data_5ETE
# 
_entry.id   5ETE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ETE         
WWPDB D_1000215491 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ETE 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Asojo, O.A.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                28838 
_citation.page_last                 28838 
_citation.title                     
'Structural and functional characterization of the CAP domain of pathogen-related yeast 1 (Pry1) protein.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/srep28838 
_citation.pdbx_database_id_PubMed   27344972 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Darwiche, R.'   1 
primary 'Kelleher, A.'   2 
primary 'Hudspeth, E.M.' 3 
primary 'Schneiter, R.'  4 
primary 'Asojo, O.A.'    5 
# 
_cell.entry_id           5ETE 
_cell.length_a           124.740 
_cell.length_b           124.740 
_cell.length_c           59.060 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5ETE 
_symmetry.space_group_name_H-M             'P 62 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                180 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Pry1p                    15903.875 1   ? ? 'residues 158-306' ? 
2 non-polymer syn '1,4-DIETHYLENE DIOXIDE' 88.105    4   ? ? ?                  ? 
3 water       nat water                    18.015    167 ? ? ?                  ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SASSSDSDLSDFASSVLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPAAVDAW
YNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAGNYEGEYADNVEPLA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SASSSDSDLSDFASSVLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPAAVDAW
YNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAGNYEGEYADNVEPLA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   SER n 
1 4   SER n 
1 5   SER n 
1 6   ASP n 
1 7   SER n 
1 8   ASP n 
1 9   LEU n 
1 10  SER n 
1 11  ASP n 
1 12  PHE n 
1 13  ALA n 
1 14  SER n 
1 15  SER n 
1 16  VAL n 
1 17  LEU n 
1 18  ALA n 
1 19  GLU n 
1 20  HIS n 
1 21  ASN n 
1 22  LYS n 
1 23  LYS n 
1 24  ARG n 
1 25  ALA n 
1 26  LEU n 
1 27  HIS n 
1 28  LYS n 
1 29  ASP n 
1 30  THR n 
1 31  PRO n 
1 32  ALA n 
1 33  LEU n 
1 34  SER n 
1 35  TRP n 
1 36  SER n 
1 37  ASP n 
1 38  THR n 
1 39  LEU n 
1 40  ALA n 
1 41  SER n 
1 42  TYR n 
1 43  ALA n 
1 44  GLN n 
1 45  ASP n 
1 46  TYR n 
1 47  ALA n 
1 48  ASP n 
1 49  ASN n 
1 50  TYR n 
1 51  ASP n 
1 52  CYS n 
1 53  SER n 
1 54  GLY n 
1 55  THR n 
1 56  LEU n 
1 57  THR n 
1 58  HIS n 
1 59  SER n 
1 60  GLY n 
1 61  GLY n 
1 62  PRO n 
1 63  TYR n 
1 64  GLY n 
1 65  GLU n 
1 66  ASN n 
1 67  LEU n 
1 68  ALA n 
1 69  LEU n 
1 70  GLY n 
1 71  TYR n 
1 72  ASP n 
1 73  GLY n 
1 74  PRO n 
1 75  ALA n 
1 76  ALA n 
1 77  VAL n 
1 78  ASP n 
1 79  ALA n 
1 80  TRP n 
1 81  TYR n 
1 82  ASN n 
1 83  GLU n 
1 84  ILE n 
1 85  SER n 
1 86  ASN n 
1 87  TYR n 
1 88  ASP n 
1 89  PHE n 
1 90  SER n 
1 91  ASN n 
1 92  PRO n 
1 93  GLY n 
1 94  PHE n 
1 95  SER n 
1 96  SER n 
1 97  ASN n 
1 98  THR n 
1 99  GLY n 
1 100 HIS n 
1 101 PHE n 
1 102 THR n 
1 103 GLN n 
1 104 VAL n 
1 105 VAL n 
1 106 TRP n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 GLN n 
1 112 VAL n 
1 113 GLY n 
1 114 CYS n 
1 115 GLY n 
1 116 ILE n 
1 117 LYS n 
1 118 THR n 
1 119 CYS n 
1 120 GLY n 
1 121 GLY n 
1 122 ALA n 
1 123 TRP n 
1 124 GLY n 
1 125 ASP n 
1 126 TYR n 
1 127 VAL n 
1 128 ILE n 
1 129 CYS n 
1 130 SER n 
1 131 TYR n 
1 132 ASP n 
1 133 PRO n 
1 134 ALA n 
1 135 GLY n 
1 136 ASN n 
1 137 TYR n 
1 138 GLU n 
1 139 GLY n 
1 140 GLU n 
1 141 TYR n 
1 142 ALA n 
1 143 ASP n 
1 144 ASN n 
1 145 VAL n 
1 146 GLU n 
1 147 PRO n 
1 148 LEU n 
1 149 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   149 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PRY1, H819_YJM1434J00135' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae YJM1434' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1294371 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      Pichia 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4919 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A0A0C6AG41_YEASX 
_struct_ref.pdbx_db_accession          A0A0C6AG41 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SASSSDSDLSDFASSVLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPAAVDAW
YNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAGNYEGEYADNVEPLA
;
_struct_ref.pdbx_align_begin           158 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5ETE 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 149 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             A0A0C6AG41 
_struct_ref_seq.db_align_beg                  158 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  306 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       151 
_struct_ref_seq.pdbx_auth_seq_align_end       299 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ? 'C3 H7 N O2 S'   121.158 
DIO non-polymer         . '1,4-DIETHYLENE DIOXIDE' ? 'C4 H8 O2'       88.105  
GLN 'L-peptide linking' y GLUTAMINE                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ETE 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.17 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         70.50 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.6M Ammonium sulphate, 0.1M MES pH 6.5, 10% v/v 1,4-dioxane' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS HTC' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-04-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54056 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54056 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5ETE 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.10 
_reflns.d_resolution_low                 30.75 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       17583 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5ETE 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     16203 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.485 
_refine.ls_d_res_high                            2.100 
_refine.ls_percent_reflns_obs                    99.44 
_refine.ls_R_factor_obs                          0.1682 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1671 
_refine.ls_R_factor_R_free                       0.1904 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.13 
_refine.ls_number_reflns_R_free                  831 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1SMB 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.20 
_refine.pdbx_overall_phase_error                 16.93 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1079 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             167 
_refine_hist.number_atoms_total               1270 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        28.485 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.011  ? ? 1137 'X-RAY DIFFRACTION' ? 
f_angle_d          0.935  ? ? 1548 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.132 ? ? 647  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.052  ? ? 155  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 203  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.1000 2.2315  2488 0.1879 100.00 0.2218 . . 157 . . 
'X-RAY DIFFRACTION' . 2.2315 2.4037  2512 0.1661 100.00 0.2080 . . 138 . . 
'X-RAY DIFFRACTION' . 2.4037 2.6455  2546 0.1689 100.00 0.1997 . . 122 . . 
'X-RAY DIFFRACTION' . 2.6455 3.0279  2543 0.1704 99.00  0.2062 . . 131 . . 
'X-RAY DIFFRACTION' . 3.0279 3.8134  2578 0.1679 99.00  0.1954 . . 123 . . 
'X-RAY DIFFRACTION' . 3.8134 28.4875 2705 0.1601 99.00  0.1669 . . 160 . . 
# 
_struct.entry_id                     5ETE 
_struct.title                        
'Structure of pathogen-related yeast protein, Pry1 in complex with a competitive inhibitor of cholesterol binding' 
_struct.pdbx_descriptor              Pry1p 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5ETE 
_struct_keywords.text            
;TAPs, testis specific proteins, Tpx, antigen 5, Ag5, pathogenesis related-1, PR-1, Sc7, CAP, cysteine-rich secretory protein, CRISP, Sterol binding protein
;
_struct_keywords.pdbx_keywords   'Sterol binding protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 10  ? ALA A 25  ? SER A 160 ALA A 175 1 ? 16 
HELX_P HELX_P2 AA2 SER A 36  ? ASN A 49  ? SER A 186 ASN A 199 1 ? 14 
HELX_P HELX_P3 AA3 ASP A 72  ? GLU A 83  ? ASP A 222 GLU A 233 1 ? 12 
HELX_P HELX_P4 AA4 ILE A 84  ? TYR A 87  ? ILE A 234 TYR A 237 5 ? 4  
HELX_P HELX_P5 AA5 THR A 98  ? TRP A 106 ? THR A 248 TRP A 256 1 ? 9  
HELX_P HELX_P6 AA6 GLU A 140 ? VAL A 145 ? GLU A 290 VAL A 295 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 52  SG ? ? ? 1_555 A CYS 119 SG ? ? A CYS 202 A CYS 269 1_555 ? ? ? ? ? ? ? 2.073 ? 
disulf2 disulf ? ? A CYS 114 SG ? ? ? 1_555 A CYS 129 SG ? ? A CYS 264 A CYS 279 1_555 ? ? ? ? ? ? ? 2.111 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           132 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            282 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    133 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     283 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -15.03 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 34  ? TRP A 35  ? SER A 184 TRP A 185 
AA1 2 GLN A 111 ? THR A 118 ? GLN A 261 THR A 268 
AA1 3 ASP A 125 ? ASP A 132 ? ASP A 275 ASP A 282 
AA1 4 GLY A 64  ? LEU A 69  ? GLY A 214 LEU A 219 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 34  ? N SER A 184 O VAL A 112 ? O VAL A 262 
AA1 2 3 N GLY A 113 ? N GLY A 263 O SER A 130 ? O SER A 280 
AA1 3 4 O TYR A 131 ? O TYR A 281 N GLY A 64  ? N GLY A 214 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A DIO 301 ? 8 'binding site for residue DIO A 301' 
AC2 Software A DIO 302 ? 6 'binding site for residue DIO A 302' 
AC3 Software A DIO 303 ? 3 'binding site for residue DIO A 303' 
AC4 Software A DIO 304 ? 5 'binding site for residue DIO A 304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 GLY A 70  ? GLY A 220 . ? 11_555 ? 
2  AC1 8 ASN A 86  ? ASN A 236 . ? 1_555  ? 
3  AC1 8 TYR A 87  ? TYR A 237 . ? 1_555  ? 
4  AC1 8 ASP A 88  ? ASP A 238 . ? 1_555  ? 
5  AC1 8 GLY A 93  ? GLY A 243 . ? 1_555  ? 
6  AC1 8 PHE A 94  ? PHE A 244 . ? 1_555  ? 
7  AC1 8 SER A 95  ? SER A 245 . ? 1_555  ? 
8  AC1 8 HOH F .   ? HOH A 453 . ? 11_555 ? 
9  AC2 6 TYR A 63  ? TYR A 213 . ? 9_555  ? 
10 AC2 6 TYR A 63  ? TYR A 213 . ? 1_555  ? 
11 AC2 6 GLN A 111 ? GLN A 261 . ? 9_555  ? 
12 AC2 6 GLN A 111 ? GLN A 261 . ? 1_555  ? 
13 AC2 6 ASP A 132 ? ASP A 282 . ? 1_555  ? 
14 AC2 6 ASP A 132 ? ASP A 282 . ? 9_555  ? 
15 AC3 3 THR A 110 ? THR A 260 . ? 9_555  ? 
16 AC3 3 GLN A 111 ? GLN A 261 . ? 1_555  ? 
17 AC3 3 GLN A 111 ? GLN A 261 . ? 9_555  ? 
18 AC4 5 GLY A 61  ? GLY A 211 . ? 1_555  ? 
19 AC4 5 PRO A 62  ? PRO A 212 . ? 1_555  ? 
20 AC4 5 TYR A 63  ? TYR A 213 . ? 1_555  ? 
21 AC4 5 ALA A 134 ? ALA A 284 . ? 1_555  ? 
22 AC4 5 TYR A 137 ? TYR A 287 . ? 1_555  ? 
# 
_atom_sites.entry_id                    5ETE 
_atom_sites.fract_transf_matrix[1][1]   0.008017 
_atom_sites.fract_transf_matrix[1][2]   0.004628 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009257 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016932 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N      . ASP A 1 8   ? -21.604 50.195 26.219  1.00 54.85  ? 158 ASP A N      1 
ATOM   2    C CA     . ASP A 1 8   ? -20.668 51.201 25.707  1.00 71.69  ? 158 ASP A CA     1 
ATOM   3    C C      . ASP A 1 8   ? -19.441 50.560 25.065  1.00 58.48  ? 158 ASP A C      1 
ATOM   4    O O      . ASP A 1 8   ? -18.952 49.528 25.525  1.00 53.98  ? 158 ASP A O      1 
ATOM   5    C CB     . ASP A 1 8   ? -20.213 52.149 26.819  1.00 66.06  ? 158 ASP A CB     1 
ATOM   6    C CG     . ASP A 1 8   ? -21.307 53.097 27.261  1.00 81.61  ? 158 ASP A CG     1 
ATOM   7    O OD1    . ASP A 1 8   ? -22.400 53.055 26.656  1.00 77.88  ? 158 ASP A OD1    1 
ATOM   8    O OD2    . ASP A 1 8   ? -21.070 53.888 28.203  1.00 71.80  ? 158 ASP A OD2    1 
ATOM   9    H HA     . ASP A 1 8   ? -21.117 51.730 25.029  1.00 86.00  ? 158 ASP A HA     1 
ATOM   10   H HB2    . ASP A 1 8   ? -19.940 51.625 27.589  1.00 79.24  ? 158 ASP A HB2    1 
ATOM   11   H HB3    . ASP A 1 8   ? -19.467 52.679 26.498  1.00 79.24  ? 158 ASP A HB3    1 
ATOM   12   N N      . LEU A 1 9   ? -18.935 51.192 24.009  1.00 57.64  ? 159 LEU A N      1 
ATOM   13   C CA     . LEU A 1 9   ? -17.785 50.656 23.292  1.00 50.19  ? 159 LEU A CA     1 
ATOM   14   C C      . LEU A 1 9   ? -16.512 50.790 24.120  1.00 43.52  ? 159 LEU A C      1 
ATOM   15   O O      . LEU A 1 9   ? -16.356 51.719 24.919  1.00 42.20  ? 159 LEU A O      1 
ATOM   16   C CB     . LEU A 1 9   ? -17.598 51.384 21.956  1.00 42.09  ? 159 LEU A CB     1 
ATOM   17   C CG     . LEU A 1 9   ? -18.760 51.370 20.957  1.00 45.37  ? 159 LEU A CG     1 
ATOM   18   C CD1    . LEU A 1 9   ? -18.332 52.005 19.633  1.00 38.22  ? 159 LEU A CD1    1 
ATOM   19   C CD2    . LEU A 1 9   ? -19.261 49.958 20.737  1.00 41.63  ? 159 LEU A CD2    1 
ATOM   20   H H      . LEU A 1 9   ? -19.239 51.930 23.689  1.00 69.14  ? 159 LEU A H      1 
ATOM   21   H HA     . LEU A 1 9   ? -17.931 49.715 23.109  1.00 60.20  ? 159 LEU A HA     1 
ATOM   22   H HB2    . LEU A 1 9   ? -17.403 52.314 22.149  1.00 50.48  ? 159 LEU A HB2    1 
ATOM   23   H HB3    . LEU A 1 9   ? -16.835 50.988 21.506  1.00 50.48  ? 159 LEU A HB3    1 
ATOM   24   H HG     . LEU A 1 9   ? -19.492 51.895 21.317  1.00 54.41  ? 159 LEU A HG     1 
ATOM   25   H HD11   . LEU A 1 9   ? -19.081 51.985 19.017  1.00 45.83  ? 159 LEU A HD11   1 
ATOM   26   H HD12   . LEU A 1 9   ? -18.061 52.922 19.796  1.00 45.83  ? 159 LEU A HD12   1 
ATOM   27   H HD13   . LEU A 1 9   ? -17.589 51.500 19.267  1.00 45.83  ? 159 LEU A HD13   1 
ATOM   28   H HD21   . LEU A 1 9   ? -19.994 49.979 20.102  1.00 49.93  ? 159 LEU A HD21   1 
ATOM   29   H HD22   . LEU A 1 9   ? -18.536 49.417 20.388  1.00 49.93  ? 159 LEU A HD22   1 
ATOM   30   H HD23   . LEU A 1 9   ? -19.566 49.597 21.584  1.00 49.93  ? 159 LEU A HD23   1 
ATOM   31   N N      . SER A 1 10  ? -15.587 49.852 23.908  1.00 36.81  ? 160 SER A N      1 
ATOM   32   C CA     . SER A 1 10  ? -14.236 50.020 24.413  1.00 32.95  ? 160 SER A CA     1 
ATOM   33   C C      . SER A 1 10  ? -13.565 51.237 23.755  1.00 32.44  ? 160 SER A C      1 
ATOM   34   O O      . SER A 1 10  ? -14.042 51.798 22.757  1.00 29.25  ? 160 SER A O      1 
ATOM   35   C CB     . SER A 1 10  ? -13.410 48.754 24.166  1.00 32.28  ? 160 SER A CB     1 
ATOM   36   O OG     . SER A 1 10  ? -13.230 48.492 22.775  1.00 31.85  ? 160 SER A OG     1 
ATOM   37   H H      . SER A 1 10  ? -15.720 49.119 23.478  1.00 44.14  ? 160 SER A H      1 
ATOM   38   H HA     . SER A 1 10  ? -14.272 50.175 25.370  1.00 39.52  ? 160 SER A HA     1 
ATOM   39   H HB2    . SER A 1 10  ? -12.539 48.866 24.578  1.00 38.71  ? 160 SER A HB2    1 
ATOM   40   H HB3    . SER A 1 10  ? -13.868 48.000 24.569  1.00 38.71  ? 160 SER A HB3    1 
ATOM   41   H HG     . SER A 1 10  ? -12.774 47.794 22.671  1.00 38.20  ? 160 SER A HG     1 
ATOM   42   N N      . ASP A 1 11  ? -12.433 51.640 24.337  1.00 32.20  ? 161 ASP A N      1 
ATOM   43   C CA     . ASP A 1 11  ? -11.640 52.719 23.763  1.00 30.54  ? 161 ASP A CA     1 
ATOM   44   C C      . ASP A 1 11  ? -11.077 52.322 22.398  1.00 35.33  ? 161 ASP A C      1 
ATOM   45   O O      . ASP A 1 11  ? -11.018 53.148 21.477  1.00 28.21  ? 161 ASP A O      1 
ATOM   46   C CB     . ASP A 1 11  ? -10.529 53.106 24.743  1.00 38.96  ? 161 ASP A CB     1 
ATOM   47   C CG     . ASP A 1 11  ? -11.073 53.732 26.051  1.00 46.54  ? 161 ASP A CG     1 
ATOM   48   O OD1    . ASP A 1 11  ? -12.266 54.120 26.111  1.00 44.14  ? 161 ASP A OD1    1 
ATOM   49   O OD2    . ASP A 1 11  ? -10.303 53.844 27.028  1.00 46.13  ? 161 ASP A OD2    1 
ATOM   50   H H      . ASP A 1 11  ? -12.107 51.305 25.059  1.00 38.61  ? 161 ASP A H      1 
ATOM   51   H HA     . ASP A 1 11  ? -12.209 53.495 23.637  1.00 36.62  ? 161 ASP A HA     1 
ATOM   52   H HB2    . ASP A 1 11  ? -10.024 52.311 24.978  1.00 46.72  ? 161 ASP A HB2    1 
ATOM   53   H HB3    . ASP A 1 11  ? -9.946  53.756 24.319  1.00 46.72  ? 161 ASP A HB3    1 
ATOM   54   N N      . PHE A 1 12  ? -10.681 51.052 22.238  1.00 29.18  ? 162 PHE A N      1 
ATOM   55   C CA     . PHE A 1 12  ? -10.249 50.561 20.931  1.00 29.07  ? 162 PHE A CA     1 
ATOM   56   C C      . PHE A 1 12  ? -11.355 50.739 19.894  1.00 28.75  ? 162 PHE A C      1 
ATOM   57   O O      . PHE A 1 12  ? -11.142 51.346 18.833  1.00 26.24  ? 162 PHE A O      1 
ATOM   58   C CB     . PHE A 1 12  ? -9.825  49.086 21.037  1.00 27.72  ? 162 PHE A CB     1 
ATOM   59   C CG     . PHE A 1 12  ? -9.392  48.456 19.720  1.00 25.52  ? 162 PHE A CG     1 
ATOM   60   C CD1    . PHE A 1 12  ? -8.192  48.806 19.116  1.00 28.61  ? 162 PHE A CD1    1 
ATOM   61   C CD2    . PHE A 1 12  ? -10.185 47.500 19.104  1.00 25.86  ? 162 PHE A CD2    1 
ATOM   62   C CE1    . PHE A 1 12  ? -7.798  48.221 17.917  1.00 26.73  ? 162 PHE A CE1    1 
ATOM   63   C CE2    . PHE A 1 12  ? -9.800  46.910 17.915  1.00 30.61  ? 162 PHE A CE2    1 
ATOM   64   C CZ     . PHE A 1 12  ? -8.611  47.262 17.317  1.00 24.84  ? 162 PHE A CZ     1 
ATOM   65   H H      . PHE A 1 12  ? -10.654 50.464 22.865  1.00 34.99  ? 162 PHE A H      1 
ATOM   66   H HA     . PHE A 1 12  ? -9.479  51.074 20.639  1.00 34.85  ? 162 PHE A HA     1 
ATOM   67   H HB2    . PHE A 1 12  ? -9.079  49.021 21.654  1.00 33.24  ? 162 PHE A HB2    1 
ATOM   68   H HB3    . PHE A 1 12  ? -10.574 48.572 21.377  1.00 33.24  ? 162 PHE A HB3    1 
ATOM   69   H HD1    . PHE A 1 12  ? -7.646  49.443 19.516  1.00 34.31  ? 162 PHE A HD1    1 
ATOM   70   H HD2    . PHE A 1 12  ? -10.989 47.251 19.498  1.00 31.01  ? 162 PHE A HD2    1 
ATOM   71   H HE1    . PHE A 1 12  ? -6.992  48.465 17.521  1.00 32.05  ? 162 PHE A HE1    1 
ATOM   72   H HE2    . PHE A 1 12  ? -10.348 46.273 17.516  1.00 36.71  ? 162 PHE A HE2    1 
ATOM   73   H HZ     . PHE A 1 12  ? -8.356  46.867 16.514  1.00 29.77  ? 162 PHE A HZ     1 
ATOM   74   N N      . ALA A 1 13  ? -12.557 50.240 20.199  1.00 26.56  ? 163 ALA A N      1 
ATOM   75   C CA     . ALA A 1 13  ? -13.652 50.293 19.231  1.00 25.61  ? 163 ALA A CA     1 
ATOM   76   C C      . ALA A 1 13  ? -14.036 51.736 18.898  1.00 28.26  ? 163 ALA A C      1 
ATOM   77   O O      . ALA A 1 13  ? -14.250 52.077 17.728  1.00 24.67  ? 163 ALA A O      1 
ATOM   78   C CB     . ALA A 1 13  ? -14.865 49.518 19.761  1.00 29.23  ? 163 ALA A CB     1 
ATOM   79   H H      . ALA A 1 13  ? -12.760 49.871 20.949  1.00 31.85  ? 163 ALA A H      1 
ATOM   80   H HA     . ALA A 1 13  ? -13.364 49.866 18.409  1.00 30.71  ? 163 ALA A HA     1 
ATOM   81   H HB1    . ALA A 1 13  ? -15.580 49.564 19.106  1.00 35.05  ? 163 ALA A HB1    1 
ATOM   82   H HB2    . ALA A 1 13  ? -14.610 48.594 19.907  1.00 35.05  ? 163 ALA A HB2    1 
ATOM   83   H HB3    . ALA A 1 13  ? -15.155 49.918 20.596  1.00 35.05  ? 163 ALA A HB3    1 
ATOM   84   N N      . SER A 1 14  ? -14.149 52.598 19.907  1.00 22.73  ? 164 SER A N      1 
ATOM   85   C CA     . SER A 1 14  ? -14.601 53.961 19.620  1.00 26.80  ? 164 SER A CA     1 
ATOM   86   C C      . SER A 1 14  ? -13.554 54.739 18.815  1.00 28.61  ? 164 SER A C      1 
ATOM   87   O O      . SER A 1 14  ? -13.906 55.503 17.900  1.00 22.34  ? 164 SER A O      1 
ATOM   88   C CB     . SER A 1 14  ? -14.968 54.695 20.919  1.00 29.33  ? 164 SER A CB     1 
ATOM   89   O OG     . SER A 1 14  ? -13.883 54.771 21.801  1.00 41.60  ? 164 SER A OG     1 
ATOM   90   H H      . SER A 1 14  ? -13.979 52.430 20.733  1.00 27.24  ? 164 SER A H      1 
ATOM   91   H HA     . SER A 1 14  ? -15.405 53.910 19.079  1.00 32.13  ? 164 SER A HA     1 
ATOM   92   H HB2    . SER A 1 14  ? -15.255 55.595 20.699  1.00 35.17  ? 164 SER A HB2    1 
ATOM   93   H HB3    . SER A 1 14  ? -15.691 54.217 21.354  1.00 35.17  ? 164 SER A HB3    1 
ATOM   94   H HG     . SER A 1 14  ? -13.624 53.998 22.004  1.00 49.89  ? 164 SER A HG     1 
ATOM   95   N N      . SER A 1 15  ? -12.264 54.533 19.105  1.00 18.87  ? 165 SER A N      1 
ATOM   96   C CA     . SER A 1 15  ? -11.237 55.266 18.363  1.00 22.33  ? 165 SER A CA     1 
ATOM   97   C C      . SER A 1 15  ? -11.144 54.794 16.908  1.00 23.32  ? 165 SER A C      1 
ATOM   98   O O      . SER A 1 15  ? -10.993 55.617 16.002  1.00 23.22  ? 165 SER A O      1 
ATOM   99   C CB     . SER A 1 15  ? -9.878  55.159 19.083  1.00 25.02  ? 165 SER A CB     1 
ATOM   100  O OG     . SER A 1 15  ? -9.320  53.850 19.031  1.00 25.86  ? 165 SER A OG     1 
ATOM   101  H H      . SER A 1 15  ? -11.967 53.993 19.706  1.00 22.61  ? 165 SER A H      1 
ATOM   102  H HA     . SER A 1 15  ? -11.483 56.204 18.347  1.00 26.77  ? 165 SER A HA     1 
ATOM   103  H HB2    . SER A 1 15  ? -9.258  55.776 18.663  1.00 30.00  ? 165 SER A HB2    1 
ATOM   104  H HB3    . SER A 1 15  ? -10.002 55.405 20.013  1.00 30.00  ? 165 SER A HB3    1 
ATOM   105  H HG     . SER A 1 15  ? -9.841  53.302 19.396  1.00 31.00  ? 165 SER A HG     1 
ATOM   106  N N      . VAL A 1 16  ? -11.232 53.480 16.662  1.00 20.61  ? 166 VAL A N      1 
ATOM   107  C CA     . VAL A 1 16  ? -11.163 52.954 15.305  1.00 21.05  ? 166 VAL A CA     1 
ATOM   108  C C      . VAL A 1 16  ? -12.409 53.344 14.502  1.00 22.32  ? 166 VAL A C      1 
ATOM   109  O O      . VAL A 1 16  ? -12.317 53.662 13.314  1.00 22.30  ? 166 VAL A O      1 
ATOM   110  C CB     . VAL A 1 16  ? -10.952 51.430 15.361  1.00 24.96  ? 166 VAL A CB     1 
ATOM   111  C CG1    . VAL A 1 16  ? -11.044 50.793 13.992  1.00 22.47  ? 166 VAL A CG1    1 
ATOM   112  C CG2    . VAL A 1 16  ? -9.573  51.111 15.992  1.00 24.76  ? 166 VAL A CG2    1 
ATOM   113  H H      . VAL A 1 16  ? -11.331 52.877 17.267  1.00 24.70  ? 166 VAL A H      1 
ATOM   114  H HA     . VAL A 1 16  ? -10.393 53.342 14.860  1.00 25.23  ? 166 VAL A HA     1 
ATOM   115  H HB     . VAL A 1 16  ? -11.638 51.036 15.922  1.00 29.93  ? 166 VAL A HB     1 
ATOM   116  H HG11   . VAL A 1 16  ? -10.905 49.837 14.079  1.00 26.94  ? 166 VAL A HG11   1 
ATOM   117  H HG12   . VAL A 1 16  ? -11.923 50.967 13.621  1.00 26.94  ? 166 VAL A HG12   1 
ATOM   118  H HG13   . VAL A 1 16  ? -10.360 51.176 13.420  1.00 26.94  ? 166 VAL A HG13   1 
ATOM   119  H HG21   . VAL A 1 16  ? -9.454  50.149 16.021  1.00 29.68  ? 166 VAL A HG21   1 
ATOM   120  H HG22   . VAL A 1 16  ? -8.877  51.515 15.450  1.00 29.68  ? 166 VAL A HG22   1 
ATOM   121  H HG23   . VAL A 1 16  ? -9.545  51.475 16.891  1.00 29.68  ? 166 VAL A HG23   1 
ATOM   122  N N      . LEU A 1 17  ? -13.591 53.299 15.123  1.00 21.69  ? 167 LEU A N      1 
ATOM   123  C CA     . LEU A 1 17  ? -14.816 53.690 14.427  1.00 19.55  ? 167 LEU A CA     1 
ATOM   124  C C      . LEU A 1 17  ? -14.764 55.153 14.013  1.00 20.24  ? 167 LEU A C      1 
ATOM   125  O O      . LEU A 1 17  ? -15.113 55.503 12.874  1.00 21.93  ? 167 LEU A O      1 
ATOM   126  C CB     . LEU A 1 17  ? -16.052 53.450 15.315  1.00 22.47  ? 167 LEU A CB     1 
ATOM   127  C CG     . LEU A 1 17  ? -17.386 53.657 14.588  1.00 21.42  ? 167 LEU A CG     1 
ATOM   128  C CD1    . LEU A 1 17  ? -17.611 52.564 13.528  1.00 26.08  ? 167 LEU A CD1    1 
ATOM   129  C CD2    . LEU A 1 17  ? -18.575 53.718 15.586  1.00 21.02  ? 167 LEU A CD2    1 
ATOM   130  H H      . LEU A 1 17  ? -13.709 53.048 15.937  1.00 26.00  ? 167 LEU A H      1 
ATOM   131  H HA     . LEU A 1 17  ? -14.911 53.152 13.625  1.00 23.43  ? 167 LEU A HA     1 
ATOM   132  H HB2    . LEU A 1 17  ? -16.030 52.536 15.640  1.00 26.94  ? 167 LEU A HB2    1 
ATOM   133  H HB3    . LEU A 1 17  ? -16.023 54.065 16.064  1.00 26.94  ? 167 LEU A HB3    1 
ATOM   134  H HG     . LEU A 1 17  ? -17.353 54.509 14.125  1.00 25.68  ? 167 LEU A HG     1 
ATOM   135  H HD11   . LEU A 1 17  ? -18.460 52.722 13.087  1.00 31.26  ? 167 LEU A HD11   1 
ATOM   136  H HD12   . LEU A 1 17  ? -16.889 52.600 12.881  1.00 31.26  ? 167 LEU A HD12   1 
ATOM   137  H HD13   . LEU A 1 17  ? -17.620 51.698 13.965  1.00 31.26  ? 167 LEU A HD13   1 
ATOM   138  H HD21   . LEU A 1 17  ? -19.398 53.849 15.089  1.00 25.20  ? 167 LEU A HD21   1 
ATOM   139  H HD22   . LEU A 1 17  ? -18.616 52.883 16.079  1.00 25.20  ? 167 LEU A HD22   1 
ATOM   140  H HD23   . LEU A 1 17  ? -18.436 54.457 16.198  1.00 25.20  ? 167 LEU A HD23   1 
ATOM   141  N N      . ALA A 1 18  ? -14.358 56.027 14.941  1.00 21.84  ? 168 ALA A N      1 
ATOM   142  C CA     . ALA A 1 18  ? -14.208 57.453 14.628  1.00 21.93  ? 168 ALA A CA     1 
ATOM   143  C C      . ALA A 1 18  ? -13.231 57.682 13.472  1.00 26.15  ? 168 ALA A C      1 
ATOM   144  O O      . ALA A 1 18  ? -13.470 58.537 12.609  1.00 22.86  ? 168 ALA A O      1 
ATOM   145  C CB     . ALA A 1 18  ? -13.739 58.217 15.864  1.00 24.79  ? 168 ALA A CB     1 
ATOM   146  H H      . ALA A 1 18  ? -14.164 55.821 15.753  1.00 26.18  ? 168 ALA A H      1 
ATOM   147  H HA     . ALA A 1 18  ? -15.070 57.809 14.365  1.00 26.29  ? 168 ALA A HA     1 
ATOM   148  H HB1    . ALA A 1 18  ? -13.646 59.155 15.638  1.00 29.71  ? 168 ALA A HB1    1 
ATOM   149  H HB2    . ALA A 1 18  ? -14.397 58.109 16.569  1.00 29.71  ? 168 ALA A HB2    1 
ATOM   150  H HB3    . ALA A 1 18  ? -12.884 57.858 16.151  1.00 29.71  ? 168 ALA A HB3    1 
ATOM   151  N N      . GLU A 1 19  ? -12.117 56.942 13.433  1.00 20.77  ? 169 GLU A N      1 
ATOM   152  C CA     . GLU A 1 19  ? -11.155 57.196 12.365  1.00 20.13  ? 169 GLU A CA     1 
ATOM   153  C C      . GLU A 1 19  ? -11.752 56.824 11.001  1.00 22.74  ? 169 GLU A C      1 
ATOM   154  O O      . GLU A 1 19  ? -11.566 57.556 10.018  1.00 20.77  ? 169 GLU A O      1 
ATOM   155  C CB     . GLU A 1 19  ? -9.842  56.454 12.636  1.00 26.54  ? 169 GLU A CB     1 
ATOM   156  C CG     . GLU A 1 19  ? -8.616  57.079 11.915  1.00 24.27  ? 169 GLU A CG     1 
ATOM   157  C CD     . GLU A 1 19  ? -8.143  58.415 12.503  1.00 30.60  ? 169 GLU A CD     1 
ATOM   158  O OE1    . GLU A 1 19  ? -8.616  58.828 13.579  1.00 25.77  ? 169 GLU A OE1    1 
ATOM   159  O OE2    . GLU A 1 19  ? -7.274  59.067 11.873  1.00 28.49  ? 169 GLU A OE2    1 
ATOM   160  H H      . GLU A 1 19  ? -11.905 56.319 13.986  1.00 24.89  ? 169 GLU A H      1 
ATOM   161  H HA     . GLU A 1 19  ? -10.957 58.145 12.348  1.00 24.12  ? 169 GLU A HA     1 
ATOM   162  H HB2    . GLU A 1 19  ? -9.666  56.469 13.590  1.00 31.82  ? 169 GLU A HB2    1 
ATOM   163  H HB3    . GLU A 1 19  ? -9.931  55.538 12.331  1.00 31.82  ? 169 GLU A HB3    1 
ATOM   164  H HG2    . GLU A 1 19  ? -7.875  56.455 11.969  1.00 29.10  ? 169 GLU A HG2    1 
ATOM   165  H HG3    . GLU A 1 19  ? -8.847  57.231 10.986  1.00 29.10  ? 169 GLU A HG3    1 
ATOM   166  N N      . HIS A 1 20  ? -12.535 55.731 10.936  1.00 21.06  ? 170 HIS A N      1 
ATOM   167  C CA     . HIS A 1 20  ? -13.229 55.385 9.695   1.00 18.19  ? 170 HIS A CA     1 
ATOM   168  C C      . HIS A 1 20  ? -14.187 56.511 9.284   1.00 22.26  ? 170 HIS A C      1 
ATOM   169  O O      . HIS A 1 20  ? -14.196 56.966 8.128   1.00 19.56  ? 170 HIS A O      1 
ATOM   170  C CB     . HIS A 1 20  ? -14.029 54.062 9.849   1.00 20.58  ? 170 HIS A CB     1 
ATOM   171  C CG     . HIS A 1 20  ? -13.226 52.798 9.669   1.00 20.27  ? 170 HIS A CG     1 
ATOM   172  N ND1    . HIS A 1 20  ? -12.530 52.204 10.698  1.00 22.45  ? 170 HIS A ND1    1 
ATOM   173  C CD2    . HIS A 1 20  ? -13.055 51.990 8.588   1.00 23.64  ? 170 HIS A CD2    1 
ATOM   174  C CE1    . HIS A 1 20  ? -11.944 51.098 10.257  1.00 21.03  ? 170 HIS A CE1    1 
ATOM   175  N NE2    . HIS A 1 20  ? -12.248 50.945 8.981   1.00 18.95  ? 170 HIS A NE2    1 
ATOM   176  H H      . HIS A 1 20  ? -12.674 55.187 11.587  1.00 25.25  ? 170 HIS A H      1 
ATOM   177  H HA     . HIS A 1 20  ? -12.577 55.266 8.987   1.00 21.80  ? 170 HIS A HA     1 
ATOM   178  H HB2    . HIS A 1 20  ? -14.415 54.038 10.738  1.00 24.66  ? 170 HIS A HB2    1 
ATOM   179  H HB3    . HIS A 1 20  ? -14.738 54.054 9.187   1.00 24.66  ? 170 HIS A HB3    1 
ATOM   180  H HD1    . HIS A 1 20  ? -12.475 52.508 11.501  1.00 26.91  ? 170 HIS A HD1    1 
ATOM   181  H HD2    . HIS A 1 20  ? -13.409 52.124 7.738   1.00 28.34  ? 170 HIS A HD2    1 
ATOM   182  H HE1    . HIS A 1 20  ? -11.409 50.528 10.760  1.00 25.21  ? 170 HIS A HE1    1 
ATOM   183  N N      . ASN A 1 21  ? -15.027 56.949 10.216  1.00 16.90  ? 171 ASN A N      1 
ATOM   184  C CA     . ASN A 1 21  ? -16.124 57.850 9.873   1.00 20.15  ? 171 ASN A CA     1 
ATOM   185  C C      . ASN A 1 21  ? -15.661 59.293 9.651   1.00 22.75  ? 171 ASN A C      1 
ATOM   186  O O      . ASN A 1 21  ? -16.325 60.039 8.910   1.00 23.79  ? 171 ASN A O      1 
ATOM   187  C CB     . ASN A 1 21  ? -17.208 57.754 10.951  1.00 20.11  ? 171 ASN A CB     1 
ATOM   188  C CG     . ASN A 1 21  ? -18.018 56.452 10.847  1.00 22.99  ? 171 ASN A CG     1 
ATOM   189  O OD1    . ASN A 1 21  ? -18.051 55.823 9.791   1.00 20.45  ? 171 ASN A OD1    1 
ATOM   190  N ND2    . ASN A 1 21  ? -18.677 56.061 11.931  1.00 20.87  ? 171 ASN A ND2    1 
ATOM   191  H H      . ASN A 1 21  ? -14.984 56.743 11.049  1.00 20.25  ? 171 ASN A H      1 
ATOM   192  H HA     . ASN A 1 21  ? -16.519 57.544 9.041   1.00 24.15  ? 171 ASN A HA     1 
ATOM   193  H HB2    . ASN A 1 21  ? -16.789 57.780 11.826  1.00 24.10  ? 171 ASN A HB2    1 
ATOM   194  H HB3    . ASN A 1 21  ? -17.821 58.500 10.853  1.00 24.10  ? 171 ASN A HB3    1 
ATOM   195  H HD21   . ASN A 1 21  ? -19.142 55.338 11.913  1.00 25.02  ? 171 ASN A HD21   1 
ATOM   196  H HD22   . ASN A 1 21  ? -18.639 56.531 12.650  1.00 25.02  ? 171 ASN A HD22   1 
ATOM   197  N N      . LYS A 1 22  ? -14.509 59.681 10.211  1.00 19.97  ? 172 LYS A N      1 
ATOM   198  C CA     . LYS A 1 22  ? -13.892 60.968 9.858   1.00 24.87  ? 172 LYS A CA     1 
ATOM   199  C C      . LYS A 1 22  ? -13.531 61.016 8.383   1.00 23.55  ? 172 LYS A C      1 
ATOM   200  O O      . LYS A 1 22  ? -13.635 62.069 7.744   1.00 23.48  ? 172 LYS A O      1 
ATOM   201  C CB     . LYS A 1 22  ? -12.600 61.206 10.661  1.00 29.85  ? 172 LYS A CB     1 
ATOM   202  C CG     . LYS A 1 22  ? -12.800 61.763 11.997  1.00 41.85  ? 172 LYS A CG     1 
ATOM   203  C CD     . LYS A 1 22  ? -11.628 61.372 12.916  1.00 47.07  ? 172 LYS A CD     1 
ATOM   204  C CE     . LYS A 1 22  ? -10.289 61.922 12.450  1.00 32.84  ? 172 LYS A CE     1 
ATOM   205  N NZ     . LYS A 1 22  ? -9.348  61.984 13.642  1.00 42.87  ? 172 LYS A NZ     1 
ATOM   206  H H      . LYS A 1 22  ? -14.069 59.223 10.792  1.00 23.94  ? 172 LYS A H      1 
ATOM   207  H HA     . LYS A 1 22  ? -14.511 61.690 10.049  1.00 29.81  ? 172 LYS A HA     1 
ATOM   208  H HB2    . LYS A 1 22  ? -12.140 60.358 10.763  1.00 35.79  ? 172 LYS A HB2    1 
ATOM   209  H HB3    . LYS A 1 22  ? -12.038 61.823 10.167  1.00 35.79  ? 172 LYS A HB3    1 
ATOM   210  H HG2    . LYS A 1 22  ? -12.839 62.730 11.942  1.00 50.20  ? 172 LYS A HG2    1 
ATOM   211  H HG3    . LYS A 1 22  ? -13.620 61.410 12.376  1.00 50.20  ? 172 LYS A HG3    1 
ATOM   212  H HD2    . LYS A 1 22  ? -11.799 61.717 13.807  1.00 56.45  ? 172 LYS A HD2    1 
ATOM   213  H HD3    . LYS A 1 22  ? -11.560 60.404 12.945  1.00 56.45  ? 172 LYS A HD3    1 
ATOM   214  H HE2    . LYS A 1 22  ? -9.907  61.333 11.780  1.00 39.38  ? 172 LYS A HE2    1 
ATOM   215  H HE3    . LYS A 1 22  ? -10.406 62.817 12.096  1.00 39.38  ? 172 LYS A HE3    1 
ATOM   216  H HZ1    . LYS A 1 22  ? -9.687  62.516 14.269  1.00 51.42  ? 172 LYS A HZ1    1 
ATOM   217  H HZ2    . LYS A 1 22  ? -9.234  61.170 13.982  1.00 51.42  ? 172 LYS A HZ2    1 
ATOM   218  H HZ3    . LYS A 1 22  ? -8.557  62.304 13.388  1.00 51.42  ? 172 LYS A HZ3    1 
ATOM   219  N N      . LYS A 1 23  ? -13.006 59.906 7.854   1.00 20.36  ? 173 LYS A N      1 
ATOM   220  C CA     . LYS A 1 23  ? -12.619 59.846 6.444   1.00 21.71  ? 173 LYS A CA     1 
ATOM   221  C C      . LYS A 1 23  ? -13.823 59.710 5.517   1.00 25.31  ? 173 LYS A C      1 
ATOM   222  O O      . LYS A 1 23  ? -13.891 60.392 4.482   1.00 23.71  ? 173 LYS A O      1 
ATOM   223  C CB     . LYS A 1 23  ? -11.661 58.682 6.194   1.00 25.12  ? 173 LYS A CB     1 
ATOM   224  C CG     . LYS A 1 23  ? -10.411 58.667 7.053   1.00 23.80  ? 173 LYS A CG     1 
ATOM   225  C CD     . LYS A 1 23  ? -9.734  60.005 7.107   1.00 25.24  ? 173 LYS A CD     1 
ATOM   226  C CE     . LYS A 1 23  ? -8.309  59.873 7.685   1.00 28.88  ? 173 LYS A CE     1 
ATOM   227  N NZ     . LYS A 1 23  ? -7.643  61.186 7.740   1.00 30.78  ? 173 LYS A NZ     1 
ATOM   228  H H      . LYS A 1 23  ? -12.864 59.179 8.289   1.00 24.40  ? 173 LYS A H      1 
ATOM   229  H HA     . LYS A 1 23  ? -12.157 60.666 6.211   1.00 26.03  ? 173 LYS A HA     1 
ATOM   230  H HB2    . LYS A 1 23  ? -12.137 57.853 6.359   1.00 30.11  ? 173 LYS A HB2    1 
ATOM   231  H HB3    . LYS A 1 23  ? -11.377 58.712 5.267   1.00 30.11  ? 173 LYS A HB3    1 
ATOM   232  H HG2    . LYS A 1 23  ? -10.652 58.416 7.958   1.00 28.53  ? 173 LYS A HG2    1 
ATOM   233  H HG3    . LYS A 1 23  ? -9.782  58.027 6.685   1.00 28.53  ? 173 LYS A HG3    1 
ATOM   234  H HD2    . LYS A 1 23  ? -9.668  60.370 6.210   1.00 30.26  ? 173 LYS A HD2    1 
ATOM   235  H HD3    . LYS A 1 23  ? -10.242 60.602 7.678   1.00 30.26  ? 173 LYS A HD3    1 
ATOM   236  H HE2    . LYS A 1 23  ? -8.359  59.517 8.586   1.00 34.63  ? 173 LYS A HE2    1 
ATOM   237  H HE3    . LYS A 1 23  ? -7.784  59.286 7.119   1.00 34.63  ? 173 LYS A HE3    1 
ATOM   238  H HZ1    . LYS A 1 23  ? -6.823  61.097 8.075   1.00 36.90  ? 173 LYS A HZ1    1 
ATOM   239  H HZ2    . LYS A 1 23  ? -7.585  61.532 6.922   1.00 36.90  ? 173 LYS A HZ2    1 
ATOM   240  H HZ3    . LYS A 1 23  ? -8.108  61.741 8.257   1.00 36.90  ? 173 LYS A HZ3    1 
ATOM   241  N N      . ARG A 1 24  ? -14.782 58.837 5.861   1.00 19.77  ? 174 ARG A N      1 
ATOM   242  C CA     . ARG A 1 24  ? -15.952 58.679 5.007   1.00 21.12  ? 174 ARG A CA     1 
ATOM   243  C C      . ARG A 1 24  ? -16.705 59.993 4.842   1.00 19.24  ? 174 ARG A C      1 
ATOM   244  O O      . ARG A 1 24  ? -17.304 60.236 3.786   1.00 19.49  ? 174 ARG A O      1 
ATOM   245  C CB     . ARG A 1 24  ? -16.900 57.584 5.553   1.00 20.02  ? 174 ARG A CB     1 
ATOM   246  C CG     . ARG A 1 24  ? -16.326 56.149 5.382   1.00 18.89  ? 174 ARG A CG     1 
ATOM   247  C CD     . ARG A 1 24  ? -17.158 55.021 6.015   1.00 22.09  ? 174 ARG A CD     1 
ATOM   248  N NE     . ARG A 1 24  ? -18.479 54.809 5.407   1.00 21.70  ? 174 ARG A NE     1 
ATOM   249  C CZ     . ARG A 1 24  ? -18.749 53.906 4.454   1.00 22.51  ? 174 ARG A CZ     1 
ATOM   250  N NH1    . ARG A 1 24  ? -17.786 53.110 3.982   1.00 18.81  ? 174 ARG A NH1    1 
ATOM   251  N NH2    . ARG A 1 24  ? -19.994 53.766 3.987   1.00 22.61  ? 174 ARG A NH2    1 
ATOM   252  H H      . ARG A 1 24  ? -14.774 58.341 6.563   1.00 23.70  ? 174 ARG A H      1 
ATOM   253  H HA     . ARG A 1 24  ? -15.657 58.398 4.127   1.00 25.32  ? 174 ARG A HA     1 
ATOM   254  H HB2    . ARG A 1 24  ? -17.046 57.738 6.500   1.00 24.00  ? 174 ARG A HB2    1 
ATOM   255  H HB3    . ARG A 1 24  ? -17.743 57.629 5.076   1.00 24.00  ? 174 ARG A HB3    1 
ATOM   256  H HG2    . ARG A 1 24  ? -16.254 55.959 4.433   1.00 22.64  ? 174 ARG A HG2    1 
ATOM   257  H HG3    . ARG A 1 24  ? -15.445 56.121 5.786   1.00 22.64  ? 174 ARG A HG3    1 
ATOM   258  H HD2    . ARG A 1 24  ? -16.663 54.191 5.936   1.00 26.47  ? 174 ARG A HD2    1 
ATOM   259  H HD3    . ARG A 1 24  ? -17.297 55.229 6.952   1.00 26.47  ? 174 ARG A HD3    1 
ATOM   260  H HE     . ARG A 1 24  ? -19.128 55.301 5.684   1.00 26.01  ? 174 ARG A HE     1 
ATOM   261  H HH11   . ARG A 1 24  ? -16.983 53.183 4.281   1.00 22.55  ? 174 ARG A HH11   1 
ATOM   262  H HH12   . ARG A 1 24  ? -17.966 52.533 3.371   1.00 22.55  ? 174 ARG A HH12   1 
ATOM   263  H HH21   . ARG A 1 24  ? -20.623 54.272 4.281   1.00 27.10  ? 174 ARG A HH21   1 
ATOM   264  H HH22   . ARG A 1 24  ? -20.159 53.189 3.371   1.00 27.10  ? 174 ARG A HH22   1 
ATOM   265  N N      . ALA A 1 25  ? -16.712 60.839 5.869   1.00 21.98  ? 175 ALA A N      1 
ATOM   266  C CA     . ALA A 1 25  ? -17.456 62.098 5.785   1.00 25.59  ? 175 ALA A CA     1 
ATOM   267  C C      . ALA A 1 25  ? -16.832 63.079 4.800   1.00 24.49  ? 175 ALA A C      1 
ATOM   268  O O      . ALA A 1 25  ? -17.480 64.080 4.443   1.00 20.87  ? 175 ALA A O      1 
ATOM   269  C CB     . ALA A 1 25  ? -17.556 62.741 7.164   1.00 22.97  ? 175 ALA A CB     1 
ATOM   270  H H      . ALA A 1 25  ? -16.302 60.713 6.615   1.00 26.35  ? 175 ALA A H      1 
ATOM   271  H HA     . ALA A 1 25  ? -18.357 61.907 5.481   1.00 30.68  ? 175 ALA A HA     1 
ATOM   272  H HB1    . ALA A 1 25  ? -18.051 63.572 7.089   1.00 27.54  ? 175 ALA A HB1    1 
ATOM   273  H HB2    . ALA A 1 25  ? -18.018 62.133 7.762   1.00 27.54  ? 175 ALA A HB2    1 
ATOM   274  H HB3    . ALA A 1 25  ? -16.662 62.917 7.496   1.00 27.54  ? 175 ALA A HB3    1 
ATOM   275  N N      . LEU A 1 26  ? -15.595 62.824 4.365   1.00 21.56  ? 176 LEU A N      1 
ATOM   276  C CA     . LEU A 1 26  ? -14.981 63.642 3.331   1.00 21.84  ? 176 LEU A CA     1 
ATOM   277  C C      . LEU A 1 26  ? -15.597 63.399 1.955   1.00 23.12  ? 176 LEU A C      1 
ATOM   278  O O      . LEU A 1 26  ? -15.401 64.229 1.073   1.00 23.84  ? 176 LEU A O      1 
ATOM   279  C CB     . LEU A 1 26  ? -13.460 63.389 3.269   1.00 21.04  ? 176 LEU A CB     1 
ATOM   280  C CG     . LEU A 1 26  ? -12.652 63.738 4.538   1.00 25.03  ? 176 LEU A CG     1 
ATOM   281  C CD1    . LEU A 1 26  ? -11.189 63.215 4.485   1.00 26.68  ? 176 LEU A CD1    1 
ATOM   282  C CD2    . LEU A 1 26  ? -12.643 65.254 4.782   1.00 26.46  ? 176 LEU A CD2    1 
ATOM   283  H H      . LEU A 1 26  ? -15.096 62.186 4.655   1.00 25.84  ? 176 LEU A H      1 
ATOM   284  H HA     . LEU A 1 26  ? -15.116 64.577 3.553   1.00 26.18  ? 176 LEU A HA     1 
ATOM   285  H HB2    . LEU A 1 26  ? -13.316 62.447 3.088   1.00 25.22  ? 176 LEU A HB2    1 
ATOM   286  H HB3    . LEU A 1 26  ? -13.094 63.915 2.542   1.00 25.22  ? 176 LEU A HB3    1 
ATOM   287  H HG     . LEU A 1 26  ? -13.083 63.322 5.301   1.00 30.00  ? 176 LEU A HG     1 
ATOM   288  H HD11   . LEU A 1 26  ? -10.735 63.465 5.305   1.00 31.99  ? 176 LEU A HD11   1 
ATOM   289  H HD12   . LEU A 1 26  ? -11.202 62.250 4.394   1.00 31.99  ? 176 LEU A HD12   1 
ATOM   290  H HD13   . LEU A 1 26  ? -10.739 63.614 3.724   1.00 31.99  ? 176 LEU A HD13   1 
ATOM   291  H HD21   . LEU A 1 26  ? -12.130 65.441 5.583   1.00 31.72  ? 176 LEU A HD21   1 
ATOM   292  H HD22   . LEU A 1 26  ? -12.238 65.694 4.018   1.00 31.72  ? 176 LEU A HD22   1 
ATOM   293  H HD23   . LEU A 1 26  ? -13.556 65.561 4.895   1.00 31.72  ? 176 LEU A HD23   1 
ATOM   294  N N      . HIS A 1 27  ? -16.362 62.311 1.766   1.00 22.47  ? 177 HIS A N      1 
ATOM   295  C CA     . HIS A 1 27  ? -16.877 61.890 0.466   1.00 22.65  ? 177 HIS A CA     1 
ATOM   296  C C      . HIS A 1 27  ? -18.399 62.073 0.339   1.00 24.85  ? 177 HIS A C      1 
ATOM   297  O O      . HIS A 1 27  ? -19.149 61.827 1.290   1.00 20.32  ? 177 HIS A O      1 
ATOM   298  C CB     . HIS A 1 27  ? -16.514 60.417 0.218   1.00 23.07  ? 177 HIS A CB     1 
ATOM   299  C CG     . HIS A 1 27  ? -15.034 60.190 0.110   1.00 23.15  ? 177 HIS A CG     1 
ATOM   300  N ND1    . HIS A 1 27  ? -14.377 60.106 -1.105  1.00 22.53  ? 177 HIS A ND1    1 
ATOM   301  C CD2    . HIS A 1 27  ? -14.070 60.148 1.060   1.00 24.66  ? 177 HIS A CD2    1 
ATOM   302  C CE1    . HIS A 1 27  ? -13.079 59.963 -0.890  1.00 24.28  ? 177 HIS A CE1    1 
ATOM   303  N NE2    . HIS A 1 27  ? -12.866 59.979 0.415   1.00 21.06  ? 177 HIS A NE2    1 
ATOM   304  H H      . HIS A 1 27  ? -16.601 61.787 2.405   1.00 26.93  ? 177 HIS A H      1 
ATOM   305  H HA     . HIS A 1 27  ? -16.454 62.422 -0.226  1.00 27.15  ? 177 HIS A HA     1 
ATOM   306  H HB2    . HIS A 1 27  ? -16.846 59.882 0.955   1.00 27.65  ? 177 HIS A HB2    1 
ATOM   307  H HB3    . HIS A 1 27  ? -16.922 60.127 -0.613  1.00 27.65  ? 177 HIS A HB3    1 
ATOM   308  H HD1    . HIS A 1 27  ? -14.755 60.122 -1.877  1.00 27.01  ? 177 HIS A HD1    1 
ATOM   309  H HD2    . HIS A 1 27  ? -14.201 60.187 1.980   1.00 29.57  ? 177 HIS A HD2    1 
ATOM   310  H HE1    . HIS A 1 27  ? -12.427 59.862 -1.546  1.00 29.11  ? 177 HIS A HE1    1 
ATOM   311  N N      . LYS A 1 28  ? -18.841 62.438 -0.868  1.00 24.27  ? 178 LYS A N      1 
ATOM   312  C CA     . LYS A 1 28  ? -20.250 62.717 -1.150  1.00 28.74  ? 178 LYS A CA     1 
ATOM   313  C C      . LYS A 1 28  ? -21.095 61.461 -0.992  1.00 25.85  ? 178 LYS A C      1 
ATOM   314  O O      . LYS A 1 28  ? -20.681 60.370 -1.373  1.00 21.40  ? 178 LYS A O      1 
ATOM   315  C CB     . LYS A 1 28  ? -20.427 63.232 -2.585  1.00 33.46  ? 178 LYS A CB     1 
ATOM   316  C CG     . LYS A 1 28  ? -19.750 64.548 -2.913  1.00 39.39  ? 178 LYS A CG     1 
ATOM   317  C CD     . LYS A 1 28  ? -20.111 65.045 -4.321  1.00 34.88  ? 178 LYS A CD     1 
ATOM   318  C CE     . LYS A 1 28  ? -19.279 66.296 -4.663  1.00 38.09  ? 178 LYS A CE     1 
ATOM   319  N NZ     . LYS A 1 28  ? -19.607 66.922 -5.986  1.00 45.37  ? 178 LYS A NZ     1 
ATOM   320  H H      . LYS A 1 28  ? -18.331 62.533 -1.554  1.00 29.10  ? 178 LYS A H      1 
ATOM   321  H HA     . LYS A 1 28  ? -20.578 63.391 -0.535  1.00 34.46  ? 178 LYS A HA     1 
ATOM   322  H HB2    . LYS A 1 28  ? -20.071 62.565 -3.193  1.00 40.13  ? 178 LYS A HB2    1 
ATOM   323  H HB3    . LYS A 1 28  ? -21.375 63.346 -2.752  1.00 40.13  ? 178 LYS A HB3    1 
ATOM   324  H HG2    . LYS A 1 28  ? -20.032 65.220 -2.274  1.00 47.24  ? 178 LYS A HG2    1 
ATOM   325  H HG3    . LYS A 1 28  ? -18.788 64.431 -2.872  1.00 47.24  ? 178 LYS A HG3    1 
ATOM   326  H HD2    . LYS A 1 28  ? -19.911 64.354 -4.971  1.00 41.83  ? 178 LYS A HD2    1 
ATOM   327  H HD3    . LYS A 1 28  ? -21.051 65.281 -4.351  1.00 41.83  ? 178 LYS A HD3    1 
ATOM   328  H HE2    . LYS A 1 28  ? -19.428 66.964 -3.976  1.00 45.68  ? 178 LYS A HE2    1 
ATOM   329  H HE3    . LYS A 1 28  ? -18.341 66.049 -4.679  1.00 45.68  ? 178 LYS A HE3    1 
ATOM   330  H HZ1    . LYS A 1 28  ? -19.093 67.636 -6.120  1.00 54.42  ? 178 LYS A HZ1    1 
ATOM   331  H HZ2    . LYS A 1 28  ? -19.467 66.338 -6.642  1.00 54.42  ? 178 LYS A HZ2    1 
ATOM   332  H HZ3    . LYS A 1 28  ? -20.461 67.174 -6.000  1.00 54.42  ? 178 LYS A HZ3    1 
ATOM   333  N N      . ASP A 1 29  ? -22.288 61.623 -0.432  1.00 21.80  ? 179 ASP A N      1 
ATOM   334  C CA     . ASP A 1 29  ? -23.291 60.547 -0.408  1.00 24.94  ? 179 ASP A CA     1 
ATOM   335  C C      . ASP A 1 29  ? -22.736 59.241 0.188   1.00 28.98  ? 179 ASP A C      1 
ATOM   336  O O      . ASP A 1 29  ? -23.091 58.138 -0.247  1.00 29.61  ? 179 ASP A O      1 
ATOM   337  C CB     . ASP A 1 29  ? -23.845 60.313 -1.826  1.00 27.62  ? 179 ASP A CB     1 
ATOM   338  C CG     . ASP A 1 29  ? -25.083 59.388 -1.834  1.00 40.63  ? 179 ASP A CG     1 
ATOM   339  O OD1    . ASP A 1 29  ? -25.849 59.416 -0.844  1.00 38.26  ? 179 ASP A OD1    1 
ATOM   340  O OD2    . ASP A 1 29  ? -25.269 58.616 -2.805  1.00 37.66  ? 179 ASP A OD2    1 
ATOM   341  H H      . ASP A 1 29  ? -22.550 62.350 -0.054  1.00 26.13  ? 179 ASP A H      1 
ATOM   342  H HA     . ASP A 1 29  ? -24.031 60.830 0.151   1.00 29.90  ? 179 ASP A HA     1 
ATOM   343  H HB2    . ASP A 1 29  ? -24.105 61.166 -2.209  1.00 33.11  ? 179 ASP A HB2    1 
ATOM   344  H HB3    . ASP A 1 29  ? -23.157 59.900 -2.371  1.00 33.11  ? 179 ASP A HB3    1 
ATOM   345  N N      . THR A 1 30  ? -21.876 59.355 1.205   1.00 23.23  ? 180 THR A N      1 
ATOM   346  C CA     . THR A 1 30  ? -21.236 58.186 1.830   1.00 23.93  ? 180 THR A CA     1 
ATOM   347  C C      . THR A 1 30  ? -21.612 58.070 3.320   1.00 27.45  ? 180 THR A C      1 
ATOM   348  O O      . THR A 1 30  ? -21.066 58.801 4.169   1.00 26.55  ? 180 THR A O      1 
ATOM   349  C CB     . THR A 1 30  ? -19.713 58.263 1.635   1.00 23.73  ? 180 THR A CB     1 
ATOM   350  O OG1    . THR A 1 30  ? -19.417 58.313 0.229   1.00 23.15  ? 180 THR A OG1    1 
ATOM   351  C CG2    . THR A 1 30  ? -18.989 57.053 2.244   1.00 23.41  ? 180 THR A CG2    1 
ATOM   352  H H      . THR A 1 30  ? -21.643 60.104 1.556   1.00 27.85  ? 180 THR A H      1 
ATOM   353  H HA     . THR A 1 30  ? -21.550 57.384 1.385   1.00 28.69  ? 180 THR A HA     1 
ATOM   354  H HB     . THR A 1 30  ? -19.376 59.066 2.062   1.00 28.45  ? 180 THR A HB     1 
ATOM   355  H HG1    . THR A 1 30  ? -19.775 58.990 -0.116  1.00 27.75  ? 180 THR A HG1    1 
ATOM   356  H HG21   . THR A 1 30  ? -18.032 57.134 2.103   1.00 28.06  ? 180 THR A HG21   1 
ATOM   357  H HG22   . THR A 1 30  ? -19.164 57.007 3.197   1.00 28.06  ? 180 THR A HG22   1 
ATOM   358  H HG23   . THR A 1 30  ? -19.301 56.235 1.826   1.00 28.06  ? 180 THR A HG23   1 
ATOM   359  N N      . PRO A 1 31  ? -22.542 57.182 3.688   1.00 26.73  ? 181 PRO A N      1 
ATOM   360  C CA     . PRO A 1 31  ? -23.004 57.112 5.091   1.00 25.43  ? 181 PRO A CA     1 
ATOM   361  C C      . PRO A 1 31  ? -21.928 56.635 6.052   1.00 25.28  ? 181 PRO A C      1 
ATOM   362  O O      . PRO A 1 31  ? -21.026 55.880 5.688   1.00 23.57  ? 181 PRO A O      1 
ATOM   363  C CB     . PRO A 1 31  ? -24.158 56.093 5.054   1.00 27.14  ? 181 PRO A CB     1 
ATOM   364  C CG     . PRO A 1 31  ? -24.519 55.931 3.571   1.00 34.00  ? 181 PRO A CG     1 
ATOM   365  C CD     . PRO A 1 31  ? -23.235 56.225 2.820   1.00 26.47  ? 181 PRO A CD     1 
ATOM   366  H HA     . PRO A 1 31  ? -23.342 57.973 5.382   1.00 30.49  ? 181 PRO A HA     1 
ATOM   367  H HB2    . PRO A 1 31  ? -23.859 55.249 5.427   1.00 32.54  ? 181 PRO A HB2    1 
ATOM   368  H HB3    . PRO A 1 31  ? -24.914 56.439 5.553   1.00 32.54  ? 181 PRO A HB3    1 
ATOM   369  H HG2    . PRO A 1 31  ? -24.814 55.022 3.404   1.00 40.77  ? 181 PRO A HG2    1 
ATOM   370  H HG3    . PRO A 1 31  ? -25.210 56.567 3.331   1.00 40.77  ? 181 PRO A HG3    1 
ATOM   371  H HD2    . PRO A 1 31  ? -22.709 55.416 2.721   1.00 31.73  ? 181 PRO A HD2    1 
ATOM   372  H HD3    . PRO A 1 31  ? -23.432 56.629 1.961   1.00 31.73  ? 181 PRO A HD3    1 
ATOM   373  N N      . ALA A 1 32  ? -22.076 57.039 7.316   1.00 21.31  ? 182 ALA A N      1 
ATOM   374  C CA     . ALA A 1 32  ? -21.210 56.552 8.383   1.00 22.90  ? 182 ALA A CA     1 
ATOM   375  C C      . ALA A 1 32  ? -21.461 55.074 8.675   1.00 27.00  ? 182 ALA A C      1 
ATOM   376  O O      . ALA A 1 32  ? -22.563 54.558 8.484   1.00 22.16  ? 182 ALA A O      1 
ATOM   377  C CB     . ALA A 1 32  ? -21.425 57.358 9.657   1.00 24.33  ? 182 ALA A CB     1 
ATOM   378  H H      . ALA A 1 32  ? -22.675 57.597 7.580   1.00 25.54  ? 182 ALA A H      1 
ATOM   379  H HA     . ALA A 1 32  ? -20.284 56.654 8.113   1.00 27.46  ? 182 ALA A HA     1 
ATOM   380  H HB1    . ALA A 1 32  ? -20.838 57.015 10.349  1.00 29.17  ? 182 ALA A HB1    1 
ATOM   381  H HB2    . ALA A 1 32  ? -21.219 58.289 9.480   1.00 29.17  ? 182 ALA A HB2    1 
ATOM   382  H HB3    . ALA A 1 32  ? -22.350 57.270 9.933   1.00 29.17  ? 182 ALA A HB3    1 
ATOM   383  N N      . LEU A 1 33  ? -20.406 54.386 9.114   1.00 22.96  ? 183 LEU A N      1 
ATOM   384  C CA     . LEU A 1 33  ? -20.504 53.010 9.586   1.00 26.16  ? 183 LEU A CA     1 
ATOM   385  C C      . LEU A 1 33  ? -20.891 52.956 11.070  1.00 21.63  ? 183 LEU A C      1 
ATOM   386  O O      . LEU A 1 33  ? -20.663 53.901 11.837  1.00 22.61  ? 183 LEU A O      1 
ATOM   387  C CB     . LEU A 1 33  ? -19.168 52.286 9.402   1.00 24.00  ? 183 LEU A CB     1 
ATOM   388  C CG     . LEU A 1 33  ? -18.534 52.274 8.006   1.00 23.28  ? 183 LEU A CG     1 
ATOM   389  C CD1    . LEU A 1 33  ? -17.117 51.705 8.049   1.00 25.39  ? 183 LEU A CD1    1 
ATOM   390  C CD2    . LEU A 1 33  ? -19.379 51.511 7.036   1.00 24.95  ? 183 LEU A CD2    1 
ATOM   391  H H      . LEU A 1 33  ? -19.608 54.704 9.148   1.00 27.52  ? 183 LEU A H      1 
ATOM   392  H HA     . LEU A 1 33  ? -21.182 52.540 9.075   1.00 31.36  ? 183 LEU A HA     1 
ATOM   393  H HB2    . LEU A 1 33  ? -18.523 52.696 9.999   1.00 28.78  ? 183 LEU A HB2    1 
ATOM   394  H HB3    . LEU A 1 33  ? -19.293 51.360 9.661   1.00 28.78  ? 183 LEU A HB3    1 
ATOM   395  H HG     . LEU A 1 33  ? -18.474 53.188 7.687   1.00 27.90  ? 183 LEU A HG     1 
ATOM   396  H HD11   . LEU A 1 33  ? -16.747 51.712 7.152   1.00 30.44  ? 183 LEU A HD11   1 
ATOM   397  H HD12   . LEU A 1 33  ? -16.574 52.255 8.636   1.00 30.44  ? 183 LEU A HD12   1 
ATOM   398  H HD13   . LEU A 1 33  ? -17.152 50.796 8.386   1.00 30.44  ? 183 LEU A HD13   1 
ATOM   399  H HD21   . LEU A 1 33  ? -18.950 51.523 6.166   1.00 29.91  ? 183 LEU A HD21   1 
ATOM   400  H HD22   . LEU A 1 33  ? -19.469 50.597 7.348   1.00 29.91  ? 183 LEU A HD22   1 
ATOM   401  H HD23   . LEU A 1 33  ? -20.252 51.930 6.981   1.00 29.91  ? 183 LEU A HD23   1 
ATOM   402  N N      . SER A 1 34  ? -21.460 51.821 11.471  1.00 21.37  ? 184 SER A N      1 
ATOM   403  C CA     . SER A 1 34  ? -21.627 51.479 12.872  1.00 21.52  ? 184 SER A CA     1 
ATOM   404  C C      . SER A 1 34  ? -20.788 50.247 13.220  1.00 21.89  ? 184 SER A C      1 
ATOM   405  O O      . SER A 1 34  ? -20.432 49.445 12.348  1.00 24.64  ? 184 SER A O      1 
ATOM   406  C CB     . SER A 1 34  ? -23.114 51.243 13.211  1.00 25.13  ? 184 SER A CB     1 
ATOM   407  O OG     . SER A 1 34  ? -23.586 50.037 12.648  1.00 32.65  ? 184 SER A OG     1 
ATOM   408  H H      . SER A 1 34  ? -21.763 51.222 10.933  1.00 25.62  ? 184 SER A H      1 
ATOM   409  H HA     . SER A 1 34  ? -21.311 52.218 13.415  1.00 25.80  ? 184 SER A HA     1 
ATOM   410  H HB2    . SER A 1 34  ? -23.213 51.199 14.175  1.00 30.13  ? 184 SER A HB2    1 
ATOM   411  H HB3    . SER A 1 34  ? -23.637 51.980 12.859  1.00 30.13  ? 184 SER A HB3    1 
ATOM   412  H HG     . SER A 1 34  ? -24.396 49.926 12.843  1.00 39.16  ? 184 SER A HG     1 
ATOM   413  N N      . TRP A 1 35  ? -20.464 50.115 14.514  1.00 24.85  ? 185 TRP A N      1 
ATOM   414  C CA     . TRP A 1 35  ? -19.618 49.024 15.012  1.00 24.80  ? 185 TRP A CA     1 
ATOM   415  C C      . TRP A 1 35  ? -20.447 47.768 15.273  1.00 25.74  ? 185 TRP A C      1 
ATOM   416  O O      . TRP A 1 35  ? -21.544 47.849 15.822  1.00 26.25  ? 185 TRP A O      1 
ATOM   417  C CB     . TRP A 1 35  ? -18.922 49.453 16.314  1.00 22.58  ? 185 TRP A CB     1 
ATOM   418  C CG     . TRP A 1 35  ? -17.849 48.512 16.858  1.00 28.08  ? 185 TRP A CG     1 
ATOM   419  C CD1    . TRP A 1 35  ? -18.018 47.539 17.811  1.00 28.61  ? 185 TRP A CD1    1 
ATOM   420  C CD2    . TRP A 1 35  ? -16.451 48.472 16.501  1.00 27.20  ? 185 TRP A CD2    1 
ATOM   421  N NE1    . TRP A 1 35  ? -16.826 46.904 18.062  1.00 26.17  ? 185 TRP A NE1    1 
ATOM   422  C CE2    . TRP A 1 35  ? -15.848 47.452 17.278  1.00 26.63  ? 185 TRP A CE2    1 
ATOM   423  C CE3    . TRP A 1 35  ? -15.654 49.188 15.604  1.00 25.04  ? 185 TRP A CE3    1 
ATOM   424  C CZ2    . TRP A 1 35  ? -14.487 47.140 17.180  1.00 27.50  ? 185 TRP A CZ2    1 
ATOM   425  C CZ3    . TRP A 1 35  ? -14.302 48.870 15.511  1.00 22.59  ? 185 TRP A CZ3    1 
ATOM   426  C CH2    . TRP A 1 35  ? -13.737 47.864 16.294  1.00 30.14  ? 185 TRP A CH2    1 
ATOM   427  H H      . TRP A 1 35  ? -20.726 50.654 15.131  1.00 29.79  ? 185 TRP A H      1 
ATOM   428  H HA     . TRP A 1 35  ? -18.938 48.813 14.353  1.00 29.73  ? 185 TRP A HA     1 
ATOM   429  H HB2    . TRP A 1 35  ? -18.499 50.313 16.162  1.00 27.07  ? 185 TRP A HB2    1 
ATOM   430  H HB3    . TRP A 1 35  ? -19.598 49.546 17.002  1.00 27.07  ? 185 TRP A HB3    1 
ATOM   431  H HD1    . TRP A 1 35  ? -18.824 47.342 18.232  1.00 34.30  ? 185 TRP A HD1    1 
ATOM   432  H HE1    . TRP A 1 35  ? -16.712 46.264 18.625  1.00 31.37  ? 185 TRP A HE1    1 
ATOM   433  H HE3    . TRP A 1 35  ? -16.019 49.866 15.083  1.00 30.02  ? 185 TRP A HE3    1 
ATOM   434  H HZ2    . TRP A 1 35  ? -14.108 46.464 17.694  1.00 32.97  ? 185 TRP A HZ2    1 
ATOM   435  H HZ3    . TRP A 1 35  ? -13.763 49.345 14.920  1.00 27.08  ? 185 TRP A HZ3    1 
ATOM   436  H HH2    . TRP A 1 35  ? -12.831 47.674 16.204  1.00 36.14  ? 185 TRP A HH2    1 
ATOM   437  N N      . SER A 1 36  ? -19.912 46.602 14.909  1.00 25.95  ? 186 SER A N      1 
ATOM   438  C CA     . SER A 1 36  ? -20.607 45.325 15.101  1.00 23.10  ? 186 SER A CA     1 
ATOM   439  C C      . SER A 1 36  ? -19.793 44.396 16.006  1.00 27.90  ? 186 SER A C      1 
ATOM   440  O O      . SER A 1 36  ? -18.646 44.059 15.688  1.00 25.13  ? 186 SER A O      1 
ATOM   441  C CB     . SER A 1 36  ? -20.878 44.670 13.742  1.00 27.08  ? 186 SER A CB     1 
ATOM   442  O OG     . SER A 1 36  ? -21.003 43.255 13.838  1.00 24.17  ? 186 SER A OG     1 
ATOM   443  H H      . SER A 1 36  ? -19.138 46.521 14.544  1.00 31.11  ? 186 SER A H      1 
ATOM   444  H HA     . SER A 1 36  ? -21.461 45.490 15.530  1.00 27.69  ? 186 SER A HA     1 
ATOM   445  H HB2    . SER A 1 36  ? -21.703 45.032 13.382  1.00 32.46  ? 186 SER A HB2    1 
ATOM   446  H HB3    . SER A 1 36  ? -20.143 44.877 13.145  1.00 32.46  ? 186 SER A HB3    1 
ATOM   447  H HG     . SER A 1 36  ? -21.640 43.057 14.349  1.00 28.97  ? 186 SER A HG     1 
ATOM   448  N N      . ASP A 1 37  ? -20.385 43.986 17.137  1.00 24.51  ? 187 ASP A N      1 
ATOM   449  C CA     . ASP A 1 37  ? -19.744 43.005 18.014  1.00 24.67  ? 187 ASP A CA     1 
ATOM   450  C C      . ASP A 1 37  ? -19.485 41.692 17.280  1.00 26.29  ? 187 ASP A C      1 
ATOM   451  O O      . ASP A 1 37  ? -18.484 41.020 17.531  1.00 23.13  ? 187 ASP A O      1 
ATOM   452  C CB     . ASP A 1 37  ? -20.602 42.743 19.262  1.00 33.16  ? 187 ASP A CB     1 
ATOM   453  C CG     . ASP A 1 37  ? -20.631 43.928 20.226  1.00 37.26  ? 187 ASP A CG     1 
ATOM   454  O OD1    . ASP A 1 37  ? -19.708 44.766 20.189  1.00 40.57  ? 187 ASP A OD1    1 
ATOM   455  O OD2    . ASP A 1 37  ? -21.593 44.027 21.008  1.00 43.41  ? 187 ASP A OD2    1 
ATOM   456  H H      . ASP A 1 37  ? -21.151 44.260 17.414  1.00 29.38  ? 187 ASP A H      1 
ATOM   457  H HA     . ASP A 1 37  ? -18.889 43.356 18.308  1.00 29.58  ? 187 ASP A HA     1 
ATOM   458  H HB2    . ASP A 1 37  ? -21.514 42.561 18.985  1.00 39.77  ? 187 ASP A HB2    1 
ATOM   459  H HB3    . ASP A 1 37  ? -20.242 41.979 19.738  1.00 39.77  ? 187 ASP A HB3    1 
ATOM   460  N N      . THR A 1 38  ? -20.386 41.306 16.378  1.00 22.22  ? 188 THR A N      1 
ATOM   461  C CA     . THR A 1 38  ? -20.197 40.093 15.587  1.00 23.79  ? 188 THR A CA     1 
ATOM   462  C C      . THR A 1 38  ? -18.943 40.189 14.709  1.00 29.64  ? 188 THR A C      1 
ATOM   463  O O      . THR A 1 38  ? -18.110 39.267 14.684  1.00 23.17  ? 188 THR A O      1 
ATOM   464  C CB     . THR A 1 38  ? -21.456 39.851 14.759  1.00 30.11  ? 188 THR A CB     1 
ATOM   465  O OG1    . THR A 1 38  ? -22.591 39.828 15.646  1.00 27.95  ? 188 THR A OG1    1 
ATOM   466  C CG2    . THR A 1 38  ? -21.374 38.535 13.994  1.00 25.07  ? 188 THR A CG2    1 
ATOM   467  H H      . THR A 1 38  ? -21.115 41.729 16.206  1.00 26.64  ? 188 THR A H      1 
ATOM   468  H HA     . THR A 1 38  ? -20.084 39.340 16.188  1.00 28.52  ? 188 THR A HA     1 
ATOM   469  H HB     . THR A 1 38  ? -21.563 40.571 14.118  1.00 36.11  ? 188 THR A HB     1 
ATOM   470  H HG1    . THR A 1 38  ? -23.296 39.696 15.208  1.00 33.51  ? 188 THR A HG1    1 
ATOM   471  H HG21   . THR A 1 38  ? -22.183 38.402 13.476  1.00 30.06  ? 188 THR A HG21   1 
ATOM   472  H HG22   . THR A 1 38  ? -20.613 38.548 13.393  1.00 30.06  ? 188 THR A HG22   1 
ATOM   473  H HG23   . THR A 1 38  ? -21.273 37.797 14.616  1.00 30.06  ? 188 THR A HG23   1 
ATOM   474  N N      . LEU A 1 39  ? -18.777 41.310 13.995  1.00 25.82  ? 189 LEU A N      1 
ATOM   475  C CA     . LEU A 1 39  ? -17.603 41.473 13.144  1.00 25.47  ? 189 LEU A CA     1 
ATOM   476  C C      . LEU A 1 39  ? -16.325 41.519 13.977  1.00 25.65  ? 189 LEU A C      1 
ATOM   477  O O      . LEU A 1 39  ? -15.314 40.915 13.596  1.00 24.34  ? 189 LEU A O      1 
ATOM   478  C CB     . LEU A 1 39  ? -17.753 42.727 12.287  1.00 27.26  ? 189 LEU A CB     1 
ATOM   479  C CG     . LEU A 1 39  ? -18.781 42.657 11.141  1.00 28.05  ? 189 LEU A CG     1 
ATOM   480  C CD1    . LEU A 1 39  ? -18.895 44.024 10.400  1.00 24.90  ? 189 LEU A CD1    1 
ATOM   481  C CD2    . LEU A 1 39  ? -18.457 41.542 10.150  1.00 29.30  ? 189 LEU A CD2    1 
ATOM   482  H H      . LEU A 1 39  ? -19.321 41.976 13.988  1.00 30.95  ? 189 LEU A H      1 
ATOM   483  H HA     . LEU A 1 39  ? -17.541 40.711 12.547  1.00 30.54  ? 189 LEU A HA     1 
ATOM   484  H HB2    . LEU A 1 39  ? -18.016 43.460 12.865  1.00 32.68  ? 189 LEU A HB2    1 
ATOM   485  H HB3    . LEU A 1 39  ? -16.891 42.926 11.888  1.00 32.68  ? 189 LEU A HB3    1 
ATOM   486  H HG     . LEU A 1 39  ? -19.651 42.462 11.522  1.00 33.63  ? 189 LEU A HG     1 
ATOM   487  H HD11   . LEU A 1 39  ? -19.548 43.944 9.688   1.00 29.85  ? 189 LEU A HD11   1 
ATOM   488  H HD12   . LEU A 1 39  ? -19.176 44.703 11.033  1.00 29.85  ? 189 LEU A HD12   1 
ATOM   489  H HD13   . LEU A 1 39  ? -18.028 44.255 10.030  1.00 29.85  ? 189 LEU A HD13   1 
ATOM   490  H HD21   . LEU A 1 39  ? -19.128 41.537 9.450   1.00 35.13  ? 189 LEU A HD21   1 
ATOM   491  H HD22   . LEU A 1 39  ? -17.580 41.705 9.768   1.00 35.13  ? 189 LEU A HD22   1 
ATOM   492  H HD23   . LEU A 1 39  ? -18.461 40.693 10.619  1.00 35.13  ? 189 LEU A HD23   1 
ATOM   493  N N      . ALA A 1 40  ? -16.376 42.173 15.149  1.00 21.48  ? 190 ALA A N      1 
ATOM   494  C CA     . ALA A 1 40  ? -15.189 42.335 15.989  1.00 29.49  ? 190 ALA A CA     1 
ATOM   495  C C      . ALA A 1 40  ? -14.759 41.023 16.637  1.00 31.50  ? 190 ALA A C      1 
ATOM   496  O O      . ALA A 1 40  ? -13.563 40.807 16.851  1.00 24.22  ? 190 ALA A O      1 
ATOM   497  C CB     . ALA A 1 40  ? -15.445 43.386 17.066  1.00 28.01  ? 190 ALA A CB     1 
ATOM   498  H H      . ALA A 1 40  ? -17.088 42.529 15.475  1.00 25.75  ? 190 ALA A H      1 
ATOM   499  H HA     . ALA A 1 40  ? -14.455 42.648 15.437  1.00 35.35  ? 190 ALA A HA     1 
ATOM   500  H HB1    . ALA A 1 40  ? -14.649 43.479 17.612  1.00 33.58  ? 190 ALA A HB1    1 
ATOM   501  H HB2    . ALA A 1 40  ? -15.654 44.231 16.639  1.00 33.58  ? 190 ALA A HB2    1 
ATOM   502  H HB3    . ALA A 1 40  ? -16.191 43.100 17.616  1.00 33.58  ? 190 ALA A HB3    1 
ATOM   503  N N      . SER A 1 41  ? -15.705 40.136 16.957  1.00 27.85  ? 191 SER A N      1 
ATOM   504  C CA     . SER A 1 41  ? -15.335 38.825 17.495  1.00 26.11  ? 191 SER A CA     1 
ATOM   505  C C      . SER A 1 41  ? -14.652 37.984 16.437  1.00 28.13  ? 191 SER A C      1 
ATOM   506  O O      . SER A 1 41  ? -13.663 37.302 16.730  1.00 33.78  ? 191 SER A O      1 
ATOM   507  C CB     . SER A 1 41  ? -16.566 38.085 18.045  1.00 30.36  ? 191 SER A CB     1 
ATOM   508  O OG     . SER A 1 41  ? -17.035 38.761 19.186  1.00 41.95  ? 191 SER A OG     1 
ATOM   509  H H      . SER A 1 41  ? -16.551 40.265 16.874  1.00 33.40  ? 191 SER A H      1 
ATOM   510  H HA     . SER A 1 41  ? -14.710 38.950 18.227  1.00 31.30  ? 191 SER A HA     1 
ATOM   511  H HB2    . SER A 1 41  ? -17.262 38.073 17.370  1.00 36.40  ? 191 SER A HB2    1 
ATOM   512  H HB3    . SER A 1 41  ? -16.316 37.180 18.288  1.00 36.40  ? 191 SER A HB3    1 
ATOM   513  H HG     . SER A 1 41  ? -17.249 39.548 18.986  1.00 50.32  ? 191 SER A HG     1 
ATOM   514  N N      . TYR A 1 42  ? -15.166 38.027 15.198  1.00 26.04  ? 192 TYR A N      1 
ATOM   515  C CA     . TYR A 1 42  ? -14.507 37.353 14.085  1.00 26.47  ? 192 TYR A CA     1 
ATOM   516  C C      . TYR A 1 42  ? -13.091 37.893 13.896  1.00 30.47  ? 192 TYR A C      1 
ATOM   517  O O      . TYR A 1 42  ? -12.122 37.127 13.813  1.00 26.08  ? 192 TYR A O      1 
ATOM   518  C CB     . TYR A 1 42  ? -15.330 37.505 12.796  1.00 25.32  ? 192 TYR A CB     1 
ATOM   519  C CG     . TYR A 1 42  ? -14.681 36.814 11.588  1.00 28.36  ? 192 TYR A CG     1 
ATOM   520  C CD1    . TYR A 1 42  ? -15.029 35.519 11.226  1.00 33.41  ? 192 TYR A CD1    1 
ATOM   521  C CD2    . TYR A 1 42  ? -13.675 37.451 10.844  1.00 28.52  ? 192 TYR A CD2    1 
ATOM   522  C CE1    . TYR A 1 42  ? -14.413 34.876 10.127  1.00 32.15  ? 192 TYR A CE1    1 
ATOM   523  C CE2    . TYR A 1 42  ? -13.065 36.833 9.763   1.00 27.18  ? 192 TYR A CE2    1 
ATOM   524  C CZ     . TYR A 1 42  ? -13.429 35.537 9.407   1.00 33.47  ? 192 TYR A CZ     1 
ATOM   525  O OH     . TYR A 1 42  ? -12.819 34.904 8.331   1.00 27.32  ? 192 TYR A OH     1 
ATOM   526  H H      . TYR A 1 42  ? -15.890 38.438 14.984  1.00 31.22  ? 192 TYR A H      1 
ATOM   527  H HA     . TYR A 1 42  ? -14.440 36.407 14.286  1.00 31.73  ? 192 TYR A HA     1 
ATOM   528  H HB2    . TYR A 1 42  ? -16.206 37.111 12.932  1.00 30.35  ? 192 TYR A HB2    1 
ATOM   529  H HB3    . TYR A 1 42  ? -15.420 38.448 12.588  1.00 30.35  ? 192 TYR A HB3    1 
ATOM   530  H HD1    . TYR A 1 42  ? -15.685 35.071 11.708  1.00 40.06  ? 192 TYR A HD1    1 
ATOM   531  H HD2    . TYR A 1 42  ? -13.421 38.316 11.074  1.00 34.20  ? 192 TYR A HD2    1 
ATOM   532  H HE1    . TYR A 1 42  ? -14.661 34.011 9.894   1.00 38.55  ? 192 TYR A HE1    1 
ATOM   533  H HE2    . TYR A 1 42  ? -12.405 37.279 9.283   1.00 32.58  ? 192 TYR A HE2    1 
ATOM   534  H HH     . TYR A 1 42  ? -12.246 35.412 7.986   1.00 32.75  ? 192 TYR A HH     1 
ATOM   535  N N      . ALA A 1 43  ? -12.951 39.219 13.859  1.00 23.15  ? 193 ALA A N      1 
ATOM   536  C CA     . ALA A 1 43  ? -11.633 39.822 13.623  1.00 30.06  ? 193 ALA A CA     1 
ATOM   537  C C      . ALA A 1 43  ? -10.643 39.461 14.735  1.00 28.62  ? 193 ALA A C      1 
ATOM   538  O O      . ALA A 1 43  ? -9.504  39.044 14.467  1.00 30.76  ? 193 ALA A O      1 
ATOM   539  C CB     . ALA A 1 43  ? -11.773 41.347 13.478  1.00 26.36  ? 193 ALA A CB     1 
ATOM   540  H H      . ALA A 1 43  ? -13.590 39.785 13.966  1.00 27.75  ? 193 ALA A H      1 
ATOM   541  H HA     . ALA A 1 43  ? -11.278 39.477 12.788  1.00 36.05  ? 193 ALA A HA     1 
ATOM   542  H HB1    . ALA A 1 43  ? -10.895 41.731 13.322  1.00 31.60  ? 193 ALA A HB1    1 
ATOM   543  H HB2    . ALA A 1 43  ? -12.356 41.541 12.728  1.00 31.60  ? 193 ALA A HB2    1 
ATOM   544  H HB3    . ALA A 1 43  ? -12.152 41.708 14.295  1.00 31.60  ? 193 ALA A HB3    1 
ATOM   545  N N      . GLN A 1 44  ? -11.054 39.620 15.993  1.00 26.70  ? 194 GLN A N      1 
ATOM   546  C CA     . GLN A 1 44  ? -10.141 39.381 17.103  1.00 30.39  ? 194 GLN A CA     1 
ATOM   547  C C      . GLN A 1 44  ? -9.764  37.904 17.208  1.00 35.54  ? 194 GLN A C      1 
ATOM   548  O O      . GLN A 1 44  ? -8.610  37.571 17.518  1.00 29.95  ? 194 GLN A O      1 
ATOM   549  C CB     . GLN A 1 44  ? -10.758 39.880 18.409  1.00 32.64  ? 194 GLN A CB     1 
ATOM   550  C CG     . GLN A 1 44  ? -9.810  39.797 19.612  1.00 29.71  ? 194 GLN A CG     1 
ATOM   551  C CD     . GLN A 1 44  ? -8.587  40.696 19.467  1.00 35.42  ? 194 GLN A CD     1 
ATOM   552  O OE1    . GLN A 1 44  ? -8.703  41.927 19.351  1.00 31.24  ? 194 GLN A OE1    1 
ATOM   553  N NE2    . GLN A 1 44  ? -7.404  40.083 19.481  1.00 32.66  ? 194 GLN A NE2    1 
ATOM   554  H H      . GLN A 1 44  ? -11.846 39.862 16.225  1.00 32.02  ? 194 GLN A H      1 
ATOM   555  H HA     . GLN A 1 44  ? -9.326  39.884 16.950  1.00 36.44  ? 194 GLN A HA     1 
ATOM   556  H HB2    . GLN A 1 44  ? -11.016 40.808 18.298  1.00 39.13  ? 194 GLN A HB2    1 
ATOM   557  H HB3    . GLN A 1 44  ? -11.540 39.343 18.610  1.00 39.13  ? 194 GLN A HB3    1 
ATOM   558  H HG2    . GLN A 1 44  ? -10.289 40.070 20.410  1.00 35.62  ? 194 GLN A HG2    1 
ATOM   559  H HG3    . GLN A 1 44  ? -9.500  38.883 19.707  1.00 35.62  ? 194 GLN A HG3    1 
ATOM   560  H HE21   . GLN A 1 44  ? -7.363  39.229 19.568  1.00 39.17  ? 194 GLN A HE21   1 
ATOM   561  H HE22   . GLN A 1 44  ? -6.681  40.542 19.403  1.00 39.17  ? 194 GLN A HE22   1 
ATOM   562  N N      . ASP A 1 45  ? -10.712 37.005 16.937  1.00 32.13  ? 195 ASP A N      1 
ATOM   563  C CA     . ASP A 1 45  ? -10.368 35.582 16.880  1.00 35.32  ? 195 ASP A CA     1 
ATOM   564  C C      . ASP A 1 45  ? -9.246  35.325 15.888  1.00 36.00  ? 195 ASP A C      1 
ATOM   565  O O      . ASP A 1 45  ? -8.343  34.532 16.168  1.00 32.84  ? 195 ASP A O      1 
ATOM   566  C CB     . ASP A 1 45  ? -11.583 34.727 16.503  1.00 36.22  ? 195 ASP A CB     1 
ATOM   567  C CG     . ASP A 1 45  ? -12.599 34.593 17.639  1.00 50.02  ? 195 ASP A CG     1 
ATOM   568  O OD1    . ASP A 1 45  ? -12.288 34.985 18.794  1.00 39.89  ? 195 ASP A OD1    1 
ATOM   569  O OD2    . ASP A 1 45  ? -13.722 34.095 17.363  1.00 50.16  ? 195 ASP A OD2    1 
ATOM   570  H H      . ASP A 1 45  ? -11.539 37.185 16.786  1.00 38.52  ? 195 ASP A H      1 
ATOM   571  H HA     . ASP A 1 45  ? -10.064 35.297 17.755  1.00 42.35  ? 195 ASP A HA     1 
ATOM   572  N N      . TYR A 1 46  ? -9.294  35.963 14.708  1.00 29.83  ? 196 TYR A N      1 
ATOM   573  C CA     . TYR A 1 46  ? -8.249  35.739 13.704  1.00 35.43  ? 196 TYR A CA     1 
ATOM   574  C C      . TYR A 1 46  ? -6.922  36.355 14.139  1.00 35.99  ? 196 TYR A C      1 
ATOM   575  O O      . TYR A 1 46  ? -5.854  35.760 13.937  1.00 32.60  ? 196 TYR A O      1 
ATOM   576  C CB     . TYR A 1 46  ? -8.685  36.302 12.354  1.00 33.77  ? 196 TYR A CB     1 
ATOM   577  C CG     . TYR A 1 46  ? -7.870  35.856 11.155  1.00 33.32  ? 196 TYR A CG     1 
ATOM   578  C CD1    . TYR A 1 46  ? -7.882  34.532 10.730  1.00 36.33  ? 196 TYR A CD1    1 
ATOM   579  C CD2    . TYR A 1 46  ? -7.112  36.772 10.428  1.00 31.59  ? 196 TYR A CD2    1 
ATOM   580  C CE1    . TYR A 1 46  ? -7.133  34.122 9.599   1.00 38.19  ? 196 TYR A CE1    1 
ATOM   581  C CE2    . TYR A 1 46  ? -6.369  36.384 9.302   1.00 28.77  ? 196 TYR A CE2    1 
ATOM   582  C CZ     . TYR A 1 46  ? -6.371  35.061 8.899   1.00 32.13  ? 196 TYR A CZ     1 
ATOM   583  O OH     . TYR A 1 46  ? -5.645  34.682 7.788   1.00 34.29  ? 196 TYR A OH     1 
ATOM   584  H H      . TYR A 1 46  ? -9.907  36.517 14.472  1.00 35.77  ? 196 TYR A H      1 
ATOM   585  H HA     . TYR A 1 46  ? -8.115  34.784 13.600  1.00 42.48  ? 196 TYR A HA     1 
ATOM   586  H HB2    . TYR A 1 46  ? -9.604  36.035 12.194  1.00 40.50  ? 196 TYR A HB2    1 
ATOM   587  H HB3    . TYR A 1 46  ? -8.633  37.270 12.396  1.00 40.50  ? 196 TYR A HB3    1 
ATOM   588  H HD1    . TYR A 1 46  ? -8.384  33.905 11.198  1.00 43.56  ? 196 TYR A HD1    1 
ATOM   589  H HD2    . TYR A 1 46  ? -7.100  37.663 10.694  1.00 37.88  ? 196 TYR A HD2    1 
ATOM   590  H HE1    . TYR A 1 46  ? -7.143  33.232 9.328   1.00 45.79  ? 196 TYR A HE1    1 
ATOM   591  H HE2    . TYR A 1 46  ? -5.865  37.012 8.837   1.00 34.49  ? 196 TYR A HE2    1 
ATOM   592  H HH     . TYR A 1 46  ? -5.238  35.344 7.471   1.00 41.12  ? 196 TYR A HH     1 
ATOM   593  N N      . ALA A 1 47  ? -6.968  37.533 14.755  1.00 32.98  ? 197 ALA A N      1 
ATOM   594  C CA     . ALA A 1 47  ? -5.743  38.158 15.243  1.00 37.01  ? 197 ALA A CA     1 
ATOM   595  C C      . ALA A 1 47  ? -5.094  37.317 16.337  1.00 38.31  ? 197 ALA A C      1 
ATOM   596  O O      . ALA A 1 47  ? -3.871  37.147 16.343  1.00 35.43  ? 197 ALA A O      1 
ATOM   597  C CB     . ALA A 1 47  ? -6.031  39.563 15.764  1.00 31.37  ? 197 ALA A CB     1 
ATOM   598  H H      . ALA A 1 47  ? -7.685  37.986 14.900  1.00 39.54  ? 197 ALA A H      1 
ATOM   599  H HA     . ALA A 1 47  ? -5.113  38.234 14.510  1.00 44.38  ? 197 ALA A HA     1 
ATOM   600  H HB1    . ALA A 1 47  ? -5.204  39.957 16.083  1.00 37.62  ? 197 ALA A HB1    1 
ATOM   601  H HB2    . ALA A 1 47  ? -6.396  40.097 15.042  1.00 37.62  ? 197 ALA A HB2    1 
ATOM   602  H HB3    . ALA A 1 47  ? -6.672  39.504 16.490  1.00 37.62  ? 197 ALA A HB3    1 
ATOM   603  N N      . ASP A 1 48  ? -5.903  36.796 17.277  1.00 38.75  ? 198 ASP A N      1 
ATOM   604  C CA     . ASP A 1 48  ? -5.399  35.896 18.320  1.00 40.10  ? 198 ASP A CA     1 
ATOM   605  C C      . ASP A 1 48  ? -4.529  34.785 17.741  1.00 41.73  ? 198 ASP A C      1 
ATOM   606  O O      . ASP A 1 48  ? -3.604  34.317 18.403  1.00 42.85  ? 198 ASP A O      1 
ATOM   607  C CB     . ASP A 1 48  ? -6.555  35.250 19.095  1.00 40.90  ? 198 ASP A CB     1 
ATOM   608  C CG     . ASP A 1 48  ? -7.198  36.183 20.119  1.00 38.44  ? 198 ASP A CG     1 
ATOM   609  O OD1    . ASP A 1 48  ? -6.660  37.275 20.429  1.00 35.10  ? 198 ASP A OD1    1 
ATOM   610  O OD2    . ASP A 1 48  ? -8.265  35.798 20.633  1.00 34.80  ? 198 ASP A OD2    1 
ATOM   611  H H      . ASP A 1 48  ? -6.747  36.952 17.329  1.00 46.47  ? 198 ASP A H      1 
ATOM   612  H HA     . ASP A 1 48  ? -4.862  36.405 18.947  1.00 48.09  ? 198 ASP A HA     1 
ATOM   613  H HB2    . ASP A 1 48  ? -7.242  34.980 18.466  1.00 49.05  ? 198 ASP A HB2    1 
ATOM   614  H HB3    . ASP A 1 48  ? -6.219  34.473 19.569  1.00 49.05  ? 198 ASP A HB3    1 
ATOM   615  N N      . ASN A 1 49  ? -4.799  34.366 16.509  1.00 39.61  ? 199 ASN A N      1 
ATOM   616  C CA     . ASN A 1 49  ? -4.083  33.275 15.866  1.00 42.02  ? 199 ASN A CA     1 
ATOM   617  C C      . ASN A 1 49  ? -2.926  33.698 14.957  1.00 39.83  ? 199 ASN A C      1 
ATOM   618  O O      . ASN A 1 49  ? -2.336  32.822 14.321  1.00 36.70  ? 199 ASN A O      1 
ATOM   619  C CB     . ASN A 1 49  ? -5.063  32.445 15.041  1.00 40.46  ? 199 ASN A CB     1 
ATOM   620  C CG     . ASN A 1 49  ? -5.989  31.605 15.907  1.00 50.00  ? 199 ASN A CG     1 
ATOM   621  O OD1    . ASN A 1 49  ? -5.626  31.208 17.017  1.00 50.18  ? 199 ASN A OD1    1 
ATOM   622  N ND2    . ASN A 1 49  ? -7.192  31.325 15.397  1.00 55.71  ? 199 ASN A ND2    1 
ATOM   623  H H      . ASN A 1 49  ? -5.412  34.710 16.013  1.00 47.50  ? 199 ASN A H      1 
ATOM   624  H HA     . ASN A 1 49  ? -3.717  32.699 16.555  1.00 50.39  ? 199 ASN A HA     1 
ATOM   625  H HB2    . ASN A 1 49  ? -5.610  33.040 14.506  1.00 48.52  ? 199 ASN A HB2    1 
ATOM   626  H HB3    . ASN A 1 49  ? -4.564  31.844 14.466  1.00 48.52  ? 199 ASN A HB3    1 
ATOM   627  H HD21   . ASN A 1 49  ? -7.751  30.854 15.849  1.00 66.83  ? 199 ASN A HD21   1 
ATOM   628  H HD22   . ASN A 1 49  ? -7.406  31.617 14.617  1.00 66.83  ? 199 ASN A HD22   1 
ATOM   629  N N      . TYR A 1 50  ? -2.591  34.990 14.852  1.00 34.87  ? 200 TYR A N      1 
ATOM   630  C CA     . TYR A 1 50  ? -1.497  35.400 13.969  1.00 44.56  ? 200 TYR A CA     1 
ATOM   631  C C      . TYR A 1 50  ? -0.149  34.913 14.515  1.00 40.29  ? 200 TYR A C      1 
ATOM   632  O O      . TYR A 1 50  ? 0.108   34.995 15.719  1.00 36.26  ? 200 TYR A O      1 
ATOM   633  C CB     . TYR A 1 50  ? -1.479  36.929 13.809  1.00 36.53  ? 200 TYR A CB     1 
ATOM   634  C CG     . TYR A 1 50  ? -0.379  37.473 12.900  1.00 33.35  ? 200 TYR A CG     1 
ATOM   635  C CD1    . TYR A 1 50  ? -0.306  37.102 11.566  1.00 39.23  ? 200 TYR A CD1    1 
ATOM   636  C CD2    . TYR A 1 50  ? 0.569   38.369 13.378  1.00 36.00  ? 200 TYR A CD2    1 
ATOM   637  C CE1    . TYR A 1 50  ? 0.690   37.595 10.732  1.00 43.24  ? 200 TYR A CE1    1 
ATOM   638  C CE2    . TYR A 1 50  ? 1.570   38.870 12.554  1.00 37.02  ? 200 TYR A CE2    1 
ATOM   639  C CZ     . TYR A 1 50  ? 1.626   38.476 11.231  1.00 45.34  ? 200 TYR A CZ     1 
ATOM   640  O OH     . TYR A 1 50  ? 2.612   38.968 10.397  1.00 44.03  ? 200 TYR A OH     1 
ATOM   641  H H      . TYR A 1 50  ? -2.975  35.635 15.273  1.00 41.82  ? 200 TYR A H      1 
ATOM   642  H HA     . TYR A 1 50  ? -1.630  35.005 13.093  1.00 53.45  ? 200 TYR A HA     1 
ATOM   643  H HB2    . TYR A 1 50  ? -2.330  37.210 13.437  1.00 43.81  ? 200 TYR A HB2    1 
ATOM   644  H HB3    . TYR A 1 50  ? -1.359  37.329 14.684  1.00 43.81  ? 200 TYR A HB3    1 
ATOM   645  H HD1    . TYR A 1 50  ? -0.932  36.505 11.225  1.00 47.05  ? 200 TYR A HD1    1 
ATOM   646  H HD2    . TYR A 1 50  ? 0.538   38.633 14.269  1.00 43.18  ? 200 TYR A HD2    1 
ATOM   647  H HE1    . TYR A 1 50  ? 0.725   37.331 9.841   1.00 51.86  ? 200 TYR A HE1    1 
ATOM   648  H HE2    . TYR A 1 50  ? 2.199   39.465 12.892  1.00 44.39  ? 200 TYR A HE2    1 
ATOM   649  H HH     . TYR A 1 50  ? 2.521   38.650 9.625   1.00 52.81  ? 200 TYR A HH     1 
ATOM   650  N N      . ASP A 1 51  ? 0.721   34.435 13.612  1.00 41.95  ? 201 ASP A N      1 
ATOM   651  C CA     . ASP A 1 51  ? 2.015   33.830 13.963  1.00 45.12  ? 201 ASP A CA     1 
ATOM   652  C C      . ASP A 1 51  ? 3.159   34.837 14.081  1.00 47.59  ? 201 ASP A C      1 
ATOM   653  O O      . ASP A 1 51  ? 4.305   34.423 14.276  1.00 48.29  ? 201 ASP A O      1 
ATOM   654  C CB     . ASP A 1 51  ? 2.407   32.740 12.942  1.00 39.29  ? 201 ASP A CB     1 
ATOM   655  C CG     . ASP A 1 51  ? 2.659   33.286 11.516  1.00 48.80  ? 201 ASP A CG     1 
ATOM   656  O OD1    . ASP A 1 51  ? 2.858   34.508 11.331  1.00 46.40  ? 201 ASP A OD1    1 
ATOM   657  O OD2    . ASP A 1 51  ? 2.672   32.468 10.562  1.00 48.24  ? 201 ASP A OD2    1 
ATOM   658  H H      . ASP A 1 51  ? 0.578   34.451 12.764  1.00 50.31  ? 201 ASP A H      1 
ATOM   659  H HA     . ASP A 1 51  ? 1.923   33.397 14.826  1.00 54.11  ? 201 ASP A HA     1 
ATOM   660  H HB2    . ASP A 1 51  ? 3.223   32.309 13.243  1.00 47.12  ? 201 ASP A HB2    1 
ATOM   661  H HB3    . ASP A 1 51  ? 1.691   32.089 12.888  1.00 47.12  ? 201 ASP A HB3    1 
ATOM   662  N N      . CYS A 1 52  ? 2.886   36.136 13.965  1.00 44.38  ? 202 CYS A N      1 
ATOM   663  C CA     . CYS A 1 52  ? 3.912   37.167 14.139  1.00 42.51  ? 202 CYS A CA     1 
ATOM   664  C C      . CYS A 1 52  ? 5.143   36.885 13.268  1.00 44.74  ? 202 CYS A C      1 
ATOM   665  O O      . CYS A 1 52  ? 6.284   37.150 13.655  1.00 45.84  ? 202 CYS A O      1 
ATOM   666  C CB     . CYS A 1 52  ? 4.290   37.313 15.621  1.00 42.88  ? 202 CYS A CB     1 
ATOM   667  S SG     . CYS A 1 52  ? 2.985   38.063 16.670  1.00 48.93  ? 202 CYS A SG     1 
ATOM   668  H H      . CYS A 1 52  ? 2.106   36.451 13.785  1.00 53.22  ? 202 CYS A H      1 
ATOM   669  H HA     . CYS A 1 52  ? 3.543   38.016 13.851  1.00 50.98  ? 202 CYS A HA     1 
ATOM   670  H HB2    . CYS A 1 52  ? 4.485   36.432 15.979  1.00 51.43  ? 202 CYS A HB2    1 
ATOM   671  H HB3    . CYS A 1 52  ? 5.078   37.874 15.687  1.00 51.43  ? 202 CYS A HB3    1 
ATOM   672  N N      . SER A 1 53  ? 4.896   36.393 12.053  1.00 41.35  ? 203 SER A N      1 
ATOM   673  C CA     . SER A 1 53  ? 5.951   36.083 11.094  1.00 44.46  ? 203 SER A CA     1 
ATOM   674  C C      . SER A 1 53  ? 6.296   37.235 10.154  1.00 52.63  ? 203 SER A C      1 
ATOM   675  O O      . SER A 1 53  ? 7.363   37.199 9.528   1.00 44.11  ? 203 SER A O      1 
ATOM   676  C CB     . SER A 1 53  ? 5.539   34.890 10.230  1.00 46.79  ? 203 SER A CB     1 
ATOM   677  O OG     . SER A 1 53  ? 4.569   35.281 9.255   1.00 47.62  ? 203 SER A OG     1 
ATOM   678  H H      . SER A 1 53  ? 4.106   36.227 11.757  1.00 49.59  ? 203 SER A H      1 
ATOM   679  H HA     . SER A 1 53  ? 6.756   35.841 11.578  1.00 53.32  ? 203 SER A HA     1 
ATOM   680  H HB2    . SER A 1 53  ? 6.323   34.544 9.776   1.00 56.11  ? 203 SER A HB2    1 
ATOM   681  H HB3    . SER A 1 53  ? 5.156   34.205 10.800  1.00 56.11  ? 203 SER A HB3    1 
ATOM   682  H HG     . SER A 1 53  ? 3.885   35.584 9.635   1.00 57.12  ? 203 SER A HG     1 
ATOM   683  N N      . GLY A 1 54  ? 5.414   38.230 9.999   1.00 45.83  ? 204 GLY A N      1 
ATOM   684  C CA     . GLY A 1 54  ? 5.636   39.311 9.063   1.00 45.66  ? 204 GLY A CA     1 
ATOM   685  C C      . GLY A 1 54  ? 4.874   39.196 7.751   1.00 46.67  ? 204 GLY A C      1 
ATOM   686  O O      . GLY A 1 54  ? 4.879   40.151 6.959   1.00 42.62  ? 204 GLY A O      1 
ATOM   687  H H      . GLY A 1 54  ? 4.675   38.293 10.434  1.00 54.96  ? 204 GLY A H      1 
ATOM   688  H HA2    . GLY A 1 54  ? 5.382   40.148 9.483   1.00 54.77  ? 204 GLY A HA2    1 
ATOM   689  H HA3    . GLY A 1 54  ? 6.583   39.356 8.854   1.00 54.77  ? 204 GLY A HA3    1 
ATOM   690  N N      . THR A 1 55  ? 4.232   38.071 7.491   1.00 46.53  ? 205 THR A N      1 
ATOM   691  C CA     . THR A 1 55  ? 3.431   37.902 6.290   1.00 69.24  ? 205 THR A CA     1 
ATOM   692  C C      . THR A 1 55  ? 1.960   38.177 6.595   1.00 64.55  ? 205 THR A C      1 
ATOM   693  O O      . THR A 1 55  ? 1.479   37.942 7.708   1.00 57.32  ? 205 THR A O      1 
ATOM   694  C CB     . THR A 1 55  ? 3.583   36.490 5.721   1.00 102.63 ? 205 THR A CB     1 
ATOM   695  O OG1    . THR A 1 55  ? 3.379   35.534 6.768   1.00 59.56  ? 205 THR A OG1    1 
ATOM   696  C CG2    . THR A 1 55  ? 4.972   36.302 5.114   1.00 93.09  ? 205 THR A CG2    1 
ATOM   697  H H      . THR A 1 55  ? 4.243   37.379 8.002   1.00 55.81  ? 205 THR A H      1 
ATOM   698  H HA     . THR A 1 55  ? 3.725   38.535 5.617   1.00 83.06  ? 205 THR A HA     1 
ATOM   699  N N      . LEU A 1 56  ? 1.251   38.675 5.585   1.00 51.47  ? 206 LEU A N      1 
ATOM   700  C CA     . LEU A 1 56  ? -0.173  38.978 5.686   1.00 45.78  ? 206 LEU A CA     1 
ATOM   701  C C      . LEU A 1 56  ? -0.947  38.067 4.742   1.00 43.66  ? 206 LEU A C      1 
ATOM   702  O O      . LEU A 1 56  ? -0.848  38.198 3.518   1.00 48.06  ? 206 LEU A O      1 
ATOM   703  C CB     . LEU A 1 56  ? -0.431  40.444 5.363   1.00 40.75  ? 206 LEU A CB     1 
ATOM   704  C CG     . LEU A 1 56  ? 0.218   41.462 6.303   1.00 43.34  ? 206 LEU A CG     1 
ATOM   705  C CD1    . LEU A 1 56  ? -0.195  42.867 5.918   1.00 39.98  ? 206 LEU A CD1    1 
ATOM   706  C CD2    . LEU A 1 56  ? -0.123  41.201 7.765   1.00 40.73  ? 206 LEU A CD2    1 
ATOM   707  H H      . LEU A 1 56  ? 1.583   38.851 4.812   1.00 61.73  ? 206 LEU A H      1 
ATOM   708  H HA     . LEU A 1 56  ? -0.475  38.808 6.592   1.00 54.91  ? 206 LEU A HA     1 
ATOM   709  H HB2    . LEU A 1 56  ? -0.100  40.623 4.469   1.00 48.87  ? 206 LEU A HB2    1 
ATOM   710  H HB3    . LEU A 1 56  ? -1.389  40.597 5.388   1.00 48.87  ? 206 LEU A HB3    1 
ATOM   711  H HG     . LEU A 1 56  ? 1.182   41.402 6.209   1.00 51.97  ? 206 LEU A HG     1 
ATOM   712  H HD11   . LEU A 1 56  ? 0.226   43.497 6.523   1.00 47.95  ? 206 LEU A HD11   1 
ATOM   713  H HD12   . LEU A 1 56  ? 0.091   43.041 5.007   1.00 47.95  ? 206 LEU A HD12   1 
ATOM   714  H HD13   . LEU A 1 56  ? -1.160  42.941 5.981   1.00 47.95  ? 206 LEU A HD13   1 
ATOM   715  H HD21   . LEU A 1 56  ? 0.312   41.872 8.315   1.00 48.85  ? 206 LEU A HD21   1 
ATOM   716  H HD22   . LEU A 1 56  ? -1.085  41.253 7.878   1.00 48.85  ? 206 LEU A HD22   1 
ATOM   717  H HD23   . LEU A 1 56  ? 0.193   40.317 8.009   1.00 48.85  ? 206 LEU A HD23   1 
ATOM   718  N N      . THR A 1 57  ? -1.719  37.155 5.318   1.00 38.42  ? 207 THR A N      1 
ATOM   719  C CA     . THR A 1 57  ? -2.572  36.238 4.575   1.00 40.35  ? 207 THR A CA     1 
ATOM   720  C C      . THR A 1 57  ? -4.030  36.487 4.956   1.00 34.02  ? 207 THR A C      1 
ATOM   721  O O      . THR A 1 57  ? -4.361  36.573 6.146   1.00 32.77  ? 207 THR A O      1 
ATOM   722  C CB     . THR A 1 57  ? -2.170  34.790 4.868   1.00 38.97  ? 207 THR A CB     1 
ATOM   723  O OG1    . THR A 1 57  ? -0.771  34.627 4.588   1.00 51.16  ? 207 THR A OG1    1 
ATOM   724  C CG2    . THR A 1 57  ? -2.958  33.813 4.016   1.00 38.78  ? 207 THR A CG2    1 
ATOM   725  H H      . THR A 1 57  ? -1.767  37.044 6.170   1.00 46.07  ? 207 THR A H      1 
ATOM   726  H HA     . THR A 1 57  ? -2.470  36.400 3.624   1.00 48.40  ? 207 THR A HA     1 
ATOM   727  H HB     . THR A 1 57  ? -2.338  34.589 5.802   1.00 46.74  ? 207 THR A HB     1 
ATOM   728  H HG1    . THR A 1 57  ? -0.537  33.836 4.745   1.00 61.37  ? 207 THR A HG1    1 
ATOM   729  H HG21   . THR A 1 57  ? -2.688  32.904 4.218   1.00 46.50  ? 207 THR A HG21   1 
ATOM   730  H HG22   . THR A 1 57  ? -3.907  33.907 4.196   1.00 46.50  ? 207 THR A HG22   1 
ATOM   731  H HG23   . THR A 1 57  ? -2.796  33.988 3.076   1.00 46.50  ? 207 THR A HG23   1 
ATOM   732  N N      . HIS A 1 58  ? -4.885  36.610 3.948   1.00 30.34  ? 208 HIS A N      1 
ATOM   733  C CA     . HIS A 1 58  ? -6.306  36.854 4.158   1.00 32.53  ? 208 HIS A CA     1 
ATOM   734  C C      . HIS A 1 58  ? -6.980  35.619 4.736   1.00 37.37  ? 208 HIS A C      1 
ATOM   735  O O      . HIS A 1 58  ? -6.536  34.489 4.520   1.00 33.41  ? 208 HIS A O      1 
ATOM   736  C CB     . HIS A 1 58  ? -6.981  37.229 2.836   1.00 33.77  ? 208 HIS A CB     1 
ATOM   737  C CG     . HIS A 1 58  ? -6.841  38.673 2.484   1.00 43.09  ? 208 HIS A CG     1 
ATOM   738  N ND1    . HIS A 1 58  ? -7.324  39.681 3.293   1.00 34.18  ? 208 HIS A ND1    1 
ATOM   739  C CD2    . HIS A 1 58  ? -6.262  39.282 1.422   1.00 40.01  ? 208 HIS A CD2    1 
ATOM   740  C CE1    . HIS A 1 58  ? -7.058  40.849 2.735   1.00 36.72  ? 208 HIS A CE1    1 
ATOM   741  N NE2    . HIS A 1 58  ? -6.414  40.635 1.601   1.00 40.00  ? 208 HIS A NE2    1 
ATOM   742  H H      . HIS A 1 58  ? -4.662  36.556 3.120   1.00 36.38  ? 208 HIS A H      1 
ATOM   743  H HA     . HIS A 1 58  ? -6.421  37.588 4.781   1.00 39.01  ? 208 HIS A HA     1 
ATOM   744  H HB2    . HIS A 1 58  ? -6.581  36.708 2.121   1.00 40.50  ? 208 HIS A HB2    1 
ATOM   745  H HB3    . HIS A 1 58  ? -7.927  37.028 2.899   1.00 40.50  ? 208 HIS A HB3    1 
ATOM   746  H HD1    . HIS A 1 58  ? -7.739  39.567 4.038   1.00 40.99  ? 208 HIS A HD1    1 
ATOM   747  H HD2    . HIS A 1 58  ? -5.847  38.863 0.703   1.00 47.99  ? 208 HIS A HD2    1 
ATOM   748  H HE1    . HIS A 1 58  ? -7.282  41.682 3.084   1.00 44.04  ? 208 HIS A HE1    1 
ATOM   749  N N      . SER A 1 59  ? -8.087  35.842 5.452   1.00 37.59  ? 209 SER A N      1 
ATOM   750  C CA     . SER A 1 59  ? -8.726  34.764 6.199   1.00 37.09  ? 209 SER A CA     1 
ATOM   751  C C      . SER A 1 59  ? -9.599  33.858 5.337   1.00 31.18  ? 209 SER A C      1 
ATOM   752  O O      . SER A 1 59  ? -9.915  32.748 5.768   1.00 34.83  ? 209 SER A O      1 
ATOM   753  C CB     . SER A 1 59  ? -9.573  35.342 7.338   1.00 33.69  ? 209 SER A CB     1 
ATOM   754  O OG     . SER A 1 59  ? -10.788 35.935 6.852   1.00 29.21  ? 209 SER A OG     1 
ATOM   755  H H      . SER A 1 59  ? -8.481  36.603 5.519   1.00 45.08  ? 209 SER A H      1 
ATOM   756  H HA     . SER A 1 59  ? -8.035  34.212 6.597   1.00 44.48  ? 209 SER A HA     1 
ATOM   757  H HB2    . SER A 1 59  ? -9.798  34.627 7.954   1.00 40.40  ? 209 SER A HB2    1 
ATOM   758  H HB3    . SER A 1 59  ? -9.056  36.022 7.798   1.00 40.40  ? 209 SER A HB3    1 
ATOM   759  H HG     . SER A 1 59  ? -10.610 36.559 6.319   1.00 35.02  ? 209 SER A HG     1 
ATOM   760  N N      . GLY A 1 60  ? -10.014 34.294 4.152   1.00 29.25  ? 210 GLY A N      1 
ATOM   761  C CA     . GLY A 1 60  ? -10.945 33.502 3.369   1.00 32.40  ? 210 GLY A CA     1 
ATOM   762  C C      . GLY A 1 60  ? -12.388 33.513 3.847   1.00 40.71  ? 210 GLY A C      1 
ATOM   763  O O      . GLY A 1 60  ? -13.180 32.686 3.378   1.00 34.42  ? 210 GLY A O      1 
ATOM   764  H H      . GLY A 1 60  ? -9.774  35.035 3.786   1.00 35.08  ? 210 GLY A H      1 
ATOM   765  H HA2    . GLY A 1 60  ? -10.935 33.824 2.454   1.00 38.85  ? 210 GLY A HA2    1 
ATOM   766  H HA3    . GLY A 1 60  ? -10.643 32.581 3.364   1.00 38.85  ? 210 GLY A HA3    1 
ATOM   767  N N      . GLY A 1 61  ? -12.765 34.428 4.748   1.00 33.07  ? 211 GLY A N      1 
ATOM   768  C CA     . GLY A 1 61  ? -14.075 34.416 5.377   1.00 31.02  ? 211 GLY A CA     1 
ATOM   769  C C      . GLY A 1 61  ? -15.195 35.066 4.571   1.00 27.42  ? 211 GLY A C      1 
ATOM   770  O O      . GLY A 1 61  ? -15.035 35.410 3.396   1.00 25.26  ? 211 GLY A O      1 
ATOM   771  H H      . GLY A 1 61  ? -12.264 35.076 5.011   1.00 39.66  ? 211 GLY A H      1 
ATOM   772  H HA2    . GLY A 1 61  ? -14.329 33.496 5.551   1.00 37.20  ? 211 GLY A HA2    1 
ATOM   773  H HA3    . GLY A 1 61  ? -14.017 34.876 6.229   1.00 37.20  ? 211 GLY A HA3    1 
ATOM   774  N N      . PRO A 1 62  ? -16.360 35.246 5.198   1.00 28.08  ? 212 PRO A N      1 
ATOM   775  C CA     . PRO A 1 62  ? -17.526 35.811 4.500   1.00 28.36  ? 212 PRO A CA     1 
ATOM   776  C C      . PRO A 1 62  ? -17.628 37.333 4.484   1.00 31.49  ? 212 PRO A C      1 
ATOM   777  O O      . PRO A 1 62  ? -18.622 37.854 3.950   1.00 25.13  ? 212 PRO A O      1 
ATOM   778  C CB     . PRO A 1 62  ? -18.685 35.226 5.302   1.00 26.34  ? 212 PRO A CB     1 
ATOM   779  C CG     . PRO A 1 62  ? -18.171 35.209 6.696   1.00 28.85  ? 212 PRO A CG     1 
ATOM   780  C CD     . PRO A 1 62  ? -16.689 34.870 6.586   1.00 26.11  ? 212 PRO A CD     1 
ATOM   781  H HA     . PRO A 1 62  ? -17.567 35.478 3.590   1.00 34.01  ? 212 PRO A HA     1 
ATOM   782  H HB2    . PRO A 1 62  ? -19.463 35.799 5.225   1.00 31.58  ? 212 PRO A HB2    1 
ATOM   783  H HB3    . PRO A 1 62  ? -18.881 34.328 4.993   1.00 31.58  ? 212 PRO A HB3    1 
ATOM   784  H HG2    . PRO A 1 62  ? -18.292 36.084 7.098   1.00 34.59  ? 212 PRO A HG2    1 
ATOM   785  H HG3    . PRO A 1 62  ? -18.639 34.531 7.207   1.00 34.59  ? 212 PRO A HG3    1 
ATOM   786  H HD2    . PRO A 1 62  ? -16.172 35.402 7.212   1.00 31.30  ? 212 PRO A HD2    1 
ATOM   787  H HD3    . PRO A 1 62  ? -16.548 33.921 6.723   1.00 31.30  ? 212 PRO A HD3    1 
ATOM   788  N N      . TYR A 1 63  ? -16.649 38.051 5.036   1.00 24.66  ? 213 TYR A N      1 
ATOM   789  C CA     . TYR A 1 63  ? -16.715 39.503 5.178   1.00 24.13  ? 213 TYR A CA     1 
ATOM   790  C C      . TYR A 1 63  ? -15.618 40.169 4.357   1.00 28.43  ? 213 TYR A C      1 
ATOM   791  O O      . TYR A 1 63  ? -14.613 39.543 3.995   1.00 21.91  ? 213 TYR A O      1 
ATOM   792  C CB     . TYR A 1 63  ? -16.565 39.908 6.643   1.00 25.66  ? 213 TYR A CB     1 
ATOM   793  C CG     . TYR A 1 63  ? -17.447 39.142 7.626   1.00 24.58  ? 213 TYR A CG     1 
ATOM   794  C CD1    . TYR A 1 63  ? -18.835 39.081 7.454   1.00 26.40  ? 213 TYR A CD1    1 
ATOM   795  C CD2    . TYR A 1 63  ? -16.889 38.459 8.726   1.00 26.57  ? 213 TYR A CD2    1 
ATOM   796  C CE1    . TYR A 1 63  ? -19.651 38.380 8.354   1.00 26.31  ? 213 TYR A CE1    1 
ATOM   797  C CE2    . TYR A 1 63  ? -17.701 37.747 9.635   1.00 23.22  ? 213 TYR A CE2    1 
ATOM   798  C CZ     . TYR A 1 63  ? -19.094 37.717 9.430   1.00 27.91  ? 213 TYR A CZ     1 
ATOM   799  O OH     . TYR A 1 63  ? -19.952 37.054 10.282  1.00 29.07  ? 213 TYR A OH     1 
ATOM   800  H H      . TYR A 1 63  ? -15.921 37.710 5.342   1.00 29.56  ? 213 TYR A H      1 
ATOM   801  H HA     . TYR A 1 63  ? -17.573 39.820 4.858   1.00 28.93  ? 213 TYR A HA     1 
ATOM   802  H HB2    . TYR A 1 63  ? -15.643 39.767 6.908   1.00 30.76  ? 213 TYR A HB2    1 
ATOM   803  H HB3    . TYR A 1 63  ? -16.786 40.849 6.726   1.00 30.76  ? 213 TYR A HB3    1 
ATOM   804  H HD1    . TYR A 1 63  ? -19.225 39.524 6.736   1.00 31.65  ? 213 TYR A HD1    1 
ATOM   805  H HD2    . TYR A 1 63  ? -15.968 38.482 8.858   1.00 31.85  ? 213 TYR A HD2    1 
ATOM   806  H HE1    . TYR A 1 63  ? -20.572 38.359 8.224   1.00 31.54  ? 213 TYR A HE1    1 
ATOM   807  H HE2    . TYR A 1 63  ? -17.322 37.306 10.361  1.00 27.83  ? 213 TYR A HE2    1 
ATOM   808  H HH     . TYR A 1 63  ? -20.744 37.146 10.020  1.00 34.85  ? 213 TYR A HH     1 
ATOM   809  N N      . GLY A 1 64  ? -15.795 41.454 4.068   1.00 22.09  ? 214 GLY A N      1 
ATOM   810  C CA     . GLY A 1 64  ? -14.668 42.247 3.595   1.00 25.15  ? 214 GLY A CA     1 
ATOM   811  C C      . GLY A 1 64  ? -13.550 42.276 4.626   1.00 20.03  ? 214 GLY A C      1 
ATOM   812  O O      . GLY A 1 64  ? -13.753 41.956 5.798   1.00 20.43  ? 214 GLY A O      1 
ATOM   813  H H      . GLY A 1 64  ? -16.538 41.881 4.135   1.00 26.48  ? 214 GLY A H      1 
ATOM   814  H HA2    . GLY A 1 64  ? -14.323 41.868 2.771   1.00 30.16  ? 214 GLY A HA2    1 
ATOM   815  H HA3    . GLY A 1 64  ? -14.957 43.157 3.423   1.00 30.16  ? 214 GLY A HA3    1 
ATOM   816  N N      . GLU A 1 65  ? -12.348 42.720 4.201   1.00 26.16  ? 215 GLU A N      1 
ATOM   817  C CA     . GLU A 1 65  ? -11.160 42.568 5.047   1.00 21.21  ? 215 GLU A CA     1 
ATOM   818  C C      . GLU A 1 65  ? -10.039 43.537 4.677   1.00 22.73  ? 215 GLU A C      1 
ATOM   819  O O      . GLU A 1 65  ? -9.603  43.563 3.528   1.00 23.90  ? 215 GLU A O      1 
ATOM   820  C CB     . GLU A 1 65  ? -10.613 41.133 4.957   1.00 23.78  ? 215 GLU A CB     1 
ATOM   821  C CG     . GLU A 1 65  ? -9.710  40.750 6.126   1.00 23.83  ? 215 GLU A CG     1 
ATOM   822  C CD     . GLU A 1 65  ? -9.527  39.242 6.246   1.00 31.38  ? 215 GLU A CD     1 
ATOM   823  O OE1    . GLU A 1 65  ? -8.539  38.708 5.730   1.00 34.30  ? 215 GLU A OE1    1 
ATOM   824  O OE2    . GLU A 1 65  ? -10.379 38.602 6.866   1.00 27.07  ? 215 GLU A OE2    1 
ATOM   825  H H      . GLU A 1 65  ? -12.203 43.103 3.445   1.00 31.37  ? 215 GLU A H      1 
ATOM   826  H HA     . GLU A 1 65  ? -11.408 42.736 5.970   1.00 25.43  ? 215 GLU A HA     1 
ATOM   827  H HB2    . GLU A 1 65  ? -11.360 40.513 4.943   1.00 28.51  ? 215 GLU A HB2    1 
ATOM   828  H HB3    . GLU A 1 65  ? -10.097 41.045 4.141   1.00 28.51  ? 215 GLU A HB3    1 
ATOM   829  H HG2    . GLU A 1 65  ? -8.836  41.150 5.996   1.00 28.57  ? 215 GLU A HG2    1 
ATOM   830  H HG3    . GLU A 1 65  ? -10.105 41.072 6.951   1.00 28.57  ? 215 GLU A HG3    1 
ATOM   831  N N      . ASN A 1 66  ? -9.563  44.309 5.655   1.00 23.73  ? 216 ASN A N      1 
ATOM   832  C CA     . ASN A 1 66  ? -8.317  45.074 5.544   1.00 20.15  ? 216 ASN A CA     1 
ATOM   833  C C      . ASN A 1 66  ? -7.347  44.616 6.636   1.00 24.62  ? 216 ASN A C      1 
ATOM   834  O O      . ASN A 1 66  ? -7.751  44.461 7.792   1.00 23.54  ? 216 ASN A O      1 
ATOM   835  C CB     . ASN A 1 66  ? -8.548  46.586 5.690   1.00 25.74  ? 216 ASN A CB     1 
ATOM   836  C CG     . ASN A 1 66  ? -9.137  47.250 4.443   1.00 23.82  ? 216 ASN A CG     1 
ATOM   837  O OD1    . ASN A 1 66  ? -8.986  46.782 3.301   1.00 23.97  ? 216 ASN A OD1    1 
ATOM   838  N ND2    . ASN A 1 66  ? -9.813  48.373 4.668   1.00 24.03  ? 216 ASN A ND2    1 
ATOM   839  H H      . ASN A 1 66  ? -9.955  44.408 6.414   1.00 28.45  ? 216 ASN A H      1 
ATOM   840  H HA     . ASN A 1 66  ? -7.910  44.907 4.679   1.00 24.15  ? 216 ASN A HA     1 
ATOM   841  H HB2    . ASN A 1 66  ? -9.163  46.738 6.424   1.00 30.86  ? 216 ASN A HB2    1 
ATOM   842  H HB3    . ASN A 1 66  ? -7.698  47.014 5.879   1.00 30.86  ? 216 ASN A HB3    1 
ATOM   843  H HD21   . ASN A 1 66  ? -10.170 48.799 4.012   1.00 28.81  ? 216 ASN A HD21   1 
ATOM   844  H HD22   . ASN A 1 66  ? -9.891  48.675 5.470   1.00 28.81  ? 216 ASN A HD22   1 
ATOM   845  N N      . LEU A 1 67  ? -6.059  44.422 6.270   1.00 23.98  ? 217 LEU A N      1 
ATOM   846  C CA     . LEU A 1 67  ? -4.992  43.997 7.179   1.00 26.97  ? 217 LEU A CA     1 
ATOM   847  C C      . LEU A 1 67  ? -3.827  45.001 7.187   1.00 24.70  ? 217 LEU A C      1 
ATOM   848  O O      . LEU A 1 67  ? -3.565  45.660 6.182   1.00 22.35  ? 217 LEU A O      1 
ATOM   849  C CB     . LEU A 1 67  ? -4.435  42.611 6.777   1.00 26.26  ? 217 LEU A CB     1 
ATOM   850  C CG     . LEU A 1 67  ? -5.374  41.413 6.553   1.00 26.13  ? 217 LEU A CG     1 
ATOM   851  C CD1    . LEU A 1 67  ? -4.617  40.192 6.023   1.00 35.69  ? 217 LEU A CD1    1 
ATOM   852  C CD2    . LEU A 1 67  ? -6.112  41.060 7.830   1.00 28.57  ? 217 LEU A CD2    1 
ATOM   853  H H      . LEU A 1 67  ? -5.780  44.539 5.465   1.00 28.75  ? 217 LEU A H      1 
ATOM   854  H HA     . LEU A 1 67  ? -5.345  43.934 8.080   1.00 32.33  ? 217 LEU A HA     1 
ATOM   855  H HB2    . LEU A 1 67  ? -3.944  42.728 5.949   1.00 31.49  ? 217 LEU A HB2    1 
ATOM   856  H HB3    . LEU A 1 67  ? -3.812  42.341 7.470   1.00 31.49  ? 217 LEU A HB3    1 
ATOM   857  H HG     . LEU A 1 67  ? -6.037  41.659 5.889   1.00 31.33  ? 217 LEU A HG     1 
ATOM   858  H HD11   . LEU A 1 67  ? -5.244  39.463 5.896   1.00 42.79  ? 217 LEU A HD11   1 
ATOM   859  H HD12   . LEU A 1 67  ? -4.201  40.422 5.177   1.00 42.79  ? 217 LEU A HD12   1 
ATOM   860  H HD13   . LEU A 1 67  ? -3.938  39.937 6.667   1.00 42.79  ? 217 LEU A HD13   1 
ATOM   861  H HD21   . LEU A 1 67  ? -6.694  40.304 7.659   1.00 34.25  ? 217 LEU A HD21   1 
ATOM   862  H HD22   . LEU A 1 67  ? -5.465  40.831 8.516   1.00 34.25  ? 217 LEU A HD22   1 
ATOM   863  H HD23   . LEU A 1 67  ? -6.637  41.825 8.113   1.00 34.25  ? 217 LEU A HD23   1 
ATOM   864  N N      . ALA A 1 68  ? -3.128  45.109 8.329   1.00 26.17  ? 218 ALA A N      1 
ATOM   865  C CA     . ALA A 1 68  ? -1.948  45.970 8.473   1.00 30.74  ? 218 ALA A CA     1 
ATOM   866  C C      . ALA A 1 68  ? -0.983  45.397 9.508   1.00 30.17  ? 218 ALA A C      1 
ATOM   867  O O      . ALA A 1 68  ? -1.392  44.697 10.434  1.00 27.05  ? 218 ALA A O      1 
ATOM   868  C CB     . ALA A 1 68  ? -2.320  47.397 8.898   1.00 26.84  ? 218 ALA A CB     1 
ATOM   869  H H      . ALA A 1 68  ? -3.326  44.682 9.049   1.00 31.38  ? 218 ALA A H      1 
ATOM   870  H HA     . ALA A 1 68  ? -1.485  46.019 7.622   1.00 36.86  ? 218 ALA A HA     1 
ATOM   871  H HB1    . ALA A 1 68  ? -1.509  47.923 8.979   1.00 32.18  ? 218 ALA A HB1    1 
ATOM   872  H HB2    . ALA A 1 68  ? -2.901  47.785 8.226   1.00 32.18  ? 218 ALA A HB2    1 
ATOM   873  H HB3    . ALA A 1 68  ? -2.778  47.363 9.752   1.00 32.18  ? 218 ALA A HB3    1 
ATOM   874  N N      . LEU A 1 69  ? 0.303   45.756 9.367   1.00 30.97  ? 219 LEU A N      1 
ATOM   875  C CA     . LEU A 1 69  ? 1.345   45.381 10.324  1.00 28.95  ? 219 LEU A CA     1 
ATOM   876  C C      . LEU A 1 69  ? 2.262   46.575 10.595  1.00 28.20  ? 219 LEU A C      1 
ATOM   877  O O      . LEU A 1 69  ? 2.785   47.190 9.658   1.00 25.79  ? 219 LEU A O      1 
ATOM   878  C CB     . LEU A 1 69  ? 2.152   44.195 9.794   1.00 32.11  ? 219 LEU A CB     1 
ATOM   879  C CG     . LEU A 1 69  ? 3.014   43.410 10.782  1.00 40.43  ? 219 LEU A CG     1 
ATOM   880  C CD1    . LEU A 1 69  ? 2.176   42.775 11.896  1.00 37.49  ? 219 LEU A CD1    1 
ATOM   881  C CD2    . LEU A 1 69  ? 3.803   42.337 10.011  1.00 47.96  ? 219 LEU A CD2    1 
ATOM   882  H H      . LEU A 1 69  ? 0.598   46.226 8.709   1.00 37.13  ? 219 LEU A H      1 
ATOM   883  H HA     . LEU A 1 69  ? 0.932   45.118 11.161  1.00 34.72  ? 219 LEU A HA     1 
ATOM   884  H HB2    . LEU A 1 69  ? 1.529   43.563 9.401   1.00 38.50  ? 219 LEU A HB2    1 
ATOM   885  H HB3    . LEU A 1 69  ? 2.746   44.524 9.102   1.00 38.50  ? 219 LEU A HB3    1 
ATOM   886  H HG     . LEU A 1 69  ? 3.652   44.014 11.193  1.00 48.49  ? 219 LEU A HG     1 
ATOM   887  H HD11   . LEU A 1 69  ? 2.765   42.290 12.495  1.00 44.96  ? 219 LEU A HD11   1 
ATOM   888  H HD12   . LEU A 1 69  ? 1.714   43.476 12.381  1.00 44.96  ? 219 LEU A HD12   1 
ATOM   889  H HD13   . LEU A 1 69  ? 1.533   42.167 11.499  1.00 44.96  ? 219 LEU A HD13   1 
ATOM   890  H HD21   . LEU A 1 69  ? 4.351   41.838 10.637  1.00 57.52  ? 219 LEU A HD21   1 
ATOM   891  H HD22   . LEU A 1 69  ? 3.177   41.741 9.570   1.00 57.52  ? 219 LEU A HD22   1 
ATOM   892  H HD23   . LEU A 1 69  ? 4.366   42.772 9.352   1.00 57.52  ? 219 LEU A HD23   1 
ATOM   893  N N      . GLY A 1 70  ? 2.443   46.916 11.868  1.00 25.64  ? 220 GLY A N      1 
ATOM   894  C CA     . GLY A 1 70  ? 3.273   48.054 12.245  1.00 29.70  ? 220 GLY A CA     1 
ATOM   895  C C      . GLY A 1 70  ? 2.512   49.281 12.719  1.00 32.46  ? 220 GLY A C      1 
ATOM   896  O O      . GLY A 1 70  ? 3.147   50.314 12.990  1.00 26.56  ? 220 GLY A O      1 
ATOM   897  H H      . GLY A 1 70  ? 2.094   46.502 12.536  1.00 30.74  ? 220 GLY A H      1 
ATOM   898  H HA2    . GLY A 1 70  ? 3.873   47.782 12.956  1.00 35.61  ? 220 GLY A HA2    1 
ATOM   899  H HA3    . GLY A 1 70  ? 3.812   48.315 11.482  1.00 35.61  ? 220 GLY A HA3    1 
ATOM   900  N N      . TYR A 1 71  ? 1.181   49.211 12.826  1.00 22.99  ? 221 TYR A N      1 
ATOM   901  C CA     . TYR A 1 71  ? 0.359   50.359 13.215  1.00 27.89  ? 221 TYR A CA     1 
ATOM   902  C C      . TYR A 1 71  ? -0.642  49.976 14.309  1.00 28.29  ? 221 TYR A C      1 
ATOM   903  O O      . TYR A 1 71  ? -1.109  48.828 14.374  1.00 23.24  ? 221 TYR A O      1 
ATOM   904  C CB     . TYR A 1 71  ? -0.416  50.913 12.000  1.00 31.91  ? 221 TYR A CB     1 
ATOM   905  C CG     . TYR A 1 71  ? 0.422   51.168 10.755  1.00 28.20  ? 221 TYR A CG     1 
ATOM   906  C CD1    . TYR A 1 71  ? 1.003   52.401 10.528  1.00 30.92  ? 221 TYR A CD1    1 
ATOM   907  C CD2    . TYR A 1 71  ? 0.602   50.178 9.799   1.00 27.99  ? 221 TYR A CD2    1 
ATOM   908  C CE1    . TYR A 1 71  ? 1.753   52.640 9.394   1.00 32.56  ? 221 TYR A CE1    1 
ATOM   909  C CE2    . TYR A 1 71  ? 1.362   50.402 8.662   1.00 32.36  ? 221 TYR A CE2    1 
ATOM   910  C CZ     . TYR A 1 71  ? 1.933   51.638 8.464   1.00 35.21  ? 221 TYR A CZ     1 
ATOM   911  O OH     . TYR A 1 71  ? 2.678   51.878 7.331   1.00 34.83  ? 221 TYR A OH     1 
ATOM   912  H H      . TYR A 1 71  ? 0.725   48.497 12.675  1.00 27.56  ? 221 TYR A H      1 
ATOM   913  H HA     . TYR A 1 71  ? 0.932   51.062 13.558  1.00 33.43  ? 221 TYR A HA     1 
ATOM   914  H HB2    . TYR A 1 71  ? -1.108  50.277 11.760  1.00 38.26  ? 221 TYR A HB2    1 
ATOM   915  H HB3    . TYR A 1 71  ? -0.824  51.756 12.254  1.00 38.26  ? 221 TYR A HB3    1 
ATOM   916  H HD1    . TYR A 1 71  ? 0.889   53.081 11.152  1.00 37.08  ? 221 TYR A HD1    1 
ATOM   917  H HD2    . TYR A 1 71  ? 0.219   49.341 9.933   1.00 33.57  ? 221 TYR A HD2    1 
ATOM   918  H HE1    . TYR A 1 71  ? 2.142   53.474 9.260   1.00 39.04  ? 221 TYR A HE1    1 
ATOM   919  H HE2    . TYR A 1 71  ? 1.475   49.726 8.033   1.00 38.81  ? 221 TYR A HE2    1 
ATOM   920  H HH     . TYR A 1 71  ? 2.707   51.187 6.854   1.00 41.77  ? 221 TYR A HH     1 
ATOM   921  N N      . ASP A 1 72  ? -0.991  50.941 15.171  1.00 27.79  ? 222 ASP A N      1 
ATOM   922  C CA     . ASP A 1 72  ? -2.156  50.715 16.029  1.00 31.31  ? 222 ASP A CA     1 
ATOM   923  C C      . ASP A 1 72  ? -3.437  50.926 15.201  1.00 27.67  ? 222 ASP A C      1 
ATOM   924  O O      . ASP A 1 72  ? -3.391  51.166 13.989  1.00 26.99  ? 222 ASP A O      1 
ATOM   925  C CB     . ASP A 1 72  ? -2.088  51.565 17.318  1.00 27.68  ? 222 ASP A CB     1 
ATOM   926  C CG     . ASP A 1 72  ? -2.418  53.034 17.127  1.00 29.34  ? 222 ASP A CG     1 
ATOM   927  O OD1    . ASP A 1 72  ? -2.747  53.496 16.020  1.00 31.71  ? 222 ASP A OD1    1 
ATOM   928  O OD2    . ASP A 1 72  ? -2.367  53.746 18.145  1.00 34.60  ? 222 ASP A OD2    1 
ATOM   929  H H      . ASP A 1 72  ? -0.593  51.696 15.274  1.00 33.32  ? 222 ASP A H      1 
ATOM   930  H HA     . ASP A 1 72  ? -2.148  49.785 16.305  1.00 37.54  ? 222 ASP A HA     1 
ATOM   931  H HB2    . ASP A 1 72  ? -2.719  51.203 17.960  1.00 33.19  ? 222 ASP A HB2    1 
ATOM   932  H HB3    . ASP A 1 72  ? -1.189  51.510 17.678  1.00 33.19  ? 222 ASP A HB3    1 
ATOM   933  N N      . GLY A 1 73  ? -4.597  50.767 15.830  1.00 28.62  ? 223 GLY A N      1 
ATOM   934  C CA     . GLY A 1 73  ? -5.854  50.726 15.107  1.00 25.44  ? 223 GLY A CA     1 
ATOM   935  C C      . GLY A 1 73  ? -6.107  51.946 14.233  1.00 23.46  ? 223 GLY A C      1 
ATOM   936  O O      . GLY A 1 73  ? -6.251  51.846 13.007  1.00 21.95  ? 223 GLY A O      1 
ATOM   937  H H      . GLY A 1 73  ? -4.679  50.680 16.682  1.00 34.32  ? 223 GLY A H      1 
ATOM   938  H HA2    . GLY A 1 73  ? -5.868  49.940 14.539  1.00 30.50  ? 223 GLY A HA2    1 
ATOM   939  H HA3    . GLY A 1 73  ? -6.584  50.653 15.742  1.00 30.50  ? 223 GLY A HA3    1 
ATOM   940  N N      . PRO A 1 74  ? -6.163  53.128 14.853  1.00 24.06  ? 224 PRO A N      1 
ATOM   941  C CA     . PRO A 1 74  ? -6.410  54.350 14.061  1.00 28.14  ? 224 PRO A CA     1 
ATOM   942  C C      . PRO A 1 74  ? -5.305  54.653 13.056  1.00 27.50  ? 224 PRO A C      1 
ATOM   943  O O      . PRO A 1 74  ? -5.580  55.154 11.955  1.00 24.37  ? 224 PRO A O      1 
ATOM   944  C CB     . PRO A 1 74  ? -6.535  55.447 15.140  1.00 28.13  ? 224 PRO A CB     1 
ATOM   945  C CG     . PRO A 1 74  ? -6.946  54.730 16.377  1.00 28.30  ? 224 PRO A CG     1 
ATOM   946  C CD     . PRO A 1 74  ? -6.245  53.379 16.301  1.00 26.37  ? 224 PRO A CD     1 
ATOM   947  H HA     . PRO A 1 74  ? -7.254  54.275 13.588  1.00 33.74  ? 224 PRO A HA     1 
ATOM   948  H HB2    . PRO A 1 74  ? -5.677  55.882 15.265  1.00 33.73  ? 224 PRO A HB2    1 
ATOM   949  H HB3    . PRO A 1 74  ? -7.211  56.090 14.876  1.00 33.73  ? 224 PRO A HB3    1 
ATOM   950  H HG2    . PRO A 1 74  ? -6.651  55.226 17.157  1.00 33.93  ? 224 PRO A HG2    1 
ATOM   951  H HG3    . PRO A 1 74  ? -7.909  54.617 16.385  1.00 33.93  ? 224 PRO A HG3    1 
ATOM   952  H HD2    . PRO A 1 74  ? -5.357  53.436 16.686  1.00 31.61  ? 224 PRO A HD2    1 
ATOM   953  H HD3    . PRO A 1 74  ? -6.779  52.695 16.734  1.00 31.61  ? 224 PRO A HD3    1 
ATOM   954  N N      . ALA A 1 75  ? -4.051  54.362 13.408  1.00 25.78  ? 225 ALA A N      1 
ATOM   955  C CA     . ALA A 1 75  ? -2.960  54.595 12.476  1.00 23.25  ? 225 ALA A CA     1 
ATOM   956  C C      . ALA A 1 75  ? -3.071  53.681 11.256  1.00 21.56  ? 225 ALA A C      1 
ATOM   957  O O      . ALA A 1 75  ? -2.739  54.102 10.143  1.00 22.67  ? 225 ALA A O      1 
ATOM   958  C CB     . ALA A 1 75  ? -1.604  54.430 13.188  1.00 22.72  ? 225 ALA A CB     1 
ATOM   959  H H      . ALA A 1 75  ? -3.814  54.036 14.168  1.00 30.91  ? 225 ALA A H      1 
ATOM   960  H HA     . ALA A 1 75  ? -3.015  55.510 12.160  1.00 27.87  ? 225 ALA A HA     1 
ATOM   961  H HB1    . ALA A 1 75  ? -0.891  54.589 12.550  1.00 27.23  ? 225 ALA A HB1    1 
ATOM   962  H HB2    . ALA A 1 75  ? -1.549  55.072 13.913  1.00 27.23  ? 225 ALA A HB2    1 
ATOM   963  H HB3    . ALA A 1 75  ? -1.540  53.528 13.539  1.00 27.23  ? 225 ALA A HB3    1 
ATOM   964  N N      . ALA A 1 76  ? -3.580  52.449 11.424  1.00 23.62  ? 226 ALA A N      1 
ATOM   965  C CA     . ALA A 1 76  ? -3.799  51.583 10.267  1.00 22.09  ? 226 ALA A CA     1 
ATOM   966  C C      . ALA A 1 76  ? -4.870  52.155 9.339   1.00 27.12  ? 226 ALA A C      1 
ATOM   967  O O      . ALA A 1 76  ? -4.729  52.128 8.107   1.00 21.01  ? 226 ALA A O      1 
ATOM   968  C CB     . ALA A 1 76  ? -4.202  50.182 10.717  1.00 25.82  ? 226 ALA A CB     1 
ATOM   969  H H      . ALA A 1 76  ? -3.800  52.104 12.181  1.00 28.32  ? 226 ALA A H      1 
ATOM   970  H HA     . ALA A 1 76  ? -2.973  51.512 9.764   1.00 26.48  ? 226 ALA A HA     1 
ATOM   971  H HB1    . ALA A 1 76  ? -4.341  49.627 9.934   1.00 30.96  ? 226 ALA A HB1    1 
ATOM   972  H HB2    . ALA A 1 76  ? -3.492  49.810 11.264  1.00 30.96  ? 226 ALA A HB2    1 
ATOM   973  H HB3    . ALA A 1 76  ? -5.022  50.239 11.232  1.00 30.96  ? 226 ALA A HB3    1 
ATOM   974  N N      . VAL A 1 77  ? -5.956  52.662 9.916   1.00 23.71  ? 227 VAL A N      1 
ATOM   975  C CA     . VAL A 1 77  ? -7.005  53.261 9.107   1.00 25.83  ? 227 VAL A CA     1 
ATOM   976  C C      . VAL A 1 77  ? -6.422  54.404 8.272   1.00 23.79  ? 227 VAL A C      1 
ATOM   977  O O      . VAL A 1 77  ? -6.727  54.545 7.087   1.00 22.62  ? 227 VAL A O      1 
ATOM   978  C CB     . VAL A 1 77  ? -8.172  53.727 10.013  1.00 22.99  ? 227 VAL A CB     1 
ATOM   979  C CG1    . VAL A 1 77  ? -9.227  54.501 9.213   1.00 25.73  ? 227 VAL A CG1    1 
ATOM   980  C CG2    . VAL A 1 77  ? -8.862  52.525 10.728  1.00 25.64  ? 227 VAL A CG2    1 
ATOM   981  H H      . VAL A 1 77  ? -6.107  52.670 10.763  1.00 28.42  ? 227 VAL A H      1 
ATOM   982  H HA     . VAL A 1 77  ? -7.351  52.592 8.496   1.00 30.97  ? 227 VAL A HA     1 
ATOM   983  H HB     . VAL A 1 77  ? -7.822  54.319 10.697  1.00 27.55  ? 227 VAL A HB     1 
ATOM   984  H HG11   . VAL A 1 77  ? -9.939  54.775 9.812   1.00 30.85  ? 227 VAL A HG11   1 
ATOM   985  H HG12   . VAL A 1 77  ? -8.810  55.281 8.814   1.00 30.85  ? 227 VAL A HG12   1 
ATOM   986  H HG13   . VAL A 1 77  ? -9.582  53.925 8.518   1.00 30.85  ? 227 VAL A HG13   1 
ATOM   987  H HG21   . VAL A 1 77  ? -9.584  52.860 11.283  1.00 30.74  ? 227 VAL A HG21   1 
ATOM   988  H HG22   . VAL A 1 77  ? -9.214  51.919 10.057  1.00 30.74  ? 227 VAL A HG22   1 
ATOM   989  H HG23   . VAL A 1 77  ? -8.207  52.067 11.278  1.00 30.74  ? 227 VAL A HG23   1 
ATOM   990  N N      . ASP A 1 78  ? -5.561  55.225 8.877   1.00 24.74  ? 228 ASP A N      1 
ATOM   991  C CA     . ASP A 1 78  ? -4.968  56.352 8.162   1.00 22.37  ? 228 ASP A CA     1 
ATOM   992  C C      . ASP A 1 78  ? -4.112  55.878 6.988   1.00 25.59  ? 228 ASP A C      1 
ATOM   993  O O      . ASP A 1 78  ? -4.171  56.453 5.896   1.00 22.07  ? 228 ASP A O      1 
ATOM   994  C CB     . ASP A 1 78  ? -4.132  57.206 9.113   1.00 27.56  ? 228 ASP A CB     1 
ATOM   995  C CG     . ASP A 1 78  ? -4.972  58.024 10.080  1.00 29.49  ? 228 ASP A CG     1 
ATOM   996  O OD1    . ASP A 1 78  ? -6.196  58.175 9.890   1.00 26.41  ? 228 ASP A OD1    1 
ATOM   997  O OD2    . ASP A 1 78  ? -4.386  58.562 11.034  1.00 31.20  ? 228 ASP A OD2    1 
ATOM   998  H H      . ASP A 1 78  ? -5.306  55.150 9.695   1.00 29.66  ? 228 ASP A H      1 
ATOM   999  H HA     . ASP A 1 78  ? -5.680  56.908 7.807   1.00 26.81  ? 228 ASP A HA     1 
ATOM   1000 H HB2    . ASP A 1 78  ? -3.557  56.624 9.636   1.00 33.04  ? 228 ASP A HB2    1 
ATOM   1001 H HB3    . ASP A 1 78  ? -3.592  57.821 8.592   1.00 33.04  ? 228 ASP A HB3    1 
ATOM   1002 N N      . ALA A 1 79  ? -3.311  54.832 7.190   1.00 24.85  ? 229 ALA A N      1 
ATOM   1003 C CA     . ALA A 1 79  ? -2.500  54.300 6.095   1.00 26.76  ? 229 ALA A CA     1 
ATOM   1004 C C      . ALA A 1 79  ? -3.375  53.782 4.959   1.00 27.97  ? 229 ALA A C      1 
ATOM   1005 O O      . ALA A 1 79  ? -3.119  54.062 3.781   1.00 22.36  ? 229 ALA A O      1 
ATOM   1006 C CB     . ALA A 1 79  ? -1.591  53.181 6.595   1.00 25.07  ? 229 ALA A CB     1 
ATOM   1007 H H      . ALA A 1 79  ? -3.220  54.418 7.938   1.00 29.79  ? 229 ALA A H      1 
ATOM   1008 H HA     . ALA A 1 79  ? -1.939  55.009 5.743   1.00 32.09  ? 229 ALA A HA     1 
ATOM   1009 H HB1    . ALA A 1 79  ? -1.065  52.846 5.852   1.00 30.05  ? 229 ALA A HB1    1 
ATOM   1010 H HB2    . ALA A 1 79  ? -1.005  53.534 7.283   1.00 30.05  ? 229 ALA A HB2    1 
ATOM   1011 H HB3    . ALA A 1 79  ? -2.138  52.469 6.961   1.00 30.05  ? 229 ALA A HB3    1 
ATOM   1012 N N      . TRP A 1 80  ? -4.397  52.994 5.296   1.00 23.22  ? 230 TRP A N      1 
ATOM   1013 C CA     . TRP A 1 80  ? -5.329  52.503 4.287   1.00 22.29  ? 230 TRP A CA     1 
ATOM   1014 C C      . TRP A 1 80  ? -5.941  53.662 3.486   1.00 21.78  ? 230 TRP A C      1 
ATOM   1015 O O      . TRP A 1 80  ? -5.954  53.649 2.247   1.00 21.48  ? 230 TRP A O      1 
ATOM   1016 C CB     . TRP A 1 80  ? -6.442  51.677 4.963   1.00 21.58  ? 230 TRP A CB     1 
ATOM   1017 C CG     . TRP A 1 80  ? -5.977  50.401 5.650   1.00 23.40  ? 230 TRP A CG     1 
ATOM   1018 C CD1    . TRP A 1 80  ? -4.865  49.646 5.357   1.00 25.48  ? 230 TRP A CD1    1 
ATOM   1019 C CD2    . TRP A 1 80  ? -6.631  49.737 6.744   1.00 26.54  ? 230 TRP A CD2    1 
ATOM   1020 N NE1    . TRP A 1 80  ? -4.791  48.555 6.212   1.00 24.52  ? 230 TRP A NE1    1 
ATOM   1021 C CE2    . TRP A 1 80  ? -5.855  48.600 7.078   1.00 26.31  ? 230 TRP A CE2    1 
ATOM   1022 C CE3    . TRP A 1 80  ? -7.796  49.997 7.479   1.00 26.04  ? 230 TRP A CE3    1 
ATOM   1023 C CZ2    . TRP A 1 80  ? -6.206  47.732 8.116   1.00 26.08  ? 230 TRP A CZ2    1 
ATOM   1024 C CZ3    . TRP A 1 80  ? -8.145  49.131 8.512   1.00 25.20  ? 230 TRP A CZ3    1 
ATOM   1025 C CH2    . TRP A 1 80  ? -7.357  48.006 8.814   1.00 24.09  ? 230 TRP A CH2    1 
ATOM   1026 H H      . TRP A 1 80  ? -4.569  52.731 6.097   1.00 27.84  ? 230 TRP A H      1 
ATOM   1027 H HA     . TRP A 1 80  ? -4.856  51.924 3.669   1.00 26.72  ? 230 TRP A HA     1 
ATOM   1028 H HB2    . TRP A 1 80  ? -6.870  52.230 5.634   1.00 25.87  ? 230 TRP A HB2    1 
ATOM   1029 H HB3    . TRP A 1 80  ? -7.091  51.424 4.288   1.00 25.87  ? 230 TRP A HB3    1 
ATOM   1030 H HD1    . TRP A 1 80  ? -4.250  49.842 4.688   1.00 30.54  ? 230 TRP A HD1    1 
ATOM   1031 H HE1    . TRP A 1 80  ? -4.169  47.962 6.214   1.00 29.39  ? 230 TRP A HE1    1 
ATOM   1032 H HE3    . TRP A 1 80  ? -8.318  50.744 7.290   1.00 31.21  ? 230 TRP A HE3    1 
ATOM   1033 H HZ2    . TRP A 1 80  ? -5.693  46.981 8.310   1.00 31.26  ? 230 TRP A HZ2    1 
ATOM   1034 H HZ3    . TRP A 1 80  ? -8.913  49.298 9.009   1.00 30.21  ? 230 TRP A HZ3    1 
ATOM   1035 H HH2    . TRP A 1 80  ? -7.614  47.443 9.507   1.00 28.88  ? 230 TRP A HH2    1 
ATOM   1036 N N      . TYR A 1 81  ? -6.454  54.669 4.180   1.00 23.80  ? 231 TYR A N      1 
ATOM   1037 C CA     . TYR A 1 81  ? -7.127  55.771 3.490   1.00 21.02  ? 231 TYR A CA     1 
ATOM   1038 C C      . TYR A 1 81  ? -6.175  56.585 2.611   1.00 26.44  ? 231 TYR A C      1 
ATOM   1039 O O      . TYR A 1 81  ? -6.605  57.129 1.589   1.00 20.20  ? 231 TYR A O      1 
ATOM   1040 C CB     . TYR A 1 81  ? -7.814  56.692 4.499   1.00 21.95  ? 231 TYR A CB     1 
ATOM   1041 C CG     . TYR A 1 81  ? -8.572  57.823 3.796   1.00 21.50  ? 231 TYR A CG     1 
ATOM   1042 C CD1    . TYR A 1 81  ? -9.812  57.601 3.226   1.00 24.36  ? 231 TYR A CD1    1 
ATOM   1043 C CD2    . TYR A 1 81  ? -8.003  59.090 3.655   1.00 24.36  ? 231 TYR A CD2    1 
ATOM   1044 C CE1    . TYR A 1 81  ? -10.492 58.618 2.553   1.00 20.33  ? 231 TYR A CE1    1 
ATOM   1045 C CE2    . TYR A 1 81  ? -8.662  60.114 2.992   1.00 22.76  ? 231 TYR A CE2    1 
ATOM   1046 C CZ     . TYR A 1 81  ? -9.903  59.878 2.446   1.00 22.48  ? 231 TYR A CZ     1 
ATOM   1047 O OH     . TYR A 1 81  ? -10.515 60.912 1.787   1.00 22.93  ? 231 TYR A OH     1 
ATOM   1048 H H      . TYR A 1 81  ? -6.430  54.742 5.036   1.00 28.53  ? 231 TYR A H      1 
ATOM   1049 H HA     . TYR A 1 81  ? -7.815  55.402 2.914   1.00 25.20  ? 231 TYR A HA     1 
ATOM   1050 H HB2    . TYR A 1 81  ? -8.450  56.178 5.021   1.00 26.31  ? 231 TYR A HB2    1 
ATOM   1051 H HB3    . TYR A 1 81  ? -7.145  57.088 5.079   1.00 26.31  ? 231 TYR A HB3    1 
ATOM   1052 H HD1    . TYR A 1 81  ? -10.203 56.761 3.298   1.00 29.20  ? 231 TYR A HD1    1 
ATOM   1053 H HD2    . TYR A 1 81  ? -7.165  59.253 4.022   1.00 29.20  ? 231 TYR A HD2    1 
ATOM   1054 H HE1    . TYR A 1 81  ? -11.329 58.458 2.181   1.00 24.37  ? 231 TYR A HE1    1 
ATOM   1055 H HE2    . TYR A 1 81  ? -8.269  60.954 2.916   1.00 27.29  ? 231 TYR A HE2    1 
ATOM   1056 H HH     . TYR A 1 81  ? -11.257 60.660 1.483   1.00 27.48  ? 231 TYR A HH     1 
ATOM   1057 N N      . ASN A 1 82  ? -4.890  56.701 2.988   1.00 24.70  ? 232 ASN A N      1 
ATOM   1058 C CA     . ASN A 1 82  ? -3.950  57.516 2.202   1.00 23.38  ? 232 ASN A CA     1 
ATOM   1059 C C      . ASN A 1 82  ? -3.772  56.999 0.768   1.00 24.88  ? 232 ASN A C      1 
ATOM   1060 O O      . ASN A 1 82  ? -3.284  57.744 -0.095  1.00 21.76  ? 232 ASN A O      1 
ATOM   1061 C CB     . ASN A 1 82  ? -2.574  57.583 2.894   1.00 25.74  ? 232 ASN A CB     1 
ATOM   1062 C CG     . ASN A 1 82  ? -2.523  58.625 4.020   1.00 32.61  ? 232 ASN A CG     1 
ATOM   1063 O OD1    . ASN A 1 82  ? -3.326  59.570 4.066   1.00 28.33  ? 232 ASN A OD1    1 
ATOM   1064 N ND2    . ASN A 1 82  ? -1.564  58.457 4.931   1.00 28.97  ? 232 ASN A ND2    1 
ATOM   1065 H H      . ASN A 1 82  ? -4.545  56.325 3.680   1.00 29.61  ? 232 ASN A H      1 
ATOM   1066 H HA     . ASN A 1 82  ? -4.296  58.420 2.147   1.00 28.02  ? 232 ASN A HA     1 
ATOM   1067 H HB2    . ASN A 1 82  ? -2.372  56.716 3.279   1.00 30.86  ? 232 ASN A HB2    1 
ATOM   1068 H HB3    . ASN A 1 82  ? -1.901  57.819 2.237   1.00 30.86  ? 232 ASN A HB3    1 
ATOM   1069 H HD21   . ASN A 1 82  ? -1.489  59.012 5.584   1.00 34.74  ? 232 ASN A HD21   1 
ATOM   1070 H HD22   . ASN A 1 82  ? -1.020  57.794 4.865   1.00 34.74  ? 232 ASN A HD22   1 
ATOM   1071 N N      . GLU A 1 83  ? -4.148  55.748 0.488   1.00 20.33  ? 233 GLU A N      1 
ATOM   1072 C CA     . GLU A 1 83  ? -4.116  55.244 -0.885  1.00 20.08  ? 233 GLU A CA     1 
ATOM   1073 C C      . GLU A 1 83  ? -4.969  56.066 -1.850  1.00 23.89  ? 233 GLU A C      1 
ATOM   1074 O O      . GLU A 1 83  ? -4.847  55.876 -3.063  1.00 22.50  ? 233 GLU A O      1 
ATOM   1075 C CB     . GLU A 1 83  ? -4.562  53.779 -0.926  1.00 25.04  ? 233 GLU A CB     1 
ATOM   1076 C CG     . GLU A 1 83  ? -3.680  52.844 -0.132  1.00 20.30  ? 233 GLU A CG     1 
ATOM   1077 C CD     . GLU A 1 83  ? -4.139  51.380 -0.136  1.00 26.20  ? 233 GLU A CD     1 
ATOM   1078 O OE1    . GLU A 1 83  ? -5.299  51.065 -0.545  1.00 22.03  ? 233 GLU A OE1    1 
ATOM   1079 O OE2    . GLU A 1 83  ? -3.324  50.538 0.289   1.00 21.74  ? 233 GLU A OE2    1 
ATOM   1080 H H      . GLU A 1 83  ? -4.423  55.177 1.070   1.00 24.36  ? 233 GLU A H      1 
ATOM   1081 H HA     . GLU A 1 83  ? -3.201  55.280 -1.204  1.00 24.07  ? 233 GLU A HA     1 
ATOM   1082 H HB2    . GLU A 1 83  ? -5.461  53.716 -0.565  1.00 30.02  ? 233 GLU A HB2    1 
ATOM   1083 H HB3    . GLU A 1 83  ? -4.558  53.477 -1.848  1.00 30.02  ? 233 GLU A HB3    1 
ATOM   1084 H HG2    . GLU A 1 83  ? -2.784  52.872 -0.503  1.00 24.33  ? 233 GLU A HG2    1 
ATOM   1085 H HG3    . GLU A 1 83  ? -3.661  53.143 0.791   1.00 24.33  ? 233 GLU A HG3    1 
ATOM   1086 N N      . ILE A 1 84  ? -5.827  56.967 -1.361  1.00 23.51  ? 234 ILE A N      1 
ATOM   1087 C CA     . ILE A 1 84  ? -6.611  57.794 -2.275  1.00 25.24  ? 234 ILE A CA     1 
ATOM   1088 C C      . ILE A 1 84  ? -5.692  58.500 -3.261  1.00 24.90  ? 234 ILE A C      1 
ATOM   1089 O O      . ILE A 1 84  ? -6.069  58.768 -4.410  1.00 20.54  ? 234 ILE A O      1 
ATOM   1090 C CB     . ILE A 1 84  ? -7.490  58.794 -1.485  1.00 24.89  ? 234 ILE A CB     1 
ATOM   1091 C CG1    . ILE A 1 84  ? -8.459  59.512 -2.441  1.00 28.48  ? 234 ILE A CG1    1 
ATOM   1092 C CG2    . ILE A 1 84  ? -6.651  59.823 -0.673  1.00 26.13  ? 234 ILE A CG2    1 
ATOM   1093 C CD1    . ILE A 1 84  ? -9.418  60.427 -1.732  1.00 25.92  ? 234 ILE A CD1    1 
ATOM   1094 H H      . ILE A 1 84  ? -5.970  57.114 -0.526  1.00 28.18  ? 234 ILE A H      1 
ATOM   1095 H HA     . ILE A 1 84  ? -7.204  57.220 -2.784  1.00 30.26  ? 234 ILE A HA     1 
ATOM   1096 H HB     . ILE A 1 84  ? -8.021  58.284 -0.854  1.00 29.84  ? 234 ILE A HB     1 
ATOM   1097 H HG12   . ILE A 1 84  ? -7.946  60.045 -3.068  1.00 34.15  ? 234 ILE A HG12   1 
ATOM   1098 H HG13   . ILE A 1 84  ? -8.979  58.847 -2.919  1.00 34.15  ? 234 ILE A HG13   1 
ATOM   1099 H HG21   . ILE A 1 84  ? -7.254  60.419 -0.201  1.00 31.33  ? 234 ILE A HG21   1 
ATOM   1100 H HG22   . ILE A 1 84  ? -6.095  59.345 -0.038  1.00 31.33  ? 234 ILE A HG22   1 
ATOM   1101 H HG23   . ILE A 1 84  ? -6.095  60.330 -1.284  1.00 31.33  ? 234 ILE A HG23   1 
ATOM   1102 H HD11   . ILE A 1 84  ? -9.998  60.845 -2.387  1.00 31.07  ? 234 ILE A HD11   1 
ATOM   1103 H HD12   . ILE A 1 84  ? -9.946  59.906 -1.106  1.00 31.07  ? 234 ILE A HD12   1 
ATOM   1104 H HD13   . ILE A 1 84  ? -8.913  61.104 -1.255  1.00 31.07  ? 234 ILE A HD13   1 
ATOM   1105 N N      . SER A 1 85  ? -4.460  58.781 -2.840  1.00 25.82  ? 235 SER A N      1 
ATOM   1106 C CA     . SER A 1 85  ? -3.535  59.515 -3.691  1.00 27.56  ? 235 SER A CA     1 
ATOM   1107 C C      . SER A 1 85  ? -3.256  58.773 -5.000  1.00 23.33  ? 235 SER A C      1 
ATOM   1108 O O      . SER A 1 85  ? -2.962  59.410 -6.006  1.00 21.68  ? 235 SER A O      1 
ATOM   1109 C CB     . SER A 1 85  ? -2.226  59.797 -2.925  1.00 28.53  ? 235 SER A CB     1 
ATOM   1110 O OG     . SER A 1 85  ? -1.405  60.651 -3.711  1.00 42.56  ? 235 SER A OG     1 
ATOM   1111 H H      . SER A 1 85  ? -4.140  58.560 -2.073  1.00 30.96  ? 235 SER A H      1 
ATOM   1112 H HA     . SER A 1 85  ? -3.933  60.370 -3.917  1.00 33.04  ? 235 SER A HA     1 
ATOM   1113 H HB2    . SER A 1 85  ? -2.433  60.234 -2.084  1.00 34.20  ? 235 SER A HB2    1 
ATOM   1114 H HB3    . SER A 1 85  ? -1.761  58.961 -2.765  1.00 34.20  ? 235 SER A HB3    1 
ATOM   1115 H HG     . SER A 1 85  ? -0.688  60.813 -3.305  1.00 51.04  ? 235 SER A HG     1 
ATOM   1116 N N      . ASN A 1 86  ? -3.357  57.443 -5.021  1.00 24.21  ? 236 ASN A N      1 
ATOM   1117 C CA     . ASN A 1 86  ? -3.115  56.663 -6.243  1.00 23.10  ? 236 ASN A CA     1 
ATOM   1118 C C      . ASN A 1 86  ? -4.357  56.436 -7.107  1.00 29.74  ? 236 ASN A C      1 
ATOM   1119 O O      . ASN A 1 86  ? -4.232  55.854 -8.194  1.00 28.03  ? 236 ASN A O      1 
ATOM   1120 C CB     . ASN A 1 86  ? -2.546  55.282 -5.895  1.00 25.23  ? 236 ASN A CB     1 
ATOM   1121 C CG     . ASN A 1 86  ? -1.322  55.345 -4.969  1.00 27.36  ? 236 ASN A CG     1 
ATOM   1122 O OD1    . ASN A 1 86  ? -0.383  56.115 -5.202  1.00 27.15  ? 236 ASN A OD1    1 
ATOM   1123 N ND2    . ASN A 1 86  ? -1.324  54.502 -3.929  1.00 24.33  ? 236 ASN A ND2    1 
ATOM   1124 H H      . ASN A 1 86  ? -3.565  56.963 -4.338  1.00 29.02  ? 236 ASN A H      1 
ATOM   1125 H HA     . ASN A 1 86  ? -2.458  57.128 -6.784  1.00 27.69  ? 236 ASN A HA     1 
ATOM   1126 H HB2    . ASN A 1 86  ? -3.233  54.764 -5.447  1.00 30.25  ? 236 ASN A HB2    1 
ATOM   1127 H HB3    . ASN A 1 86  ? -2.279  54.838 -6.714  1.00 30.25  ? 236 ASN A HB3    1 
ATOM   1128 H HD21   . ASN A 1 86  ? -0.662  54.495 -3.380  1.00 29.17  ? 236 ASN A HD21   1 
ATOM   1129 H HD22   . ASN A 1 86  ? -1.986  53.966 -3.810  1.00 29.17  ? 236 ASN A HD22   1 
ATOM   1130 N N      . TYR A 1 87  ? -5.548  56.837 -6.659  1.00 26.95  ? 237 TYR A N      1 
ATOM   1131 C CA     . TYR A 1 87  ? -6.794  56.392 -7.280  1.00 24.73  ? 237 TYR A CA     1 
ATOM   1132 C C      . TYR A 1 87  ? -7.202  57.354 -8.395  1.00 24.65  ? 237 TYR A C      1 
ATOM   1133 O O      . TYR A 1 87  ? -7.284  58.564 -8.179  1.00 27.11  ? 237 TYR A O      1 
ATOM   1134 C CB     . TYR A 1 87  ? -7.913  56.296 -6.237  1.00 25.13  ? 237 TYR A CB     1 
ATOM   1135 C CG     . TYR A 1 87  ? -9.201  55.655 -6.727  1.00 24.07  ? 237 TYR A CG     1 
ATOM   1136 C CD1    . TYR A 1 87  ? -9.298  54.280 -6.885  1.00 21.30  ? 237 TYR A CD1    1 
ATOM   1137 C CD2    . TYR A 1 87  ? -10.324 56.426 -7.009  1.00 26.77  ? 237 TYR A CD2    1 
ATOM   1138 C CE1    . TYR A 1 87  ? -10.492 53.668 -7.332  1.00 22.15  ? 237 TYR A CE1    1 
ATOM   1139 C CE2    . TYR A 1 87  ? -11.520 55.837 -7.442  1.00 25.27  ? 237 TYR A CE2    1 
ATOM   1140 C CZ     . TYR A 1 87  ? -11.598 54.462 -7.608  1.00 26.57  ? 237 TYR A CZ     1 
ATOM   1141 O OH     . TYR A 1 87  ? -12.783 53.875 -8.026  1.00 24.45  ? 237 TYR A OH     1 
ATOM   1142 H H      . TYR A 1 87  ? -5.660  57.370 -5.994  1.00 32.31  ? 237 TYR A H      1 
ATOM   1143 H HA     . TYR A 1 87  ? -6.663  55.513 -7.669  1.00 29.65  ? 237 TYR A HA     1 
ATOM   1144 H HB2    . TYR A 1 87  ? -7.592  55.770 -5.488  1.00 30.12  ? 237 TYR A HB2    1 
ATOM   1145 H HB3    . TYR A 1 87  ? -8.130  57.192 -5.935  1.00 30.12  ? 237 TYR A HB3    1 
ATOM   1146 H HD1    . TYR A 1 87  ? -8.557  53.749 -6.701  1.00 25.53  ? 237 TYR A HD1    1 
ATOM   1147 H HD2    . TYR A 1 87  ? -10.283 57.349 -6.902  1.00 32.09  ? 237 TYR A HD2    1 
ATOM   1148 H HE1    . TYR A 1 87  ? -10.540 52.745 -7.432  1.00 26.55  ? 237 TYR A HE1    1 
ATOM   1149 H HE2    . TYR A 1 87  ? -12.260 56.369 -7.627  1.00 30.29  ? 237 TYR A HE2    1 
ATOM   1150 H HH     . TYR A 1 87  ? -12.691 53.041 -8.069  1.00 29.31  ? 237 TYR A HH     1 
ATOM   1151 N N      . ASP A 1 88  ? -7.480  56.803 -9.574  1.00 27.54  ? 238 ASP A N      1 
ATOM   1152 C CA     . ASP A 1 88  ? -7.934  57.563 -10.745 1.00 31.98  ? 238 ASP A CA     1 
ATOM   1153 C C      . ASP A 1 88  ? -9.467  57.502 -10.824 1.00 28.36  ? 238 ASP A C      1 
ATOM   1154 O O      . ASP A 1 88  ? -10.042 56.480 -11.209 1.00 30.42  ? 238 ASP A O      1 
ATOM   1155 C CB     . ASP A 1 88  ? -7.288  56.992 -12.001 1.00 35.33  ? 238 ASP A CB     1 
ATOM   1156 C CG     . ASP A 1 88  ? -7.604  57.792 -13.265 1.00 36.08  ? 238 ASP A CG     1 
ATOM   1157 O OD1    . ASP A 1 88  ? -8.401  58.750 -13.224 1.00 34.63  ? 238 ASP A OD1    1 
ATOM   1158 O OD2    . ASP A 1 88  ? -7.045  57.421 -14.313 1.00 38.54  ? 238 ASP A OD2    1 
ATOM   1159 H H      . ASP A 1 88  ? -7.412  55.960 -9.727  1.00 33.01  ? 238 ASP A H      1 
ATOM   1160 H HA     . ASP A 1 88  ? -7.667  58.491 -10.655 1.00 38.35  ? 238 ASP A HA     1 
ATOM   1161 H HB2    . ASP A 1 88  ? -6.325  56.988 -11.883 1.00 42.37  ? 238 ASP A HB2    1 
ATOM   1162 H HB3    . ASP A 1 88  ? -7.608  56.086 -12.134 1.00 42.37  ? 238 ASP A HB3    1 
ATOM   1163 N N      . PHE A 1 89  ? -10.123 58.605 -10.461 1.00 27.93  ? 239 PHE A N      1 
ATOM   1164 C CA     . PHE A 1 89  ? -11.584 58.671 -10.474 1.00 32.57  ? 239 PHE A CA     1 
ATOM   1165 C C      . PHE A 1 89  ? -12.169 58.596 -11.886 1.00 37.04  ? 239 PHE A C      1 
ATOM   1166 O O      . PHE A 1 89  ? -13.356 58.279 -12.034 1.00 34.58  ? 239 PHE A O      1 
ATOM   1167 C CB     . PHE A 1 89  ? -12.059 59.957 -9.773  1.00 31.39  ? 239 PHE A CB     1 
ATOM   1168 C CG     . PHE A 1 89  ? -12.077 59.851 -8.252  1.00 35.59  ? 239 PHE A CG     1 
ATOM   1169 C CD1    . PHE A 1 89  ? -13.149 59.263 -7.602  1.00 32.99  ? 239 PHE A CD1    1 
ATOM   1170 C CD2    . PHE A 1 89  ? -11.017 60.321 -7.485  1.00 33.55  ? 239 PHE A CD2    1 
ATOM   1171 C CE1    . PHE A 1 89  ? -13.175 59.148 -6.221  1.00 29.69  ? 239 PHE A CE1    1 
ATOM   1172 C CE2    . PHE A 1 89  ? -11.031 60.207 -6.095  1.00 35.94  ? 239 PHE A CE2    1 
ATOM   1173 C CZ     . PHE A 1 89  ? -12.113 59.618 -5.465  1.00 27.81  ? 239 PHE A CZ     1 
ATOM   1174 H H      . PHE A 1 89  ? -9.743  59.332 -10.203 1.00 33.48  ? 239 PHE A H      1 
ATOM   1175 H HA     . PHE A 1 89  ? -11.932 57.917 -9.972  1.00 39.05  ? 239 PHE A HA     1 
ATOM   1176 H HB2    . PHE A 1 89  ? -11.462 60.683 -10.014 1.00 37.64  ? 239 PHE A HB2    1 
ATOM   1177 H HB3    . PHE A 1 89  ? -12.960 60.160 -10.068 1.00 37.64  ? 239 PHE A HB3    1 
ATOM   1178 H HD1    . PHE A 1 89  ? -13.864 58.941 -8.101  1.00 39.56  ? 239 PHE A HD1    1 
ATOM   1179 H HD2    . PHE A 1 89  ? -10.286 60.714 -7.905  1.00 40.23  ? 239 PHE A HD2    1 
ATOM   1180 H HE1    . PHE A 1 89  ? -13.904 58.752 -5.802  1.00 35.60  ? 239 PHE A HE1    1 
ATOM   1181 H HE2    . PHE A 1 89  ? -10.317 60.528 -5.593  1.00 43.10  ? 239 PHE A HE2    1 
ATOM   1182 H HZ     . PHE A 1 89  ? -12.131 59.545 -4.538  1.00 33.34  ? 239 PHE A HZ     1 
ATOM   1183 N N      . SER A 1 90  ? -11.382 58.872 -12.926 1.00 34.74  ? 240 SER A N      1 
ATOM   1184 C CA     . SER A 1 90  ? -11.894 58.752 -14.288 1.00 36.55  ? 240 SER A CA     1 
ATOM   1185 C C      . SER A 1 90  ? -11.655 57.365 -14.887 1.00 37.94  ? 240 SER A C      1 
ATOM   1186 O O      . SER A 1 90  ? -12.131 57.105 -15.997 1.00 36.21  ? 240 SER A O      1 
ATOM   1187 C CB     . SER A 1 90  ? -11.305 59.861 -15.179 1.00 35.69  ? 240 SER A CB     1 
ATOM   1188 O OG     . SER A 1 90  ? -9.928  59.680 -15.396 1.00 47.40  ? 240 SER A OG     1 
ATOM   1189 H H      . SER A 1 90  ? -10.562 59.125 -12.871 1.00 41.66  ? 240 SER A H      1 
ATOM   1190 H HA     . SER A 1 90  ? -12.854 58.888 -14.260 1.00 43.83  ? 240 SER A HA     1 
ATOM   1191 N N      . ASN A 1 91  ? -10.995 56.450 -14.153 1.00 33.28  ? 241 ASN A N      1 
ATOM   1192 C CA     . ASN A 1 91  ? -10.890 55.035 -14.544 1.00 36.13  ? 241 ASN A CA     1 
ATOM   1193 C C      . ASN A 1 91  ? -11.105 54.126 -13.339 1.00 35.78  ? 241 ASN A C      1 
ATOM   1194 O O      . ASN A 1 91  ? -10.214 53.366 -12.951 1.00 34.63  ? 241 ASN A O      1 
ATOM   1195 C CB     . ASN A 1 91  ? -9.535  54.735 -15.187 1.00 42.02  ? 241 ASN A CB     1 
ATOM   1196 C CG     . ASN A 1 91  ? -9.397  55.351 -16.567 1.00 49.10  ? 241 ASN A CG     1 
ATOM   1197 O OD1    . ASN A 1 91  ? -9.865  54.782 -17.561 1.00 47.01  ? 241 ASN A OD1    1 
ATOM   1198 N ND2    . ASN A 1 91  ? -8.778  56.535 -16.632 1.00 44.31  ? 241 ASN A ND2    1 
ATOM   1199 H H      . ASN A 1 91  ? -10.595 56.630 -13.414 1.00 39.91  ? 241 ASN A H      1 
ATOM   1200 H HA     . ASN A 1 91  ? -11.580 54.837 -15.196 1.00 43.33  ? 241 ASN A HA     1 
ATOM   1201 H HB2    . ASN A 1 91  ? -8.831  55.096 -14.625 1.00 50.40  ? 241 ASN A HB2    1 
ATOM   1202 H HB3    . ASN A 1 91  ? -9.431  53.775 -15.274 1.00 50.40  ? 241 ASN A HB3    1 
ATOM   1203 H HD21   . ASN A 1 91  ? -8.676  56.925 -17.392 1.00 53.15  ? 241 ASN A HD21   1 
ATOM   1204 H HD22   . ASN A 1 91  ? -8.483  56.907 -15.915 1.00 53.15  ? 241 ASN A HD22   1 
ATOM   1205 N N      . PRO A 1 92  ? -12.304 54.141 -12.754 1.00 33.69  ? 242 PRO A N      1 
ATOM   1206 C CA     . PRO A 1 92  ? -12.533 53.430 -11.485 1.00 33.48  ? 242 PRO A CA     1 
ATOM   1207 C C      . PRO A 1 92  ? -12.295 51.934 -11.590 1.00 27.41  ? 242 PRO A C      1 
ATOM   1208 O O      . PRO A 1 92  ? -12.488 51.342 -12.647 1.00 34.64  ? 242 PRO A O      1 
ATOM   1209 C CB     . PRO A 1 92  ? -14.008 53.720 -11.177 1.00 34.50  ? 242 PRO A CB     1 
ATOM   1210 C CG     . PRO A 1 92  ? -14.597 54.192 -12.466 1.00 34.10  ? 242 PRO A CG     1 
ATOM   1211 C CD     . PRO A 1 92  ? -13.496 54.887 -13.189 1.00 33.91  ? 242 PRO A CD     1 
ATOM   1212 H HA     . PRO A 1 92  ? -11.976 53.799 -10.782 1.00 40.15  ? 242 PRO A HA     1 
ATOM   1213 H HB2    . PRO A 1 92  ? -14.444 52.906 -10.879 1.00 41.37  ? 242 PRO A HB2    1 
ATOM   1214 H HB3    . PRO A 1 92  ? -14.069 54.410 -10.499 1.00 41.37  ? 242 PRO A HB3    1 
ATOM   1215 H HG2    . PRO A 1 92  ? -14.913 53.431 -12.977 1.00 40.90  ? 242 PRO A HG2    1 
ATOM   1216 H HG3    . PRO A 1 92  ? -15.325 54.807 -12.284 1.00 40.90  ? 242 PRO A HG3    1 
ATOM   1217 H HD2    . PRO A 1 92  ? -13.615 54.807 -14.148 1.00 40.66  ? 242 PRO A HD2    1 
ATOM   1218 H HD3    . PRO A 1 92  ? -13.438 55.814 -12.910 1.00 40.66  ? 242 PRO A HD3    1 
ATOM   1219 N N      . GLY A 1 93  ? -11.890 51.322 -10.474 1.00 29.69  ? 243 GLY A N      1 
ATOM   1220 C CA     . GLY A 1 93  ? -11.709 49.881 -10.405 1.00 27.26  ? 243 GLY A CA     1 
ATOM   1221 C C      . GLY A 1 93  ? -10.693 49.462 -9.351  1.00 27.11  ? 243 GLY A C      1 
ATOM   1222 O O      . GLY A 1 93  ? -10.226 50.262 -8.539  1.00 29.74  ? 243 GLY A O      1 
ATOM   1223 H H      . GLY A 1 93  ? -11.713 51.730 -9.738  1.00 35.60  ? 243 GLY A H      1 
ATOM   1224 H HA2    . GLY A 1 93  ? -12.557 49.460 -10.196 1.00 32.69  ? 243 GLY A HA2    1 
ATOM   1225 H HA3    . GLY A 1 93  ? -11.408 49.552 -11.267 1.00 32.69  ? 243 GLY A HA3    1 
ATOM   1226 N N      . PHE A 1 94  ? -10.346 48.170 -9.383  1.00 26.04  ? 244 PHE A N      1 
ATOM   1227 C CA     . PHE A 1 94  ? -9.384  47.620 -8.434  1.00 28.28  ? 244 PHE A CA     1 
ATOM   1228 C C      . PHE A 1 94  ? -7.941  47.962 -8.830  1.00 27.29  ? 244 PHE A C      1 
ATOM   1229 O O      . PHE A 1 94  ? -7.614  48.096 -10.013 1.00 24.86  ? 244 PHE A O      1 
ATOM   1230 C CB     . PHE A 1 94  ? -9.505  46.095 -8.325  1.00 33.09  ? 244 PHE A CB     1 
ATOM   1231 C CG     . PHE A 1 94  ? -8.580  45.502 -7.285  1.00 34.46  ? 244 PHE A CG     1 
ATOM   1232 C CD1    . PHE A 1 94  ? -8.846  45.664 -5.923  1.00 39.91  ? 244 PHE A CD1    1 
ATOM   1233 C CD2    . PHE A 1 94  ? -7.431  44.832 -7.663  1.00 35.70  ? 244 PHE A CD2    1 
ATOM   1234 C CE1    . PHE A 1 94  ? -7.977  45.145 -4.941  1.00 38.24  ? 244 PHE A CE1    1 
ATOM   1235 C CE2    . PHE A 1 94  ? -6.561  44.298 -6.708  1.00 35.64  ? 244 PHE A CE2    1 
ATOM   1236 C CZ     . PHE A 1 94  ? -6.828  44.463 -5.336  1.00 40.33  ? 244 PHE A CZ     1 
ATOM   1237 H H      . PHE A 1 94  ? -10.655 47.597 -9.944  1.00 31.22  ? 244 PHE A H      1 
ATOM   1238 H HA     . PHE A 1 94  ? -9.552  47.999 -7.557  1.00 33.91  ? 244 PHE A HA     1 
ATOM   1239 H HB2    . PHE A 1 94  ? -10.416 45.868 -8.079  1.00 39.68  ? 244 PHE A HB2    1 
ATOM   1240 H HB3    . PHE A 1 94  ? -9.285  45.699 -9.183  1.00 39.68  ? 244 PHE A HB3    1 
ATOM   1241 H HD1    . PHE A 1 94  ? -9.610  46.125 -5.660  1.00 47.86  ? 244 PHE A HD1    1 
ATOM   1242 H HD2    . PHE A 1 94  ? -7.241  44.723 -8.567  1.00 42.82  ? 244 PHE A HD2    1 
ATOM   1243 H HE1    . PHE A 1 94  ? -8.171  45.253 -4.038  1.00 45.86  ? 244 PHE A HE1    1 
ATOM   1244 H HE2    . PHE A 1 94  ? -5.796  43.846 -6.981  1.00 42.74  ? 244 PHE A HE2    1 
ATOM   1245 H HZ     . PHE A 1 94  ? -6.251  44.105 -4.699  1.00 48.37  ? 244 PHE A HZ     1 
ATOM   1246 N N      . SER A 1 95  ? -7.078  48.098 -7.823  1.00 30.00  ? 245 SER A N      1 
ATOM   1247 C CA     . SER A 1 95  ? -5.625  48.041 -8.025  1.00 26.81  ? 245 SER A CA     1 
ATOM   1248 C C      . SER A 1 95  ? -4.971  47.630 -6.719  1.00 31.27  ? 245 SER A C      1 
ATOM   1249 O O      . SER A 1 95  ? -5.562  47.753 -5.639  1.00 28.16  ? 245 SER A O      1 
ATOM   1250 C CB     . SER A 1 95  ? -5.038  49.376 -8.510  1.00 24.89  ? 245 SER A CB     1 
ATOM   1251 O OG     . SER A 1 95  ? -4.757  50.238 -7.416  1.00 27.38  ? 245 SER A OG     1 
ATOM   1252 H H      . SER A 1 95  ? -7.310  48.225 -7.005  1.00 35.98  ? 245 SER A H      1 
ATOM   1253 H HA     . SER A 1 95  ? -5.423  47.364 -8.690  1.00 32.15  ? 245 SER A HA     1 
ATOM   1254 H HB2    . SER A 1 95  ? -4.215  49.201 -8.994  1.00 29.84  ? 245 SER A HB2    1 
ATOM   1255 H HB3    . SER A 1 95  ? -5.680  49.809 -9.095  1.00 29.84  ? 245 SER A HB3    1 
ATOM   1256 H HG     . SER A 1 95  ? -5.461  50.398 -6.988  1.00 32.83  ? 245 SER A HG     1 
ATOM   1257 N N      . SER A 1 96  ? -3.726  47.145 -6.826  1.00 30.49  ? 246 SER A N      1 
ATOM   1258 C CA     . SER A 1 96  ? -3.056  46.611 -5.637  1.00 23.40  ? 246 SER A CA     1 
ATOM   1259 C C      . SER A 1 96  ? -2.810  47.682 -4.586  1.00 23.58  ? 246 SER A C      1 
ATOM   1260 O O      . SER A 1 96  ? -2.731  47.362 -3.396  1.00 31.73  ? 246 SER A O      1 
ATOM   1261 C CB     . SER A 1 96  ? -1.718  45.944 -6.024  1.00 30.65  ? 246 SER A CB     1 
ATOM   1262 O OG     . SER A 1 96  ? -0.870  46.861 -6.711  1.00 25.56  ? 246 SER A OG     1 
ATOM   1263 H H      . SER A 1 96  ? -3.263  47.114 -7.550  1.00 36.56  ? 246 SER A H      1 
ATOM   1264 H HA     . SER A 1 96  ? -3.622  45.931 -5.239  1.00 28.05  ? 246 SER A HA     1 
ATOM   1265 H HB2    . SER A 1 96  ? -1.270  45.644 -5.218  1.00 36.75  ? 246 SER A HB2    1 
ATOM   1266 H HB3    . SER A 1 96  ? -1.899  45.188 -6.603  1.00 36.75  ? 246 SER A HB3    1 
ATOM   1267 H HG     . SER A 1 96  ? -0.705  47.522 -6.220  1.00 30.64  ? 246 SER A HG     1 
ATOM   1268 N N      . ASN A 1 97  ? -2.668  48.947 -4.985  1.00 23.05  ? 247 ASN A N      1 
ATOM   1269 C CA     . ASN A 1 97  ? -2.362  50.009 -4.029  1.00 24.22  ? 247 ASN A CA     1 
ATOM   1270 C C      . ASN A 1 97  ? -3.499  51.027 -3.872  1.00 25.91  ? 247 ASN A C      1 
ATOM   1271 O O      . ASN A 1 97  ? -3.254  52.159 -3.435  1.00 21.43  ? 247 ASN A O      1 
ATOM   1272 C CB     . ASN A 1 97  ? -1.050  50.689 -4.423  1.00 25.43  ? 247 ASN A CB     1 
ATOM   1273 C CG     . ASN A 1 97  ? 0.096   49.705 -4.439  1.00 32.44  ? 247 ASN A CG     1 
ATOM   1274 O OD1    . ASN A 1 97  ? 0.193   48.862 -5.339  1.00 33.07  ? 247 ASN A OD1    1 
ATOM   1275 N ND2    . ASN A 1 97  ? 0.907   49.733 -3.393  1.00 30.63  ? 247 ASN A ND2    1 
ATOM   1276 H H      . ASN A 1 97  ? -2.745  49.214 -5.799  1.00 27.63  ? 247 ASN A H      1 
ATOM   1277 H HA     . ASN A 1 97  ? -2.223  49.601 -3.160  1.00 29.04  ? 247 ASN A HA     1 
ATOM   1278 H HB2    . ASN A 1 97  ? -1.139  51.067 -5.312  1.00 30.49  ? 247 ASN A HB2    1 
ATOM   1279 H HB3    . ASN A 1 97  ? -0.845  51.385 -3.780  1.00 30.49  ? 247 ASN A HB3    1 
ATOM   1280 H HD21   . ASN A 1 97  ? 1.576   49.193 -3.352  1.00 36.73  ? 247 ASN A HD21   1 
ATOM   1281 H HD22   . ASN A 1 97  ? 0.765   50.290 -2.753  1.00 36.73  ? 247 ASN A HD22   1 
ATOM   1282 N N      . THR A 1 98  ? -4.738  50.637 -4.192  1.00 24.34  ? 248 THR A N      1 
ATOM   1283 C CA     . THR A 1 98  ? -5.925  51.410 -3.814  1.00 21.38  ? 248 THR A CA     1 
ATOM   1284 C C      . THR A 1 98  ? -7.048  50.581 -3.178  1.00 25.60  ? 248 THR A C      1 
ATOM   1285 O O      . THR A 1 98  ? -8.080  51.163 -2.824  1.00 25.30  ? 248 THR A O      1 
ATOM   1286 C CB     . THR A 1 98  ? -6.523  52.159 -5.015  1.00 24.07  ? 248 THR A CB     1 
ATOM   1287 O OG1    . THR A 1 98  ? -6.916  51.237 -6.046  1.00 23.33  ? 248 THR A OG1    1 
ATOM   1288 C CG2    . THR A 1 98  ? -5.563  53.190 -5.561  1.00 25.23  ? 248 THR A CG2    1 
ATOM   1289 H H      . THR A 1 98  ? -4.917  49.920 -4.633  1.00 29.18  ? 248 THR A H      1 
ATOM   1290 H HA     . THR A 1 98  ? -5.656  52.077 -3.163  1.00 25.63  ? 248 THR A HA     1 
ATOM   1291 H HB     . THR A 1 98  ? -7.314  52.633 -4.714  1.00 28.86  ? 248 THR A HB     1 
ATOM   1292 H HG1    . THR A 1 98  ? -7.492  50.703 -5.749  1.00 27.97  ? 248 THR A HG1    1 
ATOM   1293 H HG21   . THR A 1 98  ? -5.963  53.648 -6.317  1.00 30.25  ? 248 THR A HG21   1 
ATOM   1294 H HG22   . THR A 1 98  ? -5.350  53.841 -4.874  1.00 30.25  ? 248 THR A HG22   1 
ATOM   1295 H HG23   . THR A 1 98  ? -4.744  52.759 -5.852  1.00 30.25  ? 248 THR A HG23   1 
ATOM   1296 N N      . GLY A 1 99  ? -6.867  49.266 -2.986  1.00 20.66  ? 249 GLY A N      1 
ATOM   1297 C CA     . GLY A 1 99  ? -7.937  48.363 -2.544  1.00 20.10  ? 249 GLY A CA     1 
ATOM   1298 C C      . GLY A 1 99  ? -8.342  48.526 -1.087  1.00 24.38  ? 249 GLY A C      1 
ATOM   1299 O O      . GLY A 1 99  ? -9.486  48.210 -0.727  1.00 25.00  ? 249 GLY A O      1 
ATOM   1300 H H      . GLY A 1 99  ? -6.115  48.867 -3.108  1.00 24.76  ? 249 GLY A H      1 
ATOM   1301 H HA2    . GLY A 1 99  ? -8.723  48.513 -3.092  1.00 24.09  ? 249 GLY A HA2    1 
ATOM   1302 H HA3    . GLY A 1 99  ? -7.650  47.446 -2.674  1.00 24.09  ? 249 GLY A HA3    1 
ATOM   1303 N N      . HIS A 1 100 ? -7.445  49.046 -0.253  1.00 20.37  ? 250 HIS A N      1 
ATOM   1304 C CA     . HIS A 1 100 ? -7.761  49.355 1.143   1.00 21.09  ? 250 HIS A CA     1 
ATOM   1305 C C      . HIS A 1 100 ? -8.612  50.625 1.240   1.00 25.00  ? 250 HIS A C      1 
ATOM   1306 O O      . HIS A 1 100 ? -9.640  50.644 1.937   1.00 22.83  ? 250 HIS A O      1 
ATOM   1307 C CB     . HIS A 1 100 ? -6.462  49.510 1.956   1.00 23.91  ? 250 HIS A CB     1 
ATOM   1308 C CG     . HIS A 1 100 ? -5.606  48.274 1.999   1.00 25.48  ? 250 HIS A CG     1 
ATOM   1309 N ND1    . HIS A 1 100 ? -4.291  48.251 1.570   1.00 24.57  ? 250 HIS A ND1    1 
ATOM   1310 C CD2    . HIS A 1 100 ? -5.868  47.028 2.469   1.00 29.11  ? 250 HIS A CD2    1 
ATOM   1311 C CE1    . HIS A 1 100 ? -3.793  47.039 1.754   1.00 27.08  ? 250 HIS A CE1    1 
ATOM   1312 N NE2    . HIS A 1 100 ? -4.725  46.278 2.305   1.00 27.84  ? 250 HIS A NE2    1 
ATOM   1313 H H      . HIS A 1 100 ? -6.634  49.231 -0.473  1.00 24.41  ? 250 HIS A H      1 
ATOM   1314 H HA     . HIS A 1 100 ? -8.270  48.622 1.523   1.00 25.28  ? 250 HIS A HA     1 
ATOM   1315 H HB2    . HIS A 1 100 ? -5.933  50.222 1.563   1.00 28.66  ? 250 HIS A HB2    1 
ATOM   1316 H HB3    . HIS A 1 100 ? -6.693  49.741 2.869   1.00 28.66  ? 250 HIS A HB3    1 
ATOM   1317 H HD1    . HIS A 1 100 ? -3.867  48.916 1.228   1.00 29.45  ? 250 HIS A HD1    1 
ATOM   1318 H HD2    . HIS A 1 100 ? -6.672  46.734 2.832   1.00 34.90  ? 250 HIS A HD2    1 
ATOM   1319 H HE1    . HIS A 1 100 ? -2.930  46.769 1.537   1.00 32.47  ? 250 HIS A HE1    1 
ATOM   1320 N N      . PHE A 1 101 ? -8.186  51.694 0.550   1.00 20.86  ? 251 PHE A N      1 
ATOM   1321 C CA     . PHE A 1 101 ? -8.983  52.920 0.440   1.00 21.35  ? 251 PHE A CA     1 
ATOM   1322 C C      . PHE A 1 101 ? -10.414 52.649 -0.053  1.00 21.87  ? 251 PHE A C      1 
ATOM   1323 O O      . PHE A 1 101 ? -11.379 53.169 0.526   1.00 21.56  ? 251 PHE A O      1 
ATOM   1324 C CB     . PHE A 1 101 ? -8.276  53.926 -0.478  1.00 21.75  ? 251 PHE A CB     1 
ATOM   1325 C CG     . PHE A 1 101 ? -9.195  54.952 -1.108  1.00 22.24  ? 251 PHE A CG     1 
ATOM   1326 C CD1    . PHE A 1 101 ? -9.768  55.962 -0.351  1.00 21.25  ? 251 PHE A CD1    1 
ATOM   1327 C CD2    . PHE A 1 101 ? -9.466  54.908 -2.468  1.00 20.82  ? 251 PHE A CD2    1 
ATOM   1328 C CE1    . PHE A 1 101 ? -10.631 56.910 -0.939  1.00 24.11  ? 251 PHE A CE1    1 
ATOM   1329 C CE2    . PHE A 1 101 ? -10.317 55.855 -3.072  1.00 22.58  ? 251 PHE A CE2    1 
ATOM   1330 C CZ     . PHE A 1 101 ? -10.901 56.850 -2.299  1.00 28.15  ? 251 PHE A CZ     1 
ATOM   1331 H H      . PHE A 1 101 ? -7.433  51.731 0.136   1.00 25.01  ? 251 PHE A H      1 
ATOM   1332 H HA     . PHE A 1 101 ? -9.049  53.324 1.320   1.00 25.59  ? 251 PHE A HA     1 
ATOM   1333 H HB2    . PHE A 1 101 ? -7.611  54.406 0.040   1.00 26.07  ? 251 PHE A HB2    1 
ATOM   1334 H HB3    . PHE A 1 101 ? -7.842  53.440 -1.197  1.00 26.07  ? 251 PHE A HB3    1 
ATOM   1335 H HD1    . PHE A 1 101 ? -9.598  56.002 0.563   1.00 25.47  ? 251 PHE A HD1    1 
ATOM   1336 H HD2    . PHE A 1 101 ? -9.085  54.238 -2.989  1.00 24.96  ? 251 PHE A HD2    1 
ATOM   1337 H HE1    . PHE A 1 101 ? -11.013 57.580 -0.418  1.00 28.91  ? 251 PHE A HE1    1 
ATOM   1338 H HE2    . PHE A 1 101 ? -10.495 55.808 -3.984  1.00 27.07  ? 251 PHE A HE2    1 
ATOM   1339 H HZ     . PHE A 1 101 ? -11.461 57.480 -2.693  1.00 33.75  ? 251 PHE A HZ     1 
ATOM   1340 N N      . THR A 1 102 ? -10.583 51.861 -1.135  1.00 20.14  ? 252 THR A N      1 
ATOM   1341 C CA     . THR A 1 102 ? -11.937 51.697 -1.687  1.00 24.18  ? 252 THR A CA     1 
ATOM   1342 C C      . THR A 1 102 ? -12.851 50.900 -0.740  1.00 24.14  ? 252 THR A C      1 
ATOM   1343 O O      . THR A 1 102 ? -14.083 51.088 -0.749  1.00 22.78  ? 252 THR A O      1 
ATOM   1344 C CB     . THR A 1 102 ? -11.900 51.078 -3.115  1.00 23.46  ? 252 THR A CB     1 
ATOM   1345 O OG1    . THR A 1 102 ? -11.105 49.887 -3.200  1.00 23.96  ? 252 THR A OG1    1 
ATOM   1346 C CG2    . THR A 1 102 ? -11.372 52.081 -4.128  1.00 23.00  ? 252 THR A CG2    1 
ATOM   1347 H H      . THR A 1 102 ? -9.962  51.433 -1.547  1.00 24.13  ? 252 THR A H      1 
ATOM   1348 H HA     . THR A 1 102 ? -12.329 52.580 -1.776  1.00 28.99  ? 252 THR A HA     1 
ATOM   1349 H HB     . THR A 1 102 ? -12.808 50.857 -3.374  1.00 28.12  ? 252 THR A HB     1 
ATOM   1350 H HG1    . THR A 1 102 ? -11.411 49.299 -2.684  1.00 28.73  ? 252 THR A HG1    1 
ATOM   1351 H HG21   . THR A 1 102 ? -11.354 51.681 -5.012  1.00 27.57  ? 252 THR A HG21   1 
ATOM   1352 H HG22   . THR A 1 102 ? -11.943 52.865 -4.148  1.00 27.57  ? 252 THR A HG22   1 
ATOM   1353 H HG23   . THR A 1 102 ? -10.472 52.353 -3.887  1.00 27.57  ? 252 THR A HG23   1 
ATOM   1354 N N      . GLN A 1 103 ? -12.285 50.045 0.112   1.00 19.34  ? 253 GLN A N      1 
ATOM   1355 C CA     . GLN A 1 103 ? -13.088 49.370 1.134   1.00 21.14  ? 253 GLN A CA     1 
ATOM   1356 C C      . GLN A 1 103 ? -13.415 50.309 2.297   1.00 27.69  ? 253 GLN A C      1 
ATOM   1357 O O      . GLN A 1 103 ? -14.518 50.248 2.835   1.00 18.66  ? 253 GLN A O      1 
ATOM   1358 C CB     . GLN A 1 103 ? -12.384 48.110 1.643   1.00 23.03  ? 253 GLN A CB     1 
ATOM   1359 C CG     . GLN A 1 103 ? -13.064 47.424 2.859   1.00 23.08  ? 253 GLN A CG     1 
ATOM   1360 C CD     . GLN A 1 103 ? -14.422 46.768 2.541   1.00 23.22  ? 253 GLN A CD     1 
ATOM   1361 O OE1    . GLN A 1 103 ? -14.499 45.562 2.251   1.00 21.24  ? 253 GLN A OE1    1 
ATOM   1362 N NE2    . GLN A 1 103 ? -15.501 47.558 2.633   1.00 21.43  ? 253 GLN A NE2    1 
ATOM   1363 H H      . GLN A 1 103 ? -11.449 49.841 0.122   1.00 23.18  ? 253 GLN A H      1 
ATOM   1364 H HA     . GLN A 1 103 ? -13.929 49.095 0.734   1.00 25.34  ? 253 GLN A HA     1 
ATOM   1365 H HB2    . GLN A 1 103 ? -12.351 47.462 0.922   1.00 27.61  ? 253 GLN A HB2    1 
ATOM   1366 H HB3    . GLN A 1 103 ? -11.481 48.347 1.907   1.00 27.61  ? 253 GLN A HB3    1 
ATOM   1367 H HG2    . GLN A 1 103 ? -12.474 46.732 3.195   1.00 27.66  ? 253 GLN A HG2    1 
ATOM   1368 H HG3    . GLN A 1 103 ? -13.213 48.091 3.548   1.00 27.66  ? 253 GLN A HG3    1 
ATOM   1369 H HE21   . GLN A 1 103 ? -15.413 48.382 2.860   1.00 25.69  ? 253 GLN A HE21   1 
ATOM   1370 H HE22   . GLN A 1 103 ? -16.283 47.239 2.466   1.00 25.69  ? 253 GLN A HE22   1 
ATOM   1371 N N      . VAL A 1 104 ? -12.492 51.200 2.689   1.00 20.25  ? 254 VAL A N      1 
ATOM   1372 C CA     . VAL A 1 104 ? -12.797 52.151 3.766   1.00 20.37  ? 254 VAL A CA     1 
ATOM   1373 C C      . VAL A 1 104 ? -14.013 53.009 3.415   1.00 22.62  ? 254 VAL A C      1 
ATOM   1374 O O      . VAL A 1 104 ? -14.844 53.289 4.286   1.00 20.63  ? 254 VAL A O      1 
ATOM   1375 C CB     . VAL A 1 104 ? -11.578 53.039 4.107   1.00 24.42  ? 254 VAL A CB     1 
ATOM   1376 C CG1    . VAL A 1 104 ? -11.979 54.218 5.020   1.00 20.26  ? 254 VAL A CG1    1 
ATOM   1377 C CG2    . VAL A 1 104 ? -10.516 52.248 4.819   1.00 21.55  ? 254 VAL A CG2    1 
ATOM   1378 H H      . VAL A 1 104 ? -11.703 51.273 2.357   1.00 24.27  ? 254 VAL A H      1 
ATOM   1379 H HA     . VAL A 1 104 ? -13.020 51.647 4.565   1.00 24.41  ? 254 VAL A HA     1 
ATOM   1380 H HB     . VAL A 1 104 ? -11.198 53.397 3.289   1.00 29.28  ? 254 VAL A HB     1 
ATOM   1381 H HG11   . VAL A 1 104 ? -11.191 54.751 5.211   1.00 24.28  ? 254 VAL A HG11   1 
ATOM   1382 H HG12   . VAL A 1 104 ? -12.642 54.759 4.563   1.00 24.28  ? 254 VAL A HG12   1 
ATOM   1383 H HG13   . VAL A 1 104 ? -12.350 53.867 5.844   1.00 24.28  ? 254 VAL A HG13   1 
ATOM   1384 H HG21   . VAL A 1 104 ? -9.768  52.832 5.018   1.00 25.84  ? 254 VAL A HG21   1 
ATOM   1385 H HG22   . VAL A 1 104 ? -10.887 51.893 5.642   1.00 25.84  ? 254 VAL A HG22   1 
ATOM   1386 H HG23   . VAL A 1 104 ? -10.227 51.521 4.246   1.00 25.84  ? 254 VAL A HG23   1 
ATOM   1387 N N      . VAL A 1 105 ? -14.131 53.459 2.152   1.00 22.11  ? 255 VAL A N      1 
ATOM   1388 C CA     . VAL A 1 105 ? -15.188 54.405 1.746   1.00 18.67  ? 255 VAL A CA     1 
ATOM   1389 C C      . VAL A 1 105 ? -16.352 53.731 1.004   1.00 21.43  ? 255 VAL A C      1 
ATOM   1390 O O      . VAL A 1 105 ? -17.284 54.437 0.590   1.00 21.21  ? 255 VAL A O      1 
ATOM   1391 C CB     . VAL A 1 105 ? -14.658 55.584 0.886   1.00 20.67  ? 255 VAL A CB     1 
ATOM   1392 C CG1    . VAL A 1 105 ? -13.612 56.404 1.648   1.00 22.96  ? 255 VAL A CG1    1 
ATOM   1393 C CG2    . VAL A 1 105 ? -14.095 55.138 -0.502  1.00 20.74  ? 255 VAL A CG2    1 
ATOM   1394 H H      . VAL A 1 105 ? -13.607 53.230 1.510   1.00 26.51  ? 255 VAL A H      1 
ATOM   1395 H HA     . VAL A 1 105 ? -15.560 54.793 2.553   1.00 22.37  ? 255 VAL A HA     1 
ATOM   1396 H HB     . VAL A 1 105 ? -15.403 56.178 0.707   1.00 24.78  ? 255 VAL A HB     1 
ATOM   1397 H HG11   . VAL A 1 105 ? -13.305 57.128 1.081   1.00 27.52  ? 255 VAL A HG11   1 
ATOM   1398 H HG12   . VAL A 1 105 ? -14.017 56.762 2.453   1.00 27.52  ? 255 VAL A HG12   1 
ATOM   1399 H HG13   . VAL A 1 105 ? -12.867 55.827 1.881   1.00 27.52  ? 255 VAL A HG13   1 
ATOM   1400 H HG21   . VAL A 1 105 ? -13.783 55.921 -0.982  1.00 24.85  ? 255 VAL A HG21   1 
ATOM   1401 H HG22   . VAL A 1 105 ? -13.359 54.522 -0.361  1.00 24.85  ? 255 VAL A HG22   1 
ATOM   1402 H HG23   . VAL A 1 105 ? -14.801 54.701 -1.003  1.00 24.85  ? 255 VAL A HG23   1 
ATOM   1403 N N      . TRP A 1 106 ? -16.355 52.400 0.871   1.00 19.22  ? 256 TRP A N      1 
ATOM   1404 C CA     . TRP A 1 106 ? -17.361 51.707 0.068   1.00 20.01  ? 256 TRP A CA     1 
ATOM   1405 C C      . TRP A 1 106 ? -18.767 52.087 0.526   1.00 21.20  ? 256 TRP A C      1 
ATOM   1406 O O      . TRP A 1 106 ? -19.155 51.830 1.666   1.00 20.90  ? 256 TRP A O      1 
ATOM   1407 C CB     . TRP A 1 106 ? -17.160 50.197 0.152   1.00 19.12  ? 256 TRP A CB     1 
ATOM   1408 C CG     . TRP A 1 106 ? -17.856 49.383 -0.939  1.00 22.09  ? 256 TRP A CG     1 
ATOM   1409 C CD1    . TRP A 1 106 ? -19.033 48.688 -0.808  1.00 25.21  ? 256 TRP A CD1    1 
ATOM   1410 C CD2    . TRP A 1 106 ? -17.423 49.170 -2.301  1.00 23.12  ? 256 TRP A CD2    1 
ATOM   1411 N NE1    . TRP A 1 106 ? -19.350 48.052 -1.995  1.00 25.00  ? 256 TRP A NE1    1 
ATOM   1412 C CE2    . TRP A 1 106 ? -18.393 48.346 -2.929  1.00 23.81  ? 256 TRP A CE2    1 
ATOM   1413 C CE3    . TRP A 1 106 ? -16.320 49.593 -3.051  1.00 24.67  ? 256 TRP A CE3    1 
ATOM   1414 C CZ2    . TRP A 1 106 ? -18.277 47.929 -4.263  1.00 24.30  ? 256 TRP A CZ2    1 
ATOM   1415 C CZ3    . TRP A 1 106 ? -16.223 49.199 -4.386  1.00 22.33  ? 256 TRP A CZ3    1 
ATOM   1416 C CH2    . TRP A 1 106 ? -17.190 48.364 -4.973  1.00 26.80  ? 256 TRP A CH2    1 
ATOM   1417 H H      . TRP A 1 106 ? -15.781 51.876 1.240   1.00 23.03  ? 256 TRP A H      1 
ATOM   1418 H HA     . TRP A 1 106 ? -17.265 51.973 -0.860  1.00 23.98  ? 256 TRP A HA     1 
ATOM   1419 H HB2    . TRP A 1 106 ? -16.210 50.010 0.094   1.00 22.91  ? 256 TRP A HB2    1 
ATOM   1420 H HB3    . TRP A 1 106 ? -17.500 49.889 1.007   1.00 22.91  ? 256 TRP A HB3    1 
ATOM   1421 H HD1    . TRP A 1 106 ? -19.537 48.640 -0.028  1.00 30.22  ? 256 TRP A HD1    1 
ATOM   1422 H HE1    . TRP A 1 106 ? -20.049 47.570 -2.131  1.00 29.97  ? 256 TRP A HE1    1 
ATOM   1423 H HE3    . TRP A 1 106 ? -15.672 50.143 -2.671  1.00 29.57  ? 256 TRP A HE3    1 
ATOM   1424 H HZ2    . TRP A 1 106 ? -18.923 47.388 -4.657  1.00 29.13  ? 256 TRP A HZ2    1 
ATOM   1425 H HZ3    . TRP A 1 106 ? -15.491 49.473 -4.890  1.00 26.76  ? 256 TRP A HZ3    1 
ATOM   1426 H HH2    . TRP A 1 106 ? -17.096 48.114 -5.864  1.00 32.13  ? 256 TRP A HH2    1 
ATOM   1427 N N      . LYS A 1 107 ? -19.522 52.721 -0.371  1.00 22.49  ? 257 LYS A N      1 
ATOM   1428 C CA     . LYS A 1 107 ? -20.820 53.285 0.010   1.00 21.65  ? 257 LYS A CA     1 
ATOM   1429 C C      . LYS A 1 107 ? -21.742 52.237 0.630   1.00 23.26  ? 257 LYS A C      1 
ATOM   1430 O O      . LYS A 1 107 ? -22.385 52.499 1.648   1.00 22.97  ? 257 LYS A O      1 
ATOM   1431 C CB     . LYS A 1 107 ? -21.500 53.925 -1.196  1.00 22.37  ? 257 LYS A CB     1 
ATOM   1432 C CG     . LYS A 1 107 ? -22.818 54.665 -0.872  1.00 23.95  ? 257 LYS A CG     1 
ATOM   1433 C CD     . LYS A 1 107 ? -23.551 55.101 -2.123  1.00 26.34  ? 257 LYS A CD     1 
ATOM   1434 C CE     . LYS A 1 107 ? -22.772 56.194 -2.833  1.00 35.25  ? 257 LYS A CE     1 
ATOM   1435 N NZ     . LYS A 1 107 ? -23.459 56.734 -4.035  1.00 40.05  ? 257 LYS A NZ     1 
ATOM   1436 H H      . LYS A 1 107 ? -19.311 52.837 -1.196  1.00 26.96  ? 257 LYS A H      1 
ATOM   1437 H HA     . LYS A 1 107 ? -20.675 53.980 0.671   1.00 25.96  ? 257 LYS A HA     1 
ATOM   1438 H HB2    . LYS A 1 107 ? -20.890 54.569 -1.590  1.00 26.81  ? 257 LYS A HB2    1 
ATOM   1439 H HB3    . LYS A 1 107 ? -21.703 53.230 -1.842  1.00 26.81  ? 257 LYS A HB3    1 
ATOM   1440 H HG2    . LYS A 1 107 ? -23.401 54.071 -0.373  1.00 28.72  ? 257 LYS A HG2    1 
ATOM   1441 H HG3    . LYS A 1 107 ? -22.618 55.456 -0.348  1.00 28.72  ? 257 LYS A HG3    1 
ATOM   1442 H HD2    . LYS A 1 107 ? -23.641 54.346 -2.725  1.00 31.58  ? 257 LYS A HD2    1 
ATOM   1443 H HD3    . LYS A 1 107 ? -24.423 55.451 -1.882  1.00 31.58  ? 257 LYS A HD3    1 
ATOM   1444 H HE2    . LYS A 1 107 ? -22.631 56.929 -2.216  1.00 42.27  ? 257 LYS A HE2    1 
ATOM   1445 H HE3    . LYS A 1 107 ? -21.916 55.835 -3.117  1.00 42.27  ? 257 LYS A HE3    1 
ATOM   1446 H HZ1    . LYS A 1 107 ? -22.960 57.369 -4.410  1.00 48.03  ? 257 LYS A HZ1    1 
ATOM   1447 H HZ2    . LYS A 1 107 ? -23.593 56.083 -4.627  1.00 48.03  ? 257 LYS A HZ2    1 
ATOM   1448 H HZ3    . LYS A 1 107 ? -24.245 57.082 -3.805  1.00 48.03  ? 257 LYS A HZ3    1 
ATOM   1449 N N      . SER A 1 108 ? -21.811 51.047 0.038   1.00 22.38  ? 258 SER A N      1 
ATOM   1450 C CA     . SER A 1 108 ? -22.785 50.026 0.435   1.00 27.62  ? 258 SER A CA     1 
ATOM   1451 C C      . SER A 1 108 ? -22.413 49.253 1.699   1.00 29.04  ? 258 SER A C      1 
ATOM   1452 O O      . SER A 1 108 ? -23.249 48.477 2.193   1.00 23.07  ? 258 SER A O      1 
ATOM   1453 C CB     . SER A 1 108 ? -22.976 49.012 -0.701  1.00 28.37  ? 258 SER A CB     1 
ATOM   1454 O OG     . SER A 1 108 ? -23.680 49.567 -1.800  1.00 29.49  ? 258 SER A OG     1 
ATOM   1455 H H      . SER A 1 108 ? -21.297 50.801 -0.606  1.00 26.83  ? 258 SER A H      1 
ATOM   1456 H HA     . SER A 1 108 ? -23.640 50.457 0.593   1.00 33.11  ? 258 SER A HA     1 
ATOM   1457 H HB2    . SER A 1 108 ? -22.103 48.719 -1.006  1.00 34.01  ? 258 SER A HB2    1 
ATOM   1458 H HB3    . SER A 1 108 ? -23.476 48.254 -0.360  1.00 34.01  ? 258 SER A HB3    1 
ATOM   1459 H HG     . SER A 1 108 ? -23.258 50.224 -2.109  1.00 35.36  ? 258 SER A HG     1 
ATOM   1460 N N      . THR A 1 109 ? -21.180 49.386 2.195   1.00 25.49  ? 259 THR A N      1 
ATOM   1461 C CA     . THR A 1 109 ? -20.792 48.782 3.464   1.00 20.19  ? 259 THR A CA     1 
ATOM   1462 C C      . THR A 1 109 ? -21.436 49.560 4.613   1.00 19.43  ? 259 THR A C      1 
ATOM   1463 O O      . THR A 1 109 ? -21.369 50.790 4.632   1.00 20.88  ? 259 THR A O      1 
ATOM   1464 C CB     . THR A 1 109 ? -19.257 48.800 3.606   1.00 20.36  ? 259 THR A CB     1 
ATOM   1465 O OG1    . THR A 1 109 ? -18.627 48.056 2.559   1.00 16.23  ? 259 THR A OG1    1 
ATOM   1466 C CG2    . THR A 1 109 ? -18.809 48.223 4.934   1.00 22.92  ? 259 THR A CG2    1 
ATOM   1467 H H      . THR A 1 109 ? -20.548 49.826 1.810   1.00 30.56  ? 259 THR A H      1 
ATOM   1468 H HA     . THR A 1 109 ? -21.099 47.862 3.498   1.00 24.20  ? 259 THR A HA     1 
ATOM   1469 H HB     . THR A 1 109 ? -18.950 49.719 3.564   1.00 24.40  ? 259 THR A HB     1 
ATOM   1470 H HG1    . THR A 1 109 ? -18.884 47.256 2.581   1.00 19.45  ? 259 THR A HG1    1 
ATOM   1471 H HG21   . THR A 1 109 ? -17.841 48.246 4.997   1.00 27.48  ? 259 THR A HG21   1 
ATOM   1472 H HG22   . THR A 1 109 ? -19.185 48.740 5.664   1.00 27.48  ? 259 THR A HG22   1 
ATOM   1473 H HG23   . THR A 1 109 ? -19.107 47.303 5.013   1.00 27.48  ? 259 THR A HG23   1 
ATOM   1474 N N      . THR A 1 110 ? -22.031 48.853 5.602   1.00 22.54  ? 260 THR A N      1 
ATOM   1475 C CA     . THR A 1 110 ? -22.747 49.508 6.704   1.00 21.16  ? 260 THR A CA     1 
ATOM   1476 C C      . THR A 1 110 ? -22.158 49.267 8.081   1.00 21.99  ? 260 THR A C      1 
ATOM   1477 O O      . THR A 1 110 ? -22.420 50.070 8.981   1.00 16.95  ? 260 THR A O      1 
ATOM   1478 C CB     . THR A 1 110 ? -24.219 49.056 6.750   1.00 26.54  ? 260 THR A CB     1 
ATOM   1479 O OG1    . THR A 1 110 ? -24.273 47.639 6.951   1.00 23.27  ? 260 THR A OG1    1 
ATOM   1480 C CG2    . THR A 1 110 ? -24.911 49.419 5.459   1.00 26.32  ? 260 THR A CG2    1 
ATOM   1481 H H      . THR A 1 110 ? -22.029 47.994 5.650   1.00 27.02  ? 260 THR A H      1 
ATOM   1482 H HA     . THR A 1 110 ? -22.740 50.465 6.547   1.00 25.36  ? 260 THR A HA     1 
ATOM   1483 H HB     . THR A 1 110 ? -24.673 49.504 7.481   1.00 31.82  ? 260 THR A HB     1 
ATOM   1484 H HG1    . THR A 1 110 ? -25.073 47.383 6.978   1.00 27.90  ? 260 THR A HG1    1 
ATOM   1485 H HG21   . THR A 1 110 ? -25.838 49.135 5.489   1.00 31.56  ? 260 THR A HG21   1 
ATOM   1486 H HG22   . THR A 1 110 ? -24.880 50.380 5.326   1.00 31.56  ? 260 THR A HG22   1 
ATOM   1487 H HG23   . THR A 1 110 ? -24.471 48.983 4.713   1.00 31.56  ? 260 THR A HG23   1 
ATOM   1488 N N      . GLN A 1 111 ? -21.373 48.197 8.275   1.00 16.49  ? 261 GLN A N      1 
ATOM   1489 C CA     . GLN A 1 111 ? -20.822 47.878 9.589   1.00 23.08  ? 261 GLN A CA     1 
ATOM   1490 C C      . GLN A 1 111 ? -19.357 47.448 9.474   1.00 22.01  ? 261 GLN A C      1 
ATOM   1491 O O      . GLN A 1 111 ? -18.931 46.903 8.449   1.00 19.40  ? 261 GLN A O      1 
ATOM   1492 C CB     . GLN A 1 111 ? -21.622 46.764 10.277  1.00 24.08  ? 261 GLN A CB     1 
ATOM   1493 C CG     . GLN A 1 111 ? -23.102 47.103 10.536  1.00 24.94  ? 261 GLN A CG     1 
ATOM   1494 C CD     . GLN A 1 111 ? -23.855 45.998 11.304  1.00 28.05  ? 261 GLN A CD     1 
ATOM   1495 O OE1    . GLN A 1 111 ? -24.297 44.992 10.727  1.00 30.69  ? 261 GLN A OE1    1 
ATOM   1496 N NE2    . GLN A 1 111 ? -24.013 46.198 12.596  1.00 27.41  ? 261 GLN A NE2    1 
ATOM   1497 H H      . GLN A 1 111 ? -21.148 47.643 7.657   1.00 19.76  ? 261 GLN A H      1 
ATOM   1498 H HA     . GLN A 1 111 ? -20.861 48.668 10.150  1.00 27.67  ? 261 GLN A HA     1 
ATOM   1499 H HB2    . GLN A 1 111 ? -21.596 45.973 9.717   1.00 28.87  ? 261 GLN A HB2    1 
ATOM   1500 H HB3    . GLN A 1 111 ? -21.211 46.571 11.134  1.00 28.87  ? 261 GLN A HB3    1 
ATOM   1501 H HG2    . GLN A 1 111 ? -23.151 47.918 11.061  1.00 29.90  ? 261 GLN A HG2    1 
ATOM   1502 H HG3    . GLN A 1 111 ? -23.549 47.232 9.685   1.00 29.90  ? 261 GLN A HG3    1 
ATOM   1503 H HE21   . GLN A 1 111 ? -23.703 46.913 12.962  1.00 32.86  ? 261 GLN A HE21   1 
ATOM   1504 H HE22   . GLN A 1 111 ? -24.425 45.615 13.074  1.00 32.86  ? 261 GLN A HE22   1 
ATOM   1505 N N      . VAL A 1 112 ? -18.609 47.676 10.560  1.00 22.83  ? 262 VAL A N      1 
ATOM   1506 C CA     . VAL A 1 112 ? -17.204 47.284 10.685  1.00 24.05  ? 262 VAL A CA     1 
ATOM   1507 C C      . VAL A 1 112 ? -16.960 46.769 12.098  1.00 25.61  ? 262 VAL A C      1 
ATOM   1508 O O      . VAL A 1 112 ? -17.636 47.165 13.055  1.00 20.94  ? 262 VAL A O      1 
ATOM   1509 C CB     . VAL A 1 112 ? -16.249 48.459 10.371  1.00 21.33  ? 262 VAL A CB     1 
ATOM   1510 C CG1    . VAL A 1 112 ? -16.457 49.607 11.382  1.00 20.68  ? 262 VAL A CG1    1 
ATOM   1511 C CG2    . VAL A 1 112 ? -14.788 48.006 10.342  1.00 25.85  ? 262 VAL A CG2    1 
ATOM   1512 H H      . VAL A 1 112 ? -18.908 48.073 11.262  1.00 27.37  ? 262 VAL A H      1 
ATOM   1513 H HA     . VAL A 1 112 ? -17.016 46.565 10.062  1.00 28.83  ? 262 VAL A HA     1 
ATOM   1514 H HB     . VAL A 1 112 ? -16.465 48.804 9.491   1.00 25.56  ? 262 VAL A HB     1 
ATOM   1515 H HG11   . VAL A 1 112 ? -15.848 50.332 11.166  1.00 24.79  ? 262 VAL A HG11   1 
ATOM   1516 H HG12   . VAL A 1 112 ? -17.374 49.917 11.323  1.00 24.79  ? 262 VAL A HG12   1 
ATOM   1517 H HG13   . VAL A 1 112 ? -16.275 49.278 12.276  1.00 24.79  ? 262 VAL A HG13   1 
ATOM   1518 H HG21   . VAL A 1 112 ? -14.224 48.770 10.142  1.00 30.99  ? 262 VAL A HG21   1 
ATOM   1519 H HG22   . VAL A 1 112 ? -14.553 47.639 11.208  1.00 30.99  ? 262 VAL A HG22   1 
ATOM   1520 H HG23   . VAL A 1 112 ? -14.682 47.328 9.656   1.00 30.99  ? 262 VAL A HG23   1 
ATOM   1521 N N      . GLY A 1 113 ? -15.998 45.857 12.222  1.00 23.32  ? 263 GLY A N      1 
ATOM   1522 C CA     . GLY A 1 113 ? -15.500 45.426 13.523  1.00 24.72  ? 263 GLY A CA     1 
ATOM   1523 C C      . GLY A 1 113 ? -14.072 44.927 13.376  1.00 25.81  ? 263 GLY A C      1 
ATOM   1524 O O      . GLY A 1 113 ? -13.757 44.313 12.351  1.00 22.50  ? 263 GLY A O      1 
ATOM   1525 H H      . GLY A 1 113 ? -15.613 45.469 11.558  1.00 27.96  ? 263 GLY A H      1 
ATOM   1526 H HA2    . GLY A 1 113 ? -15.514 46.168 14.147  1.00 29.64  ? 263 GLY A HA2    1 
ATOM   1527 H HA3    . GLY A 1 113 ? -16.053 44.708 13.870  1.00 29.64  ? 263 GLY A HA3    1 
ATOM   1528 N N      . CYS A 1 114 ? -13.209 45.182 14.361  1.00 24.92  ? 264 CYS A N      1 
ATOM   1529 C CA     . CYS A 1 114 ? -11.769 44.972 14.217  1.00 26.86  ? 264 CYS A CA     1 
ATOM   1530 C C      . CYS A 1 114 ? -11.158 44.264 15.432  1.00 28.08  ? 264 CYS A C      1 
ATOM   1531 O O      . CYS A 1 114 ? -11.761 44.151 16.506  1.00 26.40  ? 264 CYS A O      1 
ATOM   1532 C CB     . CYS A 1 114 ? -11.054 46.319 13.985  1.00 23.56  ? 264 CYS A CB     1 
ATOM   1533 S SG     . CYS A 1 114 ? -11.777 47.405 12.683  1.00 26.18  ? 264 CYS A SG     1 
ATOM   1534 H H      . CYS A 1 114 ? -13.437 45.482 15.134  1.00 29.88  ? 264 CYS A H      1 
ATOM   1535 H HA     . CYS A 1 114 ? -11.611 44.415 13.439  1.00 32.20  ? 264 CYS A HA     1 
ATOM   1536 H HB2    . CYS A 1 114 ? -11.067 46.818 14.817  1.00 28.25  ? 264 CYS A HB2    1 
ATOM   1537 H HB3    . CYS A 1 114 ? -10.135 46.137 13.733  1.00 28.25  ? 264 CYS A HB3    1 
ATOM   1538 N N      . GLY A 1 115 ? -9.926  43.769 15.229  1.00 27.81  ? 265 GLY A N      1 
ATOM   1539 C CA     . GLY A 1 115 ? -9.146  43.165 16.292  1.00 27.95  ? 265 GLY A CA     1 
ATOM   1540 C C      . GLY A 1 115 ? -7.671  43.524 16.160  1.00 29.62  ? 265 GLY A C      1 
ATOM   1541 O O      . GLY A 1 115 ? -7.225  44.014 15.114  1.00 28.30  ? 265 GLY A O      1 
ATOM   1542 H H      . GLY A 1 115 ? -9.525  43.777 14.469  1.00 33.34  ? 265 GLY A H      1 
ATOM   1543 H HA2    . GLY A 1 115 ? -9.467  43.477 17.153  1.00 33.51  ? 265 GLY A HA2    1 
ATOM   1544 H HA3    . GLY A 1 115 ? -9.237  42.200 16.257  1.00 33.51  ? 265 GLY A HA3    1 
ATOM   1545 N N      . ILE A 1 116 ? -6.912  43.265 17.231  1.00 29.07  ? 266 ILE A N      1 
ATOM   1546 C CA     . ILE A 1 116 ? -5.500  43.670 17.296  1.00 28.05  ? 266 ILE A CA     1 
ATOM   1547 C C      . ILE A 1 116 ? -4.690  42.681 18.136  1.00 33.05  ? 266 ILE A C      1 
ATOM   1548 O O      . ILE A 1 116 ? -5.183  42.121 19.119  1.00 29.09  ? 266 ILE A O      1 
ATOM   1549 C CB     . ILE A 1 116 ? -5.364  45.099 17.878  1.00 29.64  ? 266 ILE A CB     1 
ATOM   1550 C CG1    . ILE A 1 116 ? -3.897  45.558 17.853  1.00 28.96  ? 266 ILE A CG1    1 
ATOM   1551 C CG2    . ILE A 1 116 ? -5.935  45.158 19.318  1.00 31.64  ? 266 ILE A CG2    1 
ATOM   1552 C CD1    . ILE A 1 116 ? -3.766  47.048 17.984  1.00 27.99  ? 266 ILE A CD1    1 
ATOM   1553 H H      . ILE A 1 116 ? -7.190  42.855 17.934  1.00 34.86  ? 266 ILE A H      1 
ATOM   1554 H HA     . ILE A 1 116 ? -5.131  43.675 16.400  1.00 33.63  ? 266 ILE A HA     1 
ATOM   1555 H HB     . ILE A 1 116 ? -5.881  45.703 17.321  1.00 35.55  ? 266 ILE A HB     1 
ATOM   1556 H HG12   . ILE A 1 116 ? -3.423  45.147 18.592  1.00 34.73  ? 266 ILE A HG12   1 
ATOM   1557 H HG13   . ILE A 1 116 ? -3.496  45.292 17.010  1.00 34.73  ? 266 ILE A HG13   1 
ATOM   1558 H HG21   . ILE A 1 116 ? -5.838  46.062 19.658  1.00 37.94  ? 266 ILE A HG21   1 
ATOM   1559 H HG22   . ILE A 1 116 ? -6.872  44.911 19.296  1.00 37.94  ? 266 ILE A HG22   1 
ATOM   1560 H HG23   . ILE A 1 116 ? -5.441  44.539 19.878  1.00 37.94  ? 266 ILE A HG23   1 
ATOM   1561 H HD11   . ILE A 1 116 ? -2.825  47.284 17.962  1.00 33.56  ? 266 ILE A HD11   1 
ATOM   1562 H HD12   . ILE A 1 116 ? -4.231  47.471 17.245  1.00 33.56  ? 266 ILE A HD12   1 
ATOM   1563 H HD13   . ILE A 1 116 ? -4.159  47.326 18.826  1.00 33.56  ? 266 ILE A HD13   1 
ATOM   1564 N N      . LYS A 1 117 ? -3.421  42.493 17.755  1.00 28.22  ? 267 LYS A N      1 
ATOM   1565 C CA     . LYS A 1 117 ? -2.468  41.698 18.529  1.00 34.69  ? 267 LYS A CA     1 
ATOM   1566 C C      . LYS A 1 117 ? -1.090  42.351 18.499  1.00 35.02  ? 267 LYS A C      1 
ATOM   1567 O O      . LYS A 1 117 ? -0.605  42.741 17.433  1.00 32.15  ? 267 LYS A O      1 
ATOM   1568 C CB     . LYS A 1 117 ? -2.366  40.270 17.992  1.00 35.89  ? 267 LYS A CB     1 
ATOM   1569 C CG     . LYS A 1 117 ? -1.355  39.393 18.760  1.00 40.66  ? 267 LYS A CG     1 
ATOM   1570 C CD     . LYS A 1 117 ? -1.408  37.950 18.262  1.00 47.26  ? 267 LYS A CD     1 
ATOM   1571 C CE     . LYS A 1 117 ? -0.408  37.025 18.962  1.00 53.96  ? 267 LYS A CE     1 
ATOM   1572 N NZ     . LYS A 1 117 ? -0.613  35.603 18.495  1.00 58.38  ? 267 LYS A NZ     1 
ATOM   1573 H H      . LYS A 1 117 ? -3.085  42.824 17.036  1.00 33.83  ? 267 LYS A H      1 
ATOM   1574 H HA     . LYS A 1 117 ? -2.764  41.655 19.452  1.00 41.60  ? 267 LYS A HA     1 
ATOM   1575 H HB2    . LYS A 1 117 ? -3.236  39.848 18.058  1.00 43.04  ? 267 LYS A HB2    1 
ATOM   1576 H HB3    . LYS A 1 117 ? -2.086  40.304 17.064  1.00 43.04  ? 267 LYS A HB3    1 
ATOM   1577 H HG2    . LYS A 1 117 ? -0.458  39.734 18.618  1.00 48.77  ? 267 LYS A HG2    1 
ATOM   1578 H HG3    . LYS A 1 117 ? -1.574  39.400 19.705  1.00 48.77  ? 267 LYS A HG3    1 
ATOM   1579 H HD2    . LYS A 1 117 ? -2.299  37.598 18.416  1.00 56.68  ? 267 LYS A HD2    1 
ATOM   1580 H HD3    . LYS A 1 117 ? -1.210  37.939 17.312  1.00 56.68  ? 267 LYS A HD3    1 
ATOM   1581 H HE2    . LYS A 1 117 ? 0.496   37.296 18.740  1.00 64.72  ? 267 LYS A HE2    1 
ATOM   1582 H HE3    . LYS A 1 117 ? -0.549  37.059 19.921  1.00 64.72  ? 267 LYS A HE3    1 
ATOM   1583 H HZ1    . LYS A 1 117 ? -0.033  35.064 18.901  1.00 70.03  ? 267 LYS A HZ1    1 
ATOM   1584 H HZ2    . LYS A 1 117 ? -1.440  35.336 18.688  1.00 70.03  ? 267 LYS A HZ2    1 
ATOM   1585 H HZ3    . LYS A 1 117 ? -0.490  35.551 17.616  1.00 70.03  ? 267 LYS A HZ3    1 
ATOM   1586 N N      . THR A 1 118 ? -0.456  42.446 19.663  1.00 39.82  ? 268 THR A N      1 
ATOM   1587 C CA     . THR A 1 118 ? 0.846   43.114 19.803  1.00 42.82  ? 268 THR A CA     1 
ATOM   1588 C C      . THR A 1 118 ? 1.953   42.083 19.610  1.00 43.57  ? 268 THR A C      1 
ATOM   1589 O O      . THR A 1 118 ? 2.232   41.284 20.502  1.00 45.68  ? 268 THR A O      1 
ATOM   1590 C CB     . THR A 1 118 ? 0.965   43.790 21.164  1.00 46.30  ? 268 THR A CB     1 
ATOM   1591 O OG1    . THR A 1 118 ? 0.697   42.839 22.196  1.00 58.77  ? 268 THR A OG1    1 
ATOM   1592 C CG2    . THR A 1 118 ? -0.016  44.918 21.295  1.00 40.24  ? 268 THR A CG2    1 
ATOM   1593 H H      . THR A 1 118 ? -0.760  42.128 20.402  1.00 47.75  ? 268 THR A H      1 
ATOM   1594 H HA     . THR A 1 118 ? 0.935   43.792 19.115  1.00 51.35  ? 268 THR A HA     1 
ATOM   1595 H HB     . THR A 1 118 ? 1.861   44.145 21.273  1.00 55.53  ? 268 THR A HB     1 
ATOM   1596 H HG1    . THR A 1 118 ? 1.247   42.206 22.154  1.00 70.50  ? 268 THR A HG1    1 
ATOM   1597 H HG21   . THR A 1 118 ? 0.074   45.335 22.166  1.00 48.26  ? 268 THR A HG21   1 
ATOM   1598 H HG22   . THR A 1 118 ? 0.150   45.582 20.608  1.00 48.26  ? 268 THR A HG22   1 
ATOM   1599 H HG23   . THR A 1 118 ? -0.921  44.583 21.198  1.00 48.26  ? 268 THR A HG23   1 
ATOM   1600 N N      . CYS A 1 119 ? 2.579   42.086 18.432  1.00 46.00  ? 269 CYS A N      1 
ATOM   1601 C CA     . CYS A 1 119 ? 3.701   41.191 18.175  1.00 48.71  ? 269 CYS A CA     1 
ATOM   1602 C C      . CYS A 1 119 ? 5.010   41.722 18.757  1.00 44.44  ? 269 CYS A C      1 
ATOM   1603 O O      . CYS A 1 119 ? 5.910   40.929 19.040  1.00 42.21  ? 269 CYS A O      1 
ATOM   1604 C CB     . CYS A 1 119 ? 3.883   40.967 16.666  1.00 42.38  ? 269 CYS A CB     1 
ATOM   1605 S SG     . CYS A 1 119 ? 2.648   39.929 15.832  1.00 46.09  ? 269 CYS A SG     1 
ATOM   1606 H H      . CYS A 1 119 ? 2.373   42.595 17.771  1.00 55.17  ? 269 CYS A H      1 
ATOM   1607 H HA     . CYS A 1 119 ? 3.518   40.332 18.586  1.00 58.42  ? 269 CYS A HA     1 
ATOM   1608 H HB2    . CYS A 1 119 ? 3.870   41.833 16.229  1.00 50.83  ? 269 CYS A HB2    1 
ATOM   1609 H HB3    . CYS A 1 119 ? 4.748   40.551 16.524  1.00 50.83  ? 269 CYS A HB3    1 
ATOM   1610 N N      . GLY A 1 120 ? 5.129   43.034 18.941  1.00 43.82  ? 270 GLY A N      1 
ATOM   1611 C CA     . GLY A 1 120 ? 6.394   43.659 19.292  1.00 44.93  ? 270 GLY A CA     1 
ATOM   1612 C C      . GLY A 1 120 ? 7.494   43.259 18.330  1.00 47.02  ? 270 GLY A C      1 
ATOM   1613 O O      . GLY A 1 120 ? 7.255   42.951 17.159  1.00 46.91  ? 270 GLY A O      1 
ATOM   1614 H H      . GLY A 1 120 ? 4.477   43.591 18.867  1.00 52.56  ? 270 GLY A H      1 
ATOM   1615 H HA2    . GLY A 1 120 ? 6.299   44.625 19.271  1.00 53.89  ? 270 GLY A HA2    1 
ATOM   1616 H HA3    . GLY A 1 120 ? 6.653   43.393 20.188  1.00 53.89  ? 270 GLY A HA3    1 
ATOM   1617 N N      . GLY A 1 121 ? 8.727   43.273 18.828  1.00 52.57  ? 271 GLY A N      1 
ATOM   1618 C CA     . GLY A 1 121 ? 9.852   42.803 18.025  1.00 48.49  ? 271 GLY A CA     1 
ATOM   1619 C C      . GLY A 1 121 ? 10.030  43.604 16.745  1.00 49.53  ? 271 GLY A C      1 
ATOM   1620 O O      . GLY A 1 121 ? 9.975   44.838 16.735  1.00 44.96  ? 271 GLY A O      1 
ATOM   1621 H H      . GLY A 1 121 ? 8.938   43.545 19.617  1.00 63.06  ? 271 GLY A H      1 
ATOM   1622 H HA2    . GLY A 1 121 ? 10.669  42.868 18.544  1.00 58.16  ? 271 GLY A HA2    1 
ATOM   1623 H HA3    . GLY A 1 121 ? 9.713   41.873 17.788  1.00 58.16  ? 271 GLY A HA3    1 
ATOM   1624 N N      . ALA A 1 122 ? 10.245  42.890 15.640  1.00 48.55  ? 272 ALA A N      1 
ATOM   1625 C CA     . ALA A 1 122 ? 10.484  43.543 14.360  1.00 54.13  ? 272 ALA A CA     1 
ATOM   1626 C C      . ALA A 1 122 ? 9.218   44.101 13.724  1.00 53.00  ? 272 ALA A C      1 
ATOM   1627 O O      . ALA A 1 122 ? 9.324   44.929 12.807  1.00 55.32  ? 272 ALA A O      1 
ATOM   1628 C CB     . ALA A 1 122 ? 11.132  42.558 13.379  1.00 54.45  ? 272 ALA A CB     1 
ATOM   1629 H H      . ALA A 1 122 ? 10.257  42.031 15.607  1.00 58.23  ? 272 ALA A H      1 
ATOM   1630 H HA     . ALA A 1 122 ? 11.101  44.281 14.494  1.00 64.93  ? 272 ALA A HA     1 
ATOM   1631 H HB1    . ALA A 1 122 ? 11.284  43.009 12.534  1.00 65.31  ? 272 ALA A HB1    1 
ATOM   1632 H HB2    . ALA A 1 122 ? 11.975  42.254 13.749  1.00 65.31  ? 272 ALA A HB2    1 
ATOM   1633 H HB3    . ALA A 1 122 ? 10.535  41.804 13.250  1.00 65.31  ? 272 ALA A HB3    1 
ATOM   1634 N N      . TRP A 1 123 ? 8.036   43.672 14.180  1.00 50.62  ? 273 TRP A N      1 
ATOM   1635 C CA     . TRP A 1 123 ? 6.790   43.865 13.436  1.00 46.63  ? 273 TRP A CA     1 
ATOM   1636 C C      . TRP A 1 123 ? 5.795   44.813 14.086  1.00 36.44  ? 273 TRP A C      1 
ATOM   1637 O O      . TRP A 1 123 ? 5.040   45.469 13.367  1.00 40.06  ? 273 TRP A O      1 
ATOM   1638 C CB     . TRP A 1 123 ? 6.101   42.522 13.222  1.00 43.93  ? 273 TRP A CB     1 
ATOM   1639 C CG     . TRP A 1 123 ? 7.038   41.448 12.739  1.00 49.32  ? 273 TRP A CG     1 
ATOM   1640 C CD1    . TRP A 1 123 ? 7.374   40.290 13.388  1.00 47.64  ? 273 TRP A CD1    1 
ATOM   1641 C CD2    . TRP A 1 123 ? 7.760   41.436 11.502  1.00 49.65  ? 273 TRP A CD2    1 
ATOM   1642 N NE1    . TRP A 1 123 ? 8.250   39.555 12.623  1.00 42.35  ? 273 TRP A NE1    1 
ATOM   1643 C CE2    . TRP A 1 123 ? 8.504   40.237 11.463  1.00 46.18  ? 273 TRP A CE2    1 
ATOM   1644 C CE3    . TRP A 1 123 ? 7.854   42.325 10.425  1.00 47.01  ? 273 TRP A CE3    1 
ATOM   1645 C CZ2    . TRP A 1 123 ? 9.326   39.906 10.394  1.00 44.48  ? 273 TRP A CZ2    1 
ATOM   1646 C CZ3    . TRP A 1 123 ? 8.667   41.996 9.369   1.00 48.60  ? 273 TRP A CZ3    1 
ATOM   1647 C CH2    . TRP A 1 123 ? 9.396   40.793 9.357   1.00 49.47  ? 273 TRP A CH2    1 
ATOM   1648 H H      . TRP A 1 123 ? 7.931   43.260 14.928  1.00 60.71  ? 273 TRP A H      1 
ATOM   1649 H HA     . TRP A 1 123 ? 7.007   44.225 12.562  1.00 55.93  ? 273 TRP A HA     1 
ATOM   1650 H HB2    . TRP A 1 123 ? 5.717   42.228 14.063  1.00 52.68  ? 273 TRP A HB2    1 
ATOM   1651 H HB3    . TRP A 1 123 ? 5.401   42.630 12.559  1.00 52.68  ? 273 TRP A HB3    1 
ATOM   1652 H HD1    . TRP A 1 123 ? 7.041   40.028 14.216  1.00 57.14  ? 273 TRP A HD1    1 
ATOM   1653 H HE1    . TRP A 1 123 ? 8.585   38.793 12.839  1.00 50.79  ? 273 TRP A HE1    1 
ATOM   1654 H HE3    . TRP A 1 123 ? 7.372   43.120 10.423  1.00 56.38  ? 273 TRP A HE3    1 
ATOM   1655 H HZ2    . TRP A 1 123 ? 9.814   39.114 10.386  1.00 53.34  ? 273 TRP A HZ2    1 
ATOM   1656 H HZ3    . TRP A 1 123 ? 8.732   42.576 8.645   1.00 58.29  ? 273 TRP A HZ3    1 
ATOM   1657 H HH2    . TRP A 1 123 ? 9.938   40.597 8.628   1.00 59.34  ? 273 TRP A HH2    1 
ATOM   1658 N N      . GLY A 1 124 ? 5.779   44.928 15.410  1.00 38.05  ? 274 GLY A N      1 
ATOM   1659 C CA     . GLY A 1 124 ? 4.796   45.787 16.032  1.00 38.88  ? 274 GLY A CA     1 
ATOM   1660 C C      . GLY A 1 124 ? 3.410   45.153 15.968  1.00 38.74  ? 274 GLY A C      1 
ATOM   1661 O O      . GLY A 1 124 ? 3.257   43.932 15.978  1.00 37.20  ? 274 GLY A O      1 
ATOM   1662 H H      . GLY A 1 124 ? 6.314   44.529 15.953  1.00 45.63  ? 274 GLY A H      1 
ATOM   1663 H HA2    . GLY A 1 124 ? 5.030   45.936 16.961  1.00 46.63  ? 274 GLY A HA2    1 
ATOM   1664 H HA3    . GLY A 1 124 ? 4.771   46.642 15.574  1.00 46.63  ? 274 GLY A HA3    1 
ATOM   1665 N N      . ASP A 1 125 ? 2.387   45.999 15.871  1.00 34.59  ? 275 ASP A N      1 
ATOM   1666 C CA     . ASP A 1 125 ? 1.000   45.549 16.008  1.00 35.61  ? 275 ASP A CA     1 
ATOM   1667 C C      . ASP A 1 125 ? 0.443   44.969 14.703  1.00 28.97  ? 275 ASP A C      1 
ATOM   1668 O O      . ASP A 1 125 ? 0.673   45.500 13.611  1.00 27.72  ? 275 ASP A O      1 
ATOM   1669 C CB     . ASP A 1 125 ? 0.096   46.712 16.447  1.00 37.38  ? 275 ASP A CB     1 
ATOM   1670 C CG     . ASP A 1 125 ? 0.413   47.253 17.864  1.00 43.25  ? 275 ASP A CG     1 
ATOM   1671 O OD1    . ASP A 1 125 ? 1.031   46.541 18.696  1.00 35.69  ? 275 ASP A OD1    1 
ATOM   1672 O OD2    . ASP A 1 125 ? 0.005   48.415 18.142  1.00 38.38  ? 275 ASP A OD2    1 
ATOM   1673 H H      . ASP A 1 125 ? 2.467   46.843 15.726  1.00 41.48  ? 275 ASP A H      1 
ATOM   1674 H HA     . ASP A 1 125 ? 0.957   44.859 16.688  1.00 42.70  ? 275 ASP A HA     1 
ATOM   1675 H HB2    . ASP A 1 125 ? 0.202   47.444 15.820  1.00 44.83  ? 275 ASP A HB2    1 
ATOM   1676 H HB3    . ASP A 1 125 ? -0.825  46.408 16.445  1.00 44.83  ? 275 ASP A HB3    1 
ATOM   1677 N N      . TYR A 1 126 ? -0.322  43.889 14.836  1.00 28.74  ? 276 TYR A N      1 
ATOM   1678 C CA     . TYR A 1 126 ? -1.152  43.331 13.771  1.00 31.22  ? 276 TYR A CA     1 
ATOM   1679 C C      . TYR A 1 126 ? -2.589  43.810 13.957  1.00 29.11  ? 276 TYR A C      1 
ATOM   1680 O O      . TYR A 1 126 ? -3.142  43.690 15.054  1.00 27.88  ? 276 TYR A O      1 
ATOM   1681 C CB     . TYR A 1 126 ? -1.097  41.802 13.821  1.00 32.13  ? 276 TYR A CB     1 
ATOM   1682 C CG     . TYR A 1 126 ? -1.965  41.028 12.835  1.00 31.50  ? 276 TYR A CG     1 
ATOM   1683 C CD1    . TYR A 1 126 ? -1.485  40.665 11.576  1.00 30.06  ? 276 TYR A CD1    1 
ATOM   1684 C CD2    . TYR A 1 126 ? -3.234  40.586 13.199  1.00 28.56  ? 276 TYR A CD2    1 
ATOM   1685 C CE1    . TYR A 1 126 ? -2.277  39.924 10.681  1.00 31.57  ? 276 TYR A CE1    1 
ATOM   1686 C CE2    . TYR A 1 126 ? -4.024  39.848 12.323  1.00 28.86  ? 276 TYR A CE2    1 
ATOM   1687 C CZ     . TYR A 1 126 ? -3.549  39.517 11.069  1.00 30.55  ? 276 TYR A CZ     1 
ATOM   1688 O OH     . TYR A 1 126 ? -4.361  38.777 10.219  1.00 32.35  ? 276 TYR A OH     1 
ATOM   1689 H H      . TYR A 1 126 ? -0.378  43.443 15.569  1.00 34.45  ? 276 TYR A H      1 
ATOM   1690 H HA     . TYR A 1 126 ? -0.829  43.631 12.906  1.00 37.44  ? 276 TYR A HA     1 
ATOM   1691 H HB2    . TYR A 1 126 ? -0.179  41.531 13.663  1.00 38.53  ? 276 TYR A HB2    1 
ATOM   1692 H HB3    . TYR A 1 126 ? -1.361  41.522 14.711  1.00 38.53  ? 276 TYR A HB3    1 
ATOM   1693 H HD1    . TYR A 1 126 ? -0.635  40.939 11.314  1.00 36.04  ? 276 TYR A HD1    1 
ATOM   1694 H HD2    . TYR A 1 126 ? -3.568  40.803 14.040  1.00 34.24  ? 276 TYR A HD2    1 
ATOM   1695 H HE1    . TYR A 1 126 ? -1.951  39.702 9.839   1.00 37.86  ? 276 TYR A HE1    1 
ATOM   1696 H HE2    . TYR A 1 126 ? -4.875  39.577 12.582  1.00 34.61  ? 276 TYR A HE2    1 
ATOM   1697 H HH     . TYR A 1 126 ? -3.965  38.638 9.492   1.00 38.79  ? 276 TYR A HH     1 
ATOM   1698 N N      . VAL A 1 127 ? -3.192  44.333 12.895  1.00 27.77  ? 277 VAL A N      1 
ATOM   1699 C CA     . VAL A 1 127 ? -4.563  44.849 12.937  1.00 26.97  ? 277 VAL A CA     1 
ATOM   1700 C C      . VAL A 1 127 ? -5.345  44.237 11.778  1.00 27.00  ? 277 VAL A C      1 
ATOM   1701 O O      . VAL A 1 127 ? -4.848  44.194 10.647  1.00 28.14  ? 277 VAL A O      1 
ATOM   1702 C CB     . VAL A 1 127 ? -4.605  46.393 12.870  1.00 26.22  ? 277 VAL A CB     1 
ATOM   1703 C CG1    . VAL A 1 127 ? -6.058  46.911 12.692  1.00 28.11  ? 277 VAL A CG1    1 
ATOM   1704 C CG2    . VAL A 1 127 ? -4.003  46.999 14.119  1.00 31.01  ? 277 VAL A CG2    1 
ATOM   1705 H H      . VAL A 1 127 ? -2.823  44.404 12.122  1.00 33.29  ? 277 VAL A H      1 
ATOM   1706 H HA     . VAL A 1 127 ? -4.983  44.571 13.766  1.00 32.33  ? 277 VAL A HA     1 
ATOM   1707 H HB     . VAL A 1 127 ? -4.083  46.692 12.109  1.00 31.44  ? 277 VAL A HB     1 
ATOM   1708 H HG11   . VAL A 1 127 ? -6.045  47.881 12.654  1.00 33.71  ? 277 VAL A HG11   1 
ATOM   1709 H HG12   . VAL A 1 127 ? -6.422  46.553 11.868  1.00 33.71  ? 277 VAL A HG12   1 
ATOM   1710 H HG13   . VAL A 1 127 ? -6.592  46.617 13.446  1.00 33.71  ? 277 VAL A HG13   1 
ATOM   1711 H HG21   . VAL A 1 127 ? -4.042  47.966 14.050  1.00 37.18  ? 277 VAL A HG21   1 
ATOM   1712 H HG22   . VAL A 1 127 ? -4.511  46.701 14.890  1.00 37.18  ? 277 VAL A HG22   1 
ATOM   1713 H HG23   . VAL A 1 127 ? -3.081  46.710 14.197  1.00 37.18  ? 277 VAL A HG23   1 
ATOM   1714 N N      . ILE A 1 128 ? -6.563  43.765 12.061  1.00 24.72  ? 278 ILE A N      1 
ATOM   1715 C CA     . ILE A 1 128 ? -7.508  43.318 11.038  1.00 24.28  ? 278 ILE A CA     1 
ATOM   1716 C C      . ILE A 1 128 ? -8.860  44.002 11.268  1.00 23.98  ? 278 ILE A C      1 
ATOM   1717 O O      . ILE A 1 128 ? -9.381  43.996 12.387  1.00 23.09  ? 278 ILE A O      1 
ATOM   1718 C CB     . ILE A 1 128 ? -7.689  41.790 11.037  1.00 23.24  ? 278 ILE A CB     1 
ATOM   1719 C CG1    . ILE A 1 128 ? -8.923  41.414 10.198  1.00 25.06  ? 278 ILE A CG1    1 
ATOM   1720 C CG2    . ILE A 1 128 ? -7.832  41.243 12.481  1.00 25.68  ? 278 ILE A CG2    1 
ATOM   1721 C CD1    . ILE A 1 128 ? -9.200  39.892 10.080  1.00 29.02  ? 278 ILE A CD1    1 
ATOM   1722 H H      . ILE A 1 128 ? -6.870  43.693 12.861  1.00 29.63  ? 278 ILE A H      1 
ATOM   1723 H HA     . ILE A 1 128 ? -7.180  43.583 10.165  1.00 29.11  ? 278 ILE A HA     1 
ATOM   1724 H HB     . ILE A 1 128 ? -6.905  41.387 10.631  1.00 27.85  ? 278 ILE A HB     1 
ATOM   1725 H HG12   . ILE A 1 128 ? -9.706  41.823 10.600  1.00 30.04  ? 278 ILE A HG12   1 
ATOM   1726 H HG13   . ILE A 1 128 ? -8.802  41.759 9.300   1.00 30.04  ? 278 ILE A HG13   1 
ATOM   1727 H HG21   . ILE A 1 128 ? -7.944  40.281 12.443  1.00 30.78  ? 278 ILE A HG21   1 
ATOM   1728 H HG22   . ILE A 1 128 ? -7.033  41.465 12.983  1.00 30.78  ? 278 ILE A HG22   1 
ATOM   1729 H HG23   . ILE A 1 128 ? -8.608  41.651 12.896  1.00 30.78  ? 278 ILE A HG23   1 
ATOM   1730 H HD11   . ILE A 1 128 ? -9.993  39.757 9.537   1.00 34.79  ? 278 ILE A HD11   1 
ATOM   1731 H HD12   . ILE A 1 128 ? -8.436  39.464 9.664   1.00 34.79  ? 278 ILE A HD12   1 
ATOM   1732 H HD13   . ILE A 1 128 ? -9.341  39.528 10.968  1.00 34.79  ? 278 ILE A HD13   1 
ATOM   1733 N N      . CYS A 1 129 ? -9.434  44.564 10.206  1.00 24.02  ? 279 CYS A N      1 
ATOM   1734 C CA     . CYS A 1 129 ? -10.798 45.085 10.232  1.00 25.11  ? 279 CYS A CA     1 
ATOM   1735 C C      . CYS A 1 129 ? -11.651 44.253 9.278   1.00 21.07  ? 279 CYS A C      1 
ATOM   1736 O O      . CYS A 1 129 ? -11.234 43.976 8.149   1.00 22.81  ? 279 CYS A O      1 
ATOM   1737 C CB     . CYS A 1 129 ? -10.828 46.578 9.864   1.00 23.83  ? 279 CYS A CB     1 
ATOM   1738 S SG     . CYS A 1 129 ? -10.302 47.714 11.205  1.00 24.80  ? 279 CYS A SG     1 
ATOM   1739 H H      . CYS A 1 129 ? -9.045  44.658 9.445   1.00 28.79  ? 279 CYS A H      1 
ATOM   1740 H HA     . CYS A 1 129 ? -11.160 44.986 11.126  1.00 30.10  ? 279 CYS A HA     1 
ATOM   1741 H HB2    . CYS A 1 129 ? -10.236 46.721 9.109   1.00 28.57  ? 279 CYS A HB2    1 
ATOM   1742 H HB3    . CYS A 1 129 ? -11.735 46.817 9.616   1.00 28.57  ? 279 CYS A HB3    1 
ATOM   1743 N N      . SER A 1 130 ? -12.843 43.861 9.733   1.00 22.29  ? 280 SER A N      1 
ATOM   1744 C CA     . SER A 1 130 ? -13.819 43.110 8.947   1.00 22.13  ? 280 SER A CA     1 
ATOM   1745 C C      . SER A 1 130 ? -15.043 43.981 8.639   1.00 21.86  ? 280 SER A C      1 
ATOM   1746 O O      . SER A 1 130 ? -15.479 44.745 9.499   1.00 22.71  ? 280 SER A O      1 
ATOM   1747 C CB     . SER A 1 130 ? -14.242 41.842 9.713   1.00 24.37  ? 280 SER A CB     1 
ATOM   1748 O OG     . SER A 1 130 ? -13.108 41.017 10.005  1.00 26.96  ? 280 SER A OG     1 
ATOM   1749 H H      . SER A 1 130 ? -13.118 44.028 10.531  1.00 26.72  ? 280 SER A H      1 
ATOM   1750 H HA     . SER A 1 130 ? -13.416 42.840 8.107   1.00 26.52  ? 280 SER A HA     1 
ATOM   1751 H HB2    . SER A 1 130 ? -14.665 42.104 10.546  1.00 29.22  ? 280 SER A HB2    1 
ATOM   1752 H HB3    . SER A 1 130 ? -14.867 41.338 9.168   1.00 29.22  ? 280 SER A HB3    1 
ATOM   1753 H HG     . SER A 1 130 ? -13.352 40.330 10.423  1.00 32.33  ? 280 SER A HG     1 
ATOM   1754 N N      . TYR A 1 131 ? -15.593 43.859 7.408   1.00 20.37  ? 281 TYR A N      1 
ATOM   1755 C CA     . TYR A 1 131 ? -16.624 44.757 6.862   1.00 22.77  ? 281 TYR A CA     1 
ATOM   1756 C C      . TYR A 1 131 ? -17.809 43.987 6.281   1.00 22.75  ? 281 TYR A C      1 
ATOM   1757 O O      . TYR A 1 131 ? -17.630 42.928 5.660   1.00 17.73  ? 281 TYR A O      1 
ATOM   1758 C CB     . TYR A 1 131 ? -16.061 45.661 5.737   1.00 23.46  ? 281 TYR A CB     1 
ATOM   1759 C CG     . TYR A 1 131 ? -14.833 46.488 6.139   1.00 20.85  ? 281 TYR A CG     1 
ATOM   1760 C CD1    . TYR A 1 131 ? -14.961 47.829 6.491   1.00 22.29  ? 281 TYR A CD1    1 
ATOM   1761 C CD2    . TYR A 1 131 ? -13.553 45.921 6.157   1.00 23.57  ? 281 TYR A CD2    1 
ATOM   1762 C CE1    . TYR A 1 131 ? -13.856 48.594 6.870   1.00 22.41  ? 281 TYR A CE1    1 
ATOM   1763 C CE2    . TYR A 1 131 ? -12.409 46.702 6.548   1.00 21.13  ? 281 TYR A CE2    1 
ATOM   1764 C CZ     . TYR A 1 131 ? -12.576 48.029 6.876   1.00 20.17  ? 281 TYR A CZ     1 
ATOM   1765 O OH     . TYR A 1 131 ? -11.476 48.797 7.265   1.00 25.94  ? 281 TYR A OH     1 
ATOM   1766 H H      . TYR A 1 131 ? -15.370 43.238 6.857   1.00 24.42  ? 281 TYR A H      1 
ATOM   1767 H HA     . TYR A 1 131 ? -16.955 45.329 7.571   1.00 27.29  ? 281 TYR A HA     1 
ATOM   1768 H HB2    . TYR A 1 131 ? -15.806 45.100 4.988   1.00 28.12  ? 281 TYR A HB2    1 
ATOM   1769 H HB3    . TYR A 1 131 ? -16.755 46.280 5.461   1.00 28.12  ? 281 TYR A HB3    1 
ATOM   1770 H HD1    . TYR A 1 131 ? -15.804 48.221 6.484   1.00 26.72  ? 281 TYR A HD1    1 
ATOM   1771 H HD2    . TYR A 1 131 ? -13.443 45.027 5.928   1.00 28.26  ? 281 TYR A HD2    1 
ATOM   1772 H HE1    . TYR A 1 131 ? -13.969 49.488 7.099   1.00 26.86  ? 281 TYR A HE1    1 
ATOM   1773 H HE2    . TYR A 1 131 ? -11.561 46.320 6.556   1.00 25.33  ? 281 TYR A HE2    1 
ATOM   1774 H HH     . TYR A 1 131 ? -11.725 49.573 7.468   1.00 31.10  ? 281 TYR A HH     1 
ATOM   1775 N N      . ASP A 1 132 ? -19.021 44.552 6.434   1.00 20.28  ? 282 ASP A N      1 
ATOM   1776 C CA     . ASP A 1 132 ? -20.254 43.925 5.881   1.00 19.10  ? 282 ASP A CA     1 
ATOM   1777 C C      . ASP A 1 132 ? -21.311 44.959 5.508   1.00 21.48  ? 282 ASP A C      1 
ATOM   1778 O O      . ASP A 1 132 ? -21.534 45.904 6.277   1.00 19.17  ? 282 ASP A O      1 
ATOM   1779 C CB     . ASP A 1 132 ? -20.881 42.920 6.831   1.00 21.18  ? 282 ASP A CB     1 
ATOM   1780 C CG     . ASP A 1 132 ? -21.995 42.139 6.161   1.00 28.17  ? 282 ASP A CG     1 
ATOM   1781 O OD1    . ASP A 1 132 ? -21.665 41.198 5.405   1.00 23.67  ? 282 ASP A OD1    1 
ATOM   1782 O OD2    . ASP A 1 132 ? -23.183 42.501 6.342   1.00 25.17  ? 282 ASP A OD2    1 
ATOM   1783 H H      . ASP A 1 132 ? -19.161 45.292 6.849   1.00 24.31  ? 282 ASP A H      1 
ATOM   1784 H HA     . ASP A 1 132 ? -20.016 43.448 5.071   1.00 22.89  ? 282 ASP A HA     1 
ATOM   1785 H HB2    . ASP A 1 132 ? -20.203 42.291 7.124   1.00 25.38  ? 282 ASP A HB2    1 
ATOM   1786 H HB3    . ASP A 1 132 ? -21.254 43.389 7.593   1.00 25.38  ? 282 ASP A HB3    1 
ATOM   1787 N N      . PRO A 1 133 ? -21.921 44.859 4.314   1.00 20.75  ? 283 PRO A N      1 
ATOM   1788 C CA     . PRO A 1 133 ? -21.487 44.041 3.167   1.00 20.73  ? 283 PRO A CA     1 
ATOM   1789 C C      . PRO A 1 133 ? -20.047 44.339 2.716   1.00 23.36  ? 283 PRO A C      1 
ATOM   1790 O O      . PRO A 1 133 ? -19.521 45.426 2.993   1.00 20.64  ? 283 PRO A O      1 
ATOM   1791 C CB     . PRO A 1 133 ? -22.493 44.417 2.079   1.00 24.98  ? 283 PRO A CB     1 
ATOM   1792 C CG     . PRO A 1 133 ? -23.754 44.852 2.876   1.00 26.61  ? 283 PRO A CG     1 
ATOM   1793 C CD     . PRO A 1 133 ? -23.172 45.598 4.034   1.00 23.17  ? 283 PRO A CD     1 
ATOM   1794 H HA     . PRO A 1 133 ? -21.572 43.097 3.372   1.00 24.85  ? 283 PRO A HA     1 
ATOM   1795 H HB2    . PRO A 1 133 ? -22.148 45.152 1.548   1.00 29.95  ? 283 PRO A HB2    1 
ATOM   1796 H HB3    . PRO A 1 133 ? -22.684 43.645 1.522   1.00 29.95  ? 283 PRO A HB3    1 
ATOM   1797 H HG2    . PRO A 1 133 ? -24.310 45.431 2.331   1.00 31.90  ? 283 PRO A HG2    1 
ATOM   1798 H HG3    . PRO A 1 133 ? -24.246 44.071 3.174   1.00 31.90  ? 283 PRO A HG3    1 
ATOM   1799 H HD2    . PRO A 1 133 ? -22.975 46.514 3.783   1.00 27.78  ? 283 PRO A HD2    1 
ATOM   1800 H HD3    . PRO A 1 133 ? -23.768 45.558 4.798   1.00 27.78  ? 283 PRO A HD3    1 
ATOM   1801 N N      . ALA A 1 134 ? -19.415 43.383 2.040   1.00 22.07  ? 284 ALA A N      1 
ATOM   1802 C CA     . ALA A 1 134 ? -18.041 43.577 1.575   1.00 27.28  ? 284 ALA A CA     1 
ATOM   1803 C C      . ALA A 1 134 ? -17.980 44.615 0.455   1.00 25.88  ? 284 ALA A C      1 
ATOM   1804 O O      . ALA A 1 134 ? -18.951 44.833 -0.267  1.00 23.07  ? 284 ALA A O      1 
ATOM   1805 C CB     . ALA A 1 134 ? -17.454 42.246 1.075   1.00 29.53  ? 284 ALA A CB     1 
ATOM   1806 H H      . ALA A 1 134 ? -19.754 42.619 1.839   1.00 26.46  ? 284 ALA A H      1 
ATOM   1807 H HA     . ALA A 1 134 ? -17.495 43.892 2.312   1.00 32.71  ? 284 ALA A HA     1 
ATOM   1808 H HB1    . ALA A 1 134 ? -16.545 42.397 0.771   1.00 35.40  ? 284 ALA A HB1    1 
ATOM   1809 H HB2    . ALA A 1 134 ? -17.459 41.606 1.803   1.00 35.40  ? 284 ALA A HB2    1 
ATOM   1810 H HB3    . ALA A 1 134 ? -17.998 41.918 0.342   1.00 35.40  ? 284 ALA A HB3    1 
ATOM   1811 N N      . GLY A 1 135 ? -16.825 45.285 0.331   1.00 26.31  ? 285 GLY A N      1 
ATOM   1812 C CA     . GLY A 1 135 ? -16.565 46.185 -0.773  1.00 23.53  ? 285 GLY A CA     1 
ATOM   1813 C C      . GLY A 1 135 ? -15.780 45.506 -1.886  1.00 26.43  ? 285 GLY A C      1 
ATOM   1814 O O      . GLY A 1 135 ? -15.580 44.293 -1.892  1.00 22.84  ? 285 GLY A O      1 
ATOM   1815 H H      . GLY A 1 135 ? -16.173 45.226 0.888   1.00 31.54  ? 285 GLY A H      1 
ATOM   1816 H HA2    . GLY A 1 135 ? -17.406 46.503 -1.138  1.00 28.21  ? 285 GLY A HA2    1 
ATOM   1817 H HA3    . GLY A 1 135 ? -16.057 46.948 -0.457  1.00 28.21  ? 285 GLY A HA3    1 
ATOM   1818 N N      . ASN A 1 136 ? -15.346 46.319 -2.854  1.00 25.97  ? 286 ASN A N      1 
ATOM   1819 C CA     . ASN A 1 136 ? -14.476 45.883 -3.961  1.00 25.90  ? 286 ASN A CA     1 
ATOM   1820 C C      . ASN A 1 136 ? -15.084 44.750 -4.807  1.00 31.45  ? 286 ASN A C      1 
ATOM   1821 O O      . ASN A 1 136 ? -14.423 43.753 -5.118  1.00 24.29  ? 286 ASN A O      1 
ATOM   1822 C CB     . ASN A 1 136 ? -13.090 45.483 -3.422  1.00 25.82  ? 286 ASN A CB     1 
ATOM   1823 C CG     . ASN A 1 136 ? -12.334 46.661 -2.770  1.00 24.37  ? 286 ASN A CG     1 
ATOM   1824 O OD1    . ASN A 1 136 ? -12.702 47.829 -2.922  1.00 23.28  ? 286 ASN A OD1    1 
ATOM   1825 N ND2    . ASN A 1 136 ? -11.256 46.346 -2.072  1.00 27.06  ? 286 ASN A ND2    1 
ATOM   1826 H H      . ASN A 1 136 ? -15.548 47.154 -2.894  1.00 31.13  ? 286 ASN A H      1 
ATOM   1827 H HA     . ASN A 1 136 ? -14.344 46.640 -4.554  1.00 31.05  ? 286 ASN A HA     1 
ATOM   1828 H HB2    . ASN A 1 136 ? -13.201 44.791 -2.752  1.00 30.96  ? 286 ASN A HB2    1 
ATOM   1829 H HB3    . ASN A 1 136 ? -12.551 45.150 -4.156  1.00 30.96  ? 286 ASN A HB3    1 
ATOM   1830 H HD21   . ASN A 1 136 ? -10.798 46.964 -1.688  1.00 32.44  ? 286 ASN A HD21   1 
ATOM   1831 H HD22   . ASN A 1 136 ? -11.014 45.524 -2.002  1.00 32.44  ? 286 ASN A HD22   1 
ATOM   1832 N N      . TYR A 1 137 ? -16.344 44.923 -5.223  1.00 31.44  ? 287 TYR A N      1 
ATOM   1833 C CA     . TYR A 1 137 ? -16.965 44.058 -6.233  1.00 32.40  ? 287 TYR A CA     1 
ATOM   1834 C C      . TYR A 1 137 ? -16.750 44.640 -7.633  1.00 33.12  ? 287 TYR A C      1 
ATOM   1835 O O      . TYR A 1 137 ? -16.966 45.838 -7.865  1.00 27.35  ? 287 TYR A O      1 
ATOM   1836 C CB     . TYR A 1 137 ? -18.467 43.873 -5.973  1.00 30.31  ? 287 TYR A CB     1 
ATOM   1837 C CG     . TYR A 1 137 ? -18.790 42.925 -4.833  1.00 33.97  ? 287 TYR A CG     1 
ATOM   1838 C CD1    . TYR A 1 137 ? -18.826 41.538 -5.025  1.00 34.65  ? 287 TYR A CD1    1 
ATOM   1839 C CD2    . TYR A 1 137 ? -19.083 43.411 -3.563  1.00 35.21  ? 287 TYR A CD2    1 
ATOM   1840 C CE1    . TYR A 1 137 ? -19.143 40.670 -3.968  1.00 31.83  ? 287 TYR A CE1    1 
ATOM   1841 C CE2    . TYR A 1 137 ? -19.381 42.547 -2.502  1.00 32.43  ? 287 TYR A CE2    1 
ATOM   1842 C CZ     . TYR A 1 137 ? -19.414 41.182 -2.718  1.00 36.73  ? 287 TYR A CZ     1 
ATOM   1843 O OH     . TYR A 1 137 ? -19.719 40.347 -1.665  1.00 45.16  ? 287 TYR A OH     1 
ATOM   1844 H H      . TYR A 1 137 ? -16.866 45.542 -4.932  1.00 37.70  ? 287 TYR A H      1 
ATOM   1845 H HA     . TYR A 1 137 ? -16.545 43.184 -6.203  1.00 38.85  ? 287 TYR A HA     1 
ATOM   1846 H HB2    . TYR A 1 137 ? -18.854 44.736 -5.757  1.00 36.34  ? 287 TYR A HB2    1 
ATOM   1847 H HB3    . TYR A 1 137 ? -18.881 43.520 -6.776  1.00 36.34  ? 287 TYR A HB3    1 
ATOM   1848 H HD1    . TYR A 1 137 ? -18.644 41.187 -5.867  1.00 41.55  ? 287 TYR A HD1    1 
ATOM   1849 H HD2    . TYR A 1 137 ? -19.062 44.329 -3.411  1.00 42.23  ? 287 TYR A HD2    1 
ATOM   1850 H HE1    . TYR A 1 137 ? -19.158 39.750 -4.109  1.00 38.17  ? 287 TYR A HE1    1 
ATOM   1851 H HE2    . TYR A 1 137 ? -19.572 42.891 -1.659  1.00 38.89  ? 287 TYR A HE2    1 
ATOM   1852 H HH     . TYR A 1 137 ? -19.706 39.546 -1.920  1.00 54.17  ? 287 TYR A HH     1 
ATOM   1853 N N      . GLU A 1 138 ? -16.330 43.779 -8.565  1.00 31.97  ? 288 GLU A N      1 
ATOM   1854 C CA     . GLU A 1 138 ? -16.058 44.193 -9.937  1.00 28.25  ? 288 GLU A CA     1 
ATOM   1855 C C      . GLU A 1 138 ? -17.310 44.773 -10.590 1.00 30.98  ? 288 GLU A C      1 
ATOM   1856 O O      . GLU A 1 138 ? -18.399 44.222 -10.467 1.00 30.80  ? 288 GLU A O      1 
ATOM   1857 C CB     . GLU A 1 138 ? -15.544 42.983 -10.742 1.00 37.53  ? 288 GLU A CB     1 
ATOM   1858 C CG     . GLU A 1 138 ? -15.263 43.241 -12.238 1.00 54.00  ? 288 GLU A CG     1 
ATOM   1859 C CD     . GLU A 1 138 ? -14.987 41.939 -13.048 1.00 75.66  ? 288 GLU A CD     1 
ATOM   1860 O OE1    . GLU A 1 138 ? -14.836 40.845 -12.443 1.00 62.89  ? 288 GLU A OE1    1 
ATOM   1861 O OE2    . GLU A 1 138 ? -14.923 42.012 -14.301 1.00 71.87  ? 288 GLU A OE2    1 
ATOM   1862 H H      . GLU A 1 138 ? -16.194 42.942 -8.421  1.00 38.33  ? 288 GLU A H      1 
ATOM   1863 H HA     . GLU A 1 138 ? -15.368 44.875 -9.937  1.00 33.87  ? 288 GLU A HA     1 
ATOM   1864 H HB2    . GLU A 1 138 ? -14.716 42.678 -10.340 1.00 45.00  ? 288 GLU A HB2    1 
ATOM   1865 H HB3    . GLU A 1 138 ? -16.208 42.278 -10.689 1.00 45.00  ? 288 GLU A HB3    1 
ATOM   1866 H HG2    . GLU A 1 138 ? -16.034 43.679 -12.632 1.00 64.77  ? 288 GLU A HG2    1 
ATOM   1867 H HG3    . GLU A 1 138 ? -14.483 43.812 -12.317 1.00 64.77  ? 288 GLU A HG3    1 
ATOM   1868 N N      . GLY A 1 139 ? -17.146 45.887 -11.297 1.00 29.45  ? 289 GLY A N      1 
ATOM   1869 C CA     . GLY A 1 139 ? -18.255 46.544 -11.954 1.00 30.62  ? 289 GLY A CA     1 
ATOM   1870 C C      . GLY A 1 139 ? -19.083 47.453 -11.077 1.00 36.17  ? 289 GLY A C      1 
ATOM   1871 O O      . GLY A 1 139 ? -20.030 48.072 -11.583 1.00 35.63  ? 289 GLY A O      1 
ATOM   1872 H H      . GLY A 1 139 ? -16.391 46.282 -11.409 1.00 35.31  ? 289 GLY A H      1 
ATOM   1873 H HA2    . GLY A 1 139 ? -17.913 47.074 -12.690 1.00 36.72  ? 289 GLY A HA2    1 
ATOM   1874 H HA3    . GLY A 1 139 ? -18.846 45.868 -12.321 1.00 36.72  ? 289 GLY A HA3    1 
ATOM   1875 N N      . GLU A 1 140 ? -18.760 47.563 -9.784  1.00 35.58  ? 290 GLU A N      1 
ATOM   1876 C CA     . GLU A 1 140 ? -19.536 48.355 -8.829  1.00 31.31  ? 290 GLU A CA     1 
ATOM   1877 C C      . GLU A 1 140 ? -18.786 49.569 -8.279  1.00 30.52  ? 290 GLU A C      1 
ATOM   1878 O O      . GLU A 1 140 ? -19.332 50.277 -7.421  1.00 26.70  ? 290 GLU A O      1 
ATOM   1879 C CB     . GLU A 1 140 ? -19.975 47.458 -7.664  1.00 32.26  ? 290 GLU A CB     1 
ATOM   1880 C CG     . GLU A 1 140 ? -20.894 46.282 -8.045  1.00 36.68  ? 290 GLU A CG     1 
ATOM   1881 C CD     . GLU A 1 140 ? -22.236 46.735 -8.642  1.00 51.56  ? 290 GLU A CD     1 
ATOM   1882 O OE1    . GLU A 1 140 ? -22.870 47.691 -8.116  1.00 48.62  ? 290 GLU A OE1    1 
ATOM   1883 O OE2    . GLU A 1 140 ? -22.658 46.136 -9.654  1.00 62.02  ? 290 GLU A OE2    1 
ATOM   1884 H H      . GLU A 1 140 ? -18.077 47.178 -9.430  1.00 42.67  ? 290 GLU A H      1 
ATOM   1885 H HA     . GLU A 1 140 ? -20.336 48.678 -9.272  1.00 37.54  ? 290 GLU A HA     1 
ATOM   1886 H HB2    . GLU A 1 140 ? -19.182 47.084 -7.248  1.00 38.69  ? 290 GLU A HB2    1 
ATOM   1887 H HB3    . GLU A 1 140 ? -20.453 48.003 -7.019  1.00 38.69  ? 290 GLU A HB3    1 
ATOM   1888 H HG2    . GLU A 1 140 ? -20.444 45.731 -8.704  1.00 43.99  ? 290 GLU A HG2    1 
ATOM   1889 H HG3    . GLU A 1 140 ? -21.082 45.759 -7.250  1.00 43.99  ? 290 GLU A HG3    1 
ATOM   1890 N N      . TYR A 1 141 ? -17.549 49.823 -8.725  1.00 27.76  ? 291 TYR A N      1 
ATOM   1891 C CA     . TYR A 1 141 ? -16.727 50.864 -8.100  1.00 24.28  ? 291 TYR A CA     1 
ATOM   1892 C C      . TYR A 1 141 ? -17.325 52.254 -8.286  1.00 26.88  ? 291 TYR A C      1 
ATOM   1893 O O      . TYR A 1 141 ? -17.375 53.050 -7.339  1.00 26.13  ? 291 TYR A O      1 
ATOM   1894 C CB     . TYR A 1 141 ? -15.295 50.831 -8.654  1.00 24.14  ? 291 TYR A CB     1 
ATOM   1895 C CG     . TYR A 1 141 ? -14.463 49.700 -8.091  1.00 24.67  ? 291 TYR A CG     1 
ATOM   1896 C CD1    . TYR A 1 141 ? -13.544 49.923 -7.069  1.00 27.89  ? 291 TYR A CD1    1 
ATOM   1897 C CD2    . TYR A 1 141 ? -14.626 48.397 -8.554  1.00 26.70  ? 291 TYR A CD2    1 
ATOM   1898 C CE1    . TYR A 1 141 ? -12.791 48.881 -6.532  1.00 25.53  ? 291 TYR A CE1    1 
ATOM   1899 C CE2    . TYR A 1 141 ? -13.886 47.339 -8.027  1.00 29.48  ? 291 TYR A CE2    1 
ATOM   1900 C CZ     . TYR A 1 141 ? -12.957 47.586 -7.029  1.00 28.45  ? 291 TYR A CZ     1 
ATOM   1901 O OH     . TYR A 1 141 ? -12.241 46.534 -6.512  1.00 27.31  ? 291 TYR A OH     1 
ATOM   1902 H H      . TYR A 1 141 ? -17.169 49.413 -9.378  1.00 33.29  ? 291 TYR A H      1 
ATOM   1903 H HA     . TYR A 1 141 ? -16.678 50.690 -7.147  1.00 29.11  ? 291 TYR A HA     1 
ATOM   1904 H HB2    . TYR A 1 141 ? -15.333 50.723 -9.617  1.00 28.94  ? 291 TYR A HB2    1 
ATOM   1905 H HB3    . TYR A 1 141 ? -14.853 51.665 -8.432  1.00 28.94  ? 291 TYR A HB3    1 
ATOM   1906 H HD1    . TYR A 1 141 ? -13.425 50.786 -6.743  1.00 33.43  ? 291 TYR A HD1    1 
ATOM   1907 H HD2    . TYR A 1 141 ? -15.243 48.229 -9.230  1.00 32.02  ? 291 TYR A HD2    1 
ATOM   1908 H HE1    . TYR A 1 141 ? -12.174 49.048 -5.857  1.00 30.60  ? 291 TYR A HE1    1 
ATOM   1909 H HE2    . TYR A 1 141 ? -14.002 46.477 -8.357  1.00 35.35  ? 291 TYR A HE2    1 
ATOM   1910 H HH     . TYR A 1 141 ? -11.735 46.805 -5.898  1.00 32.75  ? 291 TYR A HH     1 
ATOM   1911 N N      . ALA A 1 142 ? -17.730 52.589 -9.509  1.00 28.48  ? 292 ALA A N      1 
ATOM   1912 C CA     . ALA A 1 142 ? -18.245 53.929 -9.773  1.00 29.52  ? 292 ALA A CA     1 
ATOM   1913 C C      . ALA A 1 142 ? -19.468 54.246 -8.924  1.00 31.66  ? 292 ALA A C      1 
ATOM   1914 O O      . ALA A 1 142 ? -19.680 55.407 -8.559  1.00 29.48  ? 292 ALA A O      1 
ATOM   1915 C CB     . ALA A 1 142 ? -18.597 54.082 -11.250 1.00 33.22  ? 292 ALA A CB     1 
ATOM   1916 H H      . ALA A 1 142 ? -17.717 52.068 -10.192 1.00 34.14  ? 292 ALA A H      1 
ATOM   1917 H HA     . ALA A 1 142 ? -17.557 54.578 -9.560  1.00 35.39  ? 292 ALA A HA     1 
ATOM   1918 H HB1    . ALA A 1 142 ? -18.937 54.978 -11.402 1.00 39.83  ? 292 ALA A HB1    1 
ATOM   1919 H HB2    . ALA A 1 142 ? -17.799 53.937 -11.782 1.00 39.83  ? 292 ALA A HB2    1 
ATOM   1920 H HB3    . ALA A 1 142 ? -19.274 53.428 -11.483 1.00 39.83  ? 292 ALA A HB3    1 
ATOM   1921 N N      . ASP A 1 143 ? -20.289 53.238 -8.608  1.00 29.32  ? 293 ASP A N      1 
ATOM   1922 C CA     . ASP A 1 143 ? -21.455 53.453 -7.758  1.00 29.97  ? 293 ASP A CA     1 
ATOM   1923 C C      . ASP A 1 143 ? -21.136 53.457 -6.259  1.00 35.78  ? 293 ASP A C      1 
ATOM   1924 O O      . ASP A 1 143 ? -21.993 53.886 -5.479  1.00 28.13  ? 293 ASP A O      1 
ATOM   1925 C CB     . ASP A 1 143 ? -22.522 52.373 -8.022  1.00 35.22  ? 293 ASP A CB     1 
ATOM   1926 C CG     . ASP A 1 143 ? -23.199 52.507 -9.392  1.00 41.23  ? 293 ASP A CG     1 
ATOM   1927 O OD1    . ASP A 1 143 ? -23.306 53.629 -9.936  1.00 41.68  ? 293 ASP A OD1    1 
ATOM   1928 O OD2    . ASP A 1 143 ? -23.635 51.465 -9.918  1.00 44.75  ? 293 ASP A OD2    1 
ATOM   1929 H H      . ASP A 1 143 ? -20.190 52.426 -8.873  1.00 35.15  ? 293 ASP A H      1 
ATOM   1930 H HA     . ASP A 1 143 ? -21.845 54.314 -7.979  1.00 35.94  ? 293 ASP A HA     1 
ATOM   1931 H HB2    . ASP A 1 143 ? -22.101 51.500 -7.982  1.00 42.24  ? 293 ASP A HB2    1 
ATOM   1932 H HB3    . ASP A 1 143 ? -23.211 52.439 -7.342  1.00 42.24  ? 293 ASP A HB3    1 
ATOM   1933 N N      . ASN A 1 144 ? -19.944 52.989 -5.818  1.00 22.29  ? 294 ASN A N      1 
ATOM   1934 C CA     . ASN A 1 144 ? -19.653 52.903 -4.391  1.00 24.90  ? 294 ASN A CA     1 
ATOM   1935 C C      . ASN A 1 144 ? -18.445 53.698 -3.921  1.00 22.07  ? 294 ASN A C      1 
ATOM   1936 O O      . ASN A 1 144 ? -18.216 53.738 -2.712  1.00 22.90  ? 294 ASN A O      1 
ATOM   1937 C CB     . ASN A 1 144 ? -19.463 51.434 -3.967  1.00 23.48  ? 294 ASN A CB     1 
ATOM   1938 C CG     . ASN A 1 144 ? -20.786 50.667 -3.928  1.00 26.25  ? 294 ASN A CG     1 
ATOM   1939 O OD1    . ASN A 1 144 ? -21.468 50.647 -2.903  1.00 22.26  ? 294 ASN A OD1    1 
ATOM   1940 N ND2    . ASN A 1 144 ? -21.147 50.039 -5.049  1.00 25.07  ? 294 ASN A ND2    1 
ATOM   1941 H H      . ASN A 1 144 ? -19.304 52.723 -6.327  1.00 26.72  ? 294 ASN A H      1 
ATOM   1942 H HA     . ASN A 1 144 ? -20.422 53.243 -3.908  1.00 29.85  ? 294 ASN A HA     1 
ATOM   1943 H HB2    . ASN A 1 144 ? -18.877 50.993 -4.602  1.00 28.14  ? 294 ASN A HB2    1 
ATOM   1944 H HB3    . ASN A 1 144 ? -19.073 51.408 -3.079  1.00 28.14  ? 294 ASN A HB3    1 
ATOM   1945 H HD21   . ASN A 1 144 ? -21.883 49.595 -5.075  1.00 30.05  ? 294 ASN A HD21   1 
ATOM   1946 H HD22   . ASN A 1 144 ? -20.643 50.078 -5.745  1.00 30.05  ? 294 ASN A HD22   1 
ATOM   1947 N N      . VAL A 1 145 ? -17.668 54.316 -4.818  1.00 23.93  ? 295 VAL A N      1 
ATOM   1948 C CA     . VAL A 1 145 ? -16.479 55.088 -4.464  1.00 19.23  ? 295 VAL A CA     1 
ATOM   1949 C C      . VAL A 1 145 ? -16.692 56.482 -5.047  1.00 21.26  ? 295 VAL A C      1 
ATOM   1950 O O      . VAL A 1 145 ? -16.420 56.725 -6.224  1.00 24.66  ? 295 VAL A O      1 
ATOM   1951 C CB     . VAL A 1 145 ? -15.179 54.442 -4.976  1.00 19.74  ? 295 VAL A CB     1 
ATOM   1952 C CG1    . VAL A 1 145 ? -13.947 55.253 -4.531  1.00 22.52  ? 295 VAL A CG1    1 
ATOM   1953 C CG2    . VAL A 1 145 ? -15.061 53.001 -4.499  1.00 19.49  ? 295 VAL A CG2    1 
ATOM   1954 H H      . VAL A 1 145 ? -17.819 54.298 -5.665  1.00 28.69  ? 295 VAL A H      1 
ATOM   1955 H HA     . VAL A 1 145 ? -16.422 55.166 -3.498  1.00 23.04  ? 295 VAL A HA     1 
ATOM   1956 H HB     . VAL A 1 145 ? -15.195 54.434 -5.945  1.00 23.66  ? 295 VAL A HB     1 
ATOM   1957 H HG11   . VAL A 1 145 ? -13.147 54.821 -4.868  1.00 27.00  ? 295 VAL A HG11   1 
ATOM   1958 H HG12   . VAL A 1 145 ? -14.015 56.152 -4.890  1.00 27.00  ? 295 VAL A HG12   1 
ATOM   1959 H HG13   . VAL A 1 145 ? -13.923 55.284 -3.562  1.00 27.00  ? 295 VAL A HG13   1 
ATOM   1960 H HG21   . VAL A 1 145 ? -14.234 52.624 -4.837  1.00 23.36  ? 295 VAL A HG21   1 
ATOM   1961 H HG22   . VAL A 1 145 ? -15.058 52.989 -3.529  1.00 23.36  ? 295 VAL A HG22   1 
ATOM   1962 H HG23   . VAL A 1 145 ? -15.817 52.495 -4.834  1.00 23.36  ? 295 VAL A HG23   1 
ATOM   1963 N N      . GLU A 1 146 ? -17.174 57.402 -4.228  1.00 24.06  ? 296 GLU A N      1 
ATOM   1964 C CA     . GLU A 1 146 ? -17.614 58.740 -4.606  1.00 23.35  ? 296 GLU A CA     1 
ATOM   1965 C C      . GLU A 1 146 ? -16.488 59.760 -4.463  1.00 25.89  ? 296 GLU A C      1 
ATOM   1966 O O      . GLU A 1 146 ? -15.580 59.578 -3.647  1.00 23.89  ? 296 GLU A O      1 
ATOM   1967 C CB     . GLU A 1 146 ? -18.788 59.169 -3.732  1.00 23.46  ? 296 GLU A CB     1 
ATOM   1968 C CG     . GLU A 1 146 ? -20.061 58.359 -3.972  1.00 31.08  ? 296 GLU A CG     1 
ATOM   1969 C CD     . GLU A 1 146 ? -20.902 58.909 -5.145  1.00 43.06  ? 296 GLU A CD     1 
ATOM   1970 O OE1    . GLU A 1 146 ? -20.625 60.032 -5.645  1.00 39.09  ? 296 GLU A OE1    1 
ATOM   1971 O OE2    . GLU A 1 146 ? -21.842 58.214 -5.563  1.00 40.88  ? 296 GLU A OE2    1 
ATOM   1972 H H      . GLU A 1 146 ? -17.262 57.262 -3.384  1.00 28.84  ? 296 GLU A H      1 
ATOM   1973 H HA     . GLU A 1 146 ? -17.907 58.734 -5.531  1.00 27.99  ? 296 GLU A HA     1 
ATOM   1974 H HB2    . GLU A 1 146 ? -18.539 59.062 -2.800  1.00 28.12  ? 296 GLU A HB2    1 
ATOM   1975 H HB3    . GLU A 1 146 ? -18.989 60.100 -3.914  1.00 28.12  ? 296 GLU A HB3    1 
ATOM   1976 H HG2    . GLU A 1 146 ? -19.819 57.443 -4.179  1.00 37.27  ? 296 GLU A HG2    1 
ATOM   1977 H HG3    . GLU A 1 146 ? -20.609 58.386 -3.171  1.00 37.27  ? 296 GLU A HG3    1 
ATOM   1978 N N      . PRO A 1 147 ? -16.529 60.849 -5.235  1.00 26.40  ? 297 PRO A N      1 
ATOM   1979 C CA     . PRO A 1 147 ? -15.502 61.893 -5.103  1.00 28.67  ? 297 PRO A CA     1 
ATOM   1980 C C      . PRO A 1 147 ? -15.668 62.724 -3.831  1.00 28.65  ? 297 PRO A C      1 
ATOM   1981 O O      . PRO A 1 147 ? -16.653 62.639 -3.098  1.00 26.90  ? 297 PRO A O      1 
ATOM   1982 C CB     . PRO A 1 147 ? -15.709 62.747 -6.360  1.00 34.45  ? 297 PRO A CB     1 
ATOM   1983 C CG     . PRO A 1 147 ? -17.138 62.587 -6.704  1.00 29.93  ? 297 PRO A CG     1 
ATOM   1984 C CD     . PRO A 1 147 ? -17.470 61.151 -6.335  1.00 27.77  ? 297 PRO A CD     1 
ATOM   1985 H HA     . PRO A 1 147 ? -14.616 61.500 -5.121  1.00 34.37  ? 297 PRO A HA     1 
ATOM   1986 H HB2    . PRO A 1 147 ? -15.505 63.675 -6.163  1.00 41.32  ? 297 PRO A HB2    1 
ATOM   1987 H HB3    . PRO A 1 147 ? -15.144 62.416 -7.077  1.00 41.32  ? 297 PRO A HB3    1 
ATOM   1988 H HG2    . PRO A 1 147 ? -17.671 63.207 -6.183  1.00 35.88  ? 297 PRO A HG2    1 
ATOM   1989 H HG3    . PRO A 1 147 ? -17.265 62.736 -7.654  1.00 35.88  ? 297 PRO A HG3    1 
ATOM   1990 H HD2    . PRO A 1 147 ? -18.386 61.085 -6.024  1.00 33.30  ? 297 PRO A HD2    1 
ATOM   1991 H HD3    . PRO A 1 147 ? -17.307 60.562 -7.089  1.00 33.30  ? 297 PRO A HD3    1 
ATOM   1992 N N      . LEU A 1 148 ? -14.652 63.550 -3.581  1.00 23.98  ? 298 LEU A N      1 
ATOM   1993 C CA     . LEU A 1 148 ? -14.614 64.422 -2.414  1.00 24.32  ? 298 LEU A CA     1 
ATOM   1994 C C      . LEU A 1 148 ? -15.709 65.476 -2.471  1.00 26.93  ? 298 LEU A C      1 
ATOM   1995 O O      . LEU A 1 148 ? -15.978 66.057 -3.523  1.00 28.90  ? 298 LEU A O      1 
ATOM   1996 C CB     . LEU A 1 148 ? -13.246 65.123 -2.312  1.00 21.71  ? 298 LEU A CB     1 
ATOM   1997 C CG     . LEU A 1 148 ? -12.052 64.200 -2.006  1.00 26.01  ? 298 LEU A CG     1 
ATOM   1998 C CD1    . LEU A 1 148 ? -10.703 64.948 -2.139  1.00 28.92  ? 298 LEU A CD1    1 
ATOM   1999 C CD2    . LEU A 1 148 ? -12.185 63.618 -0.615  1.00 24.17  ? 298 LEU A CD2    1 
ATOM   2000 H H      . LEU A 1 148 ? -13.960 63.623 -4.085  1.00 28.75  ? 298 LEU A H      1 
ATOM   2001 H HA     . LEU A 1 148 ? -14.744 63.891 -1.613  1.00 29.16  ? 298 LEU A HA     1 
ATOM   2002 H HB2    . LEU A 1 148 ? -13.063 65.565 -3.156  1.00 26.02  ? 298 LEU A HB2    1 
ATOM   2003 H HB3    . LEU A 1 148 ? -13.291 65.784 -1.603  1.00 26.02  ? 298 LEU A HB3    1 
ATOM   2004 H HG     . LEU A 1 148 ? -12.051 63.465 -2.639  1.00 31.18  ? 298 LEU A HG     1 
ATOM   2005 H HD11   . LEU A 1 148 ? -9.980  64.333 -1.939  1.00 34.67  ? 298 LEU A HD11   1 
ATOM   2006 H HD12   . LEU A 1 148 ? -10.615 65.279 -3.047  1.00 34.67  ? 298 LEU A HD12   1 
ATOM   2007 H HD13   . LEU A 1 148 ? -10.691 65.689 -1.513  1.00 34.67  ? 298 LEU A HD13   1 
ATOM   2008 H HD21   . LEU A 1 148 ? -11.426 63.040 -0.441  1.00 28.97  ? 298 LEU A HD21   1 
ATOM   2009 H HD22   . LEU A 1 148 ? -12.205 64.342 0.029   1.00 28.97  ? 298 LEU A HD22   1 
ATOM   2010 H HD23   . LEU A 1 148 ? -13.008 63.107 -0.564  1.00 28.97  ? 298 LEU A HD23   1 
ATOM   2011 N N      . ALA A 1 149 ? -16.296 65.757 -1.311  1.00 23.65  ? 299 ALA A N      1 
ATOM   2012 C CA     . ALA A 1 149 ? -17.282 66.826 -1.156  1.00 27.14  ? 299 ALA A CA     1 
ATOM   2013 C C      . ALA A 1 149 ? -16.562 68.164 -1.008  1.00 31.34  ? 299 ALA A C      1 
ATOM   2014 O O      . ALA A 1 149 ? -15.348 68.196 -0.791  1.00 23.79  ? 299 ALA A O      1 
ATOM   2015 C CB     . ALA A 1 149 ? -18.159 66.557 0.046   1.00 24.33  ? 299 ALA A CB     1 
ATOM   2016 O OXT    . ALA A 1 149 ? -17.177 69.218 -1.094  1.00 29.71  ? 299 ALA A OXT    1 
ATOM   2017 H H      . ALA A 1 149 ? -16.137 65.331 -0.581  1.00 28.35  ? 299 ALA A H      1 
ATOM   2018 H HA     . ALA A 1 149 ? -17.845 66.865 -1.945  1.00 32.53  ? 299 ALA A HA     1 
ATOM   2019 H HB1    . ALA A 1 149 ? -18.805 67.276 0.133   1.00 29.17  ? 299 ALA A HB1    1 
ATOM   2020 H HB2    . ALA A 1 149 ? -18.618 65.713 -0.081  1.00 29.17  ? 299 ALA A HB2    1 
ATOM   2021 H HB3    . ALA A 1 149 ? -17.602 66.515 0.839   1.00 29.17  ? 299 ALA A HB3    1 
HETATM 2022 C C1     . DIO B 2 .   ? -7.914  52.356 -9.892  1.00 31.95  ? 301 DIO A C1     1 
HETATM 2023 C C2     . DIO B 2 .   ? -6.218  53.942 -10.264 1.00 34.85  ? 301 DIO A C2     1 
HETATM 2024 C "C1'"  . DIO B 2 .   ? -7.268  51.544 -11.011 1.00 30.57  ? 301 DIO A "C1'"  1 
HETATM 2025 C "C2'"  . DIO B 2 .   ? -5.345  52.694 -10.318 1.00 29.57  ? 301 DIO A "C2'"  1 
HETATM 2026 O O1     . DIO B 2 .   ? -7.533  53.707 -9.860  1.00 37.23  ? 301 DIO A O1     1 
HETATM 2027 O "O1'"  . DIO B 2 .   ? -5.876  51.651 -11.087 1.00 35.36  ? 301 DIO A "O1'"  1 
HETATM 2028 H H11    . DIO B 2 .   ? -8.877  52.313 -9.999  1.00 38.32  ? 301 DIO A H11    1 
HETATM 2029 H H12    . DIO B 2 .   ? -7.675  51.952 -9.043  1.00 38.32  ? 301 DIO A H12    1 
HETATM 2030 H H21    . DIO B 2 .   ? -5.816  54.571 -9.645  1.00 41.80  ? 301 DIO A H21    1 
HETATM 2031 H H22    . DIO B 2 .   ? -6.237  54.342 -11.148 1.00 41.80  ? 301 DIO A H22    1 
HETATM 2032 H "H1'1" . DIO B 2 .   ? -7.490  50.611 -10.862 1.00 36.65  ? 301 DIO A "H1'1" 1 
HETATM 2033 H "H1'2" . DIO B 2 .   ? -7.647  51.828 -11.857 1.00 36.65  ? 301 DIO A "H1'2" 1 
HETATM 2034 H "H2'1" . DIO B 2 .   ? -5.197  52.371 -9.416  1.00 35.45  ? 301 DIO A "H2'1" 1 
HETATM 2035 H "H2'2" . DIO B 2 .   ? -4.488  52.943 -10.699 1.00 35.45  ? 301 DIO A "H2'2" 1 
HETATM 2036 C C1     . DIO C 2 .   ? -23.055 41.611 10.725  0.52 27.36  ? 302 DIO A C1     1 
HETATM 2037 C C2     . DIO C 2 .   ? -24.726 40.680 9.344   0.52 27.52  ? 302 DIO A C2     1 
HETATM 2038 C "C1'"  . DIO C 2 .   ? -22.108 40.498 10.289  0.52 27.36  ? 302 DIO A "C1'"  1 
HETATM 2039 C "C2'"  . DIO C 2 .   ? -23.794 39.508 9.039   0.52 27.84  ? 302 DIO A "C2'"  1 
HETATM 2040 O O1     . DIO C 2 .   ? -24.059 41.848 9.765   0.52 28.26  ? 302 DIO A O1     1 
HETATM 2041 O "O1'"  . DIO C 2 .   ? -22.809 39.317 10.018  0.52 28.54  ? 302 DIO A "O1'"  1 
HETATM 2042 H H11    . DIO C 2 .   ? -23.474 41.359 11.563  0.52 32.81  ? 302 DIO A H11    1 
HETATM 2043 H H12    . DIO C 2 .   ? -22.545 42.426 10.854  0.52 32.81  ? 302 DIO A H12    1 
HETATM 2044 H H21    . DIO C 2 .   ? -25.231 40.888 8.542   0.52 32.99  ? 302 DIO A H21    1 
HETATM 2045 H H22    . DIO C 2 .   ? -25.342 40.409 10.042  0.52 32.99  ? 302 DIO A H22    1 
HETATM 2046 H "H1'1" . DIO C 2 .   ? -21.456 40.331 10.987  0.52 32.81  ? 302 DIO A "H1'1" 1 
HETATM 2047 H "H1'2" . DIO C 2 .   ? -21.647 40.779 9.483   0.52 32.81  ? 302 DIO A "H1'2" 1 
HETATM 2048 H "H2'1" . DIO C 2 .   ? -24.325 38.699 8.971   0.52 33.38  ? 302 DIO A "H2'1" 1 
HETATM 2049 H "H2'2" . DIO C 2 .   ? -23.358 39.672 8.188   0.52 33.38  ? 302 DIO A "H2'2" 1 
HETATM 2050 C C1     . DIO D 2 .   ? -28.294 47.588 8.822   0.40 40.42  ? 303 DIO A C1     1 
HETATM 2051 C C2     . DIO D 2 .   ? -26.510 48.612 9.778   0.40 37.49  ? 303 DIO A C2     1 
HETATM 2052 C "C1'"  . DIO D 2 .   ? -28.787 47.060 10.155  0.40 37.65  ? 303 DIO A "C1'"  1 
HETATM 2053 C "C2'"  . DIO D 2 .   ? -26.873 48.063 11.145  0.40 40.48  ? 303 DIO A "C2'"  1 
HETATM 2054 O O1     . DIO D 2 .   ? -27.648 48.809 8.998   0.40 43.36  ? 303 DIO A O1     1 
HETATM 2055 O "O1'"  . DIO D 2 .   ? -28.228 47.716 11.262  0.40 42.99  ? 303 DIO A "O1'"  1 
HETATM 2056 H H11    . DIO D 2 .   ? -29.050 47.709 8.226   0.40 48.47  ? 303 DIO A H11    1 
HETATM 2057 H H12    . DIO D 2 .   ? -27.673 46.950 8.435   0.40 48.47  ? 303 DIO A H12    1 
HETATM 2058 H H21    . DIO D 2 .   ? -25.924 47.983 9.329   0.40 44.96  ? 303 DIO A H21    1 
HETATM 2059 H H22    . DIO D 2 .   ? -26.051 49.459 9.888   0.40 44.96  ? 303 DIO A H22    1 
HETATM 2060 H "H1'1" . DIO D 2 .   ? -29.749 47.180 10.184  0.40 45.15  ? 303 DIO A "H1'1" 1 
HETATM 2061 H "H1'2" . DIO D 2 .   ? -28.581 46.114 10.213  0.40 45.15  ? 303 DIO A "H1'2" 1 
HETATM 2062 H "H2'1" . DIO D 2 .   ? -26.663 48.730 11.818  0.40 48.55  ? 303 DIO A "H2'1" 1 
HETATM 2063 H "H2'2" . DIO D 2 .   ? -26.337 47.271 11.311  0.40 48.55  ? 303 DIO A "H2'2" 1 
HETATM 2064 C C1     . DIO E 2 .   ? -17.642 38.242 -0.815  0.87 52.76  ? 304 DIO A C1     1 
HETATM 2065 C C2     . DIO E 2 .   ? -16.894 37.239 1.120   0.87 44.93  ? 304 DIO A C2     1 
HETATM 2066 C "C1'"  . DIO E 2 .   ? -16.340 39.027 -0.961  0.87 43.24  ? 304 DIO A "C1'"  1 
HETATM 2067 C "C2'"  . DIO E 2 .   ? -15.608 38.060 1.046   0.87 43.73  ? 304 DIO A "C2'"  1 
HETATM 2068 O O1     . DIO E 2 .   ? -17.461 37.034 -0.137  0.87 53.75  ? 304 DIO A O1     1 
HETATM 2069 O "O1'"  . DIO E 2 .   ? -15.742 39.240 0.290   0.87 52.06  ? 304 DIO A "O1'"  1 
HETATM 2070 H H11    . DIO E 2 .   ? -17.994 38.054 -1.699  0.87 63.28  ? 304 DIO A H11    1 
HETATM 2071 H H12    . DIO E 2 .   ? -18.280 38.783 -0.326  0.87 63.28  ? 304 DIO A H12    1 
HETATM 2072 H H21    . DIO E 2 .   ? -16.693 36.377 1.518   0.87 53.89  ? 304 DIO A H21    1 
HETATM 2073 H H22    . DIO E 2 .   ? -17.533 37.708 1.680   0.87 53.89  ? 304 DIO A H22    1 
HETATM 2074 H "H1'1" . DIO E 2 .   ? -15.728 38.527 -1.524  0.87 51.86  ? 304 DIO A "H1'1" 1 
HETATM 2075 H "H1'2" . DIO E 2 .   ? -16.530 39.885 -1.372  0.87 51.86  ? 304 DIO A "H1'2" 1 
HETATM 2076 H "H2'1" . DIO E 2 .   ? -15.340 38.299 1.947   0.87 52.45  ? 304 DIO A "H2'1" 1 
HETATM 2077 H "H2'2" . DIO E 2 .   ? -14.915 37.513 0.644   0.87 52.45  ? 304 DIO A "H2'2" 1 
HETATM 2078 O O      . HOH F 3 .   ? -5.562  55.603 -14.497 1.00 42.04  ? 401 HOH A O      1 
HETATM 2079 O O      . HOH F 3 .   ? 3.162   45.440 19.136  1.00 48.30  ? 402 HOH A O      1 
HETATM 2080 O O      . HOH F 3 .   ? -22.109 57.160 -7.778  1.00 48.90  ? 403 HOH A O      1 
HETATM 2081 O O      . HOH F 3 .   ? -1.116  51.307 1.121   1.00 21.84  ? 404 HOH A O      1 
HETATM 2082 O O      . HOH F 3 .   ? -23.633 48.040 14.425  1.00 45.43  ? 405 HOH A O      1 
HETATM 2083 O O      . HOH F 3 .   ? -10.000 43.572 20.774  1.00 39.91  ? 406 HOH A O      1 
HETATM 2084 O O      . HOH F 3 .   ? 10.418  40.341 15.843  1.00 52.05  ? 407 HOH A O      1 
HETATM 2085 O O      . HOH F 3 .   ? -25.787 48.086 1.946   1.00 23.04  ? 408 HOH A O      1 
HETATM 2086 O O      . HOH F 3 .   ? -16.308 56.460 17.983  1.00 21.02  ? 409 HOH A O      1 
HETATM 2087 O O      . HOH F 3 .   ? -15.251 57.422 -10.492 1.00 30.43  ? 410 HOH A O      1 
HETATM 2088 O O      . HOH F 3 .   ? -9.017  33.276 20.623  1.00 48.04  ? 411 HOH A O      1 
HETATM 2089 O O      . HOH F 3 .   ? -9.201  49.935 -5.717  1.00 19.75  ? 412 HOH A O      1 
HETATM 2090 O O      . HOH F 3 .   ? -0.930  47.432 12.123  1.00 26.02  ? 413 HOH A O      1 
HETATM 2091 O O      . HOH F 3 .   ? -11.772 56.297 22.353  1.00 29.10  ? 414 HOH A O      1 
HETATM 2092 O O      . HOH F 3 .   ? -25.367 41.796 4.979   1.00 23.44  ? 415 HOH A O      1 
HETATM 2093 O O      . HOH F 3 .   ? -2.916  37.595 8.275   1.00 29.93  ? 416 HOH A O      1 
HETATM 2094 O O      . HOH F 3 .   ? -10.898 36.532 20.535  1.00 38.18  ? 417 HOH A O      1 
HETATM 2095 O O      . HOH F 3 .   ? -14.887 55.564 -8.334  1.00 21.30  ? 418 HOH A O      1 
HETATM 2096 O O      . HOH F 3 .   ? -23.387 47.772 -5.448  1.00 42.18  ? 419 HOH A O      1 
HETATM 2097 O O      . HOH F 3 .   ? -16.124 71.725 -0.854  1.00 39.09  ? 420 HOH A O      1 
HETATM 2098 O O      . HOH F 3 .   ? -9.921  45.443 1.107   1.00 23.85  ? 421 HOH A O      1 
HETATM 2099 O O      . HOH F 3 .   ? -14.529 54.576 24.643  1.00 44.97  ? 422 HOH A O      1 
HETATM 2100 O O      . HOH F 3 .   ? 1.717   46.770 -4.448  1.00 28.47  ? 423 HOH A O      1 
HETATM 2101 O O      . HOH F 3 .   ? -8.871  62.995 1.114   1.00 24.94  ? 424 HOH A O      1 
HETATM 2102 O O      . HOH F 3 .   ? -4.340  38.661 20.884  1.00 49.14  ? 425 HOH A O      1 
HETATM 2103 O O      . HOH F 3 .   ? -14.238 66.714 1.247   1.00 20.65  ? 426 HOH A O      1 
HETATM 2104 O O      . HOH F 3 .   ? -0.439  33.378 11.349  1.00 35.89  ? 427 HOH A O      1 
HETATM 2105 O O      . HOH F 3 .   ? -6.646  62.076 5.327   1.00 48.85  ? 428 HOH A O      1 
HETATM 2106 O O      . HOH F 3 .   ? -5.322  43.781 3.318   1.00 24.21  ? 429 HOH A O      1 
HETATM 2107 O O      . HOH F 3 .   ? -12.335 44.006 1.531   1.00 21.56  ? 430 HOH A O      1 
HETATM 2108 O O      . HOH F 3 .   ? -20.033 63.695 3.121   1.00 20.67  ? 431 HOH A O      1 
HETATM 2109 O O      . HOH F 3 .   ? -20.747 60.515 6.314   1.00 21.92  ? 432 HOH A O      1 
HETATM 2110 O O      . HOH F 3 .   ? -6.737  53.029 19.621  1.00 24.89  ? 433 HOH A O      1 
HETATM 2111 O O      . HOH F 3 .   ? -18.726 35.667 12.352  1.00 28.44  ? 434 HOH A O      1 
HETATM 2112 O O      . HOH F 3 .   ? -5.955  45.909 -10.552 1.00 40.95  ? 435 HOH A O      1 
HETATM 2113 O O      . HOH F 3 .   ? -14.588 66.406 -5.934  1.00 32.66  ? 436 HOH A O      1 
HETATM 2114 O O      . HOH F 3 .   ? -19.785 40.404 3.480   1.00 22.48  ? 437 HOH A O      1 
HETATM 2115 O O      . HOH F 3 .   ? -12.286 43.881 -7.424  1.00 37.15  ? 438 HOH A O      1 
HETATM 2116 O O      . HOH F 3 .   ? -12.322 43.503 19.189  1.00 38.53  ? 439 HOH A O      1 
HETATM 2117 O O      . HOH F 3 .   ? -6.558  60.772 -6.330  1.00 44.01  ? 440 HOH A O      1 
HETATM 2118 O O      . HOH F 3 .   ? -2.805  56.302 16.295  1.00 30.82  ? 441 HOH A O      1 
HETATM 2119 O O      . HOH F 3 .   ? -2.355  56.011 -10.293 1.00 33.81  ? 442 HOH A O      1 
HETATM 2120 O O      . HOH F 3 .   ? -4.119  35.966 11.720  1.00 44.46  ? 443 HOH A O      1 
HETATM 2121 O O      . HOH F 3 .   ? 3.055   53.007 13.860  1.00 29.48  ? 444 HOH A O      1 
HETATM 2122 O O      . HOH F 3 .   ? -21.434 45.605 -1.391  1.00 28.78  ? 445 HOH A O      1 
HETATM 2123 O O      . HOH F 3 .   ? -7.848  38.340 22.774  1.00 52.73  ? 446 HOH A O      1 
HETATM 2124 O O      . HOH F 3 .   ? -24.108 44.687 7.900   1.00 26.43  ? 447 HOH A O      1 
HETATM 2125 O O      . HOH F 3 .   ? -9.138  63.362 8.812   1.00 42.58  ? 448 HOH A O      1 
HETATM 2126 O O      . HOH F 3 .   ? -19.167 59.958 8.709   1.00 20.67  ? 449 HOH A O      1 
HETATM 2127 O O      . HOH F 3 .   ? -12.952 39.712 7.472   1.00 21.66  ? 450 HOH A O      1 
HETATM 2128 O O      . HOH F 3 .   ? -0.562  55.940 9.975   1.00 26.05  ? 451 HOH A O      1 
HETATM 2129 O O      . HOH F 3 .   ? -0.850  53.989 2.042   1.00 21.59  ? 452 HOH A O      1 
HETATM 2130 O O      . HOH F 3 .   ? 5.954   50.106 13.514  1.00 32.88  ? 453 HOH A O      1 
HETATM 2131 O O      . HOH F 3 .   ? -21.913 62.177 -7.047  1.00 56.40  ? 454 HOH A O      1 
HETATM 2132 O O      . HOH F 3 .   ? -9.514  50.770 -13.959 1.00 49.20  ? 455 HOH A O      1 
HETATM 2133 O O      . HOH F 3 .   ? -12.762 52.230 -15.369 1.00 43.06  ? 456 HOH A O      1 
HETATM 2134 O O      . HOH F 3 .   ? -10.608 60.872 15.985  1.00 28.85  ? 457 HOH A O      1 
HETATM 2135 O O      . HOH F 3 .   ? -17.687 56.678 -1.410  1.00 24.19  ? 458 HOH A O      1 
HETATM 2136 O O      . HOH F 3 .   ? -12.045 64.326 8.607   1.00 28.43  ? 459 HOH A O      1 
HETATM 2137 O O      . HOH F 3 .   ? 0.251   57.289 -7.771  1.00 30.22  ? 460 HOH A O      1 
HETATM 2138 O O      . HOH F 3 .   ? -23.080 53.040 5.260   1.00 32.86  ? 461 HOH A O      1 
HETATM 2139 O O      . HOH F 3 .   ? -18.627 36.433 15.029  1.00 24.98  ? 462 HOH A O      1 
HETATM 2140 O O      . HOH F 3 .   ? -6.691  62.052 12.452  1.00 52.84  ? 463 HOH A O      1 
HETATM 2141 O O      . HOH F 3 .   ? -19.391 41.881 -9.047  1.00 46.05  ? 464 HOH A O      1 
HETATM 2142 O O      . HOH F 3 .   ? -23.083 45.033 17.469  1.00 37.73  ? 465 HOH A O      1 
HETATM 2143 O O      . HOH F 3 .   ? -26.606 46.497 5.626   1.00 34.00  ? 466 HOH A O      1 
HETATM 2144 O O      . HOH F 3 .   ? -23.729 40.904 18.114  1.00 39.66  ? 467 HOH A O      1 
HETATM 2145 O O      . HOH F 3 .   ? -23.586 64.166 0.210   1.00 26.22  ? 468 HOH A O      1 
HETATM 2146 O O      . HOH F 3 .   ? -5.215  50.756 18.692  1.00 28.56  ? 469 HOH A O      1 
HETATM 2147 O O      . HOH F 3 .   ? -20.693 36.155 2.745   1.00 38.33  ? 470 HOH A O      1 
HETATM 2148 O O      . HOH F 3 .   ? -11.609 32.979 10.204  1.00 44.14  ? 471 HOH A O      1 
HETATM 2149 O O      . HOH F 3 .   ? -5.135  59.401 6.385   1.00 33.21  ? 472 HOH A O      1 
HETATM 2150 O O      . HOH F 3 .   ? -8.762  61.207 -10.221 1.00 35.99  ? 473 HOH A O      1 
HETATM 2151 O O      . HOH F 3 .   ? -24.833 54.659 -5.691  1.00 49.11  ? 474 HOH A O      1 
HETATM 2152 O O      . HOH F 3 .   ? -16.017 31.885 3.078   1.00 53.32  ? 475 HOH A O      1 
HETATM 2153 O O      . HOH F 3 .   ? 0.838   53.255 15.494  1.00 25.29  ? 476 HOH A O      1 
HETATM 2154 O O      . HOH F 3 .   ? -11.604 46.216 -11.230 1.00 36.53  ? 477 HOH A O      1 
HETATM 2155 O O      . HOH F 3 .   ? -5.458  42.222 22.074  1.00 57.66  ? 478 HOH A O      1 
HETATM 2156 O O      . HOH F 3 .   ? -12.508 63.774 -5.628  1.00 34.67  ? 479 HOH A O      1 
HETATM 2157 O O      . HOH F 3 .   ? -11.944 34.291 12.930  1.00 37.98  ? 480 HOH A O      1 
HETATM 2158 O O      . HOH F 3 .   ? -1.839  41.280 22.050  1.00 39.58  ? 481 HOH A O      1 
HETATM 2159 O O      . HOH F 3 .   ? -26.235 56.652 0.204   1.00 50.73  ? 482 HOH A O      1 
HETATM 2160 O O      . HOH F 3 .   ? -24.838 58.018 7.900   1.00 36.84  ? 483 HOH A O      1 
HETATM 2161 O O      . HOH F 3 .   ? -27.177 62.092 -0.951  1.00 42.93  ? 484 HOH A O      1 
HETATM 2162 O O      . HOH F 3 .   ? -20.994 40.975 1.209   1.00 27.46  ? 485 HOH A O      1 
HETATM 2163 O O      . HOH F 3 .   ? -18.672 57.763 14.398  1.00 21.08  ? 486 HOH A O      1 
HETATM 2164 O O      . HOH F 3 .   ? -7.852  31.123 7.224   1.00 55.28  ? 487 HOH A O      1 
HETATM 2165 O O      . HOH F 3 .   ? -9.702  58.295 16.476  1.00 36.73  ? 488 HOH A O      1 
HETATM 2166 O O      . HOH F 3 .   ? -21.637 52.092 16.474  1.00 26.28  ? 489 HOH A O      1 
HETATM 2167 O O      . HOH F 3 .   ? -9.048  48.249 -12.680 1.00 50.71  ? 490 HOH A O      1 
HETATM 2168 O O      . HOH F 3 .   ? -7.663  31.349 12.401  1.00 55.33  ? 491 HOH A O      1 
HETATM 2169 O O      . HOH F 3 .   ? -13.850 37.375 5.997   1.00 23.12  ? 492 HOH A O      1 
HETATM 2170 O O      . HOH F 3 .   ? -14.628 49.210 -12.977 1.00 61.75  ? 493 HOH A O      1 
HETATM 2171 O O      . HOH F 3 .   ? -16.782 41.565 20.330  1.00 48.00  ? 494 HOH A O      1 
HETATM 2172 O O      . HOH F 3 .   ? -24.726 45.394 15.449  1.00 41.08  ? 495 HOH A O      1 
HETATM 2173 O O      . HOH F 3 .   ? -20.546 50.986 -10.654 1.00 32.33  ? 496 HOH A O      1 
HETATM 2174 O O      . HOH F 3 .   ? -16.402 34.781 16.026  1.00 44.37  ? 497 HOH A O      1 
HETATM 2175 O O      . HOH F 3 .   ? -15.573 40.939 -7.669  1.00 45.85  ? 498 HOH A O      1 
HETATM 2176 O O      . HOH F 3 .   ? -18.105 58.046 -8.553  1.00 47.54  ? 499 HOH A O      1 
HETATM 2177 O O      . HOH F 3 .   ? -16.584 44.928 20.424  1.00 44.29  ? 500 HOH A O      1 
HETATM 2178 O O      . HOH F 3 .   ? 3.193   48.984 15.902  1.00 34.82  ? 501 HOH A O      1 
HETATM 2179 O O      . HOH F 3 .   ? -20.666 53.713 23.472  1.00 49.35  ? 502 HOH A O      1 
HETATM 2180 O O      . HOH F 3 .   ? -21.878 38.116 18.138  1.00 35.61  ? 503 HOH A O      1 
HETATM 2181 O O      . HOH F 3 .   ? -25.355 47.504 -3.424  1.00 58.28  ? 504 HOH A O      1 
HETATM 2182 O O      . HOH F 3 .   ? -4.982  61.914 2.856   1.00 50.26  ? 505 HOH A O      1 
HETATM 2183 O O      . HOH F 3 .   ? -16.584 47.305 22.418  1.00 42.60  ? 506 HOH A O      1 
HETATM 2184 O O      . HOH F 3 .   ? -14.222 46.718 -12.050 1.00 39.20  ? 507 HOH A O      1 
HETATM 2185 O O      . HOH F 3 .   ? 2.320   48.107 21.103  1.00 54.03  ? 508 HOH A O      1 
HETATM 2186 O O      . HOH F 3 .   ? -10.021 49.256 24.744  1.00 34.20  ? 509 HOH A O      1 
HETATM 2187 O O      . HOH F 3 .   ? -25.343 52.389 2.740   1.00 44.93  ? 510 HOH A O      1 
HETATM 2188 O O      . HOH F 3 .   ? -4.829  55.029 19.648  1.00 39.44  ? 511 HOH A O      1 
HETATM 2189 O O      . HOH F 3 .   ? 2.051   50.579 17.091  1.00 43.75  ? 512 HOH A O      1 
HETATM 2190 O O      . HOH F 3 .   ? -12.942 69.223 -2.624  1.00 50.85  ? 513 HOH A O      1 
HETATM 2191 O O      . HOH F 3 .   ? -1.263  58.068 11.656  1.00 30.68  ? 514 HOH A O      1 
HETATM 2192 O O      . HOH F 3 .   ? -3.350  61.190 1.276   1.00 52.60  ? 515 HOH A O      1 
HETATM 2193 O O      . HOH F 3 .   ? -14.670 33.271 14.377  1.00 41.73  ? 516 HOH A O      1 
HETATM 2194 O O      . HOH F 3 .   ? -10.480 43.179 -2.309  1.00 33.71  ? 517 HOH A O      1 
HETATM 2195 O O      . HOH F 3 .   ? -0.000  57.998 0.000   0.50 42.60  ? 518 HOH A O      1 
HETATM 2196 O O      . HOH F 3 .   ? -0.962  60.234 7.660   1.00 44.50  ? 519 HOH A O      1 
HETATM 2197 O O      . HOH F 3 .   ? -7.279  43.873 1.079   1.00 43.13  ? 520 HOH A O      1 
HETATM 2198 O O      . HOH F 3 .   ? -24.618 43.435 19.590  1.00 40.54  ? 521 HOH A O      1 
HETATM 2199 O O      . HOH F 3 .   ? -14.112 41.447 20.144  1.00 40.51  ? 522 HOH A O      1 
HETATM 2200 O O      . HOH F 3 .   ? -11.803 50.402 27.442  1.00 41.97  ? 523 HOH A O      1 
HETATM 2201 O O      . HOH F 3 .   ? -13.387 42.069 -0.501  1.00 49.25  ? 524 HOH A O      1 
HETATM 2202 O O      . HOH F 3 .   ? -9.966  32.527 13.740  1.00 44.55  ? 525 HOH A O      1 
HETATM 2203 O O      . HOH F 3 .   ? 8.644   38.213 6.435   1.00 52.10  ? 526 HOH A O      1 
HETATM 2204 O O      . HOH F 3 .   ? -21.517 46.237 -4.068  1.00 37.34  ? 527 HOH A O      1 
HETATM 2205 O O      . HOH F 3 .   ? -3.521  33.708 11.133  1.00 56.04  ? 528 HOH A O      1 
HETATM 2206 O O      . HOH F 3 .   ? -22.655 55.837 14.023  1.00 39.32  ? 529 HOH A O      1 
HETATM 2207 O O      . HOH F 3 .   ? -3.010  43.767 0.472   1.00 38.76  ? 530 HOH A O      1 
HETATM 2208 O O      . HOH F 3 .   ? 8.086   40.780 5.551   1.00 52.39  ? 531 HOH A O      1 
HETATM 2209 O O      . HOH F 3 .   ? -16.829 49.907 -12.218 1.00 32.71  ? 532 HOH A O      1 
HETATM 2210 O O      . HOH F 3 .   ? -15.088 40.183 -5.160  1.00 47.19  ? 533 HOH A O      1 
HETATM 2211 O O      . HOH F 3 .   ? 0.305   39.285 22.882  1.00 63.18  ? 534 HOH A O      1 
HETATM 2212 O O      . HOH F 3 .   ? -7.386  52.627 22.525  1.00 47.61  ? 535 HOH A O      1 
HETATM 2213 O O      . HOH F 3 .   ? -24.024 61.222 3.575   1.00 35.93  ? 536 HOH A O      1 
HETATM 2214 O O      . HOH F 3 .   ? -7.430  50.325 23.876  1.00 51.43  ? 537 HOH A O      1 
HETATM 2215 O O      . HOH F 3 .   ? -0.000  55.992 0.000   0.50 42.37  ? 538 HOH A O      1 
HETATM 2216 O O      . HOH F 3 .   ? -10.453 49.460 26.666  1.00 55.31  ? 539 HOH A O      1 
HETATM 2217 O O      . HOH F 3 .   ? 0.199   55.830 16.344  1.00 38.15  ? 540 HOH A O      1 
HETATM 2218 O O      . HOH F 3 .   ? -1.378  44.347 2.592   1.00 38.23  ? 541 HOH A O      1 
HETATM 2219 O O      . HOH F 3 .   ? -3.132  42.135 3.036   1.00 35.92  ? 542 HOH A O      1 
HETATM 2220 O O      . HOH F 3 .   ? -23.826 64.334 -2.825  1.00 44.01  ? 543 HOH A O      1 
HETATM 2221 O O      . HOH F 3 .   ? -0.000  60.790 0.000   0.50 40.69  ? 544 HOH A O      1 
HETATM 2222 O O      . HOH F 3 .   ? -5.862  53.623 -14.905 1.00 46.68  ? 545 HOH A O      1 
HETATM 2223 O O      . HOH F 3 .   ? -1.601  35.007 8.737   1.00 58.71  ? 546 HOH A O      1 
HETATM 2224 O O      . HOH F 3 .   ? -12.362 43.961 -9.725  1.00 53.38  ? 547 HOH A O      1 
HETATM 2225 O O      . HOH F 3 .   ? -25.793 63.029 1.305   1.00 28.63  ? 548 HOH A O      1 
HETATM 2226 O O      . HOH F 3 .   ? -25.871 60.090 3.322   1.00 58.16  ? 549 HOH A O      1 
HETATM 2227 O O      . HOH F 3 .   ? -13.335 38.781 21.280  1.00 55.11  ? 550 HOH A O      1 
HETATM 2228 O O      . HOH F 3 .   ? -4.661  57.360 18.219  1.00 49.57  ? 551 HOH A O      1 
HETATM 2229 O O      . HOH F 3 .   ? -15.740 72.179 1.672   1.00 46.80  ? 552 HOH A O      1 
HETATM 2230 O O      . HOH F 3 .   ? -26.710 55.617 7.766   1.00 52.02  ? 553 HOH A O      1 
HETATM 2231 O O      . HOH F 3 .   ? -10.287 42.437 -5.061  1.00 40.17  ? 554 HOH A O      1 
HETATM 2232 O O      . HOH F 3 .   ? -26.062 53.177 6.142   1.00 62.37  ? 555 HOH A O      1 
HETATM 2233 O O      . HOH F 3 .   ? -24.116 45.139 -0.972  1.00 37.75  ? 556 HOH A O      1 
HETATM 2234 O O      . HOH F 3 .   ? -26.372 46.208 -0.194  1.00 53.78  ? 557 HOH A O      1 
HETATM 2235 O O      . HOH F 3 .   ? -11.441 67.275 1.439   1.00 26.24  ? 558 HOH A O      1 
HETATM 2236 O O      . HOH F 3 .   ? -12.677 48.682 27.933  1.00 63.34  ? 559 HOH A O      1 
HETATM 2237 O O      . HOH F 3 .   ? -26.468 54.519 0.645   1.00 40.81  ? 560 HOH A O      1 
HETATM 2238 O O      . HOH F 3 .   ? -9.399  65.627 1.776   1.00 31.96  ? 561 HOH A O      1 
HETATM 2239 O O      . HOH F 3 .   ? -10.595 68.787 -1.541  1.00 56.20  ? 562 HOH A O      1 
HETATM 2240 O O      . HOH F 3 .   ? -2.931  55.254 -12.904 1.00 42.07  ? 563 HOH A O      1 
HETATM 2241 O O      . HOH F 3 .   ? -4.103  63.076 0.550   1.00 61.67  ? 564 HOH A O      1 
HETATM 2242 O O      . HOH F 3 .   ? -4.088  49.623 21.004  1.00 44.08  ? 565 HOH A O      1 
HETATM 2243 O O      . HOH F 3 .   ? -7.047  63.608 -1.229  1.00 44.36  ? 566 HOH A O      1 
HETATM 2244 O O      . HOH F 3 .   ? -1.247  57.430 -14.256 1.00 47.84  ? 567 HOH A O      1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   151 ?   ?   ?   A . n 
A 1 2   ALA 2   152 ?   ?   ?   A . n 
A 1 3   SER 3   153 ?   ?   ?   A . n 
A 1 4   SER 4   154 ?   ?   ?   A . n 
A 1 5   SER 5   155 ?   ?   ?   A . n 
A 1 6   ASP 6   156 ?   ?   ?   A . n 
A 1 7   SER 7   157 ?   ?   ?   A . n 
A 1 8   ASP 8   158 158 ASP ASP A . n 
A 1 9   LEU 9   159 159 LEU LEU A . n 
A 1 10  SER 10  160 160 SER SER A . n 
A 1 11  ASP 11  161 161 ASP ASP A . n 
A 1 12  PHE 12  162 162 PHE PHE A . n 
A 1 13  ALA 13  163 163 ALA ALA A . n 
A 1 14  SER 14  164 164 SER SER A . n 
A 1 15  SER 15  165 165 SER SER A . n 
A 1 16  VAL 16  166 166 VAL VAL A . n 
A 1 17  LEU 17  167 167 LEU LEU A . n 
A 1 18  ALA 18  168 168 ALA ALA A . n 
A 1 19  GLU 19  169 169 GLU GLU A . n 
A 1 20  HIS 20  170 170 HIS HIS A . n 
A 1 21  ASN 21  171 171 ASN ASN A . n 
A 1 22  LYS 22  172 172 LYS LYS A . n 
A 1 23  LYS 23  173 173 LYS LYS A . n 
A 1 24  ARG 24  174 174 ARG ARG A . n 
A 1 25  ALA 25  175 175 ALA ALA A . n 
A 1 26  LEU 26  176 176 LEU LEU A . n 
A 1 27  HIS 27  177 177 HIS HIS A . n 
A 1 28  LYS 28  178 178 LYS LYS A . n 
A 1 29  ASP 29  179 179 ASP ASP A . n 
A 1 30  THR 30  180 180 THR THR A . n 
A 1 31  PRO 31  181 181 PRO PRO A . n 
A 1 32  ALA 32  182 182 ALA ALA A . n 
A 1 33  LEU 33  183 183 LEU LEU A . n 
A 1 34  SER 34  184 184 SER SER A . n 
A 1 35  TRP 35  185 185 TRP TRP A . n 
A 1 36  SER 36  186 186 SER SER A . n 
A 1 37  ASP 37  187 187 ASP ASP A . n 
A 1 38  THR 38  188 188 THR THR A . n 
A 1 39  LEU 39  189 189 LEU LEU A . n 
A 1 40  ALA 40  190 190 ALA ALA A . n 
A 1 41  SER 41  191 191 SER SER A . n 
A 1 42  TYR 42  192 192 TYR TYR A . n 
A 1 43  ALA 43  193 193 ALA ALA A . n 
A 1 44  GLN 44  194 194 GLN GLN A . n 
A 1 45  ASP 45  195 195 ASP ASP A . n 
A 1 46  TYR 46  196 196 TYR TYR A . n 
A 1 47  ALA 47  197 197 ALA ALA A . n 
A 1 48  ASP 48  198 198 ASP ASP A . n 
A 1 49  ASN 49  199 199 ASN ASN A . n 
A 1 50  TYR 50  200 200 TYR TYR A . n 
A 1 51  ASP 51  201 201 ASP ASP A . n 
A 1 52  CYS 52  202 202 CYS CYS A . n 
A 1 53  SER 53  203 203 SER SER A . n 
A 1 54  GLY 54  204 204 GLY GLY A . n 
A 1 55  THR 55  205 205 THR THR A . n 
A 1 56  LEU 56  206 206 LEU LEU A . n 
A 1 57  THR 57  207 207 THR THR A . n 
A 1 58  HIS 58  208 208 HIS HIS A . n 
A 1 59  SER 59  209 209 SER SER A . n 
A 1 60  GLY 60  210 210 GLY GLY A . n 
A 1 61  GLY 61  211 211 GLY GLY A . n 
A 1 62  PRO 62  212 212 PRO PRO A . n 
A 1 63  TYR 63  213 213 TYR TYR A . n 
A 1 64  GLY 64  214 214 GLY GLY A . n 
A 1 65  GLU 65  215 215 GLU GLU A . n 
A 1 66  ASN 66  216 216 ASN ASN A . n 
A 1 67  LEU 67  217 217 LEU LEU A . n 
A 1 68  ALA 68  218 218 ALA ALA A . n 
A 1 69  LEU 69  219 219 LEU LEU A . n 
A 1 70  GLY 70  220 220 GLY GLY A . n 
A 1 71  TYR 71  221 221 TYR TYR A . n 
A 1 72  ASP 72  222 222 ASP ASP A . n 
A 1 73  GLY 73  223 223 GLY GLY A . n 
A 1 74  PRO 74  224 224 PRO PRO A . n 
A 1 75  ALA 75  225 225 ALA ALA A . n 
A 1 76  ALA 76  226 226 ALA ALA A . n 
A 1 77  VAL 77  227 227 VAL VAL A . n 
A 1 78  ASP 78  228 228 ASP ASP A . n 
A 1 79  ALA 79  229 229 ALA ALA A . n 
A 1 80  TRP 80  230 230 TRP TRP A . n 
A 1 81  TYR 81  231 231 TYR TYR A . n 
A 1 82  ASN 82  232 232 ASN ASN A . n 
A 1 83  GLU 83  233 233 GLU GLU A . n 
A 1 84  ILE 84  234 234 ILE ILE A . n 
A 1 85  SER 85  235 235 SER SER A . n 
A 1 86  ASN 86  236 236 ASN ASN A . n 
A 1 87  TYR 87  237 237 TYR TYR A . n 
A 1 88  ASP 88  238 238 ASP ASP A . n 
A 1 89  PHE 89  239 239 PHE PHE A . n 
A 1 90  SER 90  240 240 SER SER A . n 
A 1 91  ASN 91  241 241 ASN ASN A . n 
A 1 92  PRO 92  242 242 PRO PRO A . n 
A 1 93  GLY 93  243 243 GLY GLY A . n 
A 1 94  PHE 94  244 244 PHE PHE A . n 
A 1 95  SER 95  245 245 SER SER A . n 
A 1 96  SER 96  246 246 SER SER A . n 
A 1 97  ASN 97  247 247 ASN ASN A . n 
A 1 98  THR 98  248 248 THR THR A . n 
A 1 99  GLY 99  249 249 GLY GLY A . n 
A 1 100 HIS 100 250 250 HIS HIS A . n 
A 1 101 PHE 101 251 251 PHE PHE A . n 
A 1 102 THR 102 252 252 THR THR A . n 
A 1 103 GLN 103 253 253 GLN GLN A . n 
A 1 104 VAL 104 254 254 VAL VAL A . n 
A 1 105 VAL 105 255 255 VAL VAL A . n 
A 1 106 TRP 106 256 256 TRP TRP A . n 
A 1 107 LYS 107 257 257 LYS LYS A . n 
A 1 108 SER 108 258 258 SER SER A . n 
A 1 109 THR 109 259 259 THR THR A . n 
A 1 110 THR 110 260 260 THR THR A . n 
A 1 111 GLN 111 261 261 GLN GLN A . n 
A 1 112 VAL 112 262 262 VAL VAL A . n 
A 1 113 GLY 113 263 263 GLY GLY A . n 
A 1 114 CYS 114 264 264 CYS CYS A . n 
A 1 115 GLY 115 265 265 GLY GLY A . n 
A 1 116 ILE 116 266 266 ILE ILE A . n 
A 1 117 LYS 117 267 267 LYS LYS A . n 
A 1 118 THR 118 268 268 THR THR A . n 
A 1 119 CYS 119 269 269 CYS CYS A . n 
A 1 120 GLY 120 270 270 GLY GLY A . n 
A 1 121 GLY 121 271 271 GLY GLY A . n 
A 1 122 ALA 122 272 272 ALA ALA A . n 
A 1 123 TRP 123 273 273 TRP TRP A . n 
A 1 124 GLY 124 274 274 GLY GLY A . n 
A 1 125 ASP 125 275 275 ASP ASP A . n 
A 1 126 TYR 126 276 276 TYR TYR A . n 
A 1 127 VAL 127 277 277 VAL VAL A . n 
A 1 128 ILE 128 278 278 ILE ILE A . n 
A 1 129 CYS 129 279 279 CYS CYS A . n 
A 1 130 SER 130 280 280 SER SER A . n 
A 1 131 TYR 131 281 281 TYR TYR A . n 
A 1 132 ASP 132 282 282 ASP ASP A . n 
A 1 133 PRO 133 283 283 PRO PRO A . n 
A 1 134 ALA 134 284 284 ALA ALA A . n 
A 1 135 GLY 135 285 285 GLY GLY A . n 
A 1 136 ASN 136 286 286 ASN ASN A . n 
A 1 137 TYR 137 287 287 TYR TYR A . n 
A 1 138 GLU 138 288 288 GLU GLU A . n 
A 1 139 GLY 139 289 289 GLY GLY A . n 
A 1 140 GLU 140 290 290 GLU GLU A . n 
A 1 141 TYR 141 291 291 TYR TYR A . n 
A 1 142 ALA 142 292 292 ALA ALA A . n 
A 1 143 ASP 143 293 293 ASP ASP A . n 
A 1 144 ASN 144 294 294 ASN ASN A . n 
A 1 145 VAL 145 295 295 VAL VAL A . n 
A 1 146 GLU 146 296 296 GLU GLU A . n 
A 1 147 PRO 147 297 297 PRO PRO A . n 
A 1 148 LEU 148 298 298 LEU LEU A . n 
A 1 149 ALA 149 299 299 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 DIO 1   301 301 DIO DIO A . 
C 2 DIO 1   302 302 DIO DIO A . 
D 2 DIO 1   303 306 DIO DIO A . 
E 2 DIO 1   304 877 DIO DIO A . 
F 3 HOH 1   401 109 HOH HOH A . 
F 3 HOH 2   402 3   HOH HOH A . 
F 3 HOH 3   403 121 HOH HOH A . 
F 3 HOH 4   404 2   HOH HOH A . 
F 3 HOH 5   405 157 HOH HOH A . 
F 3 HOH 6   406 98  HOH HOH A . 
F 3 HOH 7   407 81  HOH HOH A . 
F 3 HOH 8   408 1   HOH HOH A . 
F 3 HOH 9   409 76  HOH HOH A . 
F 3 HOH 10  410 20  HOH HOH A . 
F 3 HOH 11  411 122 HOH HOH A . 
F 3 HOH 12  412 4   HOH HOH A . 
F 3 HOH 13  413 5   HOH HOH A . 
F 3 HOH 14  414 38  HOH HOH A . 
F 3 HOH 15  415 77  HOH HOH A . 
F 3 HOH 16  416 8   HOH HOH A . 
F 3 HOH 17  417 18  HOH HOH A . 
F 3 HOH 18  418 13  HOH HOH A . 
F 3 HOH 19  419 110 HOH HOH A . 
F 3 HOH 20  420 115 HOH HOH A . 
F 3 HOH 21  421 85  HOH HOH A . 
F 3 HOH 22  422 158 HOH HOH A . 
F 3 HOH 23  423 29  HOH HOH A . 
F 3 HOH 24  424 25  HOH HOH A . 
F 3 HOH 25  425 153 HOH HOH A . 
F 3 HOH 26  426 11  HOH HOH A . 
F 3 HOH 27  427 12  HOH HOH A . 
F 3 HOH 28  428 31  HOH HOH A . 
F 3 HOH 29  429 84  HOH HOH A . 
F 3 HOH 30  430 10  HOH HOH A . 
F 3 HOH 31  431 22  HOH HOH A . 
F 3 HOH 32  432 21  HOH HOH A . 
F 3 HOH 33  433 17  HOH HOH A . 
F 3 HOH 34  434 54  HOH HOH A . 
F 3 HOH 35  435 114 HOH HOH A . 
F 3 HOH 36  436 32  HOH HOH A . 
F 3 HOH 37  437 14  HOH HOH A . 
F 3 HOH 38  438 102 HOH HOH A . 
F 3 HOH 39  439 6   HOH HOH A . 
F 3 HOH 40  440 7   HOH HOH A . 
F 3 HOH 41  441 23  HOH HOH A . 
F 3 HOH 42  442 40  HOH HOH A . 
F 3 HOH 43  443 125 HOH HOH A . 
F 3 HOH 44  444 78  HOH HOH A . 
F 3 HOH 45  445 46  HOH HOH A . 
F 3 HOH 46  446 149 HOH HOH A . 
F 3 HOH 47  447 15  HOH HOH A . 
F 3 HOH 48  448 65  HOH HOH A . 
F 3 HOH 49  449 48  HOH HOH A . 
F 3 HOH 50  450 33  HOH HOH A . 
F 3 HOH 51  451 34  HOH HOH A . 
F 3 HOH 52  452 16  HOH HOH A . 
F 3 HOH 53  453 49  HOH HOH A . 
F 3 HOH 54  454 133 HOH HOH A . 
F 3 HOH 55  455 144 HOH HOH A . 
F 3 HOH 56  456 131 HOH HOH A . 
F 3 HOH 57  457 36  HOH HOH A . 
F 3 HOH 58  458 24  HOH HOH A . 
F 3 HOH 59  459 19  HOH HOH A . 
F 3 HOH 60  460 58  HOH HOH A . 
F 3 HOH 61  461 35  HOH HOH A . 
F 3 HOH 62  462 39  HOH HOH A . 
F 3 HOH 63  463 162 HOH HOH A . 
F 3 HOH 64  464 143 HOH HOH A . 
F 3 HOH 65  465 27  HOH HOH A . 
F 3 HOH 66  466 138 HOH HOH A . 
F 3 HOH 67  467 63  HOH HOH A . 
F 3 HOH 68  468 28  HOH HOH A . 
F 3 HOH 69  469 37  HOH HOH A . 
F 3 HOH 70  470 57  HOH HOH A . 
F 3 HOH 71  471 60  HOH HOH A . 
F 3 HOH 72  472 44  HOH HOH A . 
F 3 HOH 73  473 42  HOH HOH A . 
F 3 HOH 74  474 80  HOH HOH A . 
F 3 HOH 75  475 165 HOH HOH A . 
F 3 HOH 76  476 30  HOH HOH A . 
F 3 HOH 77  477 97  HOH HOH A . 
F 3 HOH 78  478 166 HOH HOH A . 
F 3 HOH 79  479 89  HOH HOH A . 
F 3 HOH 80  480 56  HOH HOH A . 
F 3 HOH 81  481 52  HOH HOH A . 
F 3 HOH 82  482 116 HOH HOH A . 
F 3 HOH 83  483 86  HOH HOH A . 
F 3 HOH 84  484 111 HOH HOH A . 
F 3 HOH 85  485 43  HOH HOH A . 
F 3 HOH 86  486 90  HOH HOH A . 
F 3 HOH 87  487 130 HOH HOH A . 
F 3 HOH 88  488 45  HOH HOH A . 
F 3 HOH 89  489 47  HOH HOH A . 
F 3 HOH 90  490 79  HOH HOH A . 
F 3 HOH 91  491 161 HOH HOH A . 
F 3 HOH 92  492 59  HOH HOH A . 
F 3 HOH 93  493 147 HOH HOH A . 
F 3 HOH 94  494 126 HOH HOH A . 
F 3 HOH 95  495 106 HOH HOH A . 
F 3 HOH 96  496 64  HOH HOH A . 
F 3 HOH 97  497 127 HOH HOH A . 
F 3 HOH 98  498 26  HOH HOH A . 
F 3 HOH 99  499 135 HOH HOH A . 
F 3 HOH 100 500 50  HOH HOH A . 
F 3 HOH 101 501 87  HOH HOH A . 
F 3 HOH 102 502 55  HOH HOH A . 
F 3 HOH 103 503 53  HOH HOH A . 
F 3 HOH 104 504 92  HOH HOH A . 
F 3 HOH 105 505 66  HOH HOH A . 
F 3 HOH 106 506 113 HOH HOH A . 
F 3 HOH 107 507 61  HOH HOH A . 
F 3 HOH 108 508 154 HOH HOH A . 
F 3 HOH 109 509 93  HOH HOH A . 
F 3 HOH 110 510 41  HOH HOH A . 
F 3 HOH 111 511 51  HOH HOH A . 
F 3 HOH 112 512 100 HOH HOH A . 
F 3 HOH 113 513 146 HOH HOH A . 
F 3 HOH 114 514 62  HOH HOH A . 
F 3 HOH 115 515 142 HOH HOH A . 
F 3 HOH 116 516 123 HOH HOH A . 
F 3 HOH 117 517 88  HOH HOH A . 
F 3 HOH 118 518 101 HOH HOH A . 
F 3 HOH 119 519 141 HOH HOH A . 
F 3 HOH 120 520 156 HOH HOH A . 
F 3 HOH 121 521 104 HOH HOH A . 
F 3 HOH 122 522 67  HOH HOH A . 
F 3 HOH 123 523 96  HOH HOH A . 
F 3 HOH 124 524 132 HOH HOH A . 
F 3 HOH 125 525 68  HOH HOH A . 
F 3 HOH 126 526 91  HOH HOH A . 
F 3 HOH 127 527 99  HOH HOH A . 
F 3 HOH 128 528 145 HOH HOH A . 
F 3 HOH 129 529 155 HOH HOH A . 
F 3 HOH 130 530 118 HOH HOH A . 
F 3 HOH 131 531 107 HOH HOH A . 
F 3 HOH 132 532 136 HOH HOH A . 
F 3 HOH 133 533 69  HOH HOH A . 
F 3 HOH 134 534 119 HOH HOH A . 
F 3 HOH 135 535 148 HOH HOH A . 
F 3 HOH 136 536 137 HOH HOH A . 
F 3 HOH 137 537 159 HOH HOH A . 
F 3 HOH 138 538 83  HOH HOH A . 
F 3 HOH 139 539 139 HOH HOH A . 
F 3 HOH 140 540 70  HOH HOH A . 
F 3 HOH 141 541 108 HOH HOH A . 
F 3 HOH 142 542 71  HOH HOH A . 
F 3 HOH 143 543 95  HOH HOH A . 
F 3 HOH 144 544 103 HOH HOH A . 
F 3 HOH 145 545 163 HOH HOH A . 
F 3 HOH 146 546 164 HOH HOH A . 
F 3 HOH 147 547 140 HOH HOH A . 
F 3 HOH 148 548 94  HOH HOH A . 
F 3 HOH 149 549 150 HOH HOH A . 
F 3 HOH 150 550 151 HOH HOH A . 
F 3 HOH 151 551 72  HOH HOH A . 
F 3 HOH 152 552 105 HOH HOH A . 
F 3 HOH 153 553 120 HOH HOH A . 
F 3 HOH 154 554 128 HOH HOH A . 
F 3 HOH 155 555 167 HOH HOH A . 
F 3 HOH 156 556 73  HOH HOH A . 
F 3 HOH 157 557 112 HOH HOH A . 
F 3 HOH 158 558 74  HOH HOH A . 
F 3 HOH 159 559 160 HOH HOH A . 
F 3 HOH 160 560 82  HOH HOH A . 
F 3 HOH 161 561 75  HOH HOH A . 
F 3 HOH 162 562 152 HOH HOH A . 
F 3 HOH 163 563 9   HOH HOH A . 
F 3 HOH 164 564 129 HOH HOH A . 
F 3 HOH 165 565 124 HOH HOH A . 
F 3 HOH 166 566 134 HOH HOH A . 
F 3 HOH 167 567 117 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A DIO 302 ? C DIO . 
2 1 A HOH 518 ? F HOH . 
3 1 A HOH 538 ? F HOH . 
4 1 A HOH 544 ? F HOH . 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2016-07-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? '(dev_2405)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM  ? ? ? .            2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .            3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .            4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 523 ? ? O A HOH 539 ? ? 1.82 
2 1 O A HOH 509 ? ? O A HOH 539 ? ? 1.98 
3 1 O A HOH 523 ? ? O A HOH 559 ? ? 1.99 
4 1 O A HOH 401 ? ? O A HOH 545 ? ? 2.04 
5 1 O A HOH 515 ? ? O A HOH 564 ? ? 2.16 
6 1 O A HOH 536 ? ? O A HOH 549 ? ? 2.18 
7 1 O A HOH 482 ? ? O A HOH 560 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    HH 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    TYR 
_pdbx_validate_symm_contact.auth_seq_id_1     213 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    HH 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    TYR 
_pdbx_validate_symm_contact.auth_seq_id_2     213 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   9_555 
_pdbx_validate_symm_contact.dist              1.27 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 151 ? A SER 1 
2 1 Y 1 A ALA 152 ? A ALA 2 
3 1 Y 1 A SER 153 ? A SER 3 
4 1 Y 1 A SER 154 ? A SER 4 
5 1 Y 1 A SER 155 ? A SER 5 
6 1 Y 1 A ASP 156 ? A ASP 6 
7 1 Y 1 A SER 157 ? A SER 7 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1,4-DIETHYLENE DIOXIDE' DIO 
3 water                    HOH 
#