data_5EWE
# 
_entry.id   5EWE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.285 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5EWE         
WWPDB D_1000215529 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5EWF PDB . 
unspecified 5EWG PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5EWE 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Su, Y.'           1 
'Egli, M.'         2 
'Guengerich, F.P.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            291 
_citation.language                  ? 
_citation.page_first                3747 
_citation.page_last                 3756 
_citation.title                     'Mechanism of Ribonucleotide Incorporation by Human DNA Polymerase eta.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M115.706226 
_citation.pdbx_database_id_PubMed   26740629 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Su, Y.'           1 
primary 'Egli, M.'         2 
primary 'Guengerich, F.P.' 3 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5EWE 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     99.282 
_cell.length_a_esd                 ? 
_cell.length_b                     99.282 
_cell.length_b_esd                 ? 
_cell.length_c                     81.895 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5EWE 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 'UNP residues 1-432' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*GP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3662.404  1   ?       ? ?                    ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ?                    ? 
4 non-polymer syn "CYTIDINE-5'-TRIPHOSPHATE"                           483.156   1   ?       ? ?                    ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    2   ?       ? ?                    ? 
6 non-polymer syn GLYCEROL                                             92.094    2   ?       ? ?                    ? 
7 water       nat water                                                18.015    433 ?       ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DG)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATGATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     866768 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'synthetic construct' ? 32630 ? 
3 1 sample 1 8  'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5EWE       5EWE   ? 2 ? 1 
3 PDB 5EWE       5EWE   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5EWE A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5EWE T 1 ? 12  ? 5EWE   1 ? 12  ? 1 12  
3 3 5EWE P 1 ? 8   ? 5EWE   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5EWE GLY A 1 ? UNP Q9Y253 ? ? 'expression tag' -2 1 
1 5EWE PRO A 2 ? UNP Q9Y253 ? ? 'expression tag' -1 2 
1 5EWE HIS A 3 ? UNP Q9Y253 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'             40.078  
CTP non-polymer         . "CYTIDINE-5'-TRIPHOSPHATE"           ?                               'C9 H16 N3 O14 P3' 483.156 
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5EWE 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.13 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         42.25 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'NaMES (pH 6.0), polyethylene glycol monomethyl ether 2000, and calcium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-08 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97856 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-G' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97856 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-G 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5EWE 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.66 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       54114 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.9 
_reflns.pdbx_Rmerge_I_obs                0.098 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.66 
_reflns_shell.d_res_low                   1.69 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.4 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.978 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             8.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5EWE 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.66 
_refine.ls_d_res_low                             42.990 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     54071 
_refine.ls_number_reflns_R_free                  2621 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.97 
_refine.ls_percent_reflns_R_free                 4.82 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1731 
_refine.ls_R_factor_R_free                       0.2074 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1714 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.02 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4O3N 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.71 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.18 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3261 
_refine_hist.pdbx_number_atoms_nucleic_acid   389 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             433 
_refine_hist.number_atoms_total               4126 
_refine_hist.d_res_high                       1.66 
_refine_hist.d_res_low                        42.990 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 3953 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.007  ? 5469 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 16.026 ? 2353 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.056  ? 619  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 638  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.6609 1.6798  . . 166 3412 100.00 . . . 0.3021 . 0.2757 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6798 1.6995  . . 192 3335 100.00 . . . 0.2662 . 0.2508 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6995 1.7203  . . 170 3384 100.00 . . . 0.3346 . 0.2575 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7203 1.7420  . . 162 3446 100.00 . . . 0.2648 . 0.2352 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7420 1.7650  . . 184 3349 100.00 . . . 0.2672 . 0.2271 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7650 1.7891  . . 154 3398 100.00 . . . 0.2737 . 0.2270 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7891 1.8147  . . 170 3375 100.00 . . . 0.2823 . 0.2240 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8147 1.8418  . . 142 3396 100.00 . . . 0.2158 . 0.2139 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8418 1.8706  . . 170 3383 100.00 . . . 0.2398 . 0.2126 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8706 1.9012  . . 182 3360 100.00 . . . 0.2698 . 0.2035 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9012 1.9340  . . 210 3347 100.00 . . . 0.2176 . 0.1935 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9340 1.9692  . . 122 3363 100.00 . . . 0.2190 . 0.1928 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9692 2.0071  . . 156 3442 100.00 . . . 0.2603 . 0.1793 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0071 2.0480  . . 192 3367 100.00 . . . 0.2189 . 0.1871 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0480 2.0926  . . 150 3353 100.00 . . . 0.2039 . 0.1756 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0926 2.1412  . . 184 3389 100.00 . . . 0.2197 . 0.1704 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1412 2.1948  . . 168 3366 100.00 . . . 0.2409 . 0.1655 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1948 2.2541  . . 154 3438 100.00 . . . 0.2481 . 0.1689 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2541 2.3204  . . 174 3336 100.00 . . . 0.1547 . 0.1617 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3204 2.3953  . . 166 3405 100.00 . . . 0.1892 . 0.1648 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3953 2.4809  . . 194 3395 100.00 . . . 0.2693 . 0.1789 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4809 2.5803  . . 186 3318 100.00 . . . 0.2175 . 0.1770 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5803 2.6977  . . 146 3419 100.00 . . . 0.1985 . 0.1715 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6977 2.8399  . . 168 3378 100.00 . . . 0.2079 . 0.1672 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8399 3.0177  . . 194 3357 100.00 . . . 0.2126 . 0.1668 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0177 3.2507  . . 164 3385 100.00 . . . 0.1918 . 0.1645 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2507 3.5777  . . 158 3394 100.00 . . . 0.1488 . 0.1413 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5777 4.0950  . . 210 3349 100.00 . . . 0.1658 . 0.1347 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0950 5.1579  . . 143 3410 100.00 . . . 0.1697 . 0.1379 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1579 43.0048 . . 208 3327 100.00 . . . 0.2082 . 0.1743 . . . . . . . . . . 
# 
_struct.entry_id                     5EWE 
_struct.title                        'Ternary complex of human DNA polymerase eta inserting rCTP opposite template G' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5EWE 
_struct_keywords.text            'Polymerase-DNA Complex ribonucleotide incorporation, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  AA6 LEU A 124 ? LYS A 134 ? LEU A 121 LYS A 131 1 ? 11 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? SER A 180 ? GLN A 162 SER A 177 1 ? 16 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? LEU A 232 ? ASN A 219 LEU A 229 1 ? 11 
HELX_P HELX_P11 AB2 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 AB3 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 AB4 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 AB5 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 AB6 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 AB7 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 AB8 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 AB9 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 AC1 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 AC2 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 AC3 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 E CA  . CA ? ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.251 ? 
metalc2  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 F CA  . CA ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            3.124 ? 
metalc3  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA ? ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.299 ? 
metalc4  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 F CA  . CA ? ? A ASP 115 A CA  503 1_555 ? ? ? ? ? ? ?            2.610 ? 
metalc5  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E CA  . CA ? ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc6  metalc ? ? A GLU 119 OE2   ? ? ? 1_555 F CA  . CA ? ? A GLU 116 A CA  503 1_555 ? ? ? ? ? ? ?            2.500 ? 
metalc7  metalc ? ? C DT  8   "O3'" A ? ? 1_555 F CA  . CA ? ? P DT  8   A CA  503 1_555 ? ? ? ? ? ? ?            2.283 ? 
metalc8  metalc ? ? C DT  8   "O3'" B ? ? 1_555 F CA  . CA ? ? P DT  8   A CA  503 1_555 ? ? ? ? ? ? ?            2.305 ? 
metalc9  metalc ? ? D CTP .   O1A   ? ? ? 1_555 E CA  . CA ? ? A CTP 501 A CA  502 1_555 ? ? ? ? ? ? ?            2.378 ? 
metalc10 metalc ? ? D CTP .   O1A   ? ? ? 1_555 F CA  . CA ? ? A CTP 501 A CA  503 1_555 ? ? ? ? ? ? ?            2.534 ? 
metalc11 metalc ? ? D CTP .   O1B   ? ? ? 1_555 E CA  . CA ? ? A CTP 501 A CA  502 1_555 ? ? ? ? ? ? ?            2.275 ? 
metalc12 metalc ? ? D CTP .   O1G   ? ? ? 1_555 E CA  . CA ? ? A CTP 501 A CA  502 1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc13 metalc ? ? F CA  .   CA    ? ? ? 1_555 I HOH . O  ? ? A CA  503 A HOH 638 1_555 ? ? ? ? ? ? ?            3.180 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3 A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4 A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 136 A . ? GLN 133 A GLY 137 A ? GLY 134 A 1 -1.75 
2 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 2.29  
3 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -2.89 
4 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -6.69 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA5 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 115 ? N ALA A 112 O GLU A 119 ? O GLU A 116 
AA1 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA4 2 3 O LEU A 422 ? O LEU A 419 N LEU A 334 ? N LEU A 331 
AA5 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CTP 501 ? 23 'binding site for residue CTP A 501' 
AC2 Software A CA  502 ? 5  'binding site for residue CA A 502'  
AC3 Software A CA  503 ? 6  'binding site for residue CA A 503'  
AC4 Software A GOL 504 ? 10 'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 5  'binding site for residue GOL A 505' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 23 MET A 17  ? MET A 14  . ? 1_555 ? 
3  AC1 23 ASP A 18  ? ASP A 15  . ? 1_555 ? 
4  AC1 23 CYS A 19  ? CYS A 16  . ? 1_555 ? 
5  AC1 23 PHE A 20  ? PHE A 17  . ? 1_555 ? 
6  AC1 23 PHE A 21  ? PHE A 18  . ? 1_555 ? 
7  AC1 23 TYR A 55  ? TYR A 52  . ? 1_555 ? 
8  AC1 23 ARG A 58  ? ARG A 55  . ? 1_555 ? 
9  AC1 23 ARG A 64  ? ARG A 61  . ? 1_555 ? 
10 AC1 23 ASP A 118 ? ASP A 115 . ? 1_555 ? 
11 AC1 23 LYS A 234 ? LYS A 231 . ? 1_555 ? 
12 AC1 23 CA  E .   ? CA  A 502 . ? 1_555 ? 
13 AC1 23 CA  F .   ? CA  A 503 . ? 1_555 ? 
14 AC1 23 HOH I .   ? HOH A 636 . ? 1_555 ? 
15 AC1 23 HOH I .   ? HOH A 638 . ? 1_555 ? 
16 AC1 23 HOH I .   ? HOH A 672 . ? 1_555 ? 
17 AC1 23 HOH I .   ? HOH A 679 . ? 1_555 ? 
18 AC1 23 HOH I .   ? HOH A 691 . ? 1_555 ? 
19 AC1 23 HOH I .   ? HOH A 724 . ? 1_555 ? 
20 AC1 23 HOH I .   ? HOH A 855 . ? 1_555 ? 
21 AC1 23 DT  C 8   ? DT  P 8   . ? 1_555 ? 
22 AC1 23 DG  B 4   ? DG  T 4   . ? 1_555 ? 
23 AC1 23 DA  B 5   ? DA  T 5   . ? 1_555 ? 
24 AC2 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
25 AC2 5  MET A 17  ? MET A 14  . ? 1_555 ? 
26 AC2 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
27 AC2 5  CTP D .   ? CTP A 501 . ? 1_555 ? 
28 AC2 5  CA  F .   ? CA  A 503 . ? 1_555 ? 
29 AC3 6  ASP A 16  ? ASP A 13  . ? 1_555 ? 
30 AC3 6  ASP A 118 ? ASP A 115 . ? 1_555 ? 
31 AC3 6  GLU A 119 ? GLU A 116 . ? 1_555 ? 
32 AC3 6  CTP D .   ? CTP A 501 . ? 1_555 ? 
33 AC3 6  CA  E .   ? CA  A 502 . ? 1_555 ? 
34 AC3 6  DT  C 8   ? DT  P 8   . ? 1_555 ? 
35 AC4 10 ARG A 27  ? ARG A 24  . ? 6_655 ? 
36 AC4 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
37 AC4 10 PHE A 250 ? PHE A 247 . ? 1_555 ? 
38 AC4 10 SER A 251 ? SER A 248 . ? 1_555 ? 
39 AC4 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
40 AC4 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
41 AC4 10 HOH I .   ? HOH A 670 . ? 1_555 ? 
42 AC4 10 HOH I .   ? HOH A 726 . ? 1_555 ? 
43 AC4 10 HOH I .   ? HOH A 746 . ? 1_555 ? 
44 AC4 10 HOH I .   ? HOH A 748 . ? 1_555 ? 
45 AC5 5  GLY A 274 ? GLY A 271 . ? 3_664 ? 
46 AC5 5  GLU A 280 ? GLU A 277 . ? 3_664 ? 
47 AC5 5  HOH I .   ? HOH A 620 . ? 1_555 ? 
48 AC5 5  HOH I .   ? HOH A 657 . ? 1_555 ? 
49 AC5 5  HOH I .   ? HOH A 759 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5EWE 
_atom_sites.fract_transf_matrix[1][1]   0.010072 
_atom_sites.fract_transf_matrix[1][2]   0.005815 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011631 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012211 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 63.715 40.341 1.067   1.00 48.67 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 63.464 41.769 1.153   1.00 51.07 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 62.891 42.382 -0.111  1.00 48.06 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 61.697 42.687 -0.168  1.00 49.18 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 63.740 42.563 -1.130  1.00 53.71 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 63.297 43.239 -2.363  1.00 38.81 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 62.310 42.442 -3.203  1.00 47.50 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 61.816 42.971 -4.208  1.00 52.22 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 64.611 43.458 -3.129  1.00 50.38 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 65.534 42.389 -2.611  1.00 45.96 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 65.174 42.221 -1.164  1.00 47.06 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 62.005 41.197 -2.840  1.00 37.42 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 61.087 40.364 -3.609  1.00 43.42 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 59.828 40.003 -2.834  1.00 42.38 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 59.038 39.179 -3.311  1.00 44.78 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 61.791 39.085 -4.072  1.00 34.22 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 63.123 39.333 -4.705  1.00 34.37 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 63.268 40.058 -5.868  1.00 30.63 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 64.371 38.965 -4.331  1.00 30.41 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 64.549 40.119 -6.189  1.00 33.75 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 65.239 39.463 -5.273  1.00 30.53 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 59.621 40.587 -1.656  1.00 41.49 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 58.483 40.249 -0.807  1.00 51.50 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 57.343 41.218 -1.101  1.00 43.97 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 57.454 42.419 -0.828  1.00 45.00 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 58.878 40.297 0.667   0.91 47.32 ? 1   MET A CB    1 
ATOM   27   N  N     . ALA A 1 5   ? 56.254 40.700 -1.664  1.00 42.89 ? 2   ALA A N     1 
ATOM   28   C  CA    . ALA A 1 5   ? 55.081 41.524 -1.928  1.00 38.09 ? 2   ALA A CA    1 
ATOM   29   C  C     . ALA A 1 5   ? 54.428 41.939 -0.617  1.00 36.11 ? 2   ALA A C     1 
ATOM   30   O  O     . ALA A 1 5   ? 54.337 41.151 0.328   1.00 37.38 ? 2   ALA A O     1 
ATOM   31   C  CB    . ALA A 1 5   ? 54.081 40.769 -2.806  0.96 39.99 ? 2   ALA A CB    1 
ATOM   32   N  N     . THR A 1 6   ? 53.979 43.194 -0.556  1.00 28.15 ? 3   THR A N     1 
ATOM   33   C  CA    . THR A 1 6   ? 53.477 43.777 0.679   1.00 24.02 ? 3   THR A CA    1 
ATOM   34   C  C     . THR A 1 6   ? 51.977 44.034 0.653   1.00 20.19 ? 3   THR A C     1 
ATOM   35   O  O     . THR A 1 6   ? 51.444 44.593 1.617   1.00 26.59 ? 3   THR A O     1 
ATOM   36   C  CB    . THR A 1 6   ? 54.207 45.086 0.983   1.00 25.86 ? 3   THR A CB    1 
ATOM   37   O  OG1   . THR A 1 6   ? 53.991 46.007 -0.093  1.00 23.11 ? 3   THR A OG1   1 
ATOM   38   C  CG2   . THR A 1 6   ? 55.714 44.837 1.160   1.00 32.09 ? 3   THR A CG2   1 
ATOM   39   N  N     . GLY A 1 7   ? 51.289 43.645 -0.417  1.00 22.36 ? 4   GLY A N     1 
ATOM   40   C  CA    . GLY A 1 7   ? 49.847 43.834 -0.477  1.00 22.08 ? 4   GLY A CA    1 
ATOM   41   C  C     . GLY A 1 7   ? 49.434 45.288 -0.413  1.00 25.97 ? 4   GLY A C     1 
ATOM   42   O  O     . GLY A 1 7   ? 48.442 45.621 0.251   1.00 21.88 ? 4   GLY A O     1 
ATOM   43   N  N     . GLN A 1 8   ? 50.187 46.170 -1.078  1.00 16.39 ? 5   GLN A N     1 
ATOM   44   C  CA    . GLN A 1 8   ? 49.913 47.604 -1.050  1.00 14.26 ? 5   GLN A CA    1 
ATOM   45   C  C     . GLN A 1 8   ? 49.544 48.137 -2.428  1.00 17.83 ? 5   GLN A C     1 
ATOM   46   O  O     . GLN A 1 8   ? 49.680 49.337 -2.678  1.00 19.32 ? 5   GLN A O     1 
ATOM   47   C  CB    . GLN A 1 8   ? 51.115 48.366 -0.483  1.00 15.50 ? 5   GLN A CB    1 
ATOM   48   C  CG    . GLN A 1 8   ? 51.290 48.190 1.022   1.00 21.17 ? 5   GLN A CG    1 
ATOM   49   C  CD    . GLN A 1 8   ? 52.523 48.901 1.560   1.00 18.23 ? 5   GLN A CD    1 
ATOM   50   O  OE1   . GLN A 1 8   ? 52.422 49.898 2.272   1.00 23.03 ? 5   GLN A OE1   1 
ATOM   51   N  NE2   . GLN A 1 8   ? 53.691 48.387 1.219   1.00 19.83 ? 5   GLN A NE2   1 
ATOM   52   N  N     . ASP A 1 9   ? 49.040 47.263 -3.303  1.00 19.54 ? 6   ASP A N     1 
ATOM   53   C  CA    . ASP A 1 9   ? 48.838 47.542 -4.717  1.00 20.55 ? 6   ASP A CA    1 
ATOM   54   C  C     . ASP A 1 9   ? 47.520 48.241 -5.027  1.00 20.59 ? 6   ASP A C     1 
ATOM   55   O  O     . ASP A 1 9   ? 47.371 48.778 -6.127  1.00 24.58 ? 6   ASP A O     1 
ATOM   56   C  CB    . ASP A 1 9   ? 48.883 46.233 -5.519  1.00 26.04 ? 6   ASP A CB    1 
ATOM   57   C  CG    . ASP A 1 9   ? 47.959 45.155 -4.939  1.00 33.44 ? 6   ASP A CG    1 
ATOM   58   O  OD1   . ASP A 1 9   ? 48.006 44.910 -3.710  1.00 26.81 ? 6   ASP A OD1   1 
ATOM   59   O  OD2   . ASP A 1 9   ? 47.170 44.556 -5.707  1.00 38.14 ? 6   ASP A OD2   1 
ATOM   60   N  N     . ARG A 1 10  ? 46.563 48.231 -4.106  1.00 13.72 ? 7   ARG A N     1 
ATOM   61   C  CA    . ARG A 1 10  ? 45.223 48.745 -4.349  1.00 14.89 ? 7   ARG A CA    1 
ATOM   62   C  C     . ARG A 1 10  ? 44.817 49.685 -3.227  1.00 14.42 ? 7   ARG A C     1 
ATOM   63   O  O     . ARG A 1 10  ? 45.346 49.607 -2.122  1.00 12.32 ? 7   ARG A O     1 
ATOM   64   C  CB    . ARG A 1 10  ? 44.190 47.618 -4.392  1.00 14.98 ? 7   ARG A CB    1 
ATOM   65   C  CG    . ARG A 1 10  ? 44.353 46.603 -5.499  1.00 15.75 ? 7   ARG A CG    1 
ATOM   66   C  CD    . ARG A 1 10  ? 43.256 45.564 -5.343  1.00 15.51 ? 7   ARG A CD    1 
ATOM   67   N  NE    . ARG A 1 10  ? 43.508 44.668 -4.215  1.00 15.27 ? 7   ARG A NE    1 
ATOM   68   C  CZ    . ARG A 1 10  ? 42.577 43.946 -3.592  1.00 13.02 ? 7   ARG A CZ    1 
ATOM   69   N  NH1   . ARG A 1 10  ? 41.302 44.001 -3.976  1.00 13.62 ? 7   ARG A NH1   1 
ATOM   70   N  NH2   . ARG A 1 10  ? 42.924 43.163 -2.575  1.00 14.02 ? 7   ARG A NH2   1 
ATOM   71   N  N     . VAL A 1 11  ? 43.846 50.551 -3.515  1.00 10.95 ? 8   VAL A N     1 
ATOM   72   C  CA    . VAL A 1 11  ? 43.128 51.320 -2.496  1.00 8.77  ? 8   VAL A CA    1 
ATOM   73   C  C     . VAL A 1 11  ? 41.687 50.822 -2.516  1.00 13.38 ? 8   VAL A C     1 
ATOM   74   O  O     . VAL A 1 11  ? 41.022 50.899 -3.557  1.00 11.62 ? 8   VAL A O     1 
ATOM   75   C  CB    . VAL A 1 11  ? 43.201 52.836 -2.762  1.00 11.08 ? 8   VAL A CB    1 
ATOM   76   C  CG1   . VAL A 1 11  ? 42.432 53.612 -1.669  1.00 12.91 ? 8   VAL A CG1   1 
ATOM   77   C  CG2   . VAL A 1 11  ? 44.663 53.306 -2.838  1.00 15.26 ? 8   VAL A CG2   1 
ATOM   78   N  N     . VAL A 1 12  ? 41.202 50.309 -1.374  1.00 11.78 ? 9   VAL A N     1 
ATOM   79   C  CA    . VAL A 1 12  ? 39.876 49.697 -1.277  1.00 10.90 ? 9   VAL A CA    1 
ATOM   80   C  C     . VAL A 1 12  ? 39.146 50.339 -0.106  1.00 11.11 ? 9   VAL A C     1 
ATOM   81   O  O     . VAL A 1 12  ? 39.725 50.514 0.973   1.00 11.74 ? 9   VAL A O     1 
ATOM   82   C  CB    . VAL A 1 12  ? 39.974 48.167 -1.094  1.00 9.19  ? 9   VAL A CB    1 
ATOM   83   C  CG1   . VAL A 1 12  ? 38.596 47.532 -0.813  1.00 12.32 ? 9   VAL A CG1   1 
ATOM   84   C  CG2   . VAL A 1 12  ? 40.644 47.526 -2.308  1.00 11.52 ? 9   VAL A CG2   1 
ATOM   85   N  N     . ALA A 1 13  ? 37.873 50.696 -0.306  1.00 10.78 ? 10  ALA A N     1 
ATOM   86   C  CA    . ALA A 1 13  ? 37.082 51.176 0.810   1.00 9.26  ? 10  ALA A CA    1 
ATOM   87   C  C     . ALA A 1 13  ? 35.881 50.260 1.025   1.00 12.30 ? 10  ALA A C     1 
ATOM   88   O  O     . ALA A 1 13  ? 35.434 49.569 0.112   1.00 13.22 ? 10  ALA A O     1 
ATOM   89   C  CB    . ALA A 1 13  ? 36.630 52.635 0.603   1.00 12.17 ? 10  ALA A CB    1 
ATOM   90   N  N     . LEU A 1 14  ? 35.383 50.230 2.256   1.00 8.26  ? 11  LEU A N     1 
ATOM   91   C  CA    . LEU A 1 14  ? 34.114 49.581 2.566   1.00 8.65  ? 11  LEU A CA    1 
ATOM   92   C  C     . LEU A 1 14  ? 33.222 50.640 3.197   1.00 12.89 ? 11  LEU A C     1 
ATOM   93   O  O     . LEU A 1 14  ? 33.618 51.267 4.183   1.00 12.44 ? 11  LEU A O     1 
ATOM   94   C  CB    . LEU A 1 14  ? 34.323 48.381 3.493   1.00 12.11 ? 11  LEU A CB    1 
ATOM   95   C  CG    . LEU A 1 14  ? 33.156 47.482 3.938   1.00 12.90 ? 11  LEU A CG    1 
ATOM   96   C  CD1   . LEU A 1 14  ? 32.410 48.035 5.158   1.00 14.61 ? 11  LEU A CD1   1 
ATOM   97   C  CD2   . LEU A 1 14  ? 32.150 47.250 2.777   1.00 11.72 ? 11  LEU A CD2   1 
ATOM   98   N  N     . VAL A 1 15  ? 32.040 50.860 2.615   1.00 8.41  ? 12  VAL A N     1 
ATOM   99   C  CA    . VAL A 1 15  ? 31.074 51.832 3.125   1.00 10.68 ? 12  VAL A CA    1 
ATOM   100  C  C     . VAL A 1 15  ? 29.915 51.060 3.737   1.00 14.68 ? 12  VAL A C     1 
ATOM   101  O  O     . VAL A 1 15  ? 29.402 50.116 3.124   1.00 13.66 ? 12  VAL A O     1 
ATOM   102  C  CB    . VAL A 1 15  ? 30.589 52.786 2.023   1.00 12.15 ? 12  VAL A CB    1 
ATOM   103  C  CG1   . VAL A 1 15  ? 29.501 53.721 2.582   1.00 14.91 ? 12  VAL A CG1   1 
ATOM   104  C  CG2   . VAL A 1 15  ? 31.758 53.577 1.449   1.00 13.61 ? 12  VAL A CG2   1 
ATOM   105  N  N     . ASP A 1 16  ? 29.520 51.447 4.958   1.00 11.45 ? 13  ASP A N     1 
ATOM   106  C  CA    . ASP A 1 16  ? 28.532 50.716 5.750   1.00 14.75 ? 13  ASP A CA    1 
ATOM   107  C  C     . ASP A 1 16  ? 27.558 51.735 6.333   1.00 13.12 ? 13  ASP A C     1 
ATOM   108  O  O     . ASP A 1 16  ? 27.966 52.579 7.127   1.00 12.49 ? 13  ASP A O     1 
ATOM   109  C  CB    . ASP A 1 16  ? 29.260 49.922 6.853   1.00 13.99 ? 13  ASP A CB    1 
ATOM   110  C  CG    . ASP A 1 16  ? 28.377 48.957 7.604   1.00 24.77 ? 13  ASP A CG    1 
ATOM   111  O  OD1   . ASP A 1 16  ? 27.196 49.239 7.769   1.00 20.38 ? 13  ASP A OD1   1 
ATOM   112  O  OD2   . ASP A 1 16  ? 28.892 47.912 8.069   1.00 35.12 ? 13  ASP A OD2   1 
ATOM   113  N  N     . MET A 1 17  ? 26.279 51.666 5.965   1.00 12.59 ? 14  MET A N     1 
ATOM   114  C  CA    . MET A 1 17  ? 25.332 52.657 6.475   1.00 11.26 ? 14  MET A CA    1 
ATOM   115  C  C     . MET A 1 17  ? 25.138 52.471 7.978   1.00 12.32 ? 14  MET A C     1 
ATOM   116  O  O     . MET A 1 17  ? 25.070 51.347 8.467   1.00 13.31 ? 14  MET A O     1 
ATOM   117  C  CB    . MET A 1 17  ? 23.978 52.534 5.773   1.00 12.03 ? 14  MET A CB    1 
ATOM   118  C  CG    . MET A 1 17  ? 24.058 52.564 4.258   1.00 12.39 ? 14  MET A CG    1 
ATOM   119  S  SD    . MET A 1 17  ? 24.895 54.010 3.597   1.00 16.89 ? 14  MET A SD    1 
ATOM   120  C  CE    . MET A 1 17  ? 23.845 55.347 4.123   1.00 16.62 ? 14  MET A CE    1 
ATOM   121  N  N     . ASP A 1 18  ? 25.071 53.581 8.721   1.00 10.16 ? 15  ASP A N     1 
ATOM   122  C  CA    . ASP A 1 18  ? 24.843 53.488 10.163  1.00 10.47 ? 15  ASP A CA    1 
ATOM   123  C  C     . ASP A 1 18  ? 23.378 53.173 10.439  1.00 11.96 ? 15  ASP A C     1 
ATOM   124  O  O     . ASP A 1 18  ? 22.498 53.775 9.823   1.00 11.00 ? 15  ASP A O     1 
ATOM   125  C  CB    . ASP A 1 18  ? 25.219 54.798 10.849  1.00 11.19 ? 15  ASP A CB    1 
ATOM   126  C  CG    . ASP A 1 18  ? 26.693 55.154 10.667  1.00 12.19 ? 15  ASP A CG    1 
ATOM   127  O  OD1   . ASP A 1 18  ? 27.536 54.241 10.699  1.00 13.78 ? 15  ASP A OD1   1 
ATOM   128  O  OD2   . ASP A 1 18  ? 26.994 56.351 10.528  1.00 17.04 ? 15  ASP A OD2   1 
ATOM   129  N  N     . CYS A 1 19  ? 23.124 52.260 11.395  1.00 11.38 ? 16  CYS A N     1 
ATOM   130  C  CA    . CYS A 1 19  ? 21.778 51.800 11.784  1.00 10.69 ? 16  CYS A CA    1 
ATOM   131  C  C     . CYS A 1 19  ? 20.737 52.006 10.682  1.00 9.99  ? 16  CYS A C     1 
ATOM   132  O  O     . CYS A 1 19  ? 19.798 52.806 10.830  1.00 9.78  ? 16  CYS A O     1 
ATOM   133  C  CB    . CYS A 1 19  ? 21.321 52.476 13.083  1.00 14.62 ? 16  CYS A CB    1 
ATOM   134  S  SG    . CYS A 1 19  ? 21.419 54.264 13.172  1.00 18.22 ? 16  CYS A SG    1 
ATOM   135  N  N     . PHE A 1 20  ? 20.913 51.287 9.577   1.00 9.51  ? 17  PHE A N     1 
ATOM   136  C  CA    . PHE A 1 20  ? 20.356 51.703 8.291   1.00 9.21  ? 17  PHE A CA    1 
ATOM   137  C  C     . PHE A 1 20  ? 18.838 51.796 8.325   1.00 8.88  ? 17  PHE A C     1 
ATOM   138  O  O     . PHE A 1 20  ? 18.268 52.824 7.931   1.00 9.14  ? 17  PHE A O     1 
ATOM   139  C  CB    . PHE A 1 20  ? 20.807 50.739 7.193   1.00 10.42 ? 17  PHE A CB    1 
ATOM   140  C  CG    . PHE A 1 20  ? 20.314 51.120 5.822   1.00 11.03 ? 17  PHE A CG    1 
ATOM   141  C  CD1   . PHE A 1 20  ? 20.443 52.424 5.372   1.00 12.39 ? 17  PHE A CD1   1 
ATOM   142  C  CD2   . PHE A 1 20  ? 19.700 50.182 5.010   1.00 17.81 ? 17  PHE A CD2   1 
ATOM   143  C  CE1   . PHE A 1 20  ? 19.979 52.783 4.101   1.00 16.71 ? 17  PHE A CE1   1 
ATOM   144  C  CE2   . PHE A 1 20  ? 19.239 50.544 3.735   1.00 15.21 ? 17  PHE A CE2   1 
ATOM   145  C  CZ    . PHE A 1 20  ? 19.384 51.833 3.300   1.00 16.49 ? 17  PHE A CZ    1 
ATOM   146  N  N     . PHE A 1 21  ? 18.161 50.732 8.780   1.00 9.63  ? 18  PHE A N     1 
ATOM   147  C  CA    . PHE A 1 21  ? 16.699 50.758 8.736   1.00 9.49  ? 18  PHE A CA    1 
ATOM   148  C  C     . PHE A 1 21  ? 16.157 51.857 9.640   1.00 9.44  ? 18  PHE A C     1 
ATOM   149  O  O     . PHE A 1 21  ? 15.104 52.439 9.354   1.00 10.36 ? 18  PHE A O     1 
ATOM   150  C  CB    . PHE A 1 21  ? 16.093 49.421 9.163   1.00 9.40  ? 18  PHE A CB    1 
ATOM   151  C  CG    . PHE A 1 21  ? 16.206 48.309 8.157   1.00 10.92 ? 18  PHE A CG    1 
ATOM   152  C  CD1   . PHE A 1 21  ? 17.093 48.355 7.103   1.00 12.93 ? 18  PHE A CD1   1 
ATOM   153  C  CD2   . PHE A 1 21  ? 15.401 47.190 8.295   1.00 12.33 ? 18  PHE A CD2   1 
ATOM   154  C  CE1   . PHE A 1 21  ? 17.188 47.304 6.211   1.00 16.90 ? 18  PHE A CE1   1 
ATOM   155  C  CE2   . PHE A 1 21  ? 15.478 46.149 7.391   1.00 14.15 ? 18  PHE A CE2   1 
ATOM   156  C  CZ    . PHE A 1 21  ? 16.383 46.201 6.356   1.00 17.07 ? 18  PHE A CZ    1 
ATOM   157  N  N     . VAL A 1 22  ? 16.835 52.121 10.759  1.00 8.51  ? 19  VAL A N     1 
ATOM   158  C  CA    . VAL A 1 22  ? 16.429 53.222 11.635  1.00 8.50  ? 19  VAL A CA    1 
ATOM   159  C  C     . VAL A 1 22  ? 16.533 54.561 10.898  1.00 11.49 ? 19  VAL A C     1 
ATOM   160  O  O     . VAL A 1 22  ? 15.618 55.392 10.955  1.00 9.82  ? 19  VAL A O     1 
ATOM   161  C  CB    . VAL A 1 22  ? 17.276 53.204 12.924  1.00 9.94  ? 19  VAL A CB    1 
ATOM   162  C  CG1   . VAL A 1 22  ? 17.145 54.518 13.706  1.00 12.37 ? 19  VAL A CG1   1 
ATOM   163  C  CG2   . VAL A 1 22  ? 16.871 52.018 13.793  1.00 12.44 ? 19  VAL A CG2   1 
ATOM   164  N  N     . GLN A 1 23  ? 17.646 54.792 10.180  1.00 8.54  ? 20  GLN A N     1 
ATOM   165  C  CA    . GLN A 1 23  ? 17.762 56.040 9.420   1.00 9.33  ? 20  GLN A CA    1 
ATOM   166  C  C     . GLN A 1 23  ? 16.654 56.172 8.378   1.00 10.12 ? 20  GLN A C     1 
ATOM   167  O  O     . GLN A 1 23  ? 16.150 57.280 8.150   1.00 10.11 ? 20  GLN A O     1 
ATOM   168  C  CB    . GLN A 1 23  ? 19.120 56.144 8.726   1.00 10.31 ? 20  GLN A CB    1 
ATOM   169  C  CG    . GLN A 1 23  ? 20.258 56.421 9.666   1.00 11.42 ? 20  GLN A CG    1 
ATOM   170  C  CD    . GLN A 1 23  ? 21.442 56.981 8.912   1.00 11.69 ? 20  GLN A CD    1 
ATOM   171  O  OE1   . GLN A 1 23  ? 21.501 58.181 8.639   1.00 14.49 ? 20  GLN A OE1   1 
ATOM   172  N  NE2   . GLN A 1 23  ? 22.378 56.118 8.553   1.00 13.64 ? 20  GLN A NE2   1 
ATOM   173  N  N     . VAL A 1 24  ? 16.287 55.070 7.714   1.00 8.79  ? 21  VAL A N     1 
ATOM   174  C  CA    . VAL A 1 24  ? 15.217 55.141 6.717   1.00 7.76  ? 21  VAL A CA    1 
ATOM   175  C  C     . VAL A 1 24  ? 13.916 55.581 7.379   1.00 10.74 ? 21  VAL A C     1 
ATOM   176  O  O     . VAL A 1 24  ? 13.209 56.472 6.884   1.00 10.47 ? 21  VAL A O     1 
ATOM   177  C  CB    . VAL A 1 24  ? 15.055 53.794 5.985   1.00 7.21  ? 21  VAL A CB    1 
ATOM   178  C  CG1   . VAL A 1 24  ? 13.888 53.862 4.983   1.00 11.24 ? 21  VAL A CG1   1 
ATOM   179  C  CG2   . VAL A 1 24  ? 16.333 53.433 5.240   1.00 9.50  ? 21  VAL A CG2   1 
ATOM   180  N  N     . GLU A 1 25  ? 13.601 54.989 8.530   1.00 10.53 ? 22  GLU A N     1 
ATOM   181  C  CA    . GLU A 1 25  ? 12.373 55.358 9.240   1.00 8.62  ? 22  GLU A CA    1 
ATOM   182  C  C     . GLU A 1 25  ? 12.467 56.745 9.867   1.00 11.07 ? 22  GLU A C     1 
ATOM   183  O  O     . GLU A 1 25  ? 11.449 57.442 9.953   1.00 11.56 ? 22  GLU A O     1 
ATOM   184  C  CB    . GLU A 1 25  ? 12.048 54.309 10.308  1.00 8.23  ? 22  GLU A CB    1 
ATOM   185  C  CG    . GLU A 1 25  ? 11.785 52.929 9.731   1.00 11.47 ? 22  GLU A CG    1 
ATOM   186  C  CD    . GLU A 1 25  ? 10.506 52.850 8.907   1.00 16.09 ? 22  GLU A CD    1 
ATOM   187  O  OE1   . GLU A 1 25  ? 9.584  53.679 9.115   1.00 14.38 ? 22  GLU A OE1   1 
ATOM   188  O  OE2   . GLU A 1 25  ? 10.420 51.943 8.056   1.00 17.07 ? 22  GLU A OE2   1 
ATOM   189  N  N     . GLN A 1 26  ? 13.673 57.177 10.272  1.00 9.23  ? 23  GLN A N     1 
ATOM   190  C  CA    . GLN A 1 26  ? 13.812 58.522 10.828  1.00 9.59  ? 23  GLN A CA    1 
ATOM   191  C  C     . GLN A 1 26  ? 13.699 59.588 9.748   1.00 12.17 ? 23  GLN A C     1 
ATOM   192  O  O     . GLN A 1 26  ? 13.170 60.675 10.001  1.00 12.19 ? 23  GLN A O     1 
ATOM   193  C  CB    . GLN A 1 26  ? 15.144 58.662 11.558  1.00 8.83  ? 23  GLN A CB    1 
ATOM   194  C  CG    . GLN A 1 26  ? 15.185 57.906 12.887  1.00 12.52 ? 23  GLN A CG    1 
ATOM   195  C  CD    . GLN A 1 26  ? 16.572 57.962 13.501  1.00 11.77 ? 23  GLN A CD    1 
ATOM   196  O  OE1   . GLN A 1 26  ? 17.577 57.894 12.779  1.00 13.40 ? 23  GLN A OE1   1 
ATOM   197  N  NE2   . GLN A 1 26  ? 16.639 58.109 14.825  1.00 14.50 ? 23  GLN A NE2   1 
ATOM   198  N  N     . ARG A 1 27  ? 14.190 59.303 8.545   1.00 9.36  ? 24  ARG A N     1 
ATOM   199  C  CA    . ARG A 1 27  ? 14.000 60.255 7.456   1.00 11.44 ? 24  ARG A CA    1 
ATOM   200  C  C     . ARG A 1 27  ? 12.520 60.456 7.177   1.00 10.79 ? 24  ARG A C     1 
ATOM   201  O  O     . ARG A 1 27  ? 12.060 61.589 7.017   1.00 10.74 ? 24  ARG A O     1 
ATOM   202  C  CB    . ARG A 1 27  ? 14.718 59.776 6.196   1.00 10.69 ? 24  ARG A CB    1 
ATOM   203  C  CG    . ARG A 1 27  ? 14.644 60.810 5.075   1.00 11.63 ? 24  ARG A CG    1 
ATOM   204  C  CD    . ARG A 1 27  ? 15.448 60.384 3.838   1.00 11.30 ? 24  ARG A CD    1 
ATOM   205  N  NE    . ARG A 1 27  ? 14.836 59.233 3.159   1.00 10.85 ? 24  ARG A NE    1 
ATOM   206  C  CZ    . ARG A 1 27  ? 15.237 58.760 1.985   1.00 10.95 ? 24  ARG A CZ    1 
ATOM   207  N  NH1   . ARG A 1 27  ? 16.261 59.333 1.354   1.00 9.50  ? 24  ARG A NH1   1 
ATOM   208  N  NH2   . ARG A 1 27  ? 14.608 57.723 1.434   1.00 12.33 ? 24  ARG A NH2   1 
ATOM   209  N  N     . GLN A 1 28  ? 11.759 59.359 7.165   1.00 9.19  ? 25  GLN A N     1 
ATOM   210  C  CA    . GLN A 1 28  ? 10.343 59.409 6.818   1.00 10.25 ? 25  GLN A CA    1 
ATOM   211  C  C     . GLN A 1 28  ? 9.518  60.065 7.912   1.00 10.79 ? 25  GLN A C     1 
ATOM   212  O  O     . GLN A 1 28  ? 8.558  60.791 7.620   1.00 12.15 ? 25  GLN A O     1 
ATOM   213  C  CB    . GLN A 1 28  ? 9.840  57.992 6.550   1.00 12.05 ? 25  GLN A CB    1 
ATOM   214  C  CG    . GLN A 1 28  ? 8.390  57.899 6.081   1.00 16.40 ? 25  GLN A CG    1 
ATOM   215  C  CD    . GLN A 1 28  ? 7.920  56.442 6.055   1.00 21.65 ? 25  GLN A CD    1 
ATOM   216  O  OE1   . GLN A 1 28  ? 8.603  55.575 5.516   1.00 20.92 ? 25  GLN A OE1   1 
ATOM   217  N  NE2   . GLN A 1 28  ? 6.771  56.173 6.662   1.00 27.14 ? 25  GLN A NE2   1 
ATOM   218  N  N     . ASN A 1 29  ? 9.855  59.799 9.176   1.00 9.42  ? 26  ASN A N     1 
ATOM   219  C  CA    . ASN A 1 29  ? 9.092  60.266 10.334  1.00 13.68 ? 26  ASN A CA    1 
ATOM   220  C  C     . ASN A 1 29  ? 10.000 61.101 11.222  1.00 11.07 ? 26  ASN A C     1 
ATOM   221  O  O     . ASN A 1 29  ? 10.707 60.564 12.090  1.00 10.51 ? 26  ASN A O     1 
ATOM   222  C  CB    . ASN A 1 29  ? 8.503  59.106 11.138  1.00 15.39 ? 26  ASN A CB    1 
ATOM   223  C  CG    . ASN A 1 29  ? 7.623  59.601 12.312  1.00 16.92 ? 26  ASN A CG    1 
ATOM   224  O  OD1   . ASN A 1 29  ? 7.579  60.792 12.599  1.00 17.15 ? 26  ASN A OD1   1 
ATOM   225  N  ND2   . ASN A 1 29  ? 6.930  58.680 12.981  1.00 19.58 ? 26  ASN A ND2   1 
ATOM   226  N  N     . PRO A 1 30  ? 10.004 62.422 11.046  1.00 11.63 ? 27  PRO A N     1 
ATOM   227  C  CA    . PRO A 1 30  ? 10.887 63.284 11.849  1.00 12.83 ? 27  PRO A CA    1 
ATOM   228  C  C     . PRO A 1 30  ? 10.709 63.146 13.359  1.00 12.27 ? 27  PRO A C     1 
ATOM   229  O  O     . PRO A 1 30  ? 11.651 63.457 14.103  1.00 14.04 ? 27  PRO A O     1 
ATOM   230  C  CB    . PRO A 1 30  ? 10.506 64.694 11.379  1.00 17.56 ? 27  PRO A CB    1 
ATOM   231  C  CG    . PRO A 1 30  ? 10.010 64.486 9.979   1.00 17.53 ? 27  PRO A CG    1 
ATOM   232  C  CD    . PRO A 1 30  ? 9.333  63.143 9.952   1.00 11.69 ? 27  PRO A CD    1 
ATOM   233  N  N     . HIS A 1 31  ? 9.557  62.668 13.836  1.00 13.72 ? 28  HIS A N     1 
ATOM   234  C  CA    . HIS A 1 31  ? 9.389  62.487 15.275  1.00 18.67 ? 28  HIS A CA    1 
ATOM   235  C  C     . HIS A 1 31  ? 10.324 61.436 15.846  1.00 16.08 ? 28  HIS A C     1 
ATOM   236  O  O     . HIS A 1 31  ? 10.510 61.400 17.064  1.00 16.14 ? 28  HIS A O     1 
ATOM   237  C  CB    . HIS A 1 31  ? 7.948  62.106 15.615  1.00 18.28 ? 28  HIS A CB    1 
ATOM   238  C  CG    . HIS A 1 31  ? 6.968  63.204 15.356  1.00 24.83 ? 28  HIS A CG    1 
ATOM   239  N  ND1   . HIS A 1 31  ? 6.961  64.378 16.076  1.00 33.13 ? 28  HIS A ND1   1 
ATOM   240  C  CD2   . HIS A 1 31  ? 5.980  63.319 14.439  1.00 38.28 ? 28  HIS A CD2   1 
ATOM   241  C  CE1   . HIS A 1 31  ? 6.003  65.165 15.621  1.00 32.10 ? 28  HIS A CE1   1 
ATOM   242  N  NE2   . HIS A 1 31  ? 5.392  64.546 14.627  1.00 41.44 ? 28  HIS A NE2   1 
ATOM   243  N  N     . LEU A 1 32  ? 10.920 60.588 15.008  1.00 13.09 ? 29  LEU A N     1 
ATOM   244  C  CA    . LEU A 1 32  ? 11.837 59.564 15.498  1.00 11.47 ? 29  LEU A CA    1 
ATOM   245  C  C     . LEU A 1 32  ? 13.293 60.029 15.527  1.00 15.61 ? 29  LEU A C     1 
ATOM   246  O  O     . LEU A 1 32  ? 14.149 59.333 16.094  1.00 11.80 ? 29  LEU A O     1 
ATOM   247  C  CB    . LEU A 1 32  ? 11.726 58.298 14.631  1.00 11.96 ? 29  LEU A CB    1 
ATOM   248  C  CG    . LEU A 1 32  ? 10.348 57.640 14.532  1.00 15.21 ? 29  LEU A CG    1 
ATOM   249  C  CD1   . LEU A 1 32  ? 10.390 56.451 13.565  1.00 15.12 ? 29  LEU A CD1   1 
ATOM   250  C  CD2   . LEU A 1 32  ? 9.870  57.190 15.912  1.00 16.12 ? 29  LEU A CD2   1 
ATOM   251  N  N     . ARG A 1 33  ? 13.593 61.188 14.944  1.00 11.98 ? 30  ARG A N     1 
ATOM   252  C  CA    . ARG A 1 33  ? 14.974 61.638 14.839  1.00 12.33 ? 30  ARG A CA    1 
ATOM   253  C  C     . ARG A 1 33  ? 15.543 61.980 16.205  1.00 12.89 ? 30  ARG A C     1 
ATOM   254  O  O     . ARG A 1 33  ? 14.854 62.543 17.064  1.00 14.98 ? 30  ARG A O     1 
ATOM   255  C  CB    . ARG A 1 33  ? 15.077 62.857 13.912  1.00 11.37 ? 30  ARG A CB    1 
ATOM   256  C  CG    . ARG A 1 33  ? 14.610 62.546 12.482  1.00 11.42 ? 30  ARG A CG    1 
ATOM   257  C  CD    . ARG A 1 33  ? 14.598 63.776 11.594  1.00 14.27 ? 30  ARG A CD    1 
ATOM   258  N  NE    . ARG A 1 33  ? 14.105 63.444 10.254  1.00 15.07 ? 30  ARG A NE    1 
ATOM   259  C  CZ    . ARG A 1 33  ? 14.065 64.313 9.251   1.00 16.95 ? 30  ARG A CZ    1 
ATOM   260  N  NH1   . ARG A 1 33  ? 14.501 65.552 9.460   1.00 16.30 ? 30  ARG A NH1   1 
ATOM   261  N  NH2   . ARG A 1 33  ? 13.599 63.947 8.056   1.00 15.57 ? 30  ARG A NH2   1 
ATOM   262  N  N     . ASN A 1 34  ? 16.809 61.604 16.401  1.00 16.37 ? 31  ASN A N     1 
ATOM   263  C  CA    . ASN A 1 34  ? 17.549 61.913 17.627  1.00 19.52 ? 31  ASN A CA    1 
ATOM   264  C  C     . ASN A 1 34  ? 16.881 61.319 18.857  1.00 22.23 ? 31  ASN A C     1 
ATOM   265  O  O     . ASN A 1 34  ? 16.901 61.916 19.937  1.00 23.67 ? 31  ASN A O     1 
ATOM   266  C  CB    . ASN A 1 34  ? 17.717 63.423 17.791  1.00 23.28 ? 31  ASN A CB    1 
ATOM   267  C  CG    . ASN A 1 34  ? 18.358 64.048 16.585  1.00 26.53 ? 31  ASN A CG    1 
ATOM   268  O  OD1   . ASN A 1 34  ? 19.422 63.612 16.141  1.00 34.52 ? 31  ASN A OD1   1 
ATOM   269  N  ND2   . ASN A 1 34  ? 17.689 65.026 16.006  1.00 31.13 ? 31  ASN A ND2   1 
ATOM   270  N  N     . LYS A 1 35  ? 16.267 60.150 18.700  1.00 15.46 ? 32  LYS A N     1 
ATOM   271  C  CA    . LYS A 1 35  ? 15.551 59.498 19.785  1.00 18.13 ? 32  LYS A CA    1 
ATOM   272  C  C     . LYS A 1 35  ? 16.046 58.068 19.916  1.00 13.85 ? 32  LYS A C     1 
ATOM   273  O  O     . LYS A 1 35  ? 16.517 57.487 18.937  1.00 14.93 ? 32  LYS A O     1 
ATOM   274  C  CB    . LYS A 1 35  ? 14.033 59.476 19.529  1.00 19.51 ? 32  LYS A CB    1 
ATOM   275  C  CG    . LYS A 1 35  ? 13.340 60.836 19.527  1.00 24.37 ? 32  LYS A CG    1 
ATOM   276  C  CD    . LYS A 1 35  ? 13.281 61.423 20.921  1.00 35.21 ? 32  LYS A CD    1 
ATOM   277  C  CE    . LYS A 1 35  ? 12.112 62.391 21.059  1.00 43.44 ? 32  LYS A CE    1 
ATOM   278  N  NZ    . LYS A 1 35  ? 12.021 63.299 19.880  1.00 44.93 ? 32  LYS A NZ    1 
ATOM   279  N  N     . PRO A 1 36  ? 15.938 57.466 21.103  1.00 13.06 ? 33  PRO A N     1 
ATOM   280  C  CA    . PRO A 1 36  ? 16.118 56.010 21.183  1.00 12.50 ? 33  PRO A CA    1 
ATOM   281  C  C     . PRO A 1 36  ? 14.982 55.349 20.421  1.00 11.67 ? 33  PRO A C     1 
ATOM   282  O  O     . PRO A 1 36  ? 13.804 55.505 20.766  1.00 13.28 ? 33  PRO A O     1 
ATOM   283  C  CB    . PRO A 1 36  ? 16.052 55.717 22.687  1.00 13.77 ? 33  PRO A CB    1 
ATOM   284  C  CG    . PRO A 1 36  ? 15.211 56.815 23.245  1.00 17.79 ? 33  PRO A CG    1 
ATOM   285  C  CD    . PRO A 1 36  ? 15.470 58.041 22.380  1.00 14.56 ? 33  PRO A CD    1 
ATOM   286  N  N     A CYS A 1 37  ? 15.330 54.625 19.371  0.72 12.12 ? 34  CYS A N     1 
ATOM   287  N  N     B CYS A 1 37  ? 15.341 54.598 19.375  0.28 12.10 ? 34  CYS A N     1 
ATOM   288  C  CA    A CYS A 1 37  ? 14.283 53.949 18.642  0.72 9.63  ? 34  CYS A CA    1 
ATOM   289  C  CA    B CYS A 1 37  ? 14.390 54.104 18.383  0.28 10.31 ? 34  CYS A CA    1 
ATOM   290  C  C     A CYS A 1 37  ? 14.846 52.684 18.030  0.72 10.10 ? 34  CYS A C     1 
ATOM   291  C  C     B CYS A 1 37  ? 14.877 52.765 17.833  0.28 10.21 ? 34  CYS A C     1 
ATOM   292  O  O     A CYS A 1 37  ? 16.051 52.433 18.052  0.72 12.32 ? 34  CYS A O     1 
ATOM   293  O  O     B CYS A 1 37  ? 16.082 52.542 17.704  0.28 12.27 ? 34  CYS A O     1 
ATOM   294  C  CB    A CYS A 1 37  ? 13.657 54.868 17.594  0.72 12.39 ? 34  CYS A CB    1 
ATOM   295  C  CB    B CYS A 1 37  ? 14.224 55.141 17.257  0.28 13.59 ? 34  CYS A CB    1 
ATOM   296  S  SG    A CYS A 1 37  ? 14.803 55.535 16.379  0.72 15.42 ? 34  CYS A SG    1 
ATOM   297  S  SG    B CYS A 1 37  ? 13.199 54.694 15.824  0.28 9.51  ? 34  CYS A SG    1 
ATOM   298  N  N     . ALA A 1 38  ? 13.934 51.868 17.520  1.00 10.54 ? 35  ALA A N     1 
ATOM   299  C  CA    . ALA A 1 38  ? 14.277 50.590 16.922  1.00 10.05 ? 35  ALA A CA    1 
ATOM   300  C  C     . ALA A 1 38  ? 13.254 50.265 15.853  1.00 11.97 ? 35  ALA A C     1 
ATOM   301  O  O     . ALA A 1 38  ? 12.134 50.771 15.875  1.00 9.95  ? 35  ALA A O     1 
ATOM   302  C  CB    . ALA A 1 38  ? 14.334 49.470 17.968  1.00 11.39 ? 35  ALA A CB    1 
ATOM   303  N  N     . VAL A 1 39  ? 13.657 49.414 14.912  1.00 9.62  ? 36  VAL A N     1 
ATOM   304  C  CA    . VAL A 1 39  ? 12.775 48.902 13.862  1.00 8.64  ? 36  VAL A CA    1 
ATOM   305  C  C     . VAL A 1 39  ? 12.474 47.450 14.198  1.00 13.37 ? 36  VAL A C     1 
ATOM   306  O  O     . VAL A 1 39  ? 13.382 46.691 14.556  1.00 10.93 ? 36  VAL A O     1 
ATOM   307  C  CB    . VAL A 1 39  ? 13.419 49.048 12.473  1.00 11.08 ? 36  VAL A CB    1 
ATOM   308  C  CG1   . VAL A 1 39  ? 12.519 48.444 11.376  1.00 12.87 ? 36  VAL A CG1   1 
ATOM   309  C  CG2   . VAL A 1 39  ? 13.680 50.512 12.186  1.00 13.24 ? 36  VAL A CG2   1 
ATOM   310  N  N     A VAL A 1 40  ? 11.190 47.082 14.147  0.70 11.12 ? 37  VAL A N     1 
ATOM   311  N  N     B VAL A 1 40  ? 11.213 47.049 14.038  0.30 11.22 ? 37  VAL A N     1 
ATOM   312  C  CA    A VAL A 1 40  ? 10.745 45.748 14.529  0.70 10.72 ? 37  VAL A CA    1 
ATOM   313  C  CA    B VAL A 1 40  ? 10.717 45.783 14.568  0.30 10.84 ? 37  VAL A CA    1 
ATOM   314  C  C     A VAL A 1 40  ? 10.062 45.083 13.347  0.70 12.35 ? 37  VAL A C     1 
ATOM   315  C  C     B VAL A 1 40  ? 9.877  45.075 13.509  0.30 12.52 ? 37  VAL A C     1 
ATOM   316  O  O     A VAL A 1 40  ? 9.531  45.736 12.449  0.70 13.55 ? 37  VAL A O     1 
ATOM   317  O  O     B VAL A 1 40  ? 9.061  45.710 12.832  0.30 11.60 ? 37  VAL A O     1 
ATOM   318  C  CB    A VAL A 1 40  ? 9.781  45.761 15.741  0.70 14.19 ? 37  VAL A CB    1 
ATOM   319  C  CB    B VAL A 1 40  ? 9.890  46.033 15.848  0.30 14.06 ? 37  VAL A CB    1 
ATOM   320  C  CG1   A VAL A 1 40  ? 10.522 46.106 17.023  0.70 15.52 ? 37  VAL A CG1   1 
ATOM   321  C  CG1   B VAL A 1 40  ? 9.167  44.794 16.267  0.30 11.80 ? 37  VAL A CG1   1 
ATOM   322  C  CG2   A VAL A 1 40  ? 8.611  46.732 15.515  0.70 9.96  ? 37  VAL A CG2   1 
ATOM   323  C  CG2   B VAL A 1 40  ? 10.780 46.534 16.980  0.30 14.82 ? 37  VAL A CG2   1 
ATOM   324  N  N     . GLN A 1 41  ? 10.052 43.756 13.374  1.00 12.78 ? 38  GLN A N     1 
ATOM   325  C  CA    . GLN A 1 41  ? 9.246  42.975 12.440  1.00 14.32 ? 38  GLN A CA    1 
ATOM   326  C  C     . GLN A 1 41  ? 8.260  42.123 13.222  1.00 13.53 ? 38  GLN A C     1 
ATOM   327  O  O     . GLN A 1 41  ? 8.624  41.498 14.228  1.00 14.61 ? 38  GLN A O     1 
ATOM   328  C  CB    . GLN A 1 41  ? 10.094 42.122 11.495  1.00 19.94 ? 38  GLN A CB    1 
ATOM   329  C  CG    . GLN A 1 41  ? 10.993 41.104 12.119  1.00 21.20 ? 38  GLN A CG    1 
ATOM   330  C  CD    . GLN A 1 41  ? 11.933 40.499 11.083  1.00 29.66 ? 38  GLN A CD    1 
ATOM   331  O  OE1   . GLN A 1 41  ? 11.937 40.905 9.916   1.00 25.27 ? 38  GLN A OE1   1 
ATOM   332  N  NE2   . GLN A 1 41  ? 12.726 39.520 11.503  1.00 37.15 ? 38  GLN A NE2   1 
ATOM   333  N  N     . TYR A 1 42  ? 7.004  42.150 12.766  1.00 13.58 ? 39  TYR A N     1 
ATOM   334  C  CA    . TYR A 1 42  ? 5.862  41.504 13.397  1.00 16.13 ? 39  TYR A CA    1 
ATOM   335  C  C     . TYR A 1 42  ? 5.578  42.244 14.699  1.00 20.11 ? 39  TYR A C     1 
ATOM   336  O  O     . TYR A 1 42  ? 6.231  43.253 14.992  1.00 21.94 ? 39  TYR A O     1 
ATOM   337  C  CB    . TYR A 1 42  ? 6.110  39.999 13.570  1.00 14.48 ? 39  TYR A CB    1 
ATOM   338  C  CG    . TYR A 1 42  ? 6.389  39.325 12.233  1.00 15.04 ? 39  TYR A CG    1 
ATOM   339  C  CD1   . TYR A 1 42  ? 5.395  39.223 11.269  1.00 15.19 ? 39  TYR A CD1   1 
ATOM   340  C  CD2   . TYR A 1 42  ? 7.654  38.825 11.918  1.00 11.81 ? 39  TYR A CD2   1 
ATOM   341  C  CE1   . TYR A 1 42  ? 5.652  38.625 10.027  1.00 17.28 ? 39  TYR A CE1   1 
ATOM   342  C  CE2   . TYR A 1 42  ? 7.917  38.221 10.686  1.00 17.89 ? 39  TYR A CE2   1 
ATOM   343  C  CZ    . TYR A 1 42  ? 6.911  38.126 9.744   1.00 16.50 ? 39  TYR A CZ    1 
ATOM   344  O  OH    . TYR A 1 42  ? 7.163  37.526 8.514   1.00 18.56 ? 39  TYR A OH    1 
ATOM   345  N  N     . LYS A 1 43  ? 4.590  41.808 15.465  1.00 23.11 ? 40  LYS A N     1 
ATOM   346  C  CA    . LYS A 1 43  ? 4.200  42.638 16.602  1.00 25.81 ? 40  LYS A CA    1 
ATOM   347  C  C     . LYS A 1 43  ? 3.507  41.828 17.681  1.00 30.14 ? 40  LYS A C     1 
ATOM   348  O  O     . LYS A 1 43  ? 3.601  42.165 18.865  1.00 24.20 ? 40  LYS A O     1 
ATOM   349  C  CB    . LYS A 1 43  ? 3.291  43.782 16.142  1.00 31.49 ? 40  LYS A CB    1 
ATOM   350  C  CG    . LYS A 1 43  ? 3.034  44.854 17.198  0.52 32.69 ? 40  LYS A CG    1 
ATOM   351  C  CD    . LYS A 1 43  ? 4.197  45.841 17.304  0.72 32.24 ? 40  LYS A CD    1 
ATOM   352  C  CE    . LYS A 1 43  ? 4.124  46.642 18.596  0.86 33.30 ? 40  LYS A CE    1 
ATOM   353  N  NZ    . LYS A 1 43  ? 5.378  46.560 19.406  0.95 32.75 ? 40  LYS A NZ    1 
ATOM   354  N  N     . SER A 1 44  ? 2.824  40.750 17.284  1.00 23.76 ? 41  SER A N     1 
ATOM   355  C  CA    . SER A 1 44  ? 1.971  40.032 18.223  1.00 24.86 ? 41  SER A CA    1 
ATOM   356  C  C     . SER A 1 44  ? 2.784  39.215 19.221  1.00 25.36 ? 41  SER A C     1 
ATOM   357  O  O     . SER A 1 44  ? 2.454  39.183 20.412  1.00 33.66 ? 41  SER A O     1 
ATOM   358  C  CB    . SER A 1 44  ? 0.993  39.145 17.456  1.00 33.14 ? 41  SER A CB    1 
ATOM   359  O  OG    . SER A 1 44  ? 1.676  38.322 16.529  1.00 38.66 ? 41  SER A OG    1 
ATOM   360  N  N     . TRP A 1 45  ? 3.843  38.544 18.766  1.00 24.34 ? 42  TRP A N     1 
ATOM   361  C  CA    . TRP A 1 45  ? 4.694  37.762 19.661  1.00 26.66 ? 42  TRP A CA    1 
ATOM   362  C  C     . TRP A 1 45  ? 5.715  38.693 20.314  1.00 26.48 ? 42  TRP A C     1 
ATOM   363  O  O     . TRP A 1 45  ? 6.671  39.137 19.664  1.00 21.52 ? 42  TRP A O     1 
ATOM   364  C  CB    . TRP A 1 45  ? 5.385  36.626 18.906  1.00 28.03 ? 42  TRP A CB    1 
ATOM   365  C  CG    . TRP A 1 45  ? 6.206  35.712 19.780  1.00 28.52 ? 42  TRP A CG    1 
ATOM   366  C  CD1   . TRP A 1 45  ? 7.548  35.799 20.034  1.00 33.05 ? 42  TRP A CD1   1 
ATOM   367  C  CD2   . TRP A 1 45  ? 5.735  34.581 20.521  1.00 28.84 ? 42  TRP A CD2   1 
ATOM   368  N  NE1   . TRP A 1 45  ? 7.938  34.792 20.885  1.00 30.75 ? 42  TRP A NE1   1 
ATOM   369  C  CE2   . TRP A 1 45  ? 6.844  34.029 21.195  1.00 37.39 ? 42  TRP A CE2   1 
ATOM   370  C  CE3   . TRP A 1 45  ? 4.484  33.977 20.674  1.00 35.93 ? 42  TRP A CE3   1 
ATOM   371  C  CZ2   . TRP A 1 45  ? 6.736  32.905 22.012  1.00 40.91 ? 42  TRP A CZ2   1 
ATOM   372  C  CZ3   . TRP A 1 45  ? 4.382  32.860 21.485  1.00 33.72 ? 42  TRP A CZ3   1 
ATOM   373  C  CH2   . TRP A 1 45  ? 5.499  32.337 22.142  1.00 41.31 ? 42  TRP A CH2   1 
ATOM   374  N  N     . LYS A 1 46  ? 5.486  39.006 21.591  1.00 23.56 ? 43  LYS A N     1 
ATOM   375  C  CA    . LYS A 1 46  ? 6.417  39.755 22.441  1.00 22.11 ? 43  LYS A CA    1 
ATOM   376  C  C     . LYS A 1 46  ? 6.761  41.130 21.879  1.00 19.50 ? 43  LYS A C     1 
ATOM   377  O  O     . LYS A 1 46  ? 7.856  41.647 22.106  1.00 18.88 ? 43  LYS A O     1 
ATOM   378  C  CB    . LYS A 1 46  ? 7.682  38.940 22.705  1.00 21.53 ? 43  LYS A CB    1 
ATOM   379  C  CG    . LYS A 1 46  ? 7.385  37.581 23.329  1.00 29.70 ? 43  LYS A CG    1 
ATOM   380  C  CD    . LYS A 1 46  ? 8.649  36.833 23.703  1.00 35.06 ? 43  LYS A CD    1 
ATOM   381  C  CE    . LYS A 1 46  ? 8.341  35.656 24.603  1.00 41.03 ? 43  LYS A CE    1 
ATOM   382  N  NZ    . LYS A 1 46  ? 9.590  35.026 25.110  1.00 41.01 ? 43  LYS A NZ    1 
ATOM   383  N  N     . GLY A 1 47  ? 5.817  41.750 21.173  1.00 18.46 ? 44  GLY A N     1 
ATOM   384  C  CA    . GLY A 1 47  ? 5.993  43.084 20.650  1.00 20.83 ? 44  GLY A CA    1 
ATOM   385  C  C     . GLY A 1 47  ? 6.727  43.150 19.332  1.00 16.20 ? 44  GLY A C     1 
ATOM   386  O  O     . GLY A 1 47  ? 6.910  44.247 18.804  1.00 19.37 ? 44  GLY A O     1 
ATOM   387  N  N     . GLY A 1 48  ? 7.156  42.012 18.801  1.00 17.21 ? 45  GLY A N     1 
ATOM   388  C  CA    . GLY A 1 48  ? 7.912  41.947 17.571  1.00 19.86 ? 45  GLY A CA    1 
ATOM   389  C  C     . GLY A 1 48  ? 9.405  41.824 17.828  1.00 17.76 ? 45  GLY A C     1 
ATOM   390  O  O     . GLY A 1 48  ? 9.913  42.116 18.912  1.00 17.74 ? 45  GLY A O     1 
ATOM   391  N  N     . GLY A 1 49  ? 10.132 41.406 16.794  1.00 12.39 ? 46  GLY A N     1 
ATOM   392  C  CA    . GLY A 1 49  ? 11.570 41.203 16.907  1.00 12.83 ? 46  GLY A CA    1 
ATOM   393  C  C     . GLY A 1 49  ? 12.322 42.410 16.382  1.00 12.25 ? 46  GLY A C     1 
ATOM   394  O  O     . GLY A 1 49  ? 12.034 42.910 15.297  1.00 12.37 ? 46  GLY A O     1 
ATOM   395  N  N     A ILE A 1 50  ? 13.285 42.878 17.176  0.20 11.91 ? 47  ILE A N     1 
ATOM   396  N  N     B ILE A 1 50  ? 13.304 42.853 17.151  0.80 11.78 ? 47  ILE A N     1 
ATOM   397  C  CA    A ILE A 1 50  ? 14.083 44.039 16.792  0.20 11.91 ? 47  ILE A CA    1 
ATOM   398  C  CA    B ILE A 1 50  ? 14.066 44.040 16.773  0.80 11.82 ? 47  ILE A CA    1 
ATOM   399  C  C     A ILE A 1 50  ? 15.044 43.649 15.677  0.20 13.76 ? 47  ILE A C     1 
ATOM   400  C  C     B ILE A 1 50  ? 15.094 43.688 15.707  0.80 13.70 ? 47  ILE A C     1 
ATOM   401  O  O     A ILE A 1 50  ? 15.762 42.645 15.780  0.20 15.39 ? 47  ILE A O     1 
ATOM   402  O  O     B ILE A 1 50  ? 15.895 42.756 15.872  0.80 15.03 ? 47  ILE A O     1 
ATOM   403  C  CB    A ILE A 1 50  ? 14.848 44.589 18.005  0.20 11.50 ? 47  ILE A CB    1 
ATOM   404  C  CB    B ILE A 1 50  ? 14.731 44.666 18.004  0.80 11.26 ? 47  ILE A CB    1 
ATOM   405  C  CG1   A ILE A 1 50  ? 13.889 44.926 19.151  0.20 14.62 ? 47  ILE A CG1   1 
ATOM   406  C  CG1   B ILE A 1 50  ? 13.658 45.312 18.873  0.80 15.13 ? 47  ILE A CG1   1 
ATOM   407  C  CG2   A ILE A 1 50  ? 15.670 45.807 17.605  0.20 12.34 ? 47  ILE A CG2   1 
ATOM   408  C  CG2   B ILE A 1 50  ? 15.772 45.696 17.580  0.80 12.28 ? 47  ILE A CG2   1 
ATOM   409  C  CD1   A ILE A 1 50  ? 13.280 46.293 19.068  0.20 13.43 ? 47  ILE A CD1   1 
ATOM   410  C  CD1   B ILE A 1 50  ? 14.209 45.842 20.157  0.80 15.21 ? 47  ILE A CD1   1 
ATOM   411  N  N     . ILE A 1 51  ? 15.071 44.444 14.607  1.00 10.21 ? 48  ILE A N     1 
ATOM   412  C  CA    A ILE A 1 51  ? 16.034 44.230 13.536  0.68 11.74 ? 48  ILE A CA    1 
ATOM   413  C  CA    B ILE A 1 51  ? 16.002 44.264 13.493  0.32 11.88 ? 48  ILE A CA    1 
ATOM   414  C  C     . ILE A 1 51  ? 17.095 45.329 13.486  1.00 14.56 ? 48  ILE A C     1 
ATOM   415  O  O     . ILE A 1 51  ? 18.198 45.082 12.973  1.00 16.51 ? 48  ILE A O     1 
ATOM   416  C  CB    A ILE A 1 51  ? 15.319 44.081 12.174  0.68 18.79 ? 48  ILE A CB    1 
ATOM   417  C  CB    B ILE A 1 51  ? 15.294 44.283 12.125  0.32 18.51 ? 48  ILE A CB    1 
ATOM   418  C  CG1   A ILE A 1 51  ? 16.311 43.919 11.020  0.68 24.08 ? 48  ILE A CG1   1 
ATOM   419  C  CG1   B ILE A 1 51  ? 13.901 43.674 12.179  0.32 19.09 ? 48  ILE A CG1   1 
ATOM   420  C  CG2   A ILE A 1 51  ? 14.388 45.242 11.910  0.68 14.41 ? 48  ILE A CG2   1 
ATOM   421  C  CG2   B ILE A 1 51  ? 16.126 43.530 11.095  0.32 23.12 ? 48  ILE A CG2   1 
ATOM   422  C  CD1   A ILE A 1 51  ? 15.629 43.690 9.690   0.68 23.62 ? 48  ILE A CD1   1 
ATOM   423  C  CD1   B ILE A 1 51  ? 13.192 43.778 10.839  0.32 21.13 ? 48  ILE A CD1   1 
ATOM   424  N  N     . ALA A 1 52  ? 16.814 46.521 14.019  1.00 12.00 ? 49  ALA A N     1 
ATOM   425  C  CA    . ALA A 1 52  ? 17.778 47.618 13.960  1.00 11.36 ? 49  ALA A CA    1 
ATOM   426  C  C     . ALA A 1 52  ? 17.544 48.581 15.117  1.00 10.41 ? 49  ALA A C     1 
ATOM   427  O  O     . ALA A 1 52  ? 16.407 48.767 15.553  1.00 9.25  ? 49  ALA A O     1 
ATOM   428  C  CB    . ALA A 1 52  ? 17.693 48.378 12.621  1.00 10.36 ? 49  ALA A CB    1 
ATOM   429  N  N     . VAL A 1 53  ? 18.635 49.198 15.608  1.00 10.87 ? 50  VAL A N     1 
ATOM   430  C  CA    . VAL A 1 53  ? 18.627 49.950 16.867  1.00 10.75 ? 50  VAL A CA    1 
ATOM   431  C  C     . VAL A 1 53  ? 19.408 51.249 16.697  1.00 9.16  ? 50  VAL A C     1 
ATOM   432  O  O     . VAL A 1 53  ? 20.570 51.215 16.274  1.00 12.70 ? 50  VAL A O     1 
ATOM   433  C  CB    . VAL A 1 53  ? 19.263 49.123 18.007  1.00 8.46  ? 50  VAL A CB    1 
ATOM   434  C  CG1   . VAL A 1 53  ? 19.068 49.823 19.353  1.00 11.58 ? 50  VAL A CG1   1 
ATOM   435  C  CG2   . VAL A 1 53  ? 18.690 47.720 18.033  1.00 13.21 ? 50  VAL A CG2   1 
ATOM   436  N  N     . SER A 1 54  ? 18.797 52.384 17.053  1.00 9.45  ? 51  SER A N     1 
ATOM   437  C  CA    . SER A 1 54  ? 19.505 53.661 16.980  1.00 9.98  ? 51  SER A CA    1 
ATOM   438  C  C     . SER A 1 54  ? 20.600 53.711 18.042  1.00 15.14 ? 51  SER A C     1 
ATOM   439  O  O     . SER A 1 54  ? 20.550 53.009 19.055  1.00 14.13 ? 51  SER A O     1 
ATOM   440  C  CB    . SER A 1 54  ? 18.551 54.841 17.177  1.00 11.93 ? 51  SER A CB    1 
ATOM   441  O  OG    . SER A 1 54  ? 18.168 54.989 18.551  1.00 12.94 ? 51  SER A OG    1 
ATOM   442  N  N     . TYR A 1 55  ? 21.609 54.552 17.803  1.00 11.74 ? 52  TYR A N     1 
ATOM   443  C  CA    . TYR A 1 55  ? 22.723 54.596 18.752  1.00 13.67 ? 52  TYR A CA    1 
ATOM   444  C  C     . TYR A 1 55  ? 22.275 55.103 20.123  1.00 15.20 ? 52  TYR A C     1 
ATOM   445  O  O     . TYR A 1 55  ? 22.806 54.651 21.149  1.00 16.19 ? 52  TYR A O     1 
ATOM   446  C  CB    . TYR A 1 55  ? 23.886 55.418 18.163  1.00 14.41 ? 52  TYR A CB    1 
ATOM   447  C  CG    . TYR A 1 55  ? 24.688 54.588 17.167  1.00 16.02 ? 52  TYR A CG    1 
ATOM   448  C  CD1   . TYR A 1 55  ? 24.204 54.354 15.887  1.00 14.40 ? 52  TYR A CD1   1 
ATOM   449  C  CD2   . TYR A 1 55  ? 25.890 53.976 17.522  1.00 21.43 ? 52  TYR A CD2   1 
ATOM   450  C  CE1   . TYR A 1 55  ? 24.897 53.558 14.973  1.00 15.01 ? 52  TYR A CE1   1 
ATOM   451  C  CE2   . TYR A 1 55  ? 26.599 53.178 16.604  1.00 18.33 ? 52  TYR A CE2   1 
ATOM   452  C  CZ    . TYR A 1 55  ? 26.097 52.970 15.336  1.00 18.09 ? 52  TYR A CZ    1 
ATOM   453  O  OH    . TYR A 1 55  ? 26.780 52.184 14.403  1.00 22.60 ? 52  TYR A OH    1 
ATOM   454  N  N     . GLU A 1 56  ? 21.252 55.970 20.171  1.00 13.95 ? 53  GLU A N     1 
ATOM   455  C  CA    . GLU A 1 56  ? 20.711 56.403 21.460  1.00 13.97 ? 53  GLU A CA    1 
ATOM   456  C  C     . GLU A 1 56  ? 20.122 55.232 22.234  1.00 15.62 ? 53  GLU A C     1 
ATOM   457  O  O     . GLU A 1 56  ? 20.243 55.165 23.464  1.00 16.53 ? 53  GLU A O     1 
ATOM   458  C  CB    . GLU A 1 56  ? 19.645 57.482 21.260  1.00 15.27 ? 53  GLU A CB    1 
ATOM   459  C  CG    . GLU A 1 56  ? 20.145 58.792 20.638  1.00 20.42 ? 53  GLU A CG    1 
ATOM   460  C  CD    . GLU A 1 56  ? 20.203 58.802 19.106  1.00 29.30 ? 53  GLU A CD    1 
ATOM   461  O  OE1   . GLU A 1 56  ? 19.968 57.764 18.447  1.00 23.72 ? 53  GLU A OE1   1 
ATOM   462  O  OE2   . GLU A 1 56  ? 20.496 59.881 18.547  1.00 32.04 ? 53  GLU A OE2   1 
ATOM   463  N  N     . ALA A 1 57  ? 19.449 54.310 21.536  1.00 11.41 ? 54  ALA A N     1 
ATOM   464  C  CA    . ALA A 1 57  ? 18.878 53.148 22.205  1.00 10.26 ? 54  ALA A CA    1 
ATOM   465  C  C     . ALA A 1 57  ? 19.933 52.102 22.572  1.00 10.76 ? 54  ALA A C     1 
ATOM   466  O  O     . ALA A 1 57  ? 19.755 51.370 23.556  1.00 12.76 ? 54  ALA A O     1 
ATOM   467  C  CB    . ALA A 1 57  ? 17.790 52.521 21.322  1.00 11.65 ? 54  ALA A CB    1 
ATOM   468  N  N     . ARG A 1 58  ? 21.021 51.998 21.800  1.00 12.46 ? 55  ARG A N     1 
ATOM   469  C  CA    . ARG A 1 58  ? 22.078 51.048 22.145  1.00 11.06 ? 55  ARG A CA    1 
ATOM   470  C  C     . ARG A 1 58  ? 22.702 51.380 23.492  1.00 13.46 ? 55  ARG A C     1 
ATOM   471  O  O     . ARG A 1 58  ? 23.188 50.479 24.186  1.00 14.77 ? 55  ARG A O     1 
ATOM   472  C  CB    . ARG A 1 58  ? 23.161 51.024 21.063  1.00 12.09 ? 55  ARG A CB    1 
ATOM   473  C  CG    . ARG A 1 58  ? 22.636 50.574 19.705  1.00 11.94 ? 55  ARG A CG    1 
ATOM   474  C  CD    . ARG A 1 58  ? 23.727 50.621 18.652  1.00 13.12 ? 55  ARG A CD    1 
ATOM   475  N  NE    . ARG A 1 58  ? 23.144 50.517 17.311  1.00 13.67 ? 55  ARG A NE    1 
ATOM   476  C  CZ    . ARG A 1 58  ? 23.829 50.208 16.213  1.00 15.87 ? 55  ARG A CZ    1 
ATOM   477  N  NH1   . ARG A 1 58  ? 25.135 49.945 16.283  1.00 17.45 ? 55  ARG A NH1   1 
ATOM   478  N  NH2   . ARG A 1 58  ? 23.208 50.149 15.039  1.00 14.90 ? 55  ARG A NH2   1 
ATOM   479  N  N     . ALA A 1 59  ? 22.711 52.666 23.861  1.00 14.19 ? 56  ALA A N     1 
ATOM   480  C  CA    . ALA A 1 59  ? 23.305 53.074 25.130  1.00 16.50 ? 56  ALA A CA    1 
ATOM   481  C  C     . ALA A 1 59  ? 22.568 52.480 26.322  1.00 20.39 ? 56  ALA A C     1 
ATOM   482  O  O     . ALA A 1 59  ? 23.149 52.386 27.412  1.00 20.42 ? 56  ALA A O     1 
ATOM   483  C  CB    . ALA A 1 59  ? 23.335 54.602 25.223  1.00 20.51 ? 56  ALA A CB    1 
ATOM   484  N  N     . PHE A 1 60  ? 21.314 52.067 26.136  1.00 14.85 ? 57  PHE A N     1 
ATOM   485  C  CA    . PHE A 1 60  ? 20.529 51.368 27.148  1.00 16.90 ? 57  PHE A CA    1 
ATOM   486  C  C     . PHE A 1 60  ? 20.687 49.851 27.097  1.00 17.59 ? 57  PHE A C     1 
ATOM   487  O  O     . PHE A 1 60  ? 20.113 49.152 27.944  1.00 17.59 ? 57  PHE A O     1 
ATOM   488  C  CB    . PHE A 1 60  ? 19.040 51.720 26.999  1.00 13.84 ? 57  PHE A CB    1 
ATOM   489  C  CG    . PHE A 1 60  ? 18.716 53.151 27.326  1.00 19.06 ? 57  PHE A CG    1 
ATOM   490  C  CD1   . PHE A 1 60  ? 18.850 54.145 26.365  1.00 16.59 ? 57  PHE A CD1   1 
ATOM   491  C  CD2   . PHE A 1 60  ? 18.270 53.506 28.597  1.00 22.38 ? 57  PHE A CD2   1 
ATOM   492  C  CE1   . PHE A 1 60  ? 18.548 55.471 26.657  1.00 23.22 ? 57  PHE A CE1   1 
ATOM   493  C  CE2   . PHE A 1 60  ? 17.963 54.831 28.899  1.00 30.38 ? 57  PHE A CE2   1 
ATOM   494  C  CZ    . PHE A 1 60  ? 18.109 55.817 27.929  1.00 26.59 ? 57  PHE A CZ    1 
ATOM   495  N  N     . GLY A 1 61  ? 21.424 49.323 26.124  1.00 15.08 ? 58  GLY A N     1 
ATOM   496  C  CA    . GLY A 1 61  ? 21.585 47.887 25.977  1.00 16.94 ? 58  GLY A CA    1 
ATOM   497  C  C     . GLY A 1 61  ? 20.644 47.215 25.001  1.00 14.79 ? 58  GLY A C     1 
ATOM   498  O  O     . GLY A 1 61  ? 20.625 45.979 24.935  1.00 15.47 ? 58  GLY A O     1 
ATOM   499  N  N     . VAL A 1 62  ? 19.845 47.982 24.258  1.00 12.55 ? 59  VAL A N     1 
ATOM   500  C  CA    . VAL A 1 62  ? 18.952 47.398 23.263  1.00 10.64 ? 59  VAL A CA    1 
ATOM   501  C  C     . VAL A 1 62  ? 19.786 46.851 22.111  1.00 13.88 ? 59  VAL A C     1 
ATOM   502  O  O     . VAL A 1 62  ? 20.725 47.508 21.645  1.00 15.08 ? 59  VAL A O     1 
ATOM   503  C  CB    . VAL A 1 62  ? 17.934 48.447 22.787  1.00 10.83 ? 59  VAL A CB    1 
ATOM   504  C  CG1   . VAL A 1 62  ? 17.010 47.850 21.727  1.00 14.75 ? 59  VAL A CG1   1 
ATOM   505  C  CG2   . VAL A 1 62  ? 17.127 48.967 23.960  1.00 13.37 ? 59  VAL A CG2   1 
ATOM   506  N  N     . THR A 1 63  ? 19.482 45.622 21.679  1.00 12.30 ? 60  THR A N     1 
ATOM   507  C  CA    . THR A 1 63  ? 20.230 44.977 20.606  1.00 11.50 ? 60  THR A CA    1 
ATOM   508  C  C     . THR A 1 63  ? 19.289 44.324 19.610  1.00 15.83 ? 60  THR A C     1 
ATOM   509  O  O     . THR A 1 63  ? 18.111 44.097 19.888  1.00 16.21 ? 60  THR A O     1 
ATOM   510  C  CB    . THR A 1 63  ? 21.198 43.903 21.126  1.00 20.23 ? 60  THR A CB    1 
ATOM   511  O  OG1   . THR A 1 63  ? 20.454 42.848 21.742  1.00 20.67 ? 60  THR A OG1   1 
ATOM   512  C  CG2   . THR A 1 63  ? 22.173 44.492 22.128  1.00 17.71 ? 60  THR A CG2   1 
ATOM   513  N  N     A ARG A 1 64  ? 19.842 44.009 18.439  0.51 15.38 ? 61  ARG A N     1 
ATOM   514  N  N     B ARG A 1 64  ? 19.832 44.059 18.423  0.49 15.40 ? 61  ARG A N     1 
ATOM   515  C  CA    A ARG A 1 64  ? 19.160 43.201 17.439  0.51 15.64 ? 61  ARG A CA    1 
ATOM   516  C  CA    B ARG A 1 64  ? 19.160 43.221 17.445  0.49 15.65 ? 61  ARG A CA    1 
ATOM   517  C  C     A ARG A 1 64  ? 18.786 41.838 18.019  0.51 18.47 ? 61  ARG A C     1 
ATOM   518  C  C     B ARG A 1 64  ? 18.987 41.818 18.009  0.49 18.49 ? 61  ARG A C     1 
ATOM   519  O  O     A ARG A 1 64  ? 19.435 41.331 18.938  0.51 18.94 ? 61  ARG A O     1 
ATOM   520  O  O     B ARG A 1 64  ? 19.795 41.345 18.813  0.49 19.41 ? 61  ARG A O     1 
ATOM   521  C  CB    A ARG A 1 64  ? 20.073 43.045 16.220  0.51 19.57 ? 61  ARG A CB    1 
ATOM   522  C  CB    B ARG A 1 64  ? 19.967 43.205 16.141  0.49 19.39 ? 61  ARG A CB    1 
ATOM   523  C  CG    A ARG A 1 64  ? 19.454 42.445 14.991  0.51 21.48 ? 61  ARG A CG    1 
ATOM   524  C  CG    B ARG A 1 64  ? 19.897 41.940 15.305  0.49 21.75 ? 61  ARG A CG    1 
ATOM   525  C  CD    A ARG A 1 64  ? 20.425 42.605 13.824  0.51 17.92 ? 61  ARG A CD    1 
ATOM   526  C  CD    B ARG A 1 64  ? 20.730 42.128 14.041  0.49 19.85 ? 61  ARG A CD    1 
ATOM   527  N  NE    A ARG A 1 64  ? 21.776 42.160 14.175  0.51 21.34 ? 61  ARG A NE    1 
ATOM   528  N  NE    B ARG A 1 64  ? 20.362 43.374 13.376  0.49 14.78 ? 61  ARG A NE    1 
ATOM   529  C  CZ    A ARG A 1 64  ? 22.891 42.730 13.725  0.51 21.89 ? 61  ARG A CZ    1 
ATOM   530  C  CZ    B ARG A 1 64  ? 21.218 44.236 12.837  0.49 16.11 ? 61  ARG A CZ    1 
ATOM   531  N  NH1   A ARG A 1 64  ? 22.823 43.782 12.918  0.51 16.99 ? 61  ARG A NH1   1 
ATOM   532  N  NH1   B ARG A 1 64  ? 22.522 43.995 12.869  0.49 16.35 ? 61  ARG A NH1   1 
ATOM   533  N  NH2   A ARG A 1 64  ? 24.076 42.252 14.084  0.51 19.83 ? 61  ARG A NH2   1 
ATOM   534  N  NH2   B ARG A 1 64  ? 20.762 45.346 12.264  0.49 6.49  ? 61  ARG A NH2   1 
ATOM   535  N  N     A SER A 1 65  ? 17.712 41.254 17.484  0.51 17.11 ? 62  SER A N     1 
ATOM   536  N  N     B SER A 1 65  ? 17.902 41.163 17.599  0.49 17.15 ? 62  SER A N     1 
ATOM   537  C  CA    A SER A 1 65  ? 17.106 39.974 17.848  0.51 22.15 ? 62  SER A CA    1 
ATOM   538  C  CA    B SER A 1 65  ? 17.506 39.857 18.119  0.49 20.12 ? 62  SER A CA    1 
ATOM   539  C  C     A SER A 1 65  ? 16.385 40.017 19.197  0.51 14.03 ? 62  SER A C     1 
ATOM   540  C  C     B SER A 1 65  ? 17.074 39.938 19.578  0.49 19.49 ? 62  SER A C     1 
ATOM   541  O  O     A SER A 1 65  ? 15.709 39.055 19.541  0.51 18.52 ? 62  SER A O     1 
ATOM   542  O  O     B SER A 1 65  ? 17.286 38.998 20.350  0.49 21.80 ? 62  SER A O     1 
ATOM   543  C  CB    A SER A 1 65  ? 18.109 38.806 17.875  0.51 23.29 ? 62  SER A CB    1 
ATOM   544  C  CB    B SER A 1 65  ? 18.611 38.811 17.957  0.49 24.92 ? 62  SER A CB    1 
ATOM   545  O  OG    A SER A 1 65  ? 18.612 38.622 19.185  0.51 23.92 ? 62  SER A OG    1 
ATOM   546  O  OG    B SER A 1 65  ? 19.517 38.873 19.044  0.49 28.43 ? 62  SER A OG    1 
ATOM   547  N  N     . MET A 1 66  ? 16.518 41.078 19.972  1.00 20.20 ? 63  MET A N     1 
ATOM   548  C  CA    . MET A 1 66  ? 15.771 41.206 21.212  1.00 17.08 ? 63  MET A CA    1 
ATOM   549  C  C     . MET A 1 66  ? 14.293 41.367 20.867  1.00 18.41 ? 63  MET A C     1 
ATOM   550  O  O     . MET A 1 66  ? 13.959 41.957 19.836  1.00 15.57 ? 63  MET A O     1 
ATOM   551  C  CB    . MET A 1 66  ? 16.306 42.417 21.973  1.00 17.12 ? 63  MET A CB    1 
ATOM   552  C  CG    . MET A 1 66  ? 15.781 42.715 23.315  1.00 24.07 ? 63  MET A CG    1 
ATOM   553  S  SD    . MET A 1 66  ? 16.897 44.009 23.939  1.00 23.14 ? 63  MET A SD    1 
ATOM   554  C  CE    . MET A 1 66  ? 18.390 43.108 24.295  1.00 24.70 ? 63  MET A CE    1 
ATOM   555  N  N     . TRP A 1 67  ? 13.403 40.814 21.699  1.00 16.21 ? 64  TRP A N     1 
ATOM   556  C  CA    . TRP A 1 67  ? 11.982 41.137 21.571  1.00 11.86 ? 64  TRP A CA    1 
ATOM   557  C  C     . TRP A 1 67  ? 11.728 42.565 22.032  1.00 13.41 ? 64  TRP A C     1 
ATOM   558  O  O     . TRP A 1 67  ? 12.312 43.017 23.017  1.00 14.23 ? 64  TRP A O     1 
ATOM   559  C  CB    . TRP A 1 67  ? 11.121 40.178 22.403  1.00 16.77 ? 64  TRP A CB    1 
ATOM   560  C  CG    . TRP A 1 67  ? 11.264 38.752 21.981  1.00 16.78 ? 64  TRP A CG    1 
ATOM   561  C  CD1   . TRP A 1 67  ? 11.759 37.730 22.725  1.00 21.71 ? 64  TRP A CD1   1 
ATOM   562  C  CD2   . TRP A 1 67  ? 10.947 38.204 20.697  1.00 22.59 ? 64  TRP A CD2   1 
ATOM   563  N  NE1   . TRP A 1 67  ? 11.753 36.563 21.991  1.00 24.46 ? 64  TRP A NE1   1 
ATOM   564  C  CE2   . TRP A 1 67  ? 11.260 36.830 20.741  1.00 27.09 ? 64  TRP A CE2   1 
ATOM   565  C  CE3   . TRP A 1 67  ? 10.421 38.740 19.516  1.00 18.16 ? 64  TRP A CE3   1 
ATOM   566  C  CZ2   . TRP A 1 67  ? 11.066 35.982 19.649  1.00 30.06 ? 64  TRP A CZ2   1 
ATOM   567  C  CZ3   . TRP A 1 67  ? 10.223 37.893 18.434  1.00 26.55 ? 64  TRP A CZ3   1 
ATOM   568  C  CH2   . TRP A 1 67  ? 10.553 36.532 18.509  1.00 23.94 ? 64  TRP A CH2   1 
ATOM   569  N  N     . ALA A 1 68  ? 10.839 43.275 21.327  1.00 13.50 ? 65  ALA A N     1 
ATOM   570  C  CA    . ALA A 1 68  ? 10.567 44.664 21.689  1.00 15.07 ? 65  ALA A CA    1 
ATOM   571  C  C     . ALA A 1 68  ? 10.049 44.791 23.120  1.00 14.29 ? 65  ALA A C     1 
ATOM   572  O  O     . ALA A 1 68  ? 10.374 45.761 23.812  1.00 13.34 ? 65  ALA A O     1 
ATOM   573  C  CB    . ALA A 1 68  ? 9.580  45.287 20.701  1.00 18.40 ? 65  ALA A CB    1 
ATOM   574  N  N     . ASP A 1 69  ? 9.247  43.825 23.587  1.00 15.28 ? 66  ASP A N     1 
ATOM   575  C  CA    . ASP A 1 69  ? 8.777  43.883 24.976  1.00 15.96 ? 66  ASP A CA    1 
ATOM   576  C  C     . ASP A 1 69  ? 9.952  43.842 25.944  1.00 15.36 ? 66  ASP A C     1 
ATOM   577  O  O     . ASP A 1 69  ? 9.919  44.470 27.009  1.00 16.51 ? 66  ASP A O     1 
ATOM   578  C  CB    . ASP A 1 69  ? 7.836  42.719 25.300  1.00 15.43 ? 66  ASP A CB    1 
ATOM   579  C  CG    . ASP A 1 69  ? 6.460  42.845 24.649  1.00 24.69 ? 66  ASP A CG    1 
ATOM   580  O  OD1   . ASP A 1 69  ? 6.152  43.871 24.008  1.00 25.47 ? 66  ASP A OD1   1 
ATOM   581  O  OD2   . ASP A 1 69  ? 5.670  41.896 24.808  1.00 25.68 ? 66  ASP A OD2   1 
ATOM   582  N  N     . ASP A 1 70  ? 10.984 43.070 25.603  1.00 13.29 ? 67  ASP A N     1 
ATOM   583  C  CA    . ASP A 1 70  ? 12.161 42.992 26.453  1.00 12.04 ? 67  ASP A CA    1 
ATOM   584  C  C     . ASP A 1 70  ? 13.028 44.242 26.318  1.00 13.98 ? 67  ASP A C     1 
ATOM   585  O  O     . ASP A 1 70  ? 13.591 44.719 27.306  1.00 13.59 ? 67  ASP A O     1 
ATOM   586  C  CB    . ASP A 1 70  ? 12.950 41.732 26.104  1.00 15.23 ? 67  ASP A CB    1 
ATOM   587  C  CG    . ASP A 1 70  ? 12.198 40.465 26.453  1.00 21.44 ? 67  ASP A CG    1 
ATOM   588  O  OD1   . ASP A 1 70  ? 11.318 40.517 27.344  1.00 19.77 ? 67  ASP A OD1   1 
ATOM   589  O  OD2   . ASP A 1 70  ? 12.482 39.419 25.830  1.00 21.14 ? 67  ASP A OD2   1 
ATOM   590  N  N     . ALA A 1 71  ? 13.134 44.799 25.105  1.00 12.97 ? 68  ALA A N     1 
ATOM   591  C  CA    . ALA A 1 71  ? 13.860 46.050 24.926  1.00 14.97 ? 68  ALA A CA    1 
ATOM   592  C  C     . ALA A 1 71  ? 13.235 47.179 25.735  1.00 12.75 ? 68  ALA A C     1 
ATOM   593  O  O     . ALA A 1 71  ? 13.944 48.055 26.230  1.00 13.85 ? 68  ALA A O     1 
ATOM   594  C  CB    . ALA A 1 71  ? 13.897 46.435 23.445  1.00 12.01 ? 68  ALA A CB    1 
ATOM   595  N  N     . LYS A 1 72  ? 11.903 47.198 25.840  1.00 11.04 ? 69  LYS A N     1 
ATOM   596  C  CA    . LYS A 1 72  ? 11.225 48.226 26.620  1.00 13.86 ? 69  LYS A CA    1 
ATOM   597  C  C     . LYS A 1 72  ? 11.535 48.121 28.115  1.00 14.76 ? 69  LYS A C     1 
ATOM   598  O  O     . LYS A 1 72  ? 11.409 49.116 28.839  1.00 15.60 ? 69  LYS A O     1 
ATOM   599  C  CB    . LYS A 1 72  ? 9.715  48.133 26.390  1.00 14.21 ? 69  LYS A CB    1 
ATOM   600  C  CG    . LYS A 1 72  ? 9.226  48.818 25.105  1.00 18.61 ? 69  LYS A CG    1 
ATOM   601  C  CD    . LYS A 1 72  ? 9.275  50.333 25.257  1.00 24.95 ? 69  LYS A CD    1 
ATOM   602  C  CE    . LYS A 1 72  ? 8.307  51.042 24.314  1.00 29.87 ? 69  LYS A CE    1 
ATOM   603  N  NZ    . LYS A 1 72  ? 8.212  52.517 24.630  1.00 19.06 ? 69  LYS A NZ    1 
ATOM   604  N  N     . LYS A 1 73  ? 11.944 46.943 28.589  1.00 15.36 ? 70  LYS A N     1 
ATOM   605  C  CA    . LYS A 1 73  ? 12.373 46.831 29.982  1.00 16.68 ? 70  LYS A CA    1 
ATOM   606  C  C     . LYS A 1 73  ? 13.686 47.569 30.210  1.00 17.74 ? 70  LYS A C     1 
ATOM   607  O  O     . LYS A 1 73  ? 13.886 48.172 31.272  1.00 17.35 ? 70  LYS A O     1 
ATOM   608  C  CB    . LYS A 1 73  ? 12.491 45.354 30.360  1.00 13.40 ? 70  LYS A CB    1 
ATOM   609  C  CG    . LYS A 1 73  ? 11.214 44.557 30.088  1.00 13.38 ? 70  LYS A CG    1 
ATOM   610  C  CD    . LYS A 1 73  ? 11.420 43.037 30.277  1.00 12.85 ? 70  LYS A CD    1 
ATOM   611  C  CE    . LYS A 1 73  ? 10.109 42.290 30.018  1.00 17.43 ? 70  LYS A CE    1 
ATOM   612  N  NZ    . LYS A 1 73  ? 10.312 40.820 29.882  1.00 20.63 ? 70  LYS A NZ    1 
ATOM   613  N  N     . LEU A 1 74  ? 14.574 47.563 29.215  1.00 14.41 ? 71  LEU A N     1 
ATOM   614  C  CA    . LEU A 1 74  ? 15.831 48.303 29.299  1.00 14.62 ? 71  LEU A CA    1 
ATOM   615  C  C     . LEU A 1 74  ? 15.656 49.782 28.991  1.00 18.50 ? 71  LEU A C     1 
ATOM   616  O  O     . LEU A 1 74  ? 16.401 50.617 29.517  1.00 17.17 ? 71  LEU A O     1 
ATOM   617  C  CB    . LEU A 1 74  ? 16.857 47.713 28.325  1.00 12.94 ? 71  LEU A CB    1 
ATOM   618  C  CG    . LEU A 1 74  ? 17.239 46.242 28.483  1.00 17.85 ? 71  LEU A CG    1 
ATOM   619  C  CD1   . LEU A 1 74  ? 18.178 45.830 27.352  1.00 17.68 ? 71  LEU A CD1   1 
ATOM   620  C  CD2   . LEU A 1 74  ? 17.881 46.024 29.836  1.00 17.38 ? 71  LEU A CD2   1 
ATOM   621  N  N     . CYS A 1 75  ? 14.703 50.121 28.125  1.00 13.47 ? 72  CYS A N     1 
ATOM   622  C  CA    . CYS A 1 75  ? 14.537 51.487 27.630  1.00 13.72 ? 72  CYS A CA    1 
ATOM   623  C  C     . CYS A 1 75  ? 13.037 51.759 27.526  1.00 16.64 ? 72  CYS A C     1 
ATOM   624  O  O     . CYS A 1 75  ? 12.420 51.537 26.479  1.00 15.70 ? 72  CYS A O     1 
ATOM   625  C  CB    . CYS A 1 75  ? 15.249 51.653 26.285  1.00 13.99 ? 72  CYS A CB    1 
ATOM   626  S  SG    . CYS A 1 75  ? 15.096 53.292 25.533  1.00 18.08 ? 72  CYS A SG    1 
ATOM   627  N  N     . PRO A 1 76  ? 12.410 52.227 28.607  1.00 14.95 ? 73  PRO A N     1 
ATOM   628  C  CA    . PRO A 1 76  ? 10.945 52.377 28.598  1.00 18.57 ? 73  PRO A CA    1 
ATOM   629  C  C     . PRO A 1 76  ? 10.443 53.402 27.592  1.00 13.99 ? 73  PRO A C     1 
ATOM   630  O  O     . PRO A 1 76  ? 9.295  53.294 27.139  1.00 21.75 ? 73  PRO A O     1 
ATOM   631  C  CB    . PRO A 1 76  ? 10.627 52.805 30.039  1.00 20.97 ? 73  PRO A CB    1 
ATOM   632  C  CG    . PRO A 1 76  ? 11.821 52.386 30.836  1.00 25.66 ? 73  PRO A CG    1 
ATOM   633  C  CD    . PRO A 1 76  ? 12.998 52.473 29.936  1.00 23.96 ? 73  PRO A CD    1 
ATOM   634  N  N     . ASP A 1 77  ? 11.273 54.373 27.223  1.00 16.92 ? 74  ASP A N     1 
ATOM   635  C  CA    . ASP A 1 77  ? 10.890 55.409 26.274  1.00 19.54 ? 74  ASP A CA    1 
ATOM   636  C  C     . ASP A 1 77  ? 11.208 55.042 24.830  1.00 18.31 ? 74  ASP A C     1 
ATOM   637  O  O     . ASP A 1 77  ? 11.060 55.893 23.944  1.00 16.49 ? 74  ASP A O     1 
ATOM   638  C  CB    . ASP A 1 77  ? 11.578 56.727 26.630  1.00 22.94 ? 74  ASP A CB    1 
ATOM   639  C  CG    . ASP A 1 77  ? 11.078 57.308 27.935  1.00 37.11 ? 74  ASP A CG    1 
ATOM   640  O  OD1   . ASP A 1 77  ? 9.848  57.287 28.172  1.00 39.81 ? 74  ASP A OD1   1 
ATOM   641  O  OD2   . ASP A 1 77  ? 11.917 57.787 28.722  1.00 36.88 ? 74  ASP A OD2   1 
ATOM   642  N  N     . LEU A 1 78  ? 11.623 53.798 24.577  1.00 13.13 ? 75  LEU A N     1 
ATOM   643  C  CA    . LEU A 1 78  ? 11.992 53.370 23.229  1.00 13.68 ? 75  LEU A CA    1 
ATOM   644  C  C     . LEU A 1 78  ? 10.849 53.603 22.250  1.00 10.90 ? 75  LEU A C     1 
ATOM   645  O  O     . LEU A 1 78  ? 9.722  53.180 22.501  1.00 14.35 ? 75  LEU A O     1 
ATOM   646  C  CB    . LEU A 1 78  ? 12.346 51.879 23.248  1.00 14.38 ? 75  LEU A CB    1 
ATOM   647  C  CG    . LEU A 1 78  ? 12.885 51.258 21.957  1.00 12.00 ? 75  LEU A CG    1 
ATOM   648  C  CD1   . LEU A 1 78  ? 14.251 51.853 21.569  1.00 12.44 ? 75  LEU A CD1   1 
ATOM   649  C  CD2   . LEU A 1 78  ? 12.977 49.759 22.123  1.00 13.41 ? 75  LEU A CD2   1 
ATOM   650  N  N     . LEU A 1 79  ? 11.148 54.269 21.132  1.00 9.70  ? 76  LEU A N     1 
ATOM   651  C  CA    . LEU A 1 79  ? 10.182 54.419 20.051  1.00 10.65 ? 76  LEU A CA    1 
ATOM   652  C  C     . LEU A 1 79  ? 10.391 53.311 19.024  1.00 14.54 ? 76  LEU A C     1 
ATOM   653  O  O     . LEU A 1 79  ? 11.504 52.818 18.829  1.00 13.34 ? 76  LEU A O     1 
ATOM   654  C  CB    . LEU A 1 79  ? 10.314 55.793 19.386  1.00 12.00 ? 76  LEU A CB    1 
ATOM   655  C  CG    . LEU A 1 79  ? 10.208 56.969 20.365  1.00 14.13 ? 76  LEU A CG    1 
ATOM   656  C  CD1   . LEU A 1 79  ? 10.345 58.302 19.630  1.00 14.23 ? 76  LEU A CD1   1 
ATOM   657  C  CD2   . LEU A 1 79  ? 8.910  56.890 21.134  1.00 14.58 ? 76  LEU A CD2   1 
ATOM   658  N  N     . LEU A 1 80  ? 9.305  52.903 18.380  1.00 12.25 ? 77  LEU A N     1 
ATOM   659  C  CA    . LEU A 1 80  ? 9.368  51.775 17.469  1.00 11.91 ? 77  LEU A CA    1 
ATOM   660  C  C     . LEU A 1 80  ? 8.746  52.143 16.135  1.00 14.60 ? 77  LEU A C     1 
ATOM   661  O  O     . LEU A 1 80  ? 7.743  52.863 16.072  1.00 17.37 ? 77  LEU A O     1 
ATOM   662  C  CB    . LEU A 1 80  ? 8.663  50.539 18.045  1.00 9.64  ? 77  LEU A CB    1 
ATOM   663  C  CG    . LEU A 1 80  ? 9.201  50.013 19.378  1.00 14.39 ? 77  LEU A CG    1 
ATOM   664  C  CD1   . LEU A 1 80  ? 8.313  48.874 19.860  1.00 19.88 ? 77  LEU A CD1   1 
ATOM   665  C  CD2   . LEU A 1 80  ? 10.642 49.528 19.210  1.00 16.31 ? 77  LEU A CD2   1 
ATOM   666  N  N     . ALA A 1 81  ? 9.366  51.651 15.070  1.00 10.12 ? 78  ALA A N     1 
ATOM   667  C  CA    . ALA A 1 81  ? 8.792  51.668 13.734  1.00 9.42  ? 78  ALA A CA    1 
ATOM   668  C  C     . ALA A 1 81  ? 8.700  50.221 13.286  1.00 12.80 ? 78  ALA A C     1 
ATOM   669  O  O     . ALA A 1 81  ? 9.603  49.431 13.563  1.00 17.10 ? 78  ALA A O     1 
ATOM   670  C  CB    . ALA A 1 81  ? 9.662  52.496 12.771  1.00 14.23 ? 78  ALA A CB    1 
ATOM   671  N  N     . GLN A 1 82  ? 7.604  49.843 12.632  1.00 12.98 ? 79  GLN A N     1 
ATOM   672  C  CA    . GLN A 1 82  ? 7.442  48.452 12.232  1.00 12.32 ? 79  GLN A CA    1 
ATOM   673  C  C     . GLN A 1 82  ? 7.599  48.277 10.727  1.00 14.45 ? 79  GLN A C     1 
ATOM   674  O  O     . GLN A 1 82  ? 7.134  49.106 9.932   1.00 14.27 ? 79  GLN A O     1 
ATOM   675  C  CB    . GLN A 1 82  ? 6.101  47.873 12.694  1.00 21.73 ? 79  GLN A CB    1 
ATOM   676  C  CG    . GLN A 1 82  ? 4.877  48.611 12.297  1.00 28.85 ? 79  GLN A CG    1 
ATOM   677  C  CD    . GLN A 1 82  ? 3.697  48.183 13.144  0.25 26.40 ? 79  GLN A CD    1 
ATOM   678  O  OE1   . GLN A 1 82  ? 2.924  47.310 12.755  0.61 31.04 ? 79  GLN A OE1   1 
ATOM   679  N  NE2   . GLN A 1 82  ? 3.579  48.768 14.329  1.00 27.10 ? 79  GLN A NE2   1 
ATOM   680  N  N     . VAL A 1 83  ? 8.296  47.199 10.364  1.00 13.55 ? 80  VAL A N     1 
ATOM   681  C  CA    . VAL A 1 83  ? 8.448  46.813 8.969   1.00 13.66 ? 80  VAL A CA    1 
ATOM   682  C  C     . VAL A 1 83  ? 7.082  46.547 8.356   1.00 17.48 ? 80  VAL A C     1 
ATOM   683  O  O     . VAL A 1 83  ? 6.208  45.921 8.973   1.00 14.93 ? 80  VAL A O     1 
ATOM   684  C  CB    . VAL A 1 83  ? 9.350  45.571 8.874   1.00 14.24 ? 80  VAL A CB    1 
ATOM   685  C  CG1   . VAL A 1 83  ? 9.364  45.004 7.483   1.00 18.35 ? 80  VAL A CG1   1 
ATOM   686  C  CG2   . VAL A 1 83  ? 10.779 45.931 9.313   1.00 20.57 ? 80  VAL A CG2   1 
ATOM   687  N  N     . ARG A 1 84  ? 6.906  47.008 7.122   1.00 13.01 ? 81  ARG A N     1 
ATOM   688  C  CA    . ARG A 1 84  ? 5.696  46.702 6.366   1.00 14.89 ? 81  ARG A CA    1 
ATOM   689  C  C     . ARG A 1 84  ? 5.454  45.196 6.333   1.00 16.20 ? 81  ARG A C     1 
ATOM   690  O  O     . ARG A 1 84  ? 6.388  44.402 6.228   1.00 15.41 ? 81  ARG A O     1 
ATOM   691  C  CB    . ARG A 1 84  ? 5.839  47.250 4.943   1.00 18.66 ? 81  ARG A CB    1 
ATOM   692  C  CG    . ARG A 1 84  ? 4.630  47.040 4.043   1.00 20.79 ? 81  ARG A CG    1 
ATOM   693  C  CD    . ARG A 1 84  ? 4.816  47.778 2.707   0.92 26.78 ? 81  ARG A CD    1 
ATOM   694  N  NE    . ARG A 1 84  ? 5.103  49.205 2.884   0.18 24.92 ? 81  ARG A NE    1 
ATOM   695  C  CZ    . ARG A 1 84  ? 6.160  49.840 2.377   0.33 25.03 ? 81  ARG A CZ    1 
ATOM   696  N  NH1   . ARG A 1 84  ? 7.047  49.193 1.637   0.88 26.78 ? 81  ARG A NH1   1 
ATOM   697  N  NH2   . ARG A 1 84  ? 6.328  51.137 2.600   0.98 33.66 ? 81  ARG A NH2   1 
ATOM   698  N  N     . GLU A 1 85  ? 4.192  44.808 6.438   1.00 14.41 ? 82  GLU A N     1 
ATOM   699  C  CA    . GLU A 1 85  ? 3.787  43.420 6.301   1.00 16.66 ? 82  GLU A CA    1 
ATOM   700  C  C     . GLU A 1 85  ? 2.850  43.324 5.105   1.00 20.63 ? 82  GLU A C     1 
ATOM   701  O  O     . GLU A 1 85  ? 1.909  44.116 4.991   1.00 21.73 ? 82  GLU A O     1 
ATOM   702  C  CB    . GLU A 1 85  ? 3.115  42.928 7.590   1.00 19.65 ? 82  GLU A CB    1 
ATOM   703  C  CG    . GLU A 1 85  ? 2.880  41.429 7.657   1.00 25.73 ? 82  GLU A CG    1 
ATOM   704  C  CD    . GLU A 1 85  ? 2.466  40.984 9.050   1.00 28.77 ? 82  GLU A CD    1 
ATOM   705  O  OE1   . GLU A 1 85  ? 3.006  41.538 10.031  1.00 30.85 ? 82  GLU A OE1   1 
ATOM   706  O  OE2   . GLU A 1 85  ? 1.593  40.096 9.159   1.00 29.61 ? 82  GLU A OE2   1 
ATOM   707  N  N     . SER A 1 86  ? 3.146  42.400 4.192   1.00 15.23 ? 83  SER A N     1 
ATOM   708  C  CA    . SER A 1 86  ? 2.335  42.162 3.004   1.00 16.88 ? 83  SER A CA    1 
ATOM   709  C  C     . SER A 1 86  ? 2.163  40.661 2.825   1.00 18.86 ? 83  SER A C     1 
ATOM   710  O  O     . SER A 1 86  ? 3.149  39.920 2.847   1.00 16.04 ? 83  SER A O     1 
ATOM   711  C  CB    . SER A 1 86  ? 2.980  42.762 1.752   1.00 20.76 ? 83  SER A CB    1 
ATOM   712  O  OG    . SER A 1 86  ? 3.190  44.150 1.917   1.00 30.84 ? 83  SER A OG    1 
ATOM   713  N  N     . ARG A 1 87  ? 0.913  40.227 2.642   1.00 17.16 ? 84  ARG A N     1 
ATOM   714  C  CA    . ARG A 1 87  ? 0.583  38.808 2.503   1.00 19.21 ? 84  ARG A CA    1 
ATOM   715  C  C     . ARG A 1 87  ? 1.102  37.987 3.677   1.00 20.60 ? 84  ARG A C     1 
ATOM   716  O  O     . ARG A 1 87  ? 1.526  36.840 3.515   1.00 25.11 ? 84  ARG A O     1 
ATOM   717  C  CB    . ARG A 1 87  ? 1.118  38.253 1.186   1.00 20.95 ? 84  ARG A CB    1 
ATOM   718  C  CG    . ARG A 1 87  ? 0.607  38.988 -0.034  1.00 23.32 ? 84  ARG A CG    1 
ATOM   719  C  CD    . ARG A 1 87  ? 1.050  38.279 -1.296  1.00 27.96 ? 84  ARG A CD    1 
ATOM   720  N  NE    . ARG A 1 87  ? 0.574  38.950 -2.498  1.00 34.83 ? 84  ARG A NE    1 
ATOM   721  C  CZ    . ARG A 1 87  ? 1.267  39.871 -3.157  1.00 30.42 ? 84  ARG A CZ    1 
ATOM   722  N  NH1   . ARG A 1 87  ? 2.470  40.229 -2.727  1.00 41.32 ? 84  ARG A NH1   1 
ATOM   723  N  NH2   . ARG A 1 87  ? 0.760  40.427 -4.249  1.00 42.59 ? 84  ARG A NH2   1 
ATOM   724  N  N     . GLY A 1 88  ? 1.089  38.572 4.869   1.00 20.47 ? 85  GLY A N     1 
ATOM   725  C  CA    . GLY A 1 88  ? 1.470  37.850 6.066   1.00 19.70 ? 85  GLY A CA    1 
ATOM   726  C  C     . GLY A 1 88  ? 2.953  37.697 6.289   1.00 19.93 ? 85  GLY A C     1 
ATOM   727  O  O     . GLY A 1 88  ? 3.354  36.941 7.181   1.00 18.96 ? 85  GLY A O     1 
ATOM   728  N  N     . LYS A 1 89  ? 3.789  38.387 5.523   1.00 15.62 ? 86  LYS A N     1 
ATOM   729  C  CA    . LYS A 1 89  ? 5.224  38.313 5.732   1.00 12.54 ? 86  LYS A CA    1 
ATOM   730  C  C     . LYS A 1 89  ? 5.831  39.705 5.706   1.00 16.17 ? 86  LYS A C     1 
ATOM   731  O  O     . LYS A 1 89  ? 5.243  40.660 5.187   1.00 14.57 ? 86  LYS A O     1 
ATOM   732  C  CB    . LYS A 1 89  ? 5.914  37.420 4.694   1.00 19.90 ? 86  LYS A CB    1 
ATOM   733  C  CG    . LYS A 1 89  ? 5.821  37.893 3.282   1.00 22.30 ? 86  LYS A CG    1 
ATOM   734  C  CD    . LYS A 1 89  ? 6.532  36.909 2.372   1.00 22.70 ? 86  LYS A CD    1 
ATOM   735  C  CE    . LYS A 1 89  ? 7.987  36.776 2.784   1.00 23.07 ? 86  LYS A CE    1 
ATOM   736  N  NZ    . LYS A 1 89  ? 8.701  38.093 2.566   1.00 20.28 ? 86  LYS A NZ    1 
ATOM   737  N  N     . ALA A 1 90  ? 7.036  39.805 6.261   1.00 15.73 ? 87  ALA A N     1 
ATOM   738  C  CA    . ALA A 1 90  ? 7.727  41.083 6.272   1.00 15.20 ? 87  ALA A CA    1 
ATOM   739  C  C     . ALA A 1 90  ? 8.076  41.477 4.844   1.00 18.66 ? 87  ALA A C     1 
ATOM   740  O  O     . ALA A 1 90  ? 8.449  40.638 4.016   1.00 21.63 ? 87  ALA A O     1 
ATOM   741  C  CB    . ALA A 1 90  ? 8.980  41.006 7.139   1.00 25.64 ? 87  ALA A CB    1 
ATOM   742  N  N     . ASN A 1 91  ? 7.912  42.758 4.546   1.00 15.52 ? 88  ASN A N     1 
ATOM   743  C  CA    . ASN A 1 91  ? 8.130  43.305 3.211   1.00 16.79 ? 88  ASN A CA    1 
ATOM   744  C  C     . ASN A 1 91  ? 9.201  44.377 3.345   1.00 16.84 ? 88  ASN A C     1 
ATOM   745  O  O     . ASN A 1 91  ? 8.962  45.427 3.952   1.00 17.13 ? 88  ASN A O     1 
ATOM   746  C  CB    . ASN A 1 91  ? 6.817  43.859 2.658   1.00 17.09 ? 88  ASN A CB    1 
ATOM   747  C  CG    . ASN A 1 91  ? 6.979  44.595 1.336   1.00 26.57 ? 88  ASN A CG    1 
ATOM   748  O  OD1   . ASN A 1 91  ? 8.063  44.662 0.761   1.00 22.28 ? 88  ASN A OD1   1 
ATOM   749  N  ND2   . ASN A 1 91  ? 5.872  45.136 0.837   1.00 32.44 ? 88  ASN A ND2   1 
ATOM   750  N  N     . LEU A 1 92  ? 10.390 44.107 2.806   1.00 15.03 ? 89  LEU A N     1 
ATOM   751  C  CA    . LEU A 1 92  ? 11.525 44.999 2.999   1.00 14.21 ? 89  LEU A CA    1 
ATOM   752  C  C     . LEU A 1 92  ? 11.749 45.947 1.819   1.00 15.48 ? 89  LEU A C     1 
ATOM   753  O  O     . LEU A 1 92  ? 12.837 46.516 1.705   1.00 13.10 ? 89  LEU A O     1 
ATOM   754  C  CB    . LEU A 1 92  ? 12.783 44.175 3.281   1.00 15.24 ? 89  LEU A CB    1 
ATOM   755  C  CG    . LEU A 1 92  ? 12.670 43.168 4.432   1.00 18.29 ? 89  LEU A CG    1 
ATOM   756  C  CD1   . LEU A 1 92  ? 13.918 42.324 4.546   1.00 23.81 ? 89  LEU A CD1   1 
ATOM   757  C  CD2   . LEU A 1 92  ? 12.400 43.897 5.733   1.00 17.58 ? 89  LEU A CD2   1 
ATOM   758  N  N     . THR A 1 93  ? 10.721 46.157 0.978   1.00 15.84 ? 90  THR A N     1 
ATOM   759  C  CA    A THR A 1 93  ? 10.895 46.981 -0.218  0.89 15.02 ? 90  THR A CA    1 
ATOM   760  C  CA    B THR A 1 93  ? 10.844 47.003 -0.214  0.11 15.20 ? 90  THR A CA    1 
ATOM   761  C  C     . THR A 1 93  ? 11.417 48.376 0.110   1.00 13.75 ? 90  THR A C     1 
ATOM   762  O  O     . THR A 1 93  ? 12.296 48.887 -0.596  1.00 16.56 ? 90  THR A O     1 
ATOM   763  C  CB    A THR A 1 93  ? 9.576  47.074 -0.984  0.89 19.65 ? 90  THR A CB    1 
ATOM   764  C  CB    B THR A 1 93  ? 9.477  47.183 -0.886  0.11 19.57 ? 90  THR A CB    1 
ATOM   765  O  OG1   A THR A 1 93  ? 9.168  45.757 -1.370  0.89 23.50 ? 90  THR A OG1   1 
ATOM   766  O  OG1   B THR A 1 93  ? 8.462  47.356 0.114   0.11 18.77 ? 90  THR A OG1   1 
ATOM   767  C  CG2   A THR A 1 93  ? 9.739  47.933 -2.231  0.89 16.35 ? 90  THR A CG2   1 
ATOM   768  C  CG2   B THR A 1 93  ? 9.139  46.011 -1.799  0.11 22.58 ? 90  THR A CG2   1 
ATOM   769  N  N     . LYS A 1 94  ? 10.886 49.018 1.159   1.00 12.62 ? 91  LYS A N     1 
ATOM   770  C  CA    . LYS A 1 94  ? 11.313 50.378 1.482   1.00 13.70 ? 91  LYS A CA    1 
ATOM   771  C  C     . LYS A 1 94  ? 12.822 50.458 1.663   1.00 12.65 ? 91  LYS A C     1 
ATOM   772  O  O     . LYS A 1 94  ? 13.461 51.415 1.207   1.00 13.20 ? 91  LYS A O     1 
ATOM   773  C  CB    . LYS A 1 94  ? 10.606 50.869 2.747   1.00 15.01 ? 91  LYS A CB    1 
ATOM   774  C  CG    . LYS A 1 94  ? 10.859 52.351 3.079   1.00 16.15 ? 91  LYS A CG    1 
ATOM   775  C  CD    . LYS A 1 94  ? 10.448 52.683 4.514   1.00 14.80 ? 91  LYS A CD    1 
ATOM   776  C  CE    . LYS A 1 94  ? 8.958  52.556 4.708   1.00 24.28 ? 91  LYS A CE    1 
ATOM   777  N  NZ    . LYS A 1 94  ? 8.557  52.930 6.096   1.00 15.84 ? 91  LYS A NZ    1 
ATOM   778  N  N     . TYR A 1 95  ? 13.408 49.452 2.320   1.00 11.29 ? 92  TYR A N     1 
ATOM   779  C  CA    . TYR A 1 95  ? 14.831 49.491 2.622   1.00 10.59 ? 92  TYR A CA    1 
ATOM   780  C  C     . TYR A 1 95  ? 15.660 49.102 1.413   1.00 11.51 ? 92  TYR A C     1 
ATOM   781  O  O     . TYR A 1 95  ? 16.744 49.660 1.220   1.00 13.70 ? 92  TYR A O     1 
ATOM   782  C  CB    . TYR A 1 95  ? 15.138 48.594 3.829   1.00 10.45 ? 92  TYR A CB    1 
ATOM   783  C  CG    . TYR A 1 95  ? 14.115 48.816 4.907   1.00 10.50 ? 92  TYR A CG    1 
ATOM   784  C  CD1   . TYR A 1 95  ? 14.102 49.998 5.645   1.00 10.79 ? 92  TYR A CD1   1 
ATOM   785  C  CD2   . TYR A 1 95  ? 13.098 47.897 5.116   1.00 12.38 ? 92  TYR A CD2   1 
ATOM   786  C  CE1   . TYR A 1 95  ? 13.125 50.228 6.593   1.00 10.87 ? 92  TYR A CE1   1 
ATOM   787  C  CE2   . TYR A 1 95  ? 12.114 48.118 6.048   1.00 11.59 ? 92  TYR A CE2   1 
ATOM   788  C  CZ    . TYR A 1 95  ? 12.118 49.279 6.778   1.00 12.55 ? 92  TYR A CZ    1 
ATOM   789  O  OH    . TYR A 1 95  ? 11.105 49.472 7.691   1.00 15.22 ? 92  TYR A OH    1 
ATOM   790  N  N     . ARG A 1 96  ? 15.160 48.185 0.580   1.00 13.45 ? 93  ARG A N     1 
ATOM   791  C  CA    . ARG A 1 96  ? 15.845 47.903 -0.680  1.00 12.64 ? 93  ARG A CA    1 
ATOM   792  C  C     . ARG A 1 96  ? 15.895 49.137 -1.576  1.00 15.70 ? 93  ARG A C     1 
ATOM   793  O  O     . ARG A 1 96  ? 16.926 49.412 -2.209  1.00 16.70 ? 93  ARG A O     1 
ATOM   794  C  CB    . ARG A 1 96  ? 15.146 46.755 -1.402  1.00 17.59 ? 93  ARG A CB    1 
ATOM   795  C  CG    . ARG A 1 96  ? 15.317 45.433 -0.699  1.00 16.09 ? 93  ARG A CG    1 
ATOM   796  C  CD    . ARG A 1 96  ? 14.776 44.272 -1.543  1.00 18.24 ? 93  ARG A CD    1 
ATOM   797  N  NE    . ARG A 1 96  ? 14.873 43.047 -0.763  1.00 28.53 ? 93  ARG A NE    1 
ATOM   798  C  CZ    . ARG A 1 96  ? 13.837 42.441 -0.193  1.00 23.45 ? 93  ARG A CZ    1 
ATOM   799  N  NH1   . ARG A 1 96  ? 12.610 42.915 -0.363  1.00 20.66 ? 93  ARG A NH1   1 
ATOM   800  N  NH2   . ARG A 1 96  ? 14.032 41.341 0.519   1.00 25.95 ? 93  ARG A NH2   1 
ATOM   801  N  N     . GLU A 1 97  ? 14.785 49.879 -1.655  1.00 14.75 ? 94  GLU A N     1 
ATOM   802  C  CA    . GLU A 1 97  ? 14.776 51.081 -2.486  1.00 15.03 ? 94  GLU A CA    1 
ATOM   803  C  C     . GLU A 1 97  ? 15.711 52.150 -1.930  1.00 16.69 ? 94  GLU A C     1 
ATOM   804  O  O     . GLU A 1 97  ? 16.397 52.834 -2.697  1.00 14.95 ? 94  GLU A O     1 
ATOM   805  C  CB    . GLU A 1 97  ? 13.353 51.597 -2.641  1.00 19.07 ? 94  GLU A CB    1 
ATOM   806  C  CG    . GLU A 1 97  ? 12.505 50.615 -3.460  1.00 21.70 ? 94  GLU A CG    1 
ATOM   807  C  CD    . GLU A 1 97  ? 11.104 51.105 -3.765  1.00 46.23 ? 94  GLU A CD    1 
ATOM   808  O  OE1   . GLU A 1 97  ? 10.644 52.079 -3.129  1.00 48.41 ? 94  GLU A OE1   1 
ATOM   809  O  OE2   . GLU A 1 97  ? 10.460 50.502 -4.653  1.00 47.63 ? 94  GLU A OE2   1 
ATOM   810  N  N     . ALA A 1 98  ? 15.773 52.297 -0.605  1.00 14.73 ? 95  ALA A N     1 
ATOM   811  C  CA    . ALA A 1 98  ? 16.711 53.258 -0.029  1.00 13.99 ? 95  ALA A CA    1 
ATOM   812  C  C     . ALA A 1 98  ? 18.149 52.847 -0.319  1.00 14.08 ? 95  ALA A C     1 
ATOM   813  O  O     . ALA A 1 98  ? 19.008 53.697 -0.578  1.00 15.23 ? 95  ALA A O     1 
ATOM   814  C  CB    . ALA A 1 98  ? 16.478 53.386 1.483   1.00 13.00 ? 95  ALA A CB    1 
ATOM   815  N  N     . SER A 1 99  ? 18.415 51.540 -0.295  1.00 11.50 ? 96  SER A N     1 
ATOM   816  C  CA    . SER A 1 99  ? 19.733 51.006 -0.630  1.00 11.89 ? 96  SER A CA    1 
ATOM   817  C  C     . SER A 1 99  ? 20.145 51.393 -2.046  1.00 16.47 ? 96  SER A C     1 
ATOM   818  O  O     . SER A 1 99  ? 21.294 51.789 -2.288  1.00 16.22 ? 96  SER A O     1 
ATOM   819  C  CB    . SER A 1 99  ? 19.704 49.483 -0.478  1.00 15.86 ? 96  SER A CB    1 
ATOM   820  O  OG    . SER A 1 99  ? 20.846 48.854 -1.006  1.00 24.79 ? 96  SER A OG    1 
ATOM   821  N  N     . VAL A 1 100 ? 19.217 51.282 -2.996  1.00 15.17 ? 97  VAL A N     1 
ATOM   822  C  CA    . VAL A 1 100 ? 19.519 51.676 -4.371  1.00 13.79 ? 97  VAL A CA    1 
ATOM   823  C  C     . VAL A 1 100 ? 19.894 53.157 -4.449  1.00 16.34 ? 97  VAL A C     1 
ATOM   824  O  O     . VAL A 1 100 ? 20.804 53.530 -5.200  1.00 16.42 ? 97  VAL A O     1 
ATOM   825  C  CB    . VAL A 1 100 ? 18.342 51.315 -5.292  1.00 18.03 ? 97  VAL A CB    1 
ATOM   826  C  CG1   . VAL A 1 100 ? 18.520 51.942 -6.682  1.00 20.38 ? 97  VAL A CG1   1 
ATOM   827  C  CG2   . VAL A 1 100 ? 18.245 49.801 -5.407  1.00 16.66 ? 97  VAL A CG2   1 
ATOM   828  N  N     . GLU A 1 101 ? 19.224 54.020 -3.671  1.00 13.81 ? 98  GLU A N     1 
ATOM   829  C  CA    . GLU A 1 101 ? 19.583 55.443 -3.652  1.00 13.44 ? 98  GLU A CA    1 
ATOM   830  C  C     . GLU A 1 101 ? 21.061 55.624 -3.360  1.00 15.00 ? 98  GLU A C     1 
ATOM   831  O  O     . GLU A 1 101 ? 21.761 56.406 -4.023  1.00 14.11 ? 98  GLU A O     1 
ATOM   832  C  CB    . GLU A 1 101 ? 18.787 56.212 -2.585  1.00 15.17 ? 98  GLU A CB    1 
ATOM   833  C  CG    . GLU A 1 101 ? 17.295 56.426 -2.833  1.00 20.39 ? 98  GLU A CG    1 
ATOM   834  C  CD    . GLU A 1 101 ? 16.648 57.225 -1.698  1.00 22.64 ? 98  GLU A CD    1 
ATOM   835  O  OE1   . GLU A 1 101 ? 16.971 58.432 -1.551  1.00 18.04 ? 98  GLU A OE1   1 
ATOM   836  O  OE2   . GLU A 1 101 ? 15.830 56.640 -0.940  1.00 22.91 ? 98  GLU A OE2   1 
ATOM   837  N  N     . VAL A 1 102 ? 21.533 54.923 -2.329  1.00 14.69 ? 99  VAL A N     1 
ATOM   838  C  CA    . VAL A 1 102 ? 22.904 55.074 -1.864  1.00 12.33 ? 99  VAL A CA    1 
ATOM   839  C  C     . VAL A 1 102 ? 23.872 54.471 -2.865  1.00 12.36 ? 99  VAL A C     1 
ATOM   840  O  O     . VAL A 1 102 ? 24.900 55.076 -3.186  1.00 13.12 ? 99  VAL A O     1 
ATOM   841  C  CB    . VAL A 1 102 ? 23.073 54.424 -0.481  1.00 10.76 ? 99  VAL A CB    1 
ATOM   842  C  CG1   . VAL A 1 102 ? 24.545 54.466 -0.078  1.00 19.46 ? 99  VAL A CG1   1 
ATOM   843  C  CG2   . VAL A 1 102 ? 22.241 55.171 0.552   1.00 12.14 ? 99  VAL A CG2   1 
ATOM   844  N  N     . MET A 1 103 ? 23.569 53.254 -3.345  1.00 11.85 ? 100 MET A N     1 
ATOM   845  C  CA    . MET A 1 103 ? 24.467 52.578 -4.288  1.00 12.45 ? 100 MET A CA    1 
ATOM   846  C  C     . MET A 1 103 ? 24.631 53.380 -5.576  1.00 17.51 ? 100 MET A C     1 
ATOM   847  O  O     . MET A 1 103 ? 25.710 53.385 -6.184  1.00 15.21 ? 100 MET A O     1 
ATOM   848  C  CB    . MET A 1 103 ? 23.952 51.177 -4.626  1.00 16.91 ? 100 MET A CB    1 
ATOM   849  C  CG    . MET A 1 103 ? 23.704 50.259 -3.456  1.00 20.63 ? 100 MET A CG    1 
ATOM   850  S  SD    . MET A 1 103 ? 25.241 49.819 -2.632  1.00 28.62 ? 100 MET A SD    1 
ATOM   851  C  CE    . MET A 1 103 ? 24.636 48.831 -1.251  1.00 24.72 ? 100 MET A CE    1 
ATOM   852  N  N     . GLU A 1 104 ? 23.564 54.042 -6.030  1.00 13.66 ? 101 GLU A N     1 
ATOM   853  C  CA    . GLU A 1 104 ? 23.697 54.797 -7.271  1.00 15.64 ? 101 GLU A CA    1 
ATOM   854  C  C     . GLU A 1 104 ? 24.609 56.001 -7.095  1.00 19.26 ? 101 GLU A C     1 
ATOM   855  O  O     . GLU A 1 104 ? 25.348 56.352 -8.024  1.00 17.33 ? 101 GLU A O     1 
ATOM   856  C  CB    . GLU A 1 104 ? 22.316 55.206 -7.788  1.00 17.46 ? 101 GLU A CB    1 
ATOM   857  C  CG    . GLU A 1 104 ? 21.535 54.000 -8.296  1.00 25.60 ? 101 GLU A CG    1 
ATOM   858  C  CD    . GLU A 1 104 ? 20.190 54.358 -8.885  1.00 38.51 ? 101 GLU A CD    1 
ATOM   859  O  OE1   . GLU A 1 104 ? 19.672 55.453 -8.580  1.00 42.49 ? 101 GLU A OE1   1 
ATOM   860  O  OE2   . GLU A 1 104 ? 19.655 53.534 -9.659  1.00 43.90 ? 101 GLU A OE2   1 
ATOM   861  N  N     . ILE A 1 105 ? 24.594 56.625 -5.915  1.00 14.28 ? 102 ILE A N     1 
ATOM   862  C  CA    . ILE A 1 105 ? 25.515 57.724 -5.638  1.00 10.78 ? 102 ILE A CA    1 
ATOM   863  C  C     . ILE A 1 105 ? 26.949 57.212 -5.597  1.00 12.55 ? 102 ILE A C     1 
ATOM   864  O  O     . ILE A 1 105 ? 27.853 57.812 -6.194  1.00 16.22 ? 102 ILE A O     1 
ATOM   865  C  CB    . ILE A 1 105 ? 25.134 58.427 -4.322  1.00 13.80 ? 102 ILE A CB    1 
ATOM   866  C  CG1   . ILE A 1 105 ? 23.754 59.079 -4.455  1.00 16.69 ? 102 ILE A CG1   1 
ATOM   867  C  CG2   . ILE A 1 105 ? 26.196 59.464 -3.902  1.00 14.97 ? 102 ILE A CG2   1 
ATOM   868  C  CD1   . ILE A 1 105 ? 23.158 59.504 -3.148  1.00 19.13 ? 102 ILE A CD1   1 
ATOM   869  N  N     . MET A 1 106 ? 27.181 56.096 -4.904  1.00 13.06 ? 103 MET A N     1 
ATOM   870  C  CA    . MET A 1 106 ? 28.542 55.563 -4.810  1.00 11.97 ? 103 MET A CA    1 
ATOM   871  C  C     . MET A 1 106 ? 29.088 55.193 -6.182  1.00 14.19 ? 103 MET A C     1 
ATOM   872  O  O     . MET A 1 106 ? 30.267 55.419 -6.467  1.00 13.59 ? 103 MET A O     1 
ATOM   873  C  CB    . MET A 1 106 ? 28.585 54.345 -3.882  1.00 13.35 ? 103 MET A CB    1 
ATOM   874  C  CG    . MET A 1 106 ? 28.396 54.684 -2.410  1.00 14.72 ? 103 MET A CG    1 
ATOM   875  S  SD    . MET A 1 106 ? 28.466 53.184 -1.422  1.00 18.90 ? 103 MET A SD    1 
ATOM   876  C  CE    . MET A 1 106 ? 30.069 52.565 -1.904  1.00 24.80 ? 103 MET A CE    1 
ATOM   877  N  N     . SER A 1 107 ? 28.233 54.662 -7.057  1.00 14.89 ? 104 SER A N     1 
ATOM   878  C  CA    A SER A 1 107 ? 28.659 54.258 -8.391  0.69 17.75 ? 104 SER A CA    1 
ATOM   879  C  CA    B SER A 1 107 ? 28.686 54.253 -8.380  0.31 17.76 ? 104 SER A CA    1 
ATOM   880  C  C     . SER A 1 107 ? 29.165 55.422 -9.235  1.00 17.98 ? 104 SER A C     1 
ATOM   881  O  O     . SER A 1 107 ? 29.826 55.184 -10.252 1.00 18.98 ? 104 SER A O     1 
ATOM   882  C  CB    A SER A 1 107 ? 27.507 53.560 -9.114  0.69 17.81 ? 104 SER A CB    1 
ATOM   883  C  CB    B SER A 1 107 ? 27.574 53.489 -9.106  0.31 17.86 ? 104 SER A CB    1 
ATOM   884  O  OG    A SER A 1 107 ? 27.203 52.337 -8.487  0.69 20.59 ? 104 SER A OG    1 
ATOM   885  O  OG    B SER A 1 107 ? 26.487 54.335 -9.432  0.31 21.14 ? 104 SER A OG    1 
ATOM   886  N  N     . ARG A 1 108 ? 28.863 56.673 -8.857  1.00 15.33 ? 105 ARG A N     1 
ATOM   887  C  CA    . ARG A 1 108 ? 29.380 57.803 -9.631  1.00 15.76 ? 105 ARG A CA    1 
ATOM   888  C  C     . ARG A 1 108 ? 30.876 57.962 -9.444  1.00 19.16 ? 105 ARG A C     1 
ATOM   889  O  O     . ARG A 1 108 ? 31.556 58.534 -10.306 1.00 19.28 ? 105 ARG A O     1 
ATOM   890  C  CB    . ARG A 1 108 ? 28.686 59.113 -9.238  1.00 21.75 ? 105 ARG A CB    1 
ATOM   891  C  CG    . ARG A 1 108 ? 27.177 59.088 -9.352  1.00 17.15 ? 105 ARG A CG    1 
ATOM   892  C  CD    . ARG A 1 108 ? 26.627 60.501 -9.553  1.00 27.63 ? 105 ARG A CD    1 
ATOM   893  N  NE    . ARG A 1 108 ? 27.023 61.423 -8.495  1.00 28.35 ? 105 ARG A NE    1 
ATOM   894  C  CZ    . ARG A 1 108 ? 26.211 61.848 -7.529  1.00 23.46 ? 105 ARG A CZ    1 
ATOM   895  N  NH1   . ARG A 1 108 ? 24.949 61.436 -7.491  1.00 24.40 ? 105 ARG A NH1   1 
ATOM   896  N  NH2   . ARG A 1 108 ? 26.662 62.692 -6.612  1.00 27.44 ? 105 ARG A NH2   1 
ATOM   897  N  N     . PHE A 1 109 ? 31.398 57.488 -8.321  1.00 19.08 ? 106 PHE A N     1 
ATOM   898  C  CA    . PHE A 1 109 ? 32.798 57.691 -7.989  1.00 17.43 ? 106 PHE A CA    1 
ATOM   899  C  C     . PHE A 1 109 ? 33.669 56.545 -8.480  1.00 21.80 ? 106 PHE A C     1 
ATOM   900  O  O     . PHE A 1 109 ? 34.795 56.773 -8.937  1.00 25.10 ? 106 PHE A O     1 
ATOM   901  C  CB    . PHE A 1 109 ? 32.953 57.861 -6.476  1.00 16.28 ? 106 PHE A CB    1 
ATOM   902  C  CG    . PHE A 1 109 ? 32.286 59.095 -5.929  1.00 18.06 ? 106 PHE A CG    1 
ATOM   903  C  CD1   . PHE A 1 109 ? 30.913 59.128 -5.713  1.00 13.65 ? 106 PHE A CD1   1 
ATOM   904  C  CD2   . PHE A 1 109 ? 33.032 60.225 -5.631  1.00 19.05 ? 106 PHE A CD2   1 
ATOM   905  C  CE1   . PHE A 1 109 ? 30.296 60.267 -5.220  1.00 16.43 ? 106 PHE A CE1   1 
ATOM   906  C  CE2   . PHE A 1 109 ? 32.426 61.364 -5.125  1.00 20.63 ? 106 PHE A CE2   1 
ATOM   907  C  CZ    . PHE A 1 109 ? 31.054 61.390 -4.922  1.00 23.12 ? 106 PHE A CZ    1 
ATOM   908  N  N     . ALA A 1 110 ? 33.170 55.318 -8.427  1.00 21.71 ? 107 ALA A N     1 
ATOM   909  C  CA    . ALA A 1 110 ? 34.042 54.185 -8.699  1.00 26.43 ? 107 ALA A CA    1 
ATOM   910  C  C     . ALA A 1 110 ? 33.214 52.923 -8.864  1.00 28.50 ? 107 ALA A C     1 
ATOM   911  O  O     . ALA A 1 110 ? 32.016 52.890 -8.572  1.00 21.23 ? 107 ALA A O     1 
ATOM   912  C  CB    . ALA A 1 110 ? 35.071 54.003 -7.581  1.00 24.26 ? 107 ALA A CB    1 
ATOM   913  N  N     . VAL A 1 111 ? 33.893 51.876 -9.339  1.00 31.21 ? 108 VAL A N     1 
ATOM   914  C  CA    . VAL A 1 111 ? 33.315 50.541 -9.390  1.00 29.46 ? 108 VAL A CA    1 
ATOM   915  C  C     . VAL A 1 111 ? 32.989 50.075 -7.982  1.00 17.65 ? 108 VAL A C     1 
ATOM   916  O  O     . VAL A 1 111 ? 33.836 50.141 -7.078  1.00 23.05 ? 108 VAL A O     1 
ATOM   917  C  CB    . VAL A 1 111 ? 34.295 49.571 -10.065 1.00 27.80 ? 108 VAL A CB    1 
ATOM   918  C  CG1   . VAL A 1 111 ? 33.918 48.133 -9.744  1.00 29.50 ? 108 VAL A CG1   1 
ATOM   919  C  CG2   . VAL A 1 111 ? 34.329 49.810 -11.569 1.00 40.51 ? 108 VAL A CG2   1 
ATOM   920  N  N     . ILE A 1 112 ? 31.760 49.595 -7.781  1.00 23.24 ? 109 ILE A N     1 
ATOM   921  C  CA    . ILE A 1 112 ? 31.387 49.092 -6.464  1.00 19.83 ? 109 ILE A CA    1 
ATOM   922  C  C     . ILE A 1 112 ? 30.973 47.629 -6.542  1.00 16.63 ? 109 ILE A C     1 
ATOM   923  O  O     . ILE A 1 112 ? 30.524 47.117 -7.577  1.00 16.79 ? 109 ILE A O     1 
ATOM   924  C  CB    . ILE A 1 112 ? 30.271 49.928 -5.787  1.00 22.91 ? 109 ILE A CB    1 
ATOM   925  C  CG1   . ILE A 1 112 ? 28.898 49.590 -6.361  1.00 24.13 ? 109 ILE A CG1   1 
ATOM   926  C  CG2   . ILE A 1 112 ? 30.609 51.421 -5.865  1.00 23.33 ? 109 ILE A CG2   1 
ATOM   927  C  CD1   . ILE A 1 112 ? 27.720 50.128 -5.531  1.00 24.68 ? 109 ILE A CD1   1 
ATOM   928  N  N     . GLU A 1 113 ? 31.168 46.951 -5.420  1.00 13.24 ? 110 GLU A N     1 
ATOM   929  C  CA    . GLU A 1 113 ? 30.682 45.602 -5.175  1.00 11.34 ? 110 GLU A CA    1 
ATOM   930  C  C     . GLU A 1 113 ? 29.648 45.694 -4.059  1.00 13.76 ? 110 GLU A C     1 
ATOM   931  O  O     . GLU A 1 113 ? 29.997 45.999 -2.916  1.00 14.40 ? 110 GLU A O     1 
ATOM   932  C  CB    . GLU A 1 113 ? 31.816 44.660 -4.768  1.00 13.99 ? 110 GLU A CB    1 
ATOM   933  C  CG    . GLU A 1 113 ? 31.334 43.221 -4.554  1.00 14.64 ? 110 GLU A CG    1 
ATOM   934  C  CD    . GLU A 1 113 ? 32.401 42.280 -4.008  1.00 23.86 ? 110 GLU A CD    1 
ATOM   935  O  OE1   . GLU A 1 113 ? 33.608 42.542 -4.201  1.00 20.14 ? 110 GLU A OE1   1 
ATOM   936  O  OE2   . GLU A 1 113 ? 32.024 41.266 -3.377  1.00 27.50 ? 110 GLU A OE2   1 
ATOM   937  N  N     . ARG A 1 114 ? 28.390 45.420 -4.380  1.00 16.19 ? 111 ARG A N     1 
ATOM   938  C  CA    . ARG A 1 114 ? 27.360 45.381 -3.345  1.00 12.14 ? 111 ARG A CA    1 
ATOM   939  C  C     . ARG A 1 114 ? 27.618 44.191 -2.437  1.00 18.36 ? 111 ARG A C     1 
ATOM   940  O  O     . ARG A 1 114 ? 27.671 43.045 -2.900  1.00 23.51 ? 111 ARG A O     1 
ATOM   941  C  CB    . ARG A 1 114 ? 25.977 45.296 -3.991  1.00 15.30 ? 111 ARG A CB    1 
ATOM   942  C  CG    . ARG A 1 114 ? 24.801 45.241 -3.007  1.00 22.55 ? 111 ARG A CG    1 
ATOM   943  C  CD    . ARG A 1 114 ? 23.511 44.903 -3.748  1.00 30.51 ? 111 ARG A CD    1 
ATOM   944  N  NE    . ARG A 1 114 ? 22.322 45.002 -2.906  1.00 36.23 ? 111 ARG A NE    1 
ATOM   945  C  CZ    . ARG A 1 114 ? 21.829 44.002 -2.180  1.00 38.10 ? 111 ARG A CZ    1 
ATOM   946  N  NH1   . ARG A 1 114 ? 22.433 42.819 -2.177  1.00 38.33 ? 111 ARG A NH1   1 
ATOM   947  N  NH2   . ARG A 1 114 ? 20.733 44.186 -1.446  1.00 37.24 ? 111 ARG A NH2   1 
ATOM   948  N  N     . ALA A 1 115 ? 27.814 44.453 -1.146  1.00 13.44 ? 112 ALA A N     1 
ATOM   949  C  CA    . ALA A 1 115 ? 28.118 43.378 -0.222  1.00 11.93 ? 112 ALA A CA    1 
ATOM   950  C  C     . ALA A 1 115 ? 26.918 42.940 0.604   1.00 18.39 ? 112 ALA A C     1 
ATOM   951  O  O     . ALA A 1 115 ? 26.925 41.821 1.139   1.00 19.51 ? 112 ALA A O     1 
ATOM   952  C  CB    . ALA A 1 115 ? 29.256 43.793 0.723   1.00 16.61 ? 112 ALA A CB    1 
ATOM   953  N  N     . SER A 1 116 ? 25.905 43.782 0.718   1.00 15.03 ? 113 SER A N     1 
ATOM   954  C  CA    . SER A 1 116 ? 24.708 43.503 1.507   1.00 14.17 ? 113 SER A CA    1 
ATOM   955  C  C     . SER A 1 116 ? 23.716 44.613 1.194   1.00 13.42 ? 113 SER A C     1 
ATOM   956  O  O     . SER A 1 116 ? 23.987 45.483 0.361   1.00 16.91 ? 113 SER A O     1 
ATOM   957  C  CB    . SER A 1 116 ? 25.017 43.446 3.004   1.00 19.19 ? 113 SER A CB    1 
ATOM   958  O  OG    . SER A 1 116 ? 25.302 44.754 3.505   1.00 19.68 ? 113 SER A OG    1 
ATOM   959  N  N     . ILE A 1 117 ? 22.584 44.625 1.903   1.00 13.58 ? 114 ILE A N     1 
ATOM   960  C  CA    . ILE A 1 117 ? 21.614 45.684 1.660   1.00 14.95 ? 114 ILE A CA    1 
ATOM   961  C  C     . ILE A 1 117 ? 22.208 47.059 1.966   1.00 13.92 ? 114 ILE A C     1 
ATOM   962  O  O     . ILE A 1 117 ? 21.799 48.060 1.370   1.00 16.09 ? 114 ILE A O     1 
ATOM   963  C  CB    . ILE A 1 117 ? 20.320 45.417 2.462   1.00 13.80 ? 114 ILE A CB    1 
ATOM   964  C  CG1   . ILE A 1 117 ? 19.194 46.321 1.952   1.00 22.26 ? 114 ILE A CG1   1 
ATOM   965  C  CG2   . ILE A 1 117 ? 20.550 45.624 3.944   1.00 14.54 ? 114 ILE A CG2   1 
ATOM   966  C  CD1   . ILE A 1 117 ? 17.798 45.883 2.391   1.00 20.97 ? 114 ILE A CD1   1 
ATOM   967  N  N     . ASP A 1 118 ? 23.217 47.141 2.855   1.00 12.65 ? 115 ASP A N     1 
ATOM   968  C  CA    . ASP A 1 118 ? 23.682 48.477 3.215   1.00 14.25 ? 115 ASP A CA    1 
ATOM   969  C  C     . ASP A 1 118 ? 25.203 48.615 3.238   1.00 16.12 ? 115 ASP A C     1 
ATOM   970  O  O     . ASP A 1 118 ? 25.718 49.521 3.898   1.00 13.84 ? 115 ASP A O     1 
ATOM   971  C  CB    . ASP A 1 118 ? 23.122 48.887 4.577   1.00 14.58 ? 115 ASP A CB    1 
ATOM   972  C  CG    . ASP A 1 118 ? 23.832 48.205 5.720   1.00 16.83 ? 115 ASP A CG    1 
ATOM   973  O  OD1   . ASP A 1 118 ? 24.257 47.049 5.547   1.00 18.66 ? 115 ASP A OD1   1 
ATOM   974  O  OD2   . ASP A 1 118 ? 23.972 48.822 6.791   1.00 14.19 ? 115 ASP A OD2   1 
ATOM   975  N  N     . GLU A 1 119 ? 25.933 47.741 2.554   1.00 13.98 ? 116 GLU A N     1 
ATOM   976  C  CA    . GLU A 1 119 ? 27.392 47.798 2.485   1.00 14.09 ? 116 GLU A CA    1 
ATOM   977  C  C     . GLU A 1 119 ? 27.827 47.654 1.037   1.00 13.76 ? 116 GLU A C     1 
ATOM   978  O  O     . GLU A 1 119 ? 27.243 46.867 0.287   1.00 15.71 ? 116 GLU A O     1 
ATOM   979  C  CB    . GLU A 1 119 ? 28.060 46.674 3.304   1.00 17.95 ? 116 GLU A CB    1 
ATOM   980  C  CG    . GLU A 1 119 ? 27.986 46.816 4.787   1.00 24.12 ? 116 GLU A CG    1 
ATOM   981  C  CD    . GLU A 1 119 ? 28.728 45.696 5.487   1.00 23.98 ? 116 GLU A CD    1 
ATOM   982  O  OE1   . GLU A 1 119 ? 29.452 44.954 4.793   1.00 25.79 ? 116 GLU A OE1   1 
ATOM   983  O  OE2   . GLU A 1 119 ? 28.576 45.553 6.713   1.00 32.71 ? 116 GLU A OE2   1 
ATOM   984  N  N     . ALA A 1 120 ? 28.852 48.406 0.644   1.00 14.45 ? 117 ALA A N     1 
ATOM   985  C  CA    . ALA A 1 120 ? 29.476 48.193 -0.653  1.00 11.57 ? 117 ALA A CA    1 
ATOM   986  C  C     . ALA A 1 120 ? 30.971 48.431 -0.542  1.00 12.57 ? 117 ALA A C     1 
ATOM   987  O  O     . ALA A 1 120 ? 31.413 49.328 0.177   1.00 12.46 ? 117 ALA A O     1 
ATOM   988  C  CB    . ALA A 1 120 ? 28.880 49.110 -1.721  1.00 14.83 ? 117 ALA A CB    1 
ATOM   989  N  N     . TYR A 1 121 ? 31.745 47.592 -1.225  1.00 11.91 ? 118 TYR A N     1 
ATOM   990  C  CA    . TYR A 1 121 ? 33.164 47.850 -1.392  1.00 13.85 ? 118 TYR A CA    1 
ATOM   991  C  C     . TYR A 1 121 ? 33.394 48.717 -2.614  1.00 14.87 ? 118 TYR A C     1 
ATOM   992  O  O     . TYR A 1 121 ? 32.650 48.653 -3.591  1.00 14.79 ? 118 TYR A O     1 
ATOM   993  C  CB    . TYR A 1 121 ? 33.947 46.554 -1.541  1.00 12.72 ? 118 TYR A CB    1 
ATOM   994  C  CG    . TYR A 1 121 ? 33.922 45.712 -0.314  1.00 13.83 ? 118 TYR A CG    1 
ATOM   995  C  CD1   . TYR A 1 121 ? 34.858 45.902 0.693   1.00 12.62 ? 118 TYR A CD1   1 
ATOM   996  C  CD2   . TYR A 1 121 ? 32.961 44.715 -0.150  1.00 12.31 ? 118 TYR A CD2   1 
ATOM   997  C  CE1   . TYR A 1 121 ? 34.843 45.115 1.833   1.00 13.07 ? 118 TYR A CE1   1 
ATOM   998  C  CE2   . TYR A 1 121 ? 32.937 43.931 0.981   1.00 16.74 ? 118 TYR A CE2   1 
ATOM   999  C  CZ    . TYR A 1 121 ? 33.877 44.136 1.971   1.00 16.95 ? 118 TYR A CZ    1 
ATOM   1000 O  OH    . TYR A 1 121 ? 33.851 43.360 3.102   1.00 19.36 ? 118 TYR A OH    1 
ATOM   1001 N  N     . VAL A 1 122 ? 34.458 49.514 -2.554  1.00 12.42 ? 119 VAL A N     1 
ATOM   1002 C  CA    . VAL A 1 122 ? 34.813 50.484 -3.580  1.00 14.06 ? 119 VAL A CA    1 
ATOM   1003 C  C     . VAL A 1 122 ? 36.266 50.241 -3.946  1.00 14.84 ? 119 VAL A C     1 
ATOM   1004 O  O     . VAL A 1 122 ? 37.120 50.230 -3.060  1.00 14.32 ? 119 VAL A O     1 
ATOM   1005 C  CB    . VAL A 1 122 ? 34.649 51.930 -3.060  1.00 17.32 ? 119 VAL A CB    1 
ATOM   1006 C  CG1   . VAL A 1 122 ? 34.494 52.880 -4.212  1.00 26.00 ? 119 VAL A CG1   1 
ATOM   1007 C  CG2   . VAL A 1 122 ? 33.482 52.034 -2.090  1.00 24.38 ? 119 VAL A CG2   1 
ATOM   1008 N  N     . ASP A 1 123 ? 36.558 50.054 -5.234  1.00 15.49 ? 120 ASP A N     1 
ATOM   1009 C  CA    . ASP A 1 123 ? 37.951 49.988 -5.675  1.00 11.52 ? 120 ASP A CA    1 
ATOM   1010 C  C     . ASP A 1 123 ? 38.377 51.376 -6.152  1.00 16.65 ? 120 ASP A C     1 
ATOM   1011 O  O     . ASP A 1 123 ? 38.016 51.810 -7.246  1.00 18.42 ? 120 ASP A O     1 
ATOM   1012 C  CB    . ASP A 1 123 ? 38.126 48.933 -6.761  1.00 20.42 ? 120 ASP A CB    1 
ATOM   1013 C  CG    . ASP A 1 123 ? 39.583 48.613 -7.035  1.00 26.73 ? 120 ASP A CG    1 
ATOM   1014 O  OD1   . ASP A 1 123 ? 40.435 49.537 -7.026  1.00 21.75 ? 120 ASP A OD1   1 
ATOM   1015 O  OD2   . ASP A 1 123 ? 39.884 47.422 -7.268  1.00 36.34 ? 120 ASP A OD2   1 
ATOM   1016 N  N     . LEU A 1 124 ? 39.168 52.072 -5.337  1.00 13.67 ? 121 LEU A N     1 
ATOM   1017 C  CA    . LEU A 1 124 ? 39.524 53.460 -5.585  1.00 13.78 ? 121 LEU A CA    1 
ATOM   1018 C  C     . LEU A 1 124 ? 40.867 53.635 -6.280  1.00 12.11 ? 121 LEU A C     1 
ATOM   1019 O  O     . LEU A 1 124 ? 41.304 54.778 -6.436  1.00 13.99 ? 121 LEU A O     1 
ATOM   1020 C  CB    . LEU A 1 124 ? 39.543 54.249 -4.261  1.00 13.97 ? 121 LEU A CB    1 
ATOM   1021 C  CG    . LEU A 1 124 ? 38.188 54.314 -3.566  1.00 16.49 ? 121 LEU A CG    1 
ATOM   1022 C  CD1   . LEU A 1 124 ? 38.348 54.629 -2.096  1.00 19.88 ? 121 LEU A CD1   1 
ATOM   1023 C  CD2   . LEU A 1 124 ? 37.349 55.369 -4.259  1.00 23.97 ? 121 LEU A CD2   1 
ATOM   1024 N  N     . THR A 1 125 ? 41.534 52.541 -6.680  1.00 13.18 ? 122 THR A N     1 
ATOM   1025 C  CA    . THR A 1 125 ? 42.918 52.644 -7.135  1.00 15.20 ? 122 THR A CA    1 
ATOM   1026 C  C     . THR A 1 125 ? 43.040 53.607 -8.310  1.00 13.91 ? 122 THR A C     1 
ATOM   1027 O  O     . THR A 1 125 ? 43.921 54.472 -8.321  1.00 17.16 ? 122 THR A O     1 
ATOM   1028 C  CB    . THR A 1 125 ? 43.461 51.262 -7.518  1.00 18.20 ? 122 THR A CB    1 
ATOM   1029 O  OG1   . THR A 1 125 ? 43.216 50.325 -6.459  1.00 17.74 ? 122 THR A OG1   1 
ATOM   1030 C  CG2   . THR A 1 125 ? 44.966 51.336 -7.774  1.00 19.87 ? 122 THR A CG2   1 
ATOM   1031 N  N     . SER A 1 126 ? 42.128 53.501 -9.285  1.00 16.12 ? 123 SER A N     1 
ATOM   1032 C  CA    . SER A 1 126 ? 42.206 54.359 -10.467 1.00 16.34 ? 123 SER A CA    1 
ATOM   1033 C  C     . SER A 1 126 ? 41.847 55.799 -10.143 1.00 18.57 ? 123 SER A C     1 
ATOM   1034 O  O     . SER A 1 126 ? 42.509 56.732 -10.618 1.00 19.57 ? 123 SER A O     1 
ATOM   1035 C  CB    . SER A 1 126 ? 41.285 53.825 -11.563 1.00 23.05 ? 123 SER A CB    1 
ATOM   1036 O  OG    . SER A 1 126 ? 41.774 52.597 -12.060 1.00 32.65 ? 123 SER A OG    1 
ATOM   1037 N  N     . ALA A 1 127 ? 40.797 56.006 -9.345  1.00 15.20 ? 124 ALA A N     1 
ATOM   1038 C  CA    . ALA A 1 127 ? 40.410 57.365 -8.988  1.00 18.49 ? 124 ALA A CA    1 
ATOM   1039 C  C     . ALA A 1 127 ? 41.509 58.067 -8.202  1.00 18.29 ? 124 ALA A C     1 
ATOM   1040 O  O     . ALA A 1 127 ? 41.677 59.284 -8.330  1.00 17.39 ? 124 ALA A O     1 
ATOM   1041 C  CB    . ALA A 1 127 ? 39.100 57.349 -8.198  1.00 19.62 ? 124 ALA A CB    1 
ATOM   1042 N  N     . VAL A 1 128 ? 42.254 57.322 -7.377  1.00 16.68 ? 125 VAL A N     1 
ATOM   1043 C  CA    . VAL A 1 128 ? 43.370 57.906 -6.638  1.00 16.36 ? 125 VAL A CA    1 
ATOM   1044 C  C     . VAL A 1 128 ? 44.468 58.362 -7.587  1.00 17.24 ? 125 VAL A C     1 
ATOM   1045 O  O     . VAL A 1 128 ? 45.016 59.460 -7.429  1.00 21.86 ? 125 VAL A O     1 
ATOM   1046 C  CB    . VAL A 1 128 ? 43.914 56.910 -5.599  1.00 14.75 ? 125 VAL A CB    1 
ATOM   1047 C  CG1   . VAL A 1 128 ? 45.304 57.356 -5.114  1.00 14.59 ? 125 VAL A CG1   1 
ATOM   1048 C  CG2   . VAL A 1 128 ? 42.928 56.799 -4.428  1.00 14.80 ? 125 VAL A CG2   1 
ATOM   1049 N  N     . GLN A 1 129 ? 44.831 57.514 -8.558  1.00 19.44 ? 126 GLN A N     1 
ATOM   1050 C  CA    . GLN A 1 129 ? 45.875 57.896 -9.510  1.00 33.19 ? 126 GLN A CA    1 
ATOM   1051 C  C     . GLN A 1 129 ? 45.505 59.191 -10.218 1.00 28.15 ? 126 GLN A C     1 
ATOM   1052 O  O     . GLN A 1 129 ? 46.335 60.099 -10.359 1.00 32.19 ? 126 GLN A O     1 
ATOM   1053 C  CB    . GLN A 1 129 ? 46.112 56.786 -10.534 1.00 25.64 ? 126 GLN A CB    1 
ATOM   1054 C  CG    . GLN A 1 129 ? 46.451 55.402 -9.973  1.00 30.32 ? 126 GLN A CG    1 
ATOM   1055 C  CD    . GLN A 1 129 ? 47.840 55.306 -9.356  0.54 45.29 ? 126 GLN A CD    1 
ATOM   1056 O  OE1   . GLN A 1 129 ? 48.526 56.311 -9.158  0.72 52.38 ? 126 GLN A OE1   1 
ATOM   1057 N  NE2   . GLN A 1 129 ? 48.260 54.084 -9.050  0.77 44.73 ? 126 GLN A NE2   1 
ATOM   1058 N  N     . GLU A 1 130 ? 44.249 59.299 -10.653 1.00 25.23 ? 127 GLU A N     1 
ATOM   1059 C  CA    . GLU A 1 130 ? 43.789 60.514 -11.319 1.00 28.01 ? 127 GLU A CA    1 
ATOM   1060 C  C     . GLU A 1 130 ? 43.939 61.732 -10.417 1.00 34.31 ? 127 GLU A C     1 
ATOM   1061 O  O     . GLU A 1 130 ? 44.483 62.762 -10.834 1.00 35.94 ? 127 GLU A O     1 
ATOM   1062 C  CB    . GLU A 1 130 ? 42.339 60.338 -11.776 1.00 25.24 ? 127 GLU A CB    1 
ATOM   1063 C  CG    . GLU A 1 130 ? 42.161 59.229 -12.797 1.00 28.20 ? 127 GLU A CG    1 
ATOM   1064 N  N     . ARG A 1 131 ? 43.487 61.625 -9.166  1.00 26.81 ? 128 ARG A N     1 
ATOM   1065 C  CA    . ARG A 1 131 ? 43.551 62.769 -8.265  1.00 24.59 ? 128 ARG A CA    1 
ATOM   1066 C  C     . ARG A 1 131 ? 44.982 63.130 -7.910  1.00 26.95 ? 128 ARG A C     1 
ATOM   1067 O  O     . ARG A 1 131 ? 45.277 64.306 -7.672  1.00 34.97 ? 128 ARG A O     1 
ATOM   1068 C  CB    . ARG A 1 131 ? 42.745 62.505 -6.996  1.00 24.03 ? 128 ARG A CB    1 
ATOM   1069 C  CG    . ARG A 1 131 ? 41.269 62.575 -7.180  1.00 33.12 ? 128 ARG A CG    1 
ATOM   1070 C  CD    . ARG A 1 131 ? 40.857 64.022 -7.397  1.00 39.49 ? 128 ARG A CD    1 
ATOM   1071 N  NE    . ARG A 1 131 ? 40.854 64.775 -6.149  1.00 42.20 ? 128 ARG A NE    1 
ATOM   1072 C  CZ    . ARG A 1 131 ? 39.875 64.717 -5.248  1.00 30.74 ? 128 ARG A CZ    1 
ATOM   1073 N  NH1   . ARG A 1 131 ? 38.819 63.944 -5.473  1.00 34.32 ? 128 ARG A NH1   1 
ATOM   1074 N  NH2   . ARG A 1 131 ? 39.945 65.443 -4.139  1.00 28.97 ? 128 ARG A NH2   1 
ATOM   1075 N  N     . LEU A 1 132 ? 45.883 62.142 -7.862  1.00 24.81 ? 129 LEU A N     1 
ATOM   1076 C  CA    . LEU A 1 132 ? 47.293 62.445 -7.635  1.00 26.09 ? 129 LEU A CA    1 
ATOM   1077 C  C     . LEU A 1 132 ? 47.896 63.211 -8.805  1.00 43.01 ? 129 LEU A C     1 
ATOM   1078 O  O     . LEU A 1 132 ? 48.773 64.058 -8.597  1.00 37.93 ? 129 LEU A O     1 
ATOM   1079 C  CB    . LEU A 1 132 ? 48.074 61.163 -7.368  1.00 25.56 ? 129 LEU A CB    1 
ATOM   1080 C  CG    . LEU A 1 132 ? 47.907 60.614 -5.948  1.00 22.78 ? 129 LEU A CG    1 
ATOM   1081 C  CD1   . LEU A 1 132 ? 48.550 59.244 -5.804  1.00 27.02 ? 129 LEU A CD1   1 
ATOM   1082 C  CD2   . LEU A 1 132 ? 48.499 61.607 -4.945  1.00 30.86 ? 129 LEU A CD2   1 
ATOM   1083 N  N     . GLN A 1 133 ? 47.444 62.934 -10.033 1.00 38.11 ? 130 GLN A N     1 
ATOM   1084 C  CA    . GLN A 1 133 ? 47.919 63.692 -11.188 1.00 34.12 ? 130 GLN A CA    1 
ATOM   1085 C  C     . GLN A 1 133 ? 47.374 65.113 -11.162 1.00 46.72 ? 130 GLN A C     1 
ATOM   1086 O  O     . GLN A 1 133 ? 48.123 66.082 -11.329 1.00 54.02 ? 130 GLN A O     1 
ATOM   1087 C  CB    . GLN A 1 133 ? 47.523 62.981 -12.484 1.00 38.87 ? 130 GLN A CB    1 
ATOM   1088 N  N     . LYS A 1 134 ? 46.069 65.257 -10.948 1.00 40.71 ? 131 LYS A N     1 
ATOM   1089 C  CA    . LYS A 1 134 ? 45.502 66.574 -10.711 1.00 41.90 ? 131 LYS A CA    1 
ATOM   1090 C  C     . LYS A 1 134 ? 46.063 67.142 -9.412  1.00 53.77 ? 131 LYS A C     1 
ATOM   1091 O  O     . LYS A 1 134 ? 46.563 66.410 -8.556  1.00 59.30 ? 131 LYS A O     1 
ATOM   1092 C  CB    . LYS A 1 134 ? 43.975 66.499 -10.647 1.00 48.10 ? 131 LYS A CB    1 
ATOM   1093 N  N     . LEU A 1 135 ? 45.991 68.470 -9.287  1.00 60.61 ? 132 LEU A N     1 
ATOM   1094 C  CA    . LEU A 1 135 ? 46.423 69.193 -8.093  1.00 65.44 ? 132 LEU A CA    1 
ATOM   1095 C  C     . LEU A 1 135 ? 47.592 68.523 -7.378  1.00 67.91 ? 132 LEU A C     1 
ATOM   1096 O  O     . LEU A 1 135 ? 47.452 68.077 -6.235  1.00 78.59 ? 132 LEU A O     1 
ATOM   1097 N  N     . GLN A 1 136 ? 48.731 68.410 -8.053  1.00 68.87 ? 133 GLN A N     1 
ATOM   1098 C  CA    . GLN A 1 136 ? 49.905 67.775 -7.465  1.00 63.17 ? 133 GLN A CA    1 
ATOM   1099 C  C     . GLN A 1 136 ? 51.160 68.562 -7.818  1.00 63.52 ? 133 GLN A C     1 
ATOM   1100 O  O     . GLN A 1 136 ? 51.197 69.249 -8.838  1.00 70.77 ? 133 GLN A O     1 
ATOM   1101 N  N     . GLY A 1 137 ? 52.184 68.471 -6.972  1.00 68.22 ? 134 GLY A N     1 
ATOM   1102 C  CA    . GLY A 1 137 ? 52.115 67.696 -5.747  1.00 52.09 ? 134 GLY A CA    1 
ATOM   1103 C  C     . GLY A 1 137 ? 51.858 68.558 -4.524  1.00 58.87 ? 134 GLY A C     1 
ATOM   1104 O  O     . GLY A 1 137 ? 52.727 68.710 -3.666  1.00 58.24 ? 134 GLY A O     1 
ATOM   1105 N  N     . GLN A 1 138 ? 50.657 69.127 -4.450  1.00 55.56 ? 135 GLN A N     1 
ATOM   1106 C  CA    . GLN A 1 138 ? 50.297 69.967 -3.320  1.00 55.73 ? 135 GLN A CA    1 
ATOM   1107 C  C     . GLN A 1 138 ? 50.048 69.112 -2.076  1.00 46.03 ? 135 GLN A C     1 
ATOM   1108 O  O     . GLN A 1 138 ? 49.582 67.975 -2.177  1.00 50.04 ? 135 GLN A O     1 
ATOM   1109 C  CB    . GLN A 1 138 ? 49.050 70.785 -3.644  1.00 56.18 ? 135 GLN A CB    1 
ATOM   1110 N  N     . PRO A 1 139 ? 50.357 69.633 -0.892  1.00 48.29 ? 136 PRO A N     1 
ATOM   1111 C  CA    . PRO A 1 139 ? 50.082 68.878 0.333   1.00 45.20 ? 136 PRO A CA    1 
ATOM   1112 C  C     . PRO A 1 139 ? 48.587 68.748 0.573   1.00 44.37 ? 136 PRO A C     1 
ATOM   1113 O  O     . PRO A 1 139 ? 47.770 69.507 0.046   1.00 48.46 ? 136 PRO A O     1 
ATOM   1114 C  CB    . PRO A 1 139 ? 50.750 69.715 1.427   1.00 44.93 ? 136 PRO A CB    1 
ATOM   1115 C  CG    . PRO A 1 139 ? 50.764 71.097 0.871   1.00 43.52 ? 136 PRO A CG    1 
ATOM   1116 C  CD    . PRO A 1 139 ? 50.984 70.934 -0.605  1.00 49.71 ? 136 PRO A CD    1 
ATOM   1117 N  N     . ILE A 1 140 ? 48.234 67.763 1.388   1.00 36.83 ? 137 ILE A N     1 
ATOM   1118 C  CA    . ILE A 1 140 ? 46.842 67.477 1.708   1.00 32.34 ? 137 ILE A CA    1 
ATOM   1119 C  C     . ILE A 1 140 ? 46.510 68.146 3.034   1.00 29.26 ? 137 ILE A C     1 
ATOM   1120 O  O     . ILE A 1 140 ? 47.119 67.842 4.068   1.00 26.90 ? 137 ILE A O     1 
ATOM   1121 C  CB    . ILE A 1 140 ? 46.578 65.966 1.761   1.00 28.87 ? 137 ILE A CB    1 
ATOM   1122 C  CG1   . ILE A 1 140 ? 46.687 65.373 0.361   1.00 30.81 ? 137 ILE A CG1   1 
ATOM   1123 C  CG2   . ILE A 1 140 ? 45.192 65.684 2.320   1.00 25.19 ? 137 ILE A CG2   1 
ATOM   1124 C  CD1   . ILE A 1 140 ? 47.725 64.308 0.240   1.00 36.10 ? 137 ILE A CD1   1 
ATOM   1125 N  N     . SER A 1 141 ? 45.543 69.056 3.003   1.00 23.99 ? 138 SER A N     1 
ATOM   1126 C  CA    . SER A 1 141 ? 45.108 69.757 4.201   1.00 27.05 ? 138 SER A CA    1 
ATOM   1127 C  C     . SER A 1 141 ? 44.249 68.856 5.084   1.00 21.82 ? 138 SER A C     1 
ATOM   1128 O  O     . SER A 1 141 ? 43.437 68.067 4.589   1.00 21.89 ? 138 SER A O     1 
ATOM   1129 C  CB    . SER A 1 141 ? 44.316 71.009 3.814   1.00 23.21 ? 138 SER A CB    1 
ATOM   1130 O  OG    . SER A 1 141 ? 43.525 71.469 4.898   1.00 34.84 ? 138 SER A OG    1 
ATOM   1131 N  N     . ALA A 1 142 ? 44.415 68.991 6.400   1.00 16.58 ? 139 ALA A N     1 
ATOM   1132 C  CA    . ALA A 1 142 ? 43.533 68.291 7.323   1.00 21.99 ? 139 ALA A CA    1 
ATOM   1133 C  C     . ALA A 1 142 ? 42.071 68.656 7.101   1.00 22.97 ? 139 ALA A C     1 
ATOM   1134 O  O     . ALA A 1 142 ? 41.185 67.869 7.454   1.00 20.13 ? 139 ALA A O     1 
ATOM   1135 C  CB    . ALA A 1 142 ? 43.927 68.584 8.771   1.00 24.74 ? 139 ALA A CB    1 
ATOM   1136 N  N     . ASP A 1 143 ? 41.797 69.823 6.510   1.00 19.29 ? 140 ASP A N     1 
ATOM   1137 C  CA    . ASP A 1 143 ? 40.415 70.219 6.265   1.00 22.44 ? 140 ASP A CA    1 
ATOM   1138 C  C     . ASP A 1 143 ? 39.747 69.344 5.213   1.00 20.37 ? 140 ASP A C     1 
ATOM   1139 O  O     . ASP A 1 143 ? 38.511 69.332 5.129   1.00 21.20 ? 140 ASP A O     1 
ATOM   1140 C  CB    . ASP A 1 143 ? 40.356 71.687 5.842   1.00 25.71 ? 140 ASP A CB    1 
ATOM   1141 C  CG    . ASP A 1 143 ? 40.824 72.630 6.938   1.00 33.94 ? 140 ASP A CG    1 
ATOM   1142 O  OD1   . ASP A 1 143 ? 40.805 72.235 8.123   0.66 32.97 ? 140 ASP A OD1   1 
ATOM   1143 O  OD2   . ASP A 1 143 ? 41.207 73.775 6.612   0.67 46.49 ? 140 ASP A OD2   1 
ATOM   1144 N  N     . LEU A 1 144 ? 40.528 68.621 4.411   1.00 16.25 ? 141 LEU A N     1 
ATOM   1145 C  CA    . LEU A 1 144 ? 39.952 67.678 3.464   1.00 17.20 ? 141 LEU A CA    1 
ATOM   1146 C  C     . LEU A 1 144 ? 39.581 66.353 4.114   1.00 19.13 ? 141 LEU A C     1 
ATOM   1147 O  O     . LEU A 1 144 ? 38.930 65.533 3.459   1.00 17.17 ? 141 LEU A O     1 
ATOM   1148 C  CB    . LEU A 1 144 ? 40.918 67.419 2.305   1.00 16.87 ? 141 LEU A CB    1 
ATOM   1149 C  CG    . LEU A 1 144 ? 41.302 68.628 1.444   1.00 21.19 ? 141 LEU A CG    1 
ATOM   1150 C  CD1   . LEU A 1 144 ? 42.209 68.191 0.332   1.00 23.59 ? 141 LEU A CD1   1 
ATOM   1151 C  CD2   . LEU A 1 144 ? 40.045 69.286 0.900   1.00 25.23 ? 141 LEU A CD2   1 
ATOM   1152 N  N     . LEU A 1 145 ? 39.949 66.141 5.383   1.00 14.52 ? 142 LEU A N     1 
ATOM   1153 C  CA    . LEU A 1 145 ? 39.695 64.875 6.081   1.00 14.17 ? 142 LEU A CA    1 
ATOM   1154 C  C     . LEU A 1 145 ? 38.992 65.123 7.420   1.00 15.60 ? 142 LEU A C     1 
ATOM   1155 O  O     . LEU A 1 145 ? 39.462 64.696 8.479   1.00 14.18 ? 142 LEU A O     1 
ATOM   1156 C  CB    . LEU A 1 145 ? 41.016 64.116 6.253   1.00 14.32 ? 142 LEU A CB    1 
ATOM   1157 C  CG    . LEU A 1 145 ? 41.670 63.691 4.925   1.00 13.83 ? 142 LEU A CG    1 
ATOM   1158 C  CD1   . LEU A 1 145 ? 43.181 63.411 5.015   1.00 17.18 ? 142 LEU A CD1   1 
ATOM   1159 C  CD2   . LEU A 1 145 ? 40.965 62.456 4.371   1.00 17.09 ? 142 LEU A CD2   1 
ATOM   1160 N  N     . PRO A 1 146 ? 37.815 65.769 7.403   1.00 14.95 ? 143 PRO A N     1 
ATOM   1161 C  CA    . PRO A 1 146 ? 37.207 66.237 8.660   1.00 15.19 ? 143 PRO A CA    1 
ATOM   1162 C  C     . PRO A 1 146 ? 36.595 65.151 9.524   1.00 15.10 ? 143 PRO A C     1 
ATOM   1163 O  O     . PRO A 1 146 ? 36.231 65.443 10.670  1.00 15.25 ? 143 PRO A O     1 
ATOM   1164 C  CB    . PRO A 1 146 ? 36.115 67.195 8.177   1.00 20.96 ? 143 PRO A CB    1 
ATOM   1165 C  CG    . PRO A 1 146 ? 35.701 66.614 6.853   1.00 14.65 ? 143 PRO A CG    1 
ATOM   1166 C  CD    . PRO A 1 146 ? 36.991 66.127 6.230   1.00 17.17 ? 143 PRO A CD    1 
ATOM   1167 N  N     . SER A 1 147 ? 36.420 63.927 9.015   1.00 13.23 ? 144 SER A N     1 
ATOM   1168 C  CA    . SER A 1 147 ? 35.808 62.868 9.808   1.00 12.01 ? 144 SER A CA    1 
ATOM   1169 C  C     . SER A 1 147 ? 36.652 61.595 9.777   1.00 10.46 ? 144 SER A C     1 
ATOM   1170 O  O     . SER A 1 147 ? 36.143 60.521 10.118  1.00 10.98 ? 144 SER A O     1 
ATOM   1171 C  CB    . SER A 1 147 ? 34.377 62.582 9.330   1.00 16.52 ? 144 SER A CB    1 
ATOM   1172 O  OG    . SER A 1 147 ? 34.371 62.072 8.011   1.00 15.92 ? 144 SER A OG    1 
ATOM   1173 N  N     . THR A 1 148 ? 37.944 61.727 9.440   1.00 12.44 ? 145 THR A N     1 
ATOM   1174 C  CA    . THR A 1 148 ? 38.877 60.606 9.272   1.00 9.90  ? 145 THR A CA    1 
ATOM   1175 C  C     . THR A 1 148 ? 39.709 60.360 10.525  1.00 11.71 ? 145 THR A C     1 
ATOM   1176 O  O     . THR A 1 148 ? 40.294 61.293 11.089  1.00 13.43 ? 145 THR A O     1 
ATOM   1177 C  CB    . THR A 1 148 ? 39.826 60.869 8.095   1.00 12.24 ? 145 THR A CB    1 
ATOM   1178 O  OG1   . THR A 1 148 ? 39.078 60.912 6.878   1.00 13.33 ? 145 THR A OG1   1 
ATOM   1179 C  CG2   . THR A 1 148 ? 40.892 59.755 7.974   1.00 9.72  ? 145 THR A CG2   1 
ATOM   1180 N  N     . TYR A 1 149 ? 39.787 59.094 10.929  1.00 9.45  ? 146 TYR A N     1 
ATOM   1181 C  CA    . TYR A 1 149 ? 40.720 58.622 11.950  1.00 10.31 ? 146 TYR A CA    1 
ATOM   1182 C  C     . TYR A 1 149 ? 41.865 57.885 11.274  1.00 11.35 ? 146 TYR A C     1 
ATOM   1183 O  O     . TYR A 1 149 ? 41.644 57.133 10.317  1.00 12.43 ? 146 TYR A O     1 
ATOM   1184 C  CB    . TYR A 1 149 ? 40.034 57.663 12.920  1.00 11.17 ? 146 TYR A CB    1 
ATOM   1185 C  CG    . TYR A 1 149 ? 39.183 58.355 13.954  1.00 12.63 ? 146 TYR A CG    1 
ATOM   1186 C  CD1   . TYR A 1 149 ? 37.907 58.805 13.651  1.00 14.60 ? 146 TYR A CD1   1 
ATOM   1187 C  CD2   . TYR A 1 149 ? 39.665 58.541 15.238  1.00 12.04 ? 146 TYR A CD2   1 
ATOM   1188 C  CE1   . TYR A 1 149 ? 37.135 59.439 14.618  1.00 20.89 ? 146 TYR A CE1   1 
ATOM   1189 C  CE2   . TYR A 1 149 ? 38.914 59.163 16.196  1.00 20.06 ? 146 TYR A CE2   1 
ATOM   1190 C  CZ    . TYR A 1 149 ? 37.657 59.611 15.890  1.00 22.41 ? 146 TYR A CZ    1 
ATOM   1191 O  OH    . TYR A 1 149 ? 36.925 60.231 16.878  1.00 28.67 ? 146 TYR A OH    1 
ATOM   1192 N  N     . ILE A 1 150 ? 43.079 58.059 11.795  1.00 9.37  ? 147 ILE A N     1 
ATOM   1193 C  CA    . ILE A 1 150 ? 44.229 57.284 11.337  1.00 10.63 ? 147 ILE A CA    1 
ATOM   1194 C  C     . ILE A 1 150 ? 44.508 56.225 12.391  1.00 11.99 ? 147 ILE A C     1 
ATOM   1195 O  O     . ILE A 1 150 ? 44.923 56.548 13.509  1.00 13.63 ? 147 ILE A O     1 
ATOM   1196 C  CB    . ILE A 1 150 ? 45.470 58.153 11.106  1.00 11.59 ? 147 ILE A CB    1 
ATOM   1197 C  CG1   . ILE A 1 150 ? 45.159 59.357 10.206  1.00 13.13 ? 147 ILE A CG1   1 
ATOM   1198 C  CG2   . ILE A 1 150 ? 46.623 57.274 10.549  1.00 13.77 ? 147 ILE A CG2   1 
ATOM   1199 C  CD1   . ILE A 1 150 ? 44.689 59.010 8.801   1.00 12.87 ? 147 ILE A CD1   1 
ATOM   1200 N  N     . GLU A 1 151 ? 44.261 54.958 12.062  1.00 11.51 ? 148 GLU A N     1 
ATOM   1201 C  CA    . GLU A 1 151 ? 44.376 53.918 13.076  1.00 10.95 ? 148 GLU A CA    1 
ATOM   1202 C  C     . GLU A 1 151 ? 45.822 53.808 13.541  1.00 13.73 ? 148 GLU A C     1 
ATOM   1203 O  O     . GLU A 1 151 ? 46.747 53.790 12.727  1.00 12.80 ? 148 GLU A O     1 
ATOM   1204 C  CB    . GLU A 1 151 ? 43.891 52.574 12.529  1.00 10.53 ? 148 GLU A CB    1 
ATOM   1205 C  CG    . GLU A 1 151 ? 44.104 51.393 13.495  1.00 14.19 ? 148 GLU A CG    1 
ATOM   1206 C  CD    . GLU A 1 151 ? 43.414 51.545 14.839  1.00 20.76 ? 148 GLU A CD    1 
ATOM   1207 O  OE1   . GLU A 1 151 ? 42.416 52.293 14.948  1.00 21.18 ? 148 GLU A OE1   1 
ATOM   1208 O  OE2   . GLU A 1 151 ? 43.871 50.900 15.808  1.00 19.77 ? 148 GLU A OE2   1 
ATOM   1209 N  N     . GLY A 1 152 ? 46.012 53.766 14.861  1.00 13.24 ? 149 GLY A N     1 
ATOM   1210 C  CA    . GLY A 1 152 ? 47.330 53.674 15.456  1.00 15.28 ? 149 GLY A CA    1 
ATOM   1211 C  C     . GLY A 1 152 ? 47.909 54.998 15.904  1.00 19.61 ? 149 GLY A C     1 
ATOM   1212 O  O     . GLY A 1 152 ? 48.867 55.005 16.688  1.00 18.43 ? 149 GLY A O     1 
ATOM   1213 N  N     . LEU A 1 153 ? 47.359 56.110 15.425  1.00 13.94 ? 150 LEU A N     1 
ATOM   1214 C  CA    . LEU A 1 153 ? 47.803 57.445 15.823  1.00 14.69 ? 150 LEU A CA    1 
ATOM   1215 C  C     . LEU A 1 153 ? 46.730 58.164 16.656  1.00 18.43 ? 150 LEU A C     1 
ATOM   1216 O  O     . LEU A 1 153 ? 45.544 57.886 16.520  1.00 17.27 ? 150 LEU A O     1 
ATOM   1217 C  CB    . LEU A 1 153 ? 48.138 58.268 14.584  1.00 14.59 ? 150 LEU A CB    1 
ATOM   1218 C  CG    . LEU A 1 153 ? 49.267 57.673 13.745  1.00 15.80 ? 150 LEU A CG    1 
ATOM   1219 C  CD1   . LEU A 1 153 ? 49.597 58.578 12.571  1.00 16.77 ? 150 LEU A CD1   1 
ATOM   1220 C  CD2   . LEU A 1 153 ? 50.512 57.440 14.604  1.00 22.77 ? 150 LEU A CD2   1 
ATOM   1221 N  N     . PRO A 1 154 ? 47.137 59.112 17.514  1.00 15.16 ? 151 PRO A N     1 
ATOM   1222 C  CA    . PRO A 1 154 ? 48.506 59.601 17.739  1.00 18.14 ? 151 PRO A CA    1 
ATOM   1223 C  C     . PRO A 1 154 ? 49.329 58.656 18.590  1.00 15.29 ? 151 PRO A C     1 
ATOM   1224 O  O     . PRO A 1 154 ? 48.760 57.823 19.293  1.00 19.90 ? 151 PRO A O     1 
ATOM   1225 C  CB    . PRO A 1 154 ? 48.280 60.931 18.467  1.00 18.70 ? 151 PRO A CB    1 
ATOM   1226 C  CG    . PRO A 1 154 ? 47.017 60.713 19.225  1.00 18.30 ? 151 PRO A CG    1 
ATOM   1227 C  CD    . PRO A 1 154 ? 46.156 59.834 18.338  1.00 15.49 ? 151 PRO A CD    1 
ATOM   1228 N  N     . GLN A 1 155 ? 50.649 58.787 18.530  1.00 21.03 ? 152 GLN A N     1 
ATOM   1229 C  CA    . GLN A 1 155 ? 51.528 57.918 19.305  1.00 20.57 ? 152 GLN A CA    1 
ATOM   1230 C  C     . GLN A 1 155 ? 52.270 56.948 18.401  1.00 33.90 ? 152 GLN A C     1 
ATOM   1231 O  O     . GLN A 1 155 ? 52.298 55.745 18.661  1.00 46.52 ? 152 GLN A O     1 
ATOM   1232 N  N     . VAL A 1 164 ? 42.107 65.416 25.959  1.00 33.72 ? 161 VAL A N     1 
ATOM   1233 C  CA    . VAL A 1 164 ? 41.375 64.339 26.621  1.00 34.60 ? 161 VAL A CA    1 
ATOM   1234 C  C     . VAL A 1 164 ? 39.966 64.161 26.048  1.00 36.11 ? 161 VAL A C     1 
ATOM   1235 O  O     . VAL A 1 164 ? 39.132 63.478 26.646  1.00 38.70 ? 161 VAL A O     1 
ATOM   1236 C  CB    . VAL A 1 164 ? 41.297 64.576 28.148  1.00 41.38 ? 161 VAL A CB    1 
ATOM   1237 C  CG1   . VAL A 1 164 ? 42.691 64.750 28.739  1.00 30.79 ? 161 VAL A CG1   1 
ATOM   1238 C  CG2   . VAL A 1 164 ? 40.424 65.776 28.454  1.00 32.68 ? 161 VAL A CG2   1 
ATOM   1239 N  N     . GLN A 1 165 ? 39.696 64.771 24.897  1.00 33.50 ? 162 GLN A N     1 
ATOM   1240 C  CA    . GLN A 1 165 ? 38.417 64.620 24.218  1.00 33.89 ? 162 GLN A CA    1 
ATOM   1241 C  C     . GLN A 1 165 ? 38.613 63.896 22.891  1.00 31.33 ? 162 GLN A C     1 
ATOM   1242 O  O     . GLN A 1 165 ? 39.697 63.919 22.304  1.00 28.71 ? 162 GLN A O     1 
ATOM   1243 C  CB    . GLN A 1 165 ? 37.745 65.978 23.983  1.00 39.55 ? 162 GLN A CB    1 
ATOM   1244 N  N     . LYS A 1 166 ? 37.540 63.251 22.419  1.00 27.97 ? 163 LYS A N     1 
ATOM   1245 C  CA    . LYS A 1 166 ? 37.663 62.359 21.269  1.00 25.08 ? 163 LYS A CA    1 
ATOM   1246 C  C     . LYS A 1 166 ? 38.124 63.113 20.021  1.00 22.19 ? 163 LYS A C     1 
ATOM   1247 O  O     . LYS A 1 166 ? 39.025 62.658 19.303  1.00 22.33 ? 163 LYS A O     1 
ATOM   1248 C  CB    . LYS A 1 166 ? 36.331 61.643 21.017  1.00 28.47 ? 163 LYS A CB    1 
ATOM   1249 N  N     . GLU A 1 167 ? 37.523 64.276 19.747  1.00 25.48 ? 164 GLU A N     1 
ATOM   1250 C  CA    . GLU A 1 167 ? 37.866 64.984 18.517  1.00 27.16 ? 164 GLU A CA    1 
ATOM   1251 C  C     . GLU A 1 167 ? 39.291 65.518 18.556  1.00 23.56 ? 164 GLU A C     1 
ATOM   1252 O  O     . GLU A 1 167 ? 39.966 65.562 17.519  1.00 21.27 ? 164 GLU A O     1 
ATOM   1253 C  CB    . GLU A 1 167 ? 36.864 66.115 18.252  1.00 27.31 ? 164 GLU A CB    1 
ATOM   1254 C  CG    . GLU A 1 167 ? 37.223 67.051 17.090  1.00 30.14 ? 164 GLU A CG    1 
ATOM   1255 C  CD    . GLU A 1 167 ? 37.176 66.384 15.713  1.00 28.45 ? 164 GLU A CD    1 
ATOM   1256 O  OE1   . GLU A 1 167 ? 36.675 65.244 15.595  1.00 30.28 ? 164 GLU A OE1   1 
ATOM   1257 O  OE2   . GLU A 1 167 ? 37.646 67.015 14.737  1.00 32.89 ? 164 GLU A OE2   1 
ATOM   1258 N  N     . GLY A 1 168 ? 39.771 65.928 19.730  1.00 28.45 ? 165 GLY A N     1 
ATOM   1259 C  CA    . GLY A 1 168 ? 41.159 66.340 19.830  1.00 24.73 ? 165 GLY A CA    1 
ATOM   1260 C  C     . GLY A 1 168 ? 42.111 65.197 19.548  1.00 21.98 ? 165 GLY A C     1 
ATOM   1261 O  O     . GLY A 1 168 ? 43.134 65.376 18.883  1.00 26.04 ? 165 GLY A O     1 
ATOM   1262 N  N     . MET A 1 169 ? 41.784 64.002 20.046  1.00 17.41 ? 166 MET A N     1 
ATOM   1263 C  CA    . MET A 1 169 ? 42.598 62.832 19.740  1.00 18.70 ? 166 MET A CA    1 
ATOM   1264 C  C     . MET A 1 169 ? 42.551 62.507 18.254  1.00 18.89 ? 166 MET A C     1 
ATOM   1265 O  O     . MET A 1 169 ? 43.576 62.159 17.659  1.00 20.59 ? 166 MET A O     1 
ATOM   1266 C  CB    . MET A 1 169 ? 42.131 61.637 20.572  1.00 24.35 ? 166 MET A CB    1 
ATOM   1267 C  CG    . MET A 1 169 ? 42.296 61.865 22.071  0.48 28.48 ? 166 MET A CG    1 
ATOM   1268 S  SD    . MET A 1 169 ? 44.028 61.702 22.586  0.59 37.68 ? 166 MET A SD    1 
ATOM   1269 C  CE    . MET A 1 169 ? 44.414 60.083 21.908  1.00 20.35 ? 166 MET A CE    1 
ATOM   1270 N  N     . ARG A 1 170 ? 41.380 62.625 17.627  1.00 19.44 ? 167 ARG A N     1 
ATOM   1271 C  CA    . ARG A 1 170 ? 41.311 62.383 16.186  1.00 14.87 ? 167 ARG A CA    1 
ATOM   1272 C  C     . ARG A 1 170 ? 42.255 63.308 15.437  1.00 14.71 ? 167 ARG A C     1 
ATOM   1273 O  O     . ARG A 1 170 ? 43.006 62.874 14.552  1.00 17.64 ? 167 ARG A O     1 
ATOM   1274 C  CB    . ARG A 1 170 ? 39.878 62.567 15.679  1.00 18.68 ? 167 ARG A CB    1 
ATOM   1275 C  CG    . ARG A 1 170 ? 39.709 62.178 14.204  1.00 13.87 ? 167 ARG A CG    1 
ATOM   1276 C  CD    . ARG A 1 170 ? 38.405 62.689 13.604  1.00 17.62 ? 167 ARG A CD    1 
ATOM   1277 N  NE    . ARG A 1 170 ? 38.390 64.146 13.430  1.00 17.49 ? 167 ARG A NE    1 
ATOM   1278 C  CZ    . ARG A 1 170 ? 38.953 64.788 12.409  1.00 17.89 ? 167 ARG A CZ    1 
ATOM   1279 N  NH1   . ARG A 1 170 ? 39.598 64.119 11.462  1.00 13.41 ? 167 ARG A NH1   1 
ATOM   1280 N  NH2   . ARG A 1 170 ? 38.869 66.114 12.322  1.00 20.71 ? 167 ARG A NH2   1 
ATOM   1281 N  N     . LYS A 1 171 ? 42.236 64.602 15.781  1.00 16.29 ? 168 LYS A N     1 
ATOM   1282 C  CA    . LYS A 1 171 ? 43.016 65.561 15.011  1.00 17.80 ? 168 LYS A CA    1 
ATOM   1283 C  C     . LYS A 1 171 ? 44.505 65.427 15.291  1.00 14.89 ? 168 LYS A C     1 
ATOM   1284 O  O     . LYS A 1 171 ? 45.324 65.628 14.390  1.00 19.00 ? 168 LYS A O     1 
ATOM   1285 C  CB    . LYS A 1 171 ? 42.528 66.979 15.297  1.00 20.12 ? 168 LYS A CB    1 
ATOM   1286 C  CG    . LYS A 1 171 ? 41.227 67.284 14.582  1.00 26.74 ? 168 LYS A CG    1 
ATOM   1287 C  CD    . LYS A 1 171 ? 40.652 68.633 14.976  0.63 30.06 ? 168 LYS A CD    1 
ATOM   1288 C  CE    . LYS A 1 171 ? 41.233 69.739 14.122  0.58 27.89 ? 168 LYS A CE    1 
ATOM   1289 N  NZ    . LYS A 1 171 ? 41.371 71.004 14.895  0.53 39.15 ? 168 LYS A NZ    1 
ATOM   1290 N  N     . GLN A 1 172 ? 44.881 65.110 16.532  1.00 17.52 ? 169 GLN A N     1 
ATOM   1291 C  CA    . GLN A 1 172 ? 46.302 64.907 16.810  1.00 20.31 ? 169 GLN A CA    1 
ATOM   1292 C  C     . GLN A 1 172 ? 46.856 63.759 15.974  1.00 19.67 ? 169 GLN A C     1 
ATOM   1293 O  O     . GLN A 1 172 ? 47.962 63.851 15.429  1.00 18.53 ? 169 GLN A O     1 
ATOM   1294 C  CB    . GLN A 1 172 ? 46.521 64.647 18.302  1.00 18.75 ? 169 GLN A CB    1 
ATOM   1295 N  N     . GLY A 1 173 ? 46.088 62.679 15.837  1.00 19.51 ? 170 GLY A N     1 
ATOM   1296 C  CA    . GLY A 1 173 ? 46.532 61.579 14.996  1.00 15.41 ? 170 GLY A CA    1 
ATOM   1297 C  C     . GLY A 1 173 ? 46.597 61.949 13.528  1.00 14.29 ? 170 GLY A C     1 
ATOM   1298 O  O     . GLY A 1 173 ? 47.553 61.596 12.831  1.00 15.00 ? 170 GLY A O     1 
ATOM   1299 N  N     . LEU A 1 174 ? 45.572 62.648 13.033  1.00 14.23 ? 171 LEU A N     1 
ATOM   1300 C  CA    . LEU A 1 174 ? 45.588 63.096 11.648  1.00 15.71 ? 171 LEU A CA    1 
ATOM   1301 C  C     . LEU A 1 174 ? 46.770 64.020 11.380  1.00 17.49 ? 171 LEU A C     1 
ATOM   1302 O  O     . LEU A 1 174 ? 47.438 63.893 10.349  1.00 14.49 ? 171 LEU A O     1 
ATOM   1303 C  CB    . LEU A 1 174 ? 44.268 63.788 11.310  1.00 14.01 ? 171 LEU A CB    1 
ATOM   1304 C  CG    . LEU A 1 174 ? 44.105 64.271 9.875   1.00 15.24 ? 171 LEU A CG    1 
ATOM   1305 C  CD1   . LEU A 1 174 ? 44.196 63.100 8.888   1.00 16.28 ? 171 LEU A CD1   1 
ATOM   1306 C  CD2   . LEU A 1 174 ? 42.764 65.033 9.747   1.00 15.63 ? 171 LEU A CD2   1 
ATOM   1307 N  N     . PHE A 1 175 ? 47.055 64.944 12.304  1.00 16.30 ? 172 PHE A N     1 
ATOM   1308 C  CA    . PHE A 1 175 ? 48.210 65.828 12.138  1.00 19.41 ? 172 PHE A CA    1 
ATOM   1309 C  C     . PHE A 1 175 ? 49.514 65.038 12.076  1.00 19.40 ? 172 PHE A C     1 
ATOM   1310 O  O     . PHE A 1 175 ? 50.354 65.282 11.202  1.00 21.14 ? 172 PHE A O     1 
ATOM   1311 C  CB    . PHE A 1 175 ? 48.262 66.849 13.276  1.00 17.94 ? 172 PHE A CB    1 
ATOM   1312 C  CG    . PHE A 1 175 ? 47.142 67.856 13.243  1.00 28.79 ? 172 PHE A CG    1 
ATOM   1313 C  CD1   . PHE A 1 175 ? 46.540 68.210 12.049  1.00 33.99 ? 172 PHE A CD1   1 
ATOM   1314 C  CD2   . PHE A 1 175 ? 46.695 68.449 14.417  1.00 31.85 ? 172 PHE A CD2   1 
ATOM   1315 C  CE1   . PHE A 1 175 ? 45.513 69.143 12.018  1.00 39.23 ? 172 PHE A CE1   1 
ATOM   1316 C  CE2   . PHE A 1 175 ? 45.666 69.386 14.393  1.00 42.76 ? 172 PHE A CE2   1 
ATOM   1317 C  CZ    . PHE A 1 175 ? 45.075 69.728 13.192  1.00 38.11 ? 172 PHE A CZ    1 
ATOM   1318 N  N     . GLN A 1 176 ? 49.714 64.096 13.004  1.00 20.67 ? 173 GLN A N     1 
ATOM   1319 C  CA    . GLN A 1 176 ? 50.931 63.286 12.964  1.00 18.28 ? 173 GLN A CA    1 
ATOM   1320 C  C     . GLN A 1 176 ? 51.054 62.549 11.640  1.00 19.62 ? 173 GLN A C     1 
ATOM   1321 O  O     . GLN A 1 176 ? 52.148 62.456 11.076  1.00 18.32 ? 173 GLN A O     1 
ATOM   1322 C  CB    . GLN A 1 176 ? 50.963 62.290 14.127  1.00 19.85 ? 173 GLN A CB    1 
ATOM   1323 C  CG    . GLN A 1 176 ? 51.097 62.936 15.497  1.00 20.62 ? 173 GLN A CG    1 
ATOM   1324 C  CD    . GLN A 1 176 ? 51.294 61.928 16.612  1.00 22.46 ? 173 GLN A CD    1 
ATOM   1325 O  OE1   . GLN A 1 176 ? 51.173 60.721 16.410  1.00 21.51 ? 173 GLN A OE1   1 
ATOM   1326 N  NE2   . GLN A 1 176 ? 51.619 62.423 17.800  1.00 28.15 ? 173 GLN A NE2   1 
ATOM   1327 N  N     . TRP A 1 177 ? 49.932 62.038 11.115  1.00 16.84 ? 174 TRP A N     1 
ATOM   1328 C  CA    . TRP A 1 177 ? 49.957 61.333 9.837   1.00 14.99 ? 174 TRP A CA    1 
ATOM   1329 C  C     . TRP A 1 177 ? 50.309 62.268 8.685   1.00 17.22 ? 174 TRP A C     1 
ATOM   1330 O  O     . TRP A 1 177 ? 51.169 61.948 7.858   1.00 17.54 ? 174 TRP A O     1 
ATOM   1331 C  CB    . TRP A 1 177 ? 48.596 60.674 9.592   1.00 13.10 ? 174 TRP A CB    1 
ATOM   1332 C  CG    . TRP A 1 177 ? 48.416 60.030 8.262   1.00 12.77 ? 174 TRP A CG    1 
ATOM   1333 C  CD1   . TRP A 1 177 ? 47.737 60.548 7.186   1.00 14.30 ? 174 TRP A CD1   1 
ATOM   1334 C  CD2   . TRP A 1 177 ? 48.872 58.729 7.859   1.00 13.43 ? 174 TRP A CD2   1 
ATOM   1335 N  NE1   . TRP A 1 177 ? 47.758 59.660 6.145   1.00 13.21 ? 174 TRP A NE1   1 
ATOM   1336 C  CE2   . TRP A 1 177 ? 48.447 58.535 6.525   1.00 16.25 ? 174 TRP A CE2   1 
ATOM   1337 C  CE3   . TRP A 1 177 ? 49.609 57.712 8.493   1.00 14.94 ? 174 TRP A CE3   1 
ATOM   1338 C  CZ2   . TRP A 1 177 ? 48.724 57.359 5.811   1.00 14.09 ? 174 TRP A CZ2   1 
ATOM   1339 C  CZ3   . TRP A 1 177 ? 49.892 56.550 7.782   1.00 19.37 ? 174 TRP A CZ3   1 
ATOM   1340 C  CH2   . TRP A 1 177 ? 49.448 56.379 6.456   1.00 14.85 ? 174 TRP A CH2   1 
ATOM   1341 N  N     . LEU A 1 178 ? 49.636 63.420 8.603   1.00 19.20 ? 175 LEU A N     1 
ATOM   1342 C  CA    . LEU A 1 178 ? 49.865 64.320 7.479   1.00 19.20 ? 175 LEU A CA    1 
ATOM   1343 C  C     . LEU A 1 178 ? 51.250 64.950 7.540   1.00 25.17 ? 175 LEU A C     1 
ATOM   1344 O  O     . LEU A 1 178 ? 51.848 65.220 6.493   1.00 27.18 ? 175 LEU A O     1 
ATOM   1345 C  CB    . LEU A 1 178 ? 48.781 65.396 7.435   1.00 17.92 ? 175 LEU A CB    1 
ATOM   1346 C  CG    . LEU A 1 178 ? 47.401 64.827 7.072   1.00 20.42 ? 175 LEU A CG    1 
ATOM   1347 C  CD1   . LEU A 1 178 ? 46.320 65.883 7.221   1.00 22.82 ? 175 LEU A CD1   1 
ATOM   1348 C  CD2   . LEU A 1 178 ? 47.410 64.248 5.651   1.00 16.18 ? 175 LEU A CD2   1 
ATOM   1349 N  N     . ASP A 1 179 ? 51.785 65.158 8.745   1.00 23.23 ? 176 ASP A N     1 
ATOM   1350 C  CA    . ASP A 1 179 ? 53.113 65.759 8.865   1.00 27.96 ? 176 ASP A CA    1 
ATOM   1351 C  C     . ASP A 1 179 ? 54.207 64.826 8.368   1.00 32.14 ? 176 ASP A C     1 
ATOM   1352 O  O     . ASP A 1 179 ? 55.248 65.298 7.900   1.00 35.64 ? 176 ASP A O     1 
ATOM   1353 C  CB    . ASP A 1 179 ? 53.392 66.161 10.313  1.00 27.02 ? 176 ASP A CB    1 
ATOM   1354 C  CG    . ASP A 1 179 ? 52.651 67.410 10.719  1.00 30.24 ? 176 ASP A CG    1 
ATOM   1355 O  OD1   . ASP A 1 179 ? 52.275 68.190 9.820   1.00 44.17 ? 176 ASP A OD1   1 
ATOM   1356 O  OD2   . ASP A 1 179 ? 52.449 67.617 11.935  1.00 43.68 ? 176 ASP A OD2   1 
ATOM   1357 N  N     . SER A 1 180 ? 53.997 63.517 8.455   1.00 22.29 ? 177 SER A N     1 
ATOM   1358 C  CA    . SER A 1 180 ? 54.977 62.525 8.033   1.00 27.05 ? 177 SER A CA    1 
ATOM   1359 C  C     . SER A 1 180 ? 54.846 62.120 6.571   1.00 35.09 ? 177 SER A C     1 
ATOM   1360 O  O     . SER A 1 180 ? 55.670 61.338 6.082   1.00 37.88 ? 177 SER A O     1 
ATOM   1361 C  CB    . SER A 1 180 ? 54.856 61.268 8.899   1.00 30.95 ? 177 SER A CB    1 
ATOM   1362 O  OG    . SER A 1 180 ? 54.742 61.602 10.268  1.00 37.27 ? 177 SER A OG    1 
ATOM   1363 N  N     . LEU A 1 181 ? 53.832 62.611 5.870   1.00 22.55 ? 178 LEU A N     1 
ATOM   1364 C  CA    . LEU A 1 181 ? 53.501 62.101 4.544   1.00 18.05 ? 178 LEU A CA    1 
ATOM   1365 C  C     . LEU A 1 181 ? 54.441 62.639 3.465   1.00 28.47 ? 178 LEU A C     1 
ATOM   1366 O  O     . LEU A 1 181 ? 54.652 63.849 3.365   1.00 36.85 ? 178 LEU A O     1 
ATOM   1367 C  CB    . LEU A 1 181 ? 52.059 62.486 4.216   1.00 26.82 ? 178 LEU A CB    1 
ATOM   1368 C  CG    . LEU A 1 181 ? 51.206 61.600 3.321   1.00 34.44 ? 178 LEU A CG    1 
ATOM   1369 C  CD1   . LEU A 1 181 ? 51.163 60.166 3.850   1.00 24.95 ? 178 LEU A CD1   1 
ATOM   1370 C  CD2   . LEU A 1 181 ? 49.808 62.219 3.230   1.00 21.98 ? 178 LEU A CD2   1 
ATOM   1371 N  N     . GLN A 1 182 ? 54.966 61.738 2.627   1.00 34.05 ? 179 GLN A N     1 
ATOM   1372 C  CA    . GLN A 1 182 ? 55.849 62.105 1.515   1.00 36.91 ? 179 GLN A CA    1 
ATOM   1373 C  C     . GLN A 1 182 ? 55.003 62.437 0.290   1.00 43.93 ? 179 GLN A C     1 
ATOM   1374 O  O     . GLN A 1 182 ? 54.678 61.569 -0.521  1.00 48.51 ? 179 GLN A O     1 
ATOM   1375 C  CB    . GLN A 1 182 ? 56.832 60.979 1.219   1.00 43.53 ? 179 GLN A CB    1 
ATOM   1376 N  N     . ILE A 1 183 ? 54.672 63.725 0.132   1.00 33.92 ? 180 ILE A N     1 
ATOM   1377 C  CA    . ILE A 1 183 ? 53.719 64.145 -0.897  1.00 46.78 ? 180 ILE A CA    1 
ATOM   1378 C  C     . ILE A 1 183 ? 54.306 64.195 -2.298  1.00 48.78 ? 180 ILE A C     1 
ATOM   1379 O  O     . ILE A 1 183 ? 53.550 64.361 -3.265  1.00 45.93 ? 180 ILE A O     1 
ATOM   1380 C  CB    . ILE A 1 183 ? 53.128 65.528 -0.565  1.00 43.63 ? 180 ILE A CB    1 
ATOM   1381 N  N     . ASP A 1 184 ? 55.621 64.046 -2.447  1.00 48.20 ? 181 ASP A N     1 
ATOM   1382 C  CA    . ASP A 1 184 ? 56.262 64.137 -3.753  1.00 50.26 ? 181 ASP A CA    1 
ATOM   1383 C  C     . ASP A 1 184 ? 56.409 62.788 -4.447  1.00 55.80 ? 181 ASP A C     1 
ATOM   1384 O  O     . ASP A 1 184 ? 56.858 62.744 -5.597  1.00 47.00 ? 181 ASP A O     1 
ATOM   1385 C  CB    . ASP A 1 184 ? 57.641 64.793 -3.620  1.00 47.85 ? 181 ASP A CB    1 
ATOM   1386 N  N     . ASN A 1 185 ? 56.044 61.694 -3.787  1.00 50.66 ? 182 ASN A N     1 
ATOM   1387 C  CA    . ASN A 1 185 ? 56.199 60.347 -4.330  1.00 41.68 ? 182 ASN A CA    1 
ATOM   1388 C  C     . ASN A 1 185 ? 54.815 59.803 -4.665  1.00 42.21 ? 182 ASN A C     1 
ATOM   1389 O  O     . ASN A 1 185 ? 54.118 59.278 -3.792  1.00 35.53 ? 182 ASN A O     1 
ATOM   1390 C  CB    . ASN A 1 185 ? 56.929 59.450 -3.335  1.00 42.01 ? 182 ASN A CB    1 
ATOM   1391 C  CG    . ASN A 1 185 ? 57.054 58.023 -3.819  1.00 43.42 ? 182 ASN A CG    1 
ATOM   1392 O  OD1   . ASN A 1 185 ? 56.883 57.733 -5.007  1.00 44.12 ? 182 ASN A OD1   1 
ATOM   1393 N  ND2   . ASN A 1 185 ? 57.350 57.113 -2.894  1.00 48.94 ? 182 ASN A ND2   1 
ATOM   1394 N  N     . LEU A 1 186 ? 54.430 59.903 -5.939  1.00 36.35 ? 183 LEU A N     1 
ATOM   1395 C  CA    . LEU A 1 186 ? 53.091 59.494 -6.347  1.00 42.94 ? 183 LEU A CA    1 
ATOM   1396 C  C     . LEU A 1 186 ? 52.843 58.002 -6.178  1.00 37.38 ? 183 LEU A C     1 
ATOM   1397 O  O     . LEU A 1 186 ? 51.688 57.574 -6.274  1.00 39.23 ? 183 LEU A O     1 
ATOM   1398 C  CB    . LEU A 1 186 ? 52.839 59.895 -7.802  1.00 43.58 ? 183 LEU A CB    1 
ATOM   1399 C  CG    . LEU A 1 186 ? 52.901 61.388 -8.125  1.00 44.33 ? 183 LEU A CG    1 
ATOM   1400 C  CD1   . LEU A 1 186 ? 52.172 61.662 -9.427  1.00 48.35 ? 183 LEU A CD1   1 
ATOM   1401 C  CD2   . LEU A 1 186 ? 52.324 62.228 -6.991  1.00 43.24 ? 183 LEU A CD2   1 
ATOM   1402 N  N     . THR A 1 187 ? 53.880 57.205 -5.922  1.00 40.99 ? 184 THR A N     1 
ATOM   1403 C  CA    . THR A 1 187 ? 53.723 55.773 -5.713  1.00 36.59 ? 184 THR A CA    1 
ATOM   1404 C  C     . THR A 1 187 ? 53.746 55.366 -4.243  1.00 28.81 ? 184 THR A C     1 
ATOM   1405 O  O     . THR A 1 187 ? 53.725 54.165 -3.959  1.00 32.97 ? 184 THR A O     1 
ATOM   1406 C  CB    . THR A 1 187 ? 54.816 54.995 -6.459  1.00 43.34 ? 184 THR A CB    1 
ATOM   1407 O  OG1   . THR A 1 187 ? 56.073 55.173 -5.792  1.00 46.69 ? 184 THR A OG1   1 
ATOM   1408 C  CG2   . THR A 1 187 ? 54.930 55.471 -7.903  1.00 44.72 ? 184 THR A CG2   1 
ATOM   1409 N  N     . SER A 1 188 ? 53.806 56.312 -3.310  1.00 26.85 ? 185 SER A N     1 
ATOM   1410 C  CA    . SER A 1 188 ? 53.764 55.958 -1.890  1.00 17.62 ? 185 SER A CA    1 
ATOM   1411 C  C     . SER A 1 188 ? 52.412 55.341 -1.551  1.00 18.46 ? 185 SER A C     1 
ATOM   1412 O  O     . SER A 1 188 ? 51.373 55.998 -1.733  1.00 16.93 ? 185 SER A O     1 
ATOM   1413 C  CB    . SER A 1 188 ? 54.014 57.168 -0.998  1.00 25.30 ? 185 SER A CB    1 
ATOM   1414 O  OG    . SER A 1 188 ? 53.714 56.882 0.370   1.00 26.01 ? 185 SER A OG    1 
ATOM   1415 N  N     . PRO A 1 189 ? 52.374 54.096 -1.080  1.00 16.99 ? 186 PRO A N     1 
ATOM   1416 C  CA    . PRO A 1 189 ? 51.091 53.516 -0.646  1.00 14.24 ? 186 PRO A CA    1 
ATOM   1417 C  C     . PRO A 1 189 ? 50.380 54.340 0.408   1.00 13.39 ? 186 PRO A C     1 
ATOM   1418 O  O     . PRO A 1 189 ? 49.141 54.434 0.377   1.00 13.50 ? 186 PRO A O     1 
ATOM   1419 C  CB    . PRO A 1 189 ? 51.505 52.145 -0.104  1.00 18.11 ? 186 PRO A CB    1 
ATOM   1420 C  CG    . PRO A 1 189 ? 52.743 51.797 -0.901  1.00 19.14 ? 186 PRO A CG    1 
ATOM   1421 C  CD    . PRO A 1 189 ? 53.469 53.110 -1.051  1.00 18.88 ? 186 PRO A CD    1 
ATOM   1422 N  N     . ASP A 1 190 ? 51.119 54.933 1.355   1.00 12.13 ? 187 ASP A N     1 
ATOM   1423 C  CA    . ASP A 1 190 ? 50.478 55.739 2.386   1.00 11.69 ? 187 ASP A CA    1 
ATOM   1424 C  C     . ASP A 1 190 ? 49.820 56.965 1.780   1.00 12.22 ? 187 ASP A C     1 
ATOM   1425 O  O     . ASP A 1 190 ? 48.717 57.343 2.186   1.00 13.02 ? 187 ASP A O     1 
ATOM   1426 C  CB    . ASP A 1 190 ? 51.480 56.179 3.457   1.00 16.37 ? 187 ASP A CB    1 
ATOM   1427 C  CG    . ASP A 1 190 ? 51.907 55.049 4.378   1.00 21.60 ? 187 ASP A CG    1 
ATOM   1428 O  OD1   . ASP A 1 190 ? 51.283 53.963 4.381   1.00 14.17 ? 187 ASP A OD1   1 
ATOM   1429 O  OD2   . ASP A 1 190 ? 52.884 55.270 5.128   1.00 24.80 ? 187 ASP A OD2   1 
ATOM   1430 N  N     . LEU A 1 191 ? 50.484 57.595 0.803   1.00 12.57 ? 188 LEU A N     1 
ATOM   1431 C  CA    . LEU A 1 191 ? 49.879 58.728 0.111   1.00 15.41 ? 188 LEU A CA    1 
ATOM   1432 C  C     . LEU A 1 191 ? 48.636 58.299 -0.655  1.00 12.12 ? 188 LEU A C     1 
ATOM   1433 O  O     . LEU A 1 191 ? 47.626 59.012 -0.654  1.00 12.27 ? 188 LEU A O     1 
ATOM   1434 C  CB    . LEU A 1 191 ? 50.894 59.374 -0.841  1.00 15.67 ? 188 LEU A CB    1 
ATOM   1435 C  CG    . LEU A 1 191 ? 50.372 60.560 -1.670  1.00 20.65 ? 188 LEU A CG    1 
ATOM   1436 C  CD1   . LEU A 1 191 ? 49.880 61.665 -0.778  1.00 17.33 ? 188 LEU A CD1   1 
ATOM   1437 C  CD2   . LEU A 1 191 ? 51.472 61.085 -2.590  1.00 21.87 ? 188 LEU A CD2   1 
ATOM   1438 N  N     . GLN A 1 192 ? 48.691 57.133 -1.304  1.00 11.97 ? 189 GLN A N     1 
ATOM   1439 C  CA    . GLN A 1 192 ? 47.541 56.643 -2.060  1.00 12.12 ? 189 GLN A CA    1 
ATOM   1440 C  C     . GLN A 1 192 ? 46.343 56.414 -1.148  1.00 11.78 ? 189 GLN A C     1 
ATOM   1441 O  O     . GLN A 1 192 ? 45.221 56.812 -1.485  1.00 12.51 ? 189 GLN A O     1 
ATOM   1442 C  CB    . GLN A 1 192 ? 47.922 55.377 -2.818  1.00 14.08 ? 189 GLN A CB    1 
ATOM   1443 C  CG    . GLN A 1 192 ? 48.919 55.677 -3.928  1.00 16.90 ? 189 GLN A CG    1 
ATOM   1444 C  CD    . GLN A 1 192 ? 49.523 54.430 -4.540  1.00 29.34 ? 189 GLN A CD    1 
ATOM   1445 O  OE1   . GLN A 1 192 ? 49.296 53.317 -4.071  1.00 34.11 ? 189 GLN A OE1   1 
ATOM   1446 N  NE2   . GLN A 1 192 ? 50.303 54.614 -5.604  1.00 43.59 ? 189 GLN A NE2   1 
ATOM   1447 N  N     . LEU A 1 193 ? 46.566 55.821 0.033   1.00 12.01 ? 190 LEU A N     1 
ATOM   1448 C  CA    . LEU A 1 193 ? 45.472 55.653 0.995   1.00 9.71  ? 190 LEU A CA    1 
ATOM   1449 C  C     . LEU A 1 193 ? 44.894 56.992 1.431   1.00 11.10 ? 190 LEU A C     1 
ATOM   1450 O  O     . LEU A 1 193 ? 43.681 57.111 1.657   1.00 11.72 ? 190 LEU A O     1 
ATOM   1451 C  CB    . LEU A 1 193 ? 45.963 54.885 2.229   1.00 12.21 ? 190 LEU A CB    1 
ATOM   1452 C  CG    . LEU A 1 193 ? 46.314 53.409 2.081   1.00 10.52 ? 190 LEU A CG    1 
ATOM   1453 C  CD1   . LEU A 1 193 ? 46.708 52.841 3.460   1.00 12.59 ? 190 LEU A CD1   1 
ATOM   1454 C  CD2   . LEU A 1 193 ? 45.145 52.627 1.473   1.00 11.40 ? 190 LEU A CD2   1 
ATOM   1455 N  N     . THR A 1 194 ? 45.752 58.000 1.607   1.00 10.00 ? 191 THR A N     1 
ATOM   1456 C  CA    . THR A 1 194 ? 45.293 59.303 2.072   1.00 10.60 ? 191 THR A CA    1 
ATOM   1457 C  C     . THR A 1 194 ? 44.392 59.951 1.038   1.00 12.14 ? 191 THR A C     1 
ATOM   1458 O  O     . THR A 1 194 ? 43.332 60.481 1.378   1.00 13.18 ? 191 THR A O     1 
ATOM   1459 C  CB    . THR A 1 194 ? 46.482 60.208 2.367   1.00 12.42 ? 191 THR A CB    1 
ATOM   1460 O  OG1   . THR A 1 194 ? 47.317 59.568 3.332   1.00 14.83 ? 191 THR A OG1   1 
ATOM   1461 C  CG2   . THR A 1 194 ? 46.006 61.558 2.927   1.00 12.69 ? 191 THR A CG2   1 
ATOM   1462 N  N     . VAL A 1 195 ? 44.802 59.906 -0.226  1.00 11.09 ? 192 VAL A N     1 
ATOM   1463 C  CA    . VAL A 1 195 ? 43.954 60.437 -1.289  1.00 12.26 ? 192 VAL A CA    1 
ATOM   1464 C  C     . VAL A 1 195 ? 42.664 59.636 -1.374  1.00 11.58 ? 192 VAL A C     1 
ATOM   1465 O  O     . VAL A 1 195 ? 41.584 60.199 -1.582  1.00 13.48 ? 192 VAL A O     1 
ATOM   1466 C  CB    . VAL A 1 195 ? 44.721 60.446 -2.621  1.00 13.49 ? 192 VAL A CB    1 
ATOM   1467 C  CG1   . VAL A 1 195 ? 43.788 60.848 -3.771  1.00 13.66 ? 192 VAL A CG1   1 
ATOM   1468 C  CG2   . VAL A 1 195 ? 45.892 61.412 -2.521  1.00 17.14 ? 192 VAL A CG2   1 
ATOM   1469 N  N     . GLY A 1 196 ? 42.759 58.314 -1.201  1.00 13.24 ? 193 GLY A N     1 
ATOM   1470 C  CA    . GLY A 1 196 ? 41.562 57.488 -1.088  1.00 13.03 ? 193 GLY A CA    1 
ATOM   1471 C  C     . GLY A 1 196 ? 40.607 57.990 -0.023  1.00 12.93 ? 193 GLY A C     1 
ATOM   1472 O  O     . GLY A 1 196 ? 39.401 58.092 -0.257  1.00 11.89 ? 193 GLY A O     1 
ATOM   1473 N  N     . ALA A 1 197 ? 41.136 58.310 1.170   1.00 11.58 ? 194 ALA A N     1 
ATOM   1474 C  CA    . ALA A 1 197 ? 40.291 58.832 2.238   1.00 9.62  ? 194 ALA A CA    1 
ATOM   1475 C  C     . ALA A 1 197 ? 39.653 60.178 1.861   1.00 11.96 ? 194 ALA A C     1 
ATOM   1476 O  O     . ALA A 1 197 ? 38.503 60.448 2.226   1.00 12.10 ? 194 ALA A O     1 
ATOM   1477 C  CB    . ALA A 1 197 ? 41.101 58.951 3.538   1.00 11.06 ? 194 ALA A CB    1 
ATOM   1478 N  N     . VAL A 1 198 ? 40.374 61.030 1.130   1.00 10.88 ? 195 VAL A N     1 
ATOM   1479 C  CA    . VAL A 1 198 ? 39.794 62.294 0.659   1.00 11.79 ? 195 VAL A CA    1 
ATOM   1480 C  C     . VAL A 1 198 ? 38.587 62.041 -0.237  1.00 11.92 ? 195 VAL A C     1 
ATOM   1481 O  O     . VAL A 1 198 ? 37.522 62.659 -0.076  1.00 11.87 ? 195 VAL A O     1 
ATOM   1482 C  CB    . VAL A 1 198 ? 40.859 63.127 -0.067  1.00 12.14 ? 195 VAL A CB    1 
ATOM   1483 C  CG1   . VAL A 1 198 ? 40.199 64.336 -0.762  1.00 16.74 ? 195 VAL A CG1   1 
ATOM   1484 C  CG2   . VAL A 1 198 ? 41.889 63.590 0.945   1.00 17.03 ? 195 VAL A CG2   1 
ATOM   1485 N  N     . ILE A 1 199 ? 38.732 61.117 -1.182  1.00 9.92  ? 196 ILE A N     1 
ATOM   1486 C  CA    . ILE A 1 199 ? 37.618 60.757 -2.058  1.00 13.07 ? 196 ILE A CA    1 
ATOM   1487 C  C     . ILE A 1 199 ? 36.459 60.170 -1.257  1.00 13.54 ? 196 ILE A C     1 
ATOM   1488 O  O     . ILE A 1 199 ? 35.292 60.464 -1.532  1.00 11.75 ? 196 ILE A O     1 
ATOM   1489 C  CB    . ILE A 1 199 ? 38.091 59.793 -3.158  1.00 14.44 ? 196 ILE A CB    1 
ATOM   1490 C  CG1   . ILE A 1 199 ? 39.093 60.481 -4.090  1.00 13.13 ? 196 ILE A CG1   1 
ATOM   1491 C  CG2   . ILE A 1 199 ? 36.884 59.238 -3.962  1.00 11.59 ? 196 ILE A CG2   1 
ATOM   1492 C  CD1   . ILE A 1 199 ? 39.837 59.519 -4.978  1.00 14.06 ? 196 ILE A CD1   1 
ATOM   1493 N  N     . VAL A 1 200 ? 36.751 59.315 -0.266  1.00 10.35 ? 197 VAL A N     1 
ATOM   1494 C  CA    . VAL A 1 200 ? 35.662 58.728 0.513   1.00 10.01 ? 197 VAL A CA    1 
ATOM   1495 C  C     . VAL A 1 200 ? 34.944 59.791 1.347   1.00 11.19 ? 197 VAL A C     1 
ATOM   1496 O  O     . VAL A 1 200 ? 33.719 59.702 1.547   1.00 11.09 ? 197 VAL A O     1 
ATOM   1497 C  CB    . VAL A 1 200 ? 36.194 57.553 1.363   1.00 9.47  ? 197 VAL A CB    1 
ATOM   1498 C  CG1   . VAL A 1 200 ? 35.086 56.990 2.266   1.00 10.77 ? 197 VAL A CG1   1 
ATOM   1499 C  CG2   . VAL A 1 200 ? 36.710 56.441 0.427   1.00 13.84 ? 197 VAL A CG2   1 
ATOM   1500 N  N     . GLU A 1 201 ? 35.667 60.815 1.841   1.00 11.46 ? 198 GLU A N     1 
ATOM   1501 C  CA    . GLU A 1 201 ? 34.993 61.940 2.490   1.00 11.96 ? 198 GLU A CA    1 
ATOM   1502 C  C     . GLU A 1 201 ? 34.000 62.588 1.529   1.00 12.98 ? 198 GLU A C     1 
ATOM   1503 O  O     . GLU A 1 201 ? 32.868 62.903 1.919   1.00 12.83 ? 198 GLU A O     1 
ATOM   1504 C  CB    . GLU A 1 201 ? 35.996 63.000 2.982   1.00 12.04 ? 198 GLU A CB    1 
ATOM   1505 C  CG    . GLU A 1 201 ? 36.910 62.595 4.160   1.00 13.28 ? 198 GLU A CG    1 
ATOM   1506 C  CD    . GLU A 1 201 ? 36.313 62.856 5.540   1.00 16.33 ? 198 GLU A CD    1 
ATOM   1507 O  OE1   . GLU A 1 201 ? 35.098 63.158 5.674   1.00 15.94 ? 198 GLU A OE1   1 
ATOM   1508 O  OE2   . GLU A 1 201 ? 37.078 62.752 6.522   1.00 13.69 ? 198 GLU A OE2   1 
ATOM   1509 N  N     . GLU A 1 202 ? 34.410 62.762 0.263   1.00 11.09 ? 199 GLU A N     1 
ATOM   1510 C  CA    . GLU A 1 202 ? 33.543 63.361 -0.755  1.00 10.61 ? 199 GLU A CA    1 
ATOM   1511 C  C     . GLU A 1 202 ? 32.344 62.465 -1.049  1.00 14.89 ? 199 GLU A C     1 
ATOM   1512 O  O     . GLU A 1 202 ? 31.211 62.953 -1.171  1.00 13.55 ? 199 GLU A O     1 
ATOM   1513 C  CB    . GLU A 1 202 ? 34.359 63.634 -2.032  1.00 12.28 ? 199 GLU A CB    1 
ATOM   1514 C  CG    . GLU A 1 202 ? 35.468 64.684 -1.808  1.00 18.38 ? 199 GLU A CG    1 
ATOM   1515 C  CD    . GLU A 1 202 ? 36.495 64.790 -2.939  1.00 24.48 ? 199 GLU A CD    1 
ATOM   1516 O  OE1   . GLU A 1 202 ? 36.419 64.015 -3.911  1.00 24.66 ? 199 GLU A OE1   1 
ATOM   1517 O  OE2   . GLU A 1 202 ? 37.383 65.668 -2.846  1.00 25.12 ? 199 GLU A OE2   1 
ATOM   1518 N  N     . MET A 1 203 ? 32.580 61.151 -1.141  1.00 10.70 ? 200 MET A N     1 
ATOM   1519 C  CA    A MET A 1 203 ? 31.494 60.198 -1.369  0.49 12.57 ? 200 MET A CA    1 
ATOM   1520 C  CA    B MET A 1 203 ? 31.490 60.213 -1.377  0.51 12.58 ? 200 MET A CA    1 
ATOM   1521 C  C     . MET A 1 203 ? 30.492 60.233 -0.230  1.00 14.05 ? 200 MET A C     1 
ATOM   1522 O  O     . MET A 1 203 ? 29.270 60.240 -0.453  1.00 11.04 ? 200 MET A O     1 
ATOM   1523 C  CB    A MET A 1 203 ? 32.048 58.780 -1.519  0.49 11.95 ? 200 MET A CB    1 
ATOM   1524 C  CB    B MET A 1 203 ? 32.056 58.807 -1.576  0.51 11.95 ? 200 MET A CB    1 
ATOM   1525 C  CG    A MET A 1 203 ? 33.012 58.591 -2.652  0.49 14.19 ? 200 MET A CG    1 
ATOM   1526 C  CG    B MET A 1 203 ? 31.035 57.797 -2.031  0.51 10.73 ? 200 MET A CG    1 
ATOM   1527 S  SD    A MET A 1 203 ? 33.601 56.891 -2.753  0.49 22.67 ? 200 MET A SD    1 
ATOM   1528 S  SD    B MET A 1 203 ? 31.710 56.125 -2.098  0.51 18.42 ? 200 MET A SD    1 
ATOM   1529 C  CE    A MET A 1 203 ? 32.060 56.058 -3.125  0.49 10.39 ? 200 MET A CE    1 
ATOM   1530 C  CE    B MET A 1 203 ? 33.228 56.384 -3.008  0.51 21.59 ? 200 MET A CE    1 
ATOM   1531 N  N     . ARG A 1 204 ? 30.991 60.237 1.008   1.00 8.41  ? 201 ARG A N     1 
ATOM   1532 C  CA    . ARG A 1 204 ? 30.076 60.199 2.138   1.00 8.22  ? 201 ARG A CA    1 
ATOM   1533 C  C     . ARG A 1 204 ? 29.317 61.517 2.275   1.00 10.21 ? 201 ARG A C     1 
ATOM   1534 O  O     . ARG A 1 204 ? 28.147 61.515 2.674   1.00 11.99 ? 201 ARG A O     1 
ATOM   1535 C  CB    . ARG A 1 204 ? 30.847 59.855 3.417   1.00 13.31 ? 201 ARG A CB    1 
ATOM   1536 C  CG    . ARG A 1 204 ? 31.363 58.403 3.426   1.00 11.62 ? 201 ARG A CG    1 
ATOM   1537 C  CD    . ARG A 1 204 ? 32.176 58.075 4.700   1.00 12.97 ? 201 ARG A CD    1 
ATOM   1538 N  NE    . ARG A 1 204 ? 31.494 58.527 5.904   1.00 12.18 ? 201 ARG A NE    1 
ATOM   1539 C  CZ    . ARG A 1 204 ? 31.940 59.475 6.713   1.00 14.26 ? 201 ARG A CZ    1 
ATOM   1540 N  NH1   . ARG A 1 204 ? 33.111 60.054 6.480   1.00 15.23 ? 201 ARG A NH1   1 
ATOM   1541 N  NH2   . ARG A 1 204 ? 31.211 59.851 7.764   1.00 13.85 ? 201 ARG A NH2   1 
ATOM   1542 N  N     . ALA A 1 205 ? 29.947 62.639 1.918   1.00 11.88 ? 202 ALA A N     1 
ATOM   1543 C  CA    . ALA A 1 205 ? 29.234 63.919 1.903   1.00 11.15 ? 202 ALA A CA    1 
ATOM   1544 C  C     . ALA A 1 205 ? 28.124 63.908 0.857   1.00 11.00 ? 202 ALA A C     1 
ATOM   1545 O  O     . ALA A 1 205 ? 27.015 64.401 1.114   1.00 13.23 ? 202 ALA A O     1 
ATOM   1546 C  CB    . ALA A 1 205 ? 30.212 65.059 1.626   1.00 13.27 ? 202 ALA A CB    1 
ATOM   1547 N  N     . ALA A 1 206 ? 28.394 63.305 -0.312  1.00 10.57 ? 203 ALA A N     1 
ATOM   1548 C  CA    . ALA A 1 206 ? 27.383 63.225 -1.363  1.00 11.59 ? 203 ALA A CA    1 
ATOM   1549 C  C     . ALA A 1 206 ? 26.213 62.353 -0.932  1.00 12.47 ? 203 ALA A C     1 
ATOM   1550 O  O     . ALA A 1 206 ? 25.051 62.704 -1.168  1.00 12.08 ? 203 ALA A O     1 
ATOM   1551 C  CB    . ALA A 1 206 ? 27.992 62.692 -2.660  1.00 14.67 ? 203 ALA A CB    1 
ATOM   1552 N  N     . ILE A 1 207 ? 26.497 61.217 -0.292  1.00 11.11 ? 204 ILE A N     1 
ATOM   1553 C  CA    . ILE A 1 207 ? 25.413 60.377 0.217   1.00 11.73 ? 204 ILE A CA    1 
ATOM   1554 C  C     . ILE A 1 207 ? 24.556 61.161 1.201   1.00 10.86 ? 204 ILE A C     1 
ATOM   1555 O  O     . ILE A 1 207 ? 23.319 61.150 1.115   1.00 11.99 ? 204 ILE A O     1 
ATOM   1556 C  CB    . ILE A 1 207 ? 25.974 59.094 0.857   1.00 10.46 ? 204 ILE A CB    1 
ATOM   1557 C  CG1   . ILE A 1 207 ? 26.644 58.219 -0.212  1.00 10.59 ? 204 ILE A CG1   1 
ATOM   1558 C  CG2   . ILE A 1 207 ? 24.861 58.313 1.571   1.00 10.65 ? 204 ILE A CG2   1 
ATOM   1559 C  CD1   . ILE A 1 207 ? 27.555 57.096 0.381   1.00 11.70 ? 204 ILE A CD1   1 
ATOM   1560 N  N     . GLU A 1 208 ? 25.192 61.835 2.171   1.00 9.34  ? 205 GLU A N     1 
ATOM   1561 C  CA    . GLU A 1 208 ? 24.392 62.517 3.189   1.00 9.73  ? 205 GLU A CA    1 
ATOM   1562 C  C     . GLU A 1 208 ? 23.608 63.666 2.574   1.00 12.00 ? 205 GLU A C     1 
ATOM   1563 O  O     . GLU A 1 208 ? 22.427 63.853 2.889   1.00 13.52 ? 205 GLU A O     1 
ATOM   1564 C  CB    . GLU A 1 208 ? 25.261 63.015 4.346   1.00 14.39 ? 205 GLU A CB    1 
ATOM   1565 C  CG    . GLU A 1 208 ? 24.392 63.553 5.499   1.00 15.87 ? 205 GLU A CG    1 
ATOM   1566 C  CD    . GLU A 1 208 ? 25.174 63.902 6.742   1.00 21.33 ? 205 GLU A CD    1 
ATOM   1567 O  OE1   . GLU A 1 208 ? 26.421 63.930 6.672   1.00 22.71 ? 205 GLU A OE1   1 
ATOM   1568 O  OE2   . GLU A 1 208 ? 24.543 64.144 7.794   1.00 24.32 ? 205 GLU A OE2   1 
ATOM   1569 N  N     . ARG A 1 209 ? 24.226 64.411 1.649   1.00 10.79 ? 206 ARG A N     1 
ATOM   1570 C  CA    . ARG A 1 209 ? 23.512 65.529 1.032   1.00 14.31 ? 206 ARG A CA    1 
ATOM   1571 C  C     . ARG A 1 209 ? 22.307 65.043 0.238   1.00 12.81 ? 206 ARG A C     1 
ATOM   1572 O  O     . ARG A 1 209 ? 21.222 65.633 0.330   1.00 17.61 ? 206 ARG A O     1 
ATOM   1573 C  CB    . ARG A 1 209 ? 24.431 66.346 0.115   1.00 14.13 ? 206 ARG A CB    1 
ATOM   1574 C  CG    . ARG A 1 209 ? 23.684 67.553 -0.518  1.00 19.88 ? 206 ARG A CG    1 
ATOM   1575 C  CD    . ARG A 1 209 ? 24.488 68.336 -1.555  1.00 21.46 ? 206 ARG A CD    1 
ATOM   1576 N  NE    . ARG A 1 209 ? 24.522 67.711 -2.884  1.00 29.26 ? 206 ARG A NE    1 
ATOM   1577 C  CZ    . ARG A 1 209 ? 23.576 67.825 -3.817  1.00 27.93 ? 206 ARG A CZ    1 
ATOM   1578 N  NH1   . ARG A 1 209 ? 22.473 68.523 -3.582  1.00 20.53 ? 206 ARG A NH1   1 
ATOM   1579 N  NH2   . ARG A 1 209 ? 23.734 67.230 -4.995  1.00 23.38 ? 206 ARG A NH2   1 
ATOM   1580 N  N     . GLU A 1 210 ? 22.475 63.980 -0.545  1.00 10.72 ? 207 GLU A N     1 
ATOM   1581 C  CA    . GLU A 1 210 ? 21.451 63.577 -1.502  1.00 10.59 ? 207 GLU A CA    1 
ATOM   1582 C  C     . GLU A 1 210 ? 20.432 62.592 -0.943  1.00 14.49 ? 207 GLU A C     1 
ATOM   1583 O  O     . GLU A 1 210 ? 19.385 62.390 -1.572  1.00 13.02 ? 207 GLU A O     1 
ATOM   1584 C  CB    . GLU A 1 210 ? 22.124 62.998 -2.749  1.00 12.87 ? 207 GLU A CB    1 
ATOM   1585 C  CG    . GLU A 1 210 ? 23.012 64.030 -3.423  1.00 13.98 ? 207 GLU A CG    1 
ATOM   1586 C  CD    . GLU A 1 210 ? 23.792 63.485 -4.597  1.00 21.45 ? 207 GLU A CD    1 
ATOM   1587 O  OE1   . GLU A 1 210 ? 23.260 62.622 -5.326  1.00 23.05 ? 207 GLU A OE1   1 
ATOM   1588 O  OE2   . GLU A 1 210 ? 24.935 63.945 -4.800  1.00 25.02 ? 207 GLU A OE2   1 
ATOM   1589 N  N     . THR A 1 211 ? 20.694 61.979 0.218   1.00 10.28 ? 208 THR A N     1 
ATOM   1590 C  CA    . THR A 1 211 ? 19.728 61.058 0.803   1.00 10.76 ? 208 THR A CA    1 
ATOM   1591 C  C     . THR A 1 211 ? 19.354 61.378 2.231   1.00 12.82 ? 208 THR A C     1 
ATOM   1592 O  O     . THR A 1 211 ? 18.327 60.869 2.700   1.00 14.39 ? 208 THR A O     1 
ATOM   1593 C  CB    . THR A 1 211 ? 20.243 59.608 0.767   1.00 12.62 ? 208 THR A CB    1 
ATOM   1594 O  OG1   . THR A 1 211 ? 21.286 59.433 1.740   1.00 13.16 ? 208 THR A OG1   1 
ATOM   1595 C  CG2   . THR A 1 211 ? 20.749 59.239 -0.613  1.00 13.27 ? 208 THR A CG2   1 
ATOM   1596 N  N     . GLY A 1 212 ? 20.157 62.154 2.949   1.00 11.73 ? 209 GLY A N     1 
ATOM   1597 C  CA    . GLY A 1 212 ? 19.999 62.339 4.373   1.00 11.79 ? 209 GLY A CA    1 
ATOM   1598 C  C     . GLY A 1 212 ? 20.672 61.281 5.231   1.00 15.06 ? 209 GLY A C     1 
ATOM   1599 O  O     . GLY A 1 212 ? 20.693 61.428 6.457   1.00 18.59 ? 209 GLY A O     1 
ATOM   1600 N  N     . PHE A 1 213 ? 21.231 60.241 4.630   1.00 11.54 ? 210 PHE A N     1 
ATOM   1601 C  CA    . PHE A 1 213 ? 21.759 59.110 5.386   1.00 10.23 ? 210 PHE A CA    1 
ATOM   1602 C  C     . PHE A 1 213 ? 23.239 59.287 5.706   1.00 11.03 ? 210 PHE A C     1 
ATOM   1603 O  O     . PHE A 1 213 ? 24.025 59.728 4.862   1.00 14.88 ? 210 PHE A O     1 
ATOM   1604 C  CB    . PHE A 1 213 ? 21.567 57.811 4.606   1.00 12.36 ? 210 PHE A CB    1 
ATOM   1605 C  CG    . PHE A 1 213 ? 20.130 57.480 4.297   1.00 10.51 ? 210 PHE A CG    1 
ATOM   1606 C  CD1   . PHE A 1 213 ? 19.106 57.791 5.190   1.00 12.80 ? 210 PHE A CD1   1 
ATOM   1607 C  CD2   . PHE A 1 213 ? 19.809 56.850 3.104   1.00 11.36 ? 210 PHE A CD2   1 
ATOM   1608 C  CE1   . PHE A 1 213 ? 17.776 57.478 4.879   1.00 11.43 ? 210 PHE A CE1   1 
ATOM   1609 C  CE2   . PHE A 1 213 ? 18.491 56.526 2.789   1.00 11.18 ? 210 PHE A CE2   1 
ATOM   1610 C  CZ    . PHE A 1 213 ? 17.474 56.831 3.680   1.00 9.64  ? 210 PHE A CZ    1 
ATOM   1611 N  N     . GLN A 1 214 ? 23.615 58.913 6.929   1.00 11.71 ? 211 GLN A N     1 
ATOM   1612 C  CA    . GLN A 1 214 ? 24.997 58.905 7.386   1.00 12.48 ? 211 GLN A CA    1 
ATOM   1613 C  C     . GLN A 1 214 ? 25.570 57.499 7.312   1.00 10.84 ? 211 GLN A C     1 
ATOM   1614 O  O     . GLN A 1 214 ? 24.847 56.504 7.413   1.00 10.72 ? 211 GLN A O     1 
ATOM   1615 C  CB    . GLN A 1 214 ? 25.098 59.422 8.826   1.00 13.04 ? 211 GLN A CB    1 
ATOM   1616 C  CG    . GLN A 1 214 ? 24.882 60.933 8.899   1.00 15.17 ? 211 GLN A CG    1 
ATOM   1617 C  CD    . GLN A 1 214 ? 25.017 61.490 10.293  1.00 18.89 ? 211 GLN A CD    1 
ATOM   1618 O  OE1   . GLN A 1 214 ? 25.077 60.750 11.273  1.00 17.20 ? 211 GLN A OE1   1 
ATOM   1619 N  NE2   . GLN A 1 214 ? 25.055 62.817 10.392  1.00 24.31 ? 211 GLN A NE2   1 
ATOM   1620 N  N     . CYS A 1 215 ? 26.883 57.421 7.122   1.00 12.12 ? 212 CYS A N     1 
ATOM   1621 C  CA    . CYS A 1 215 ? 27.520 56.116 7.063   1.00 12.61 ? 212 CYS A CA    1 
ATOM   1622 C  C     . CYS A 1 215 ? 28.918 56.204 7.644   1.00 11.39 ? 212 CYS A C     1 
ATOM   1623 O  O     . CYS A 1 215 ? 29.468 57.292 7.871   1.00 12.99 ? 212 CYS A O     1 
ATOM   1624 C  CB    . CYS A 1 215 ? 27.590 55.588 5.637   1.00 11.51 ? 212 CYS A CB    1 
ATOM   1625 S  SG    . CYS A 1 215 ? 28.585 56.658 4.588   1.00 17.73 ? 212 CYS A SG    1 
ATOM   1626 N  N     . SER A 1 216 ? 29.494 55.032 7.870   1.00 10.79 ? 213 SER A N     1 
ATOM   1627 C  CA    . SER A 1 216 ? 30.898 54.895 8.230   1.00 11.44 ? 213 SER A CA    1 
ATOM   1628 C  C     . SER A 1 216 ? 31.651 54.258 7.068   1.00 12.12 ? 213 SER A C     1 
ATOM   1629 O  O     . SER A 1 216 ? 31.049 53.671 6.168   1.00 11.28 ? 213 SER A O     1 
ATOM   1630 C  CB    . SER A 1 216 ? 31.036 54.051 9.497   1.00 12.69 ? 213 SER A CB    1 
ATOM   1631 O  OG    . SER A 1 216 ? 30.316 54.682 10.541  1.00 16.43 ? 213 SER A OG    1 
ATOM   1632 N  N     . ALA A 1 217 ? 32.978 54.399 7.063   1.00 9.63  ? 214 ALA A N     1 
ATOM   1633 C  CA    . ALA A 1 217 ? 33.753 53.736 6.023   1.00 8.36  ? 214 ALA A CA    1 
ATOM   1634 C  C     . ALA A 1 217 ? 35.127 53.359 6.557   1.00 12.29 ? 214 ALA A C     1 
ATOM   1635 O  O     . ALA A 1 217 ? 35.642 53.982 7.493   1.00 11.07 ? 214 ALA A O     1 
ATOM   1636 C  CB    . ALA A 1 217 ? 33.918 54.604 4.759   1.00 11.31 ? 214 ALA A CB    1 
ATOM   1637 N  N     . GLY A 1 218 ? 35.707 52.330 5.962   1.00 9.06  ? 215 GLY A N     1 
ATOM   1638 C  CA    . GLY A 1 218 ? 37.117 52.012 6.161   1.00 9.81  ? 215 GLY A CA    1 
ATOM   1639 C  C     . GLY A 1 218 ? 37.855 52.150 4.842   1.00 9.11  ? 215 GLY A C     1 
ATOM   1640 O  O     . GLY A 1 218 ? 37.288 51.886 3.786   1.00 9.45  ? 215 GLY A O     1 
ATOM   1641 N  N     . ILE A 1 219 ? 39.110 52.602 4.905   1.00 7.92  ? 216 ILE A N     1 
ATOM   1642 C  CA    . ILE A 1 219 ? 39.973 52.703 3.726   1.00 7.88  ? 216 ILE A CA    1 
ATOM   1643 C  C     . ILE A 1 219 ? 41.266 51.953 4.028   1.00 11.14 ? 216 ILE A C     1 
ATOM   1644 O  O     . ILE A 1 219 ? 41.943 52.258 5.017   1.00 9.88  ? 216 ILE A O     1 
ATOM   1645 C  CB    . ILE A 1 219 ? 40.293 54.172 3.363   1.00 10.88 ? 216 ILE A CB    1 
ATOM   1646 C  CG1   . ILE A 1 219 ? 39.006 54.983 3.127   1.00 9.57  ? 216 ILE A CG1   1 
ATOM   1647 C  CG2   . ILE A 1 219 ? 41.203 54.247 2.136   1.00 11.48 ? 216 ILE A CG2   1 
ATOM   1648 C  CD1   . ILE A 1 219 ? 38.520 55.729 4.378   1.00 15.11 ? 216 ILE A CD1   1 
ATOM   1649 N  N     . SER A 1 220 ? 41.622 51.000 3.170   1.00 8.13  ? 217 SER A N     1 
ATOM   1650 C  CA    . SER A 1 220 ? 42.874 50.279 3.338   1.00 7.39  ? 217 SER A CA    1 
ATOM   1651 C  C     . SER A 1 220 ? 43.294 49.724 1.981   1.00 10.57 ? 217 SER A C     1 
ATOM   1652 O  O     . SER A 1 220 ? 42.863 50.225 0.930   1.00 9.97  ? 217 SER A O     1 
ATOM   1653 C  CB    . SER A 1 220 ? 42.733 49.181 4.409   1.00 11.37 ? 217 SER A CB    1 
ATOM   1654 O  OG    . SER A 1 220 ? 44.011 48.620 4.724   1.00 11.25 ? 217 SER A OG    1 
ATOM   1655 N  N     . HIS A 1 221 ? 44.152 48.712 1.991   1.00 9.04  ? 218 HIS A N     1 
ATOM   1656 C  CA    . HIS A 1 221 ? 44.669 48.148 0.748   1.00 9.65  ? 218 HIS A CA    1 
ATOM   1657 C  C     . HIS A 1 221 ? 43.919 46.911 0.271   1.00 8.58  ? 218 HIS A C     1 
ATOM   1658 O  O     . HIS A 1 221 ? 44.240 46.406 -0.816  1.00 11.10 ? 218 HIS A O     1 
ATOM   1659 C  CB    . HIS A 1 221 ? 46.164 47.819 0.898   1.00 10.70 ? 218 HIS A CB    1 
ATOM   1660 C  CG    . HIS A 1 221 ? 47.044 49.030 1.004   1.00 11.03 ? 218 HIS A CG    1 
ATOM   1661 N  ND1   . HIS A 1 221 ? 47.166 49.952 -0.013  1.00 10.54 ? 218 HIS A ND1   1 
ATOM   1662 C  CD2   . HIS A 1 221 ? 47.870 49.451 1.997   1.00 11.52 ? 218 HIS A CD2   1 
ATOM   1663 C  CE1   . HIS A 1 221 ? 48.020 50.897 0.351   1.00 12.38 ? 218 HIS A CE1   1 
ATOM   1664 N  NE2   . HIS A 1 221 ? 48.457 50.619 1.568   1.00 13.17 ? 218 HIS A NE2   1 
ATOM   1665 N  N     . ASN A 1 222 ? 42.947 46.404 1.032   1.00 8.53  ? 219 ASN A N     1 
ATOM   1666 C  CA    . ASN A 1 222 ? 42.199 45.212 0.641   1.00 9.68  ? 219 ASN A CA    1 
ATOM   1667 C  C     . ASN A 1 222 ? 40.860 45.203 1.372   1.00 9.39  ? 219 ASN A C     1 
ATOM   1668 O  O     . ASN A 1 222 ? 40.605 46.026 2.259   1.00 10.44 ? 219 ASN A O     1 
ATOM   1669 C  CB    . ASN A 1 222 ? 43.003 43.926 0.914   1.00 10.16 ? 219 ASN A CB    1 
ATOM   1670 C  CG    . ASN A 1 222 ? 43.404 43.782 2.383   1.00 11.33 ? 219 ASN A CG    1 
ATOM   1671 O  OD1   . ASN A 1 222 ? 42.544 43.699 3.256   1.00 10.81 ? 219 ASN A OD1   1 
ATOM   1672 N  ND2   . ASN A 1 222 ? 44.720 43.696 2.649   1.00 11.42 ? 219 ASN A ND2   1 
ATOM   1673 N  N     . LYS A 1 223 ? 39.996 44.261 0.976   1.00 12.25 ? 220 LYS A N     1 
ATOM   1674 C  CA    . LYS A 1 223 ? 38.620 44.261 1.464   1.00 9.35  ? 220 LYS A CA    1 
ATOM   1675 C  C     . LYS A 1 223 ? 38.540 43.913 2.948   1.00 12.87 ? 220 LYS A C     1 
ATOM   1676 O  O     . LYS A 1 223 ? 37.740 44.507 3.684   1.00 11.84 ? 220 LYS A O     1 
ATOM   1677 C  CB    . LYS A 1 223 ? 37.771 43.290 0.626   1.00 13.34 ? 220 LYS A CB    1 
ATOM   1678 C  CG    . LYS A 1 223 ? 37.491 43.814 -0.782  1.00 12.50 ? 220 LYS A CG    1 
ATOM   1679 C  CD    . LYS A 1 223 ? 36.976 42.703 -1.727  1.00 24.42 ? 220 LYS A CD    1 
ATOM   1680 C  CE    . LYS A 1 223 ? 35.619 42.173 -1.313  1.00 27.39 ? 220 LYS A CE    1 
ATOM   1681 N  NZ    . LYS A 1 223 ? 35.119 41.096 -2.263  1.00 20.25 ? 220 LYS A NZ    1 
ATOM   1682 N  N     . VAL A 1 224 ? 39.331 42.929 3.404   1.00 10.31 ? 221 VAL A N     1 
ATOM   1683 C  CA    . VAL A 1 224 ? 39.262 42.512 4.801   1.00 11.43 ? 221 VAL A CA    1 
ATOM   1684 C  C     . VAL A 1 224 ? 39.689 43.649 5.723   1.00 10.96 ? 221 VAL A C     1 
ATOM   1685 O  O     . VAL A 1 224 ? 39.046 43.906 6.749   1.00 12.09 ? 221 VAL A O     1 
ATOM   1686 C  CB    . VAL A 1 224 ? 40.120 41.251 5.032   1.00 13.02 ? 221 VAL A CB    1 
ATOM   1687 C  CG1   . VAL A 1 224 ? 40.378 41.031 6.503   1.00 16.31 ? 221 VAL A CG1   1 
ATOM   1688 C  CG2   . VAL A 1 224 ? 39.419 40.040 4.436   1.00 16.77 ? 221 VAL A CG2   1 
ATOM   1689 N  N     . LEU A 1 225 ? 40.780 44.348 5.378   1.00 10.56 ? 222 LEU A N     1 
ATOM   1690 C  CA    . LEU A 1 225 ? 41.224 45.451 6.225   1.00 10.81 ? 222 LEU A CA    1 
ATOM   1691 C  C     . LEU A 1 225 ? 40.283 46.643 6.131   1.00 10.27 ? 222 LEU A C     1 
ATOM   1692 O  O     . LEU A 1 225 ? 40.089 47.349 7.125   1.00 10.08 ? 222 LEU A O     1 
ATOM   1693 C  CB    . LEU A 1 225 ? 42.643 45.889 5.867   1.00 8.73  ? 222 LEU A CB    1 
ATOM   1694 C  CG    . LEU A 1 225 ? 43.763 44.908 6.241   1.00 9.87  ? 222 LEU A CG    1 
ATOM   1695 C  CD1   . LEU A 1 225 ? 45.104 45.518 5.866   1.00 12.12 ? 222 LEU A CD1   1 
ATOM   1696 C  CD2   . LEU A 1 225 ? 43.727 44.558 7.723   1.00 12.65 ? 222 LEU A CD2   1 
ATOM   1697 N  N     . ALA A 1 226 ? 39.682 46.881 4.961   1.00 10.79 ? 223 ALA A N     1 
ATOM   1698 C  CA    . ALA A 1 226 ? 38.736 47.989 4.866   1.00 8.96  ? 223 ALA A CA    1 
ATOM   1699 C  C     . ALA A 1 226 ? 37.503 47.715 5.712   1.00 10.16 ? 223 ALA A C     1 
ATOM   1700 O  O     . ALA A 1 226 ? 36.966 48.621 6.357   1.00 11.04 ? 223 ALA A O     1 
ATOM   1701 C  CB    . ALA A 1 226 ? 38.328 48.233 3.405   1.00 11.23 ? 223 ALA A CB    1 
ATOM   1702 N  N     . LYS A 1 227 ? 37.025 46.469 5.707   1.00 10.92 ? 224 LYS A N     1 
ATOM   1703 C  CA    . LYS A 1 227 ? 35.876 46.100 6.534   1.00 11.63 ? 224 LYS A CA    1 
ATOM   1704 C  C     . LYS A 1 227 ? 36.199 46.244 8.010   1.00 12.12 ? 224 LYS A C     1 
ATOM   1705 O  O     . LYS A 1 227 ? 35.410 46.801 8.777   1.00 11.10 ? 224 LYS A O     1 
ATOM   1706 C  CB    . LYS A 1 227 ? 35.452 44.660 6.224   1.00 10.03 ? 224 LYS A CB    1 
ATOM   1707 C  CG    . LYS A 1 227 ? 34.383 44.142 7.114   1.00 16.33 ? 224 LYS A CG    1 
ATOM   1708 C  CD    . LYS A 1 227 ? 33.137 44.958 6.869   0.89 19.51 ? 224 LYS A CD    1 
ATOM   1709 C  CE    . LYS A 1 227 ? 31.900 44.202 7.238   0.70 30.98 ? 224 LYS A CE    1 
ATOM   1710 N  NZ    . LYS A 1 227 ? 32.221 43.135 8.218   0.67 21.89 ? 224 LYS A NZ    1 
ATOM   1711 N  N     . LEU A 1 228 ? 37.368 45.760 8.418   1.00 11.14 ? 225 LEU A N     1 
ATOM   1712 C  CA    . LEU A 1 228 ? 37.795 45.919 9.800   1.00 11.19 ? 225 LEU A CA    1 
ATOM   1713 C  C     . LEU A 1 228 ? 37.915 47.393 10.176  1.00 13.76 ? 225 LEU A C     1 
ATOM   1714 O  O     . LEU A 1 228 ? 37.423 47.824 11.230  1.00 12.98 ? 225 LEU A O     1 
ATOM   1715 C  CB    . LEU A 1 228 ? 39.123 45.185 9.980   1.00 13.40 ? 225 LEU A CB    1 
ATOM   1716 C  CG    . LEU A 1 228 ? 39.636 45.053 11.400  1.00 16.39 ? 225 LEU A CG    1 
ATOM   1717 C  CD1   . LEU A 1 228 ? 38.714 44.116 12.214  1.00 18.82 ? 225 LEU A CD1   1 
ATOM   1718 C  CD2   . LEU A 1 228 ? 41.066 44.540 11.346  1.00 14.57 ? 225 LEU A CD2   1 
ATOM   1719 N  N     . ALA A 1 229 ? 38.539 48.185 9.300   1.00 11.57 ? 226 ALA A N     1 
ATOM   1720 C  CA    . ALA A 1 229 ? 38.710 49.614 9.541   1.00 10.64 ? 226 ALA A CA    1 
ATOM   1721 C  C     . ALA A 1 229 ? 37.375 50.308 9.755   1.00 10.23 ? 226 ALA A C     1 
ATOM   1722 O  O     . ALA A 1 229 ? 37.244 51.157 10.643  1.00 12.01 ? 226 ALA A O     1 
ATOM   1723 C  CB    . ALA A 1 229 ? 39.439 50.251 8.361   1.00 11.53 ? 226 ALA A CB    1 
ATOM   1724 N  N     . CYS A 1 230 ? 36.371 49.962 8.943   1.00 11.06 ? 227 CYS A N     1 
ATOM   1725 C  CA    . CYS A 1 230 ? 35.078 50.635 9.013   1.00 11.09 ? 227 CYS A CA    1 
ATOM   1726 C  C     . CYS A 1 230 ? 34.471 50.553 10.415  1.00 11.61 ? 227 CYS A C     1 
ATOM   1727 O  O     . CYS A 1 230 ? 33.908 51.537 10.917  1.00 14.80 ? 227 CYS A O     1 
ATOM   1728 C  CB    . CYS A 1 230 ? 34.154 50.002 7.976   1.00 10.45 ? 227 CYS A CB    1 
ATOM   1729 S  SG    . CYS A 1 230 ? 32.568 50.799 7.869   1.00 14.26 ? 227 CYS A SG    1 
ATOM   1730 N  N     . GLY A 1 231 ? 34.627 49.415 11.084  1.00 14.44 ? 228 GLY A N     1 
ATOM   1731 C  CA    . GLY A 1 231 ? 34.026 49.235 12.393  1.00 14.25 ? 228 GLY A CA    1 
ATOM   1732 C  C     . GLY A 1 231 ? 34.757 49.905 13.536  1.00 13.17 ? 228 GLY A C     1 
ATOM   1733 O  O     . GLY A 1 231 ? 34.225 49.962 14.650  1.00 16.99 ? 228 GLY A O     1 
ATOM   1734 N  N     . LEU A 1 232 ? 35.955 50.434 13.291  1.00 13.99 ? 229 LEU A N     1 
ATOM   1735 C  CA    . LEU A 1 232 ? 36.761 50.940 14.397  1.00 13.17 ? 229 LEU A CA    1 
ATOM   1736 C  C     . LEU A 1 232 ? 36.239 52.260 14.964  1.00 14.41 ? 229 LEU A C     1 
ATOM   1737 O  O     . LEU A 1 232 ? 36.464 52.542 16.147  1.00 14.24 ? 229 LEU A O     1 
ATOM   1738 C  CB    . LEU A 1 232 ? 38.218 51.091 13.959  1.00 14.43 ? 229 LEU A CB    1 
ATOM   1739 C  CG    . LEU A 1 232 ? 38.984 49.798 13.634  1.00 16.05 ? 229 LEU A CG    1 
ATOM   1740 C  CD1   . LEU A 1 232 ? 40.397 50.088 13.118  1.00 15.66 ? 229 LEU A CD1   1 
ATOM   1741 C  CD2   . LEU A 1 232 ? 39.045 48.922 14.853  1.00 21.03 ? 229 LEU A CD2   1 
ATOM   1742 N  N     A ASN A 1 233 ? 35.481 53.068 14.203  0.45 12.45 ? 230 ASN A N     1 
ATOM   1743 N  N     B ASN A 1 233 ? 35.645 53.100 14.117  0.55 12.28 ? 230 ASN A N     1 
ATOM   1744 C  CA    A ASN A 1 233 ? 35.094 54.388 14.729  0.45 10.94 ? 230 ASN A CA    1 
ATOM   1745 C  CA    B ASN A 1 233 ? 35.070 54.375 14.520  0.55 10.71 ? 230 ASN A CA    1 
ATOM   1746 C  C     A ASN A 1 233 ? 33.655 54.791 14.366  0.45 14.12 ? 230 ASN A C     1 
ATOM   1747 C  C     B ASN A 1 233 ? 33.704 54.471 13.843  0.55 11.25 ? 230 ASN A C     1 
ATOM   1748 O  O     A ASN A 1 233 ? 33.380 55.957 14.068  0.45 12.90 ? 230 ASN A O     1 
ATOM   1749 O  O     B ASN A 1 233 ? 33.564 55.029 12.756  0.55 13.61 ? 230 ASN A O     1 
ATOM   1750 C  CB    A ASN A 1 233 ? 36.081 55.461 14.268  0.45 11.66 ? 230 ASN A CB    1 
ATOM   1751 C  CB    B ASN A 1 233 ? 35.998 55.550 14.163  0.55 11.46 ? 230 ASN A CB    1 
ATOM   1752 C  CG    A ASN A 1 233 ? 37.420 55.340 14.966  0.45 14.13 ? 230 ASN A CG    1 
ATOM   1753 C  CG    B ASN A 1 233 ? 37.305 55.507 14.939  0.55 14.34 ? 230 ASN A CG    1 
ATOM   1754 O  OD1   A ASN A 1 233 ? 37.521 55.612 16.167  0.45 15.04 ? 230 ASN A OD1   1 
ATOM   1755 O  OD1   B ASN A 1 233 ? 37.346 55.865 16.124  0.55 14.33 ? 230 ASN A OD1   1 
ATOM   1756 N  ND2   A ASN A 1 233 ? 38.449 54.917 14.232  0.45 13.27 ? 230 ASN A ND2   1 
ATOM   1757 N  ND2   B ASN A 1 233 ? 38.376 55.060 14.285  0.55 13.42 ? 230 ASN A ND2   1 
ATOM   1758 N  N     . LYS A 1 234 ? 32.711 53.864 14.477  1.00 24.07 ? 231 LYS A N     1 
ATOM   1759 C  CA    . LYS A 1 234 ? 31.301 54.103 14.136  1.00 19.12 ? 231 LYS A CA    1 
ATOM   1760 C  C     . LYS A 1 234 ? 30.631 54.927 15.240  1.00 27.25 ? 231 LYS A C     1 
ATOM   1761 O  O     . LYS A 1 234 ? 31.022 54.829 16.405  1.00 32.23 ? 231 LYS A O     1 
ATOM   1762 C  CB    . LYS A 1 234 ? 30.561 52.770 13.959  1.00 26.13 ? 231 LYS A CB    1 
ATOM   1763 C  CG    . LYS A 1 234 ? 30.562 52.157 12.559  1.00 25.40 ? 231 LYS A CG    1 
ATOM   1764 C  CD    . LYS A 1 234 ? 29.451 51.070 12.447  1.00 21.66 ? 231 LYS A CD    1 
ATOM   1765 C  CE    . LYS A 1 234 ? 29.105 50.665 10.996  1.00 26.88 ? 231 LYS A CE    1 
ATOM   1766 N  NZ    . LYS A 1 234 ? 28.044 51.536 10.329  1.00 18.81 ? 231 LYS A NZ    1 
ATOM   1767 N  N     . PRO A 1 235 ? 29.610 55.730 14.903  1.00 17.27 ? 232 PRO A N     1 
ATOM   1768 C  CA    . PRO A 1 235 ? 29.034 56.006 13.583  1.00 13.73 ? 232 PRO A CA    1 
ATOM   1769 C  C     . PRO A 1 235 ? 29.559 57.299 12.964  1.00 14.62 ? 232 PRO A C     1 
ATOM   1770 O  O     . PRO A 1 235 ? 30.227 58.079 13.641  1.00 15.54 ? 232 PRO A O     1 
ATOM   1771 C  CB    . PRO A 1 235 ? 27.544 56.138 13.894  1.00 16.48 ? 232 PRO A CB    1 
ATOM   1772 C  CG    . PRO A 1 235 ? 27.542 56.823 15.249  1.00 19.85 ? 232 PRO A CG    1 
ATOM   1773 C  CD    . PRO A 1 235 ? 28.751 56.270 15.979  1.00 20.92 ? 232 PRO A CD    1 
ATOM   1774 N  N     . ASN A 1 236 ? 29.239 57.506 11.684  1.00 13.17 ? 233 ASN A N     1 
ATOM   1775 C  CA    . ASN A 1 236 ? 29.458 58.774 10.976  1.00 13.00 ? 233 ASN A CA    1 
ATOM   1776 C  C     . ASN A 1 236 ? 30.930 59.187 10.963  1.00 10.70 ? 233 ASN A C     1 
ATOM   1777 O  O     . ASN A 1 236 ? 31.245 60.378 11.022  1.00 12.97 ? 233 ASN A O     1 
ATOM   1778 C  CB    . ASN A 1 236 ? 28.593 59.898 11.568  1.00 16.17 ? 233 ASN A CB    1 
ATOM   1779 C  CG    . ASN A 1 236 ? 28.480 61.104 10.640  1.00 14.38 ? 233 ASN A CG    1 
ATOM   1780 O  OD1   . ASN A 1 236 ? 28.537 60.969 9.427   1.00 17.09 ? 233 ASN A OD1   1 
ATOM   1781 N  ND2   . ASN A 1 236 ? 28.349 62.295 11.221  1.00 22.94 ? 233 ASN A ND2   1 
ATOM   1782 N  N     . ARG A 1 237 ? 31.842 58.211 10.900  1.00 11.27 ? 234 ARG A N     1 
ATOM   1783 C  CA    . ARG A 1 237 ? 33.274 58.489 10.795  1.00 10.59 ? 234 ARG A CA    1 
ATOM   1784 C  C     . ARG A 1 237 ? 33.904 57.481 9.846   1.00 11.69 ? 234 ARG A C     1 
ATOM   1785 O  O     . ARG A 1 237 ? 33.316 56.439 9.538   1.00 12.34 ? 234 ARG A O     1 
ATOM   1786 C  CB    . ARG A 1 237 ? 33.983 58.407 12.158  1.00 11.94 ? 234 ARG A CB    1 
ATOM   1787 C  CG    . ARG A 1 237 ? 33.454 59.388 13.188  1.00 13.18 ? 234 ARG A CG    1 
ATOM   1788 C  CD    . ARG A 1 237 ? 33.964 60.799 12.894  1.00 21.84 ? 234 ARG A CD    1 
ATOM   1789 N  NE    . ARG A 1 237 ? 33.591 61.747 13.948  1.00 26.61 ? 234 ARG A NE    1 
ATOM   1790 C  CZ    . ARG A 1 237 ? 32.492 62.500 13.929  1.00 30.52 ? 234 ARG A CZ    1 
ATOM   1791 N  NH1   . ARG A 1 237 ? 31.640 62.431 12.913  1.00 28.72 ? 234 ARG A NH1   1 
ATOM   1792 N  NH2   . ARG A 1 237 ? 32.243 63.329 14.935  1.00 41.39 ? 234 ARG A NH2   1 
ATOM   1793 N  N     . GLN A 1 238 ? 35.116 57.777 9.395   1.00 9.08  ? 235 GLN A N     1 
ATOM   1794 C  CA    . GLN A 1 238 ? 35.839 56.835 8.549   1.00 9.48  ? 235 GLN A CA    1 
ATOM   1795 C  C     . GLN A 1 238 ? 37.241 56.640 9.091   1.00 10.60 ? 235 GLN A C     1 
ATOM   1796 O  O     . GLN A 1 238 ? 37.806 57.537 9.712   1.00 10.95 ? 235 GLN A O     1 
ATOM   1797 C  CB    . GLN A 1 238 ? 35.907 57.301 7.082   1.00 9.78  ? 235 GLN A CB    1 
ATOM   1798 C  CG    . GLN A 1 238 ? 36.467 58.722 6.902   1.00 12.20 ? 235 GLN A CG    1 
ATOM   1799 C  CD    . GLN A 1 238 ? 36.438 59.152 5.446   1.00 15.29 ? 235 GLN A CD    1 
ATOM   1800 O  OE1   . GLN A 1 238 ? 35.366 59.307 4.849   1.00 16.80 ? 235 GLN A OE1   1 
ATOM   1801 N  NE2   . GLN A 1 238 ? 37.611 59.330 4.859   1.00 9.91  ? 235 GLN A NE2   1 
ATOM   1802 N  N     . THR A 1 239 ? 37.812 55.461 8.829   1.00 9.49  ? 236 THR A N     1 
ATOM   1803 C  CA    . THR A 1 239 ? 39.091 55.094 9.426   1.00 9.54  ? 236 THR A CA    1 
ATOM   1804 C  C     . THR A 1 239 ? 40.026 54.584 8.345   1.00 10.27 ? 236 THR A C     1 
ATOM   1805 O  O     . THR A 1 239 ? 39.637 53.744 7.525   1.00 10.72 ? 236 THR A O     1 
ATOM   1806 C  CB    . THR A 1 239 ? 38.905 54.015 10.496  1.00 8.67  ? 236 THR A CB    1 
ATOM   1807 O  OG1   . THR A 1 239 ? 37.964 54.471 11.472  1.00 11.13 ? 236 THR A OG1   1 
ATOM   1808 C  CG2   . THR A 1 239 ? 40.243 53.714 11.209  1.00 11.22 ? 236 THR A CG2   1 
ATOM   1809 N  N     . LEU A 1 240 ? 41.258 55.093 8.352   1.00 8.94  ? 237 LEU A N     1 
ATOM   1810 C  CA    . LEU A 1 240 ? 42.304 54.659 7.431   1.00 9.30  ? 237 LEU A CA    1 
ATOM   1811 C  C     . LEU A 1 240 ? 43.215 53.679 8.166   1.00 10.64 ? 237 LEU A C     1 
ATOM   1812 O  O     . LEU A 1 240 ? 43.787 54.024 9.208   1.00 10.99 ? 237 LEU A O     1 
ATOM   1813 C  CB    . LEU A 1 240 ? 43.090 55.870 6.911   1.00 10.67 ? 237 LEU A CB    1 
ATOM   1814 C  CG    . LEU A 1 240 ? 44.154 55.708 5.825   1.00 10.26 ? 237 LEU A CG    1 
ATOM   1815 C  CD1   . LEU A 1 240 ? 44.407 57.067 5.158   1.00 11.96 ? 237 LEU A CD1   1 
ATOM   1816 C  CD2   . LEU A 1 240 ? 45.470 55.129 6.385   1.00 11.83 ? 237 LEU A CD2   1 
ATOM   1817 N  N     . VAL A 1 241 ? 43.342 52.464 7.634   1.00 8.74  ? 238 VAL A N     1 
ATOM   1818 C  CA    . VAL A 1 241 ? 44.236 51.447 8.192   1.00 11.09 ? 238 VAL A CA    1 
ATOM   1819 C  C     . VAL A 1 241 ? 45.368 51.253 7.194   1.00 10.87 ? 238 VAL A C     1 
ATOM   1820 O  O     . VAL A 1 241 ? 45.157 50.734 6.093   1.00 11.33 ? 238 VAL A O     1 
ATOM   1821 C  CB    . VAL A 1 241 ? 43.502 50.134 8.488   1.00 10.43 ? 238 VAL A CB    1 
ATOM   1822 C  CG1   . VAL A 1 241 ? 44.502 48.952 8.679   1.00 12.25 ? 238 VAL A CG1   1 
ATOM   1823 C  CG2   . VAL A 1 241 ? 42.637 50.292 9.720   1.00 11.05 ? 238 VAL A CG2   1 
ATOM   1824 N  N     . SER A 1 242 ? 46.562 51.726 7.556   1.00 7.78  ? 239 SER A N     1 
ATOM   1825 C  CA    . SER A 1 242 ? 47.713 51.612 6.679   1.00 9.33  ? 239 SER A CA    1 
ATOM   1826 C  C     . SER A 1 242 ? 48.365 50.245 6.842   1.00 8.63  ? 239 SER A C     1 
ATOM   1827 O  O     . SER A 1 242 ? 48.103 49.516 7.799   1.00 10.78 ? 239 SER A O     1 
ATOM   1828 C  CB    . SER A 1 242 ? 48.730 52.708 6.996   1.00 13.76 ? 239 SER A CB    1 
ATOM   1829 O  OG    . SER A 1 242 ? 49.198 52.529 8.320   1.00 14.17 ? 239 SER A OG    1 
ATOM   1830 N  N     . HIS A 1 243 ? 49.227 49.899 5.884   1.00 10.34 ? 240 HIS A N     1 
ATOM   1831 C  CA    . HIS A 1 243 ? 49.948 48.636 5.995   1.00 9.73  ? 240 HIS A CA    1 
ATOM   1832 C  C     . HIS A 1 243 ? 50.804 48.620 7.255   1.00 12.89 ? 240 HIS A C     1 
ATOM   1833 O  O     . HIS A 1 243 ? 50.867 47.606 7.968   1.00 11.65 ? 240 HIS A O     1 
ATOM   1834 C  CB    . HIS A 1 243 ? 50.809 48.407 4.744   1.00 14.11 ? 240 HIS A CB    1 
ATOM   1835 C  CG    . HIS A 1 243 ? 51.570 47.120 4.779   1.00 13.79 ? 240 HIS A CG    1 
ATOM   1836 N  ND1   . HIS A 1 243 ? 50.971 45.896 4.577   1.00 19.01 ? 240 HIS A ND1   1 
ATOM   1837 C  CD2   . HIS A 1 243 ? 52.878 46.863 5.024   1.00 20.10 ? 240 HIS A CD2   1 
ATOM   1838 C  CE1   . HIS A 1 243 ? 51.878 44.941 4.680   1.00 22.02 ? 240 HIS A CE1   1 
ATOM   1839 N  NE2   . HIS A 1 243 ? 53.042 45.500 4.955   1.00 19.66 ? 240 HIS A NE2   1 
ATOM   1840 N  N     . GLY A 1 244 ? 51.412 49.760 7.578   1.00 12.22 ? 241 GLY A N     1 
ATOM   1841 C  CA    . GLY A 1 244 ? 52.245 49.857 8.759   1.00 12.82 ? 241 GLY A CA    1 
ATOM   1842 C  C     . GLY A 1 244 ? 51.490 49.710 10.060  1.00 12.01 ? 241 GLY A C     1 
ATOM   1843 O  O     . GLY A 1 244 ? 52.087 49.306 11.061  1.00 12.73 ? 241 GLY A O     1 
ATOM   1844 N  N     . SER A 1 245 ? 50.176 49.981 10.062  1.00 8.77  ? 242 SER A N     1 
ATOM   1845 C  CA    . SER A 1 245 ? 49.394 49.857 11.289  1.00 9.06  ? 242 SER A CA    1 
ATOM   1846 C  C     . SER A 1 245 ? 49.042 48.415 11.629  1.00 9.85  ? 242 SER A C     1 
ATOM   1847 O  O     . SER A 1 245 ? 48.576 48.157 12.737  1.00 10.76 ? 242 SER A O     1 
ATOM   1848 C  CB    . SER A 1 245 ? 48.095 50.673 11.191  1.00 12.18 ? 242 SER A CB    1 
ATOM   1849 O  OG    . SER A 1 245 ? 47.154 50.021 10.356  1.00 15.66 ? 242 SER A OG    1 
ATOM   1850 N  N     . VAL A 1 246 ? 49.261 47.469 10.720  1.00 10.86 ? 243 VAL A N     1 
ATOM   1851 C  CA    . VAL A 1 246 ? 48.743 46.114 10.903  1.00 9.98  ? 243 VAL A CA    1 
ATOM   1852 C  C     . VAL A 1 246 ? 49.399 45.370 12.070  1.00 9.46  ? 243 VAL A C     1 
ATOM   1853 O  O     . VAL A 1 246 ? 48.668 44.743 12.850  1.00 9.20  ? 243 VAL A O     1 
ATOM   1854 C  CB    . VAL A 1 246 ? 48.858 45.328 9.586   1.00 10.56 ? 243 VAL A CB    1 
ATOM   1855 C  CG1   . VAL A 1 246 ? 48.579 43.830 9.800   1.00 13.25 ? 243 VAL A CG1   1 
ATOM   1856 C  CG2   . VAL A 1 246 ? 47.882 45.917 8.572   1.00 12.43 ? 243 VAL A CG2   1 
ATOM   1857 N  N     . PRO A 1 247 ? 50.729 45.393 12.274  1.00 9.32  ? 244 PRO A N     1 
ATOM   1858 C  CA    . PRO A 1 247 ? 51.265 44.590 13.399  1.00 8.83  ? 244 PRO A CA    1 
ATOM   1859 C  C     . PRO A 1 247 ? 50.689 44.968 14.760  1.00 8.63  ? 244 PRO A C     1 
ATOM   1860 O  O     . PRO A 1 247 ? 50.286 44.076 15.523  1.00 11.03 ? 244 PRO A O     1 
ATOM   1861 C  CB    . PRO A 1 247 ? 52.787 44.832 13.310  1.00 11.61 ? 244 PRO A CB    1 
ATOM   1862 C  CG    . PRO A 1 247 ? 53.031 45.085 11.854  1.00 12.82 ? 244 PRO A CG    1 
ATOM   1863 C  CD    . PRO A 1 247 ? 51.824 45.914 11.423  1.00 9.80  ? 244 PRO A CD    1 
ATOM   1864 N  N     . GLN A 1 248 ? 50.628 46.258 15.108  1.00 10.00 ? 245 GLN A N     1 
ATOM   1865 C  CA    . GLN A 1 248 ? 50.040 46.601 16.400  1.00 9.45  ? 245 GLN A CA    1 
ATOM   1866 C  C     . GLN A 1 248 ? 48.541 46.306 16.431  1.00 12.03 ? 245 GLN A C     1 
ATOM   1867 O  O     . GLN A 1 248 ? 48.031 45.792 17.435  1.00 11.51 ? 245 GLN A O     1 
ATOM   1868 C  CB    . GLN A 1 248 ? 50.313 48.069 16.738  1.00 14.53 ? 245 GLN A CB    1 
ATOM   1869 C  CG    . GLN A 1 248 ? 51.804 48.360 16.951  1.00 21.33 ? 245 GLN A CG    1 
ATOM   1870 C  CD    . GLN A 1 248 ? 52.042 49.541 17.875  1.00 31.39 ? 245 GLN A CD    1 
ATOM   1871 O  OE1   . GLN A 1 248 ? 51.845 49.438 19.087  1.00 39.16 ? 245 GLN A OE1   1 
ATOM   1872 N  NE2   . GLN A 1 248 ? 52.475 50.670 17.309  1.00 27.21 ? 245 GLN A NE2   1 
ATOM   1873 N  N     . LEU A 1 249 ? 47.820 46.634 15.347  1.00 11.69 ? 246 LEU A N     1 
ATOM   1874 C  CA    . LEU A 1 249 ? 46.374 46.414 15.320  1.00 10.34 ? 246 LEU A CA    1 
ATOM   1875 C  C     . LEU A 1 249 ? 46.045 44.934 15.496  1.00 9.51  ? 246 LEU A C     1 
ATOM   1876 O  O     . LEU A 1 249 ? 45.158 44.568 16.284  1.00 10.97 ? 246 LEU A O     1 
ATOM   1877 C  CB    . LEU A 1 249 ? 45.800 46.941 13.999  1.00 10.96 ? 246 LEU A CB    1 
ATOM   1878 C  CG    . LEU A 1 249 ? 44.307 46.717 13.779  1.00 10.86 ? 246 LEU A CG    1 
ATOM   1879 C  CD1   . LEU A 1 249 ? 43.530 47.456 14.864  1.00 14.10 ? 246 LEU A CD1   1 
ATOM   1880 C  CD2   . LEU A 1 249 ? 43.925 47.200 12.376  1.00 13.14 ? 246 LEU A CD2   1 
ATOM   1881 N  N     . PHE A 1 250 ? 46.788 44.065 14.809  1.00 8.93  ? 247 PHE A N     1 
ATOM   1882 C  CA    . PHE A 1 250 ? 46.520 42.633 14.889  1.00 9.08  ? 247 PHE A CA    1 
ATOM   1883 C  C     . PHE A 1 250 ? 47.023 42.007 16.182  1.00 10.67 ? 247 PHE A C     1 
ATOM   1884 O  O     . PHE A 1 250 ? 46.617 40.886 16.501  1.00 10.29 ? 247 PHE A O     1 
ATOM   1885 C  CB    . PHE A 1 250 ? 47.143 41.901 13.692  1.00 9.77  ? 247 PHE A CB    1 
ATOM   1886 C  CG    . PHE A 1 250 ? 46.296 41.936 12.441  1.00 9.43  ? 247 PHE A CG    1 
ATOM   1887 C  CD1   . PHE A 1 250 ? 45.172 42.737 12.372  1.00 11.79 ? 247 PHE A CD1   1 
ATOM   1888 C  CD2   . PHE A 1 250 ? 46.633 41.159 11.334  1.00 10.13 ? 247 PHE A CD2   1 
ATOM   1889 C  CE1   . PHE A 1 250 ? 44.386 42.759 11.233  1.00 13.42 ? 247 PHE A CE1   1 
ATOM   1890 C  CE2   . PHE A 1 250 ? 45.843 41.171 10.198  1.00 11.55 ? 247 PHE A CE2   1 
ATOM   1891 C  CZ    . PHE A 1 250 ? 44.716 41.973 10.152  1.00 12.49 ? 247 PHE A CZ    1 
ATOM   1892 N  N     . SER A 1 251 ? 47.917 42.688 16.918  1.00 10.61 ? 248 SER A N     1 
ATOM   1893 C  CA    . SER A 1 251 ? 48.549 42.050 18.072  1.00 8.38  ? 248 SER A CA    1 
ATOM   1894 C  C     . SER A 1 251 ? 47.557 41.744 19.187  1.00 8.81  ? 248 SER A C     1 
ATOM   1895 O  O     . SER A 1 251 ? 47.802 40.819 19.962  1.00 11.36 ? 248 SER A O     1 
ATOM   1896 C  CB    . SER A 1 251 ? 49.696 42.925 18.610  1.00 8.89  ? 248 SER A CB    1 
ATOM   1897 O  OG    . SER A 1 251 ? 49.201 44.092 19.247  1.00 12.06 ? 248 SER A OG    1 
ATOM   1898 N  N     . GLN A 1 252 ? 46.431 42.475 19.273  1.00 9.45  ? 249 GLN A N     1 
ATOM   1899 C  CA    . GLN A 1 252 ? 45.404 42.191 20.267  1.00 12.91 ? 249 GLN A CA    1 
ATOM   1900 C  C     . GLN A 1 252 ? 44.035 42.005 19.626  1.00 14.70 ? 249 GLN A C     1 
ATOM   1901 O  O     . GLN A 1 252 ? 43.020 42.190 20.305  1.00 14.37 ? 249 GLN A O     1 
ATOM   1902 C  CB    . GLN A 1 252 ? 45.311 43.308 21.305  1.00 16.30 ? 249 GLN A CB    1 
ATOM   1903 C  CG    . GLN A 1 252 ? 46.588 43.588 22.031  1.00 17.58 ? 249 GLN A CG    1 
ATOM   1904 C  CD    . GLN A 1 252 ? 46.404 44.699 23.028  1.00 19.19 ? 249 GLN A CD    1 
ATOM   1905 O  OE1   . GLN A 1 252 ? 46.618 45.878 22.718  1.00 27.75 ? 249 GLN A OE1   1 
ATOM   1906 N  NE2   . GLN A 1 252 ? 45.953 44.340 24.215  1.00 19.24 ? 249 GLN A NE2   1 
ATOM   1907 N  N     . MET A 1 253 ? 43.991 41.660 18.337  1.00 11.06 ? 250 MET A N     1 
ATOM   1908 C  CA    . MET A 1 253 ? 42.739 41.574 17.597  1.00 12.08 ? 250 MET A CA    1 
ATOM   1909 C  C     . MET A 1 253 ? 42.227 40.144 17.662  1.00 10.40 ? 250 MET A C     1 
ATOM   1910 O  O     . MET A 1 253 ? 42.865 39.251 17.092  1.00 11.17 ? 250 MET A O     1 
ATOM   1911 C  CB    . MET A 1 253 ? 42.953 41.990 16.146  1.00 10.63 ? 250 MET A CB    1 
ATOM   1912 C  CG    . MET A 1 253 ? 41.682 41.938 15.272  1.00 14.72 ? 250 MET A CG    1 
ATOM   1913 S  SD    . MET A 1 253 ? 40.407 43.101 15.817  1.00 17.11 ? 250 MET A SD    1 
ATOM   1914 C  CE    . MET A 1 253 ? 41.209 44.702 15.566  1.00 17.65 ? 250 MET A CE    1 
ATOM   1915 N  N     . PRO A 1 254 ? 41.100 39.873 18.325  1.00 13.50 ? 251 PRO A N     1 
ATOM   1916 C  CA    . PRO A 1 254 ? 40.577 38.501 18.334  1.00 13.85 ? 251 PRO A CA    1 
ATOM   1917 C  C     . PRO A 1 254 ? 40.375 37.990 16.916  1.00 10.32 ? 251 PRO A C     1 
ATOM   1918 O  O     . PRO A 1 254 ? 39.891 38.707 16.041  1.00 12.21 ? 251 PRO A O     1 
ATOM   1919 C  CB    . PRO A 1 254 ? 39.242 38.627 19.084  1.00 11.18 ? 251 PRO A CB    1 
ATOM   1920 C  CG    . PRO A 1 254 ? 39.409 39.833 19.945  1.00 14.50 ? 251 PRO A CG    1 
ATOM   1921 C  CD    . PRO A 1 254 ? 40.237 40.792 19.081  1.00 14.63 ? 251 PRO A CD    1 
ATOM   1922 N  N     . ILE A 1 255 ? 40.754 36.724 16.708  1.00 12.12 ? 252 ILE A N     1 
ATOM   1923 C  CA    . ILE A 1 255 ? 40.651 36.087 15.398  1.00 12.28 ? 252 ILE A CA    1 
ATOM   1924 C  C     . ILE A 1 255 ? 39.239 36.207 14.828  1.00 10.95 ? 252 ILE A C     1 
ATOM   1925 O  O     . ILE A 1 255 ? 39.066 36.451 13.630  1.00 11.84 ? 252 ILE A O     1 
ATOM   1926 C  CB    . ILE A 1 255 ? 41.126 34.622 15.494  1.00 13.85 ? 252 ILE A CB    1 
ATOM   1927 C  CG1   . ILE A 1 255 ? 42.656 34.613 15.554  1.00 17.98 ? 252 ILE A CG1   1 
ATOM   1928 C  CG2   . ILE A 1 255 ? 40.645 33.793 14.300  1.00 14.89 ? 252 ILE A CG2   1 
ATOM   1929 C  CD1   . ILE A 1 255 ? 43.242 33.369 16.161  1.00 23.61 ? 252 ILE A CD1   1 
ATOM   1930 N  N     . ARG A 1 256 ? 38.210 36.084 15.682  1.00 9.84  ? 253 ARG A N     1 
ATOM   1931 C  CA    . ARG A 1 256 ? 36.828 36.066 15.213  1.00 12.64 ? 253 ARG A CA    1 
ATOM   1932 C  C     . ARG A 1 256 ? 36.379 37.388 14.614  1.00 14.63 ? 253 ARG A C     1 
ATOM   1933 O  O     . ARG A 1 256 ? 35.298 37.441 14.018  1.00 16.69 ? 253 ARG A O     1 
ATOM   1934 C  CB    . ARG A 1 256 ? 35.889 35.712 16.362  1.00 16.38 ? 253 ARG A CB    1 
ATOM   1935 C  CG    . ARG A 1 256 ? 35.722 36.852 17.349  1.00 14.82 ? 253 ARG A CG    1 
ATOM   1936 C  CD    . ARG A 1 256 ? 34.784 36.467 18.479  1.00 17.86 ? 253 ARG A CD    1 
ATOM   1937 N  NE    . ARG A 1 256 ? 34.802 37.465 19.543  1.00 19.68 ? 253 ARG A NE    1 
ATOM   1938 C  CZ    . ARG A 1 256 ? 35.671 37.482 20.551  1.00 19.07 ? 253 ARG A CZ    1 
ATOM   1939 N  NH1   . ARG A 1 256 ? 36.612 36.546 20.652  1.00 20.59 ? 253 ARG A NH1   1 
ATOM   1940 N  NH2   . ARG A 1 256 ? 35.599 38.447 21.464  1.00 22.96 ? 253 ARG A NH2   1 
ATOM   1941 N  N     . LYS A 1 257 ? 37.167 38.456 14.754  1.00 12.53 ? 254 LYS A N     1 
ATOM   1942 C  CA    . LYS A 1 257 ? 36.766 39.749 14.207  1.00 13.23 ? 254 LYS A CA    1 
ATOM   1943 C  C     . LYS A 1 257 ? 37.062 39.896 12.724  1.00 15.45 ? 254 LYS A C     1 
ATOM   1944 O  O     . LYS A 1 257 ? 36.540 40.826 12.086  1.00 15.98 ? 254 LYS A O     1 
ATOM   1945 C  CB    . LYS A 1 257 ? 37.469 40.884 14.966  1.00 12.91 ? 254 LYS A CB    1 
ATOM   1946 C  CG    . LYS A 1 257 ? 37.215 40.865 16.439  1.00 15.90 ? 254 LYS A CG    1 
ATOM   1947 C  CD    . LYS A 1 257 ? 35.769 41.173 16.748  1.00 20.96 ? 254 LYS A CD    1 
ATOM   1948 C  CE    . LYS A 1 257 ? 35.494 41.041 18.241  1.00 32.76 ? 254 LYS A CE    1 
ATOM   1949 N  NZ    . LYS A 1 257 ? 34.051 41.240 18.542  1.00 30.15 ? 254 LYS A NZ    1 
ATOM   1950 N  N     . ILE A 1 258 ? 37.902 39.031 12.168  1.00 10.16 ? 255 ILE A N     1 
ATOM   1951 C  CA    A ILE A 1 258 ? 38.296 39.125 10.769  0.48 11.40 ? 255 ILE A CA    1 
ATOM   1952 C  CA    B ILE A 1 258 ? 38.292 39.136 10.767  0.52 11.38 ? 255 ILE A CA    1 
ATOM   1953 C  C     . ILE A 1 258 ? 37.233 38.456 9.914   1.00 13.37 ? 255 ILE A C     1 
ATOM   1954 O  O     . ILE A 1 258 ? 36.763 37.362 10.243  1.00 13.75 ? 255 ILE A O     1 
ATOM   1955 C  CB    A ILE A 1 258 ? 39.671 38.465 10.568  0.48 12.06 ? 255 ILE A CB    1 
ATOM   1956 C  CB    B ILE A 1 258 ? 39.682 38.507 10.543  0.52 12.08 ? 255 ILE A CB    1 
ATOM   1957 C  CG1   A ILE A 1 258 ? 40.705 39.095 11.511  0.48 15.06 ? 255 ILE A CG1   1 
ATOM   1958 C  CG1   B ILE A 1 258 ? 40.799 39.507 10.880  0.52 17.52 ? 255 ILE A CG1   1 
ATOM   1959 C  CG2   A ILE A 1 258 ? 40.108 38.560 9.120   0.48 15.35 ? 255 ILE A CG2   1 
ATOM   1960 C  CG2   B ILE A 1 258 ? 39.840 38.013 9.107   0.52 14.43 ? 255 ILE A CG2   1 
ATOM   1961 C  CD1   A ILE A 1 258 ? 40.861 40.594 11.343  0.48 18.46 ? 255 ILE A CD1   1 
ATOM   1962 C  CD1   B ILE A 1 258 ? 40.924 39.835 12.355  0.52 19.07 ? 255 ILE A CD1   1 
ATOM   1963 N  N     . ARG A 1 259 ? 36.857 39.107 8.811   1.00 15.92 ? 256 ARG A N     1 
ATOM   1964 C  CA    . ARG A 1 259 ? 35.816 38.567 7.938   1.00 16.02 ? 256 ARG A CA    1 
ATOM   1965 C  C     . ARG A 1 259 ? 36.167 37.161 7.463   1.00 16.33 ? 256 ARG A C     1 
ATOM   1966 O  O     . ARG A 1 259 ? 37.266 36.923 6.949   1.00 16.86 ? 256 ARG A O     1 
ATOM   1967 C  CB    . ARG A 1 259 ? 35.613 39.486 6.727   1.00 18.14 ? 256 ARG A CB    1 
ATOM   1968 C  CG    . ARG A 1 259 ? 34.384 39.109 5.888   1.00 29.69 ? 256 ARG A CG    1 
ATOM   1969 C  CD    . ARG A 1 259 ? 34.395 39.771 4.510   1.00 33.57 ? 256 ARG A CD    1 
ATOM   1970 N  NE    . ARG A 1 259 ? 35.482 39.271 3.666   1.00 40.80 ? 256 ARG A NE    1 
ATOM   1971 C  CZ    . ARG A 1 259 ? 35.720 39.685 2.425   0.37 32.90 ? 256 ARG A CZ    1 
ATOM   1972 N  NH1   . ARG A 1 259 ? 34.943 40.608 1.872   0.83 30.02 ? 256 ARG A NH1   1 
ATOM   1973 N  NH2   . ARG A 1 259 ? 36.734 39.176 1.732   0.80 42.62 ? 256 ARG A NH2   1 
ATOM   1974 N  N     . SER A 1 260 ? 35.223 36.237 7.659   1.00 14.63 ? 257 SER A N     1 
ATOM   1975 C  CA    . SER A 1 260 ? 35.216 34.802 7.340   1.00 15.85 ? 257 SER A CA    1 
ATOM   1976 C  C     . SER A 1 260 ? 35.729 33.945 8.491   1.00 17.82 ? 257 SER A C     1 
ATOM   1977 O  O     . SER A 1 260 ? 35.604 32.723 8.428   1.00 14.50 ? 257 SER A O     1 
ATOM   1978 C  CB    . SER A 1 260 ? 35.990 34.443 6.057   1.00 19.23 ? 257 SER A CB    1 
ATOM   1979 O  OG    . SER A 1 260 ? 37.388 34.393 6.282   1.00 18.76 ? 257 SER A OG    1 
ATOM   1980 N  N     . LEU A 1 261 ? 36.280 34.545 9.549   1.00 12.69 ? 258 LEU A N     1 
ATOM   1981 C  CA    . LEU A 1 261 ? 36.770 33.802 10.702  1.00 13.25 ? 258 LEU A CA    1 
ATOM   1982 C  C     . LEU A 1 261 ? 35.833 33.878 11.903  1.00 13.11 ? 258 LEU A C     1 
ATOM   1983 O  O     . LEU A 1 261 ? 36.214 33.457 13.000  1.00 12.66 ? 258 LEU A O     1 
ATOM   1984 C  CB    . LEU A 1 261 ? 38.169 34.301 11.091  1.00 12.09 ? 258 LEU A CB    1 
ATOM   1985 C  CG    . LEU A 1 261 ? 39.208 34.166 9.973   1.00 13.83 ? 258 LEU A CG    1 
ATOM   1986 C  CD1   . LEU A 1 261 ? 40.614 34.545 10.471  1.00 11.93 ? 258 LEU A CD1   1 
ATOM   1987 C  CD2   . LEU A 1 261 ? 39.213 32.746 9.405   1.00 16.06 ? 258 LEU A CD2   1 
ATOM   1988 N  N     . GLY A 1 262 ? 34.602 34.377 11.721  1.00 11.79 ? 259 GLY A N     1 
ATOM   1989 C  CA    . GLY A 1 262 ? 33.664 34.471 12.820  1.00 12.72 ? 259 GLY A CA    1 
ATOM   1990 C  C     . GLY A 1 262 ? 32.928 33.196 13.173  1.00 14.27 ? 259 GLY A C     1 
ATOM   1991 O  O     . GLY A 1 262 ? 32.102 33.211 14.092  1.00 16.32 ? 259 GLY A O     1 
ATOM   1992 N  N     . GLY A 1 263 ? 33.191 32.101 12.458  1.00 13.86 ? 260 GLY A N     1 
ATOM   1993 C  CA    . GLY A 1 263 ? 32.460 30.864 12.632  1.00 15.10 ? 260 GLY A CA    1 
ATOM   1994 C  C     . GLY A 1 263 ? 33.344 29.678 12.977  1.00 17.40 ? 260 GLY A C     1 
ATOM   1995 O  O     . GLY A 1 263 ? 34.282 29.792 13.781  1.00 15.14 ? 260 GLY A O     1 
ATOM   1996 N  N     . LYS A 1 264 ? 33.049 28.527 12.362  1.00 15.05 ? 261 LYS A N     1 
ATOM   1997 C  CA    . LYS A 1 264 ? 33.715 27.279 12.731  1.00 17.55 ? 261 LYS A CA    1 
ATOM   1998 C  C     . LYS A 1 264 ? 35.201 27.290 12.379  1.00 17.35 ? 261 LYS A C     1 
ATOM   1999 O  O     . LYS A 1 264 ? 36.021 26.770 13.142  1.00 15.57 ? 261 LYS A O     1 
ATOM   2000 C  CB    . LYS A 1 264 ? 33.027 26.099 12.044  1.00 17.57 ? 261 LYS A CB    1 
ATOM   2001 C  CG    . LYS A 1 264 ? 31.595 25.902 12.462  1.00 28.94 ? 261 LYS A CG    1 
ATOM   2002 C  CD    . LYS A 1 264 ? 31.008 24.695 11.748  1.00 25.07 ? 261 LYS A CD    1 
ATOM   2003 C  CE    . LYS A 1 264 ? 29.595 24.417 12.220  0.70 36.35 ? 261 LYS A CE    1 
ATOM   2004 N  NZ    . LYS A 1 264 ? 29.123 23.105 11.715  0.74 35.28 ? 261 LYS A NZ    1 
ATOM   2005 N  N     . LEU A 1 265 ? 35.566 27.838 11.220  1.00 14.40 ? 262 LEU A N     1 
ATOM   2006 C  CA    . LEU A 1 265 ? 36.982 27.889 10.862  1.00 16.35 ? 262 LEU A CA    1 
ATOM   2007 C  C     . LEU A 1 265 ? 37.766 28.716 11.874  1.00 15.33 ? 262 LEU A C     1 
ATOM   2008 O  O     . LEU A 1 265 ? 38.819 28.290 12.365  1.00 14.55 ? 262 LEU A O     1 
ATOM   2009 C  CB    . LEU A 1 265 ? 37.159 28.460 9.457   1.00 13.51 ? 262 LEU A CB    1 
ATOM   2010 C  CG    . LEU A 1 265 ? 38.612 28.739 9.034   1.00 13.36 ? 262 LEU A CG    1 
ATOM   2011 C  CD1   . LEU A 1 265 ? 39.483 27.474 9.073   1.00 22.02 ? 262 LEU A CD1   1 
ATOM   2012 C  CD2   . LEU A 1 265 ? 38.623 29.371 7.643   1.00 15.53 ? 262 LEU A CD2   1 
ATOM   2013 N  N     . GLY A 1 266 ? 37.259 29.897 12.218  1.00 15.87 ? 263 GLY A N     1 
ATOM   2014 C  CA    . GLY A 1 266 ? 37.962 30.705 13.202  1.00 15.25 ? 263 GLY A CA    1 
ATOM   2015 C  C     . GLY A 1 266 ? 38.099 30.001 14.541  1.00 18.13 ? 263 GLY A C     1 
ATOM   2016 O  O     . GLY A 1 266 ? 39.152 30.060 15.181  1.00 13.27 ? 263 GLY A O     1 
ATOM   2017 N  N     . ALA A 1 267 ? 37.034 29.322 14.980  1.00 14.92 ? 264 ALA A N     1 
ATOM   2018 C  CA    . ALA A 1 267 ? 37.099 28.574 16.230  1.00 17.83 ? 264 ALA A CA    1 
ATOM   2019 C  C     . ALA A 1 267 ? 38.149 27.481 16.157  1.00 16.05 ? 264 ALA A C     1 
ATOM   2020 O  O     . ALA A 1 267 ? 38.829 27.192 17.153  1.00 15.87 ? 264 ALA A O     1 
ATOM   2021 C  CB    . ALA A 1 267 ? 35.726 27.981 16.549  1.00 17.18 ? 264 ALA A CB    1 
ATOM   2022 N  N     . SER A 1 268 ? 38.298 26.867 14.977  1.00 13.55 ? 265 SER A N     1 
ATOM   2023 C  CA    A SER A 1 268 ? 39.283 25.805 14.795  0.24 16.35 ? 265 SER A CA    1 
ATOM   2024 C  CA    B SER A 1 268 ? 39.284 25.802 14.842  0.45 16.33 ? 265 SER A CA    1 
ATOM   2025 C  CA    C SER A 1 268 ? 39.282 25.806 14.789  0.31 16.35 ? 265 SER A CA    1 
ATOM   2026 C  C     . SER A 1 268 ? 40.703 26.356 14.809  1.00 17.40 ? 265 SER A C     1 
ATOM   2027 O  O     . SER A 1 268 ? 41.617 25.716 15.337  1.00 15.71 ? 265 SER A O     1 
ATOM   2028 C  CB    A SER A 1 268 ? 39.017 25.061 13.484  0.24 18.54 ? 265 SER A CB    1 
ATOM   2029 C  CB    B SER A 1 268 ? 38.992 24.949 13.602  0.45 18.75 ? 265 SER A CB    1 
ATOM   2030 C  CB    C SER A 1 268 ? 39.006 25.084 13.471  0.31 18.53 ? 265 SER A CB    1 
ATOM   2031 O  OG    A SER A 1 268 ? 37.744 24.438 13.492  0.24 16.66 ? 265 SER A OG    1 
ATOM   2032 O  OG    B SER A 1 268 ? 39.433 25.553 12.403  0.45 17.22 ? 265 SER A OG    1 
ATOM   2033 O  OG    C SER A 1 268 ? 39.907 24.014 13.281  0.31 16.55 ? 265 SER A OG    1 
ATOM   2034 N  N     . VAL A 1 269 ? 40.910 27.536 14.217  1.00 12.56 ? 266 VAL A N     1 
ATOM   2035 C  CA    . VAL A 1 269 ? 42.230 28.164 14.273  1.00 14.08 ? 266 VAL A CA    1 
ATOM   2036 C  C     . VAL A 1 269 ? 42.641 28.365 15.728  1.00 14.50 ? 266 VAL A C     1 
ATOM   2037 O  O     . VAL A 1 269 ? 43.767 28.047 16.137  1.00 14.94 ? 266 VAL A O     1 
ATOM   2038 C  CB    . VAL A 1 269 ? 42.228 29.500 13.501  1.00 15.88 ? 266 VAL A CB    1 
ATOM   2039 C  CG1   . VAL A 1 269 ? 43.525 30.277 13.771  1.00 15.58 ? 266 VAL A CG1   1 
ATOM   2040 C  CG2   . VAL A 1 269 ? 42.037 29.277 12.001  1.00 15.09 ? 266 VAL A CG2   1 
ATOM   2041 N  N     . ILE A 1 270 ? 41.712 28.868 16.539  1.00 12.15 ? 267 ILE A N     1 
ATOM   2042 C  CA    . ILE A 1 270 ? 41.992 29.141 17.945  1.00 13.70 ? 267 ILE A CA    1 
ATOM   2043 C  C     . ILE A 1 270 ? 42.311 27.852 18.690  1.00 15.33 ? 267 ILE A C     1 
ATOM   2044 O  O     . ILE A 1 270 ? 43.294 27.773 19.444  1.00 16.86 ? 267 ILE A O     1 
ATOM   2045 C  CB    . ILE A 1 270 ? 40.798 29.873 18.573  1.00 14.19 ? 267 ILE A CB    1 
ATOM   2046 C  CG1   . ILE A 1 270 ? 40.711 31.296 18.030  1.00 15.46 ? 267 ILE A CG1   1 
ATOM   2047 C  CG2   . ILE A 1 270 ? 40.900 29.877 20.085  1.00 17.83 ? 267 ILE A CG2   1 
ATOM   2048 C  CD1   . ILE A 1 270 ? 39.395 31.967 18.373  1.00 17.12 ? 267 ILE A CD1   1 
ATOM   2049 N  N     . GLU A 1 271 ? 41.487 26.819 18.476  1.00 15.33 ? 268 GLU A N     1 
ATOM   2050 C  CA    . GLU A 1 271 ? 41.611 25.570 19.219  1.00 14.73 ? 268 GLU A CA    1 
ATOM   2051 C  C     . GLU A 1 271 ? 42.847 24.779 18.802  1.00 17.45 ? 268 GLU A C     1 
ATOM   2052 O  O     . GLU A 1 271 ? 43.600 24.288 19.657  1.00 22.44 ? 268 GLU A O     1 
ATOM   2053 C  CB    . GLU A 1 271 ? 40.343 24.734 19.025  1.00 22.76 ? 268 GLU A CB    1 
ATOM   2054 N  N     . ILE A 1 272 ? 43.069 24.634 17.493  1.00 14.12 ? 269 ILE A N     1 
ATOM   2055 C  CA    . ILE A 1 272 ? 44.156 23.785 17.016  1.00 16.48 ? 269 ILE A CA    1 
ATOM   2056 C  C     . ILE A 1 272 ? 45.508 24.429 17.292  1.00 18.08 ? 269 ILE A C     1 
ATOM   2057 O  O     . ILE A 1 272 ? 46.466 23.749 17.677  1.00 17.55 ? 269 ILE A O     1 
ATOM   2058 C  CB    . ILE A 1 272 ? 43.981 23.468 15.519  1.00 17.49 ? 269 ILE A CB    1 
ATOM   2059 C  CG1   . ILE A 1 272 ? 42.771 22.562 15.285  1.00 21.36 ? 269 ILE A CG1   1 
ATOM   2060 C  CG2   . ILE A 1 272 ? 45.254 22.828 14.947  1.00 20.91 ? 269 ILE A CG2   1 
ATOM   2061 C  CD1   . ILE A 1 272 ? 42.445 22.361 13.819  1.00 24.01 ? 269 ILE A CD1   1 
ATOM   2062 N  N     . LEU A 1 273 ? 45.620 25.745 17.086  1.00 14.57 ? 270 LEU A N     1 
ATOM   2063 C  CA    . LEU A 1 273 ? 46.907 26.408 17.252  1.00 16.05 ? 270 LEU A CA    1 
ATOM   2064 C  C     . LEU A 1 273 ? 47.130 26.933 18.667  1.00 17.87 ? 270 LEU A C     1 
ATOM   2065 O  O     . LEU A 1 273 ? 48.278 27.235 19.028  1.00 19.23 ? 270 LEU A O     1 
ATOM   2066 C  CB    . LEU A 1 273 ? 47.034 27.549 16.239  1.00 15.66 ? 270 LEU A CB    1 
ATOM   2067 C  CG    . LEU A 1 273 ? 46.934 27.141 14.764  1.00 18.93 ? 270 LEU A CG    1 
ATOM   2068 C  CD1   . LEU A 1 273 ? 47.110 28.362 13.891  1.00 17.99 ? 270 LEU A CD1   1 
ATOM   2069 C  CD2   . LEU A 1 273 ? 47.980 26.075 14.405  1.00 19.03 ? 270 LEU A CD2   1 
ATOM   2070 N  N     . GLY A 1 274 ? 46.078 27.022 19.475  1.00 15.85 ? 271 GLY A N     1 
ATOM   2071 C  CA    . GLY A 1 274 ? 46.198 27.519 20.836  1.00 17.72 ? 271 GLY A CA    1 
ATOM   2072 C  C     . GLY A 1 274 ? 46.502 28.999 20.905  1.00 24.17 ? 271 GLY A C     1 
ATOM   2073 O  O     . GLY A 1 274 ? 47.254 29.438 21.788  1.00 17.46 ? 271 GLY A O     1 
ATOM   2074 N  N     . ILE A 1 275 ? 45.944 29.783 19.989  1.00 13.83 ? 272 ILE A N     1 
ATOM   2075 C  CA    . ILE A 1 275 ? 46.208 31.216 19.929  1.00 13.67 ? 272 ILE A CA    1 
ATOM   2076 C  C     . ILE A 1 275 ? 44.892 31.964 20.100  1.00 15.59 ? 272 ILE A C     1 
ATOM   2077 O  O     . ILE A 1 275 ? 43.809 31.389 20.007  1.00 16.03 ? 272 ILE A O     1 
ATOM   2078 C  CB    . ILE A 1 275 ? 46.893 31.630 18.614  1.00 13.75 ? 272 ILE A CB    1 
ATOM   2079 C  CG1   . ILE A 1 275 ? 45.998 31.312 17.414  1.00 14.20 ? 272 ILE A CG1   1 
ATOM   2080 C  CG2   . ILE A 1 275 ? 48.235 30.923 18.478  1.00 15.03 ? 272 ILE A CG2   1 
ATOM   2081 C  CD1   . ILE A 1 275 ? 46.545 31.887 16.079  1.00 14.86 ? 272 ILE A CD1   1 
ATOM   2082 N  N     . GLU A 1 276 ? 44.997 33.276 20.315  1.00 13.17 ? 273 GLU A N     1 
ATOM   2083 C  CA    . GLU A 1 276 ? 43.824 34.130 20.455  1.00 13.97 ? 273 GLU A CA    1 
ATOM   2084 C  C     . GLU A 1 276 ? 43.744 35.261 19.441  1.00 12.87 ? 273 GLU A C     1 
ATOM   2085 O  O     . GLU A 1 276 ? 42.638 35.660 19.064  1.00 14.60 ? 273 GLU A O     1 
ATOM   2086 C  CB    . GLU A 1 276 ? 43.789 34.773 21.849  1.00 21.80 ? 273 GLU A CB    1 
ATOM   2087 C  CG    . GLU A 1 276 ? 43.551 33.846 23.011  1.00 25.74 ? 273 GLU A CG    1 
ATOM   2088 C  CD    . GLU A 1 276 ? 43.341 34.633 24.302  1.00 41.22 ? 273 GLU A CD    1 
ATOM   2089 O  OE1   . GLU A 1 276 ? 42.718 35.717 24.243  1.00 51.07 ? 273 GLU A OE1   1 
ATOM   2090 O  OE2   . GLU A 1 276 ? 43.808 34.185 25.369  1.00 58.34 ? 273 GLU A OE2   1 
ATOM   2091 N  N     . TYR A 1 277 ? 44.872 35.813 19.020  1.00 13.83 ? 274 TYR A N     1 
ATOM   2092 C  CA    . TYR A 1 277 ? 44.882 37.048 18.260  1.00 10.72 ? 274 TYR A CA    1 
ATOM   2093 C  C     . TYR A 1 277 ? 45.426 36.828 16.860  1.00 14.35 ? 274 TYR A C     1 
ATOM   2094 O  O     . TYR A 1 277 ? 46.264 35.953 16.625  1.00 12.52 ? 274 TYR A O     1 
ATOM   2095 C  CB    . TYR A 1 277 ? 45.723 38.099 18.963  1.00 12.39 ? 274 TYR A CB    1 
ATOM   2096 C  CG    . TYR A 1 277 ? 45.269 38.358 20.380  1.00 11.45 ? 274 TYR A CG    1 
ATOM   2097 C  CD1   . TYR A 1 277 ? 43.977 38.822 20.644  1.00 11.85 ? 274 TYR A CD1   1 
ATOM   2098 C  CD2   . TYR A 1 277 ? 46.129 38.154 21.449  1.00 11.40 ? 274 TYR A CD2   1 
ATOM   2099 C  CE1   . TYR A 1 277 ? 43.558 39.067 21.940  1.00 14.21 ? 274 TYR A CE1   1 
ATOM   2100 C  CE2   . TYR A 1 277 ? 45.722 38.406 22.758  1.00 16.26 ? 274 TYR A CE2   1 
ATOM   2101 C  CZ    . TYR A 1 277 ? 44.436 38.855 22.995  1.00 18.44 ? 274 TYR A CZ    1 
ATOM   2102 O  OH    . TYR A 1 277 ? 44.025 39.108 24.285  1.00 22.74 ? 274 TYR A OH    1 
ATOM   2103 N  N     . MET A 1 278 ? 44.983 37.694 15.949  1.00 10.85 ? 275 MET A N     1 
ATOM   2104 C  CA    . MET A 1 278 ? 45.326 37.542 14.542  1.00 11.28 ? 275 MET A CA    1 
ATOM   2105 C  C     . MET A 1 278 ? 46.835 37.579 14.333  1.00 12.08 ? 275 MET A C     1 
ATOM   2106 O  O     . MET A 1 278 ? 47.377 36.808 13.534  1.00 12.41 ? 275 MET A O     1 
ATOM   2107 C  CB    . MET A 1 278 ? 44.618 38.637 13.735  1.00 12.80 ? 275 MET A CB    1 
ATOM   2108 C  CG    . MET A 1 278 ? 44.549 38.372 12.262  1.00 18.97 ? 275 MET A CG    1 
ATOM   2109 S  SD    . MET A 1 278 ? 43.534 36.922 11.837  1.00 19.25 ? 275 MET A SD    1 
ATOM   2110 C  CE    . MET A 1 278 ? 43.892 36.816 10.086  1.00 25.47 ? 275 MET A CE    1 
ATOM   2111 N  N     . GLY A 1 279 ? 47.537 38.446 15.070  1.00 11.38 ? 276 GLY A N     1 
ATOM   2112 C  CA    . GLY A 1 279 ? 48.969 38.580 14.865  1.00 11.10 ? 276 GLY A CA    1 
ATOM   2113 C  C     . GLY A 1 279 ? 49.751 37.323 15.190  1.00 12.98 ? 276 GLY A C     1 
ATOM   2114 O  O     . GLY A 1 279 ? 50.796 37.063 14.582  1.00 13.78 ? 276 GLY A O     1 
ATOM   2115 N  N     . GLU A 1 280 ? 49.254 36.515 16.131  1.00 10.27 ? 277 GLU A N     1 
ATOM   2116 C  CA    . GLU A 1 280 ? 49.949 35.285 16.503  1.00 11.74 ? 277 GLU A CA    1 
ATOM   2117 C  C     . GLU A 1 280 ? 50.059 34.301 15.353  1.00 12.46 ? 277 GLU A C     1 
ATOM   2118 O  O     . GLU A 1 280 ? 50.887 33.381 15.420  1.00 13.07 ? 277 GLU A O     1 
ATOM   2119 C  CB    . GLU A 1 280 ? 49.244 34.600 17.661  1.00 13.75 ? 277 GLU A CB    1 
ATOM   2120 C  CG    . GLU A 1 280 ? 49.194 35.429 18.914  1.00 11.90 ? 277 GLU A CG    1 
ATOM   2121 C  CD    . GLU A 1 280 ? 48.506 34.683 20.028  1.00 14.54 ? 277 GLU A CD    1 
ATOM   2122 O  OE1   . GLU A 1 280 ? 49.139 33.793 20.629  1.00 18.46 ? 277 GLU A OE1   1 
ATOM   2123 O  OE2   . GLU A 1 280 ? 47.324 34.966 20.281  1.00 18.20 ? 277 GLU A OE2   1 
ATOM   2124 N  N     . LEU A 1 281 ? 49.237 34.450 14.317  1.00 10.51 ? 278 LEU A N     1 
ATOM   2125 C  CA    . LEU A 1 281 ? 49.352 33.562 13.169  1.00 9.47  ? 278 LEU A CA    1 
ATOM   2126 C  C     . LEU A 1 281 ? 50.687 33.697 12.446  1.00 10.58 ? 278 LEU A C     1 
ATOM   2127 O  O     . LEU A 1 281 ? 51.050 32.796 11.687  1.00 11.49 ? 278 LEU A O     1 
ATOM   2128 C  CB    . LEU A 1 281 ? 48.213 33.831 12.171  1.00 11.05 ? 278 LEU A CB    1 
ATOM   2129 C  CG    . LEU A 1 281 ? 46.889 33.177 12.554  1.00 11.90 ? 278 LEU A CG    1 
ATOM   2130 C  CD1   . LEU A 1 281 ? 45.757 33.804 11.756  1.00 12.83 ? 278 LEU A CD1   1 
ATOM   2131 C  CD2   . LEU A 1 281 ? 46.957 31.672 12.274  1.00 14.32 ? 278 LEU A CD2   1 
ATOM   2132 N  N     . THR A 1 282 ? 51.404 34.819 12.609  1.00 12.26 ? 279 THR A N     1 
ATOM   2133 C  CA    . THR A 1 282 ? 52.627 35.001 11.826  1.00 12.76 ? 279 THR A CA    1 
ATOM   2134 C  C     . THR A 1 282 ? 53.690 33.961 12.158  1.00 12.73 ? 279 THR A C     1 
ATOM   2135 O  O     . THR A 1 282 ? 54.619 33.775 11.365  1.00 15.15 ? 279 THR A O     1 
ATOM   2136 C  CB    . THR A 1 282 ? 53.223 36.406 12.021  1.00 14.44 ? 279 THR A CB    1 
ATOM   2137 O  OG1   . THR A 1 282 ? 53.574 36.603 13.398  1.00 14.60 ? 279 THR A OG1   1 
ATOM   2138 C  CG2   . THR A 1 282 ? 52.243 37.492 11.573  1.00 12.44 ? 279 THR A CG2   1 
ATOM   2139 N  N     . GLN A 1 283 ? 53.583 33.298 13.315  1.00 12.64 ? 280 GLN A N     1 
ATOM   2140 C  CA    . GLN A 1 283 ? 54.618 32.363 13.751  1.00 15.48 ? 280 GLN A CA    1 
ATOM   2141 C  C     . GLN A 1 283 ? 54.594 31.032 13.014  1.00 22.71 ? 280 GLN A C     1 
ATOM   2142 O  O     . GLN A 1 283 ? 55.488 30.209 13.244  1.00 26.33 ? 280 GLN A O     1 
ATOM   2143 C  CB    . GLN A 1 283 ? 54.492 32.017 15.238  1.00 17.20 ? 280 GLN A CB    1 
ATOM   2144 C  CG    . GLN A 1 283 ? 54.181 33.100 16.203  1.00 29.99 ? 280 GLN A CG    1 
ATOM   2145 C  CD    . GLN A 1 283 ? 53.675 32.486 17.492  1.00 35.26 ? 280 GLN A CD    1 
ATOM   2146 O  OE1   . GLN A 1 283 ? 52.473 32.464 17.767  1.00 26.79 ? 280 GLN A OE1   1 
ATOM   2147 N  NE2   . GLN A 1 283 ? 54.602 31.915 18.266  1.00 26.15 ? 280 GLN A NE2   1 
ATOM   2148 N  N     . PHE A 1 284 ? 53.596 30.777 12.179  1.00 14.52 ? 281 PHE A N     1 
ATOM   2149 C  CA    . PHE A 1 284 ? 53.432 29.491 11.521  1.00 14.94 ? 281 PHE A CA    1 
ATOM   2150 C  C     . PHE A 1 284 ? 53.838 29.592 10.059  1.00 18.27 ? 281 PHE A C     1 
ATOM   2151 O  O     . PHE A 1 284 ? 53.659 30.631 9.426   1.00 16.95 ? 281 PHE A O     1 
ATOM   2152 C  CB    . PHE A 1 284 ? 51.985 29.015 11.655  1.00 12.76 ? 281 PHE A CB    1 
ATOM   2153 C  CG    . PHE A 1 284 ? 51.570 28.847 13.081  1.00 14.63 ? 281 PHE A CG    1 
ATOM   2154 C  CD1   . PHE A 1 284 ? 51.888 27.690 13.775  1.00 19.66 ? 281 PHE A CD1   1 
ATOM   2155 C  CD2   . PHE A 1 284 ? 50.922 29.870 13.755  1.00 12.44 ? 281 PHE A CD2   1 
ATOM   2156 C  CE1   . PHE A 1 284 ? 51.522 27.546 15.102  1.00 24.07 ? 281 PHE A CE1   1 
ATOM   2157 C  CE2   . PHE A 1 284 ? 50.564 29.732 15.086  1.00 15.69 ? 281 PHE A CE2   1 
ATOM   2158 C  CZ    . PHE A 1 284 ? 50.866 28.567 15.757  1.00 21.58 ? 281 PHE A CZ    1 
ATOM   2159 N  N     . THR A 1 285 ? 54.411 28.514 9.526   1.00 12.11 ? 282 THR A N     1 
ATOM   2160 C  CA    . THR A 1 285 ? 54.715 28.514 8.101   1.00 13.28 ? 282 THR A CA    1 
ATOM   2161 C  C     . THR A 1 285 ? 53.442 28.333 7.279   1.00 12.68 ? 282 THR A C     1 
ATOM   2162 O  O     . THR A 1 285 ? 52.406 27.878 7.767   1.00 13.67 ? 282 THR A O     1 
ATOM   2163 C  CB    . THR A 1 285 ? 55.700 27.400 7.734   1.00 15.42 ? 282 THR A CB    1 
ATOM   2164 O  OG1   . THR A 1 285 ? 55.023 26.140 7.795   1.00 15.83 ? 282 THR A OG1   1 
ATOM   2165 C  CG2   . THR A 1 285 ? 56.869 27.399 8.692   1.00 17.14 ? 282 THR A CG2   1 
ATOM   2166 N  N     . GLU A 1 286 ? 53.529 28.711 6.004   1.00 13.05 ? 283 GLU A N     1 
ATOM   2167 C  CA    . GLU A 1 286 ? 52.388 28.519 5.115   1.00 12.52 ? 283 GLU A CA    1 
ATOM   2168 C  C     . GLU A 1 286 ? 51.988 27.050 5.058   1.00 12.72 ? 283 GLU A C     1 
ATOM   2169 O  O     . GLU A 1 286 ? 50.796 26.722 5.125   1.00 12.85 ? 283 GLU A O     1 
ATOM   2170 C  CB    . GLU A 1 286 ? 52.713 29.047 3.716   1.00 17.79 ? 283 GLU A CB    1 
ATOM   2171 C  CG    . GLU A 1 286 ? 51.497 29.085 2.805   1.00 15.11 ? 283 GLU A CG    1 
ATOM   2172 C  CD    . GLU A 1 286 ? 51.789 29.741 1.463   1.00 25.32 ? 283 GLU A CD    1 
ATOM   2173 O  OE1   . GLU A 1 286 ? 52.968 30.025 1.180   1.00 25.27 ? 283 GLU A OE1   1 
ATOM   2174 O  OE2   . GLU A 1 286 ? 50.832 29.996 0.702   1.00 23.19 ? 283 GLU A OE2   1 
ATOM   2175 N  N     . SER A 1 287 ? 52.975 26.149 4.966   1.00 14.57 ? 284 SER A N     1 
ATOM   2176 C  CA    A SER A 1 287 ? 52.667 24.724 4.897   0.76 12.49 ? 284 SER A CA    1 
ATOM   2177 C  CA    B SER A 1 287 ? 52.664 24.725 4.893   0.24 12.61 ? 284 SER A CA    1 
ATOM   2178 C  C     . SER A 1 287 ? 51.981 24.237 6.167   1.00 13.52 ? 284 SER A C     1 
ATOM   2179 O  O     . SER A 1 287 ? 51.083 23.382 6.109   1.00 13.62 ? 284 SER A O     1 
ATOM   2180 C  CB    A SER A 1 287 ? 53.942 23.914 4.646   0.76 15.50 ? 284 SER A CB    1 
ATOM   2181 C  CB    B SER A 1 287 ? 53.936 23.919 4.615   0.24 15.51 ? 284 SER A CB    1 
ATOM   2182 O  OG    A SER A 1 287 ? 54.509 24.239 3.401   0.76 22.28 ? 284 SER A OG    1 
ATOM   2183 O  OG    B SER A 1 287 ? 54.869 24.033 5.677   0.24 14.17 ? 284 SER A OG    1 
ATOM   2184 N  N     . GLN A 1 288 ? 52.400 24.753 7.330   1.00 11.61 ? 285 GLN A N     1 
ATOM   2185 C  CA    . GLN A 1 288 ? 51.723 24.392 8.571   1.00 10.05 ? 285 GLN A CA    1 
ATOM   2186 C  C     . GLN A 1 288 ? 50.255 24.803 8.516   1.00 14.62 ? 285 GLN A C     1 
ATOM   2187 O  O     . GLN A 1 288 ? 49.362 24.015 8.838   1.00 14.21 ? 285 GLN A O     1 
ATOM   2188 C  CB    . GLN A 1 288 ? 52.406 25.050 9.778   1.00 12.53 ? 285 GLN A CB    1 
ATOM   2189 C  CG    . GLN A 1 288 ? 53.723 24.418 10.207  1.00 17.27 ? 285 GLN A CG    1 
ATOM   2190 C  CD    . GLN A 1 288 ? 54.330 25.105 11.418  1.00 22.85 ? 285 GLN A CD    1 
ATOM   2191 O  OE1   . GLN A 1 288 ? 54.604 26.303 11.396  1.00 16.59 ? 285 GLN A OE1   1 
ATOM   2192 N  NE2   . GLN A 1 288 ? 54.552 24.345 12.478  1.00 31.18 ? 285 GLN A NE2   1 
ATOM   2193 N  N     . LEU A 1 289 ? 49.980 26.034 8.087   1.00 12.38 ? 286 LEU A N     1 
ATOM   2194 C  CA    . LEU A 1 289 ? 48.588 26.477 8.076   1.00 12.96 ? 286 LEU A CA    1 
ATOM   2195 C  C     . LEU A 1 289 ? 47.773 25.699 7.053   1.00 14.34 ? 286 LEU A C     1 
ATOM   2196 O  O     . LEU A 1 289 ? 46.616 25.345 7.314   1.00 15.52 ? 286 LEU A O     1 
ATOM   2197 C  CB    . LEU A 1 289 ? 48.510 27.979 7.809   1.00 11.08 ? 286 LEU A CB    1 
ATOM   2198 C  CG    . LEU A 1 289 ? 49.183 28.847 8.874   1.00 10.09 ? 286 LEU A CG    1 
ATOM   2199 C  CD1   . LEU A 1 289 ? 49.236 30.335 8.457   1.00 14.18 ? 286 LEU A CD1   1 
ATOM   2200 C  CD2   . LEU A 1 289 ? 48.532 28.674 10.239  1.00 13.15 ? 286 LEU A CD2   1 
ATOM   2201 N  N     . GLN A 1 290 ? 48.369 25.385 5.902   1.00 14.30 ? 287 GLN A N     1 
ATOM   2202 C  CA    . GLN A 1 290 ? 47.666 24.575 4.910   1.00 13.47 ? 287 GLN A CA    1 
ATOM   2203 C  C     . GLN A 1 290 ? 47.387 23.169 5.419   1.00 15.50 ? 287 GLN A C     1 
ATOM   2204 O  O     . GLN A 1 290 ? 46.381 22.555 5.039   1.00 16.30 ? 287 GLN A O     1 
ATOM   2205 C  CB    . GLN A 1 290 ? 48.474 24.502 3.621   1.00 13.07 ? 287 GLN A CB    1 
ATOM   2206 C  CG    . GLN A 1 290 ? 48.562 25.824 2.855   1.00 15.19 ? 287 GLN A CG    1 
ATOM   2207 C  CD    . GLN A 1 290 ? 49.491 25.720 1.675   1.00 23.17 ? 287 GLN A CD    1 
ATOM   2208 O  OE1   . GLN A 1 290 ? 50.511 25.029 1.740   1.00 19.82 ? 287 GLN A OE1   1 
ATOM   2209 N  NE2   . GLN A 1 290 ? 49.141 26.388 0.578   1.00 23.31 ? 287 GLN A NE2   1 
ATOM   2210 N  N     . SER A 1 291 ? 48.254 22.634 6.274   1.00 14.99 ? 288 SER A N     1 
ATOM   2211 C  CA    A SER A 1 291 ? 48.042 21.278 6.770   0.26 14.16 ? 288 SER A CA    1 
ATOM   2212 C  CA    B SER A 1 291 ? 48.042 21.277 6.769   0.46 14.12 ? 288 SER A CA    1 
ATOM   2213 C  CA    C SER A 1 291 ? 48.040 21.279 6.766   0.28 14.15 ? 288 SER A CA    1 
ATOM   2214 C  C     . SER A 1 291 ? 46.838 21.212 7.698   1.00 19.06 ? 288 SER A C     1 
ATOM   2215 O  O     . SER A 1 291 ? 46.088 20.229 7.684   1.00 24.09 ? 288 SER A O     1 
ATOM   2216 C  CB    A SER A 1 291 ? 49.299 20.781 7.479   0.26 14.62 ? 288 SER A CB    1 
ATOM   2217 C  CB    B SER A 1 291 ? 49.304 20.759 7.471   0.46 14.62 ? 288 SER A CB    1 
ATOM   2218 C  CB    C SER A 1 291 ? 49.296 20.770 7.467   0.28 14.62 ? 288 SER A CB    1 
ATOM   2219 O  OG    A SER A 1 291 ? 50.425 20.945 6.641   0.26 13.62 ? 288 SER A OG    1 
ATOM   2220 O  OG    B SER A 1 291 ? 49.542 21.415 8.708   0.46 14.33 ? 288 SER A OG    1 
ATOM   2221 O  OG    C SER A 1 291 ? 49.148 19.405 7.798   0.28 12.42 ? 288 SER A OG    1 
ATOM   2222 N  N     . HIS A 1 292 ? 46.629 22.254 8.503   1.00 15.63 ? 289 HIS A N     1 
ATOM   2223 C  CA    . HIS A 1 292 ? 45.501 22.255 9.423   1.00 20.96 ? 289 HIS A CA    1 
ATOM   2224 C  C     . HIS A 1 292 ? 44.206 22.689 8.753   1.00 20.93 ? 289 HIS A C     1 
ATOM   2225 O  O     . HIS A 1 292 ? 43.135 22.177 9.087   1.00 25.87 ? 289 HIS A O     1 
ATOM   2226 C  CB    . HIS A 1 292 ? 45.790 23.183 10.595  1.00 18.50 ? 289 HIS A CB    1 
ATOM   2227 C  CG    . HIS A 1 292 ? 46.911 22.729 11.469  1.00 19.80 ? 289 HIS A CG    1 
ATOM   2228 N  ND1   . HIS A 1 292 ? 46.857 21.563 12.202  1.00 22.31 ? 289 HIS A ND1   1 
ATOM   2229 C  CD2   . HIS A 1 292 ? 48.110 23.294 11.744  1.00 23.56 ? 289 HIS A CD2   1 
ATOM   2230 C  CE1   . HIS A 1 292 ? 47.973 21.433 12.898  1.00 22.92 ? 289 HIS A CE1   1 
ATOM   2231 N  NE2   . HIS A 1 292 ? 48.753 22.466 12.633  1.00 26.52 ? 289 HIS A NE2   1 
ATOM   2232 N  N     . PHE A 1 293 ? 44.269 23.657 7.839   1.00 16.21 ? 290 PHE A N     1 
ATOM   2233 C  CA    . PHE A 1 293 ? 43.051 24.315 7.377   1.00 18.85 ? 290 PHE A CA    1 
ATOM   2234 C  C     . PHE A 1 293 ? 42.824 24.179 5.877   1.00 19.48 ? 290 PHE A C     1 
ATOM   2235 O  O     . PHE A 1 293 ? 41.873 24.768 5.349   1.00 22.22 ? 290 PHE A O     1 
ATOM   2236 C  CB    . PHE A 1 293 ? 43.084 25.792 7.808   1.00 16.18 ? 290 PHE A CB    1 
ATOM   2237 C  CG    . PHE A 1 293 ? 43.460 25.969 9.255   1.00 17.62 ? 290 PHE A CG    1 
ATOM   2238 C  CD1   . PHE A 1 293 ? 42.618 25.516 10.264  1.00 15.81 ? 290 PHE A CD1   1 
ATOM   2239 C  CD2   . PHE A 1 293 ? 44.679 26.543 9.607   1.00 17.12 ? 290 PHE A CD2   1 
ATOM   2240 C  CE1   . PHE A 1 293 ? 42.971 25.633 11.599  1.00 17.64 ? 290 PHE A CE1   1 
ATOM   2241 C  CE2   . PHE A 1 293 ? 45.046 26.680 10.932  1.00 13.86 ? 290 PHE A CE2   1 
ATOM   2242 C  CZ    . PHE A 1 293 ? 44.193 26.214 11.941  1.00 16.65 ? 290 PHE A CZ    1 
ATOM   2243 N  N     . GLY A 1 294 ? 43.638 23.395 5.182   1.00 19.19 ? 291 GLY A N     1 
ATOM   2244 C  CA    . GLY A 1 294 ? 43.488 23.233 3.752   1.00 16.76 ? 291 GLY A CA    1 
ATOM   2245 C  C     . GLY A 1 294 ? 44.337 24.217 2.970   1.00 18.29 ? 291 GLY A C     1 
ATOM   2246 O  O     . GLY A 1 294 ? 44.777 25.249 3.477   1.00 18.86 ? 291 GLY A O     1 
ATOM   2247 N  N     . GLU A 1 295 ? 44.555 23.887 1.693   1.00 17.35 ? 292 GLU A N     1 
ATOM   2248 C  CA    . GLU A 1 295 ? 45.468 24.661 0.857   1.00 17.89 ? 292 GLU A CA    1 
ATOM   2249 C  C     . GLU A 1 295 ? 44.998 26.104 0.702   1.00 16.41 ? 292 GLU A C     1 
ATOM   2250 O  O     . GLU A 1 295 ? 45.784 27.049 0.837   1.00 18.18 ? 292 GLU A O     1 
ATOM   2251 C  CB    . GLU A 1 295 ? 45.596 23.991 -0.515  1.00 21.55 ? 292 GLU A CB    1 
ATOM   2252 C  CG    . GLU A 1 295 ? 46.541 24.689 -1.473  1.00 26.91 ? 292 GLU A CG    1 
ATOM   2253 C  CD    . GLU A 1 295 ? 46.523 24.068 -2.857  0.40 28.91 ? 292 GLU A CD    1 
ATOM   2254 O  OE1   . GLU A 1 295 ? 46.359 22.832 -2.957  0.72 29.35 ? 292 GLU A OE1   1 
ATOM   2255 O  OE2   . GLU A 1 295 ? 46.664 24.818 -3.845  0.44 28.53 ? 292 GLU A OE2   1 
ATOM   2256 N  N     . LYS A 1 296 ? 43.713 26.290 0.409   1.00 16.41 ? 293 LYS A N     1 
ATOM   2257 C  CA    . LYS A 1 296 ? 43.194 27.628 0.153   1.00 15.44 ? 293 LYS A CA    1 
ATOM   2258 C  C     . LYS A 1 296 ? 43.125 28.451 1.438   1.00 17.90 ? 293 LYS A C     1 
ATOM   2259 O  O     . LYS A 1 296 ? 43.618 29.588 1.491   1.00 16.95 ? 293 LYS A O     1 
ATOM   2260 C  CB    . LYS A 1 296 ? 41.824 27.505 -0.515  1.00 23.74 ? 293 LYS A CB    1 
ATOM   2261 C  CG    . LYS A 1 296 ? 41.075 28.805 -0.702  1.00 34.35 ? 293 LYS A CG    1 
ATOM   2262 C  CD    . LYS A 1 296 ? 39.682 28.550 -1.254  0.69 27.04 ? 293 LYS A CD    1 
ATOM   2263 C  CE    . LYS A 1 296 ? 38.685 29.603 -0.773  0.71 36.42 ? 293 LYS A CE    1 
ATOM   2264 N  NZ    . LYS A 1 296 ? 38.833 30.874 -1.561  0.64 32.73 ? 293 LYS A NZ    1 
ATOM   2265 N  N     . ASN A 1 297 ? 42.554 27.876 2.494   1.00 15.71 ? 294 ASN A N     1 
ATOM   2266 C  CA    . ASN A 1 297 ? 42.461 28.604 3.759   1.00 15.43 ? 294 ASN A CA    1 
ATOM   2267 C  C     . ASN A 1 297 ? 43.841 28.886 4.338   1.00 18.37 ? 294 ASN A C     1 
ATOM   2268 O  O     . ASN A 1 297 ? 44.069 29.956 4.913   1.00 13.64 ? 294 ASN A O     1 
ATOM   2269 C  CB    . ASN A 1 297 ? 41.641 27.817 4.774   1.00 19.66 ? 294 ASN A CB    1 
ATOM   2270 C  CG    . ASN A 1 297 ? 40.151 27.830 4.481   1.00 26.55 ? 294 ASN A CG    1 
ATOM   2271 O  OD1   . ASN A 1 297 ? 39.638 28.710 3.787   1.00 27.89 ? 294 ASN A OD1   1 
ATOM   2272 N  ND2   . ASN A 1 297 ? 39.442 26.857 5.041   1.00 20.87 ? 294 ASN A ND2   1 
ATOM   2273 N  N     . GLY A 1 298 ? 44.762 27.926 4.228   1.00 16.54 ? 295 GLY A N     1 
ATOM   2274 C  CA    . GLY A 1 298 ? 46.081 28.115 4.813   1.00 15.79 ? 295 GLY A CA    1 
ATOM   2275 C  C     . GLY A 1 298 ? 46.873 29.214 4.129   1.00 14.17 ? 295 GLY A C     1 
ATOM   2276 O  O     . GLY A 1 298 ? 47.528 30.032 4.796   1.00 12.67 ? 295 GLY A O     1 
ATOM   2277 N  N     . SER A 1 299 ? 46.850 29.240 2.791   1.00 13.28 ? 296 SER A N     1 
ATOM   2278 C  CA    A SER A 1 299 ? 47.491 30.330 2.067   0.70 15.09 ? 296 SER A CA    1 
ATOM   2279 C  CA    B SER A 1 299 ? 47.504 30.333 2.086   0.30 15.11 ? 296 SER A CA    1 
ATOM   2280 C  C     . SER A 1 299 ? 46.832 31.659 2.411   1.00 13.11 ? 296 SER A C     1 
ATOM   2281 O  O     . SER A 1 299 ? 47.511 32.677 2.574   1.00 13.23 ? 296 SER A O     1 
ATOM   2282 C  CB    A SER A 1 299 ? 47.421 30.075 0.558   0.70 17.08 ? 296 SER A CB    1 
ATOM   2283 C  CB    B SER A 1 299 ? 47.498 30.079 0.579   0.30 17.11 ? 296 SER A CB    1 
ATOM   2284 O  OG    A SER A 1 299 ? 48.184 28.933 0.192   0.70 17.02 ? 296 SER A OG    1 
ATOM   2285 O  OG    B SER A 1 299 ? 46.183 29.900 0.096   0.30 15.69 ? 296 SER A OG    1 
ATOM   2286 N  N     . TRP A 1 300 ? 45.501 31.663 2.533   1.00 11.75 ? 297 TRP A N     1 
ATOM   2287 C  CA    . TRP A 1 300 ? 44.810 32.915 2.828   1.00 12.07 ? 297 TRP A CA    1 
ATOM   2288 C  C     . TRP A 1 300 ? 45.193 33.436 4.205   1.00 12.87 ? 297 TRP A C     1 
ATOM   2289 O  O     . TRP A 1 300 ? 45.455 34.636 4.364   1.00 13.59 ? 297 TRP A O     1 
ATOM   2290 C  CB    . TRP A 1 300 ? 43.297 32.714 2.718   1.00 13.53 ? 297 TRP A CB    1 
ATOM   2291 C  CG    . TRP A 1 300 ? 42.506 33.956 2.952   1.00 14.79 ? 297 TRP A CG    1 
ATOM   2292 C  CD1   . TRP A 1 300 ? 42.171 34.897 2.022   1.00 17.26 ? 297 TRP A CD1   1 
ATOM   2293 C  CD2   . TRP A 1 300 ? 41.933 34.393 4.192   1.00 12.01 ? 297 TRP A CD2   1 
ATOM   2294 N  NE1   . TRP A 1 300 ? 41.434 35.902 2.610   1.00 20.35 ? 297 TRP A NE1   1 
ATOM   2295 C  CE2   . TRP A 1 300 ? 41.272 35.614 3.938   1.00 18.74 ? 297 TRP A CE2   1 
ATOM   2296 C  CE3   . TRP A 1 300 ? 41.913 33.873 5.490   1.00 16.95 ? 297 TRP A CE3   1 
ATOM   2297 C  CZ2   . TRP A 1 300 ? 40.593 36.315 4.927   1.00 15.16 ? 297 TRP A CZ2   1 
ATOM   2298 C  CZ3   . TRP A 1 300 ? 41.245 34.581 6.471   1.00 20.16 ? 297 TRP A CZ3   1 
ATOM   2299 C  CH2   . TRP A 1 300 ? 40.598 35.785 6.180   1.00 14.84 ? 297 TRP A CH2   1 
ATOM   2300 N  N     . LEU A 1 301 ? 45.269 32.538 5.198   1.00 10.54 ? 298 LEU A N     1 
ATOM   2301 C  CA    . LEU A 1 301 ? 45.607 32.950 6.562   1.00 12.02 ? 298 LEU A CA    1 
ATOM   2302 C  C     . LEU A 1 301 ? 47.046 33.428 6.651   1.00 12.12 ? 298 LEU A C     1 
ATOM   2303 O  O     . LEU A 1 301 ? 47.342 34.381 7.379   1.00 10.55 ? 298 LEU A O     1 
ATOM   2304 C  CB    . LEU A 1 301 ? 45.403 31.792 7.541   1.00 11.01 ? 298 LEU A CB    1 
ATOM   2305 C  CG    . LEU A 1 301 ? 43.960 31.383 7.860   1.00 13.54 ? 298 LEU A CG    1 
ATOM   2306 C  CD1   . LEU A 1 301 ? 43.944 29.977 8.448   1.00 15.90 ? 298 LEU A CD1   1 
ATOM   2307 C  CD2   . LEU A 1 301 ? 43.360 32.368 8.860   1.00 11.83 ? 298 LEU A CD2   1 
ATOM   2308 N  N     . TYR A 1 302 ? 47.957 32.767 5.925   1.00 12.28 ? 299 TYR A N     1 
ATOM   2309 C  CA    . TYR A 1 302 ? 49.364 33.162 5.966   1.00 11.63 ? 299 TYR A CA    1 
ATOM   2310 C  C     . TYR A 1 302 ? 49.543 34.593 5.473   1.00 14.32 ? 299 TYR A C     1 
ATOM   2311 O  O     . TYR A 1 302 ? 50.280 35.387 6.073   1.00 12.42 ? 299 TYR A O     1 
ATOM   2312 C  CB    . TYR A 1 302 ? 50.199 32.195 5.114   1.00 10.77 ? 299 TYR A CB    1 
ATOM   2313 C  CG    . TYR A 1 302 ? 51.672 32.518 5.102   1.00 12.78 ? 299 TYR A CG    1 
ATOM   2314 C  CD1   . TYR A 1 302 ? 52.504 32.028 6.097   1.00 11.27 ? 299 TYR A CD1   1 
ATOM   2315 C  CD2   . TYR A 1 302 ? 52.230 33.302 4.101   1.00 14.93 ? 299 TYR A CD2   1 
ATOM   2316 C  CE1   . TYR A 1 302 ? 53.858 32.323 6.115   1.00 13.75 ? 299 TYR A CE1   1 
ATOM   2317 C  CE2   . TYR A 1 302 ? 53.589 33.612 4.112   1.00 23.71 ? 299 TYR A CE2   1 
ATOM   2318 C  CZ    . TYR A 1 302 ? 54.393 33.107 5.120   1.00 20.47 ? 299 TYR A CZ    1 
ATOM   2319 O  OH    . TYR A 1 302 ? 55.740 33.388 5.154   1.00 25.05 ? 299 TYR A OH    1 
ATOM   2320 N  N     . ALA A 1 303 ? 48.878 34.943 4.376   1.00 12.32 ? 300 ALA A N     1 
ATOM   2321 C  CA    . ALA A 1 303 ? 48.975 36.308 3.871   1.00 12.45 ? 300 ALA A CA    1 
ATOM   2322 C  C     . ALA A 1 303 ? 48.170 37.277 4.734   1.00 11.20 ? 300 ALA A C     1 
ATOM   2323 O  O     . ALA A 1 303 ? 48.634 38.389 5.024   1.00 11.90 ? 300 ALA A O     1 
ATOM   2324 C  CB    . ALA A 1 303 ? 48.489 36.353 2.414   1.00 15.48 ? 300 ALA A CB    1 
ATOM   2325 N  N     . MET A 1 304 ? 46.971 36.870 5.166   1.00 11.66 ? 301 MET A N     1 
ATOM   2326 C  CA    . MET A 1 304 ? 46.070 37.806 5.845   1.00 12.36 ? 301 MET A CA    1 
ATOM   2327 C  C     . MET A 1 304 ? 46.635 38.272 7.180   1.00 11.21 ? 301 MET A C     1 
ATOM   2328 O  O     . MET A 1 304 ? 46.454 39.439 7.558   1.00 12.39 ? 301 MET A O     1 
ATOM   2329 C  CB    . MET A 1 304 ? 44.694 37.173 6.056   1.00 13.00 ? 301 MET A CB    1 
ATOM   2330 C  CG    . MET A 1 304 ? 43.603 38.172 6.471   1.00 16.05 ? 301 MET A CG    1 
ATOM   2331 S  SD    . MET A 1 304 ? 43.204 39.317 5.149   1.00 16.46 ? 301 MET A SD    1 
ATOM   2332 C  CE    . MET A 1 304 ? 43.995 40.854 5.707   1.00 15.19 ? 301 MET A CE    1 
ATOM   2333 N  N     . CYS A 1 305 ? 47.321 37.388 7.915   1.00 10.13 ? 302 CYS A N     1 
ATOM   2334 C  CA    . CYS A 1 305 ? 47.843 37.833 9.208   1.00 11.30 ? 302 CYS A CA    1 
ATOM   2335 C  C     . CYS A 1 305 ? 48.984 38.829 9.057   1.00 11.15 ? 302 CYS A C     1 
ATOM   2336 O  O     . CYS A 1 305 ? 49.375 39.447 10.056  1.00 12.40 ? 302 CYS A O     1 
ATOM   2337 C  CB    . CYS A 1 305 ? 48.293 36.636 10.067  1.00 10.62 ? 302 CYS A CB    1 
ATOM   2338 S  SG    . CYS A 1 305 ? 49.769 35.809 9.449   1.00 12.28 ? 302 CYS A SG    1 
ATOM   2339 N  N     . ARG A 1 306 ? 49.490 39.013 7.834   1.00 9.80  ? 303 ARG A N     1 
ATOM   2340 C  CA    . ARG A 1 306 ? 50.475 40.023 7.478   1.00 10.00 ? 303 ARG A CA    1 
ATOM   2341 C  C     . ARG A 1 306 ? 49.828 41.241 6.820   1.00 13.97 ? 303 ARG A C     1 
ATOM   2342 O  O     . ARG A 1 306 ? 50.537 42.150 6.363   1.00 15.48 ? 303 ARG A O     1 
ATOM   2343 C  CB    . ARG A 1 306 ? 51.534 39.406 6.561   1.00 11.45 ? 303 ARG A CB    1 
ATOM   2344 C  CG    . ARG A 1 306 ? 52.347 38.304 7.263   1.00 12.11 ? 303 ARG A CG    1 
ATOM   2345 C  CD    . ARG A 1 306 ? 53.200 37.436 6.291   1.00 16.95 ? 303 ARG A CD    1 
ATOM   2346 N  NE    . ARG A 1 306 ? 54.158 36.670 7.089   1.00 14.87 ? 303 ARG A NE    1 
ATOM   2347 C  CZ    . ARG A 1 306 ? 53.839 35.589 7.791   1.00 13.89 ? 303 ARG A CZ    1 
ATOM   2348 N  NH1   . ARG A 1 306 ? 52.603 35.114 7.748   1.00 12.60 ? 303 ARG A NH1   1 
ATOM   2349 N  NH2   . ARG A 1 306 ? 54.756 34.973 8.534   1.00 14.30 ? 303 ARG A NH2   1 
ATOM   2350 N  N     . GLY A 1 307 ? 48.501 41.286 6.804   1.00 11.48 ? 304 GLY A N     1 
ATOM   2351 C  CA    . GLY A 1 307 ? 47.760 42.389 6.226   1.00 10.84 ? 304 GLY A CA    1 
ATOM   2352 C  C     . GLY A 1 307 ? 47.564 42.302 4.729   1.00 12.07 ? 304 GLY A C     1 
ATOM   2353 O  O     . GLY A 1 307 ? 47.203 43.311 4.114   1.00 13.59 ? 304 GLY A O     1 
ATOM   2354 N  N     . ILE A 1 308 ? 47.775 41.127 4.129   1.00 12.29 ? 305 ILE A N     1 
ATOM   2355 C  CA    . ILE A 1 308 ? 47.809 40.951 2.678   1.00 9.93  ? 305 ILE A CA    1 
ATOM   2356 C  C     . ILE A 1 308 ? 46.647 40.064 2.250   1.00 12.59 ? 305 ILE A C     1 
ATOM   2357 O  O     . ILE A 1 308 ? 46.471 38.965 2.786   1.00 12.12 ? 305 ILE A O     1 
ATOM   2358 C  CB    . ILE A 1 308 ? 49.149 40.344 2.231   1.00 11.05 ? 305 ILE A CB    1 
ATOM   2359 C  CG1   . ILE A 1 308 ? 50.278 41.325 2.571   1.00 17.14 ? 305 ILE A CG1   1 
ATOM   2360 C  CG2   . ILE A 1 308 ? 49.125 40.009 0.745   1.00 15.12 ? 305 ILE A CG2   1 
ATOM   2361 C  CD1   . ILE A 1 308 ? 51.663 40.789 2.276   1.00 18.25 ? 305 ILE A CD1   1 
ATOM   2362 N  N     . GLU A 1 309 ? 45.863 40.542 1.280   1.00 10.91 ? 306 GLU A N     1 
ATOM   2363 C  CA    . GLU A 1 309 ? 44.692 39.825 0.782   1.00 16.36 ? 306 GLU A CA    1 
ATOM   2364 C  C     . GLU A 1 309 ? 44.441 40.286 -0.645  1.00 17.93 ? 306 GLU A C     1 
ATOM   2365 O  O     . GLU A 1 309 ? 44.577 41.474 -0.940  1.00 18.35 ? 306 GLU A O     1 
ATOM   2366 C  CB    . GLU A 1 309 ? 43.439 40.110 1.631   1.00 17.84 ? 306 GLU A CB    1 
ATOM   2367 C  CG    . GLU A 1 309 ? 42.438 38.969 1.634   1.00 28.13 ? 306 GLU A CG    1 
ATOM   2368 C  CD    . GLU A 1 309 ? 40.990 39.412 1.514   1.00 27.48 ? 306 GLU A CD    1 
ATOM   2369 O  OE1   . GLU A 1 309 ? 40.702 40.629 1.362   1.00 24.89 ? 306 GLU A OE1   1 
ATOM   2370 O  OE2   . GLU A 1 309 ? 40.127 38.519 1.586   1.00 32.27 ? 306 GLU A OE2   1 
ATOM   2371 N  N     . HIS A 1 310 ? 44.047 39.363 -1.527  1.00 18.65 ? 307 HIS A N     1 
ATOM   2372 C  CA    . HIS A 1 310 ? 43.938 39.708 -2.944  1.00 16.75 ? 307 HIS A CA    1 
ATOM   2373 C  C     . HIS A 1 310 ? 42.534 39.570 -3.519  1.00 15.01 ? 307 HIS A C     1 
ATOM   2374 O  O     . HIS A 1 310 ? 42.364 39.770 -4.730  1.00 22.45 ? 307 HIS A O     1 
ATOM   2375 C  CB    . HIS A 1 310 ? 44.915 38.863 -3.771  1.00 22.86 ? 307 HIS A CB    1 
ATOM   2376 C  CG    . HIS A 1 310 ? 46.342 39.073 -3.385  1.00 29.94 ? 307 HIS A CG    1 
ATOM   2377 N  ND1   . HIS A 1 310 ? 46.941 40.313 -3.418  1.00 30.56 ? 307 HIS A ND1   1 
ATOM   2378 C  CD2   . HIS A 1 310 ? 47.279 38.212 -2.925  1.00 37.41 ? 307 HIS A CD2   1 
ATOM   2379 C  CE1   . HIS A 1 310 ? 48.191 40.205 -3.004  1.00 32.48 ? 307 HIS A CE1   1 
ATOM   2380 N  NE2   . HIS A 1 310 ? 48.422 38.940 -2.703  1.00 33.11 ? 307 HIS A NE2   1 
ATOM   2381 N  N     . ASP A 1 311 ? 41.533 39.256 -2.701  1.00 15.87 ? 308 ASP A N     1 
ATOM   2382 C  CA    . ASP A 1 311 ? 40.159 39.138 -3.175  1.00 15.71 ? 308 ASP A CA    1 
ATOM   2383 C  C     . ASP A 1 311 ? 39.736 40.422 -3.889  1.00 17.78 ? 308 ASP A C     1 
ATOM   2384 O  O     . ASP A 1 311 ? 39.772 41.501 -3.282  1.00 13.82 ? 308 ASP A O     1 
ATOM   2385 C  CB    . ASP A 1 311 ? 39.226 38.855 -1.998  1.00 16.51 ? 308 ASP A CB    1 
ATOM   2386 C  CG    . ASP A 1 311 ? 37.796 38.612 -2.438  1.00 29.22 ? 308 ASP A CG    1 
ATOM   2387 O  OD1   . ASP A 1 311 ? 37.603 38.022 -3.521  1.00 34.88 ? 308 ASP A OD1   1 
ATOM   2388 O  OD2   . ASP A 1 311 ? 36.869 39.004 -1.704  1.00 32.86 ? 308 ASP A OD2   1 
ATOM   2389 N  N     . PRO A 1 312 ? 39.347 40.361 -5.160  1.00 15.09 ? 309 PRO A N     1 
ATOM   2390 C  CA    . PRO A 1 312 ? 39.078 41.598 -5.890  1.00 14.99 ? 309 PRO A CA    1 
ATOM   2391 C  C     . PRO A 1 312 ? 37.729 42.195 -5.518  1.00 12.47 ? 309 PRO A C     1 
ATOM   2392 O  O     . PRO A 1 312 ? 36.809 41.502 -5.071  1.00 15.97 ? 309 PRO A O     1 
ATOM   2393 C  CB    . PRO A 1 312 ? 39.106 41.144 -7.357  1.00 16.88 ? 309 PRO A CB    1 
ATOM   2394 C  CG    . PRO A 1 312 ? 38.625 39.724 -7.286  1.00 17.28 ? 309 PRO A CG    1 
ATOM   2395 C  CD    . PRO A 1 312 ? 39.194 39.165 -6.010  1.00 20.14 ? 309 PRO A CD    1 
ATOM   2396 N  N     . VAL A 1 313 ? 37.648 43.518 -5.647  1.00 12.20 ? 310 VAL A N     1 
ATOM   2397 C  CA    . VAL A 1 313 ? 36.349 44.186 -5.624  1.00 12.95 ? 310 VAL A CA    1 
ATOM   2398 C  C     . VAL A 1 313 ? 35.647 43.797 -6.921  1.00 15.39 ? 310 VAL A C     1 
ATOM   2399 O  O     . VAL A 1 313 ? 36.099 44.166 -8.008  1.00 15.35 ? 310 VAL A O     1 
ATOM   2400 C  CB    . VAL A 1 313 ? 36.492 45.707 -5.497  1.00 13.95 ? 310 VAL A CB    1 
ATOM   2401 C  CG1   . VAL A 1 313 ? 35.126 46.374 -5.544  1.00 14.30 ? 310 VAL A CG1   1 
ATOM   2402 C  CG2   . VAL A 1 313 ? 37.228 46.078 -4.208  1.00 13.65 ? 310 VAL A CG2   1 
ATOM   2403 N  N     . LYS A 1 314 ? 34.573 42.997 -6.816  1.00 15.20 ? 311 LYS A N     1 
ATOM   2404 C  CA    . LYS A 1 314 ? 33.912 42.512 -8.027  1.00 13.17 ? 311 LYS A CA    1 
ATOM   2405 C  C     . LYS A 1 314 ? 32.951 43.568 -8.570  1.00 17.13 ? 311 LYS A C     1 
ATOM   2406 O  O     . LYS A 1 314 ? 32.215 44.196 -7.804  1.00 19.15 ? 311 LYS A O     1 
ATOM   2407 C  CB    . LYS A 1 314 ? 33.147 41.223 -7.730  1.00 16.77 ? 311 LYS A CB    1 
ATOM   2408 C  CG    . LYS A 1 314 ? 34.056 40.059 -7.362  1.00 21.32 ? 311 LYS A CG    1 
ATOM   2409 C  CD    . LYS A 1 314 ? 33.317 38.977 -6.603  1.00 32.24 ? 311 LYS A CD    1 
ATOM   2410 C  CE    . LYS A 1 314 ? 34.299 37.911 -6.128  0.61 28.82 ? 311 LYS A CE    1 
ATOM   2411 N  NZ    . LYS A 1 314 ? 35.408 38.504 -5.311  0.66 33.97 ? 311 LYS A NZ    1 
ATOM   2412 N  N     . PRO A 1 315 ? 32.927 43.776 -9.878  1.00 14.82 ? 312 PRO A N     1 
ATOM   2413 C  CA    . PRO A 1 315 ? 31.998 44.751 -10.448 1.00 17.47 ? 312 PRO A CA    1 
ATOM   2414 C  C     . PRO A 1 315 ? 30.578 44.213 -10.470 1.00 21.11 ? 312 PRO A C     1 
ATOM   2415 O  O     . PRO A 1 315 ? 30.151 43.629 -11.470 1.00 22.33 ? 312 PRO A O     1 
ATOM   2416 C  CB    . PRO A 1 315 ? 32.543 44.964 -11.865 1.00 23.68 ? 312 PRO A CB    1 
ATOM   2417 C  CG    . PRO A 1 315 ? 33.177 43.650 -12.203 1.00 20.01 ? 312 PRO A CG    1 
ATOM   2418 C  CD    . PRO A 1 315 ? 33.775 43.145 -10.909 1.00 17.16 ? 312 PRO A CD    1 
ATOM   2419 N  N     . ARG A 1 316 ? 29.835 44.402 -9.382  1.00 18.50 ? 313 ARG A N     1 
ATOM   2420 C  CA    . ARG A 1 316 ? 28.516 43.783 -9.253  1.00 14.57 ? 313 ARG A CA    1 
ATOM   2421 C  C     . ARG A 1 316 ? 27.691 44.620 -8.290  1.00 18.75 ? 313 ARG A C     1 
ATOM   2422 O  O     . ARG A 1 316 ? 28.014 44.690 -7.104  1.00 18.51 ? 313 ARG A O     1 
ATOM   2423 C  CB    . ARG A 1 316 ? 28.636 42.343 -8.757  1.00 20.77 ? 313 ARG A CB    1 
ATOM   2424 C  CG    . ARG A 1 316 ? 27.341 41.530 -8.813  1.00 31.23 ? 313 ARG A CG    1 
ATOM   2425 C  CD    . ARG A 1 316 ? 27.464 40.251 -7.979  1.00 28.03 ? 313 ARG A CD    1 
ATOM   2426 N  NE    . ARG A 1 316 ? 27.488 40.561 -6.552  1.00 41.36 ? 313 ARG A NE    1 
ATOM   2427 C  CZ    . ARG A 1 316 ? 28.293 39.993 -5.659  1.00 51.67 ? 313 ARG A CZ    1 
ATOM   2428 N  NH1   . ARG A 1 316 ? 29.172 39.068 -6.034  1.00 36.15 ? 313 ARG A NH1   1 
ATOM   2429 N  NH2   . ARG A 1 316 ? 28.225 40.363 -4.384  1.00 39.07 ? 313 ARG A NH2   1 
ATOM   2430 N  N     . GLN A 1 317 ? 26.628 45.241 -8.806  1.00 18.98 ? 314 GLN A N     1 
ATOM   2431 C  CA    . GLN A 1 317 ? 25.724 46.063 -8.012  1.00 24.44 ? 314 GLN A CA    1 
ATOM   2432 C  C     . GLN A 1 317 ? 24.378 45.402 -7.758  1.00 32.03 ? 314 GLN A C     1 
ATOM   2433 O  O     . GLN A 1 317 ? 23.665 45.818 -6.838  1.00 36.48 ? 314 GLN A O     1 
ATOM   2434 C  CB    . GLN A 1 317 ? 25.495 47.407 -8.716  1.00 32.58 ? 314 GLN A CB    1 
ATOM   2435 C  CG    . GLN A 1 317 ? 25.252 48.584 -7.797  0.49 34.16 ? 314 GLN A CG    1 
ATOM   2436 C  CD    . GLN A 1 317 ? 25.349 49.906 -8.531  0.43 30.73 ? 314 GLN A CD    1 
ATOM   2437 O  OE1   . GLN A 1 317 ? 26.287 50.130 -9.298  0.73 37.69 ? 314 GLN A OE1   1 
ATOM   2438 N  NE2   . GLN A 1 317 ? 24.381 50.789 -8.301  1.00 35.95 ? 314 GLN A NE2   1 
ATOM   2439 N  N     . LEU A 1 318 ? 24.022 44.392 -8.537  1.00 25.40 ? 315 LEU A N     1 
ATOM   2440 C  CA    . LEU A 1 318 ? 22.758 43.680 -8.451  1.00 30.04 ? 315 LEU A CA    1 
ATOM   2441 C  C     . LEU A 1 318 ? 22.944 42.308 -7.820  1.00 28.49 ? 315 LEU A C     1 
ATOM   2442 O  O     . LEU A 1 318 ? 23.927 41.625 -8.112  1.00 24.64 ? 315 LEU A O     1 
ATOM   2443 C  CB    . LEU A 1 318 ? 22.149 43.495 -9.843  1.00 26.14 ? 315 LEU A CB    1 
ATOM   2444 C  CG    . LEU A 1 318 ? 21.856 44.766 -10.636 1.00 26.15 ? 315 LEU A CG    1 
ATOM   2445 C  CD1   . LEU A 1 318 ? 21.332 44.388 -12.002 1.00 29.42 ? 315 LEU A CD1   1 
ATOM   2446 C  CD2   . LEU A 1 318 ? 20.854 45.626 -9.885  1.00 32.01 ? 315 LEU A CD2   1 
ATOM   2447 N  N     . PRO A 1 319 ? 22.013 41.867 -6.974  1.00 30.28 ? 316 PRO A N     1 
ATOM   2448 C  CA    . PRO A 1 319 ? 22.067 40.485 -6.472  1.00 27.18 ? 316 PRO A CA    1 
ATOM   2449 C  C     . PRO A 1 319 ? 21.962 39.454 -7.593  1.00 22.71 ? 316 PRO A C     1 
ATOM   2450 O  O     . PRO A 1 319 ? 21.308 39.678 -8.613  1.00 32.98 ? 316 PRO A O     1 
ATOM   2451 C  CB    . PRO A 1 319 ? 20.859 40.400 -5.526  1.00 28.94 ? 316 PRO A CB    1 
ATOM   2452 C  CG    . PRO A 1 319 ? 20.001 41.608 -5.857  1.00 35.11 ? 316 PRO A CG    1 
ATOM   2453 C  CD    . PRO A 1 319 ? 20.953 42.660 -6.328  1.00 32.25 ? 316 PRO A CD    1 
ATOM   2454 N  N     . LYS A 1 320 ? 22.619 38.298 -7.385  1.00 21.24 ? 317 LYS A N     1 
ATOM   2455 C  CA    . LYS A 1 320 ? 22.575 37.164 -8.308  1.00 20.42 ? 317 LYS A CA    1 
ATOM   2456 C  C     . LYS A 1 320 ? 21.366 36.262 -8.095  1.00 20.78 ? 317 LYS A C     1 
ATOM   2457 O  O     . LYS A 1 320 ? 21.120 35.363 -8.909  1.00 23.11 ? 317 LYS A O     1 
ATOM   2458 C  CB    . LYS A 1 320 ? 23.834 36.294 -8.164  1.00 33.28 ? 317 LYS A CB    1 
ATOM   2459 C  CG    . LYS A 1 320 ? 25.162 37.021 -8.290  1.00 38.07 ? 317 LYS A CG    1 
ATOM   2460 C  CD    . LYS A 1 320 ? 26.341 36.062 -8.058  1.00 34.20 ? 317 LYS A CD    1 
ATOM   2461 C  CE    . LYS A 1 320 ? 27.121 35.799 -9.335  1.00 38.79 ? 317 LYS A CE    1 
ATOM   2462 N  NZ    . LYS A 1 320 ? 28.424 35.105 -9.074  1.00 37.98 ? 317 LYS A NZ    1 
ATOM   2463 N  N     . THR A 1 321 ? 20.658 36.438 -6.990  1.00 22.36 ? 318 THR A N     1 
ATOM   2464 C  CA    . THR A 1 321 ? 19.469 35.673 -6.662  1.00 20.99 ? 318 THR A CA    1 
ATOM   2465 C  C     . THR A 1 321 ? 18.465 36.658 -6.090  1.00 19.74 ? 318 THR A C     1 
ATOM   2466 O  O     . THR A 1 321 ? 18.842 37.698 -5.549  1.00 25.74 ? 318 THR A O     1 
ATOM   2467 C  CB    . THR A 1 321 ? 19.750 34.553 -5.635  1.00 23.40 ? 318 THR A CB    1 
ATOM   2468 O  OG1   . THR A 1 321 ? 20.246 35.130 -4.423  1.00 31.55 ? 318 THR A OG1   1 
ATOM   2469 C  CG2   . THR A 1 321 ? 20.762 33.561 -6.146  1.00 18.70 ? 318 THR A CG2   1 
ATOM   2470 N  N     . ILE A 1 322 ? 17.183 36.356 -6.268  1.00 17.22 ? 319 ILE A N     1 
ATOM   2471 C  CA    . ILE A 1 322 ? 16.101 37.103 -5.643  1.00 16.73 ? 319 ILE A CA    1 
ATOM   2472 C  C     . ILE A 1 322 ? 15.231 36.084 -4.922  1.00 19.10 ? 319 ILE A C     1 
ATOM   2473 O  O     . ILE A 1 322 ? 14.736 35.147 -5.552  1.00 17.84 ? 319 ILE A O     1 
ATOM   2474 C  CB    . ILE A 1 322 ? 15.279 37.899 -6.671  1.00 15.49 ? 319 ILE A CB    1 
ATOM   2475 C  CG1   . ILE A 1 322 ? 16.153 38.991 -7.307  1.00 20.59 ? 319 ILE A CG1   1 
ATOM   2476 C  CG2   . ILE A 1 322 ? 14.027 38.490 -6.027  1.00 19.46 ? 319 ILE A CG2   1 
ATOM   2477 C  CD1   . ILE A 1 322 ? 15.402 39.894 -8.285  1.00 20.36 ? 319 ILE A CD1   1 
ATOM   2478 N  N     . GLY A 1 323 ? 15.080 36.232 -3.603  1.00 16.89 ? 320 GLY A N     1 
ATOM   2479 C  CA    . GLY A 1 323 ? 14.440 35.197 -2.814  1.00 16.52 ? 320 GLY A CA    1 
ATOM   2480 C  C     . GLY A 1 323 ? 13.458 35.753 -1.801  1.00 16.24 ? 320 GLY A C     1 
ATOM   2481 O  O     . GLY A 1 323 ? 13.514 36.918 -1.413  1.00 19.30 ? 320 GLY A O     1 
ATOM   2482 N  N     . CYS A 1 324 ? 12.565 34.865 -1.361  1.00 16.24 ? 321 CYS A N     1 
ATOM   2483 C  CA    A CYS A 1 324 ? 11.480 35.199 -0.440  0.41 17.29 ? 321 CYS A CA    1 
ATOM   2484 C  CA    C CYS A 1 324 ? 11.476 35.194 -0.455  0.59 17.28 ? 321 CYS A CA    1 
ATOM   2485 C  C     . CYS A 1 324 ? 11.343 34.057 0.551   1.00 14.07 ? 321 CYS A C     1 
ATOM   2486 O  O     . CYS A 1 324 ? 11.175 32.908 0.145   1.00 19.68 ? 321 CYS A O     1 
ATOM   2487 C  CB    A CYS A 1 324 ? 10.136 35.396 -1.168  0.41 18.77 ? 321 CYS A CB    1 
ATOM   2488 C  CB    C CYS A 1 324 ? 10.191 35.362 -1.268  0.59 18.86 ? 321 CYS A CB    1 
ATOM   2489 S  SG    A CYS A 1 324 ? 9.991  36.853 -2.230  0.41 19.67 ? 321 CYS A SG    1 
ATOM   2490 S  SG    C CYS A 1 324 ? 8.798  35.807 -0.341  0.59 28.15 ? 321 CYS A SG    1 
ATOM   2491 N  N     . SER A 1 325 ? 11.407 34.362 1.854   1.00 16.67 ? 322 SER A N     1 
ATOM   2492 C  CA    . SER A 1 325 ? 11.343 33.293 2.850   1.00 16.89 ? 322 SER A CA    1 
ATOM   2493 C  C     . SER A 1 325 ? 10.499 33.687 4.055   1.00 17.34 ? 322 SER A C     1 
ATOM   2494 O  O     . SER A 1 325 ? 10.347 34.869 4.377   1.00 16.73 ? 322 SER A O     1 
ATOM   2495 C  CB    . SER A 1 325 ? 12.750 32.879 3.332   1.00 18.81 ? 322 SER A CB    1 
ATOM   2496 O  OG    . SER A 1 325 ? 13.371 33.904 4.079   1.00 24.07 ? 322 SER A OG    1 
ATOM   2497 N  N     . LYS A 1 326 ? 9.940  32.674 4.716   1.00 17.61 ? 323 LYS A N     1 
ATOM   2498 C  CA    . LYS A 1 326 ? 9.223  32.893 5.969   1.00 15.16 ? 323 LYS A CA    1 
ATOM   2499 C  C     . LYS A 1 326 ? 9.411  31.690 6.882   1.00 18.55 ? 323 LYS A C     1 
ATOM   2500 O  O     . LYS A 1 326 ? 9.268  30.542 6.441   1.00 14.54 ? 323 LYS A O     1 
ATOM   2501 C  CB    . LYS A 1 326 ? 7.725  33.138 5.716   1.00 16.08 ? 323 LYS A CB    1 
ATOM   2502 C  CG    . LYS A 1 326 ? 6.963  33.464 6.991   1.00 17.44 ? 323 LYS A CG    1 
ATOM   2503 C  CD    . LYS A 1 326 ? 5.529  33.876 6.725   1.00 18.80 ? 323 LYS A CD    1 
ATOM   2504 C  CE    . LYS A 1 326 ? 4.760  34.014 8.037   1.00 19.42 ? 323 LYS A CE    1 
ATOM   2505 N  NZ    . LYS A 1 326 ? 5.262  35.148 8.833   1.00 20.04 ? 323 LYS A NZ    1 
ATOM   2506 N  N     . ASN A 1 327 ? 9.715  31.967 8.150   1.00 17.83 ? 324 ASN A N     1 
ATOM   2507 C  CA    . ASN A 1 327 ? 9.783  30.964 9.203   1.00 17.97 ? 324 ASN A CA    1 
ATOM   2508 C  C     . ASN A 1 327 ? 8.414  30.768 9.842   1.00 20.90 ? 324 ASN A C     1 
ATOM   2509 O  O     . ASN A 1 327 ? 7.594  31.690 9.917   1.00 18.29 ? 324 ASN A O     1 
ATOM   2510 C  CB    . ASN A 1 327 ? 10.766 31.374 10.304  1.00 19.40 ? 324 ASN A CB    1 
ATOM   2511 C  CG    . ASN A 1 327 ? 12.215 31.405 9.845   1.00 26.92 ? 324 ASN A CG    1 
ATOM   2512 O  OD1   . ASN A 1 327 ? 12.529 31.226 8.670   1.00 27.73 ? 324 ASN A OD1   1 
ATOM   2513 N  ND2   . ASN A 1 327 ? 13.112 31.656 10.792  1.00 35.69 ? 324 ASN A ND2   1 
ATOM   2514 N  N     . PHE A 1 328 ? 8.185  29.555 10.336  1.00 17.26 ? 325 PHE A N     1 
ATOM   2515 C  CA    . PHE A 1 328 ? 6.947  29.192 11.019  1.00 16.84 ? 325 PHE A CA    1 
ATOM   2516 C  C     . PHE A 1 328 ? 7.336  28.494 12.315  1.00 26.90 ? 325 PHE A C     1 
ATOM   2517 O  O     . PHE A 1 328 ? 7.340  27.260 12.395  1.00 21.56 ? 325 PHE A O     1 
ATOM   2518 C  CB    . PHE A 1 328 ? 6.067  28.320 10.124  1.00 21.28 ? 325 PHE A CB    1 
ATOM   2519 C  CG    . PHE A 1 328 ? 5.714  28.967 8.810   1.00 18.43 ? 325 PHE A CG    1 
ATOM   2520 C  CD1   . PHE A 1 328 ? 4.631  29.835 8.702   1.00 16.19 ? 325 PHE A CD1   1 
ATOM   2521 C  CD2   . PHE A 1 328 ? 6.482  28.726 7.683   1.00 17.92 ? 325 PHE A CD2   1 
ATOM   2522 C  CE1   . PHE A 1 328 ? 4.307  30.429 7.488   1.00 19.62 ? 325 PHE A CE1   1 
ATOM   2523 C  CE2   . PHE A 1 328 ? 6.165  29.312 6.467   1.00 15.46 ? 325 PHE A CE2   1 
ATOM   2524 C  CZ    . PHE A 1 328 ? 5.085  30.166 6.361   1.00 17.10 ? 325 PHE A CZ    1 
ATOM   2525 N  N     . PRO A 1 329 ? 7.673  29.258 13.351  1.00 26.68 ? 326 PRO A N     1 
ATOM   2526 C  CA    . PRO A 1 329 ? 8.241  28.659 14.560  1.00 28.30 ? 326 PRO A CA    1 
ATOM   2527 C  C     . PRO A 1 329 ? 7.184  28.031 15.462  1.00 26.40 ? 326 PRO A C     1 
ATOM   2528 O  O     . PRO A 1 329 ? 6.003  28.387 15.440  1.00 24.31 ? 326 PRO A O     1 
ATOM   2529 C  CB    . PRO A 1 329 ? 8.918  29.846 15.253  1.00 29.02 ? 326 PRO A CB    1 
ATOM   2530 C  CG    . PRO A 1 329 ? 8.110  31.028 14.828  1.00 32.11 ? 326 PRO A CG    1 
ATOM   2531 C  CD    . PRO A 1 329 ? 7.633  30.729 13.421  1.00 25.37 ? 326 PRO A CD    1 
ATOM   2532 N  N     . GLY A 1 330 ? 7.648  27.065 16.251  1.00 33.07 ? 327 GLY A N     1 
ATOM   2533 C  CA    . GLY A 1 330 ? 6.852  26.526 17.345  1.00 40.27 ? 327 GLY A CA    1 
ATOM   2534 C  C     . GLY A 1 330 ? 5.546  25.921 16.877  1.00 33.53 ? 327 GLY A C     1 
ATOM   2535 O  O     . GLY A 1 330 ? 5.495  25.159 15.906  1.00 27.77 ? 327 GLY A O     1 
ATOM   2536 N  N     . LYS A 1 331 ? 4.464  26.275 17.577  1.00 31.45 ? 328 LYS A N     1 
ATOM   2537 C  CA    . LYS A 1 331 ? 3.142  25.746 17.268  1.00 34.31 ? 328 LYS A CA    1 
ATOM   2538 C  C     . LYS A 1 331 ? 2.607  26.237 15.931  1.00 29.58 ? 328 LYS A C     1 
ATOM   2539 O  O     . LYS A 1 331 ? 1.626  25.676 15.436  1.00 33.27 ? 328 LYS A O     1 
ATOM   2540 C  CB    . LYS A 1 331 ? 2.155  26.106 18.385  1.00 38.13 ? 328 LYS A CB    1 
ATOM   2541 N  N     . THR A 1 332 ? 3.228  27.248 15.329  1.00 23.01 ? 329 THR A N     1 
ATOM   2542 C  CA    . THR A 1 332 ? 2.783  27.746 14.037  1.00 23.87 ? 329 THR A CA    1 
ATOM   2543 C  C     . THR A 1 332 ? 3.325  26.936 12.862  1.00 24.34 ? 329 THR A C     1 
ATOM   2544 O  O     . THR A 1 332 ? 2.926  27.208 11.726  1.00 24.91 ? 329 THR A O     1 
ATOM   2545 C  CB    . THR A 1 332 ? 3.169  29.221 13.873  1.00 28.93 ? 329 THR A CB    1 
ATOM   2546 O  OG1   . THR A 1 332 ? 4.574  29.340 13.604  1.00 26.27 ? 329 THR A OG1   1 
ATOM   2547 C  CG2   . THR A 1 332 ? 2.841  29.993 15.140  1.00 32.77 ? 329 THR A CG2   1 
ATOM   2548 N  N     . ALA A 1 333 ? 4.192  25.949 13.107  1.00 23.29 ? 330 ALA A N     1 
ATOM   2549 C  CA    . ALA A 1 333 ? 4.735  25.120 12.031  1.00 22.13 ? 330 ALA A CA    1 
ATOM   2550 C  C     . ALA A 1 333 ? 3.618  24.549 11.168  1.00 20.78 ? 330 ALA A C     1 
ATOM   2551 O  O     . ALA A 1 333 ? 2.584  24.106 11.673  1.00 28.44 ? 330 ALA A O     1 
ATOM   2552 C  CB    . ALA A 1 333 ? 5.579  23.984 12.612  1.00 20.14 ? 330 ALA A CB    1 
ATOM   2553 N  N     . LEU A 1 334 ? 3.821  24.570 9.853   1.00 18.70 ? 331 LEU A N     1 
ATOM   2554 C  CA    . LEU A 1 334 ? 2.751  24.210 8.932   1.00 18.92 ? 331 LEU A CA    1 
ATOM   2555 C  C     . LEU A 1 334 ? 2.540  22.703 8.942   1.00 25.54 ? 331 LEU A C     1 
ATOM   2556 O  O     . LEU A 1 334 ? 3.491  21.931 8.772   1.00 28.48 ? 331 LEU A O     1 
ATOM   2557 C  CB    . LEU A 1 334 ? 3.075  24.680 7.516   1.00 25.01 ? 331 LEU A CB    1 
ATOM   2558 C  CG    . LEU A 1 334 ? 3.384  26.165 7.347   1.00 23.96 ? 331 LEU A CG    1 
ATOM   2559 C  CD1   . LEU A 1 334 ? 3.545  26.459 5.856   1.00 19.72 ? 331 LEU A CD1   1 
ATOM   2560 C  CD2   . LEU A 1 334 ? 2.303  27.025 7.977   1.00 18.69 ? 331 LEU A CD2   1 
ATOM   2561 N  N     . ALA A 1 335 ? 1.292  22.285 9.125   1.00 20.42 ? 332 ALA A N     1 
ATOM   2562 C  CA    . ALA A 1 335 ? 0.991  20.879 9.376   1.00 29.01 ? 332 ALA A CA    1 
ATOM   2563 C  C     . ALA A 1 335 ? -0.139 20.331 8.510   1.00 25.39 ? 332 ALA A C     1 
ATOM   2564 O  O     . ALA A 1 335 ? -0.547 19.180 8.714   1.00 30.09 ? 332 ALA A O     1 
ATOM   2565 C  CB    . ALA A 1 335 ? 0.656  20.661 10.858  1.00 30.21 ? 332 ALA A CB    1 
ATOM   2566 N  N     . THR A 1 336 ? -0.661 21.109 7.560   1.00 20.00 ? 333 THR A N     1 
ATOM   2567 C  CA    . THR A 1 336 ? -1.652 20.624 6.608   1.00 26.92 ? 333 THR A CA    1 
ATOM   2568 C  C     . THR A 1 336 ? -1.217 20.968 5.189   1.00 30.97 ? 333 THR A C     1 
ATOM   2569 O  O     . THR A 1 336 ? -0.503 21.949 4.962   1.00 23.29 ? 333 THR A O     1 
ATOM   2570 C  CB    . THR A 1 336 ? -3.047 21.213 6.848   1.00 22.46 ? 333 THR A CB    1 
ATOM   2571 O  OG1   . THR A 1 336 ? -3.118 22.537 6.312   1.00 24.87 ? 333 THR A OG1   1 
ATOM   2572 C  CG2   . THR A 1 336 ? -3.405 21.238 8.356   1.00 25.04 ? 333 THR A CG2   1 
ATOM   2573 N  N     . ARG A 1 337 ? -1.678 20.158 4.231   1.00 28.04 ? 334 ARG A N     1 
ATOM   2574 C  CA    . ARG A 1 337 ? -1.341 20.393 2.827   1.00 21.45 ? 334 ARG A CA    1 
ATOM   2575 C  C     . ARG A 1 337 ? -1.884 21.732 2.336   1.00 26.80 ? 334 ARG A C     1 
ATOM   2576 O  O     . ARG A 1 337 ? -1.204 22.450 1.590   1.00 26.40 ? 334 ARG A O     1 
ATOM   2577 C  CB    . ARG A 1 337 ? -1.872 19.247 1.964   1.00 28.63 ? 334 ARG A CB    1 
ATOM   2578 C  CG    . ARG A 1 337 ? -1.654 19.438 0.471   1.00 38.78 ? 334 ARG A CG    1 
ATOM   2579 C  CD    . ARG A 1 337 ? -2.319 18.329 -0.335  1.00 40.73 ? 334 ARG A CD    1 
ATOM   2580 N  N     . GLU A 1 338 ? -3.107 22.088 2.741   1.00 25.59 ? 335 GLU A N     1 
ATOM   2581 C  CA    . GLU A 1 338 ? -3.670 23.379 2.345   1.00 32.90 ? 335 GLU A CA    1 
ATOM   2582 C  C     . GLU A 1 338 ? -2.823 24.537 2.866   1.00 24.17 ? 335 GLU A C     1 
ATOM   2583 O  O     . GLU A 1 338 ? -2.660 25.554 2.180   1.00 21.38 ? 335 GLU A O     1 
ATOM   2584 C  CB    . GLU A 1 338 ? -5.112 23.506 2.845   1.00 26.54 ? 335 GLU A CB    1 
ATOM   2585 N  N     . GLN A 1 339 ? -2.271 24.393 4.073   1.00 22.76 ? 336 GLN A N     1 
ATOM   2586 C  CA    . GLN A 1 339 ? -1.418 25.428 4.655   1.00 23.73 ? 336 GLN A CA    1 
ATOM   2587 C  C     . GLN A 1 339 ? -0.142 25.625 3.851   1.00 28.04 ? 336 GLN A C     1 
ATOM   2588 O  O     . GLN A 1 339 ? 0.258  26.760 3.554   1.00 25.21 ? 336 GLN A O     1 
ATOM   2589 C  CB    . GLN A 1 339 ? -1.055 25.050 6.084   1.00 31.68 ? 336 GLN A CB    1 
ATOM   2590 C  CG    . GLN A 1 339 ? -1.804 25.780 7.138   1.00 27.88 ? 336 GLN A CG    1 
ATOM   2591 C  CD    . GLN A 1 339 ? -1.252 25.468 8.505   1.00 25.18 ? 336 GLN A CD    1 
ATOM   2592 O  OE1   . GLN A 1 339 ? -0.841 24.336 8.786   1.00 23.04 ? 336 GLN A OE1   1 
ATOM   2593 N  NE2   . GLN A 1 339 ? -1.206 26.479 9.356   1.00 23.08 ? 336 GLN A NE2   1 
ATOM   2594 N  N     . VAL A 1 340 ? 0.550  24.526 3.551   1.00 22.77 ? 337 VAL A N     1 
ATOM   2595 C  CA    . VAL A 1 340 ? 1.773  24.618 2.767   1.00 22.05 ? 337 VAL A CA    1 
ATOM   2596 C  C     . VAL A 1 340 ? 1.478  25.268 1.422   1.00 22.58 ? 337 VAL A C     1 
ATOM   2597 O  O     . VAL A 1 340 ? 2.204  26.161 0.975   1.00 20.89 ? 337 VAL A O     1 
ATOM   2598 C  CB    . VAL A 1 340 ? 2.410  23.223 2.613   1.00 21.73 ? 337 VAL A CB    1 
ATOM   2599 C  CG1   . VAL A 1 340 ? 3.626  23.283 1.699   1.00 22.25 ? 337 VAL A CG1   1 
ATOM   2600 C  CG2   . VAL A 1 340 ? 2.790  22.648 3.980   1.00 19.64 ? 337 VAL A CG2   1 
ATOM   2601 N  N     . GLN A 1 341 ? 0.384  24.860 0.775   1.00 18.09 ? 338 GLN A N     1 
ATOM   2602 C  CA    . GLN A 1 341 ? 0.060  25.403 -0.539  1.00 20.58 ? 338 GLN A CA    1 
ATOM   2603 C  C     . GLN A 1 341 ? -0.294 26.881 -0.466  1.00 23.24 ? 338 GLN A C     1 
ATOM   2604 O  O     . GLN A 1 341 ? 0.122  27.660 -1.329  1.00 19.92 ? 338 GLN A O     1 
ATOM   2605 C  CB    . GLN A 1 341 ? -1.070 24.596 -1.176  1.00 24.54 ? 338 GLN A CB    1 
ATOM   2606 C  CG    . GLN A 1 341 ? -0.640 23.175 -1.494  1.00 20.57 ? 338 GLN A CG    1 
ATOM   2607 C  CD    . GLN A 1 341 ? -1.725 22.366 -2.179  1.00 32.37 ? 338 GLN A CD    1 
ATOM   2608 O  OE1   . GLN A 1 341 ? -2.908 22.534 -1.906  1.00 36.14 ? 338 GLN A OE1   1 
ATOM   2609 N  NE2   . GLN A 1 341 ? -1.319 21.491 -3.091  1.00 42.24 ? 338 GLN A NE2   1 
ATOM   2610 N  N     . TRP A 1 342 ? -1.038 27.299 0.563   1.00 16.94 ? 339 TRP A N     1 
ATOM   2611 C  CA    . TRP A 1 342 ? -1.407 28.708 0.668   1.00 22.36 ? 339 TRP A CA    1 
ATOM   2612 C  C     . TRP A 1 342 ? -0.185 29.595 0.910   1.00 15.53 ? 339 TRP A C     1 
ATOM   2613 O  O     . TRP A 1 342 ? -0.045 30.651 0.283   1.00 14.70 ? 339 TRP A O     1 
ATOM   2614 C  CB    . TRP A 1 342 ? -2.442 28.900 1.778   1.00 21.87 ? 339 TRP A CB    1 
ATOM   2615 C  CG    . TRP A 1 342 ? -3.049 30.263 1.743   1.00 22.81 ? 339 TRP A CG    1 
ATOM   2616 C  CD1   . TRP A 1 342 ? -4.052 30.698 0.920   1.00 20.83 ? 339 TRP A CD1   1 
ATOM   2617 C  CD2   . TRP A 1 342 ? -2.676 31.382 2.546   1.00 21.45 ? 339 TRP A CD2   1 
ATOM   2618 N  NE1   . TRP A 1 342 ? -4.334 32.012 1.174   1.00 23.41 ? 339 TRP A NE1   1 
ATOM   2619 C  CE2   . TRP A 1 342 ? -3.505 32.457 2.171   1.00 19.74 ? 339 TRP A CE2   1 
ATOM   2620 C  CE3   . TRP A 1 342 ? -1.724 31.578 3.553   1.00 21.94 ? 339 TRP A CE3   1 
ATOM   2621 C  CZ2   . TRP A 1 342 ? -3.405 33.716 2.754   1.00 26.04 ? 339 TRP A CZ2   1 
ATOM   2622 C  CZ3   . TRP A 1 342 ? -1.631 32.817 4.135   1.00 22.76 ? 339 TRP A CZ3   1 
ATOM   2623 C  CH2   . TRP A 1 342 ? -2.467 33.876 3.736   1.00 25.40 ? 339 TRP A CH2   1 
ATOM   2624 N  N     . TRP A 1 343 ? 0.715  29.183 1.802   1.00 17.67 ? 340 TRP A N     1 
ATOM   2625 C  CA    . TRP A 1 343 ? 1.900  29.998 2.058   1.00 15.35 ? 340 TRP A CA    1 
ATOM   2626 C  C     . TRP A 1 343 ? 2.860  29.995 0.875   1.00 15.94 ? 340 TRP A C     1 
ATOM   2627 O  O     . TRP A 1 343 ? 3.482  31.025 0.594   1.00 16.42 ? 340 TRP A O     1 
ATOM   2628 C  CB    . TRP A 1 343 ? 2.606  29.530 3.330   1.00 17.24 ? 340 TRP A CB    1 
ATOM   2629 C  CG    . TRP A 1 343 ? 1.901  30.063 4.563   1.00 18.28 ? 340 TRP A CG    1 
ATOM   2630 C  CD1   . TRP A 1 343 ? 1.152  29.357 5.456   1.00 21.79 ? 340 TRP A CD1   1 
ATOM   2631 C  CD2   . TRP A 1 343 ? 1.871  31.429 5.000   1.00 16.99 ? 340 TRP A CD2   1 
ATOM   2632 N  NE1   . TRP A 1 343 ? 0.665  30.199 6.433   1.00 18.39 ? 340 TRP A NE1   1 
ATOM   2633 C  CE2   . TRP A 1 343 ? 1.089  31.477 6.170   1.00 23.30 ? 340 TRP A CE2   1 
ATOM   2634 C  CE3   . TRP A 1 343 ? 2.440  32.614 4.520   1.00 19.37 ? 340 TRP A CE3   1 
ATOM   2635 C  CZ2   . TRP A 1 343 ? 0.874  32.662 6.878   1.00 18.73 ? 340 TRP A CZ2   1 
ATOM   2636 C  CZ3   . TRP A 1 343 ? 2.213  33.788 5.215   1.00 24.10 ? 340 TRP A CZ3   1 
ATOM   2637 C  CH2   . TRP A 1 343 ? 1.434  33.804 6.379   1.00 17.38 ? 340 TRP A CH2   1 
ATOM   2638 N  N     . LEU A 1 344 ? 2.975  28.879 0.150   1.00 16.24 ? 341 LEU A N     1 
ATOM   2639 C  CA    . LEU A 1 344 ? 3.798  28.909 -1.063  1.00 18.55 ? 341 LEU A CA    1 
ATOM   2640 C  C     . LEU A 1 344 ? 3.245  29.913 -2.057  1.00 18.53 ? 341 LEU A C     1 
ATOM   2641 O  O     . LEU A 1 344 ? 4.004  30.624 -2.728  1.00 15.99 ? 341 LEU A O     1 
ATOM   2642 C  CB    . LEU A 1 344 ? 3.878  27.521 -1.704  1.00 15.78 ? 341 LEU A CB    1 
ATOM   2643 C  CG    . LEU A 1 344 ? 4.804  26.509 -1.026  1.00 15.55 ? 341 LEU A CG    1 
ATOM   2644 C  CD1   . LEU A 1 344 ? 4.555  25.118 -1.624  1.00 20.62 ? 341 LEU A CD1   1 
ATOM   2645 C  CD2   . LEU A 1 344 ? 6.278  26.902 -1.149  1.00 21.76 ? 341 LEU A CD2   1 
ATOM   2646 N  N     . LEU A 1 345 ? 1.919  30.015 -2.140  1.00 16.35 ? 342 LEU A N     1 
ATOM   2647 C  CA    . LEU A 1 345 ? 1.327  31.022 -3.012  1.00 15.11 ? 342 LEU A CA    1 
ATOM   2648 C  C     . LEU A 1 345 ? 1.639  32.440 -2.532  1.00 19.50 ? 342 LEU A C     1 
ATOM   2649 O  O     . LEU A 1 345 ? 1.945  33.319 -3.340  1.00 15.63 ? 342 LEU A O     1 
ATOM   2650 C  CB    . LEU A 1 345 ? -0.181 30.810 -3.112  1.00 16.72 ? 342 LEU A CB    1 
ATOM   2651 C  CG    . LEU A 1 345 ? -0.859 31.847 -4.002  1.00 19.65 ? 342 LEU A CG    1 
ATOM   2652 C  CD1   . LEU A 1 345 ? -0.289 31.765 -5.418  1.00 24.78 ? 342 LEU A CD1   1 
ATOM   2653 C  CD2   . LEU A 1 345 ? -2.362 31.608 -4.011  1.00 23.35 ? 342 LEU A CD2   1 
ATOM   2654 N  N     . GLN A 1 346 ? 1.570  32.688 -1.221  1.00 14.59 ? 343 GLN A N     1 
ATOM   2655 C  CA    . GLN A 1 346 ? 1.880  34.023 -0.727  1.00 16.15 ? 343 GLN A CA    1 
ATOM   2656 C  C     . GLN A 1 346 ? 3.315  34.411 -1.071  1.00 15.30 ? 343 GLN A C     1 
ATOM   2657 O  O     . GLN A 1 346 ? 3.573  35.529 -1.536  1.00 15.19 ? 343 GLN A O     1 
ATOM   2658 C  CB    . GLN A 1 346 ? 1.661  34.103 0.784   1.00 18.08 ? 343 GLN A CB    1 
ATOM   2659 C  CG    . GLN A 1 346 ? 0.243  33.746 1.236   1.00 19.22 ? 343 GLN A CG    1 
ATOM   2660 C  CD    . GLN A 1 346 ? -0.847 34.337 0.365   1.00 19.69 ? 343 GLN A CD    1 
ATOM   2661 O  OE1   . GLN A 1 346 ? -1.052 35.548 0.328   1.00 23.15 ? 343 GLN A OE1   1 
ATOM   2662 N  NE2   . GLN A 1 346 ? -1.573 33.477 -0.326  1.00 20.46 ? 343 GLN A NE2   1 
ATOM   2663 N  N     . LEU A 1 347 ? 4.263  33.502 -0.821  1.00 15.51 ? 344 LEU A N     1 
ATOM   2664 C  CA    . LEU A 1 347 ? 5.660  33.772 -1.155  1.00 16.09 ? 344 LEU A CA    1 
ATOM   2665 C  C     . LEU A 1 347 ? 5.841  33.982 -2.654  1.00 15.35 ? 344 LEU A C     1 
ATOM   2666 O  O     . LEU A 1 347 ? 6.565  34.889 -3.078  1.00 15.12 ? 344 LEU A O     1 
ATOM   2667 C  CB    . LEU A 1 347 ? 6.550  32.627 -0.684  1.00 13.51 ? 344 LEU A CB    1 
ATOM   2668 C  CG    . LEU A 1 347 ? 6.667  32.369 0.815   1.00 18.82 ? 344 LEU A CG    1 
ATOM   2669 C  CD1   . LEU A 1 347 ? 7.685  31.266 1.065   1.00 21.33 ? 344 LEU A CD1   1 
ATOM   2670 C  CD2   . LEU A 1 347 ? 7.066  33.593 1.533   1.00 26.64 ? 344 LEU A CD2   1 
ATOM   2671 N  N     . ALA A 1 348 ? 5.197  33.140 -3.466  1.00 14.47 ? 345 ALA A N     1 
ATOM   2672 C  CA    . ALA A 1 348 ? 5.325  33.260 -4.916  1.00 14.55 ? 345 ALA A CA    1 
ATOM   2673 C  C     . ALA A 1 348 ? 4.772  34.583 -5.429  1.00 16.60 ? 345 ALA A C     1 
ATOM   2674 O  O     . ALA A 1 348 ? 5.306  35.144 -6.392  1.00 15.32 ? 345 ALA A O     1 
ATOM   2675 C  CB    . ALA A 1 348 ? 4.624  32.081 -5.600  1.00 14.61 ? 345 ALA A CB    1 
ATOM   2676 N  N     . GLN A 1 349 ? 3.708  35.104 -4.808  1.00 12.77 ? 346 GLN A N     1 
ATOM   2677 C  CA    . GLN A 1 349 ? 3.166  36.387 -5.234  1.00 13.76 ? 346 GLN A CA    1 
ATOM   2678 C  C     . GLN A 1 349 ? 4.119  37.538 -4.919  1.00 14.04 ? 346 GLN A C     1 
ATOM   2679 O  O     . GLN A 1 349 ? 4.273  38.456 -5.729  1.00 14.55 ? 346 GLN A O     1 
ATOM   2680 C  CB    . GLN A 1 349 ? 1.804  36.623 -4.581  1.00 12.91 ? 346 GLN A CB    1 
ATOM   2681 C  CG    . GLN A 1 349 ? 0.711  35.722 -5.148  1.00 19.91 ? 346 GLN A CG    1 
ATOM   2682 C  CD    . GLN A 1 349 ? -0.595 35.830 -4.395  1.00 32.28 ? 346 GLN A CD    1 
ATOM   2683 O  OE1   . GLN A 1 349 ? -0.614 36.152 -3.212  1.00 34.38 ? 346 GLN A OE1   1 
ATOM   2684 N  NE2   . GLN A 1 349 ? -1.697 35.548 -5.077  1.00 34.27 ? 346 GLN A NE2   1 
ATOM   2685 N  N     . GLU A 1 350 ? 4.745  37.531 -3.741  1.00 16.19 ? 347 GLU A N     1 
ATOM   2686 C  CA    . GLU A 1 350 ? 5.733  38.571 -3.484  1.00 17.14 ? 347 GLU A CA    1 
ATOM   2687 C  C     . GLU A 1 350 ? 6.925  38.423 -4.415  1.00 14.73 ? 347 GLU A C     1 
ATOM   2688 O  O     . GLU A 1 350 ? 7.460  39.420 -4.911  1.00 17.20 ? 347 GLU A O     1 
ATOM   2689 C  CB    . GLU A 1 350 ? 6.216  38.559 -2.035  1.00 20.35 ? 347 GLU A CB    1 
ATOM   2690 C  CG    . GLU A 1 350 ? 7.179  39.732 -1.815  1.00 23.96 ? 347 GLU A CG    1 
ATOM   2691 C  CD    . GLU A 1 350 ? 7.980  39.673 -0.529  1.00 36.13 ? 347 GLU A CD    1 
ATOM   2692 O  OE1   . GLU A 1 350 ? 8.849  40.548 -0.347  1.00 35.30 ? 347 GLU A OE1   1 
ATOM   2693 O  OE2   . GLU A 1 350 ? 7.747  38.770 0.293   1.00 42.82 ? 347 GLU A OE2   1 
ATOM   2694 N  N     . LEU A 1 351 ? 7.353  37.186 -4.658  1.00 14.26 ? 348 LEU A N     1 
ATOM   2695 C  CA    . LEU A 1 351 ? 8.495  36.961 -5.540  1.00 13.42 ? 348 LEU A CA    1 
ATOM   2696 C  C     . LEU A 1 351 ? 8.182  37.408 -6.965  1.00 16.31 ? 348 LEU A C     1 
ATOM   2697 O  O     . LEU A 1 351 ? 9.023  38.025 -7.624  1.00 16.98 ? 348 LEU A O     1 
ATOM   2698 C  CB    . LEU A 1 351 ? 8.896  35.492 -5.497  1.00 14.71 ? 348 LEU A CB    1 
ATOM   2699 C  CG    . LEU A 1 351 ? 10.080 35.096 -6.379  1.00 14.38 ? 348 LEU A CG    1 
ATOM   2700 C  CD1   . LEU A 1 351 ? 11.325 35.877 -5.934  1.00 20.98 ? 348 LEU A CD1   1 
ATOM   2701 C  CD2   . LEU A 1 351 ? 10.297 33.602 -6.319  1.00 19.98 ? 348 LEU A CD2   1 
ATOM   2702 N  N     . GLU A 1 352 ? 6.973  37.110 -7.455  1.00 15.54 ? 349 GLU A N     1 
ATOM   2703 C  CA    . GLU A 1 352 ? 6.576  37.572 -8.787  1.00 16.06 ? 349 GLU A CA    1 
ATOM   2704 C  C     . GLU A 1 352 ? 6.662  39.084 -8.902  1.00 17.11 ? 349 GLU A C     1 
ATOM   2705 O  O     . GLU A 1 352 ? 7.190  39.607 -9.892  1.00 15.71 ? 349 GLU A O     1 
ATOM   2706 C  CB    . GLU A 1 352 ? 5.156  37.103 -9.125  1.00 16.60 ? 349 GLU A CB    1 
ATOM   2707 C  CG    . GLU A 1 352 ? 4.784  37.322 -10.601 1.00 23.32 ? 349 GLU A CG    1 
ATOM   2708 C  CD    . GLU A 1 352 ? 3.277  37.251 -10.854 0.42 26.79 ? 349 GLU A CD    1 
ATOM   2709 O  OE1   . GLU A 1 352 ? 2.808  37.774 -11.897 0.30 25.83 ? 349 GLU A OE1   1 
ATOM   2710 O  OE2   . GLU A 1 352 ? 2.551  36.679 -10.008 0.38 26.67 ? 349 GLU A OE2   1 
ATOM   2711 N  N     . GLU A 1 353 ? 6.175  39.806 -7.888  1.00 15.75 ? 350 GLU A N     1 
ATOM   2712 C  CA    . GLU A 1 353 ? 6.251  41.264 -7.918  1.00 12.25 ? 350 GLU A CA    1 
ATOM   2713 C  C     . GLU A 1 353 ? 7.697  41.743 -7.985  1.00 17.21 ? 350 GLU A C     1 
ATOM   2714 O  O     . GLU A 1 353 ? 8.012  42.669 -8.741  1.00 18.79 ? 350 GLU A O     1 
ATOM   2715 C  CB    . GLU A 1 353 ? 5.564  41.850 -6.687  1.00 20.39 ? 350 GLU A CB    1 
ATOM   2716 C  CG    . GLU A 1 353 ? 4.089  41.585 -6.633  1.00 32.38 ? 350 GLU A CG    1 
ATOM   2717 C  CD    . GLU A 1 353 ? 3.427  42.355 -5.518  0.27 32.58 ? 350 GLU A CD    1 
ATOM   2718 O  OE1   . GLU A 1 353 ? 2.189  42.488 -5.545  0.57 39.02 ? 350 GLU A OE1   1 
ATOM   2719 O  OE2   . GLU A 1 353 ? 4.152  42.829 -4.618  0.87 46.53 ? 350 GLU A OE2   1 
ATOM   2720 N  N     . ARG A 1 354 ? 8.590  41.134 -7.192  1.00 15.97 ? 351 ARG A N     1 
ATOM   2721 C  CA    . ARG A 1 354 ? 9.990  41.557 -7.211  1.00 12.20 ? 351 ARG A CA    1 
ATOM   2722 C  C     . ARG A 1 354 ? 10.649 41.219 -8.539  1.00 13.96 ? 351 ARG A C     1 
ATOM   2723 O  O     . ARG A 1 354 ? 11.461 42.000 -9.051  1.00 17.53 ? 351 ARG A O     1 
ATOM   2724 C  CB    . ARG A 1 354 ? 10.781 40.895 -6.067  1.00 15.06 ? 351 ARG A CB    1 
ATOM   2725 C  CG    . ARG A 1 354 ? 10.532 41.483 -4.674  1.00 20.70 ? 351 ARG A CG    1 
ATOM   2726 C  CD    . ARG A 1 354 ? 11.587 40.942 -3.665  1.00 21.20 ? 351 ARG A CD    1 
ATOM   2727 N  NE    . ARG A 1 354 ? 12.952 41.381 -3.973  1.00 28.10 ? 351 ARG A NE    1 
ATOM   2728 C  CZ    . ARG A 1 354 ? 14.055 40.880 -3.410  1.00 26.52 ? 351 ARG A CZ    1 
ATOM   2729 N  NH1   . ARG A 1 354 ? 13.966 39.914 -2.510  1.00 20.53 ? 351 ARG A NH1   1 
ATOM   2730 N  NH2   . ARG A 1 354 ? 15.252 41.333 -3.747  1.00 23.51 ? 351 ARG A NH2   1 
ATOM   2731 N  N     . LEU A 1 355 ? 10.348 40.037 -9.087  1.00 13.86 ? 352 LEU A N     1 
ATOM   2732 C  CA    . LEU A 1 355 ? 10.972 39.620 -10.342 1.00 15.54 ? 352 LEU A CA    1 
ATOM   2733 C  C     . LEU A 1 355 ? 10.521 40.488 -11.505 1.00 15.87 ? 352 LEU A C     1 
ATOM   2734 O  O     . LEU A 1 355 ? 11.319 40.810 -12.395 1.00 15.74 ? 352 LEU A O     1 
ATOM   2735 C  CB    . LEU A 1 355 ? 10.639 38.165 -10.630 1.00 12.96 ? 352 LEU A CB    1 
ATOM   2736 C  CG    . LEU A 1 355 ? 11.343 37.157 -9.731  1.00 17.67 ? 352 LEU A CG    1 
ATOM   2737 C  CD1   . LEU A 1 355 ? 10.817 35.755 -9.995  1.00 15.58 ? 352 LEU A CD1   1 
ATOM   2738 C  CD2   . LEU A 1 355 ? 12.835 37.223 -9.968  1.00 19.77 ? 352 LEU A CD2   1 
ATOM   2739 N  N     . THR A 1 356 ? 9.234  40.837 -11.538 1.00 16.35 ? 353 THR A N     1 
ATOM   2740 C  CA    . THR A 1 356 ? 8.737  41.650 -12.637 1.00 15.05 ? 353 THR A CA    1 
ATOM   2741 C  C     . THR A 1 356 ? 9.374  43.031 -12.611 1.00 17.06 ? 353 THR A C     1 
ATOM   2742 O  O     . THR A 1 356 ? 9.745  43.570 -13.658 1.00 19.14 ? 353 THR A O     1 
ATOM   2743 C  CB    . THR A 1 356 ? 7.209  41.735 -12.579 1.00 16.45 ? 353 THR A CB    1 
ATOM   2744 O  OG1   . THR A 1 356 ? 6.668  40.414 -12.722 1.00 19.06 ? 353 THR A OG1   1 
ATOM   2745 C  CG2   . THR A 1 356 ? 6.686  42.601 -13.715 1.00 22.05 ? 353 THR A CG2   1 
ATOM   2746 N  N     . LYS A 1 357 ? 9.537  43.606 -11.417 1.00 16.17 ? 354 LYS A N     1 
ATOM   2747 C  CA    . LYS A 1 357 ? 10.252 44.869 -11.302 1.00 18.30 ? 354 LYS A CA    1 
ATOM   2748 C  C     . LYS A 1 357 ? 11.703 44.706 -11.733 1.00 18.56 ? 354 LYS A C     1 
ATOM   2749 O  O     . LYS A 1 357 ? 12.247 45.552 -12.454 1.00 18.42 ? 354 LYS A O     1 
ATOM   2750 C  CB    . LYS A 1 357 ? 10.153 45.382 -9.866  1.00 23.03 ? 354 LYS A CB    1 
ATOM   2751 C  CG    . LYS A 1 357 ? 10.992 46.613 -9.565  1.00 29.32 ? 354 LYS A CG    1 
ATOM   2752 C  CD    . LYS A 1 357 ? 10.350 47.863 -10.126 0.46 26.12 ? 354 LYS A CD    1 
ATOM   2753 C  CE    . LYS A 1 357 ? 10.629 49.055 -9.229  0.97 38.16 ? 354 LYS A CE    1 
ATOM   2754 N  NZ    . LYS A 1 357 ? 12.077 49.143 -8.910  1.00 32.65 ? 354 LYS A NZ    1 
ATOM   2755 N  N     . ASP A 1 358 ? 12.332 43.598 -11.335 1.00 18.87 ? 355 ASP A N     1 
ATOM   2756 C  CA    . ASP A 1 358 ? 13.729 43.362 -11.689 1.00 18.93 ? 355 ASP A CA    1 
ATOM   2757 C  C     . ASP A 1 358 ? 13.909 43.265 -13.200 1.00 19.19 ? 355 ASP A C     1 
ATOM   2758 O  O     . ASP A 1 358 ? 14.892 43.774 -13.752 1.00 20.52 ? 355 ASP A O     1 
ATOM   2759 C  CB    . ASP A 1 358 ? 14.224 42.088 -10.994 1.00 17.53 ? 355 ASP A CB    1 
ATOM   2760 C  CG    . ASP A 1 358 ? 15.701 41.808 -11.259 1.00 25.01 ? 355 ASP A CG    1 
ATOM   2761 O  OD1   . ASP A 1 358 ? 16.544 42.494 -10.658 1.00 20.81 ? 355 ASP A OD1   1 
ATOM   2762 O  OD2   . ASP A 1 358 ? 16.009 40.913 -12.067 1.00 22.66 ? 355 ASP A OD2   1 
ATOM   2763 N  N     . ARG A 1 359 ? 12.962 42.621 -13.884 1.00 17.30 ? 356 ARG A N     1 
ATOM   2764 C  CA    . ARG A 1 359 ? 13.056 42.463 -15.332 1.00 17.59 ? 356 ARG A CA    1 
ATOM   2765 C  C     . ARG A 1 359 ? 12.937 43.809 -16.042 1.00 18.85 ? 356 ARG A C     1 
ATOM   2766 O  O     . ARG A 1 359 ? 13.675 44.078 -16.996 1.00 21.18 ? 356 ARG A O     1 
ATOM   2767 C  CB    . ARG A 1 359 ? 11.970 41.504 -15.818 1.00 20.81 ? 356 ARG A CB    1 
ATOM   2768 C  CG    . ARG A 1 359 ? 12.074 41.100 -17.287 1.00 21.72 ? 356 ARG A CG    1 
ATOM   2769 C  CD    . ARG A 1 359 ? 10.921 40.173 -17.646 1.00 22.34 ? 356 ARG A CD    1 
ATOM   2770 N  NE    . ARG A 1 359 ? 9.626  40.845 -17.529 1.00 25.31 ? 356 ARG A NE    1 
ATOM   2771 C  CZ    . ARG A 1 359 ? 8.462  40.218 -17.365 1.00 29.64 ? 356 ARG A CZ    1 
ATOM   2772 N  NH1   . ARG A 1 359 ? 8.419  38.893 -17.286 1.00 33.73 ? 356 ARG A NH1   1 
ATOM   2773 N  NH2   . ARG A 1 359 ? 7.337  40.919 -17.275 1.00 26.00 ? 356 ARG A NH2   1 
ATOM   2774 N  N     . ASN A 1 360 ? 12.024 44.672 -15.579 1.00 19.94 ? 357 ASN A N     1 
ATOM   2775 C  CA    . ASN A 1 360 ? 11.877 46.005 -16.168 1.00 20.92 ? 357 ASN A CA    1 
ATOM   2776 C  C     . ASN A 1 360 ? 13.074 46.899 -15.859 1.00 22.22 ? 357 ASN A C     1 
ATOM   2777 O  O     . ASN A 1 360 ? 13.494 47.703 -16.702 1.00 23.69 ? 357 ASN A O     1 
ATOM   2778 C  CB    . ASN A 1 360 ? 10.602 46.669 -15.648 1.00 15.43 ? 357 ASN A CB    1 
ATOM   2779 C  CG    . ASN A 1 360 ? 9.345  46.123 -16.293 1.00 26.45 ? 357 ASN A CG    1 
ATOM   2780 O  OD1   . ASN A 1 360 ? 9.339  45.789 -17.470 1.00 27.60 ? 357 ASN A OD1   1 
ATOM   2781 N  ND2   . ASN A 1 360 ? 8.267  46.050 -15.522 1.00 31.05 ? 357 ASN A ND2   1 
ATOM   2782 N  N     . ASP A 1 361 ? 13.616 46.797 -14.643 1.00 18.96 ? 358 ASP A N     1 
ATOM   2783 C  CA    . ASP A 1 361 ? 14.687 47.692 -14.220 1.00 21.24 ? 358 ASP A CA    1 
ATOM   2784 C  C     . ASP A 1 361 ? 16.036 47.279 -14.791 1.00 23.64 ? 358 ASP A C     1 
ATOM   2785 O  O     . ASP A 1 361 ? 16.829 48.138 -15.198 1.00 23.11 ? 358 ASP A O     1 
ATOM   2786 C  CB    . ASP A 1 361 ? 14.787 47.729 -12.694 1.00 19.13 ? 358 ASP A CB    1 
ATOM   2787 C  CG    . ASP A 1 361 ? 13.646 48.491 -12.039 1.00 30.23 ? 358 ASP A CG    1 
ATOM   2788 O  OD1   . ASP A 1 361 ? 12.905 49.208 -12.747 1.00 32.44 ? 358 ASP A OD1   1 
ATOM   2789 O  OD2   . ASP A 1 361 ? 13.500 48.374 -10.803 1.00 36.06 ? 358 ASP A OD2   1 
ATOM   2790 N  N     . ASN A 1 362 ? 16.323 45.978 -14.814 1.00 19.77 ? 359 ASN A N     1 
ATOM   2791 C  CA    . ASN A 1 362 ? 17.692 45.509 -14.995 1.00 26.23 ? 359 ASN A CA    1 
ATOM   2792 C  C     . ASN A 1 362 ? 17.876 44.608 -16.210 1.00 21.97 ? 359 ASN A C     1 
ATOM   2793 O  O     . ASN A 1 362 ? 18.954 44.037 -16.375 1.00 24.00 ? 359 ASN A O     1 
ATOM   2794 C  CB    . ASN A 1 362 ? 18.160 44.804 -13.715 1.00 20.92 ? 359 ASN A CB    1 
ATOM   2795 C  CG    . ASN A 1 362 ? 18.067 45.710 -12.498 1.00 29.03 ? 359 ASN A CG    1 
ATOM   2796 O  OD1   . ASN A 1 362 ? 18.481 46.865 -12.549 1.00 24.21 ? 359 ASN A OD1   1 
ATOM   2797 N  ND2   . ASN A 1 362 ? 17.508 45.196 -11.403 1.00 26.95 ? 359 ASN A ND2   1 
ATOM   2798 N  N     . ASP A 1 363 ? 16.865 44.476 -17.069 1.00 17.72 ? 360 ASP A N     1 
ATOM   2799 C  CA    . ASP A 1 363 ? 17.008 43.791 -18.357 1.00 20.49 ? 360 ASP A CA    1 
ATOM   2800 C  C     . ASP A 1 363 ? 17.536 42.365 -18.196 1.00 28.77 ? 360 ASP A C     1 
ATOM   2801 O  O     . ASP A 1 363 ? 18.507 41.962 -18.840 1.00 24.15 ? 360 ASP A O     1 
ATOM   2802 C  CB    . ASP A 1 363 ? 17.906 44.599 -19.303 1.00 23.51 ? 360 ASP A CB    1 
ATOM   2803 C  CG    . ASP A 1 363 ? 17.370 45.999 -19.561 1.00 29.97 ? 360 ASP A CG    1 
ATOM   2804 O  OD1   . ASP A 1 363 ? 16.281 46.120 -20.169 1.00 30.72 ? 360 ASP A OD1   1 
ATOM   2805 O  OD2   . ASP A 1 363 ? 18.037 46.977 -19.161 1.00 34.13 ? 360 ASP A OD2   1 
ATOM   2806 N  N     . ARG A 1 364 ? 16.870 41.588 -17.346 1.00 23.41 ? 361 ARG A N     1 
ATOM   2807 C  CA    . ARG A 1 364 ? 17.284 40.214 -17.106 1.00 26.19 ? 361 ARG A CA    1 
ATOM   2808 C  C     . ARG A 1 364 ? 16.085 39.410 -16.624 1.00 24.66 ? 361 ARG A C     1 
ATOM   2809 O  O     . ARG A 1 364 ? 15.101 39.969 -16.127 1.00 20.32 ? 361 ARG A O     1 
ATOM   2810 C  CB    . ARG A 1 364 ? 18.436 40.153 -16.098 1.00 22.53 ? 361 ARG A CB    1 
ATOM   2811 C  CG    . ARG A 1 364 ? 18.089 40.707 -14.722 1.00 21.04 ? 361 ARG A CG    1 
ATOM   2812 C  CD    . ARG A 1 364 ? 19.211 40.460 -13.725 1.00 23.89 ? 361 ARG A CD    1 
ATOM   2813 N  NE    . ARG A 1 364 ? 18.835 40.834 -12.358 1.00 21.72 ? 361 ARG A NE    1 
ATOM   2814 C  CZ    . ARG A 1 364 ? 19.637 40.704 -11.307 1.00 23.92 ? 361 ARG A CZ    1 
ATOM   2815 N  NH1   . ARG A 1 364 ? 20.857 40.212 -11.469 1.00 30.54 ? 361 ARG A NH1   1 
ATOM   2816 N  NH2   . ARG A 1 364 ? 19.220 41.059 -10.094 1.00 24.71 ? 361 ARG A NH2   1 
ATOM   2817 N  N     . VAL A 1 365 ? 16.186 38.086 -16.780 1.00 22.10 ? 362 VAL A N     1 
ATOM   2818 C  CA    . VAL A 1 365 ? 15.142 37.148 -16.384 1.00 20.69 ? 362 VAL A CA    1 
ATOM   2819 C  C     . VAL A 1 365 ? 15.770 35.960 -15.666 1.00 20.45 ? 362 VAL A C     1 
ATOM   2820 O  O     . VAL A 1 365 ? 16.792 35.416 -16.103 1.00 20.40 ? 362 VAL A O     1 
ATOM   2821 C  CB    . VAL A 1 365 ? 14.322 36.671 -17.602 1.00 23.86 ? 362 VAL A CB    1 
ATOM   2822 C  CG1   . VAL A 1 365 ? 15.237 36.110 -18.684 1.00 33.40 ? 362 VAL A CG1   1 
ATOM   2823 C  CG2   . VAL A 1 365 ? 13.311 35.633 -17.183 0.38 20.21 ? 362 VAL A CG2   1 
ATOM   2824 N  N     . ALA A 1 366 ? 15.166 35.564 -14.549 1.00 16.33 ? 363 ALA A N     1 
ATOM   2825 C  CA    . ALA A 1 366 ? 15.612 34.370 -13.853 1.00 18.32 ? 363 ALA A CA    1 
ATOM   2826 C  C     . ALA A 1 366 ? 15.119 33.124 -14.581 1.00 19.17 ? 363 ALA A C     1 
ATOM   2827 O  O     . ALA A 1 366 ? 14.027 33.110 -15.157 1.00 20.00 ? 363 ALA A O     1 
ATOM   2828 C  CB    . ALA A 1 366 ? 15.102 34.384 -12.414 1.00 17.56 ? 363 ALA A CB    1 
ATOM   2829 N  N     . THR A 1 367 ? 15.927 32.061 -14.549 1.00 17.71 ? 364 THR A N     1 
ATOM   2830 C  CA    . THR A 1 367 ? 15.580 30.840 -15.261 1.00 17.53 ? 364 THR A CA    1 
ATOM   2831 C  C     . THR A 1 367 ? 15.440 29.604 -14.380 1.00 18.97 ? 364 THR A C     1 
ATOM   2832 O  O     . THR A 1 367 ? 15.023 28.556 -14.883 1.00 19.48 ? 364 THR A O     1 
ATOM   2833 C  CB    . THR A 1 367 ? 16.616 30.546 -16.360 1.00 25.21 ? 364 THR A CB    1 
ATOM   2834 O  OG1   . THR A 1 367 ? 17.901 30.342 -15.768 1.00 24.32 ? 364 THR A OG1   1 
ATOM   2835 C  CG2   . THR A 1 367 ? 16.706 31.717 -17.319 1.00 23.62 ? 364 THR A CG2   1 
ATOM   2836 N  N     . GLN A 1 368 ? 15.759 29.692 -13.094 1.00 19.50 ? 365 GLN A N     1 
ATOM   2837 C  CA    . GLN A 1 368 ? 15.678 28.566 -12.180 1.00 20.93 ? 365 GLN A CA    1 
ATOM   2838 C  C     . GLN A 1 368 ? 14.989 28.999 -10.892 1.00 16.66 ? 365 GLN A C     1 
ATOM   2839 O  O     . GLN A 1 368 ? 15.254 30.082 -10.371 1.00 19.69 ? 365 GLN A O     1 
ATOM   2840 C  CB    . GLN A 1 368 ? 17.064 28.022 -11.856 1.00 22.07 ? 365 GLN A CB    1 
ATOM   2841 C  CG    . GLN A 1 368 ? 17.075 26.798 -10.964 1.00 22.81 ? 365 GLN A CG    1 
ATOM   2842 C  CD    . GLN A 1 368 ? 18.488 26.349 -10.646 1.00 26.11 ? 365 GLN A CD    1 
ATOM   2843 O  OE1   . GLN A 1 368 ? 19.252 27.067 -9.998  1.00 32.87 ? 365 GLN A OE1   1 
ATOM   2844 N  NE2   . GLN A 1 368 ? 18.856 25.170 -11.131 1.00 31.63 ? 365 GLN A NE2   1 
ATOM   2845 N  N     . LEU A 1 369 ? 14.118 28.137 -10.385 1.00 18.50 ? 366 LEU A N     1 
ATOM   2846 C  CA    . LEU A 1 369 ? 13.444 28.342 -9.105  1.00 16.56 ? 366 LEU A CA    1 
ATOM   2847 C  C     . LEU A 1 369 ? 13.963 27.304 -8.121  1.00 17.32 ? 366 LEU A C     1 
ATOM   2848 O  O     . LEU A 1 369 ? 13.887 26.103 -8.390  1.00 19.99 ? 366 LEU A O     1 
ATOM   2849 C  CB    . LEU A 1 369 ? 11.926 28.222 -9.271  1.00 20.43 ? 366 LEU A CB    1 
ATOM   2850 C  CG    . LEU A 1 369 ? 11.081 28.497 -8.015  1.00 21.06 ? 366 LEU A CG    1 
ATOM   2851 C  CD1   . LEU A 1 369 ? 11.175 29.957 -7.625  1.00 23.14 ? 366 LEU A CD1   1 
ATOM   2852 C  CD2   . LEU A 1 369 ? 9.623  28.087 -8.232  1.00 26.84 ? 366 LEU A CD2   1 
ATOM   2853 N  N     . VAL A 1 370 ? 14.499 27.762 -6.991  1.00 14.76 ? 367 VAL A N     1 
ATOM   2854 C  CA    . VAL A 1 370 ? 14.987 26.890 -5.933  1.00 12.75 ? 367 VAL A CA    1 
ATOM   2855 C  C     . VAL A 1 370 ? 14.004 26.952 -4.773  1.00 15.53 ? 367 VAL A C     1 
ATOM   2856 O  O     . VAL A 1 370 ? 13.680 28.043 -4.287  1.00 19.42 ? 367 VAL A O     1 
ATOM   2857 C  CB    . VAL A 1 370 ? 16.399 27.298 -5.478  1.00 20.22 ? 367 VAL A CB    1 
ATOM   2858 C  CG1   . VAL A 1 370 ? 16.827 26.443 -4.301  1.00 24.96 ? 367 VAL A CG1   1 
ATOM   2859 C  CG2   . VAL A 1 370 ? 17.396 27.162 -6.642  1.00 16.64 ? 367 VAL A CG2   1 
ATOM   2860 N  N     . VAL A 1 371 ? 13.536 25.789 -4.326  1.00 15.96 ? 368 VAL A N     1 
ATOM   2861 C  CA    . VAL A 1 371 ? 12.617 25.690 -3.194  1.00 16.72 ? 368 VAL A CA    1 
ATOM   2862 C  C     . VAL A 1 371 ? 13.385 25.081 -2.027  1.00 17.57 ? 368 VAL A C     1 
ATOM   2863 O  O     . VAL A 1 371 ? 13.981 24.007 -2.164  1.00 20.81 ? 368 VAL A O     1 
ATOM   2864 C  CB    . VAL A 1 371 ? 11.376 24.861 -3.553  1.00 19.87 ? 368 VAL A CB    1 
ATOM   2865 C  CG1   . VAL A 1 371 ? 10.318 24.966 -2.445  1.00 26.40 ? 368 VAL A CG1   1 
ATOM   2866 C  CG2   . VAL A 1 371 ? 10.814 25.314 -4.888  1.00 25.51 ? 368 VAL A CG2   1 
ATOM   2867 N  N     . SER A 1 372 ? 13.411 25.787 -0.892  1.00 18.39 ? 369 SER A N     1 
ATOM   2868 C  CA    . SER A 1 372 ? 14.081 25.338 0.323   1.00 18.33 ? 369 SER A CA    1 
ATOM   2869 C  C     . SER A 1 372 ? 13.057 25.243 1.450   1.00 19.13 ? 369 SER A C     1 
ATOM   2870 O  O     . SER A 1 372 ? 12.233 26.141 1.614   1.00 23.98 ? 369 SER A O     1 
ATOM   2871 C  CB    . SER A 1 372 ? 15.201 26.312 0.712   1.00 19.96 ? 369 SER A CB    1 
ATOM   2872 O  OG    . SER A 1 372 ? 15.855 25.924 1.909   1.00 31.86 ? 369 SER A OG    1 
ATOM   2873 N  N     . ILE A 1 373 ? 13.103 24.164 2.231   1.00 17.29 ? 370 ILE A N     1 
ATOM   2874 C  CA    . ILE A 1 373 ? 12.241 24.027 3.401   1.00 17.66 ? 370 ILE A CA    1 
ATOM   2875 C  C     . ILE A 1 373 ? 13.079 23.611 4.604   1.00 22.76 ? 370 ILE A C     1 
ATOM   2876 O  O     . ILE A 1 373 ? 14.171 23.055 4.470   1.00 20.95 ? 370 ILE A O     1 
ATOM   2877 C  CB    . ILE A 1 373 ? 11.112 23.000 3.175   1.00 17.12 ? 370 ILE A CB    1 
ATOM   2878 C  CG1   . ILE A 1 373 ? 11.716 21.589 3.062   1.00 25.23 ? 370 ILE A CG1   1 
ATOM   2879 C  CG2   . ILE A 1 373 ? 10.268 23.371 1.944   1.00 21.71 ? 370 ILE A CG2   1 
ATOM   2880 C  CD1   . ILE A 1 373 ? 10.709 20.515 2.852   1.00 27.94 ? 370 ILE A CD1   1 
ATOM   2881 N  N     . ARG A 1 374 ? 12.555 23.882 5.796   1.00 20.70 ? 371 ARG A N     1 
ATOM   2882 C  CA    . ARG A 1 374 ? 13.086 23.304 7.023   1.00 21.14 ? 371 ARG A CA    1 
ATOM   2883 C  C     . ARG A 1 374 ? 11.984 22.531 7.731   1.00 24.12 ? 371 ARG A C     1 
ATOM   2884 O  O     . ARG A 1 374 ? 10.830 22.973 7.769   1.00 25.12 ? 371 ARG A O     1 
ATOM   2885 C  CB    . ARG A 1 374 ? 13.644 24.370 7.975   1.00 21.21 ? 371 ARG A CB    1 
ATOM   2886 C  CG    . ARG A 1 374 ? 14.453 23.770 9.133   1.00 25.91 ? 371 ARG A CG    1 
ATOM   2887 C  CD    . ARG A 1 374 ? 14.777 24.777 10.191  1.00 33.88 ? 371 ARG A CD    1 
ATOM   2888 N  NE    . ARG A 1 374 ? 15.250 26.041 9.621   1.00 31.61 ? 371 ARG A NE    1 
ATOM   2889 C  CZ    . ARG A 1 374 ? 14.692 27.230 9.842   0.23 33.14 ? 371 ARG A CZ    1 
ATOM   2890 N  NH1   . ARG A 1 374 ? 13.624 27.321 10.639  0.93 35.65 ? 371 ARG A NH1   1 
ATOM   2891 N  NH2   . ARG A 1 374 ? 15.222 28.310 9.277   0.72 36.92 ? 371 ARG A NH2   1 
ATOM   2892 N  N     . VAL A 1 375 ? 12.349 21.395 8.321   1.00 25.12 ? 372 VAL A N     1 
ATOM   2893 C  CA    . VAL A 1 375 ? 11.382 20.552 9.011   1.00 29.74 ? 372 VAL A CA    1 
ATOM   2894 C  C     . VAL A 1 375 ? 11.579 20.710 10.512  1.00 26.03 ? 372 VAL A C     1 
ATOM   2895 O  O     . VAL A 1 375 ? 12.673 21.033 10.993  1.00 27.68 ? 372 VAL A O     1 
ATOM   2896 C  CB    . VAL A 1 375 ? 11.497 19.079 8.581   1.00 31.43 ? 372 VAL A CB    1 
ATOM   2897 C  CG1   . VAL A 1 375 ? 11.472 18.985 7.064   1.00 30.97 ? 372 VAL A CG1   1 
ATOM   2898 C  CG2   . VAL A 1 375 ? 12.759 18.458 9.149   1.00 35.80 ? 372 VAL A CG2   1 
ATOM   2899 N  N     . GLN A 1 376 ? 10.494 20.502 11.253  1.00 25.95 ? 373 GLN A N     1 
ATOM   2900 C  CA    . GLN A 1 376 ? 10.516 20.741 12.690  1.00 32.97 ? 373 GLN A CA    1 
ATOM   2901 C  C     . GLN A 1 376 ? 11.514 19.821 13.377  1.00 28.61 ? 373 GLN A C     1 
ATOM   2902 O  O     . GLN A 1 376 ? 11.530 18.611 13.135  1.00 38.64 ? 373 GLN A O     1 
ATOM   2903 C  CB    . GLN A 1 376 ? 9.125  20.535 13.285  1.00 31.43 ? 373 GLN A CB    1 
ATOM   2904 C  CG    . GLN A 1 376 ? 9.052  20.938 14.749  1.00 31.54 ? 373 GLN A CG    1 
ATOM   2905 C  CD    . GLN A 1 376 ? 7.776  21.681 15.084  1.00 42.22 ? 373 GLN A CD    1 
ATOM   2906 O  OE1   . GLN A 1 376 ? 6.679  21.134 14.972  1.00 36.09 ? 373 GLN A OE1   1 
ATOM   2907 N  NE2   . GLN A 1 376 ? 7.911  22.944 15.482  1.00 40.96 ? 373 GLN A NE2   1 
ATOM   2908 N  N     . GLY A 1 377 ? 12.346 20.407 14.241  1.00 31.60 ? 374 GLY A N     1 
ATOM   2909 C  CA    . GLY A 1 377 ? 13.398 19.693 14.935  1.00 39.25 ? 374 GLY A CA    1 
ATOM   2910 C  C     . GLY A 1 377 ? 14.775 19.843 14.322  1.00 47.16 ? 374 GLY A C     1 
ATOM   2911 O  O     . GLY A 1 377 ? 15.770 19.503 14.976  1.00 42.61 ? 374 GLY A O     1 
ATOM   2912 N  N     . ASP A 1 378 ? 14.863 20.346 13.094  1.00 29.87 ? 375 ASP A N     1 
ATOM   2913 C  CA    . ASP A 1 378 ? 16.133 20.474 12.393  1.00 35.25 ? 375 ASP A CA    1 
ATOM   2914 C  C     . ASP A 1 378 ? 16.765 21.825 12.717  1.00 41.19 ? 375 ASP A C     1 
ATOM   2915 O  O     . ASP A 1 378 ? 16.102 22.866 12.638  1.00 38.91 ? 375 ASP A O     1 
ATOM   2916 C  CB    . ASP A 1 378 ? 15.911 20.322 10.887  1.00 37.65 ? 375 ASP A CB    1 
ATOM   2917 C  CG    . ASP A 1 378 ? 17.174 19.955 10.139  1.00 40.40 ? 375 ASP A CG    1 
ATOM   2918 O  OD1   . ASP A 1 378 ? 18.284 20.189 10.673  1.00 35.05 ? 375 ASP A OD1   1 
ATOM   2919 O  OD2   . ASP A 1 378 ? 17.045 19.434 9.010   1.00 37.90 ? 375 ASP A OD2   1 
ATOM   2920 N  N     . LYS A 1 379 ? 18.041 21.805 13.094  1.00 37.82 ? 376 LYS A N     1 
ATOM   2921 C  CA    . LYS A 1 379 ? 18.742 23.023 13.473  1.00 44.93 ? 376 LYS A CA    1 
ATOM   2922 C  C     . LYS A 1 379 ? 19.347 23.758 12.286  1.00 46.34 ? 376 LYS A C     1 
ATOM   2923 O  O     . LYS A 1 379 ? 19.765 24.911 12.436  1.00 39.63 ? 376 LYS A O     1 
ATOM   2924 N  N     . ARG A 1 380 ? 19.395 23.124 11.118  1.00 39.76 ? 377 ARG A N     1 
ATOM   2925 C  CA    . ARG A 1 380 ? 19.994 23.734 9.944   1.00 43.58 ? 377 ARG A CA    1 
ATOM   2926 C  C     . ARG A 1 380 ? 19.078 24.808 9.365   1.00 32.56 ? 377 ARG A C     1 
ATOM   2927 O  O     . ARG A 1 380 ? 17.862 24.811 9.574   1.00 39.18 ? 377 ARG A O     1 
ATOM   2928 C  CB    . ARG A 1 380 ? 20.285 22.674 8.882   1.00 37.54 ? 377 ARG A CB    1 
ATOM   2929 C  CG    . ARG A 1 380 ? 21.169 21.532 9.362   1.00 36.63 ? 377 ARG A CG    1 
ATOM   2930 C  CD    . ARG A 1 380 ? 21.232 20.424 8.326   1.00 37.94 ? 377 ARG A CD    1 
ATOM   2931 N  NE    . ARG A 1 380 ? 19.982 19.668 8.238   1.00 39.42 ? 377 ARG A NE    1 
ATOM   2932 C  CZ    . ARG A 1 380 ? 19.741 18.732 7.323   1.00 38.27 ? 377 ARG A CZ    1 
ATOM   2933 N  NH1   . ARG A 1 380 ? 20.663 18.439 6.412   1.00 34.79 ? 377 ARG A NH1   1 
ATOM   2934 N  NH2   . ARG A 1 380 ? 18.581 18.088 7.314   1.00 38.37 ? 377 ARG A NH2   1 
ATOM   2935 N  N     . LEU A 1 381 ? 19.688 25.738 8.629   1.00 29.36 ? 378 LEU A N     1 
ATOM   2936 C  CA    . LEU A 1 381 ? 18.906 26.719 7.886   1.00 34.08 ? 378 LEU A CA    1 
ATOM   2937 C  C     . LEU A 1 381 ? 17.951 26.025 6.921   1.00 35.32 ? 378 LEU A C     1 
ATOM   2938 O  O     . LEU A 1 381 ? 16.744 26.289 6.921   1.00 36.01 ? 378 LEU A O     1 
ATOM   2939 C  CB    . LEU A 1 381 ? 19.837 27.674 7.136   1.00 35.22 ? 378 LEU A CB    1 
ATOM   2940 N  N     . SER A 1 382 ? 18.474 25.121 6.098   1.00 34.15 ? 379 SER A N     1 
ATOM   2941 C  CA    . SER A 1 382 ? 17.661 24.352 5.166   1.00 31.52 ? 379 SER A CA    1 
ATOM   2942 C  C     . SER A 1 382 ? 17.762 22.875 5.506   1.00 26.51 ? 379 SER A C     1 
ATOM   2943 O  O     . SER A 1 382 ? 18.863 22.361 5.734   1.00 27.98 ? 379 SER A O     1 
ATOM   2944 C  CB    . SER A 1 382 ? 18.101 24.578 3.720   1.00 27.93 ? 379 SER A CB    1 
ATOM   2945 O  OG    . SER A 1 382 ? 17.390 23.709 2.852   1.00 35.28 ? 379 SER A OG    1 
ATOM   2946 N  N     . SER A 1 383 ? 16.613 22.203 5.547   1.00 25.15 ? 380 SER A N     1 
ATOM   2947 C  CA    . SER A 1 383 ? 16.581 20.749 5.610   1.00 23.18 ? 380 SER A CA    1 
ATOM   2948 C  C     . SER A 1 383 ? 16.631 20.117 4.234   1.00 26.61 ? 380 SER A C     1 
ATOM   2949 O  O     . SER A 1 383 ? 17.016 18.950 4.112   1.00 26.62 ? 380 SER A O     1 
ATOM   2950 C  CB    . SER A 1 383 ? 15.312 20.264 6.318   1.00 26.64 ? 380 SER A CB    1 
ATOM   2951 O  OG    . SER A 1 383 ? 15.197 20.822 7.613   1.00 26.42 ? 380 SER A OG    1 
ATOM   2952 N  N     . LEU A 1 384 ? 16.249 20.862 3.201   1.00 23.79 ? 381 LEU A N     1 
ATOM   2953 C  CA    . LEU A 1 384 ? 16.086 20.298 1.871   1.00 20.36 ? 381 LEU A CA    1 
ATOM   2954 C  C     . LEU A 1 384 ? 15.946 21.397 0.830   1.00 23.11 ? 381 LEU A C     1 
ATOM   2955 O  O     . LEU A 1 384 ? 15.185 22.349 1.040   1.00 22.70 ? 381 LEU A O     1 
ATOM   2956 C  CB    . LEU A 1 384 ? 14.852 19.404 1.822   1.00 21.43 ? 381 LEU A CB    1 
ATOM   2957 C  CG    . LEU A 1 384 ? 14.691 18.747 0.454   1.00 30.27 ? 381 LEU A CG    1 
ATOM   2958 C  CD1   . LEU A 1 384 ? 15.161 17.290 0.495   1.00 43.80 ? 381 LEU A CD1   1 
ATOM   2959 C  CD2   . LEU A 1 384 ? 13.278 18.889 -0.068  1.00 37.07 ? 381 LEU A CD2   1 
ATOM   2960 N  N     . ARG A 1 385 ? 16.660 21.268 -0.294  1.00 25.17 ? 382 ARG A N     1 
ATOM   2961 C  CA    . ARG A 1 385 ? 16.536 22.167 -1.436  1.00 17.60 ? 382 ARG A CA    1 
ATOM   2962 C  C     . ARG A 1 385 ? 16.286 21.353 -2.699  1.00 16.17 ? 382 ARG A C     1 
ATOM   2963 O  O     . ARG A 1 385 ? 16.954 20.342 -2.936  1.00 18.57 ? 382 ARG A O     1 
ATOM   2964 C  CB    . ARG A 1 385 ? 17.799 23.022 -1.639  1.00 20.56 ? 382 ARG A CB    1 
ATOM   2965 C  CG    . ARG A 1 385 ? 17.841 24.303 -0.824  1.00 25.84 ? 382 ARG A CG    1 
ATOM   2966 C  CD    . ARG A 1 385 ? 19.276 24.876 -0.734  1.00 24.89 ? 382 ARG A CD    1 
ATOM   2967 N  NE    . ARG A 1 385 ? 20.021 24.278 0.377   1.00 27.72 ? 382 ARG A NE    1 
ATOM   2968 C  CZ    . ARG A 1 385 ? 21.228 24.674 0.777   1.00 28.66 ? 382 ARG A CZ    1 
ATOM   2969 N  NH1   . ARG A 1 385 ? 21.853 25.663 0.150   1.00 26.23 ? 382 ARG A NH1   1 
ATOM   2970 N  NH2   . ARG A 1 385 ? 21.814 24.070 1.803   1.00 24.67 ? 382 ARG A NH2   1 
ATOM   2971 N  N     . ARG A 1 386 ? 15.327 21.803 -3.508  1.00 14.90 ? 383 ARG A N     1 
ATOM   2972 C  CA    . ARG A 1 386 ? 15.059 21.224 -4.822  1.00 17.45 ? 383 ARG A CA    1 
ATOM   2973 C  C     . ARG A 1 386 ? 14.859 22.368 -5.804  1.00 22.46 ? 383 ARG A C     1 
ATOM   2974 O  O     . ARG A 1 386 ? 14.526 23.485 -5.412  1.00 20.08 ? 383 ARG A O     1 
ATOM   2975 C  CB    . ARG A 1 386 ? 13.826 20.317 -4.806  1.00 17.39 ? 383 ARG A CB    1 
ATOM   2976 C  CG    . ARG A 1 386 ? 13.952 19.091 -3.920  1.00 16.58 ? 383 ARG A CG    1 
ATOM   2977 C  CD    . ARG A 1 386 ? 14.865 18.076 -4.569  1.00 18.36 ? 383 ARG A CD    1 
ATOM   2978 N  NE    . ARG A 1 386 ? 14.972 16.821 -3.829  1.00 19.47 ? 383 ARG A NE    1 
ATOM   2979 C  CZ    . ARG A 1 386 ? 15.844 16.595 -2.850  1.00 26.31 ? 383 ARG A CZ    1 
ATOM   2980 N  NH1   . ARG A 1 386 ? 16.677 17.553 -2.462  1.00 28.62 ? 383 ARG A NH1   1 
ATOM   2981 N  NH2   . ARG A 1 386 ? 15.883 15.404 -2.253  1.00 30.29 ? 383 ARG A NH2   1 
ATOM   2982 N  N     A CYS A 1 387 ? 15.049 22.075 -7.084  0.48 23.57 ? 384 CYS A N     1 
ATOM   2983 N  N     B CYS A 1 387 ? 15.062 22.093 -7.093  0.52 23.57 ? 384 CYS A N     1 
ATOM   2984 C  CA    A CYS A 1 387 ? 14.927 23.081 -8.124  0.48 22.11 ? 384 CYS A CA    1 
ATOM   2985 C  CA    B CYS A 1 387 ? 14.975 23.134 -8.109  0.52 22.10 ? 384 CYS A CA    1 
ATOM   2986 C  C     A CYS A 1 387 ? 13.895 22.668 -9.160  0.48 24.03 ? 384 CYS A C     1 
ATOM   2987 C  C     B CYS A 1 387 ? 14.154 22.665 -9.303  0.52 24.14 ? 384 CYS A C     1 
ATOM   2988 O  O     A CYS A 1 387 ? 13.419 21.530 -9.198  0.48 23.91 ? 384 CYS A O     1 
ATOM   2989 O  O     B CYS A 1 387 ? 14.063 21.468 -9.583  0.52 24.88 ? 384 CYS A O     1 
ATOM   2990 C  CB    A CYS A 1 387 ? 16.267 23.330 -8.823  0.48 26.85 ? 384 CYS A CB    1 
ATOM   2991 C  CB    B CYS A 1 387 ? 16.372 23.577 -8.586  0.52 26.32 ? 384 CYS A CB    1 
ATOM   2992 S  SG    A CYS A 1 387 ? 17.589 23.735 -7.706  0.48 26.34 ? 384 CYS A SG    1 
ATOM   2993 S  SG    B CYS A 1 387 ? 17.375 22.268 -9.320  0.52 35.84 ? 384 CYS A SG    1 
ATOM   2994 N  N     . CYS A 1 388 ? 13.563 23.631 -10.008 1.00 28.77 ? 385 CYS A N     1 
ATOM   2995 C  CA    . CYS A 1 388 ? 12.793 23.370 -11.216 1.00 27.89 ? 385 CYS A CA    1 
ATOM   2996 C  C     . CYS A 1 388 ? 12.970 24.572 -12.130 1.00 28.26 ? 385 CYS A C     1 
ATOM   2997 O  O     . CYS A 1 388 ? 13.545 25.591 -11.742 1.00 22.38 ? 385 CYS A O     1 
ATOM   2998 C  CB    . CYS A 1 388 ? 11.314 23.112 -10.907 1.00 26.08 ? 385 CYS A CB    1 
ATOM   2999 S  SG    . CYS A 1 388 ? 10.449 24.522 -10.197 1.00 30.04 ? 385 CYS A SG    1 
ATOM   3000 N  N     . ALA A 1 389 ? 12.476 24.449 -13.357 1.00 24.54 ? 386 ALA A N     1 
ATOM   3001 C  CA    . ALA A 1 389 ? 12.628 25.527 -14.319 1.00 22.79 ? 386 ALA A CA    1 
ATOM   3002 C  C     . ALA A 1 389 ? 11.673 26.671 -14.002 1.00 25.37 ? 386 ALA A C     1 
ATOM   3003 O  O     . ALA A 1 389 ? 10.506 26.454 -13.666 1.00 28.67 ? 386 ALA A O     1 
ATOM   3004 C  CB    . ALA A 1 389 ? 12.382 25.013 -15.739 1.00 25.02 ? 386 ALA A CB    1 
ATOM   3005 N  N     . LEU A 1 390 ? 12.182 27.895 -14.097 1.00 19.50 ? 387 LEU A N     1 
ATOM   3006 C  CA    . LEU A 1 390 ? 11.364 29.099 -13.979 1.00 21.59 ? 387 LEU A CA    1 
ATOM   3007 C  C     . LEU A 1 390 ? 11.185 29.635 -15.393 1.00 26.42 ? 387 LEU A C     1 
ATOM   3008 O  O     . LEU A 1 390 ? 12.076 30.289 -15.940 1.00 26.51 ? 387 LEU A O     1 
ATOM   3009 C  CB    . LEU A 1 390 ? 12.028 30.123 -13.066 1.00 23.64 ? 387 LEU A CB    1 
ATOM   3010 C  CG    . LEU A 1 390 ? 11.150 31.137 -12.326 1.00 25.01 ? 387 LEU A CG    1 
ATOM   3011 C  CD1   . LEU A 1 390 ? 12.037 31.993 -11.439 1.00 18.84 ? 387 LEU A CD1   1 
ATOM   3012 C  CD2   . LEU A 1 390 ? 10.321 32.011 -13.262 1.00 23.19 ? 387 LEU A CD2   1 
ATOM   3013 N  N     . THR A 1 391 ? 10.033 29.351 -15.992 1.00 23.60 ? 388 THR A N     1 
ATOM   3014 C  CA    . THR A 1 391 ? 9.789  29.742 -17.371 1.00 20.13 ? 388 THR A CA    1 
ATOM   3015 C  C     . THR A 1 391 ? 8.795  30.876 -17.524 1.00 29.37 ? 388 THR A C     1 
ATOM   3016 O  O     . THR A 1 391 ? 8.733  31.473 -18.602 1.00 30.16 ? 388 THR A O     1 
ATOM   3017 C  CB    . THR A 1 391 ? 9.295  28.540 -18.183 1.00 25.30 ? 388 THR A CB    1 
ATOM   3018 O  OG1   . THR A 1 391 ? 8.084  28.033 -17.608 1.00 32.80 ? 388 THR A OG1   1 
ATOM   3019 C  CG2   . THR A 1 391 ? 10.338 27.450 -18.165 1.00 23.92 ? 388 THR A CG2   1 
ATOM   3020 N  N     . ARG A 1 392 ? 8.018  31.178 -16.488 1.00 26.54 ? 389 ARG A N     1 
ATOM   3021 C  CA    . ARG A 1 392 ? 7.034  32.245 -16.521 1.00 28.06 ? 389 ARG A CA    1 
ATOM   3022 C  C     . ARG A 1 392 ? 6.961  32.917 -15.164 1.00 19.95 ? 389 ARG A C     1 
ATOM   3023 O  O     . ARG A 1 392 ? 6.929  32.246 -14.130 1.00 25.20 ? 389 ARG A O     1 
ATOM   3024 C  CB    . ARG A 1 392 ? 5.648  31.724 -16.879 1.00 31.80 ? 389 ARG A CB    1 
ATOM   3025 C  CG    . ARG A 1 392 ? 5.461  31.527 -18.343 1.00 37.15 ? 389 ARG A CG    1 
ATOM   3026 C  CD    . ARG A 1 392 ? 4.246  30.692 -18.584 1.00 45.89 ? 389 ARG A CD    1 
ATOM   3027 N  NE    . ARG A 1 392 ? 4.017  30.527 -20.006 1.00 49.37 ? 389 ARG A NE    1 
ATOM   3028 C  CZ    . ARG A 1 392 ? 2.981  29.878 -20.510 1.00 41.29 ? 389 ARG A CZ    1 
ATOM   3029 N  NH1   . ARG A 1 392 ? 2.085  29.336 -19.693 1.00 45.43 ? 389 ARG A NH1   1 
ATOM   3030 N  NH2   . ARG A 1 392 ? 2.842  29.777 -21.824 1.00 36.55 ? 389 ARG A NH2   1 
ATOM   3031 N  N     . TYR A 1 393 ? 6.918  34.245 -15.186 1.00 18.95 ? 390 TYR A N     1 
ATOM   3032 C  CA    . TYR A 1 393 ? 6.723  35.038 -13.977 1.00 21.85 ? 390 TYR A CA    1 
ATOM   3033 C  C     . TYR A 1 393 ? 5.230  35.018 -13.652 1.00 22.03 ? 390 TYR A C     1 
ATOM   3034 O  O     . TYR A 1 393 ? 4.492  35.983 -13.870 1.00 27.70 ? 390 TYR A O     1 
ATOM   3035 C  CB    . TYR A 1 393 ? 7.251  36.452 -14.174 1.00 25.25 ? 390 TYR A CB    1 
ATOM   3036 C  CG    . TYR A 1 393 ? 8.763  36.588 -14.136 1.00 20.75 ? 390 TYR A CG    1 
ATOM   3037 C  CD1   . TYR A 1 393 ? 9.589  35.465 -14.070 1.00 22.95 ? 390 TYR A CD1   1 
ATOM   3038 C  CD2   . TYR A 1 393 ? 9.355  37.843 -14.140 1.00 19.35 ? 390 TYR A CD2   1 
ATOM   3039 C  CE1   . TYR A 1 393 ? 10.979 35.600 -14.024 1.00 19.24 ? 390 TYR A CE1   1 
ATOM   3040 C  CE2   . TYR A 1 393 ? 10.736 37.988 -14.107 1.00 17.19 ? 390 TYR A CE2   1 
ATOM   3041 C  CZ    . TYR A 1 393 ? 11.536 36.867 -14.035 1.00 15.20 ? 390 TYR A CZ    1 
ATOM   3042 O  OH    . TYR A 1 393 ? 12.905 37.030 -13.975 1.00 19.45 ? 390 TYR A OH    1 
ATOM   3043 N  N     . ASP A 1 394 ? 4.796  33.881 -13.112 1.00 22.31 ? 391 ASP A N     1 
ATOM   3044 C  CA    A ASP A 1 394 ? 3.403  33.646 -12.753 0.51 23.46 ? 391 ASP A CA    1 
ATOM   3045 C  CA    B ASP A 1 394 ? 3.398  33.608 -12.778 0.49 23.46 ? 391 ASP A CA    1 
ATOM   3046 C  C     . ASP A 1 394 ? 3.375  32.987 -11.384 1.00 18.63 ? 391 ASP A C     1 
ATOM   3047 O  O     . ASP A 1 394 ? 3.872  31.873 -11.212 1.00 21.55 ? 391 ASP A O     1 
ATOM   3048 C  CB    A ASP A 1 394 ? 2.700  32.767 -13.788 0.51 23.03 ? 391 ASP A CB    1 
ATOM   3049 C  CB    B ASP A 1 394 ? 2.798  32.659 -13.825 0.49 23.05 ? 391 ASP A CB    1 
ATOM   3050 C  CG    A ASP A 1 394 ? 1.249  32.530 -13.449 0.51 25.22 ? 391 ASP A CG    1 
ATOM   3051 C  CG    B ASP A 1 394 ? 1.321  32.374 -13.620 0.49 25.62 ? 391 ASP A CG    1 
ATOM   3052 O  OD1   A ASP A 1 394 ? 0.972  31.620 -12.642 0.51 17.56 ? 391 ASP A OD1   1 
ATOM   3053 O  OD1   B ASP A 1 394 ? 0.731  32.826 -12.617 0.49 22.82 ? 391 ASP A OD1   1 
ATOM   3054 O  OD2   A ASP A 1 394 ? 0.388  33.256 -13.988 0.51 30.72 ? 391 ASP A OD2   1 
ATOM   3055 O  OD2   B ASP A 1 394 ? 0.751  31.667 -14.487 0.49 24.31 ? 391 ASP A OD2   1 
ATOM   3056 N  N     . ALA A 1 395 ? 2.804  33.694 -10.393 1.00 18.82 ? 392 ALA A N     1 
ATOM   3057 C  CA    . ALA A 1 395 ? 2.852  33.206 -9.009  1.00 17.43 ? 392 ALA A CA    1 
ATOM   3058 C  C     . ALA A 1 395 ? 2.142  31.865 -8.835  1.00 18.99 ? 392 ALA A C     1 
ATOM   3059 O  O     . ALA A 1 395 ? 2.601  31.006 -8.070  1.00 19.52 ? 392 ALA A O     1 
ATOM   3060 C  CB    . ALA A 1 395 ? 2.260  34.250 -8.055  1.00 17.46 ? 392 ALA A CB    1 
ATOM   3061 N  N     . HIS A 1 396 ? 1.005  31.668 -9.513  1.00 19.40 ? 393 HIS A N     1 
ATOM   3062 C  CA    . HIS A 1 396 ? 0.292  30.400 -9.381  1.00 22.94 ? 393 HIS A CA    1 
ATOM   3063 C  C     . HIS A 1 396 ? 1.106  29.252 -9.950  1.00 20.83 ? 393 HIS A C     1 
ATOM   3064 O  O     . HIS A 1 396 ? 1.175  28.178 -9.343  1.00 21.17 ? 393 HIS A O     1 
ATOM   3065 C  CB    . HIS A 1 396 ? -1.079 30.484 -10.059 1.00 22.93 ? 393 HIS A CB    1 
ATOM   3066 C  CG    . HIS A 1 396 ? -2.131 31.111 -9.198  1.00 34.60 ? 393 HIS A CG    1 
ATOM   3067 N  ND1   . HIS A 1 396 ? -2.400 32.464 -9.214  1.00 40.37 ? 393 HIS A ND1   1 
ATOM   3068 C  CD2   . HIS A 1 396 ? -2.965 30.573 -8.276  1.00 38.93 ? 393 HIS A CD2   1 
ATOM   3069 C  CE1   . HIS A 1 396 ? -3.362 32.730 -8.349  1.00 40.65 ? 393 HIS A CE1   1 
ATOM   3070 N  NE2   . HIS A 1 396 ? -3.721 31.600 -7.765  1.00 38.99 ? 393 HIS A NE2   1 
ATOM   3071 N  N     . LYS A 1 397 ? 1.767  29.472 -11.093 1.00 22.78 ? 394 LYS A N     1 
ATOM   3072 C  CA    . LYS A 1 397 ? 2.624  28.428 -11.644 1.00 23.41 ? 394 LYS A CA    1 
ATOM   3073 C  C     . LYS A 1 397 ? 3.839  28.183 -10.761 1.00 17.71 ? 394 LYS A C     1 
ATOM   3074 O  O     . LYS A 1 397 ? 4.220  27.030 -10.520 1.00 20.34 ? 394 LYS A O     1 
ATOM   3075 C  CB    . LYS A 1 397 ? 3.064  28.788 -13.063 1.00 21.52 ? 394 LYS A CB    1 
ATOM   3076 C  CG    . LYS A 1 397 ? 4.048  27.778 -13.644 1.00 27.77 ? 394 LYS A CG    1 
ATOM   3077 C  CD    . LYS A 1 397 ? 4.318  28.006 -15.115 1.00 30.82 ? 394 LYS A CD    1 
ATOM   3078 C  CE    . LYS A 1 397 ? 5.523  27.192 -15.573 1.00 27.97 ? 394 LYS A CE    1 
ATOM   3079 N  NZ    . LYS A 1 397 ? 5.482  25.783 -15.057 1.00 33.24 ? 394 LYS A NZ    1 
ATOM   3080 N  N     . MET A 1 398 ? 4.468  29.249 -10.270 1.00 18.26 ? 395 MET A N     1 
ATOM   3081 C  CA    . MET A 1 398 ? 5.644  29.050 -9.433  1.00 19.29 ? 395 MET A CA    1 
ATOM   3082 C  C     . MET A 1 398 ? 5.296  28.289 -8.161  1.00 16.57 ? 395 MET A C     1 
ATOM   3083 O  O     . MET A 1 398 ? 6.035  27.383 -7.750  1.00 20.00 ? 395 MET A O     1 
ATOM   3084 C  CB    . MET A 1 398 ? 6.293  30.400 -9.124  1.00 17.92 ? 395 MET A CB    1 
ATOM   3085 C  CG    . MET A 1 398 ? 7.083  30.916 -10.312 1.00 17.57 ? 395 MET A CG    1 
ATOM   3086 S  SD    . MET A 1 398 ? 8.068  32.357 -9.902  1.00 30.03 ? 395 MET A SD    1 
ATOM   3087 C  CE    . MET A 1 398 ? 6.760  33.561 -9.724  1.00 20.38 ? 395 MET A CE    1 
ATOM   3088 N  N     . SER A 1 399 ? 4.156  28.620 -7.538  1.00 18.99 ? 396 SER A N     1 
ATOM   3089 C  CA    . SER A 1 399 ? 3.782  27.968 -6.285  1.00 16.95 ? 396 SER A CA    1 
ATOM   3090 C  C     . SER A 1 399 ? 3.334  26.530 -6.518  1.00 22.99 ? 396 SER A C     1 
ATOM   3091 O  O     . SER A 1 399 ? 3.602  25.648 -5.691  1.00 20.75 ? 396 SER A O     1 
ATOM   3092 C  CB    . SER A 1 399 ? 2.683  28.773 -5.583  1.00 21.29 ? 396 SER A CB    1 
ATOM   3093 O  OG    . SER A 1 399 ? 1.487  28.792 -6.336  1.00 26.29 ? 396 SER A OG    1 
ATOM   3094 N  N     . HIS A 1 400 ? 2.649  26.274 -7.636  1.00 22.04 ? 397 HIS A N     1 
ATOM   3095 C  CA    . HIS A 1 400 ? 2.316  24.897 -7.989  1.00 19.02 ? 397 HIS A CA    1 
ATOM   3096 C  C     . HIS A 1 400 ? 3.574  24.072 -8.248  1.00 21.15 ? 397 HIS A C     1 
ATOM   3097 O  O     . HIS A 1 400 ? 3.681  22.930 -7.788  1.00 22.90 ? 397 HIS A O     1 
ATOM   3098 C  CB    . HIS A 1 400 ? 1.410  24.875 -9.221  1.00 26.27 ? 397 HIS A CB    1 
ATOM   3099 C  CG    . HIS A 1 400 ? 1.057  23.492 -9.675  1.00 38.47 ? 397 HIS A CG    1 
ATOM   3100 N  ND1   . HIS A 1 400 ? -0.083 22.841 -9.257  1.00 41.59 ? 397 HIS A ND1   1 
ATOM   3101 C  CD2   . HIS A 1 400 ? 1.709  22.626 -10.488 1.00 37.83 ? 397 HIS A CD2   1 
ATOM   3102 C  CE1   . HIS A 1 400 ? -0.126 21.639 -9.804  1.00 40.77 ? 397 HIS A CE1   1 
ATOM   3103 N  NE2   . HIS A 1 400 ? 0.951  21.481 -10.551 1.00 40.42 ? 397 HIS A NE2   1 
ATOM   3104 N  N     . ASP A 1 401 ? 4.539  24.634 -8.988  1.00 23.58 ? 398 ASP A N     1 
ATOM   3105 C  CA    . ASP A 1 401 ? 5.776  23.912 -9.270  1.00 22.32 ? 398 ASP A CA    1 
ATOM   3106 C  C     . ASP A 1 401 ? 6.569  23.656 -7.996  1.00 23.06 ? 398 ASP A C     1 
ATOM   3107 O  O     . ASP A 1 401 ? 7.164  22.582 -7.830  1.00 22.40 ? 398 ASP A O     1 
ATOM   3108 C  CB    . ASP A 1 401 ? 6.626  24.692 -10.280 1.00 22.41 ? 398 ASP A CB    1 
ATOM   3109 C  CG    . ASP A 1 401 ? 6.011  24.718 -11.683 1.00 31.42 ? 398 ASP A CG    1 
ATOM   3110 O  OD1   . ASP A 1 401 ? 5.063  23.945 -11.946 1.00 28.50 ? 398 ASP A OD1   1 
ATOM   3111 O  OD2   . ASP A 1 401 ? 6.493  25.499 -12.537 1.00 32.31 ? 398 ASP A OD2   1 
ATOM   3112 N  N     . ALA A 1 402 ? 6.590  24.632 -7.081  1.00 19.84 ? 399 ALA A N     1 
ATOM   3113 C  CA    . ALA A 1 402 ? 7.311  24.449 -5.827  1.00 17.55 ? 399 ALA A CA    1 
ATOM   3114 C  C     . ALA A 1 402 ? 6.713  23.312 -5.020  1.00 15.94 ? 399 ALA A C     1 
ATOM   3115 O  O     . ALA A 1 402 ? 7.439  22.502 -4.430  1.00 20.39 ? 399 ALA A O     1 
ATOM   3116 C  CB    . ALA A 1 402 ? 7.292  25.751 -5.020  1.00 20.99 ? 399 ALA A CB    1 
ATOM   3117 N  N     . PHE A 1 403 ? 5.385  23.238 -4.968  1.00 21.16 ? 400 PHE A N     1 
ATOM   3118 C  CA    . PHE A 1 403 ? 4.765  22.139 -4.247  1.00 21.13 ? 400 PHE A CA    1 
ATOM   3119 C  C     . PHE A 1 403 ? 5.120  20.809 -4.895  1.00 23.95 ? 400 PHE A C     1 
ATOM   3120 O  O     . PHE A 1 403 ? 5.432  19.836 -4.200  1.00 25.76 ? 400 PHE A O     1 
ATOM   3121 C  CB    . PHE A 1 403 ? 3.253  22.326 -4.186  1.00 23.05 ? 400 PHE A CB    1 
ATOM   3122 C  CG    . PHE A 1 403 ? 2.569  21.324 -3.302  1.00 26.38 ? 400 PHE A CG    1 
ATOM   3123 C  CD1   . PHE A 1 403 ? 2.632  21.444 -1.922  1.00 27.36 ? 400 PHE A CD1   1 
ATOM   3124 C  CD2   . PHE A 1 403 ? 1.895  20.244 -3.849  1.00 29.45 ? 400 PHE A CD2   1 
ATOM   3125 C  CE1   . PHE A 1 403 ? 2.021  20.513 -1.105  1.00 34.94 ? 400 PHE A CE1   1 
ATOM   3126 C  CE2   . PHE A 1 403 ? 1.276  19.318 -3.037  1.00 33.35 ? 400 PHE A CE2   1 
ATOM   3127 C  CZ    . PHE A 1 403 ? 1.339  19.451 -1.664  1.00 38.66 ? 400 PHE A CZ    1 
ATOM   3128 N  N     . THR A 1 404 ? 5.119  20.767 -6.230  1.00 23.82 ? 401 THR A N     1 
ATOM   3129 C  CA    . THR A 1 404 ? 5.422  19.529 -6.941  1.00 24.66 ? 401 THR A CA    1 
ATOM   3130 C  C     . THR A 1 404 ? 6.786  18.972 -6.546  1.00 23.04 ? 401 THR A C     1 
ATOM   3131 O  O     . THR A 1 404 ? 6.924  17.769 -6.299  1.00 25.81 ? 401 THR A O     1 
ATOM   3132 C  CB    . THR A 1 404 ? 5.352  19.765 -8.451  1.00 23.03 ? 401 THR A CB    1 
ATOM   3133 O  OG1   . THR A 1 404 ? 4.005  20.083 -8.823  1.00 28.01 ? 401 THR A OG1   1 
ATOM   3134 C  CG2   . THR A 1 404 ? 5.797  18.532 -9.210  1.00 27.20 ? 401 THR A CG2   1 
ATOM   3135 N  N     . VAL A 1 405 ? 7.810  19.827 -6.460  1.00 25.11 ? 402 VAL A N     1 
ATOM   3136 C  CA    . VAL A 1 405 ? 9.144  19.294 -6.209  1.00 26.96 ? 402 VAL A CA    1 
ATOM   3137 C  C     . VAL A 1 405 ? 9.389  18.959 -4.740  1.00 26.14 ? 402 VAL A C     1 
ATOM   3138 O  O     . VAL A 1 405 ? 10.344 18.233 -4.445  1.00 25.58 ? 402 VAL A O     1 
ATOM   3139 C  CB    . VAL A 1 405 ? 10.253 20.234 -6.722  1.00 24.14 ? 402 VAL A CB    1 
ATOM   3140 C  CG1   . VAL A 1 405 ? 10.075 20.506 -8.215  1.00 27.91 ? 402 VAL A CG1   1 
ATOM   3141 C  CG2   . VAL A 1 405 ? 10.294 21.521 -5.928  1.00 22.55 ? 402 VAL A CG2   1 
ATOM   3142 N  N     . ILE A 1 406 ? 8.563  19.437 -3.801  1.00 23.87 ? 403 ILE A N     1 
ATOM   3143 C  CA    . ILE A 1 406 ? 8.732  19.064 -2.397  1.00 20.86 ? 403 ILE A CA    1 
ATOM   3144 C  C     . ILE A 1 406 ? 7.663  18.096 -1.897  1.00 23.83 ? 403 ILE A C     1 
ATOM   3145 O  O     . ILE A 1 406 ? 7.795  17.594 -0.766  1.00 26.57 ? 403 ILE A O     1 
ATOM   3146 C  CB    . ILE A 1 406 ? 8.795  20.299 -1.468  1.00 27.39 ? 403 ILE A CB    1 
ATOM   3147 C  CG1   . ILE A 1 406 ? 7.433  20.988 -1.371  1.00 21.36 ? 403 ILE A CG1   1 
ATOM   3148 C  CG2   . ILE A 1 406 ? 9.871  21.260 -1.932  1.00 32.21 ? 403 ILE A CG2   1 
ATOM   3149 C  CD1   . ILE A 1 406 ? 7.325  21.964 -0.197  1.00 24.51 ? 403 ILE A CD1   1 
ATOM   3150 N  N     . LYS A 1 407 ? 6.626  17.820 -2.700  1.00 30.24 ? 404 LYS A N     1 
ATOM   3151 C  CA    . LYS A 1 407 ? 5.516  16.927 -2.349  1.00 32.48 ? 404 LYS A CA    1 
ATOM   3152 C  C     . LYS A 1 407 ? 5.911  15.699 -1.535  1.00 41.83 ? 404 LYS A C     1 
ATOM   3153 O  O     . LYS A 1 407 ? 5.326  15.415 -0.485  1.00 33.65 ? 404 LYS A O     1 
ATOM   3154 C  CB    . LYS A 1 407 ? 4.831  16.443 -3.631  1.00 37.32 ? 404 LYS A CB    1 
ATOM   3155 C  CG    . LYS A 1 407 ? 3.630  17.223 -4.034  1.00 37.09 ? 404 LYS A CG    1 
ATOM   3156 C  CD    . LYS A 1 407 ? 2.838  16.514 -5.112  1.00 36.11 ? 404 LYS A CD    1 
ATOM   3157 C  CE    . LYS A 1 407 ? 3.690  16.193 -6.322  1.00 41.24 ? 404 LYS A CE    1 
ATOM   3158 N  NZ    . LYS A 1 407 ? 2.833  16.042 -7.533  1.00 46.32 ? 404 LYS A NZ    1 
ATOM   3159 N  N     . ASN A 1 408 ? 6.861  14.919 -2.036  1.00 36.07 ? 405 ASN A N     1 
ATOM   3160 C  CA    . ASN A 1 408 ? 7.106  13.601 -1.474  1.00 38.66 ? 405 ASN A CA    1 
ATOM   3161 C  C     . ASN A 1 408 ? 8.040  13.629 -0.272  1.00 31.77 ? 405 ASN A C     1 
ATOM   3162 O  O     . ASN A 1 408 ? 8.428  12.567 0.221   1.00 36.79 ? 405 ASN A O     1 
ATOM   3163 C  CB    . ASN A 1 408 ? 7.617  12.668 -2.569  1.00 36.42 ? 405 ASN A CB    1 
ATOM   3164 C  CG    . ASN A 1 408 ? 6.590  12.473 -3.667  0.66 38.65 ? 405 ASN A CG    1 
ATOM   3165 O  OD1   . ASN A 1 408 ? 5.615  11.740 -3.494  0.47 39.95 ? 405 ASN A OD1   1 
ATOM   3166 N  ND2   . ASN A 1 408 ? 6.781  13.155 -4.788  0.64 31.16 ? 405 ASN A ND2   1 
ATOM   3167 N  N     . CYS A 1 409 ? 8.386  14.819 0.225   1.00 37.41 ? 406 CYS A N     1 
ATOM   3168 C  CA    . CYS A 1 409 ? 8.979  14.929 1.551   1.00 36.05 ? 406 CYS A CA    1 
ATOM   3169 C  C     . CYS A 1 409 ? 7.947  14.707 2.640   1.00 34.95 ? 406 CYS A C     1 
ATOM   3170 O  O     . CYS A 1 409 ? 8.315  14.489 3.798   1.00 37.87 ? 406 CYS A O     1 
ATOM   3171 C  CB    . CYS A 1 409 ? 9.614  16.304 1.741   1.00 35.29 ? 406 CYS A CB    1 
ATOM   3172 S  SG    . CYS A 1 409 ? 10.754 16.729 0.444   1.00 56.75 ? 406 CYS A SG    1 
ATOM   3173 N  N     . ASN A 1 410 ? 6.669  14.766 2.289   1.00 35.06 ? 407 ASN A N     1 
ATOM   3174 C  CA    . ASN A 1 410 ? 5.599  14.564 3.252   1.00 34.07 ? 407 ASN A CA    1 
ATOM   3175 C  C     . ASN A 1 410 ? 5.517  13.086 3.619   1.00 37.47 ? 407 ASN A C     1 
ATOM   3176 O  O     . ASN A 1 410 ? 5.134  12.253 2.794   1.00 45.24 ? 407 ASN A O     1 
ATOM   3177 C  CB    . ASN A 1 410 ? 4.287  15.066 2.666   1.00 32.32 ? 407 ASN A CB    1 
ATOM   3178 C  CG    . ASN A 1 410 ? 3.149  14.974 3.641   1.00 29.31 ? 407 ASN A CG    1 
ATOM   3179 O  OD1   . ASN A 1 410 ? 3.348  14.681 4.818   1.00 30.46 ? 407 ASN A OD1   1 
ATOM   3180 N  ND2   . ASN A 1 410 ? 1.943  15.240 3.162   1.00 29.71 ? 407 ASN A ND2   1 
ATOM   3181 N  N     . THR A 1 411 ? 5.877  12.761 4.858   1.00 34.28 ? 408 THR A N     1 
ATOM   3182 C  CA    . THR A 1 411 ? 5.820  11.386 5.341   1.00 40.29 ? 408 THR A CA    1 
ATOM   3183 C  C     . THR A 1 411 ? 4.451  11.000 5.878   1.00 42.09 ? 408 THR A C     1 
ATOM   3184 O  O     . THR A 1 411 ? 4.264  9.841  6.259   1.00 48.18 ? 408 THR A O     1 
ATOM   3185 C  CB    . THR A 1 411 ? 6.870  11.165 6.431   1.00 38.10 ? 408 THR A CB    1 
ATOM   3186 O  OG1   . THR A 1 411 ? 6.424  11.761 7.655   1.00 38.86 ? 408 THR A OG1   1 
ATOM   3187 C  CG2   . THR A 1 411 ? 8.195  11.796 6.026   1.00 40.73 ? 408 THR A CG2   1 
ATOM   3188 N  N     . SER A 1 412 ? 3.493  11.925 5.911   1.00 38.29 ? 409 SER A N     1 
ATOM   3189 C  CA    . SER A 1 412 ? 2.199  11.643 6.519   1.00 34.40 ? 409 SER A CA    1 
ATOM   3190 C  C     . SER A 1 412 ? 1.386  10.672 5.670   1.00 42.86 ? 409 SER A C     1 
ATOM   3191 O  O     . SER A 1 412 ? 1.395  10.737 4.438   1.00 42.76 ? 409 SER A O     1 
ATOM   3192 C  CB    . SER A 1 412 ? 1.411  12.939 6.716   1.00 42.21 ? 409 SER A CB    1 
ATOM   3193 O  OG    . SER A 1 412 ? 0.017  12.685 6.780   1.00 44.01 ? 409 SER A OG    1 
ATOM   3194 N  N     . GLY A 1 413 ? 0.671  9.774  6.341   1.00 49.08 ? 410 GLY A N     1 
ATOM   3195 C  CA    . GLY A 1 413 ? -0.239 8.870  5.665   1.00 54.85 ? 410 GLY A CA    1 
ATOM   3196 C  C     . GLY A 1 413 ? -1.563 9.521  5.312   1.00 60.86 ? 410 GLY A C     1 
ATOM   3197 O  O     . GLY A 1 413 ? -2.144 9.229  4.261   1.00 59.70 ? 410 GLY A O     1 
ATOM   3198 N  N     . ILE A 1 414 ? -2.053 10.402 6.186   1.00 56.21 ? 411 ILE A N     1 
ATOM   3199 C  CA    . ILE A 1 414 ? -3.289 11.126 5.907   1.00 46.40 ? 411 ILE A CA    1 
ATOM   3200 C  C     . ILE A 1 414 ? -3.013 12.193 4.858   1.00 51.98 ? 411 ILE A C     1 
ATOM   3201 O  O     . ILE A 1 414 ? -2.073 12.988 4.991   1.00 47.84 ? 411 ILE A O     1 
ATOM   3202 C  CB    . ILE A 1 414 ? -3.865 11.735 7.193   1.00 47.22 ? 411 ILE A CB    1 
ATOM   3203 N  N     . GLN A 1 415 ? -3.847 12.222 3.812   1.00 60.04 ? 412 GLN A N     1 
ATOM   3204 C  CA    . GLN A 1 415 ? -3.532 12.999 2.616   1.00 52.89 ? 412 GLN A CA    1 
ATOM   3205 C  C     . GLN A 1 415 ? -3.639 14.503 2.842   1.00 54.74 ? 412 GLN A C     1 
ATOM   3206 O  O     . GLN A 1 415 ? -2.977 15.277 2.139   1.00 50.43 ? 412 GLN A O     1 
ATOM   3207 N  N     . THR A 1 416 ? -4.461 14.940 3.795   1.00 55.16 ? 413 THR A N     1 
ATOM   3208 C  CA    . THR A 1 416 ? -4.632 16.365 4.054   1.00 47.42 ? 413 THR A CA    1 
ATOM   3209 C  C     . THR A 1 416 ? -3.586 16.932 5.001   1.00 38.85 ? 413 THR A C     1 
ATOM   3210 O  O     . THR A 1 416 ? -3.532 18.155 5.177   1.00 33.18 ? 413 THR A O     1 
ATOM   3211 C  CB    . THR A 1 416 ? -6.019 16.643 4.636   1.00 49.85 ? 413 THR A CB    1 
ATOM   3212 O  OG1   . THR A 1 416 ? -6.150 15.955 5.885   1.00 51.17 ? 413 THR A OG1   1 
ATOM   3213 C  CG2   . THR A 1 416 ? -7.101 16.179 3.681   1.00 47.15 ? 413 THR A CG2   1 
ATOM   3214 N  N     . GLU A 1 417 ? -2.751 16.087 5.593   1.00 28.95 ? 414 GLU A N     1 
ATOM   3215 C  CA    . GLU A 1 417 ? -1.819 16.485 6.636   1.00 37.33 ? 414 GLU A CA    1 
ATOM   3216 C  C     . GLU A 1 417 ? -0.384 16.470 6.119   1.00 38.18 ? 414 GLU A C     1 
ATOM   3217 O  O     . GLU A 1 417 ? -0.048 15.736 5.184   1.00 36.58 ? 414 GLU A O     1 
ATOM   3218 C  CB    . GLU A 1 417 ? -1.962 15.570 7.859   1.00 38.51 ? 414 GLU A CB    1 
ATOM   3219 C  CG    . GLU A 1 417 ? -3.410 15.283 8.214   1.00 41.34 ? 414 GLU A CG    1 
ATOM   3220 C  CD    . GLU A 1 417 ? -4.116 16.528 8.725   1.00 37.81 ? 414 GLU A CD    1 
ATOM   3221 O  OE1   . GLU A 1 417 ? -3.577 17.190 9.643   1.00 45.07 ? 414 GLU A OE1   1 
ATOM   3222 O  OE2   . GLU A 1 417 ? -5.192 16.867 8.185   1.00 38.48 ? 414 GLU A OE2   1 
ATOM   3223 N  N     . TRP A 1 418 ? 0.461  17.294 6.737   1.00 29.54 ? 415 TRP A N     1 
ATOM   3224 C  CA    . TRP A 1 418 ? 1.870  17.381 6.378   1.00 25.46 ? 415 TRP A CA    1 
ATOM   3225 C  C     . TRP A 1 418 ? 2.707  17.011 7.591   1.00 35.32 ? 415 TRP A C     1 
ATOM   3226 O  O     . TRP A 1 418 ? 2.612  17.660 8.635   1.00 26.98 ? 415 TRP A O     1 
ATOM   3227 C  CB    . TRP A 1 418 ? 2.238  18.780 5.868   1.00 27.44 ? 415 TRP A CB    1 
ATOM   3228 C  CG    . TRP A 1 418 ? 3.584  18.795 5.227   1.00 22.30 ? 415 TRP A CG    1 
ATOM   3229 C  CD1   . TRP A 1 418 ? 4.791  18.821 5.855   1.00 31.27 ? 415 TRP A CD1   1 
ATOM   3230 C  CD2   . TRP A 1 418 ? 3.858  18.744 3.827   1.00 25.76 ? 415 TRP A CD2   1 
ATOM   3231 N  NE1   . TRP A 1 418 ? 5.804  18.793 4.926   1.00 24.36 ? 415 TRP A NE1   1 
ATOM   3232 C  CE2   . TRP A 1 418 ? 5.255  18.746 3.673   1.00 31.71 ? 415 TRP A CE2   1 
ATOM   3233 C  CE3   . TRP A 1 418 ? 3.055  18.702 2.688   1.00 29.07 ? 415 TRP A CE3   1 
ATOM   3234 C  CZ2   . TRP A 1 418 ? 5.869  18.711 2.421   1.00 30.02 ? 415 TRP A CZ2   1 
ATOM   3235 C  CZ3   . TRP A 1 418 ? 3.665  18.665 1.447   1.00 35.27 ? 415 TRP A CZ3   1 
ATOM   3236 C  CH2   . TRP A 1 418 ? 5.057  18.667 1.326   1.00 31.02 ? 415 TRP A CH2   1 
ATOM   3237 N  N     . SER A 1 419 ? 3.515  15.962 7.451   1.00 29.66 ? 416 SER A N     1 
ATOM   3238 C  CA    . SER A 1 419 ? 4.447  15.535 8.481   1.00 29.40 ? 416 SER A CA    1 
ATOM   3239 C  C     . SER A 1 419 ? 5.794  15.275 7.810   1.00 31.02 ? 416 SER A C     1 
ATOM   3240 O  O     . SER A 1 419 ? 5.830  14.760 6.695   1.00 40.08 ? 416 SER A O     1 
ATOM   3241 C  CB    . SER A 1 419 ? 3.945  14.271 9.198   1.00 28.98 ? 416 SER A CB    1 
ATOM   3242 N  N     . PRO A 1 420 ? 6.900  15.677 8.454   1.00 28.57 ? 417 PRO A N     1 
ATOM   3243 C  CA    . PRO A 1 420 ? 6.945  16.469 9.685   1.00 32.07 ? 417 PRO A CA    1 
ATOM   3244 C  C     . PRO A 1 420 ? 6.592  17.924 9.383   1.00 32.90 ? 417 PRO A C     1 
ATOM   3245 O  O     . PRO A 1 420 ? 6.776  18.344 8.244   1.00 32.85 ? 417 PRO A O     1 
ATOM   3246 C  CB    . PRO A 1 420 ? 8.398  16.326 10.136  1.00 33.50 ? 417 PRO A CB    1 
ATOM   3247 C  CG    . PRO A 1 420 ? 9.152  16.178 8.856   1.00 34.26 ? 417 PRO A CG    1 
ATOM   3248 C  CD    . PRO A 1 420 ? 8.251  15.374 7.949   1.00 35.34 ? 417 PRO A CD    1 
ATOM   3249 N  N     . PRO A 1 421 ? 6.074  18.661 10.366  1.00 31.18 ? 418 PRO A N     1 
ATOM   3250 C  CA    . PRO A 1 421 ? 5.642  20.036 10.093  1.00 28.81 ? 418 PRO A CA    1 
ATOM   3251 C  C     . PRO A 1 421 ? 6.801  20.898 9.619   1.00 25.96 ? 418 PRO A C     1 
ATOM   3252 O  O     . PRO A 1 421 ? 7.960  20.674 9.979   1.00 27.52 ? 418 PRO A O     1 
ATOM   3253 C  CB    . PRO A 1 421 ? 5.100  20.516 11.447  1.00 29.97 ? 418 PRO A CB    1 
ATOM   3254 C  CG    . PRO A 1 421 ? 4.764  19.255 12.194  1.00 31.29 ? 418 PRO A CG    1 
ATOM   3255 C  CD    . PRO A 1 421 ? 5.801  18.261 11.756  1.00 32.38 ? 418 PRO A CD    1 
ATOM   3256 N  N     . LEU A 1 422 ? 6.471  21.904 8.806   1.00 23.48 ? 419 LEU A N     1 
ATOM   3257 C  CA    . LEU A 1 422 ? 7.463  22.755 8.163   1.00 27.79 ? 419 LEU A CA    1 
ATOM   3258 C  C     . LEU A 1 422 ? 7.657  24.031 8.968   1.00 19.83 ? 419 LEU A C     1 
ATOM   3259 O  O     . LEU A 1 422 ? 6.692  24.757 9.222   1.00 25.82 ? 419 LEU A O     1 
ATOM   3260 C  CB    . LEU A 1 422 ? 7.034  23.105 6.737   1.00 30.49 ? 419 LEU A CB    1 
ATOM   3261 C  CG    . LEU A 1 422 ? 6.847  21.917 5.801   1.00 20.94 ? 419 LEU A CG    1 
ATOM   3262 C  CD1   . LEU A 1 422 ? 6.628  22.387 4.370   1.00 23.65 ? 419 LEU A CD1   1 
ATOM   3263 C  CD2   . LEU A 1 422 ? 8.064  21.006 5.909   1.00 29.45 ? 419 LEU A CD2   1 
ATOM   3264 N  N     . THR A 1 423 ? 8.900  24.312 9.351   1.00 20.70 ? 420 THR A N     1 
ATOM   3265 C  CA    . THR A 1 423 ? 9.198  25.531 10.086  1.00 19.02 ? 420 THR A CA    1 
ATOM   3266 C  C     . THR A 1 423 ? 9.822  26.619 9.219   1.00 19.39 ? 420 THR A C     1 
ATOM   3267 O  O     . THR A 1 423 ? 10.167 27.678 9.745   1.00 17.73 ? 420 THR A O     1 
ATOM   3268 C  CB    . THR A 1 423 ? 10.116 25.232 11.278  1.00 27.56 ? 420 THR A CB    1 
ATOM   3269 O  OG1   . THR A 1 423 ? 11.316 24.587 10.822  1.00 24.41 ? 420 THR A OG1   1 
ATOM   3270 C  CG2   . THR A 1 423 ? 9.398  24.327 12.270  1.00 27.28 ? 420 THR A CG2   1 
ATOM   3271 N  N     . MET A 1 424 ? 9.994  26.386 7.917   1.00 20.09 ? 421 MET A N     1 
ATOM   3272 C  CA    A MET A 1 424 ? 10.480 27.424 7.021   0.39 18.12 ? 421 MET A CA    1 
ATOM   3273 C  CA    B MET A 1 424 ? 10.449 27.441 7.019   0.61 18.06 ? 421 MET A CA    1 
ATOM   3274 C  C     . MET A 1 424 ? 10.114 27.048 5.591   1.00 16.57 ? 421 MET A C     1 
ATOM   3275 O  O     . MET A 1 424 ? 10.189 25.870 5.228   1.00 17.47 ? 421 MET A O     1 
ATOM   3276 C  CB    A MET A 1 424 ? 11.999 27.601 7.177   0.39 20.80 ? 421 MET A CB    1 
ATOM   3277 C  CB    B MET A 1 424 ? 11.961 27.723 7.126   0.61 20.74 ? 421 MET A CB    1 
ATOM   3278 C  CG    A MET A 1 424 ? 12.626 28.649 6.285   0.39 20.74 ? 421 MET A CG    1 
ATOM   3279 C  CG    B MET A 1 424 ? 12.406 28.951 6.299   0.61 20.68 ? 421 MET A CG    1 
ATOM   3280 S  SD    A MET A 1 424 ? 12.947 28.024 4.630   0.39 17.99 ? 421 MET A SD    1 
ATOM   3281 S  SD    B MET A 1 424 ? 14.164 29.132 5.895   0.61 25.35 ? 421 MET A SD    1 
ATOM   3282 C  CE    A MET A 1 424 ? 14.343 26.933 4.896   0.39 22.85 ? 421 MET A CE    1 
ATOM   3283 C  CE    B MET A 1 424 ? 14.482 27.617 4.982   0.61 23.33 ? 421 MET A CE    1 
ATOM   3284 N  N     . LEU A 1 425 ? 9.718  28.053 4.799   1.00 15.02 ? 422 LEU A N     1 
ATOM   3285 C  CA    . LEU A 1 425 ? 9.543  27.965 3.353   1.00 16.27 ? 422 LEU A CA    1 
ATOM   3286 C  C     . LEU A 1 425 ? 10.382 29.061 2.714   1.00 16.71 ? 422 LEU A C     1 
ATOM   3287 O  O     . LEU A 1 425 ? 10.414 30.183 3.212   1.00 18.86 ? 422 LEU A O     1 
ATOM   3288 C  CB    . LEU A 1 425 ? 8.088  28.148 2.928   1.00 14.79 ? 422 LEU A CB    1 
ATOM   3289 C  CG    . LEU A 1 425 ? 7.043  27.126 3.346   1.00 18.24 ? 422 LEU A CG    1 
ATOM   3290 C  CD1   . LEU A 1 425 ? 5.669  27.625 2.926   1.00 18.47 ? 422 LEU A CD1   1 
ATOM   3291 C  CD2   . LEU A 1 425 ? 7.329  25.774 2.715   1.00 24.40 ? 422 LEU A CD2   1 
ATOM   3292 N  N     . PHE A 1 426 ? 11.034 28.759 1.586   1.00 17.18 ? 423 PHE A N     1 
ATOM   3293 C  CA    . PHE A 1 426 ? 11.998 29.694 1.005   1.00 18.98 ? 423 PHE A CA    1 
ATOM   3294 C  C     . PHE A 1 426 ? 11.981 29.480 -0.499  1.00 18.67 ? 423 PHE A C     1 
ATOM   3295 O  O     . PHE A 1 426 ? 12.264 28.373 -0.962  1.00 25.38 ? 423 PHE A O     1 
ATOM   3296 C  CB    . PHE A 1 426 ? 13.402 29.429 1.582   1.00 19.90 ? 423 PHE A CB    1 
ATOM   3297 C  CG    . PHE A 1 426 ? 14.417 30.525 1.356   1.00 28.17 ? 423 PHE A CG    1 
ATOM   3298 C  CD1   . PHE A 1 426 ? 14.173 31.596 0.507   1.00 26.85 ? 423 PHE A CD1   1 
ATOM   3299 C  CD2   . PHE A 1 426 ? 15.642 30.466 2.008   1.00 29.19 ? 423 PHE A CD2   1 
ATOM   3300 C  CE1   . PHE A 1 426 ? 15.125 32.590 0.327   1.00 32.70 ? 423 PHE A CE1   1 
ATOM   3301 C  CE2   . PHE A 1 426 ? 16.601 31.454 1.826   1.00 36.07 ? 423 PHE A CE2   1 
ATOM   3302 C  CZ    . PHE A 1 426 ? 16.343 32.516 0.977   1.00 36.27 ? 423 PHE A CZ    1 
ATOM   3303 N  N     . LEU A 1 427 ? 11.610 30.505 -1.255  1.00 13.81 ? 424 LEU A N     1 
ATOM   3304 C  CA    . LEU A 1 427 ? 11.611 30.440 -2.715  1.00 15.06 ? 424 LEU A CA    1 
ATOM   3305 C  C     . LEU A 1 427 ? 12.678 31.384 -3.232  1.00 17.64 ? 424 LEU A C     1 
ATOM   3306 O  O     . LEU A 1 427 ? 12.678 32.567 -2.886  1.00 20.06 ? 424 LEU A O     1 
ATOM   3307 C  CB    . LEU A 1 427 ? 10.264 30.849 -3.316  1.00 18.76 ? 424 LEU A CB    1 
ATOM   3308 C  CG    . LEU A 1 427 ? 8.997  30.034 -3.059  1.00 20.98 ? 424 LEU A CG    1 
ATOM   3309 C  CD1   . LEU A 1 427 ? 7.836  30.650 -3.842  1.00 20.65 ? 424 LEU A CD1   1 
ATOM   3310 C  CD2   . LEU A 1 427 ? 9.199  28.574 -3.429  1.00 21.12 ? 424 LEU A CD2   1 
ATOM   3311 N  N     A CYS A 1 428 ? 13.547 30.892 -4.110  0.68 17.48 ? 425 CYS A N     1 
ATOM   3312 N  N     B CYS A 1 428 ? 13.583 30.859 -4.048  0.32 17.52 ? 425 CYS A N     1 
ATOM   3313 C  CA    A CYS A 1 428 ? 14.660 31.700 -4.594  0.68 18.03 ? 425 CYS A CA    1 
ATOM   3314 C  CA    B CYS A 1 428 ? 14.655 31.643 -4.638  0.32 18.06 ? 425 CYS A CA    1 
ATOM   3315 C  C     A CYS A 1 428 ? 14.786 31.570 -6.106  0.68 15.89 ? 425 CYS A C     1 
ATOM   3316 C  C     B CYS A 1 428 ? 14.561 31.566 -6.153  0.32 16.02 ? 425 CYS A C     1 
ATOM   3317 O  O     A CYS A 1 428 ? 14.955 30.460 -6.616  0.68 17.85 ? 425 CYS A O     1 
ATOM   3318 O  O     B CYS A 1 428 ? 14.323 30.493 -6.715  0.32 17.15 ? 425 CYS A O     1 
ATOM   3319 C  CB    A CYS A 1 428 ? 15.965 31.279 -3.919  0.68 18.04 ? 425 CYS A CB    1 
ATOM   3320 C  CB    B CYS A 1 428 ? 16.030 31.144 -4.175  0.32 18.20 ? 425 CYS A CB    1 
ATOM   3321 S  SG    A CYS A 1 428 ? 17.299 32.399 -4.307  0.68 23.66 ? 425 CYS A SG    1 
ATOM   3322 S  SG    B CYS A 1 428 ? 16.311 31.272 -2.404  0.32 23.20 ? 425 CYS A SG    1 
ATOM   3323 N  N     . ALA A 1 429 ? 14.732 32.707 -6.811  1.00 14.69 ? 426 ALA A N     1 
ATOM   3324 C  CA    . ALA A 1 429 ? 14.896 32.749 -8.263  1.00 12.82 ? 426 ALA A CA    1 
ATOM   3325 C  C     . ALA A 1 429 ? 16.364 33.018 -8.575  1.00 17.73 ? 426 ALA A C     1 
ATOM   3326 O  O     . ALA A 1 429 ? 16.959 33.943 -8.013  1.00 16.12 ? 426 ALA A O     1 
ATOM   3327 C  CB    . ALA A 1 429 ? 14.016 33.839 -8.882  1.00 15.40 ? 426 ALA A CB    1 
ATOM   3328 N  N     . THR A 1 430 ? 16.947 32.231 -9.478  1.00 17.80 ? 427 THR A N     1 
ATOM   3329 C  CA    A THR A 1 430 ? 18.389 32.200 -9.709  0.56 16.43 ? 427 THR A CA    1 
ATOM   3330 C  CA    B THR A 1 430 ? 18.368 32.426 -9.755  0.44 16.58 ? 427 THR A CA    1 
ATOM   3331 C  C     . THR A 1 430 ? 18.656 32.044 -11.202 1.00 18.45 ? 427 THR A C     1 
ATOM   3332 O  O     . THR A 1 430 ? 17.737 31.869 -12.005 1.00 16.94 ? 427 THR A O     1 
ATOM   3333 C  CB    A THR A 1 430 ? 19.064 31.042 -8.958  0.56 18.59 ? 427 THR A CB    1 
ATOM   3334 C  CB    B THR A 1 430 ? 19.226 31.647 -8.755  0.44 18.60 ? 427 THR A CB    1 
ATOM   3335 O  OG1   A THR A 1 430 ? 18.667 29.796 -9.547  0.56 23.67 ? 427 THR A OG1   1 
ATOM   3336 O  OG1   B THR A 1 430 ? 20.606 31.950 -8.988  0.44 19.40 ? 427 THR A OG1   1 
ATOM   3337 C  CG2   A THR A 1 430 ? 18.691 31.029 -7.483  0.56 19.21 ? 427 THR A CG2   1 
ATOM   3338 C  CG2   B THR A 1 430 ? 18.997 30.154 -8.895  0.44 19.61 ? 427 THR A CG2   1 
ATOM   3339 N  N     . LYS A 1 431 ? 19.948 32.015 -11.554 1.00 17.73 ? 428 LYS A N     1 
ATOM   3340 C  CA    . LYS A 1 431 ? 20.413 31.775 -12.927 1.00 17.30 ? 428 LYS A CA    1 
ATOM   3341 C  C     . LYS A 1 431 ? 19.800 32.782 -13.909 1.00 15.88 ? 428 LYS A C     1 
ATOM   3342 O  O     . LYS A 1 431 ? 19.105 32.430 -14.862 1.00 20.04 ? 428 LYS A O     1 
ATOM   3343 C  CB    . LYS A 1 431 ? 20.146 30.325 -13.352 1.00 20.40 ? 428 LYS A CB    1 
ATOM   3344 C  CG    . LYS A 1 431 ? 21.103 29.340 -12.678 1.00 28.96 ? 428 LYS A CG    1 
ATOM   3345 C  CD    . LYS A 1 431 ? 20.673 27.895 -12.833 0.67 32.09 ? 428 LYS A CD    1 
ATOM   3346 C  CE    . LYS A 1 431 ? 21.711 26.959 -12.216 0.67 33.07 ? 428 LYS A CE    1 
ATOM   3347 N  NZ    . LYS A 1 431 ? 22.108 27.393 -10.845 0.82 38.08 ? 428 LYS A NZ    1 
ATOM   3348 N  N     . PHE A 1 432 ? 20.094 34.053 -13.659 1.00 18.06 ? 429 PHE A N     1 
ATOM   3349 C  CA    . PHE A 1 432 ? 19.580 35.126 -14.504 1.00 18.76 ? 429 PHE A CA    1 
ATOM   3350 C  C     . PHE A 1 432 ? 20.250 35.108 -15.876 1.00 25.59 ? 429 PHE A C     1 
ATOM   3351 O  O     . PHE A 1 432 ? 21.434 34.783 -16.004 1.00 22.36 ? 429 PHE A O     1 
ATOM   3352 C  CB    . PHE A 1 432 ? 19.796 36.485 -13.830 1.00 19.28 ? 429 PHE A CB    1 
ATOM   3353 C  CG    . PHE A 1 432 ? 18.822 36.772 -12.706 1.00 20.72 ? 429 PHE A CG    1 
ATOM   3354 C  CD1   . PHE A 1 432 ? 17.610 37.390 -12.965 1.00 16.52 ? 429 PHE A CD1   1 
ATOM   3355 C  CD2   . PHE A 1 432 ? 19.113 36.407 -11.400 1.00 26.06 ? 429 PHE A CD2   1 
ATOM   3356 C  CE1   . PHE A 1 432 ? 16.704 37.645 -11.937 1.00 16.29 ? 429 PHE A CE1   1 
ATOM   3357 C  CE2   . PHE A 1 432 ? 18.213 36.666 -10.364 1.00 22.94 ? 429 PHE A CE2   1 
ATOM   3358 C  CZ    . PHE A 1 432 ? 17.013 37.290 -10.633 1.00 23.68 ? 429 PHE A CZ    1 
ATOM   3359 N  N     . SER A 1 433 ? 19.473 35.464 -16.903 1.00 21.48 ? 430 SER A N     1 
ATOM   3360 C  CA    . SER A 1 433 ? 19.959 35.640 -18.264 1.00 23.61 ? 430 SER A CA    1 
ATOM   3361 C  C     . SER A 1 433 ? 19.539 37.015 -18.759 1.00 27.14 ? 430 SER A C     1 
ATOM   3362 O  O     . SER A 1 433 ? 18.507 37.548 -18.347 1.00 23.28 ? 430 SER A O     1 
ATOM   3363 C  CB    . SER A 1 433 ? 19.413 34.569 -19.217 1.00 28.91 ? 430 SER A CB    1 
ATOM   3364 O  OG    . SER A 1 433 ? 19.636 33.269 -18.709 1.00 45.23 ? 430 SER A OG    1 
ATOM   3365 N  N     . ALA A 1 434 ? 20.350 37.586 -19.643 1.00 21.00 ? 431 ALA A N     1 
ATOM   3366 C  CA    . ALA A 1 434 ? 20.037 38.898 -20.196 1.00 23.48 ? 431 ALA A CA    1 
ATOM   3367 C  C     . ALA A 1 434 ? 18.708 38.857 -20.940 1.00 30.32 ? 431 ALA A C     1 
ATOM   3368 O  O     . ALA A 1 434 ? 18.368 37.859 -21.582 1.00 26.50 ? 431 ALA A O     1 
ATOM   3369 C  CB    . ALA A 1 434 ? 21.155 39.359 -21.131 1.00 33.48 ? 431 ALA A CB    1 
ATOM   3370 N  N     . SER A 1 435 ? 17.954 39.952 -20.847 1.00 28.41 ? 432 SER A N     1 
ATOM   3371 C  CA    . SER A 1 435 ? 16.610 40.029 -21.419 1.00 35.48 ? 432 SER A CA    1 
ATOM   3372 C  C     . SER A 1 435 ? 16.383 41.338 -22.180 1.00 39.66 ? 432 SER A C     1 
ATOM   3373 O  O     . SER A 1 435 ? 15.465 41.451 -22.991 1.00 50.05 ? 432 SER A O     1 
ATOM   3374 C  CB    . SER A 1 435 ? 15.554 39.887 -20.319 1.00 36.65 ? 432 SER A CB    1 
ATOM   3375 O  OG    . SER A 1 435 ? 14.246 40.059 -20.840 1.00 53.01 ? 432 SER A OG    1 
ATOM   3376 O  OXT   . SER A 1 435 ? 17.100 42.320 -22.000 1.00 44.14 ? 432 SER A OXT   1 
ATOM   3377 O  "O3'" . DC  B 2 1   ? 10.993 27.126 16.576  1.00 60.15 ? 1   DC  T "O3'" 1 
ATOM   3378 P  P     . DA  B 2 2   ? 11.355 27.145 18.143  1.00 80.78 ? 2   DA  T P     1 
ATOM   3379 O  OP1   . DA  B 2 2   ? 12.722 26.593 18.302  1.00 74.45 ? 2   DA  T OP1   1 
ATOM   3380 O  OP2   . DA  B 2 2   ? 10.216 26.545 18.872  1.00 65.82 ? 2   DA  T OP2   1 
ATOM   3381 O  "O5'" . DA  B 2 2   ? 11.378 28.698 18.513  1.00 61.56 ? 2   DA  T "O5'" 1 
ATOM   3382 C  "C5'" . DA  B 2 2   ? 12.133 29.605 17.723  1.00 64.09 ? 2   DA  T "C5'" 1 
ATOM   3383 C  "C4'" . DA  B 2 2   ? 11.942 31.026 18.216  1.00 61.04 ? 2   DA  T "C4'" 1 
ATOM   3384 O  "O4'" . DA  B 2 2   ? 10.608 31.482 17.872  1.00 50.20 ? 2   DA  T "O4'" 1 
ATOM   3385 C  "C3'" . DA  B 2 2   ? 12.071 31.202 19.729  1.00 59.24 ? 2   DA  T "C3'" 1 
ATOM   3386 O  "O3'" . DA  B 2 2   ? 12.716 32.435 20.016  1.00 54.06 ? 2   DA  T "O3'" 1 
ATOM   3387 C  "C2'" . DA  B 2 2   ? 10.617 31.209 20.194  1.00 53.58 ? 2   DA  T "C2'" 1 
ATOM   3388 C  "C1'" . DA  B 2 2   ? 9.947  31.925 19.034  1.00 47.20 ? 2   DA  T "C1'" 1 
ATOM   3389 N  N9    . DA  B 2 2   ? 8.529  31.627 18.900  1.00 42.21 ? 2   DA  T N9    1 
ATOM   3390 C  C8    . DA  B 2 2   ? 7.847  30.569 19.438  1.00 44.17 ? 2   DA  T C8    1 
ATOM   3391 N  N7    . DA  B 2 2   ? 6.568  30.564 19.151  1.00 42.37 ? 2   DA  T N7    1 
ATOM   3392 C  C5    . DA  B 2 2   ? 6.403  31.700 18.368  1.00 41.28 ? 2   DA  T C5    1 
ATOM   3393 C  C6    . DA  B 2 2   ? 5.278  32.265 17.740  1.00 39.95 ? 2   DA  T C6    1 
ATOM   3394 N  N6    . DA  B 2 2   ? 4.052  31.732 17.810  1.00 42.61 ? 2   DA  T N6    1 
ATOM   3395 N  N1    . DA  B 2 2   ? 5.460  33.402 17.033  1.00 41.40 ? 2   DA  T N1    1 
ATOM   3396 C  C2    . DA  B 2 2   ? 6.687  33.928 16.962  1.00 35.85 ? 2   DA  T C2    1 
ATOM   3397 N  N3    . DA  B 2 2   ? 7.819  33.489 17.510  1.00 44.23 ? 2   DA  T N3    1 
ATOM   3398 C  C4    . DA  B 2 2   ? 7.604  32.361 18.206  1.00 39.56 ? 2   DA  T C4    1 
ATOM   3399 P  P     . DT  B 2 3   ? 14.311 32.486 20.211  1.00 67.79 ? 3   DT  T P     1 
ATOM   3400 O  OP1   . DT  B 2 3   ? 14.771 31.127 20.581  1.00 58.45 ? 3   DT  T OP1   1 
ATOM   3401 O  OP2   . DT  B 2 3   ? 14.594 33.644 21.091  1.00 65.52 ? 3   DT  T OP2   1 
ATOM   3402 O  "O5'" . DT  B 2 3   ? 14.884 32.808 18.747  1.00 68.15 ? 3   DT  T "O5'" 1 
ATOM   3403 C  "C5'" . DT  B 2 3   ? 15.303 34.132 18.406  1.00 54.10 ? 3   DT  T "C5'" 1 
ATOM   3404 C  "C4'" . DT  B 2 3   ? 14.254 34.813 17.550  1.00 55.04 ? 3   DT  T "C4'" 1 
ATOM   3405 O  "O4'" . DT  B 2 3   ? 14.693 36.149 17.167  1.00 56.63 ? 3   DT  T "O4'" 1 
ATOM   3406 C  "C3'" . DT  B 2 3   ? 13.913 34.091 16.233  1.00 54.70 ? 3   DT  T "C3'" 1 
ATOM   3407 O  "O3'" . DT  B 2 3   ? 12.501 33.978 16.113  1.00 48.36 ? 3   DT  T "O3'" 1 
ATOM   3408 C  "C2'" . DT  B 2 3   ? 14.485 35.033 15.172  1.00 46.32 ? 3   DT  T "C2'" 1 
ATOM   3409 C  "C1'" . DT  B 2 3   ? 14.251 36.364 15.849  1.00 47.44 ? 3   DT  T "C1'" 1 
ATOM   3410 N  N1    . DT  B 2 3   ? 14.980 37.526 15.228  1.00 50.66 ? 3   DT  T N1    1 
ATOM   3411 C  C2    . DT  B 2 3   ? 14.251 38.614 14.794  1.00 43.68 ? 3   DT  T C2    1 
ATOM   3412 O  O2    . DT  B 2 3   ? 13.033 38.692 14.901  1.00 38.50 ? 3   DT  T O2    1 
ATOM   3413 N  N3    . DT  B 2 3   ? 14.997 39.620 14.237  1.00 41.27 ? 3   DT  T N3    1 
ATOM   3414 C  C4    . DT  B 2 3   ? 16.373 39.643 14.063  1.00 38.10 ? 3   DT  T C4    1 
ATOM   3415 O  O4    . DT  B 2 3   ? 16.955 40.591 13.545  1.00 39.20 ? 3   DT  T O4    1 
ATOM   3416 C  C5    . DT  B 2 3   ? 17.076 38.473 14.534  1.00 38.71 ? 3   DT  T C5    1 
ATOM   3417 C  C7    . DT  B 2 3   ? 18.572 38.393 14.407  1.00 29.67 ? 3   DT  T C7    1 
ATOM   3418 C  C6    . DT  B 2 3   ? 16.354 37.481 15.086  1.00 47.37 ? 3   DT  T C6    1 
ATOM   3419 P  P     . DG  B 2 4   ? 11.835 33.214 14.868  1.00 56.87 ? 4   DG  T P     1 
ATOM   3420 O  OP1   . DG  B 2 4   ? 10.399 33.102 15.194  1.00 55.67 ? 4   DG  T OP1   1 
ATOM   3421 O  OP2   . DG  B 2 4   ? 12.656 32.027 14.545  1.00 56.02 ? 4   DG  T OP2   1 
ATOM   3422 O  "O5'" . DG  B 2 4   ? 11.975 34.227 13.637  1.00 35.14 ? 4   DG  T "O5'" 1 
ATOM   3423 C  "C5'" . DG  B 2 4   ? 11.246 35.442 13.630  1.00 30.08 ? 4   DG  T "C5'" 1 
ATOM   3424 C  "C4'" . DG  B 2 4   ? 11.545 36.227 12.365  1.00 25.89 ? 4   DG  T "C4'" 1 
ATOM   3425 O  "O4'" . DG  B 2 4   ? 12.919 36.698 12.398  1.00 25.59 ? 4   DG  T "O4'" 1 
ATOM   3426 C  "C3'" . DG  B 2 4   ? 11.424 35.440 11.058  1.00 24.91 ? 4   DG  T "C3'" 1 
ATOM   3427 O  "O3'" . DG  B 2 4   ? 10.971 36.318 10.063  1.00 21.76 ? 4   DG  T "O3'" 1 
ATOM   3428 C  "C2'" . DG  B 2 4   ? 12.868 35.033 10.793  1.00 24.56 ? 4   DG  T "C2'" 1 
ATOM   3429 C  "C1'" . DG  B 2 4   ? 13.560 36.307 11.209  1.00 23.94 ? 4   DG  T "C1'" 1 
ATOM   3430 N  N9    . DG  B 2 4   ? 14.982 36.157 11.474  1.00 31.69 ? 4   DG  T N9    1 
ATOM   3431 C  C8    . DG  B 2 4   ? 15.611 35.128 12.125  1.00 24.63 ? 4   DG  T C8    1 
ATOM   3432 N  N7    . DG  B 2 4   ? 16.903 35.283 12.212  1.00 26.74 ? 4   DG  T N7    1 
ATOM   3433 C  C5    . DG  B 2 4   ? 17.135 36.493 11.566  1.00 19.44 ? 4   DG  T C5    1 
ATOM   3434 C  C6    . DG  B 2 4   ? 18.338 37.192 11.341  1.00 21.89 ? 4   DG  T C6    1 
ATOM   3435 O  O6    . DG  B 2 4   ? 19.484 36.879 11.683  1.00 21.58 ? 4   DG  T O6    1 
ATOM   3436 N  N1    . DG  B 2 4   ? 18.117 38.387 10.657  1.00 19.85 ? 4   DG  T N1    1 
ATOM   3437 C  C2    . DG  B 2 4   ? 16.886 38.841 10.240  1.00 19.70 ? 4   DG  T C2    1 
ATOM   3438 N  N2    . DG  B 2 4   ? 16.865 40.017 9.582   1.00 22.29 ? 4   DG  T N2    1 
ATOM   3439 N  N3    . DG  B 2 4   ? 15.756 38.198 10.458  1.00 19.70 ? 4   DG  T N3    1 
ATOM   3440 C  C4    . DG  B 2 4   ? 15.959 37.035 11.112  1.00 21.25 ? 4   DG  T C4    1 
ATOM   3441 P  P     . DA  B 2 5   ? 10.686 35.811 8.573   1.00 20.92 ? 5   DA  T P     1 
ATOM   3442 O  OP1   . DA  B 2 5   ? 9.341  36.303 8.212   1.00 23.48 ? 5   DA  T OP1   1 
ATOM   3443 O  OP2   . DA  B 2 5   ? 11.041 34.382 8.475   1.00 19.03 ? 5   DA  T OP2   1 
ATOM   3444 O  "O5'" . DA  B 2 5   ? 11.720 36.632 7.685   1.00 20.42 ? 5   DA  T "O5'" 1 
ATOM   3445 C  "C5'" . DA  B 2 5   ? 11.598 38.047 7.557   1.00 20.81 ? 5   DA  T "C5'" 1 
ATOM   3446 C  "C4'" . DA  B 2 5   ? 12.542 38.572 6.497   1.00 18.66 ? 5   DA  T "C4'" 1 
ATOM   3447 O  "O4'" . DA  B 2 5   ? 13.910 38.480 6.971   1.00 17.63 ? 5   DA  T "O4'" 1 
ATOM   3448 C  "C3'" . DA  B 2 5   ? 12.503 37.831 5.160   1.00 18.20 ? 5   DA  T "C3'" 1 
ATOM   3449 O  "O3'" . DA  B 2 5   ? 12.591 38.779 4.126   1.00 17.28 ? 5   DA  T "O3'" 1 
ATOM   3450 C  "C2'" . DA  B 2 5   ? 13.751 36.946 5.213   1.00 20.79 ? 5   DA  T "C2'" 1 
ATOM   3451 C  "C1'" . DA  B 2 5   ? 14.704 37.839 6.000   1.00 18.76 ? 5   DA  T "C1'" 1 
ATOM   3452 N  N9    . DA  B 2 5   ? 15.755 37.124 6.709   1.00 18.74 ? 5   DA  T N9    1 
ATOM   3453 C  C8    . DA  B 2 5   ? 15.627 36.015 7.489   1.00 20.93 ? 5   DA  T C8    1 
ATOM   3454 N  N7    . DA  B 2 5   ? 16.758 35.620 8.027   1.00 18.64 ? 5   DA  T N7    1 
ATOM   3455 C  C5    . DA  B 2 5   ? 17.683 36.550 7.578   1.00 16.81 ? 5   DA  T C5    1 
ATOM   3456 C  C6    . DA  B 2 5   ? 19.065 36.700 7.796   1.00 20.26 ? 5   DA  T C6    1 
ATOM   3457 N  N6    . DA  B 2 5   ? 19.779 35.860 8.547   1.00 22.33 ? 5   DA  T N6    1 
ATOM   3458 N  N1    . DA  B 2 5   ? 19.684 37.743 7.199   1.00 17.25 ? 5   DA  T N1    1 
ATOM   3459 C  C2    . DA  B 2 5   ? 18.965 38.570 6.444   1.00 23.13 ? 5   DA  T C2    1 
ATOM   3460 N  N3    . DA  B 2 5   ? 17.661 38.529 6.173   1.00 19.94 ? 5   DA  T N3    1 
ATOM   3461 C  C4    . DA  B 2 5   ? 17.080 37.489 6.780   1.00 16.90 ? 5   DA  T C4    1 
ATOM   3462 P  P     . DT  B 2 6   ? 12.536 38.336 2.593   1.00 18.51 ? 6   DT  T P     1 
ATOM   3463 O  OP1   . DT  B 2 6   ? 12.265 39.561 1.828   1.00 22.28 ? 6   DT  T OP1   1 
ATOM   3464 O  OP2   . DT  B 2 6   ? 11.635 37.179 2.427   1.00 20.61 ? 6   DT  T OP2   1 
ATOM   3465 O  "O5'" . DT  B 2 6   ? 14.041 37.967 2.266   1.00 26.75 ? 6   DT  T "O5'" 1 
ATOM   3466 C  "C5'" . DT  B 2 6   ? 14.920 39.035 2.198   1.00 26.30 ? 6   DT  T "C5'" 1 
ATOM   3467 C  "C4'" . DT  B 2 6   ? 16.346 38.606 2.056   1.00 25.55 ? 6   DT  T "C4'" 1 
ATOM   3468 O  "O4'" . DT  B 2 6   ? 16.696 37.655 3.043   1.00 24.43 ? 6   DT  T "O4'" 1 
ATOM   3469 C  "C3'" . DT  B 2 6   ? 16.751 37.960 0.736   1.00 27.27 ? 6   DT  T "C3'" 1 
ATOM   3470 O  "O3'" . DT  B 2 6   ? 17.233 39.003 -0.089  1.00 29.28 ? 6   DT  T "O3'" 1 
ATOM   3471 C  "C2'" . DT  B 2 6   ? 17.875 36.968 1.176   1.00 26.73 ? 6   DT  T "C2'" 1 
ATOM   3472 C  "C1'" . DT  B 2 6   ? 17.982 37.280 2.681   1.00 26.62 ? 6   DT  T "C1'" 1 
ATOM   3473 N  N1    . DT  B 2 6   ? 18.430 36.202 3.574   1.00 19.84 ? 6   DT  T N1    1 
ATOM   3474 C  C2    . DT  B 2 6   ? 19.733 36.239 4.025   1.00 16.67 ? 6   DT  T C2    1 
ATOM   3475 O  O2    . DT  B 2 6   ? 20.535 37.093 3.672   1.00 21.78 ? 6   DT  T O2    1 
ATOM   3476 N  N3    . DT  B 2 6   ? 20.069 35.236 4.881   1.00 20.29 ? 6   DT  T N3    1 
ATOM   3477 C  C4    . DT  B 2 6   ? 19.253 34.231 5.352   1.00 18.15 ? 6   DT  T C4    1 
ATOM   3478 O  O4    . DT  B 2 6   ? 19.650 33.380 6.131   1.00 22.75 ? 6   DT  T O4    1 
ATOM   3479 C  C5    . DT  B 2 6   ? 17.888 34.260 4.863   1.00 23.60 ? 6   DT  T C5    1 
ATOM   3480 C  C7    . DT  B 2 6   ? 16.907 33.214 5.307   1.00 22.78 ? 6   DT  T C7    1 
ATOM   3481 C  C6    . DT  B 2 6   ? 17.546 35.248 4.014   1.00 21.43 ? 6   DT  T C6    1 
ATOM   3482 P  P     . DG  B 2 7   ? 17.546 38.802 -1.642  1.00 30.79 ? 7   DG  T P     1 
ATOM   3483 O  OP1   . DG  B 2 7   ? 17.568 40.160 -2.224  1.00 38.89 ? 7   DG  T OP1   1 
ATOM   3484 O  OP2   . DG  B 2 7   ? 16.746 37.727 -2.245  1.00 27.50 ? 7   DG  T OP2   1 
ATOM   3485 O  "O5'" . DG  B 2 7   ? 19.053 38.268 -1.651  1.00 36.98 ? 7   DG  T "O5'" 1 
ATOM   3486 C  "C5'" . DG  B 2 7   ? 20.087 39.130 -1.281  1.00 40.54 ? 7   DG  T "C5'" 1 
ATOM   3487 C  "C4'" . DG  B 2 7   ? 21.374 38.365 -1.079  1.00 20.61 ? 7   DG  T "C4'" 1 
ATOM   3488 O  "O4'" . DG  B 2 7   ? 21.269 37.520 0.078   1.00 24.53 ? 7   DG  T "O4'" 1 
ATOM   3489 C  "C3'" . DG  B 2 7   ? 21.787 37.436 -2.232  1.00 24.39 ? 7   DG  T "C3'" 1 
ATOM   3490 O  "O3'" . DG  B 2 7   ? 22.861 38.031 -2.973  1.00 26.88 ? 7   DG  T "O3'" 1 
ATOM   3491 C  "C2'" . DG  B 2 7   ? 22.221 36.136 -1.525  1.00 26.19 ? 7   DG  T "C2'" 1 
ATOM   3492 C  "C1'" . DG  B 2 7   ? 22.272 36.556 -0.060  1.00 25.74 ? 7   DG  T "C1'" 1 
ATOM   3493 N  N9    . DG  B 2 7   ? 22.047 35.464 0.878   1.00 25.76 ? 7   DG  T N9    1 
ATOM   3494 C  C8    . DG  B 2 7   ? 20.899 34.732 1.064   1.00 17.85 ? 7   DG  T C8    1 
ATOM   3495 N  N7    . DG  B 2 7   ? 21.020 33.806 1.974   1.00 19.96 ? 7   DG  T N7    1 
ATOM   3496 C  C5    . DG  B 2 7   ? 22.337 33.937 2.416   1.00 17.20 ? 7   DG  T C5    1 
ATOM   3497 C  C6    . DG  B 2 7   ? 23.054 33.201 3.386   1.00 15.13 ? 7   DG  T C6    1 
ATOM   3498 O  O6    . DG  B 2 7   ? 22.660 32.267 4.079   1.00 18.51 ? 7   DG  T O6    1 
ATOM   3499 N  N1    . DG  B 2 7   ? 24.371 33.657 3.507   1.00 17.88 ? 7   DG  T N1    1 
ATOM   3500 C  C2    . DG  B 2 7   ? 24.909 34.687 2.793   1.00 17.16 ? 7   DG  T C2    1 
ATOM   3501 N  N2    . DG  B 2 7   ? 26.204 34.985 3.045   1.00 20.80 ? 7   DG  T N2    1 
ATOM   3502 N  N3    . DG  B 2 7   ? 24.246 35.377 1.871   1.00 19.76 ? 7   DG  T N3    1 
ATOM   3503 C  C4    . DG  B 2 7   ? 22.976 34.942 1.740   1.00 20.34 ? 7   DG  T C4    1 
ATOM   3504 P  P     . DA  B 2 8   ? 23.568 37.266 -4.198  1.00 27.14 ? 8   DA  T P     1 
ATOM   3505 O  OP1   . DA  B 2 8   ? 23.888 38.259 -5.230  1.00 28.81 ? 8   DA  T OP1   1 
ATOM   3506 O  OP2   . DA  B 2 8   ? 22.835 36.027 -4.564  1.00 28.09 ? 8   DA  T OP2   1 
ATOM   3507 O  "O5'" . DA  B 2 8   ? 24.946 36.763 -3.567  1.00 26.41 ? 8   DA  T "O5'" 1 
ATOM   3508 C  "C5'" . DA  B 2 8   ? 25.797 37.672 -2.883  1.00 28.88 ? 8   DA  T "C5'" 1 
ATOM   3509 C  "C4'" . DA  B 2 8   ? 27.093 36.971 -2.516  1.00 18.70 ? 8   DA  T "C4'" 1 
ATOM   3510 O  "O4'" . DA  B 2 8   ? 26.854 36.119 -1.376  1.00 24.86 ? 8   DA  T "O4'" 1 
ATOM   3511 C  "C3'" . DA  B 2 8   ? 27.654 36.089 -3.627  1.00 28.54 ? 8   DA  T "C3'" 1 
ATOM   3512 O  "O3'" . DA  B 2 8   ? 29.026 36.355 -3.808  1.00 31.55 ? 8   DA  T "O3'" 1 
ATOM   3513 C  "C2'" . DA  B 2 8   ? 27.407 34.660 -3.149  1.00 26.18 ? 8   DA  T "C2'" 1 
ATOM   3514 C  "C1'" . DA  B 2 8   ? 27.287 34.809 -1.635  1.00 24.68 ? 8   DA  T "C1'" 1 
ATOM   3515 N  N9    . DA  B 2 8   ? 26.310 33.893 -1.074  1.00 19.63 ? 8   DA  T N9    1 
ATOM   3516 C  C8    . DA  B 2 8   ? 25.015 33.717 -1.491  1.00 20.93 ? 8   DA  T C8    1 
ATOM   3517 N  N7    . DA  B 2 8   ? 24.367 32.809 -0.817  1.00 18.74 ? 8   DA  T N7    1 
ATOM   3518 C  C5    . DA  B 2 8   ? 25.302 32.346 0.101   1.00 18.21 ? 8   DA  T C5    1 
ATOM   3519 C  C6    . DA  B 2 8   ? 25.243 31.376 1.115   1.00 19.64 ? 8   DA  T C6    1 
ATOM   3520 N  N6    . DA  B 2 8   ? 24.154 30.649 1.381   1.00 16.82 ? 8   DA  T N6    1 
ATOM   3521 N  N1    . DA  B 2 8   ? 26.358 31.174 1.856   1.00 16.00 ? 8   DA  T N1    1 
ATOM   3522 C  C2    . DA  B 2 8   ? 27.446 31.888 1.585   1.00 15.43 ? 8   DA  T C2    1 
ATOM   3523 N  N3    . DA  B 2 8   ? 27.623 32.830 0.662   1.00 15.62 ? 8   DA  T N3    1 
ATOM   3524 C  C4    . DA  B 2 8   ? 26.503 33.010 -0.053  1.00 21.21 ? 8   DA  T C4    1 
ATOM   3525 P  P     . DC  B 2 9   ? 29.830 35.674 -5.019  1.00 29.91 ? 9   DC  T P     1 
ATOM   3526 O  OP1   . DC  B 2 9   ? 30.947 36.598 -5.296  1.00 37.63 ? 9   DC  T OP1   1 
ATOM   3527 O  OP2   . DC  B 2 9   ? 28.958 35.241 -6.132  1.00 28.08 ? 9   DC  T OP2   1 
ATOM   3528 O  "O5'" . DC  B 2 9   ? 30.387 34.334 -4.361  1.00 24.51 ? 9   DC  T "O5'" 1 
ATOM   3529 C  "C5'" . DC  B 2 9   ? 31.125 34.420 -3.167  1.00 25.41 ? 9   DC  T "C5'" 1 
ATOM   3530 C  "C4'" . DC  B 2 9   ? 31.306 33.047 -2.577  1.00 24.27 ? 9   DC  T "C4'" 1 
ATOM   3531 O  "O4'" . DC  B 2 9   ? 30.041 32.572 -2.059  1.00 27.43 ? 9   DC  T "O4'" 1 
ATOM   3532 C  "C3'" . DC  B 2 9   ? 31.774 31.976 -3.580  1.00 26.14 ? 9   DC  T "C3'" 1 
ATOM   3533 O  "O3'" . DC  B 2 9   ? 32.873 31.296 -3.035  1.00 38.25 ? 9   DC  T "O3'" 1 
ATOM   3534 C  "C2'" . DC  B 2 9   ? 30.561 31.052 -3.698  1.00 27.03 ? 9   DC  T "C2'" 1 
ATOM   3535 C  "C1'" . DC  B 2 9   ? 29.990 31.197 -2.304  1.00 25.31 ? 9   DC  T "C1'" 1 
ATOM   3536 N  N1    . DC  B 2 9   ? 28.606 30.673 -2.153  1.00 20.61 ? 9   DC  T N1    1 
ATOM   3537 C  C2    . DC  B 2 9   ? 28.336 29.821 -1.097  1.00 19.41 ? 9   DC  T C2    1 
ATOM   3538 O  O2    . DC  B 2 9   ? 29.245 29.582 -0.288  1.00 20.92 ? 9   DC  T O2    1 
ATOM   3539 N  N3    . DC  B 2 9   ? 27.090 29.300 -0.969  1.00 22.51 ? 9   DC  T N3    1 
ATOM   3540 C  C4    . DC  B 2 9   ? 26.140 29.605 -1.864  1.00 23.10 ? 9   DC  T C4    1 
ATOM   3541 N  N4    . DC  B 2 9   ? 24.929 29.061 -1.705  1.00 20.07 ? 9   DC  T N4    1 
ATOM   3542 C  C5    . DC  B 2 9   ? 26.404 30.463 -2.967  1.00 22.53 ? 9   DC  T C5    1 
ATOM   3543 C  C6    . DC  B 2 9   ? 27.641 30.962 -3.082  1.00 20.41 ? 9   DC  T C6    1 
ATOM   3544 P  P     . DG  B 2 10  ? 33.839 30.386 -3.941  1.00 32.01 ? 10  DG  T P     1 
ATOM   3545 O  OP1   . DG  B 2 10  ? 35.088 31.140 -4.131  1.00 38.29 ? 10  DG  T OP1   1 
ATOM   3546 O  OP2   . DG  B 2 10  ? 33.127 29.782 -5.089  1.00 33.00 ? 10  DG  T OP2   1 
ATOM   3547 O  "O5'" . DG  B 2 10  ? 34.176 29.202 -2.950  1.00 30.90 ? 10  DG  T "O5'" 1 
ATOM   3548 C  "C5'" . DG  B 2 10  ? 34.289 29.468 -1.562  1.00 29.82 ? 10  DG  T "C5'" 1 
ATOM   3549 C  "C4'" . DG  B 2 10  ? 34.289 28.173 -0.786  1.00 23.51 ? 10  DG  T "C4'" 1 
ATOM   3550 O  "O4'" . DG  B 2 10  ? 32.926 27.776 -0.514  1.00 28.26 ? 10  DG  T "O4'" 1 
ATOM   3551 C  "C3'" . DG  B 2 10  ? 34.929 27.005 -1.518  1.00 32.79 ? 10  DG  T "C3'" 1 
ATOM   3552 O  "O3'" . DG  B 2 10  ? 35.579 26.174 -0.591  1.00 29.57 ? 10  DG  T "O3'" 1 
ATOM   3553 C  "C2'" . DG  B 2 10  ? 33.737 26.302 -2.164  1.00 26.12 ? 10  DG  T "C2'" 1 
ATOM   3554 C  "C1'" . DG  B 2 10  ? 32.637 26.543 -1.141  1.00 26.87 ? 10  DG  T "C1'" 1 
ATOM   3555 N  N9    . DG  B 2 10  ? 31.304 26.638 -1.730  1.00 25.22 ? 10  DG  T N9    1 
ATOM   3556 C  C8    . DG  B 2 10  ? 30.886 27.524 -2.696  1.00 24.05 ? 10  DG  T C8    1 
ATOM   3557 N  N7    . DG  B 2 10  ? 29.629 27.380 -3.025  1.00 20.87 ? 10  DG  T N7    1 
ATOM   3558 C  C5    . DG  B 2 10  ? 29.194 26.328 -2.232  1.00 18.63 ? 10  DG  T C5    1 
ATOM   3559 C  C6    . DG  B 2 10  ? 27.924 25.712 -2.145  1.00 18.04 ? 10  DG  T C6    1 
ATOM   3560 O  O6    . DG  B 2 10  ? 26.893 25.982 -2.775  1.00 19.78 ? 10  DG  T O6    1 
ATOM   3561 N  N1    . DG  B 2 10  ? 27.917 24.687 -1.210  1.00 19.51 ? 10  DG  T N1    1 
ATOM   3562 C  C2    . DG  B 2 10  ? 28.998 24.300 -0.451  1.00 16.14 ? 10  DG  T C2    1 
ATOM   3563 N  N2    . DG  B 2 10  ? 28.793 23.279 0.400   1.00 19.84 ? 10  DG  T N2    1 
ATOM   3564 N  N3    . DG  B 2 10  ? 30.193 24.859 -0.522  1.00 17.58 ? 10  DG  T N3    1 
ATOM   3565 C  C4    . DG  B 2 10  ? 30.219 25.869 -1.422  1.00 19.31 ? 10  DG  T C4    1 
ATOM   3566 P  P     . DC  B 2 11  ? 36.435 24.922 -1.104  1.00 28.41 ? 11  DC  T P     1 
ATOM   3567 O  OP1   . DC  B 2 11  ? 37.536 24.726 -0.136  1.00 32.80 ? 11  DC  T OP1   1 
ATOM   3568 O  OP2   . DC  B 2 11  ? 36.737 25.069 -2.534  1.00 24.07 ? 11  DC  T OP2   1 
ATOM   3569 O  "O5'" . DC  B 2 11  ? 35.413 23.710 -0.954  1.00 25.22 ? 11  DC  T "O5'" 1 
ATOM   3570 C  "C5'" . DC  B 2 11  ? 34.993 23.320 0.322   1.00 20.66 ? 11  DC  T "C5'" 1 
ATOM   3571 C  "C4'" . DC  B 2 11  ? 34.177 22.048 0.242   1.00 23.61 ? 11  DC  T "C4'" 1 
ATOM   3572 O  "O4'" . DC  B 2 11  ? 32.875 22.329 -0.319  1.00 22.11 ? 11  DC  T "O4'" 1 
ATOM   3573 C  "C3'" . DC  B 2 11  ? 34.786 20.930 -0.607  1.00 20.74 ? 11  DC  T "C3'" 1 
ATOM   3574 O  "O3'" . DC  B 2 11  ? 34.745 19.737 0.156   1.00 18.89 ? 11  DC  T "O3'" 1 
ATOM   3575 C  "C2'" . DC  B 2 11  ? 33.878 20.870 -1.860  1.00 16.62 ? 11  DC  T "C2'" 1 
ATOM   3576 C  "C1'" . DC  B 2 11  ? 32.551 21.364 -1.303  1.00 18.52 ? 11  DC  T "C1'" 1 
ATOM   3577 N  N1    . DC  B 2 11  ? 31.669 22.035 -2.296  1.00 17.45 ? 11  DC  T N1    1 
ATOM   3578 C  C2    . DC  B 2 11  ? 30.339 21.613 -2.427  1.00 10.97 ? 11  DC  T C2    1 
ATOM   3579 O  O2    . DC  B 2 11  ? 29.943 20.659 -1.754  1.00 17.14 ? 11  DC  T O2    1 
ATOM   3580 N  N3    . DC  B 2 11  ? 29.530 22.255 -3.312  1.00 16.05 ? 11  DC  T N3    1 
ATOM   3581 C  C4    . DC  B 2 11  ? 30.009 23.279 -4.030  1.00 16.86 ? 11  DC  T C4    1 
ATOM   3582 N  N4    . DC  B 2 11  ? 29.177 23.894 -4.889  1.00 18.62 ? 11  DC  T N4    1 
ATOM   3583 C  C5    . DC  B 2 11  ? 31.352 23.730 -3.893  1.00 18.16 ? 11  DC  T C5    1 
ATOM   3584 C  C6    . DC  B 2 11  ? 32.143 23.081 -3.023  1.00 15.93 ? 11  DC  T C6    1 
ATOM   3585 P  P     . DT  B 2 12  ? 35.500 18.409 -0.347  1.00 18.53 ? 12  DT  T P     1 
ATOM   3586 O  OP1   . DT  B 2 12  ? 35.851 17.608 0.847   1.00 21.45 ? 12  DT  T OP1   1 
ATOM   3587 O  OP2   . DT  B 2 12  ? 36.537 18.824 -1.294  1.00 19.39 ? 12  DT  T OP2   1 
ATOM   3588 O  "O5'" . DT  B 2 12  ? 34.355 17.624 -1.134  1.00 18.24 ? 12  DT  T "O5'" 1 
ATOM   3589 C  "C5'" . DT  B 2 12  ? 33.298 17.022 -0.417  1.00 19.90 ? 12  DT  T "C5'" 1 
ATOM   3590 C  "C4'" . DT  B 2 12  ? 32.259 16.501 -1.378  1.00 19.04 ? 12  DT  T "C4'" 1 
ATOM   3591 O  "O4'" . DT  B 2 12  ? 31.629 17.617 -2.045  1.00 19.29 ? 12  DT  T "O4'" 1 
ATOM   3592 C  "C3'" . DT  B 2 12  ? 32.823 15.615 -2.503  1.00 24.71 ? 12  DT  T "C3'" 1 
ATOM   3593 O  "O3'" . DT  B 2 12  ? 32.250 14.326 -2.448  1.00 22.64 ? 12  DT  T "O3'" 1 
ATOM   3594 C  "C2'" . DT  B 2 12  ? 32.412 16.335 -3.788  1.00 28.00 ? 12  DT  T "C2'" 1 
ATOM   3595 C  "C1'" . DT  B 2 12  ? 31.242 17.174 -3.319  1.00 24.07 ? 12  DT  T "C1'" 1 
ATOM   3596 N  N1    . DT  B 2 12  ? 30.976 18.334 -4.210  1.00 21.48 ? 12  DT  T N1    1 
ATOM   3597 C  C2    . DT  B 2 12  ? 29.697 18.572 -4.644  1.00 18.09 ? 12  DT  T C2    1 
ATOM   3598 O  O2    . DT  B 2 12  ? 28.737 17.898 -4.307  1.00 23.80 ? 12  DT  T O2    1 
ATOM   3599 N  N3    . DT  B 2 12  ? 29.567 19.646 -5.483  1.00 19.24 ? 12  DT  T N3    1 
ATOM   3600 C  C4    . DT  B 2 12  ? 30.576 20.473 -5.942  1.00 20.06 ? 12  DT  T C4    1 
ATOM   3601 O  O4    . DT  B 2 12  ? 30.359 21.409 -6.696  1.00 24.40 ? 12  DT  T O4    1 
ATOM   3602 C  C5    . DT  B 2 12  ? 31.900 20.160 -5.448  1.00 19.96 ? 12  DT  T C5    1 
ATOM   3603 C  C7    . DT  B 2 12  ? 33.084 20.978 -5.864  1.00 26.20 ? 12  DT  T C7    1 
ATOM   3604 C  C6    . DT  B 2 12  ? 32.030 19.115 -4.622  1.00 22.62 ? 12  DT  T C6    1 
ATOM   3605 O  "O5'" . DA  C 3 1   ? 21.162 20.524 -10.376 1.00 39.84 ? 1   DA  P "O5'" 1 
ATOM   3606 C  "C5'" . DA  C 3 1   ? 20.981 19.175 -10.803 1.00 33.51 ? 1   DA  P "C5'" 1 
ATOM   3607 C  "C4'" . DA  C 3 1   ? 20.978 18.212 -9.626  1.00 28.83 ? 1   DA  P "C4'" 1 
ATOM   3608 O  "O4'" . DA  C 3 1   ? 22.332 17.969 -9.188  1.00 30.52 ? 1   DA  P "O4'" 1 
ATOM   3609 C  "C3'" . DA  C 3 1   ? 20.220 18.685 -8.388  1.00 24.68 ? 1   DA  P "C3'" 1 
ATOM   3610 O  "O3'" . DA  C 3 1   ? 19.664 17.582 -7.718  1.00 25.93 ? 1   DA  P "O3'" 1 
ATOM   3611 C  "C2'" . DA  C 3 1   ? 21.293 19.344 -7.538  1.00 27.75 ? 1   DA  P "C2'" 1 
ATOM   3612 C  "C1'" . DA  C 3 1   ? 22.582 18.643 -7.980  1.00 31.68 ? 1   DA  P "C1'" 1 
ATOM   3613 N  N9    . DA  C 3 1   ? 23.675 19.573 -8.193  1.00 27.91 ? 1   DA  P N9    1 
ATOM   3614 C  C8    . DA  C 3 1   ? 23.718 20.631 -9.054  1.00 21.39 ? 1   DA  P C8    1 
ATOM   3615 N  N7    . DA  C 3 1   ? 24.841 21.303 -9.011  1.00 30.83 ? 1   DA  P N7    1 
ATOM   3616 C  C5    . DA  C 3 1   ? 25.571 20.640 -8.043  1.00 19.57 ? 1   DA  P C5    1 
ATOM   3617 C  C6    . DA  C 3 1   ? 26.856 20.834 -7.529  1.00 21.67 ? 1   DA  P C6    1 
ATOM   3618 N  N6    . DA  C 3 1   ? 27.674 21.827 -7.925  1.00 21.92 ? 1   DA  P N6    1 
ATOM   3619 N  N1    . DA  C 3 1   ? 27.279 19.971 -6.586  1.00 28.16 ? 1   DA  P N1    1 
ATOM   3620 C  C2    . DA  C 3 1   ? 26.473 18.986 -6.194  1.00 21.24 ? 1   DA  P C2    1 
ATOM   3621 N  N3    . DA  C 3 1   ? 25.251 18.695 -6.613  1.00 20.97 ? 1   DA  P N3    1 
ATOM   3622 C  C4    . DA  C 3 1   ? 24.861 19.564 -7.546  1.00 20.06 ? 1   DA  P C4    1 
ATOM   3623 P  P     . DG  C 3 2   ? 18.487 17.817 -6.647  1.00 23.54 ? 2   DG  P P     1 
ATOM   3624 O  OP1   . DG  C 3 2   ? 17.704 16.563 -6.554  1.00 25.63 ? 2   DG  P OP1   1 
ATOM   3625 O  OP2   . DG  C 3 2   ? 17.873 19.114 -6.983  1.00 24.40 ? 2   DG  P OP2   1 
ATOM   3626 O  "O5'" . DG  C 3 2   ? 19.268 18.072 -5.282  1.00 22.42 ? 2   DG  P "O5'" 1 
ATOM   3627 C  "C5'" . DG  C 3 2   ? 19.879 17.001 -4.632  1.00 23.15 ? 2   DG  P "C5'" 1 
ATOM   3628 C  "C4'" . DG  C 3 2   ? 20.787 17.519 -3.552  1.00 22.58 ? 2   DG  P "C4'" 1 
ATOM   3629 O  "O4'" . DG  C 3 2   ? 21.848 18.304 -4.136  1.00 22.35 ? 2   DG  P "O4'" 1 
ATOM   3630 C  "C3'" . DG  C 3 2   ? 20.104 18.424 -2.518  1.00 26.39 ? 2   DG  P "C3'" 1 
ATOM   3631 O  "O3'" . DG  C 3 2   ? 20.249 17.820 -1.265  1.00 28.54 ? 2   DG  P "O3'" 1 
ATOM   3632 C  "C2'" . DG  C 3 2   ? 20.875 19.747 -2.616  1.00 21.26 ? 2   DG  P "C2'" 1 
ATOM   3633 C  "C1'" . DG  C 3 2   ? 22.201 19.281 -3.209  1.00 17.76 ? 2   DG  P "C1'" 1 
ATOM   3634 N  N9    . DG  C 3 2   ? 22.987 20.331 -3.854  1.00 21.25 ? 2   DG  P N9    1 
ATOM   3635 C  C8    . DG  C 3 2   ? 22.564 21.268 -4.773  1.00 19.13 ? 2   DG  P C8    1 
ATOM   3636 N  N7    . DG  C 3 2   ? 23.507 22.089 -5.148  1.00 21.63 ? 2   DG  P N7    1 
ATOM   3637 C  C5    . DG  C 3 2   ? 24.636 21.664 -4.439  1.00 19.54 ? 2   DG  P C5    1 
ATOM   3638 C  C6    . DG  C 3 2   ? 25.969 22.170 -4.429  1.00 17.10 ? 2   DG  P C6    1 
ATOM   3639 O  O6    . DG  C 3 2   ? 26.449 23.122 -5.071  1.00 20.25 ? 2   DG  P O6    1 
ATOM   3640 N  N1    . DG  C 3 2   ? 26.782 21.448 -3.557  1.00 19.02 ? 2   DG  P N1    1 
ATOM   3641 C  C2    . DG  C 3 2   ? 26.375 20.377 -2.811  1.00 17.43 ? 2   DG  P C2    1 
ATOM   3642 N  N2    . DG  C 3 2   ? 27.308 19.802 -2.029  1.00 19.87 ? 2   DG  P N2    1 
ATOM   3643 N  N3    . DG  C 3 2   ? 25.137 19.897 -2.813  1.00 19.58 ? 2   DG  P N3    1 
ATOM   3644 C  C4    . DG  C 3 2   ? 24.328 20.588 -3.646  1.00 20.37 ? 2   DG  P C4    1 
ATOM   3645 P  P     . DC  C 3 3   ? 19.667 18.466 0.082   1.00 25.13 ? 3   DC  P P     1 
ATOM   3646 O  OP1   . DC  C 3 3   ? 18.928 17.351 0.679   1.00 28.51 ? 3   DC  P OP1   1 
ATOM   3647 O  OP2   . DC  C 3 3   ? 19.042 19.797 -0.073  1.00 24.26 ? 3   DC  P OP2   1 
ATOM   3648 O  "O5'" . DC  C 3 3   ? 20.980 18.746 0.942   1.00 29.01 ? 3   DC  P "O5'" 1 
ATOM   3649 C  "C5'" . DC  C 3 3   ? 21.988 17.756 1.042   1.00 35.48 ? 3   DC  P "C5'" 1 
ATOM   3650 C  "C4'" . DC  C 3 3   ? 23.266 18.357 1.603   1.00 22.98 ? 3   DC  P "C4'" 1 
ATOM   3651 O  "O4'" . DC  C 3 3   ? 23.873 19.219 0.607   1.00 28.80 ? 3   DC  P "O4'" 1 
ATOM   3652 C  "C3'" . DC  C 3 3   ? 23.082 19.217 2.863   1.00 25.92 ? 3   DC  P "C3'" 1 
ATOM   3653 O  "O3'" . DC  C 3 3   ? 24.034 18.850 3.831   1.00 24.88 ? 3   DC  P "O3'" 1 
ATOM   3654 C  "C2'" . DC  C 3 3   ? 23.325 20.639 2.365   1.00 25.40 ? 3   DC  P "C2'" 1 
ATOM   3655 C  "C1'" . DC  C 3 3   ? 24.305 20.398 1.231   1.00 23.78 ? 3   DC  P "C1'" 1 
ATOM   3656 N  N1    . DC  C 3 3   ? 24.296 21.473 0.243   1.00 24.28 ? 3   DC  P N1    1 
ATOM   3657 C  C2    . DC  C 3 3   ? 25.467 22.187 -0.001  1.00 16.31 ? 3   DC  P C2    1 
ATOM   3658 O  O2    . DC  C 3 3   ? 26.497 21.881 0.609   1.00 23.84 ? 3   DC  P O2    1 
ATOM   3659 N  N3    . DC  C 3 3   ? 25.447 23.183 -0.908  1.00 21.35 ? 3   DC  P N3    1 
ATOM   3660 C  C4    . DC  C 3 3   ? 24.321 23.482 -1.540  1.00 21.71 ? 3   DC  P C4    1 
ATOM   3661 N  N4    . DC  C 3 3   ? 24.355 24.482 -2.417  1.00 23.94 ? 3   DC  P N4    1 
ATOM   3662 C  C5    . DC  C 3 3   ? 23.105 22.762 -1.303  1.00 23.12 ? 3   DC  P C5    1 
ATOM   3663 C  C6    . DC  C 3 3   ? 23.140 21.775 -0.409  1.00 21.18 ? 3   DC  P C6    1 
ATOM   3664 P  P     . DG  C 3 4   ? 24.045 19.557 5.268   1.00 31.18 ? 4   DG  P P     1 
ATOM   3665 O  OP1   . DG  C 3 4   ? 24.385 18.510 6.256   1.00 37.13 ? 4   DG  P OP1   1 
ATOM   3666 O  OP2   . DG  C 3 4   ? 22.814 20.353 5.445   1.00 26.47 ? 4   DG  P OP2   1 
ATOM   3667 O  "O5'" . DG  C 3 4   ? 25.283 20.570 5.187   1.00 26.96 ? 4   DG  P "O5'" 1 
ATOM   3668 C  "C5'" . DG  C 3 4   ? 26.577 20.087 4.835   1.00 30.27 ? 4   DG  P "C5'" 1 
ATOM   3669 C  "C4'" . DG  C 3 4   ? 27.645 21.147 5.066   1.00 25.99 ? 4   DG  P "C4'" 1 
ATOM   3670 O  "O4'" . DG  C 3 4   ? 27.647 22.109 3.973   1.00 26.25 ? 4   DG  P "O4'" 1 
ATOM   3671 C  "C3'" . DG  C 3 4   ? 27.501 21.955 6.351   1.00 30.69 ? 4   DG  P "C3'" 1 
ATOM   3672 O  "O3'" . DG  C 3 4   ? 28.803 22.177 6.914   1.00 30.06 ? 4   DG  P "O3'" 1 
ATOM   3673 C  "C2'" . DG  C 3 4   ? 26.835 23.254 5.875   1.00 24.29 ? 4   DG  P "C2'" 1 
ATOM   3674 C  "C1'" . DG  C 3 4   ? 27.390 23.420 4.462   1.00 22.11 ? 4   DG  P "C1'" 1 
ATOM   3675 N  N9    . DG  C 3 4   ? 26.457 24.087 3.534   1.00 22.07 ? 4   DG  P N9    1 
ATOM   3676 C  C8    . DG  C 3 4   ? 25.135 23.776 3.318   1.00 20.84 ? 4   DG  P C8    1 
ATOM   3677 N  N7    . DG  C 3 4   ? 24.556 24.547 2.430   1.00 19.48 ? 4   DG  P N7    1 
ATOM   3678 C  C5    . DG  C 3 4   ? 25.575 25.416 2.023   1.00 16.86 ? 4   DG  P C5    1 
ATOM   3679 C  C6    . DG  C 3 4   ? 25.550 26.485 1.091   1.00 16.39 ? 4   DG  P C6    1 
ATOM   3680 O  O6    . DG  C 3 4   ? 24.607 26.883 0.403   1.00 22.46 ? 4   DG  P O6    1 
ATOM   3681 N  N1    . DG  C 3 4   ? 26.789 27.122 0.997   1.00 14.92 ? 4   DG  P N1    1 
ATOM   3682 C  C2    . DG  C 3 4   ? 27.908 26.757 1.711   1.00 13.17 ? 4   DG  P C2    1 
ATOM   3683 N  N2    . DG  C 3 4   ? 29.017 27.485 1.503   1.00 15.00 ? 4   DG  P N2    1 
ATOM   3684 N  N3    . DG  C 3 4   ? 27.932 25.776 2.593   1.00 17.78 ? 4   DG  P N3    1 
ATOM   3685 C  C4    . DG  C 3 4   ? 26.736 25.151 2.698   1.00 18.11 ? 4   DG  P C4    1 
ATOM   3686 P  P     . DT  C 3 5   ? 28.996 23.058 8.244   1.00 35.58 ? 5   DT  P P     1 
ATOM   3687 O  OP1   . DT  C 3 5   ? 30.145 22.472 8.965   1.00 47.82 ? 5   DT  P OP1   1 
ATOM   3688 O  OP2   . DT  C 3 5   ? 27.710 23.261 8.932   1.00 27.60 ? 5   DT  P OP2   1 
ATOM   3689 O  "O5'" . DT  C 3 5   ? 29.375 24.501 7.671   1.00 28.83 ? 5   DT  P "O5'" 1 
ATOM   3690 C  "C5'" . DT  C 3 5   ? 30.500 24.642 6.870   1.00 22.70 ? 5   DT  P "C5'" 1 
ATOM   3691 C  "C4'" . DT  C 3 5   ? 30.759 26.106 6.570   1.00 21.07 ? 5   DT  P "C4'" 1 
ATOM   3692 O  "O4'" . DT  C 3 5   ? 29.801 26.591 5.606   1.00 20.00 ? 5   DT  P "O4'" 1 
ATOM   3693 C  "C3'" . DT  C 3 5   ? 30.665 27.041 7.777   1.00 20.44 ? 5   DT  P "C3'" 1 
ATOM   3694 O  "O3'" . DT  C 3 5   ? 31.858 27.800 7.837   1.00 19.50 ? 5   DT  P "O3'" 1 
ATOM   3695 C  "C2'" . DT  C 3 5   ? 29.439 27.927 7.479   1.00 16.67 ? 5   DT  P "C2'" 1 
ATOM   3696 C  "C1'" . DT  C 3 5   ? 29.417 27.908 5.961   1.00 19.96 ? 5   DT  P "C1'" 1 
ATOM   3697 N  N1    . DT  C 3 5   ? 28.086 28.141 5.346   1.00 18.03 ? 5   DT  P N1    1 
ATOM   3698 C  C2    . DT  C 3 5   ? 27.942 29.130 4.404   1.00 13.53 ? 5   DT  P C2    1 
ATOM   3699 O  O2    . DT  C 3 5   ? 28.845 29.886 4.076   1.00 15.84 ? 5   DT  P O2    1 
ATOM   3700 N  N3    . DT  C 3 5   ? 26.689 29.219 3.852   1.00 16.82 ? 5   DT  P N3    1 
ATOM   3701 C  C4    . DT  C 3 5   ? 25.598 28.432 4.140   1.00 16.45 ? 5   DT  P C4    1 
ATOM   3702 O  O4    . DT  C 3 5   ? 24.509 28.605 3.597   1.00 18.90 ? 5   DT  P O4    1 
ATOM   3703 C  C5    . DT  C 3 5   ? 25.818 27.410 5.138   1.00 19.07 ? 5   DT  P C5    1 
ATOM   3704 C  C7    . DT  C 3 5   ? 24.702 26.492 5.539   1.00 22.68 ? 5   DT  P C7    1 
ATOM   3705 C  C6    . DT  C 3 5   ? 27.041 27.305 5.675   1.00 17.72 ? 5   DT  P C6    1 
ATOM   3706 P  P     . DC  C 3 6   ? 32.165 28.734 9.102   1.00 15.82 ? 6   DC  P P     1 
ATOM   3707 O  OP1   . DC  C 3 6   ? 33.657 28.753 9.220   1.00 17.12 ? 6   DC  P OP1   1 
ATOM   3708 O  OP2   . DC  C 3 6   ? 31.361 28.322 10.251  1.00 16.35 ? 6   DC  P OP2   1 
ATOM   3709 O  "O5'" . DC  C 3 6   ? 31.705 30.165 8.630   1.00 14.04 ? 6   DC  P "O5'" 1 
ATOM   3710 C  "C5'" . DC  C 3 6   ? 32.355 30.805 7.557   1.00 15.76 ? 6   DC  P "C5'" 1 
ATOM   3711 C  "C4'" . DC  C 3 6   ? 31.598 32.060 7.193   1.00 19.35 ? 6   DC  P "C4'" 1 
ATOM   3712 O  "O4'" . DC  C 3 6   ? 30.351 31.694 6.557   1.00 19.05 ? 6   DC  P "O4'" 1 
ATOM   3713 C  "C3'" . DC  C 3 6   ? 31.215 32.934 8.396   1.00 19.51 ? 6   DC  P "C3'" 1 
ATOM   3714 O  "O3'" . DC  C 3 6   ? 31.974 34.121 8.360   1.00 19.66 ? 6   DC  P "O3'" 1 
ATOM   3715 C  "C2'" . DC  C 3 6   ? 29.712 33.209 8.213   1.00 19.37 ? 6   DC  P "C2'" 1 
ATOM   3716 C  "C1'" . DC  C 3 6   ? 29.442 32.723 6.787   1.00 17.91 ? 6   DC  P "C1'" 1 
ATOM   3717 N  N1    . DC  C 3 6   ? 28.090 32.193 6.613   1.00 16.31 ? 6   DC  P N1    1 
ATOM   3718 C  C2    . DC  C 3 6   ? 27.309 32.668 5.561   1.00 15.51 ? 6   DC  P C2    1 
ATOM   3719 O  O2    . DC  C 3 6   ? 27.782 33.518 4.802   1.00 17.50 ? 6   DC  P O2    1 
ATOM   3720 N  N3    . DC  C 3 6   ? 26.049 32.195 5.416   1.00 16.83 ? 6   DC  P N3    1 
ATOM   3721 C  C4    . DC  C 3 6   ? 25.584 31.273 6.263   1.00 19.99 ? 6   DC  P C4    1 
ATOM   3722 N  N4    . DC  C 3 6   ? 24.336 30.835 6.083   1.00 19.30 ? 6   DC  P N4    1 
ATOM   3723 C  C5    . DC  C 3 6   ? 26.375 30.764 7.340   1.00 17.77 ? 6   DC  P C5    1 
ATOM   3724 C  C6    . DC  C 3 6   ? 27.614 31.248 7.476   1.00 14.85 ? 6   DC  P C6    1 
ATOM   3725 P  P     . DA  C 3 7   ? 31.803 35.255 9.487   1.00 16.61 ? 7   DA  P P     1 
ATOM   3726 O  OP1   . DA  C 3 7   ? 33.113 35.925 9.622   1.00 16.86 ? 7   DA  P OP1   1 
ATOM   3727 O  OP2   . DA  C 3 7   ? 31.137 34.712 10.685  1.00 16.79 ? 7   DA  P OP2   1 
ATOM   3728 O  "O5'" . DA  C 3 7   ? 30.733 36.248 8.859   1.00 17.93 ? 7   DA  P "O5'" 1 
ATOM   3729 C  "C5'" . DA  C 3 7   ? 31.031 36.936 7.682   1.00 30.33 ? 7   DA  P "C5'" 1 
ATOM   3730 C  "C4'" . DA  C 3 7   ? 29.765 37.481 7.045   1.00 26.24 ? 7   DA  P "C4'" 1 
ATOM   3731 O  "O4'" . DA  C 3 7   ? 28.882 36.413 6.681   1.00 22.47 ? 7   DA  P "O4'" 1 
ATOM   3732 C  "C3'" . DA  C 3 7   ? 28.891 38.350 7.927   1.00 24.08 ? 7   DA  P "C3'" 1 
ATOM   3733 O  "O3'" . DA  C 3 7   ? 29.460 39.675 8.094   1.00 27.31 ? 7   DA  P "O3'" 1 
ATOM   3734 C  "C2'" . DA  C 3 7   ? 27.583 38.365 7.129   1.00 23.12 ? 7   DA  P "C2'" 1 
ATOM   3735 C  "C1'" . DA  C 3 7   ? 27.602 36.998 6.430   1.00 21.37 ? 7   DA  P "C1'" 1 
ATOM   3736 N  N9    . DA  C 3 7   ? 26.562 36.088 6.882   1.00 19.25 ? 7   DA  P N9    1 
ATOM   3737 C  C8    . DA  C 3 7   ? 26.656 35.124 7.849   1.00 17.32 ? 7   DA  P C8    1 
ATOM   3738 N  N7    . DA  C 3 7   ? 25.546 34.448 8.032   1.00 23.13 ? 7   DA  P N7    1 
ATOM   3739 C  C5    . DA  C 3 7   ? 24.662 35.018 7.125   1.00 18.81 ? 7   DA  P C5    1 
ATOM   3740 C  C6    . DA  C 3 7   ? 23.316 34.754 6.829   1.00 21.18 ? 7   DA  P C6    1 
ATOM   3741 N  N6    . DA  C 3 7   ? 22.613 33.795 7.425   1.00 19.65 ? 7   DA  P N6    1 
ATOM   3742 N  N1    . DA  C 3 7   ? 22.728 35.501 5.878   1.00 18.29 ? 7   DA  P N1    1 
ATOM   3743 C  C2    . DA  C 3 7   ? 23.442 36.449 5.267   1.00 17.85 ? 7   DA  P C2    1 
ATOM   3744 N  N3    . DA  C 3 7   ? 24.718 36.800 5.466   1.00 21.77 ? 7   DA  P N3    1 
ATOM   3745 C  C4    . DA  C 3 7   ? 25.270 36.028 6.414   1.00 18.56 ? 7   DA  P C4    1 
ATOM   3746 P  P     A DT  C 3 8   ? 28.784 40.763 9.082   0.73 20.45 ? 8   DT  P P     1 
ATOM   3747 P  P     B DT  C 3 8   ? 29.880 40.583 6.834   0.27 24.76 ? 8   DT  P P     1 
ATOM   3748 O  OP1   A DT  C 3 8   ? 29.779 41.820 9.337   0.73 21.47 ? 8   DT  P OP1   1 
ATOM   3749 O  OP1   B DT  C 3 8   ? 30.483 39.876 5.678   0.27 29.70 ? 8   DT  P OP1   1 
ATOM   3750 O  OP2   A DT  C 3 8   ? 28.131 40.067 10.216  0.73 19.00 ? 8   DT  P OP2   1 
ATOM   3751 O  OP2   B DT  C 3 8   ? 30.672 41.598 7.529   0.27 27.38 ? 8   DT  P OP2   1 
ATOM   3752 O  "O5'" A DT  C 3 8   ? 27.628 41.426 8.201   0.73 18.92 ? 8   DT  P "O5'" 1 
ATOM   3753 O  "O5'" B DT  C 3 8   ? 28.504 41.199 6.320   0.27 22.95 ? 8   DT  P "O5'" 1 
ATOM   3754 C  "C5'" A DT  C 3 8   ? 27.895 41.845 6.879   0.73 24.72 ? 8   DT  P "C5'" 1 
ATOM   3755 C  "C5'" B DT  C 3 8   ? 27.767 42.052 7.157   0.27 23.42 ? 8   DT  P "C5'" 1 
ATOM   3756 C  "C4'" A DT  C 3 8   ? 26.632 42.387 6.242   0.73 20.38 ? 8   DT  P "C4'" 1 
ATOM   3757 C  "C4'" B DT  C 3 8   ? 26.549 42.566 6.428   0.27 20.54 ? 8   DT  P "C4'" 1 
ATOM   3758 O  "O4'" A DT  C 3 8   ? 25.658 41.320 6.115   0.73 20.68 ? 8   DT  P "O4'" 1 
ATOM   3759 O  "O4'" B DT  C 3 8   ? 25.627 41.469 6.203   0.27 20.68 ? 8   DT  P "O4'" 1 
ATOM   3760 C  "C3'" A DT  C 3 8   ? 25.954 43.489 7.035   0.73 24.57 ? 8   DT  P "C3'" 1 
ATOM   3761 C  "C3'" B DT  C 3 8   ? 25.758 43.624 7.176   0.27 24.05 ? 8   DT  P "C3'" 1 
ATOM   3762 O  "O3'" A DT  C 3 8   ? 25.405 44.443 6.142   0.73 24.19 ? 8   DT  P "O3'" 1 
ATOM   3763 O  "O3'" B DT  C 3 8   ? 25.146 44.498 6.247   0.27 24.39 ? 8   DT  P "O3'" 1 
ATOM   3764 C  "C2'" A DT  C 3 8   ? 24.871 42.738 7.817   0.73 22.36 ? 8   DT  P "C2'" 1 
ATOM   3765 C  "C2'" B DT  C 3 8   ? 24.727 42.789 7.919   0.27 22.27 ? 8   DT  P "C2'" 1 
ATOM   3766 C  "C1'" A DT  C 3 8   ? 24.485 41.641 6.834   0.73 19.17 ? 8   DT  P "C1'" 1 
ATOM   3767 C  "C1'" B DT  C 3 8   ? 24.415 41.716 6.886   0.27 19.29 ? 8   DT  P "C1'" 1 
ATOM   3768 N  N1    A DT  C 3 8   ? 23.957 40.388 7.468   0.73 19.82 ? 8   DT  P N1    1 
ATOM   3769 N  N1    B DT  C 3 8   ? 23.928 40.438 7.475   0.27 19.83 ? 8   DT  P N1    1 
ATOM   3770 C  C2    A DT  C 3 8   ? 22.736 39.892 7.052   0.73 21.09 ? 8   DT  P C2    1 
ATOM   3771 C  C2    B DT  C 3 8   ? 22.730 39.915 7.043   0.27 21.04 ? 8   DT  P C2    1 
ATOM   3772 O  O2    A DT  C 3 8   ? 22.056 40.434 6.203   0.73 22.99 ? 8   DT  P O2    1 
ATOM   3773 O  O2    B DT  C 3 8   ? 22.040 40.445 6.193   0.27 22.87 ? 8   DT  P O2    1 
ATOM   3774 N  N3    A DT  C 3 8   ? 22.336 38.742 7.677   0.73 20.66 ? 8   DT  P N3    1 
ATOM   3775 N  N3    B DT  C 3 8   ? 22.366 38.742 7.647   0.27 20.63 ? 8   DT  P N3    1 
ATOM   3776 C  C4    A DT  C 3 8   ? 23.027 38.036 8.647   0.73 19.72 ? 8   DT  P C4    1 
ATOM   3777 C  C4    B DT  C 3 8   ? 23.068 38.050 8.617   0.27 19.75 ? 8   DT  P C4    1 
ATOM   3778 O  O4    A DT  C 3 8   ? 22.586 37.010 9.153   0.73 19.72 ? 8   DT  P O4    1 
ATOM   3779 O  O4    B DT  C 3 8   ? 22.658 37.000 9.100   0.27 19.74 ? 8   DT  P O4    1 
ATOM   3780 C  C5    A DT  C 3 8   ? 24.299 38.606 9.037   0.73 20.44 ? 8   DT  P C5    1 
ATOM   3781 C  C5    B DT  C 3 8   ? 24.315 38.654 9.027   0.27 20.40 ? 8   DT  P C5    1 
ATOM   3782 C  C7    A DT  C 3 8   ? 25.130 37.932 10.087  0.73 21.69 ? 8   DT  P C7    1 
ATOM   3783 C  C7    B DT  C 3 8   ? 25.161 37.997 10.077  0.27 21.65 ? 8   DT  P C7    1 
ATOM   3784 C  C6    A DT  C 3 8   ? 24.698 39.738 8.437   0.73 17.81 ? 8   DT  P C6    1 
ATOM   3785 C  C6    B DT  C 3 8   ? 24.679 39.806 8.445   0.27 18.00 ? 8   DT  P C6    1 
HETATM 3786 N  N1    . CTP D 4 .   ? 20.864 41.935 8.907   1.00 14.20 ? 501 CTP A N1    1 
HETATM 3787 C  C2    . CTP D 4 .   ? 20.042 40.863 9.129   1.00 16.27 ? 501 CTP A C2    1 
HETATM 3788 N  N3    . CTP D 4 .   ? 20.366 39.937 10.089  1.00 17.29 ? 501 CTP A N3    1 
HETATM 3789 C  C4    . CTP D 4 .   ? 21.482 40.081 10.876  1.00 17.02 ? 501 CTP A C4    1 
HETATM 3790 C  C5    . CTP D 4 .   ? 22.323 41.176 10.664  1.00 14.73 ? 501 CTP A C5    1 
HETATM 3791 C  C6    . CTP D 4 .   ? 21.927 42.158 9.753   1.00 12.46 ? 501 CTP A C6    1 
HETATM 3792 O  O2    . CTP D 4 .   ? 19.026 40.725 8.451   1.00 20.28 ? 501 CTP A O2    1 
HETATM 3793 N  N4    . CTP D 4 .   ? 21.726 39.170 11.819  1.00 17.73 ? 501 CTP A N4    1 
HETATM 3794 C  "C1'" . CTP D 4 .   ? 20.517 42.869 7.809   1.00 16.10 ? 501 CTP A "C1'" 1 
HETATM 3795 C  "C2'" . CTP D 4 .   ? 19.361 43.758 8.248   1.00 14.47 ? 501 CTP A "C2'" 1 
HETATM 3796 O  "O2'" . CTP D 4 .   ? 18.567 44.042 7.118   1.00 19.71 ? 501 CTP A "O2'" 1 
HETATM 3797 C  "C3'" . CTP D 4 .   ? 20.024 45.033 8.693   1.00 17.96 ? 501 CTP A "C3'" 1 
HETATM 3798 C  "C4'" . CTP D 4 .   ? 21.197 45.090 7.741   1.00 17.58 ? 501 CTP A "C4'" 1 
HETATM 3799 O  "O4'" . CTP D 4 .   ? 21.607 43.736 7.588   1.00 19.69 ? 501 CTP A "O4'" 1 
HETATM 3800 O  "O3'" . CTP D 4 .   ? 19.152 46.122 8.502   1.00 23.04 ? 501 CTP A "O3'" 1 
HETATM 3801 C  "C5'" . CTP D 4 .   ? 22.336 45.971 8.230   1.00 17.48 ? 501 CTP A "C5'" 1 
HETATM 3802 O  "O5'" . CTP D 4 .   ? 23.004 45.253 9.238   1.00 18.65 ? 501 CTP A "O5'" 1 
HETATM 3803 P  PA    . CTP D 4 .   ? 24.105 45.938 10.150  1.00 16.22 ? 501 CTP A PA    1 
HETATM 3804 O  O1A   . CTP D 4 .   ? 25.014 46.755 9.279   1.00 20.22 ? 501 CTP A O1A   1 
HETATM 3805 O  O2A   . CTP D 4 .   ? 24.764 44.842 10.950  1.00 18.54 ? 501 CTP A O2A   1 
HETATM 3806 O  O3A   . CTP D 4 .   ? 23.324 46.843 11.202  1.00 17.25 ? 501 CTP A O3A   1 
HETATM 3807 P  PB    . CTP D 4 .   ? 22.939 48.395 11.188  1.00 12.72 ? 501 CTP A PB    1 
HETATM 3808 O  O1B   . CTP D 4 .   ? 23.186 49.064 9.850   1.00 11.39 ? 501 CTP A O1B   1 
HETATM 3809 O  O2B   . CTP D 4 .   ? 21.531 48.451 11.736  1.00 13.83 ? 501 CTP A O2B   1 
HETATM 3810 O  O3B   . CTP D 4 .   ? 23.876 48.963 12.352  1.00 13.71 ? 501 CTP A O3B   1 
HETATM 3811 P  PG    . CTP D 4 .   ? 25.396 49.516 12.286  1.00 13.15 ? 501 CTP A PG    1 
HETATM 3812 O  O1G   . CTP D 4 .   ? 25.975 49.174 10.956  1.00 13.46 ? 501 CTP A O1G   1 
HETATM 3813 O  O2G   . CTP D 4 .   ? 25.371 50.984 12.569  1.00 14.32 ? 501 CTP A O2G   1 
HETATM 3814 O  O3G   . CTP D 4 .   ? 26.094 48.790 13.425  1.00 14.18 ? 501 CTP A O3G   1 
HETATM 3815 CA CA    . CA  E 5 .   ? 25.178 49.068 8.752   1.00 11.81 ? 502 CA  A CA    1 
HETATM 3816 CA CA    . CA  F 5 .   ? 26.235 46.343 7.097   0.25 22.86 ? 503 CA  A CA    1 
HETATM 3817 C  C1    . GOL G 6 .   ? 52.019 40.285 17.200  1.00 11.85 ? 504 GOL A C1    1 
HETATM 3818 O  O1    . GOL G 6 .   ? 51.356 39.044 17.102  1.00 16.37 ? 504 GOL A O1    1 
HETATM 3819 C  C2    . GOL G 6 .   ? 51.925 41.072 15.880  1.00 13.15 ? 504 GOL A C2    1 
HETATM 3820 O  O2    . GOL G 6 .   ? 50.569 41.335 15.575  1.00 13.44 ? 504 GOL A O2    1 
HETATM 3821 C  C3    . GOL G 6 .   ? 52.606 40.361 14.709  1.00 15.85 ? 504 GOL A C3    1 
HETATM 3822 O  O3    . GOL G 6 .   ? 52.638 41.225 13.579  1.00 17.71 ? 504 GOL A O3    1 
HETATM 3823 C  C1    . GOL H 6 .   ? 50.624 27.649 -3.828  1.00 41.53 ? 505 GOL A C1    1 
HETATM 3824 O  O1    . GOL H 6 .   ? 49.802 28.770 -4.050  1.00 42.18 ? 505 GOL A O1    1 
HETATM 3825 C  C2    . GOL H 6 .   ? 52.005 28.112 -3.396  1.00 38.58 ? 505 GOL A C2    1 
HETATM 3826 O  O2    . GOL H 6 .   ? 51.988 29.506 -3.385  1.00 27.70 ? 505 GOL A O2    1 
HETATM 3827 C  C3    . GOL H 6 .   ? 52.996 27.691 -4.466  1.00 26.19 ? 505 GOL A C3    1 
HETATM 3828 O  O3    . GOL H 6 .   ? 54.289 28.215 -4.246  1.00 32.79 ? 505 GOL A O3    1 
HETATM 3829 O  O     . HOH I 7 .   ? 4.151  43.214 -2.385  1.00 42.25 ? 601 HOH A O     1 
HETATM 3830 O  O     . HOH I 7 .   ? -1.805 17.910 10.868  1.00 37.92 ? 602 HOH A O     1 
HETATM 3831 O  O     . HOH I 7 .   ? 10.540 53.134 -1.114  1.00 35.64 ? 603 HOH A O     1 
HETATM 3832 O  O     . HOH I 7 .   ? 50.924 21.292 4.444   1.00 21.44 ? 604 HOH A O     1 
HETATM 3833 O  O     . HOH I 7 .   ? 25.216 55.761 -10.757 1.00 30.89 ? 605 HOH A O     1 
HETATM 3834 O  O     . HOH I 7 .   ? 63.393 39.464 -1.068  1.00 37.01 ? 606 HOH A O     1 
HETATM 3835 O  O     . HOH I 7 .   ? 53.234 66.159 13.608  0.48 27.81 ? 607 HOH A O     1 
HETATM 3836 O  O     . HOH I 7 .   ? 0.761  37.139 -12.894 1.00 41.74 ? 608 HOH A O     1 
HETATM 3837 O  O     . HOH I 7 .   ? 37.852 67.177 -1.085  1.00 28.99 ? 609 HOH A O     1 
HETATM 3838 O  O     . HOH I 7 .   ? 14.744 31.398 7.819   1.00 37.79 ? 610 HOH A O     1 
HETATM 3839 O  O     . HOH I 7 .   ? 53.823 25.274 1.369   1.00 31.37 ? 611 HOH A O     1 
HETATM 3840 O  O     . HOH I 7 .   ? 35.122 61.661 16.259  1.00 30.48 ? 612 HOH A O     1 
HETATM 3841 O  O     . HOH I 7 .   ? 48.100 51.656 -2.833  1.00 28.31 ? 613 HOH A O     1 
HETATM 3842 O  O     . HOH I 7 .   ? 24.079 40.525 -10.251 1.00 28.96 ? 614 HOH A O     1 
HETATM 3843 O  O     . HOH I 7 .   ? 38.406 36.833 1.688   1.00 44.56 ? 615 HOH A O     1 
HETATM 3844 O  O     . HOH I 7 .   ? 11.602 44.077 -2.260  1.00 32.65 ? 616 HOH A O     1 
HETATM 3845 O  O     . HOH I 7 .   ? 15.717 17.373 9.177   1.00 47.93 ? 617 HOH A O     1 
HETATM 3846 O  O     . HOH I 7 .   ? 18.854 58.716 16.411  1.00 24.96 ? 618 HOH A O     1 
HETATM 3847 O  O     . HOH I 7 .   ? 12.135 22.745 15.139  1.00 39.99 ? 619 HOH A O     1 
HETATM 3848 O  O     . HOH I 7 .   ? 53.412 31.587 -3.295  1.00 38.56 ? 620 HOH A O     1 
HETATM 3849 O  O     . HOH I 7 .   ? 42.418 50.025 17.678  1.00 46.61 ? 621 HOH A O     1 
HETATM 3850 O  O     . HOH I 7 .   ? 56.528 23.811 7.583   1.00 21.54 ? 622 HOH A O     1 
HETATM 3851 O  O     . HOH I 7 .   ? 35.504 56.704 17.671  1.00 31.58 ? 623 HOH A O     1 
HETATM 3852 O  O     . HOH I 7 .   ? 8.860  56.001 9.888   1.00 25.35 ? 624 HOH A O     1 
HETATM 3853 O  O     . HOH I 7 .   ? 10.405 49.714 -12.629 1.00 42.40 ? 625 HOH A O     1 
HETATM 3854 O  O     . HOH I 7 .   ? 8.882  65.164 17.574  1.00 39.94 ? 626 HOH A O     1 
HETATM 3855 O  O     . HOH I 7 .   ? 40.038 44.970 -6.542  1.00 14.37 ? 627 HOH A O     1 
HETATM 3856 O  O     . HOH I 7 .   ? 44.150 24.718 22.123  1.00 35.86 ? 628 HOH A O     1 
HETATM 3857 O  O     . HOH I 7 .   ? 40.552 32.030 -0.049  1.00 41.87 ? 629 HOH A O     1 
HETATM 3858 O  O     . HOH I 7 .   ? 17.954 15.240 -0.745  0.73 33.19 ? 630 HOH A O     1 
HETATM 3859 O  O     . HOH I 7 .   ? 9.853  36.940 -18.157 1.00 42.05 ? 631 HOH A O     1 
HETATM 3860 O  O     . HOH I 7 .   ? 39.556 55.552 17.747  1.00 31.55 ? 632 HOH A O     1 
HETATM 3861 O  O     . HOH I 7 .   ? 3.984  40.357 -0.640  1.00 40.22 ? 633 HOH A O     1 
HETATM 3862 O  O     . HOH I 7 .   ? 51.502 32.784 20.370  1.00 27.53 ? 634 HOH A O     1 
HETATM 3863 O  O     . HOH I 7 .   ? 35.996 59.058 -8.822  1.00 35.24 ? 635 HOH A O     1 
HETATM 3864 O  O     . HOH I 7 .   ? 25.365 46.604 14.596  1.00 23.74 ? 636 HOH A O     1 
HETATM 3865 O  O     . HOH I 7 .   ? -6.417 19.149 8.209   1.00 37.29 ? 637 HOH A O     1 
HETATM 3866 O  O     . HOH I 7 .   ? 27.766 46.443 9.882   1.00 32.83 ? 638 HOH A O     1 
HETATM 3867 O  O     . HOH I 7 .   ? 21.152 47.629 -3.273  1.00 29.82 ? 639 HOH A O     1 
HETATM 3868 O  O     . HOH I 7 .   ? 56.606 27.262 12.760  1.00 33.13 ? 640 HOH A O     1 
HETATM 3869 O  O     . HOH I 7 .   ? 30.509 35.936 -10.399 1.00 32.19 ? 641 HOH A O     1 
HETATM 3870 O  O     . HOH I 7 .   ? 16.505 43.060 -5.245  1.00 40.27 ? 642 HOH A O     1 
HETATM 3871 O  O     . HOH I 7 .   ? 29.297 47.827 -9.776  1.00 31.14 ? 643 HOH A O     1 
HETATM 3872 O  O     . HOH I 7 .   ? 47.610 21.056 -1.490  1.00 27.84 ? 644 HOH A O     1 
HETATM 3873 O  O     . HOH I 7 .   ? 44.394 45.433 18.638  1.00 34.31 ? 645 HOH A O     1 
HETATM 3874 O  O     . HOH I 7 .   ? 22.060 44.059 26.001  1.00 25.02 ? 646 HOH A O     1 
HETATM 3875 O  O     . HOH I 7 .   ? 41.202 54.617 14.853  1.00 24.93 ? 647 HOH A O     1 
HETATM 3876 O  O     . HOH I 7 .   ? 6.283  44.393 -9.708  1.00 23.60 ? 648 HOH A O     1 
HETATM 3877 O  O     . HOH I 7 .   ? 11.767 58.341 23.303  1.00 30.05 ? 649 HOH A O     1 
HETATM 3878 O  O     . HOH I 7 .   ? 11.833 39.126 -1.186  1.00 24.29 ? 650 HOH A O     1 
HETATM 3879 O  O     . HOH I 7 .   ? 26.350 65.865 -3.685  1.00 28.20 ? 651 HOH A O     1 
HETATM 3880 O  O     . HOH I 7 .   ? 18.022 59.537 -3.698  1.00 23.07 ? 652 HOH A O     1 
HETATM 3881 O  O     . HOH I 7 .   ? 32.821 63.839 4.539   1.00 17.86 ? 653 HOH A O     1 
HETATM 3882 O  O     . HOH I 7 .   ? 13.397 43.619 -5.295  1.00 32.53 ? 654 HOH A O     1 
HETATM 3883 O  O     . HOH I 7 .   ? 2.207  22.887 13.982  1.00 30.13 ? 655 HOH A O     1 
HETATM 3884 O  O     . HOH I 7 .   ? 36.091 67.898 11.672  1.00 29.52 ? 656 HOH A O     1 
HETATM 3885 O  O     . HOH I 7 .   ? 47.880 28.088 -2.345  1.00 34.30 ? 657 HOH A O     1 
HETATM 3886 O  O     . HOH I 7 .   ? 11.890 39.840 31.784  1.00 22.03 ? 658 HOH A O     1 
HETATM 3887 O  O     . HOH I 7 .   ? 13.507 43.783 -19.634 1.00 35.36 ? 659 HOH A O     1 
HETATM 3888 O  O     . HOH I 7 .   ? -5.478 18.847 10.491  1.00 46.07 ? 660 HOH A O     1 
HETATM 3889 O  O     . HOH I 7 .   ? 40.659 42.240 -0.880  1.00 12.86 ? 661 HOH A O     1 
HETATM 3890 O  O     . HOH I 7 .   ? 35.306 54.134 10.948  1.00 12.43 ? 662 HOH A O     1 
HETATM 3891 O  O     . HOH I 7 .   ? 24.517 53.039 -10.676 1.00 35.70 ? 663 HOH A O     1 
HETATM 3892 O  O     . HOH I 7 .   ? 13.957 54.967 -1.835  1.00 21.33 ? 664 HOH A O     1 
HETATM 3893 O  O     . HOH I 7 .   ? 9.075  15.390 -3.450  1.00 43.28 ? 665 HOH A O     1 
HETATM 3894 O  O     . HOH I 7 .   ? 7.743  45.306 28.310  1.00 29.68 ? 666 HOH A O     1 
HETATM 3895 O  O     . HOH I 7 .   ? 35.889 46.581 13.027  1.00 23.30 ? 667 HOH A O     1 
HETATM 3896 O  O     . HOH I 7 .   ? 43.252 41.626 -6.433  1.00 27.92 ? 668 HOH A O     1 
HETATM 3897 O  O     . HOH I 7 .   ? 12.646 49.565 33.184  1.00 29.42 ? 669 HOH A O     1 
HETATM 3898 O  O     . HOH I 7 .   ? 49.572 38.763 19.077  1.00 10.60 ? 670 HOH A O     1 
HETATM 3899 O  O     . HOH I 7 .   ? 25.511 53.441 28.105  1.00 33.83 ? 671 HOH A O     1 
HETATM 3900 O  O     . HOH I 7 .   ? 21.007 48.195 14.359  1.00 13.74 ? 672 HOH A O     1 
HETATM 3901 O  O     . HOH I 7 .   ? 4.141  44.997 12.127  1.00 37.20 ? 673 HOH A O     1 
HETATM 3902 O  O     . HOH I 7 .   ? 45.763 44.208 -2.404  1.00 21.48 ? 674 HOH A O     1 
HETATM 3903 O  O     . HOH I 7 .   ? -0.625 33.988 -10.606 1.00 37.30 ? 675 HOH A O     1 
HETATM 3904 O  O     . HOH I 7 .   ? 28.143 59.906 6.988   1.00 22.06 ? 676 HOH A O     1 
HETATM 3905 O  O     . HOH I 7 .   ? 51.132 53.568 16.896  1.00 32.82 ? 677 HOH A O     1 
HETATM 3906 O  O     . HOH I 7 .   ? 55.708 55.559 1.600   0.98 40.71 ? 678 HOH A O     1 
HETATM 3907 O  O     . HOH I 7 .   ? 16.609 42.205 6.919   1.00 28.31 ? 679 HOH A O     1 
HETATM 3908 O  O     . HOH I 7 .   ? 16.063 43.803 -8.354  1.00 34.31 ? 680 HOH A O     1 
HETATM 3909 O  O     . HOH I 7 .   ? 21.808 47.653 -6.165  1.00 34.78 ? 681 HOH A O     1 
HETATM 3910 O  O     . HOH I 7 .   ? 11.951 32.770 -16.991 1.00 33.59 ? 682 HOH A O     1 
HETATM 3911 O  O     . HOH I 7 .   ? 14.508 39.384 24.047  1.00 18.92 ? 683 HOH A O     1 
HETATM 3912 O  O     . HOH I 7 .   ? 2.448  42.192 21.307  0.78 35.20 ? 684 HOH A O     1 
HETATM 3913 O  O     . HOH I 7 .   ? 39.586 60.834 -9.072  1.00 29.68 ? 685 HOH A O     1 
HETATM 3914 O  O     . HOH I 7 .   ? 22.026 49.986 -7.234  0.56 30.38 ? 686 HOH A O     1 
HETATM 3915 O  O     . HOH I 7 .   ? 27.032 49.808 18.212  1.00 29.82 ? 687 HOH A O     1 
HETATM 3916 O  O     . HOH I 7 .   ? -0.281 27.257 -3.978  1.00 31.11 ? 688 HOH A O     1 
HETATM 3917 O  O     . HOH I 7 .   ? 35.796 42.610 10.187  1.00 20.06 ? 689 HOH A O     1 
HETATM 3918 O  O     . HOH I 7 .   ? 51.980 32.740 9.106   1.00 15.91 ? 690 HOH A O     1 
HETATM 3919 O  O     . HOH I 7 .   ? 19.510 48.466 9.824   1.00 13.52 ? 691 HOH A O     1 
HETATM 3920 O  O     . HOH I 7 .   ? 52.143 52.192 6.252   1.00 18.19 ? 692 HOH A O     1 
HETATM 3921 O  O     . HOH I 7 .   ? 43.154 59.177 16.575  1.00 18.34 ? 693 HOH A O     1 
HETATM 3922 O  O     . HOH I 7 .   ? 12.937 43.806 -7.651  1.00 26.03 ? 694 HOH A O     1 
HETATM 3923 O  O     . HOH I 7 .   ? 5.629  47.569 -0.356  1.00 45.00 ? 695 HOH A O     1 
HETATM 3924 O  O     . HOH I 7 .   ? 49.010 69.066 5.594   1.00 48.62 ? 696 HOH A O     1 
HETATM 3925 O  O     . HOH I 7 .   ? 9.081  48.041 3.206   1.00 16.76 ? 697 HOH A O     1 
HETATM 3926 O  O     . HOH I 7 .   ? 36.129 52.420 -10.791 1.00 37.98 ? 698 HOH A O     1 
HETATM 3927 O  O     . HOH I 7 .   ? -4.989 20.134 4.007   1.00 26.57 ? 699 HOH A O     1 
HETATM 3928 O  O     . HOH I 7 .   ? 55.263 38.728 13.191  0.50 16.93 ? 700 HOH A O     1 
HETATM 3929 O  O     . HOH I 7 .   ? 23.536 59.475 -8.744  1.00 35.22 ? 701 HOH A O     1 
HETATM 3930 O  O     A HOH I 7 .   ? 37.469 65.909 1.186   0.61 19.86 ? 702 HOH A O     1 
HETATM 3931 O  O     B HOH I 7 .   ? 36.766 66.768 1.997   0.39 15.51 ? 702 HOH A O     1 
HETATM 3932 O  O     . HOH I 7 .   ? 9.270  49.154 30.534  1.00 30.17 ? 703 HOH A O     1 
HETATM 3933 O  O     . HOH I 7 .   ? 32.888 37.765 15.270  1.00 30.36 ? 704 HOH A O     1 
HETATM 3934 O  O     . HOH I 7 .   ? -1.278 41.828 2.277   1.00 35.52 ? 705 HOH A O     1 
HETATM 3935 O  O     . HOH I 7 .   ? 7.663  34.416 10.202  1.00 20.20 ? 706 HOH A O     1 
HETATM 3936 O  O     . HOH I 7 .   ? 25.635 64.486 12.490  1.00 36.76 ? 707 HOH A O     1 
HETATM 3937 O  O     . HOH I 7 .   ? 20.887 57.448 24.846  1.00 25.06 ? 708 HOH A O     1 
HETATM 3938 O  O     . HOH I 7 .   ? 22.298 39.259 -13.605 1.00 34.13 ? 709 HOH A O     1 
HETATM 3939 O  O     . HOH I 7 .   ? 44.703 41.950 24.747  1.00 34.72 ? 710 HOH A O     1 
HETATM 3940 O  O     . HOH I 7 .   ? 20.801 61.466 -5.763  1.00 25.87 ? 711 HOH A O     1 
HETATM 3941 O  O     . HOH I 7 .   ? 46.446 21.071 18.319  1.00 32.97 ? 712 HOH A O     1 
HETATM 3942 O  O     . HOH I 7 .   ? 25.182 58.089 11.988  1.00 18.46 ? 713 HOH A O     1 
HETATM 3943 O  O     . HOH I 7 .   ? -4.361 26.204 0.108   1.00 33.71 ? 714 HOH A O     1 
HETATM 3944 O  O     . HOH I 7 .   ? 40.226 35.315 20.358  1.00 17.17 ? 715 HOH A O     1 
HETATM 3945 O  O     . HOH I 7 .   ? 15.376 53.796 -5.073  1.00 24.06 ? 716 HOH A O     1 
HETATM 3946 O  O     . HOH I 7 .   ? 6.030  43.786 10.713  1.00 22.67 ? 717 HOH A O     1 
HETATM 3947 O  O     . HOH I 7 .   ? 33.297 40.170 -0.303  1.00 33.22 ? 718 HOH A O     1 
HETATM 3948 O  O     . HOH I 7 .   ? 4.380  37.919 16.126  1.00 25.24 ? 719 HOH A O     1 
HETATM 3949 O  O     . HOH I 7 .   ? 10.276 56.494 3.516   1.00 21.89 ? 720 HOH A O     1 
HETATM 3950 O  O     . HOH I 7 .   ? 57.178 32.211 7.204   1.00 38.06 ? 721 HOH A O     1 
HETATM 3951 O  O     . HOH I 7 .   ? 50.094 51.463 3.634   1.00 13.70 ? 722 HOH A O     1 
HETATM 3952 O  O     . HOH I 7 .   ? 19.510 21.903 1.706   1.00 27.24 ? 723 HOH A O     1 
HETATM 3953 O  O     . HOH I 7 .   ? 23.729 38.863 13.708  1.00 30.21 ? 724 HOH A O     1 
HETATM 3954 O  O     . HOH I 7 .   ? 48.400 45.671 3.282   1.00 21.12 ? 725 HOH A O     1 
HETATM 3955 O  O     . HOH I 7 .   ? 50.985 41.334 11.298  1.00 17.76 ? 726 HOH A O     1 
HETATM 3956 O  O     . HOH I 7 .   ? 14.083 39.578 -13.573 1.00 18.73 ? 727 HOH A O     1 
HETATM 3957 O  O     . HOH I 7 .   ? 30.805 65.485 -2.250  1.00 20.65 ? 728 HOH A O     1 
HETATM 3958 O  O     . HOH I 7 .   ? 8.353  27.499 -12.005 1.00 26.19 ? 729 HOH A O     1 
HETATM 3959 O  O     . HOH I 7 .   ? 55.600 44.465 5.319   1.00 34.02 ? 730 HOH A O     1 
HETATM 3960 O  O     . HOH I 7 .   ? 20.630 68.309 0.816   1.00 16.21 ? 731 HOH A O     1 
HETATM 3961 O  O     . HOH I 7 .   ? 49.521 53.633 12.527  1.00 18.38 ? 732 HOH A O     1 
HETATM 3962 O  O     . HOH I 7 .   ? 31.577 49.236 15.126  0.87 34.73 ? 733 HOH A O     1 
HETATM 3963 O  O     . HOH I 7 .   ? 20.346 58.211 -5.606  1.00 24.25 ? 734 HOH A O     1 
HETATM 3964 O  O     . HOH I 7 .   ? 22.556 40.978 18.936  0.72 30.69 ? 735 HOH A O     1 
HETATM 3965 O  O     . HOH I 7 .   ? 52.712 52.932 18.923  1.00 34.12 ? 736 HOH A O     1 
HETATM 3966 O  O     . HOH I 7 .   ? 22.096 34.611 -11.411 1.00 24.62 ? 737 HOH A O     1 
HETATM 3967 O  O     . HOH I 7 .   ? 37.735 27.532 19.700  1.00 30.61 ? 738 HOH A O     1 
HETATM 3968 O  O     . HOH I 7 .   ? 22.979 36.735 -20.048 1.00 26.95 ? 739 HOH A O     1 
HETATM 3969 O  O     . HOH I 7 .   ? 12.968 57.463 4.283   1.00 13.64 ? 740 HOH A O     1 
HETATM 3970 O  O     . HOH I 7 .   ? 25.758 61.506 13.875  1.00 32.08 ? 741 HOH A O     1 
HETATM 3971 O  O     . HOH I 7 .   ? 30.248 59.980 15.689  1.00 36.06 ? 742 HOH A O     1 
HETATM 3972 O  O     . HOH I 7 .   ? 51.897 48.524 13.737  1.00 14.30 ? 743 HOH A O     1 
HETATM 3973 O  O     . HOH I 7 .   ? 28.007 41.986 -12.186 1.00 26.50 ? 744 HOH A O     1 
HETATM 3974 O  O     . HOH I 7 .   ? 7.182  52.265 9.330   1.00 30.15 ? 745 HOH A O     1 
HETATM 3975 O  O     . HOH I 7 .   ? 54.820 41.666 11.888  1.00 27.70 ? 746 HOH A O     1 
HETATM 3976 O  O     . HOH I 7 .   ? 19.496 19.424 13.277  1.00 48.74 ? 747 HOH A O     1 
HETATM 3977 O  O     . HOH I 7 .   ? 53.171 37.110 16.212  1.00 20.13 ? 748 HOH A O     1 
HETATM 3978 O  O     . HOH I 7 .   ? 22.856 32.535 -15.134 1.00 24.37 ? 749 HOH A O     1 
HETATM 3979 O  O     A HOH I 7 .   ? 24.949 41.597 -2.063  0.42 25.53 ? 750 HOH A O     1 
HETATM 3980 O  O     B HOH I 7 .   ? 24.359 40.918 -3.455  0.58 28.58 ? 750 HOH A O     1 
HETATM 3981 O  O     . HOH I 7 .   ? 38.759 53.983 -8.849  1.00 23.41 ? 751 HOH A O     1 
HETATM 3982 O  O     . HOH I 7 .   ? 12.597 53.890 0.217   1.00 18.93 ? 752 HOH A O     1 
HETATM 3983 O  O     . HOH I 7 .   ? 48.251 50.219 14.608  1.00 14.20 ? 753 HOH A O     1 
HETATM 3984 O  O     . HOH I 7 .   ? 58.605 37.791 -5.712  0.81 34.92 ? 754 HOH A O     1 
HETATM 3985 O  O     . HOH I 7 .   ? 42.869 56.575 15.422  1.00 33.11 ? 755 HOH A O     1 
HETATM 3986 O  O     . HOH I 7 .   ? 9.354  38.820 26.266  0.90 38.50 ? 756 HOH A O     1 
HETATM 3987 O  O     . HOH I 7 .   ? 3.722  66.505 13.496  1.00 37.96 ? 757 HOH A O     1 
HETATM 3988 O  O     . HOH I 7 .   ? 22.455 26.119 8.265   0.77 33.98 ? 758 HOH A O     1 
HETATM 3989 O  O     . HOH I 7 .   ? 54.931 25.639 -3.294  1.00 42.32 ? 759 HOH A O     1 
HETATM 3990 O  O     . HOH I 7 .   ? 42.335 42.116 23.043  1.00 35.87 ? 760 HOH A O     1 
HETATM 3991 O  O     . HOH I 7 .   ? 25.501 54.189 21.857  1.00 25.45 ? 761 HOH A O     1 
HETATM 3992 O  O     . HOH I 7 .   ? 26.905 59.694 4.443   1.00 16.93 ? 762 HOH A O     1 
HETATM 3993 O  O     . HOH I 7 .   ? 52.287 43.195 8.323   1.00 31.52 ? 763 HOH A O     1 
HETATM 3994 O  O     . HOH I 7 .   ? 13.200 23.699 12.737  1.00 35.61 ? 764 HOH A O     1 
HETATM 3995 O  O     . HOH I 7 .   ? 18.653 62.129 -4.293  1.00 17.83 ? 765 HOH A O     1 
HETATM 3996 O  O     . HOH I 7 .   ? 40.742 52.183 17.227  1.00 35.97 ? 766 HOH A O     1 
HETATM 3997 O  O     . HOH I 7 .   ? 43.910 31.256 -0.910  1.00 26.65 ? 767 HOH A O     1 
HETATM 3998 O  O     . HOH I 7 .   ? 23.265 47.727 22.883  1.00 30.29 ? 768 HOH A O     1 
HETATM 3999 O  O     . HOH I 7 .   ? 7.109  38.785 16.885  1.00 25.33 ? 769 HOH A O     1 
HETATM 4000 O  O     . HOH I 7 .   ? 52.955 45.699 8.194   1.00 18.61 ? 770 HOH A O     1 
HETATM 4001 O  O     . HOH I 7 .   ? -2.503 19.218 -4.308  1.00 46.48 ? 771 HOH A O     1 
HETATM 4002 O  O     . HOH I 7 .   ? 23.507 34.543 -17.928 1.00 27.54 ? 772 HOH A O     1 
HETATM 4003 O  O     . HOH I 7 .   ? 20.687 46.734 -18.166 0.88 41.94 ? 773 HOH A O     1 
HETATM 4004 O  O     . HOH I 7 .   ? 46.581 70.502 7.454   1.00 29.92 ? 774 HOH A O     1 
HETATM 4005 O  O     . HOH I 7 .   ? 18.664 45.891 -2.395  1.00 44.65 ? 775 HOH A O     1 
HETATM 4006 O  O     . HOH I 7 .   ? 55.761 26.683 4.142   1.00 20.49 ? 776 HOH A O     1 
HETATM 4007 O  O     . HOH I 7 .   ? 61.016 40.946 -7.363  1.00 40.85 ? 777 HOH A O     1 
HETATM 4008 O  O     . HOH I 7 .   ? 21.022 60.337 10.433  1.00 36.26 ? 778 HOH A O     1 
HETATM 4009 O  O     . HOH I 7 .   ? 44.890 36.650 2.282   1.00 17.82 ? 779 HOH A O     1 
HETATM 4010 O  O     . HOH I 7 .   ? 45.593 42.175 -5.101  1.00 36.70 ? 780 HOH A O     1 
HETATM 4011 O  O     . HOH I 7 .   ? 33.142 38.646 -3.264  1.00 39.90 ? 781 HOH A O     1 
HETATM 4012 O  O     . HOH I 7 .   ? 15.100 66.196 16.261  1.00 36.30 ? 782 HOH A O     1 
HETATM 4013 O  O     . HOH I 7 .   ? 31.279 42.689 4.148   1.00 25.93 ? 783 HOH A O     1 
HETATM 4014 O  O     . HOH I 7 .   ? 14.020 27.721 -17.425 1.00 30.46 ? 784 HOH A O     1 
HETATM 4015 O  O     . HOH I 7 .   ? 3.349  38.041 23.225  1.00 36.63 ? 785 HOH A O     1 
HETATM 4016 O  O     . HOH I 7 .   ? 35.158 32.110 15.292  1.00 16.89 ? 786 HOH A O     1 
HETATM 4017 O  O     . HOH I 7 .   ? 20.541 47.485 -14.437 0.76 35.70 ? 787 HOH A O     1 
HETATM 4018 O  O     . HOH I 7 .   ? 17.052 61.352 22.745  0.56 28.45 ? 788 HOH A O     1 
HETATM 4019 O  O     . HOH I 7 .   ? 20.299 57.368 13.516  1.00 22.44 ? 789 HOH A O     1 
HETATM 4020 O  O     . HOH I 7 .   ? 8.019  53.153 1.454   1.00 31.73 ? 790 HOH A O     1 
HETATM 4021 O  O     . HOH I 7 .   ? 10.015 43.352 -18.879 1.00 40.52 ? 791 HOH A O     1 
HETATM 4022 O  O     . HOH I 7 .   ? 43.558 29.740 22.348  1.00 26.88 ? 792 HOH A O     1 
HETATM 4023 O  O     . HOH I 7 .   ? 43.325 60.091 13.903  1.00 16.25 ? 793 HOH A O     1 
HETATM 4024 O  O     . HOH I 7 .   ? 46.571 53.638 9.843   1.00 11.82 ? 794 HOH A O     1 
HETATM 4025 O  O     . HOH I 7 .   ? 4.711  49.990 8.643   0.75 26.99 ? 795 HOH A O     1 
HETATM 4026 O  O     . HOH I 7 .   ? 46.409 49.797 16.625  1.00 21.51 ? 796 HOH A O     1 
HETATM 4027 O  O     . HOH I 7 .   ? 50.743 25.864 18.415  1.00 37.20 ? 797 HOH A O     1 
HETATM 4028 O  O     . HOH I 7 .   ? 31.759 35.518 15.793  1.00 30.29 ? 798 HOH A O     1 
HETATM 4029 O  O     . HOH I 7 .   ? 41.016 25.436 2.370   1.00 16.67 ? 799 HOH A O     1 
HETATM 4030 O  O     . HOH I 7 .   ? 21.766 63.448 8.219   1.00 28.26 ? 800 HOH A O     1 
HETATM 4031 O  O     . HOH I 7 .   ? 37.549 41.971 8.285   1.00 14.69 ? 801 HOH A O     1 
HETATM 4032 O  O     . HOH I 7 .   ? 36.834 55.212 -10.260 1.00 30.61 ? 802 HOH A O     1 
HETATM 4033 O  O     . HOH I 7 .   ? 44.760 70.228 0.480   1.00 40.08 ? 803 HOH A O     1 
HETATM 4034 O  O     . HOH I 7 .   ? 40.115 67.629 10.195  1.00 19.01 ? 804 HOH A O     1 
HETATM 4035 O  O     . HOH I 7 .   ? 41.949 24.093 -0.259  1.00 26.39 ? 805 HOH A O     1 
HETATM 4036 O  O     . HOH I 7 .   ? 22.524 45.005 17.889  1.00 22.61 ? 806 HOH A O     1 
HETATM 4037 O  O     . HOH I 7 .   ? 39.776 31.254 2.392   1.00 37.33 ? 807 HOH A O     1 
HETATM 4038 O  O     . HOH I 7 .   ? 0.073  25.510 12.079  1.00 33.59 ? 808 HOH A O     1 
HETATM 4039 O  O     . HOH I 7 .   ? 3.362  43.786 23.189  1.00 35.03 ? 809 HOH A O     1 
HETATM 4040 O  O     . HOH I 7 .   ? 21.459 56.635 15.777  1.00 18.07 ? 810 HOH A O     1 
HETATM 4041 O  O     . HOH I 7 .   ? 53.819 57.973 5.690   1.00 33.92 ? 811 HOH A O     1 
HETATM 4042 O  O     . HOH I 7 .   ? 8.750  48.976 5.999   1.00 14.93 ? 812 HOH A O     1 
HETATM 4043 O  O     . HOH I 7 .   ? -3.991 34.297 -1.756  1.00 44.12 ? 813 HOH A O     1 
HETATM 4044 O  O     . HOH I 7 .   ? 50.007 32.985 1.069   1.00 27.79 ? 814 HOH A O     1 
HETATM 4045 O  O     . HOH I 7 .   ? 46.990 51.947 -5.263  1.00 28.18 ? 815 HOH A O     1 
HETATM 4046 O  O     . HOH I 7 .   ? 2.222  38.913 -7.781  1.00 31.76 ? 816 HOH A O     1 
HETATM 4047 O  O     . HOH I 7 .   ? 35.607 30.880 6.141   1.00 21.18 ? 817 HOH A O     1 
HETATM 4048 O  O     . HOH I 7 .   ? 1.117  24.964 -4.282  1.00 28.65 ? 818 HOH A O     1 
HETATM 4049 O  O     . HOH I 7 .   ? 32.646 38.852 17.563  1.00 31.00 ? 819 HOH A O     1 
HETATM 4050 O  O     . HOH I 7 .   ? 27.825 64.784 9.111   0.76 33.00 ? 820 HOH A O     1 
HETATM 4051 O  O     . HOH I 7 .   ? 8.122  47.574 -13.010 1.00 31.46 ? 821 HOH A O     1 
HETATM 4052 O  O     . HOH I 7 .   ? 46.523 43.391 0.301   1.00 14.11 ? 822 HOH A O     1 
HETATM 4053 O  O     . HOH I 7 .   ? 5.069  52.075 15.127  1.00 34.28 ? 823 HOH A O     1 
HETATM 4054 O  O     . HOH I 7 .   ? 6.567  50.761 6.182   1.00 24.67 ? 824 HOH A O     1 
HETATM 4055 O  O     . HOH I 7 .   ? 18.238 61.087 13.878  1.00 25.16 ? 825 HOH A O     1 
HETATM 4056 O  O     . HOH I 7 .   ? 45.448 20.259 3.446   1.00 36.09 ? 826 HOH A O     1 
HETATM 4057 O  O     . HOH I 7 .   ? 46.470 54.301 -6.720  1.00 34.64 ? 827 HOH A O     1 
HETATM 4058 O  O     . HOH I 7 .   ? 51.151 23.422 14.058  1.00 39.94 ? 828 HOH A O     1 
HETATM 4059 O  O     . HOH I 7 .   ? 15.585 67.023 11.775  1.00 35.71 ? 829 HOH A O     1 
HETATM 4060 O  O     . HOH I 7 .   ? 27.731 32.712 -10.653 1.00 41.20 ? 830 HOH A O     1 
HETATM 4061 O  O     . HOH I 7 .   ? 31.177 41.029 -0.559  1.00 38.02 ? 831 HOH A O     1 
HETATM 4062 O  O     . HOH I 7 .   ? 5.909  62.948 11.442  1.00 31.92 ? 832 HOH A O     1 
HETATM 4063 O  O     . HOH I 7 .   ? 8.736  62.304 19.263  1.00 29.41 ? 833 HOH A O     1 
HETATM 4064 O  O     . HOH I 7 .   ? 7.461  40.482 29.134  1.00 34.55 ? 834 HOH A O     1 
HETATM 4065 O  O     . HOH I 7 .   ? 56.097 35.353 14.333  1.00 27.67 ? 835 HOH A O     1 
HETATM 4066 O  O     . HOH I 7 .   ? 56.054 29.707 4.801   1.00 27.58 ? 836 HOH A O     1 
HETATM 4067 O  O     . HOH I 7 .   ? 40.285 51.104 -9.545  1.00 22.25 ? 837 HOH A O     1 
HETATM 4068 O  O     . HOH I 7 .   ? 44.232 54.556 17.105  1.00 31.49 ? 838 HOH A O     1 
HETATM 4069 O  O     . HOH I 7 .   ? 2.166  46.840 7.228   1.00 34.18 ? 839 HOH A O     1 
HETATM 4070 O  O     . HOH I 7 .   ? 12.153 56.085 1.819   1.00 21.37 ? 840 HOH A O     1 
HETATM 4071 O  O     . HOH I 7 .   ? 35.193 65.324 21.286  0.74 30.69 ? 841 HOH A O     1 
HETATM 4072 O  O     . HOH I 7 .   ? 33.527 40.736 9.421   1.00 32.18 ? 842 HOH A O     1 
HETATM 4073 O  O     . HOH I 7 .   ? 7.618  29.348 -13.929 1.00 25.29 ? 843 HOH A O     1 
HETATM 4074 O  O     . HOH I 7 .   ? 12.263 42.280 -21.093 1.00 49.91 ? 844 HOH A O     1 
HETATM 4075 O  O     . HOH I 7 .   ? 7.026  55.864 11.982  1.00 24.89 ? 845 HOH A O     1 
HETATM 4076 O  O     . HOH I 7 .   ? 31.381 47.757 9.721   1.00 39.14 ? 846 HOH A O     1 
HETATM 4077 O  O     . HOH I 7 .   ? 36.554 26.360 5.643   1.00 29.19 ? 847 HOH A O     1 
HETATM 4078 O  O     . HOH I 7 .   ? 52.532 59.341 7.303   1.00 36.30 ? 848 HOH A O     1 
HETATM 4079 O  O     . HOH I 7 .   ? 15.670 66.894 7.050   1.00 27.25 ? 849 HOH A O     1 
HETATM 4080 O  O     . HOH I 7 .   ? 6.227  54.630 14.172  1.00 43.86 ? 850 HOH A O     1 
HETATM 4081 O  O     . HOH I 7 .   ? 1.325  46.311 2.863   1.00 40.59 ? 851 HOH A O     1 
HETATM 4082 O  O     . HOH I 7 .   ? 57.750 61.679 10.237  1.00 35.26 ? 852 HOH A O     1 
HETATM 4083 O  O     . HOH I 7 .   ? 38.267 35.065 18.513  1.00 16.85 ? 853 HOH A O     1 
HETATM 4084 O  O     . HOH I 7 .   ? 55.707 30.887 2.083   1.00 44.73 ? 854 HOH A O     1 
HETATM 4085 O  O     . HOH I 7 .   ? 28.172 46.991 12.166  1.00 30.58 ? 855 HOH A O     1 
HETATM 4086 O  O     . HOH I 7 .   ? 37.760 35.829 23.367  1.00 31.03 ? 856 HOH A O     1 
HETATM 4087 O  O     . HOH I 7 .   ? 21.864 42.158 3.533   1.00 27.77 ? 857 HOH A O     1 
HETATM 4088 O  O     . HOH I 7 .   ? 10.039 33.291 22.497  1.00 40.78 ? 858 HOH A O     1 
HETATM 4089 O  O     . HOH I 7 .   ? 17.902 59.744 8.512   1.00 33.42 ? 859 HOH A O     1 
HETATM 4090 O  O     . HOH I 7 .   ? 14.174 54.861 28.023  1.00 29.06 ? 860 HOH A O     1 
HETATM 4091 O  O     . HOH I 7 .   ? -0.008 41.339 5.564   1.00 25.94 ? 861 HOH A O     1 
HETATM 4092 O  O     . HOH I 7 .   ? 5.761  57.986 8.907   1.00 42.48 ? 862 HOH A O     1 
HETATM 4093 O  O     . HOH I 7 .   ? 6.787  39.784 26.720  0.75 30.79 ? 863 HOH A O     1 
HETATM 4094 O  O     . HOH I 7 .   ? 57.507 36.306 8.239   1.00 35.14 ? 864 HOH A O     1 
HETATM 4095 O  O     . HOH I 7 .   ? 13.563 51.129 -15.057 1.00 45.79 ? 865 HOH A O     1 
HETATM 4096 O  O     . HOH I 7 .   ? 35.189 24.574 15.205  1.00 34.49 ? 866 HOH A O     1 
HETATM 4097 O  O     . HOH I 7 .   ? 44.457 19.636 11.944  1.00 39.27 ? 867 HOH A O     1 
HETATM 4098 O  O     . HOH I 7 .   ? 53.533 42.448 4.980   1.00 37.66 ? 868 HOH A O     1 
HETATM 4099 O  O     . HOH I 7 .   ? 54.026 54.208 2.152   1.00 26.23 ? 869 HOH A O     1 
HETATM 4100 O  O     . HOH I 7 .   ? 21.531 25.010 5.587   1.00 28.35 ? 870 HOH A O     1 
HETATM 4101 O  O     A HOH I 7 .   ? 25.554 49.474 25.925  0.38 26.27 ? 871 HOH A O     1 
HETATM 4102 O  O     B HOH I 7 .   ? 24.756 48.951 28.182  0.62 38.54 ? 871 HOH A O     1 
HETATM 4103 O  O     . HOH I 7 .   ? 56.797 32.049 9.966   1.00 37.27 ? 872 HOH A O     1 
HETATM 4104 O  O     . HOH I 7 .   ? 52.483 46.073 -3.183  1.00 27.25 ? 873 HOH A O     1 
HETATM 4105 O  O     . HOH I 7 .   ? 16.604 35.357 -22.188 1.00 42.86 ? 874 HOH A O     1 
HETATM 4106 O  O     . HOH I 7 .   ? 52.075 46.347 19.510  0.65 27.29 ? 875 HOH A O     1 
HETATM 4107 O  O     . HOH I 7 .   ? 8.248  51.254 -0.396  1.00 38.80 ? 876 HOH A O     1 
HETATM 4108 O  O     A HOH I 7 .   ? 54.695 25.791 15.256  0.45 22.89 ? 877 HOH A O     1 
HETATM 4109 O  O     B HOH I 7 .   ? 55.648 27.272 14.812  0.55 32.46 ? 877 HOH A O     1 
HETATM 4110 O  O     . HOH I 7 .   ? 42.700 47.598 -8.638  1.00 34.58 ? 878 HOH A O     1 
HETATM 4111 O  O     . HOH I 7 .   ? 38.643 32.551 4.075   1.00 37.89 ? 879 HOH A O     1 
HETATM 4112 O  O     A HOH I 7 .   ? 56.331 36.083 3.657   0.37 23.55 ? 880 HOH A O     1 
HETATM 4113 O  O     B HOH I 7 .   ? 54.845 37.316 2.716   0.63 32.22 ? 880 HOH A O     1 
HETATM 4114 O  O     . HOH I 7 .   ? -2.921 37.520 1.911   1.00 41.05 ? 881 HOH A O     1 
HETATM 4115 O  O     . HOH I 7 .   ? 21.285 27.239 -2.517  1.00 38.34 ? 882 HOH A O     1 
HETATM 4116 O  O     . HOH I 7 .   ? 56.539 38.728 7.316   1.00 45.72 ? 883 HOH A O     1 
HETATM 4117 O  O     . HOH I 7 .   ? 34.432 36.330 3.209   1.00 43.89 ? 884 HOH A O     1 
HETATM 4118 O  O     . HOH I 7 .   ? 42.314 37.032 -6.323  1.00 30.87 ? 885 HOH A O     1 
HETATM 4119 O  O     A HOH I 7 .   ? 41.991 36.560 -1.094  0.42 22.56 ? 886 HOH A O     1 
HETATM 4120 O  O     B HOH I 7 .   ? 41.134 35.064 -1.588  0.58 32.44 ? 886 HOH A O     1 
HETATM 4121 O  O     . HOH I 7 .   ? 21.516 47.115 29.937  1.00 34.33 ? 887 HOH A O     1 
HETATM 4122 O  O     A HOH I 7 .   ? 0.962  29.438 10.587  0.62 28.61 ? 888 HOH A O     1 
HETATM 4123 O  O     B HOH I 7 .   ? -0.296 30.457 9.868   0.38 25.37 ? 888 HOH A O     1 
HETATM 4124 O  O     . HOH I 7 .   ? 3.215  47.005 9.177   1.00 37.67 ? 889 HOH A O     1 
HETATM 4125 O  O     A HOH I 7 .   ? 33.110 52.210 17.179  0.46 24.74 ? 890 HOH A O     1 
HETATM 4126 O  O     B HOH I 7 .   ? 33.379 53.954 17.545  0.54 23.64 ? 890 HOH A O     1 
HETATM 4127 O  O     . HOH I 7 .   ? 33.928 65.001 -5.654  1.00 32.67 ? 891 HOH A O     1 
HETATM 4128 O  O     . HOH I 7 .   ? 57.319 54.402 -1.161  1.00 44.41 ? 892 HOH A O     1 
HETATM 4129 O  O     . HOH I 7 .   ? 36.432 33.493 19.619  1.00 26.73 ? 893 HOH A O     1 
HETATM 4130 O  O     . HOH I 7 .   ? 17.801 47.100 -8.799  1.00 39.22 ? 894 HOH A O     1 
HETATM 4131 O  O     . HOH I 7 .   ? 50.233 66.373 3.924   1.00 39.24 ? 895 HOH A O     1 
HETATM 4132 O  O     . HOH I 7 .   ? 45.699 33.018 -0.766  1.00 36.86 ? 896 HOH A O     1 
HETATM 4133 O  O     . HOH I 7 .   ? 10.030 48.867 -18.444 1.00 30.78 ? 897 HOH A O     1 
HETATM 4134 O  O     . HOH I 7 .   ? 57.901 63.361 3.745   1.00 40.01 ? 898 HOH A O     1 
HETATM 4135 O  O     . HOH I 7 .   ? -0.302 42.618 8.127   0.75 31.40 ? 899 HOH A O     1 
HETATM 4136 O  O     . HOH I 7 .   ? 7.905  42.649 -2.739  0.98 53.61 ? 900 HOH A O     1 
HETATM 4137 O  O     . HOH I 7 .   ? 38.681 70.150 9.626   1.00 44.17 ? 901 HOH A O     1 
HETATM 4138 O  O     . HOH I 7 .   ? 44.462 36.341 -0.118  1.00 27.11 ? 902 HOH A O     1 
HETATM 4139 O  O     . HOH I 7 .   ? 6.389  47.051 22.934  1.00 32.23 ? 903 HOH A O     1 
HETATM 4140 O  O     . HOH I 7 .   ? -1.416 35.758 -8.438  1.00 39.04 ? 904 HOH A O     1 
HETATM 4141 O  O     . HOH I 7 .   ? -1.648 23.900 12.049  1.00 44.67 ? 905 HOH A O     1 
HETATM 4142 O  O     . HOH I 7 .   ? 36.236 24.204 10.465  1.00 37.92 ? 906 HOH A O     1 
HETATM 4143 O  O     . HOH I 7 .   ? -1.295 36.821 15.783  1.00 42.92 ? 907 HOH A O     1 
HETATM 4144 O  O     . HOH I 7 .   ? 14.981 16.469 16.347  1.00 48.57 ? 908 HOH A O     1 
HETATM 4145 O  O     . HOH I 7 .   ? 21.621 24.005 -9.374  1.00 44.84 ? 909 HOH A O     1 
HETATM 4146 O  O     . HOH I 7 .   ? 45.467 40.527 27.131  1.00 32.06 ? 910 HOH A O     1 
HETATM 4147 O  O     . HOH I 7 .   ? 47.096 23.682 21.115  1.00 40.27 ? 911 HOH A O     1 
HETATM 4148 O  O     . HOH I 7 .   ? 41.987 35.931 -3.830  1.00 39.59 ? 912 HOH A O     1 
HETATM 4149 O  O     . HOH I 7 .   ? 32.382 60.010 16.789  1.00 37.70 ? 913 HOH A O     1 
HETATM 4150 O  O     . HOH I 7 .   ? 34.394 44.645 11.407  1.00 27.18 ? 914 HOH A O     1 
HETATM 4151 O  O     . HOH I 7 .   ? 58.718 65.259 7.136   1.00 45.54 ? 915 HOH A O     1 
HETATM 4152 O  O     . HOH I 7 .   ? 22.272 39.132 16.008  1.00 44.32 ? 916 HOH A O     1 
HETATM 4153 O  O     . HOH I 7 .   ? -6.129 17.396 12.152  1.00 41.66 ? 917 HOH A O     1 
HETATM 4154 O  O     A HOH I 7 .   ? 25.302 42.700 -11.432 0.41 21.13 ? 918 HOH A O     1 
HETATM 4155 O  O     B HOH I 7 .   ? 25.496 44.171 -11.292 0.59 21.49 ? 918 HOH A O     1 
HETATM 4156 O  O     . HOH I 7 .   ? 17.320 62.272 7.458   1.00 38.50 ? 919 HOH A O     1 
HETATM 4157 O  O     . HOH I 7 .   ? 6.755  45.868 -12.023 1.00 33.42 ? 920 HOH A O     1 
HETATM 4158 O  O     . HOH I 7 .   ? 22.298 58.081 12.207  1.00 39.27 ? 921 HOH A O     1 
HETATM 4159 O  O     . HOH I 7 .   ? 15.651 36.922 22.927  1.00 47.14 ? 922 HOH A O     1 
HETATM 4160 O  O     . HOH I 7 .   ? -3.914 28.075 -1.619  1.00 33.97 ? 923 HOH A O     1 
HETATM 4161 O  O     . HOH I 7 .   ? 26.786 46.675 16.752  1.00 34.45 ? 924 HOH A O     1 
HETATM 4162 O  O     . HOH I 7 .   ? 36.318 25.748 3.396   1.00 37.55 ? 925 HOH A O     1 
HETATM 4163 O  O     . HOH I 7 .   ? 53.262 41.464 9.889   1.00 27.81 ? 926 HOH A O     1 
HETATM 4164 O  O     . HOH I 7 .   ? 22.454 46.243 15.871  1.00 30.90 ? 927 HOH A O     1 
HETATM 4165 O  O     . HOH I 7 .   ? 36.915 23.882 17.168  1.00 35.97 ? 928 HOH A O     1 
HETATM 4166 O  O     . HOH I 7 .   ? 28.569 61.626 15.035  1.00 42.93 ? 929 HOH A O     1 
HETATM 4167 O  O     . HOH I 7 .   ? 16.294 39.321 26.053  1.00 42.58 ? 930 HOH A O     1 
HETATM 4168 O  O     . HOH I 7 .   ? 28.155 66.725 -2.043  1.00 38.34 ? 931 HOH A O     1 
HETATM 4169 O  O     . HOH I 7 .   ? 36.245 25.429 19.448  1.00 38.29 ? 932 HOH A O     1 
HETATM 4170 O  O     . HOH I 7 .   ? 31.928 28.012 16.347  1.00 44.91 ? 933 HOH A O     1 
HETATM 4171 O  O     . HOH I 7 .   ? 15.391 47.018 -5.009  1.00 43.60 ? 934 HOH A O     1 
HETATM 4172 O  O     . HOH I 7 .   ? 55.527 39.369 9.699   1.00 32.70 ? 935 HOH A O     1 
HETATM 4173 O  O     . HOH I 7 .   ? 41.757 43.510 -7.938  1.00 22.16 ? 936 HOH A O     1 
HETATM 4174 O  O     . HOH I 7 .   ? 6.220  42.743 28.754  1.00 41.62 ? 937 HOH A O     1 
HETATM 4175 O  O     A HOH I 7 .   ? 53.724 48.782 -3.298  0.50 26.36 ? 938 HOH A O     1 
HETATM 4176 O  O     B HOH I 7 .   ? 52.180 48.060 -5.052  0.50 33.15 ? 938 HOH A O     1 
HETATM 4177 O  O     . HOH I 7 .   ? 41.378 31.271 23.356  1.00 39.71 ? 939 HOH A O     1 
HETATM 4178 O  O     . HOH I 7 .   ? 21.190 59.646 -7.428  1.00 37.31 ? 940 HOH A O     1 
HETATM 4179 O  O     . HOH I 7 .   ? 14.921 55.230 30.093  1.00 44.36 ? 941 HOH A O     1 
HETATM 4180 O  O     . HOH I 7 .   ? 16.327 58.875 -5.694  1.00 35.62 ? 942 HOH A O     1 
HETATM 4181 O  O     . HOH I 7 .   ? 24.394 38.816 -19.408 1.00 35.83 ? 943 HOH A O     1 
HETATM 4182 O  O     . HOH I 7 .   ? 35.322 32.069 17.752  0.82 35.07 ? 944 HOH A O     1 
HETATM 4183 O  O     . HOH I 7 .   ? 28.649 45.422 14.014  0.52 29.36 ? 945 HOH A O     1 
HETATM 4184 O  O     . HOH I 7 .   ? 8.452  46.625 31.050  1.00 33.51 ? 946 HOH A O     1 
HETATM 4185 O  O     . HOH I 7 .   ? 39.700 63.381 -10.160 1.00 45.31 ? 947 HOH A O     1 
HETATM 4186 O  O     . HOH I 7 .   ? 39.914 33.141 22.183  1.00 30.73 ? 948 HOH A O     1 
HETATM 4187 O  O     . HOH I 7 .   ? 13.158 55.633 -4.194  0.90 33.77 ? 949 HOH A O     1 
HETATM 4188 O  O     . HOH I 7 .   ? 22.962 58.529 23.788  1.00 35.63 ? 950 HOH A O     1 
HETATM 4189 O  O     . HOH I 7 .   ? 15.653 58.251 26.519  0.74 34.74 ? 951 HOH A O     1 
HETATM 4190 O  O     . HOH I 7 .   ? 11.086 45.384 -5.322  0.69 29.54 ? 952 HOH A O     1 
HETATM 4191 O  O     . HOH I 7 .   ? 30.925 47.463 12.600  1.00 37.11 ? 953 HOH A O     1 
HETATM 4192 O  O     . HOH I 7 .   ? 56.921 22.052 9.445   1.00 38.81 ? 954 HOH A O     1 
HETATM 4193 O  O     . HOH I 7 .   ? 41.530 57.835 18.528  1.00 36.07 ? 955 HOH A O     1 
HETATM 4194 O  O     . HOH I 7 .   ? 21.966 55.944 29.995  1.00 56.11 ? 956 HOH A O     1 
HETATM 4195 O  O     . HOH I 7 .   ? 17.400 45.696 -4.841  1.00 42.56 ? 957 HOH A O     1 
HETATM 4196 O  O     . HOH I 7 .   ? 59.435 60.774 3.453   1.00 43.50 ? 958 HOH A O     1 
HETATM 4197 O  O     . HOH I 7 .   ? 51.821 34.988 0.729   1.00 36.55 ? 959 HOH A O     1 
HETATM 4198 O  O     . HOH I 7 .   ? 13.586 59.823 24.812  0.78 30.21 ? 960 HOH A O     1 
HETATM 4199 O  O     . HOH I 7 .   ? 33.111 25.335 16.571  1.00 38.44 ? 961 HOH A O     1 
HETATM 4200 O  O     . HOH I 7 .   ? 24.648 43.448 19.538  1.00 37.82 ? 962 HOH A O     1 
HETATM 4201 O  O     . HOH J 7 .   ? 38.614 26.220 1.513   1.00 31.67 ? 101 HOH T O     1 
HETATM 4202 O  O     . HOH J 7 .   ? 38.876 19.769 -1.010  1.00 39.12 ? 102 HOH T O     1 
HETATM 4203 O  O     . HOH J 7 .   ? 8.911  37.048 5.788   0.56 19.09 ? 103 HOH T O     1 
HETATM 4204 O  O     . HOH J 7 .   ? 21.917 32.353 -1.582  1.00 37.00 ? 104 HOH T O     1 
HETATM 4205 O  O     . HOH J 7 .   ? 13.543 38.256 18.197  1.00 36.01 ? 105 HOH T O     1 
HETATM 4206 O  O     . HOH J 7 .   ? 10.189 24.722 15.883  1.00 42.35 ? 106 HOH T O     1 
HETATM 4207 O  O     . HOH J 7 .   ? 25.926 27.118 -4.951  1.00 33.98 ? 107 HOH T O     1 
HETATM 4208 O  O     . HOH J 7 .   ? 12.659 33.604 22.943  1.00 46.74 ? 108 HOH T O     1 
HETATM 4209 O  O     . HOH J 7 .   ? 10.594 41.619 1.404   1.00 20.83 ? 109 HOH T O     1 
HETATM 4210 O  O     . HOH J 7 .   ? 13.052 33.613 6.801   1.00 20.68 ? 110 HOH T O     1 
HETATM 4211 O  O     . HOH J 7 .   ? 4.068  35.336 15.670  0.58 28.59 ? 111 HOH T O     1 
HETATM 4212 O  O     . HOH J 7 .   ? 10.314 38.827 14.522  1.00 34.06 ? 112 HOH T O     1 
HETATM 4213 O  O     . HOH J 7 .   ? 32.711 27.088 -5.497  0.59 30.60 ? 113 HOH T O     1 
HETATM 4214 O  O     . HOH J 7 .   ? 20.061 31.542 3.229   1.00 34.42 ? 114 HOH T O     1 
HETATM 4215 O  O     . HOH J 7 .   ? 28.354 28.259 -5.311  1.00 28.83 ? 115 HOH T O     1 
HETATM 4216 O  O     . HOH J 7 .   ? 18.217 35.379 -2.358  0.92 38.32 ? 116 HOH T O     1 
HETATM 4217 O  O     . HOH J 7 .   ? 31.306 30.975 0.947   1.00 28.83 ? 117 HOH T O     1 
HETATM 4218 O  O     . HOH J 7 .   ? 17.078 40.850 4.730   1.00 31.28 ? 118 HOH T O     1 
HETATM 4219 O  O     . HOH J 7 .   ? 14.481 40.960 8.223   1.00 23.41 ? 119 HOH T O     1 
HETATM 4220 O  O     . HOH J 7 .   ? 27.428 32.873 -5.793  1.00 33.65 ? 120 HOH T O     1 
HETATM 4221 O  O     . HOH J 7 .   ? 30.035 34.287 1.101   1.00 30.16 ? 121 HOH T O     1 
HETATM 4222 O  O     . HOH J 7 .   ? 35.170 23.601 -4.413  1.00 29.78 ? 122 HOH T O     1 
HETATM 4223 O  O     . HOH J 7 .   ? 29.956 18.751 0.375   1.00 29.76 ? 123 HOH T O     1 
HETATM 4224 O  O     . HOH J 7 .   ? 11.961 27.876 13.989  1.00 51.31 ? 124 HOH T O     1 
HETATM 4225 O  O     . HOH J 7 .   ? 31.352 21.458 -9.381  1.00 36.50 ? 125 HOH T O     1 
HETATM 4226 O  O     . HOH J 7 .   ? 30.450 12.071 -1.997  1.00 36.19 ? 126 HOH T O     1 
HETATM 4227 O  O     . HOH J 7 .   ? 21.492 30.225 0.213   1.00 39.65 ? 127 HOH T O     1 
HETATM 4228 O  O     . HOH J 7 .   ? 16.039 33.231 9.707   0.89 29.61 ? 128 HOH T O     1 
HETATM 4229 O  O     . HOH J 7 .   ? 30.098 26.302 -6.452  1.00 30.31 ? 129 HOH T O     1 
HETATM 4230 O  O     . HOH J 7 .   ? 27.631 37.143 1.433   1.00 34.92 ? 130 HOH T O     1 
HETATM 4231 O  O     . HOH J 7 .   ? 31.019 22.051 2.169   1.00 39.38 ? 131 HOH T O     1 
HETATM 4232 O  O     . HOH J 7 .   ? 33.723 13.178 0.025   1.00 43.81 ? 132 HOH T O     1 
HETATM 4233 O  O     . HOH J 7 .   ? 17.534 35.004 16.271  1.00 47.40 ? 133 HOH T O     1 
HETATM 4234 O  O     . HOH J 7 .   ? 22.484 39.987 2.005   1.00 41.04 ? 134 HOH T O     1 
HETATM 4235 O  O     . HOH J 7 .   ? 40.170 24.574 -2.255  0.70 33.06 ? 135 HOH T O     1 
HETATM 4236 O  O     . HOH J 7 .   ? 28.830 14.314 -2.986  1.00 37.07 ? 136 HOH T O     1 
HETATM 4237 O  O     . HOH J 7 .   ? 7.339  34.571 13.456  1.00 39.71 ? 137 HOH T O     1 
HETATM 4238 O  O     . HOH J 7 .   ? 30.018 25.245 -8.575  1.00 45.19 ? 138 HOH T O     1 
HETATM 4239 O  O     . HOH J 7 .   ? 8.539  37.116 15.270  1.00 33.58 ? 139 HOH T O     1 
HETATM 4240 O  O     . HOH K 7 .   ? 15.626 19.450 -8.084  1.00 31.61 ? 101 HOH P O     1 
HETATM 4241 O  O     . HOH K 7 .   ? 28.527 38.121 11.850  0.63 26.97 ? 102 HOH P O     1 
HETATM 4242 O  O     . HOH K 7 .   ? 23.065 35.223 10.957  1.00 33.07 ? 103 HOH P O     1 
HETATM 4243 O  O     . HOH K 7 .   ? 25.330 25.009 -6.491  1.00 31.74 ? 104 HOH P O     1 
HETATM 4244 O  O     . HOH K 7 .   ? 29.530 32.916 11.747  1.00 24.02 ? 105 HOH P O     1 
HETATM 4245 O  O     . HOH K 7 .   ? 31.414 30.445 3.661   1.00 28.34 ? 106 HOH P O     1 
HETATM 4246 O  O     . HOH K 7 .   ? 25.729 38.934 4.102   1.00 28.36 ? 107 HOH P O     1 
HETATM 4247 O  O     . HOH K 7 .   ? 28.944 29.497 10.870  1.00 38.28 ? 108 HOH P O     1 
HETATM 4248 O  O     . HOH K 7 .   ? 34.789 28.341 6.728   1.00 24.01 ? 109 HOH P O     1 
HETATM 4249 O  O     . HOH K 7 .   ? 21.574 22.616 4.437   1.00 33.30 ? 110 HOH P O     1 
HETATM 4250 O  O     . HOH K 7 .   ? 15.237 16.068 -7.722  1.00 26.10 ? 111 HOH P O     1 
HETATM 4251 O  O     . HOH K 7 .   ? 23.269 22.974 6.294   1.00 40.88 ? 112 HOH P O     1 
HETATM 4252 O  O     . HOH K 7 .   ? 22.143 27.112 3.627   1.00 35.98 ? 113 HOH P O     1 
HETATM 4253 O  O     . HOH K 7 .   ? 34.849 30.958 10.471  1.00 13.39 ? 114 HOH P O     1 
HETATM 4254 O  O     . HOH K 7 .   ? 22.923 24.097 -7.044  1.00 39.25 ? 115 HOH P O     1 
HETATM 4255 O  O     . HOH K 7 .   ? 30.150 34.644 3.718   1.00 25.41 ? 116 HOH P O     1 
HETATM 4256 O  O     A HOH K 7 .   ? 18.662 21.123 -5.134  0.55 19.07 ? 117 HOH P O     1 
HETATM 4257 O  O     B HOH K 7 .   ? 19.086 21.614 -6.597  0.45 26.43 ? 117 HOH P O     1 
HETATM 4258 O  O     . HOH K 7 .   ? 28.000 19.663 1.605   0.90 38.63 ? 118 HOH P O     1 
HETATM 4259 O  O     . HOH K 7 .   ? 33.707 38.109 11.398  1.00 23.44 ? 119 HOH P O     1 
HETATM 4260 O  O     . HOH K 7 .   ? 24.451 16.194 -5.383  1.00 25.24 ? 120 HOH P O     1 
HETATM 4261 O  O     . HOH K 7 .   ? 24.868 32.633 10.358  1.00 41.48 ? 121 HOH P O     1 
HETATM 4262 O  O     . HOH K 7 .   ? 25.749 41.484 11.525  1.00 35.54 ? 122 HOH P O     1 
HETATM 4263 O  O     . HOH K 7 .   ? 23.588 28.719 8.354   1.00 34.48 ? 123 HOH P O     1 
HETATM 4264 O  O     . HOH K 7 .   ? 21.521 25.119 -3.999  1.00 41.45 ? 124 HOH P O     1 
HETATM 4265 O  O     . HOH K 7 .   ? 33.185 27.659 4.606   0.62 22.70 ? 125 HOH P O     1 
HETATM 4266 O  O     . HOH K 7 .   ? 23.144 31.180 9.860   1.00 34.85 ? 126 HOH P O     1 
HETATM 4267 O  O     . HOH K 7 .   ? 32.611 34.712 4.807   1.00 32.64 ? 127 HOH P O     1 
HETATM 4268 O  O     . HOH K 7 .   ? 26.715 16.827 1.623   0.70 29.02 ? 128 HOH P O     1 
HETATM 4269 O  O     . HOH K 7 .   ? 23.965 24.178 8.577   0.81 38.71 ? 129 HOH P O     1 
HETATM 4270 O  O     . HOH K 7 .   ? 33.675 32.126 4.324   1.00 26.13 ? 130 HOH P O     1 
HETATM 4271 O  O     . HOH K 7 .   ? 19.639 23.662 -5.660  1.00 43.11 ? 131 HOH P O     1 
HETATM 4272 O  O     . HOH K 7 .   ? 19.191 41.488 3.052   1.00 35.39 ? 132 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 ?   ?   ?   A . n 
A 1 157 PRO 157 154 ?   ?   ?   A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 ?   ?   ?   A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DG  4   4   4   DG  DG  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CTP 1   501 1   CTP CTP A . 
E 5 CA  1   502 1   CA  CA  A . 
F 5 CA  1   503 2   CA  CA  A . 
G 6 GOL 1   504 1   GOL GOL A . 
H 6 GOL 1   505 2   GOL GOL A . 
I 7 HOH 1   601 438 HOH HOH A . 
I 7 HOH 2   602 451 HOH HOH A . 
I 7 HOH 3   603 369 HOH HOH A . 
I 7 HOH 4   604 207 HOH WAT A . 
I 7 HOH 5   605 377 HOH HOH A . 
I 7 HOH 6   606 603 HOH HOH A . 
I 7 HOH 7   607 596 HOH HOH A . 
I 7 HOH 8   608 351 HOH HOH A . 
I 7 HOH 9   609 295 HOH WAT A . 
I 7 HOH 10  610 506 HOH HOH A . 
I 7 HOH 11  611 66  HOH WAT A . 
I 7 HOH 12  612 392 HOH HOH A . 
I 7 HOH 13  613 305 HOH WAT A . 
I 7 HOH 14  614 78  HOH WAT A . 
I 7 HOH 15  615 562 HOH HOH A . 
I 7 HOH 16  616 153 HOH WAT A . 
I 7 HOH 17  617 444 HOH HOH A . 
I 7 HOH 18  618 249 HOH WAT A . 
I 7 HOH 19  619 443 HOH HOH A . 
I 7 HOH 20  620 418 HOH HOH A . 
I 7 HOH 21  621 591 HOH HOH A . 
I 7 HOH 22  622 71  HOH WAT A . 
I 7 HOH 23  623 464 HOH HOH A . 
I 7 HOH 24  624 222 HOH WAT A . 
I 7 HOH 25  625 76  HOH WAT A . 
I 7 HOH 26  626 348 HOH HOH A . 
I 7 HOH 27  627 31  HOH WAT A . 
I 7 HOH 28  628 484 HOH HOH A . 
I 7 HOH 29  629 77  HOH WAT A . 
I 7 HOH 30  630 501 HOH HOH A . 
I 7 HOH 31  631 474 HOH HOH A . 
I 7 HOH 32  632 108 HOH WAT A . 
I 7 HOH 33  633 321 HOH WAT A . 
I 7 HOH 34  634 329 HOH WAT A . 
I 7 HOH 35  635 380 HOH HOH A . 
I 7 HOH 36  636 202 HOH WAT A . 
I 7 HOH 37  637 523 HOH HOH A . 
I 7 HOH 38  638 111 HOH WAT A . 
I 7 HOH 39  639 296 HOH WAT A . 
I 7 HOH 40  640 415 HOH HOH A . 
I 7 HOH 41  641 477 HOH HOH A . 
I 7 HOH 42  642 481 HOH HOH A . 
I 7 HOH 43  643 382 HOH HOH A . 
I 7 HOH 44  644 365 HOH HOH A . 
I 7 HOH 45  645 406 HOH HOH A . 
I 7 HOH 46  646 248 HOH WAT A . 
I 7 HOH 47  647 309 HOH WAT A . 
I 7 HOH 48  648 41  HOH WAT A . 
I 7 HOH 49  649 353 HOH HOH A . 
I 7 HOH 50  650 219 HOH WAT A . 
I 7 HOH 51  651 227 HOH WAT A . 
I 7 HOH 52  652 159 HOH WAT A . 
I 7 HOH 53  653 602 HOH HOH A . 
I 7 HOH 54  654 50  HOH WAT A . 
I 7 HOH 55  655 430 HOH HOH A . 
I 7 HOH 56  656 466 HOH HOH A . 
I 7 HOH 57  657 419 HOH HOH A . 
I 7 HOH 58  658 101 HOH WAT A . 
I 7 HOH 59  659 180 HOH WAT A . 
I 7 HOH 60  660 448 HOH HOH A . 
I 7 HOH 61  661 5   HOH WAT A . 
I 7 HOH 62  662 6   HOH WAT A . 
I 7 HOH 63  663 512 HOH HOH A . 
I 7 HOH 64  664 229 HOH WAT A . 
I 7 HOH 65  665 554 HOH HOH A . 
I 7 HOH 66  666 364 HOH HOH A . 
I 7 HOH 67  667 62  HOH WAT A . 
I 7 HOH 68  668 423 HOH HOH A . 
I 7 HOH 69  669 483 HOH HOH A . 
I 7 HOH 70  670 16  HOH WAT A . 
I 7 HOH 71  671 356 HOH HOH A . 
I 7 HOH 72  672 82  HOH WAT A . 
I 7 HOH 73  673 495 HOH HOH A . 
I 7 HOH 74  674 171 HOH WAT A . 
I 7 HOH 75  675 450 HOH HOH A . 
I 7 HOH 76  676 147 HOH WAT A . 
I 7 HOH 77  677 478 HOH HOH A . 
I 7 HOH 78  678 505 HOH HOH A . 
I 7 HOH 79  679 251 HOH WAT A . 
I 7 HOH 80  680 92  HOH WAT A . 
I 7 HOH 81  681 375 HOH HOH A . 
I 7 HOH 82  682 442 HOH HOH A . 
I 7 HOH 83  683 65  HOH WAT A . 
I 7 HOH 84  684 553 HOH HOH A . 
I 7 HOH 85  685 381 HOH HOH A . 
I 7 HOH 86  686 559 HOH HOH A . 
I 7 HOH 87  687 152 HOH WAT A . 
I 7 HOH 88  688 434 HOH HOH A . 
I 7 HOH 89  689 28  HOH WAT A . 
I 7 HOH 90  690 22  HOH WAT A . 
I 7 HOH 91  691 61  HOH WAT A . 
I 7 HOH 92  692 38  HOH WAT A . 
I 7 HOH 93  693 68  HOH WAT A . 
I 7 HOH 94  694 155 HOH WAT A . 
I 7 HOH 95  695 490 HOH HOH A . 
I 7 HOH 96  696 592 HOH HOH A . 
I 7 HOH 97  697 69  HOH WAT A . 
I 7 HOH 98  698 378 HOH HOH A . 
I 7 HOH 99  699 470 HOH HOH A . 
I 7 HOH 100 700 507 HOH HOH A . 
I 7 HOH 101 701 376 HOH HOH A . 
I 7 HOH 102 702 235 HOH WAT A . 
I 7 HOH 103 703 183 HOH WAT A . 
I 7 HOH 104 704 469 HOH HOH A . 
I 7 HOH 105 705 367 HOH HOH A . 
I 7 HOH 106 706 107 HOH WAT A . 
I 7 HOH 107 707 489 HOH HOH A . 
I 7 HOH 108 708 161 HOH WAT A . 
I 7 HOH 109 709 172 HOH WAT A . 
I 7 HOH 110 710 350 HOH HOH A . 
I 7 HOH 111 711 106 HOH WAT A . 
I 7 HOH 112 712 411 HOH HOH A . 
I 7 HOH 113 713 25  HOH WAT A . 
I 7 HOH 114 714 304 HOH WAT A . 
I 7 HOH 115 715 12  HOH WAT A . 
I 7 HOH 116 716 55  HOH WAT A . 
I 7 HOH 117 717 29  HOH WAT A . 
I 7 HOH 118 718 384 HOH HOH A . 
I 7 HOH 119 719 337 HOH HOH A . 
I 7 HOH 120 720 102 HOH WAT A . 
I 7 HOH 121 721 417 HOH HOH A . 
I 7 HOH 122 722 73  HOH WAT A . 
I 7 HOH 123 723 149 HOH WAT A . 
I 7 HOH 124 724 360 HOH HOH A . 
I 7 HOH 125 725 60  HOH WAT A . 
I 7 HOH 126 726 44  HOH WAT A . 
I 7 HOH 127 727 45  HOH WAT A . 
I 7 HOH 128 728 46  HOH WAT A . 
I 7 HOH 129 729 224 HOH WAT A . 
I 7 HOH 130 730 476 HOH HOH A . 
I 7 HOH 131 731 137 HOH WAT A . 
I 7 HOH 132 732 24  HOH WAT A . 
I 7 HOH 133 733 577 HOH HOH A . 
I 7 HOH 134 734 238 HOH WAT A . 
I 7 HOH 135 735 580 HOH HOH A . 
I 7 HOH 136 736 257 HOH WAT A . 
I 7 HOH 137 737 97  HOH WAT A . 
I 7 HOH 138 738 214 HOH WAT A . 
I 7 HOH 139 739 154 HOH WAT A . 
I 7 HOH 140 740 20  HOH WAT A . 
I 7 HOH 141 741 168 HOH WAT A . 
I 7 HOH 142 742 311 HOH WAT A . 
I 7 HOH 143 743 11  HOH WAT A . 
I 7 HOH 144 744 182 HOH WAT A . 
I 7 HOH 145 745 84  HOH WAT A . 
I 7 HOH 146 746 294 HOH WAT A . 
I 7 HOH 147 747 524 HOH HOH A . 
I 7 HOH 148 748 312 HOH WAT A . 
I 7 HOH 149 749 357 HOH HOH A . 
I 7 HOH 150 750 383 HOH HOH A . 
I 7 HOH 151 751 47  HOH WAT A . 
I 7 HOH 152 752 64  HOH WAT A . 
I 7 HOH 153 753 14  HOH WAT A . 
I 7 HOH 154 754 586 HOH HOH A . 
I 7 HOH 155 755 88  HOH WAT A . 
I 7 HOH 156 756 594 HOH HOH A . 
I 7 HOH 157 757 347 HOH HOH A . 
I 7 HOH 158 758 587 HOH HOH A . 
I 7 HOH 159 759 163 HOH WAT A . 
I 7 HOH 160 760 473 HOH HOH A . 
I 7 HOH 161 761 95  HOH WAT A . 
I 7 HOH 162 762 201 HOH WAT A . 
I 7 HOH 163 763 340 HOH HOH A . 
I 7 HOH 164 764 330 HOH WAT A . 
I 7 HOH 165 765 297 HOH WAT A . 
I 7 HOH 166 766 547 HOH HOH A . 
I 7 HOH 167 767 27  HOH WAT A . 
I 7 HOH 168 768 359 HOH HOH A . 
I 7 HOH 169 769 110 HOH WAT A . 
I 7 HOH 170 770 32  HOH WAT A . 
I 7 HOH 171 771 538 HOH HOH A . 
I 7 HOH 172 772 150 HOH WAT A . 
I 7 HOH 173 773 597 HOH HOH A . 
I 7 HOH 174 774 314 HOH WAT A . 
I 7 HOH 175 775 373 HOH HOH A . 
I 7 HOH 176 776 241 HOH WAT A . 
I 7 HOH 177 777 504 HOH HOH A . 
I 7 HOH 178 778 402 HOH HOH A . 
I 7 HOH 179 779 42  HOH WAT A . 
I 7 HOH 180 780 422 HOH HOH A . 
I 7 HOH 181 781 552 HOH HOH A . 
I 7 HOH 182 782 509 HOH HOH A . 
I 7 HOH 183 783 320 HOH WAT A . 
I 7 HOH 184 784 510 HOH HOH A . 
I 7 HOH 185 785 354 HOH HOH A . 
I 7 HOH 186 786 80  HOH WAT A . 
I 7 HOH 187 787 605 HOH HOH A . 
I 7 HOH 188 788 548 HOH HOH A . 
I 7 HOH 189 789 302 HOH WAT A . 
I 7 HOH 190 790 75  HOH WAT A . 
I 7 HOH 191 791 440 HOH HOH A . 
I 7 HOH 192 792 499 HOH HOH A . 
I 7 HOH 193 793 39  HOH WAT A . 
I 7 HOH 194 794 36  HOH WAT A . 
I 7 HOH 195 795 518 HOH HOH A . 
I 7 HOH 196 796 175 HOH WAT A . 
I 7 HOH 197 797 79  HOH WAT A . 
I 7 HOH 198 798 94  HOH WAT A . 
I 7 HOH 199 799 18  HOH WAT A . 
I 7 HOH 200 800 100 HOH WAT A . 
I 7 HOH 201 801 54  HOH WAT A . 
I 7 HOH 202 802 379 HOH HOH A . 
I 7 HOH 203 803 514 HOH HOH A . 
I 7 HOH 204 804 57  HOH WAT A . 
I 7 HOH 205 805 67  HOH WAT A . 
I 7 HOH 206 806 81  HOH WAT A . 
I 7 HOH 207 807 471 HOH HOH A . 
I 7 HOH 208 808 326 HOH WAT A . 
I 7 HOH 209 809 306 HOH WAT A . 
I 7 HOH 210 810 40  HOH WAT A . 
I 7 HOH 211 811 394 HOH HOH A . 
I 7 HOH 212 812 53  HOH WAT A . 
I 7 HOH 213 813 436 HOH HOH A . 
I 7 HOH 214 814 421 HOH HOH A . 
I 7 HOH 215 815 324 HOH WAT A . 
I 7 HOH 216 816 472 HOH HOH A . 
I 7 HOH 217 817 86  HOH WAT A . 
I 7 HOH 218 818 435 HOH HOH A . 
I 7 HOH 219 819 239 HOH WAT A . 
I 7 HOH 220 820 535 HOH HOH A . 
I 7 HOH 221 821 87  HOH WAT A . 
I 7 HOH 222 822 30  HOH WAT A . 
I 7 HOH 223 823 502 HOH HOH A . 
I 7 HOH 224 824 63  HOH WAT A . 
I 7 HOH 225 825 109 HOH WAT A . 
I 7 HOH 226 826 246 HOH WAT A . 
I 7 HOH 227 827 388 HOH HOH A . 
I 7 HOH 228 828 331 HOH WAT A . 
I 7 HOH 229 829 352 HOH HOH A . 
I 7 HOH 230 830 599 HOH HOH A . 
I 7 HOH 231 831 517 HOH HOH A . 
I 7 HOH 232 832 346 HOH HOH A . 
I 7 HOH 233 833 349 HOH HOH A . 
I 7 HOH 234 834 244 HOH WAT A . 
I 7 HOH 235 835 414 HOH HOH A . 
I 7 HOH 236 836 416 HOH HOH A . 
I 7 HOH 237 837 33  HOH WAT A . 
I 7 HOH 238 838 89  HOH WAT A . 
I 7 HOH 239 839 170 HOH WAT A . 
I 7 HOH 240 840 34  HOH WAT A . 
I 7 HOH 241 841 569 HOH HOH A . 
I 7 HOH 242 842 403 HOH HOH A . 
I 7 HOH 243 843 166 HOH WAT A . 
I 7 HOH 244 844 555 HOH HOH A . 
I 7 HOH 245 845 90  HOH WAT A . 
I 7 HOH 246 846 181 HOH WAT A . 
I 7 HOH 247 847 409 HOH HOH A . 
I 7 HOH 248 848 503 HOH HOH A . 
I 7 HOH 249 849 126 HOH WAT A . 
I 7 HOH 250 850 527 HOH HOH A . 
I 7 HOH 251 851 541 HOH HOH A . 
I 7 HOH 252 852 397 HOH HOH A . 
I 7 HOH 253 853 48  HOH WAT A . 
I 7 HOH 254 854 566 HOH HOH A . 
I 7 HOH 255 855 607 HOH HOH A . 
I 7 HOH 256 856 604 HOH HOH A . 
I 7 HOH 257 857 83  HOH WAT A . 
I 7 HOH 258 858 565 HOH HOH A . 
I 7 HOH 259 859 345 HOH HOH A . 
I 7 HOH 260 860 98  HOH WAT A . 
I 7 HOH 261 861 216 HOH WAT A . 
I 7 HOH 262 862 322 HOH WAT A . 
I 7 HOH 263 863 539 HOH HOH A . 
I 7 HOH 264 864 371 HOH HOH A . 
I 7 HOH 265 865 315 HOH WAT A . 
I 7 HOH 266 866 522 HOH HOH A . 
I 7 HOH 267 867 572 HOH HOH A . 
I 7 HOH 268 868 341 HOH HOH A . 
I 7 HOH 269 869 156 HOH WAT A . 
I 7 HOH 270 870 445 HOH HOH A . 
I 7 HOH 271 871 452 HOH HOH A . 
I 7 HOH 272 872 413 HOH HOH A . 
I 7 HOH 273 873 145 HOH WAT A . 
I 7 HOH 274 874 573 HOH HOH A . 
I 7 HOH 275 875 575 HOH HOH A . 
I 7 HOH 276 876 515 HOH HOH A . 
I 7 HOH 277 877 479 HOH HOH A . 
I 7 HOH 278 878 318 HOH WAT A . 
I 7 HOH 279 879 179 HOH WAT A . 
I 7 HOH 280 880 576 HOH HOH A . 
I 7 HOH 281 881 526 HOH HOH A . 
I 7 HOH 282 882 488 HOH HOH A . 
I 7 HOH 283 883 332 HOH WAT A . 
I 7 HOH 284 884 570 HOH HOH A . 
I 7 HOH 285 885 253 HOH WAT A . 
I 7 HOH 286 886 225 HOH WAT A . 
I 7 HOH 287 887 358 HOH HOH A . 
I 7 HOH 288 888 460 HOH HOH A . 
I 7 HOH 289 889 511 HOH HOH A . 
I 7 HOH 290 890 162 HOH WAT A . 
I 7 HOH 291 891 396 HOH HOH A . 
I 7 HOH 292 892 399 HOH HOH A . 
I 7 HOH 293 893 99  HOH WAT A . 
I 7 HOH 294 894 441 HOH HOH A . 
I 7 HOH 295 895 585 HOH HOH A . 
I 7 HOH 296 896 420 HOH HOH A . 
I 7 HOH 297 897 146 HOH WAT A . 
I 7 HOH 298 898 519 HOH HOH A . 
I 7 HOH 299 899 533 HOH HOH A . 
I 7 HOH 300 900 439 HOH HOH A . 
I 7 HOH 301 901 391 HOH HOH A . 
I 7 HOH 302 902 123 HOH WAT A . 
I 7 HOH 303 903 362 HOH HOH A . 
I 7 HOH 304 904 574 HOH HOH A . 
I 7 HOH 305 905 431 HOH HOH A . 
I 7 HOH 306 906 408 HOH HOH A . 
I 7 HOH 307 907 563 HOH HOH A . 
I 7 HOH 308 908 558 HOH HOH A . 
I 7 HOH 309 909 601 HOH HOH A . 
I 7 HOH 310 910 516 HOH HOH A . 
I 7 HOH 311 911 303 HOH WAT A . 
I 7 HOH 312 912 546 HOH HOH A . 
I 7 HOH 313 913 404 HOH HOH A . 
I 7 HOH 314 914 298 HOH WAT A . 
I 7 HOH 315 915 395 HOH HOH A . 
I 7 HOH 316 916 462 HOH HOH A . 
I 7 HOH 317 917 449 HOH HOH A . 
I 7 HOH 318 918 424 HOH HOH A . 
I 7 HOH 319 919 93  HOH WAT A . 
I 7 HOH 320 920 534 HOH HOH A . 
I 7 HOH 321 921 335 HOH WAT A . 
I 7 HOH 322 922 467 HOH HOH A . 
I 7 HOH 323 923 433 HOH HOH A . 
I 7 HOH 324 924 463 HOH HOH A . 
I 7 HOH 325 925 165 HOH WAT A . 
I 7 HOH 326 926 140 HOH WAT A . 
I 7 HOH 327 927 114 HOH WAT A . 
I 7 HOH 328 928 530 HOH HOH A . 
I 7 HOH 329 929 583 HOH HOH A . 
I 7 HOH 330 930 468 HOH HOH A . 
I 7 HOH 331 931 525 HOH HOH A . 
I 7 HOH 332 932 412 HOH HOH A . 
I 7 HOH 333 933 410 HOH HOH A . 
I 7 HOH 334 934 372 HOH HOH A . 
I 7 HOH 335 935 325 HOH WAT A . 
I 7 HOH 336 936 176 HOH WAT A . 
I 7 HOH 337 937 544 HOH HOH A . 
I 7 HOH 338 938 487 HOH HOH A . 
I 7 HOH 339 939 498 HOH HOH A . 
I 7 HOH 340 940 491 HOH HOH A . 
I 7 HOH 341 941 143 HOH WAT A . 
I 7 HOH 342 942 405 HOH HOH A . 
I 7 HOH 343 943 520 HOH HOH A . 
I 7 HOH 344 944 593 HOH HOH A . 
I 7 HOH 345 945 608 HOH HOH A . 
I 7 HOH 346 946 363 HOH HOH A . 
I 7 HOH 347 947 390 HOH HOH A . 
I 7 HOH 348 948 135 HOH WAT A . 
I 7 HOH 349 949 370 HOH HOH A . 
I 7 HOH 350 950 355 HOH HOH A . 
I 7 HOH 351 951 579 HOH HOH A . 
I 7 HOH 352 952 598 HOH HOH A . 
I 7 HOH 353 953 59  HOH WAT A . 
I 7 HOH 354 954 508 HOH HOH A . 
I 7 HOH 355 955 319 HOH WAT A . 
I 7 HOH 356 956 556 HOH HOH A . 
I 7 HOH 357 957 374 HOH HOH A . 
I 7 HOH 358 958 529 HOH HOH A . 
I 7 HOH 359 959 536 HOH HOH A . 
I 7 HOH 360 960 571 HOH HOH A . 
I 7 HOH 361 961 564 HOH HOH A . 
I 7 HOH 362 962 252 HOH WAT A . 
J 7 HOH 1   101 85  HOH WAT T . 
J 7 HOH 2   102 148 HOH WAT T . 
J 7 HOH 3   103 368 HOH HOH T . 
J 7 HOH 4   104 456 HOH HOH T . 
J 7 HOH 5   105 455 HOH HOH T . 
J 7 HOH 6   106 486 HOH HOH T . 
J 7 HOH 7   107 292 HOH WAT T . 
J 7 HOH 8   108 590 HOH HOH T . 
J 7 HOH 9   109 26  HOH WAT T . 
J 7 HOH 10  110 213 HOH WAT T . 
J 7 HOH 11  111 545 HOH HOH T . 
J 7 HOH 12  112 492 HOH HOH T . 
J 7 HOH 13  113 581 HOH HOH T . 
J 7 HOH 14  114 458 HOH HOH T . 
J 7 HOH 15  115 427 HOH HOH T . 
J 7 HOH 16  116 550 HOH HOH T . 
J 7 HOH 17  117 328 HOH WAT T . 
J 7 HOH 18  118 461 HOH HOH T . 
J 7 HOH 19  119 158 HOH WAT T . 
J 7 HOH 20  120 425 HOH HOH T . 
J 7 HOH 21  121 454 HOH HOH T . 
J 7 HOH 22  122 475 HOH HOH T . 
J 7 HOH 23  123 459 HOH HOH T . 
J 7 HOH 24  124 595 HOH HOH T . 
J 7 HOH 25  125 282 HOH WAT T . 
J 7 HOH 26  126 37  HOH WAT T . 
J 7 HOH 27  127 457 HOH HOH T . 
J 7 HOH 28  128 531 HOH HOH T . 
J 7 HOH 29  129 428 HOH HOH T . 
J 7 HOH 30  130 385 HOH HOH T . 
J 7 HOH 31  131 567 HOH HOH T . 
J 7 HOH 32  132 339 HOH HOH T . 
J 7 HOH 33  133 482 HOH HOH T . 
J 7 HOH 34  134 387 HOH HOH T . 
J 7 HOH 35  135 589 HOH HOH T . 
J 7 HOH 36  136 600 HOH HOH T . 
J 7 HOH 37  137 338 HOH HOH T . 
J 7 HOH 38  138 543 HOH HOH T . 
J 7 HOH 39  139 336 HOH HOH T . 
K 7 HOH 1   101 250 HOH WAT P . 
K 7 HOH 2   102 560 HOH HOH P . 
K 7 HOH 3   103 361 HOH HOH P . 
K 7 HOH 4   104 429 HOH HOH P . 
K 7 HOH 5   105 407 HOH HOH P . 
K 7 HOH 6   106 333 HOH WAT P . 
K 7 HOH 7   107 386 HOH HOH P . 
K 7 HOH 8   108 549 HOH HOH P . 
K 7 HOH 9   109 160 HOH WAT P . 
K 7 HOH 10  110 446 HOH HOH P . 
K 7 HOH 11  111 432 HOH HOH P . 
K 7 HOH 12  112 496 HOH HOH P . 
K 7 HOH 13  113 521 HOH HOH P . 
K 7 HOH 14  114 3   HOH WAT P . 
K 7 HOH 15  115 493 HOH HOH P . 
K 7 HOH 16  116 453 HOH HOH P . 
K 7 HOH 17  117 447 HOH HOH P . 
K 7 HOH 18  118 537 HOH HOH P . 
K 7 HOH 19  119 58  HOH WAT P . 
K 7 HOH 20  120 119 HOH WAT P . 
K 7 HOH 21  121 588 HOH HOH P . 
K 7 HOH 22  122 606 HOH HOH P . 
K 7 HOH 23  123 485 HOH HOH P . 
K 7 HOH 24  124 497 HOH HOH P . 
K 7 HOH 25  125 561 HOH HOH P . 
K 7 HOH 26  126 542 HOH HOH P . 
K 7 HOH 27  127 540 HOH HOH P . 
K 7 HOH 28  128 568 HOH HOH P . 
K 7 HOH 29  129 584 HOH HOH P . 
K 7 HOH 30  130 231 HOH WAT P . 
K 7 HOH 31  131 532 HOH HOH P . 
K 7 HOH 32  132 232 HOH WAT P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5640  ? 
1 MORE         -58   ? 
1 'SSA (A^2)'  20960 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 85.0  ? 
2  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 96.0  ? 
3  O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 88.6  ? 
4  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A   ? D CTP .   ? A CTP 501 ? 1_555 103.4 ? 
5  O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A   ? D CTP .   ? A CTP 501 ? 1_555 171.2 ? 
6  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A   ? D CTP .   ? A CTP 501 ? 1_555 92.8  ? 
7  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B   ? D CTP .   ? A CTP 501 ? 1_555 174.9 ? 
8  O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B   ? D CTP .   ? A CTP 501 ? 1_555 91.2  ? 
9  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B   ? D CTP .   ? A CTP 501 ? 1_555 87.3  ? 
10 O1A   ? D CTP .   ? A CTP 501 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B   ? D CTP .   ? A CTP 501 ? 1_555 80.3  ? 
11 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G   ? D CTP .   ? A CTP 501 ? 1_555 95.9  ? 
12 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G   ? D CTP .   ? A CTP 501 ? 1_555 95.0  ? 
13 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G   ? D CTP .   ? A CTP 501 ? 1_555 167.8 ? 
14 O1A   ? D CTP .   ? A CTP 501 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G   ? D CTP .   ? A CTP 501 ? 1_555 81.9  ? 
15 O1B   ? D CTP .   ? A CTP 501 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G   ? D CTP .   ? A CTP 501 ? 1_555 81.0  ? 
16 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 96.3  ? 
17 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 92.2  ? 
18 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 134.7 ? 
19 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 166.7 ? 
20 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 72.6  ? 
21 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 90.8  ? 
22 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 165.2 ? 
23 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 68.9  ? 
24 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 97.6  ? 
25 "O3'" A C DT  8   ? P DT  8   ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 7.1   ? 
26 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O1A   ? D CTP .   ? A CTP 501 ? 1_555 79.2  ? 
27 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O1A   ? D CTP .   ? A CTP 501 ? 1_555 95.9  ? 
28 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O1A   ? D CTP .   ? A CTP 501 ? 1_555 129.4 ? 
29 "O3'" A C DT  8   ? P DT  8   ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O1A   ? D CTP .   ? A CTP 501 ? 1_555 108.7 ? 
30 "O3'" B C DT  8   ? P DT  8   ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O1A   ? D CTP .   ? A CTP 501 ? 1_555 102.7 ? 
31 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O     ? I HOH .   ? A HOH 638 ? 1_555 68.6  ? 
32 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O     ? I HOH .   ? A HOH 638 ? 1_555 151.2 ? 
33 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O     ? I HOH .   ? A HOH 638 ? 1_555 72.2  ? 
34 "O3'" A C DT  8   ? P DT  8   ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O     ? I HOH .   ? A HOH 638 ? 1_555 124.6 ? 
35 "O3'" B C DT  8   ? P DT  8   ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O     ? I HOH .   ? A HOH 638 ? 1_555 125.1 ? 
36 O1A   ? D CTP .   ? A CTP 501 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O     ? I HOH .   ? A HOH 638 ? 1_555 58.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-01-13 
2 'Structure model' 1 1 2016-01-20 
3 'Structure model' 1 2 2016-03-02 
4 'Structure model' 1 3 2017-09-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' pdbx_audit_support    
3 4 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.10_2155 1 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .         2 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? ARP      ? ? ? .         3 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot     ? ? ? .         4 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .         5 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .         6 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DT 3  ? ? "C1'" T DT 3  ? ? N1    T DT 3  ? ? 110.62 108.30 2.32  0.30 N 
2 1 "C1'" T DT 6  ? ? "O4'" T DT 6  ? ? "C4'" T DT 6  ? ? 103.24 110.10 -6.86 1.00 N 
3 1 "O4'" T DC 9  ? ? "C1'" T DC 9  ? ? N1    T DC 9  ? ? 111.27 108.30 2.97  0.30 N 
4 1 "O4'" T DT 12 ? ? "C1'" T DT 12 ? ? N1    T DT 12 ? ? 110.31 108.30 2.01  0.30 N 
5 1 "O4'" P DG 2  ? ? "C1'" P DG 2  ? ? N9    P DG 2  ? ? 110.28 108.30 1.98  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 22.88   65.73   
2 1 TYR A 39  ? ? 68.77   -178.48 
3 1 LYS A 40  ? ? -156.77 -29.29  
4 1 SER A 62  ? A 71.73   -9.19   
5 1 SER A 113 ? ? -171.21 -174.14 
6 1 LEU A 132 ? ? 31.91   62.13   
7 1 SER A 217 ? ? -156.30 -159.48 
8 1 ASN A 230 ? A -141.31 43.28   
9 1 SER A 257 ? ? 91.13   -8.78   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A MET 1   ? CG    ? A MET 4   CG    
2   1 Y 1 A MET 1   ? SD    ? A MET 4   SD    
3   1 Y 1 A MET 1   ? CE    ? A MET 4   CE    
4   1 Y 1 A GLU 127 ? CD    ? A GLU 130 CD    
5   1 Y 1 A GLU 127 ? OE1   ? A GLU 130 OE1   
6   1 Y 1 A GLU 127 ? OE2   ? A GLU 130 OE2   
7   1 Y 1 A GLN 130 ? CG    ? A GLN 133 CG    
8   1 Y 1 A GLN 130 ? CD    ? A GLN 133 CD    
9   1 Y 1 A GLN 130 ? OE1   ? A GLN 133 OE1   
10  1 Y 1 A GLN 130 ? NE2   ? A GLN 133 NE2   
11  1 Y 1 A LYS 131 ? CG    ? A LYS 134 CG    
12  1 Y 1 A LYS 131 ? CD    ? A LYS 134 CD    
13  1 Y 1 A LYS 131 ? CE    ? A LYS 134 CE    
14  1 Y 1 A LYS 131 ? NZ    ? A LYS 134 NZ    
15  1 Y 1 A LEU 132 ? CB    ? A LEU 135 CB    
16  1 Y 1 A LEU 132 ? CG    ? A LEU 135 CG    
17  1 Y 1 A LEU 132 ? CD1   ? A LEU 135 CD1   
18  1 Y 1 A LEU 132 ? CD2   ? A LEU 135 CD2   
19  1 Y 1 A GLN 133 ? CB    ? A GLN 136 CB    
20  1 Y 1 A GLN 133 ? CG    ? A GLN 136 CG    
21  1 Y 1 A GLN 133 ? CD    ? A GLN 136 CD    
22  1 Y 1 A GLN 133 ? OE1   ? A GLN 136 OE1   
23  1 Y 1 A GLN 133 ? NE2   ? A GLN 136 NE2   
24  1 Y 1 A GLN 135 ? CG    ? A GLN 138 CG    
25  1 Y 1 A GLN 135 ? CD    ? A GLN 138 CD    
26  1 Y 1 A GLN 135 ? OE1   ? A GLN 138 OE1   
27  1 Y 1 A GLN 135 ? NE2   ? A GLN 138 NE2   
28  1 Y 1 A GLN 152 ? CB    ? A GLN 155 CB    
29  1 Y 1 A GLN 152 ? CG    ? A GLN 155 CG    
30  1 Y 1 A GLN 152 ? CD    ? A GLN 155 CD    
31  1 Y 1 A GLN 152 ? OE1   ? A GLN 155 OE1   
32  1 Y 1 A GLN 152 ? NE2   ? A GLN 155 NE2   
33  1 Y 1 A GLN 162 ? CG    ? A GLN 165 CG    
34  1 Y 1 A GLN 162 ? CD    ? A GLN 165 CD    
35  1 Y 1 A GLN 162 ? OE1   ? A GLN 165 OE1   
36  1 Y 1 A GLN 162 ? NE2   ? A GLN 165 NE2   
37  1 Y 1 A LYS 163 ? CG    ? A LYS 166 CG    
38  1 Y 1 A LYS 163 ? CD    ? A LYS 166 CD    
39  1 Y 1 A LYS 163 ? CE    ? A LYS 166 CE    
40  1 Y 1 A LYS 163 ? NZ    ? A LYS 166 NZ    
41  1 Y 1 A GLN 169 ? CG    ? A GLN 172 CG    
42  1 Y 1 A GLN 169 ? CD    ? A GLN 172 CD    
43  1 Y 1 A GLN 169 ? OE1   ? A GLN 172 OE1   
44  1 Y 1 A GLN 169 ? NE2   ? A GLN 172 NE2   
45  1 Y 1 A GLN 179 ? CG    ? A GLN 182 CG    
46  1 Y 1 A GLN 179 ? CD    ? A GLN 182 CD    
47  1 Y 1 A GLN 179 ? OE1   ? A GLN 182 OE1   
48  1 Y 1 A GLN 179 ? NE2   ? A GLN 182 NE2   
49  1 Y 1 A ILE 180 ? CG1   ? A ILE 183 CG1   
50  1 Y 1 A ILE 180 ? CG2   ? A ILE 183 CG2   
51  1 Y 1 A ILE 180 ? CD1   ? A ILE 183 CD1   
52  1 Y 1 A ASP 181 ? CG    ? A ASP 184 CG    
53  1 Y 1 A ASP 181 ? OD1   ? A ASP 184 OD1   
54  1 Y 1 A ASP 181 ? OD2   ? A ASP 184 OD2   
55  1 Y 1 A GLU 268 ? CG    ? A GLU 271 CG    
56  1 Y 1 A GLU 268 ? CD    ? A GLU 271 CD    
57  1 Y 1 A GLU 268 ? OE1   ? A GLU 271 OE1   
58  1 Y 1 A GLU 268 ? OE2   ? A GLU 271 OE2   
59  1 Y 1 A LYS 328 ? CG    ? A LYS 331 CG    
60  1 Y 1 A LYS 328 ? CD    ? A LYS 331 CD    
61  1 Y 1 A LYS 328 ? CE    ? A LYS 331 CE    
62  1 Y 1 A LYS 328 ? NZ    ? A LYS 331 NZ    
63  1 Y 1 A ARG 334 ? NE    ? A ARG 337 NE    
64  1 Y 1 A ARG 334 ? CZ    ? A ARG 337 CZ    
65  1 Y 1 A ARG 334 ? NH1   ? A ARG 337 NH1   
66  1 Y 1 A ARG 334 ? NH2   ? A ARG 337 NH2   
67  1 Y 1 A GLU 335 ? CG    ? A GLU 338 CG    
68  1 Y 1 A GLU 335 ? CD    ? A GLU 338 CD    
69  1 Y 1 A GLU 335 ? OE1   ? A GLU 338 OE1   
70  1 Y 1 A GLU 335 ? OE2   ? A GLU 338 OE2   
71  1 Y 1 A LYS 376 ? CB    ? A LYS 379 CB    
72  1 Y 1 A LYS 376 ? CG    ? A LYS 379 CG    
73  1 Y 1 A LYS 376 ? CD    ? A LYS 379 CD    
74  1 Y 1 A LYS 376 ? CE    ? A LYS 379 CE    
75  1 Y 1 A LYS 376 ? NZ    ? A LYS 379 NZ    
76  1 Y 1 A LEU 378 ? CG    ? A LEU 381 CG    
77  1 Y 1 A LEU 378 ? CD1   ? A LEU 381 CD1   
78  1 Y 1 A LEU 378 ? CD2   ? A LEU 381 CD2   
79  1 Y 1 A ILE 411 ? CG1   ? A ILE 414 CG1   
80  1 Y 1 A ILE 411 ? CG2   ? A ILE 414 CG2   
81  1 Y 1 A ILE 411 ? CD1   ? A ILE 414 CD1   
82  1 Y 1 A GLN 412 ? CB    ? A GLN 415 CB    
83  1 Y 1 A GLN 412 ? CG    ? A GLN 415 CG    
84  1 Y 1 A GLN 412 ? CD    ? A GLN 415 CD    
85  1 Y 1 A GLN 412 ? OE1   ? A GLN 415 OE1   
86  1 Y 1 A GLN 412 ? NE2   ? A GLN 415 NE2   
87  1 Y 1 A SER 416 ? OG    ? A SER 419 OG    
88  1 Y 1 T DC  1   ? "O5'" ? B DC  1   "O5'" 
89  1 Y 1 T DC  1   ? "C5'" ? B DC  1   "C5'" 
90  1 Y 1 T DC  1   ? "C4'" ? B DC  1   "C4'" 
91  1 Y 1 T DC  1   ? "O4'" ? B DC  1   "O4'" 
92  1 Y 1 T DC  1   ? "C3'" ? B DC  1   "C3'" 
93  1 Y 1 T DC  1   ? "C2'" ? B DC  1   "C2'" 
94  1 Y 1 T DC  1   ? "C1'" ? B DC  1   "C1'" 
95  1 Y 1 T DC  1   ? N1    ? B DC  1   N1    
96  1 Y 1 T DC  1   ? C2    ? B DC  1   C2    
97  1 Y 1 T DC  1   ? O2    ? B DC  1   O2    
98  1 Y 1 T DC  1   ? N3    ? B DC  1   N3    
99  1 Y 1 T DC  1   ? C4    ? B DC  1   C4    
100 1 Y 1 T DC  1   ? N4    ? B DC  1   N4    
101 1 Y 1 T DC  1   ? C5    ? B DC  1   C5    
102 1 Y 1 T DC  1   ? C6    ? B DC  1   C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 153 ? A GLY 156 
2 1 Y 1 A PRO 154 ? A PRO 157 
3 1 Y 1 A THR 155 ? A THR 158 
4 1 Y 1 A THR 156 ? A THR 159 
5 1 Y 1 A ALA 157 ? A ALA 160 
6 1 Y 1 A GLU 158 ? A GLU 161 
7 1 Y 1 A GLU 159 ? A GLU 162 
8 1 Y 1 A THR 160 ? A THR 163 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5EWE 'double helix'        
5EWE 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 0.230  -0.022 -0.153 -15.622 -5.160 1.804  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 0.042  -0.056 0.265  -2.705  -5.852 6.431  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.256 -0.102 -0.394 -7.535  -3.074 1.061  3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.102  -0.113 0.069  5.335   -0.696 2.631  4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.209  -0.034 -0.373 12.537  -4.240 2.485  5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.221 -0.112 -0.131 -0.864  -1.366 2.032  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.065  -0.131 0.072  -2.304  -1.634 -0.621 7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.175 -0.305 -0.203 13.778  -3.607 7.861  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 1.058  -0.943 3.125 -2.888 3.855 26.428 -2.941 -2.961 2.831 8.344 6.251   
26.856 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.425 -1.117 3.424 5.411  3.955 27.259 -3.246 2.166  3.093 8.234 -11.265 
28.056 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.487 -0.418 3.110 -2.997 0.745 34.882 -0.802 0.378  3.131 1.241 4.987   
35.015 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.619  -0.826 3.275 3.798  0.691 27.179 -1.914 -0.359 3.307 1.462 -8.031  
27.446 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.287 -0.578 3.741 -4.134 4.301 38.147 -1.480 -0.147 3.667 6.531 6.279   
38.593 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.228 -0.697 3.433 -0.935 1.369 35.931 -1.333 0.231  3.410 2.217 1.515   
35.968 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.392  -0.455 3.036 -0.066 1.752 24.812 -1.542 -0.928 2.996 4.070 0.153   
24.873 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of Environmental Health Sciences' 'United States' 'R01 ES010375' 1 
'National Institutes of Health/National Cancer Institute'                           'United States' 'P01 CA160032' 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "CYTIDINE-5'-TRIPHOSPHATE" CTP 
5 'CALCIUM ION'              CA  
6 GLYCEROL                   GOL 
7 water                      HOH 
#