . GLU A 1 1078 ? -21.760 -25.822 -62.606 1.00 77.56  ? 1078 GLU A CB    1 
ATOM   8006  C  CG    . GLU A 1 1078 ? -21.169 -26.328 -63.926 1.00 84.45  ? 1078 GLU A CG    1 
ATOM   8007  C  CD    . GLU A 1 1078 ? -21.924 -27.502 -64.592 1.00 90.07  ? 1078 GLU A CD    1 
ATOM   8008  O  OE1   . GLU A 1 1078 ? -22.605 -28.291 -63.906 1.00 99.47  ? 1078 GLU A OE1   1 
ATOM   8009  O  OE2   . GLU A 1 1078 ? -21.821 -27.673 -65.829 1.00 88.34  ? 1078 GLU A OE2   1 
ATOM   8010  N  N     . THR A 1 1079 ? -21.274 -22.609 -61.965 1.00 83.78  ? 1079 THR A N     1 
ATOM   8011  C  CA    . THR A 1 1079 ? -21.088 -21.284 -62.523 1.00 80.78  ? 1079 THR A CA    1 
ATOM   8012  C  C     . THR A 1 1079 ? -20.214 -20.387 -61.637 1.00 77.65  ? 1079 THR A C     1 
ATOM   8013  O  O     . THR A 1 1079 ? -19.338 -19.685 -62.150 1.00 83.85  ? 1079 THR A O     1 
ATOM   8014  C  CB    . THR A 1 1079 ? -22.466 -20.636 -62.793 1.00 86.61  ? 1079 THR A CB    1 
ATOM   8015  O  OG1   . THR A 1 1079 ? -23.262 -20.589 -61.586 1.00 89.50  ? 1079 THR A OG1   1 
ATOM   8016  C  CG2   . THR A 1 1079 ? -23.212 -21.447 -63.856 1.00 89.24  ? 1079 THR A CG2   1 
ATOM   8017  N  N     . VAL A 1 1080 ? -20.484 -20.389 -60.340 1.00 72.40  ? 1080 VAL A N     1 
ATOM   8018  C  CA    . VAL A 1 1080 ? -19.727 -19.578 -59.393 1.00 69.60  ? 1080 VAL A CA    1 
ATOM   8019  C  C     . VAL A 1 1080 ? -19.185 -20.462 -58.293 1.00 72.35  ? 1080 VAL A C     1 
ATOM   8020  O  O     . VAL A 1 1080 ? -19.944 -20.957 -57.464 1.00 80.68  ? 1080 VAL A O     1 
ATOM   8021  C  CB    . VAL A 1 1080 ? -20.596 -18.548 -58.705 1.00 69.38  ? 1080 VAL A CB    1 
ATOM   8022  C  CG1   . VAL A 1 1080 ? -19.798 -17.896 -57.597 1.00 76.46  ? 1080 VAL A CG1   1 
ATOM   8023  C  CG2   . VAL A 1 1080 ? -21.044 -17.498 -59.695 1.00 69.56  ? 1080 VAL A CG2   1 
ATOM   8024  N  N     . PRO A 1 1081 ? -17.872 -20.696 -58.289 1.00 75.86  ? 1081 PRO A N     1 
ATOM   8025  C  CA    . PRO A 1 1081 ? -17.261 -21.643 -57.356 1.00 78.95  ? 1081 PRO A CA    1 
ATOM   8026  C  C     . PRO A 1 1081 ? -16.860 -20.974 -56.049 1.00 87.38  ? 1081 PRO A C     1 
ATOM   8027  O  O     . PRO A 1 1081 ? -16.665 -19.743 -55.989 1.00 93.97  ? 1081 PRO A O     1 
ATOM   8028  C  CB    . PRO A 1 1081 ? -16.004 -22.070 -58.086 1.00 81.28  ? 1081 PRO A CB    1 
ATOM   8029  C  CG    . PRO A 1 1081 ? -15.612 -20.850 -58.826 1.00 82.98  ? 1081 PRO A CG    1 
ATOM   8030  C  CD    . PRO A 1 1081 ? -16.900 -20.235 -59.290 1.00 82.98  ? 1081 PRO A CD    1 
ATOM   8031  N  N     . ASN A 1 1082 ? -16.737 -21.807 -55.017 1.00 95.56  ? 1082 ASN A N     1 
ATOM   8032  C  CA    . ASN A 1 1082 ? -16.187 -21.402 -53.713 1.00 85.07  ? 1082 ASN A CA    1 
ATOM   8033  C  C     . ASN A 1 1082 ? -17.009 -20.333 -52.961 1.00 80.36  ? 1082 ASN A C     1 
ATOM   8034  O  O     . ASN A 1 1082 ? -16.448 -19.645 -52.123 1.00 89.99  ? 1082 ASN A O     1 
ATOM   8035  C  CB    . ASN A 1 1082 ? -14.783 -20.860 -53.936 1.00 82.86  ? 1082 ASN A CB    1 
ATOM   8036  C  CG    . ASN A 1 1082 ? -14.002 -21.678 -54.928 1.00 81.73  ? 1082 ASN A CG    1 
ATOM   8037  O  OD1   . ASN A 1 1082 ? -14.199 -22.877 -55.041 1.00 77.66  ? 1082 ASN A OD1   1 
ATOM   8038  N  ND2   . ASN A 1 1082 ? -13.105 -21.032 -55.646 1.00 89.37  ? 1082 ASN A ND2   1 
ATOM   8039  N  N     . ALA A 1 1083 ? -18.303 -20.197 -53.244 1.00 73.80  ? 1083 ALA A N     1 
ATOM   8040  C  CA    . ALA A 1 1083 ? -19.110 -19.148 -52.651 1.00 80.65  ? 1083 ALA A CA    1 
ATOM   8041  C  C     . ALA A 1 1083 ? -19.362 -19.426 -51.171 1.00 92.46  ? 1083 ALA A C     1 
ATOM   8042  O  O     . ALA A 1 1083 ? -19.516 -20.590 -50.774 1.00 89.71  ? 1083 ALA A O     1 
ATOM   8043  C  CB    . ALA A 1 1083 ? -20.425 -19.046 -53.386 1.00 88.34  ? 1083 ALA A CB    1 
ATOM   8044  N  N     . ASN A 1 1084 ? -19.395 -18.360 -50.361 1.00 97.49  ? 1084 ASN A N     1 
ATOM   8045  C  CA    . ASN A 1 1084 ? -19.686 -18.518 -48.927 1.00 85.83  ? 1084 ASN A CA    1 
ATOM   8046  C  C     . ASN A 1 1084 ? -21.180 -18.750 -48.698 1.00 77.00  ? 1084 ASN A C     1 
ATOM   8047  O  O     . ASN A 1 1084 ? -22.003 -18.646 -49.612 1.00 77.78  ? 1084 ASN A O     1 
ATOM   8048  C  CB    . ASN A 1 1084 ? -19.140 -17.355 -48.108 1.00 82.13  ? 1084 ASN A CB    1 
ATOM   8049  C  CG    . ASN A 1 1084 ? -17.641 -17.464 -47.908 1.00 82.35  ? 1084 ASN A CG    1 
ATOM   8050  O  OD1   . ASN A 1 1084 ? -17.170 -18.299 -47.136 1.00 91.02  ? 1084 ASN A OD1   1 
ATOM   8051  N  ND2   . ASN A 1 1084 ? -16.882 -16.633 -48.613 1.00 78.31  ? 1084 ASN A ND2   1 
ATOM   8052  N  N     . ILE A 1 1085 ? -21.505 -19.065 -47.457 1.00 76.87  ? 1085 ILE A N     1 
ATOM   8053  C  CA    . ILE A 1 1085 ? -22.883 -19.247 -47.000 1.00 84.68  ? 1085 ILE A CA    1 
ATOM   8054  C  C     . ILE A 1 1085 ? -23.764 -18.024 -47.278 1.00 91.11  ? 1085 ILE A C     1 
ATOM   8055  O  O     . ILE A 1 1085 ? -23.296 -16.880 -47.194 1.00 106.07 ? 1085 ILE A O     1 
ATOM   8056  C  CB    . ILE A 1 1085 ? -22.917 -19.504 -45.495 1.00 85.47  ? 1085 ILE A CB    1 
ATOM   8057  C  CG1   . ILE A 1 1085 ? -24.285 -20.073 -45.116 1.00 88.97  ? 1085 ILE A CG1   1 
ATOM   8058  C  CG2   . ILE A 1 1085 ? -22.555 -18.225 -44.726 1.00 85.41  ? 1085 ILE A CG2   1 
ATOM   8059  C  CD1   . ILE A 1 1085 ? -24.215 -21.169 -44.080 1.00 93.91  ? 1085 ILE A CD1   1 
ATOM   8060  N  N     . SER A 1 1086 ? -25.023 -18.265 -47.616 1.00 94.23  ? 1086 SER A N     1 
ATOM   8061  C  CA    . SER A 1 1086 ? -26.001 -17.188 -47.685 1.00 94.65  ? 1086 SER A CA    1 
ATOM   8062  C  C     . SER A 1 1086 ? -26.532 -16.916 -46.284 1.00 98.27  ? 1086 SER A C     1 
ATOM   8063  O  O     . SER A 1 1086 ? -27.540 -17.490 -45.893 1.00 83.41  ? 1086 SER A O     1 
ATOM   8064  C  CB    . SER A 1 1086 ? -27.094 -17.512 -48.682 1.00 96.98  ? 1086 SER A CB    1 
ATOM   8065  O  OG    . SER A 1 1086 ? -26.526 -17.566 -49.978 1.00 90.67  ? 1086 SER A OG    1 
ATOM   8066  N  N     . GLY A 1 1087 ? -25.810 -16.083 -45.549 1.00 111.21 ? 1087 GLY A N     1 
ATOM   8067  C  CA    . GLY A 1 1087 ? -26.062 -15.802 -44.152 1.00 118.04 ? 1087 GLY A CA    1 
ATOM   8068  C  C     . GLY A 1 1087 ? -25.373 -14.519 -43.678 1.00 125.09 ? 1087 GLY A C     1 
ATOM   8069  O  O     . GLY A 1 1087 ? -24.803 -13.762 -44.478 1.00 120.09 ? 1087 GLY A O     1 
ATOM   8070  N  N     . GLY A 1 1088 ? -25.483 -14.246 -42.378 1.00 123.88 ? 1088 GLY A N     1 
ATOM   8071  C  CA    . GLY A 1 1088 ? -24.871 -13.071 -41.744 1.00 126.19 ? 1088 GLY A CA    1 
ATOM   8072  C  C     . GLY A 1 1088 ? -25.442 -11.697 -42.085 1.00 125.00 ? 1088 GLY A C     1 
ATOM   8073  O  O     . GLY A 1 1088 ? -24.783 -10.682 -41.819 1.00 123.95 ? 1088 GLY A O     1 
ATOM   8074  N  N     . SER A 1 1089 ? -26.655 -11.658 -42.651 1.00 119.28 ? 1089 SER A N     1 
ATOM   8075  C  CA    . SER A 1 1089 ? -27.350 -10.396 -43.057 1.00 114.16 ? 1089 SER A CA    1 
ATOM   8076  C  C     . SER A 1 1089 ? -26.686 -9.622  -44.211 1.00 103.26 ? 1089 SER A C     1 
ATOM   8077  O  O     . SER A 1 1089 ? -27.078 -8.495  -44.486 1.00 84.13  ? 1089 SER A O     1 
ATOM   8078  C  CB    . SER A 1 1089 ? -27.537 -9.455  -41.826 1.00 117.59 ? 1089 SER A CB    1 
ATOM   8079  O  OG    . SER A 1 1089 ? -28.902 -9.285  -41.445 1.00 110.19 ? 1089 SER A OG    1 
ATOM   8080  N  N     . VAL A 1 1090 ? -25.748 -10.256 -44.929 1.00 98.57  ? 1090 VAL A N     1 
ATOM   8081  C  CA    . VAL A 1 1090 ? -24.916 -9.545  -45.899 1.00 100.78 ? 1090 VAL A CA    1 
ATOM   8082  C  C     . VAL A 1 1090 ? -24.849 -10.179 -47.299 1.00 97.50  ? 1090 VAL A C     1 
ATOM   8083  O  O     . VAL A 1 1090 ? -24.008 -9.841  -48.120 1.00 89.54  ? 1090 VAL A O     1 
ATOM   8084  C  CB    . VAL A 1 1090 ? -23.495 -9.396  -45.346 1.00 106.62 ? 1090 VAL A CB    1 
ATOM   8085  C  CG1   . VAL A 1 1090 ? -23.490 -8.395  -44.206 1.00 105.60 ? 1090 VAL A CG1   1 
ATOM   8086  C  CG2   . VAL A 1 1090 ? -22.957 -10.749 -44.898 1.00 110.24 ? 1090 VAL A CG2   1 
ATOM   8087  N  N     . VAL A 1 1091 ? -25.778 -11.088 -47.597 1.00 106.64 ? 1091 VAL A N     1 
ATOM   8088  C  CA    . VAL A 1 1091 ? -25.767 -11.805 -48.868 1.00 104.32 ? 1091 VAL A CA    1 
ATOM   8089  C  C     . VAL A 1 1091 ? -25.880 -10.792 -49.998 1.00 102.63 ? 1091 VAL A C     1 
ATOM   8090  O  O     . VAL A 1 1091 ? -25.056 -10.813 -50.911 1.00 103.75 ? 1091 VAL A O     1 
ATOM   8091  C  CB    . VAL A 1 1091 ? -26.921 -12.833 -49.000 1.00 110.93 ? 1091 VAL A CB    1 
ATOM   8092  C  CG1   . VAL A 1 1091 ? -26.765 -13.636 -50.282 1.00 112.45 ? 1091 VAL A CG1   1 
ATOM   8093  C  CG2   . VAL A 1 1091 ? -26.969 -13.790 -47.815 1.00 115.24 ? 1091 VAL A CG2   1 
ATOM   8094  N  N     . ALA A 1 1092 ? -26.863 -9.896  -49.924 1.00 105.73 ? 1092 ALA A N     1 
ATOM   8095  C  CA    . ALA A 1 1092 ? -27.066 -8.879  -50.944 1.00 108.42 ? 1092 ALA A CA    1 
ATOM   8096  C  C     . ALA A 1 1092 ? -25.913 -7.877  -51.012 1.00 103.27 ? 1092 ALA A C     1 
ATOM   8097  O  O     . ALA A 1 1092 ? -25.424 -7.578  -52.091 1.00 110.86 ? 1092 ALA A O     1 
ATOM   8098  C  CB    . ALA A 1 1092 ? -28.374 -8.150  -50.684 1.00 115.97 ? 1092 ALA A CB    1 
ATOM   8099  N  N     . ASP A 1 1093 ? -25.478 -7.378  -49.859 1.00 100.28 ? 1093 ASP A N     1 
ATOM   8100  C  CA    . ASP A 1 1093 ? -24.330 -6.443  -49.784 1.00 106.22 ? 1093 ASP A CA    1 
ATOM   8101  C  C     . ASP A 1 1093 ? -23.144 -6.936  -50.595 1.00 85.87  ? 1093 ASP A C     1 
ATOM   8102  O  O     . ASP A 1 1093 ? -22.602 -6.212  -51.439 1.00 87.52  ? 1093 ASP A O     1 
ATOM   8103  C  CB    . ASP A 1 1093 ? -23.860 -6.210  -48.348 1.00 126.41 ? 1093 ASP A CB    1 
ATOM   8104  C  CG    . ASP A 1 1093 ? -25.005 -6.062  -47.358 1.00 139.28 ? 1093 ASP A CG    1 
ATOM   8105  O  OD1   . ASP A 1 1093 ? -26.069 -6.718  -47.533 1.00 138.91 ? 1093 ASP A OD1   1 
ATOM   8106  O  OD2   . ASP A 1 1093 ? -24.807 -5.300  -46.386 1.00 133.45 ? 1093 ASP A OD2   1 
ATOM   8107  N  N     . LEU A 1 1094 ? -22.760 -8.172  -50.313 1.00 82.52  ? 1094 LEU A N     1 
ATOM   8108  C  CA    . LEU A 1 1094 ? -21.503 -8.724  -50.777 1.00 87.77  ? 1094 LEU A CA    1 
ATOM   8109  C  C     . LEU A 1 1094 ? -21.604 -9.213  -52.219 1.00 87.00  ? 1094 LEU A C     1 
ATOM   8110  O  O     . LEU A 1 1094 ? -20.742 -8.894  -53.045 1.00 79.34  ? 1094 LEU A O     1 
ATOM   8111  C  CB    . LEU A 1 1094 ? -21.122 -9.882  -49.862 1.00 90.09  ? 1094 LEU A CB    1 
ATOM   8112  C  CG    . LEU A 1 1094 ? -20.968 -9.496  -48.388 1.00 83.17  ? 1094 LEU A CG    1 
ATOM   8113  C  CD1   . LEU A 1 1094 ? -20.803 -10.745 -47.521 1.00 82.24  ? 1094 LEU A CD1   1 
ATOM   8114  C  CD2   . LEU A 1 1094 ? -19.802 -8.525  -48.250 1.00 81.55  ? 1094 LEU A CD2   1 
ATOM   8115  N  N     . ASN A 1 1095 ? -22.653 -9.968  -52.528 1.00 84.51  ? 1095 ASN A N     1 
ATOM   8116  C  CA    . ASN A 1 1095 ? -22.874 -10.405 -53.902 1.00 83.70  ? 1095 ASN A CA    1 
ATOM   8117  C  C     . ASN A 1 1095 ? -23.243 -9.245  -54.804 1.00 78.10  ? 1095 ASN A C     1 
ATOM   8118  O  O     . ASN A 1 1095 ? -22.919 -9.260  -55.979 1.00 77.67  ? 1095 ASN A O     1 
ATOM   8119  C  CB    . ASN A 1 1095 ? -23.929 -11.504 -53.966 1.00 87.51  ? 1095 ASN A CB    1 
ATOM   8120  C  CG    . ASN A 1 1095 ? -23.407 -12.833 -53.434 1.00 94.11  ? 1095 ASN A CG    1 
ATOM   8121  O  OD1   . ASN A 1 1095 ? -22.505 -13.452 -54.021 1.00 100.16 ? 1095 ASN A OD1   1 
ATOM   8122  N  ND2   . ASN A 1 1095 ? -23.965 -13.278 -52.316 1.00 97.92  ? 1095 ASN A ND2   1 
ATOM   8123  N  N     . GLY A 1 1096 ? -23.910 -8.238  -54.253 1.00 82.09  ? 1096 GLY A N     1 
ATOM   8124  C  CA    . GLY A 1 1096 ? -24.120 -6.966  -54.954 1.00 84.63  ? 1096 GLY A CA    1 
ATOM   8125  C  C     . GLY A 1 1096 ? -22.839 -6.260  -55.362 1.00 87.90  ? 1096 GLY A C     1 
ATOM   8126  O  O     . GLY A 1 1096 ? -22.758 -5.728  -56.466 1.00 88.92  ? 1096 GLY A O     1 
ATOM   8127  N  N     . LEU A 1 1097 ? -21.837 -6.255  -54.483 1.00 84.89  ? 1097 LEU A N     1 
ATOM   8128  C  CA    . LEU A 1 1097 ? -20.533 -5.691  -54.820 1.00 83.90  ? 1097 LEU A CA    1 
ATOM   8129  C  C     . LEU A 1 1097 ? -19.804 -6.491  -55.902 1.00 84.45  ? 1097 LEU A C     1 
ATOM   8130  O  O     . LEU A 1 1097 ? -19.098 -5.914  -56.730 1.00 76.11  ? 1097 LEU A O     1 
ATOM   8131  C  CB    . LEU A 1 1097 ? -19.657 -5.560  -53.581 1.00 80.03  ? 1097 LEU A CB    1 
ATOM   8132  C  CG    . LEU A 1 1097 ? -20.153 -4.433  -52.682 1.00 83.12  ? 1097 LEU A CG    1 
ATOM   8133  C  CD1   . LEU A 1 1097 ? -19.400 -4.444  -51.363 1.00 90.04  ? 1097 LEU A CD1   1 
ATOM   8134  C  CD2   . LEU A 1 1097 ? -20.014 -3.074  -53.353 1.00 87.93  ? 1097 LEU A CD2   1 
ATOM   8135  N  N     . ALA A 1 1098 ? -19.980 -7.808  -55.897 1.00 85.72  ? 1098 ALA A N     1 
ATOM   8136  C  CA    . ALA A 1 1098 ? -19.358 -8.669  -56.904 1.00 80.67  ? 1098 ALA A CA    1 
ATOM   8137  C  C     . ALA A 1 1098 ? -20.063 -8.580  -58.269 1.00 76.57  ? 1098 ALA A C     1 
ATOM   8138  O  O     . ALA A 1 1098 ? -19.419 -8.696  -59.310 1.00 79.14  ? 1098 ALA A O     1 
ATOM   8139  C  CB    . ALA A 1 1098 ? -19.243 -10.100 -56.395 1.00 81.70  ? 1098 ALA A CB    1 
ATOM   8140  N  N     . VAL A 1 1099 ? -21.380 -8.393  -58.256 1.00 69.69  ? 1099 VAL A N     1 
ATOM   8141  C  CA    . VAL A 1 1099 ? -22.150 -8.216  -59.482 1.00 72.83  ? 1099 VAL A CA    1 
ATOM   8142  C  C     . VAL A 1 1099 ? -21.804 -6.868  -60.118 1.00 82.69  ? 1099 VAL A C     1 
ATOM   8143  O  O     . VAL A 1 1099 ? -21.558 -6.789  -61.316 1.00 71.92  ? 1099 VAL A O     1 
ATOM   8144  C  CB    . VAL A 1 1099 ? -23.672 -8.383  -59.263 1.00 79.23  ? 1099 VAL A CB    1 
ATOM   8145  C  CG1   . VAL A 1 1099 ? -24.464 -7.908  -60.482 1.00 82.98  ? 1099 VAL A CG1   1 
ATOM   8146  C  CG2   . VAL A 1 1099 ? -24.017 -9.835  -58.971 1.00 80.29  ? 1099 VAL A CG2   1 
ATOM   8147  N  N     . LYS A 1 1100 ? -21.787 -5.823  -59.296 1.00 94.48  ? 1100 LYS A N     1 
ATOM   8148  C  CA    . LYS A 1 1100 ? -21.318 -4.499  -59.702 1.00 93.77  ? 1100 LYS A CA    1 
ATOM   8149  C  C     . LYS A 1 1100 ? -19.914 -4.562  -60.306 1.00 94.93  ? 1100 LYS A C     1 
ATOM   8150  O  O     . LYS A 1 1100 ? -19.651 -3.963  -61.336 1.00 101.94 ? 1100 LYS A O     1 
ATOM   8151  C  CB    . LYS A 1 1100 ? -21.278 -3.623  -58.446 1.00 98.93  ? 1100 LYS A CB    1 
ATOM   8152  C  CG    . LYS A 1 1100 ? -20.807 -2.196  -58.648 1.00 105.49 ? 1100 LYS A CG    1 
ATOM   8153  C  CD    . LYS A 1 1100 ? -21.586 -1.264  -57.736 1.00 112.99 ? 1100 LYS A CD    1 
ATOM   8154  C  CE    . LYS A 1 1100 ? -21.019 0.146   -57.735 1.00 124.59 ? 1100 LYS A CE    1 
ATOM   8155  N  NZ    . LYS A 1 1100 ? -19.929 0.314   -56.735 1.00 129.78 ? 1100 LYS A NZ    1 
ATOM   8156  N  N     . ASP A 1 1101 ? -19.018 -5.309  -59.673 1.00 90.21  ? 1101 ASP A N     1 
ATOM   8157  C  CA    . ASP A 1 1101 ? -17.662 -5.469  -60.189 1.00 82.57  ? 1101 ASP A CA    1 
ATOM   8158  C  C     . ASP A 1 1101 ? -17.614 -6.061  -61.612 1.00 83.42  ? 1101 ASP A C     1 
ATOM   8159  O  O     . ASP A 1 1101 ? -16.887 -5.569  -62.451 1.00 76.53  ? 1101 ASP A O     1 
ATOM   8160  C  CB    . ASP A 1 1101 ? -16.880 -6.366  -59.255 1.00 79.77  ? 1101 ASP A CB    1 
ATOM   8161  C  CG    . ASP A 1 1101 ? -15.470 -6.524  -59.693 1.00 82.72  ? 1101 ASP A CG    1 
ATOM   8162  O  OD1   . ASP A 1 1101 ? -14.870 -5.511  -60.113 1.00 87.31  ? 1101 ASP A OD1   1 
ATOM   8163  O  OD2   . ASP A 1 1101 ? -14.966 -7.658  -59.636 1.00 89.34  ? 1101 ASP A OD2   1 
ATOM   8164  N  N     . ALA A 1 1102 ? -18.385 -7.113  -61.880 1.00 92.81  ? 1102 ALA A N     1 
ATOM   8165  C  CA    . ALA A 1 1102 ? -18.462 -7.692  -63.240 1.00 87.69  ? 1102 ALA A CA    1 
ATOM   8166  C  C     . ALA A 1 1102 ? -19.041 -6.728  -64.244 1.00 88.21  ? 1102 ALA A C     1 
ATOM   8167  O  O     . ALA A 1 1102 ? -18.550 -6.628  -65.356 1.00 97.41  ? 1102 ALA A O     1 
ATOM   8168  C  CB    . ALA A 1 1102 ? -19.247 -8.981  -63.254 1.00 96.35  ? 1102 ALA A CB    1 
ATOM   8169  N  N     . CYS A 1 1103 ? -20.108 -6.039  -63.858 1.00 95.93  ? 1103 CYS A N     1 
ATOM   8170  C  CA    . CYS A 1 1103 ? -20.757 -5.043  -64.714 1.00 98.77  ? 1103 CYS A CA    1 
ATOM   8171  C  C     . CYS A 1 1103 ? -19.804 -3.939  -65.122 1.00 97.48  ? 1103 CYS A C     1 
ATOM   8172  O  O     . CYS A 1 1103 ? -19.776 -3.569  -66.279 1.00 100.88 ? 1103 CYS A O     1 
ATOM   8173  C  CB    . CYS A 1 1103 ? -21.960 -4.443  -64.009 1.00 99.58  ? 1103 CYS A CB    1 
ATOM   8174  S  SG    . CYS A 1 1103 ? -23.276 -5.643  -63.836 1.00 105.57 ? 1103 CYS A SG    1 
ATOM   8175  N  N     . GLN A 1 1104 ? -19.037 -3.414  -64.173 1.00 92.75  ? 1104 GLN A N     1 
ATOM   8176  C  CA    . GLN A 1 1104 ? -18.100 -2.317  -64.447 1.00 98.71  ? 1104 GLN A CA    1 
ATOM   8177  C  C     . GLN A 1 1104 ? -16.988 -2.745  -65.405 1.00 98.63  ? 1104 GLN A C     1 
ATOM   8178  O  O     . GLN A 1 1104 ? -16.686 -2.042  -66.366 1.00 87.15  ? 1104 GLN A O     1 
ATOM   8179  C  CB    . GLN A 1 1104 ? -17.458 -1.790  -63.182 1.00 97.89  ? 1104 GLN A CB    1 
ATOM   8180  C  CG    . GLN A 1 1104 ? -18.194 -0.632  -62.536 1.00 99.32  ? 1104 GLN A CG    1 
ATOM   8181  C  CD    . GLN A 1 1104 ? -17.967 -0.625  -61.028 1.00 99.67  ? 1104 GLN A CD    1 
ATOM   8182  O  OE1   . GLN A 1 1104 ? -18.810 -0.172  -60.256 1.00 86.56  ? 1104 GLN A OE1   1 
ATOM   8183  N  NE2   . GLN A 1 1104 ? -16.826 -1.172  -60.600 1.00 100.10 ? 1104 GLN A NE2   1 
ATOM   8184  N  N     . THR A 1 1105 ? -16.384 -3.894  -65.128 1.00 95.61  ? 1105 THR A N     1 
ATOM   8185  C  CA    . THR A 1 1105 ? -15.466 -4.543  -66.054 1.00 88.18  ? 1105 THR A CA    1 
ATOM   8186  C  C     . THR A 1 1105 ? -16.047 -4.591  -67.463 1.00 85.87  ? 1105 THR A C     1 
ATOM   8187  O  O     . THR A 1 1105 ? -15.381 -4.195  -68.416 1.00 113.44 ? 1105 THR A O     1 
ATOM   8188  C  CB    . THR A 1 1105 ? -15.125 -5.995  -65.651 1.00 83.27  ? 1105 THR A CB    1 
ATOM   8189  O  OG1   . THR A 1 1105 ? -15.169 -6.149  -64.231 1.00 84.66  ? 1105 THR A OG1   1 
ATOM   8190  C  CG2   . THR A 1 1105 ? -13.738 -6.359  -66.127 1.00 86.12  ? 1105 THR A CG2   1 
ATOM   8191  N  N     . LEU A 1 1106 ? -17.278 -5.074  -67.584 1.00 82.80  ? 1106 LEU A N     1 
ATOM   8192  C  CA    . LEU A 1 1106 ? -17.944 -5.167  -68.883 1.00 87.76  ? 1106 LEU A CA    1 
ATOM   8193  C  C     . LEU A 1 1106 ? -18.147 -3.798  -69.515 1.00 81.50  ? 1106 LEU A C     1 
ATOM   8194  O  O     . LEU A 1 1106 ? -17.948 -3.637  -70.710 1.00 82.67  ? 1106 LEU A O     1 
ATOM   8195  C  CB    . LEU A 1 1106 ? -19.313 -5.860  -68.787 1.00 95.31  ? 1106 LEU A CB    1 
ATOM   8196  C  CG    . LEU A 1 1106 ? -19.322 -7.396  -68.832 1.00 102.53 ? 1106 LEU A CG    1 
ATOM   8197  C  CD1   . LEU A 1 1106 ? -20.687 -7.933  -68.435 1.00 103.50 ? 1106 LEU A CD1   1 
ATOM   8198  C  CD2   . LEU A 1 1106 ? -18.923 -7.930  -70.205 1.00 106.57 ? 1106 LEU A CD2   1 
ATOM   8199  N  N     . LEU A 1 1107 ? -18.530 -2.816  -68.712 1.00 77.12  ? 1107 LEU A N     1 
ATOM   8200  C  CA    . LEU A 1 1107 ? -18.736 -1.461  -69.206 1.00 86.19  ? 1107 LEU A CA    1 
ATOM   8201  C  C     . LEU A 1 1107 ? -17.432 -0.813  -69.636 1.00 101.42 ? 1107 LEU A C     1 
ATOM   8202  O  O     . LEU A 1 1107 ? -17.434 -0.086  -70.614 1.00 112.46 ? 1107 LEU A O     1 
ATOM   8203  C  CB    . LEU A 1 1107 ? -19.372 -0.633  -68.116 1.00 88.94  ? 1107 LEU A CB    1 
ATOM   8204  C  CG    . LEU A 1 1107 ? -20.291 0.445   -68.651 1.00 96.04  ? 1107 LEU A CG    1 
ATOM   8205  C  CD1   . LEU A 1 1107 ? -21.474 -0.204  -69.363 1.00 96.01  ? 1107 LEU A CD1   1 
ATOM   8206  C  CD2   . LEU A 1 1107 ? -20.732 1.348   -67.498 1.00 105.12 ? 1107 LEU A CD2   1 
ATOM   8207  N  N     . LYS A 1 1108 ? -16.323 -1.071  -68.931 1.00 104.65 ? 1108 LYS A N     1 
ATOM   8208  C  CA    . LYS A 1 1108 ? -14.987 -0.553  -69.332 1.00 102.73 ? 1108 LYS A CA    1 
ATOM   8209  C  C     . LYS A 1 1108 ? -14.583 -1.041  -70.720 1.00 106.41 ? 1108 LYS A C     1 
ATOM   8210  O  O     . LYS A 1 1108 ? -14.120 -0.254  -71.542 1.00 122.26 ? 1108 LYS A O     1 
ATOM   8211  C  CB    . LYS A 1 1108 ? -13.849 -1.030  -68.399 1.00 105.62 ? 1108 LYS A CB    1 
ATOM   8212  C  CG    . LYS A 1 1108 ? -13.469 -0.114  -67.241 1.00 125.26 ? 1108 LYS A CG    1 
ATOM   8213  C  CD    . LYS A 1 1108 ? -14.363 -0.363  -66.022 1.00 151.28 ? 1108 LYS A CD    1 
ATOM   8214  C  CE    . LYS A 1 1108 ? -13.905 0.333   -64.738 1.00 151.03 ? 1108 LYS A CE    1 
ATOM   8215  N  NZ    . LYS A 1 1108 ? -14.963 0.351   -63.677 1.00 139.16 ? 1108 LYS A NZ    1 
ATOM   8216  N  N     . ARG A 1 1109 ? -14.751 -2.341  -70.959 1.00 101.30 ? 1109 ARG A N     1 
ATOM   8217  C  CA    . ARG A 1 1109 ? -14.465 -2.956  -72.256 1.00 97.20  ? 1109 ARG A CA    1 
ATOM   8218  C  C     . ARG A 1 1109 ? -15.265 -2.343  -73.389 1.00 92.65  ? 1109 ARG A C     1 
ATOM   8219  O  O     . ARG A 1 1109 ? -14.759 -2.190  -74.490 1.00 92.74  ? 1109 ARG A O     1 
ATOM   8220  C  CB    . ARG A 1 1109 ? -14.719 -4.449  -72.195 1.00 103.34 ? 1109 ARG A CB    1 
ATOM   8221  C  CG    . ARG A 1 1109 ? -13.522 -5.193  -71.636 1.00 108.67 ? 1109 ARG A CG    1 
ATOM   8222  C  CD    . ARG A 1 1109 ? -13.665 -6.683  -71.814 1.00 97.17  ? 1109 ARG A CD    1 
ATOM   8223  N  NE    . ARG A 1 1109 ? -13.584 -7.308  -70.509 1.00 89.00  ? 1109 ARG A NE    1 
ATOM   8224  C  CZ    . ARG A 1 1109 ? -14.130 -8.471  -70.216 1.00 86.16  ? 1109 ARG A CZ    1 
ATOM   8225  N  NH1   . ARG A 1 1109 ? -14.796 -9.158  -71.137 1.00 85.90  ? 1109 ARG A NH1   1 
ATOM   8226  N  NH2   . ARG A 1 1109 ? -14.002 -8.953  -68.990 1.00 94.89  ? 1109 ARG A NH2   1 
ATOM   8227  N  N     . LEU A 1 1110 ? -16.512 -2.004  -73.098 1.00 100.07 ? 1110 LEU A N     1 
ATOM   8228  C  CA    . LEU A 1 1110 ? -17.448 -1.460  -74.080 1.00 110.04 ? 1110 LEU A CA    1 
ATOM   8229  C  C     . LEU A 1 1110 ? -17.414 0.054   -74.275 1.00 122.72 ? 1110 LEU A C     1 
ATOM   8230  O  O     . LEU A 1 1110 ? -17.999 0.548   -75.239 1.00 120.18 ? 1110 LEU A O     1 
ATOM   8231  C  CB    . LEU A 1 1110 ? -18.873 -1.871  -73.695 1.00 103.78 ? 1110 LEU A CB    1 
ATOM   8232  C  CG    . LEU A 1 1110 ? -19.207 -3.360  -73.799 1.00 92.37  ? 1110 LEU A CG    1 
ATOM   8233  C  CD1   . LEU A 1 1110 ? -20.427 -3.679  -72.950 1.00 87.94  ? 1110 LEU A CD1   1 
ATOM   8234  C  CD2   . LEU A 1 1110 ? -19.436 -3.753  -75.249 1.00 89.82  ? 1110 LEU A CD2   1 
ATOM   8235  N  N     . GLU A 1 1111 ? -16.764 0.797   -73.382 1.00 127.97 ? 1111 GLU A N     1 
ATOM   8236  C  CA    . GLU A 1 1111 ? -16.801 2.272   -73.438 1.00 133.09 ? 1111 GLU A CA    1 
ATOM   8237  C  C     . GLU A 1 1111 ? -16.361 2.876   -74.778 1.00 116.76 ? 1111 GLU A C     1 
ATOM   8238  O  O     . GLU A 1 1111 ? -16.971 3.841   -75.233 1.00 119.44 ? 1111 GLU A O     1 
ATOM   8239  C  CB    . GLU A 1 1111 ? -15.958 2.872   -72.296 1.00 138.88 ? 1111 GLU A CB    1 
ATOM   8240  C  CG    . GLU A 1 1111 ? -16.805 3.232   -71.083 1.00 150.19 ? 1111 GLU A CG    1 
ATOM   8241  C  CD    . GLU A 1 1111 ? -16.016 3.570   -69.824 1.00 150.76 ? 1111 GLU A CD    1 
ATOM   8242  O  OE1   . GLU A 1 1111 ? -14.827 3.952   -69.950 1.00 139.54 ? 1111 GLU A OE1   1 
ATOM   8243  O  OE2   . GLU A 1 1111 ? -16.601 3.467   -68.710 1.00 127.27 ? 1111 GLU A OE2   1 
ATOM   8244  N  N     . PRO A 1 1112 ? -15.327 2.310   -75.424 1.00 98.05  ? 1112 PRO A N     1 
ATOM   8245  C  CA    . PRO A 1 1112 ? -15.010 2.661   -76.808 1.00 94.67  ? 1112 PRO A CA    1 
ATOM   8246  C  C     . PRO A 1 1112 ? -16.205 2.561   -77.758 1.00 106.64 ? 1112 PRO A C     1 
ATOM   8247  O  O     . PRO A 1 1112 ? -16.460 3.493   -78.531 1.00 114.89 ? 1112 PRO A O     1 
ATOM   8248  C  CB    . PRO A 1 1112 ? -14.018 1.569   -77.211 1.00 88.93  ? 1112 PRO A CB    1 
ATOM   8249  C  CG    . PRO A 1 1112 ? -13.349 1.181   -75.941 1.00 94.76  ? 1112 PRO A CG    1 
ATOM   8250  C  CD    . PRO A 1 1112 ? -14.171 1.675   -74.778 1.00 97.02  ? 1112 PRO A CD    1 
ATOM   8251  N  N     . ILE A 1 1113 ? -16.923 1.439   -77.686 1.00 117.82 ? 1113 ILE A N     1 
ATOM   8252  C  CA    . ILE A 1 1113 ? -18.108 1.190   -78.523 1.00 123.67 ? 1113 ILE A CA    1 
ATOM   8253  C  C     . ILE A 1 1113 ? -19.284 2.106   -78.155 1.00 122.24 ? 1113 ILE A C     1 
ATOM   8254  O  O     . ILE A 1 1113 ? -20.028 2.557   -79.038 1.00 126.26 ? 1113 ILE A O     1 
ATOM   8255  C  CB    . ILE A 1 1113 ? -18.513 -0.294  -78.480 1.00 115.84 ? 1113 ILE A CB    1 
ATOM   8256  C  CG1   . ILE A 1 1113 ? -17.339 -1.140  -79.025 1.00 115.54 ? 1113 ILE A CG1   1 
ATOM   8257  C  CG2   . ILE A 1 1113 ? -19.811 -0.487  -79.251 1.00 112.51 ? 1113 ILE A CG2   1 
ATOM   8258  C  CD1   . ILE A 1 1113 ? -17.688 -2.503  -79.591 1.00 113.54 ? 1113 ILE A CD1   1 
ATOM   8259  N  N     . ILE A 1 1114 ? -19.432 2.395   -76.865 1.00 120.21 ? 1114 ILE A N     1 
ATOM   8260  C  CA    . ILE A 1 1114 ? -20.528 3.240   -76.381 1.00 131.35 ? 1114 ILE A CA    1 
ATOM   8261  C  C     . ILE A 1 1114 ? -20.328 4.713   -76.758 1.00 132.39 ? 1114 ILE A C     1 
ATOM   8262  O  O     . ILE A 1 1114 ? -21.277 5.369   -77.193 1.00 134.64 ? 1114 ILE A O     1 
ATOM   8263  C  CB    . ILE A 1 1114 ? -20.821 3.067   -74.869 1.00 131.43 ? 1114 ILE A CB    1 
ATOM   8264  C  CG1   . ILE A 1 1114 ? -21.188 1.594   -74.605 1.00 137.16 ? 1114 ILE A CG1   1 
ATOM   8265  C  CG2   . ILE A 1 1114 ? -21.931 4.028   -74.417 1.00 119.95 ? 1114 ILE A CG2   1 
ATOM   8266  C  CD1   . ILE A 1 1114 ? -22.173 1.354   -73.482 1.00 138.34 ? 1114 ILE A CD1   1 
ATOM   8267  N  N     . SER A 1 1115 ? -19.109 5.230   -76.607 1.00 137.17 ? 1115 SER A N     1 
ATOM   8268  C  CA    . SER A 1 1115 ? -18.797 6.618   -76.999 1.00 132.19 ? 1115 SER A CA    1 
ATOM   8269  C  C     . SER A 1 1115 ? -18.955 6.867   -78.515 1.00 129.40 ? 1115 SER A C     1 
ATOM   8270  O  O     . SER A 1 1115 ? -19.366 7.956   -78.936 1.00 138.25 ? 1115 SER A O     1 
ATOM   8271  C  CB    . SER A 1 1115 ? -17.367 6.982   -76.579 1.00 126.96 ? 1115 SER A CB    1 
ATOM   8272  O  OG    . SER A 1 1115 ? -16.419 6.402   -77.467 1.00 129.44 ? 1115 SER A OG    1 
ATOM   8273  N  N     . LYS A 1 1116 ? -18.662 5.842   -79.316 1.00 120.37 ? 1116 LYS A N     1 
ATOM   8274  C  CA    . LYS A 1 1116 ? -18.727 5.940   -80.776 1.00 123.07 ? 1116 LYS A CA    1 
ATOM   8275  C  C     . LYS A 1 1116 ? -20.149 5.815   -81.345 1.00 113.13 ? 1116 LYS A C     1 
ATOM   8276  O  O     . LYS A 1 1116 ? -20.362 6.036   -82.532 1.00 103.54 ? 1116 LYS A O     1 
ATOM   8277  C  CB    . LYS A 1 1116 ? -17.751 4.967   -81.446 1.00 127.44 ? 1116 LYS A CB    1 
ATOM   8278  C  CG    . LYS A 1 1116 ? -17.112 5.574   -82.689 1.00 133.68 ? 1116 LYS A CG    1 
ATOM   8279  C  CD    . LYS A 1 1116 ? -16.618 4.539   -83.684 1.00 136.25 ? 1116 LYS A CD    1 
ATOM   8280  C  CE    . LYS A 1 1116 ? -16.455 5.183   -85.051 1.00 144.14 ? 1116 LYS A CE    1 
ATOM   8281  N  NZ    . LYS A 1 1116 ? -16.006 4.206   -86.076 1.00 153.39 ? 1116 LYS A NZ    1 
ATOM   8282  N  N     . ASN A 1 1117 ? -21.117 5.458   -80.492 1.00 111.01 ? 1117 ASN A N     1 
ATOM   8283  C  CA    . ASN A 1 1117 ? -22.521 5.254   -80.874 1.00 113.98 ? 1117 ASN A CA    1 
ATOM   8284  C  C     . ASN A 1 1117 ? -23.372 5.372   -79.607 1.00 114.21 ? 1117 ASN A C     1 
ATOM   8285  O  O     . ASN A 1 1117 ? -23.933 4.382   -79.125 1.00 119.10 ? 1117 ASN A O     1 
ATOM   8286  C  CB    . ASN A 1 1117 ? -22.654 3.886   -81.545 1.00 114.22 ? 1117 ASN A CB    1 
ATOM   8287  C  CG    . ASN A 1 1117 ? -24.090 3.457   -81.738 1.00 113.88 ? 1117 ASN A CG    1 
ATOM   8288  O  OD1   . ASN A 1 1117 ? -25.019 4.231   -81.495 1.00 103.65 ? 1117 ASN A OD1   1 
ATOM   8289  N  ND2   . ASN A 1 1117 ? -24.281 2.203   -82.166 1.00 116.51 ? 1117 ASN A ND2   1 
ATOM   8290  N  N     . PRO A 1 1118 ? -23.453 6.602   -79.037 1.00 108.76 ? 1118 PRO A N     1 
ATOM   8291  C  CA    . PRO A 1 1118 ? -24.085 6.763   -77.717 1.00 103.32 ? 1118 PRO A CA    1 
ATOM   8292  C  C     . PRO A 1 1118 ? -25.597 6.571   -77.708 1.00 99.34  ? 1118 PRO A C     1 
ATOM   8293  O  O     . PRO A 1 1118 ? -26.138 6.294   -76.642 1.00 95.83  ? 1118 PRO A O     1 
ATOM   8294  C  CB    . PRO A 1 1118 ? -23.649 8.168   -77.279 1.00 105.41 ? 1118 PRO A CB    1 
ATOM   8295  C  CG    . PRO A 1 1118 ? -22.373 8.406   -78.014 1.00 104.58 ? 1118 PRO A CG    1 
ATOM   8296  C  CD    . PRO A 1 1118 ? -22.627 7.781   -79.362 1.00 109.62 ? 1118 PRO A CD    1 
ATOM   8297  N  N     . LYS A 1 1119 ? -26.258 6.678   -78.861 1.00 112.29 ? 1119 LYS A N     1 
ATOM   8298  C  CA    . LYS A 1 1119 ? -27.694 6.473   -78.961 1.00 132.84 ? 1119 LYS A CA    1 
ATOM   8299  C  C     . LYS A 1 1119 ? -28.106 5.050   -79.405 1.00 128.28 ? 1119 LYS A C     1 
ATOM   8300  O  O     . LYS A 1 1119 ? -29.240 4.850   -79.806 1.00 127.97 ? 1119 LYS A O     1 
ATOM   8301  C  CB    . LYS A 1 1119 ? -28.274 7.469   -79.978 1.00 146.11 ? 1119 LYS A CB    1 
ATOM   8302  C  CG    . LYS A 1 1119 ? -28.219 8.932   -79.556 1.00 155.87 ? 1119 LYS A CG    1 
ATOM   8303  C  CD    . LYS A 1 1119 ? -29.254 9.264   -78.485 1.00 154.63 ? 1119 LYS A CD    1 
ATOM   8304  C  CE    . LYS A 1 1119 ? -29.795 10.679  -78.643 1.00 155.52 ? 1119 LYS A CE    1 
ATOM   8305  N  NZ    . LYS A 1 1119 ? -28.730 11.707  -78.501 1.00 158.38 ? 1119 LYS A NZ    1 
ATOM   8306  N  N     . GLY A 1 1120 ? -27.171 4.110   -79.340 1.00 124.26 ? 1120 GLY A N     1 
ATOM   8307  C  CA    . GLY A 1 1120 ? -27.411 2.751   -79.838 1.00 117.91 ? 1120 GLY A CA    1 
ATOM   8308  C  C     . GLY A 1 1120 ? -27.951 1.832   -78.758 1.00 112.00 ? 1120 GLY A C     1 
ATOM   8309  O  O     . GLY A 1 1120 ? -27.728 2.049   -77.570 1.00 103.40 ? 1120 GLY A O     1 
ATOM   8310  N  N     . THR A 1 1121 ? -28.674 0.805   -79.189 1.00 107.38 ? 1121 THR A N     1 
ATOM   8311  C  CA    . THR A 1 1121 ? -29.235 -0.196  -78.292 1.00 104.66 ? 1121 THR A CA    1 
ATOM   8312  C  C     . THR A 1 1121 ? -28.155 -1.119  -77.739 1.00 103.73 ? 1121 THR A C     1 
ATOM   8313  O  O     . THR A 1 1121 ? -27.058 -1.174  -78.285 1.00 109.76 ? 1121 THR A O     1 
ATOM   8314  C  CB    . THR A 1 1121 ? -30.239 -1.084  -79.071 1.00 106.12 ? 1121 THR A CB    1 
ATOM   8315  O  OG1   . THR A 1 1121 ? -29.630 -1.564  -80.281 1.00 99.66  ? 1121 THR A OG1   1 
ATOM   8316  C  CG2   . THR A 1 1121 ? -31.492 -0.297  -79.437 1.00 104.08 ? 1121 THR A CG2   1 
ATOM   8317  N  N     . TRP A 1 1122 ? -28.459 -1.847  -76.665 1.00 100.36 ? 1122 TRP A N     1 
ATOM   8318  C  CA    . TRP A 1 1122 ? -27.537 -2.878  -76.160 1.00 95.00  ? 1122 TRP A CA    1 
ATOM   8319  C  C     . TRP A 1 1122 ? -27.297 -4.025  -77.177 1.00 95.45  ? 1122 TRP A C     1 
ATOM   8320  O  O     . TRP A 1 1122 ? -26.204 -4.601  -77.229 1.00 98.17  ? 1122 TRP A O     1 
ATOM   8321  C  CB    . TRP A 1 1122 ? -28.041 -3.439  -74.820 1.00 94.87  ? 1122 TRP A CB    1 
ATOM   8322  C  CG    . TRP A 1 1122 ? -27.451 -2.758  -73.616 1.00 94.24  ? 1122 TRP A CG    1 
ATOM   8323  C  CD1   . TRP A 1 1122 ? -28.084 -1.900  -72.754 1.00 97.92  ? 1122 TRP A CD1   1 
ATOM   8324  C  CD2   . TRP A 1 1122 ? -26.109 -2.886  -73.138 1.00 91.18  ? 1122 TRP A CD2   1 
ATOM   8325  N  NE1   . TRP A 1 1122 ? -27.213 -1.488  -71.765 1.00 94.12  ? 1122 TRP A NE1   1 
ATOM   8326  C  CE2   . TRP A 1 1122 ? -25.991 -2.076  -71.980 1.00 95.71  ? 1122 TRP A CE2   1 
ATOM   8327  C  CE3   . TRP A 1 1122 ? -24.992 -3.609  -73.569 1.00 89.11  ? 1122 TRP A CE3   1 
ATOM   8328  C  CZ2   . TRP A 1 1122 ? -24.781 -1.970  -71.248 1.00 91.78  ? 1122 TRP A CZ2   1 
ATOM   8329  C  CZ3   . TRP A 1 1122 ? -23.789 -3.507  -72.837 1.00 88.06  ? 1122 TRP A CZ3   1 
ATOM   8330  C  CH2   . TRP A 1 1122 ? -23.696 -2.688  -71.695 1.00 84.36  ? 1122 TRP A CH2   1 
ATOM   8331  N  N     . LYS A 1 1123 ? -28.317 -4.330  -77.983 1.00 90.07  ? 1123 LYS A N     1 
ATOM   8332  C  CA    . LYS A 1 1123 ? -28.177 -5.255  -79.099 1.00 83.10  ? 1123 LYS A CA    1 
ATOM   8333  C  C     . LYS A 1 1123 ? -27.121 -4.825  -80.105 1.00 82.65  ? 1123 LYS A C     1 
ATOM   8334  O  O     . LYS A 1 1123 ? -26.403 -5.664  -80.638 1.00 87.99  ? 1123 LYS A O     1 
ATOM   8335  C  CB    . LYS A 1 1123 ? -29.552 -5.463  -79.768 1.00 87.96  ? 1123 LYS A CB    1 
ATOM   8336  C  CG    . LYS A 1 1123 ? -29.509 -6.396  -80.962 1.00 101.00 ? 1123 LYS A CG    1 
ATOM   8337  C  CD    . LYS A 1 1123 ? -30.717 -7.306  -81.109 1.00 114.54 ? 1123 LYS A CD    1 
ATOM   8338  C  CE    . LYS A 1 1123 ? -30.403 -8.376  -82.164 1.00 127.82 ? 1123 LYS A CE    1 
ATOM   8339  N  NZ    . LYS A 1 1123 ? -31.580 -9.175  -82.614 1.00 131.51 ? 1123 LYS A NZ    1 
ATOM   8340  N  N     . ASP A 1 1124 ? -27.037 -3.530  -80.382 1.00 88.31  ? 1124 ASP A N     1 
ATOM   8341  C  CA    . ASP A 1 1124 ? -26.059 -2.997  -81.337 1.00 95.99  ? 1124 ASP A CA    1 
ATOM   8342  C  C     . ASP A 1 1124 ? -24.654 -3.013  -80.754 1.00 100.00 ? 1124 ASP A C     1 
ATOM   8343  O  O     . ASP A 1 1124 ? -23.697 -3.370  -81.450 1.00 110.62 ? 1124 ASP A O     1 
ATOM   8344  C  CB    . ASP A 1 1124 ? -26.485 -1.578  -81.721 1.00 111.14 ? 1124 ASP A CB    1 
ATOM   8345  C  CG    . ASP A 1 1124 ? -26.108 -1.211  -83.143 1.00 129.41 ? 1124 ASP A CG    1 
ATOM   8346  O  OD1   . ASP A 1 1124 ? -25.019 -1.631  -83.606 1.00 139.59 ? 1124 ASP A OD1   1 
ATOM   8347  O  OD2   . ASP A 1 1124 ? -26.904 -0.482  -83.787 1.00 140.76 ? 1124 ASP A OD2   1 
ATOM   8348  N  N     . TRP A 1 1125 ? -24.552 -2.607  -79.487 1.00 94.38  ? 1125 TRP A N     1 
ATOM   8349  C  CA    . TRP A 1 1125 ? -23.282 -2.578  -78.771 1.00 98.30  ? 1125 TRP A CA    1 
ATOM   8350  C  C     . TRP A 1 1125 ? -22.701 -3.974  -78.588 1.00 95.36  ? 1125 TRP A C     1 
ATOM   8351  O  O     . TRP A 1 1125 ? -21.508 -4.182  -78.805 1.00 91.76  ? 1125 TRP A O     1 
ATOM   8352  C  CB    . TRP A 1 1125 ? -23.389 -1.900  -77.389 1.00 103.63 ? 1125 TRP A CB    1 
ATOM   8353  C  CG    . TRP A 1 1125 ? -23.733 -0.430  -77.421 1.00 105.38 ? 1125 TRP A CG    1 
ATOM   8354  C  CD1   . TRP A 1 1125 ? -23.462 0.450   -78.415 1.00 107.14 ? 1125 TRP A CD1   1 
ATOM   8355  C  CD2   . TRP A 1 1125 ? -24.400 0.314   -76.398 1.00 109.80 ? 1125 TRP A CD2   1 
ATOM   8356  N  NE1   . TRP A 1 1125 ? -23.928 1.695   -78.084 1.00 109.86 ? 1125 TRP A NE1   1 
ATOM   8357  C  CE2   . TRP A 1 1125 ? -24.512 1.638   -76.852 1.00 108.68 ? 1125 TRP A CE2   1 
ATOM   8358  C  CE3   . TRP A 1 1125 ? -24.932 -0.018  -75.148 1.00 124.58 ? 1125 TRP A CE3   1 
ATOM   8359  C  CZ2   . TRP A 1 1125 ? -25.125 2.639   -76.103 1.00 124.80 ? 1125 TRP A CZ2   1 
ATOM   8360  C  CZ3   . TRP A 1 1125 ? -25.545 0.981   -74.395 1.00 130.96 ? 1125 TRP A CZ3   1 
ATOM   8361  C  CH2   . TRP A 1 1125 ? -25.633 2.293   -74.877 1.00 133.06 ? 1125 TRP A CH2   1 
ATOM   8362  N  N     . ALA A 1 1126 ? -23.554 -4.916  -78.196 1.00 99.88  ? 1126 ALA A N     1 
ATOM   8363  C  CA    . ALA A 1 1126 ? -23.170 -6.324  -78.069 1.00 100.52 ? 1126 ALA A CA    1 
ATOM   8364  C  C     . ALA A 1 1126 ? -22.704 -6.906  -79.398 1.00 93.19  ? 1126 ALA A C     1 
ATOM   8365  O  O     . ALA A 1 1126 ? -21.706 -7.621  -79.447 1.00 93.23  ? 1126 ALA A O     1 
ATOM   8366  C  CB    . ALA A 1 1126 ? -24.336 -7.153  -77.540 1.00 97.06  ? 1126 ALA A CB    1 
ATOM   8367  N  N     . GLN A 1 1127 ? -23.420 -6.588  -80.475 1.00 91.10  ? 1127 GLN A N     1 
ATOM   8368  C  CA    . GLN A 1 1127 ? -23.107 -7.137  -81.786 1.00 94.50  ? 1127 GLN A CA    1 
ATOM   8369  C  C     . GLN A 1 1127 ? -21.788 -6.611  -82.308 1.00 96.35  ? 1127 GLN A C     1 
ATOM   8370  O  O     . GLN A 1 1127 ? -20.959 -7.400  -82.738 1.00 101.23 ? 1127 GLN A O     1 
ATOM   8371  C  CB    . GLN A 1 1127 ? -24.191 -6.772  -82.791 1.00 102.82 ? 1127 GLN A CB    1 
ATOM   8372  C  CG    . GLN A 1 1127 ? -24.043 -7.536  -84.086 1.00 106.75 ? 1127 GLN A CG    1 
ATOM   8373  C  CD    . GLN A 1 1127 ? -24.050 -9.015  -83.816 1.00 105.32 ? 1127 GLN A CD    1 
ATOM   8374  O  OE1   . GLN A 1 1127 ? -24.861 -9.488  -83.020 1.00 116.50 ? 1127 GLN A OE1   1 
ATOM   8375  N  NE2   . GLN A 1 1127 ? -23.137 -9.750  -84.438 1.00 101.45 ? 1127 GLN A NE2   1 
ATOM   8376  N  N     . THR A 1 1128 ? -21.577 -5.296  -82.264 1.00 93.60  ? 1128 THR A N     1 
ATOM   8377  C  CA    . THR A 1 1128 ? -20.308 -4.727  -82.735 1.00 91.91  ? 1128 THR A CA    1 
ATOM   8378  C  C     . THR A 1 1128 ? -19.129 -5.156  -81.846 1.00 91.14  ? 1128 THR A C     1 
ATOM   8379  O  O     . THR A 1 1128 ? -18.029 -5.326  -82.354 1.00 99.82  ? 1128 THR A O     1 
ATOM   8380  C  CB    . THR A 1 1128 ? -20.439 -3.226  -82.869 1.00 82.47  ? 1128 THR A CB    1 
ATOM   8381  O  OG1   . THR A 1 1128 ? -20.610 -2.697  -81.565 1.00 86.44  ? 1128 THR A OG1   1 
ATOM   8382  C  CG2   . THR A 1 1128 ? -21.665 -2.860  -83.772 1.00 75.24  ? 1128 THR A CG2   1 
ATOM   8383  N  N     . ALA A 1 1129 ? -19.365 -5.356  -80.548 1.00 90.48  ? 1129 ALA A N     1 
ATOM   8384  C  CA    . ALA A 1 1129 ? -18.354 -5.928  -79.646 1.00 91.68  ? 1129 ALA A CA    1 
ATOM   8385  C  C     . ALA A 1 1129 ? -17.914 -7.325  -80.095 1.00 86.60  ? 1129 ALA A C     1 
ATOM   8386  O  O     . ALA A 1 1129 ? -16.717 -7.622  -80.149 1.00 86.91  ? 1129 ALA A O     1 
ATOM   8387  C  CB    . ALA A 1 1129 ? -18.911 -5.993  -78.234 1.00 94.38  ? 1129 ALA A CB    1 
ATOM   8388  N  N     . PHE A 1 1130 ? -18.884 -8.162  -80.442 1.00 87.70  ? 1130 PHE A N     1 
ATOM   8389  C  CA    . PHE A 1 1130 ? -18.575 -9.465  -81.009 1.00 97.85  ? 1130 PHE A CA    1 
ATOM   8390  C  C     . PHE A 1 1130 ? -17.801 -9.307  -82.319 1.00 101.46 ? 1130 PHE A C     1 
ATOM   8391  O  O     . PHE A 1 1130 ? -16.785 -9.971  -82.512 1.00 122.24 ? 1130 PHE A O     1 
ATOM   8392  C  CB    . PHE A 1 1130 ? -19.821 -10.302 -81.239 1.00 92.65  ? 1130 PHE A CB    1 
ATOM   8393  C  CG    . PHE A 1 1130 ? -19.514 -11.712 -81.649 1.00 87.50  ? 1130 PHE A CG    1 
ATOM   8394  C  CD1   . PHE A 1 1130 ? -18.894 -12.578 -80.764 1.00 86.94  ? 1130 PHE A CD1   1 
ATOM   8395  C  CD2   . PHE A 1 1130 ? -19.815 -12.166 -82.926 1.00 86.23  ? 1130 PHE A CD2   1 
ATOM   8396  C  CE1   . PHE A 1 1130 ? -18.605 -13.880 -81.143 1.00 87.18  ? 1130 PHE A CE1   1 
ATOM   8397  C  CE2   . PHE A 1 1130 ? -19.530 -13.467 -83.311 1.00 85.18  ? 1130 PHE A CE2   1 
ATOM   8398  C  CZ    . PHE A 1 1130 ? -18.927 -14.328 -82.417 1.00 85.64  ? 1130 PHE A CZ    1 
ATOM   8399  N  N     . ASP A 1 1131 ? -18.264 -8.414  -83.191 1.00 91.77  ? 1131 ASP A N     1 
ATOM   8400  C  CA    . ASP A 1 1131 ? -17.627 -8.195  -84.495 1.00 95.86  ? 1131 ASP A CA    1 
ATOM   8401  C  C     . ASP A 1 1131 ? -16.187 -7.666  -84.368 1.00 93.54  ? 1131 ASP A C     1 
ATOM   8402  O  O     . ASP A 1 1131 ? -15.388 -7.847  -85.287 1.00 95.43  ? 1131 ASP A O     1 
ATOM   8403  C  CB    . ASP A 1 1131 ? -18.464 -7.206  -85.357 1.00 97.34  ? 1131 ASP A CB    1 
ATOM   8404  C  CG    . ASP A 1 1131 ? -19.863 -7.753  -85.755 1.00 99.51  ? 1131 ASP A CG    1 
ATOM   8405  O  OD1   . ASP A 1 1131 ? -20.177 -8.922  -85.462 1.00 100.48 ? 1131 ASP A OD1   1 
ATOM   8406  O  OD2   . ASP A 1 1131 ? -20.657 -7.005  -86.378 1.00 94.89  ? 1131 ASP A OD2   1 
ATOM   8407  N  N     . GLU A 1 1132 ? -15.874 -7.016  -83.243 1.00 82.23  ? 1132 GLU A N     1 
ATOM   8408  C  CA    . GLU A 1 1132 ? -14.532 -6.511  -82.963 1.00 81.18  ? 1132 GLU A CA    1 
ATOM   8409  C  C     . GLU A 1 1132 ? -13.757 -7.367  -81.974 1.00 80.36  ? 1132 GLU A C     1 
ATOM   8410  O  O     . GLU A 1 1132 ? -12.761 -6.910  -81.414 1.00 91.45  ? 1132 GLU A O     1 
ATOM   8411  C  CB    . GLU A 1 1132 ? -14.602 -5.063  -82.515 1.00 91.92  ? 1132 GLU A CB    1 
ATOM   8412  C  CG    . GLU A 1 1132 ? -14.729 -4.141  -83.723 1.00 104.36 ? 1132 GLU A CG    1 
ATOM   8413  C  CD    . GLU A 1 1132 ? -15.476 -2.855  -83.425 1.00 114.46 ? 1132 GLU A CD    1 
ATOM   8414  O  OE1   . GLU A 1 1132 ? -15.331 -2.323  -82.291 1.00 119.47 ? 1132 GLU A OE1   1 
ATOM   8415  O  OE2   . GLU A 1 1132 ? -16.206 -2.389  -84.336 1.00 108.40 ? 1132 GLU A OE2   1 
ATOM   8416  N  N     . SER A 1 1133 ? -14.187 -8.607  -81.755 1.00 75.64  ? 1133 SER A N     1 
ATOM   8417  C  CA    . SER A 1 1133 ? -13.502 -9.533  -80.837 1.00 78.71  ? 1133 SER A CA    1 
ATOM   8418  C  C     . SER A 1 1133 ? -13.260 -8.968  -79.436 1.00 77.24  ? 1133 SER A C     1 
ATOM   8419  O  O     . SER A 1 1133 ? -12.136 -8.975  -78.914 1.00 74.00  ? 1133 SER A O     1 
ATOM   8420  C  CB    . SER A 1 1133 ? -12.181 -10.096 -81.423 1.00 76.63  ? 1133 SER A CB    1 
ATOM   8421  O  OG    . SER A 1 1133 ? -12.391 -10.876 -82.600 1.00 77.24  ? 1133 SER A OG    1 
ATOM   8422  N  N     . ILE A 1 1134 ? -14.344 -8.464  -78.845 1.00 90.98  ? 1134 ILE A N     1 
ATOM   8423  C  CA    . ILE A 1 1134 ? -14.370 -8.057  -77.450 1.00 101.52 ? 1134 ILE A CA    1 
ATOM   8424  C  C     . ILE A 1 1134 ? -15.221 -9.082  -76.699 1.00 106.45 ? 1134 ILE A C     1 
ATOM   8425  O  O     . ILE A 1 1134 ? -16.340 -9.444  -77.112 1.00 116.48 ? 1134 ILE A O     1 
ATOM   8426  C  CB    . ILE A 1 1134 ? -14.920 -6.649  -77.215 1.00 99.52  ? 1134 ILE A CB    1 
ATOM   8427  C  CG1   . ILE A 1 1134 ? -14.070 -5.632  -77.976 1.00 110.39 ? 1134 ILE A CG1   1 
ATOM   8428  C  CG2   . ILE A 1 1134 ? -14.897 -6.340  -75.727 1.00 95.72  ? 1134 ILE A CG2   1 
ATOM   8429  C  CD1   . ILE A 1 1134 ? -14.664 -4.244  -78.016 1.00 116.92 ? 1134 ILE A CD1   1 
ATOM   8430  N  N     . ASN A 1 1135 ? -14.654 -9.556  -75.586 1.00 97.70  ? 1135 ASN A N     1 
ATOM   8431  C  CA    . ASN A 1 1135 ? -15.262 -10.600 -74.772 1.00 88.35  ? 1135 ASN A CA    1 
ATOM   8432  C  C     . ASN A 1 1135 ? -16.452 -10.012 -73.992 1.00 93.13  ? 1135 ASN A C     1 
ATOM   8433  O  O     . ASN A 1 1135 ? -16.341 -8.932  -73.373 1.00 101.95 ? 1135 ASN A O     1 
ATOM   8434  C  CB    . ASN A 1 1135 ? -14.207 -11.179 -73.812 1.00 85.03  ? 1135 ASN A CB    1 
ATOM   8435  C  CG    . ASN A 1 1135 ? -14.765 -12.221 -72.833 1.00 82.08  ? 1135 ASN A CG    1 
ATOM   8436  O  OD1   . ASN A 1 1135 ? -15.777 -12.890 -73.065 1.00 85.45  ? 1135 ASN A OD1   1 
ATOM   8437  N  ND2   . ASN A 1 1135 ? -14.065 -12.380 -71.738 1.00 81.21  ? 1135 ASN A ND2   1 
ATOM   8438  N  N     . LEU A 1 1136 ? -17.585 -10.724 -74.036 1.00 87.34  ? 1136 LEU A N     1 
ATOM   8439  C  CA    . LEU A 1 1136 ? -18.829 -10.299 -73.348 1.00 81.52  ? 1136 LEU A CA    1 
ATOM   8440  C  C     . LEU A 1 1136 ? -19.172 -11.165 -72.117 1.00 85.35  ? 1136 LEU A C     1 
ATOM   8441  O  O     . LEU A 1 1136 ? -20.321 -11.218 -71.711 1.00 85.40  ? 1136 LEU A O     1 
ATOM   8442  C  CB    . LEU A 1 1136 ? -19.969 -10.291 -74.343 1.00 77.32  ? 1136 LEU A CB    1 
ATOM   8443  C  CG    . LEU A 1 1136 ? -19.809 -9.201  -75.414 1.00 83.21  ? 1136 LEU A CG    1 
ATOM   8444  C  CD1   . LEU A 1 1136 ? -20.484 -9.577  -76.734 1.00 91.93  ? 1136 LEU A CD1   1 
ATOM   8445  C  CD2   . LEU A 1 1136 ? -20.320 -7.857  -74.928 1.00 76.38  ? 1136 LEU A CD2   1 
ATOM   8446  N  N     . SER A 1 1137 ? -18.173 -11.813 -71.531 1.00 89.43  ? 1137 SER A N     1 
ATOM   8447  C  CA    . SER A 1 1137 ? -18.353 -12.582 -70.319 1.00 83.81  ? 1137 SER A CA    1 
ATOM   8448  C  C     . SER A 1 1137 ? -17.367 -12.056 -69.292 1.00 83.26  ? 1137 SER A C     1 
ATOM   8449  O  O     . SER A 1 1137 ? -16.221 -11.727 -69.627 1.00 88.05  ? 1137 SER A O     1 
ATOM   8450  C  CB    . SER A 1 1137 ? -18.201 -14.069 -70.580 1.00 89.92  ? 1137 SER A CB    1 
ATOM   8451  O  OG    . SER A 1 1137 ? -19.147 -14.771 -69.808 1.00 95.46  ? 1137 SER A OG    1 
ATOM   8452  N  N     . ALA A 1 1138 ? -17.800 -11.958 -68.051 1.00 78.72  ? 1138 ALA A N     1 
ATOM   8453  C  CA    . ALA A 1 1138 ? -16.931 -11.386 -66.995 1.00 76.64  ? 1138 ALA A CA    1 
ATOM   8454  C  C     . ALA A 1 1138 ? -17.258 -11.956 -65.650 1.00 77.57  ? 1138 ALA A C     1 
ATOM   8455  O  O     . ALA A 1 1138 ? -18.423 -12.031 -65.262 1.00 80.32  ? 1138 ALA A O     1 
ATOM   8456  C  CB    . ALA A 1 1138 ? -17.034 -9.874  -66.952 1.00 73.97  ? 1138 ALA A CB    1 
ATOM   8457  N  N     . VAL A 1 1139 ? -16.217 -12.395 -64.941 1.00 79.24  ? 1139 VAL A N     1 
ATOM   8458  C  CA    . VAL A 1 1139 ? -16.313 -12.718 -63.526 1.00 75.02  ? 1139 VAL A CA    1 
ATOM   8459  C  C     . VAL A 1 1139 ? -16.285 -11.405 -62.762 1.00 82.18  ? 1139 VAL A C     1 
ATOM   8460  O  O     . VAL A 1 1139 ? -15.585 -10.485 -63.132 1.00 99.88  ? 1139 VAL A O     1 
ATOM   8461  C  CB    . VAL A 1 1139 ? -15.158 -13.564 -63.060 1.00 74.70  ? 1139 VAL A CB    1 
ATOM   8462  C  CG1   . VAL A 1 1139 ? -15.232 -13.732 -61.553 1.00 81.28  ? 1139 VAL A CG1   1 
ATOM   8463  C  CG2   . VAL A 1 1139 ? -15.212 -14.914 -63.759 1.00 77.68  ? 1139 VAL A CG2   1 
ATOM   8464  N  N     . GLY A 1 1140 ? -17.075 -11.335 -61.703 1.00 85.06  ? 1140 GLY A N     1 
ATOM   8465  C  CA    . GLY A 1 1140 ? -17.040 -10.242 -60.738 1.00 80.06  ? 1140 GLY A CA    1 
ATOM   8466  C  C     . GLY A 1 1140 ? -16.612 -10.838 -59.431 1.00 82.69  ? 1140 GLY A C     1 
ATOM   8467  O  O     . GLY A 1 1140 ? -16.882 -12.015 -59.165 1.00 77.32  ? 1140 GLY A O     1 
ATOM   8468  N  N     . TYR A 1 1141 ? -15.927 -10.035 -58.631 1.00 86.61  ? 1141 TYR A N     1 
ATOM   8469  C  CA    . TYR A 1 1141 ? -15.332 -10.496 -57.374 1.00 82.81  ? 1141 TYR A CA    1 
ATOM   8470  C  C     . TYR A 1 1141 ? -15.252 -9.366  -56.369 1.00 83.87  ? 1141 TYR A C     1 
ATOM   8471  O  O     . TYR A 1 1141 ? -14.829 -8.257  -56.688 1.00 88.38  ? 1141 TYR A O     1 
ATOM   8472  C  CB    . TYR A 1 1141 ? -13.921 -11.023 -57.617 1.00 78.25  ? 1141 TYR A CB    1 
ATOM   8473  C  CG    . TYR A 1 1141 ? -13.350 -11.771 -56.442 1.00 80.72  ? 1141 TYR A CG    1 
ATOM   8474  C  CD1   . TYR A 1 1141 ? -13.993 -12.893 -55.939 1.00 86.20  ? 1141 TYR A CD1   1 
ATOM   8475  C  CD2   . TYR A 1 1141 ? -12.154 -11.387 -55.846 1.00 85.08  ? 1141 TYR A CD2   1 
ATOM   8476  C  CE1   . TYR A 1 1141 ? -13.475 -13.606 -54.863 1.00 83.96  ? 1141 TYR A CE1   1 
ATOM   8477  C  CE2   . TYR A 1 1141 ? -11.621 -12.098 -54.770 1.00 85.02  ? 1141 TYR A CE2   1 
ATOM   8478  C  CZ    . TYR A 1 1141 ? -12.286 -13.215 -54.279 1.00 79.09  ? 1141 TYR A CZ    1 
ATOM   8479  O  OH    . TYR A 1 1141 ? -11.798 -13.945 -53.210 1.00 61.54  ? 1141 TYR A OH    1 
ATOM   8480  N  N     . PHE A 1 1142 ? -15.685 -9.656  -55.155 1.00 87.01  ? 1142 PHE A N     1 
ATOM   8481  C  CA    . PHE A 1 1142 ? -15.481 -8.766  -54.016 1.00 89.45  ? 1142 PHE A CA    1 
ATOM   8482  C  C     . PHE A 1 1142 ? -14.747 -9.552  -52.941 1.00 81.01  ? 1142 PHE A C     1 
ATOM   8483  O  O     . PHE A 1 1142 ? -15.146 -10.657 -52.580 1.00 63.65  ? 1142 PHE A O     1 
ATOM   8484  C  CB    . PHE A 1 1142 ? -16.805 -8.256  -53.494 1.00 98.62  ? 1142 PHE A CB    1 
ATOM   8485  C  CG    . PHE A 1 1142 ? -16.647 -7.446  -52.280 1.00 96.75  ? 1142 PHE A CG    1 
ATOM   8486  C  CD1   . PHE A 1 1142 ? -15.969 -6.241  -52.353 1.00 93.60  ? 1142 PHE A CD1   1 
ATOM   8487  C  CD2   . PHE A 1 1142 ? -17.083 -7.914  -51.062 1.00 94.98  ? 1142 PHE A CD2   1 
ATOM   8488  C  CE1   . PHE A 1 1142 ? -15.764 -5.481  -51.232 1.00 92.20  ? 1142 PHE A CE1   1 
ATOM   8489  C  CE2   . PHE A 1 1142 ? -16.889 -7.153  -49.932 1.00 102.63 ? 1142 PHE A CE2   1 
ATOM   8490  C  CZ    . PHE A 1 1142 ? -16.222 -5.937  -50.017 1.00 98.53  ? 1142 PHE A CZ    1 
ATOM   8491  N  N     . ARG A 1 1143 ? -13.679 -8.944  -52.419 1.00 89.84  ? 1143 ARG A N     1 
ATOM   8492  C  CA    . ARG A 1 1143 ? -12.720 -9.650  -51.564 1.00 87.09  ? 1143 ARG A CA    1 
ATOM   8493  C  C     . ARG A 1 1143 ? -13.199 -9.818  -50.136 1.00 86.90  ? 1143 ARG A C     1 
ATOM   8494  O  O     . ARG A 1 1143 ? -12.746 -10.720 -49.444 1.00 75.16  ? 1143 ARG A O     1 
ATOM   8495  C  CB    . ARG A 1 1143 ? -11.399 -8.898  -51.534 1.00 87.39  ? 1143 ARG A CB    1 
ATOM   8496  C  CG    . ARG A 1 1143 ? -10.866 -8.541  -52.914 1.00 100.36 ? 1143 ARG A CG    1 
ATOM   8497  C  CD    . ARG A 1 1143 ? -9.389  -8.157  -52.892 1.00 112.65 ? 1143 ARG A CD    1 
ATOM   8498  N  NE    . ARG A 1 1143 ? -8.557  -9.223  -52.321 1.00 123.31 ? 1143 ARG A NE    1 
ATOM   8499  C  CZ    . ARG A 1 1143 ? -7.226  -9.264  -52.350 1.00 128.81 ? 1143 ARG A CZ    1 
ATOM   8500  N  NH1   . ARG A 1 1143 ? -6.513  -8.290  -52.914 1.00 136.31 ? 1143 ARG A NH1   1 
ATOM   8501  N  NH2   . ARG A 1 1143 ? -6.600  -10.304 -51.808 1.00 132.82 ? 1143 ARG A NH2   1 
ATOM   8502  N  N     . GLY A 1 1144 ? -14.094 -8.941  -49.689 1.00 92.23  ? 1144 GLY A N     1 
ATOM   8503  C  CA    . GLY A 1 1144 ? -14.683 -9.024  -48.356 1.00 88.54  ? 1144 GLY A CA    1 
ATOM   8504  C  C     . GLY A 1 1144 ? -14.351 -7.826  -47.511 1.00 92.66  ? 1144 GLY A C     1 
ATOM   8505  O  O     . GLY A 1 1144 ? -13.319 -7.182  -47.704 1.00 95.46  ? 1144 GLY A O     1 
ATOM   8506  N  N     . TYR A 1 1145 ? -15.240 -7.519  -46.566 1.00 105.77 ? 1145 TYR A N     1 
ATOM   8507  C  CA    . TYR A 1 1145 ? -15.041 -6.414  -45.639 1.00 114.34 ? 1145 TYR A CA    1 
ATOM   8508  C  C     . TYR A 1 1145 ? -13.937 -6.853  -44.674 1.00 113.53 ? 1145 TYR A C     1 
ATOM   8509  O  O     . TYR A 1 1145 ? -13.921 -8.012  -44.206 1.00 102.12 ? 1145 TYR A O     1 
ATOM   8510  C  CB    . TYR A 1 1145 ? -16.328 -6.079  -44.849 1.00 120.74 ? 1145 TYR A CB    1 
ATOM   8511  C  CG    . TYR A 1 1145 ? -17.596 -5.672  -45.633 1.00 117.71 ? 1145 TYR A CG    1 
ATOM   8512  C  CD1   . TYR A 1 1145 ? -17.553 -4.761  -46.702 1.00 111.55 ? 1145 TYR A CD1   1 
ATOM   8513  C  CD2   . TYR A 1 1145 ? -18.859 -6.147  -45.228 1.00 118.77 ? 1145 TYR A CD2   1 
ATOM   8514  C  CE1   . TYR A 1 1145 ? -18.722 -4.384  -47.375 1.00 120.45 ? 1145 TYR A CE1   1 
ATOM   8515  C  CE2   . TYR A 1 1145 ? -20.030 -5.780  -45.891 1.00 124.78 ? 1145 TYR A CE2   1 
ATOM   8516  C  CZ    . TYR A 1 1145 ? -19.974 -4.904  -46.969 1.00 127.66 ? 1145 TYR A CZ    1 
ATOM   8517  O  OH    . TYR A 1 1145 ? -21.166 -4.560  -47.623 1.00 113.41 ? 1145 TYR A OH    1 
ATOM   8518  N  N     . GLU A 1 1146 ? -13.009 -5.928  -44.398 1.00 109.97 ? 1146 GLU A N     1 
ATOM   8519  C  CA    . GLU A 1 1146 ? -11.936 -6.187  -43.456 1.00 103.82 ? 1146 GLU A CA    1 
ATOM   8520  C  C     . GLU A 1 1146 ? -12.568 -6.389  -42.084 1.00 111.42 ? 1146 GLU A C     1 
ATOM   8521  O  O     . GLU A 1 1146 ? -13.494 -5.660  -41.703 1.00 124.32 ? 1146 GLU A O     1 
ATOM   8522  C  CB    . GLU A 1 1146 ? -10.924 -5.053  -43.413 1.00 103.64 ? 1146 GLU A CB    1 
ATOM   8523  C  CG    . GLU A 1 1146 ? -10.085 -4.930  -44.674 1.00 111.60 ? 1146 GLU A CG    1 
ATOM   8524  C  CD    . GLU A 1 1146 ? -9.255  -6.172  -44.987 1.00 118.45 ? 1146 GLU A CD    1 
ATOM   8525  O  OE1   . GLU A 1 1146 ? -8.553  -6.715  -44.094 1.00 112.76 ? 1146 GLU A OE1   1 
ATOM   8526  O  OE2   . GLU A 1 1146 ? -9.293  -6.597  -46.159 1.00 124.67 ? 1146 GLU A OE2   1 
ATOM   8527  N  N     . SER A 1 1147 ? -12.085 -7.392  -41.358 1.00 113.27 ? 1147 SER A N     1 
ATOM   8528  C  CA    . SER A 1 1147 ? -12.689 -7.788  -40.092 1.00 124.24 ? 1147 SER A CA    1 
ATOM   8529  C  C     . SER A 1 1147 ? -11.739 -8.633  -39.262 1.00 125.52 ? 1147 SER A C     1 
ATOM   8530  O  O     . SER A 1 1147 ? -11.031 -9.487  -39.812 1.00 146.87 ? 1147 SER A O     1 
ATOM   8531  C  CB    . SER A 1 1147 ? -13.969 -8.562  -40.347 1.00 135.20 ? 1147 SER A CB    1 
ATOM   8532  O  OG    . SER A 1 1147 ? -14.143 -9.542  -39.344 1.00 148.29 ? 1147 SER A OG    1 
ATOM   8533  N  N     . ASP A 1 1148 ? -11.722 -8.405  -37.951 1.00 116.71 ? 1148 ASP A N     1 
ATOM   8534  C  CA    . ASP A 1 1148 ? -10.894 -9.205  -37.055 1.00 117.00 ? 1148 ASP A CA    1 
ATOM   8535  C  C     . ASP A 1 1148 ? -11.275 -9.075  -35.575 1.00 111.02 ? 1148 ASP A C     1 
ATOM   8536  O  O     . ASP A 1 1148 ? -11.929 -8.128  -35.129 1.00 106.55 ? 1148 ASP A O     1 
ATOM   8537  C  CB    . ASP A 1 1148 ? -9.411  -8.890  -37.251 1.00 120.86 ? 1148 ASP A CB    1 
ATOM   8538  C  CG    . ASP A 1 1148 ? -9.142  -7.425  -37.256 1.00 124.72 ? 1148 ASP A CG    1 
ATOM   8539  O  OD1   . ASP A 1 1148 ? -9.152  -6.827  -36.153 1.00 127.23 ? 1148 ASP A OD1   1 
ATOM   8540  O  OD2   . ASP A 1 1148 ? -8.939  -6.881  -38.365 1.00 124.51 ? 1148 ASP A OD2   1 
ATOM   8541  N  N     . MET A 1 1149 ? -10.769 -10.043 -34.826 1.00 111.64 ? 1149 MET A N     1 
ATOM   8542  C  CA    . MET A 1 1149 ? -11.067 -10.215 -33.429 1.00 116.95 ? 1149 MET A CA    1 
ATOM   8543  C  C     . MET A 1 1149 ? -9.928  -11.020 -32.790 1.00 124.63 ? 1149 MET A C     1 
ATOM   8544  O  O     . MET A 1 1149 ? -9.671  -12.171 -33.154 1.00 130.38 ? 1149 MET A O     1 
ATOM   8545  C  CB    . MET A 1 1149 ? -12.370 -10.990 -33.296 1.00 120.69 ? 1149 MET A CB    1 
ATOM   8546  C  CG    . MET A 1 1149 ? -12.898 -11.059 -31.881 1.00 123.05 ? 1149 MET A CG    1 
ATOM   8547  S  SD    . MET A 1 1149 ? -13.373 -9.420  -31.326 1.00 124.03 ? 1149 MET A SD    1 
ATOM   8548  C  CE    . MET A 1 1149 ? -13.247 -9.653  -29.560 1.00 125.54 ? 1149 MET A CE    1 
ATOM   8549  N  N     . ASN A 1 1150 ? -9.263  -10.404 -31.817 1.00 128.50 ? 1150 ASN A N     1 
ATOM   8550  C  CA    . ASN A 1 1150 ? -8.373  -11.101 -30.909 1.00 125.59 ? 1150 ASN A CA    1 
ATOM   8551  C  C     . ASN A 1 1150 ? -9.226  -11.520 -29.699 1.00 110.69 ? 1150 ASN A C     1 
ATOM   8552  O  O     . ASN A 1 1150 ? -9.582  -10.684 -28.856 1.00 116.62 ? 1150 ASN A O     1 
ATOM   8553  C  CB    . ASN A 1 1150 ? -7.220  -10.185 -30.530 1.00 131.72 ? 1150 ASN A CB    1 
ATOM   8554  C  CG    . ASN A 1 1150 ? -6.090  -10.932 -29.869 1.00 142.32 ? 1150 ASN A CG    1 
ATOM   8555  O  OD1   . ASN A 1 1150 ? -6.262  -11.526 -28.798 1.00 140.34 ? 1150 ASN A OD1   1 
ATOM   8556  N  ND2   . ASN A 1 1150 ? -4.922  -10.915 -30.504 1.00 147.82 ? 1150 ASN A ND2   1 
ATOM   8557  N  N     . TRP A 1 1151 ? -9.575  -12.810 -29.639 1.00 102.00 ? 1151 TRP A N     1 
ATOM   8558  C  CA    . TRP A 1 1151 ? -10.423 -13.319 -28.564 1.00 115.72 ? 1151 TRP A CA    1 
ATOM   8559  C  C     . TRP A 1 1151 ? -9.729  -13.471 -27.201 1.00 120.73 ? 1151 TRP A C     1 
ATOM   8560  O  O     . TRP A 1 1151 ? -10.408 -13.587 -26.175 1.00 109.31 ? 1151 TRP A O     1 
ATOM   8561  C  CB    . TRP A 1 1151 ? -11.124 -14.630 -28.962 1.00 115.86 ? 1151 TRP A CB    1 
ATOM   8562  C  CG    . TRP A 1 1151 ? -12.495 -14.323 -29.403 1.00 117.52 ? 1151 TRP A CG    1 
ATOM   8563  C  CD1   . TRP A 1 1151 ? -12.955 -14.274 -30.678 1.00 123.49 ? 1151 TRP A CD1   1 
ATOM   8564  C  CD2   . TRP A 1 1151 ? -13.572 -13.900 -28.568 1.00 118.51 ? 1151 TRP A CD2   1 
ATOM   8565  N  NE1   . TRP A 1 1151 ? -14.268 -13.880 -30.690 1.00 123.81 ? 1151 TRP A NE1   1 
ATOM   8566  C  CE2   . TRP A 1 1151 ? -14.668 -13.641 -29.403 1.00 119.12 ? 1151 TRP A CE2   1 
ATOM   8567  C  CE3   . TRP A 1 1151 ? -13.716 -13.725 -27.187 1.00 131.73 ? 1151 TRP A CE3   1 
ATOM   8568  C  CZ2   . TRP A 1 1151 ? -15.898 -13.228 -28.909 1.00 125.70 ? 1151 TRP A CZ2   1 
ATOM   8569  C  CZ3   . TRP A 1 1151 ? -14.944 -13.316 -26.695 1.00 131.27 ? 1151 TRP A CZ3   1 
ATOM   8570  C  CH2   . TRP A 1 1151 ? -16.015 -13.071 -27.553 1.00 127.67 ? 1151 TRP A CH2   1 
ATOM   8571  N  N     . GLU A 1 1152 ? -8.395  -13.466 -27.183 1.00 126.23 ? 1152 GLU A N     1 
ATOM   8572  C  CA    . GLU A 1 1152 ? -7.652  -13.505 -25.923 1.00 129.58 ? 1152 GLU A CA    1 
ATOM   8573  C  C     . GLU A 1 1152 ? -7.787  -12.183 -25.172 1.00 129.18 ? 1152 GLU A C     1 
ATOM   8574  O  O     . GLU A 1 1152 ? -8.194  -12.154 -24.008 1.00 117.91 ? 1152 GLU A O     1 
ATOM   8575  C  CB    . GLU A 1 1152 ? -6.175  -13.812 -26.180 1.00 124.21 ? 1152 GLU A CB    1 
ATOM   8576  C  CG    . GLU A 1 1152 ? -5.511  -14.534 -25.021 1.00 132.27 ? 1152 GLU A CG    1 
ATOM   8577  C  CD    . GLU A 1 1152 ? -6.226  -15.832 -24.661 1.00 142.55 ? 1152 GLU A CD    1 
ATOM   8578  O  OE1   . GLU A 1 1152 ? -6.253  -16.769 -25.495 1.00 152.90 ? 1152 GLU A OE1   1 
ATOM   8579  O  OE2   . GLU A 1 1152 ? -6.779  -15.907 -23.544 1.00 142.50 ? 1152 GLU A OE2   1 
ATOM   8580  N  N     . LYS A 1 1153 ? -7.453  -11.093 -25.862 1.00 131.39 ? 1153 LYS A N     1 
ATOM   8581  C  CA    . LYS A 1 1153 ? -7.574  -9.735  -25.322 1.00 137.24 ? 1153 LYS A CA    1 
ATOM   8582  C  C     . LYS A 1 1153 ? -9.012  -9.213  -25.306 1.00 144.93 ? 1153 LYS A C     1 
ATOM   8583  O  O     . LYS A 1 1153 ? -9.297  -8.227  -24.631 1.00 164.58 ? 1153 LYS A O     1 
ATOM   8584  C  CB    . LYS A 1 1153 ? -6.773  -8.724  -26.165 1.00 136.23 ? 1153 LYS A CB    1 
ATOM   8585  C  CG    . LYS A 1 1153 ? -5.329  -9.090  -26.451 1.00 144.30 ? 1153 LYS A CG    1 
ATOM   8586  C  CD    . LYS A 1 1153 ? -4.659  -8.099  -27.402 1.00 143.46 ? 1153 LYS A CD    1 
ATOM   8587  C  CE    . LYS A 1 1153 ? -3.774  -8.815  -28.420 1.00 141.00 ? 1153 LYS A CE    1 
ATOM   8588  N  NZ    . LYS A 1 1153 ? -2.477  -8.144  -28.680 1.00 138.88 ? 1153 LYS A NZ    1 
ATOM   8589  N  N     . GLY A 1 1154 ? -9.907  -9.850  -26.062 1.00 151.88 ? 1154 GLY A N     1 
ATOM   8590  C  CA    . GLY A 1 1154 ? -11.295 -9.416  -26.149 1.00 148.74 ? 1154 GLY A CA    1 
ATOM   8591  C  C     . GLY A 1 1154 ? -11.510 -8.131  -26.938 1.00 150.79 ? 1154 GLY A C     1 
ATOM   8592  O  O     . GLY A 1 1154 ? -12.532 -7.465  -26.753 1.00 161.80 ? 1154 GLY A O     1 
ATOM   8593  N  N     . GLU A 1 1155 ? -10.561 -7.775  -27.821 1.00 141.39 ? 1155 GLU A N     1 
ATOM   8594  C  CA    . GLU A 1 1155 ? -10.608 -6.531  -28.589 1.00 136.46 ? 1155 GLU A CA    1 
ATOM   8595  C  C     . GLU A 1 1155 ? -10.389 -6.757  -30.085 1.00 122.72 ? 1155 GLU A C     1 
ATOM   8596  O  O     . GLU A 1 1155 ? -9.620  -7.617  -30.465 1.00 126.42 ? 1155 GLU A O     1 
ATOM   8597  C  CB    . GLU A 1 1155 ? -9.524  -5.558  -28.069 1.00 150.03 ? 1155 GLU A CB    1 
ATOM   8598  C  CG    . GLU A 1 1155 ? -8.263  -5.411  -28.939 1.00 154.35 ? 1155 GLU A CG    1 
ATOM   8599  C  CD    . GLU A 1 1155 ? -7.088  -4.749  -28.223 1.00 151.53 ? 1155 GLU A CD    1 
ATOM   8600  O  OE1   . GLU A 1 1155 ? -6.558  -5.358  -27.264 1.00 149.58 ? 1155 GLU A OE1   1 
ATOM   8601  O  OE2   . GLU A 1 1155 ? -6.676  -3.639  -28.639 1.00 135.79 ? 1155 GLU A OE2   1 
ATOM   8602  N  N     . GLY A 1 1156 ? -11.055 -5.943  -30.901 1.00 114.56 ? 1156 GLY A N     1 
ATOM   8603  C  CA    . GLY A 1 1156 ? -10.980 -6.092  -32.346 1.00 118.11 ? 1156 GLY A CA    1 
ATOM   8604  C  C     . GLY A 1 1156 ? -11.959 -5.204  -33.089 1.00 116.89 ? 1156 GLY A C     1 
ATOM   8605  O  O     . GLY A 1 1156 ? -12.738 -4.452  -32.468 1.00 110.27 ? 1156 GLY A O     1 
ATOM   8606  N  N     . GLN A 1 1157 ? -11.930 -5.311  -34.418 1.00 118.60 ? 1157 GLN A N     1 
ATOM   8607  C  CA    . GLN A 1 1157 ? -12.839 -4.595  -35.314 1.00 123.30 ? 1157 GLN A CA    1 
ATOM   8608  C  C     . GLN A 1 1157 ? -13.634 -5.621  -36.109 1.00 119.96 ? 1157 GLN A C     1 
ATOM   8609  O  O     . GLN A 1 1157 ? -13.465 -5.731  -37.315 1.00 127.31 ? 1157 GLN A O     1 
ATOM   8610  C  CB    . GLN A 1 1157 ? -12.052 -3.687  -36.266 1.00 126.33 ? 1157 GLN A CB    1 
ATOM   8611  C  CG    . GLN A 1 1157 ? -11.093 -2.731  -35.575 1.00 121.41 ? 1157 GLN A CG    1 
ATOM   8612  C  CD    . GLN A 1 1157 ? -11.789 -1.494  -35.070 1.00 119.79 ? 1157 GLN A CD    1 
ATOM   8613  O  OE1   . GLN A 1 1157 ? -12.388 -0.756  -35.854 1.00 133.21 ? 1157 GLN A OE1   1 
ATOM   8614  N  NE2   . GLN A 1 1157 ? -11.718 -1.254  -33.759 1.00 110.44 ? 1157 GLN A NE2   1 
ATOM   8615  N  N     . PRO A 1 1158 ? -14.493 -6.398  -35.426 1.00 120.62 ? 1158 PRO A N     1 
ATOM   8616  C  CA    . PRO A 1 1158 ? -15.229 -7.471  -36.093 1.00 118.38 ? 1158 PRO A CA    1 
ATOM   8617  C  C     . PRO A 1 1158 ? -16.310 -7.018  -37.058 1.00 112.44 ? 1158 PRO A C     1 
ATOM   8618  O  O     . PRO A 1 1158 ? -16.612 -7.736  -38.017 1.00 121.67 ? 1158 PRO A O     1 
ATOM   8619  C  CB    . PRO A 1 1158 ? -15.875 -8.247  -34.939 1.00 117.02 ? 1158 PRO A CB    1 
ATOM   8620  C  CG    . PRO A 1 1158 ? -15.918 -7.285  -33.814 1.00 125.77 ? 1158 PRO A CG    1 
ATOM   8621  C  CD    . PRO A 1 1158 ? -14.725 -6.399  -33.971 1.00 122.58 ? 1158 PRO A CD    1 
ATOM   8622  N  N     . PHE A 1 1159 ? -16.880 -5.832  -36.822 1.00 106.57 ? 1159 PHE A N     1 
ATOM   8623  C  CA    . PHE A 1 1159 ? -18.061 -5.381  -37.552 1.00 93.73  ? 1159 PHE A CA    1 
ATOM   8624  C  C     . PHE A 1 1159 ? -17.819 -4.189  -38.485 1.00 88.60  ? 1159 PHE A C     1 
ATOM   8625  O  O     . PHE A 1 1159 ? -17.103 -3.237  -38.161 1.00 88.37  ? 1159 PHE A O     1 
ATOM   8626  C  CB    . PHE A 1 1159 ? -19.182 -5.074  -36.582 1.00 95.25  ? 1159 PHE A CB    1 
ATOM   8627  C  CG    . PHE A 1 1159 ? -19.416 -6.168  -35.590 1.00 92.74  ? 1159 PHE A CG    1 
ATOM   8628  C  CD1   . PHE A 1 1159 ? -19.910 -7.382  -35.997 1.00 100.32 ? 1159 PHE A CD1   1 
ATOM   8629  C  CD2   . PHE A 1 1159 ? -19.138 -5.986  -34.257 1.00 91.49  ? 1159 PHE A CD2   1 
ATOM   8630  C  CE1   . PHE A 1 1159 ? -20.124 -8.400  -35.087 1.00 102.84 ? 1159 PHE A CE1   1 
ATOM   8631  C  CE2   . PHE A 1 1159 ? -19.357 -6.997  -33.338 1.00 92.29  ? 1159 PHE A CE2   1 
ATOM   8632  C  CZ    . PHE A 1 1159 ? -19.842 -8.208  -33.752 1.00 91.32  ? 1159 PHE A CZ    1 
ATOM   8633  N  N     . GLU A 1 1160 ? -18.427 -4.265  -39.653 1.00 92.50  ? 1160 GLU A N     1 
ATOM   8634  C  CA    . GLU A 1 1160 ? -18.272 -3.271  -40.719 1.00 96.31  ? 1160 GLU A CA    1 
ATOM   8635  C  C     . GLU A 1 1160 ? -19.185 -2.071  -40.478 1.00 94.45  ? 1160 GLU A C     1 
ATOM   8636  O  O     . GLU A 1 1160 ? -18.829 -0.951  -40.819 1.00 93.19  ? 1160 GLU A O     1 
ATOM   8637  C  CB    . GLU A 1 1160 ? -18.637 -3.939  -42.048 1.00 99.77  ? 1160 GLU A CB    1 
ATOM   8638  C  CG    . GLU A 1 1160 ? -18.665 -3.005  -43.244 1.00 115.19 ? 1160 GLU A CG    1 
ATOM   8639  C  CD    . GLU A 1 1160 ? -17.291 -2.514  -43.656 1.00 125.47 ? 1160 GLU A CD    1 
ATOM   8640  O  OE1   . GLU A 1 1160 ? -16.347 -2.636  -42.843 1.00 118.98 ? 1160 GLU A OE1   1 
ATOM   8641  O  OE2   . GLU A 1 1160 ? -17.159 -2.017  -44.805 1.00 134.35 ? 1160 GLU A OE2   1 
ATOM   8642  N  N     . TYR A 1 1161 ? -20.369 -2.326  -39.927 1.00 91.77  ? 1161 TYR A N     1 
ATOM   8643  C  CA    . TYR A 1 1161 ? -21.353 -1.299  -39.616 1.00 92.11  ? 1161 TYR A CA    1 
ATOM   8644  C  C     . TYR A 1 1161 ? -22.401 -1.813  -38.625 1.00 98.48  ? 1161 TYR A C     1 
ATOM   8645  O  O     . TYR A 1 1161 ? -22.447 -3.009  -38.336 1.00 94.85  ? 1161 TYR A O     1 
ATOM   8646  C  CB    . TYR A 1 1161 ? -22.050 -0.794  -40.885 1.00 93.39  ? 1161 TYR A CB    1 
ATOM   8647  C  CG    . TYR A 1 1161 ? -22.686 -1.870  -41.725 1.00 92.53  ? 1161 TYR A CG    1 
ATOM   8648  C  CD1   . TYR A 1 1161 ? -23.945 -2.389  -41.424 1.00 93.54  ? 1161 TYR A CD1   1 
ATOM   8649  C  CD2   . TYR A 1 1161 ? -22.033 -2.356  -42.831 1.00 104.06 ? 1161 TYR A CD2   1 
ATOM   8650  C  CE1   . TYR A 1 1161 ? -24.522 -3.376  -42.208 1.00 97.52  ? 1161 TYR A CE1   1 
ATOM   8651  C  CE2   . TYR A 1 1161 ? -22.593 -3.335  -43.627 1.00 115.12 ? 1161 TYR A CE2   1 
ATOM   8652  C  CZ    . TYR A 1 1161 ? -23.835 -3.845  -43.320 1.00 109.57 ? 1161 TYR A CZ    1 
ATOM   8653  O  OH    . TYR A 1 1161 ? -24.338 -4.821  -44.153 1.00 106.19 ? 1161 TYR A OH    1 
ATOM   8654  N  N     . PHE A 1 1162 ? -23.224 -0.890  -38.119 1.00 102.02 ? 1162 PHE A N     1 
ATOM   8655  C  CA    . PHE A 1 1162 ? -24.215 -1.217  -37.106 1.00 102.90 ? 1162 PHE A CA    1 
ATOM   8656  C  C     . PHE A 1 1162 ? -25.591 -0.712  -37.544 1.00 105.45 ? 1162 PHE A C     1 
ATOM   8657  O  O     . PHE A 1 1162 ? -25.740 0.447   -37.904 1.00 103.31 ? 1162 PHE A O     1 
ATOM   8658  C  CB    . PHE A 1 1162 ? -23.870 -0.511  -35.814 1.00 100.84 ? 1162 PHE A CB    1 
ATOM   8659  C  CG    . PHE A 1 1162 ? -22.548 -0.905  -35.264 1.00 103.52 ? 1162 PHE A CG    1 
ATOM   8660  C  CD1   . PHE A 1 1162 ? -21.382 -0.425  -35.837 1.00 106.94 ? 1162 PHE A CD1   1 
ATOM   8661  C  CD2   . PHE A 1 1162 ? -22.464 -1.766  -34.187 1.00 99.04  ? 1162 PHE A CD2   1 
ATOM   8662  C  CE1   . PHE A 1 1162 ? -20.149 -0.791  -35.342 1.00 102.84 ? 1162 PHE A CE1   1 
ATOM   8663  C  CE2   . PHE A 1 1162 ? -21.238 -2.132  -33.681 1.00 103.48 ? 1162 PHE A CE2   1 
ATOM   8664  C  CZ    . PHE A 1 1162 ? -20.078 -1.644  -34.259 1.00 108.66 ? 1162 PHE A CZ    1 
ATOM   8665  N  N     . VAL A 1 1163 ? -26.565 -1.602  -37.535 1.00 109.05 ? 1163 VAL A N     1 
ATOM   8666  C  CA    . VAL A 1 1163 ? -27.932 -1.209  -37.811 1.00 112.93 ? 1163 VAL A CA    1 
ATOM   8667  C  C     . VAL A 1 1163 ? -28.550 -0.755  -36.496 1.00 123.03 ? 1163 VAL A C     1 
ATOM   8668  O  O     . VAL A 1 1163 ? -28.457 -1.468  -35.476 1.00 112.38 ? 1163 VAL A O     1 
ATOM   8669  C  CB    . VAL A 1 1163 ? -28.665 -2.340  -38.503 1.00 114.87 ? 1163 VAL A CB    1 
ATOM   8670  C  CG1   . VAL A 1 1163 ? -29.997 -1.847  -39.034 1.00 119.01 ? 1163 VAL A CG1   1 
ATOM   8671  C  CG2   . VAL A 1 1163 ? -27.784 -2.861  -39.636 1.00 117.77 ? 1163 VAL A CG2   1 
ATOM   8672  N  N     . TYR A 1 1164 ? -29.150 0.444   -36.518 1.00 126.63 ? 1164 TYR A N     1 
ATOM   8673  C  CA    . TYR A 1 1164 ? -29.814 1.015   -35.335 1.00 109.16 ? 1164 TYR A CA    1 
ATOM   8674  C  C     . TYR A 1 1164 ? -31.332 1.061   -35.455 1.00 103.55 ? 1164 TYR A C     1 
ATOM   8675  O  O     . TYR A 1 1164 ? -31.865 1.301   -36.520 1.00 98.24  ? 1164 TYR A O     1 
ATOM   8676  C  CB    . TYR A 1 1164 ? -29.320 2.438   -35.044 1.00 100.10 ? 1164 TYR A CB    1 
ATOM   8677  C  CG    . TYR A 1 1164 ? -27.890 2.482   -34.616 1.00 93.32  ? 1164 TYR A CG    1 
ATOM   8678  C  CD1   . TYR A 1 1164 ? -27.499 1.899   -33.414 1.00 88.94  ? 1164 TYR A CD1   1 
ATOM   8679  C  CD2   . TYR A 1 1164 ? -26.909 3.088   -35.423 1.00 85.93  ? 1164 TYR A CD2   1 
ATOM   8680  C  CE1   . TYR A 1 1164 ? -26.170 1.917   -33.019 1.00 90.89  ? 1164 TYR A CE1   1 
ATOM   8681  C  CE2   . TYR A 1 1164 ? -25.571 3.114   -35.035 1.00 80.32  ? 1164 TYR A CE2   1 
ATOM   8682  C  CZ    . TYR A 1 1164 ? -25.204 2.520   -33.837 1.00 85.79  ? 1164 TYR A CZ    1 
ATOM   8683  O  OH    . TYR A 1 1164 ? -23.887 2.520   -33.429 1.00 84.63  ? 1164 TYR A OH    1 
ATOM   8684  N  N     . GLY A 1 1165 ? -32.011 0.839   -34.345 1.00 96.25  ? 1165 GLY A N     1 
ATOM   8685  C  CA    . GLY A 1 1165 ? -33.454 0.878   -34.348 1.00 90.71  ? 1165 GLY A CA    1 
ATOM   8686  C  C     . GLY A 1 1165 ? -34.017 0.981   -32.962 1.00 89.03  ? 1165 GLY A C     1 
ATOM   8687  O  O     . GLY A 1 1165 ? -33.270 0.988   -31.976 1.00 101.56 ? 1165 GLY A O     1 
ATOM   8688  N  N     . ALA A 1 1166 ? -35.328 1.083   -32.895 1.00 87.29  ? 1166 ALA A N     1 
ATOM   8689  C  CA    . ALA A 1 1166 ? -36.060 1.051   -31.633 1.00 100.15 ? 1166 ALA A CA    1 
ATOM   8690  C  C     . ALA A 1 1166 ? -37.457 0.542   -31.899 1.00 95.03  ? 1166 ALA A C     1 
ATOM   8691  O  O     . ALA A 1 1166 ? -37.922 0.615   -33.029 1.00 92.42  ? 1166 ALA A O     1 
ATOM   8692  C  CB    . ALA A 1 1166 ? -36.115 2.436   -31.017 1.00 115.32 ? 1166 ALA A CB    1 
ATOM   8693  N  N     . ALA A 1 1167 ? -38.126 0.040   -30.864 1.00 94.43  ? 1167 ALA A N     1 
ATOM   8694  C  CA    . ALA A 1 1167 ? -39.470 -0.484  -31.028 1.00 97.14  ? 1167 ALA A CA    1 
ATOM   8695  C  C     . ALA A 1 1167 ? -40.268 -0.404  -29.745 1.00 102.50 ? 1167 ALA A C     1 
ATOM   8696  O  O     . ALA A 1 1167 ? -39.767 -0.742  -28.672 1.00 94.48  ? 1167 ALA A O     1 
ATOM   8697  C  CB    . ALA A 1 1167 ? -39.408 -1.930  -31.480 1.00 104.30 ? 1167 ALA A CB    1 
ATOM   8698  N  N     . CYS A 1 1168 ? -41.519 0.028   -29.886 1.00 105.74 ? 1168 CYS A N     1 
ATOM   8699  C  CA    . CYS A 1 1168 ? -42.456 0.176   -28.795 1.00 102.86 ? 1168 CYS A CA    1 
ATOM   8700  C  C     . CYS A 1 1168 ? -43.612 -0.785  -29.032 1.00 96.64  ? 1168 CYS A C     1 
ATOM   8701  O  O     . CYS A 1 1168 ? -44.067 -0.929  -30.169 1.00 95.34  ? 1168 CYS A O     1 
ATOM   8702  C  CB    . CYS A 1 1168 ? -42.948 1.613   -28.770 1.00 104.06 ? 1168 CYS A CB    1 
ATOM   8703  S  SG    . CYS A 1 1168 ? -44.343 1.855   -27.672 1.00 116.42 ? 1168 CYS A SG    1 
ATOM   8704  N  N     . SER A 1 1169 ? -44.087 -1.437  -27.971 1.00 88.11  ? 1169 SER A N     1 
ATOM   8705  C  CA    . SER A 1 1169 ? -45.198 -2.404  -28.065 1.00 89.09  ? 1169 SER A CA    1 
ATOM   8706  C  C     . SER A 1 1169 ? -46.168 -2.304  -26.882 1.00 85.82  ? 1169 SER A C     1 
ATOM   8707  O  O     . SER A 1 1169 ? -45.736 -2.178  -25.743 1.00 86.17  ? 1169 SER A O     1 
ATOM   8708  C  CB    . SER A 1 1169 ? -44.671 -3.852  -28.077 1.00 90.74  ? 1169 SER A CB    1 
ATOM   8709  O  OG    . SER A 1 1169 ? -44.503 -4.371  -29.384 1.00 89.71  ? 1169 SER A OG    1 
ATOM   8710  N  N     . GLU A 1 1170 ? -47.464 -2.417  -27.174 1.00 88.28  ? 1170 GLU A N     1 
ATOM   8711  C  CA    . GLU A 1 1170 ? -48.511 -2.362  -26.175 1.00 96.95  ? 1170 GLU A CA    1 
ATOM   8712  C  C     . GLU A 1 1170 ? -49.368 -3.616  -26.228 1.00 100.42 ? 1170 GLU A C     1 
ATOM   8713  O  O     . GLU A 1 1170 ? -49.735 -4.068  -27.309 1.00 106.23 ? 1170 GLU A O     1 
ATOM   8714  C  CB    . GLU A 1 1170 ? -49.387 -1.146  -26.386 1.00 98.34  ? 1170 GLU A CB    1 
ATOM   8715  C  CG    . GLU A 1 1170 ? -50.532 -0.999  -25.395 1.00 99.26  ? 1170 GLU A CG    1 
ATOM   8716  C  CD    . GLU A 1 1170 ? -51.352 0.265   -25.632 1.00 114.20 ? 1170 GLU A CD    1 
ATOM   8717  O  OE1   . GLU A 1 1170 ? -50.999 1.064   -26.530 1.00 120.58 ? 1170 GLU A OE1   1 
ATOM   8718  O  OE2   . GLU A 1 1170 ? -52.358 0.473   -24.917 1.00 126.01 ? 1170 GLU A OE2   1 
ATOM   8719  N  N     . VAL A 1 1171 ? -49.692 -4.156  -25.059 1.00 96.36  ? 1171 VAL A N     1 
ATOM   8720  C  CA    . VAL A 1 1171 ? -50.498 -5.381  -24.940 1.00 91.02  ? 1171 VAL A CA    1 
ATOM   8721  C  C     . VAL A 1 1171 ? -51.573 -5.255  -23.861 1.00 93.55  ? 1171 VAL A C     1 
ATOM   8722  O  O     . VAL A 1 1171 ? -51.479 -4.409  -22.990 1.00 104.84 ? 1171 VAL A O     1 
ATOM   8723  C  CB    . VAL A 1 1171 ? -49.585 -6.588  -24.641 1.00 93.69  ? 1171 VAL A CB    1 
ATOM   8724  C  CG1   . VAL A 1 1171 ? -48.400 -6.600  -25.593 1.00 92.78  ? 1171 VAL A CG1   1 
ATOM   8725  C  CG2   . VAL A 1 1171 ? -49.084 -6.567  -23.208 1.00 94.87  ? 1171 VAL A CG2   1 
ATOM   8726  N  N     . GLU A 1 1172 ? -52.604 -6.091  -23.943 1.00 93.46  ? 1172 GLU A N     1 
ATOM   8727  C  CA    . GLU A 1 1172 ? -53.566 -6.269  -22.853 1.00 98.14  ? 1172 GLU A CA    1 
ATOM   8728  C  C     . GLU A 1 1172 ? -53.625 -7.757  -22.535 1.00 92.49  ? 1172 GLU A C     1 
ATOM   8729  O  O     . GLU A 1 1172 ? -53.807 -8.576  -23.441 1.00 92.30  ? 1172 GLU A O     1 
ATOM   8730  C  CB    . GLU A 1 1172 ? -54.957 -5.761  -23.259 1.00 100.14 ? 1172 GLU A CB    1 
ATOM   8731  C  CG    . GLU A 1 1172 ? -56.070 -6.237  -22.324 1.00 107.33 ? 1172 GLU A CG    1 
ATOM   8732  C  CD    . GLU A 1 1172 ? -57.378 -5.448  -22.408 1.00 110.95 ? 1172 GLU A CD    1 
ATOM   8733  O  OE1   . GLU A 1 1172 ? -57.637 -4.742  -23.409 1.00 103.84 ? 1172 GLU A OE1   1 
ATOM   8734  O  OE2   . GLU A 1 1172 ? -58.181 -5.564  -21.454 1.00 122.17 ? 1172 GLU A OE2   1 
ATOM   8735  N  N     . ILE A 1 1173 ? -53.481 -8.096  -21.258 1.00 85.82  ? 1173 ILE A N     1 
ATOM   8736  C  CA    . ILE A 1 1173 ? -53.570 -9.483  -20.800 1.00 86.60  ? 1173 ILE A CA    1 
ATOM   8737  C  C     . ILE A 1 1173 ? -54.867 -9.747  -20.058 1.00 91.35  ? 1173 ILE A C     1 
ATOM   8738  O  O     . ILE A 1 1173 ? -55.448 -8.845  -19.494 1.00 99.04  ? 1173 ILE A O     1 
ATOM   8739  C  CB    . ILE A 1 1173 ? -52.340 -9.858  -19.962 1.00 85.02  ? 1173 ILE A CB    1 
ATOM   8740  C  CG1   . ILE A 1 1173 ? -52.572 -9.585  -18.480 1.00 88.70  ? 1173 ILE A CG1   1 
ATOM   8741  C  CG2   . ILE A 1 1173 ? -51.130 -9.103  -20.493 1.00 85.73  ? 1173 ILE A CG2   1 
ATOM   8742  C  CD1   . ILE A 1 1173 ? -51.304 -9.515  -17.654 1.00 93.40  ? 1173 ILE A CD1   1 
ATOM   8743  N  N     . ASP A 1 1174 ? -55.308 -10.998 -20.104 1.00 106.99 ? 1174 ASP A N     1 
ATOM   8744  C  CA    . ASP A 1 1174 ? -56.411 -11.522 -19.309 1.00 112.70 ? 1174 ASP A CA    1 
ATOM   8745  C  C     . ASP A 1 1174 ? -55.747 -12.228 -18.127 1.00 108.27 ? 1174 ASP A C     1 
ATOM   8746  O  O     . ASP A 1 1174 ? -55.094 -13.254 -18.302 1.00 115.47 ? 1174 ASP A O     1 
ATOM   8747  C  CB    . ASP A 1 1174 ? -57.314 -12.455 -20.140 1.00 110.30 ? 1174 ASP A CB    1 
ATOM   8748  C  CG    . ASP A 1 1174 ? -58.522 -12.959 -19.360 1.00 115.72 ? 1174 ASP A CG    1 
ATOM   8749  O  OD1   . ASP A 1 1174 ? -58.475 -12.934 -18.102 1.00 113.65 ? 1174 ASP A OD1   1 
ATOM   8750  O  OD2   . ASP A 1 1174 ? -59.510 -13.386 -20.012 1.00 113.35 ? 1174 ASP A OD2   1 
ATOM   8751  N  N     . CYS A 1 1175 ? -55.907 -11.674 -16.933 1.00 100.51 ? 1175 CYS A N     1 
ATOM   8752  C  CA    . CYS A 1 1175 ? -55.276 -12.251 -15.752 1.00 100.41 ? 1175 CYS A CA    1 
ATOM   8753  C  C     . CYS A 1 1175 ? -55.934 -13.549 -15.278 1.00 97.41  ? 1175 CYS A C     1 
ATOM   8754  O  O     . CYS A 1 1175 ? -55.337 -14.285 -14.512 1.00 97.82  ? 1175 CYS A O     1 
ATOM   8755  C  CB    . CYS A 1 1175 ? -55.241 -11.237 -14.617 1.00 108.29 ? 1175 CYS A CB    1 
ATOM   8756  S  SG    . CYS A 1 1175 ? -54.353 -9.724  -15.049 1.00 107.58 ? 1175 CYS A SG    1 
ATOM   8757  N  N     . LEU A 1 1176 ? -57.160 -13.815 -15.720 1.00 94.60  ? 1176 LEU A N     1 
ATOM   8758  C  CA    . LEU A 1 1176 ? -57.911 -15.028 -15.375 1.00 109.67 ? 1176 LEU A CA    1 
ATOM   8759  C  C     . LEU A 1 1176 ? -57.593 -16.251 -16.258 1.00 115.41 ? 1176 LEU A C     1 
ATOM   8760  O  O     . LEU A 1 1176 ? -57.726 -17.390 -15.815 1.00 117.42 ? 1176 LEU A O     1 
ATOM   8761  C  CB    . LEU A 1 1176 ? -59.405 -14.750 -15.545 1.00 111.35 ? 1176 LEU A CB    1 
ATOM   8762  C  CG    . LEU A 1 1176 ? -60.188 -14.097 -14.423 1.00 103.01 ? 1176 LEU A CG    1 
ATOM   8763  C  CD1   . LEU A 1 1176 ? -61.343 -13.305 -15.018 1.00 96.25  ? 1176 LEU A CD1   1 
ATOM   8764  C  CD2   . LEU A 1 1176 ? -60.658 -15.178 -13.457 1.00 105.04 ? 1176 LEU A CD2   1 
ATOM   8765  N  N     . THR A 1 1177 ? -57.227 -16.004 -17.513 1.00 109.90 ? 1177 THR A N     1 
ATOM   8766  C  CA    . THR A 1 1177 ? -56.941 -17.067 -18.465 1.00 101.99 ? 1177 THR A CA    1 
ATOM   8767  C  C     . THR A 1 1177 ? -55.481 -17.091 -18.954 1.00 97.65  ? 1177 THR A C     1 
ATOM   8768  O  O     . THR A 1 1177 ? -55.052 -18.086 -19.547 1.00 112.63 ? 1177 THR A O     1 
ATOM   8769  C  CB    . THR A 1 1177 ? -57.876 -16.965 -19.695 1.00 107.64 ? 1177 THR A CB    1 
ATOM   8770  O  OG1   . THR A 1 1177 ? -57.495 -15.853 -20.517 1.00 108.90 ? 1177 THR A OG1   1 
ATOM   8771  C  CG2   . THR A 1 1177 ? -59.335 -16.804 -19.269 1.00 109.68 ? 1177 THR A CG2   1 
ATOM   8772  N  N     . GLY A 1 1178 ? -54.724 -16.022 -18.716 1.00 89.21  ? 1178 GLY A N     1 
ATOM   8773  C  CA    . GLY A 1 1178 ? -53.382 -15.893 -19.249 1.00 87.82  ? 1178 GLY A CA    1 
ATOM   8774  C  C     . GLY A 1 1178 ? -53.302 -15.571 -20.729 1.00 86.71  ? 1178 GLY A C     1 
ATOM   8775  O  O     . GLY A 1 1178 ? -52.228 -15.660 -21.321 1.00 97.65  ? 1178 GLY A O     1 
ATOM   8776  N  N     . ASP A 1 1179 ? -54.421 -15.179 -21.324 1.00 87.60  ? 1179 ASP A N     1 
ATOM   8777  C  CA    . ASP A 1 1179 ? -54.455 -14.778 -22.738 1.00 96.93  ? 1179 ASP A CA    1 
ATOM   8778  C  C     . ASP A 1 1179 ? -53.804 -13.401 -22.873 1.00 87.94  ? 1179 ASP A C     1 
ATOM   8779  O  O     . ASP A 1 1179 ? -53.605 -12.707 -21.879 1.00 84.75  ? 1179 ASP A O     1 
ATOM   8780  C  CB    . ASP A 1 1179 ? -55.913 -14.724 -23.217 1.00 102.50 ? 1179 ASP A CB    1 
ATOM   8781  C  CG    . ASP A 1 1179 ? -56.043 -14.645 -24.723 1.00 102.55 ? 1179 ASP A CG    1 
ATOM   8782  O  OD1   . ASP A 1 1179 ? -56.078 -15.715 -25.367 1.00 111.26 ? 1179 ASP A OD1   1 
ATOM   8783  O  OD2   . ASP A 1 1179 ? -56.138 -13.516 -25.256 1.00 102.94 ? 1179 ASP A OD2   1 
ATOM   8784  N  N     . HIS A 1 1180 ? -53.459 -13.014 -24.083 1.00 86.63  ? 1180 HIS A N     1 
ATOM   8785  C  CA    . HIS A 1 1180 ? -53.079 -11.633 -24.356 1.00 86.97  ? 1180 HIS A CA    1 
ATOM   8786  C  C     . HIS A 1 1180 ? -53.378 -11.219 -25.787 1.00 84.83  ? 1180 HIS A C     1 
ATOM   8787  O  O     . HIS A 1 1180 ? -53.686 -12.061 -26.644 1.00 105.02 ? 1180 HIS A O     1 
ATOM   8788  C  CB    . HIS A 1 1180 ? -51.606 -11.410 -24.036 1.00 88.98  ? 1180 HIS A CB    1 
ATOM   8789  C  CG    . HIS A 1 1180 ? -50.677 -11.752 -25.156 1.00 91.40  ? 1180 HIS A CG    1 
ATOM   8790  N  ND1   . HIS A 1 1180 ? -50.305 -13.045 -25.446 1.00 90.67  ? 1180 HIS A ND1   1 
ATOM   8791  C  CD2   . HIS A 1 1180 ? -50.021 -10.963 -26.041 1.00 94.84  ? 1180 HIS A CD2   1 
ATOM   8792  C  CE1   . HIS A 1 1180 ? -49.462 -13.040 -26.466 1.00 92.05  ? 1180 HIS A CE1   1 
ATOM   8793  N  NE2   . HIS A 1 1180 ? -49.272 -11.789 -26.844 1.00 90.30  ? 1180 HIS A NE2   1 
ATOM   8794  N  N     . LYS A 1 1181 ? -53.296 -9.919  -26.016 1.00 71.25  ? 1181 LYS A N     1 
ATOM   8795  C  CA    . LYS A 1 1181 ? -53.570 -9.334  -27.309 1.00 88.41  ? 1181 LYS A CA    1 
ATOM   8796  C  C     . LYS A 1 1181 ? -52.538 -8.248  -27.533 1.00 85.59  ? 1181 LYS A C     1 
ATOM   8797  O  O     . LYS A 1 1181 ? -52.268 -7.483  -26.619 1.00 93.89  ? 1181 LYS A O     1 
ATOM   8798  C  CB    . LYS A 1 1181 ? -54.972 -8.713  -27.368 1.00 97.95  ? 1181 LYS A CB    1 
ATOM   8799  C  CG    . LYS A 1 1181 ? -55.301 -8.030  -28.700 1.00 106.60 ? 1181 LYS A CG    1 
ATOM   8800  C  CD    . LYS A 1 1181 ? -55.247 -8.991  -29.899 1.00 114.33 ? 1181 LYS A CD    1 
ATOM   8801  C  CE    . LYS A 1 1181 ? -55.232 -8.229  -31.220 1.00 120.15 ? 1181 LYS A CE    1 
ATOM   8802  N  NZ    . LYS A 1 1181 ? -55.758 -9.014  -32.371 1.00 124.11 ? 1181 LYS A NZ    1 
ATOM   8803  N  N     . ASN A 1 1182 ? -51.948 -8.231  -28.724 1.00 86.98  ? 1182 ASN A N     1 
ATOM   8804  C  CA    . ASN A 1 1182 ? -51.007 -7.200  -29.112 1.00 89.62  ? 1182 ASN A CA    1 
ATOM   8805  C  C     . ASN A 1 1182 ? -51.809 -6.085  -29.691 1.00 87.86  ? 1182 ASN A C     1 
ATOM   8806  O  O     . ASN A 1 1182 ? -52.449 -6.251  -30.718 1.00 101.63 ? 1182 ASN A O     1 
ATOM   8807  C  CB    . ASN A 1 1182 ? -50.005 -7.741  -30.095 1.00 95.31  ? 1182 ASN A CB    1 
ATOM   8808  C  CG    . ASN A 1 1182 ? -49.128 -8.793  -29.472 1.00 97.79  ? 1182 ASN A CG    1 
ATOM   8809  O  OD1   . ASN A 1 1182 ? -49.200 -9.045  -28.259 1.00 80.00  ? 1182 ASN A OD1   1 
ATOM   8810  N  ND2   . ASN A 1 1182 ? -48.295 -9.425  -30.295 1.00 109.47 ? 1182 ASN A ND2   1 
ATOM   8811  N  N     . ILE A 1 1183 ? -51.788 -4.942  -29.019 1.00 91.54  ? 1183 ILE A N     1 
ATOM   8812  C  CA    . ILE A 1 1183 ? -52.610 -3.807  -29.414 1.00 91.87  ? 1183 ILE A CA    1 
ATOM   8813  C  C     . ILE A 1 1183 ? -51.922 -3.026  -30.519 1.00 94.14  ? 1183 ILE A C     1 
ATOM   8814  O  O     . ILE A 1 1183 ? -52.510 -2.756  -31.558 1.00 91.99  ? 1183 ILE A O     1 
ATOM   8815  C  CB    . ILE A 1 1183 ? -52.877 -2.887  -28.201 1.00 88.06  ? 1183 ILE A CB    1 
ATOM   8816  C  CG1   . ILE A 1 1183 ? -54.025 -3.468  -27.374 1.00 91.32  ? 1183 ILE A CG1   1 
ATOM   8817  C  CG2   . ILE A 1 1183 ? -53.220 -1.465  -28.623 1.00 88.37  ? 1183 ILE A CG2   1 
ATOM   8818  C  CD1   . ILE A 1 1183 ? -53.738 -3.556  -25.897 1.00 98.13  ? 1183 ILE A CD1   1 
ATOM   8819  N  N     . ARG A 1 1184 ? -50.670 -2.662  -30.281 1.00 90.86  ? 1184 ARG A N     1 
ATOM   8820  C  CA    . ARG A 1 1184 ? -49.963 -1.784  -31.186 1.00 95.77  ? 1184 ARG A CA    1 
ATOM   8821  C  C     . ARG A 1 1184 ? -48.468 -1.971  -31.078 1.00 98.48  ? 1184 ARG A C     1 
ATOM   8822  O  O     . ARG A 1 1184 ? -47.947 -2.203  -29.988 1.00 106.25 ? 1184 ARG A O     1 
ATOM   8823  C  CB    . ARG A 1 1184 ? -50.287 -0.330  -30.877 1.00 97.62  ? 1184 ARG A CB    1 
ATOM   8824  C  CG    . ARG A 1 1184 ? -49.529 0.653   -31.740 1.00 95.34  ? 1184 ARG A CG    1 
ATOM   8825  C  CD    . ARG A 1 1184 ? -49.753 2.070   -31.279 1.00 98.13  ? 1184 ARG A CD    1 
ATOM   8826  N  NE    . ARG A 1 1184 ? -49.313 3.003   -32.302 1.00 103.67 ? 1184 ARG A NE    1 
ATOM   8827  C  CZ    . ARG A 1 1184 ? -49.417 4.318   -32.205 1.00 107.08 ? 1184 ARG A CZ    1 
ATOM   8828  N  NH1   . ARG A 1 1184 ? -49.922 4.861   -31.111 1.00 107.87 ? 1184 ARG A NH1   1 
ATOM   8829  N  NH2   . ARG A 1 1184 ? -49.008 5.091   -33.207 1.00 116.91 ? 1184 ARG A NH2   1 
ATOM   8830  N  N     . THR A 1 1185 ? -47.791 -1.837  -32.211 1.00 93.43  ? 1185 THR A N     1 
ATOM   8831  C  CA    . THR A 1 1185 ? -46.346 -1.840  -32.248 1.00 88.37  ? 1185 THR A CA    1 
ATOM   8832  C  C     . THR A 1 1185 ? -45.844 -0.735  -33.174 1.00 92.79  ? 1185 THR A C     1 
ATOM   8833  O  O     . THR A 1 1185 ? -46.430 -0.489  -34.224 1.00 88.84  ? 1185 THR A O     1 
ATOM   8834  C  CB    . THR A 1 1185 ? -45.823 -3.216  -32.662 1.00 89.54  ? 1185 THR A CB    1 
ATOM   8835  O  OG1   . THR A 1 1185 ? -46.425 -4.217  -31.833 1.00 78.80  ? 1185 THR A OG1   1 
ATOM   8836  C  CG2   . THR A 1 1185 ? -44.320 -3.291  -32.508 1.00 95.14  ? 1185 THR A CG2   1 
ATOM   8837  N  N     . ASP A 1 1186 ? -44.788 -0.052  -32.742 1.00 102.35 ? 1186 ASP A N     1 
ATOM   8838  C  CA    . ASP A 1 1186 ? -44.196 1.081   -33.459 1.00 110.63 ? 1186 ASP A CA    1 
ATOM   8839  C  C     . ASP A 1 1186 ? -42.708 0.784   -33.626 1.00 111.73 ? 1186 ASP A C     1 
ATOM   8840  O  O     . ASP A 1 1186 ? -42.046 0.448   -32.649 1.00 97.44  ? 1186 ASP A O     1 
ATOM   8841  C  CB    . ASP A 1 1186 ? -44.312 2.335   -32.593 1.00 117.23 ? 1186 ASP A CB    1 
ATOM   8842  C  CG    . ASP A 1 1186 ? -45.743 2.756   -32.352 1.00 120.16 ? 1186 ASP A CG    1 
ATOM   8843  O  OD1   . ASP A 1 1186 ? -46.355 3.312   -33.291 1.00 124.19 ? 1186 ASP A OD1   1 
ATOM   8844  O  OD2   . ASP A 1 1186 ? -46.239 2.561   -31.217 1.00 107.93 ? 1186 ASP A OD2   1 
ATOM   8845  N  N     . ILE A 1 1187 ? -42.196 0.901   -34.849 1.00 107.90 ? 1187 ILE A N     1 
ATOM   8846  C  CA    . ILE A 1 1187 ? -40.804 0.564   -35.145 1.00 102.33 ? 1187 ILE A CA    1 
ATOM   8847  C  C     . ILE A 1 1187 ? -40.155 1.645   -35.987 1.00 95.64  ? 1187 ILE A C     1 
ATOM   8848  O  O     . ILE A 1 1187 ? -40.643 1.977   -37.066 1.00 98.75  ? 1187 ILE A O     1 
ATOM   8849  C  CB    . ILE A 1 1187 ? -40.670 -0.799  -35.847 1.00 105.19 ? 1187 ILE A CB    1 
ATOM   8850  C  CG1   . ILE A 1 1187 ? -41.219 -1.915  -34.943 1.00 107.57 ? 1187 ILE A CG1   1 
ATOM   8851  C  CG2   . ILE A 1 1187 ? -39.209 -1.063  -36.187 1.00 108.08 ? 1187 ILE A CG2   1 
ATOM   8852  C  CD1   . ILE A 1 1187 ? -41.257 -3.294  -35.567 1.00 109.59 ? 1187 ILE A CD1   1 
ATOM   8853  N  N     . VAL A 1 1188 ? -39.031 2.181   -35.509 1.00 95.87  ? 1188 VAL A N     1 
ATOM   8854  C  CA    . VAL A 1 1188 ? -38.179 3.060   -36.318 1.00 96.92  ? 1188 VAL A CA    1 
ATOM   8855  C  C     . VAL A 1 1188 ? -36.851 2.356   -36.557 1.00 93.94  ? 1188 VAL A C     1 
ATOM   8856  O  O     . VAL A 1 1188 ? -36.329 1.673   -35.668 1.00 91.15  ? 1188 VAL A O     1 
ATOM   8857  C  CB    . VAL A 1 1188 ? -37.900 4.406   -35.657 1.00 103.25 ? 1188 VAL A CB    1 
ATOM   8858  C  CG1   . VAL A 1 1188 ? -37.209 5.333   -36.656 1.00 103.95 ? 1188 VAL A CG1   1 
ATOM   8859  C  CG2   . VAL A 1 1188 ? -39.190 5.021   -35.138 1.00 107.79 ? 1188 VAL A CG2   1 
ATOM   8860  N  N     . MET A 1 1189 ? -36.290 2.565   -37.745 1.00 88.45  ? 1189 MET A N     1 
ATOM   8861  C  CA    . MET A 1 1189 ? -35.124 1.791   -38.184 1.00 99.15  ? 1189 MET A CA    1 
ATOM   8862  C  C     . MET A 1 1189 ? -34.192 2.553   -39.110 1.00 105.09 ? 1189 MET A C     1 
ATOM   8863  O  O     . MET A 1 1189 ? -34.619 3.011   -40.155 1.00 108.78 ? 1189 MET A O     1 
ATOM   8864  C  CB    . MET A 1 1189 ? -35.621 0.523   -38.881 1.00 103.58 ? 1189 MET A CB    1 
ATOM   8865  C  CG    . MET A 1 1189 ? -34.598 -0.610  -38.990 1.00 106.84 ? 1189 MET A CG    1 
ATOM   8866  S  SD    . MET A 1 1189 ? -34.298 -1.582  -37.500 1.00 113.61 ? 1189 MET A SD    1 
ATOM   8867  C  CE    . MET A 1 1189 ? -35.874 -1.455  -36.657 1.00 113.51 ? 1189 MET A CE    1 
ATOM   8868  N  N     . ASP A 1 1190 ? -32.918 2.615   -38.738 1.00 105.56 ? 1190 ASP A N     1 
ATOM   8869  C  CA    . ASP A 1 1190 ? -31.842 3.191   -39.569 1.00 112.19 ? 1190 ASP A CA    1 
ATOM   8870  C  C     . ASP A 1 1190 ? -31.334 2.135   -40.541 1.00 115.41 ? 1190 ASP A C     1 
ATOM   8871  O  O     . ASP A 1 1190 ? -30.631 1.224   -40.114 1.00 127.74 ? 1190 ASP A O     1 
ATOM   8872  C  CB    . ASP A 1 1190 ? -30.695 3.648   -38.631 1.00 120.92 ? 1190 ASP A CB    1 
ATOM   8873  C  CG    . ASP A 1 1190 ? -29.432 4.154   -39.370 1.00 123.89 ? 1190 ASP A CG    1 
ATOM   8874  O  OD1   . ASP A 1 1190 ? -29.484 4.483   -40.582 1.00 117.39 ? 1190 ASP A OD1   1 
ATOM   8875  O  OD2   . ASP A 1 1190 ? -28.371 4.235   -38.696 1.00 113.32 ? 1190 ASP A OD2   1 
ATOM   8876  N  N     . VAL A 1 1191 ? -31.667 2.262   -41.822 1.00 114.73 ? 1191 VAL A N     1 
ATOM   8877  C  CA    . VAL A 1 1191 ? -31.295 1.275   -42.842 1.00 121.15 ? 1191 VAL A CA    1 
ATOM   8878  C  C     . VAL A 1 1191 ? -30.266 1.786   -43.868 1.00 129.75 ? 1191 VAL A C     1 
ATOM   8879  O  O     . VAL A 1 1191 ? -30.001 1.103   -44.875 1.00 155.21 ? 1191 VAL A O     1 
ATOM   8880  C  CB    . VAL A 1 1191 ? -32.539 0.802   -43.599 1.00 119.35 ? 1191 VAL A CB    1 
ATOM   8881  C  CG1   . VAL A 1 1191 ? -33.540 0.249   -42.602 1.00 117.91 ? 1191 VAL A CG1   1 
ATOM   8882  C  CG2   . VAL A 1 1191 ? -33.135 1.936   -44.446 1.00 120.22 ? 1191 VAL A CG2   1 
ATOM   8883  N  N     . GLY A 1 1192 ? -29.702 2.971   -43.618 1.00 121.94 ? 1192 GLY A N     1 
ATOM   8884  C  CA    . GLY A 1 1192 ? -28.929 3.684   -44.631 1.00 115.29 ? 1192 GLY A CA    1 
ATOM   8885  C  C     . GLY A 1 1192 ? -29.843 4.044   -45.790 1.00 104.40 ? 1192 GLY A C     1 
ATOM   8886  O  O     . GLY A 1 1192 ? -30.998 4.439   -45.574 1.00 93.74  ? 1192 GLY A O     1 
ATOM   8887  N  N     . CYS A 1 1193 ? -29.329 3.896   -47.008 1.00 113.36 ? 1193 CYS A N     1 
ATOM   8888  C  CA    . CYS A 1 1193 ? -30.164 3.954   -48.218 1.00 122.44 ? 1193 CYS A CA    1 
ATOM   8889  C  C     . CYS A 1 1193 ? -30.633 2.569   -48.609 1.00 118.85 ? 1193 CYS A C     1 
ATOM   8890  O  O     . CYS A 1 1193 ? -29.858 1.769   -49.130 1.00 125.60 ? 1193 CYS A O     1 
ATOM   8891  C  CB    . CYS A 1 1193 ? -29.399 4.631   -49.351 1.00 116.49 ? 1193 CYS A CB    1 
ATOM   8892  S  SG    . CYS A 1 1193 ? -28.401 5.967   -48.670 1.00 120.87 ? 1193 CYS A SG    1 
ATOM   8893  N  N     . SER A 1 1194 ? -31.901 2.292   -48.365 1.00 111.65 ? 1194 SER A N     1 
ATOM   8894  C  CA    . SER A 1 1194 ? -32.509 1.026   -48.781 1.00 111.49 ? 1194 SER A CA    1 
ATOM   8895  C  C     . SER A 1 1194 ? -32.395 0.821   -50.303 1.00 112.65 ? 1194 SER A C     1 
ATOM   8896  O  O     . SER A 1 1194 ? -32.764 1.712   -51.076 1.00 109.35 ? 1194 SER A O     1 
ATOM   8897  C  CB    . SER A 1 1194 ? -33.970 0.959   -48.359 1.00 109.66 ? 1194 SER A CB    1 
ATOM   8898  O  OG    . SER A 1 1194 ? -34.470 -0.356  -48.498 1.00 102.74 ? 1194 SER A OG    1 
ATOM   8899  N  N     . ILE A 1 1195 ? -31.838 -0.325  -50.709 1.00 110.37 ? 1195 ILE A N     1 
ATOM   8900  C  CA    . ILE A 1 1195 ? -31.765 -0.698  -52.135 1.00 103.72 ? 1195 ILE A CA    1 
ATOM   8901  C  C     . ILE A 1 1195 ? -33.143 -1.050  -52.685 1.00 103.41 ? 1195 ILE A C     1 
ATOM   8902  O  O     . ILE A 1 1195 ? -33.435 -0.872  -53.862 1.00 94.11  ? 1195 ILE A O     1 
ATOM   8903  C  CB    . ILE A 1 1195 ? -30.835 -1.926  -52.386 1.00 107.72 ? 1195 ILE A CB    1 
ATOM   8904  C  CG1   . ILE A 1 1195 ? -29.466 -1.763  -51.713 1.00 119.13 ? 1195 ILE A CG1   1 
ATOM   8905  C  CG2   . ILE A 1 1195 ? -30.624 -2.157  -53.884 1.00 101.86 ? 1195 ILE A CG2   1 
ATOM   8906  C  CD1   . ILE A 1 1195 ? -28.643 -3.039  -51.626 1.00 127.16 ? 1195 ILE A CD1   1 
ATOM   8907  N  N     . ASN A 1 1196 ? -34.010 -1.558  -51.819 1.00 112.23 ? 1196 ASN A N     1 
ATOM   8908  C  CA    . ASN A 1 1196 ? -35.425 -1.840  -52.147 1.00 97.58  ? 1196 ASN A CA    1 
ATOM   8909  C  C     . ASN A 1 1196 ? -36.240 -1.792  -50.861 1.00 91.78  ? 1196 ASN A C     1 
ATOM   8910  O  O     . ASN A 1 1196 ? -36.218 -2.735  -50.078 1.00 88.02  ? 1196 ASN A O     1 
ATOM   8911  C  CB    . ASN A 1 1196 ? -35.567 -3.215  -52.799 1.00 98.75  ? 1196 ASN A CB    1 
ATOM   8912  C  CG    . ASN A 1 1196 ? -36.923 -3.431  -53.412 1.00 89.37  ? 1196 ASN A CG    1 
ATOM   8913  O  OD1   . ASN A 1 1196 ? -37.946 -3.304  -52.755 1.00 92.07  ? 1196 ASN A OD1   1 
ATOM   8914  N  ND2   . ASN A 1 1196 ? -36.935 -3.771  -54.680 1.00 89.02  ? 1196 ASN A ND2   1 
ATOM   8915  N  N     . PRO A 1 1197 ? -36.952 -0.679  -50.620 1.00 91.56  ? 1197 PRO A N     1 
ATOM   8916  C  CA    . PRO A 1 1197 ? -37.662 -0.542  -49.342 1.00 87.72  ? 1197 PRO A CA    1 
ATOM   8917  C  C     . PRO A 1 1197 ? -38.857 -1.458  -49.157 1.00 86.66  ? 1197 PRO A C     1 
ATOM   8918  O  O     . PRO A 1 1197 ? -39.219 -1.716  -48.017 1.00 93.09  ? 1197 PRO A O     1 
ATOM   8919  C  CB    . PRO A 1 1197 ? -38.125 0.915   -49.334 1.00 84.10  ? 1197 PRO A CB    1 
ATOM   8920  C  CG    . PRO A 1 1197 ? -37.893 1.415   -50.725 1.00 95.99  ? 1197 PRO A CG    1 
ATOM   8921  C  CD    . PRO A 1 1197 ? -36.787 0.606   -51.308 1.00 93.86  ? 1197 PRO A CD    1 
ATOM   8922  N  N     . ALA A 1 1198 ? -39.466 -1.941  -50.234 1.00 86.12  ? 1198 ALA A N     1 
ATOM   8923  C  CA    . ALA A 1 1198 ? -40.520 -2.944  -50.140 1.00 87.42  ? 1198 ALA A CA    1 
ATOM   8924  C  C     . ALA A 1 1198 ? -39.967 -4.211  -49.503 1.00 87.49  ? 1198 ALA A C     1 
ATOM   8925  O  O     . ALA A 1 1198 ? -40.515 -4.718  -48.513 1.00 101.64 ? 1198 ALA A O     1 
ATOM   8926  C  CB    . ALA A 1 1198 ? -41.089 -3.243  -51.520 1.00 86.56  ? 1198 ALA A CB    1 
ATOM   8927  N  N     . ILE A 1 1199 ? -38.869 -4.696  -50.080 1.00 82.90  ? 1199 ILE A N     1 
ATOM   8928  C  CA    . ILE A 1 1199 ? -38.160 -5.888  -49.614 1.00 81.55  ? 1199 ILE A CA    1 
ATOM   8929  C  C     . ILE A 1 1199 ? -37.578 -5.685  -48.209 1.00 87.69  ? 1199 ILE A C     1 
ATOM   8930  O  O     . ILE A 1 1199 ? -37.687 -6.567  -47.356 1.00 86.51  ? 1199 ILE A O     1 
ATOM   8931  C  CB    . ILE A 1 1199 ? -37.052 -6.251  -50.653 1.00 75.91  ? 1199 ILE A CB    1 
ATOM   8932  C  CG1   . ILE A 1 1199 ? -37.713 -6.905  -51.862 1.00 71.78  ? 1199 ILE A CG1   1 
ATOM   8933  C  CG2   . ILE A 1 1199 ? -35.964 -7.166  -50.091 1.00 74.47  ? 1199 ILE A CG2   1 
ATOM   8934  C  CD1   . ILE A 1 1199 ? -36.954 -6.761  -53.151 1.00 74.43  ? 1199 ILE A CD1   1 
ATOM   8935  N  N     . ASP A 1 1200 ? -36.978 -4.525  -47.965 1.00 91.80  ? 1200 ASP A N     1 
ATOM   8936  C  CA    . ASP A 1 1200 ? -36.402 -4.249  -46.654 1.00 96.11  ? 1200 ASP A CA    1 
ATOM   8937  C  C     . ASP A 1 1200 ? -37.466 -4.094  -45.547 1.00 92.69  ? 1200 ASP A C     1 
ATOM   8938  O  O     . ASP A 1 1200 ? -37.310 -4.660  -44.468 1.00 96.98  ? 1200 ASP A O     1 
ATOM   8939  C  CB    . ASP A 1 1200 ? -35.441 -3.053  -46.791 1.00 107.03 ? 1200 ASP A CB    1 
ATOM   8940  C  CG    . ASP A 1 1200 ? -34.147 -3.434  -47.560 1.00 115.16 ? 1200 ASP A CG    1 
ATOM   8941  O  OD1   . ASP A 1 1200 ? -33.512 -4.428  -47.137 1.00 122.68 ? 1200 ASP A OD1   1 
ATOM   8942  O  OD2   . ASP A 1 1200 ? -33.766 -2.779  -48.575 1.00 102.29 ? 1200 ASP A OD2   1 
ATOM   8943  N  N     . ILE A 1 1201 ? -38.574 -3.408  -45.817 1.00 86.47  ? 1201 ILE A N     1 
ATOM   8944  C  CA    . ILE A 1 1201 ? -39.705 -3.373  -44.854 1.00 85.34  ? 1201 ILE A CA    1 
ATOM   8945  C  C     . ILE A 1 1201 ? -40.318 -4.761  -44.645 1.00 87.75  ? 1201 ILE A C     1 
ATOM   8946  O  O     . ILE A 1 1201 ? -40.691 -5.113  -43.528 1.00 88.03  ? 1201 ILE A O     1 
ATOM   8947  C  CB    . ILE A 1 1201 ? -40.815 -2.370  -45.239 1.00 91.46  ? 1201 ILE A CB    1 
ATOM   8948  C  CG1   . ILE A 1 1201 ? -40.314 -0.923  -45.160 1.00 90.19  ? 1201 ILE A CG1   1 
ATOM   8949  C  CG2   . ILE A 1 1201 ? -42.022 -2.534  -44.312 1.00 98.76  ? 1201 ILE A CG2   1 
ATOM   8950  C  CD1   . ILE A 1 1201 ? -41.361 0.121   -45.534 1.00 89.75  ? 1201 ILE A CD1   1 
ATOM   8951  N  N     . GLY A 1 1202 ? -40.406 -5.562  -45.707 1.00 88.50  ? 1202 GLY A N     1 
ATOM   8952  C  CA    . GLY A 1 1202 ? -40.822 -6.967  -45.589 1.00 84.33  ? 1202 GLY A CA    1 
ATOM   8953  C  C     . GLY A 1 1202 ? -39.976 -7.771  -44.615 1.00 89.23  ? 1202 GLY A C     1 
ATOM   8954  O  O     . GLY A 1 1202 ? -40.494 -8.601  -43.868 1.00 86.29  ? 1202 GLY A O     1 
ATOM   8955  N  N     . GLN A 1 1203 ? -38.668 -7.522  -44.622 1.00 95.98  ? 1203 GLN A N     1 
ATOM   8956  C  CA    . GLN A 1 1203 ? -37.724 -8.205  -43.732 1.00 92.94  ? 1203 GLN A CA    1 
ATOM   8957  C  C     . GLN A 1 1203 ? -37.848 -7.765  -42.279 1.00 90.17  ? 1203 GLN A C     1 
ATOM   8958  O  O     . GLN A 1 1203 ? -37.700 -8.579  -41.380 1.00 104.20 ? 1203 GLN A O     1 
ATOM   8959  C  CB    . GLN A 1 1203 ? -36.303 -7.923  -44.197 1.00 96.45  ? 1203 GLN A CB    1 
ATOM   8960  C  CG    . GLN A 1 1203 ? -35.929 -8.623  -45.494 1.00 105.15 ? 1203 GLN A CG    1 
ATOM   8961  C  CD    . GLN A 1 1203 ? -35.367 -10.010 -45.250 1.00 113.81 ? 1203 GLN A CD    1 
ATOM   8962  O  OE1   . GLN A 1 1203 ? -36.120 -10.969 -45.023 1.00 122.54 ? 1203 GLN A OE1   1 
ATOM   8963  N  NE2   . GLN A 1 1203 ? -34.032 -10.124 -45.284 1.00 115.40 ? 1203 GLN A NE2   1 
ATOM   8964  N  N     . ILE A 1 1204 ? -38.118 -6.484  -42.057 1.00 89.65  ? 1204 ILE A N     1 
ATOM   8965  C  CA    . ILE A 1 1204 ? -38.331 -5.953  -40.701 1.00 94.50  ? 1204 ILE A CA    1 
ATOM   8966  C  C     . ILE A 1 1204 ? -39.568 -6.585  -40.038 1.00 94.56  ? 1204 ILE A C     1 
ATOM   8967  O  O     . ILE A 1 1204 ? -39.477 -7.097  -38.924 1.00 81.06  ? 1204 ILE A O     1 
ATOM   8968  C  CB    . ILE A 1 1204 ? -38.384 -4.401  -40.625 1.00 100.12 ? 1204 ILE A CB    1 
ATOM   8969  C  CG1   . ILE A 1 1204 ? -37.120 -3.779  -41.235 1.00 98.29  ? 1204 ILE A CG1   1 
ATOM   8970  C  CG2   . ILE A 1 1204 ? -38.482 -3.949  -39.170 1.00 99.36  ? 1204 ILE A CG2   1 
ATOM   8971  C  CD1   . ILE A 1 1204 ? -37.195 -2.290  -41.459 1.00 91.32  ? 1204 ILE A CD1   1 
ATOM   8972  N  N     . GLU A 1 1205 ? -40.701 -6.565  -40.739 1.00 105.67 ? 1205 GLU A N     1 
ATOM   8973  C  CA    . GLU A 1 1205 ? -41.968 -7.157  -40.260 1.00 99.63  ? 1205 GLU A CA    1 
ATOM   8974  C  C     . GLU A 1 1205 ? -41.842 -8.638  -39.981 1.00 91.20  ? 1205 GLU A C     1 
ATOM   8975  O  O     . GLU A 1 1205 ? -42.251 -9.115  -38.919 1.00 98.18  ? 1205 GLU A O     1 
ATOM   8976  C  CB    . GLU A 1 1205 ? -43.072 -6.984  -41.302 1.00 104.58 ? 1205 GLU A CB    1 
ATOM   8977  C  CG    . GLU A 1 1205 ? -43.511 -5.551  -41.551 1.00 119.65 ? 1205 GLU A CG    1 
ATOM   8978  C  CD    . GLU A 1 1205 ? -44.493 -5.408  -42.715 1.00 138.25 ? 1205 GLU A CD    1 
ATOM   8979  O  OE1   . GLU A 1 1205 ? -44.796 -6.413  -43.401 1.00 151.98 ? 1205 GLU A OE1   1 
ATOM   8980  O  OE2   . GLU A 1 1205 ? -44.969 -4.272  -42.958 1.00 145.03 ? 1205 GLU A OE2   1 
ATOM   8981  N  N     . GLY A 1 1206 ? -41.303 -9.361  -40.960 1.00 77.86  ? 1206 GLY A N     1 
ATOM   8982  C  CA    . GLY A 1 1206 ? -41.056 -10.784 -40.839 1.00 79.72  ? 1206 GLY A CA    1 
ATOM   8983  C  C     . GLY A 1 1206 ? -40.177 -11.153 -39.662 1.00 82.68  ? 1206 GLY A C     1 
ATOM   8984  O  O     . GLY A 1 1206 ? -40.530 -12.016 -38.878 1.00 77.06  ? 1206 GLY A O     1 
ATOM   8985  N  N     . ALA A 1 1207 ? -39.030 -10.506 -39.544 1.00 87.65  ? 1207 ALA A N     1 
ATOM   8986  C  CA    . ALA A 1 1207 ? -38.155 -10.717 -38.391 1.00 87.91  ? 1207 ALA A CA    1 
ATOM   8987  C  C     . ALA A 1 1207 ? -38.858 -10.388 -37.060 1.00 81.75  ? 1207 ALA A C     1 
ATOM   8988  O  O     . ALA A 1 1207 ? -38.743 -11.147 -36.099 1.00 81.12  ? 1207 ALA A O     1 
ATOM   8989  C  CB    . ALA A 1 1207 ? -36.879 -9.876  -38.567 1.00 80.66  ? 1207 ALA A CB    1 
ATOM   8990  N  N     . PHE A 1 1208 ? -39.600 -9.281  -37.023 1.00 74.06  ? 1208 PHE A N     1 
ATOM   8991  C  CA    . PHE A 1 1208 ? -40.303 -8.845  -35.817 1.00 79.79  ? 1208 PHE A CA    1 
ATOM   8992  C  C     . PHE A 1 1208 ? -41.292 -9.896  -35.332 1.00 81.83  ? 1208 PHE A C     1 
ATOM   8993  O  O     . PHE A 1 1208 ? -41.253 -10.276 -34.159 1.00 94.00  ? 1208 PHE A O     1 
ATOM   8994  C  CB    . PHE A 1 1208 ? -41.039 -7.523  -36.022 1.00 85.54  ? 1208 PHE A CB    1 
ATOM   8995  C  CG    . PHE A 1 1208 ? -41.996 -7.217  -34.903 1.00 96.64  ? 1208 PHE A CG    1 
ATOM   8996  C  CD1   . PHE A 1 1208 ? -41.523 -6.826  -33.662 1.00 98.02  ? 1208 PHE A CD1   1 
ATOM   8997  C  CD2   . PHE A 1 1208 ? -43.373 -7.397  -35.065 1.00 106.10 ? 1208 PHE A CD2   1 
ATOM   8998  C  CE1   . PHE A 1 1208 ? -42.409 -6.582  -32.625 1.00 103.99 ? 1208 PHE A CE1   1 
ATOM   8999  C  CE2   . PHE A 1 1208 ? -44.262 -7.163  -34.026 1.00 100.02 ? 1208 PHE A CE2   1 
ATOM   9000  C  CZ    . PHE A 1 1208 ? -43.779 -6.754  -32.806 1.00 100.32 ? 1208 PHE A CZ    1 
ATOM   9001  N  N     . ILE A 1 1209 ? -42.159 -10.367 -36.233 1.00 79.60  ? 1209 ILE A N     1 
ATOM   9002  C  CA    . ILE A 1 1209 ? -43.151 -11.404 -35.905 1.00 85.00  ? 1209 ILE A CA    1 
ATOM   9003  C  C     . ILE A 1 1209 ? -42.481 -12.716 -35.489 1.00 90.41  ? 1209 ILE A C     1 
ATOM   9004  O  O     . ILE A 1 1209 ? -42.966 -13.416 -34.603 1.00 98.53  ? 1209 ILE A O     1 
ATOM   9005  C  CB    . ILE A 1 1209 ? -44.064 -11.693 -37.099 1.00 86.64  ? 1209 ILE A CB    1 
ATOM   9006  C  CG1   . ILE A 1 1209 ? -44.923 -10.468 -37.395 1.00 89.76  ? 1209 ILE A CG1   1 
ATOM   9007  C  CG2   . ILE A 1 1209 ? -44.954 -12.907 -36.829 1.00 88.81  ? 1209 ILE A CG2   1 
ATOM   9008  C  CD1   . ILE A 1 1209 ? -46.080 -10.290 -36.433 1.00 100.47 ? 1209 ILE A CD1   1 
ATOM   9009  N  N     . GLN A 1 1210 ? -41.349 -13.024 -36.107 1.00 93.52  ? 1210 GLN A N     1 
ATOM   9010  C  CA    . GLN A 1 1210 ? -40.592 -14.233 -35.775 1.00 93.90  ? 1210 GLN A CA    1 
ATOM   9011  C  C     . GLN A 1 1210 ? -40.032 -14.131 -34.363 1.00 93.42  ? 1210 GLN A C     1 
ATOM   9012  O  O     . GLN A 1 1210 ? -40.093 -15.083 -33.597 1.00 92.21  ? 1210 GLN A O     1 
ATOM   9013  C  CB    . GLN A 1 1210 ? -39.483 -14.439 -36.801 1.00 91.70  ? 1210 GLN A CB    1 
ATOM   9014  C  CG    . GLN A 1 1210 ? -39.022 -15.871 -36.956 1.00 95.41  ? 1210 GLN A CG    1 
ATOM   9015  C  CD    . GLN A 1 1210 ? -38.358 -16.096 -38.303 1.00 103.19 ? 1210 GLN A CD    1 
ATOM   9016  O  OE1   . GLN A 1 1210 ? -37.700 -15.196 -38.840 1.00 96.34  ? 1210 GLN A OE1   1 
ATOM   9017  N  NE2   . GLN A 1 1210 ? -38.533 -17.298 -38.863 1.00 101.82 ? 1210 GLN A NE2   1 
ATOM   9018  N  N     . GLY A 1 1211 ? -39.496 -12.964 -34.027 1.00 92.41  ? 1211 GLY A N     1 
ATOM   9019  C  CA    . GLY A 1 1211 ? -39.091 -12.666 -32.668 1.00 92.82  ? 1211 GLY A CA    1 
ATOM   9020  C  C     . GLY A 1 1211 ? -40.249 -12.602 -31.697 1.00 87.13  ? 1211 GLY A C     1 
ATOM   9021  O  O     . GLY A 1 1211 ? -40.146 -13.089 -30.577 1.00 80.67  ? 1211 GLY A O     1 
ATOM   9022  N  N     . MET A 1 1212 ? -41.356 -12.008 -32.123 1.00 81.39  ? 1212 MET A N     1 
ATOM   9023  C  CA    . MET A 1 1212 ? -42.549 -11.971 -31.294 1.00 81.79  ? 1212 MET A CA    1 
ATOM   9024  C  C     . MET A 1 1212 ? -42.949 -13.392 -30.884 1.00 79.06  ? 1212 MET A C     1 
ATOM   9025  O  O     . MET A 1 1212 ? -43.191 -13.643 -29.712 1.00 69.90  ? 1212 MET A O     1 
ATOM   9026  C  CB    . MET A 1 1212 ? -43.689 -11.276 -32.028 1.00 89.75  ? 1212 MET A CB    1 
ATOM   9027  C  CG    . MET A 1 1212 ? -44.890 -10.955 -31.157 1.00 93.72  ? 1212 MET A CG    1 
ATOM   9028  S  SD    . MET A 1 1212 ? -46.412 -11.059 -32.110 1.00 102.49 ? 1212 MET A SD    1 
ATOM   9029  C  CE    . MET A 1 1212 ? -46.590 -12.847 -32.283 1.00 97.18  ? 1212 MET A CE    1 
ATOM   9030  N  N     . GLY A 1 1213 ? -42.995 -14.308 -31.849 1.00 82.02  ? 1213 GLY A N     1 
ATOM   9031  C  CA    . GLY A 1 1213 ? -43.269 -15.727 -31.576 1.00 86.01  ? 1213 GLY A CA    1 
ATOM   9032  C  C     . GLY A 1 1213 ? -42.268 -16.411 -30.647 1.00 90.31  ? 1213 GLY A C     1 
ATOM   9033  O  O     . GLY A 1 1213 ? -42.671 -17.127 -29.730 1.00 78.82  ? 1213 GLY A O     1 
ATOM   9034  N  N     . LEU A 1 1214 ? -40.977 -16.194 -30.881 1.00 92.85  ? 1214 LEU A N     1 
ATOM   9035  C  CA    . LEU A 1 1214 ? -39.898 -16.713 -30.017 1.00 94.61  ? 1214 LEU A CA    1 
ATOM   9036  C  C     . LEU A 1 1214 ? -40.114 -16.367 -28.545 1.00 81.58  ? 1214 LEU A C     1 
ATOM   9037  O  O     . LEU A 1 1214 ? -39.864 -17.187 -27.670 1.00 73.88  ? 1214 LEU A O     1 
ATOM   9038  C  CB    . LEU A 1 1214 ? -38.517 -16.181 -30.485 1.00 99.68  ? 1214 LEU A CB    1 
ATOM   9039  C  CG    . LEU A 1 1214 ? -37.293 -16.214 -29.534 1.00 100.85 ? 1214 LEU A CG    1 
ATOM   9040  C  CD1   . LEU A 1 1214 ? -36.780 -17.609 -29.179 1.00 97.13  ? 1214 LEU A CD1   1 
ATOM   9041  C  CD2   . LEU A 1 1214 ? -36.170 -15.393 -30.146 1.00 100.48 ? 1214 LEU A CD2   1 
ATOM   9042  N  N     . TYR A 1 1215 ? -40.550 -15.136 -28.298 1.00 76.07  ? 1215 TYR A N     1 
ATOM   9043  C  CA    . TYR A 1 1215 ? -40.667 -14.613 -26.951 1.00 77.63  ? 1215 TYR A CA    1 
ATOM   9044  C  C     . TYR A 1 1215 ? -42.045 -14.814 -26.322 1.00 82.52  ? 1215 TYR A C     1 
ATOM   9045  O  O     . TYR A 1 1215 ? -42.159 -14.729 -25.105 1.00 72.38  ? 1215 TYR A O     1 
ATOM   9046  C  CB    . TYR A 1 1215 ? -40.345 -13.135 -26.903 1.00 72.35  ? 1215 TYR A CB    1 
ATOM   9047  C  CG    . TYR A 1 1215 ? -38.969 -12.755 -27.354 1.00 66.91  ? 1215 TYR A CG    1 
ATOM   9048  C  CD1   . TYR A 1 1215 ? -37.836 -13.187 -26.676 1.00 63.48  ? 1215 TYR A CD1   1 
ATOM   9049  C  CD2   . TYR A 1 1215 ? -38.810 -11.893 -28.427 1.00 69.72  ? 1215 TYR A CD2   1 
ATOM   9050  C  CE1   . TYR A 1 1215 ? -36.572 -12.793 -27.092 1.00 69.21  ? 1215 TYR A CE1   1 
ATOM   9051  C  CE2   . TYR A 1 1215 ? -37.563 -11.494 -28.862 1.00 74.10  ? 1215 TYR A CE2   1 
ATOM   9052  C  CZ    . TYR A 1 1215 ? -36.438 -11.937 -28.206 1.00 73.61  ? 1215 TYR A CZ    1 
ATOM   9053  O  OH    . TYR A 1 1215 ? -35.214 -11.498 -28.694 1.00 68.48  ? 1215 TYR A OH    1 
ATOM   9054  N  N     . THR A 1 1216 ? -43.084 -15.093 -27.112 1.00 90.04  ? 1216 THR A N     1 
ATOM   9055  C  CA    . THR A 1 1216 ? -44.449 -15.289 -26.570 1.00 94.45  ? 1216 THR A CA    1 
ATOM   9056  C  C     . THR A 1 1216 ? -45.013 -16.712 -26.752 1.00 97.71  ? 1216 THR A C     1 
ATOM   9057  O  O     . THR A 1 1216 ? -45.187 -17.442 -25.774 1.00 110.97 ? 1216 THR A O     1 
ATOM   9058  C  CB    . THR A 1 1216 ? -45.460 -14.338 -27.259 1.00 96.59  ? 1216 THR A CB    1 
ATOM   9059  O  OG1   . THR A 1 1216 ? -45.410 -14.502 -28.682 1.00 85.97  ? 1216 THR A OG1   1 
ATOM   9060  C  CG2   . THR A 1 1216 ? -45.146 -12.927 -26.944 1.00 105.50 ? 1216 THR A CG2   1 
ATOM   9061  N  N     . ILE A 1 1217 ? -45.322 -17.098 -27.978 1.00 84.10  ? 1217 ILE A N     1 
ATOM   9062  C  CA    . ILE A 1 1217 ? -46.126 -18.304 -28.201 1.00 79.91  ? 1217 ILE A CA    1 
ATOM   9063  C  C     . ILE A 1 1217 ? -45.365 -19.568 -28.627 1.00 81.19  ? 1217 ILE A C     1 
ATOM   9064  O  O     . ILE A 1 1217 ? -45.867 -20.667 -28.384 1.00 79.11  ? 1217 ILE A O     1 
ATOM   9065  C  CB    . ILE A 1 1217 ? -47.210 -18.052 -29.240 1.00 79.34  ? 1217 ILE A CB    1 
ATOM   9066  C  CG1   . ILE A 1 1217 ? -46.687 -17.153 -30.348 1.00 87.63  ? 1217 ILE A CG1   1 
ATOM   9067  C  CG2   . ILE A 1 1217 ? -48.391 -17.371 -28.581 1.00 83.51  ? 1217 ILE A CG2   1 
ATOM   9068  C  CD1   . ILE A 1 1217 ? -47.647 -16.981 -31.499 1.00 99.11  ? 1217 ILE A CD1   1 
ATOM   9069  N  N     . GLU A 1 1218 ? -44.163 -19.422 -29.172 1.00 88.37  ? 1218 GLU A N     1 
ATOM   9070  C  CA    . GLU A 1 1218 ? -43.414 -20.581 -29.682 1.00 84.13  ? 1218 GLU A CA    1 
ATOM   9071  C  C     . GLU A 1 1218 ? -42.671 -21.277 -28.541 1.00 83.24  ? 1218 GLU A C     1 
ATOM   9072  O  O     . GLU A 1 1218 ? -41.862 -20.681 -27.843 1.00 77.10  ? 1218 GLU A O     1 
ATOM   9073  C  CB    . GLU A 1 1218 ? -42.415 -20.145 -30.727 1.00 84.02  ? 1218 GLU A CB    1 
ATOM   9074  C  CG    . GLU A 1 1218 ? -43.112 -19.616 -31.945 1.00 82.03  ? 1218 GLU A CG    1 
ATOM   9075  C  CD    . GLU A 1 1218 ? -42.182 -19.250 -33.054 1.00 76.78  ? 1218 GLU A CD    1 
ATOM   9076  O  OE1   . GLU A 1 1218 ? -41.223 -20.009 -33.330 1.00 67.15  ? 1218 GLU A OE1   1 
ATOM   9077  O  OE2   . GLU A 1 1218 ? -42.461 -18.206 -33.670 1.00 79.45  ? 1218 GLU A OE2   1 
ATOM   9078  N  N     . GLU A 1 1219 ? -42.955 -22.564 -28.377 1.00 81.49  ? 1219 GLU A N     1 
ATOM   9079  C  CA    . GLU A 1 1219 ? -42.574 -23.341 -27.188 1.00 81.84  ? 1219 GLU A CA    1 
ATOM   9080  C  C     . GLU A 1 1219 ? -42.375 -24.828 -27.554 1.00 87.73  ? 1219 GLU A C     1 
ATOM   9081  O  O     . GLU A 1 1219 ? -43.254 -25.447 -28.175 1.00 106.94 ? 1219 GLU A O     1 
ATOM   9082  C  CB    . GLU A 1 1219 ? -43.729 -23.164 -26.195 1.00 83.66  ? 1219 GLU A CB    1 
ATOM   9083  C  CG    . GLU A 1 1219 ? -43.877 -24.222 -25.111 1.00 95.04  ? 1219 GLU A CG    1 
ATOM   9084  C  CD    . GLU A 1 1219 ? -44.629 -23.729 -23.868 1.00 98.77  ? 1219 GLU A CD    1 
ATOM   9085  O  OE1   . GLU A 1 1219 ? -45.878 -23.651 -23.891 1.00 100.44 ? 1219 GLU A OE1   1 
ATOM   9086  O  OE2   . GLU A 1 1219 ? -43.963 -23.428 -22.849 1.00 108.67 ? 1219 GLU A OE2   1 
ATOM   9087  N  N     . LEU A 1 1220 ? -41.220 -25.387 -27.167 1.00 86.21  ? 1220 LEU A N     1 
ATOM   9088  C  CA    . LEU A 1 1220 ? -40.872 -26.769 -27.486 1.00 96.24  ? 1220 LEU A CA    1 
ATOM   9089  C  C     . LEU A 1 1220 ? -40.986 -27.623 -26.225 1.00 94.46  ? 1220 LEU A C     1 
ATOM   9090  O  O     . LEU A 1 1220 ? -40.270 -27.372 -25.250 1.00 108.32 ? 1220 LEU A O     1 
ATOM   9091  C  CB    . LEU A 1 1220 ? -39.419 -26.875 -28.004 1.00 106.31 ? 1220 LEU A CB    1 
ATOM   9092  C  CG    . LEU A 1 1220 ? -38.886 -26.237 -29.300 1.00 104.34 ? 1220 LEU A CG    1 
ATOM   9093  C  CD1   . LEU A 1 1220 ? -37.350 -26.333 -29.389 1.00 98.54  ? 1220 LEU A CD1   1 
ATOM   9094  C  CD2   . LEU A 1 1220 ? -39.554 -26.883 -30.506 1.00 103.59 ? 1220 LEU A CD2   1 
ATOM   9095  N  N     . ASN A 1 1221 ? -41.854 -28.627 -26.253 1.00 87.94  ? 1221 ASN A N     1 
ATOM   9096  C  CA    . ASN A 1 1221 ? -42.170 -29.388 -25.053 1.00 98.27  ? 1221 ASN A CA    1 
ATOM   9097  C  C     . ASN A 1 1221 ? -41.488 -30.739 -25.073 1.00 97.14  ? 1221 ASN A C     1 
ATOM   9098  O  O     . ASN A 1 1221 ? -41.873 -31.552 -25.913 1.00 105.49 ? 1221 ASN A O     1 
ATOM   9099  C  CB    . ASN A 1 1221 ? -43.700 -29.632 -24.969 1.00 104.42 ? 1221 ASN A CB    1 
ATOM   9100  C  CG    . ASN A 1 1221 ? -44.528 -28.357 -25.089 1.00 96.63  ? 1221 ASN A CG    1 
ATOM   9101  O  OD1   . ASN A 1 1221 ? -45.556 -28.318 -25.776 1.00 94.01  ? 1221 ASN A OD1   1 
ATOM   9102  N  ND2   . ASN A 1 1221 ? -44.098 -27.320 -24.405 1.00 97.29  ? 1221 ASN A ND2   1 
ATOM   9103  N  N     . TYR A 1 1222 ? -40.516 -30.965 -24.171 1.00 83.43  ? 1222 TYR A N     1 
ATOM   9104  C  CA    . TYR A 1 1222 ? -39.815 -32.230 -24.086 1.00 83.03  ? 1222 TYR A CA    1 
ATOM   9105  C  C     . TYR A 1 1222 ? -40.197 -33.011 -22.827 1.00 85.66  ? 1222 TYR A C     1 
ATOM   9106  O  O     . TYR A 1 1222 ? -40.420 -32.430 -21.787 1.00 99.24  ? 1222 TYR A O     1 
ATOM   9107  C  CB    . TYR A 1 1222 ? -38.311 -32.007 -24.117 1.00 77.13  ? 1222 TYR A CB    1 
ATOM   9108  C  CG    . TYR A 1 1222 ? -37.774 -31.523 -25.441 1.00 83.56  ? 1222 TYR A CG    1 
ATOM   9109  C  CD1   . TYR A 1 1222 ? -37.554 -32.414 -26.496 1.00 84.83  ? 1222 TYR A CD1   1 
ATOM   9110  C  CD2   . TYR A 1 1222 ? -37.452 -30.167 -25.637 1.00 89.14  ? 1222 TYR A CD2   1 
ATOM   9111  C  CE1   . TYR A 1 1222 ? -37.045 -31.968 -27.716 1.00 88.85  ? 1222 TYR A CE1   1 
ATOM   9112  C  CE2   . TYR A 1 1222 ? -36.944 -29.709 -26.851 1.00 87.70  ? 1222 TYR A CE2   1 
ATOM   9113  C  CZ    . TYR A 1 1222 ? -36.743 -30.611 -27.889 1.00 92.80  ? 1222 TYR A CZ    1 
ATOM   9114  O  OH    . TYR A 1 1222 ? -36.245 -30.161 -29.102 1.00 97.77  ? 1222 TYR A OH    1 
ATOM   9115  N  N     . SER A 1 1223 ? -40.265 -34.331 -22.940 1.00 82.68  ? 1223 SER A N     1 
ATOM   9116  C  CA    . SER A 1 1223 ? -40.541 -35.196 -21.794 1.00 86.04  ? 1223 SER A CA    1 
ATOM   9117  C  C     . SER A 1 1223 ? -39.278 -35.359 -20.941 1.00 93.95  ? 1223 SER A C     1 
ATOM   9118  O  O     . SER A 1 1223 ? -38.180 -35.130 -21.446 1.00 99.16  ? 1223 SER A O     1 
ATOM   9119  C  CB    . SER A 1 1223 ? -40.990 -36.562 -22.299 1.00 93.89  ? 1223 SER A CB    1 
ATOM   9120  O  OG    . SER A 1 1223 ? -39.957 -37.207 -23.033 1.00 93.65  ? 1223 SER A OG    1 
ATOM   9121  N  N     . PRO A 1 1224 ? -39.418 -35.772 -19.667 1.00 100.93 ? 1224 PRO A N     1 
ATOM   9122  C  CA    . PRO A 1 1224 ? -38.287 -36.188 -18.820 1.00 97.76  ? 1224 PRO A CA    1 
ATOM   9123  C  C     . PRO A 1 1224 ? -37.380 -37.274 -19.421 1.00 99.87  ? 1224 PRO A C     1 
ATOM   9124  O  O     . PRO A 1 1224 ? -36.258 -37.442 -18.970 1.00 86.01  ? 1224 PRO A O     1 
ATOM   9125  C  CB    . PRO A 1 1224 ? -38.975 -36.740 -17.583 1.00 114.58 ? 1224 PRO A CB    1 
ATOM   9126  C  CG    . PRO A 1 1224 ? -40.303 -36.076 -17.554 1.00 115.62 ? 1224 PRO A CG    1 
ATOM   9127  C  CD    . PRO A 1 1224 ? -40.706 -35.948 -18.980 1.00 112.10 ? 1224 PRO A CD    1 
ATOM   9128  N  N     . GLN A 1 1225 ? -37.894 -38.037 -20.385 1.00 103.22 ? 1225 GLN A N     1 
ATOM   9129  C  CA    . GLN A 1 1225 ? -37.143 -38.960 -21.231 1.00 110.46 ? 1225 GLN A CA    1 
ATOM   9130  C  C     . GLN A 1 1225 ? -36.496 -38.327 -22.499 1.00 104.11 ? 1225 GLN A C     1 
ATOM   9131  O  O     . GLN A 1 1225 ? -35.808 -39.020 -23.244 1.00 107.55 ? 1225 GLN A O     1 
ATOM   9132  C  CB    . GLN A 1 1225 ? -38.127 -40.030 -21.753 1.00 118.48 ? 1225 GLN A CB    1 
ATOM   9133  C  CG    . GLN A 1 1225 ? -38.472 -41.088 -20.751 1.00 121.32 ? 1225 GLN A CG    1 
ATOM   9134  C  CD    . GLN A 1 1225 ? -37.202 -41.718 -20.263 1.00 128.13 ? 1225 GLN A CD    1 
ATOM   9135  O  OE1   . GLN A 1 1225 ? -36.635 -42.574 -20.940 1.00 119.89 ? 1225 GLN A OE1   1 
ATOM   9136  N  NE2   . GLN A 1 1225 ? -36.698 -41.245 -19.119 1.00 133.59 ? 1225 GLN A NE2   1 
ATOM   9137  N  N     . GLY A 1 1226 ? -36.729 -37.037 -22.738 1.00 95.97  ? 1226 GLY A N     1 
ATOM   9138  C  CA    . GLY A 1 1226 ? -36.159 -36.326 -23.878 1.00 91.06  ? 1226 GLY A CA    1 
ATOM   9139  C  C     . GLY A 1 1226 ? -36.921 -36.451 -25.189 1.00 96.75  ? 1226 GLY A C     1 
ATOM   9140  O  O     . GLY A 1 1226 ? -36.393 -36.088 -26.241 1.00 113.18 ? 1226 GLY A O     1 
ATOM   9141  N  N     . ILE A 1 1227 ? -38.161 -36.936 -25.135 1.00 105.42 ? 1227 ILE A N     1 
ATOM   9142  C  CA    . ILE A 1 1227 ? -38.987 -37.090 -26.336 1.00 107.65 ? 1227 ILE A CA    1 
ATOM   9143  C  C     . ILE A 1 1227 ? -39.650 -35.745 -26.569 1.00 100.83 ? 1227 ILE A C     1 
ATOM   9144  O  O     . ILE A 1 1227 ? -40.146 -35.145 -25.636 1.00 113.09 ? 1227 ILE A O     1 
ATOM   9145  C  CB    . ILE A 1 1227 ? -40.096 -38.161 -26.182 1.00 98.44  ? 1227 ILE A CB    1 
ATOM   9146  C  CG1   . ILE A 1 1227 ? -39.471 -39.544 -26.122 1.00 98.21  ? 1227 ILE A CG1   1 
ATOM   9147  C  CG2   . ILE A 1 1227 ? -41.080 -38.111 -27.355 1.00 91.55  ? 1227 ILE A CG2   1 
ATOM   9148  C  CD1   . ILE A 1 1227 ? -38.381 -39.710 -25.085 1.00 101.52 ? 1227 ILE A CD1   1 
ATOM   9149  N  N     . LEU A 1 1228 ? -39.658 -35.280 -27.811 1.00 90.76  ? 1228 LEU A N     1 
ATOM   9150  C  CA    . LEU A 1 1228 ? -40.378 -34.059 -28.169 1.00 96.20  ? 1228 LEU A CA    1 
ATOM   9151  C  C     . LEU A 1 1228 ? -41.870 -34.363 -28.274 1.00 101.54 ? 1228 LEU A C     1 
ATOM   9152  O  O     . LEU A 1 1228 ? -42.258 -35.382 -28.856 1.00 117.14 ? 1228 LEU A O     1 
ATOM   9153  C  CB    . LEU A 1 1228 ? -39.869 -33.489 -29.492 1.00 93.05  ? 1228 LEU A CB    1 
ATOM   9154  C  CG    . LEU A 1 1228 ? -40.503 -32.170 -29.934 1.00 88.27  ? 1228 LEU A CG    1 
ATOM   9155  C  CD1   . LEU A 1 1228 ? -39.987 -31.025 -29.080 1.00 88.40  ? 1228 LEU A CD1   1 
ATOM   9156  C  CD2   . LEU A 1 1228 ? -40.262 -31.898 -31.415 1.00 88.08  ? 1228 LEU A CD2   1 
ATOM   9157  N  N     . HIS A 1 1229 ? -42.696 -33.481 -27.711 1.00 101.93 ? 1229 HIS A N     1 
ATOM   9158  C  CA    . HIS A 1 1229 ? -44.148 -33.636 -27.759 1.00 105.79 ? 1229 HIS A CA    1 
ATOM   9159  C  C     . HIS A 1 1229 ? -44.721 -32.741 -28.838 1.00 101.67 ? 1229 HIS A C     1 
ATOM   9160  O  O     . HIS A 1 1229 ? -44.365 -31.558 -28.939 1.00 89.35  ? 1229 HIS A O     1 
ATOM   9161  C  CB    . HIS A 1 1229 ? -44.756 -33.326 -26.393 1.00 115.01 ? 1229 HIS A CB    1 
ATOM   9162  C  CG    . HIS A 1 1229 ? -44.571 -34.423 -25.394 1.00 113.06 ? 1229 HIS A CG    1 
ATOM   9163  N  ND1   . HIS A 1 1229 ? -44.349 -34.183 -24.055 1.00 111.05 ? 1229 HIS A ND1   1 
ATOM   9164  C  CD2   . HIS A 1 1229 ? -44.569 -35.769 -25.544 1.00 112.84 ? 1229 HIS A CD2   1 
ATOM   9165  C  CE1   . HIS A 1 1229 ? -44.229 -35.337 -23.423 1.00 118.52 ? 1229 HIS A CE1   1 
ATOM   9166  N  NE2   . HIS A 1 1229 ? -44.357 -36.314 -24.304 1.00 118.52 ? 1229 HIS A NE2   1 
ATOM   9167  N  N     . THR A 1 1230 ? -45.610 -33.321 -29.636 1.00 103.88 ? 1230 THR A N     1 
ATOM   9168  C  CA    . THR A 1 1230 ? -45.930 -32.789 -30.949 1.00 118.54 ? 1230 THR A CA    1 
ATOM   9169  C  C     . THR A 1 1230 ? -47.425 -32.998 -31.293 1.00 114.18 ? 1230 THR A C     1 
ATOM   9170  O  O     . THR A 1 1230 ? -47.831 -32.883 -32.451 1.00 129.54 ? 1230 THR A O     1 
ATOM   9171  C  CB    . THR A 1 1230 ? -44.871 -33.381 -31.958 1.00 132.53 ? 1230 THR A CB    1 
ATOM   9172  O  OG1   . THR A 1 1230 ? -44.474 -32.397 -32.942 1.00 130.07 ? 1230 THR A OG1   1 
ATOM   9173  C  CG2   . THR A 1 1230 ? -45.318 -34.743 -32.601 1.00 128.40 ? 1230 THR A CG2   1 
ATOM   9174  N  N     . ARG A 1 1231 ? -48.255 -33.226 -30.267 1.00 105.46 ? 1231 ARG A N     1 
ATOM   9175  C  CA    . ARG A 1 1231 ? -49.624 -33.681 -30.453 1.00 111.16 ? 1231 ARG A CA    1 
ATOM   9176  C  C     . ARG A 1 1231 ? -50.531 -33.099 -29.367 1.00 106.14 ? 1231 ARG A C     1 
ATOM   9177  O  O     . ARG A 1 1231 ? -50.130 -32.956 -28.207 1.00 114.08 ? 1231 ARG A O     1 
ATOM   9178  C  CB    . ARG A 1 1231 ? -49.663 -35.214 -30.434 1.00 121.31 ? 1231 ARG A CB    1 
ATOM   9179  C  CG    . ARG A 1 1231 ? -50.352 -35.865 -31.635 1.00 134.29 ? 1231 ARG A CG    1 
ATOM   9180  C  CD    . ARG A 1 1231 ? -50.317 -37.396 -31.540 1.00 142.22 ? 1231 ARG A CD    1 
ATOM   9181  N  NE    . ARG A 1 1231 ? -49.090 -38.019 -32.069 1.00 147.04 ? 1231 ARG A NE    1 
ATOM   9182  C  CZ    . ARG A 1 1231 ? -48.735 -39.301 -31.892 1.00 145.02 ? 1231 ARG A CZ    1 
ATOM   9183  N  NH1   . ARG A 1 1231 ? -49.491 -40.142 -31.186 1.00 149.16 ? 1231 ARG A NH1   1 
ATOM   9184  N  NH2   . ARG A 1 1231 ? -47.605 -39.758 -32.424 1.00 132.27 ? 1231 ARG A NH2   1 
ATOM   9185  N  N     . GLY A 1 1232 ? -51.757 -32.746 -29.758 1.00 107.47 ? 1232 GLY A N     1 
ATOM   9186  C  CA    . GLY A 1 1232 ? -52.714 -32.098 -28.848 1.00 102.64 ? 1232 GLY A CA    1 
ATOM   9187  C  C     . GLY A 1 1232 ? -52.317 -30.649 -28.586 1.00 100.08 ? 1232 GLY A C     1 
ATOM   9188  O  O     . GLY A 1 1232 ? -51.885 -29.954 -29.496 1.00 110.36 ? 1232 GLY A O     1 
ATOM   9189  N  N     . PRO A 1 1233 ? -52.481 -30.166 -27.350 1.00 104.00 ? 1233 PRO A N     1 
ATOM   9190  C  CA    . PRO A 1 1233 ? -51.953 -28.848 -26.971 1.00 112.49 ? 1233 PRO A CA    1 
ATOM   9191  C  C     . PRO A 1 1233 ? -50.415 -28.714 -26.929 1.00 117.83 ? 1233 PRO A C     1 
ATOM   9192  O  O     . PRO A 1 1233 ? -49.921 -27.580 -26.845 1.00 125.11 ? 1233 PRO A O     1 
ATOM   9193  C  CB    . PRO A 1 1233 ? -52.533 -28.616 -25.572 1.00 115.28 ? 1233 PRO A CB    1 
ATOM   9194  C  CG    . PRO A 1 1233 ? -53.589 -29.655 -25.368 1.00 118.85 ? 1233 PRO A CG    1 
ATOM   9195  C  CD    . PRO A 1 1233 ? -53.706 -30.489 -26.607 1.00 111.70 ? 1233 PRO A CD    1 
ATOM   9196  N  N     . ASP A 1 1234 ? -49.673 -29.831 -26.977 1.00 113.06 ? 1234 ASP A N     1 
ATOM   9197  C  CA    . ASP A 1 1234 ? -48.212 -29.784 -27.108 1.00 104.35 ? 1234 ASP A CA    1 
ATOM   9198  C  C     . ASP A 1 1234 ? -47.750 -29.322 -28.523 1.00 101.39 ? 1234 ASP A C     1 
ATOM   9199  O  O     . ASP A 1 1234 ? -46.563 -29.027 -28.719 1.00 101.25 ? 1234 ASP A O     1 
ATOM   9200  C  CB    . ASP A 1 1234 ? -47.581 -31.164 -26.822 1.00 100.59 ? 1234 ASP A CB    1 
ATOM   9201  C  CG    . ASP A 1 1234 ? -47.826 -31.666 -25.405 1.00 104.75 ? 1234 ASP A CG    1 
ATOM   9202  O  OD1   . ASP A 1 1234 ? -47.623 -30.883 -24.455 1.00 125.65 ? 1234 ASP A OD1   1 
ATOM   9203  O  OD2   . ASP A 1 1234 ? -48.177 -32.862 -25.236 1.00 97.09  ? 1234 ASP A OD2   1 
ATOM   9204  N  N     . GLN A 1 1235 ? -48.670 -29.292 -29.498 1.00 86.98  ? 1235 GLN A N     1 
ATOM   9205  C  CA    . GLN A 1 1235 ? -48.382 -28.750 -30.820 1.00 90.72  ? 1235 GLN A CA    1 
ATOM   9206  C  C     . GLN A 1 1235 ? -47.671 -27.411 -30.799 1.00 86.88  ? 1235 GLN A C     1 
ATOM   9207  O  O     . GLN A 1 1235 ? -48.031 -26.531 -30.033 1.00 100.47 ? 1235 GLN A O     1 
ATOM   9208  C  CB    . GLN A 1 1235 ? -49.679 -28.500 -31.558 1.00 106.19 ? 1235 GLN A CB    1 
ATOM   9209  C  CG    . GLN A 1 1235 ? -50.360 -29.704 -32.171 1.00 107.97 ? 1235 GLN A CG    1 
ATOM   9210  C  CD    . GLN A 1 1235 ? -51.705 -29.305 -32.754 1.00 120.00 ? 1235 GLN A CD    1 
ATOM   9211  O  OE1   . GLN A 1 1235 ? -52.282 -28.263 -32.390 1.00 118.93 ? 1235 GLN A OE1   1 
ATOM   9212  N  NE2   . GLN A 1 1235 ? -52.210 -30.118 -33.669 1.00 133.17 ? 1235 GLN A NE2   1 
ATOM   9213  N  N     . TYR A 1 1236 ? -46.680 -27.265 -31.675 1.00 86.06  ? 1236 TYR A N     1 
ATOM   9214  C  CA    . TYR A 1 1236 ? -45.888 -26.057 -31.806 1.00 85.70  ? 1236 TYR A CA    1 
ATOM   9215  C  C     . TYR A 1 1236 ? -46.654 -25.092 -32.695 1.00 90.91  ? 1236 TYR A C     1 
ATOM   9216  O  O     . TYR A 1 1236 ? -47.123 -25.453 -33.774 1.00 107.08 ? 1236 TYR A O     1 
ATOM   9217  C  CB    . TYR A 1 1236 ? -44.524 -26.405 -32.395 1.00 84.58  ? 1236 TYR A CB    1 
ATOM   9218  C  CG    . TYR A 1 1236 ? -43.548 -25.248 -32.490 1.00 86.60  ? 1236 TYR A CG    1 
ATOM   9219  C  CD1   . TYR A 1 1236 ? -43.651 -24.290 -33.514 1.00 84.59  ? 1236 TYR A CD1   1 
ATOM   9220  C  CD2   . TYR A 1 1236 ? -42.507 -25.116 -31.573 1.00 81.18  ? 1236 TYR A CD2   1 
ATOM   9221  C  CE1   . TYR A 1 1236 ? -42.752 -23.244 -33.601 1.00 80.08  ? 1236 TYR A CE1   1 
ATOM   9222  C  CE2   . TYR A 1 1236 ? -41.603 -24.075 -31.668 1.00 78.59  ? 1236 TYR A CE2   1 
ATOM   9223  C  CZ    . TYR A 1 1236 ? -41.735 -23.147 -32.676 1.00 76.60  ? 1236 TYR A CZ    1 
ATOM   9224  O  OH    . TYR A 1 1236 ? -40.843 -22.120 -32.764 1.00 76.56  ? 1236 TYR A OH    1 
ATOM   9225  N  N     . LYS A 1 1237 ? -46.760 -23.849 -32.229 1.00 93.14  ? 1237 LYS A N     1 
ATOM   9226  C  CA    . LYS A 1 1237 ? -47.523 -22.823 -32.905 1.00 95.42  ? 1237 LYS A CA    1 
ATOM   9227  C  C     . LYS A 1 1237 ? -46.633 -21.644 -33.231 1.00 90.31  ? 1237 LYS A C     1 
ATOM   9228  O  O     . LYS A 1 1237 ? -46.051 -21.027 -32.340 1.00 95.65  ? 1237 LYS A O     1 
ATOM   9229  C  CB    . LYS A 1 1237 ? -48.699 -22.391 -32.044 1.00 100.80 ? 1237 LYS A CB    1 
ATOM   9230  C  CG    . LYS A 1 1237 ? -49.606 -23.544 -31.638 1.00 105.11 ? 1237 LYS A CG    1 
ATOM   9231  C  CD    . LYS A 1 1237 ? -50.483 -24.011 -32.793 1.00 107.92 ? 1237 LYS A CD    1 
ATOM   9232  C  CE    . LYS A 1 1237 ? -51.359 -25.181 -32.376 1.00 107.37 ? 1237 LYS A CE    1 
ATOM   9233  N  NZ    . LYS A 1 1237 ? -52.179 -25.678 -33.506 1.00 109.10 ? 1237 LYS A NZ    1 
ATOM   9234  N  N     . ILE A 1 1238 ? -46.503 -21.361 -34.517 1.00 85.70  ? 1238 ILE A N     1 
ATOM   9235  C  CA    . ILE A 1 1238 ? -45.878 -20.103 -34.981 1.00 87.68  ? 1238 ILE A CA    1 
ATOM   9236  C  C     . ILE A 1 1238 ? -46.945 -19.014 -35.035 1.00 80.55  ? 1238 ILE A C     1 
ATOM   9237  O  O     . ILE A 1 1238 ? -48.119 -19.335 -35.033 1.00 82.40  ? 1238 ILE A O     1 
ATOM   9238  C  CB    . ILE A 1 1238 ? -45.208 -20.251 -36.370 1.00 96.70  ? 1238 ILE A CB    1 
ATOM   9239  C  CG1   . ILE A 1 1238 ? -46.240 -20.487 -37.480 1.00 98.62  ? 1238 ILE A CG1   1 
ATOM   9240  C  CG2   . ILE A 1 1238 ? -44.176 -21.368 -36.346 1.00 100.64 ? 1238 ILE A CG2   1 
ATOM   9241  C  CD1   . ILE A 1 1238 ? -45.635 -20.467 -38.867 1.00 103.14 ? 1238 ILE A CD1   1 
ATOM   9242  N  N     . PRO A 1 1239 ? -46.549 -17.734 -35.078 1.00 83.22  ? 1239 PRO A N     1 
ATOM   9243  C  CA    . PRO A 1 1239 ? -47.559 -16.655 -35.104 1.00 87.04  ? 1239 PRO A CA    1 
ATOM   9244  C  C     . PRO A 1 1239 ? -48.499 -16.731 -36.326 1.00 95.01  ? 1239 PRO A C     1 
ATOM   9245  O  O     . PRO A 1 1239 ? -48.046 -16.971 -37.463 1.00 108.26 ? 1239 PRO A O     1 
ATOM   9246  C  CB    . PRO A 1 1239 ? -46.724 -15.350 -35.151 1.00 84.88  ? 1239 PRO A CB    1 
ATOM   9247  C  CG    . PRO A 1 1239 ? -45.303 -15.775 -35.086 1.00 95.23  ? 1239 PRO A CG    1 
ATOM   9248  C  CD    . PRO A 1 1239 ? -45.242 -17.217 -35.509 1.00 92.41  ? 1239 PRO A CD    1 
ATOM   9249  N  N     . ALA A 1 1240 ? -49.794 -16.557 -36.074 1.00 91.90  ? 1240 ALA A N     1 
ATOM   9250  C  CA    . ALA A 1 1240 ? -50.808 -16.496 -37.119 1.00 94.39  ? 1240 ALA A CA    1 
ATOM   9251  C  C     . ALA A 1 1240 ? -51.308 -15.048 -37.302 1.00 96.69  ? 1240 ALA A C     1 
ATOM   9252  O  O     . ALA A 1 1240 ? -50.772 -14.141 -36.668 1.00 96.46  ? 1240 ALA A O     1 
ATOM   9253  C  CB    . ALA A 1 1240 ? -51.943 -17.419 -36.727 1.00 101.25 ? 1240 ALA A CB    1 
ATOM   9254  N  N     . ILE A 1 1241 ? -52.306 -14.833 -38.161 1.00 96.24  ? 1241 ILE A N     1 
ATOM   9255  C  CA    . ILE A 1 1241 ? -52.885 -13.498 -38.373 1.00 91.20  ? 1241 ILE A CA    1 
ATOM   9256  C  C     . ILE A 1 1241 ? -53.452 -12.900 -37.081 1.00 98.31  ? 1241 ILE A C     1 
ATOM   9257  O  O     . ILE A 1 1241 ? -53.308 -11.702 -36.822 1.00 119.82 ? 1241 ILE A O     1 
ATOM   9258  C  CB    . ILE A 1 1241 ? -54.014 -13.526 -39.430 1.00 91.47  ? 1241 ILE A CB    1 
ATOM   9259  C  CG1   . ILE A 1 1241 ? -53.495 -14.119 -40.742 1.00 102.70 ? 1241 ILE A CG1   1 
ATOM   9260  C  CG2   . ILE A 1 1241 ? -54.576 -12.131 -39.669 1.00 89.43  ? 1241 ILE A CG2   1 
ATOM   9261  C  CD1   . ILE A 1 1241 ? -54.104 -13.549 -42.019 1.00 105.57 ? 1241 ILE A CD1   1 
ATOM   9262  N  N     . CYS A 1 1242 ? -54.079 -13.750 -36.269 1.00 99.35  ? 1242 CYS A N     1 
ATOM   9263  C  CA    . CYS A 1 1242 ? -54.693 -13.321 -35.006 1.00 106.28 ? 1242 CYS A CA    1 
ATOM   9264  C  C     . CYS A 1 1242 ? -53.697 -12.828 -33.956 1.00 109.05 ? 1242 CYS A C     1 
ATOM   9265  O  O     . CYS A 1 1242 ? -54.117 -12.206 -32.990 1.00 128.63 ? 1242 CYS A O     1 
ATOM   9266  C  CB    . CYS A 1 1242 ? -55.531 -14.448 -34.408 1.00 112.58 ? 1242 CYS A CB    1 
ATOM   9267  S  SG    . CYS A 1 1242 ? -54.739 -16.072 -34.427 1.00 108.01 ? 1242 CYS A SG    1 
ATOM   9268  N  N     . ASP A 1 1243 ? -52.408 -13.119 -34.135 1.00 105.61 ? 1243 ASP A N     1 
ATOM   9269  C  CA    . ASP A 1 1243 ? -51.336 -12.664 -33.244 1.00 105.58 ? 1243 ASP A CA    1 
ATOM   9270  C  C     . ASP A 1 1243 ? -50.646 -11.362 -33.700 1.00 105.68 ? 1243 ASP A C     1 
ATOM   9271  O  O     . ASP A 1 1243 ? -49.826 -10.797 -32.971 1.00 113.70 ? 1243 ASP A O     1 
ATOM   9272  C  CB    . ASP A 1 1243 ? -50.298 -13.781 -33.070 1.00 107.78 ? 1243 ASP A CB    1 
ATOM   9273  C  CG    . ASP A 1 1243 ? -50.934 -15.143 -32.797 1.00 112.42 ? 1243 ASP A CG    1 
ATOM   9274  O  OD1   . ASP A 1 1243 ? -52.020 -15.195 -32.178 1.00 116.27 ? 1243 ASP A OD1   1 
ATOM   9275  O  OD2   . ASP A 1 1243 ? -50.353 -16.169 -33.217 1.00 120.63 ? 1243 ASP A OD2   1 
ATOM   9276  N  N     . MET A 1 1244 ? -50.997 -10.878 -34.888 1.00 99.57  ? 1244 MET A N     1 
ATOM   9277  C  CA    . MET A 1 1244 ? -50.309 -9.755  -35.502 1.00 93.43  ? 1244 MET A CA    1 
ATOM   9278  C  C     . MET A 1 1244 ? -50.917 -8.455  -34.910 1.00 99.47  ? 1244 MET A C     1 
ATOM   9279  O  O     . MET A 1 1244 ? -52.149 -8.310  -34.856 1.00 118.70 ? 1244 MET A O     1 
ATOM   9280  C  CB    . MET A 1 1244 ? -50.506 -9.861  -37.002 1.00 96.70  ? 1244 MET A CB    1 
ATOM   9281  C  CG    . MET A 1 1244 ? -49.635 -8.967  -37.861 1.00 113.99 ? 1244 MET A CG    1 
ATOM   9282  S  SD    . MET A 1 1244 ? -50.442 -7.566  -38.707 1.00 138.50 ? 1244 MET A SD    1 
ATOM   9283  C  CE    . MET A 1 1244 ? -51.699 -8.388  -39.688 1.00 129.55 ? 1244 MET A CE    1 
ATOM   9284  N  N     . PRO A 1 1245 ? -50.067 -7.518  -34.448 1.00 90.62  ? 1245 PRO A N     1 
ATOM   9285  C  CA    . PRO A 1 1245 ? -50.610 -6.424  -33.642 1.00 89.50  ? 1245 PRO A CA    1 
ATOM   9286  C  C     . PRO A 1 1245 ? -51.638 -5.554  -34.399 1.00 95.63  ? 1245 PRO A C     1 
ATOM   9287  O  O     . PRO A 1 1245 ? -51.401 -5.188  -35.565 1.00 99.79  ? 1245 PRO A O     1 
ATOM   9288  C  CB    . PRO A 1 1245 ? -49.363 -5.621  -33.279 1.00 89.40  ? 1245 PRO A CB    1 
ATOM   9289  C  CG    . PRO A 1 1245 ? -48.414 -5.891  -34.409 1.00 88.20  ? 1245 PRO A CG    1 
ATOM   9290  C  CD    . PRO A 1 1245 ? -48.637 -7.332  -34.739 1.00 88.72  ? 1245 PRO A CD    1 
ATOM   9291  N  N     . THR A 1 1246 ? -52.754 -5.248  -33.735 1.00 89.55  ? 1246 THR A N     1 
ATOM   9292  C  CA    . THR A 1 1246 ? -53.865 -4.501  -34.321 1.00 92.69  ? 1246 THR A CA    1 
ATOM   9293  C  C     . THR A 1 1246 ? -53.384 -3.287  -35.109 1.00 97.04  ? 1246 THR A C     1 
ATOM   9294  O  O     . THR A 1 1246 ? -53.822 -3.055  -36.223 1.00 94.94  ? 1246 THR A O     1 
ATOM   9295  C  CB    . THR A 1 1246 ? -54.825 -4.076  -33.206 1.00 98.91  ? 1246 THR A CB    1 
ATOM   9296  O  OG1   . THR A 1 1246 ? -55.245 -5.255  -32.506 1.00 94.33  ? 1246 THR A OG1   1 
ATOM   9297  C  CG2   . THR A 1 1246 ? -56.043 -3.297  -33.765 1.00 104.13 ? 1246 THR A CG2   1 
ATOM   9298  N  N     . GLU A 1 1247 ? -52.470 -2.525  -34.522 1.00 105.54 ? 1247 GLU A N     1 
ATOM   9299  C  CA    . GLU A 1 1247 ? -51.845 -1.385  -35.190 1.00 108.53 ? 1247 GLU A CA    1 
ATOM   9300  C  C     . GLU A 1 1247 ? -50.356 -1.659  -35.387 1.00 102.40 ? 1247 GLU A C     1 
ATOM   9301  O  O     . GLU A 1 1247 ? -49.724 -2.313  -34.569 1.00 111.29 ? 1247 GLU A O     1 
ATOM   9302  C  CB    . GLU A 1 1247 ? -52.059 -0.113  -34.382 1.00 116.17 ? 1247 GLU A CB    1 
ATOM   9303  C  CG    . GLU A 1 1247 ? -53.279 0.696   -34.804 1.00 120.24 ? 1247 GLU A CG    1 
ATOM   9304  C  CD    . GLU A 1 1247 ? -52.970 2.184   -34.893 1.00 126.61 ? 1247 GLU A CD    1 
ATOM   9305  O  OE1   . GLU A 1 1247 ? -52.928 2.866   -33.832 1.00 123.65 ? 1247 GLU A OE1   1 
ATOM   9306  O  OE2   . GLU A 1 1247 ? -52.745 2.667   -36.031 1.00 123.52 ? 1247 GLU A OE2   1 
ATOM   9307  N  N     . LEU A 1 1248 ? -49.799 -1.158  -36.476 1.00 88.54  ? 1248 LEU A N     1 
ATOM   9308  C  CA    . LEU A 1 1248 ? -48.408 -1.409  -36.789 1.00 95.43  ? 1248 LEU A CA    1 
ATOM   9309  C  C     . LEU A 1 1248 ? -47.826 -0.254  -37.610 1.00 91.04  ? 1248 LEU A C     1 
ATOM   9310  O  O     . LEU A 1 1248 ? -48.203 -0.064  -38.755 1.00 90.17  ? 1248 LEU A O     1 
ATOM   9311  C  CB    . LEU A 1 1248 ? -48.263 -2.751  -37.510 1.00 109.01 ? 1248 LEU A CB    1 
ATOM   9312  C  CG    . LEU A 1 1248 ? -46.851 -3.168  -37.951 1.00 122.15 ? 1248 LEU A CG    1 
ATOM   9313  C  CD1   . LEU A 1 1248 ? -45.859 -3.094  -36.800 1.00 129.04 ? 1248 LEU A CD1   1 
ATOM   9314  C  CD2   . LEU A 1 1248 ? -46.877 -4.576  -38.528 1.00 129.89 ? 1248 LEU A CD2   1 
ATOM   9315  N  N     . HIS A 1 1249 ? -46.903 0.499   -37.016 1.00 91.62  ? 1249 HIS A N     1 
ATOM   9316  C  CA    . HIS A 1 1249 ? -46.286 1.633   -37.689 1.00 97.08  ? 1249 HIS A CA    1 
ATOM   9317  C  C     . HIS A 1 1249 ? -44.797 1.383   -37.880 1.00 97.64  ? 1249 HIS A C     1 
ATOM   9318  O  O     . HIS A 1 1249 ? -44.129 0.937   -36.946 1.00 77.91  ? 1249 HIS A O     1 
ATOM   9319  C  CB    . HIS A 1 1249 ? -46.550 2.888   -36.899 1.00 108.43 ? 1249 HIS A CB    1 
ATOM   9320  C  CG    . HIS A 1 1249 ? -47.996 3.102   -36.596 1.00 114.34 ? 1249 HIS A CG    1 
ATOM   9321  N  ND1   . HIS A 1 1249 ? -48.790 3.958   -37.324 1.00 120.10 ? 1249 HIS A ND1   1 
ATOM   9322  C  CD2   . HIS A 1 1249 ? -48.791 2.572   -35.639 1.00 115.11 ? 1249 HIS A CD2   1 
ATOM   9323  C  CE1   . HIS A 1 1249 ? -50.010 3.959   -36.817 1.00 118.40 ? 1249 HIS A CE1   1 
ATOM   9324  N  NE2   . HIS A 1 1249 ? -50.037 3.126   -35.795 1.00 109.38 ? 1249 HIS A NE2   1 
ATOM   9325  N  N     . ILE A 1 1250 ? -44.292 1.669   -39.080 1.00 104.44 ? 1250 ILE A N     1 
ATOM   9326  C  CA    . ILE A 1 1250 ? -42.879 1.440   -39.403 1.00 101.22 ? 1250 ILE A CA    1 
ATOM   9327  C  C     . ILE A 1 1250 ? -42.268 2.616   -40.147 1.00 100.12 ? 1250 ILE A C     1 
ATOM   9328  O  O     . ILE A 1 1250 ? -42.692 2.934   -41.249 1.00 95.94  ? 1250 ILE A O     1 
ATOM   9329  C  CB    . ILE A 1 1250 ? -42.690 0.109   -40.142 1.00 97.68  ? 1250 ILE A CB    1 
ATOM   9330  C  CG1   . ILE A 1 1250 ? -42.502 -1.003  -39.104 1.00 93.98  ? 1250 ILE A CG1   1 
ATOM   9331  C  CG2   . ILE A 1 1250 ? -41.482 0.176   -41.063 1.00 102.72 ? 1250 ILE A CG2   1 
ATOM   9332  C  CD1   . ILE A 1 1250 ? -42.749 -2.393  -39.624 1.00 93.79  ? 1250 ILE A CD1   1 
ATOM   9333  N  N     . ALA A 1 1251 ? -41.242 3.206   -39.535 1.00 103.84 ? 1251 ALA A N     1 
ATOM   9334  C  CA    . ALA A 1 1251 ? -40.514 4.332   -40.107 1.00 107.04 ? 1251 ALA A CA    1 
ATOM   9335  C  C     . ALA A 1 1251 ? -39.088 3.927   -40.455 1.00 108.53 ? 1251 ALA A C     1 
ATOM   9336  O  O     . ALA A 1 1251 ? -38.434 3.201   -39.689 1.00 107.38 ? 1251 ALA A O     1 
ATOM   9337  C  CB    . ALA A 1 1251 ? -40.508 5.502   -39.150 1.00 117.45 ? 1251 ALA A CB    1 
ATOM   9338  N  N     . LEU A 1 1252 ? -38.622 4.386   -41.617 1.00 103.46 ? 1252 LEU A N     1 
ATOM   9339  C  CA    . LEU A 1 1252 ? -37.202 4.296   -41.994 1.00 105.56 ? 1252 LEU A CA    1 
ATOM   9340  C  C     . LEU A 1 1252 ? -36.562 5.666   -41.832 1.00 103.11 ? 1252 LEU A C     1 
ATOM   9341  O  O     . LEU A 1 1252 ? -36.830 6.579   -42.604 1.00 111.86 ? 1252 LEU A O     1 
ATOM   9342  C  CB    . LEU A 1 1252 ? -37.032 3.773   -43.418 1.00 114.71 ? 1252 LEU A CB    1 
ATOM   9343  C  CG    . LEU A 1 1252 ? -37.575 2.358   -43.681 1.00 115.39 ? 1252 LEU A CG    1 
ATOM   9344  C  CD1   . LEU A 1 1252 ? -37.204 1.923   -45.087 1.00 119.67 ? 1252 LEU A CD1   1 
ATOM   9345  C  CD2   . LEU A 1 1252 ? -37.092 1.329   -42.669 1.00 108.44 ? 1252 LEU A CD2   1 
ATOM   9346  N  N     . LEU A 1 1253 ? -35.686 5.786   -40.825 1.00 108.52 ? 1253 LEU A N     1 
ATOM   9347  C  CA    . LEU A 1 1253 ? -34.952 7.022   -40.538 1.00 109.78 ? 1253 LEU A CA    1 
ATOM   9348  C  C     . LEU A 1 1253 ? -34.248 7.495   -41.842 1.00 113.14 ? 1253 LEU A C     1 
ATOM   9349  O  O     . LEU A 1 1253 ? -33.716 6.662   -42.603 1.00 114.13 ? 1253 LEU A O     1 
ATOM   9350  C  CB    . LEU A 1 1253 ? -33.981 6.702   -39.412 1.00 119.05 ? 1253 LEU A CB    1 
ATOM   9351  C  CG    . LEU A 1 1253 ? -32.962 7.704   -38.895 1.00 133.57 ? 1253 LEU A CG    1 
ATOM   9352  C  CD1   . LEU A 1 1253 ? -32.669 7.415   -37.420 1.00 130.15 ? 1253 LEU A CD1   1 
ATOM   9353  C  CD2   . LEU A 1 1253 ? -31.686 7.662   -39.735 1.00 138.87 ? 1253 LEU A CD2   1 
ATOM   9354  N  N     . PRO A 1 1254 ? -34.294 8.814   -42.141 1.00 110.38 ? 1254 PRO A N     1 
ATOM   9355  C  CA    . PRO A 1 1254 ? -33.642 9.271   -43.375 1.00 113.74 ? 1254 PRO A CA    1 
ATOM   9356  C  C     . PRO A 1 1254 ? -32.108 9.007   -43.421 1.00 120.98 ? 1254 PRO A C     1 
ATOM   9357  O  O     . PRO A 1 1254 ? -31.408 9.167   -42.424 1.00 112.85 ? 1254 PRO A O     1 
ATOM   9358  C  CB    . PRO A 1 1254 ? -34.005 10.737  -43.409 1.00 115.16 ? 1254 PRO A CB    1 
ATOM   9359  C  CG    . PRO A 1 1254 ? -35.408 10.715  -42.886 1.00 110.21 ? 1254 PRO A CG    1 
ATOM   9360  C  CD    . PRO A 1 1254 ? -35.402 9.704   -41.772 1.00 106.56 ? 1254 PRO A CD    1 
ATOM   9361  N  N     . PRO A 1 1255 ? -31.590 8.639   -44.601 1.00 126.25 ? 1255 PRO A N     1 
ATOM   9362  C  CA    . PRO A 1 1255 ? -30.230 8.129   -44.840 1.00 130.46 ? 1255 PRO A CA    1 
ATOM   9363  C  C     . PRO A 1 1255 ? -29.085 9.047   -44.445 1.00 140.51 ? 1255 PRO A C     1 
ATOM   9364  O  O     . PRO A 1 1255 ? -29.329 10.228  -44.273 1.00 158.45 ? 1255 PRO A O     1 
ATOM   9365  C  CB    . PRO A 1 1255 ? -30.188 8.001   -46.370 1.00 131.19 ? 1255 PRO A CB    1 
ATOM   9366  C  CG    . PRO A 1 1255 ? -31.175 9.010   -46.884 1.00 117.51 ? 1255 PRO A CG    1 
ATOM   9367  C  CD    . PRO A 1 1255 ? -32.264 9.041   -45.859 1.00 116.21 ? 1255 PRO A CD    1 
ATOM   9368  N  N     . SER A 1 1256 ? -27.854 8.525   -44.352 1.00 153.39 ? 1256 SER A N     1 
ATOM   9369  C  CA    . SER A 1 1256 ? -26.654 9.387   -44.140 1.00 167.59 ? 1256 SER A CA    1 
ATOM   9370  C  C     . SER A 1 1256 ? -25.275 8.793   -44.549 1.00 176.68 ? 1256 SER A C     1 
ATOM   9371  O  O     . SER A 1 1256 ? -24.267 9.002   -43.861 1.00 199.42 ? 1256 SER A O     1 
ATOM   9372  C  CB    . SER A 1 1256 ? -26.636 9.978   -42.701 1.00 156.76 ? 1256 SER A CB    1 
ATOM   9373  O  OG    . SER A 1 1256 ? -27.369 9.191   -41.774 1.00 153.02 ? 1256 SER A OG    1 
ATOM   9374  N  N     . GLN A 1 1257 ? -25.232 8.080   -45.680 1.00 160.43 ? 1257 GLN A N     1 
ATOM   9375  C  CA    . GLN A 1 1257 ? -23.971 7.746   -46.402 1.00 150.85 ? 1257 GLN A CA    1 
ATOM   9376  C  C     . GLN A 1 1257 ? -22.981 6.790   -45.709 1.00 149.66 ? 1257 GLN A C     1 
ATOM   9377  O  O     . GLN A 1 1257 ? -22.420 7.100   -44.654 1.00 139.94 ? 1257 GLN A O     1 
ATOM   9378  C  CB    . GLN A 1 1257 ? -23.202 9.012   -46.843 1.00 142.95 ? 1257 GLN A CB    1 
ATOM   9379  C  CG    . GLN A 1 1257 ? -24.000 10.017  -47.668 1.00 141.67 ? 1257 GLN A CG    1 
ATOM   9380  C  CD    . GLN A 1 1257 ? -24.969 9.367   -48.649 1.00 131.91 ? 1257 GLN A CD    1 
ATOM   9381  O  OE1   . GLN A 1 1257 ? -24.678 9.245   -49.840 1.00 120.96 ? 1257 GLN A OE1   1 
ATOM   9382  N  NE2   . GLN A 1 1257 ? -26.129 8.945   -48.148 1.00 118.25 ? 1257 GLN A NE2   1 
ATOM   9383  N  N     . ASN A 1 1258 ? -22.718 5.661   -46.383 1.00 152.62 ? 1258 ASN A N     1 
ATOM   9384  C  CA    . ASN A 1 1258 ? -21.808 4.613   -45.933 1.00 147.16 ? 1258 ASN A CA    1 
ATOM   9385  C  C     . ASN A 1 1258 ? -20.986 4.185   -47.157 1.00 154.69 ? 1258 ASN A C     1 
ATOM   9386  O  O     . ASN A 1 1258 ? -21.284 3.154   -47.767 1.00 154.78 ? 1258 ASN A O     1 
ATOM   9387  C  CB    . ASN A 1 1258 ? -22.585 3.380   -45.391 1.00 146.91 ? 1258 ASN A CB    1 
ATOM   9388  C  CG    . ASN A 1 1258 ? -23.510 3.691   -44.202 1.00 147.73 ? 1258 ASN A CG    1 
ATOM   9389  O  OD1   . ASN A 1 1258 ? -23.174 3.395   -43.057 1.00 148.66 ? 1258 ASN A OD1   1 
ATOM   9390  N  ND2   . ASN A 1 1258 ? -24.701 4.227   -44.481 1.00 143.40 ? 1258 ASN A ND2   1 
ATOM   9391  N  N     . SER A 1 1259 ? -19.991 4.999   -47.529 1.00 164.57 ? 1259 SER A N     1 
ATOM   9392  C  CA    . SER A 1 1259 ? -19.144 4.775   -48.706 1.00 166.80 ? 1259 SER A CA    1 
ATOM   9393  C  C     . SER A 1 1259 ? -18.582 3.331   -48.806 1.00 171.92 ? 1259 SER A C     1 
ATOM   9394  O  O     . SER A 1 1259 ? -18.410 2.784   -49.909 1.00 184.92 ? 1259 SER A O     1 
ATOM   9395  C  CB    . SER A 1 1259 ? -17.993 5.792   -48.693 1.00 157.90 ? 1259 SER A CB    1 
ATOM   9396  O  OG    . SER A 1 1259 ? -16.873 5.317   -49.415 1.00 160.38 ? 1259 SER A OG    1 
ATOM   9397  N  N     . ASN A 1 1260 ? -18.298 2.751   -47.639 1.00 151.56 ? 1260 ASN A N     1 
ATOM   9398  C  CA    . ASN A 1 1260 ? -17.913 1.342   -47.500 1.00 134.03 ? 1260 ASN A CA    1 
ATOM   9399  C  C     . ASN A 1 1260 ? -18.912 0.229   -47.965 1.00 135.47 ? 1260 ASN A C     1 
ATOM   9400  O  O     . ASN A 1 1260 ? -18.466 -0.820  -48.442 1.00 139.07 ? 1260 ASN A O     1 
ATOM   9401  C  CB    . ASN A 1 1260 ? -17.453 1.093   -46.065 1.00 128.87 ? 1260 ASN A CB    1 
ATOM   9402  C  CG    . ASN A 1 1260 ? -18.530 1.418   -45.055 1.00 137.57 ? 1260 ASN A CG    1 
ATOM   9403  O  OD1   . ASN A 1 1260 ? -19.455 2.182   -45.349 1.00 134.60 ? 1260 ASN A OD1   1 
ATOM   9404  N  ND2   . ASN A 1 1260 ? -18.428 0.837   -43.863 1.00 136.43 ? 1260 ASN A ND2   1 
ATOM   9405  N  N     . THR A 1 1261 ? -20.225 0.429   -47.817 1.00 124.26 ? 1261 THR A N     1 
ATOM   9406  C  CA    . THR A 1 1261 ? -21.223 -0.590  -48.201 1.00 118.98 ? 1261 THR A CA    1 
ATOM   9407  C  C     . THR A 1 1261 ? -21.849 -0.314  -49.574 1.00 114.07 ? 1261 THR A C     1 
ATOM   9408  O  O     . THR A 1 1261 ? -21.711 0.780   -50.131 1.00 112.66 ? 1261 THR A O     1 
ATOM   9409  C  CB    . THR A 1 1261 ? -22.398 -0.655  -47.205 1.00 123.90 ? 1261 THR A CB    1 
ATOM   9410  O  OG1   . THR A 1 1261 ? -23.100 0.591   -47.213 1.00 125.03 ? 1261 THR A OG1   1 
ATOM   9411  C  CG2   . THR A 1 1261 ? -21.920 -0.953  -45.801 1.00 127.78 ? 1261 THR A CG2   1 
ATOM   9412  N  N     . LEU A 1 1262 ? -22.553 -1.319  -50.093 1.00 111.58 ? 1262 LEU A N     1 
ATOM   9413  C  CA    . LEU A 1 1262 ? -23.182 -1.253  -51.415 1.00 113.57 ? 1262 LEU A CA    1 
ATOM   9414  C  C     . LEU A 1 1262 ? -24.291 -0.226  -51.512 1.00 111.36 ? 1262 LEU A C     1 
ATOM   9415  O  O     . LEU A 1 1262 ? -25.371 -0.424  -50.942 1.00 100.64 ? 1262 LEU A O     1 
ATOM   9416  C  CB    . LEU A 1 1262 ? -23.786 -2.610  -51.751 1.00 119.01 ? 1262 LEU A CB    1 
ATOM   9417  C  CG    . LEU A 1 1262 ? -24.586 -2.690  -53.048 1.00 114.40 ? 1262 LEU A CG    1 
ATOM   9418  C  CD1   . LEU A 1 1262 ? -23.764 -2.188  -54.237 1.00 110.01 ? 1262 LEU A CD1   1 
ATOM   9419  C  CD2   . LEU A 1 1262 ? -25.046 -4.130  -53.228 1.00 110.68 ? 1262 LEU A CD2   1 
ATOM   9420  N  N     . TYR A 1 1263 ? -24.032 0.851   -52.253 1.00 112.26 ? 1263 TYR A N     1 
ATOM   9421  C  CA    . TYR A 1 1263 ? -24.952 1.998   -52.375 1.00 102.80 ? 1263 TYR A CA    1 
ATOM   9422  C  C     . TYR A 1 1263 ? -25.430 2.539   -51.025 1.00 100.19 ? 1263 TYR A C     1 
ATOM   9423  O  O     . TYR A 1 1263 ? -26.585 2.930   -50.890 1.00 85.00  ? 1263 TYR A O     1 
ATOM   9424  C  CB    . TYR A 1 1263 ? -26.173 1.700   -53.253 1.00 99.73  ? 1263 TYR A CB    1 
ATOM   9425  C  CG    . TYR A 1 1263 ? -25.826 1.256   -54.649 1.00 101.98 ? 1263 TYR A CG    1 
ATOM   9426  C  CD1   . TYR A 1 1263 ? -24.721 1.788   -55.322 1.00 93.15  ? 1263 TYR A CD1   1 
ATOM   9427  C  CD2   . TYR A 1 1263 ? -26.611 0.301   -55.309 1.00 101.47 ? 1263 TYR A CD2   1 
ATOM   9428  C  CE1   . TYR A 1 1263 ? -24.406 1.376   -56.602 1.00 93.96  ? 1263 TYR A CE1   1 
ATOM   9429  C  CE2   . TYR A 1 1263 ? -26.294 -0.117  -56.591 1.00 95.71  ? 1263 TYR A CE2   1 
ATOM   9430  C  CZ    . TYR A 1 1263 ? -25.192 0.422   -57.223 1.00 92.21  ? 1263 TYR A CZ    1 
ATOM   9431  O  OH    . TYR A 1 1263 ? -24.874 0.006   -58.479 1.00 87.04  ? 1263 TYR A OH    1 
ATOM   9432  N  N     . SER A 1 1264 ? -24.537 2.549   -50.027 1.00 113.09 ? 1264 SER A N     1 
ATOM   9433  C  CA    . SER A 1 1264 ? -24.858 3.036   -48.674 1.00 114.36 ? 1264 SER A CA    1 
ATOM   9434  C  C     . SER A 1 1264 ? -26.017 2.313   -47.979 1.00 118.98 ? 1264 SER A C     1 
ATOM   9435  O  O     . SER A 1 1264 ? -26.650 2.884   -47.083 1.00 117.55 ? 1264 SER A O     1 
ATOM   9436  C  CB    . SER A 1 1264 ? -25.149 4.539   -48.771 1.00 118.51 ? 1264 SER A CB    1 
ATOM   9437  O  OG    . SER A 1 1264 ? -24.313 5.163   -49.752 1.00 116.55 ? 1264 SER A OG    1 
ATOM   9438  N  N     . SER A 1 1265 ? -26.313 1.078   -48.386 1.00 111.86 ? 1265 SER A N     1 
ATOM   9439  C  CA    . SER A 1 1265 ? -27.398 0.314   -47.779 1.00 105.50 ? 1265 SER A CA    1 
ATOM   9440  C  C     . SER A 1 1265 ? -26.872 -0.421  -46.570 1.00 109.94 ? 1265 SER A C     1 
ATOM   9441  O  O     . SER A 1 1265 ? -25.684 -0.703  -46.484 1.00 102.88 ? 1265 SER A O     1 
ATOM   9442  C  CB    . SER A 1 1265 ? -27.922 -0.724  -48.759 1.00 101.76 ? 1265 SER A CB    1 
ATOM   9443  O  OG    . SER A 1 1265 ? -27.038 -1.838  -48.842 1.00 108.71 ? 1265 SER A OG    1 
ATOM   9444  N  N     . LYS A 1 1266 ? -27.760 -0.724  -45.631 1.00 109.59 ? 1266 LYS A N     1 
ATOM   9445  C  CA    . LYS A 1 1266 ? -27.402 -1.569  -44.498 1.00 103.92 ? 1266 LYS A CA    1 
ATOM   9446  C  C     . LYS A 1 1266 ? -28.212 -2.855  -44.568 1.00 89.06  ? 1266 LYS A C     1 
ATOM   9447  O  O     . LYS A 1 1266 ? -29.446 -2.827  -44.741 1.00 80.53  ? 1266 LYS A O     1 
ATOM   9448  C  CB    . LYS A 1 1266 ? -27.553 -0.824  -43.168 1.00 119.21 ? 1266 LYS A CB    1 
ATOM   9449  C  CG    . LYS A 1 1266 ? -26.567 0.332   -42.969 1.00 123.48 ? 1266 LYS A CG    1 
ATOM   9450  C  CD    . LYS A 1 1266 ? -26.658 0.893   -41.554 1.00 130.09 ? 1266 LYS A CD    1 
ATOM   9451  C  CE    . LYS A 1 1266 ? -25.924 2.217   -41.415 1.00 135.79 ? 1266 LYS A CE    1 
ATOM   9452  N  NZ    . LYS A 1 1266 ? -26.160 2.836   -40.079 1.00 134.06 ? 1266 LYS A NZ    1 
ATOM   9453  N  N     . GLY A 1 1267 ? -27.482 -3.957  -44.530 1.00 96.04  ? 1267 GLY A N     1 
ATOM   9454  C  CA    . GLY A 1 1267 ? -28.058 -5.293  -44.487 1.00 101.40 ? 1267 GLY A CA    1 
ATOM   9455  C  C     . GLY A 1 1267 ? -28.830 -5.566  -43.195 1.00 100.75 ? 1267 GLY A C     1 
ATOM   9456  O  O     . GLY A 1 1267 ? -28.254 -5.945  -42.167 1.00 79.76  ? 1267 GLY A O     1 
ATOM   9457  N  N     . LEU A 1 1268 ? -30.129 -5.350  -43.283 1.00 107.08 ? 1268 LEU A N     1 
ATOM   9458  C  CA    . LEU A 1 1268 ? -31.088 -5.865  -42.313 1.00 105.73 ? 1268 LEU A CA    1 
ATOM   9459  C  C     . LEU A 1 1268 ? -31.508 -7.242  -42.794 1.00 111.45 ? 1268 LEU A C     1 
ATOM   9460  O  O     . LEU A 1 1268 ? -31.060 -7.681  -43.856 1.00 123.16 ? 1268 LEU A O     1 
ATOM   9461  C  CB    . LEU A 1 1268 ? -32.306 -4.960  -42.238 1.00 103.33 ? 1268 LEU A CB    1 
ATOM   9462  C  CG    . LEU A 1 1268 ? -32.753 -4.312  -43.552 1.00 106.15 ? 1268 LEU A CG    1 
ATOM   9463  C  CD1   . LEU A 1 1268 ? -34.266 -4.222  -43.612 1.00 115.07 ? 1268 LEU A CD1   1 
ATOM   9464  C  CD2   . LEU A 1 1268 ? -32.135 -2.927  -43.717 1.00 104.69 ? 1268 LEU A CD2   1 
ATOM   9465  N  N     . GLY A 1 1269 ? -32.359 -7.911  -42.041 1.00 112.16 ? 1269 GLY A N     1 
ATOM   9466  C  CA    . GLY A 1 1269 ? -32.812 -9.240  -42.457 1.00 118.34 ? 1269 GLY A CA    1 
ATOM   9467  C  C     . GLY A 1 1269 ? -32.957 -10.077 -41.219 1.00 123.72 ? 1269 GLY A C     1 
ATOM   9468  O  O     . GLY A 1 1269 ? -34.059 -10.571 -40.913 1.00 118.40 ? 1269 GLY A O     1 
ATOM   9469  N  N     . GLU A 1 1270 ? -31.849 -10.209 -40.495 1.00 119.39 ? 1270 GLU A N     1 
ATOM   9470  C  CA    . GLU A 1 1270 ? -31.918 -10.858 -39.173 1.00 121.96 ? 1270 GLU A CA    1 
ATOM   9471  C  C     . GLU A 1 1270 ? -32.228 -9.934  -38.015 1.00 117.31 ? 1270 GLU A C     1 
ATOM   9472  O  O     . GLU A 1 1270 ? -32.663 -10.430 -36.948 1.00 101.67 ? 1270 GLU A O     1 
ATOM   9473  C  CB    . GLU A 1 1270 ? -30.721 -11.768 -38.872 1.00 121.83 ? 1270 GLU A CB    1 
ATOM   9474  C  CG    . GLU A 1 1270 ? -29.434 -11.443 -39.598 1.00 121.97 ? 1270 GLU A CG    1 
ATOM   9475  C  CD    . GLU A 1 1270 ? -28.327 -12.379 -39.196 1.00 118.58 ? 1270 GLU A CD    1 
ATOM   9476  O  OE1   . GLU A 1 1270 ? -27.213 -12.262 -39.753 1.00 120.07 ? 1270 GLU A OE1   1 
ATOM   9477  O  OE2   . GLU A 1 1270 ? -28.588 -13.226 -38.317 1.00 110.47 ? 1270 GLU A OE2   1 
ATOM   9478  N  N     . LEU A 1 1271 ? -32.078 -8.607  -38.225 1.00 122.12 ? 1271 LEU A N     1 
ATOM   9479  C  CA    . LEU A 1 1271 ? -32.126 -7.629  -37.068 1.00 122.36 ? 1271 LEU A CA    1 
ATOM   9480  C  C     . LEU A 1 1271 ? -33.435 -7.762  -36.308 1.00 115.73 ? 1271 LEU A C     1 
ATOM   9481  O  O     . LEU A 1 1271 ? -33.486 -8.043  -35.085 1.00 107.78 ? 1271 LEU A O     1 
ATOM   9482  C  CB    . LEU A 1 1271 ? -32.099 -6.151  -37.440 1.00 121.81 ? 1271 LEU A CB    1 
ATOM   9483  C  CG    . LEU A 1 1271 ? -31.883 -5.612  -38.830 1.00 136.42 ? 1271 LEU A CG    1 
ATOM   9484  C  CD1   . LEU A 1 1271 ? -32.587 -4.265  -38.889 1.00 138.49 ? 1271 LEU A CD1   1 
ATOM   9485  C  CD2   . LEU A 1 1271 ? -30.388 -5.491  -39.064 1.00 141.06 ? 1271 LEU A CD2   1 
ATOM   9486  N  N     . GLY A 1 1272 ? -34.497 -7.502  -37.069 1.00 110.30 ? 1272 GLY A N     1 
ATOM   9487  C  CA    . GLY A 1 1272 ? -35.822 -7.314  -36.514 1.00 104.28 ? 1272 GLY A CA    1 
ATOM   9488  C  C     . GLY A 1 1272 ? -36.240 -8.306  -35.462 1.00 92.29  ? 1272 GLY A C     1 
ATOM   9489  O  O     . GLY A 1 1272 ? -37.217 -8.054  -34.792 1.00 98.16  ? 1272 GLY A O     1 
ATOM   9490  N  N     . VAL A 1 1273 ? -35.591 -9.471  -35.388 1.00 89.17  ? 1273 VAL A N     1 
ATOM   9491  C  CA    . VAL A 1 1273 ? -35.990 -10.529 -34.463 1.00 93.54  ? 1273 VAL A CA    1 
ATOM   9492  C  C     . VAL A 1 1273 ? -35.983 -10.095 -33.016 1.00 105.61 ? 1273 VAL A C     1 
ATOM   9493  O  O     . VAL A 1 1273 ? -36.988 -10.285 -32.331 1.00 88.24  ? 1273 VAL A O     1 
ATOM   9494  C  CB    . VAL A 1 1273 ? -35.137 -11.806 -34.585 1.00 86.37  ? 1273 VAL A CB    1 
ATOM   9495  C  CG1   . VAL A 1 1273 ? -35.464 -12.784 -33.469 1.00 79.74  ? 1273 VAL A CG1   1 
ATOM   9496  C  CG2   . VAL A 1 1273 ? -35.386 -12.468 -35.918 1.00 88.47  ? 1273 VAL A CG2   1 
ATOM   9497  N  N     . PHE A 1 1274 ? -34.892 -9.490  -32.554 1.00 117.19 ? 1274 PHE A N     1 
ATOM   9498  C  CA    . PHE A 1 1274 ? -34.827 -9.009  -31.168 1.00 103.10 ? 1274 PHE A CA    1 
ATOM   9499  C  C     . PHE A 1 1274 ? -35.913 -7.976  -30.816 1.00 95.73  ? 1274 PHE A C     1 
ATOM   9500  O  O     . PHE A 1 1274 ? -36.359 -7.910  -29.671 1.00 88.24  ? 1274 PHE A O     1 
ATOM   9501  C  CB    . PHE A 1 1274 ? -33.439 -8.461  -30.867 1.00 101.91 ? 1274 PHE A CB    1 
ATOM   9502  C  CG    . PHE A 1 1274 ? -33.400 -7.592  -29.660 1.00 102.38 ? 1274 PHE A CG    1 
ATOM   9503  C  CD1   . PHE A 1 1274 ? -33.294 -8.148  -28.402 1.00 105.25 ? 1274 PHE A CD1   1 
ATOM   9504  C  CD2   . PHE A 1 1274 ? -33.515 -6.215  -29.785 1.00 107.85 ? 1274 PHE A CD2   1 
ATOM   9505  C  CE1   . PHE A 1 1274 ? -33.278 -7.343  -27.282 1.00 108.50 ? 1274 PHE A CE1   1 
ATOM   9506  C  CE2   . PHE A 1 1274 ? -33.503 -5.400  -28.677 1.00 109.63 ? 1274 PHE A CE2   1 
ATOM   9507  C  CZ    . PHE A 1 1274 ? -33.383 -5.966  -27.421 1.00 115.54 ? 1274 PHE A CZ    1 
ATOM   9508  N  N     . LEU A 1 1275 ? -36.347 -7.179  -31.792 1.00 96.82  ? 1275 LEU A N     1 
ATOM   9509  C  CA    . LEU A 1 1275 ? -37.410 -6.186  -31.553 1.00 91.58  ? 1275 LEU A CA    1 
ATOM   9510  C  C     . LEU A 1 1275 ? -38.755 -6.799  -31.141 1.00 91.24  ? 1275 LEU A C     1 
ATOM   9511  O  O     . LEU A 1 1275 ? -39.597 -6.121  -30.545 1.00 88.08  ? 1275 LEU A O     1 
ATOM   9512  C  CB    . LEU A 1 1275 ? -37.584 -5.276  -32.755 1.00 89.16  ? 1275 LEU A CB    1 
ATOM   9513  C  CG    . LEU A 1 1275 ? -36.222 -4.647  -33.075 1.00 88.57  ? 1275 LEU A CG    1 
ATOM   9514  C  CD1   . LEU A 1 1275 ? -36.328 -3.829  -34.339 1.00 92.61  ? 1275 LEU A CD1   1 
ATOM   9515  C  CD2   . LEU A 1 1275 ? -35.687 -3.810  -31.921 1.00 84.41  ? 1275 LEU A CD2   1 
ATOM   9516  N  N     . GLY A 1 1276 ? -38.950 -8.083  -31.448 1.00 103.07 ? 1276 GLY A N     1 
ATOM   9517  C  CA    . GLY A 1 1276 ? -40.056 -8.871  -30.904 1.00 107.17 ? 1276 GLY A CA    1 
ATOM   9518  C  C     . GLY A 1 1276 ? -40.172 -8.879  -29.384 1.00 97.89  ? 1276 GLY A C     1 
ATOM   9519  O  O     . GLY A 1 1276 ? -41.272 -9.052  -28.878 1.00 104.81 ? 1276 GLY A O     1 
ATOM   9520  N  N     . CYS A 1 1277 ? -39.063 -8.709  -28.659 1.00 92.61  ? 1277 CYS A N     1 
ATOM   9521  C  CA    . CYS A 1 1277 ? -39.093 -8.662  -27.194 1.00 96.02  ? 1277 CYS A CA    1 
ATOM   9522  C  C     . CYS A 1 1277 ? -39.742 -7.374  -26.620 1.00 94.46  ? 1277 CYS A C     1 
ATOM   9523  O  O     . CYS A 1 1277 ? -40.052 -7.323  -25.418 1.00 92.57  ? 1277 CYS A O     1 
ATOM   9524  C  CB    . CYS A 1 1277 ? -37.703 -8.933  -26.578 1.00 93.62  ? 1277 CYS A CB    1 
ATOM   9525  S  SG    . CYS A 1 1277 ? -36.515 -7.571  -26.563 1.00 97.16  ? 1277 CYS A SG    1 
ATOM   9526  N  N     . SER A 1 1278 ? -39.959 -6.349  -27.458 1.00 79.06  ? 1278 SER A N     1 
ATOM   9527  C  CA    . SER A 1 1278 ? -40.820 -5.238  -27.050 1.00 78.23  ? 1278 SER A CA    1 
ATOM   9528  C  C     . SER A 1 1278 ? -42.196 -5.776  -26.535 1.00 79.76  ? 1278 SER A C     1 
ATOM   9529  O  O     . SER A 1 1278 ? -42.723 -5.298  -25.529 1.00 87.75  ? 1278 SER A O     1 
ATOM   9530  C  CB    . SER A 1 1278 ? -40.926 -4.139  -28.118 1.00 72.41  ? 1278 SER A CB    1 
ATOM   9531  O  OG    . SER A 1 1278 ? -41.784 -4.508  -29.164 1.00 76.23  ? 1278 SER A OG    1 
ATOM   9532  N  N     . VAL A 1 1279 ? -42.718 -6.804  -27.198 1.00 80.26  ? 1279 VAL A N     1 
ATOM   9533  C  CA    . VAL A 1 1279 ? -43.954 -7.463  -26.771 1.00 83.77  ? 1279 VAL A CA    1 
ATOM   9534  C  C     . VAL A 1 1279 ? -43.767 -8.200  -25.441 1.00 84.95  ? 1279 VAL A C     1 
ATOM   9535  O  O     . VAL A 1 1279 ? -44.635 -8.131  -24.565 1.00 99.26  ? 1279 VAL A O     1 
ATOM   9536  C  CB    . VAL A 1 1279 ? -44.447 -8.428  -27.850 1.00 84.56  ? 1279 VAL A CB    1 
ATOM   9537  C  CG1   . VAL A 1 1279 ? -45.650 -9.217  -27.352 1.00 84.79  ? 1279 VAL A CG1   1 
ATOM   9538  C  CG2   . VAL A 1 1279 ? -44.779 -7.635  -29.108 1.00 89.78  ? 1279 VAL A CG2   1 
ATOM   9539  N  N     . PHE A 1 1280 ? -42.653 -8.902  -25.293 1.00 84.33  ? 1280 PHE A N     1 
ATOM   9540  C  CA    . PHE A 1 1280 ? -42.280 -9.608  -24.061 1.00 88.53  ? 1280 PHE A CA    1 
ATOM   9541  C  C     . PHE A 1 1280 ? -42.300 -8.670  -22.857 1.00 91.77  ? 1280 PHE A C     1 
ATOM   9542  O  O     . PHE A 1 1280 ? -42.935 -8.960  -21.840 1.00 83.86  ? 1280 PHE A O     1 
ATOM   9543  C  CB    . PHE A 1 1280 ? -40.870 -10.204 -24.245 1.00 87.06  ? 1280 PHE A CB    1 
ATOM   9544  C  CG    . PHE A 1 1280 ? -40.370 -10.977 -23.070 1.00 77.52  ? 1280 PHE A CG    1 
ATOM   9545  C  CD1   . PHE A 1 1280 ? -40.694 -12.316 -22.917 1.00 79.49  ? 1280 PHE A CD1   1 
ATOM   9546  C  CD2   . PHE A 1 1280 ? -39.570 -10.379 -22.137 1.00 76.89  ? 1280 PHE A CD2   1 
ATOM   9547  C  CE1   . PHE A 1 1280 ? -40.241 -13.050 -21.833 1.00 77.87  ? 1280 PHE A CE1   1 
ATOM   9548  C  CE2   . PHE A 1 1280 ? -39.123 -11.097 -21.040 1.00 90.23  ? 1280 PHE A CE2   1 
ATOM   9549  C  CZ    . PHE A 1 1280 ? -39.458 -12.438 -20.886 1.00 83.86  ? 1280 PHE A CZ    1 
ATOM   9550  N  N     . PHE A 1 1281 ? -41.613 -7.536  -22.979 1.00 93.66  ? 1281 PHE A N     1 
ATOM   9551  C  CA    . PHE A 1 1281 ? -41.517 -6.592  -21.863 1.00 88.77  ? 1281 PHE A CA    1 
ATOM   9552  C  C     . PHE A 1 1281 ? -42.777 -5.776  -21.645 1.00 81.07  ? 1281 PHE A C     1 
ATOM   9553  O  O     . PHE A 1 1281 ? -43.015 -5.296  -20.536 1.00 75.20  ? 1281 PHE A O     1 
ATOM   9554  C  CB    . PHE A 1 1281 ? -40.324 -5.654  -22.040 1.00 85.22  ? 1281 PHE A CB    1 
ATOM   9555  C  CG    . PHE A 1 1281 ? -39.049 -6.378  -21.983 1.00 79.63  ? 1281 PHE A CG    1 
ATOM   9556  C  CD1   . PHE A 1 1281 ? -38.759 -7.145  -20.881 1.00 75.02  ? 1281 PHE A CD1   1 
ATOM   9557  C  CD2   . PHE A 1 1281 ? -38.207 -6.407  -23.058 1.00 83.03  ? 1281 PHE A CD2   1 
ATOM   9558  C  CE1   . PHE A 1 1281 ? -37.612 -7.884  -20.826 1.00 75.54  ? 1281 PHE A CE1   1 
ATOM   9559  C  CE2   . PHE A 1 1281 ? -37.047 -7.143  -23.009 1.00 83.54  ? 1281 PHE A CE2   1 
ATOM   9560  C  CZ    . PHE A 1 1281 ? -36.752 -7.879  -21.889 1.00 80.38  ? 1281 PHE A CZ    1 
ATOM   9561  N  N     . ALA A 1 1282 ? -43.592 -5.629  -22.688 1.00 83.33  ? 1282 ALA A N     1 
ATOM   9562  C  CA    . ALA A 1 1282 ? -44.937 -5.060  -22.544 1.00 87.11  ? 1282 ALA A CA    1 
ATOM   9563  C  C     . ALA A 1 1282 ? -45.825 -5.969  -21.678 1.00 87.28  ? 1282 ALA A C     1 
ATOM   9564  O  O     . ALA A 1 1282 ? -46.521 -5.488  -20.796 1.00 98.10  ? 1282 ALA A O     1 
ATOM   9565  C  CB    . ALA A 1 1282 ? -45.589 -4.854  -23.905 1.00 87.24  ? 1282 ALA A CB    1 
ATOM   9566  N  N     . ILE A 1 1283 ? -45.770 -7.276  -21.920 1.00 88.38  ? 1283 ILE A N     1 
ATOM   9567  C  CA    . ILE A 1 1283 ? -46.494 -8.264  -21.109 1.00 95.87  ? 1283 ILE A CA    1 
ATOM   9568  C  C     . ILE A 1 1283 ? -45.932 -8.321  -19.677 1.00 106.34 ? 1283 ILE A C     1 
ATOM   9569  O  O     . ILE A 1 1283 ? -46.688 -8.412  -18.701 1.00 104.47 ? 1283 ILE A O     1 
ATOM   9570  C  CB    . ILE A 1 1283 ? -46.428 -9.647  -21.787 1.00 101.84 ? 1283 ILE A CB    1 
ATOM   9571  C  CG1   . ILE A 1 1283 ? -47.140 -9.593  -23.146 1.00 102.80 ? 1283 ILE A CG1   1 
ATOM   9572  C  CG2   . ILE A 1 1283 ? -47.064 -10.718 -20.909 1.00 104.27 ? 1283 ILE A CG2   1 
ATOM   9573  C  CD1   . ILE A 1 1283 ? -46.893 -10.802 -24.014 1.00 105.00 ? 1283 ILE A CD1   1 
ATOM   9574  N  N     . HIS A 1 1284 ? -44.602 -8.287  -19.576 1.00 114.27 ? 1284 HIS A N     1 
ATOM   9575  C  CA    . HIS A 1 1284 ? -43.899 -8.229  -18.293 1.00 110.60 ? 1284 HIS A CA    1 
ATOM   9576  C  C     . HIS A 1 1284 ? -44.382 -7.048  -17.456 1.00 111.43 ? 1284 HIS A C     1 
ATOM   9577  O  O     . HIS A 1 1284 ? -44.584 -7.183  -16.239 1.00 135.36 ? 1284 HIS A O     1 
ATOM   9578  C  CB    . HIS A 1 1284 ? -42.383 -8.104  -18.487 1.00 110.65 ? 1284 HIS A CB    1 
ATOM   9579  C  CG    . HIS A 1 1284 ? -41.590 -8.325  -17.228 1.00 108.67 ? 1284 HIS A CG    1 
ATOM   9580  N  ND1   . HIS A 1 1284 ? -41.337 -7.321  -16.317 1.00 109.62 ? 1284 HIS A ND1   1 
ATOM   9581  C  CD2   . HIS A 1 1284 ? -40.984 -9.434  -16.737 1.00 105.26 ? 1284 HIS A CD2   1 
ATOM   9582  C  CE1   . HIS A 1 1284 ? -40.621 -7.802  -15.316 1.00 103.44 ? 1284 HIS A CE1   1 
ATOM   9583  N  NE2   . HIS A 1 1284 ? -40.396 -9.083  -15.544 1.00 103.80 ? 1284 HIS A NE2   1 
ATOM   9584  N  N     . ASP A 1 1285 ? -44.566 -5.902  -18.118 1.00 106.96 ? 1285 ASP A N     1 
ATOM   9585  C  CA    . ASP A 1 1285 ? -45.093 -4.677  -17.489 1.00 104.47 ? 1285 ASP A CA    1 
ATOM   9586  C  C     . ASP A 1 1285 ? -46.522 -4.877  -16.968 1.00 96.48  ? 1285 ASP A C     1 
ATOM   9587  O  O     . ASP A 1 1285 ? -46.816 -4.547  -15.813 1.00 93.16  ? 1285 ASP A O     1 
ATOM   9588  C  CB    . ASP A 1 1285 ? -45.046 -3.464  -18.434 1.00 107.31 ? 1285 ASP A CB    1 
ATOM   9589  C  CG    . ASP A 1 1285 ? -45.657 -2.195  -17.817 1.00 104.72 ? 1285 ASP A CG    1 
ATOM   9590  O  OD1   . ASP A 1 1285 ? -45.637 -2.015  -16.573 1.00 94.49  ? 1285 ASP A OD1   1 
ATOM   9591  O  OD2   . ASP A 1 1285 ? -46.150 -1.359  -18.600 1.00 109.62 ? 1285 ASP A OD2   1 
ATOM   9592  N  N     . ALA A 1 1286 ? -47.389 -5.422  -17.829 1.00 99.02  ? 1286 ALA A N     1 
ATOM   9593  C  CA    . ALA A 1 1286 ? -48.785 -5.728  -17.478 1.00 100.67 ? 1286 ALA A CA    1 
ATOM   9594  C  C     . ALA A 1 1286 ? -48.921 -6.665  -16.294 1.00 106.86 ? 1286 ALA A C     1 
ATOM   9595  O  O     . ALA A 1 1286 ? -49.764 -6.433  -15.427 1.00 123.78 ? 1286 ALA A O     1 
ATOM   9596  C  CB    . ALA A 1 1286 ? -49.604 -6.189  -18.676 1.00 96.17  ? 1286 ALA A CB    1 
ATOM   9597  N  N     . VAL A 1 1287 ? -48.097 -7.713  -16.251 1.00 99.54  ? 1287 VAL A N     1 
ATOM   9598  C  CA    . VAL A 1 1287 ? -48.092 -8.642  -15.116 1.00 102.09 ? 1287 VAL A CA    1 
ATOM   9599  C  C     . VAL A 1 1287 ? -47.653 -7.942  -13.826 1.00 114.64 ? 1287 VAL A C     1 
ATOM   9600  O  O     . VAL A 1 1287 ? -48.241 -8.185  -12.771 1.00 143.78 ? 1287 VAL A O     1 
ATOM   9601  C  CB    . VAL A 1 1287 ? -47.302 -9.912  -15.378 1.00 101.91 ? 1287 VAL A CB    1 
ATOM   9602  C  CG1   . VAL A 1 1287 ? -47.241 -10.757 -14.126 1.00 107.55 ? 1287 VAL A CG1   1 
ATOM   9603  C  CG2   . VAL A 1 1287 ? -48.001 -10.714 -16.454 1.00 107.77 ? 1287 VAL A CG2   1 
ATOM   9604  N  N     . SER A 1 1288 ? -46.645 -7.076  -13.908 1.00 115.48 ? 1288 SER A N     1 
ATOM   9605  C  CA    . SER A 1 1288 ? -46.177 -6.331  -12.733 1.00 126.46 ? 1288 SER A CA    1 
ATOM   9606  C  C     . SER A 1 1288 ? -47.267 -5.414  -12.141 1.00 120.36 ? 1288 SER A C     1 
ATOM   9607  O  O     . SER A 1 1288 ? -47.392 -5.301  -10.917 1.00 114.04 ? 1288 SER A O     1 
ATOM   9608  C  CB    . SER A 1 1288 ? -44.886 -5.557  -13.032 1.00 131.63 ? 1288 SER A CB    1 
ATOM   9609  O  OG    . SER A 1 1288 ? -43.756 -6.389  -12.811 1.00 132.18 ? 1288 SER A OG    1 
ATOM   9610  N  N     . ALA A 1 1289 ? -48.055 -4.789  -13.018 1.00 108.03 ? 1289 ALA A N     1 
ATOM   9611  C  CA    . ALA A 1 1289 ? -49.159 -3.926  -12.599 1.00 101.59 ? 1289 ALA A CA    1 
ATOM   9612  C  C     . ALA A 1 1289 ? -50.261 -4.685  -11.863 1.00 102.16 ? 1289 ALA A C     1 
ATOM   9613  O  O     . ALA A 1 1289 ? -50.903 -4.131  -10.975 1.00 108.42 ? 1289 ALA A O     1 
ATOM   9614  C  CB    . ALA A 1 1289 ? -49.711 -3.163  -13.798 1.00 99.64  ? 1289 ALA A CB    1 
ATOM   9615  N  N     . ALA A 1 1290 ? -50.487 -5.940  -12.244 1.00 103.27 ? 1290 ALA A N     1 
ATOM   9616  C  CA    . ALA A 1 1290 ? -51.392 -6.835  -11.514 1.00 108.98 ? 1290 ALA A CA    1 
ATOM   9617  C  C     . ALA A 1 1290 ? -50.788 -7.293  -10.194 1.00 110.78 ? 1290 ALA A C     1 
ATOM   9618  O  O     . ALA A 1 1290 ? -51.516 -7.483  -9.225  1.00 116.30 ? 1290 ALA A O     1 
ATOM   9619  C  CB    . ALA A 1 1290 ? -51.747 -8.051  -12.361 1.00 105.86 ? 1290 ALA A CB    1 
ATOM   9620  N  N     . ARG A 1 1291 ? -49.467 -7.487  -10.168 1.00 112.35 ? 1291 ARG A N     1 
ATOM   9621  C  CA    . ARG A 1 1291 ? -48.751 -7.902  -8.951  1.00 118.69 ? 1291 ARG A CA    1 
ATOM   9622  C  C     . ARG A 1 1291 ? -48.539 -6.781  -7.935  1.00 123.95 ? 1291 ARG A C     1 
ATOM   9623  O  O     . ARG A 1 1291 ? -48.418 -7.063  -6.745  1.00 118.05 ? 1291 ARG A O     1 
ATOM   9624  C  CB    . ARG A 1 1291 ? -47.399 -8.555  -9.294  1.00 112.14 ? 1291 ARG A CB    1 
ATOM   9625  C  CG    . ARG A 1 1291 ? -47.505 -9.967  -9.868  1.00 94.59  ? 1291 ARG A CG    1 
ATOM   9626  C  CD    . ARG A 1 1291 ? -46.136 -10.524 -10.169 1.00 81.86  ? 1291 ARG A CD    1 
ATOM   9627  N  NE    . ARG A 1 1291 ? -45.558 -11.192 -9.013  1.00 85.35  ? 1291 ARG A NE    1 
ATOM   9628  C  CZ    . ARG A 1 1291 ? -45.878 -12.424 -8.597  1.00 95.40  ? 1291 ARG A CZ    1 
ATOM   9629  N  NH1   . ARG A 1 1291 ? -46.802 -13.133 -9.229  1.00 106.87 ? 1291 ARG A NH1   1 
ATOM   9630  N  NH2   . ARG A 1 1291 ? -45.283 -12.962 -7.529  1.00 89.07  ? 1291 ARG A NH2   1 
ATOM   9631  N  N     . GLN A 1 1292 ? -48.474 -5.528  -8.393  1.00 129.25 ? 1292 GLN A N     1 
ATOM   9632  C  CA    . GLN A 1 1292 ? -48.356 -4.376  -7.488  1.00 125.07 ? 1292 GLN A CA    1 
ATOM   9633  C  C     . GLN A 1 1292 ? -49.702 -4.072  -6.809  1.00 120.33 ? 1292 GLN A C     1 
ATOM   9634  O  O     . GLN A 1 1292 ? -49.749 -3.873  -5.596  1.00 116.31 ? 1292 GLN A O     1 
ATOM   9635  C  CB    . GLN A 1 1292 ? -47.802 -3.136  -8.236  1.00 128.64 ? 1292 GLN A CB    1 
ATOM   9636  C  CG    . GLN A 1 1292 ? -48.832 -2.352  -9.068  1.00 137.37 ? 1292 GLN A CG    1 
ATOM   9637  C  CD    . GLN A 1 1292 ? -48.239 -1.291  -10.004 1.00 134.96 ? 1292 GLN A CD    1 
ATOM   9638  O  OE1   . GLN A 1 1292 ? -47.067 -0.921  -9.913  1.00 120.15 ? 1292 GLN A OE1   1 
ATOM   9639  N  NE2   . GLN A 1 1292 ? -49.069 -0.798  -10.917 1.00 136.51 ? 1292 GLN A NE2   1 
ATOM   9640  N  N     . GLU A 1 1293 ? -50.784 -4.076  -7.593  1.00 116.85 ? 1293 GLU A N     1 
ATOM   9641  C  CA    . GLU A 1 1293 ? -52.129 -3.763  -7.105  1.00 116.27 ? 1293 GLU A CA    1 
ATOM   9642  C  C     . GLU A 1 1293 ? -52.572 -4.770  -6.050  1.00 104.45 ? 1293 GLU A C     1 
ATOM   9643  O  O     . GLU A 1 1293 ? -53.231 -4.404  -5.076  1.00 112.91 ? 1293 GLU A O     1 
ATOM   9644  C  CB    . GLU A 1 1293 ? -53.160 -3.731  -8.248  1.00 128.58 ? 1293 GLU A CB    1 
ATOM   9645  C  CG    . GLU A 1 1293 ? -54.578 -3.287  -7.845  1.00 131.89 ? 1293 GLU A CG    1 
ATOM   9646  C  CD    . GLU A 1 1293 ? -55.598 -3.375  -8.987  1.00 133.62 ? 1293 GLU A CD    1 
ATOM   9647  O  OE1   . GLU A 1 1293 ? -55.433 -4.228  -9.881  1.00 142.37 ? 1293 GLU A OE1   1 
ATOM   9648  O  OE2   . GLU A 1 1293 ? -56.581 -2.602  -9.007  1.00 130.62 ? 1293 GLU A OE2   1 
ATOM   9649  N  N     . ARG A 1 1294 ? -52.204 -6.030  -6.252  1.00 102.04 ? 1294 ARG A N     1 
ATOM   9650  C  CA    . ARG A 1 1294 ? -52.575 -7.130  -5.359  1.00 116.35 ? 1294 ARG A CA    1 
ATOM   9651  C  C     . ARG A 1 1294 ? -51.561 -7.361  -4.237  1.00 117.36 ? 1294 ARG A C     1 
ATOM   9652  O  O     . ARG A 1 1294 ? -51.837 -8.132  -3.320  1.00 117.91 ? 1294 ARG A O     1 
ATOM   9653  C  CB    . ARG A 1 1294 ? -52.715 -8.447  -6.130  1.00 117.17 ? 1294 ARG A CB    1 
ATOM   9654  C  CG    . ARG A 1 1294 ? -53.705 -8.396  -7.277  1.00 122.55 ? 1294 ARG A CG    1 
ATOM   9655  C  CD    . ARG A 1 1294 ? -53.571 -9.596  -8.200  1.00 115.90 ? 1294 ARG A CD    1 
ATOM   9656  N  NE    . ARG A 1 1294 ? -54.329 -9.399  -9.429  1.00 102.13 ? 1294 ARG A NE    1 
ATOM   9657  C  CZ    . ARG A 1 1294 ? -54.683 -10.369 -10.259 1.00 104.80 ? 1294 ARG A CZ    1 
ATOM   9658  N  NH1   . ARG A 1 1294 ? -54.346 -11.631 -10.025 1.00 103.17 ? 1294 ARG A NH1   1 
ATOM   9659  N  NH2   . ARG A 1 1294 ? -55.391 -10.076 -11.336 1.00 113.02 ? 1294 ARG A NH2   1 
ATOM   9660  N  N     . GLY A 1 1295 ? -50.383 -6.744  -4.349  1.00 118.86 ? 1295 GLY A N     1 
ATOM   9661  C  CA    . GLY A 1 1295 ? -49.441 -6.623  -3.238  1.00 124.92 ? 1295 GLY A CA    1 
ATOM   9662  C  C     . GLY A 1 1295 ? -48.411 -7.726  -3.118  1.00 123.92 ? 1295 GLY A C     1 
ATOM   9663  O  O     . GLY A 1 1295 ? -48.011 -8.070  -2.010  1.00 107.42 ? 1295 GLY A O     1 
ATOM   9664  N  N     . LEU A 1 1296 ? -47.943 -8.243  -4.257  1.00 133.24 ? 1296 LEU A N     1 
ATOM   9665  C  CA    . LEU A 1 1296 ? -46.886 -9.276  -4.286  1.00 134.82 ? 1296 LEU A CA    1 
ATOM   9666  C  C     . LEU A 1 1296 ? -45.586 -8.707  -4.813  1.00 130.10 ? 1296 LEU A C     1 
ATOM   9667  O  O     . LEU A 1 1296 ? -45.269 -8.887  -5.983  1.00 128.63 ? 1296 LEU A O     1 
ATOM   9668  C  CB    . LEU A 1 1296 ? -47.350 -10.498 -5.088  1.00 145.98 ? 1296 LEU A CB    1 
ATOM   9669  C  CG    . LEU A 1 1296 ? -48.852 -10.822 -5.001  1.00 152.60 ? 1296 LEU A CG    1 
ATOM   9670  C  CD1   . LEU A 1 1296 ? -49.604 -10.329 -6.242  1.00 148.15 ? 1296 LEU A CD1   1 
ATOM   9671  C  CD2   . LEU A 1 1296 ? -49.073 -12.315 -4.796  1.00 151.33 ? 1296 LEU A CD2   1 
ATOM   9672  N  N     . HIS A 1 1297 ? -44.830 -8.020  -3.950  1.00 142.17 ? 1297 HIS A N     1 
ATOM   9673  C  CA    . HIS A 1 1297 ? -43.600 -7.328  -4.367  1.00 144.27 ? 1297 HIS A CA    1 
ATOM   9674  C  C     . HIS A 1 1297 ? -42.440 -8.349  -4.446  1.00 145.43 ? 1297 HIS A C     1 
ATOM   9675  O  O     . HIS A 1 1297 ? -42.665 -9.576  -4.358  1.00 134.26 ? 1297 HIS A O     1 
ATOM   9676  C  CB    . HIS A 1 1297 ? -43.325 -6.097  -3.448  1.00 145.43 ? 1297 HIS A CB    1 
ATOM   9677  C  CG    . HIS A 1 1297 ? -44.496 -5.138  -3.304  1.00 148.01 ? 1297 HIS A CG    1 
ATOM   9678  N  ND1   . HIS A 1 1297 ? -45.242 -5.031  -2.143  1.00 138.66 ? 1297 HIS A ND1   1 
ATOM   9679  C  CD2   . HIS A 1 1297 ? -45.024 -4.228  -4.166  1.00 137.06 ? 1297 HIS A CD2   1 
ATOM   9680  C  CE1   . HIS A 1 1297 ? -46.182 -4.113  -2.303  1.00 125.40 ? 1297 HIS A CE1   1 
ATOM   9681  N  NE2   . HIS A 1 1297 ? -46.074 -3.612  -3.521  1.00 120.27 ? 1297 HIS A NE2   1 
ATOM   9682  N  N     . GLY A 1 1298 ? -41.234 -7.855  -4.709  1.00 145.24 ? 1298 GLY A N     1 
ATOM   9683  C  CA    . GLY A 1 1298 ? -40.028 -8.676  -4.697  1.00 156.72 ? 1298 GLY A CA    1 
ATOM   9684  C  C     . GLY A 1 1298 ? -39.721 -9.351  -6.036  1.00 154.52 ? 1298 GLY A C     1 
ATOM   9685  O  O     . GLY A 1 1298 ? -39.758 -8.666  -7.047  1.00 136.07 ? 1298 GLY A O     1 
ATOM   9686  N  N     . PRO A 1 1299 ? -39.388 -10.654 -6.032  1.00 162.23 ? 1299 PRO A N     1 
ATOM   9687  C  CA    . PRO A 1 1299 ? -38.790 -11.268 -7.234  1.00 159.00 ? 1299 PRO A CA    1 
ATOM   9688  C  C     . PRO A 1 1299 ? -39.808 -11.716 -8.291  1.00 150.13 ? 1299 PRO A C     1 
ATOM   9689  O  O     . PRO A 1 1299 ? -40.517 -12.687 -8.061  1.00 132.06 ? 1299 PRO A O     1 
ATOM   9690  C  CB    . PRO A 1 1299 ? -38.084 -12.500 -6.650  1.00 161.04 ? 1299 PRO A CB    1 
ATOM   9691  C  CG    . PRO A 1 1299 ? -38.954 -12.917 -5.495  1.00 152.87 ? 1299 PRO A CG    1 
ATOM   9692  C  CD    . PRO A 1 1299 ? -39.744 -11.701 -5.048  1.00 159.74 ? 1299 PRO A CD    1 
ATOM   9693  N  N     . LEU A 1 1300 ? -39.880 -11.006 -9.423  1.00 142.80 ? 1300 LEU A N     1 
ATOM   9694  C  CA    . LEU A 1 1300 ? -40.608 -11.442 -10.603 1.00 131.67 ? 1300 LEU A CA    1 
ATOM   9695  C  C     . LEU A 1 1300 ? -39.610 -11.521 -11.741 1.00 143.29 ? 1300 LEU A C     1 
ATOM   9696  O  O     . LEU A 1 1300 ? -39.267 -10.513 -12.376 1.00 141.99 ? 1300 LEU A O     1 
ATOM   9697  C  CB    . LEU A 1 1300 ? -41.730 -10.486 -11.001 1.00 123.46 ? 1300 LEU A CB    1 
ATOM   9698  C  CG    . LEU A 1 1300 ? -42.506 -10.946 -12.242 1.00 109.48 ? 1300 LEU A CG    1 
ATOM   9699  C  CD1   . LEU A 1 1300 ? -43.252 -12.238 -11.926 1.00 102.51 ? 1300 LEU A CD1   1 
ATOM   9700  C  CD2   . LEU A 1 1300 ? -43.440 -9.850  -12.760 1.00 104.81 ? 1300 LEU A CD2   1 
ATOM   9701  N  N     . THR A 1 1301 ? -39.160 -12.751 -12.032 1.00 148.35 ? 1301 THR A N     1 
ATOM   9702  C  CA    . THR A 1 1301 ? -38.478 -13.005 -13.314 1.00 143.97 ? 1301 THR A CA    1 
ATOM   9703  C  C     . THR A 1 1301 ? -39.391 -13.948 -14.112 1.00 134.42 ? 1301 THR A C     1 
ATOM   9704  O  O     . THR A 1 1301 ? -39.681 -15.096 -13.719 1.00 102.53 ? 1301 THR A O     1 
ATOM   9705  C  CB    . THR A 1 1301 ? -37.023 -13.507 -13.188 1.00 143.17 ? 1301 THR A CB    1 
ATOM   9706  O  OG1   . THR A 1 1301 ? -36.556 -13.348 -11.845 1.00 132.20 ? 1301 THR A OG1   1 
ATOM   9707  C  CG2   . THR A 1 1301 ? -36.112 -12.707 -14.138 1.00 140.74 ? 1301 THR A CG2   1 
ATOM   9708  N  N     . LEU A 1 1302 ? -39.886 -13.404 -15.224 1.00 134.09 ? 1302 LEU A N     1 
ATOM   9709  C  CA    . LEU A 1 1302 ? -40.644 -14.174 -16.192 1.00 124.08 ? 1302 LEU A CA    1 
ATOM   9710  C  C     . LEU A 1 1302 ? -39.656 -14.600 -17.277 1.00 116.34 ? 1302 LEU A C     1 
ATOM   9711  O  O     . LEU A 1 1302 ? -38.857 -13.790 -17.774 1.00 125.19 ? 1302 LEU A O     1 
ATOM   9712  C  CB    . LEU A 1 1302 ? -41.760 -13.346 -16.824 1.00 115.98 ? 1302 LEU A CB    1 
ATOM   9713  C  CG    . LEU A 1 1302 ? -42.859 -12.970 -15.838 1.00 115.18 ? 1302 LEU A CG    1 
ATOM   9714  C  CD1   . LEU A 1 1302 ? -43.807 -11.958 -16.456 1.00 116.98 ? 1302 LEU A CD1   1 
ATOM   9715  C  CD2   . LEU A 1 1302 ? -43.600 -14.210 -15.371 1.00 120.73 ? 1302 LEU A CD2   1 
ATOM   9716  N  N     . ASN A 1 1303 ? -39.711 -15.882 -17.620 1.00 94.87  ? 1303 ASN A N     1 
ATOM   9717  C  CA    . ASN A 1 1303 ? -38.872 -16.469 -18.627 1.00 90.41  ? 1303 ASN A CA    1 
ATOM   9718  C  C     . ASN A 1 1303 ? -39.506 -16.484 -19.995 1.00 103.34 ? 1303 ASN A C     1 
ATOM   9719  O  O     . ASN A 1 1303 ? -40.711 -16.437 -20.108 1.00 121.97 ? 1303 ASN A O     1 
ATOM   9720  C  CB    . ASN A 1 1303 ? -38.683 -17.905 -18.254 1.00 85.66  ? 1303 ASN A CB    1 
ATOM   9721  C  CG    . ASN A 1 1303 ? -37.754 -18.063 -17.113 1.00 81.92  ? 1303 ASN A CG    1 
ATOM   9722  O  OD1   . ASN A 1 1303 ? -36.674 -17.477 -17.107 1.00 75.95  ? 1303 ASN A OD1   1 
ATOM   9723  N  ND2   . ASN A 1 1303 ? -38.149 -18.869 -16.141 1.00 85.65  ? 1303 ASN A ND2   1 
ATOM   9724  N  N     . SER A 1 1304 ? -38.658 -16.586 -21.022 1.00 105.57 ? 1304 SER A N     1 
ATOM   9725  C  CA    . SER A 1 1304 ? -39.098 -16.722 -22.383 1.00 99.12  ? 1304 SER A CA    1 
ATOM   9726  C  C     . SER A 1 1304 ? -39.164 -18.213 -22.749 1.00 101.40 ? 1304 SER A C     1 
ATOM   9727  O  O     . SER A 1 1304 ? -38.295 -18.980 -22.338 1.00 99.38  ? 1304 SER A O     1 
ATOM   9728  C  CB    . SER A 1 1304 ? -38.189 -16.013 -23.371 1.00 94.16  ? 1304 SER A CB    1 
ATOM   9729  O  OG    . SER A 1 1304 ? -38.624 -16.287 -24.697 1.00 92.60  ? 1304 SER A OG    1 
ATOM   9730  N  N     . PRO A 1 1305 ? -40.190 -18.643 -23.509 1.00 95.57  ? 1305 PRO A N     1 
ATOM   9731  C  CA    . PRO A 1 1305 ? -41.296 -17.849 -24.031 1.00 85.75  ? 1305 PRO A CA    1 
ATOM   9732  C  C     . PRO A 1 1305 ? -42.362 -17.540 -22.995 1.00 87.60  ? 1305 PRO A C     1 
ATOM   9733  O  O     . PRO A 1 1305 ? -42.668 -18.383 -22.149 1.00 101.12 ? 1305 PRO A O     1 
ATOM   9734  C  CB    . PRO A 1 1305 ? -41.882 -18.728 -25.127 1.00 86.44  ? 1305 PRO A CB    1 
ATOM   9735  C  CG    . PRO A 1 1305 ? -41.512 -20.114 -24.755 1.00 88.13  ? 1305 PRO A CG    1 
ATOM   9736  C  CD    . PRO A 1 1305 ? -40.419 -20.079 -23.727 1.00 92.70  ? 1305 PRO A CD    1 
ATOM   9737  N  N     . LEU A 1 1306 ? -42.925 -16.330 -23.055 1.00 86.26  ? 1306 LEU A N     1 
ATOM   9738  C  CA    . LEU A 1 1306 ? -43.947 -15.871 -22.118 1.00 81.99  ? 1306 LEU A CA    1 
ATOM   9739  C  C     . LEU A 1 1306 ? -45.303 -16.426 -22.586 1.00 86.89  ? 1306 LEU A C     1 
ATOM   9740  O  O     . LEU A 1 1306 ? -46.086 -15.744 -23.254 1.00 86.66  ? 1306 LEU A O     1 
ATOM   9741  C  CB    . LEU A 1 1306 ? -43.919 -14.342 -22.071 1.00 80.16  ? 1306 LEU A CB    1 
ATOM   9742  C  CG    . LEU A 1 1306 ? -43.942 -13.659 -20.720 1.00 80.89  ? 1306 LEU A CG    1 
ATOM   9743  C  CD1   . LEU A 1 1306 ? -44.117 -12.152 -20.889 1.00 80.01  ? 1306 LEU A CD1   1 
ATOM   9744  C  CD2   . LEU A 1 1306 ? -45.057 -14.257 -19.890 1.00 89.64  ? 1306 LEU A CD2   1 
ATOM   9745  N  N     . THR A 1 1307 ? -45.558 -17.692 -22.247 1.00 84.91  ? 1307 THR A N     1 
ATOM   9746  C  CA    . THR A 1 1307 ? -46.717 -18.425 -22.738 1.00 87.25  ? 1307 THR A CA    1 
ATOM   9747  C  C     . THR A 1 1307 ? -47.926 -18.061 -21.880 1.00 93.83  ? 1307 THR A C     1 
ATOM   9748  O  O     . THR A 1 1307 ? -47.760 -17.421 -20.850 1.00 92.63  ? 1307 THR A O     1 
ATOM   9749  C  CB    . THR A 1 1307 ? -46.452 -19.954 -22.720 1.00 83.39  ? 1307 THR A CB    1 
ATOM   9750  O  OG1   . THR A 1 1307 ? -46.306 -20.429 -21.376 1.00 80.60  ? 1307 THR A OG1   1 
ATOM   9751  C  CG2   . THR A 1 1307 ? -45.187 -20.272 -23.503 1.00 80.12  ? 1307 THR A CG2   1 
ATOM   9752  N  N     . PRO A 1 1308 ? -49.152 -18.438 -22.305 1.00 98.98  ? 1308 PRO A N     1 
ATOM   9753  C  CA    . PRO A 1 1308 ? -50.316 -18.174 -21.464 1.00 107.75 ? 1308 PRO A CA    1 
ATOM   9754  C  C     . PRO A 1 1308 ? -50.266 -18.810 -20.064 1.00 107.96 ? 1308 PRO A C     1 
ATOM   9755  O  O     . PRO A 1 1308 ? -50.804 -18.246 -19.105 1.00 106.34 ? 1308 PRO A O     1 
ATOM   9756  C  CB    . PRO A 1 1308 ? -51.464 -18.724 -22.300 1.00 117.00 ? 1308 PRO A CB    1 
ATOM   9757  C  CG    . PRO A 1 1308 ? -51.023 -18.437 -23.686 1.00 113.44 ? 1308 PRO A CG    1 
ATOM   9758  C  CD    . PRO A 1 1308 ? -49.568 -18.808 -23.663 1.00 111.17 ? 1308 PRO A CD    1 
ATOM   9759  N  N     . GLU A 1 1309 ? -49.639 -19.981 -19.973 1.00 111.62 ? 1309 GLU A N     1 
ATOM   9760  C  CA    . GLU A 1 1309 ? -49.376 -20.635 -18.699 1.00 111.99 ? 1309 GLU A CA    1 
ATOM   9761  C  C     . GLU A 1 1309 ? -48.605 -19.711 -17.769 1.00 110.45 ? 1309 GLU A C     1 
ATOM   9762  O  O     . GLU A 1 1309 ? -49.044 -19.438 -16.648 1.00 133.36 ? 1309 GLU A O     1 
ATOM   9763  C  CB    . GLU A 1 1309 ? -48.566 -21.901 -18.930 1.00 109.81 ? 1309 GLU A CB    1 
ATOM   9764  C  CG    . GLU A 1 1309 ? -48.055 -22.539 -17.653 1.00 106.51 ? 1309 GLU A CG    1 
ATOM   9765  C  CD    . GLU A 1 1309 ? -47.457 -23.900 -17.911 1.00 112.56 ? 1309 GLU A CD    1 
ATOM   9766  O  OE1   . GLU A 1 1309 ? -46.873 -24.069 -19.016 1.00 106.93 ? 1309 GLU A OE1   1 
ATOM   9767  O  OE2   . GLU A 1 1309 ? -47.578 -24.784 -17.017 1.00 110.62 ? 1309 GLU A OE2   1 
ATOM   9768  N  N     . LYS A 1 1310 ? -47.458 -19.235 -18.254 1.00 99.83  ? 1310 LYS A N     1 
ATOM   9769  C  CA    . LYS A 1 1310 ? -46.586 -18.350 -17.461 1.00 98.38  ? 1310 LYS A CA    1 
ATOM   9770  C  C     . LYS A 1 1310 ? -47.250 -17.028 -17.089 1.00 95.04  ? 1310 LYS A C     1 
ATOM   9771  O  O     . LYS A 1 1310 ? -47.036 -16.537 -15.988 1.00 97.65  ? 1310 LYS A O     1 
ATOM   9772  C  CB    . LYS A 1 1310 ? -45.243 -18.070 -18.158 1.00 102.73 ? 1310 LYS A CB    1 
ATOM   9773  C  CG    . LYS A 1 1310 ? -44.230 -19.206 -18.128 1.00 103.56 ? 1310 LYS A CG    1 
ATOM   9774  C  CD    . LYS A 1 1310 ? -42.914 -18.758 -18.752 1.00 112.67 ? 1310 LYS A CD    1 
ATOM   9775  C  CE    . LYS A 1 1310 ? -42.006 -19.926 -19.133 1.00 120.26 ? 1310 LYS A CE    1 
ATOM   9776  N  NZ    . LYS A 1 1310 ? -42.238 -20.457 -20.511 1.00 118.54 ? 1310 LYS A NZ    1 
ATOM   9777  N  N     . ILE A 1 1311 ? -48.055 -16.460 -17.993 1.00 96.72  ? 1311 ILE A N     1 
ATOM   9778  C  CA    . ILE A 1 1311 ? -48.779 -15.207 -17.696 1.00 94.46  ? 1311 ILE A CA    1 
ATOM   9779  C  C     . ILE A 1 1311 ? -49.742 -15.418 -16.523 1.00 94.18  ? 1311 ILE A C     1 
ATOM   9780  O  O     . ILE A 1 1311 ? -49.652 -14.718 -15.512 1.00 88.96  ? 1311 ILE A O     1 
ATOM   9781  C  CB    . ILE A 1 1311 ? -49.512 -14.643 -18.932 1.00 95.00  ? 1311 ILE A CB    1 
ATOM   9782  C  CG1   . ILE A 1 1311 ? -48.501 -14.249 -20.009 1.00 100.64 ? 1311 ILE A CG1   1 
ATOM   9783  C  CG2   . ILE A 1 1311 ? -50.349 -13.423 -18.573 1.00 91.23  ? 1311 ILE A CG2   1 
ATOM   9784  C  CD1   . ILE A 1 1311 ? -49.078 -14.194 -21.411 1.00 108.51 ? 1311 ILE A CD1   1 
ATOM   9785  N  N     . ARG A 1 1312 ? -50.639 -16.392 -16.662 1.00 96.67  ? 1312 ARG A N     1 
ATOM   9786  C  CA    . ARG A 1 1312 ? -51.696 -16.657 -15.678 1.00 98.96  ? 1312 ARG A CA    1 
ATOM   9787  C  C     . ARG A 1 1312 ? -51.169 -16.873 -14.271 1.00 104.79 ? 1312 ARG A C     1 
ATOM   9788  O  O     . ARG A 1 1312 ? -51.659 -16.262 -13.322 1.00 133.27 ? 1312 ARG A O     1 
ATOM   9789  C  CB    . ARG A 1 1312 ? -52.502 -17.888 -16.103 1.00 98.32  ? 1312 ARG A CB    1 
ATOM   9790  C  CG    . ARG A 1 1312 ? -53.574 -18.312 -15.104 1.00 104.68 ? 1312 ARG A CG    1 
ATOM   9791  C  CD    . ARG A 1 1312 ? -54.784 -17.405 -15.189 1.00 102.29 ? 1312 ARG A CD    1 
ATOM   9792  N  NE    . ARG A 1 1312 ? -55.747 -17.600 -14.108 1.00 90.79  ? 1312 ARG A NE    1 
ATOM   9793  C  CZ    . ARG A 1 1312 ? -55.577 -17.190 -12.859 1.00 92.64  ? 1312 ARG A CZ    1 
ATOM   9794  N  NH1   . ARG A 1 1312 ? -54.459 -16.590 -12.474 1.00 88.67  ? 1312 ARG A NH1   1 
ATOM   9795  N  NH2   . ARG A 1 1312 ? -56.530 -17.409 -11.975 1.00 106.30 ? 1312 ARG A NH2   1 
ATOM   9796  N  N     . MET A 1 1313 ? -50.180 -17.751 -14.154 1.00 93.86  ? 1313 MET A N     1 
ATOM   9797  C  CA    . MET A 1 1313 ? -49.645 -18.167 -12.861 1.00 90.82  ? 1313 MET A CA    1 
ATOM   9798  C  C     . MET A 1 1313 ? -48.838 -17.061 -12.184 1.00 82.08  ? 1313 MET A C     1 
ATOM   9799  O  O     . MET A 1 1313 ? -48.646 -17.092 -10.964 1.00 90.70  ? 1313 MET A O     1 
ATOM   9800  C  CB    . MET A 1 1313 ? -48.890 -19.477 -13.061 1.00 96.81  ? 1313 MET A CB    1 
ATOM   9801  C  CG    . MET A 1 1313 ? -49.730 -20.547 -13.775 1.00 92.66  ? 1313 MET A CG    1 
ATOM   9802  S  SD    . MET A 1 1313 ? -50.825 -21.568 -12.749 1.00 98.63  ? 1313 MET A SD    1 
ATOM   9803  C  CE    . MET A 1 1313 ? -51.722 -20.412 -11.716 1.00 99.96  ? 1313 MET A CE    1 
ATOM   9804  N  N     . ALA A 1 1314 ? -48.388 -16.091 -12.969 1.00 77.46  ? 1314 ALA A N     1 
ATOM   9805  C  CA    . ALA A 1 1314 ? -47.780 -14.874 -12.448 1.00 86.22  ? 1314 ALA A CA    1 
ATOM   9806  C  C     . ALA A 1 1314 ? -48.802 -13.886 -11.898 1.00 93.40  ? 1314 ALA A C     1 
ATOM   9807  O  O     . ALA A 1 1314 ? -48.500 -13.167 -10.940 1.00 106.27 ? 1314 ALA A O     1 
ATOM   9808  C  CB    . ALA A 1 1314 ? -46.935 -14.212 -13.507 1.00 95.00  ? 1314 ALA A CB    1 
ATOM   9809  N  N     . CYS A 1 1315 ? -50.003 -13.824 -12.486 1.00 99.26  ? 1315 CYS A N     1 
ATOM   9810  C  CA    . CYS A 1 1315 ? -51.119 -13.041 -11.899 1.00 108.42 ? 1315 CYS A CA    1 
ATOM   9811  C  C     . CYS A 1 1315 ? -51.794 -13.824 -10.781 1.00 109.60 ? 1315 CYS A C     1 
ATOM   9812  O  O     . CYS A 1 1315 ? -52.877 -14.385 -10.974 1.00 115.37 ? 1315 CYS A O     1 
ATOM   9813  C  CB    . CYS A 1 1315 ? -52.128 -12.668 -12.998 1.00 106.33 ? 1315 CYS A CB    1 
ATOM   9814  S  SG    . CYS A 1 1315 ? -51.391 -11.681 -14.322 1.00 108.41 ? 1315 CYS A SG    1 
ATOM   9815  N  N     . GLU A 1 1316 ? -51.147 -13.885 -9.613  1.00 108.91 ? 1316 GLU A N     1 
ATOM   9816  C  CA    . GLU A 1 1316 ? -51.673 -14.627 -8.486  1.00 106.26 ? 1316 GLU A CA    1 
ATOM   9817  C  C     . GLU A 1 1316 ? -52.889 -13.884 -7.914  1.00 111.62 ? 1316 GLU A C     1 
ATOM   9818  O  O     . GLU A 1 1316 ? -52.975 -12.651 -7.956  1.00 124.19 ? 1316 GLU A O     1 
ATOM   9819  C  CB    . GLU A 1 1316 ? -50.600 -14.855 -7.387  1.00 105.54 ? 1316 GLU A CB    1 
ATOM   9820  C  CG    . GLU A 1 1316 ? -49.223 -15.404 -7.823  1.00 106.86 ? 1316 GLU A CG    1 
ATOM   9821  C  CD    . GLU A 1 1316 ? -48.392 -16.070 -6.682  1.00 109.01 ? 1316 GLU A CD    1 
ATOM   9822  O  OE1   . GLU A 1 1316 ? -48.984 -16.757 -5.821  1.00 111.77 ? 1316 GLU A OE1   1 
ATOM   9823  O  OE2   . GLU A 1 1316 ? -47.134 -15.950 -6.638  1.00 94.36  ? 1316 GLU A OE2   1 
ATOM   9824  N  N     . ASP A 1 1317 ? -53.837 -14.683 -7.427  1.00 107.82 ? 1317 ASP A N     1 
ATOM   9825  C  CA    . ASP A 1 1317 ? -55.091 -14.223 -6.841  1.00 111.67 ? 1317 ASP A CA    1 
ATOM   9826  C  C     . ASP A 1 1317 ? -55.604 -15.354 -5.961  1.00 103.38 ? 1317 ASP A C     1 
ATOM   9827  O  O     . ASP A 1 1317 ? -54.831 -16.260 -5.686  1.00 86.59  ? 1317 ASP A O     1 
ATOM   9828  C  CB    . ASP A 1 1317 ? -56.110 -13.848 -7.930  1.00 118.30 ? 1317 ASP A CB    1 
ATOM   9829  C  CG    . ASP A 1 1317 ? -56.256 -14.921 -8.999  1.00 115.78 ? 1317 ASP A CG    1 
ATOM   9830  O  OD1   . ASP A 1 1317 ? -56.394 -16.101 -8.608  1.00 102.35 ? 1317 ASP A OD1   1 
ATOM   9831  O  OD2   . ASP A 1 1317 ? -56.235 -14.575 -10.218 1.00 117.23 ? 1317 ASP A OD2   1 
ATOM   9832  N  N     . LYS A 1 1318 ? -56.857 -15.323 -5.505  1.00 104.96 ? 1318 LYS A N     1 
ATOM   9833  C  CA    . LYS A 1 1318 ? -57.379 -16.420 -4.671  1.00 114.06 ? 1318 LYS A CA    1 
ATOM   9834  C  C     . LYS A 1 1318 ? -57.345 -17.780 -5.384  1.00 110.69 ? 1318 LYS A C     1 
ATOM   9835  O  O     . LYS A 1 1318 ? -57.161 -18.821 -4.750  1.00 116.04 ? 1318 LYS A O     1 
ATOM   9836  C  CB    . LYS A 1 1318 ? -58.798 -16.111 -4.158  1.00 121.12 ? 1318 LYS A CB    1 
ATOM   9837  C  CG    . LYS A 1 1318 ? -59.898 -16.030 -5.212  1.00 128.74 ? 1318 LYS A CG    1 
ATOM   9838  C  CD    . LYS A 1 1318 ? -61.229 -15.559 -4.612  1.00 134.37 ? 1318 LYS A CD    1 
ATOM   9839  C  CE    . LYS A 1 1318 ? -62.203 -15.018 -5.665  1.00 133.02 ? 1318 LYS A CE    1 
ATOM   9840  N  NZ    . LYS A 1 1318 ? -63.377 -14.261 -5.119  1.00 125.68 ? 1318 LYS A NZ    1 
ATOM   9841  N  N     . PHE A 1 1319 ? -57.499 -17.750 -6.706  1.00 107.86 ? 1319 PHE A N     1 
ATOM   9842  C  CA    . PHE A 1 1319 ? -57.556 -18.983 -7.507  1.00 101.40 ? 1319 PHE A CA    1 
ATOM   9843  C  C     . PHE A 1 1319 ? -56.183 -19.652 -7.629  1.00 105.28 ? 1319 PHE A C     1 
ATOM   9844  O  O     . PHE A 1 1319 ? -56.100 -20.875 -7.591  1.00 102.99 ? 1319 PHE A O     1 
ATOM   9845  C  CB    . PHE A 1 1319 ? -58.152 -18.722 -8.896  1.00 104.16 ? 1319 PHE A CB    1 
ATOM   9846  C  CG    . PHE A 1 1319 ? -59.482 -18.015 -8.865  1.00 101.60 ? 1319 PHE A CG    1 
ATOM   9847  C  CD1   . PHE A 1 1319 ? -60.597 -18.635 -8.293  1.00 94.86  ? 1319 PHE A CD1   1 
ATOM   9848  C  CD2   . PHE A 1 1319 ? -59.621 -16.723 -9.399  1.00 93.50  ? 1319 PHE A CD2   1 
ATOM   9849  C  CE1   . PHE A 1 1319 ? -61.822 -17.987 -8.257  1.00 89.68  ? 1319 PHE A CE1   1 
ATOM   9850  C  CE2   . PHE A 1 1319 ? -60.841 -16.073 -9.357  1.00 89.75  ? 1319 PHE A CE2   1 
ATOM   9851  C  CZ    . PHE A 1 1319 ? -61.939 -16.710 -8.788  1.00 91.64  ? 1319 PHE A CZ    1 
ATOM   9852  N  N     . THR A 1 1320 ? -55.114 -18.867 -7.744  1.00 107.85 ? 1320 THR A N     1 
ATOM   9853  C  CA    . THR A 1 1320 ? -53.758 -19.414 -7.734  1.00 108.33 ? 1320 THR A CA    1 
ATOM   9854  C  C     . THR A 1 1320 ? -53.407 -20.066 -6.385  1.00 114.32 ? 1320 THR A C     1 
ATOM   9855  O  O     . THR A 1 1320 ? -52.772 -21.112 -6.364  1.00 111.40 ? 1320 THR A O     1 
ATOM   9856  C  CB    . THR A 1 1320 ? -52.737 -18.350 -8.099  1.00 110.83 ? 1320 THR A CB    1 
ATOM   9857  O  OG1   . THR A 1 1320 ? -53.000 -17.936 -9.440  1.00 117.98 ? 1320 THR A OG1   1 
ATOM   9858  C  CG2   . THR A 1 1320 ? -51.317 -18.903 -8.016  1.00 116.25 ? 1320 THR A CG2   1 
ATOM   9859  N  N     . LYS A 1 1321 ? -53.839 -19.453 -5.276  1.00 120.24 ? 1321 LYS A N     1 
ATOM   9860  C  CA    . LYS A 1 1321 ? -53.607 -19.997 -3.925  1.00 128.70 ? 1321 LYS A CA    1 
ATOM   9861  C  C     . LYS A 1 1321 ? -54.414 -21.290 -3.699  1.00 133.73 ? 1321 LYS A C     1 
ATOM   9862  O  O     . LYS A 1 1321 ? -53.944 -22.217 -3.028  1.00 137.87 ? 1321 LYS A O     1 
ATOM   9863  C  CB    . LYS A 1 1321 ? -53.964 -18.980 -2.815  1.00 133.18 ? 1321 LYS A CB    1 
ATOM   9864  C  CG    . LYS A 1 1321 ? -53.690 -17.505 -3.086  1.00 137.65 ? 1321 LYS A CG    1 
ATOM   9865  C  CD    . LYS A 1 1321 ? -52.209 -17.168 -3.160  1.00 143.39 ? 1321 LYS A CD    1 
ATOM   9866  C  CE    . LYS A 1 1321 ? -51.970 -15.914 -3.999  1.00 145.71 ? 1321 LYS A CE    1 
ATOM   9867  N  NZ    . LYS A 1 1321 ? -52.718 -14.697 -3.562  1.00 138.76 ? 1321 LYS A NZ    1 
ATOM   9868  N  N     . MET A 1 1322 ? -55.620 -21.327 -4.270  1.00 127.08 ? 1322 MET A N     1 
ATOM   9869  C  CA    . MET A 1 1322 ? -56.596 -22.384 -4.018  1.00 122.66 ? 1322 MET A CA    1 
ATOM   9870  C  C     . MET A 1 1322 ? -56.241 -23.758 -4.598  1.00 122.46 ? 1322 MET A C     1 
ATOM   9871  O  O     . MET A 1 1322 ? -56.540 -24.775 -3.992  1.00 124.87 ? 1322 MET A O     1 
ATOM   9872  C  CB    . MET A 1 1322 ? -58.020 -21.967 -4.430  1.00 128.93 ? 1322 MET A CB    1 
ATOM   9873  C  CG    . MET A 1 1322 ? -59.132 -22.676 -3.647  1.00 130.04 ? 1322 MET A CG    1 
ATOM   9874  S  SD    . MET A 1 1322 ? -60.823 -22.484 -4.295  1.00 128.23 ? 1322 MET A SD    1 
ATOM   9875  C  CE    . MET A 1 1322 ? -61.052 -20.694 -4.310  1.00 120.19 ? 1322 MET A CE    1 
ATOM   9876  N  N     . ILE A 1 1323 ? -55.618 -23.783 -5.767  1.00 121.81 ? 1323 ILE A N     1 
ATOM   9877  C  CA    . ILE A 1 1323 ? -55.390 -25.022 -6.522  1.00 117.85 ? 1323 ILE A CA    1 
ATOM   9878  C  C     . ILE A 1 1323 ? -54.535 -26.047 -5.769  1.00 103.96 ? 1323 ILE A C     1 
ATOM   9879  O  O     . ILE A 1 1323 ? -53.594 -25.645 -5.082  1.00 118.11 ? 1323 ILE A O     1 
ATOM   9880  C  CB    . ILE A 1 1323 ? -54.709 -24.761 -7.912  1.00 127.01 ? 1323 ILE A CB    1 
ATOM   9881  C  CG1   . ILE A 1 1323 ? -53.266 -24.261 -7.774  1.00 126.75 ? 1323 ILE A CG1   1 
ATOM   9882  C  CG2   . ILE A 1 1323 ? -55.510 -23.796 -8.788  1.00 130.33 ? 1323 ILE A CG2   1 
ATOM   9883  C  CD1   . ILE A 1 1323 ? -52.246 -25.330 -8.091  1.00 128.26 ? 1323 ILE A CD1   1 
ATOM   9884  N  N     . PRO A 1 1324 ? -54.862 -27.355 -5.879  1.00 94.79  ? 1324 PRO A N     1 
ATOM   9885  C  CA    . PRO A 1 1324 ? -54.079 -28.392 -5.200  1.00 100.43 ? 1324 PRO A CA    1 
ATOM   9886  C  C     . PRO A 1 1324 ? -52.773 -28.674 -5.929  1.00 104.28 ? 1324 PRO A C     1 
ATOM   9887  O  O     . PRO A 1 1324 ? -52.757 -28.712 -7.141  1.00 116.24 ? 1324 PRO A O     1 
ATOM   9888  C  CB    . PRO A 1 1324 ? -55.012 -29.611 -5.203  1.00 97.20  ? 1324 PRO A CB    1 
ATOM   9889  C  CG    . PRO A 1 1324 ? -56.004 -29.346 -6.282  1.00 100.41 ? 1324 PRO A CG    1 
ATOM   9890  C  CD    . PRO A 1 1324 ? -56.136 -27.865 -6.410  1.00 95.94  ? 1324 PRO A CD    1 
ATOM   9891  N  N     . ARG A 1 1325 ? -51.688 -28.883 -5.179  1.00 101.61 ? 1325 ARG A N     1 
ATOM   9892  C  CA    . ARG A 1 1325 ? -50.347 -29.004 -5.750  1.00 106.95 ? 1325 ARG A CA    1 
ATOM   9893  C  C     . ARG A 1 1325 ? -49.659 -30.290 -5.316  1.00 128.49 ? 1325 ARG A C     1 
ATOM   9894  O  O     . ARG A 1 1325 ? -50.105 -31.008 -4.387  1.00 154.86 ? 1325 ARG A O     1 
ATOM   9895  C  CB    . ARG A 1 1325 ? -49.480 -27.807 -5.367  1.00 101.64 ? 1325 ARG A CB    1 
ATOM   9896  C  CG    . ARG A 1 1325 ? -50.195 -26.476 -5.441  1.00 95.45  ? 1325 ARG A CG    1 
ATOM   9897  C  CD    . ARG A 1 1325 ? -49.294 -25.405 -6.010  1.00 94.03  ? 1325 ARG A CD    1 
ATOM   9898  N  NE    . ARG A 1 1325 ? -49.941 -24.096 -5.964  1.00 99.89  ? 1325 ARG A NE    1 
ATOM   9899  C  CZ    . ARG A 1 1325 ? -49.568 -23.024 -6.672  1.00 103.88 ? 1325 ARG A CZ    1 
ATOM   9900  N  NH1   . ARG A 1 1325 ? -48.542 -23.088 -7.518  1.00 104.58 ? 1325 ARG A NH1   1 
ATOM   9901  N  NH2   . ARG A 1 1325 ? -50.231 -21.872 -6.540  1.00 102.43 ? 1325 ARG A NH2   1 
ATOM   9902  N  N     . ASP A 1 1326 ? -48.528 -30.576 -5.953  1.00 136.84 ? 1326 ASP A N     1 
ATOM   9903  C  CA    . ASP A 1 1326 ? -47.753 -31.793 -5.700  1.00 137.31 ? 1326 ASP A CA    1 
ATOM   9904  C  C     . ASP A 1 1326 ? -46.383 -31.451 -5.134  1.00 146.71 ? 1326 ASP A C     1 
ATOM   9905  O  O     . ASP A 1 1326 ? -45.855 -30.340 -5.331  1.00 152.42 ? 1326 ASP A O     1 
ATOM   9906  C  CB    . ASP A 1 1326 ? -47.712 -32.579 -7.008  1.00 130.84 ? 1326 ASP A CB    1 
ATOM   9907  C  CG    . ASP A 1 1326 ? -49.112 -32.723 -7.636  1.00 119.41 ? 1326 ASP A CG    1 
ATOM   9908  O  OD1   . ASP A 1 1326 ? -49.883 -33.577 -7.151  1.00 105.74 ? 1326 ASP A OD1   1 
ATOM   9909  O  OD2   . ASP A 1 1326 ? -49.452 -31.976 -8.589  1.00 106.04 ? 1326 ASP A OD2   1 
ATOM   9910  N  N     . GLU A 1 1327 ? -45.740 -32.442 -4.500  1.00 142.51 ? 1327 GLU A N     1 
ATOM   9911  C  CA    . GLU A 1 1327 ? -44.298 -32.345 -4.151  1.00 139.45 ? 1327 GLU A CA    1 
ATOM   9912  C  C     . GLU A 1 1327 ? -43.507 -32.599 -5.426  1.00 133.80 ? 1327 GLU A C     1 
ATOM   9913  O  O     . GLU A 1 1327 ? -43.905 -33.416 -6.248  1.00 149.64 ? 1327 GLU A O     1 
ATOM   9914  C  CB    . GLU A 1 1327 ? -43.816 -33.300 -3.067  1.00 146.14 ? 1327 GLU A CB    1 
ATOM   9915  C  CG    . GLU A 1 1327 ? -44.704 -33.389 -1.852  1.00 152.78 ? 1327 GLU A CG    1 
ATOM   9916  C  CD    . GLU A 1 1327 ? -45.715 -34.492 -2.013  1.00 158.19 ? 1327 GLU A CD    1 
ATOM   9917  O  OE1   . GLU A 1 1327 ? -46.374 -34.525 -3.086  1.00 151.76 ? 1327 GLU A OE1   1 
ATOM   9918  O  OE2   . GLU A 1 1327 ? -45.821 -35.326 -1.085  1.00 154.48 ? 1327 GLU A OE2   1 
ATOM   9919  N  N     . PRO A 1 1328 ? -42.392 -31.878 -5.610  1.00 128.07 ? 1328 PRO A N     1 
ATOM   9920  C  CA    . PRO A 1 1328 ? -41.457 -32.081 -6.740  1.00 126.15 ? 1328 PRO A CA    1 
ATOM   9921  C  C     . PRO A 1 1328 ? -41.186 -33.526 -7.226  1.00 122.52 ? 1328 PRO A C     1 
ATOM   9922  O  O     . PRO A 1 1328 ? -41.534 -33.855 -8.373  1.00 111.76 ? 1328 PRO A O     1 
ATOM   9923  C  CB    . PRO A 1 1328 ? -40.165 -31.421 -6.225  1.00 118.83 ? 1328 PRO A CB    1 
ATOM   9924  C  CG    . PRO A 1 1328 ? -40.662 -30.275 -5.389  1.00 115.92 ? 1328 PRO A CG    1 
ATOM   9925  C  CD    . PRO A 1 1328 ? -42.012 -30.680 -4.826  1.00 118.79 ? 1328 PRO A CD    1 
ATOM   9926  N  N     . GLY A 1 1329 ? -40.608 -34.371 -6.369  1.00 123.82 ? 1329 GLY A N     1 
ATOM   9927  C  CA    . GLY A 1 1329 ? -40.205 -35.722 -6.756  1.00 135.18 ? 1329 GLY A CA    1 
ATOM   9928  C  C     . GLY A 1 1329 ? -41.223 -36.826 -6.536  1.00 138.97 ? 1329 GLY A C     1 
ATOM   9929  O  O     . GLY A 1 1329 ? -40.882 -38.009 -6.670  1.00 147.03 ? 1329 GLY A O     1 
ATOM   9930  N  N     . SER A 1 1330 ? -42.463 -36.469 -6.194  1.00 136.69 ? 1330 SER A N     1 
ATOM   9931  C  CA    . SER A 1 1330 ? -43.529 -37.457 -5.943  1.00 135.28 ? 1330 SER A CA    1 
ATOM   9932  C  C     . SER A 1 1330 ? -44.106 -38.095 -7.210  1.00 136.48 ? 1330 SER A C     1 
ATOM   9933  O  O     . SER A 1 1330 ? -44.620 -39.210 -7.150  1.00 136.04 ? 1330 SER A O     1 
ATOM   9934  C  CB    . SER A 1 1330 ? -44.662 -36.855 -5.087  1.00 128.97 ? 1330 SER A CB    1 
ATOM   9935  O  OG    . SER A 1 1330 ? -44.722 -35.441 -5.187  1.00 121.22 ? 1330 SER A OG    1 
ATOM   9936  N  N     . TYR A 1 1331 ? -44.010 -37.389 -8.344  1.00 137.71 ? 1331 TYR A N     1 
ATOM   9937  C  CA    . TYR A 1 1331 ? -44.533 -37.849 -9.647  1.00 126.64 ? 1331 TYR A CA    1 
ATOM   9938  C  C     . TYR A 1 1331 ? -43.527 -37.580 -10.746 1.00 116.24 ? 1331 TYR A C     1 
ATOM   9939  O  O     . TYR A 1 1331 ? -42.639 -36.733 -10.583 1.00 106.42 ? 1331 TYR A O     1 
ATOM   9940  C  CB    . TYR A 1 1331 ? -45.820 -37.095 -10.000 1.00 123.35 ? 1331 TYR A CB    1 
ATOM   9941  C  CG    . TYR A 1 1331 ? -45.600 -35.611 -10.214 1.00 120.15 ? 1331 TYR A CG    1 
ATOM   9942  C  CD1   . TYR A 1 1331 ? -45.418 -34.749 -9.138  1.00 121.21 ? 1331 TYR A CD1   1 
ATOM   9943  C  CD2   . TYR A 1 1331 ? -45.552 -35.072 -11.490 1.00 125.06 ? 1331 TYR A CD2   1 
ATOM   9944  C  CE1   . TYR A 1 1331 ? -45.203 -33.390 -9.330  1.00 128.29 ? 1331 TYR A CE1   1 
ATOM   9945  C  CE2   . TYR A 1 1331 ? -45.343 -33.713 -11.691 1.00 127.25 ? 1331 TYR A CE2   1 
ATOM   9946  C  CZ    . TYR A 1 1331 ? -45.170 -32.878 -10.611 1.00 129.26 ? 1331 TYR A CZ    1 
ATOM   9947  O  OH    . TYR A 1 1331 ? -44.963 -31.537 -10.814 1.00 131.49 ? 1331 TYR A OH    1 
ATOM   9948  N  N     . VAL A 1 1332 ? -43.687 -38.273 -11.873 1.00 113.12 ? 1332 VAL A N     1 
ATOM   9949  C  CA    . VAL A 1 1332 ? -42.902 -37.998 -13.098 1.00 112.04 ? 1332 VAL A CA    1 
ATOM   9950  C  C     . VAL A 1 1332 ? -43.747 -37.102 -14.042 1.00 116.85 ? 1332 VAL A C     1 
ATOM   9951  O  O     . VAL A 1 1332 ? -44.821 -37.518 -14.462 1.00 123.91 ? 1332 VAL A O     1 
ATOM   9952  C  CB    . VAL A 1 1332 ? -42.410 -39.310 -13.807 1.00 101.14 ? 1332 VAL A CB    1 
ATOM   9953  C  CG1   . VAL A 1 1332 ? -43.527 -40.074 -14.510 1.00 96.43  ? 1332 VAL A CG1   1 
ATOM   9954  C  CG2   . VAL A 1 1332 ? -41.314 -39.010 -14.822 1.00 107.60 ? 1332 VAL A CG2   1 
ATOM   9955  N  N     . PRO A 1 1333 ? -43.281 -35.875 -14.348 1.00 109.31 ? 1333 PRO A N     1 
ATOM   9956  C  CA    . PRO A 1 1333 ? -44.130 -34.948 -15.094 1.00 102.99 ? 1333 PRO A CA    1 
ATOM   9957  C  C     . PRO A 1 1333 ? -44.219 -35.307 -16.565 1.00 107.19 ? 1333 PRO A C     1 
ATOM   9958  O  O     . PRO A 1 1333 ? -43.348 -35.985 -17.090 1.00 107.69 ? 1333 PRO A O     1 
ATOM   9959  C  CB    . PRO A 1 1333 ? -43.415 -33.610 -14.913 1.00 110.53 ? 1333 PRO A CB    1 
ATOM   9960  C  CG    . PRO A 1 1333 ? -41.980 -33.970 -14.721 1.00 112.70 ? 1333 PRO A CG    1 
ATOM   9961  C  CD    . PRO A 1 1333 ? -41.979 -35.280 -13.990 1.00 109.69 ? 1333 PRO A CD    1 
ATOM   9962  N  N     . TRP A 1 1334 ? -45.259 -34.833 -17.235 1.00 110.64 ? 1334 TRP A N     1 
ATOM   9963  C  CA    . TRP A 1 1334 ? -45.340 -34.914 -18.702 1.00 108.28 ? 1334 TRP A CA    1 
ATOM   9964  C  C     . TRP A 1 1334 ? -44.242 -34.096 -19.399 1.00 104.52 ? 1334 TRP A C     1 
ATOM   9965  O  O     . TRP A 1 1334 ? -43.840 -34.488 -20.488 1.00 98.67  ? 1334 TRP A O     1 
ATOM   9966  C  CB    . TRP A 1 1334 ? -46.684 -34.399 -19.227 1.00 108.84 ? 1334 TRP A CB    1 
ATOM   9967  C  CG    . TRP A 1 1334 ? -46.979 -34.664 -20.737 1.00 108.87 ? 1334 TRP A CG    1 
ATOM   9968  C  CD1   . TRP A 1 1334 ? -47.117 -33.724 -21.738 1.00 102.34 ? 1334 TRP A CD1   1 
ATOM   9969  C  CD2   . TRP A 1 1334 ? -47.214 -35.934 -21.363 1.00 95.60  ? 1334 TRP A CD2   1 
ATOM   9970  N  NE1   . TRP A 1 1334 ? -47.416 -34.336 -22.931 1.00 90.92  ? 1334 TRP A NE1   1 
ATOM   9971  C  CE2   . TRP A 1 1334 ? -47.483 -35.689 -22.728 1.00 94.63  ? 1334 TRP A CE2   1 
ATOM   9972  C  CE3   . TRP A 1 1334 ? -47.226 -37.252 -20.902 1.00 95.81  ? 1334 TRP A CE3   1 
ATOM   9973  C  CZ2   . TRP A 1 1334 ? -47.751 -36.718 -23.634 1.00 101.56 ? 1334 TRP A CZ2   1 
ATOM   9974  C  CZ3   . TRP A 1 1334 ? -47.494 -38.279 -21.809 1.00 99.96  ? 1334 TRP A CZ3   1 
ATOM   9975  C  CH2   . TRP A 1 1334 ? -47.750 -38.004 -23.156 1.00 99.79  ? 1334 TRP A CH2   1 
ATOM   9976  N  N     . ASN A 1 1335 ? -43.778 -33.001 -18.784 1.00 106.94 ? 1335 ASN A N     1 
ATOM   9977  C  CA    . ASN A 1 1335 ? -42.762 -32.098 -19.420 1.00 114.44 ? 1335 ASN A CA    1 
ATOM   9978  C  C     . ASN A 1 1335 ? -41.583 -31.685 -18.521 1.00 112.38 ? 1335 ASN A C     1 
ATOM   9979  O  O     . ASN A 1 1335 ? -41.528 -32.075 -17.369 1.00 111.21 ? 1335 ASN A O     1 
ATOM   9980  C  CB    . ASN A 1 1335 ? -43.481 -30.916 -20.092 1.00 114.06 ? 1335 ASN A CB    1 
ATOM   9981  C  CG    . ASN A 1 1335 ? -44.331 -31.359 -21.289 1.00 122.20 ? 1335 ASN A CG    1 
ATOM   9982  O  OD1   . ASN A 1 1335 ? -43.841 -32.007 -22.224 1.00 125.25 ? 1335 ASN A OD1   1 
ATOM   9983  N  ND2   . ASN A 1 1335 ? -45.610 -31.017 -21.259 1.00 122.46 ? 1335 ASN A ND2   1 
ATOM   9984  N  N     . VAL A 1 1336 ? -40.644 -30.923 -19.081 1.00 112.68 ? 1336 VAL A N     1 
ATOM   9985  C  CA    . VAL A 1 1336 ? -39.450 -30.339 -18.387 1.00 114.99 ? 1336 VAL A CA    1 
ATOM   9986  C  C     . VAL A 1 1336 ? -38.460 -31.424 -17.974 1.00 112.98 ? 1336 VAL A C     1 
ATOM   9987  O  O     . VAL A 1 1336 ? -37.998 -32.181 -18.821 1.00 99.32  ? 1336 VAL A O     1 
ATOM   9988  C  CB    . VAL A 1 1336 ? -39.735 -29.281 -17.258 1.00 113.50 ? 1336 VAL A CB    1 
ATOM   9989  C  CG1   . VAL A 1 1336 ? -39.517 -29.855 -15.860 1.00 112.10 ? 1336 VAL A CG1   1 
ATOM   9990  C  CG2   . VAL A 1 1336 ? -38.829 -28.053 -17.428 1.00 101.37 ? 1336 VAL A CG2   1 
HETATM 9991  FE FE1   . FES B 2 .    ? -42.174 -17.479 -46.802 1.00 82.37  ? 3001 FES A FE1   1 
HETATM 9992  FE FE2   . FES B 2 .    ? -45.232 -17.110 -46.693 1.00 86.65  ? 3001 FES A FE2   1 
HETATM 9993  S  S1    . FES B 2 .    ? -43.591 -16.265 -48.003 1.00 70.16  ? 3001 FES A S1    1 
HETATM 9994  S  S2    . FES B 2 .    ? -43.837 -18.685 -45.963 1.00 63.46  ? 3001 FES A S2    1 
HETATM 9995  FE FE1   . FES C 2 .    ? -52.114 -29.505 -45.703 1.00 134.82 ? 3002 FES A FE1   1 
HETATM 9996  FE FE2   . FES C 2 .    ? -50.405 -28.095 -43.683 1.00 146.05 ? 3002 FES A FE2   1 
HETATM 9997  S  S1    . FES C 2 .    ? -52.286 -27.490 -44.713 1.00 135.93 ? 3002 FES A S1    1 
HETATM 9998  S  S2    . FES C 2 .    ? -49.921 -29.266 -45.536 1.00 119.53 ? 3002 FES A S2    1 
HETATM 9999  N  N1    . MTE D 3 .    ? -36.078 -14.142 -45.239 1.00 98.85  ? 3003 MTE A N1    1 
HETATM 10000 C  C2    . MTE D 3 .    ? -36.802 -15.182 -45.793 1.00 106.47 ? 3003 MTE A C2    1 
HETATM 10001 N  N2    . MTE D 3 .    ? -37.983 -14.953 -46.435 1.00 96.99  ? 3003 MTE A N2    1 
HETATM 10002 N  N3    . MTE D 3 .    ? -36.372 -16.470 -45.729 1.00 108.17 ? 3003 MTE A N3    1 
HETATM 10003 C  C4    . MTE D 3 .    ? -35.207 -16.825 -45.118 1.00 106.08 ? 3003 MTE A C4    1 
HETATM 10004 O  O4    . MTE D 3 .    ? -34.817 -18.017 -45.065 1.00 98.02  ? 3003 MTE A O4    1 
HETATM 10005 N  N5    . MTE D 3 .    ? -33.218 -16.051 -43.824 1.00 95.32  ? 3003 MTE A N5    1 
HETATM 10006 C  C6    . MTE D 3 .    ? -32.680 -15.063 -42.894 1.00 94.31  ? 3003 MTE A C6    1 
HETATM 10007 C  C7    . MTE D 3 .    ? -32.772 -13.671 -43.516 1.00 96.74  ? 3003 MTE A C7    1 
HETATM 10008 N  N8    . MTE D 3 .    ? -34.113 -13.400 -44.055 1.00 104.64 ? 3003 MTE A N8    1 
HETATM 10009 C  C9    . MTE D 3 .    ? -34.359 -15.768 -44.509 1.00 100.96 ? 3003 MTE A C9    1 
HETATM 10010 C  C10   . MTE D 3 .    ? -34.884 -14.379 -44.595 1.00 100.82 ? 3003 MTE A C10   1 
HETATM 10011 C  "C1'" . MTE D 3 .    ? -31.262 -15.316 -42.443 1.00 93.90  ? 3003 MTE A "C1'" 1 
HETATM 10012 S  "S1'" . MTE D 3 .    ? -30.782 -16.481 -41.312 1.00 100.75 ? 3003 MTE A "S1'" 1 
HETATM 10013 C  "C2'" . MTE D 3 .    ? -30.257 -14.606 -42.900 1.00 94.00  ? 3003 MTE A "C2'" 1 
HETATM 10014 S  "S2'" . MTE D 3 .    ? -28.785 -15.016 -42.175 1.00 87.03  ? 3003 MTE A "S2'" 1 
HETATM 10015 C  "C3'" . MTE D 3 .    ? -30.439 -13.529 -43.951 1.00 98.54  ? 3003 MTE A "C3'" 1 
HETATM 10016 O  "O3'" . MTE D 3 .    ? -31.760 -13.603 -44.524 1.00 91.38  ? 3003 MTE A "O3'" 1 
HETATM 10017 C  "C4'" . MTE D 3 .    ? -29.331 -13.617 -45.023 1.00 105.85 ? 3003 MTE A "C4'" 1 
HETATM 10018 O  "O4'" . MTE D 3 .    ? -29.681 -12.923 -46.235 1.00 121.44 ? 3003 MTE A "O4'" 1 
HETATM 10019 P  P     . MTE D 3 .    ? -29.360 -11.355 -46.465 1.00 131.71 ? 3003 MTE A P     1 
HETATM 10020 O  O1P   . MTE D 3 .    ? -29.633 -11.064 -47.937 1.00 110.29 ? 3003 MTE A O1P   1 
HETATM 10021 O  O2P   . MTE D 3 .    ? -30.271 -10.596 -45.521 1.00 138.14 ? 3003 MTE A O2P   1 
HETATM 10022 O  O3P   . MTE D 3 .    ? -27.922 -11.319 -46.027 1.00 123.43 ? 3003 MTE A O3P   1 
HETATM 10023 P  PA    . FAD E 4 .    ? -64.118 -37.836 -39.658 1.00 81.31  ? 3004 FAD A PA    1 
HETATM 10024 O  O1A   . FAD E 4 .    ? -64.749 -37.902 -41.046 1.00 75.11  ? 3004 FAD A O1A   1 
HETATM 10025 O  O2A   . FAD E 4 .    ? -62.628 -37.750 -39.501 1.00 80.14  ? 3004 FAD A O2A   1 
HETATM 10026 O  O5B   . FAD E 4 .    ? -64.629 -39.110 -38.813 1.00 90.89  ? 3004 FAD A O5B   1 
HETATM 10027 C  C5B   . FAD E 4 .    ? -64.211 -39.379 -37.472 1.00 89.76  ? 3004 FAD A C5B   1 
HETATM 10028 C  C4B   . FAD E 4 .    ? -65.051 -40.488 -36.841 1.00 84.65  ? 3004 FAD A C4B   1 
HETATM 10029 O  O4B   . FAD E 4 .    ? -66.421 -40.121 -36.965 1.00 84.34  ? 3004 FAD A O4B   1 
HETATM 10030 C  C3B   . FAD E 4 .    ? -64.894 -41.821 -37.560 1.00 82.82  ? 3004 FAD A C3B   1 
HETATM 10031 O  O3B   . FAD E 4 .    ? -64.747 -42.884 -36.623 1.00 79.39  ? 3004 FAD A O3B   1 
HETATM 10032 C  C2B   . FAD E 4 .    ? -66.152 -41.959 -38.399 1.00 82.16  ? 3004 FAD A C2B   1 
HETATM 10033 O  O2B   . FAD E 4 .    ? -66.542 -43.308 -38.622 1.00 77.51  ? 3004 FAD A O2B   1 
HETATM 10034 C  C1B   . FAD E 4 .    ? -67.138 -41.223 -37.531 1.00 82.90  ? 3004 FAD A C1B   1 
HETATM 10035 N  N9A   . FAD E 4 .    ? -68.332 -40.624 -38.142 1.00 80.40  ? 3004 FAD A N9A   1 
HETATM 10036 C  C8A   . FAD E 4 .    ? -68.415 -39.488 -38.857 1.00 78.66  ? 3004 FAD A C8A   1 
HETATM 10037 N  N7A   . FAD E 4 .    ? -69.710 -39.204 -39.175 1.00 82.76  ? 3004 FAD A N7A   1 
HETATM 10038 C  C5A   . FAD E 4 .    ? -70.446 -40.170 -38.606 1.00 84.38  ? 3004 FAD A C5A   1 
HETATM 10039 C  C6A   . FAD E 4 .    ? -71.877 -40.480 -38.517 1.00 81.38  ? 3004 FAD A C6A   1 
HETATM 10040 N  N6A   . FAD E 4 .    ? -72.735 -39.661 -39.149 1.00 81.79  ? 3004 FAD A N6A   1 
HETATM 10041 N  N1A   . FAD E 4 .    ? -72.250 -41.594 -37.824 1.00 81.07  ? 3004 FAD A N1A   1 
HETATM 10042 C  C2A   . FAD E 4 .    ? -71.361 -42.408 -37.198 1.00 80.09  ? 3004 FAD A C2A   1 
HETATM 10043 N  N3A   . FAD E 4 .    ? -70.033 -42.179 -37.225 1.00 83.92  ? 3004 FAD A N3A   1 
HETATM 10044 C  C4A   . FAD E 4 .    ? -69.542 -41.100 -37.910 1.00 85.16  ? 3004 FAD A C4A   1 
HETATM 10045 N  N1    . FAD E 4 .    ? -61.672 -29.506 -32.653 1.00 100.11 ? 3004 FAD A N1    1 
HETATM 10046 C  C2    . FAD E 4 .    ? -61.990 -28.590 -31.725 1.00 101.62 ? 3004 FAD A C2    1 
HETATM 10047 O  O2    . FAD E 4 .    ? -62.924 -28.878 -30.959 1.00 101.27 ? 3004 FAD A O2    1 
HETATM 10048 N  N3    . FAD E 4 .    ? -61.351 -27.410 -31.601 1.00 108.74 ? 3004 FAD A N3    1 
HETATM 10049 C  C4    . FAD E 4 .    ? -60.348 -27.036 -32.410 1.00 106.85 ? 3004 FAD A C4    1 
HETATM 10050 O  O4    . FAD E 4 .    ? -59.780 -25.914 -32.274 1.00 116.97 ? 3004 FAD A O4    1 
HETATM 10051 C  C4X   . FAD E 4 .    ? -59.952 -27.999 -33.469 1.00 90.98  ? 3004 FAD A C4X   1 
HETATM 10052 N  N5    . FAD E 4 .    ? -58.948 -27.748 -34.324 1.00 91.55  ? 3004 FAD A N5    1 
HETATM 10053 C  C5X   . FAD E 4 .    ? -58.590 -28.645 -35.271 1.00 87.14  ? 3004 FAD A C5X   1 
HETATM 10054 C  C6    . FAD E 4 .    ? -57.537 -28.339 -36.140 1.00 83.34  ? 3004 FAD A C6    1 
HETATM 10055 C  C7    . FAD E 4 .    ? -57.150 -29.244 -37.117 1.00 79.99  ? 3004 FAD A C7    1 
HETATM 10056 C  C7M   . FAD E 4 .    ? -56.031 -28.911 -38.063 1.00 78.74  ? 3004 FAD A C7M   1 
HETATM 10057 C  C8    . FAD E 4 .    ? -57.868 -30.546 -37.221 1.00 85.59  ? 3004 FAD A C8    1 
HETATM 10058 C  C8M   . FAD E 4 .    ? -57.497 -31.561 -38.264 1.00 83.79  ? 3004 FAD A C8M   1 
HETATM 10059 C  C9    . FAD E 4 .    ? -58.917 -30.855 -36.363 1.00 88.54  ? 3004 FAD A C9    1 
HETATM 10060 C  C9A   . FAD E 4 .    ? -59.316 -29.947 -35.384 1.00 84.59  ? 3004 FAD A C9A   1 
HETATM 10061 N  N10   . FAD E 4 .    ? -60.374 -30.228 -34.499 1.00 79.10  ? 3004 FAD A N10   1 
HETATM 10062 C  C10   . FAD E 4 .    ? -60.690 -29.274 -33.534 1.00 87.96  ? 3004 FAD A C10   1 
HETATM 10063 C  "C1'" . FAD E 4 .    ? -61.122 -31.490 -34.524 1.00 76.91  ? 3004 FAD A "C1'" 1 
HETATM 10064 C  "C2'" . FAD E 4 .    ? -62.146 -31.525 -35.654 1.00 71.46  ? 3004 FAD A "C2'" 1 
HETATM 10065 O  "O2'" . FAD E 4 .    ? -63.115 -30.543 -35.302 1.00 69.25  ? 3004 FAD A "O2'" 1 
HETATM 10066 C  "C3'" . FAD E 4 .    ? -62.748 -32.940 -35.838 1.00 70.61  ? 3004 FAD A "C3'" 1 
HETATM 10067 O  "O3'" . FAD E 4 .    ? -61.821 -33.839 -36.440 1.00 68.62  ? 3004 FAD A "O3'" 1 
HETATM 10068 C  "C4'" . FAD E 4 .    ? -63.897 -33.032 -36.809 1.00 74.22  ? 3004 FAD A "C4'" 1 
HETATM 10069 O  "O4'" . FAD E 4 .    ? -65.046 -32.415 -36.244 1.00 84.32  ? 3004 FAD A "O4'" 1 
HETATM 10070 C  "C5'" . FAD E 4 .    ? -64.238 -34.477 -37.148 1.00 73.18  ? 3004 FAD A "C5'" 1 
HETATM 10071 O  "O5'" . FAD E 4 .    ? -65.202 -34.430 -38.197 1.00 74.43  ? 3004 FAD A "O5'" 1 
HETATM 10072 P  P     . FAD E 4 .    ? -64.946 -35.280 -39.529 1.00 70.79  ? 3004 FAD A P     1 
HETATM 10073 O  O1P   . FAD E 4 .    ? -63.681 -34.795 -40.153 1.00 76.93  ? 3004 FAD A O1P   1 
HETATM 10074 O  O2P   . FAD E 4 .    ? -66.127 -35.285 -40.470 1.00 71.05  ? 3004 FAD A O2P   1 
HETATM 10075 O  O3P   . FAD E 4 .    ? -64.749 -36.670 -38.778 1.00 67.52  ? 3004 FAD A O3P   1 
HETATM 10076 MO MO    . MOS F 5 .    ? -27.997 -17.004 -40.102 1.00 150.11 ? 3005 MOS A MO    1 
HETATM 10077 S  S     . MOS F 5 .    ? -26.081 -18.423 -40.217 0.63 113.74 ? 3005 MOS A S     1 
HETATM 10078 O  O1    . MOS F 5 .    ? -28.380 -17.334 -41.897 1.00 145.89 ? 3005 MOS A O1    1 
HETATM 10079 O  O2    . MOS F 5 .    ? -26.841 -15.622 -40.569 1.00 160.25 ? 3005 MOS A O2    1 
HETATM 10080 O  O     . HOH G 6 .    ? -33.087 -19.400 -27.299 1.00 101.43 ? 3101 HOH A O     1 
HETATM 10081 O  O     . HOH G 6 .    ? -55.176 -6.797  -11.004 1.00 88.36  ? 3102 HOH A O     1 
HETATM 10082 O  O     . HOH G 6 .    ? -33.475 -36.223 -26.823 1.00 74.32  ? 3103 HOH A O     1 
HETATM 10083 O  O     . HOH G 6 .    ? -37.695 -55.527 -52.581 1.00 65.11  ? 3104 HOH A O     1 
HETATM 10084 O  O     . HOH G 6 .    ? -49.343 -22.114 -50.415 1.00 82.86  ? 3105 HOH A O     1 
HETATM 10085 O  O     . HOH G 6 .    ? -32.708 -19.201 -69.296 1.00 63.72  ? 3106 HOH A O     1 
HETATM 10086 O  O     . HOH G 6 .    ? -47.967 -5.415  -30.175 1.00 88.89  ? 3107 HOH A O     1 
HETATM 10087 O  O     . HOH G 6 .    ? -36.351 -25.408 -53.144 1.00 75.05  ? 3108 HOH A O     1 
HETATM 10088 O  O     . HOH G 6 .    ? -38.433 -18.716 -26.148 1.00 70.21  ? 3109 HOH A O     1 
HETATM 10089 O  O     . HOH G 6 .    ? -59.230 -41.469 -52.081 1.00 84.61  ? 3110 HOH A O     1 
HETATM 10090 O  O     . HOH G 6 .    ? -47.787 -34.124 -16.357 1.00 83.12  ? 3111 HOH A O     1 
HETATM 10091 O  O     . HOH G 6 .    ? -25.404 -25.758 -30.212 1.00 98.59  ? 3112 HOH A O     1 
HETATM 10092 O  O     . HOH G 6 .    ? -46.767 0.212   -29.772 1.00 98.11  ? 3113 HOH A O     1 
HETATM 10093 O  O     . HOH G 6 .    ? -60.966 -12.438 -63.783 1.00 52.34  ? 3114 HOH A O     1 
HETATM 10094 O  O     . HOH G 6 .    ? -38.154 -18.734 -52.539 1.00 43.04  ? 3115 HOH A O     1 
HETATM 10095 O  O     . HOH G 6 .    ? -37.092 -55.612 -39.964 1.00 65.54  ? 3116 HOH A O     1 
HETATM 10096 O  O     . HOH G 6 .    ? -71.642 -25.476 -66.908 1.00 81.04  ? 3117 HOH A O     1 
HETATM 10097 O  O     . HOH G 6 .    ? -46.883 -34.997 -27.889 1.00 87.63  ? 3118 HOH A O     1 
HETATM 10098 O  O     . HOH G 6 .    ? -62.915 -18.598 -24.611 1.00 57.10  ? 3119 HOH A O     1 
HETATM 10099 O  O     . HOH G 6 .    ? -60.337 -11.054 -17.231 1.00 76.06  ? 3120 HOH A O     1 
HETATM 10100 O  O     . HOH G 6 .