data_5EWF
# 
_entry.id   5EWF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5EWF         
WWPDB D_1000215582 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5EWE PDB . 
unspecified 5EWG PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5EWF 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Su, Y.'           1 
'Egli, M.'         2 
'Guengerich, F.P.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            291 
_citation.language                  ? 
_citation.page_first                3747 
_citation.page_last                 3756 
_citation.title                     'Mechanism of Ribonucleotide Incorporation by Human DNA Polymerase eta.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M115.706226 
_citation.pdbx_database_id_PubMed   26740629 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Su, Y.'           1 ? 
primary 'Egli, M.'         2 ? 
primary 'Guengerich, F.P.' 3 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5EWF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     99.124 
_cell.length_a_esd                 ? 
_cell.length_b                     99.124 
_cell.length_b_esd                 ? 
_cell.length_c                     81.384 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5EWF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                     48617.707 1   2.7.7.7 ? 'UNP residues 1-432' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*(8OG)P*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3678.404  1   ?       ? ?                    ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ?                    ? 
4 non-polymer syn GLYCEROL                                                 92.094    1   ?       ? ?                    ? 
5 non-polymer syn 'CALCIUM ION'                                            40.078    1   ?       ? ?                    ? 
6 non-polymer syn "CYTIDINE-5'-TRIPHOSPHATE"                               483.156   1   ?       ? ?                    ? 
7 water       nat water                                                    18.015    387 ?       ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no yes '(DC)(DA)(DT)(8OG)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATGATGACGCT T ? 
3 polydeoxyribonucleotide no no  '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   8OG n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     866768 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'synthetic construct' ? 32630 ? 
3 1 sample 1 8  'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5EWF       5EWF   ? 2 ? 1 
3 PDB 5EWF       5EWF   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5EWF A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5EWF T 1 ? 12  ? 5EWF   1 ? 12  ? 1 12  
3 3 5EWF P 1 ? 8   ? 5EWF   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5EWF GLY A 1 ? UNP Q9Y253 ? ? 'expression tag' -2 1 
1 5EWF PRO A 2 ? UNP Q9Y253 ? ? 'expression tag' -1 2 
1 5EWF HIS A 3 ? UNP Q9Y253 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8OG 'DNA linking'       n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
'C10 H14 N5 O8 P'  363.221 
ALA 'L-peptide linking' y ALANINE                                     ?                                                       
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                                                       
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                                                       
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                                                       
'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                               ?                                                       
'Ca 2'             40.078  
CTP non-polymer         . "CYTIDINE-5'-TRIPHOSPHATE"                  ?                                                       
'C9 H16 N3 O14 P3' 483.156 
CYS 'L-peptide linking' y CYSTEINE                                    ?                                                       
'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ?                                                       
'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                ?                                                       
'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                                                       
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                                                       
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                                                       
'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL                                    'GLYCERIN; PROPANE-1,2,3-TRIOL'                         
'C3 H8 O3'         92.094  
HIS 'L-peptide linking' y HISTIDINE                                   ?                                                       
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                       ?                                                       
'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                                                       
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                                                       
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                                                       
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                                                       
'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                                                       
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                                                       
'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                      ?                                                       
'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                   ?                                                       
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ?                                                       
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                    ?                                                       
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                      ?                                                       
'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5EWF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.11 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         41.68 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'NaMES (pH 6.0), polyethylene glycol monomethyl ether 2000, and calcium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-31 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5EWF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.78 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       43104 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.8 
_reflns.pdbx_Rmerge_I_obs                0.115 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            18.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.78 
_reflns_shell.d_res_low                   1.81 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.9 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.229 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5EWF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.782 
_refine.ls_d_res_low                             42.922 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     43080 
_refine.ls_number_reflns_R_free                  2043 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.20 
_refine.ls_percent_reflns_R_free                 4.72 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1812 
_refine.ls_R_factor_R_free                       0.2158 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1795 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.12 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4O3P 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.50 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.19 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3234 
_refine_hist.pdbx_number_atoms_nucleic_acid   390 
_refine_hist.pdbx_number_atoms_ligand         36 
_refine_hist.number_atoms_solvent             387 
_refine_hist.number_atoms_total               4047 
_refine_hist.d_res_high                       1.782 
_refine_hist.d_res_low                        42.922 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 3921 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.146  ? 5435 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 17.062 ? 2328 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.057  ? 617  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 621  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.7818 1.8028  . . 160 2715 98.00  . . . 0.3040 . 0.2739 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8028 1.8247  . . 108 2796 99.00  . . . 0.3042 . 0.2672 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8247 1.8478  . . 128 2856 99.00  . . . 0.3279 . 0.2606 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8478 1.8721  . . 152 2713 100.00 . . . 0.2975 . 0.2523 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8721 1.8978  . . 146 2790 99.00  . . . 0.2585 . 0.2367 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8978 1.9249  . . 140 2798 100.00 . . . 0.2863 . 0.2257 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9249 1.9536  . . 156 2791 99.00  . . . 0.3004 . 0.2231 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9536 1.9842  . . 146 2791 100.00 . . . 0.2360 . 0.2056 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9842 2.0167  . . 158 2767 100.00 . . . 0.2393 . 0.2015 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0167 2.0515  . . 140 2791 100.00 . . . 0.2370 . 0.1965 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0515 2.0888  . . 162 2775 100.00 . . . 0.2260 . 0.1861 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0888 2.1289  . . 152 2805 100.00 . . . 0.2422 . 0.1819 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1289 2.1724  . . 122 2808 100.00 . . . 0.2555 . 0.1883 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1724 2.2196  . . 166 2785 100.00 . . . 0.2185 . 0.1850 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2196 2.2713  . . 142 2770 99.00  . . . 0.2240 . 0.1873 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2713 2.3281  . . 140 2823 100.00 . . . 0.2219 . 0.1783 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3281 2.3910  . . 120 2811 100.00 . . . 0.2822 . 0.1731 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3910 2.4614  . . 130 2801 100.00 . . . 0.2284 . 0.1847 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4614 2.5408  . . 106 2830 99.00  . . . 0.2158 . 0.1796 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5408 2.6316  . . 108 2776 99.00  . . . 0.2179 . 0.1848 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6316 2.7369  . . 146 2803 99.00  . . . 0.2609 . 0.1829 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7369 2.8615  . . 128 2811 99.00  . . . 0.2044 . 0.1831 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8615 3.0123  . . 118 2785 99.00  . . . 0.3072 . 0.1890 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0123 3.2010  . . 148 2795 99.00  . . . 0.2126 . 0.1793 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2010 3.4480  . . 140 2743 99.00  . . . 0.1934 . 0.1573 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4480 3.7948  . . 158 2753 99.00  . . . 0.2041 . 0.1484 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7948 4.3435  . . 116 2777 98.00  . . . 0.1484 . 0.1408 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3435 5.4706  . . 136 2751 98.00  . . . 0.1427 . 0.1562 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4706 42.9344 . . 129 2741 97.00  . . . 0.2005 . 0.1871 . . . . . . . . . . 
# 
_struct.entry_id                     5EWF 
_struct.title                        
'Ternary complex of human DNA polymerase eta inserting rCTP opposite an 8-Oxodeoxyguanosine Lesion' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5EWF 
_struct_keywords.text            'Polymerase-DNA Complex, ribonucleotide incorporation, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
I N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  AA6 LEU A 124 ? LEU A 135 ? LEU A 121 LEU A 132 1 ? 12 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? ASN A 233 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P11 AB2 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P12 AB3 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P13 AB4 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P14 AB5 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P15 AB6 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P16 AB7 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P17 AB8 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P18 AB9 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P19 AC1 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P20 AC2 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASP 16  OD1   ? ? ? 1_555 E CA  . CA  ? ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.344 ? 
metalc2  metalc ?    ? A MET 17  O     ? ? ? 1_555 E CA  . CA  ? ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.289 ? 
metalc3  metalc ?    ? A ASP 118 OD2   ? ? ? 1_555 E CA  . CA  ? ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.311 ? 
covale1  covale both ? B DT  3   "O3'" A ? ? 1_555 B 8OG 4 P   A ? T DT  3   T 8OG 4   1_555 ? ? ? ? ? ? ?            1.609 ? 
covale2  covale both ? B DT  3   "O3'" B ? ? 1_555 B 8OG 4 P   B ? T DT  3   T 8OG 4   1_555 ? ? ? ? ? ? ?            1.612 ? 
covale3  covale both ? B 8OG 4   "O3'" A ? ? 1_555 B DA  5 P   ? ? T 8OG 4   T DA  5   1_555 ? ? ? ? ? ? ?            1.600 ? 
covale4  covale both ? B 8OG 4   "O3'" B ? ? 1_555 B DA  5 P   ? ? T 8OG 4   T DA  5   1_555 ? ? ? ? ? ? ?            1.604 ? 
metalc4  metalc ?    ? E CA  .   CA    ? ? ? 1_555 F CTP . O1G ? ? A CA  502 T CTP 101 1_555 ? ? ? ? ? ? ?            2.288 ? 
metalc5  metalc ?    ? E CA  .   CA    ? ? ? 1_555 F CTP . O1A ? ? A CA  502 T CTP 101 1_555 ? ? ? ? ? ? ?            2.350 ? 
metalc6  metalc ?    ? E CA  .   CA    ? ? ? 1_555 F CTP . O1B ? ? A CA  502 T CTP 101 1_555 ? ? ? ? ? ? ?            2.284 ? 
hydrog1  hydrog ?    ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 -0.33 
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -2.24 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -2.75 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? ARG A 114 ? ILE A 109 ARG A 111 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA5 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
AA1 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA4 2 3 O LEU A 422 ? O LEU A 419 N LEU A 334 ? N LEU A 331 
AA5 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GOL 501 ? 10 'binding site for residue GOL A 501' 
AC2 Software A CA  502 ? 4  'binding site for residue CA A 502'  
AC3 Software T CTP 101 ? 27 'binding site for residue CTP T 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ARG A 27  ? ARG A 24  . ? 6_545 ? 
2  AC1 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
3  AC1 10 PHE A 250 ? PHE A 247 . ? 1_555 ? 
4  AC1 10 SER A 251 ? SER A 248 . ? 1_555 ? 
5  AC1 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
6  AC1 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
7  AC1 10 HOH G .   ? HOH A 666 . ? 1_555 ? 
8  AC1 10 HOH G .   ? HOH A 682 . ? 1_555 ? 
9  AC1 10 HOH G .   ? HOH A 695 . ? 1_555 ? 
10 AC1 10 HOH G .   ? HOH A 733 . ? 1_555 ? 
11 AC2 4  ASP A 16  ? ASP A 13  . ? 1_555 ? 
12 AC2 4  MET A 17  ? MET A 14  . ? 1_555 ? 
13 AC2 4  ASP A 118 ? ASP A 115 . ? 1_555 ? 
14 AC2 4  CTP F .   ? CTP T 101 . ? 1_555 ? 
15 AC3 27 ASP A 16  ? ASP A 13  . ? 1_555 ? 
16 AC3 27 MET A 17  ? MET A 14  . ? 1_555 ? 
17 AC3 27 ASP A 18  ? ASP A 15  . ? 1_555 ? 
18 AC3 27 CYS A 19  ? CYS A 16  . ? 1_555 ? 
19 AC3 27 PHE A 20  ? PHE A 17  . ? 1_555 ? 
20 AC3 27 PHE A 21  ? PHE A 18  . ? 1_555 ? 
21 AC3 27 ILE A 51  ? ILE A 48  . ? 1_555 ? 
22 AC3 27 TYR A 55  ? TYR A 52  . ? 1_555 ? 
23 AC3 27 ARG A 58  ? ARG A 55  . ? 1_555 ? 
24 AC3 27 ARG A 64  ? ARG A 61  . ? 1_555 ? 
25 AC3 27 ASP A 118 ? ASP A 115 . ? 1_555 ? 
26 AC3 27 LYS A 234 ? LYS A 231 . ? 1_555 ? 
27 AC3 27 CA  E .   ? CA  A 502 . ? 1_555 ? 
28 AC3 27 HOH G .   ? HOH A 694 . ? 1_555 ? 
29 AC3 27 HOH G .   ? HOH A 710 . ? 1_555 ? 
30 AC3 27 DT  C 8   ? DT  P 8   . ? 1_555 ? 
31 AC3 27 DT  B 3   ? DT  T 3   . ? 1_555 ? 
32 AC3 27 8OG B 4   ? 8OG T 4   . ? 1_555 ? 
33 AC3 27 DA  B 5   ? DA  T 5   . ? 1_555 ? 
34 AC3 27 HOH H .   ? HOH T 208 . ? 1_555 ? 
35 AC3 27 HOH H .   ? HOH T 210 . ? 1_555 ? 
36 AC3 27 HOH H .   ? HOH T 211 . ? 1_555 ? 
37 AC3 27 HOH H .   ? HOH T 213 . ? 1_555 ? 
38 AC3 27 HOH H .   ? HOH T 219 . ? 1_555 ? 
39 AC3 27 HOH H .   ? HOH T 224 . ? 1_555 ? 
40 AC3 27 HOH H .   ? HOH T 231 . ? 1_555 ? 
41 AC3 27 HOH H .   ? HOH T 233 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5EWF 
_atom_sites.fract_transf_matrix[1][1]   0.010088 
_atom_sites.fract_transf_matrix[1][2]   0.005825 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011649 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012287 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 52.246  11.224 -1.646  1.00 53.82 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 53.380  10.392 -1.282  1.00 50.81 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 54.454  10.378 -2.351  1.00 53.69 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 55.440  11.116 -2.255  1.00 52.68 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 54.273  9.534  -3.374  1.00 59.29 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 55.192  9.561  -4.526  1.00 52.08 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 55.077  10.825 -5.366  1.00 59.53 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 55.906  11.029 -6.267  1.00 54.10 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 54.786  8.318  -5.333  1.00 57.15 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 53.362  8.038  -4.922  1.00 50.31 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 53.267  8.460  -3.482  1.00 53.74 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 54.086  11.675 -5.096  1.00 48.22 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 53.874  12.913 -5.835  1.00 51.21 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 54.163  14.149 -4.995  1.00 49.02 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 53.797  15.259 -5.395  1.00 51.87 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 52.439  12.955 -6.369  1.00 39.89 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 52.011  11.676 -7.012  1.00 38.95 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 52.617  11.176 -8.146  1.00 38.60 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 51.054  10.781 -6.670  1.00 40.34 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 52.040  10.036 -8.483  1.00 34.43 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 51.089  9.774  -7.604  1.00 37.68 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 54.804  13.985 -3.841  1.00 49.08 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 55.078  15.096 -2.937  1.00 54.38 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 56.481  15.618 -3.224  1.00 47.70 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 57.474  14.959 -2.896  1.00 45.98 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 54.938  14.655 -1.482  1.00 48.14 ? 1   MET A CB    1 
ATOM   27   N  N     . ALA A 1 5   ? 56.562  16.790 -3.849  1.00 50.48 ? 2   ALA A N     1 
ATOM   28   C  CA    . ALA A 1 5   ? 57.856  17.411 -4.101  1.00 48.43 ? 2   ALA A CA    1 
ATOM   29   C  C     . ALA A 1 5   ? 58.545  17.741 -2.782  1.00 41.55 ? 2   ALA A C     1 
ATOM   30   O  O     . ALA A 1 5   ? 57.908  18.191 -1.824  1.00 38.85 ? 2   ALA A O     1 
ATOM   31   C  CB    . ALA A 1 5   ? 57.692  18.673 -4.952  1.00 47.73 ? 2   ALA A CB    1 
ATOM   32   N  N     . THR A 1 6   ? 59.856  17.499 -2.730  1.00 35.08 ? 3   THR A N     1 
ATOM   33   C  CA    . THR A 1 6   ? 60.622  17.656 -1.502  1.00 32.02 ? 3   THR A CA    1 
ATOM   34   C  C     . THR A 1 6   ? 61.611  18.811 -1.549  1.00 28.69 ? 3   THR A C     1 
ATOM   35   O  O     . THR A 1 6   ? 62.364  18.991 -0.591  1.00 26.06 ? 3   THR A O     1 
ATOM   36   C  CB    . THR A 1 6   ? 61.379  16.369 -1.171  1.00 31.87 ? 3   THR A CB    1 
ATOM   37   O  OG1   . THR A 1 6   ? 62.323  16.087 -2.214  1.00 28.22 ? 3   THR A OG1   1 
ATOM   38   C  CG2   . THR A 1 6   ? 60.397  15.189 -1.013  1.00 34.74 ? 3   THR A CG2   1 
ATOM   39   N  N     . GLY A 1 7   ? 61.637  19.587 -2.626  1.00 24.40 ? 4   GLY A N     1 
ATOM   40   C  CA    . GLY A 1 7   ? 62.503  20.761 -2.656  1.00 25.09 ? 4   GLY A CA    1 
ATOM   41   C  C     . GLY A 1 7   ? 63.978  20.435 -2.574  1.00 28.09 ? 4   GLY A C     1 
ATOM   42   O  O     . GLY A 1 7   ? 64.736  21.151 -1.901  1.00 24.35 ? 4   GLY A O     1 
ATOM   43   N  N     . GLN A 1 8   ? 64.407  19.366 -3.254  1.00 19.12 ? 5   GLN A N     1 
ATOM   44   C  CA    . GLN A 1 8   ? 65.799  18.917 -3.243  1.00 19.21 ? 5   GLN A CA    1 
ATOM   45   C  C     . GLN A 1 8   ? 66.443  18.976 -4.630  1.00 19.13 ? 5   GLN A C     1 
ATOM   46   O  O     . GLN A 1 8   ? 67.452  18.307 -4.878  1.00 26.82 ? 5   GLN A O     1 
ATOM   47   C  CB    . GLN A 1 8   ? 65.886  17.501 -2.668  1.00 22.04 ? 5   GLN A CB    1 
ATOM   48   C  CG    . GLN A 1 8   ? 65.605  17.423 -1.168  1.00 25.42 ? 5   GLN A CG    1 
ATOM   49   C  CD    . GLN A 1 8   ? 65.590  15.988 -0.633  1.00 21.65 ? 5   GLN A CD    1 
ATOM   50   O  OE1   . GLN A 1 8   ? 66.502  15.561 0.062   1.00 26.23 ? 5   GLN A OE1   1 
ATOM   51   N  NE2   . GLN A 1 8   ? 64.546  15.255 -0.956  1.00 23.44 ? 5   GLN A NE2   1 
ATOM   52   N  N     . ASP A 1 9   ? 65.893  19.798 -5.521  1.00 24.06 ? 6   ASP A N     1 
ATOM   53   C  CA    . ASP A 1 9   ? 66.270  19.854 -6.926  1.00 22.77 ? 6   ASP A CA    1 
ATOM   54   C  C     . ASP A 1 9   ? 67.563  20.622 -7.183  1.00 28.78 ? 6   ASP A C     1 
ATOM   55   O  O     . ASP A 1 9   ? 68.206  20.396 -8.213  1.00 29.37 ? 6   ASP A O     1 
ATOM   56   C  CB    . ASP A 1 9   ? 65.137  20.516 -7.720  1.00 31.96 ? 6   ASP A CB    1 
ATOM   57   C  CG    . ASP A 1 9   ? 64.638  21.807 -7.064  1.00 39.14 ? 6   ASP A CG    1 
ATOM   58   O  OD1   . ASP A 1 9   ? 64.285  21.790 -5.856  1.00 37.28 ? 6   ASP A OD1   1 
ATOM   59   O  OD2   . ASP A 1 9   ? 64.608  22.856 -7.749  1.00 44.69 ? 6   ASP A OD2   1 
ATOM   60   N  N     . ARG A 1 10  ? 67.947  21.527 -6.291  1.00 21.39 ? 7   ARG A N     1 
ATOM   61   C  CA    . ARG A 1 10  ? 69.076  22.413 -6.512  1.00 19.98 ? 7   ARG A CA    1 
ATOM   62   C  C     . ARG A 1 10  ? 70.078  22.292 -5.374  1.00 20.94 ? 7   ARG A C     1 
ATOM   63   O  O     . ARG A 1 10  ? 69.738  21.881 -4.263  1.00 17.41 ? 7   ARG A O     1 
ATOM   64   C  CB    . ARG A 1 10  ? 68.631  23.880 -6.582  1.00 18.61 ? 7   ARG A CB    1 
ATOM   65   C  CG    . ARG A 1 10  ? 67.645  24.253 -7.681  1.00 21.57 ? 7   ARG A CG    1 
ATOM   66   C  CD    . ARG A 1 10  ? 67.257  25.739 -7.502  1.00 18.90 ? 7   ARG A CD    1 
ATOM   67   N  NE    . ARG A 1 10  ? 66.344  25.933 -6.374  1.00 22.77 ? 7   ARG A NE    1 
ATOM   68   C  CZ    . ARG A 1 10  ? 66.176  27.084 -5.724  1.00 18.63 ? 7   ARG A CZ    1 
ATOM   69   N  NH1   . ARG A 1 10  ? 66.856  28.164 -6.099  1.00 23.50 ? 7   ARG A NH1   1 
ATOM   70   N  NH2   . ARG A 1 10  ? 65.316  27.166 -4.716  1.00 21.84 ? 7   ARG A NH2   1 
ATOM   71   N  N     . VAL A 1 11  ? 71.311  22.703 -5.655  1.00 15.69 ? 8   VAL A N     1 
ATOM   72   C  CA    . VAL A 1 11  ? 72.328  22.927 -4.630  1.00 12.06 ? 8   VAL A CA    1 
ATOM   73   C  C     . VAL A 1 11  ? 72.609  24.422 -4.641  1.00 20.87 ? 8   VAL A C     1 
ATOM   74   O  O     . VAL A 1 11  ? 72.993  24.969 -5.679  1.00 16.05 ? 8   VAL A O     1 
ATOM   75   C  CB    . VAL A 1 11  ? 73.607  22.120 -4.894  1.00 16.39 ? 8   VAL A CB    1 
ATOM   76   C  CG1   . VAL A 1 11  ? 74.668  22.419 -3.804  1.00 16.40 ? 8   VAL A CG1   1 
ATOM   77   C  CG2   . VAL A 1 11  ? 73.301  20.598 -4.968  1.00 18.88 ? 8   VAL A CG2   1 
ATOM   78   N  N     . VAL A 1 12  ? 72.386  25.084 -3.508  1.00 17.55 ? 9   VAL A N     1 
ATOM   79   C  CA    . VAL A 1 12  ? 72.521  26.537 -3.402  1.00 17.08 ? 9   VAL A CA    1 
ATOM   80   C  C     . VAL A 1 12  ? 73.473  26.832 -2.244  1.00 21.18 ? 9   VAL A C     1 
ATOM   81   O  O     . VAL A 1 12  ? 73.340  26.248 -1.162  1.00 15.60 ? 9   VAL A O     1 
ATOM   82   C  CB    . VAL A 1 12  ? 71.155  27.224 -3.181  1.00 14.09 ? 9   VAL A CB    1 
ATOM   83   C  CG1   . VAL A 1 12  ? 71.310  28.724 -2.965  1.00 18.26 ? 9   VAL A CG1   1 
ATOM   84   C  CG2   . VAL A 1 12  ? 70.209  26.978 -4.373  1.00 17.80 ? 9   VAL A CG2   1 
ATOM   85   N  N     . ALA A 1 13  ? 74.435  27.732 -2.462  1.00 16.63 ? 10  ALA A N     1 
ATOM   86   C  CA    . ALA A 1 13  ? 75.247  28.192 -1.350  1.00 14.50 ? 10  ALA A CA    1 
ATOM   87   C  C     . ALA A 1 13  ? 75.044  29.689 -1.131  1.00 17.78 ? 10  ALA A C     1 
ATOM   88   O  O     . ALA A 1 13  ? 74.662  30.431 -2.043  1.00 15.04 ? 10  ALA A O     1 
ATOM   89   C  CB    . ALA A 1 13  ? 76.736  27.869 -1.564  1.00 14.74 ? 10  ALA A CB    1 
ATOM   90   N  N     . LEU A 1 14  ? 75.294  30.130 0.101   1.00 12.31 ? 11  LEU A N     1 
ATOM   91   C  CA    . LEU A 1 14  ? 75.380  31.553 0.428   1.00 12.92 ? 11  LEU A CA    1 
ATOM   92   C  C     . LEU A 1 14  ? 76.739  31.809 1.072   1.00 18.37 ? 11  LEU A C     1 
ATOM   93   O  O     . LEU A 1 14  ? 77.072  31.182 2.082   1.00 14.21 ? 11  LEU A O     1 
ATOM   94   C  CB    . LEU A 1 14  ? 74.235  31.961 1.350   1.00 16.71 ? 11  LEU A CB    1 
ATOM   95   C  CG    . LEU A 1 14  ? 74.022  33.410 1.789   1.00 18.71 ? 11  LEU A CG    1 
ATOM   96   C  CD1   . LEU A 1 14  ? 74.820  33.737 3.061   1.00 17.53 ? 11  LEU A CD1   1 
ATOM   97   C  CD2   . LEU A 1 14  ? 74.334  34.420 0.650   1.00 17.03 ? 11  LEU A CD2   1 
ATOM   98   N  N     . VAL A 1 15  ? 77.523  32.722 0.488   1.00 12.34 ? 12  VAL A N     1 
ATOM   99   C  CA    . VAL A 1 15  ? 78.853  33.064 0.995   1.00 15.81 ? 12  VAL A CA    1 
ATOM   100  C  C     . VAL A 1 15  ? 78.767  34.443 1.622   1.00 15.93 ? 12  VAL A C     1 
ATOM   101  O  O     . VAL A 1 15  ? 78.213  35.365 1.017   1.00 15.54 ? 12  VAL A O     1 
ATOM   102  C  CB    . VAL A 1 15  ? 79.926  33.028 -0.106  1.00 19.79 ? 12  VAL A CB    1 
ATOM   103  C  CG1   . VAL A 1 15  ? 81.288  33.470 0.468   1.00 20.55 ? 12  VAL A CG1   1 
ATOM   104  C  CG2   . VAL A 1 15  ? 80.014  31.645 -0.704  1.00 21.69 ? 12  VAL A CG2   1 
ATOM   105  N  N     . ASP A 1 16  ? 79.299  34.575 2.840   1.00 12.70 ? 13  ASP A N     1 
ATOM   106  C  CA    . ASP A 1 16  ? 79.147  35.781 3.637   1.00 15.82 ? 13  ASP A CA    1 
ATOM   107  C  C     . ASP A 1 16  ? 80.511  36.115 4.226   1.00 12.46 ? 13  ASP A C     1 
ATOM   108  O  O     . ASP A 1 16  ? 81.040  35.342 5.021   1.00 15.55 ? 13  ASP A O     1 
ATOM   109  C  CB    . ASP A 1 16  ? 78.107  35.561 4.749   1.00 16.17 ? 13  ASP A CB    1 
ATOM   110  C  CG    . ASP A 1 16  ? 77.679  36.840 5.422   1.00 26.41 ? 13  ASP A CG    1 
ATOM   111  O  OD1   . ASP A 1 16  ? 78.488  37.759 5.491   1.00 22.03 ? 13  ASP A OD1   1 
ATOM   112  O  OD2   . ASP A 1 16  ? 76.512  36.935 5.877   1.00 31.46 ? 13  ASP A OD2   1 
ATOM   113  N  N     . MET A 1 17  ? 81.077  37.262 3.864   1.00 15.60 ? 14  MET A N     1 
ATOM   114  C  CA    . MET A 1 17  ? 82.402  37.586 4.386   1.00 15.04 ? 14  MET A CA    1 
ATOM   115  C  C     . MET A 1 17  ? 82.330  37.856 5.886   1.00 12.68 ? 14  MET A C     1 
ATOM   116  O  O     . MET A 1 17  ? 81.407  38.507 6.370   1.00 16.86 ? 14  MET A O     1 
ATOM   117  C  CB    . MET A 1 17  ? 82.985  38.805 3.667   1.00 17.85 ? 14  MET A CB    1 
ATOM   118  C  CG    . MET A 1 17  ? 82.928  38.706 2.146   1.00 17.06 ? 14  MET A CG    1 
ATOM   119  S  SD    . MET A 1 17  ? 83.814  37.302 1.492   1.00 19.42 ? 14  MET A SD    1 
ATOM   120  C  CE    . MET A 1 17  ? 85.450  37.647 2.107   1.00 18.29 ? 14  MET A CE    1 
ATOM   121  N  N     . ASP A 1 18  ? 83.320  37.350 6.628   1.00 13.13 ? 15  ASP A N     1 
ATOM   122  C  CA    . ASP A 1 18  ? 83.384  37.599 8.065   1.00 14.01 ? 15  ASP A CA    1 
ATOM   123  C  C     . ASP A 1 18  ? 83.866  39.022 8.319   1.00 15.02 ? 15  ASP A C     1 
ATOM   124  O  O     . ASP A 1 18  ? 84.799  39.477 7.658   1.00 15.17 ? 15  ASP A O     1 
ATOM   125  C  CB    . ASP A 1 18  ? 84.344  36.606 8.721   1.00 14.89 ? 15  ASP A CB    1 
ATOM   126  C  CG    . ASP A 1 18  ? 83.893  35.165 8.549   1.00 16.00 ? 15  ASP A CG    1 
ATOM   127  O  OD1   . ASP A 1 18  ? 82.679  34.926 8.630   1.00 15.44 ? 15  ASP A OD1   1 
ATOM   128  O  OD2   . ASP A 1 18  ? 84.750  34.277 8.378   1.00 18.00 ? 15  ASP A OD2   1 
ATOM   129  N  N     . CYS A 1 19  ? 83.239  39.703 9.293   1.00 13.29 ? 16  CYS A N     1 
ATOM   130  C  CA    . CYS A 1 19  ? 83.495  41.106 9.659   1.00 15.17 ? 16  CYS A CA    1 
ATOM   131  C  C     . CYS A 1 19  ? 84.202  41.873 8.541   1.00 16.37 ? 16  CYS A C     1 
ATOM   132  O  O     . CYS A 1 19  ? 85.371  42.262 8.655   1.00 16.23 ? 16  CYS A O     1 
ATOM   133  C  CB    . CYS A 1 19  ? 84.290  41.187 10.966  1.00 16.62 ? 16  CYS A CB    1 
ATOM   134  S  SG    . CYS A 1 19  ? 85.779  40.164 11.041  1.00 22.06 ? 16  CYS A SG    1 
ATOM   135  N  N     . PHE A 1 20  ? 83.478  42.071 7.446   1.00 12.58 ? 17  PHE A N     1 
ATOM   136  C  CA    . PHE A 1 20  ? 84.105  42.346 6.160   1.00 15.16 ? 17  PHE A CA    1 
ATOM   137  C  C     . PHE A 1 20  ? 84.947  43.617 6.194   1.00 13.61 ? 17  PHE A C     1 
ATOM   138  O  O     . PHE A 1 20  ? 86.125  43.588 5.828   1.00 13.58 ? 17  PHE A O     1 
ATOM   139  C  CB    . PHE A 1 20  ? 83.042  42.453 5.069   1.00 13.20 ? 17  PHE A CB    1 
ATOM   140  C  CG    . PHE A 1 20  ? 83.617  42.692 3.712   1.00 15.78 ? 17  PHE A CG    1 
ATOM   141  C  CD1   . PHE A 1 20  ? 84.641  41.893 3.243   1.00 18.02 ? 17  PHE A CD1   1 
ATOM   142  C  CD2   . PHE A 1 20  ? 83.156  43.729 2.917   1.00 18.90 ? 17  PHE A CD2   1 
ATOM   143  C  CE1   . PHE A 1 20  ? 85.199  42.116 1.992   1.00 21.25 ? 17  PHE A CE1   1 
ATOM   144  C  CE2   . PHE A 1 20  ? 83.714  43.949 1.653   1.00 20.40 ? 17  PHE A CE2   1 
ATOM   145  C  CZ    . PHE A 1 20  ? 84.725  43.146 1.203   1.00 18.33 ? 17  PHE A CZ    1 
ATOM   146  N  N     . PHE A 1 21  ? 84.353  44.744 6.610   1.00 11.97 ? 18  PHE A N     1 
ATOM   147  C  CA    . PHE A 1 21  ? 85.088  46.016 6.597   1.00 12.57 ? 18  PHE A CA    1 
ATOM   148  C  C     . PHE A 1 21  ? 86.324  45.925 7.482   1.00 13.31 ? 18  PHE A C     1 
ATOM   149  O  O     . PHE A 1 21  ? 87.374  46.510 7.175   1.00 12.49 ? 18  PHE A O     1 
ATOM   150  C  CB    . PHE A 1 21  ? 84.207  47.178 7.067   1.00 12.92 ? 18  PHE A CB    1 
ATOM   151  C  CG    . PHE A 1 21  ? 83.185  47.651 6.062   1.00 16.64 ? 18  PHE A CG    1 
ATOM   152  C  CD1   . PHE A 1 21  ? 82.766  46.852 5.025   1.00 17.83 ? 18  PHE A CD1   1 
ATOM   153  C  CD2   . PHE A 1 21  ? 82.626  48.922 6.195   1.00 14.08 ? 18  PHE A CD2   1 
ATOM   154  C  CE1   . PHE A 1 21  ? 81.805  47.299 4.123   1.00 20.17 ? 18  PHE A CE1   1 
ATOM   155  C  CE2   . PHE A 1 21  ? 81.687  49.382 5.287   1.00 16.61 ? 18  PHE A CE2   1 
ATOM   156  C  CZ    . PHE A 1 21  ? 81.264  48.552 4.259   1.00 19.78 ? 18  PHE A CZ    1 
ATOM   157  N  N     . VAL A 1 22  ? 86.211  45.204 8.598   1.00 13.65 ? 19  VAL A N     1 
ATOM   158  C  CA    . VAL A 1 22  ? 87.363  44.982 9.466   1.00 13.42 ? 19  VAL A CA    1 
ATOM   159  C  C     . VAL A 1 22  ? 88.459  44.212 8.728   1.00 17.31 ? 19  VAL A C     1 
ATOM   160  O  O     . VAL A 1 22  ? 89.636  44.585 8.779   1.00 13.26 ? 19  VAL A O     1 
ATOM   161  C  CB    . VAL A 1 22  ? 86.924  44.264 10.752  1.00 15.65 ? 19  VAL A CB    1 
ATOM   162  C  CG1   . VAL A 1 22  ? 88.140  43.720 11.506  1.00 15.09 ? 19  VAL A CG1   1 
ATOM   163  C  CG2   . VAL A 1 22  ? 86.127  45.219 11.632  1.00 16.62 ? 19  VAL A CG2   1 
ATOM   164  N  N     . GLN A 1 23  ? 88.099  43.139 8.010   1.00 11.87 ? 20  GLN A N     1 
ATOM   165  C  CA    . GLN A 1 23  ? 89.138  42.408 7.280   1.00 16.22 ? 20  GLN A CA    1 
ATOM   166  C  C     . GLN A 1 23  ? 89.806  43.297 6.230   1.00 15.26 ? 20  GLN A C     1 
ATOM   167  O  O     . GLN A 1 23  ? 91.015  43.181 5.989   1.00 14.60 ? 20  GLN A O     1 
ATOM   168  C  CB    . GLN A 1 23  ? 88.556  41.166 6.600   1.00 14.10 ? 20  GLN A CB    1 
ATOM   169  C  CG    . GLN A 1 23  ? 88.262  40.020 7.525   1.00 16.96 ? 20  GLN A CG    1 
ATOM   170  C  CD    . GLN A 1 23  ? 88.127  38.746 6.744   1.00 14.77 ? 20  GLN A CD    1 
ATOM   171  O  OE1   . GLN A 1 23  ? 89.125  38.075 6.459   1.00 17.65 ? 20  GLN A OE1   1 
ATOM   172  N  NE2   . GLN A 1 23  ? 86.888  38.410 6.357   1.00 15.25 ? 20  GLN A NE2   1 
ATOM   173  N  N     . VAL A 1 24  ? 89.029  44.174 5.582   1.00 9.60  ? 21  VAL A N     1 
ATOM   174  C  CA    . VAL A 1 24  ? 89.607  45.071 4.572   1.00 11.01 ? 21  VAL A CA    1 
ATOM   175  C  C     . VAL A 1 24  ? 90.642  45.979 5.224   1.00 15.54 ? 21  VAL A C     1 
ATOM   176  O  O     . VAL A 1 24  ? 91.768  46.143 4.723   1.00 13.34 ? 21  VAL A O     1 
ATOM   177  C  CB    . VAL A 1 24  ? 88.500  45.881 3.863   1.00 12.85 ? 21  VAL A CB    1 
ATOM   178  C  CG1   . VAL A 1 24  ? 89.112  46.929 2.900   1.00 15.65 ? 21  VAL A CG1   1 
ATOM   179  C  CG2   . VAL A 1 24  ? 87.571  44.945 3.071   1.00 15.71 ? 21  VAL A CG2   1 
ATOM   180  N  N     . GLU A 1 25  ? 90.289  46.556 6.376   1.00 12.78 ? 22  GLU A N     1 
ATOM   181  C  CA    . GLU A 1 25  ? 91.217  47.451 7.062   1.00 16.07 ? 22  GLU A CA    1 
ATOM   182  C  C     . GLU A 1 25  ? 92.398  46.690 7.652   1.00 14.94 ? 22  GLU A C     1 
ATOM   183  O  O     . GLU A 1 25  ? 93.507  47.237 7.711   1.00 15.32 ? 22  GLU A O     1 
ATOM   184  C  CB    . GLU A 1 25  ? 90.485  48.236 8.152   1.00 12.29 ? 22  GLU A CB    1 
ATOM   185  C  CG    . GLU A 1 25  ? 89.394  49.158 7.590   1.00 12.35 ? 22  GLU A CG    1 
ATOM   186  C  CD    . GLU A 1 25  ? 89.950  50.298 6.745   1.00 18.40 ? 22  GLU A CD    1 
ATOM   187  O  OE1   . GLU A 1 25  ? 91.125  50.686 6.938   1.00 21.30 ? 22  GLU A OE1   1 
ATOM   188  O  OE2   . GLU A 1 25  ? 89.207  50.826 5.893   1.00 19.41 ? 22  GLU A OE2   1 
ATOM   189  N  N     . GLN A 1 26  ? 92.181  45.436 8.080   1.00 14.88 ? 23  GLN A N     1 
ATOM   190  C  CA    . GLN A 1 26  ? 93.269  44.634 8.648   1.00 13.17 ? 23  GLN A CA    1 
ATOM   191  C  C     . GLN A 1 26  ? 94.247  44.172 7.582   1.00 14.08 ? 23  GLN A C     1 
ATOM   192  O  O     . GLN A 1 26  ? 95.458  44.086 7.838   1.00 14.91 ? 23  GLN A O     1 
ATOM   193  C  CB    . GLN A 1 26  ? 92.726  43.412 9.378   1.00 12.80 ? 23  GLN A CB    1 
ATOM   194  C  CG    . GLN A 1 26  ? 92.111  43.745 10.708  1.00 17.22 ? 23  GLN A CG    1 
ATOM   195  C  CD    . GLN A 1 26  ? 91.465  42.529 11.338  1.00 16.40 ? 23  GLN A CD    1 
ATOM   196  O  OE1   . GLN A 1 26  ? 90.860  41.695 10.638  1.00 17.58 ? 23  GLN A OE1   1 
ATOM   197  N  NE2   . GLN A 1 26  ? 91.609  42.400 12.658  1.00 17.76 ? 23  GLN A NE2   1 
ATOM   198  N  N     . ARG A 1 27  ? 93.749  43.857 6.389   1.00 14.48 ? 24  ARG A N     1 
ATOM   199  C  CA    . ARG A 1 27  ? 94.661  43.561 5.296   1.00 15.98 ? 24  ARG A CA    1 
ATOM   200  C  C     . ARG A 1 27  ? 95.560  44.759 5.022   1.00 14.97 ? 24  ARG A C     1 
ATOM   201  O  O     . ARG A 1 27  ? 96.776  44.611 4.879   1.00 15.54 ? 24  ARG A O     1 
ATOM   202  C  CB    . ARG A 1 27  ? 93.880  43.176 4.040   1.00 12.83 ? 24  ARG A CB    1 
ATOM   203  C  CG    . ARG A 1 27  ? 94.786  42.774 2.875   1.00 17.47 ? 24  ARG A CG    1 
ATOM   204  C  CD    . ARG A 1 27  ? 93.992  42.282 1.665   1.00 15.10 ? 24  ARG A CD    1 
ATOM   205  N  NE    . ARG A 1 27  ? 93.314  43.381 0.970   1.00 18.43 ? 24  ARG A NE    1 
ATOM   206  C  CZ    . ARG A 1 27  ? 92.705  43.258 -0.197  1.00 15.80 ? 24  ARG A CZ    1 
ATOM   207  N  NH1   . ARG A 1 27  ? 92.686  42.071 -0.824  1.00 12.75 ? 24  ARG A NH1   1 
ATOM   208  N  NH2   . ARG A 1 27  ? 92.113  44.326 -0.739  1.00 15.44 ? 24  ARG A NH2   1 
ATOM   209  N  N     . GLN A 1 28  ? 94.973  45.955 4.997   1.00 13.25 ? 25  GLN A N     1 
ATOM   210  C  CA    . GLN A 1 28  ? 95.717  47.157 4.636   1.00 15.23 ? 25  GLN A CA    1 
ATOM   211  C  C     . GLN A 1 28  ? 96.688  47.571 5.732   1.00 13.55 ? 25  GLN A C     1 
ATOM   212  O  O     . GLN A 1 28  ? 97.798  48.042 5.433   1.00 14.34 ? 25  GLN A O     1 
ATOM   213  C  CB    . GLN A 1 28  ? 94.747  48.294 4.347   1.00 14.45 ? 25  GLN A CB    1 
ATOM   214  C  CG    . GLN A 1 28  ? 95.401  49.603 3.964   1.00 16.88 ? 25  GLN A CG    1 
ATOM   215  C  CD    . GLN A 1 28  ? 94.354  50.709 3.878   1.00 25.52 ? 25  GLN A CD    1 
ATOM   216  O  OE1   . GLN A 1 28  ? 93.302  50.517 3.273   1.00 24.33 ? 25  GLN A OE1   1 
ATOM   217  N  NE2   . GLN A 1 28  ? 94.624  51.844 4.504   1.00 28.22 ? 25  GLN A NE2   1 
ATOM   218  N  N     . ASN A 1 29  ? 96.295  47.412 6.996   1.00 12.38 ? 26  ASN A N     1 
ATOM   219  C  CA    . ASN A 1 29  ? 97.109  47.831 8.141   1.00 18.39 ? 26  ASN A CA    1 
ATOM   220  C  C     . ASN A 1 29  ? 97.415  46.645 9.037   1.00 16.78 ? 26  ASN A C     1 
ATOM   221  O  O     . ASN A 1 29  ? 96.606  46.303 9.923   1.00 16.57 ? 26  ASN A O     1 
ATOM   222  C  CB    . ASN A 1 29  ? 96.408  48.926 8.950   1.00 20.42 ? 26  ASN A CB    1 
ATOM   223  C  CG    . ASN A 1 29  ? 97.278  49.450 10.116  1.00 19.72 ? 26  ASN A CG    1 
ATOM   224  O  OD1   . ASN A 1 29  ? 98.335  48.895 10.429  1.00 19.15 ? 26  ASN A OD1   1 
ATOM   225  N  ND2   . ASN A 1 29  ? 96.826  50.528 10.752  1.00 21.50 ? 26  ASN A ND2   1 
ATOM   226  N  N     . PRO A 1 30  ? 98.574  46.003 8.872   1.00 15.71 ? 27  PRO A N     1 
ATOM   227  C  CA    . PRO A 1 30  ? 98.883  44.800 9.671   1.00 16.11 ? 27  PRO A CA    1 
ATOM   228  C  C     . PRO A 1 30  ? 98.836  45.003 11.183  1.00 18.23 ? 27  PRO A C     1 
ATOM   229  O  O     . PRO A 1 30  ? 98.637  44.019 11.909  1.00 18.85 ? 27  PRO A O     1 
ATOM   230  C  CB    . PRO A 1 30  ? 100.305 44.431 9.210   1.00 18.51 ? 27  PRO A CB    1 
ATOM   231  C  CG    . PRO A 1 30  ? 100.404 45.002 7.834   1.00 22.37 ? 27  PRO A CG    1 
ATOM   232  C  CD    . PRO A 1 30  ? 99.562  46.250 7.810   1.00 16.08 ? 27  PRO A CD    1 
ATOM   233  N  N     . HIS A 1 31  ? 99.011  46.235 11.683  1.00 16.65 ? 28  HIS A N     1 
ATOM   234  C  CA    . HIS A 1 31  ? 98.932  46.479 13.122  1.00 22.05 ? 28  HIS A CA    1 
ATOM   235  C  C     . HIS A 1 31  ? 97.559  46.175 13.703  1.00 18.80 ? 28  HIS A C     1 
ATOM   236  O  O     . HIS A 1 31  ? 97.441  46.017 14.925  1.00 19.14 ? 28  HIS A O     1 
ATOM   237  C  CB    . HIS A 1 31  ? 99.277  47.932 13.450  1.00 24.33 ? 28  HIS A CB    1 
ATOM   238  C  CG    . HIS A 1 31  ? 100.715 48.269 13.228  1.00 28.59 ? 28  HIS A CG    1 
ATOM   239  N  ND1   . HIS A 1 31  ? 101.739 47.564 13.821  1.00 31.22 ? 28  HIS A ND1   1 
ATOM   240  C  CD2   . HIS A 1 31  ? 101.302 49.237 12.487  1.00 38.69 ? 28  HIS A CD2   1 
ATOM   241  C  CE1   . HIS A 1 31  ? 102.898 48.077 13.445  1.00 33.91 ? 28  HIS A CE1   1 
ATOM   242  N  NE2   . HIS A 1 31  ? 102.660 49.094 12.637  1.00 40.70 ? 28  HIS A NE2   1 
ATOM   243  N  N     . LEU A 1 32  ? 96.521  46.113 12.864  1.00 17.80 ? 29  LEU A N     1 
ATOM   244  C  CA    . LEU A 1 32  ? 95.154  45.835 13.291  1.00 17.28 ? 29  LEU A CA    1 
ATOM   245  C  C     . LEU A 1 32  ? 94.831  44.347 13.330  1.00 20.09 ? 29  LEU A C     1 
ATOM   246  O  O     . LEU A 1 32  ? 93.778  43.969 13.859  1.00 16.66 ? 29  LEU A O     1 
ATOM   247  C  CB    . LEU A 1 32  ? 94.163  46.518 12.348  1.00 17.46 ? 29  LEU A CB    1 
ATOM   248  C  CG    . LEU A 1 32  ? 94.260  48.045 12.275  1.00 24.28 ? 29  LEU A CG    1 
ATOM   249  C  CD1   . LEU A 1 32  ? 93.235  48.645 11.291  1.00 18.97 ? 29  LEU A CD1   1 
ATOM   250  C  CD2   . LEU A 1 32  ? 94.096  48.637 13.666  1.00 19.18 ? 29  LEU A CD2   1 
ATOM   251  N  N     . ARG A 1 33  ? 95.694  43.506 12.764  1.00 15.35 ? 30  ARG A N     1 
ATOM   252  C  CA    . ARG A 1 33  ? 95.399  42.084 12.650  1.00 15.71 ? 30  ARG A CA    1 
ATOM   253  C  C     . ARG A 1 33  ? 95.397  41.410 14.017  1.00 16.30 ? 30  ARG A C     1 
ATOM   254  O  O     . ARG A 1 33  ? 96.243  41.698 14.874  1.00 19.95 ? 30  ARG A O     1 
ATOM   255  C  CB    . ARG A 1 33  ? 96.414  41.401 11.725  1.00 16.10 ? 30  ARG A CB    1 
ATOM   256  C  CG    . ARG A 1 33  ? 96.325  41.898 10.280  1.00 17.22 ? 30  ARG A CG    1 
ATOM   257  C  CD    . ARG A 1 33  ? 97.443  41.347 9.405   1.00 20.34 ? 30  ARG A CD    1 
ATOM   258  N  NE    . ARG A 1 33  ? 97.399  41.962 8.078   1.00 18.52 ? 30  ARG A NE    1 
ATOM   259  C  CZ    . ARG A 1 33  ? 98.153  41.569 7.059   1.00 24.87 ? 30  ARG A CZ    1 
ATOM   260  N  NH1   . ARG A 1 33  ? 99.005  40.568 7.227   1.00 19.71 ? 30  ARG A NH1   1 
ATOM   261  N  NH2   . ARG A 1 33  ? 98.060  42.179 5.883   1.00 18.25 ? 30  ARG A NH2   1 
ATOM   262  N  N     . ASN A 1 34  ? 94.429  40.513 14.209  1.00 18.31 ? 31  ASN A N     1 
ATOM   263  C  CA    . ASN A 1 34  ? 94.315  39.698 15.421  1.00 25.57 ? 31  ASN A CA    1 
ATOM   264  C  C     . ASN A 1 34  ? 94.159  40.549 16.670  1.00 28.35 ? 31  ASN A C     1 
ATOM   265  O  O     . ASN A 1 34  ? 94.650  40.193 17.743  1.00 27.96 ? 31  ASN A O     1 
ATOM   266  C  CB    . ASN A 1 34  ? 95.514  38.763 15.560  1.00 27.67 ? 31  ASN A CB    1 
ATOM   267  C  CG    . ASN A 1 34  ? 95.603  37.796 14.411  1.00 35.17 ? 31  ASN A CG    1 
ATOM   268  O  OD1   . ASN A 1 34  ? 94.643  37.088 14.105  1.00 44.48 ? 31  ASN A OD1   1 
ATOM   269  N  ND2   . ASN A 1 34  ? 96.729  37.800 13.729  1.00 33.25 ? 31  ASN A ND2   1 
ATOM   270  N  N     . LYS A 1 35  ? 93.485  41.681 16.540  1.00 20.80 ? 32  LYS A N     1 
ATOM   271  C  CA    . LYS A 1 35  ? 93.285  42.604 17.642  1.00 22.78 ? 32  LYS A CA    1 
ATOM   272  C  C     . LYS A 1 35  ? 91.808  42.925 17.751  1.00 20.55 ? 32  LYS A C     1 
ATOM   273  O  O     . LYS A 1 35  ? 91.071  42.840 16.761  1.00 21.18 ? 32  LYS A O     1 
ATOM   274  C  CB    . LYS A 1 35  ? 94.086  43.897 17.428  1.00 26.09 ? 32  LYS A CB    1 
ATOM   275  C  CG    . LYS A 1 35  ? 95.593  43.703 17.464  1.00 25.94 ? 32  LYS A CG    1 
ATOM   276  C  CD    . LYS A 1 35  ? 96.143  44.040 18.837  1.00 34.40 ? 32  LYS A CD    1 
ATOM   277  C  CE    . LYS A 1 35  ? 97.647  43.825 18.888  1.00 37.45 ? 32  LYS A CE    1 
ATOM   278  N  NZ    . LYS A 1 35  ? 98.299  44.410 17.682  1.00 45.64 ? 32  LYS A NZ    1 
ATOM   279  N  N     . PRO A 1 36  ? 91.341  43.315 18.941  1.00 20.64 ? 33  PRO A N     1 
ATOM   280  C  CA    . PRO A 1 36  ? 89.992  43.886 19.036  1.00 15.69 ? 33  PRO A CA    1 
ATOM   281  C  C     . PRO A 1 36  ? 89.980  45.204 18.275  1.00 18.45 ? 33  PRO A C     1 
ATOM   282  O  O     . PRO A 1 36  ? 90.693  46.149 18.632  1.00 15.79 ? 33  PRO A O     1 
ATOM   283  C  CB    . PRO A 1 36  ? 89.793  44.091 20.542  1.00 20.01 ? 33  PRO A CB    1 
ATOM   284  C  CG    . PRO A 1 36  ? 91.172  44.295 21.071  1.00 25.05 ? 33  PRO A CG    1 
ATOM   285  C  CD    . PRO A 1 36  ? 92.078  43.420 20.214  1.00 22.01 ? 33  PRO A CD    1 
ATOM   286  N  N     . CYS A 1 37  ? 89.170  45.264 17.220  1.00 16.26 ? 34  CYS A N     1 
ATOM   287  C  CA    A CYS A 1 37  ? 89.146  46.476 16.427  0.76 15.29 ? 34  CYS A CA    1 
ATOM   288  C  CA    B CYS A 1 37  ? 89.208  46.358 16.257  0.24 15.50 ? 34  CYS A CA    1 
ATOM   289  C  C     . CYS A 1 37  ? 87.791  46.624 15.758  1.00 13.46 ? 34  CYS A C     1 
ATOM   290  O  O     . CYS A 1 37  ? 86.968  45.708 15.720  1.00 16.58 ? 34  CYS A O     1 
ATOM   291  C  CB    A CYS A 1 37  ? 90.288  46.510 15.400  0.76 17.76 ? 34  CYS A CB    1 
ATOM   292  C  CB    B CYS A 1 37  ? 90.167  45.980 15.113  0.24 17.10 ? 34  CYS A CB    1 
ATOM   293  S  SG    A CYS A 1 37  ? 90.228  45.241 14.151  0.76 20.00 ? 34  CYS A SG    1 
ATOM   294  S  SG    B CYS A 1 37  ? 90.232  47.031 13.649  0.24 14.17 ? 34  CYS A SG    1 
ATOM   295  N  N     . ALA A 1 38  ? 87.522  47.854 15.338  1.00 15.51 ? 35  ALA A N     1 
ATOM   296  C  CA    . ALA A 1 38  ? 86.236  48.179 14.738  1.00 14.03 ? 35  ALA A CA    1 
ATOM   297  C  C     . ALA A 1 38  ? 86.455  49.220 13.653  1.00 16.42 ? 35  ALA A C     1 
ATOM   298  O  O     . ALA A 1 38  ? 87.441  49.954 13.673  1.00 15.15 ? 35  ALA A O     1 
ATOM   299  C  CB    . ALA A 1 38  ? 85.237  48.705 15.779  1.00 14.76 ? 35  ALA A CB    1 
ATOM   300  N  N     . VAL A 1 39  ? 85.504  49.298 12.720  1.00 14.74 ? 36  VAL A N     1 
ATOM   301  C  CA    . VAL A 1 39  ? 85.499  50.306 11.663  1.00 15.67 ? 36  VAL A CA    1 
ATOM   302  C  C     . VAL A 1 39  ? 84.409  51.313 12.009  1.00 20.42 ? 36  VAL A C     1 
ATOM   303  O  O     . VAL A 1 39  ? 83.293  50.924 12.369  1.00 16.08 ? 36  VAL A O     1 
ATOM   304  C  CB    . VAL A 1 39  ? 85.289  49.664 10.279  1.00 16.14 ? 36  VAL A CB    1 
ATOM   305  C  CG1   . VAL A 1 39  ? 85.157  50.723 9.182   1.00 18.12 ? 36  VAL A CG1   1 
ATOM   306  C  CG2   . VAL A 1 39  ? 86.467  48.744 9.965   1.00 16.04 ? 36  VAL A CG2   1 
ATOM   307  N  N     . VAL A 1 40  ? 84.749  52.604 11.958  1.00 16.56 ? 37  VAL A N     1 
ATOM   308  C  CA    A VAL A 1 40  ? 83.857  53.674 12.398  0.77 16.91 ? 37  VAL A CA    1 
ATOM   309  C  CA    B VAL A 1 40  ? 83.871  53.678 12.405  0.23 17.01 ? 37  VAL A CA    1 
ATOM   310  C  C     . VAL A 1 40  ? 83.635  54.652 11.254  1.00 19.90 ? 37  VAL A C     1 
ATOM   311  O  O     . VAL A 1 40  ? 84.494  54.831 10.389  1.00 17.36 ? 37  VAL A O     1 
ATOM   312  C  CB    A VAL A 1 40  ? 84.417  54.424 13.625  0.77 20.14 ? 37  VAL A CB    1 
ATOM   313  C  CB    B VAL A 1 40  ? 84.496  54.371 13.641  0.23 20.07 ? 37  VAL A CB    1 
ATOM   314  C  CG1   A VAL A 1 40  ? 84.631  53.462 14.773  0.77 22.74 ? 37  VAL A CG1   1 
ATOM   315  C  CG1   B VAL A 1 40  ? 84.087  55.820 13.756  0.23 18.83 ? 37  VAL A CG1   1 
ATOM   316  C  CG2   A VAL A 1 40  ? 85.715  55.138 13.270  0.77 15.25 ? 37  VAL A CG2   1 
ATOM   317  C  CG2   B VAL A 1 40  ? 84.133  53.609 14.913  0.23 20.62 ? 37  VAL A CG2   1 
ATOM   318  N  N     . GLN A 1 41  ? 82.453  55.280 11.237  1.00 18.45 ? 38  GLN A N     1 
ATOM   319  C  CA    . GLN A 1 41  ? 82.182  56.350 10.291  1.00 18.26 ? 38  GLN A CA    1 
ATOM   320  C  C     . GLN A 1 41  ? 81.921  57.634 11.061  1.00 24.20 ? 38  GLN A C     1 
ATOM   321  O  O     . GLN A 1 41  ? 81.215  57.632 12.073  1.00 18.57 ? 38  GLN A O     1 
ATOM   322  C  CB    . GLN A 1 41  ? 81.013  56.041 9.345   1.00 22.63 ? 38  GLN A CB    1 
ATOM   323  C  CG    . GLN A 1 41  ? 79.713  55.705 10.008  1.00 26.13 ? 38  GLN A CG    1 
ATOM   324  C  CD    . GLN A 1 41  ? 78.667  55.256 9.009   1.00 29.23 ? 38  GLN A CD    1 
ATOM   325  O  OE1   . GLN A 1 41  ? 77.542  54.956 9.380   1.00 39.30 ? 38  GLN A OE1   1 
ATOM   326  N  NE2   . GLN A 1 41  ? 79.041  55.191 7.737   1.00 25.43 ? 38  GLN A NE2   1 
ATOM   327  N  N     . TYR A 1 42  ? 82.522  58.719 10.576  1.00 19.81 ? 39  TYR A N     1 
ATOM   328  C  CA    . TYR A 1 42  ? 82.520  60.019 11.233  1.00 20.87 ? 39  TYR A CA    1 
ATOM   329  C  C     . TYR A 1 42  ? 83.302  59.904 12.539  1.00 27.07 ? 39  TYR A C     1 
ATOM   330  O  O     . TYR A 1 42  ? 83.935  58.871 12.800  1.00 28.97 ? 39  TYR A O     1 
ATOM   331  C  CB    . TYR A 1 42  ? 81.085  60.534 11.402  1.00 20.11 ? 39  TYR A CB    1 
ATOM   332  C  CG    . TYR A 1 42  ? 80.364  60.572 10.058  1.00 24.22 ? 39  TYR A CG    1 
ATOM   333  C  CD1   . TYR A 1 42  ? 80.767  61.462 9.066   1.00 22.72 ? 39  TYR A CD1   1 
ATOM   334  C  CD2   . TYR A 1 42  ? 79.316  59.695 9.764   1.00 18.08 ? 39  TYR A CD2   1 
ATOM   335  C  CE1   . TYR A 1 42  ? 80.137  61.502 7.826   1.00 20.83 ? 39  TYR A CE1   1 
ATOM   336  C  CE2   . TYR A 1 42  ? 78.684  59.717 8.512   1.00 22.46 ? 39  TYR A CE2   1 
ATOM   337  C  CZ    . TYR A 1 42  ? 79.103  60.627 7.551   1.00 25.14 ? 39  TYR A CZ    1 
ATOM   338  O  OH    . TYR A 1 42  ? 78.492  60.673 6.311   1.00 24.01 ? 39  TYR A OH    1 
ATOM   339  N  N     . LYS A 1 43  ? 83.322  60.952 13.347  1.00 29.20 ? 40  LYS A N     1 
ATOM   340  C  CA    . LYS A 1 43  ? 84.275  60.951 14.452  1.00 29.82 ? 40  LYS A CA    1 
ATOM   341  C  C     . LYS A 1 43  ? 83.907  61.977 15.505  1.00 32.80 ? 40  LYS A C     1 
ATOM   342  O  O     . LYS A 1 43  ? 84.092  61.736 16.701  1.00 28.85 ? 40  LYS A O     1 
ATOM   343  C  CB    . LYS A 1 43  ? 85.691  61.212 13.936  1.00 39.76 ? 40  LYS A CB    1 
ATOM   344  N  N     . SER A 1 44  ? 83.353  63.108 15.064  1.00 32.13 ? 41  SER A N     1 
ATOM   345  C  CA    . SER A 1 44  ? 83.093  64.216 15.973  1.00 33.69 ? 41  SER A CA    1 
ATOM   346  C  C     . SER A 1 44  ? 81.979  63.891 16.961  1.00 36.44 ? 41  SER A C     1 
ATOM   347  O  O     . SER A 1 44  ? 82.050  64.290 18.128  1.00 37.71 ? 41  SER A O     1 
ATOM   348  C  CB    . SER A 1 44  ? 82.759  65.471 15.166  1.00 41.22 ? 41  SER A CB    1 
ATOM   349  O  OG    . SER A 1 44  ? 81.678  65.225 14.280  1.00 43.24 ? 41  SER A OG    1 
ATOM   350  N  N     . TRP A 1 45  ? 80.940  63.179 16.524  1.00 31.25 ? 42  TRP A N     1 
ATOM   351  C  CA    . TRP A 1 45  ? 79.816  62.860 17.399  1.00 30.55 ? 42  TRP A CA    1 
ATOM   352  C  C     . TRP A 1 45  ? 80.117  61.535 18.092  1.00 30.37 ? 42  TRP A C     1 
ATOM   353  O  O     . TRP A 1 45  ? 80.112  60.479 17.452  1.00 29.69 ? 42  TRP A O     1 
ATOM   354  C  CB    . TRP A 1 45  ? 78.500  62.793 16.625  1.00 33.11 ? 42  TRP A CB    1 
ATOM   355  C  CG    . TRP A 1 45  ? 77.302  62.554 17.513  1.00 34.05 ? 42  TRP A CG    1 
ATOM   356  C  CD1   . TRP A 1 45  ? 76.714  61.351 17.794  1.00 38.09 ? 42  TRP A CD1   1 
ATOM   357  C  CD2   . TRP A 1 45  ? 76.558  63.539 18.239  1.00 36.19 ? 42  TRP A CD2   1 
ATOM   358  N  NE1   . TRP A 1 45  ? 75.653  61.527 18.651  1.00 39.18 ? 42  TRP A NE1   1 
ATOM   359  C  CE2   . TRP A 1 45  ? 75.533  62.862 18.935  1.00 42.07 ? 42  TRP A CE2   1 
ATOM   360  C  CE3   . TRP A 1 45  ? 76.654  64.928 18.366  1.00 41.73 ? 42  TRP A CE3   1 
ATOM   361  C  CZ2   . TRP A 1 45  ? 74.615  63.527 19.744  1.00 49.43 ? 42  TRP A CZ2   1 
ATOM   362  C  CZ3   . TRP A 1 45  ? 75.740  65.586 19.171  1.00 41.49 ? 42  TRP A CZ3   1 
ATOM   363  C  CH2   . TRP A 1 45  ? 74.735  64.887 19.848  1.00 48.10 ? 42  TRP A CH2   1 
ATOM   364  N  N     . LYS A 1 46  ? 80.435  61.609 19.386  1.00 30.05 ? 43  LYS A N     1 
ATOM   365  C  CA    . LYS A 1 46  ? 80.679  60.443 20.241  1.00 26.49 ? 43  LYS A CA    1 
ATOM   366  C  C     . LYS A 1 46  ? 81.716  59.483 19.664  1.00 26.15 ? 43  LYS A C     1 
ATOM   367  O  O     . LYS A 1 46  ? 81.646  58.271 19.886  1.00 24.30 ? 43  LYS A O     1 
ATOM   368  C  CB    . LYS A 1 46  ? 79.366  59.716 20.532  1.00 23.30 ? 43  LYS A CB    1 
ATOM   369  C  CG    . LYS A 1 46  ? 78.319  60.633 21.159  1.00 33.58 ? 43  LYS A CG    1 
ATOM   370  C  CD    . LYS A 1 46  ? 77.111  59.859 21.654  1.00 37.84 ? 43  LYS A CD    1 
ATOM   371  C  CE    . LYS A 1 46  ? 76.238  60.725 22.538  1.00 47.98 ? 43  LYS A CE    1 
ATOM   372  N  NZ    . LYS A 1 46  ? 75.085  59.948 23.069  1.00 49.71 ? 43  LYS A NZ    1 
ATOM   373  N  N     . GLY A 1 47  ? 82.694  60.008 18.930  1.00 25.57 ? 44  GLY A N     1 
ATOM   374  C  CA    . GLY A 1 47  ? 83.785  59.206 18.419  1.00 21.60 ? 44  GLY A CA    1 
ATOM   375  C  C     . GLY A 1 47  ? 83.501  58.497 17.112  1.00 20.83 ? 44  GLY A C     1 
ATOM   376  O  O     . GLY A 1 47  ? 84.380  57.789 16.606  1.00 23.25 ? 44  GLY A O     1 
ATOM   377  N  N     . GLY A 1 48  ? 82.312  58.662 16.555  1.00 24.70 ? 45  GLY A N     1 
ATOM   378  C  CA    . GLY A 1 48  ? 81.930  57.991 15.334  1.00 29.17 ? 45  GLY A CA    1 
ATOM   379  C  C     . GLY A 1 48  ? 81.046  56.783 15.599  1.00 23.49 ? 45  GLY A C     1 
ATOM   380  O  O     . GLY A 1 48  ? 81.017  56.212 16.694  1.00 23.33 ? 45  GLY A O     1 
ATOM   381  N  N     . GLY A 1 49  ? 80.313  56.378 14.562  1.00 17.12 ? 46  GLY A N     1 
ATOM   382  C  CA    . GLY A 1 49  ? 79.411  55.242 14.676  1.00 22.98 ? 46  GLY A CA    1 
ATOM   383  C  C     . GLY A 1 49  ? 80.121  53.994 14.196  1.00 17.76 ? 46  GLY A C     1 
ATOM   384  O  O     . GLY A 1 49  ? 80.766  54.005 13.147  1.00 18.04 ? 46  GLY A O     1 
ATOM   385  N  N     . ILE A 1 50  ? 80.011  52.928 14.972  1.00 16.77 ? 47  ILE A N     1 
ATOM   386  C  CA    A ILE A 1 50  ? 80.642  51.654 14.636  0.31 19.03 ? 47  ILE A CA    1 
ATOM   387  C  CA    B ILE A 1 50  ? 80.645  51.663 14.622  0.69 19.05 ? 47  ILE A CA    1 
ATOM   388  C  C     . ILE A 1 50  ? 79.826  50.966 13.549  1.00 21.02 ? 47  ILE A C     1 
ATOM   389  O  O     . ILE A 1 50  ? 78.612  50.774 13.696  1.00 20.35 ? 47  ILE A O     1 
ATOM   390  C  CB    A ILE A 1 50  ? 80.759  50.758 15.880  0.31 16.85 ? 47  ILE A CB    1 
ATOM   391  C  CB    B ILE A 1 50  ? 80.799  50.773 15.860  0.69 16.75 ? 47  ILE A CB    1 
ATOM   392  C  CG1   A ILE A 1 50  ? 81.531  51.464 17.005  0.31 20.90 ? 47  ILE A CG1   1 
ATOM   393  C  CG1   B ILE A 1 50  ? 81.853  51.367 16.792  0.69 21.59 ? 47  ILE A CG1   1 
ATOM   394  C  CG2   A ILE A 1 50  ? 81.411  49.435 15.519  0.31 17.34 ? 47  ILE A CG2   1 
ATOM   395  C  CG2   B ILE A 1 50  ? 81.167  49.360 15.449  0.69 17.28 ? 47  ILE A CG2   1 
ATOM   396  C  CD1   A ILE A 1 50  ? 83.025  51.310 16.946  0.31 18.69 ? 47  ILE A CD1   1 
ATOM   397  C  CD1   B ILE A 1 50  ? 82.111  50.509 17.965  0.69 17.54 ? 47  ILE A CD1   1 
ATOM   398  N  N     . ILE A 1 51  ? 80.492  50.578 12.464  1.00 13.98 ? 48  ILE A N     1 
ATOM   399  C  CA    . ILE A 1 51  ? 79.841  49.853 11.385  1.00 16.64 ? 48  ILE A CA    1 
ATOM   400  C  C     . ILE A 1 51  ? 80.224  48.373 11.366  1.00 18.92 ? 48  ILE A C     1 
ATOM   401  O  O     . ILE A 1 51  ? 79.412  47.546 10.933  1.00 19.43 ? 48  ILE A O     1 
ATOM   402  C  CB    . ILE A 1 51  ? 80.125  50.513 10.016  1.00 26.53 ? 48  ILE A CB    1 
ATOM   403  C  CG1   . ILE A 1 51  ? 79.683  49.624 8.849   1.00 24.28 ? 48  ILE A CG1   1 
ATOM   404  C  CG2   . ILE A 1 51  ? 81.578  50.817 9.843   1.00 29.36 ? 48  ILE A CG2   1 
ATOM   405  C  CD1   . ILE A 1 51  ? 79.514  50.394 7.576   1.00 34.53 ? 48  ILE A CD1   1 
ATOM   406  N  N     . ALA A 1 52  ? 81.423  48.009 11.837  1.00 15.12 ? 49  ALA A N     1 
ATOM   407  C  CA    . ALA A 1 52  ? 81.877  46.619 11.799  1.00 17.63 ? 49  ALA A CA    1 
ATOM   408  C  C     . ALA A 1 52  ? 82.844  46.341 12.948  1.00 16.56 ? 49  ALA A C     1 
ATOM   409  O  O     . ALA A 1 52  ? 83.582  47.231 13.379  1.00 14.01 ? 49  ALA A O     1 
ATOM   410  C  CB    . ALA A 1 52  ? 82.555  46.302 10.465  1.00 15.39 ? 49  ALA A CB    1 
ATOM   411  N  N     . VAL A 1 53  ? 82.855  45.087 13.422  1.00 15.60 ? 50  VAL A N     1 
ATOM   412  C  CA    . VAL A 1 53  ? 83.508  44.726 14.684  1.00 15.58 ? 50  VAL A CA    1 
ATOM   413  C  C     . VAL A 1 53  ? 84.238  43.397 14.537  1.00 12.93 ? 50  VAL A C     1 
ATOM   414  O  O     . VAL A 1 53  ? 83.627  42.389 14.149  1.00 15.54 ? 50  VAL A O     1 
ATOM   415  C  CB    . VAL A 1 53  ? 82.476  44.622 15.832  1.00 14.25 ? 50  VAL A CB    1 
ATOM   416  C  CG1   . VAL A 1 53  ? 83.160  44.386 17.157  1.00 15.94 ? 50  VAL A CG1   1 
ATOM   417  C  CG2   . VAL A 1 53  ? 81.612  45.855 15.869  1.00 14.83 ? 50  VAL A CG2   1 
ATOM   418  N  N     . SER A 1 54  ? 85.523  43.368 14.910  1.00 12.57 ? 51  SER A N     1 
ATOM   419  C  CA    . SER A 1 54  ? 86.275  42.127 14.817  1.00 15.34 ? 51  SER A CA    1 
ATOM   420  C  C     . SER A 1 54  ? 85.786  41.157 15.878  1.00 22.17 ? 51  SER A C     1 
ATOM   421  O  O     . SER A 1 54  ? 85.290  41.562 16.934  1.00 17.13 ? 51  SER A O     1 
ATOM   422  C  CB    . SER A 1 54  ? 87.772  42.351 15.012  1.00 19.17 ? 51  SER A CB    1 
ATOM   423  O  OG    . SER A 1 54  ? 88.093  42.558 16.393  1.00 19.81 ? 51  SER A OG    1 
ATOM   424  N  N     . TYR A 1 55  ? 85.968  39.861 15.614  1.00 18.60 ? 52  TYR A N     1 
ATOM   425  C  CA    . TYR A 1 55  ? 85.461  38.877 16.571  1.00 23.60 ? 52  TYR A CA    1 
ATOM   426  C  C     . TYR A 1 55  ? 86.127  39.033 17.937  1.00 20.32 ? 52  TYR A C     1 
ATOM   427  O  O     . TYR A 1 55  ? 85.479  38.817 18.971  1.00 21.82 ? 52  TYR A O     1 
ATOM   428  C  CB    . TYR A 1 55  ? 85.608  37.462 15.998  1.00 20.74 ? 52  TYR A CB    1 
ATOM   429  C  CG    . TYR A 1 55  ? 84.495  37.187 15.008  1.00 22.49 ? 52  TYR A CG    1 
ATOM   430  C  CD1   . TYR A 1 55  ? 84.560  37.674 13.711  1.00 20.06 ? 52  TYR A CD1   1 
ATOM   431  C  CD2   . TYR A 1 55  ? 83.342  36.514 15.390  1.00 29.48 ? 52  TYR A CD2   1 
ATOM   432  C  CE1   . TYR A 1 55  ? 83.518  37.464 12.806  1.00 21.73 ? 52  TYR A CE1   1 
ATOM   433  C  CE2   . TYR A 1 55  ? 82.303  36.296 14.496  1.00 23.53 ? 52  TYR A CE2   1 
ATOM   434  C  CZ    . TYR A 1 55  ? 82.391  36.775 13.203  1.00 26.51 ? 52  TYR A CZ    1 
ATOM   435  O  OH    . TYR A 1 55  ? 81.353  36.562 12.298  1.00 29.21 ? 52  TYR A OH    1 
ATOM   436  N  N     . GLU A 1 56  ? 87.385  39.478 17.972  1.00 18.26 ? 53  GLU A N     1 
ATOM   437  C  CA    . GLU A 1 56  ? 88.033  39.722 19.259  1.00 18.38 ? 53  GLU A CA    1 
ATOM   438  C  C     . GLU A 1 56  ? 87.334  40.830 20.038  1.00 22.71 ? 53  GLU A C     1 
ATOM   439  O  O     . GLU A 1 56  ? 87.218  40.752 21.268  1.00 19.04 ? 53  GLU A O     1 
ATOM   440  C  CB    . GLU A 1 56  ? 89.505  40.085 19.060  1.00 18.18 ? 53  GLU A CB    1 
ATOM   441  C  CG    . GLU A 1 56  ? 90.374  38.985 18.500  1.00 30.60 ? 53  GLU A CG    1 
ATOM   442  C  CD    . GLU A 1 56  ? 90.405  38.943 16.977  1.00 33.81 ? 53  GLU A CD    1 
ATOM   443  O  OE1   . GLU A 1 56  ? 89.564  39.596 16.317  1.00 30.17 ? 53  GLU A OE1   1 
ATOM   444  O  OE2   . GLU A 1 56  ? 91.281  38.237 16.438  1.00 30.51 ? 53  GLU A OE2   1 
ATOM   445  N  N     . ALA A 1 57  ? 86.886  41.888 19.344  1.00 18.24 ? 54  ALA A N     1 
ATOM   446  C  CA    . ALA A 1 57  ? 86.164  42.966 20.019  1.00 16.58 ? 54  ALA A CA    1 
ATOM   447  C  C     . ALA A 1 57  ? 84.734  42.576 20.381  1.00 18.69 ? 54  ALA A C     1 
ATOM   448  O  O     . ALA A 1 57  ? 84.197  43.068 21.385  1.00 17.55 ? 54  ALA A O     1 
ATOM   449  C  CB    . ALA A 1 57  ? 86.148  44.226 19.142  1.00 14.74 ? 54  ALA A CB    1 
ATOM   450  N  N     . ARG A 1 58  ? 84.101  41.698 19.593  1.00 16.46 ? 55  ARG A N     1 
ATOM   451  C  CA    . ARG A 1 58  ? 82.737  41.280 19.914  1.00 16.53 ? 55  ARG A CA    1 
ATOM   452  C  C     . ARG A 1 58  ? 82.674  40.573 21.259  1.00 23.34 ? 55  ARG A C     1 
ATOM   453  O  O     . ARG A 1 58  ? 81.638  40.612 21.933  1.00 20.72 ? 55  ARG A O     1 
ATOM   454  C  CB    . ARG A 1 58  ? 82.181  40.356 18.835  1.00 18.70 ? 55  ARG A CB    1 
ATOM   455  C  CG    . ARG A 1 58  ? 82.043  41.015 17.487  1.00 18.14 ? 55  ARG A CG    1 
ATOM   456  C  CD    . ARG A 1 58  ? 81.518  40.039 16.443  1.00 16.56 ? 55  ARG A CD    1 
ATOM   457  N  NE    . ARG A 1 58  ? 81.716  40.585 15.095  1.00 17.14 ? 55  ARG A NE    1 
ATOM   458  C  CZ    . ARG A 1 58  ? 81.148  40.108 13.989  1.00 20.67 ? 55  ARG A CZ    1 
ATOM   459  N  NH1   . ARG A 1 58  ? 80.336  39.055 14.042  1.00 21.49 ? 55  ARG A NH1   1 
ATOM   460  N  NH2   . ARG A 1 58  ? 81.401  40.678 12.821  1.00 22.46 ? 55  ARG A NH2   1 
ATOM   461  N  N     . ALA A 1 59  ? 83.765  39.921 21.658  1.00 18.64 ? 56  ALA A N     1 
ATOM   462  C  CA    . ALA A 1 59  ? 83.782  39.204 22.926  1.00 24.89 ? 56  ALA A CA    1 
ATOM   463  C  C     . ALA A 1 59  ? 83.646  40.152 24.108  1.00 27.46 ? 56  ALA A C     1 
ATOM   464  O  O     . ALA A 1 59  ? 83.260  39.714 25.200  1.00 25.79 ? 56  ALA A O     1 
ATOM   465  C  CB    . ALA A 1 59  ? 85.068  38.375 23.045  1.00 21.18 ? 56  ALA A CB    1 
ATOM   466  N  N     . PHE A 1 60  ? 83.946  41.436 23.912  1.00 21.68 ? 57  PHE A N     1 
ATOM   467  C  CA    . PHE A 1 60  ? 83.738  42.461 24.925  1.00 24.05 ? 57  PHE A CA    1 
ATOM   468  C  C     . PHE A 1 60  ? 82.360  43.113 24.861  1.00 21.79 ? 57  PHE A C     1 
ATOM   469  O  O     . PHE A 1 60  ? 82.083  44.017 25.660  1.00 23.81 ? 57  PHE A O     1 
ATOM   470  C  CB    . PHE A 1 60  ? 84.821  43.546 24.796  1.00 20.77 ? 57  PHE A CB    1 
ATOM   471  C  CG    . PHE A 1 60  ? 86.197  43.065 25.142  1.00 23.91 ? 57  PHE A CG    1 
ATOM   472  C  CD1   . PHE A 1 60  ? 87.002  42.461 24.185  1.00 25.34 ? 57  PHE A CD1   1 
ATOM   473  C  CD2   . PHE A 1 60  ? 86.693  43.217 26.428  1.00 26.19 ? 57  PHE A CD2   1 
ATOM   474  C  CE1   . PHE A 1 60  ? 88.277  42.015 24.508  1.00 25.88 ? 57  PHE A CE1   1 
ATOM   475  C  CE2   . PHE A 1 60  ? 87.962  42.779 26.754  1.00 34.71 ? 57  PHE A CE2   1 
ATOM   476  C  CZ    . PHE A 1 60  ? 88.752  42.172 25.793  1.00 30.41 ? 57  PHE A CZ    1 
ATOM   477  N  N     . GLY A 1 61  ? 81.494  42.705 23.937  1.00 20.14 ? 58  GLY A N     1 
ATOM   478  C  CA    . GLY A 1 61  ? 80.193  43.346 23.806  1.00 19.21 ? 58  GLY A CA    1 
ATOM   479  C  C     . GLY A 1 61  ? 80.110  44.486 22.810  1.00 22.31 ? 58  GLY A C     1 
ATOM   480  O  O     . GLY A 1 61  ? 79.056  45.129 22.711  1.00 21.05 ? 58  GLY A O     1 
ATOM   481  N  N     . VAL A 1 62  ? 81.170  44.744 22.046  1.00 17.93 ? 59  VAL A N     1 
ATOM   482  C  CA    . VAL A 1 62  ? 81.134  45.810 21.054  1.00 19.79 ? 59  VAL A CA    1 
ATOM   483  C  C     . VAL A 1 62  ? 80.221  45.395 19.912  1.00 18.41 ? 59  VAL A C     1 
ATOM   484  O  O     . VAL A 1 62  ? 80.268  44.254 19.442  1.00 18.84 ? 59  VAL A O     1 
ATOM   485  C  CB    . VAL A 1 62  ? 82.555  46.127 20.561  1.00 20.55 ? 59  VAL A CB    1 
ATOM   486  C  CG1   . VAL A 1 62  ? 82.517  47.185 19.466  1.00 21.76 ? 59  VAL A CG1   1 
ATOM   487  C  CG2   . VAL A 1 62  ? 83.408  46.595 21.732  1.00 19.82 ? 59  VAL A CG2   1 
ATOM   488  N  N     . THR A 1 63  ? 79.344  46.299 19.484  1.00 21.30 ? 60  THR A N     1 
ATOM   489  C  CA    . THR A 1 63  ? 78.418  45.953 18.413  1.00 15.63 ? 60  THR A CA    1 
ATOM   490  C  C     . THR A 1 63  ? 78.299  47.092 17.423  1.00 19.64 ? 60  THR A C     1 
ATOM   491  O  O     . THR A 1 63  ? 78.657  48.233 17.705  1.00 21.30 ? 60  THR A O     1 
ATOM   492  C  CB    . THR A 1 63  ? 77.009  45.634 18.929  1.00 21.04 ? 60  THR A CB    1 
ATOM   493  O  OG1   . THR A 1 63  ? 76.488  46.786 19.583  1.00 25.06 ? 60  THR A OG1   1 
ATOM   494  C  CG2   . THR A 1 63  ? 77.033  44.469 19.894  1.00 22.39 ? 60  THR A CG2   1 
ATOM   495  N  N     . ARG A 1 64  ? 77.785  46.738 16.252  1.00 23.47 ? 61  ARG A N     1 
ATOM   496  C  CA    A ARG A 1 64  ? 77.435  47.721 15.244  0.33 24.05 ? 61  ARG A CA    1 
ATOM   497  C  CA    B ARG A 1 64  ? 77.430  47.717 15.237  0.67 24.03 ? 61  ARG A CA    1 
ATOM   498  C  C     . ARG A 1 64  ? 76.408  48.698 15.797  1.00 26.87 ? 61  ARG A C     1 
ATOM   499  O  O     . ARG A 1 64  ? 75.592  48.346 16.651  1.00 24.91 ? 61  ARG A O     1 
ATOM   500  C  CB    A ARG A 1 64  ? 76.909  46.999 14.001  0.33 27.41 ? 61  ARG A CB    1 
ATOM   501  C  CB    B ARG A 1 64  ? 76.889  46.984 14.003  0.67 27.42 ? 61  ARG A CB    1 
ATOM   502  C  CG    A ARG A 1 64  ? 75.794  47.698 13.266  0.33 31.20 ? 61  ARG A CG    1 
ATOM   503  C  CG    B ARG A 1 64  ? 76.188  47.810 12.948  0.67 32.82 ? 61  ARG A CG    1 
ATOM   504  C  CD    A ARG A 1 64  ? 74.930  46.666 12.567  0.33 28.00 ? 61  ARG A CD    1 
ATOM   505  C  CD    B ARG A 1 64  ? 75.922  46.908 11.740  0.67 29.68 ? 61  ARG A CD    1 
ATOM   506  N  NE    A ARG A 1 64  ? 75.726  45.802 11.697  0.33 31.56 ? 61  ARG A NE    1 
ATOM   507  N  NE    B ARG A 1 64  ? 74.988  45.827 12.068  0.67 28.64 ? 61  ARG A NE    1 
ATOM   508  C  CZ    A ARG A 1 64  ? 75.432  44.532 11.442  0.33 30.95 ? 61  ARG A CZ    1 
ATOM   509  C  CZ    B ARG A 1 64  ? 75.118  44.582 11.615  0.67 32.23 ? 61  ARG A CZ    1 
ATOM   510  N  NH1   A ARG A 1 64  ? 76.215  43.820 10.640  0.33 24.15 ? 61  ARG A NH1   1 
ATOM   511  N  NH1   B ARG A 1 64  ? 76.148  44.289 10.829  0.67 22.88 ? 61  ARG A NH1   1 
ATOM   512  N  NH2   A ARG A 1 64  ? 74.355  43.978 11.993  0.33 29.17 ? 61  ARG A NH2   1 
ATOM   513  N  NH2   B ARG A 1 64  ? 74.238  43.638 11.949  0.67 28.42 ? 61  ARG A NH2   1 
ATOM   514  N  N     . SER A 1 65  ? 76.475  49.943 15.306  1.00 24.06 ? 62  SER A N     1 
ATOM   515  C  CA    . SER A 1 65  ? 75.579  51.054 15.638  1.00 30.48 ? 62  SER A CA    1 
ATOM   516  C  C     . SER A 1 65  ? 75.953  51.710 16.960  1.00 27.26 ? 62  SER A C     1 
ATOM   517  O  O     . SER A 1 65  ? 75.472  52.800 17.280  1.00 39.23 ? 62  SER A O     1 
ATOM   518  C  CB    . SER A 1 65  ? 74.127  50.593 15.665  1.00 27.01 ? 62  SER A CB    1 
ATOM   519  O  OG    . SER A 1 65  ? 73.725  50.345 16.988  1.00 38.70 ? 62  SER A OG    1 
ATOM   520  N  N     . MET A 1 66  ? 76.804  51.052 17.729  1.00 27.25 ? 63  MET A N     1 
ATOM   521  C  CA    . MET A 1 66  ? 77.308  51.636 18.958  1.00 22.09 ? 63  MET A CA    1 
ATOM   522  C  C     . MET A 1 66  ? 78.220  52.814 18.624  1.00 24.22 ? 63  MET A C     1 
ATOM   523  O  O     . MET A 1 66  ? 78.898  52.814 17.592  1.00 23.79 ? 63  MET A O     1 
ATOM   524  C  CB    . MET A 1 66  ? 78.041  50.544 19.735  1.00 22.34 ? 63  MET A CB    1 
ATOM   525  C  CG    . MET A 1 66  ? 78.705  50.864 21.054  1.00 26.40 ? 63  MET A CG    1 
ATOM   526  S  SD    . MET A 1 66  ? 79.271  49.274 21.763  1.00 29.93 ? 63  MET A SD    1 
ATOM   527  C  CE    . MET A 1 66  ? 77.716  48.466 22.130  1.00 29.62 ? 63  MET A CE    1 
ATOM   528  N  N     . TRP A 1 67  ? 78.188  53.851 19.462  1.00 25.31 ? 64  TRP A N     1 
ATOM   529  C  CA    . TRP A 1 67  ? 79.174  54.923 19.344  1.00 20.52 ? 64  TRP A CA    1 
ATOM   530  C  C     . TRP A 1 67  ? 80.543  54.431 19.795  1.00 18.48 ? 64  TRP A C     1 
ATOM   531  O  O     . TRP A 1 67  ? 80.664  53.710 20.790  1.00 18.71 ? 64  TRP A O     1 
ATOM   532  C  CB    . TRP A 1 67  ? 78.765  56.137 20.184  1.00 22.46 ? 64  TRP A CB    1 
ATOM   533  C  CG    . TRP A 1 67  ? 77.429  56.668 19.806  1.00 23.71 ? 64  TRP A CG    1 
ATOM   534  C  CD1   . TRP A 1 67  ? 76.307  56.710 20.589  1.00 30.27 ? 64  TRP A CD1   1 
ATOM   535  C  CD2   . TRP A 1 67  ? 77.051  57.192 18.531  1.00 29.62 ? 64  TRP A CD2   1 
ATOM   536  N  NE1   . TRP A 1 67  ? 75.258  57.256 19.878  1.00 28.04 ? 64  TRP A NE1   1 
ATOM   537  C  CE2   . TRP A 1 67  ? 75.690  57.554 18.612  1.00 30.50 ? 64  TRP A CE2   1 
ATOM   538  C  CE3   . TRP A 1 67  ? 77.736  57.403 17.328  1.00 25.20 ? 64  TRP A CE3   1 
ATOM   539  C  CZ2   . TRP A 1 67  ? 75.001  58.117 17.538  1.00 40.56 ? 64  TRP A CZ2   1 
ATOM   540  C  CZ3   . TRP A 1 67  ? 77.046  57.962 16.262  1.00 31.51 ? 64  TRP A CZ3   1 
ATOM   541  C  CH2   . TRP A 1 67  ? 75.694  58.308 16.376  1.00 34.50 ? 64  TRP A CH2   1 
ATOM   542  N  N     . ALA A 1 68  ? 81.588  54.852 19.077  1.00 20.05 ? 65  ALA A N     1 
ATOM   543  C  CA    . ALA A 1 68  ? 82.932  54.396 19.412  1.00 19.93 ? 65  ALA A CA    1 
ATOM   544  C  C     . ALA A 1 68  ? 83.319  54.793 20.835  1.00 17.98 ? 65  ALA A C     1 
ATOM   545  O  O     . ALA A 1 68  ? 83.993  54.025 21.531  1.00 19.23 ? 65  ALA A O     1 
ATOM   546  C  CB    . ALA A 1 68  ? 83.934  54.943 18.393  1.00 20.38 ? 65  ALA A CB    1 
ATOM   547  N  N     . ASP A 1 69  ? 82.884  55.976 21.300  1.00 20.52 ? 66  ASP A N     1 
ATOM   548  C  CA    . ASP A 1 69  ? 83.168  56.353 22.689  1.00 22.88 ? 66  ASP A CA    1 
ATOM   549  C  C     . ASP A 1 69  ? 82.560  55.350 23.664  1.00 22.13 ? 66  ASP A C     1 
ATOM   550  O  O     . ASP A 1 69  ? 83.149  55.047 24.708  1.00 18.73 ? 66  ASP A O     1 
ATOM   551  C  CB    . ASP A 1 69  ? 82.645  57.757 22.996  1.00 20.47 ? 66  ASP A CB    1 
ATOM   552  C  CG    . ASP A 1 69  ? 83.470  58.864 22.336  1.00 32.76 ? 66  ASP A CG    1 
ATOM   553  O  OD1   . ASP A 1 69  ? 84.549  58.591 21.754  1.00 27.75 ? 66  ASP A OD1   1 
ATOM   554  O  OD2   . ASP A 1 69  ? 83.030  60.025 22.425  1.00 29.51 ? 66  ASP A OD2   1 
ATOM   555  N  N     . ASP A 1 70  ? 81.390  54.814 23.330  1.00 18.87 ? 67  ASP A N     1 
ATOM   556  C  CA    . ASP A 1 70  ? 80.740  53.837 24.195  1.00 16.89 ? 67  ASP A CA    1 
ATOM   557  C  C     . ASP A 1 70  ? 81.393  52.467 24.074  1.00 19.62 ? 67  ASP A C     1 
ATOM   558  O  O     . ASP A 1 70  ? 81.520  51.742 25.064  1.00 19.30 ? 67  ASP A O     1 
ATOM   559  C  CB    . ASP A 1 70  ? 79.254  53.758 23.848  1.00 19.01 ? 67  ASP A CB    1 
ATOM   560  C  CG    . ASP A 1 70  ? 78.524  55.044 24.159  1.00 28.33 ? 67  ASP A CG    1 
ATOM   561  O  OD1   . ASP A 1 70  ? 78.999  55.778 25.048  1.00 27.11 ? 67  ASP A OD1   1 
ATOM   562  O  OD2   . ASP A 1 70  ? 77.486  55.322 23.516  1.00 26.75 ? 67  ASP A OD2   1 
ATOM   563  N  N     . ALA A 1 71  ? 81.816  52.103 22.866  1.00 20.35 ? 68  ALA A N     1 
ATOM   564  C  CA    . ALA A 1 71  ? 82.537  50.852 22.682  1.00 19.13 ? 68  ALA A CA    1 
ATOM   565  C  C     . ALA A 1 71  ? 83.836  50.833 23.478  1.00 20.80 ? 68  ALA A C     1 
ATOM   566  O  O     . ALA A 1 71  ? 84.237  49.785 23.988  1.00 20.66 ? 68  ALA A O     1 
ATOM   567  C  CB    . ALA A 1 71  ? 82.832  50.639 21.198  1.00 20.40 ? 68  ALA A CB    1 
ATOM   568  N  N     . LYS A 1 72  ? 84.525  51.978 23.560  1.00 16.61 ? 69  LYS A N     1 
ATOM   569  C  CA    . LYS A 1 72  ? 85.752  52.073 24.343  1.00 20.58 ? 69  LYS A CA    1 
ATOM   570  C  C     . LYS A 1 72  ? 85.507  51.855 25.831  1.00 22.34 ? 69  LYS A C     1 
ATOM   571  O  O     . LYS A 1 72  ? 86.426  51.446 26.547  1.00 21.08 ? 69  LYS A O     1 
ATOM   572  C  CB    . LYS A 1 72  ? 86.406  53.433 24.112  1.00 21.16 ? 69  LYS A CB    1 
ATOM   573  C  CG    . LYS A 1 72  ? 87.302  53.470 22.871  1.00 24.53 ? 69  LYS A CG    1 
ATOM   574  C  CD    . LYS A 1 72  ? 88.565  52.647 23.099  1.00 25.43 ? 69  LYS A CD    1 
ATOM   575  C  CE    . LYS A 1 72  ? 89.724  53.141 22.226  1.00 33.60 ? 69  LYS A CE    1 
ATOM   576  N  NZ    . LYS A 1 72  ? 91.023  52.436 22.531  1.00 26.39 ? 69  LYS A NZ    1 
ATOM   577  N  N     . LYS A 1 73  ? 84.285  52.092 26.305  1.00 22.76 ? 70  LYS A N     1 
ATOM   578  C  CA    . LYS A 1 73  ? 83.966  51.780 27.695  1.00 22.88 ? 70  LYS A CA    1 
ATOM   579  C  C     . LYS A 1 73  ? 83.970  50.274 27.930  1.00 26.36 ? 70  LYS A C     1 
ATOM   580  O  O     . LYS A 1 73  ? 84.451  49.807 28.968  1.00 22.73 ? 70  LYS A O     1 
ATOM   581  C  CB    . LYS A 1 73  ? 82.617  52.408 28.066  1.00 23.80 ? 70  LYS A CB    1 
ATOM   582  C  CG    . LYS A 1 73  ? 82.559  53.906 27.747  1.00 22.03 ? 70  LYS A CG    1 
ATOM   583  C  CD    . LYS A 1 73  ? 81.169  54.523 27.933  1.00 20.78 ? 70  LYS A CD    1 
ATOM   584  C  CE    . LYS A 1 73  ? 81.205  56.041 27.715  1.00 19.28 ? 70  LYS A CE    1 
ATOM   585  N  NZ    . LYS A 1 73  ? 79.817  56.597 27.539  1.00 23.95 ? 70  LYS A NZ    1 
ATOM   586  N  N     . LEU A 1 74  ? 83.470  49.497 26.960  1.00 20.80 ? 71  LEU A N     1 
ATOM   587  C  CA    . LEU A 1 74  ? 83.474  48.035 27.062  1.00 22.44 ? 71  LEU A CA    1 
ATOM   588  C  C     . LEU A 1 74  ? 84.838  47.440 26.741  1.00 24.51 ? 71  LEU A C     1 
ATOM   589  O  O     . LEU A 1 74  ? 85.184  46.369 27.252  1.00 20.99 ? 71  LEU A O     1 
ATOM   590  C  CB    . LEU A 1 74  ? 82.432  47.433 26.108  1.00 17.70 ? 71  LEU A CB    1 
ATOM   591  C  CG    . LEU A 1 74  ? 80.971  47.856 26.261  1.00 21.94 ? 71  LEU A CG    1 
ATOM   592  C  CD1   . LEU A 1 74  ? 80.138  47.238 25.152  1.00 24.45 ? 71  LEU A CD1   1 
ATOM   593  C  CD2   . LEU A 1 74  ? 80.474  47.381 27.601  1.00 20.32 ? 71  LEU A CD2   1 
ATOM   594  N  N     . CYS A 1 75  ? 85.617  48.110 25.894  1.00 21.90 ? 72  CYS A N     1 
ATOM   595  C  CA    . CYS A 1 75  ? 86.890  47.580 25.401  1.00 19.33 ? 72  CYS A CA    1 
ATOM   596  C  C     . CYS A 1 75  ? 87.874  48.740 25.298  1.00 24.65 ? 72  CYS A C     1 
ATOM   597  O  O     . CYS A 1 75  ? 87.973  49.406 24.259  1.00 22.57 ? 72  CYS A O     1 
ATOM   598  C  CB    . CYS A 1 75  ? 86.702  46.881 24.056  1.00 18.67 ? 72  CYS A CB    1 
ATOM   599  S  SG    . CYS A 1 75  ? 88.203  46.156 23.346  1.00 23.99 ? 72  CYS A SG    1 
ATOM   600  N  N     . PRO A 1 76  ? 88.615  49.020 26.369  1.00 22.54 ? 73  PRO A N     1 
ATOM   601  C  CA    . PRO A 1 76  ? 89.497  50.195 26.359  1.00 24.10 ? 73  PRO A CA    1 
ATOM   602  C  C     . PRO A 1 76  ? 90.632  50.085 25.361  1.00 20.33 ? 73  PRO A C     1 
ATOM   603  O  O     . PRO A 1 76  ? 91.132  51.120 24.913  1.00 24.66 ? 73  PRO A O     1 
ATOM   604  C  CB    . PRO A 1 76  ? 90.027  50.258 27.799  1.00 22.55 ? 73  PRO A CB    1 
ATOM   605  C  CG    . PRO A 1 76  ? 89.031  49.478 28.605  1.00 30.04 ? 73  PRO A CG    1 
ATOM   606  C  CD    . PRO A 1 76  ? 88.522  48.397 27.703  1.00 26.54 ? 73  PRO A CD    1 
ATOM   607  N  N     . ASP A 1 77  ? 91.047  48.878 24.996  1.00 24.10 ? 74  ASP A N     1 
ATOM   608  C  CA    . ASP A 1 77  ? 92.117  48.704 24.025  1.00 27.05 ? 74  ASP A CA    1 
ATOM   609  C  C     . ASP A 1 77  ? 91.615  48.608 22.589  1.00 26.38 ? 74  ASP A C     1 
ATOM   610  O  O     . ASP A 1 77  ? 92.411  48.308 21.693  1.00 21.81 ? 74  ASP A O     1 
ATOM   611  C  CB    . ASP A 1 77  ? 92.937  47.470 24.376  1.00 26.45 ? 74  ASP A CB    1 
ATOM   612  C  CG    . ASP A 1 77  ? 93.667  47.631 25.691  1.00 38.41 ? 74  ASP A CG    1 
ATOM   613  O  OD1   . ASP A 1 77  ? 94.202  48.736 25.950  1.00 35.91 ? 74  ASP A OD1   1 
ATOM   614  O  OD2   . ASP A 1 77  ? 93.662  46.667 26.475  1.00 34.17 ? 74  ASP A OD2   1 
ATOM   615  N  N     . LEU A 1 78  ? 90.332  48.890 22.351  1.00 17.11 ? 75  LEU A N     1 
ATOM   616  C  CA    . LEU A 1 78  ? 89.766  48.811 21.006  1.00 20.61 ? 75  LEU A CA    1 
ATOM   617  C  C     . LEU A 1 78  ? 90.560  49.666 20.017  1.00 17.48 ? 75  LEU A C     1 
ATOM   618  O  O     . LEU A 1 78  ? 90.743  50.866 20.227  1.00 20.50 ? 75  LEU A O     1 
ATOM   619  C  CB    . LEU A 1 78  ? 88.303  49.284 21.041  1.00 18.14 ? 75  LEU A CB    1 
ATOM   620  C  CG    . LEU A 1 78  ? 87.486  49.122 19.756  1.00 17.63 ? 75  LEU A CG    1 
ATOM   621  C  CD1   . LEU A 1 78  ? 87.335  47.645 19.454  1.00 16.44 ? 75  LEU A CD1   1 
ATOM   622  C  CD2   . LEU A 1 78  ? 86.113  49.761 19.947  1.00 17.09 ? 75  LEU A CD2   1 
ATOM   623  N  N     . LEU A 1 79  ? 91.024  49.057 18.931  1.00 14.42 ? 76  LEU A N     1 
ATOM   624  C  CA    . LEU A 1 79  ? 91.639  49.829 17.855  1.00 14.63 ? 76  LEU A CA    1 
ATOM   625  C  C     . LEU A 1 79  ? 90.573  50.215 16.834  1.00 21.88 ? 76  LEU A C     1 
ATOM   626  O  O     . LEU A 1 79  ? 89.602  49.491 16.622  1.00 16.56 ? 76  LEU A O     1 
ATOM   627  C  CB    . LEU A 1 79  ? 92.753  49.030 17.178  1.00 18.14 ? 76  LEU A CB    1 
ATOM   628  C  CG    . LEU A 1 79  ? 93.822  48.536 18.162  1.00 20.14 ? 76  LEU A CG    1 
ATOM   629  C  CD1   . LEU A 1 79  ? 94.871  47.661 17.463  1.00 18.27 ? 76  LEU A CD1   1 
ATOM   630  C  CD2   . LEU A 1 79  ? 94.465  49.730 18.872  1.00 19.71 ? 76  LEU A CD2   1 
ATOM   631  N  N     . LEU A 1 80  ? 90.751  51.373 16.205  1.00 18.13 ? 77  LEU A N     1 
ATOM   632  C  CA    . LEU A 1 80  ? 89.736  51.874 15.290  1.00 15.99 ? 77  LEU A CA    1 
ATOM   633  C  C     . LEU A 1 80  ? 90.349  52.206 13.941  1.00 21.97 ? 77  LEU A C     1 
ATOM   634  O  O     . LEU A 1 80  ? 91.452  52.756 13.864  1.00 20.76 ? 77  LEU A O     1 
ATOM   635  C  CB    . LEU A 1 80  ? 89.050  53.125 15.839  1.00 16.27 ? 77  LEU A CB    1 
ATOM   636  C  CG    . LEU A 1 80  ? 88.241  52.962 17.122  1.00 16.34 ? 77  LEU A CG    1 
ATOM   637  C  CD1   . LEU A 1 80  ? 87.683  54.313 17.547  1.00 22.24 ? 77  LEU A CD1   1 
ATOM   638  C  CD2   . LEU A 1 80  ? 87.117  51.948 16.928  1.00 18.29 ? 77  LEU A CD2   1 
ATOM   639  N  N     . ALA A 1 81  ? 89.608  51.888 12.884  1.00 14.65 ? 78  ALA A N     1 
ATOM   640  C  CA    . ALA A 1 81  ? 89.878  52.370 11.538  1.00 17.36 ? 78  ALA A CA    1 
ATOM   641  C  C     . ALA A 1 81  ? 88.677  53.181 11.082  1.00 17.81 ? 78  ALA A C     1 
ATOM   642  O  O     . ALA A 1 81  ? 87.532  52.792 11.310  1.00 21.13 ? 78  ALA A O     1 
ATOM   643  C  CB    . ALA A 1 81  ? 90.158  51.196 10.570  1.00 20.71 ? 78  ALA A CB    1 
ATOM   644  N  N     . GLN A 1 82  ? 88.943  54.315 10.449  1.00 15.01 ? 79  GLN A N     1 
ATOM   645  C  CA    . GLN A 1 82  ? 87.908  55.227 10.003  1.00 16.89 ? 79  GLN A CA    1 
ATOM   646  C  C     . GLN A 1 82  ? 87.633  55.068 8.522   1.00 22.09 ? 79  GLN A C     1 
ATOM   647  O  O     . GLN A 1 82  ? 88.555  54.960 7.707   1.00 18.81 ? 79  GLN A O     1 
ATOM   648  C  CB    . GLN A 1 82  ? 88.309  56.675 10.274  1.00 22.43 ? 79  GLN A CB    1 
ATOM   649  C  CG    . GLN A 1 82  ? 88.670  56.929 11.685  0.51 26.75 ? 79  GLN A CG    1 
ATOM   650  C  CD    . GLN A 1 82  ? 88.842  58.390 11.919  0.33 29.71 ? 79  GLN A CD    1 
ATOM   651  O  OE1   . GLN A 1 82  ? 87.904  59.173 11.776  0.54 29.39 ? 79  GLN A OE1   1 
ATOM   652  N  NE2   . GLN A 1 82  ? 90.052  58.780 12.235  0.80 27.00 ? 79  GLN A NE2   1 
ATOM   653  N  N     . VAL A 1 83  ? 86.350  55.072 8.184   1.00 17.56 ? 80  VAL A N     1 
ATOM   654  C  CA    . VAL A 1 83  ? 85.941  55.084 6.795   1.00 17.78 ? 80  VAL A CA    1 
ATOM   655  C  C     . VAL A 1 83  ? 86.371  56.400 6.164   1.00 22.01 ? 80  VAL A C     1 
ATOM   656  O  O     . VAL A 1 83  ? 86.289  57.466 6.789   1.00 17.91 ? 80  VAL A O     1 
ATOM   657  C  CB    . VAL A 1 83  ? 84.420  54.884 6.711   1.00 22.41 ? 80  VAL A CB    1 
ATOM   658  C  CG1   . VAL A 1 83  ? 83.892  55.265 5.357   1.00 24.59 ? 80  VAL A CG1   1 
ATOM   659  C  CG2   . VAL A 1 83  ? 84.057  53.423 7.067   1.00 25.33 ? 80  VAL A CG2   1 
ATOM   660  N  N     . ARG A 1 84  ? 86.848  56.328 4.929   1.00 18.33 ? 81  ARG A N     1 
ATOM   661  C  CA    . ARG A 1 84  ? 87.193  57.538 4.192   1.00 20.03 ? 81  ARG A CA    1 
ATOM   662  C  C     . ARG A 1 84  ? 85.990  58.467 4.140   1.00 20.61 ? 81  ARG A C     1 
ATOM   663  O  O     . ARG A 1 84  ? 84.844  58.023 4.068   1.00 18.03 ? 81  ARG A O     1 
ATOM   664  C  CB    . ARG A 1 84  ? 87.652  57.173 2.780   1.00 21.09 ? 81  ARG A CB    1 
ATOM   665  C  CG    . ARG A 1 84  ? 87.975  58.333 1.846   1.00 25.83 ? 81  ARG A CG    1 
ATOM   666  C  CD    . ARG A 1 84  ? 88.370  57.799 0.462   1.00 35.16 ? 81  ARG A CD    1 
ATOM   667  N  NE    . ARG A 1 84  ? 89.432  56.793 0.566   0.47 43.78 ? 81  ARG A NE    1 
ATOM   668  C  CZ    . ARG A 1 84  ? 89.349  55.541 0.119   0.26 34.17 ? 81  ARG A CZ    1 
ATOM   669  N  NH1   . ARG A 1 84  ? 88.256  55.111 -0.492  0.82 30.73 ? 81  ARG A NH1   1 
ATOM   670  N  NH2   . ARG A 1 84  ? 90.370  54.711 0.286   0.97 40.26 ? 81  ARG A NH2   1 
ATOM   671  N  N     . GLU A 1 85  ? 86.257  59.759 4.232   1.00 20.25 ? 82  GLU A N     1 
ATOM   672  C  CA    . GLU A 1 85  ? 85.238  60.784 4.107   1.00 21.57 ? 82  GLU A CA    1 
ATOM   673  C  C     . GLU A 1 85  ? 85.588  61.642 2.901   1.00 24.35 ? 82  GLU A C     1 
ATOM   674  O  O     . GLU A 1 85  ? 86.746  62.037 2.740   1.00 24.19 ? 82  GLU A O     1 
ATOM   675  C  CB    . GLU A 1 85  ? 85.187  61.624 5.377   1.00 25.57 ? 82  GLU A CB    1 
ATOM   676  C  CG    . GLU A 1 85  ? 83.807  61.930 5.866   1.00 37.00 ? 82  GLU A CG    1 
ATOM   677  C  CD    . GLU A 1 85  ? 83.850  62.654 7.188   1.00 39.11 ? 82  GLU A CD    1 
ATOM   678  O  OE1   . GLU A 1 85  ? 84.180  61.992 8.193   1.00 44.49 ? 82  GLU A OE1   1 
ATOM   679  O  OE2   . GLU A 1 85  ? 83.580  63.878 7.204   1.00 39.71 ? 82  GLU A OE2   1 
ATOM   680  N  N     . SER A 1 86  ? 84.613  61.880 2.032   1.00 19.31 ? 83  SER A N     1 
ATOM   681  C  CA    . SER A 1 86  ? 84.826  62.713 0.856   1.00 24.09 ? 83  SER A CA    1 
ATOM   682  C  C     . SER A 1 86  ? 83.622  63.626 0.703   1.00 23.93 ? 83  SER A C     1 
ATOM   683  O  O     . SER A 1 86  ? 82.482  63.166 0.798   1.00 20.53 ? 83  SER A O     1 
ATOM   684  C  CB    . SER A 1 86  ? 85.029  61.873 -0.409  1.00 28.44 ? 83  SER A CB    1 
ATOM   685  O  OG    . SER A 1 86  ? 86.048  60.910 -0.199  1.00 36.92 ? 83  SER A OG    1 
ATOM   686  N  N     . ARG A 1 87  ? 83.883  64.921 0.518   1.00 22.94 ? 84  ARG A N     1 
ATOM   687  C  CA    . ARG A 1 87  ? 82.815  65.920 0.389   1.00 26.42 ? 84  ARG A CA    1 
ATOM   688  C  C     . ARG A 1 87  ? 81.840  65.864 1.559   1.00 25.48 ? 84  ARG A C     1 
ATOM   689  O  O     . ARG A 1 87  ? 80.637  66.099 1.405   1.00 28.66 ? 84  ARG A O     1 
ATOM   690  C  CB    . ARG A 1 87  ? 82.077  65.737 -0.931  1.00 26.28 ? 84  ARG A CB    1 
ATOM   691  C  CG    . ARG A 1 87  ? 82.957  65.982 -2.123  1.00 26.03 ? 84  ARG A CG    1 
ATOM   692  C  CD    . ARG A 1 87  ? 82.164  65.922 -3.399  1.00 33.55 ? 84  ARG A CD    1 
ATOM   693  N  NE    . ARG A 1 87  ? 82.700  64.880 -4.272  1.00 45.89 ? 84  ARG A NE    1 
ATOM   694  C  CZ    . ARG A 1 87  ? 83.469  65.122 -5.327  1.00 36.57 ? 84  ARG A CZ    1 
ATOM   695  N  NH1   . ARG A 1 87  ? 83.929  64.116 -6.068  1.00 49.25 ? 84  ARG A NH1   1 
ATOM   696  N  NH2   . ARG A 1 87  ? 83.772  66.373 -5.632  1.00 44.51 ? 84  ARG A NH2   1 
ATOM   697  N  N     . GLY A 1 88  ? 82.348  65.544 2.741   1.00 23.64 ? 85  GLY A N     1 
ATOM   698  C  CA    . GLY A 1 88  ? 81.537  65.557 3.941   1.00 24.75 ? 85  GLY A CA    1 
ATOM   699  C  C     . GLY A 1 88  ? 80.702  64.324 4.157   1.00 23.63 ? 85  GLY A C     1 
ATOM   700  O  O     . GLY A 1 88  ? 79.873  64.308 5.073   1.00 23.80 ? 85  GLY A O     1 
ATOM   701  N  N     . LYS A 1 89  ? 80.864  63.296 3.340   1.00 19.80 ? 86  LYS A N     1 
ATOM   702  C  CA    . LYS A 1 89  ? 80.090  62.090 3.554   1.00 21.55 ? 86  LYS A CA    1 
ATOM   703  C  C     . LYS A 1 89  ? 81.003  60.881 3.537   1.00 22.94 ? 86  LYS A C     1 
ATOM   704  O  O     . LYS A 1 89  ? 82.106  60.897 2.975   1.00 21.77 ? 86  LYS A O     1 
ATOM   705  C  CB    . LYS A 1 89  ? 78.961  61.908 2.525   1.00 23.09 ? 86  LYS A CB    1 
ATOM   706  C  CG    . LYS A 1 89  ? 79.417  61.720 1.104   1.00 30.22 ? 86  LYS A CG    1 
ATOM   707  C  CD    . LYS A 1 89  ? 78.217  61.487 0.201   1.00 33.25 ? 86  LYS A CD    1 
ATOM   708  C  CE    . LYS A 1 89  ? 77.388  60.302 0.703   1.00 28.80 ? 86  LYS A CE    1 
ATOM   709  N  NZ    . LYS A 1 89  ? 78.173  59.033 0.546   0.77 20.34 ? 86  LYS A NZ    1 
ATOM   710  N  N     . ALA A 1 90  ? 80.503  59.821 4.155   1.00 21.24 ? 87  ALA A N     1 
ATOM   711  C  CA    . ALA A 1 90  ? 81.257  58.585 4.208   1.00 19.43 ? 87  ALA A CA    1 
ATOM   712  C  C     . ALA A 1 90  ? 81.369  58.014 2.803   1.00 25.11 ? 87  ALA A C     1 
ATOM   713  O  O     . ALA A 1 90  ? 80.417  58.045 2.016   1.00 25.62 ? 87  ALA A O     1 
ATOM   714  C  CB    . ALA A 1 90  ? 80.586  57.600 5.160   1.00 26.56 ? 87  ALA A CB    1 
ATOM   715  N  N     . ASN A 1 91  ? 82.556  57.524 2.482   1.00 22.66 ? 88  ASN A N     1 
ATOM   716  C  CA    . ASN A 1 91  ? 82.903  57.069 1.143   1.00 20.34 ? 88  ASN A CA    1 
ATOM   717  C  C     . ASN A 1 91  ? 83.329  55.614 1.272   1.00 21.34 ? 88  ASN A C     1 
ATOM   718  O  O     . ASN A 1 91  ? 84.409  55.325 1.794   1.00 20.63 ? 88  ASN A O     1 
ATOM   719  C  CB    . ASN A 1 91  ? 84.023  57.937 0.571   1.00 21.05 ? 88  ASN A CB    1 
ATOM   720  C  CG    . ASN A 1 91  ? 84.447  57.523 -0.824  1.00 27.90 ? 88  ASN A CG    1 
ATOM   721  O  OD1   . ASN A 1 91  ? 84.128  56.439 -1.298  1.00 27.31 ? 88  ASN A OD1   1 
ATOM   722  N  ND2   . ASN A 1 91  ? 85.201  58.397 -1.485  1.00 37.75 ? 88  ASN A ND2   1 
ATOM   723  N  N     . LEU A 1 92  ? 82.496  54.706 0.777   1.00 22.49 ? 89  LEU A N     1 
ATOM   724  C  CA    . LEU A 1 92  ? 82.692  53.276 0.976   1.00 19.89 ? 89  LEU A CA    1 
ATOM   725  C  C     . LEU A 1 92  ? 83.403  52.615 -0.197  1.00 18.64 ? 89  LEU A C     1 
ATOM   726  O  O     . LEU A 1 92  ? 83.374  51.384 -0.313  1.00 16.95 ? 89  LEU A O     1 
ATOM   727  C  CB    . LEU A 1 92  ? 81.341  52.608 1.234   1.00 19.12 ? 89  LEU A CB    1 
ATOM   728  C  CG    . LEU A 1 92  ? 80.565  53.213 2.403   1.00 22.36 ? 89  LEU A CG    1 
ATOM   729  C  CD1   . LEU A 1 92  ? 79.196  52.552 2.534   1.00 31.96 ? 89  LEU A CD1   1 
ATOM   730  C  CD2   . LEU A 1 92  ? 81.377  53.051 3.672   1.00 17.89 ? 89  LEU A CD2   1 
ATOM   731  N  N     . THR A 1 93  ? 84.055  53.411 -1.052  1.00 19.98 ? 90  THR A N     1 
ATOM   732  C  CA    . THR A 1 93  ? 84.669  52.894 -2.278  1.00 18.87 ? 90  THR A CA    1 
ATOM   733  C  C     . THR A 1 93  ? 85.647  51.756 -2.008  1.00 20.37 ? 90  THR A C     1 
ATOM   734  O  O     . THR A 1 93  ? 85.682  50.766 -2.753  1.00 20.38 ? 90  THR A O     1 
ATOM   735  C  CB    . THR A 1 93  ? 85.386  54.032 -3.006  1.00 27.38 ? 90  THR A CB    1 
ATOM   736  O  OG1   . THR A 1 93  ? 84.416  55.001 -3.421  1.00 30.44 ? 90  THR A OG1   1 
ATOM   737  C  CG2   . THR A 1 93  ? 86.148  53.506 -4.226  1.00 25.00 ? 90  THR A CG2   1 
ATOM   738  N  N     . LYS A 1 94  ? 86.456  51.881 -0.957  1.00 15.36 ? 91  LYS A N     1 
ATOM   739  C  CA    . LYS A 1 94  ? 87.432  50.834 -0.639  1.00 18.19 ? 91  LYS A CA    1 
ATOM   740  C  C     . LYS A 1 94  ? 86.760  49.477 -0.458  1.00 19.08 ? 91  LYS A C     1 
ATOM   741  O  O     . LYS A 1 94  ? 87.280  48.451 -0.919  1.00 18.87 ? 91  LYS A O     1 
ATOM   742  C  CB    . LYS A 1 94  ? 88.199  51.206 0.628   1.00 17.77 ? 91  LYS A CB    1 
ATOM   743  C  CG    . LYS A 1 94  ? 89.352  50.258 0.944   1.00 18.38 ? 91  LYS A CG    1 
ATOM   744  C  CD    . LYS A 1 94  ? 89.916  50.440 2.375   1.00 17.55 ? 91  LYS A CD    1 
ATOM   745  C  CE    . LYS A 1 94  ? 90.410  51.839 2.610   1.00 24.83 ? 91  LYS A CE    1 
ATOM   746  N  NZ    . LYS A 1 94  ? 91.055  51.953 3.947   1.00 18.23 ? 91  LYS A NZ    1 
ATOM   747  N  N     . TYR A 1 95  ? 85.598  49.456 0.210   1.00 18.54 ? 92  TYR A N     1 
ATOM   748  C  CA    . TYR A 1 95  ? 84.917  48.205 0.524   1.00 17.17 ? 92  TYR A CA    1 
ATOM   749  C  C     . TYR A 1 95  ? 84.160  47.659 -0.679  1.00 15.98 ? 92  TYR A C     1 
ATOM   750  O  O     . TYR A 1 95  ? 84.104  46.436 -0.861  1.00 17.74 ? 92  TYR A O     1 
ATOM   751  C  CB    . TYR A 1 95  ? 83.991  48.405 1.737   1.00 14.47 ? 92  TYR A CB    1 
ATOM   752  C  CG    . TYR A 1 95  ? 84.719  49.182 2.808   1.00 14.23 ? 92  TYR A CG    1 
ATOM   753  C  CD1   . TYR A 1 95  ? 85.773  48.608 3.509   1.00 13.99 ? 92  TYR A CD1   1 
ATOM   754  C  CD2   . TYR A 1 95  ? 84.416  50.514 3.049   1.00 17.49 ? 92  TYR A CD2   1 
ATOM   755  C  CE1   . TYR A 1 95  ? 86.471  49.325 4.435   1.00 14.42 ? 92  TYR A CE1   1 
ATOM   756  C  CE2   . TYR A 1 95  ? 85.111  51.249 3.981   1.00 17.59 ? 92  TYR A CE2   1 
ATOM   757  C  CZ    . TYR A 1 95  ? 86.153  50.655 4.658   1.00 19.46 ? 92  TYR A CZ    1 
ATOM   758  O  OH    . TYR A 1 95  ? 86.850  51.386 5.586   1.00 18.74 ? 92  TYR A OH    1 
ATOM   759  N  N     . ARG A 1 96  ? 83.602  48.537 -1.524  1.00 18.99 ? 93  ARG A N     1 
ATOM   760  C  CA    A ARG A 1 96  ? 82.983  48.070 -2.762  0.45 19.15 ? 93  ARG A CA    1 
ATOM   761  C  CA    B ARG A 1 96  ? 82.986  48.069 -2.764  0.55 19.14 ? 93  ARG A CA    1 
ATOM   762  C  C     . ARG A 1 96  ? 84.020  47.447 -3.692  1.00 18.80 ? 93  ARG A C     1 
ATOM   763  O  O     . ARG A 1 96  ? 83.741  46.441 -4.353  1.00 20.91 ? 93  ARG A O     1 
ATOM   764  C  CB    A ARG A 1 96  ? 82.259  49.222 -3.463  0.45 21.78 ? 93  ARG A CB    1 
ATOM   765  C  CB    B ARG A 1 96  ? 82.272  49.212 -3.479  0.55 21.78 ? 93  ARG A CB    1 
ATOM   766  C  CG    A ARG A 1 96  ? 81.129  49.854 -2.650  0.45 20.72 ? 93  ARG A CG    1 
ATOM   767  C  CG    B ARG A 1 96  ? 81.030  49.692 -2.773  0.55 20.64 ? 93  ARG A CG    1 
ATOM   768  C  CD    A ARG A 1 96  ? 80.358  50.890 -3.484  0.45 26.27 ? 93  ARG A CD    1 
ATOM   769  C  CD    B ARG A 1 96  ? 80.284  50.716 -3.623  0.55 26.44 ? 93  ARG A CD    1 
ATOM   770  N  NE    A ARG A 1 96  ? 81.244  51.877 -4.095  0.45 24.06 ? 93  ARG A NE    1 
ATOM   771  N  NE    B ARG A 1 96  ? 79.315  51.428 -2.805  0.55 27.49 ? 93  ARG A NE    1 
ATOM   772  C  CZ    A ARG A 1 96  ? 81.279  53.171 -3.780  0.45 29.46 ? 93  ARG A CZ    1 
ATOM   773  C  CZ    B ARG A 1 96  ? 79.539  52.614 -2.251  0.55 20.52 ? 93  ARG A CZ    1 
ATOM   774  N  NH1   A ARG A 1 96  ? 80.462  53.667 -2.854  0.45 25.06 ? 93  ARG A NH1   1 
ATOM   775  N  NH1   B ARG A 1 96  ? 80.679  53.250 -2.447  0.55 27.87 ? 93  ARG A NH1   1 
ATOM   776  N  NH2   A ARG A 1 96  ? 82.134  53.977 -4.400  0.45 21.32 ? 93  ARG A NH2   1 
ATOM   777  N  NH2   B ARG A 1 96  ? 78.611  53.173 -1.511  0.55 24.92 ? 93  ARG A NH2   1 
ATOM   778  N  N     . GLU A 1 97  ? 85.215  48.042 -3.764  1.00 17.24 ? 94  GLU A N     1 
ATOM   779  C  CA    . GLU A 1 97  ? 86.280  47.475 -4.586  1.00 19.57 ? 94  GLU A CA    1 
ATOM   780  C  C     . GLU A 1 97  ? 86.759  46.137 -4.032  1.00 19.09 ? 94  GLU A C     1 
ATOM   781  O  O     . GLU A 1 97  ? 86.981  45.193 -4.800  1.00 20.02 ? 94  GLU A O     1 
ATOM   782  C  CB    . GLU A 1 97  ? 87.428  48.473 -4.717  1.00 25.64 ? 94  GLU A CB    1 
ATOM   783  C  CG    . GLU A 1 97  ? 87.038  49.627 -5.632  1.00 21.81 ? 94  GLU A CG    1 
ATOM   784  C  CD    . GLU A 1 97  ? 88.093  50.710 -5.763  1.00 37.98 ? 94  GLU A CD    1 
ATOM   785  O  OE1   . GLU A 1 97  ? 89.174  50.599 -5.146  1.00 42.79 ? 94  GLU A OE1   1 
ATOM   786  O  OE2   . GLU A 1 97  ? 87.827  51.683 -6.503  1.00 41.77 ? 94  GLU A OE2   1 
ATOM   787  N  N     . ALA A 1 98  ? 86.905  46.020 -2.714  1.00 17.49 ? 95  ALA A N     1 
ATOM   788  C  CA    . ALA A 1 98  ? 87.268  44.713 -2.153  1.00 19.68 ? 95  ALA A CA    1 
ATOM   789  C  C     . ALA A 1 98  ? 86.165  43.686 -2.407  1.00 17.11 ? 95  ALA A C     1 
ATOM   790  O  O     . ALA A 1 98  ? 86.445  42.501 -2.623  1.00 21.76 ? 95  ALA A O     1 
ATOM   791  C  CB    . ALA A 1 98  ? 87.558  44.845 -0.655  1.00 16.81 ? 95  ALA A CB    1 
ATOM   792  N  N     . SER A 1 99  ? 84.905  44.128 -2.381  1.00 16.65 ? 96  SER A N     1 
ATOM   793  C  CA    . SER A 1 99  ? 83.778  43.256 -2.710  1.00 17.17 ? 96  SER A CA    1 
ATOM   794  C  C     . SER A 1 99  ? 83.907  42.696 -4.120  1.00 17.22 ? 96  SER A C     1 
ATOM   795  O  O     . SER A 1 99  ? 83.665  41.507 -4.360  1.00 16.41 ? 96  SER A O     1 
ATOM   796  C  CB    . SER A 1 99  ? 82.475  44.050 -2.577  1.00 18.33 ? 96  SER A CB    1 
ATOM   797  O  OG    . SER A 1 99  ? 81.369  43.268 -2.931  1.00 29.91 ? 96  SER A OG    1 
ATOM   798  N  N     . VAL A 1 100 ? 84.251  43.558 -5.074  1.00 20.15 ? 97  VAL A N     1 
ATOM   799  C  CA    . VAL A 1 100 ? 84.443  43.118 -6.453  1.00 19.61 ? 97  VAL A CA    1 
ATOM   800  C  C     . VAL A 1 100 ? 85.557  42.074 -6.539  1.00 19.58 ? 97  VAL A C     1 
ATOM   801  O  O     . VAL A 1 100 ? 85.436  41.087 -7.274  1.00 22.86 ? 97  VAL A O     1 
ATOM   802  C  CB    . VAL A 1 100 ? 84.710  44.340 -7.357  1.00 22.60 ? 97  VAL A CB    1 
ATOM   803  C  CG1   . VAL A 1 100 ? 85.235  43.905 -8.730  1.00 23.31 ? 97  VAL A CG1   1 
ATOM   804  C  CG2   . VAL A 1 100 ? 83.441  45.171 -7.506  1.00 21.74 ? 97  VAL A CG2   1 
ATOM   805  N  N     . GLU A 1 101 ? 86.649  42.255 -5.778  1.00 18.85 ? 98  GLU A N     1 
ATOM   806  C  CA    . GLU A 1 101 ? 87.699  41.232 -5.745  1.00 16.82 ? 98  GLU A CA    1 
ATOM   807  C  C     . GLU A 1 101 ? 87.106  39.859 -5.447  1.00 18.63 ? 98  GLU A C     1 
ATOM   808  O  O     . GLU A 1 101 ? 87.429  38.860 -6.108  1.00 18.19 ? 98  GLU A O     1 
ATOM   809  C  CB    . GLU A 1 101 ? 88.753  41.538 -4.672  1.00 21.46 ? 98  GLU A CB    1 
ATOM   810  C  CG    . GLU A 1 101 ? 89.755  42.629 -4.959  1.00 22.87 ? 98  GLU A CG    1 
ATOM   811  C  CD    . GLU A 1 101 ? 90.735  42.812 -3.800  1.00 22.22 ? 98  GLU A CD    1 
ATOM   812  O  OE1   . GLU A 1 101 ? 91.596  41.920 -3.581  1.00 21.88 ? 98  GLU A OE1   1 
ATOM   813  O  OE2   . GLU A 1 101 ? 90.634  43.847 -3.102  1.00 25.98 ? 98  GLU A OE2   1 
ATOM   814  N  N     . VAL A 1 102 ? 86.266  39.797 -4.415  1.00 15.86 ? 99  VAL A N     1 
ATOM   815  C  CA    . VAL A 1 102 ? 85.694  38.523 -3.977  1.00 19.84 ? 99  VAL A CA    1 
ATOM   816  C  C     . VAL A 1 102 ? 84.696  37.995 -4.994  1.00 15.42 ? 99  VAL A C     1 
ATOM   817  O  O     . VAL A 1 102 ? 84.731  36.810 -5.359  1.00 16.97 ? 99  VAL A O     1 
ATOM   818  C  CB    . VAL A 1 102 ? 85.041  38.676 -2.593  1.00 13.84 ? 99  VAL A CB    1 
ATOM   819  C  CG1   . VAL A 1 102 ? 84.299  37.374 -2.235  1.00 19.26 ? 99  VAL A CG1   1 
ATOM   820  C  CG2   . VAL A 1 102 ? 86.136  38.985 -1.556  1.00 16.01 ? 99  VAL A CG2   1 
ATOM   821  N  N     . MET A 1 103 ? 83.774  38.857 -5.450  1.00 17.98 ? 100 MET A N     1 
ATOM   822  C  CA    . MET A 1 103 ? 82.731  38.407 -6.376  1.00 17.12 ? 100 MET A CA    1 
ATOM   823  C  C     . MET A 1 103 ? 83.327  37.882 -7.672  1.00 20.38 ? 100 MET A C     1 
ATOM   824  O  O     . MET A 1 103 ? 82.774  36.959 -8.282  1.00 20.14 ? 100 MET A O     1 
ATOM   825  C  CB    . MET A 1 103 ? 81.750  39.538 -6.701  1.00 21.33 ? 100 MET A CB    1 
ATOM   826  C  CG    . MET A 1 103 ? 81.152  40.252 -5.519  1.00 29.74 ? 100 MET A CG    1 
ATOM   827  S  SD    . MET A 1 103 ? 79.842  39.273 -4.773  1.00 33.89 ? 100 MET A SD    1 
ATOM   828  C  CE    . MET A 1 103 ? 79.319  40.328 -3.436  1.00 22.97 ? 100 MET A CE    1 
ATOM   829  N  N     . GLU A 1 104 ? 84.438  38.472 -8.124  1.00 18.75 ? 101 GLU A N     1 
ATOM   830  C  CA    . GLU A 1 104 ? 85.034  38.013 -9.375  1.00 21.72 ? 101 GLU A CA    1 
ATOM   831  C  C     . GLU A 1 104 ? 85.637  36.626 -9.223  1.00 22.25 ? 101 GLU A C     1 
ATOM   832  O  O     . GLU A 1 104 ? 85.568  35.814 -10.155 1.00 20.54 ? 101 GLU A O     1 
ATOM   833  C  CB    . GLU A 1 104 ? 86.087  39.018 -9.862  1.00 23.26 ? 101 GLU A CB    1 
ATOM   834  C  CG    . GLU A 1 104 ? 85.475  40.339 -10.277 1.00 30.54 ? 101 GLU A CG    1 
ATOM   835  C  CD    . GLU A 1 104 ? 86.467  41.293 -10.923 1.00 42.72 ? 101 GLU A CD    1 
ATOM   836  O  OE1   . GLU A 1 104 ? 87.693  41.152 -10.690 1.00 38.81 ? 101 GLU A OE1   1 
ATOM   837  O  OE2   . GLU A 1 104 ? 86.003  42.187 -11.664 1.00 49.18 ? 101 GLU A OE2   1 
ATOM   838  N  N     . ILE A 1 105 ? 86.202  36.326 -8.054  1.00 20.32 ? 102 ILE A N     1 
ATOM   839  C  CA    . ILE A 1 105 ? 86.677  34.972 -7.773  1.00 15.22 ? 102 ILE A CA    1 
ATOM   840  C  C     . ILE A 1 105 ? 85.515  33.983 -7.758  1.00 19.51 ? 102 ILE A C     1 
ATOM   841  O  O     . ILE A 1 105 ? 85.569  32.929 -8.409  1.00 21.42 ? 102 ILE A O     1 
ATOM   842  C  CB    . ILE A 1 105 ? 87.463  34.955 -6.448  1.00 15.46 ? 102 ILE A CB    1 
ATOM   843  C  CG1   . ILE A 1 105 ? 88.727  35.797 -6.597  1.00 21.96 ? 102 ILE A CG1   1 
ATOM   844  C  CG2   . ILE A 1 105 ? 87.888  33.516 -6.029  1.00 17.26 ? 102 ILE A CG2   1 
ATOM   845  C  CD1   . ILE A 1 105 ? 89.383  36.102 -5.270  1.00 20.48 ? 102 ILE A CD1   1 
ATOM   846  N  N     . MET A 1 106 ? 84.450  34.300 -7.012  1.00 18.67 ? 103 MET A N     1 
ATOM   847  C  CA    . MET A 1 106 ? 83.301  33.393 -6.936  1.00 21.53 ? 103 MET A CA    1 
ATOM   848  C  C     . MET A 1 106 ? 82.711  33.121 -8.315  1.00 20.23 ? 103 MET A C     1 
ATOM   849  O  O     . MET A 1 106 ? 82.328  31.985 -8.623  1.00 19.90 ? 103 MET A O     1 
ATOM   850  C  CB    . MET A 1 106 ? 82.218  33.961 -6.014  1.00 22.85 ? 103 MET A CB    1 
ATOM   851  C  CG    . MET A 1 106 ? 82.591  33.986 -4.518  1.00 21.66 ? 103 MET A CG    1 
ATOM   852  S  SD    . MET A 1 106 ? 81.284  34.750 -3.535  1.00 22.52 ? 103 MET A SD    1 
ATOM   853  C  CE    . MET A 1 106 ? 79.943  33.597 -3.829  1.00 25.70 ? 103 MET A CE    1 
ATOM   854  N  N     . SER A 1 107 ? 82.638  34.149 -9.167  1.00 20.95 ? 104 SER A N     1 
ATOM   855  C  CA    A SER A 1 107 ? 82.106  33.980 -10.513 0.62 22.06 ? 104 SER A CA    1 
ATOM   856  C  CA    B SER A 1 107 ? 82.081  33.950 -10.498 0.38 22.10 ? 104 SER A CA    1 
ATOM   857  C  C     . SER A 1 107 ? 82.900  32.980 -11.346 1.00 25.96 ? 104 SER A C     1 
ATOM   858  O  O     . SER A 1 107 ? 82.410  32.539 -12.392 1.00 27.74 ? 104 SER A O     1 
ATOM   859  C  CB    A SER A 1 107 ? 82.067  35.327 -11.236 0.62 24.26 ? 104 SER A CB    1 
ATOM   860  C  CB    B SER A 1 107 ? 81.946  35.292 -11.222 0.38 24.30 ? 104 SER A CB    1 
ATOM   861  O  OG    A SER A 1 107 ? 81.198  36.214 -10.572 0.62 26.49 ? 104 SER A OG    1 
ATOM   862  O  OG    B SER A 1 107 ? 83.207  35.757 -11.657 0.38 25.93 ? 104 SER A OG    1 
ATOM   863  N  N     . ARG A 1 108 ? 84.126  32.621 -10.933 1.00 20.84 ? 105 ARG A N     1 
ATOM   864  C  CA    . ARG A 1 108 ? 84.839  31.602 -11.702 1.00 20.97 ? 105 ARG A CA    1 
ATOM   865  C  C     . ARG A 1 108 ? 84.235  30.221 -11.512 1.00 29.67 ? 105 ARG A C     1 
ATOM   866  O  O     . ARG A 1 108 ? 84.453  29.333 -12.343 1.00 26.38 ? 105 ARG A O     1 
ATOM   867  C  CB    . ARG A 1 108 ? 86.322  31.541 -11.324 1.00 23.61 ? 105 ARG A CB    1 
ATOM   868  C  CG    . ARG A 1 108 ? 87.052  32.857 -11.466 1.00 23.22 ? 105 ARG A CG    1 
ATOM   869  C  CD    . ARG A 1 108 ? 88.525  32.633 -11.733 1.00 34.20 ? 105 ARG A CD    1 
ATOM   870  N  NE    . ARG A 1 108 ? 89.165  31.813 -10.713 1.00 35.04 ? 105 ARG A NE    1 
ATOM   871  C  CZ    . ARG A 1 108 ? 89.944  32.300 -9.752  1.00 31.06 ? 105 ARG A CZ    1 
ATOM   872  N  NH1   . ARG A 1 108 ? 90.175  33.601 -9.690  1.00 29.01 ? 105 ARG A NH1   1 
ATOM   873  N  NH2   . ARG A 1 108 ? 90.494  31.485 -8.867  1.00 31.12 ? 105 ARG A NH2   1 
ATOM   874  N  N     . PHE A 1 109 ? 83.503  30.017 -10.426 1.00 23.44 ? 106 PHE A N     1 
ATOM   875  C  CA    . PHE A 1 109 ? 83.009  28.696 -10.075 1.00 25.50 ? 106 PHE A CA    1 
ATOM   876  C  C     . PHE A 1 109 ? 81.572  28.470 -10.501 1.00 31.47 ? 106 PHE A C     1 
ATOM   877  O  O     . PHE A 1 109 ? 81.216  27.344 -10.861 1.00 34.24 ? 106 PHE A O     1 
ATOM   878  C  CB    . PHE A 1 109 ? 83.132  28.484 -8.566  1.00 24.09 ? 106 PHE A CB    1 
ATOM   879  C  CG    . PHE A 1 109 ? 84.541  28.440 -8.072  1.00 22.59 ? 106 PHE A CG    1 
ATOM   880  C  CD1   . PHE A 1 109 ? 85.239  29.609 -7.798  1.00 19.07 ? 106 PHE A CD1   1 
ATOM   881  C  CD2   . PHE A 1 109 ? 85.176  27.224 -7.872  1.00 25.70 ? 106 PHE A CD2   1 
ATOM   882  C  CE1   . PHE A 1 109 ? 86.541  29.562 -7.329  1.00 22.94 ? 106 PHE A CE1   1 
ATOM   883  C  CE2   . PHE A 1 109 ? 86.469  27.172 -7.406  1.00 23.00 ? 106 PHE A CE2   1 
ATOM   884  C  CZ    . PHE A 1 109 ? 87.156  28.342 -7.132  1.00 25.30 ? 106 PHE A CZ    1 
ATOM   885  N  N     . ALA A 1 110 ? 80.751  29.511 -10.499 1.00 26.08 ? 107 ALA A N     1 
ATOM   886  C  CA    . ALA A 1 110 ? 79.339  29.369 -10.819 1.00 31.34 ? 107 ALA A CA    1 
ATOM   887  C  C     . ALA A 1 110 ? 78.744  30.757 -10.969 1.00 33.57 ? 107 ALA A C     1 
ATOM   888  O  O     . ALA A 1 110 ? 79.366  31.759 -10.613 1.00 29.85 ? 107 ALA A O     1 
ATOM   889  C  CB    . ALA A 1 110 ? 78.593  28.582 -9.742  1.00 31.07 ? 107 ALA A CB    1 
ATOM   890  N  N     . VAL A 1 111 ? 77.513  30.796 -11.486 1.00 34.24 ? 108 VAL A N     1 
ATOM   891  C  CA    . VAL A 1 111 ? 76.765  32.043 -11.553 1.00 33.42 ? 108 VAL A CA    1 
ATOM   892  C  C     . VAL A 1 111 ? 76.390  32.481 -10.142 1.00 27.24 ? 108 VAL A C     1 
ATOM   893  O  O     . VAL A 1 111 ? 75.961  31.666 -9.310  1.00 30.10 ? 108 VAL A O     1 
ATOM   894  C  CB    . VAL A 1 111 ? 75.515  31.873 -12.434 1.00 48.24 ? 108 VAL A CB    1 
ATOM   895  N  N     . ILE A 1 112 ? 76.565  33.772 -9.855  1.00 31.44 ? 109 ILE A N     1 
ATOM   896  C  CA    . ILE A 1 112 ? 76.287  34.275 -8.517  1.00 27.66 ? 109 ILE A CA    1 
ATOM   897  C  C     . ILE A 1 112 ? 75.221  35.354 -8.581  1.00 19.72 ? 109 ILE A C     1 
ATOM   898  O  O     . ILE A 1 112 ? 75.022  36.023 -9.603  1.00 23.29 ? 109 ILE A O     1 
ATOM   899  C  CB    . ILE A 1 112 ? 77.563  34.804 -7.812  1.00 27.48 ? 109 ILE A CB    1 
ATOM   900  C  CG1   . ILE A 1 112 ? 77.940  36.180 -8.339  1.00 27.81 ? 109 ILE A CG1   1 
ATOM   901  C  CG2   . ILE A 1 112 ? 78.707  33.786 -7.961  1.00 25.83 ? 109 ILE A CG2   1 
ATOM   902  C  CD1   . ILE A 1 112 ? 79.064  36.856 -7.550  1.00 33.43 ? 109 ILE A CD1   1 
ATOM   903  N  N     . GLU A 1 113 ? 74.497  35.487 -7.479  1.00 17.40 ? 110 GLU A N     1 
ATOM   904  C  CA    . GLU A 1 113 ? 73.602  36.602 -7.231  1.00 21.16 ? 110 GLU A CA    1 
ATOM   905  C  C     . GLU A 1 113 ? 74.205  37.433 -6.108  1.00 19.82 ? 110 GLU A C     1 
ATOM   906  O  O     . GLU A 1 113 ? 74.290  36.965 -4.966  1.00 19.95 ? 110 GLU A O     1 
ATOM   907  C  CB    . GLU A 1 113 ? 72.205  36.130 -6.836  1.00 19.92 ? 110 GLU A CB    1 
ATOM   908  C  CG    . GLU A 1 113 ? 71.288  37.293 -6.460  1.00 20.30 ? 110 GLU A CG    1 
ATOM   909  C  CD    . GLU A 1 113 ? 69.902  36.841 -6.044  1.00 29.32 ? 110 GLU A CD    1 
ATOM   910  O  OE1   . GLU A 1 113 ? 69.560  35.664 -6.293  1.00 26.55 ? 110 GLU A OE1   1 
ATOM   911  O  OE2   . GLU A 1 113 ? 69.169  37.659 -5.451  1.00 29.05 ? 110 GLU A OE2   1 
ATOM   912  N  N     . ARG A 1 114 ? 74.623  38.659 -6.427  1.00 19.48 ? 111 ARG A N     1 
ATOM   913  C  CA    . ARG A 1 114 ? 75.078  39.581 -5.396  1.00 20.12 ? 111 ARG A CA    1 
ATOM   914  C  C     . ARG A 1 114 ? 73.904  39.922 -4.494  1.00 21.35 ? 111 ARG A C     1 
ATOM   915  O  O     . ARG A 1 114 ? 72.870  40.406 -4.969  1.00 23.22 ? 111 ARG A O     1 
ATOM   916  C  CB    . ARG A 1 114 ? 75.667  40.850 -6.030  1.00 21.87 ? 111 ARG A CB    1 
ATOM   917  C  CG    . ARG A 1 114 ? 76.192  41.895 -5.036  1.00 28.86 ? 111 ARG A CG    1 
ATOM   918  C  CD    . ARG A 1 114 ? 76.401  43.258 -5.728  1.00 29.61 ? 111 ARG A CD    1 
ATOM   919  N  NE    . ARG A 1 114 ? 77.137  44.235 -4.916  1.00 36.66 ? 111 ARG A NE    1 
ATOM   920  C  CZ    . ARG A 1 114 ? 76.576  45.102 -4.069  1.00 35.14 ? 111 ARG A CZ    1 
ATOM   921  N  NH1   . ARG A 1 114 ? 75.260  45.117 -3.891  1.00 34.13 ? 111 ARG A NH1   1 
ATOM   922  N  NH2   . ARG A 1 114 ? 77.334  45.960 -3.385  1.00 34.78 ? 111 ARG A NH2   1 
ATOM   923  N  N     . ALA A 1 115 ? 74.044  39.633 -3.201  1.00 19.84 ? 112 ALA A N     1 
ATOM   924  C  CA    . ALA A 1 115 ? 72.975  39.865 -2.239  1.00 19.72 ? 112 ALA A CA    1 
ATOM   925  C  C     . ALA A 1 115 ? 73.187  41.116 -1.398  1.00 18.75 ? 112 ALA A C     1 
ATOM   926  O  O     . ALA A 1 115 ? 72.214  41.680 -0.886  1.00 22.32 ? 112 ALA A O     1 
ATOM   927  C  CB    . ALA A 1 115 ? 72.831  38.647 -1.308  1.00 19.31 ? 112 ALA A CB    1 
ATOM   928  N  N     . SER A 1 116 ? 74.420  41.564 -1.256  1.00 18.68 ? 113 SER A N     1 
ATOM   929  C  CA    . SER A 1 116 ? 74.768  42.772 -0.523  1.00 21.11 ? 113 SER A CA    1 
ATOM   930  C  C     . SER A 1 116 ? 76.215  43.077 -0.885  1.00 17.80 ? 113 SER A C     1 
ATOM   931  O  O     . SER A 1 116 ? 76.794  42.428 -1.762  1.00 18.46 ? 113 SER A O     1 
ATOM   932  C  CB    . SER A 1 116 ? 74.600  42.581 0.983   1.00 20.49 ? 113 SER A CB    1 
ATOM   933  O  OG    . SER A 1 116 ? 75.576  41.650 1.451   1.00 20.04 ? 113 SER A OG    1 
ATOM   934  N  N     . ILE A 1 117 ? 76.820  44.030 -0.178  1.00 16.91 ? 114 ILE A N     1 
ATOM   935  C  CA    . ILE A 1 117 ? 78.218  44.333 -0.454  1.00 16.05 ? 114 ILE A CA    1 
ATOM   936  C  C     . ILE A 1 117 ? 79.118  43.129 -0.186  1.00 18.31 ? 114 ILE A C     1 
ATOM   937  O  O     . ILE A 1 117 ? 80.183  43.001 -0.803  1.00 20.82 ? 114 ILE A O     1 
ATOM   938  C  CB    . ILE A 1 117 ? 78.676  45.566 0.354   1.00 22.47 ? 114 ILE A CB    1 
ATOM   939  C  CG1   . ILE A 1 117 ? 80.009  46.084 -0.185  1.00 24.16 ? 114 ILE A CG1   1 
ATOM   940  C  CG2   . ILE A 1 117 ? 78.757  45.249 1.858   1.00 20.44 ? 114 ILE A CG2   1 
ATOM   941  C  CD1   . ILE A 1 117 ? 80.339  47.471 0.319   1.00 24.07 ? 114 ILE A CD1   1 
ATOM   942  N  N     . ASP A 1 118 ? 78.719  42.210 0.712   1.00 17.19 ? 115 ASP A N     1 
ATOM   943  C  CA    . ASP A 1 118 ? 79.641  41.132 1.067   1.00 17.02 ? 115 ASP A CA    1 
ATOM   944  C  C     . ASP A 1 118 ? 78.980  39.754 1.106   1.00 15.34 ? 115 ASP A C     1 
ATOM   945  O  O     . ASP A 1 118 ? 79.522  38.833 1.732   1.00 15.38 ? 115 ASP A O     1 
ATOM   946  C  CB    . ASP A 1 118 ? 80.319  41.421 2.403   1.00 16.03 ? 115 ASP A CB    1 
ATOM   947  C  CG    . ASP A 1 118 ? 79.412  41.161 3.588   1.00 18.89 ? 115 ASP A CG    1 
ATOM   948  O  OD1   . ASP A 1 118 ? 78.191  41.351 3.451   1.00 19.01 ? 115 ASP A OD1   1 
ATOM   949  O  OD2   . ASP A 1 118 ? 79.927  40.749 4.650   1.00 17.54 ? 115 ASP A OD2   1 
ATOM   950  N  N     . GLU A 1 119 ? 77.831  39.584 0.461   1.00 16.62 ? 116 GLU A N     1 
ATOM   951  C  CA    . GLU A 1 119 ? 77.176  38.280 0.363   1.00 17.75 ? 116 GLU A CA    1 
ATOM   952  C  C     . GLU A 1 119 ? 76.848  37.979 -1.091  1.00 16.43 ? 116 GLU A C     1 
ATOM   953  O  O     . GLU A 1 119 ? 76.490  38.876 -1.858  1.00 15.23 ? 116 GLU A O     1 
ATOM   954  C  CB    . GLU A 1 119 ? 75.876  38.229 1.172   1.00 16.76 ? 116 GLU A CB    1 
ATOM   955  C  CG    . GLU A 1 119 ? 76.036  38.326 2.664   1.00 20.78 ? 116 GLU A CG    1 
ATOM   956  C  CD    . GLU A 1 119 ? 74.700  38.188 3.373   1.00 28.67 ? 116 GLU A CD    1 
ATOM   957  O  OE1   . GLU A 1 119 ? 73.677  38.058 2.678   1.00 29.07 ? 116 GLU A OE1   1 
ATOM   958  O  OE2   . GLU A 1 119 ? 74.662  38.224 4.616   1.00 32.46 ? 116 GLU A OE2   1 
ATOM   959  N  N     . ALA A 1 120 ? 76.973  36.719 -1.474  1.00 15.53 ? 117 ALA A N     1 
ATOM   960  C  CA    . ALA A 1 120 ? 76.512  36.290 -2.782  1.00 16.59 ? 117 ALA A CA    1 
ATOM   961  C  C     . ALA A 1 120 ? 75.936  34.891 -2.660  1.00 20.25 ? 117 ALA A C     1 
ATOM   962  O  O     . ALA A 1 120 ? 76.490  34.046 -1.953  1.00 16.87 ? 117 ALA A O     1 
ATOM   963  C  CB    . ALA A 1 120 ? 77.631  36.297 -3.817  1.00 19.22 ? 117 ALA A CB    1 
ATOM   964  N  N     . TYR A 1 121 ? 74.825  34.654 -3.346  1.00 16.26 ? 118 TYR A N     1 
ATOM   965  C  CA    . TYR A 1 121 ? 74.332  33.293 -3.518  1.00 17.04 ? 118 TYR A CA    1 
ATOM   966  C  C     . TYR A 1 121 ? 74.955  32.652 -4.744  1.00 18.49 ? 118 TYR A C     1 
ATOM   967  O  O     . TYR A 1 121 ? 75.253  33.323 -5.734  1.00 20.04 ? 118 TYR A O     1 
ATOM   968  C  CB    . TYR A 1 121 ? 72.817  33.283 -3.663  1.00 15.83 ? 118 TYR A CB    1 
ATOM   969  C  CG    . TYR A 1 121 ? 72.086  33.704 -2.424  1.00 18.65 ? 118 TYR A CG    1 
ATOM   970  C  CD1   . TYR A 1 121 ? 71.801  32.790 -1.417  1.00 19.17 ? 118 TYR A CD1   1 
ATOM   971  C  CD2   . TYR A 1 121 ? 71.672  35.016 -2.253  1.00 17.55 ? 118 TYR A CD2   1 
ATOM   972  C  CE1   . TYR A 1 121 ? 71.120  33.178 -0.280  1.00 16.66 ? 118 TYR A CE1   1 
ATOM   973  C  CE2   . TYR A 1 121 ? 71.002  35.413 -1.122  1.00 22.08 ? 118 TYR A CE2   1 
ATOM   974  C  CZ    . TYR A 1 121 ? 70.719  34.487 -0.141  1.00 24.47 ? 118 TYR A CZ    1 
ATOM   975  O  OH    . TYR A 1 121 ? 70.040  34.877 0.982   1.00 22.10 ? 118 TYR A OH    1 
ATOM   976  N  N     . VAL A 1 122 ? 75.114  31.330 -4.681  1.00 17.07 ? 119 VAL A N     1 
ATOM   977  C  CA    . VAL A 1 122 ? 75.764  30.532 -5.710  1.00 19.59 ? 119 VAL A CA    1 
ATOM   978  C  C     . VAL A 1 122 ? 74.809  29.404 -6.058  1.00 23.90 ? 119 VAL A C     1 
ATOM   979  O  O     . VAL A 1 122 ? 74.403  28.654 -5.167  1.00 18.91 ? 119 VAL A O     1 
ATOM   980  C  CB    . VAL A 1 122 ? 77.099  29.944 -5.215  1.00 20.96 ? 119 VAL A CB    1 
ATOM   981  C  CG1   . VAL A 1 122 ? 77.979  29.588 -6.379  1.00 29.21 ? 119 VAL A CG1   1 
ATOM   982  C  CG2   . VAL A 1 122 ? 77.795  30.904 -4.251  1.00 26.14 ? 119 VAL A CG2   1 
ATOM   983  N  N     . ASP A 1 123 ? 74.460  29.263 -7.337  1.00 20.12 ? 120 ASP A N     1 
ATOM   984  C  CA    . ASP A 1 123 ? 73.718  28.084 -7.784  1.00 22.88 ? 120 ASP A CA    1 
ATOM   985  C  C     . ASP A 1 123 ? 74.709  27.036 -8.297  1.00 28.09 ? 120 ASP A C     1 
ATOM   986  O  O     . ASP A 1 123 ? 75.262  27.169 -9.394  1.00 24.09 ? 120 ASP A O     1 
ATOM   987  C  CB    . ASP A 1 123 ? 72.680  28.447 -8.841  1.00 27.14 ? 120 ASP A CB    1 
ATOM   988  C  CG    . ASP A 1 123 ? 71.672  27.329 -9.061  1.00 30.82 ? 120 ASP A CG    1 
ATOM   989  O  OD1   . ASP A 1 123 ? 72.088  26.150 -9.116  1.00 26.50 ? 120 ASP A OD1   1 
ATOM   990  O  OD2   . ASP A 1 123 ? 70.458  27.617 -9.152  1.00 42.43 ? 120 ASP A OD2   1 
ATOM   991  N  N     . LEU A 1 124 ? 74.914  25.978 -7.512  1.00 22.10 ? 121 LEU A N     1 
ATOM   992  C  CA    . LEU A 1 124 ? 75.958  24.996 -7.770  1.00 20.59 ? 121 LEU A CA    1 
ATOM   993  C  C     . LEU A 1 124 ? 75.448  23.739 -8.466  1.00 17.90 ? 121 LEU A C     1 
ATOM   994  O  O     . LEU A 1 124 ? 76.239  22.823 -8.697  1.00 20.42 ? 121 LEU A O     1 
ATOM   995  C  CB    . LEU A 1 124 ? 76.649  24.611 -6.451  1.00 19.66 ? 121 LEU A CB    1 
ATOM   996  C  CG    . LEU A 1 124 ? 77.450  25.720 -5.768  1.00 23.04 ? 121 LEU A CG    1 
ATOM   997  C  CD1   . LEU A 1 124 ? 77.608  25.462 -4.284  1.00 27.79 ? 121 LEU A CD1   1 
ATOM   998  C  CD2   . LEU A 1 124 ? 78.808  25.833 -6.429  1.00 29.46 ? 121 LEU A CD2   1 
ATOM   999  N  N     . THR A 1 125 ? 74.164  23.693 -8.834  1.00 16.59 ? 122 THR A N     1 
ATOM   1000 C  CA    . THR A 1 125 ? 73.568  22.453 -9.325  1.00 19.55 ? 122 THR A CA    1 
ATOM   1001 C  C     . THR A 1 125 ? 74.360  21.866 -10.493 1.00 24.58 ? 122 THR A C     1 
ATOM   1002 O  O     . THR A 1 125 ? 74.665  20.668 -10.509 1.00 24.92 ? 122 THR A O     1 
ATOM   1003 C  CB    . THR A 1 125 ? 72.108  22.704 -9.709  1.00 21.24 ? 122 THR A CB    1 
ATOM   1004 O  OG1   . THR A 1 125 ? 71.438  23.359 -8.622  1.00 21.76 ? 122 THR A OG1   1 
ATOM   1005 C  CG2   . THR A 1 125 ? 71.385  21.370 -9.998  1.00 23.21 ? 122 THR A CG2   1 
ATOM   1006 N  N     . SER A 1 126 ? 74.738  22.707 -11.464 1.00 26.30 ? 123 SER A N     1 
ATOM   1007 C  CA    . SER A 1 126 ? 75.453  22.207 -12.638 1.00 26.24 ? 123 SER A CA    1 
ATOM   1008 C  C     . SER A 1 126 ? 76.888  21.829 -12.301 1.00 28.05 ? 123 SER A C     1 
ATOM   1009 O  O     . SER A 1 126 ? 77.390  20.800 -12.763 1.00 30.37 ? 123 SER A O     1 
ATOM   1010 C  CB    . SER A 1 126 ? 75.429  23.250 -13.758 1.00 35.76 ? 123 SER A CB    1 
ATOM   1011 O  OG    . SER A 1 126 ? 74.102  23.475 -14.208 1.00 42.12 ? 123 SER A OG    1 
ATOM   1012 N  N     . ALA A 1 127 ? 77.569  22.657 -11.507 1.00 19.80 ? 124 ALA A N     1 
ATOM   1013 C  CA    . ALA A 1 127 ? 78.933  22.339 -11.104 1.00 24.10 ? 124 ALA A CA    1 
ATOM   1014 C  C     . ALA A 1 127 ? 78.993  21.018 -10.347 1.00 24.81 ? 124 ALA A C     1 
ATOM   1015 O  O     . ALA A 1 127 ? 79.962  20.256 -10.481 1.00 25.77 ? 124 ALA A O     1 
ATOM   1016 C  CB    . ALA A 1 127 ? 79.498  23.479 -10.251 1.00 24.83 ? 124 ALA A CB    1 
ATOM   1017 N  N     . VAL A 1 128 ? 77.965  20.728 -9.545  1.00 24.21 ? 125 VAL A N     1 
ATOM   1018 C  CA    . VAL A 1 128 ? 77.909  19.460 -8.825  1.00 25.97 ? 125 VAL A CA    1 
ATOM   1019 C  C     . VAL A 1 128 ? 77.719  18.301 -9.795  1.00 25.88 ? 125 VAL A C     1 
ATOM   1020 O  O     . VAL A 1 128 ? 78.364  17.257 -9.662  1.00 26.90 ? 125 VAL A O     1 
ATOM   1021 C  CB    . VAL A 1 128 ? 76.788  19.511 -7.769  1.00 27.32 ? 125 VAL A CB    1 
ATOM   1022 C  CG1   . VAL A 1 128 ? 76.410  18.114 -7.313  1.00 25.17 ? 125 VAL A CG1   1 
ATOM   1023 C  CG2   . VAL A 1 128 ? 77.230  20.358 -6.590  1.00 19.03 ? 125 VAL A CG2   1 
ATOM   1024 N  N     . GLN A 1 129 ? 76.833  18.467 -10.778 1.00 25.60 ? 126 GLN A N     1 
ATOM   1025 C  CA    . GLN A 1 129 ? 76.609  17.413 -11.764 1.00 33.55 ? 126 GLN A CA    1 
ATOM   1026 C  C     . GLN A 1 129 ? 77.902  17.062 -12.488 1.00 35.70 ? 126 GLN A C     1 
ATOM   1027 O  O     . GLN A 1 129 ? 78.264  15.885 -12.604 1.00 42.61 ? 126 GLN A O     1 
ATOM   1028 C  CB    . GLN A 1 129 ? 75.538  17.852 -12.761 1.00 33.19 ? 126 GLN A CB    1 
ATOM   1029 C  CG    . GLN A 1 129 ? 75.454  16.967 -13.986 1.00 43.21 ? 126 GLN A CG    1 
ATOM   1030 N  N     . GLU A 1 130 ? 78.624  18.083 -12.963 1.00 36.31 ? 127 GLU A N     1 
ATOM   1031 C  CA    . GLU A 1 130 ? 79.876  17.840 -13.671 1.00 37.67 ? 127 GLU A CA    1 
ATOM   1032 C  C     . GLU A 1 130 ? 80.899  17.171 -12.763 1.00 42.22 ? 127 GLU A C     1 
ATOM   1033 O  O     . GLU A 1 130 ? 81.572  16.217 -13.167 1.00 41.02 ? 127 GLU A O     1 
ATOM   1034 C  CB    . GLU A 1 130 ? 80.420  19.158 -14.226 1.00 31.74 ? 127 GLU A CB    1 
ATOM   1035 N  N     . ARG A 1 131 ? 81.008  17.644 -11.521 1.00 34.54 ? 128 ARG A N     1 
ATOM   1036 C  CA    . ARG A 1 131 ? 81.987  17.095 -10.593 1.00 32.09 ? 128 ARG A CA    1 
ATOM   1037 C  C     . ARG A 1 131 ? 81.636  15.668 -10.181 1.00 36.99 ? 128 ARG A C     1 
ATOM   1038 O  O     . ARG A 1 131 ? 82.540  14.868 -9.906  1.00 37.58 ? 128 ARG A O     1 
ATOM   1039 C  CB    . ARG A 1 131 ? 82.094  18.015 -9.375  1.00 31.18 ? 128 ARG A CB    1 
ATOM   1040 C  CG    . ARG A 1 131 ? 83.107  17.608 -8.336  1.00 36.27 ? 128 ARG A CG    1 
ATOM   1041 C  CD    . ARG A 1 131 ? 84.532  17.771 -8.836  1.00 38.32 ? 128 ARG A CD    1 
ATOM   1042 N  NE    . ARG A 1 131 ? 85.450  17.726 -7.712  1.00 39.40 ? 128 ARG A NE    1 
ATOM   1043 C  CZ    . ARG A 1 131 ? 85.875  18.810 -7.073  1.00 27.37 ? 128 ARG A CZ    1 
ATOM   1044 N  NH1   . ARG A 1 131 ? 85.480  20.008 -7.485  1.00 30.48 ? 128 ARG A NH1   1 
ATOM   1045 N  NH2   . ARG A 1 131 ? 86.711  18.691 -6.052  1.00 40.92 ? 128 ARG A NH2   1 
ATOM   1046 N  N     . LEU A 1 132 ? 80.341  15.327 -10.143 1.00 38.68 ? 129 LEU A N     1 
ATOM   1047 C  CA    . LEU A 1 132 ? 79.938  13.956 -9.828  1.00 35.80 ? 129 LEU A CA    1 
ATOM   1048 C  C     . LEU A 1 132 ? 80.335  12.983 -10.932 1.00 55.20 ? 129 LEU A C     1 
ATOM   1049 O  O     . LEU A 1 132 ? 80.514  11.789 -10.666 1.00 53.91 ? 129 LEU A O     1 
ATOM   1050 C  CB    . LEU A 1 132 ? 78.425  13.882 -9.588  1.00 37.11 ? 129 LEU A CB    1 
ATOM   1051 C  CG    . LEU A 1 132 ? 77.908  14.194 -8.182  1.00 34.61 ? 129 LEU A CG    1 
ATOM   1052 C  CD1   . LEU A 1 132 ? 76.401  14.375 -8.169  1.00 37.02 ? 129 LEU A CD1   1 
ATOM   1053 C  CD2   . LEU A 1 132 ? 78.316  13.093 -7.206  0.91 40.28 ? 129 LEU A CD2   1 
ATOM   1054 N  N     . GLN A 1 133 ? 80.460  13.466 -12.173 1.00 50.77 ? 130 GLN A N     1 
ATOM   1055 C  CA    . GLN A 1 133 ? 80.923  12.611 -13.260 1.00 47.77 ? 130 GLN A CA    1 
ATOM   1056 C  C     . GLN A 1 133 ? 82.441  12.480 -13.269 1.00 55.39 ? 130 GLN A C     1 
ATOM   1057 O  O     . GLN A 1 133 ? 82.964  11.418 -13.624 1.00 56.47 ? 130 GLN A O     1 
ATOM   1058 C  CB    . GLN A 1 133 ? 80.430  13.154 -14.602 1.00 46.21 ? 130 GLN A CB    1 
ATOM   1059 N  N     . LYS A 1 134 ? 83.159  13.537 -12.881 1.00 51.14 ? 131 LYS A N     1 
ATOM   1060 C  CA    . LYS A 1 134 ? 84.617  13.465 -12.833 1.00 56.83 ? 131 LYS A CA    1 
ATOM   1061 C  C     . LYS A 1 134 ? 85.074  12.556 -11.700 1.00 63.11 ? 131 LYS A C     1 
ATOM   1062 O  O     . LYS A 1 134 ? 85.903  11.662 -11.901 1.00 62.46 ? 131 LYS A O     1 
ATOM   1063 C  CB    . LYS A 1 134 ? 85.208  14.867 -12.679 1.00 57.40 ? 131 LYS A CB    1 
ATOM   1064 N  N     . LEU A 1 135 ? 84.550  12.778 -10.497 1.00 67.37 ? 132 LEU A N     1 
ATOM   1065 C  CA    . LEU A 1 135 ? 84.697  11.809 -9.423  1.00 62.96 ? 132 LEU A CA    1 
ATOM   1066 C  C     . LEU A 1 135 ? 83.813  10.616 -9.753  1.00 68.75 ? 132 LEU A C     1 
ATOM   1067 O  O     . LEU A 1 135 ? 82.622  10.624 -9.430  1.00 71.72 ? 132 LEU A O     1 
ATOM   1068 C  CB    . LEU A 1 135 ? 84.318  12.425 -8.073  1.00 64.50 ? 132 LEU A CB    1 
ATOM   1069 N  N     . GLN A 1 136 ? 84.390  9.605  -10.411 1.00 67.81 ? 133 GLN A N     1 
ATOM   1070 C  CA    . GLN A 1 136 ? 83.662  8.467  -10.970 1.00 69.56 ? 133 GLN A CA    1 
ATOM   1071 C  C     . GLN A 1 136 ? 82.590  7.941  -10.023 1.00 71.17 ? 133 GLN A C     1 
ATOM   1072 O  O     . GLN A 1 136 ? 81.417  8.313  -10.130 1.00 71.62 ? 133 GLN A O     1 
ATOM   1073 C  CB    . GLN A 1 136 ? 84.640  7.343  -11.327 1.00 61.30 ? 133 GLN A CB    1 
ATOM   1074 N  N     . GLY A 1 137 ? 82.984  7.065  -9.108  1.00 71.28 ? 134 GLY A N     1 
ATOM   1075 C  CA    . GLY A 1 137 ? 82.127  6.658  -8.015  1.00 56.87 ? 134 GLY A CA    1 
ATOM   1076 C  C     . GLY A 1 137 ? 82.938  6.717  -6.741  1.00 56.14 ? 134 GLY A C     1 
ATOM   1077 O  O     . GLY A 1 137 ? 82.597  6.093  -5.731  1.00 59.98 ? 134 GLY A O     1 
ATOM   1078 N  N     . GLN A 1 138 ? 84.025  7.479  -6.799  1.00 60.51 ? 135 GLN A N     1 
ATOM   1079 C  CA    . GLN A 1 138 ? 84.984  7.520  -5.707  1.00 53.19 ? 135 GLN A CA    1 
ATOM   1080 C  C     . GLN A 1 138 ? 84.338  8.113  -4.458  1.00 50.72 ? 135 GLN A C     1 
ATOM   1081 O  O     . GLN A 1 138 ? 83.541  9.053  -4.556  1.00 49.92 ? 135 GLN A O     1 
ATOM   1082 C  CB    . GLN A 1 138 ? 86.204  8.348  -6.113  1.00 51.08 ? 135 GLN A CB    1 
ATOM   1083 N  N     . PRO A 1 139 ? 84.666  7.607  -3.274  1.00 49.78 ? 136 PRO A N     1 
ATOM   1084 C  CA    . PRO A 1 139 ? 84.100  8.182  -2.054  1.00 47.50 ? 136 PRO A CA    1 
ATOM   1085 C  C     . PRO A 1 139 ? 84.633  9.587  -1.833  1.00 43.16 ? 136 PRO A C     1 
ATOM   1086 O  O     . PRO A 1 139 ? 85.612  10.019 -2.443  1.00 41.48 ? 136 PRO A O     1 
ATOM   1087 C  CB    . PRO A 1 139 ? 84.569  7.228  -0.946  1.00 51.45 ? 136 PRO A CB    1 
ATOM   1088 C  CG    . PRO A 1 139 ? 85.517  6.240  -1.606  1.00 46.27 ? 136 PRO A CG    1 
ATOM   1089 C  CD    . PRO A 1 139 ? 85.818  6.741  -2.981  1.00 51.38 ? 136 PRO A CD    1 
ATOM   1090 N  N     . ILE A 1 140 ? 83.961  10.311 -0.953  1.00 42.02 ? 137 ILE A N     1 
ATOM   1091 C  CA    . ILE A 1 140 ? 84.373  11.659 -0.592  1.00 32.10 ? 137 ILE A CA    1 
ATOM   1092 C  C     . ILE A 1 140 ? 85.129  11.569 0.724   1.00 32.21 ? 137 ILE A C     1 
ATOM   1093 O  O     . ILE A 1 140 ? 84.571  11.148 1.744   1.00 33.64 ? 137 ILE A O     1 
ATOM   1094 C  CB    . ILE A 1 140 ? 83.170  12.607 -0.487  1.00 36.43 ? 137 ILE A CB    1 
ATOM   1095 C  CG1   . ILE A 1 140 ? 82.367  12.604 -1.796  1.00 33.06 ? 137 ILE A CG1   1 
ATOM   1096 C  CG2   . ILE A 1 140 ? 83.637  14.015 -0.129  1.00 28.68 ? 137 ILE A CG2   1 
ATOM   1097 C  CD1   . ILE A 1 140 ? 83.174  12.985 -3.012  1.00 47.65 ? 137 ILE A CD1   1 
ATOM   1098 N  N     . SER A 1 141 ? 86.398  11.958 0.696   1.00 29.60 ? 138 SER A N     1 
ATOM   1099 C  CA    . SER A 1 141 ? 87.244  11.946 1.877   1.00 31.43 ? 138 SER A CA    1 
ATOM   1100 C  C     . SER A 1 141 ? 86.923  13.129 2.785   1.00 26.12 ? 138 SER A C     1 
ATOM   1101 O  O     . SER A 1 141 ? 86.595  14.225 2.319   1.00 25.92 ? 138 SER A O     1 
ATOM   1102 C  CB    . SER A 1 141 ? 88.721  11.996 1.464   1.00 29.11 ? 138 SER A CB    1 
ATOM   1103 O  OG    . SER A 1 141 ? 89.521  12.545 2.494   1.00 34.16 ? 138 SER A OG    1 
ATOM   1104 N  N     . ALA A 1 142 ? 87.046  12.911 4.097   1.00 25.29 ? 139 ALA A N     1 
ATOM   1105 C  CA    . ALA A 1 142 ? 86.872  14.019 5.026   1.00 27.94 ? 139 ALA A CA    1 
ATOM   1106 C  C     . ALA A 1 142 ? 87.910  15.112 4.806   1.00 29.34 ? 139 ALA A C     1 
ATOM   1107 O  O     . ALA A 1 142 ? 87.670  16.268 5.186   1.00 22.95 ? 139 ALA A O     1 
ATOM   1108 C  CB    . ALA A 1 142 ? 86.935  13.528 6.474   1.00 30.09 ? 139 ALA A CB    1 
ATOM   1109 N  N     . ASP A 1 143 ? 89.054  14.776 4.199   1.00 23.92 ? 140 ASP A N     1 
ATOM   1110 C  CA    . ASP A 1 143 ? 90.078  15.778 3.947   1.00 27.13 ? 140 ASP A CA    1 
ATOM   1111 C  C     . ASP A 1 143 ? 89.625  16.810 2.923   1.00 29.32 ? 140 ASP A C     1 
ATOM   1112 O  O     . ASP A 1 143 ? 90.193  17.908 2.880   1.00 24.61 ? 140 ASP A O     1 
ATOM   1113 C  CB    . ASP A 1 143 ? 91.373  15.115 3.468   1.00 38.16 ? 140 ASP A CB    1 
ATOM   1114 C  CG    . ASP A 1 143 ? 92.019  14.237 4.530   1.00 51.84 ? 140 ASP A CG    1 
ATOM   1115 O  OD1   . ASP A 1 143 ? 91.707  14.402 5.730   1.00 45.46 ? 140 ASP A OD1   1 
ATOM   1116 O  OD2   . ASP A 1 143 ? 92.856  13.383 4.158   1.00 63.25 ? 140 ASP A OD2   1 
ATOM   1117 N  N     . LEU A 1 144 ? 88.622  16.489 2.101   1.00 21.68 ? 141 LEU A N     1 
ATOM   1118 C  CA    . LEU A 1 144 ? 88.096  17.469 1.162   1.00 22.59 ? 141 LEU A CA    1 
ATOM   1119 C  C     . LEU A 1 144 ? 87.135  18.457 1.817   1.00 22.46 ? 141 LEU A C     1 
ATOM   1120 O  O     . LEU A 1 144 ? 86.740  19.422 1.158   1.00 20.67 ? 141 LEU A O     1 
ATOM   1121 C  CB    . LEU A 1 144 ? 87.397  16.768 -0.008  1.00 23.22 ? 141 LEU A CB    1 
ATOM   1122 C  CG    . LEU A 1 144 ? 88.265  15.837 -0.869  1.00 23.32 ? 141 LEU A CG    1 
ATOM   1123 C  CD1   . LEU A 1 144 ? 87.437  15.219 -1.986  1.00 27.49 ? 141 LEU A CD1   1 
ATOM   1124 C  CD2   . LEU A 1 144 ? 89.453  16.602 -1.436  1.00 23.76 ? 141 LEU A CD2   1 
ATOM   1125 N  N     . LEU A 1 145 ? 86.794  18.265 3.094   1.00 18.52 ? 142 LEU A N     1 
ATOM   1126 C  CA    . LEU A 1 145 ? 85.830  19.114 3.806   1.00 19.81 ? 142 LEU A CA    1 
ATOM   1127 C  C     . LEU A 1 145 ? 86.403  19.579 5.143   1.00 19.84 ? 142 LEU A C     1 
ATOM   1128 O  O     . LEU A 1 145 ? 85.797  19.378 6.200   1.00 20.18 ? 142 LEU A O     1 
ATOM   1129 C  CB    . LEU A 1 145 ? 84.513  18.355 4.000   1.00 18.78 ? 142 LEU A CB    1 
ATOM   1130 C  CG    . LEU A 1 145 ? 83.833  17.959 2.690   1.00 17.23 ? 142 LEU A CG    1 
ATOM   1131 C  CD1   . LEU A 1 145 ? 82.830  16.788 2.841   1.00 21.04 ? 142 LEU A CD1   1 
ATOM   1132 C  CD2   . LEU A 1 145 ? 83.136  19.176 2.080   1.00 19.02 ? 142 LEU A CD2   1 
ATOM   1133 N  N     . PRO A 1 146 ? 87.560  20.259 5.130   1.00 19.18 ? 143 PRO A N     1 
ATOM   1134 C  CA    . PRO A 1 146 ? 88.270  20.539 6.387   1.00 19.36 ? 143 PRO A CA    1 
ATOM   1135 C  C     . PRO A 1 146 ? 87.660  21.631 7.243   1.00 17.37 ? 143 PRO A C     1 
ATOM   1136 O  O     . PRO A 1 146 ? 88.100  21.813 8.390   1.00 18.69 ? 143 PRO A O     1 
ATOM   1137 C  CB    . PRO A 1 146 ? 89.665  20.964 5.905   1.00 23.99 ? 143 PRO A CB    1 
ATOM   1138 C  CG    . PRO A 1 146 ? 89.392  21.597 4.567   1.00 20.20 ? 143 PRO A CG    1 
ATOM   1139 C  CD    . PRO A 1 146 ? 88.288  20.785 3.958   1.00 21.52 ? 143 PRO A CD    1 
ATOM   1140 N  N     . SER A 1 147 ? 86.677  22.379 6.732   1.00 20.02 ? 144 SER A N     1 
ATOM   1141 C  CA    . SER A 1 147 ? 86.055  23.427 7.529   1.00 19.89 ? 144 SER A CA    1 
ATOM   1142 C  C     . SER A 1 147 ? 84.535  23.315 7.506   1.00 15.86 ? 144 SER A C     1 
ATOM   1143 O  O     . SER A 1 147 ? 83.853  24.290 7.821   1.00 14.59 ? 144 SER A O     1 
ATOM   1144 C  CB    . SER A 1 147 ? 86.497  24.819 7.053   1.00 17.17 ? 144 SER A CB    1 
ATOM   1145 O  OG    . SER A 1 147 ? 86.027  25.090 5.743   1.00 19.29 ? 144 SER A OG    1 
ATOM   1146 N  N     . THR A 1 148 ? 84.006  22.125 7.209   1.00 17.25 ? 145 THR A N     1 
ATOM   1147 C  CA    . THR A 1 148 ? 82.563  21.912 7.031   1.00 15.34 ? 145 THR A CA    1 
ATOM   1148 C  C     . THR A 1 148 ? 81.926  21.306 8.279   1.00 15.86 ? 145 THR A C     1 
ATOM   1149 O  O     . THR A 1 148 ? 82.435  20.324 8.831   1.00 16.75 ? 145 THR A O     1 
ATOM   1150 C  CB    . THR A 1 148 ? 82.317  20.994 5.830   1.00 19.08 ? 145 THR A CB    1 
ATOM   1151 O  OG1   . THR A 1 148 ? 82.713  21.671 4.635   1.00 16.85 ? 145 THR A OG1   1 
ATOM   1152 C  CG2   . THR A 1 148 ? 80.821  20.616 5.712   1.00 14.34 ? 145 THR A CG2   1 
ATOM   1153 N  N     . TYR A 1 149 ? 80.800  21.878 8.702   1.00 13.71 ? 146 TYR A N     1 
ATOM   1154 C  CA    . TYR A 1 149 ? 79.929  21.288 9.713   1.00 14.34 ? 146 TYR A CA    1 
ATOM   1155 C  C     . TYR A 1 149 ? 78.712  20.681 9.039   1.00 16.78 ? 146 TYR A C     1 
ATOM   1156 O  O     . TYR A 1 149 ? 78.166  21.267 8.096   1.00 15.89 ? 146 TYR A O     1 
ATOM   1157 C  CB    . TYR A 1 149 ? 79.442  22.351 10.695  1.00 14.36 ? 146 TYR A CB    1 
ATOM   1158 C  CG    . TYR A 1 149 ? 80.453  22.731 11.741  1.00 16.74 ? 146 TYR A CG    1 
ATOM   1159 C  CD1   . TYR A 1 149 ? 81.467  23.648 11.465  1.00 19.72 ? 146 TYR A CD1   1 
ATOM   1160 C  CD2   . TYR A 1 149 ? 80.359  22.205 13.021  1.00 16.56 ? 146 TYR A CD2   1 
ATOM   1161 C  CE1   . TYR A 1 149 ? 82.385  23.997 12.437  1.00 21.31 ? 146 TYR A CE1   1 
ATOM   1162 C  CE2   . TYR A 1 149 ? 81.262  22.534 13.983  1.00 22.27 ? 146 TYR A CE2   1 
ATOM   1163 C  CZ    . TYR A 1 149 ? 82.272  23.433 13.699  1.00 24.61 ? 146 TYR A CZ    1 
ATOM   1164 O  OH    . TYR A 1 149 ? 83.162  23.767 14.689  1.00 29.04 ? 146 TYR A OH    1 
ATOM   1165 N  N     . ILE A 1 150 ? 78.243  19.546 9.565   1.00 12.89 ? 147 ILE A N     1 
ATOM   1166 C  CA    . ILE A 1 150 ? 77.010  18.926 9.094   1.00 16.43 ? 147 ILE A CA    1 
ATOM   1167 C  C     . ILE A 1 150 ? 75.957  19.195 10.156  1.00 16.14 ? 147 ILE A C     1 
ATOM   1168 O  O     . ILE A 1 150 ? 76.042  18.656 11.264  1.00 17.07 ? 147 ILE A O     1 
ATOM   1169 C  CB    . ILE A 1 150 ? 77.164  17.419 8.857   1.00 16.50 ? 147 ILE A CB    1 
ATOM   1170 C  CG1   . ILE A 1 150 ? 78.346  17.117 7.924   1.00 16.31 ? 147 ILE A CG1   1 
ATOM   1171 C  CG2   . ILE A 1 150 ? 75.824  16.822 8.324   1.00 18.23 ? 147 ILE A CG2   1 
ATOM   1172 C  CD1   . ILE A 1 150 ? 78.203  17.688 6.515   1.00 17.10 ? 147 ILE A CD1   1 
ATOM   1173 N  N     . GLU A 1 151 ? 74.980  20.046 9.841   1.00 14.33 ? 148 GLU A N     1 
ATOM   1174 C  CA    . GLU A 1 151 ? 74.045  20.472 10.869  1.00 12.63 ? 148 GLU A CA    1 
ATOM   1175 C  C     . GLU A 1 151 ? 73.246  19.270 11.345  1.00 17.52 ? 148 GLU A C     1 
ATOM   1176 O  O     . GLU A 1 151 ? 72.751  18.490 10.535  1.00 17.06 ? 148 GLU A O     1 
ATOM   1177 C  CB    . GLU A 1 151 ? 73.100  21.550 10.324  1.00 16.39 ? 148 GLU A CB    1 
ATOM   1178 C  CG    . GLU A 1 151 ? 71.965  21.940 11.275  1.00 20.07 ? 148 GLU A CG    1 
ATOM   1179 C  CD    . GLU A 1 151 ? 72.415  22.456 12.626  1.00 24.13 ? 148 GLU A CD    1 
ATOM   1180 O  OE1   . GLU A 1 151 ? 73.531  22.990 12.754  1.00 26.06 ? 148 GLU A OE1   1 
ATOM   1181 O  OE2   . GLU A 1 151 ? 71.628  22.339 13.584  1.00 23.75 ? 148 GLU A OE2   1 
ATOM   1182 N  N     . GLY A 1 152 ? 73.131  19.122 12.659  1.00 18.21 ? 149 GLY A N     1 
ATOM   1183 C  CA    . GLY A 1 152 ? 72.388  18.035 13.252  1.00 19.24 ? 149 GLY A CA    1 
ATOM   1184 C  C     . GLY A 1 152 ? 73.255  16.874 13.686  1.00 22.79 ? 149 GLY A C     1 
ATOM   1185 O  O     . GLY A 1 152 ? 72.790  16.020 14.444  1.00 21.82 ? 149 GLY A O     1 
ATOM   1186 N  N     . LEU A 1 153 ? 74.500  16.832 13.226  1.00 20.48 ? 150 LEU A N     1 
ATOM   1187 C  CA    . LEU A 1 153 ? 75.441  15.768 13.568  1.00 18.40 ? 150 LEU A CA    1 
ATOM   1188 C  C     . LEU A 1 153 ? 76.627  16.332 14.357  1.00 23.51 ? 150 LEU A C     1 
ATOM   1189 O  O     . LEU A 1 153 ? 76.952  17.513 14.217  1.00 23.44 ? 150 LEU A O     1 
ATOM   1190 C  CB    . LEU A 1 153 ? 75.935  15.086 12.297  1.00 21.34 ? 150 LEU A CB    1 
ATOM   1191 C  CG    . LEU A 1 153 ? 74.862  14.423 11.450  1.00 21.50 ? 150 LEU A CG    1 
ATOM   1192 C  CD1   . LEU A 1 153 ? 75.499  13.689 10.308  1.00 18.75 ? 150 LEU A CD1   1 
ATOM   1193 C  CD2   . LEU A 1 153 ? 74.032  13.465 12.307  1.00 27.55 ? 150 LEU A CD2   1 
ATOM   1194 N  N     . PRO A 1 154 ? 77.282  15.503 15.192  1.00 21.34 ? 151 PRO A N     1 
ATOM   1195 C  CA    . PRO A 1 154 ? 76.989  14.084 15.454  1.00 26.40 ? 151 PRO A CA    1 
ATOM   1196 C  C     . PRO A 1 154 ? 75.759  13.882 16.327  1.00 23.27 ? 151 PRO A C     1 
ATOM   1197 O  O     . PRO A 1 154 ? 75.416  14.757 17.122  1.00 25.91 ? 151 PRO A O     1 
ATOM   1198 C  CB    . PRO A 1 154 ? 78.248  13.599 16.180  1.00 25.80 ? 151 PRO A CB    1 
ATOM   1199 C  CG    . PRO A 1 154 ? 78.720  14.805 16.924  1.00 28.86 ? 151 PRO A CG    1 
ATOM   1200 C  CD    . PRO A 1 154 ? 78.432  15.977 15.982  1.00 25.59 ? 151 PRO A CD    1 
ATOM   1201 N  N     . GLN A 1 155 ? 75.107  12.734 16.174  1.00 24.50 ? 152 GLN A N     1 
ATOM   1202 C  CA    . GLN A 1 155 ? 73.951  12.373 16.979  1.00 28.35 ? 152 GLN A CA    1 
ATOM   1203 C  C     . GLN A 1 155 ? 74.160  10.959 17.505  1.00 42.84 ? 152 GLN A C     1 
ATOM   1204 O  O     . GLN A 1 155 ? 74.940  10.179 16.949  1.00 35.46 ? 152 GLN A O     1 
ATOM   1205 C  CB    . GLN A 1 155 ? 72.635  12.466 16.179  1.00 36.30 ? 152 GLN A CB    1 
ATOM   1206 C  CG    . GLN A 1 155 ? 71.401  12.664 17.053  0.94 35.34 ? 152 GLN A CG    1 
ATOM   1207 C  CD    . GLN A 1 155 ? 70.101  12.776 16.269  0.19 29.57 ? 152 GLN A CD    1 
ATOM   1208 O  OE1   . GLN A 1 155 ? 69.304  13.691 16.497  0.43 25.31 ? 152 GLN A OE1   1 
ATOM   1209 N  NE2   . GLN A 1 155 ? 69.867  11.832 15.364  0.55 27.15 ? 152 GLN A NE2   1 
ATOM   1210 N  N     . GLY A 1 156 ? 73.473  10.645 18.600  1.00 41.05 ? 153 GLY A N     1 
ATOM   1211 C  CA    . GLY A 1 156 ? 73.582  9.336  19.219  1.00 52.60 ? 153 GLY A CA    1 
ATOM   1212 C  C     . GLY A 1 156 ? 74.745  9.218  20.186  1.00 46.72 ? 153 GLY A C     1 
ATOM   1213 O  O     . GLY A 1 156 ? 74.584  8.750  21.317  1.00 66.20 ? 153 GLY A O     1 
ATOM   1214 N  N     . VAL A 1 164 ? 84.582  16.192 23.276  1.00 54.28 ? 161 VAL A N     1 
ATOM   1215 C  CA    . VAL A 1 164 ? 85.836  16.842 23.646  1.00 43.86 ? 161 VAL A CA    1 
ATOM   1216 C  C     . VAL A 1 164 ? 85.835  18.330 23.287  1.00 56.46 ? 161 VAL A C     1 
ATOM   1217 O  O     . VAL A 1 164 ? 85.161  19.138 23.933  1.00 54.03 ? 161 VAL A O     1 
ATOM   1218 N  N     . GLN A 1 165 ? 86.600  18.687 22.259  1.00 58.86 ? 162 GLN A N     1 
ATOM   1219 C  CA    . GLN A 1 165 ? 86.765  20.070 21.832  1.00 52.85 ? 162 GLN A CA    1 
ATOM   1220 C  C     . GLN A 1 165 ? 85.993  20.324 20.543  1.00 45.20 ? 162 GLN A C     1 
ATOM   1221 O  O     . GLN A 1 165 ? 85.452  19.408 19.918  1.00 40.79 ? 162 GLN A O     1 
ATOM   1222 C  CB    . GLN A 1 165 ? 88.248  20.410 21.642  1.00 48.18 ? 162 GLN A CB    1 
ATOM   1223 N  N     . LYS A 1 166 ? 85.969  21.595 20.139  1.00 41.30 ? 163 LYS A N     1 
ATOM   1224 C  CA    . LYS A 1 166 ? 85.116  22.003 19.028  1.00 40.40 ? 163 LYS A CA    1 
ATOM   1225 C  C     . LYS A 1 166 ? 85.448  21.238 17.749  1.00 33.33 ? 163 LYS A C     1 
ATOM   1226 O  O     . LYS A 1 166 ? 84.549  20.756 17.049  1.00 32.58 ? 163 LYS A O     1 
ATOM   1227 C  CB    . LYS A 1 166 ? 85.241  23.510 18.801  1.00 42.25 ? 163 LYS A CB    1 
ATOM   1228 C  CG    . LYS A 1 166 ? 83.904  24.178 18.624  1.00 39.60 ? 163 LYS A CG    1 
ATOM   1229 C  CD    . LYS A 1 166 ? 83.989  25.427 17.778  0.65 40.51 ? 163 LYS A CD    1 
ATOM   1230 C  CE    . LYS A 1 166 ? 82.587  25.948 17.528  0.43 31.89 ? 163 LYS A CE    1 
ATOM   1231 N  NZ    . LYS A 1 166 ? 81.654  24.834 17.136  0.92 38.79 ? 163 LYS A NZ    1 
ATOM   1232 N  N     . GLU A 1 167 ? 86.737  21.102 17.432  1.00 34.31 ? 164 GLU A N     1 
ATOM   1233 C  CA    . GLU A 1 167 ? 87.114  20.518 16.148  1.00 33.70 ? 164 GLU A CA    1 
ATOM   1234 C  C     . GLU A 1 167 ? 86.848  19.018 16.112  1.00 33.87 ? 164 GLU A C     1 
ATOM   1235 O  O     . GLU A 1 167 ? 86.484  18.471 15.062  1.00 28.58 ? 164 GLU A O     1 
ATOM   1236 C  CB    . GLU A 1 167 ? 88.586  20.819 15.846  1.00 33.30 ? 164 GLU A CB    1 
ATOM   1237 C  CG    . GLU A 1 167 ? 89.184  20.052 14.660  1.00 35.87 ? 164 GLU A CG    1 
ATOM   1238 C  CD    . GLU A 1 167 ? 88.589  20.446 13.306  1.00 34.68 ? 164 GLU A CD    1 
ATOM   1239 O  OE1   . GLU A 1 167 ? 87.856  21.456 13.229  1.00 36.02 ? 164 GLU A OE1   1 
ATOM   1240 O  OE2   . GLU A 1 167 ? 88.873  19.743 12.314  1.00 33.09 ? 164 GLU A OE2   1 
ATOM   1241 N  N     . GLY A 1 168 ? 87.050  18.327 17.236  1.00 36.96 ? 165 GLY A N     1 
ATOM   1242 C  CA    . GLY A 1 168 ? 86.778  16.901 17.259  1.00 32.98 ? 165 GLY A CA    1 
ATOM   1243 C  C     . GLY A 1 168 ? 85.313  16.602 17.020  1.00 28.47 ? 165 GLY A C     1 
ATOM   1244 O  O     . GLY A 1 168 ? 84.965  15.646 16.319  1.00 27.02 ? 165 GLY A O     1 
ATOM   1245 N  N     . MET A 1 169 ? 84.437  17.427 17.585  1.00 26.52 ? 166 MET A N     1 
ATOM   1246 C  CA    . MET A 1 169 ? 83.008  17.247 17.368  1.00 29.87 ? 166 MET A CA    1 
ATOM   1247 C  C     . MET A 1 169 ? 82.627  17.537 15.919  1.00 26.87 ? 166 MET A C     1 
ATOM   1248 O  O     . MET A 1 169 ? 81.791  16.835 15.342  1.00 25.23 ? 166 MET A O     1 
ATOM   1249 C  CB    . MET A 1 169 ? 82.229  18.126 18.342  1.00 33.77 ? 166 MET A CB    1 
ATOM   1250 C  CG    . MET A 1 169 ? 82.646  17.925 19.799  0.57 35.21 ? 166 MET A CG    1 
ATOM   1251 S  SD    . MET A 1 169 ? 81.396  18.438 20.998  0.75 53.27 ? 166 MET A SD    1 
ATOM   1252 C  CE    . MET A 1 169 ? 82.422  19.138 22.283  1.00 53.61 ? 166 MET A CE    1 
ATOM   1253 N  N     . ARG A 1 170 ? 83.251  18.543 15.299  1.00 25.72 ? 167 ARG A N     1 
ATOM   1254 C  CA    . ARG A 1 170 ? 83.002  18.778 13.877  1.00 19.83 ? 167 ARG A CA    1 
ATOM   1255 C  C     . ARG A 1 170 ? 83.322  17.532 13.070  1.00 23.44 ? 167 ARG A C     1 
ATOM   1256 O  O     . ARG A 1 170 ? 82.533  17.106 12.218  1.00 21.15 ? 167 ARG A O     1 
ATOM   1257 C  CB    . ARG A 1 170 ? 83.830  19.960 13.371  1.00 21.21 ? 167 ARG A CB    1 
ATOM   1258 C  CG    . ARG A 1 170 ? 83.585  20.280 11.891  1.00 23.94 ? 167 ARG A CG    1 
ATOM   1259 C  CD    . ARG A 1 170 ? 84.655  21.193 11.296  1.00 25.06 ? 167 ARG A CD    1 
ATOM   1260 N  NE    . ARG A 1 170 ? 85.918  20.490 11.054  1.00 21.74 ? 167 ARG A NE    1 
ATOM   1261 C  CZ    . ARG A 1 170 ? 86.147  19.693 10.013  1.00 22.73 ? 167 ARG A CZ    1 
ATOM   1262 N  NH1   . ARG A 1 170 ? 85.199  19.478 9.126   1.00 21.84 ? 167 ARG A NH1   1 
ATOM   1263 N  NH2   . ARG A 1 170 ? 87.334  19.105 9.855   1.00 19.06 ? 167 ARG A NH2   1 
ATOM   1264 N  N     . LYS A 1 171 ? 84.470  16.911 13.348  1.00 21.92 ? 168 LYS A N     1 
ATOM   1265 C  CA    . LYS A 1 171 ? 84.866  15.743 12.570  1.00 24.38 ? 168 LYS A CA    1 
ATOM   1266 C  C     . LYS A 1 171 ? 83.981  14.541 12.878  1.00 20.34 ? 168 LYS A C     1 
ATOM   1267 O  O     . LYS A 1 171 ? 83.673  13.754 11.982  1.00 23.45 ? 168 LYS A O     1 
ATOM   1268 C  CB    . LYS A 1 171 ? 86.339  15.414 12.816  1.00 27.49 ? 168 LYS A CB    1 
ATOM   1269 C  CG    . LYS A 1 171 ? 87.295  16.486 12.301  1.00 34.36 ? 168 LYS A CG    1 
ATOM   1270 C  CD    . LYS A 1 171 ? 88.728  15.954 12.163  1.00 34.48 ? 168 LYS A CD    1 
ATOM   1271 N  N     . GLN A 1 172 ? 83.558  14.380 14.131  1.00 22.80 ? 169 GLN A N     1 
ATOM   1272 C  CA    . GLN A 1 172 ? 82.643  13.280 14.440  1.00 25.92 ? 169 GLN A CA    1 
ATOM   1273 C  C     . GLN A 1 172 ? 81.356  13.394 13.629  1.00 25.78 ? 169 GLN A C     1 
ATOM   1274 O  O     . GLN A 1 172 ? 80.871  12.403 13.072  1.00 23.27 ? 169 GLN A O     1 
ATOM   1275 C  CB    . GLN A 1 172 ? 82.338  13.249 15.935  1.00 23.72 ? 169 GLN A CB    1 
ATOM   1276 N  N     . GLY A 1 173 ? 80.792  14.600 13.542  1.00 27.07 ? 170 GLY A N     1 
ATOM   1277 C  CA    . GLY A 1 173 ? 79.613  14.786 12.716  1.00 23.81 ? 170 GLY A CA    1 
ATOM   1278 C  C     . GLY A 1 173 ? 79.894  14.529 11.252  1.00 17.48 ? 170 GLY A C     1 
ATOM   1279 O  O     . GLY A 1 173 ? 79.099  13.904 10.558  1.00 18.61 ? 170 GLY A O     1 
ATOM   1280 N  N     . LEU A 1 174 ? 81.032  15.016 10.758  1.00 18.37 ? 171 LEU A N     1 
ATOM   1281 C  CA    . LEU A 1 174 ? 81.356  14.807 9.356   1.00 19.26 ? 171 LEU A CA    1 
ATOM   1282 C  C     . LEU A 1 174 ? 81.547  13.327 9.054   1.00 20.30 ? 171 LEU A C     1 
ATOM   1283 O  O     . LEU A 1 174 ? 81.130  12.834 7.997   1.00 21.50 ? 171 LEU A O     1 
ATOM   1284 C  CB    . LEU A 1 174 ? 82.619  15.603 8.996   1.00 20.83 ? 171 LEU A CB    1 
ATOM   1285 C  CG    . LEU A 1 174 ? 83.123  15.496 7.570   1.00 22.01 ? 171 LEU A CG    1 
ATOM   1286 C  CD1   . LEU A 1 174 ? 82.072  16.032 6.615   1.00 20.53 ? 171 LEU A CD1   1 
ATOM   1287 C  CD2   . LEU A 1 174 ? 84.445  16.277 7.433   1.00 19.31 ? 171 LEU A CD2   1 
ATOM   1288 N  N     . PHE A 1 175 ? 82.196  12.604 9.963   1.00 23.46 ? 172 PHE A N     1 
ATOM   1289 C  CA    . PHE A 1 175 ? 82.361  11.169 9.765   1.00 24.90 ? 172 PHE A CA    1 
ATOM   1290 C  C     . PHE A 1 175 ? 81.010  10.460 9.688   1.00 23.25 ? 172 PHE A C     1 
ATOM   1291 O  O     . PHE A 1 175 ? 80.794  9.621  8.807   1.00 28.57 ? 172 PHE A O     1 
ATOM   1292 C  CB    . PHE A 1 175 ? 83.229  10.600 10.880  1.00 25.73 ? 172 PHE A CB    1 
ATOM   1293 C  CG    . PHE A 1 175 ? 84.672  11.022 10.781  1.00 36.62 ? 172 PHE A CG    1 
ATOM   1294 C  CD1   . PHE A 1 175 ? 85.258  11.222 9.542   1.00 39.23 ? 172 PHE A CD1   1 
ATOM   1295 C  CD2   . PHE A 1 175 ? 85.434  11.237 11.922  1.00 38.98 ? 172 PHE A CD2   1 
ATOM   1296 C  CE1   . PHE A 1 175 ? 86.588  11.613 9.436   1.00 42.07 ? 172 PHE A CE1   1 
ATOM   1297 C  CE2   . PHE A 1 175 ? 86.768  11.630 11.823  1.00 44.71 ? 172 PHE A CE2   1 
ATOM   1298 C  CZ    . PHE A 1 175 ? 87.339  11.822 10.577  1.00 38.12 ? 172 PHE A CZ    1 
ATOM   1299 N  N     . GLN A 1 176 ? 80.084  10.786 10.596  1.00 23.73 ? 173 GLN A N     1 
ATOM   1300 C  CA    . GLN A 1 176 ? 78.777  10.129 10.558  1.00 22.13 ? 173 GLN A CA    1 
ATOM   1301 C  C     . GLN A 1 176 ? 78.070  10.395 9.240   1.00 24.25 ? 173 GLN A C     1 
ATOM   1302 O  O     . GLN A 1 176 ? 77.431  9.499  8.681   1.00 23.74 ? 173 GLN A O     1 
ATOM   1303 C  CB    . GLN A 1 176 ? 77.904  10.580 11.732  1.00 27.43 ? 173 GLN A CB    1 
ATOM   1304 C  CG    . GLN A 1 176 ? 78.383  10.110 13.101  1.00 29.99 ? 173 GLN A CG    1 
ATOM   1305 C  CD    . GLN A 1 176 ? 77.406  10.443 14.208  1.00 36.56 ? 173 GLN A CD    1 
ATOM   1306 O  OE1   . GLN A 1 176 ? 76.442  11.182 13.998  1.00 36.28 ? 173 GLN A OE1   1 
ATOM   1307 N  NE2   . GLN A 1 176 ? 77.631  9.872  15.390  1.00 27.36 ? 173 GLN A NE2   1 
ATOM   1308 N  N     . TRP A 1 177 ? 78.194  11.624 8.717   1.00 20.55 ? 174 TRP A N     1 
ATOM   1309 C  CA    . TRP A 1 177 ? 77.577  11.976 7.444   1.00 21.30 ? 174 TRP A CA    1 
ATOM   1310 C  C     . TRP A 1 177 ? 78.198  11.191 6.289   1.00 19.73 ? 174 TRP A C     1 
ATOM   1311 O  O     . TRP A 1 177 ? 77.485  10.579 5.482   1.00 24.19 ? 174 TRP A O     1 
ATOM   1312 C  CB    . TRP A 1 177 ? 77.731  13.488 7.222   1.00 18.94 ? 174 TRP A CB    1 
ATOM   1313 C  CG    . TRP A 1 177 ? 77.247  13.978 5.920   1.00 17.78 ? 174 TRP A CG    1 
ATOM   1314 C  CD1   . TRP A 1 177 ? 78.005  14.324 4.849   1.00 20.03 ? 174 TRP A CD1   1 
ATOM   1315 C  CD2   . TRP A 1 177 ? 75.887  14.221 5.551   1.00 16.19 ? 174 TRP A CD2   1 
ATOM   1316 N  NE1   . TRP A 1 177 ? 77.206  14.750 3.822   1.00 19.35 ? 174 TRP A NE1   1 
ATOM   1317 C  CE2   . TRP A 1 177 ? 75.897  14.693 4.224   1.00 20.05 ? 174 TRP A CE2   1 
ATOM   1318 C  CE3   . TRP A 1 177 ? 74.660  14.053 6.203   1.00 19.75 ? 174 TRP A CE3   1 
ATOM   1319 C  CZ2   . TRP A 1 177 ? 74.729  15.017 3.535   1.00 17.27 ? 174 TRP A CZ2   1 
ATOM   1320 C  CZ3   . TRP A 1 177 ? 73.497  14.379 5.519   1.00 21.24 ? 174 TRP A CZ3   1 
ATOM   1321 C  CH2   . TRP A 1 177 ? 73.537  14.862 4.205   1.00 18.19 ? 174 TRP A CH2   1 
ATOM   1322 N  N     . LEU A 1 178 ? 79.526  11.236 6.167   1.00 21.31 ? 175 LEU A N     1 
ATOM   1323 C  CA    . LEU A 1 178 ? 80.179  10.575 5.042   1.00 20.66 ? 175 LEU A CA    1 
ATOM   1324 C  C     . LEU A 1 178 ? 79.991  9.064  5.102   1.00 28.51 ? 175 LEU A C     1 
ATOM   1325 O  O     . LEU A 1 178 ? 79.895  8.414  4.056   1.00 29.74 ? 175 LEU A O     1 
ATOM   1326 C  CB    . LEU A 1 178 ? 81.666  10.917 5.016   1.00 24.91 ? 175 LEU A CB    1 
ATOM   1327 C  CG    . LEU A 1 178 ? 81.969  12.390 4.746   1.00 25.06 ? 175 LEU A CG    1 
ATOM   1328 C  CD1   . LEU A 1 178 ? 83.468  12.658 4.905   1.00 23.14 ? 175 LEU A CD1   1 
ATOM   1329 C  CD2   . LEU A 1 178 ? 81.479  12.784 3.353   1.00 21.00 ? 175 LEU A CD2   1 
ATOM   1330 N  N     . ASP A 1 179 ? 79.936  8.495  6.310   1.00 27.27 ? 176 ASP A N     1 
ATOM   1331 C  CA    . ASP A 1 179 ? 79.770  7.048  6.437   1.00 36.01 ? 176 ASP A CA    1 
ATOM   1332 C  C     . ASP A 1 179 ? 78.413  6.587  5.935   1.00 32.93 ? 176 ASP A C     1 
ATOM   1333 O  O     . ASP A 1 179 ? 78.278  5.446  5.487   1.00 45.31 ? 176 ASP A O     1 
ATOM   1334 C  CB    . ASP A 1 179 ? 79.959  6.608  7.886   1.00 30.08 ? 176 ASP A CB    1 
ATOM   1335 C  CG    . ASP A 1 179 ? 81.403  6.555  8.281   1.00 34.59 ? 176 ASP A CG    1 
ATOM   1336 O  OD1   . ASP A 1 179 ? 82.255  6.582  7.369   1.00 46.10 ? 176 ASP A OD1   1 
ATOM   1337 O  OD2   . ASP A 1 179 ? 81.695  6.481  9.493   1.00 46.03 ? 176 ASP A OD2   1 
ATOM   1338 N  N     . SER A 1 180 ? 77.411  7.452  5.979   1.00 31.25 ? 177 SER A N     1 
ATOM   1339 C  CA    . SER A 1 180 ? 76.066  7.102  5.558   1.00 33.23 ? 177 SER A CA    1 
ATOM   1340 C  C     . SER A 1 180 ? 75.773  7.430  4.101   1.00 40.28 ? 177 SER A C     1 
ATOM   1341 O  O     . SER A 1 180 ? 74.680  7.107  3.618   1.00 41.83 ? 177 SER A O     1 
ATOM   1342 C  CB    . SER A 1 180 ? 75.049  7.828  6.440   1.00 29.68 ? 177 SER A CB    1 
ATOM   1343 O  OG    . SER A 1 180 ? 75.403  7.706  7.800   1.00 38.97 ? 177 SER A OG    1 
ATOM   1344 N  N     . LEU A 1 181 ? 76.700  8.071  3.397   1.00 27.16 ? 178 LEU A N     1 
ATOM   1345 C  CA    . LEU A 1 181 ? 76.402  8.598  2.071   1.00 23.38 ? 178 LEU A CA    1 
ATOM   1346 C  C     . LEU A 1 181 ? 76.334  7.491  1.019   1.00 37.60 ? 178 LEU A C     1 
ATOM   1347 O  O     . LEU A 1 181 ? 77.208  6.622  0.961   1.00 42.39 ? 178 LEU A O     1 
ATOM   1348 C  CB    . LEU A 1 181 ? 77.474  9.620  1.691   1.00 34.30 ? 178 LEU A CB    1 
ATOM   1349 C  CG    . LEU A 1 181 ? 77.136  10.865 0.889   1.00 38.35 ? 178 LEU A CG    1 
ATOM   1350 C  CD1   . LEU A 1 181 ? 75.905  11.574 1.467   1.00 31.19 ? 178 LEU A CD1   1 
ATOM   1351 C  CD2   . LEU A 1 181 ? 78.381  11.780 0.896   1.00 21.62 ? 178 LEU A CD2   1 
ATOM   1352 N  N     . GLN A 1 182 ? 75.302  7.541  0.171   1.00 34.77 ? 179 GLN A N     1 
ATOM   1353 C  CA    . GLN A 1 182 ? 75.139  6.604  -0.941  1.00 45.12 ? 179 GLN A CA    1 
ATOM   1354 C  C     . GLN A 1 182 ? 75.916  7.138  -2.140  1.00 53.80 ? 179 GLN A C     1 
ATOM   1355 O  O     . GLN A 1 182 ? 75.378  7.846  -2.996  1.00 56.03 ? 179 GLN A O     1 
ATOM   1356 C  CB    . GLN A 1 182 ? 73.664  6.408  -1.272  1.00 47.24 ? 179 GLN A CB    1 
ATOM   1357 N  N     . ILE A 1 183 ? 77.200  6.772  -2.209  1.00 46.93 ? 180 ILE A N     1 
ATOM   1358 C  CA    . ILE A 1 183 ? 78.085  7.295  -3.243  1.00 54.65 ? 180 ILE A CA    1 
ATOM   1359 C  C     . ILE A 1 183 ? 77.713  6.784  -4.630  1.00 56.39 ? 180 ILE A C     1 
ATOM   1360 O  O     . ILE A 1 183 ? 78.051  7.424  -5.634  1.00 55.58 ? 180 ILE A O     1 
ATOM   1361 C  CB    . ILE A 1 183 ? 79.547  6.948  -2.896  1.00 59.40 ? 180 ILE A CB    1 
ATOM   1362 C  CG1   . ILE A 1 183 ? 80.520  7.763  -3.752  1.00 52.75 ? 180 ILE A CG1   1 
ATOM   1363 C  CG2   . ILE A 1 183 ? 79.799  5.447  -3.045  1.00 54.41 ? 180 ILE A CG2   1 
ATOM   1364 C  CD1   . ILE A 1 183 ? 80.500  9.251  -3.451  1.00 50.56 ? 180 ILE A CD1   1 
ATOM   1365 N  N     . ASP A 1 184 ? 77.008  5.652  -4.711  1.00 56.71 ? 181 ASP A N     1 
ATOM   1366 C  CA    . ASP A 1 184 ? 76.647  5.058  -5.994  1.00 61.61 ? 181 ASP A CA    1 
ATOM   1367 C  C     . ASP A 1 184 ? 75.506  5.791  -6.686  1.00 62.66 ? 181 ASP A C     1 
ATOM   1368 O  O     . ASP A 1 184 ? 75.348  5.656  -7.905  1.00 55.35 ? 181 ASP A O     1 
ATOM   1369 C  CB    . ASP A 1 184 ? 76.260  3.587  -5.800  1.00 52.18 ? 181 ASP A CB    1 
ATOM   1370 N  N     . ASN A 1 185 ? 74.711  6.558  -5.944  1.00 51.65 ? 182 ASN A N     1 
ATOM   1371 C  CA    . ASN A 1 185 ? 73.505  7.188  -6.476  1.00 54.28 ? 182 ASN A CA    1 
ATOM   1372 C  C     . ASN A 1 185 ? 73.838  8.627  -6.855  1.00 48.55 ? 182 ASN A C     1 
ATOM   1373 O  O     . ASN A 1 185 ? 73.938  9.501  -5.991  1.00 40.97 ? 182 ASN A O     1 
ATOM   1374 C  CB    . ASN A 1 185 ? 72.375  7.126  -5.454  1.00 44.15 ? 182 ASN A CB    1 
ATOM   1375 C  CG    . ASN A 1 185 ? 71.036  7.483  -6.050  1.00 46.64 ? 182 ASN A CG    1 
ATOM   1376 O  OD1   . ASN A 1 185 ? 70.948  7.921  -7.202  0.71 44.66 ? 182 ASN A OD1   1 
ATOM   1377 N  ND2   . ASN A 1 185 ? 69.978  7.310  -5.265  0.57 50.63 ? 182 ASN A ND2   1 
ATOM   1378 N  N     . LEU A 1 186 ? 73.984  8.878  -8.155  1.00 44.55 ? 183 LEU A N     1 
ATOM   1379 C  CA    . LEU A 1 186 ? 74.308  10.226 -8.610  1.00 47.65 ? 183 LEU A CA    1 
ATOM   1380 C  C     . LEU A 1 186 ? 73.151  11.207 -8.446  1.00 44.60 ? 183 LEU A C     1 
ATOM   1381 O  O     . LEU A 1 186 ? 73.373  12.415 -8.584  1.00 42.49 ? 183 LEU A O     1 
ATOM   1382 C  CB    . LEU A 1 186 ? 74.763  10.203 -10.073 1.00 49.23 ? 183 LEU A CB    1 
ATOM   1383 C  CG    . LEU A 1 186 ? 75.987  9.357  -10.447 1.00 53.23 ? 183 LEU A CG    1 
ATOM   1384 C  CD1   . LEU A 1 186 ? 76.710  9.977  -11.644 0.54 50.65 ? 183 LEU A CD1   1 
ATOM   1385 C  CD2   . LEU A 1 186 ? 76.960  9.179  -9.275  0.73 52.00 ? 183 LEU A CD2   1 
ATOM   1386 N  N     . THR A 1 187 ? 71.934  10.736 -8.160  1.00 44.45 ? 184 THR A N     1 
ATOM   1387 C  CA    . THR A 1 187 ? 70.802  11.626 -7.924  1.00 40.94 ? 184 THR A CA    1 
ATOM   1388 C  C     . THR A 1 187 ? 70.488  11.818 -6.446  1.00 31.92 ? 184 THR A C     1 
ATOM   1389 O  O     . THR A 1 187 ? 69.503  12.490 -6.127  1.00 38.87 ? 184 THR A O     1 
ATOM   1390 C  CB    . THR A 1 187 ? 69.537  11.116 -8.636  1.00 42.02 ? 184 THR A CB    1 
ATOM   1391 O  OG1   . THR A 1 187 ? 69.027  9.957  -7.961  1.00 47.18 ? 184 THR A OG1   1 
ATOM   1392 C  CG2   . THR A 1 187 ? 69.837  10.772 -10.083 1.00 48.90 ? 184 THR A CG2   1 
ATOM   1393 N  N     . SER A 1 188 ? 71.264  11.234 -5.543  1.00 31.93 ? 185 SER A N     1 
ATOM   1394 C  CA    . SER A 1 188 ? 71.041  11.456 -4.114  1.00 28.51 ? 185 SER A CA    1 
ATOM   1395 C  C     . SER A 1 188 ? 71.202  12.938 -3.785  1.00 22.18 ? 185 SER A C     1 
ATOM   1396 O  O     . SER A 1 188 ? 72.296  13.492 -3.989  1.00 20.76 ? 185 SER A O     1 
ATOM   1397 C  CB    . SER A 1 188 ? 72.016  10.635 -3.279  1.00 31.50 ? 185 SER A CB    1 
ATOM   1398 O  OG    . SER A 1 188 ? 71.935  10.989 -1.903  1.00 34.92 ? 185 SER A OG    1 
ATOM   1399 N  N     . PRO A 1 189 ? 70.146  13.621 -3.323  1.00 21.45 ? 186 PRO A N     1 
ATOM   1400 C  CA    . PRO A 1 189 ? 70.313  15.017 -2.879  1.00 20.27 ? 186 PRO A CA    1 
ATOM   1401 C  C     . PRO A 1 189 ? 71.373  15.189 -1.808  1.00 17.28 ? 186 PRO A C     1 
ATOM   1402 O  O     . PRO A 1 189 ? 72.062  16.223 -1.799  1.00 18.39 ? 186 PRO A O     1 
ATOM   1403 C  CB    . PRO A 1 189 ? 68.918  15.385 -2.354  1.00 23.33 ? 186 PRO A CB    1 
ATOM   1404 C  CG    . PRO A 1 189 ? 67.968  14.425 -3.073  1.00 22.82 ? 186 PRO A CG    1 
ATOM   1405 C  CD    . PRO A 1 189 ? 68.750  13.160 -3.218  1.00 21.58 ? 186 PRO A CD    1 
ATOM   1406 N  N     . ASP A 1 190 ? 71.539  14.218 -0.897  1.00 16.51 ? 187 ASP A N     1 
ATOM   1407 C  CA    . ASP A 1 190 ? 72.544  14.380 0.147   1.00 16.70 ? 187 ASP A CA    1 
ATOM   1408 C  C     . ASP A 1 190 ? 73.940  14.330 -0.443  1.00 18.02 ? 187 ASP A C     1 
ATOM   1409 O  O     . ASP A 1 190 ? 74.824  15.102 -0.047  1.00 17.38 ? 187 ASP A O     1 
ATOM   1410 C  CB    . ASP A 1 190 ? 72.413  13.308 1.228   1.00 15.48 ? 187 ASP A CB    1 
ATOM   1411 C  CG    . ASP A 1 190 ? 71.185  13.491 2.114   1.00 20.50 ? 187 ASP A CG    1 
ATOM   1412 O  OD1   . ASP A 1 190 ? 70.581  14.585 2.159   1.00 15.62 ? 187 ASP A OD1   1 
ATOM   1413 O  OD2   . ASP A 1 190 ? 70.836  12.507 2.797   1.00 27.13 ? 187 ASP A OD2   1 
ATOM   1414 N  N     . LEU A 1 191 ? 74.157  13.424 -1.391  1.00 16.73 ? 188 LEU A N     1 
ATOM   1415 C  CA    . LEU A 1 191 ? 75.430  13.403 -2.102  1.00 21.55 ? 188 LEU A CA    1 
ATOM   1416 C  C     . LEU A 1 191 ? 75.658  14.702 -2.866  1.00 17.96 ? 188 LEU A C     1 
ATOM   1417 O  O     . LEU A 1 191 ? 76.784  15.225 -2.893  1.00 19.62 ? 188 LEU A O     1 
ATOM   1418 C  CB    . LEU A 1 191 ? 75.471  12.211 -3.053  1.00 19.05 ? 188 LEU A CB    1 
ATOM   1419 C  CG    . LEU A 1 191 ? 76.768  12.026 -3.855  1.00 23.91 ? 188 LEU A CG    1 
ATOM   1420 C  CD1   . LEU A 1 191 ? 77.947  11.843 -2.936  1.00 22.36 ? 188 LEU A CD1   1 
ATOM   1421 C  CD2   . LEU A 1 191 ? 76.640  10.843 -4.802  1.00 31.47 ? 188 LEU A CD2   1 
ATOM   1422 N  N     . GLN A 1 192 ? 74.611  15.232 -3.502  1.00 18.07 ? 189 GLN A N     1 
ATOM   1423 C  CA    . GLN A 1 192 ? 74.753  16.485 -4.243  1.00 18.89 ? 189 GLN A CA    1 
ATOM   1424 C  C     . GLN A 1 192 ? 75.156  17.630 -3.322  1.00 17.87 ? 189 GLN A C     1 
ATOM   1425 O  O     . GLN A 1 192 ? 76.071  18.403 -3.652  1.00 18.68 ? 189 GLN A O     1 
ATOM   1426 C  CB    . GLN A 1 192 ? 73.459  16.811 -4.988  1.00 17.87 ? 189 GLN A CB    1 
ATOM   1427 C  CG    . GLN A 1 192 ? 73.228  15.868 -6.174  1.00 23.91 ? 189 GLN A CG    1 
ATOM   1428 C  CD    . GLN A 1 192 ? 71.796  15.850 -6.673  1.00 31.71 ? 189 GLN A CD    1 
ATOM   1429 O  OE1   . GLN A 1 192 ? 70.930  16.571 -6.175  1.00 37.05 ? 189 GLN A OE1   1 
ATOM   1430 N  NE2   . GLN A 1 192 ? 71.536  15.004 -7.670  1.00 42.21 ? 189 GLN A NE2   1 
ATOM   1431 N  N     . LEU A 1 193 ? 74.516  17.739 -2.148  1.00 16.27 ? 190 LEU A N     1 
ATOM   1432 C  CA    . LEU A 1 193 ? 74.936  18.759 -1.183  1.00 14.71 ? 190 LEU A CA    1 
ATOM   1433 C  C     . LEU A 1 193 ? 76.387  18.571 -0.763  1.00 16.20 ? 190 LEU A C     1 
ATOM   1434 O  O     . LEU A 1 193 ? 77.115  19.556 -0.564  1.00 16.53 ? 190 LEU A O     1 
ATOM   1435 C  CB    . LEU A 1 193 ? 74.058  18.751 0.064   1.00 16.54 ? 190 LEU A CB    1 
ATOM   1436 C  CG    . LEU A 1 193 ? 72.591  19.119 -0.121  1.00 14.85 ? 190 LEU A CG    1 
ATOM   1437 C  CD1   . LEU A 1 193 ? 71.888  19.103 1.238   1.00 17.74 ? 190 LEU A CD1   1 
ATOM   1438 C  CD2   . LEU A 1 193 ? 72.458  20.496 -0.770  1.00 14.22 ? 190 LEU A CD2   1 
ATOM   1439 N  N     . THR A 1 194 ? 76.816  17.318 -0.575  1.00 14.72 ? 191 THR A N     1 
ATOM   1440 C  CA    . THR A 1 194 ? 78.181  17.073 -0.118  1.00 17.19 ? 191 THR A CA    1 
ATOM   1441 C  C     . THR A 1 194 ? 79.189  17.525 -1.158  1.00 16.07 ? 191 THR A C     1 
ATOM   1442 O  O     . THR A 1 194 ? 80.216  18.124 -0.819  1.00 16.90 ? 191 THR A O     1 
ATOM   1443 C  CB    . THR A 1 194 ? 78.375  15.596 0.191   1.00 17.46 ? 191 THR A CB    1 
ATOM   1444 O  OG1   . THR A 1 194 ? 77.402  15.200 1.153   1.00 19.14 ? 191 THR A OG1   1 
ATOM   1445 C  CG2   . THR A 1 194 ? 79.793  15.341 0.753   1.00 19.69 ? 191 THR A CG2   1 
ATOM   1446 N  N     . VAL A 1 195 ? 78.927  17.212 -2.426  1.00 17.77 ? 192 VAL A N     1 
ATOM   1447 C  CA    . VAL A 1 195 ? 79.802  17.689 -3.489  1.00 22.32 ? 192 VAL A CA    1 
ATOM   1448 C  C     . VAL A 1 195 ? 79.756  19.202 -3.564  1.00 16.58 ? 192 VAL A C     1 
ATOM   1449 O  O     . VAL A 1 195 ? 80.785  19.858 -3.782  1.00 20.24 ? 192 VAL A O     1 
ATOM   1450 C  CB    . VAL A 1 195 ? 79.420  17.039 -4.830  1.00 21.26 ? 192 VAL A CB    1 
ATOM   1451 C  CG1   . VAL A 1 195 ? 80.259  17.641 -5.969  1.00 20.10 ? 192 VAL A CG1   1 
ATOM   1452 C  CG2   . VAL A 1 195 ? 79.652  15.539 -4.746  1.00 22.33 ? 192 VAL A CG2   1 
ATOM   1453 N  N     . GLY A 1 196 ? 78.562  19.778 -3.427  1.00 20.38 ? 193 GLY A N     1 
ATOM   1454 C  CA    . GLY A 1 196 ? 78.455  21.225 -3.343  1.00 15.75 ? 193 GLY A CA    1 
ATOM   1455 C  C     . GLY A 1 196 ? 79.361  21.804 -2.278  1.00 17.44 ? 193 GLY A C     1 
ATOM   1456 O  O     . GLY A 1 196 ? 80.023  22.825 -2.499  1.00 17.16 ? 193 GLY A O     1 
ATOM   1457 N  N     . ALA A 1 197 ? 79.422  21.152 -1.111  1.00 15.01 ? 194 ALA A N     1 
ATOM   1458 C  CA    . ALA A 1 197 ? 80.282  21.633 -0.034  1.00 13.64 ? 194 ALA A CA    1 
ATOM   1459 C  C     . ALA A 1 197 ? 81.766  21.518 -0.397  1.00 17.82 ? 194 ALA A C     1 
ATOM   1460 O  O     . ALA A 1 197 ? 82.571  22.374 -0.018  1.00 18.75 ? 194 ALA A O     1 
ATOM   1461 C  CB    . ALA A 1 197 ? 79.980  20.876 1.259   1.00 15.58 ? 194 ALA A CB    1 
ATOM   1462 N  N     . VAL A 1 198 ? 82.147  20.474 -1.128  1.00 16.39 ? 195 VAL A N     1 
ATOM   1463 C  CA    . VAL A 1 198 ? 83.532  20.347 -1.584  1.00 16.90 ? 195 VAL A CA    1 
ATOM   1464 C  C     . VAL A 1 198 ? 83.908  21.516 -2.491  1.00 16.51 ? 195 VAL A C     1 
ATOM   1465 O  O     . VAL A 1 198 ? 84.995  22.101 -2.362  1.00 18.82 ? 195 VAL A O     1 
ATOM   1466 C  CB    . VAL A 1 198 ? 83.737  19.000 -2.299  1.00 20.07 ? 195 VAL A CB    1 
ATOM   1467 C  CG1   . VAL A 1 198 ? 85.106  18.992 -3.020  1.00 20.57 ? 195 VAL A CG1   1 
ATOM   1468 C  CG2   . VAL A 1 198 ? 83.630  17.847 -1.294  1.00 20.35 ? 195 VAL A CG2   1 
ATOM   1469 N  N     . ILE A 1 199 ? 83.009  21.882 -3.405  1.00 14.71 ? 196 ILE A N     1 
ATOM   1470 C  CA    . ILE A 1 199 ? 83.254  23.018 -4.291  1.00 18.68 ? 196 ILE A CA    1 
ATOM   1471 C  C     . ILE A 1 199 ? 83.343  24.314 -3.492  1.00 19.54 ? 196 ILE A C     1 
ATOM   1472 O  O     . ILE A 1 199 ? 84.187  25.177 -3.776  1.00 17.50 ? 196 ILE A O     1 
ATOM   1473 C  CB    . ILE A 1 199 ? 82.165  23.098 -5.374  1.00 17.39 ? 196 ILE A CB    1 
ATOM   1474 C  CG1   . ILE A 1 199 ? 82.231  21.866 -6.286  1.00 19.61 ? 196 ILE A CG1   1 
ATOM   1475 C  CG2   . ILE A 1 199 ? 82.305  24.377 -6.181  1.00 17.60 ? 196 ILE A CG2   1 
ATOM   1476 C  CD1   . ILE A 1 199 ? 81.026  21.685 -7.149  1.00 19.77 ? 196 ILE A CD1   1 
ATOM   1477 N  N     . VAL A 1 200 ? 82.476  24.476 -2.483  1.00 15.41 ? 197 VAL A N     1 
ATOM   1478 C  CA    . VAL A 1 200 ? 82.505  25.694 -1.671  1.00 15.68 ? 197 VAL A CA    1 
ATOM   1479 C  C     . VAL A 1 200 ? 83.786  25.767 -0.846  1.00 16.53 ? 197 VAL A C     1 
ATOM   1480 O  O     . VAL A 1 200 ? 84.340  26.856 -0.642  1.00 17.26 ? 197 VAL A O     1 
ATOM   1481 C  CB    . VAL A 1 200 ? 81.243  25.785 -0.782  1.00 12.62 ? 197 VAL A CB    1 
ATOM   1482 C  CG1   . VAL A 1 200 ? 81.337  26.992 0.155   1.00 13.48 ? 197 VAL A CG1   1 
ATOM   1483 C  CG2   . VAL A 1 200 ? 79.989  25.934 -1.680  1.00 15.85 ? 197 VAL A CG2   1 
ATOM   1484 N  N     . GLU A 1 201 ? 84.290  24.621 -0.358  1.00 14.66 ? 198 GLU A N     1 
ATOM   1485 C  CA    . GLU A 1 201 ? 85.612  24.631 0.266   1.00 16.81 ? 198 GLU A CA    1 
ATOM   1486 C  C     . GLU A 1 201 ? 86.660  25.187 -0.696  1.00 19.48 ? 198 GLU A C     1 
ATOM   1487 O  O     . GLU A 1 201 ? 87.504  26.011 -0.315  1.00 17.19 ? 198 GLU A O     1 
ATOM   1488 C  CB    . GLU A 1 201 ? 86.027  23.214 0.706   1.00 19.63 ? 198 GLU A CB    1 
ATOM   1489 C  CG    . GLU A 1 201 ? 85.233  22.601 1.880   1.00 15.87 ? 198 GLU A CG    1 
ATOM   1490 C  CD    . GLU A 1 201 ? 85.746  22.979 3.262   1.00 21.43 ? 198 GLU A CD    1 
ATOM   1491 O  OE1   . GLU A 1 201 ? 86.649  23.850 3.420   1.00 20.25 ? 198 GLU A OE1   1 
ATOM   1492 O  OE2   . GLU A 1 201 ? 85.216  22.389 4.223   1.00 18.17 ? 198 GLU A OE2   1 
ATOM   1493 N  N     . GLU A 1 202 ? 86.632  24.714 -1.944  1.00 15.61 ? 199 GLU A N     1 
ATOM   1494 C  CA    . GLU A 1 202 ? 87.589  25.170 -2.952  1.00 13.66 ? 199 GLU A CA    1 
ATOM   1495 C  C     . GLU A 1 202 ? 87.421  26.658 -3.237  1.00 19.60 ? 199 GLU A C     1 
ATOM   1496 O  O     . GLU A 1 202 ? 88.415  27.397 -3.313  1.00 16.41 ? 199 GLU A O     1 
ATOM   1497 C  CB    . GLU A 1 202 ? 87.421  24.339 -4.227  1.00 16.91 ? 199 GLU A CB    1 
ATOM   1498 C  CG    . GLU A 1 202 ? 87.812  22.872 -4.009  1.00 25.55 ? 199 GLU A CG    1 
ATOM   1499 C  CD    . GLU A 1 202 ? 87.334  21.948 -5.124  1.00 28.46 ? 199 GLU A CD    1 
ATOM   1500 O  OE1   . GLU A 1 202 ? 86.685  22.437 -6.078  1.00 29.22 ? 199 GLU A OE1   1 
ATOM   1501 O  OE2   . GLU A 1 202 ? 87.625  20.735 -5.042  1.00 29.87 ? 199 GLU A OE2   1 
ATOM   1502 N  N     . MET A 1 203 ? 86.167  27.106 -3.378  1.00 16.29 ? 200 MET A N     1 
ATOM   1503 C  CA    A MET A 1 203 ? 85.873  28.522 -3.599  0.45 17.59 ? 200 MET A CA    1 
ATOM   1504 C  CA    B MET A 1 203 ? 85.886  28.520 -3.606  0.55 17.59 ? 200 MET A CA    1 
ATOM   1505 C  C     . MET A 1 203 ? 86.378  29.380 -2.449  1.00 16.94 ? 200 MET A C     1 
ATOM   1506 O  O     . MET A 1 203 ? 86.969  30.453 -2.663  1.00 15.32 ? 200 MET A O     1 
ATOM   1507 C  CB    A MET A 1 203 ? 84.365  28.734 -3.763  0.45 16.64 ? 200 MET A CB    1 
ATOM   1508 C  CB    B MET A 1 203 ? 84.382  28.715 -3.814  0.55 16.65 ? 200 MET A CB    1 
ATOM   1509 C  CG    A MET A 1 203 ? 83.707  27.947 -4.872  0.45 17.76 ? 200 MET A CG    1 
ATOM   1510 C  CG    B MET A 1 203 ? 83.962  30.147 -4.069  0.55 15.59 ? 200 MET A CG    1 
ATOM   1511 S  SD    A MET A 1 203 ? 81.937  28.294 -4.946  0.45 25.26 ? 200 MET A SD    1 
ATOM   1512 S  SD    B MET A 1 203 ? 82.166  30.360 -4.062  0.55 21.52 ? 200 MET A SD    1 
ATOM   1513 C  CE    A MET A 1 203 ? 82.020  30.076 -5.128  0.45 14.99 ? 200 MET A CE    1 
ATOM   1514 C  CE    B MET A 1 203 ? 81.664  29.434 -5.501  0.55 20.69 ? 200 MET A CE    1 
ATOM   1515 N  N     . ARG A 1 204 ? 86.128  28.944 -1.213  1.00 13.36 ? 201 ARG A N     1 
ATOM   1516 C  CA    . ARG A 1 204 ? 86.558  29.732 -0.064  1.00 16.97 ? 201 ARG A CA    1 
ATOM   1517 C  C     . ARG A 1 204 ? 88.080  29.724 0.073   1.00 18.62 ? 201 ARG A C     1 
ATOM   1518 O  O     . ARG A 1 204 ? 88.678  30.737 0.463   1.00 16.23 ? 201 ARG A O     1 
ATOM   1519 C  CB    . ARG A 1 204 ? 85.881  29.212 1.202   1.00 18.15 ? 201 ARG A CB    1 
ATOM   1520 C  CG    . ARG A 1 204 ? 84.377  29.505 1.218   1.00 14.82 ? 201 ARG A CG    1 
ATOM   1521 C  CD    . ARG A 1 204 ? 83.686  28.949 2.471   1.00 17.81 ? 201 ARG A CD    1 
ATOM   1522 N  NE    . ARG A 1 204 ? 84.418  29.330 3.678   1.00 15.90 ? 201 ARG A NE    1 
ATOM   1523 C  CZ    . ARG A 1 204 ? 85.026  28.467 4.484   1.00 19.39 ? 201 ARG A CZ    1 
ATOM   1524 N  NH1   . ARG A 1 204 ? 84.959  27.161 4.232   1.00 20.21 ? 201 ARG A NH1   1 
ATOM   1525 N  NH2   . ARG A 1 204 ? 85.702  28.907 5.542   1.00 18.92 ? 201 ARG A NH2   1 
ATOM   1526 N  N     . ALA A 1 205 ? 88.727  28.596 -0.261  1.00 14.25 ? 202 ALA A N     1 
ATOM   1527 C  CA    . ALA A 1 205 ? 90.191  28.572 -0.291  1.00 14.92 ? 202 ALA A CA    1 
ATOM   1528 C  C     . ALA A 1 205 ? 90.728  29.567 -1.315  1.00 17.52 ? 202 ALA A C     1 
ATOM   1529 O  O     . ALA A 1 205 ? 91.717  30.270 -1.057  1.00 17.76 ? 202 ALA A O     1 
ATOM   1530 C  CB    . ALA A 1 205 ? 90.694  27.165 -0.617  1.00 16.06 ? 202 ALA A CB    1 
ATOM   1531 N  N     . ALA A 1 206 ? 90.084  29.643 -2.476  1.00 14.83 ? 203 ALA A N     1 
ATOM   1532 C  CA    . ALA A 1 206 ? 90.518  30.569 -3.514  1.00 14.79 ? 203 ALA A CA    1 
ATOM   1533 C  C     . ALA A 1 206 ? 90.347  32.017 -3.078  1.00 19.83 ? 203 ALA A C     1 
ATOM   1534 O  O     . ALA A 1 206 ? 91.227  32.853 -3.326  1.00 17.85 ? 203 ALA A O     1 
ATOM   1535 C  CB    . ALA A 1 206 ? 89.757  30.293 -4.811  1.00 18.70 ? 203 ALA A CB    1 
ATOM   1536 N  N     . ILE A 1 207 ? 89.217  32.345 -2.448  1.00 14.62 ? 204 ILE A N     1 
ATOM   1537 C  CA    . ILE A 1 207 ? 89.029  33.706 -1.945  1.00 16.35 ? 204 ILE A CA    1 
ATOM   1538 C  C     . ILE A 1 207 ? 90.141  34.054 -0.965  1.00 13.96 ? 204 ILE A C     1 
ATOM   1539 O  O     . ILE A 1 207 ? 90.758  35.126 -1.049  1.00 15.75 ? 204 ILE A O     1 
ATOM   1540 C  CB    . ILE A 1 207 ? 87.635  33.854 -1.306  1.00 13.90 ? 204 ILE A CB    1 
ATOM   1541 C  CG1   . ILE A 1 207 ? 86.551  33.656 -2.383  1.00 15.37 ? 204 ILE A CG1   1 
ATOM   1542 C  CG2   . ILE A 1 207 ? 87.506  35.218 -0.591  1.00 14.76 ? 204 ILE A CG2   1 
ATOM   1543 C  CD1   . ILE A 1 207 ? 85.090  33.563 -1.814  1.00 15.87 ? 204 ILE A CD1   1 
ATOM   1544 N  N     . GLU A 1 208 ? 90.436  33.147 -0.027  1.00 12.69 ? 205 GLU A N     1 
ATOM   1545 C  CA    . GLU A 1 208 ? 91.423  33.505 0.991   1.00 14.51 ? 205 GLU A CA    1 
ATOM   1546 C  C     . GLU A 1 208 ? 92.819  33.613 0.385   1.00 14.72 ? 205 GLU A C     1 
ATOM   1547 O  O     . GLU A 1 208 ? 93.562  34.552 0.691   1.00 18.16 ? 205 GLU A O     1 
ATOM   1548 C  CB    . GLU A 1 208 ? 91.420  32.500 2.144   1.00 20.85 ? 205 GLU A CB    1 
ATOM   1549 C  CG    . GLU A 1 208 ? 92.252  33.025 3.344   1.00 17.93 ? 205 GLU A CG    1 
ATOM   1550 C  CD    . GLU A 1 208 ? 92.204  32.128 4.568   1.00 24.09 ? 205 GLU A CD    1 
ATOM   1551 O  OE1   . GLU A 1 208 ? 91.684  30.992 4.473   1.00 24.03 ? 205 GLU A OE1   1 
ATOM   1552 O  OE2   . GLU A 1 208 ? 92.706  32.559 5.622   1.00 26.53 ? 205 GLU A OE2   1 
ATOM   1553 N  N     . ARG A 1 209 ? 93.180  32.683 -0.507  1.00 15.59 ? 206 ARG A N     1 
ATOM   1554 C  CA    . ARG A 1 209 ? 94.504  32.747 -1.132  1.00 19.31 ? 206 ARG A CA    1 
ATOM   1555 C  C     . ARG A 1 209 ? 94.695  34.034 -1.931  1.00 19.91 ? 206 ARG A C     1 
ATOM   1556 O  O     . ARG A 1 209 ? 95.757  34.671 -1.850  1.00 21.69 ? 206 ARG A O     1 
ATOM   1557 C  CB    . ARG A 1 209 ? 94.743  31.536 -2.043  1.00 16.68 ? 206 ARG A CB    1 
ATOM   1558 C  CG    . ARG A 1 209 ? 96.153  31.572 -2.665  1.00 25.03 ? 206 ARG A CG    1 
ATOM   1559 C  CD    . ARG A 1 209 ? 96.426  30.499 -3.752  1.00 26.81 ? 206 ARG A CD    1 
ATOM   1560 N  NE    . ARG A 1 209 ? 95.827  30.795 -5.061  1.00 34.81 ? 206 ARG A NE    1 
ATOM   1561 C  CZ    . ARG A 1 209 ? 96.354  31.595 -5.991  1.00 34.10 ? 206 ARG A CZ    1 
ATOM   1562 N  NH1   . ARG A 1 209 ? 97.500  32.231 -5.775  1.00 25.04 ? 206 ARG A NH1   1 
ATOM   1563 N  NH2   . ARG A 1 209 ? 95.719  31.770 -7.146  1.00 27.00 ? 206 ARG A NH2   1 
ATOM   1564 N  N     . GLU A 1 210 ? 93.689  34.428 -2.707  1.00 13.47 ? 207 GLU A N     1 
ATOM   1565 C  CA    . GLU A 1 210 ? 93.813  35.535 -3.653  1.00 15.94 ? 207 GLU A CA    1 
ATOM   1566 C  C     . GLU A 1 210 ? 93.446  36.899 -3.076  1.00 17.25 ? 207 GLU A C     1 
ATOM   1567 O  O     . GLU A 1 210 ? 93.755  37.919 -3.701  1.00 15.99 ? 207 GLU A O     1 
ATOM   1568 C  CB    . GLU A 1 210 ? 92.963  35.245 -4.889  1.00 18.00 ? 207 GLU A CB    1 
ATOM   1569 C  CG    . GLU A 1 210 ? 93.406  33.957 -5.554  1.00 19.26 ? 207 GLU A CG    1 
ATOM   1570 C  CD    . GLU A 1 210 ? 92.600  33.604 -6.781  1.00 25.21 ? 207 GLU A CD    1 
ATOM   1571 O  OE1   . GLU A 1 210 ? 92.162  34.533 -7.492  1.00 27.47 ? 207 GLU A OE1   1 
ATOM   1572 O  OE2   . GLU A 1 210 ? 92.427  32.388 -7.038  1.00 31.40 ? 207 GLU A OE2   1 
ATOM   1573 N  N     . THR A 1 211 ? 92.827  36.966 -1.899  1.00 14.04 ? 208 THR A N     1 
ATOM   1574 C  CA    . THR A 1 211 ? 92.517  38.271 -1.324  1.00 14.82 ? 208 THR A CA    1 
ATOM   1575 C  C     . THR A 1 211 ? 92.957  38.421 0.112   1.00 15.14 ? 208 THR A C     1 
ATOM   1576 O  O     . THR A 1 211 ? 93.056  39.560 0.588   1.00 17.49 ? 208 THR A O     1 
ATOM   1577 C  CB    . THR A 1 211 ? 91.001  38.570 -1.382  1.00 17.59 ? 208 THR A CB    1 
ATOM   1578 O  OG1   . THR A 1 211 ? 90.305  37.712 -0.468  1.00 16.84 ? 208 THR A OG1   1 
ATOM   1579 C  CG2   . THR A 1 211 ? 90.442  38.381 -2.769  1.00 17.61 ? 208 THR A CG2   1 
ATOM   1580 N  N     . GLY A 1 212 ? 93.209  37.332 0.819   1.00 16.23 ? 209 GLY A N     1 
ATOM   1581 C  CA    . GLY A 1 212 ? 93.463  37.385 2.239   1.00 18.11 ? 209 GLY A CA    1 
ATOM   1582 C  C     . GLY A 1 212 ? 92.219  37.351 3.103   1.00 18.39 ? 209 GLY A C     1 
ATOM   1583 O  O     . GLY A 1 212 ? 92.342  37.302 4.325   1.00 20.27 ? 209 GLY A O     1 
ATOM   1584 N  N     . PHE A 1 213 ? 91.031  37.368 2.505   1.00 14.14 ? 210 PHE A N     1 
ATOM   1585 C  CA    . PHE A 1 213 ? 89.786  37.468 3.252   1.00 14.93 ? 210 PHE A CA    1 
ATOM   1586 C  C     . PHE A 1 213 ? 89.214  36.090 3.558   1.00 16.86 ? 210 PHE A C     1 
ATOM   1587 O  O     . PHE A 1 213 ? 89.224  35.194 2.706   1.00 17.58 ? 210 PHE A O     1 
ATOM   1588 C  CB    . PHE A 1 213 ? 88.749  38.281 2.475   1.00 14.16 ? 210 PHE A CB    1 
ATOM   1589 C  CG    . PHE A 1 213 ? 89.183  39.689 2.156   1.00 13.54 ? 210 PHE A CG    1 
ATOM   1590 C  CD1   . PHE A 1 213 ? 89.965  40.410 3.048   1.00 17.38 ? 210 PHE A CD1   1 
ATOM   1591 C  CD2   . PHE A 1 213 ? 88.811  40.273 0.966   1.00 14.15 ? 210 PHE A CD2   1 
ATOM   1592 C  CE1   . PHE A 1 213 ? 90.395  41.703 2.755   1.00 14.73 ? 210 PHE A CE1   1 
ATOM   1593 C  CE2   . PHE A 1 213 ? 89.218  41.606 0.649   1.00 14.79 ? 210 PHE A CE2   1 
ATOM   1594 C  CZ    . PHE A 1 213 ? 90.004  42.315 1.547   1.00 17.78 ? 210 PHE A CZ    1 
ATOM   1595 N  N     . GLN A 1 214 ? 88.703  35.941 4.778   1.00 15.85 ? 211 GLN A N     1 
ATOM   1596 C  CA    . GLN A 1 214 ? 87.982  34.751 5.210   1.00 14.59 ? 211 GLN A CA    1 
ATOM   1597 C  C     . GLN A 1 214 ? 86.478  34.957 5.126   1.00 13.32 ? 211 GLN A C     1 
ATOM   1598 O  O     . GLN A 1 214 ? 85.968  36.075 5.242   1.00 14.64 ? 211 GLN A O     1 
ATOM   1599 C  CB    . GLN A 1 214 ? 88.355  34.396 6.643   1.00 13.32 ? 211 GLN A CB    1 
ATOM   1600 C  CG    . GLN A 1 214 ? 89.817  33.945 6.739   1.00 16.04 ? 211 GLN A CG    1 
ATOM   1601 C  CD    . GLN A 1 214 ? 90.205  33.460 8.110   1.00 21.44 ? 211 GLN A CD    1 
ATOM   1602 O  OE1   . GLN A 1 214 ? 89.512  33.716 9.094   1.00 20.73 ? 211 GLN A OE1   1 
ATOM   1603 N  NE2   . GLN A 1 214 ? 91.338  32.741 8.184   1.00 24.32 ? 211 GLN A NE2   1 
ATOM   1604 N  N     . CYS A 1 215 ? 85.760  33.858 4.959   1.00 14.87 ? 212 CYS A N     1 
ATOM   1605 C  CA    . CYS A 1 215 ? 84.310  33.974 4.898   1.00 13.96 ? 212 CYS A CA    1 
ATOM   1606 C  C     . CYS A 1 215 ? 83.703  32.717 5.486   1.00 13.72 ? 212 CYS A C     1 
ATOM   1607 O  O     . CYS A 1 215 ? 84.390  31.710 5.716   1.00 14.57 ? 212 CYS A O     1 
ATOM   1608 C  CB    . CYS A 1 215 ? 83.834  34.181 3.468   1.00 14.95 ? 212 CYS A CB    1 
ATOM   1609 S  SG    . CYS A 1 215 ? 84.271  32.802 2.406   1.00 20.49 ? 212 CYS A SG    1 
ATOM   1610 N  N     . SER A 1 216 ? 82.400  32.785 5.706   1.00 13.80 ? 213 SER A N     1 
ATOM   1611 C  CA    . SER A 1 216 ? 81.589  31.632 6.082   1.00 14.01 ? 213 SER A CA    1 
ATOM   1612 C  C     . SER A 1 216 ? 80.642  31.310 4.931   1.00 14.67 ? 213 SER A C     1 
ATOM   1613 O  O     . SER A 1 216 ? 80.398  32.148 4.060   1.00 14.03 ? 213 SER A O     1 
ATOM   1614 C  CB    . SER A 1 216 ? 80.802  31.916 7.361   1.00 15.66 ? 213 SER A CB    1 
ATOM   1615 O  OG    . SER A 1 216 ? 81.672  32.275 8.430   1.00 18.57 ? 213 SER A OG    1 
ATOM   1616 N  N     . ALA A 1 217 ? 80.124  30.079 4.907   1.00 11.82 ? 214 ALA A N     1 
ATOM   1617 C  CA    . ALA A 1 217 ? 79.157  29.760 3.864   1.00 11.71 ? 214 ALA A CA    1 
ATOM   1618 C  C     . ALA A 1 217 ? 78.128  28.765 4.394   1.00 14.29 ? 214 ALA A C     1 
ATOM   1619 O  O     . ALA A 1 217 ? 78.410  27.989 5.308   1.00 14.48 ? 214 ALA A O     1 
ATOM   1620 C  CB    . ALA A 1 217 ? 79.843  29.189 2.605   1.00 12.49 ? 214 ALA A CB    1 
ATOM   1621 N  N     . GLY A 1 218 ? 76.932  28.806 3.817   1.00 12.99 ? 215 GLY A N     1 
ATOM   1622 C  CA    . GLY A 1 218 ? 75.944  27.758 3.997   1.00 10.26 ? 215 GLY A CA    1 
ATOM   1623 C  C     . GLY A 1 218 ? 75.737  27.054 2.671   1.00 12.00 ? 215 GLY A C     1 
ATOM   1624 O  O     . GLY A 1 218 ? 75.830  27.674 1.616   1.00 14.26 ? 215 GLY A O     1 
ATOM   1625 N  N     . ILE A 1 219 ? 75.477  25.744 2.727   1.00 12.11 ? 216 ILE A N     1 
ATOM   1626 C  CA    . ILE A 1 219 ? 75.163  24.942 1.550   1.00 10.88 ? 216 ILE A CA    1 
ATOM   1627 C  C     . ILE A 1 219 ? 73.865  24.190 1.839   1.00 15.11 ? 216 ILE A C     1 
ATOM   1628 O  O     . ILE A 1 219 ? 73.778  23.470 2.838   1.00 13.82 ? 216 ILE A O     1 
ATOM   1629 C  CB    . ILE A 1 219 ? 76.284  23.941 1.218   1.00 15.94 ? 216 ILE A CB    1 
ATOM   1630 C  CG1   . ILE A 1 219 ? 77.632  24.659 1.023   1.00 15.45 ? 216 ILE A CG1   1 
ATOM   1631 C  CG2   . ILE A 1 219 ? 75.906  23.084 0.009   1.00 15.66 ? 216 ILE A CG2   1 
ATOM   1632 C  CD1   . ILE A 1 219 ? 78.504  24.640 2.260   1.00 16.19 ? 216 ILE A CD1   1 
ATOM   1633 N  N     . SER A 1 220 ? 72.856  24.372 0.992   1.00 13.55 ? 217 SER A N     1 
ATOM   1634 C  CA    . SER A 1 220 ? 71.607  23.638 1.166   1.00 13.20 ? 217 SER A CA    1 
ATOM   1635 C  C     . SER A 1 220 ? 70.907  23.561 -0.185  1.00 15.60 ? 217 SER A C     1 
ATOM   1636 O  O     . SER A 1 220 ? 71.551  23.643 -1.239  1.00 15.45 ? 217 SER A O     1 
ATOM   1637 C  CB    . SER A 1 220 ? 70.728  24.285 2.254   1.00 15.16 ? 217 SER A CB    1 
ATOM   1638 O  OG    . SER A 1 220 ? 69.631  23.426 2.617   1.00 14.14 ? 217 SER A OG    1 
ATOM   1639 N  N     . HIS A 1 221 ? 69.594  23.375 -0.164  1.00 16.16 ? 218 HIS A N     1 
ATOM   1640 C  CA    . HIS A 1 221 ? 68.839  23.176 -1.398  1.00 15.74 ? 218 HIS A CA    1 
ATOM   1641 C  C     . HIS A 1 221 ? 68.158  24.441 -1.894  1.00 13.67 ? 218 HIS A C     1 
ATOM   1642 O  O     . HIS A 1 221 ? 67.530  24.419 -2.960  1.00 15.88 ? 218 HIS A O     1 
ATOM   1643 C  CB    . HIS A 1 221 ? 67.800  22.064 -1.199  1.00 15.14 ? 218 HIS A CB    1 
ATOM   1644 C  CG    . HIS A 1 221 ? 68.406  20.698 -1.138  1.00 15.39 ? 218 HIS A CG    1 
ATOM   1645 N  ND1   . HIS A 1 221 ? 69.104  20.149 -2.194  1.00 15.39 ? 218 HIS A ND1   1 
ATOM   1646 C  CD2   . HIS A 1 221 ? 68.418  19.767 -0.150  1.00 15.55 ? 218 HIS A CD2   1 
ATOM   1647 C  CE1   . HIS A 1 221 ? 69.516  18.937 -1.862  1.00 17.92 ? 218 HIS A CE1   1 
ATOM   1648 N  NE2   . HIS A 1 221 ? 69.122  18.686 -0.625  1.00 16.51 ? 218 HIS A NE2   1 
ATOM   1649 N  N     . ASN A 1 222 ? 68.244  25.534 -1.145  1.00 13.68 ? 219 ASN A N     1 
ATOM   1650 C  CA    . ASN A 1 222 ? 67.599  26.777 -1.546  1.00 14.47 ? 219 ASN A CA    1 
ATOM   1651 C  C     . ASN A 1 222 ? 68.250  27.925 -0.788  1.00 15.75 ? 219 ASN A C     1 
ATOM   1652 O  O     . ASN A 1 222 ? 69.079  27.718 0.102   1.00 14.93 ? 219 ASN A O     1 
ATOM   1653 C  CB    . ASN A 1 222 ? 66.082  26.746 -1.296  1.00 17.28 ? 219 ASN A CB    1 
ATOM   1654 C  CG    . ASN A 1 222 ? 65.729  26.423 0.158   1.00 18.37 ? 219 ASN A CG    1 
ATOM   1655 O  OD1   . ASN A 1 222 ? 66.055  27.179 1.074   1.00 16.23 ? 219 ASN A OD1   1 
ATOM   1656 N  ND2   . ASN A 1 222 ? 65.012  25.314 0.359   1.00 15.56 ? 219 ASN A ND2   1 
ATOM   1657 N  N     . LYS A 1 223 ? 67.852  29.143 -1.156  1.00 17.88 ? 220 LYS A N     1 
ATOM   1658 C  CA    . LYS A 1 223 ? 68.537  30.335 -0.657  1.00 16.72 ? 220 LYS A CA    1 
ATOM   1659 C  C     . LYS A 1 223 ? 68.276  30.563 0.828   1.00 17.82 ? 220 LYS A C     1 
ATOM   1660 O  O     . LYS A 1 223 ? 69.196  30.926 1.577   1.00 16.18 ? 220 LYS A O     1 
ATOM   1661 C  CB    . LYS A 1 223 ? 68.104  31.558 -1.476  1.00 17.13 ? 220 LYS A CB    1 
ATOM   1662 C  CG    . LYS A 1 223 ? 68.707  31.583 -2.875  1.00 18.20 ? 220 LYS A CG    1 
ATOM   1663 C  CD    . LYS A 1 223 ? 67.982  32.602 -3.808  1.00 27.50 ? 220 LYS A CD    1 
ATOM   1664 C  CE    . LYS A 1 223 ? 68.060  34.017 -3.308  1.00 31.62 ? 220 LYS A CE    1 
ATOM   1665 N  NZ    . LYS A 1 223 ? 67.493  35.022 -4.319  1.00 25.37 ? 220 LYS A NZ    1 
ATOM   1666 N  N     . VAL A 1 224 ? 67.025  30.388 1.275   1.00 13.91 ? 221 VAL A N     1 
ATOM   1667 C  CA    . VAL A 1 224 ? 66.711  30.619 2.683   1.00 13.29 ? 221 VAL A CA    1 
ATOM   1668 C  C     . VAL A 1 224 ? 67.475  29.652 3.578   1.00 14.91 ? 221 VAL A C     1 
ATOM   1669 O  O     . VAL A 1 224 ? 67.982  30.043 4.634   1.00 16.57 ? 221 VAL A O     1 
ATOM   1670 C  CB    . VAL A 1 224 ? 65.195  30.522 2.939   1.00 17.01 ? 221 VAL A CB    1 
ATOM   1671 C  CG1   . VAL A 1 224 ? 64.921  30.373 4.405   1.00 17.63 ? 221 VAL A CG1   1 
ATOM   1672 C  CG2   . VAL A 1 224 ? 64.503  31.760 2.420   1.00 22.37 ? 221 VAL A CG2   1 
ATOM   1673 N  N     . LEU A 1 225 ? 67.549  28.374 3.191   1.00 10.97 ? 222 LEU A N     1 
ATOM   1674 C  CA    . LEU A 1 225 ? 68.277  27.406 4.014   1.00 12.13 ? 222 LEU A CA    1 
ATOM   1675 C  C     . LEU A 1 225 ? 69.777  27.634 3.934   1.00 15.11 ? 222 LEU A C     1 
ATOM   1676 O  O     . LEU A 1 225 ? 70.482  27.474 4.936   1.00 12.75 ? 222 LEU A O     1 
ATOM   1677 C  CB    . LEU A 1 225 ? 67.943  25.968 3.596   1.00 11.36 ? 222 LEU A CB    1 
ATOM   1678 C  CG    . LEU A 1 225 ? 66.517  25.529 3.972   1.00 14.87 ? 222 LEU A CG    1 
ATOM   1679 C  CD1   . LEU A 1 225 ? 66.354  24.044 3.628   1.00 17.10 ? 222 LEU A CD1   1 
ATOM   1680 C  CD2   . LEU A 1 225 ? 66.257  25.769 5.452   1.00 17.13 ? 222 LEU A CD2   1 
ATOM   1681 N  N     . ALA A 1 226 ? 70.284  28.035 2.766   1.00 13.91 ? 223 ALA A N     1 
ATOM   1682 C  CA    . ALA A 1 226 ? 71.718  28.320 2.675   1.00 15.36 ? 223 ALA A CA    1 
ATOM   1683 C  C     . ALA A 1 226 ? 72.094  29.509 3.547   1.00 14.88 ? 223 ALA A C     1 
ATOM   1684 O  O     . ALA A 1 226 ? 73.152  29.513 4.191   1.00 15.03 ? 223 ALA A O     1 
ATOM   1685 C  CB    . ALA A 1 226 ? 72.120  28.582 1.222   1.00 15.40 ? 223 ALA A CB    1 
ATOM   1686 N  N     . LYS A 1 227 ? 71.252  30.541 3.551   1.00 12.71 ? 224 LYS A N     1 
ATOM   1687 C  CA    . LYS A 1 227 ? 71.519  31.719 4.358   1.00 15.79 ? 224 LYS A CA    1 
ATOM   1688 C  C     . LYS A 1 227 ? 71.485  31.387 5.850   1.00 15.00 ? 224 LYS A C     1 
ATOM   1689 O  O     . LYS A 1 227 ? 72.353  31.819 6.618   1.00 13.82 ? 224 LYS A O     1 
ATOM   1690 C  CB    . LYS A 1 227 ? 70.507  32.802 4.006   1.00 13.02 ? 224 LYS A CB    1 
ATOM   1691 C  CG    . LYS A 1 227 ? 70.478  33.874 5.039   1.00 19.74 ? 224 LYS A CG    1 
ATOM   1692 C  CD    . LYS A 1 227 ? 71.625  34.790 4.825   1.00 27.32 ? 224 LYS A CD    1 
ATOM   1693 C  CE    . LYS A 1 227 ? 71.548  35.848 5.860   0.48 28.40 ? 224 LYS A CE    1 
ATOM   1694 N  NZ    . LYS A 1 227 ? 70.614  36.787 5.283   0.74 26.94 ? 224 LYS A NZ    1 
ATOM   1695 N  N     . LEU A 1 228 ? 70.483  30.618 6.276   1.00 16.00 ? 225 LEU A N     1 
ATOM   1696 C  CA    . LEU A 1 228 ? 70.422  30.170 7.659   1.00 15.32 ? 225 LEU A CA    1 
ATOM   1697 C  C     . LEU A 1 228 ? 71.629  29.307 8.008   1.00 14.80 ? 225 LEU A C     1 
ATOM   1698 O  O     . LEU A 1 228 ? 72.251  29.485 9.068   1.00 17.80 ? 225 LEU A O     1 
ATOM   1699 C  CB    . LEU A 1 228 ? 69.119  29.399 7.862   1.00 16.48 ? 225 LEU A CB    1 
ATOM   1700 C  CG    . LEU A 1 228 ? 68.726  28.978 9.262   1.00 24.29 ? 225 LEU A CG    1 
ATOM   1701 C  CD1   . LEU A 1 228 ? 68.374  30.239 10.089  1.00 21.60 ? 225 LEU A CD1   1 
ATOM   1702 C  CD2   . LEU A 1 228 ? 67.561  27.967 9.156   1.00 16.85 ? 225 LEU A CD2   1 
ATOM   1703 N  N     . ALA A 1 229 ? 71.980  28.375 7.118   1.00 14.59 ? 226 ALA A N     1 
ATOM   1704 C  CA    . ALA A 1 229 ? 73.133  27.508 7.337   1.00 13.41 ? 226 ALA A CA    1 
ATOM   1705 C  C     . ALA A 1 229 ? 74.416  28.310 7.535   1.00 15.94 ? 226 ALA A C     1 
ATOM   1706 O  O     . ALA A 1 229 ? 75.239  27.982 8.399   1.00 15.77 ? 226 ALA A O     1 
ATOM   1707 C  CB    . ALA A 1 229 ? 73.300  26.557 6.154   1.00 15.02 ? 226 ALA A CB    1 
ATOM   1708 N  N     . CYS A 1 230 ? 74.622  29.336 6.712   1.00 12.76 ? 227 CYS A N     1 
ATOM   1709 C  CA    . CYS A 1 230 ? 75.844  30.142 6.792   1.00 12.85 ? 227 CYS A CA    1 
ATOM   1710 C  C     . CYS A 1 230 ? 76.085  30.702 8.198   1.00 12.83 ? 227 CYS A C     1 
ATOM   1711 O  O     . CYS A 1 230 ? 77.226  30.735 8.683   1.00 16.54 ? 227 CYS A O     1 
ATOM   1712 C  CB    . CYS A 1 230 ? 75.745  31.275 5.777   1.00 15.10 ? 227 CYS A CB    1 
ATOM   1713 S  SG    . CYS A 1 230 ? 77.244  32.256 5.684   1.00 17.78 ? 227 CYS A SG    1 
ATOM   1714 N  N     . GLY A 1 231 ? 75.026  31.135 8.873   1.00 17.36 ? 228 GLY A N     1 
ATOM   1715 C  CA    . GLY A 1 231 ? 75.203  31.726 10.188  1.00 20.04 ? 228 GLY A CA    1 
ATOM   1716 C  C     . GLY A 1 231 ? 75.375  30.741 11.326  1.00 19.15 ? 228 GLY A C     1 
ATOM   1717 O  O     . GLY A 1 231 ? 75.651  31.163 12.453  1.00 20.07 ? 228 GLY A O     1 
ATOM   1718 N  N     . LEU A 1 232 ? 75.224  29.439 11.064  1.00 18.78 ? 229 LEU A N     1 
ATOM   1719 C  CA    . LEU A 1 232 ? 75.262  28.460 12.149  1.00 17.53 ? 229 LEU A CA    1 
ATOM   1720 C  C     . LEU A 1 232 ? 76.669  28.275 12.708  1.00 22.65 ? 229 LEU A C     1 
ATOM   1721 O  O     . LEU A 1 232 ? 76.827  27.975 13.898  1.00 19.08 ? 229 LEU A O     1 
ATOM   1722 C  CB    . LEU A 1 232 ? 74.710  27.120 11.669  1.00 18.98 ? 229 LEU A CB    1 
ATOM   1723 C  CG    . LEU A 1 232 ? 73.209  27.123 11.356  1.00 21.59 ? 229 LEU A CG    1 
ATOM   1724 C  CD1   . LEU A 1 232 ? 72.764  25.749 10.865  1.00 16.56 ? 229 LEU A CD1   1 
ATOM   1725 C  CD2   . LEU A 1 232 ? 72.456  27.501 12.601  1.00 24.11 ? 229 LEU A CD2   1 
ATOM   1726 N  N     . ASN A 1 233 ? 77.709  28.433 11.868  1.00 18.20 ? 230 ASN A N     1 
ATOM   1727 C  CA    . ASN A 1 233 ? 79.093  28.250 12.302  1.00 17.17 ? 230 ASN A CA    1 
ATOM   1728 C  C     . ASN A 1 233 ? 79.928  29.366 11.669  1.00 24.19 ? 230 ASN A C     1 
ATOM   1729 O  O     . ASN A 1 233 ? 80.484  29.199 10.586  1.00 27.40 ? 230 ASN A O     1 
ATOM   1730 C  CB    . ASN A 1 233 ? 79.621  26.871 11.922  1.00 16.04 ? 230 ASN A CB    1 
ATOM   1731 C  CG    . ASN A 1 233 ? 78.831  25.749 12.586  1.00 22.11 ? 230 ASN A CG    1 
ATOM   1732 O  OD1   . ASN A 1 233 ? 77.956  25.114 11.968  1.00 20.52 ? 230 ASN A OD1   1 
ATOM   1733 N  ND2   . ASN A 1 233 ? 79.123  25.515 13.859  1.00 15.31 ? 230 ASN A ND2   1 
ATOM   1734 N  N     . LYS A 1 234 ? 79.960  30.509 12.340  1.00 30.09 ? 231 LYS A N     1 
ATOM   1735 C  CA    . LYS A 1 234 ? 80.775  31.668 11.951  1.00 23.26 ? 231 LYS A CA    1 
ATOM   1736 C  C     . LYS A 1 234 ? 81.800  31.887 13.057  1.00 29.90 ? 231 LYS A C     1 
ATOM   1737 O  O     . LYS A 1 234 ? 81.511  31.612 14.222  1.00 41.24 ? 231 LYS A O     1 
ATOM   1738 C  CB    . LYS A 1 234 ? 79.902  32.921 11.775  1.00 33.31 ? 231 LYS A CB    1 
ATOM   1739 C  CG    . LYS A 1 234 ? 79.307  33.176 10.386  1.00 29.93 ? 231 LYS A CG    1 
ATOM   1740 C  CD    . LYS A 1 234 ? 78.946  34.690 10.219  1.00 31.72 ? 231 LYS A CD    1 
ATOM   1741 C  CE    . LYS A 1 234 ? 78.799  35.152 8.741   1.00 31.96 ? 231 LYS A CE    1 
ATOM   1742 N  NZ    . LYS A 1 234 ? 80.051  35.789 8.115   1.00 19.63 ? 231 LYS A NZ    1 
ATOM   1743 N  N     . PRO A 1 235 ? 82.995  32.390 12.722  1.00 23.01 ? 232 PRO A N     1 
ATOM   1744 C  CA    . PRO A 1 235 ? 83.498  32.735 11.389  1.00 20.53 ? 232 PRO A CA    1 
ATOM   1745 C  C     . PRO A 1 235 ? 84.344  31.633 10.767  1.00 15.93 ? 232 PRO A C     1 
ATOM   1746 O  O     . PRO A 1 235 ? 84.694  30.667 11.447  1.00 17.34 ? 232 PRO A O     1 
ATOM   1747 C  CB    . PRO A 1 235 ? 84.377  33.959 11.673  1.00 18.10 ? 232 PRO A CB    1 
ATOM   1748 C  CG    . PRO A 1 235 ? 84.974  33.649 13.044  1.00 18.78 ? 232 PRO A CG    1 
ATOM   1749 C  CD    . PRO A 1 235 ? 83.910  32.857 13.789  1.00 24.27 ? 232 PRO A CD    1 
ATOM   1750 N  N     . ASN A 1 236 ? 84.694  31.808 9.490   1.00 14.93 ? 233 ASN A N     1 
ATOM   1751 C  CA    . ASN A 1 236 ? 85.685  30.969 8.800   1.00 14.81 ? 233 ASN A CA    1 
ATOM   1752 C  C     . ASN A 1 236 ? 85.284  29.498 8.768   1.00 15.55 ? 233 ASN A C     1 
ATOM   1753 O  O     . ASN A 1 236 ? 86.144  28.619 8.804   1.00 15.42 ? 233 ASN A O     1 
ATOM   1754 C  CB    . ASN A 1 236 ? 87.081  31.124 9.436   1.00 19.65 ? 233 ASN A CB    1 
ATOM   1755 C  CG    . ASN A 1 236 ? 88.200  30.630 8.530   1.00 19.97 ? 233 ASN A CG    1 
ATOM   1756 O  OD1   . ASN A 1 236 ? 88.065  30.636 7.312   1.00 21.44 ? 233 ASN A OD1   1 
ATOM   1757 N  ND2   . ASN A 1 236 ? 89.312  30.186 9.128   1.00 22.80 ? 233 ASN A ND2   1 
ATOM   1758 N  N     . ARG A 1 237 ? 83.985  29.199 8.698   1.00 14.08 ? 234 ARG A N     1 
ATOM   1759 C  CA    . ARG A 1 237 ? 83.523  27.813 8.596   1.00 17.14 ? 234 ARG A CA    1 
ATOM   1760 C  C     . ARG A 1 237 ? 82.342  27.770 7.636   1.00 12.66 ? 234 ARG A C     1 
ATOM   1761 O  O     . ARG A 1 237 ? 81.730  28.799 7.331   1.00 16.67 ? 234 ARG A O     1 
ATOM   1762 C  CB    . ARG A 1 237 ? 83.075  27.226 9.951   1.00 13.61 ? 234 ARG A CB    1 
ATOM   1763 C  CG    . ARG A 1 237 ? 84.154  27.149 11.019  1.00 20.75 ? 234 ARG A CG    1 
ATOM   1764 C  CD    . ARG A 1 237 ? 85.195  26.085 10.676  1.00 25.22 ? 234 ARG A CD    1 
ATOM   1765 N  NE    . ARG A 1 237 ? 86.215  25.977 11.719  1.00 29.22 ? 234 ARG A NE    1 
ATOM   1766 C  CZ    . ARG A 1 237 ? 87.431  26.511 11.643  1.00 39.64 ? 234 ARG A CZ    1 
ATOM   1767 N  NH1   . ARG A 1 237 ? 87.802  27.188 10.560  1.00 29.05 ? 234 ARG A NH1   1 
ATOM   1768 N  NH2   . ARG A 1 237 ? 88.287  26.351 12.647  1.00 42.30 ? 234 ARG A NH2   1 
ATOM   1769 N  N     . GLN A 1 238 ? 81.986  26.570 7.191   1.00 13.67 ? 235 GLN A N     1 
ATOM   1770 C  CA    . GLN A 1 238 ? 80.803  26.413 6.353   1.00 14.35 ? 235 GLN A CA    1 
ATOM   1771 C  C     . GLN A 1 238 ? 79.937  25.277 6.877   1.00 15.06 ? 235 GLN A C     1 
ATOM   1772 O  O     . GLN A 1 238 ? 80.425  24.339 7.502   1.00 15.25 ? 235 GLN A O     1 
ATOM   1773 C  CB    . GLN A 1 238 ? 81.162  26.166 4.879   1.00 12.05 ? 235 GLN A CB    1 
ATOM   1774 C  CG    . GLN A 1 238 ? 82.072  24.924 4.649   1.00 14.85 ? 235 GLN A CG    1 
ATOM   1775 C  CD    . GLN A 1 238 ? 82.463  24.772 3.187   1.00 15.81 ? 235 GLN A CD    1 
ATOM   1776 O  OE1   . GLN A 1 238 ? 83.117  25.653 2.617   1.00 18.00 ? 235 GLN A OE1   1 
ATOM   1777 N  NE2   . GLN A 1 238 ? 82.068  23.658 2.567   1.00 11.24 ? 235 GLN A NE2   1 
ATOM   1778 N  N     . THR A 1 239 ? 78.635  25.368 6.616   1.00 14.78 ? 236 THR A N     1 
ATOM   1779 C  CA    . THR A 1 239 ? 77.680  24.458 7.238   1.00 13.67 ? 236 THR A CA    1 
ATOM   1780 C  C     . THR A 1 239 ? 76.763  23.899 6.169   1.00 12.40 ? 236 THR A C     1 
ATOM   1781 O  O     . THR A 1 239 ? 76.238  24.659 5.357   1.00 12.38 ? 236 THR A O     1 
ATOM   1782 C  CB    . THR A 1 239 ? 76.870  25.179 8.306   1.00 14.28 ? 236 THR A CB    1 
ATOM   1783 O  OG1   . THR A 1 239 ? 77.772  25.720 9.279   1.00 15.11 ? 236 THR A OG1   1 
ATOM   1784 C  CG2   . THR A 1 239 ? 75.896  24.199 9.024   1.00 13.98 ? 236 THR A CG2   1 
ATOM   1785 N  N     . LEU A 1 240 ? 76.597  22.574 6.156   1.00 13.33 ? 237 LEU A N     1 
ATOM   1786 C  CA    . LEU A 1 240 ? 75.701  21.892 5.228   1.00 14.99 ? 237 LEU A CA    1 
ATOM   1787 C  C     . LEU A 1 240 ? 74.401  21.598 5.969   1.00 14.44 ? 237 LEU A C     1 
ATOM   1788 O  O     . LEU A 1 240 ? 74.417  20.924 7.003   1.00 14.15 ? 237 LEU A O     1 
ATOM   1789 C  CB    . LEU A 1 240 ? 76.346  20.606 4.706   1.00 12.98 ? 237 LEU A CB    1 
ATOM   1790 C  CG    . LEU A 1 240 ? 75.682  19.780 3.610   1.00 15.30 ? 237 LEU A CG    1 
ATOM   1791 C  CD1   . LEU A 1 240 ? 76.727  18.888 2.939   1.00 15.23 ? 237 LEU A CD1   1 
ATOM   1792 C  CD2   . LEU A 1 240 ? 74.539  18.900 4.159   1.00 15.37 ? 237 LEU A CD2   1 
ATOM   1793 N  N     . VAL A 1 241 ? 73.285  22.120 5.458   1.00 12.48 ? 238 VAL A N     1 
ATOM   1794 C  CA    . VAL A 1 241 ? 71.964  21.836 6.007   1.00 14.48 ? 238 VAL A CA    1 
ATOM   1795 C  C     . VAL A 1 241 ? 71.236  20.962 4.999   1.00 15.99 ? 238 VAL A C     1 
ATOM   1796 O  O     . VAL A 1 241 ? 70.881  21.413 3.909   1.00 14.91 ? 238 VAL A O     1 
ATOM   1797 C  CB    . VAL A 1 241 ? 71.198  23.120 6.330   1.00 14.16 ? 238 VAL A CB    1 
ATOM   1798 C  CG1   . VAL A 1 241 ? 69.685  22.827 6.567   1.00 13.78 ? 238 VAL A CG1   1 
ATOM   1799 C  CG2   . VAL A 1 241 ? 71.842  23.779 7.553   1.00 13.04 ? 238 VAL A CG2   1 
ATOM   1800 N  N     . SER A 1 242 ? 71.066  19.686 5.342   1.00 14.78 ? 239 SER A N     1 
ATOM   1801 C  CA    . SER A 1 242 ? 70.378  18.750 4.470   1.00 12.92 ? 239 SER A CA    1 
ATOM   1802 C  C     . SER A 1 242 ? 68.869  18.888 4.611   1.00 12.20 ? 239 SER A C     1 
ATOM   1803 O  O     . SER A 1 242 ? 68.349  19.467 5.571   1.00 14.47 ? 239 SER A O     1 
ATOM   1804 C  CB    . SER A 1 242 ? 70.787  17.309 4.800   1.00 16.55 ? 239 SER A CB    1 
ATOM   1805 O  OG    . SER A 1 242 ? 70.281  17.001 6.091   1.00 16.14 ? 239 SER A OG    1 
ATOM   1806 N  N     . HIS A 1 243 ? 68.151  18.336 3.630   1.00 14.73 ? 240 HIS A N     1 
ATOM   1807 C  CA    . HIS A 1 243 ? 66.698  18.335 3.740   1.00 16.62 ? 240 HIS A CA    1 
ATOM   1808 C  C     . HIS A 1 243 ? 66.256  17.623 5.011   1.00 18.83 ? 240 HIS A C     1 
ATOM   1809 O  O     . HIS A 1 243 ? 65.352  18.092 5.717   1.00 17.27 ? 240 HIS A O     1 
ATOM   1810 C  CB    . HIS A 1 243 ? 66.071  17.673 2.519   1.00 16.58 ? 240 HIS A CB    1 
ATOM   1811 C  CG    . HIS A 1 243 ? 64.583  17.584 2.603   1.00 18.56 ? 240 HIS A CG    1 
ATOM   1812 N  ND1   . HIS A 1 243 ? 63.772  18.683 2.431   1.00 24.00 ? 240 HIS A ND1   1 
ATOM   1813 C  CD2   . HIS A 1 243 ? 63.759  16.541 2.870   1.00 20.24 ? 240 HIS A CD2   1 
ATOM   1814 C  CE1   . HIS A 1 243 ? 62.507  18.320 2.568   1.00 30.02 ? 240 HIS A CE1   1 
ATOM   1815 N  NE2   . HIS A 1 243 ? 62.473  17.028 2.842   1.00 26.04 ? 240 HIS A NE2   1 
ATOM   1816 N  N     . GLY A 1 244 ? 66.900  16.496 5.324   1.00 17.43 ? 241 GLY A N     1 
ATOM   1817 C  CA    . GLY A 1 244 ? 66.544  15.731 6.502   1.00 17.33 ? 241 GLY A CA    1 
ATOM   1818 C  C     . GLY A 1 244 ? 66.806  16.452 7.805   1.00 15.93 ? 241 GLY A C     1 
ATOM   1819 O  O     . GLY A 1 244 ? 66.146  16.173 8.805   1.00 15.67 ? 241 GLY A O     1 
ATOM   1820 N  N     . SER A 1 245 ? 67.758  17.405 7.820   1.00 11.84 ? 242 SER A N     1 
ATOM   1821 C  CA    . SER A 1 245 ? 68.019  18.125 9.061   1.00 10.01 ? 242 SER A CA    1 
ATOM   1822 C  C     . SER A 1 245 ? 66.952  19.157 9.393   1.00 13.07 ? 242 SER A C     1 
ATOM   1823 O  O     . SER A 1 245 ? 66.993  19.728 10.485  1.00 14.75 ? 242 SER A O     1 
ATOM   1824 C  CB    . SER A 1 245 ? 69.387  18.837 9.005   1.00 18.90 ? 242 SER A CB    1 
ATOM   1825 O  OG    . SER A 1 245 ? 69.329  19.945 8.130   1.00 17.51 ? 242 SER A OG    1 
ATOM   1826 N  N     . VAL A 1 246 ? 66.010  19.422 8.493   1.00 15.11 ? 243 VAL A N     1 
ATOM   1827 C  CA    . VAL A 1 246 ? 65.140  20.585 8.670   1.00 11.74 ? 243 VAL A CA    1 
ATOM   1828 C  C     . VAL A 1 246 ? 64.180  20.411 9.849   1.00 13.45 ? 243 VAL A C     1 
ATOM   1829 O  O     . VAL A 1 246 ? 64.031  21.360 10.635  1.00 13.48 ? 243 VAL A O     1 
ATOM   1830 C  CB    . VAL A 1 246 ? 64.399  20.920 7.366   1.00 14.06 ? 243 VAL A CB    1 
ATOM   1831 C  CG1   . VAL A 1 246 ? 63.221  21.893 7.644   1.00 14.24 ? 243 VAL A CG1   1 
ATOM   1832 C  CG2   . VAL A 1 246 ? 65.401  21.526 6.358   1.00 14.43 ? 243 VAL A CG2   1 
ATOM   1833 N  N     . PRO A 1 247 ? 63.521  19.258 10.053  1.00 13.84 ? 244 PRO A N     1 
ATOM   1834 C  CA    . PRO A 1 247 ? 62.555  19.202 11.170  1.00 16.49 ? 244 PRO A CA    1 
ATOM   1835 C  C     . PRO A 1 247 ? 63.171  19.522 12.525  1.00 14.92 ? 244 PRO A C     1 
ATOM   1836 O  O     . PRO A 1 247 ? 62.601  20.312 13.287  1.00 16.06 ? 244 PRO A O     1 
ATOM   1837 C  CB    . PRO A 1 247 ? 62.013  17.758 11.100  1.00 14.61 ? 244 PRO A CB    1 
ATOM   1838 C  CG    . PRO A 1 247 ? 62.110  17.405 9.651   1.00 17.10 ? 244 PRO A CG    1 
ATOM   1839 C  CD    . PRO A 1 247 ? 63.426  18.048 9.208   1.00 13.36 ? 244 PRO A CD    1 
ATOM   1840 N  N     . GLN A 1 248 ? 64.322  18.937 12.858  1.00 15.92 ? 245 GLN A N     1 
ATOM   1841 C  CA    . GLN A 1 248 ? 64.902  19.252 14.156  1.00 15.23 ? 245 GLN A CA    1 
ATOM   1842 C  C     . GLN A 1 248 ? 65.411  20.691 14.206  1.00 16.28 ? 245 GLN A C     1 
ATOM   1843 O  O     . GLN A 1 248 ? 65.251  21.377 15.224  1.00 14.39 ? 245 GLN A O     1 
ATOM   1844 C  CB    . GLN A 1 248 ? 66.024  18.272 14.488  1.00 20.10 ? 245 GLN A CB    1 
ATOM   1845 C  CG    . GLN A 1 248 ? 65.528  16.854 14.733  1.00 24.14 ? 245 GLN A CG    1 
ATOM   1846 C  CD    . GLN A 1 248 ? 66.509  16.026 15.544  1.00 37.74 ? 245 GLN A CD    1 
ATOM   1847 O  OE1   . GLN A 1 248 ? 66.591  16.174 16.765  1.00 44.12 ? 245 GLN A OE1   1 
ATOM   1848 N  NE2   . GLN A 1 248 ? 67.259  15.144 14.871  1.00 32.11 ? 245 GLN A NE2   1 
ATOM   1849 N  N     . LEU A 1 249 ? 66.047  21.154 13.129  1.00 14.21 ? 246 LEU A N     1 
ATOM   1850 C  CA    . LEU A 1 249 ? 66.566  22.524 13.104  1.00 12.39 ? 246 LEU A CA    1 
ATOM   1851 C  C     . LEU A 1 249 ? 65.435  23.538 13.271  1.00 12.53 ? 246 LEU A C     1 
ATOM   1852 O  O     . LEU A 1 249 ? 65.548  24.492 14.056  1.00 14.31 ? 246 LEU A O     1 
ATOM   1853 C  CB    . LEU A 1 249 ? 67.312  22.758 11.786  1.00 14.34 ? 246 LEU A CB    1 
ATOM   1854 C  CG    . LEU A 1 249 ? 67.823  24.169 11.511  1.00 15.12 ? 246 LEU A CG    1 
ATOM   1855 C  CD1   . LEU A 1 249 ? 68.866  24.500 12.550  1.00 16.47 ? 246 LEU A CD1   1 
ATOM   1856 C  CD2   . LEU A 1 249 ? 68.384  24.306 10.074  1.00 17.63 ? 246 LEU A CD2   1 
ATOM   1857 N  N     . PHE A 1 250 ? 64.319  23.325 12.567  1.00 13.66 ? 247 PHE A N     1 
ATOM   1858 C  CA    . PHE A 1 250 ? 63.208  24.268 12.628  1.00 16.08 ? 247 PHE A CA    1 
ATOM   1859 C  C     . PHE A 1 250 ? 62.410  24.150 13.914  1.00 18.27 ? 247 PHE A C     1 
ATOM   1860 O  O     . PHE A 1 250 ? 61.653  25.068 14.234  1.00 15.37 ? 247 PHE A O     1 
ATOM   1861 C  CB    . PHE A 1 250 ? 62.279  24.074 11.427  1.00 14.18 ? 247 PHE A CB    1 
ATOM   1862 C  CG    . PHE A 1 250 ? 62.716  24.811 10.189  1.00 14.44 ? 247 PHE A CG    1 
ATOM   1863 C  CD1   . PHE A 1 250 ? 63.947  25.451 10.145  1.00 15.63 ? 247 PHE A CD1   1 
ATOM   1864 C  CD2   . PHE A 1 250 ? 61.880  24.877 9.076   1.00 13.87 ? 247 PHE A CD2   1 
ATOM   1865 C  CE1   . PHE A 1 250 ? 64.349  26.155 9.001   1.00 18.42 ? 247 PHE A CE1   1 
ATOM   1866 C  CE2   . PHE A 1 250 ? 62.268  25.577 7.938   1.00 16.77 ? 247 PHE A CE2   1 
ATOM   1867 C  CZ    . PHE A 1 250 ? 63.513  26.218 7.906   1.00 15.95 ? 247 PHE A CZ    1 
ATOM   1868 N  N     . SER A 1 251 ? 62.551  23.042 14.654  1.00 14.44 ? 248 SER A N     1 
ATOM   1869 C  CA    . SER A 1 251 ? 61.696  22.834 15.816  1.00 14.09 ? 248 SER A CA    1 
ATOM   1870 C  C     . SER A 1 251 ? 61.974  23.828 16.936  1.00 13.61 ? 248 SER A C     1 
ATOM   1871 O  O     . SER A 1 251 ? 61.084  24.087 17.744  1.00 14.24 ? 248 SER A O     1 
ATOM   1872 C  CB    . SER A 1 251 ? 61.830  21.389 16.329  1.00 16.25 ? 248 SER A CB    1 
ATOM   1873 O  OG    . SER A 1 251 ? 63.039  21.198 17.024  1.00 16.78 ? 248 SER A OG    1 
ATOM   1874 N  N     . GLN A 1 252 ? 63.182  24.412 17.003  1.00 16.66 ? 249 GLN A N     1 
ATOM   1875 C  CA    . GLN A 1 252 ? 63.452  25.451 17.988  1.00 18.59 ? 249 GLN A CA    1 
ATOM   1876 C  C     . GLN A 1 252 ? 63.977  26.724 17.333  1.00 19.39 ? 249 GLN A C     1 
ATOM   1877 O  O     . GLN A 1 252 ? 64.654  27.516 17.999  1.00 17.62 ? 249 GLN A O     1 
ATOM   1878 C  CB    . GLN A 1 252 ? 64.463  24.985 19.041  1.00 22.73 ? 249 GLN A CB    1 
ATOM   1879 C  CG    . GLN A 1 252 ? 64.111  23.702 19.747  1.00 23.97 ? 249 GLN A CG    1 
ATOM   1880 C  CD    . GLN A 1 252 ? 65.185  23.304 20.742  1.00 29.07 ? 249 GLN A CD    1 
ATOM   1881 O  OE1   . GLN A 1 252 ? 66.146  22.609 20.401  1.00 28.99 ? 249 GLN A OE1   1 
ATOM   1882 N  NE2   . GLN A 1 252 ? 65.043  23.768 21.972  1.00 24.83 ? 249 GLN A NE2   1 
ATOM   1883 N  N     . MET A 1 253 ? 63.691  26.928 16.047  1.00 14.55 ? 250 MET A N     1 
ATOM   1884 C  CA    . MET A 1 253 ? 64.233  28.059 15.302  1.00 16.08 ? 250 MET A CA    1 
ATOM   1885 C  C     . MET A 1 253 ? 63.245  29.210 15.384  1.00 14.82 ? 250 MET A C     1 
ATOM   1886 O  O     . MET A 1 253 ? 62.154  29.108 14.811  1.00 14.74 ? 250 MET A O     1 
ATOM   1887 C  CB    . MET A 1 253 ? 64.486  27.672 13.838  1.00 14.81 ? 250 MET A CB    1 
ATOM   1888 C  CG    . MET A 1 253 ? 65.113  28.786 12.981  1.00 20.20 ? 250 MET A CG    1 
ATOM   1889 S  SD    . MET A 1 253 ? 66.726  29.319 13.580  1.00 20.50 ? 250 MET A SD    1 
ATOM   1890 C  CE    . MET A 1 253 ? 67.699  27.824 13.412  1.00 18.55 ? 250 MET A CE    1 
ATOM   1891 N  N     . PRO A 1 254 ? 63.560  30.303 16.082  1.00 17.57 ? 251 PRO A N     1 
ATOM   1892 C  CA    . PRO A 1 254 ? 62.634  31.447 16.111  1.00 19.36 ? 251 PRO A CA    1 
ATOM   1893 C  C     . PRO A 1 254 ? 62.280  31.886 14.695  1.00 13.68 ? 251 PRO A C     1 
ATOM   1894 O  O     . PRO A 1 254 ? 63.129  31.927 13.807  1.00 13.92 ? 251 PRO A O     1 
ATOM   1895 C  CB    . PRO A 1 254 ? 63.421  32.531 16.865  1.00 17.00 ? 251 PRO A CB    1 
ATOM   1896 C  CG    . PRO A 1 254 ? 64.448  31.781 17.643  1.00 19.75 ? 251 PRO A CG    1 
ATOM   1897 C  CD    . PRO A 1 254 ? 64.825  30.608 16.760  1.00 17.51 ? 251 PRO A CD    1 
ATOM   1898 N  N     . ILE A 1 255 ? 60.998  32.202 14.498  1.00 16.04 ? 252 ILE A N     1 
ATOM   1899 C  CA    . ILE A 1 255 ? 60.498  32.597 13.186  1.00 13.91 ? 252 ILE A CA    1 
ATOM   1900 C  C     . ILE A 1 255 ? 61.284  33.782 12.619  1.00 14.07 ? 252 ILE A C     1 
ATOM   1901 O  O     . ILE A 1 255 ? 61.553  33.837 11.415  1.00 14.07 ? 252 ILE A O     1 
ATOM   1902 C  CB    . ILE A 1 255 ? 58.983  32.874 13.285  1.00 19.90 ? 252 ILE A CB    1 
ATOM   1903 C  CG1   . ILE A 1 255 ? 58.243  31.534 13.336  1.00 19.87 ? 252 ILE A CG1   1 
ATOM   1904 C  CG2   . ILE A 1 255 ? 58.467  33.728 12.119  1.00 22.70 ? 252 ILE A CG2   1 
ATOM   1905 C  CD1   . ILE A 1 255 ? 56.882  31.629 13.952  1.00 24.07 ? 252 ILE A CD1   1 
ATOM   1906 N  N     . ARG A 1 256 ? 61.689  34.736 13.473  1.00 12.50 ? 253 ARG A N     1 
ATOM   1907 C  CA    . ARG A 1 256 ? 62.376  35.934 12.984  1.00 14.59 ? 253 ARG A CA    1 
ATOM   1908 C  C     . ARG A 1 256 ? 63.735  35.648 12.359  1.00 20.90 ? 253 ARG A C     1 
ATOM   1909 O  O     . ARG A 1 256 ? 64.296  36.533 11.700  1.00 21.27 ? 253 ARG A O     1 
ATOM   1910 C  CB    . ARG A 1 256 ? 62.564  36.947 14.119  1.00 17.92 ? 253 ARG A CB    1 
ATOM   1911 C  CG    . ARG A 1 256 ? 63.514  36.466 15.186  1.00 20.79 ? 253 ARG A CG    1 
ATOM   1912 C  CD    . ARG A 1 256 ? 63.803  37.525 16.241  1.00 26.47 ? 253 ARG A CD    1 
ATOM   1913 N  NE    . ARG A 1 256 ? 64.667  36.975 17.286  1.00 26.13 ? 253 ARG A NE    1 
ATOM   1914 C  CZ    . ARG A 1 256 ? 64.251  36.222 18.305  1.00 28.39 ? 253 ARG A CZ    1 
ATOM   1915 N  NH1   . ARG A 1 256 ? 62.964  35.925 18.444  1.00 28.31 ? 253 ARG A NH1   1 
ATOM   1916 N  NH2   . ARG A 1 256 ? 65.134  35.760 19.190  1.00 29.96 ? 253 ARG A NH2   1 
ATOM   1917 N  N     . LYS A 1 257 ? 64.284  34.451 12.541  1.00 18.27 ? 254 LYS A N     1 
ATOM   1918 C  CA    . LYS A 1 257 ? 65.591  34.151 11.971  1.00 16.33 ? 254 LYS A CA    1 
ATOM   1919 C  C     . LYS A 1 257 ? 65.544  33.821 10.490  1.00 22.47 ? 254 LYS A C     1 
ATOM   1920 O  O     . LYS A 1 257 ? 66.605  33.800 9.845   1.00 20.15 ? 254 LYS A O     1 
ATOM   1921 C  CB    . LYS A 1 257 ? 66.238  32.986 12.721  1.00 17.23 ? 254 LYS A CB    1 
ATOM   1922 C  CG    . LYS A 1 257 ? 66.377  33.253 14.177  1.00 20.56 ? 254 LYS A CG    1 
ATOM   1923 C  CD    . LYS A 1 257 ? 67.253  34.448 14.430  1.00 27.69 ? 254 LYS A CD    1 
ATOM   1924 C  CE    . LYS A 1 257 ? 67.374  34.693 15.923  0.57 33.78 ? 254 LYS A CE    1 
ATOM   1925 N  NZ    . LYS A 1 257 ? 68.324  35.788 16.214  0.87 31.18 ? 254 LYS A NZ    1 
ATOM   1926 N  N     . ILE A 1 258 ? 64.365  33.539 9.949   1.00 16.14 ? 255 ILE A N     1 
ATOM   1927 C  CA    A ILE A 1 258 ? 64.217  33.156 8.548   0.55 17.49 ? 255 ILE A CA    1 
ATOM   1928 C  CA    B ILE A 1 258 ? 64.245  33.155 8.549   0.45 17.48 ? 255 ILE A CA    1 
ATOM   1929 C  C     . ILE A 1 258 ? 64.170  34.417 7.700   1.00 18.70 ? 255 ILE A C     1 
ATOM   1930 O  O     . ILE A 1 258 ? 63.431  35.352 8.019   1.00 17.09 ? 255 ILE A O     1 
ATOM   1931 C  CB    A ILE A 1 258 ? 62.938  32.330 8.343   0.55 16.80 ? 255 ILE A CB    1 
ATOM   1932 C  CB    B ILE A 1 258 ? 63.016  32.255 8.334   0.45 16.88 ? 255 ILE A CB    1 
ATOM   1933 C  CG1   A ILE A 1 258 ? 62.969  31.044 9.177   0.55 19.44 ? 255 ILE A CG1   1 
ATOM   1934 C  CG1   B ILE A 1 258 ? 63.341  30.789 8.669   0.45 20.97 ? 255 ILE A CG1   1 
ATOM   1935 C  CG2   A ILE A 1 258 ? 62.742  32.020 6.853   0.55 18.35 ? 255 ILE A CG2   1 
ATOM   1936 C  CG2   B ILE A 1 258 ? 62.527  32.342 6.893   0.45 18.72 ? 255 ILE A CG2   1 
ATOM   1937 C  CD1   A ILE A 1 258 ? 63.871  29.968 8.603   0.55 19.89 ? 255 ILE A CD1   1 
ATOM   1938 C  CD1   B ILE A 1 258 ? 63.709  30.519 10.126  0.45 16.13 ? 255 ILE A CD1   1 
ATOM   1939 N  N     . ARG A 1 259 ? 64.944  34.439 6.615   1.00 17.96 ? 256 ARG A N     1 
ATOM   1940 C  CA    . ARG A 1 259 ? 65.000  35.613 5.747   1.00 17.21 ? 256 ARG A CA    1 
ATOM   1941 C  C     . ARG A 1 259 ? 63.604  35.981 5.255   1.00 20.49 ? 256 ARG A C     1 
ATOM   1942 O  O     . ARG A 1 259 ? 62.890  35.139 4.698   1.00 16.21 ? 256 ARG A O     1 
ATOM   1943 C  CB    . ARG A 1 259 ? 65.923  35.353 4.557   1.00 20.08 ? 256 ARG A CB    1 
ATOM   1944 C  CG    . ARG A 1 259 ? 66.207  36.603 3.698   1.00 28.98 ? 256 ARG A CG    1 
ATOM   1945 C  CD    . ARG A 1 259 ? 66.826  36.234 2.345   1.00 39.86 ? 256 ARG A CD    1 
ATOM   1946 N  NE    . ARG A 1 259 ? 65.936  35.381 1.551   1.00 44.75 ? 256 ARG A NE    1 
ATOM   1947 C  CZ    . ARG A 1 259 ? 66.176  34.985 0.301   1.00 44.91 ? 256 ARG A CZ    1 
ATOM   1948 N  NH1   . ARG A 1 259 ? 67.288  35.366 -0.319  1.00 35.69 ? 256 ARG A NH1   1 
ATOM   1949 N  NH2   . ARG A 1 259 ? 65.300  34.205 -0.336  1.00 39.94 ? 256 ARG A NH2   1 
ATOM   1950 N  N     . SER A 1 260 ? 63.235  37.246 5.489   1.00 19.64 ? 257 SER A N     1 
ATOM   1951 C  CA    . SER A 1 260 ? 61.998  37.967 5.170   1.00 20.52 ? 257 SER A CA    1 
ATOM   1952 C  C     . SER A 1 260 ? 60.997  37.922 6.318   1.00 22.93 ? 257 SER A C     1 
ATOM   1953 O  O     . SER A 1 260 ? 59.987  38.627 6.270   1.00 20.01 ? 257 SER A O     1 
ATOM   1954 C  CB    . SER A 1 260 ? 61.319  37.494 3.871   1.00 23.85 ? 257 SER A CB    1 
ATOM   1955 O  OG    . SER A 1 260 ? 60.704  36.233 4.016   1.00 19.23 ? 257 SER A OG    1 
ATOM   1956 N  N     . LEU A 1 261 ? 61.269  37.157 7.370   1.00 15.86 ? 258 LEU A N     1 
ATOM   1957 C  CA    . LEU A 1 261 ? 60.392  37.079 8.528   1.00 17.99 ? 258 LEU A CA    1 
ATOM   1958 C  C     . LEU A 1 261 ? 60.953  37.835 9.728   1.00 17.47 ? 258 LEU A C     1 
ATOM   1959 O  O     . LEU A 1 261 ? 60.410  37.729 10.837  1.00 16.39 ? 258 LEU A O     1 
ATOM   1960 C  CB    . LEU A 1 261 ? 60.123  35.603 8.862   1.00 14.98 ? 258 LEU A CB    1 
ATOM   1961 C  CG    . LEU A 1 261 ? 59.422  34.820 7.746   1.00 20.46 ? 258 LEU A CG    1 
ATOM   1962 C  CD1   . LEU A 1 261 ? 59.149  33.383 8.197   1.00 15.02 ? 258 LEU A CD1   1 
ATOM   1963 C  CD2   . LEU A 1 261 ? 58.114  35.498 7.295   1.00 17.13 ? 258 LEU A CD2   1 
ATOM   1964 N  N     . GLY A 1 262 ? 61.993  38.655 9.525   1.00 16.78 ? 259 GLY A N     1 
ATOM   1965 C  CA    . GLY A 1 262 ? 62.552  39.418 10.614  1.00 14.72 ? 259 GLY A CA    1 
ATOM   1966 C  C     . GLY A 1 262 ? 61.839  40.702 10.943  1.00 20.15 ? 259 GLY A C     1 
ATOM   1967 O  O     . GLY A 1 262 ? 62.266  41.403 11.863  1.00 20.59 ? 259 GLY A O     1 
ATOM   1968 N  N     . GLY A 1 263 ? 60.761  41.029 10.229  1.00 16.88 ? 260 GLY A N     1 
ATOM   1969 C  CA    . GLY A 1 263 ? 60.073  42.289 10.419  1.00 16.44 ? 260 GLY A CA    1 
ATOM   1970 C  C     . GLY A 1 263 ? 58.619  42.116 10.807  1.00 21.49 ? 260 GLY A C     1 
ATOM   1971 O  O     . GLY A 1 263 ? 58.284  41.233 11.612  1.00 19.22 ? 260 GLY A O     1 
ATOM   1972 N  N     . LYS A 1 264 ? 57.743  42.949 10.233  1.00 19.47 ? 261 LYS A N     1 
ATOM   1973 C  CA    . LYS A 1 264 ? 56.347  42.984 10.666  1.00 19.64 ? 261 LYS A CA    1 
ATOM   1974 C  C     . LYS A 1 264 ? 55.591  41.717 10.285  1.00 18.72 ? 261 LYS A C     1 
ATOM   1975 O  O     . LYS A 1 264 ? 54.706  41.274 11.028  1.00 22.44 ? 261 LYS A O     1 
ATOM   1976 C  CB    . LYS A 1 264 ? 55.637  44.201 10.068  1.00 22.06 ? 261 LYS A CB    1 
ATOM   1977 C  CG    . LYS A 1 264 ? 56.259  45.519 10.411  1.00 24.98 ? 261 LYS A CG    1 
ATOM   1978 C  CD    . LYS A 1 264 ? 55.521  46.629 9.657   1.00 31.39 ? 261 LYS A CD    1 
ATOM   1979 C  CE    . LYS A 1 264 ? 55.982  48.011 10.068  1.00 41.82 ? 261 LYS A CE    1 
ATOM   1980 N  NZ    . LYS A 1 264 ? 55.070  49.041 9.488   1.00 44.37 ? 261 LYS A NZ    1 
ATOM   1981 N  N     . LEU A 1 265 ? 55.873  41.157 9.107   1.00 15.97 ? 262 LEU A N     1 
ATOM   1982 C  CA    . LEU A 1 265 ? 55.198  39.915 8.729   1.00 16.94 ? 262 LEU A CA    1 
ATOM   1983 C  C     . LEU A 1 265 ? 55.538  38.800 9.705   1.00 16.52 ? 262 LEU A C     1 
ATOM   1984 O  O     . LEU A 1 265 ? 54.648  38.069 10.158  1.00 17.29 ? 262 LEU A O     1 
ATOM   1985 C  CB    . LEU A 1 265 ? 55.563  39.520 7.297   1.00 18.97 ? 262 LEU A CB    1 
ATOM   1986 C  CG    . LEU A 1 265 ? 55.106  38.127 6.844   1.00 19.28 ? 262 LEU A CG    1 
ATOM   1987 C  CD1   . LEU A 1 265 ? 53.580  38.024 6.846   1.00 30.18 ? 262 LEU A CD1   1 
ATOM   1988 C  CD2   . LEU A 1 265 ? 55.678  37.814 5.452   1.00 21.36 ? 262 LEU A CD2   1 
ATOM   1989 N  N     . GLY A 1 266 ? 56.817  38.670 10.061  1.00 16.59 ? 263 GLY A N     1 
ATOM   1990 C  CA    . GLY A 1 266 ? 57.200  37.668 11.041  1.00 19.28 ? 263 GLY A CA    1 
ATOM   1991 C  C     . GLY A 1 266 ? 56.521  37.896 12.378  1.00 22.90 ? 263 GLY A C     1 
ATOM   1992 O  O     . GLY A 1 266 ? 56.018  36.957 12.999  1.00 18.49 ? 263 GLY A O     1 
ATOM   1993 N  N     . ALA A 1 267 ? 56.460  39.157 12.820  1.00 19.65 ? 264 ALA A N     1 
ATOM   1994 C  CA    . ALA A 1 267 ? 55.789  39.453 14.082  1.00 22.68 ? 264 ALA A CA    1 
ATOM   1995 C  C     . ALA A 1 267 ? 54.317  39.066 14.025  1.00 17.80 ? 264 ALA A C     1 
ATOM   1996 O  O     . ALA A 1 267 ? 53.752  38.597 15.020  1.00 22.28 ? 264 ALA A O     1 
ATOM   1997 C  CB    . ALA A 1 267 ? 55.943  40.937 14.433  1.00 24.48 ? 264 ALA A CB    1 
ATOM   1998 N  N     . SER A 1 268 ? 53.683  39.236 12.863  1.00 20.32 ? 265 SER A N     1 
ATOM   1999 C  CA    . SER A 1 268 ? 52.270  38.900 12.753  1.00 19.06 ? 265 SER A CA    1 
ATOM   2000 C  C     . SER A 1 268 ? 52.046  37.398 12.666  1.00 20.94 ? 265 SER A C     1 
ATOM   2001 O  O     . SER A 1 268 ? 51.018  36.911 13.152  1.00 20.69 ? 265 SER A O     1 
ATOM   2002 C  CB    . SER A 1 268 ? 51.626  39.598 11.548  1.00 26.05 ? 265 SER A CB    1 
ATOM   2003 O  OG    . SER A 1 268 ? 52.003  39.005 10.322  1.00 31.99 ? 265 SER A OG    1 
ATOM   2004 N  N     . VAL A 1 269 ? 52.971  36.648 12.055  1.00 19.45 ? 266 VAL A N     1 
ATOM   2005 C  CA    . VAL A 1 269 ? 52.868  35.190 12.110  1.00 16.03 ? 266 VAL A CA    1 
ATOM   2006 C  C     . VAL A 1 269 ? 52.822  34.734 13.567  1.00 19.59 ? 266 VAL A C     1 
ATOM   2007 O  O     . VAL A 1 269 ? 51.929  33.976 13.985  1.00 18.85 ? 266 VAL A O     1 
ATOM   2008 C  CB    . VAL A 1 269 ? 54.037  34.528 11.349  1.00 20.41 ? 266 VAL A CB    1 
ATOM   2009 C  CG1   . VAL A 1 269 ? 53.995  33.005 11.547  1.00 17.61 ? 266 VAL A CG1   1 
ATOM   2010 C  CG2   . VAL A 1 269 ? 53.982  34.850 9.882   1.00 20.91 ? 266 VAL A CG2   1 
ATOM   2011 N  N     . ILE A 1 270 ? 53.770  35.230 14.368  1.00 16.75 ? 267 ILE A N     1 
ATOM   2012 C  CA    . ILE A 1 270 ? 53.848  34.887 15.788  1.00 16.94 ? 267 ILE A CA    1 
ATOM   2013 C  C     . ILE A 1 270 ? 52.561  35.267 16.513  1.00 24.28 ? 267 ILE A C     1 
ATOM   2014 O  O     . ILE A 1 270 ? 52.004  34.477 17.289  1.00 21.92 ? 267 ILE A O     1 
ATOM   2015 C  CB    . ILE A 1 270 ? 55.076  35.572 16.416  1.00 16.83 ? 267 ILE A CB    1 
ATOM   2016 C  CG1   . ILE A 1 270 ? 56.366  34.990 15.818  1.00 16.40 ? 267 ILE A CG1   1 
ATOM   2017 C  CG2   . ILE A 1 270 ? 55.055  35.461 17.938  1.00 21.46 ? 267 ILE A CG2   1 
ATOM   2018 C  CD1   . ILE A 1 270 ? 57.616  35.803 16.131  1.00 22.75 ? 267 ILE A CD1   1 
ATOM   2019 N  N     . GLU A 1 271 ? 52.067  36.489 16.271  1.00 23.47 ? 268 GLU A N     1 
ATOM   2020 C  CA    . GLU A 1 271 ? 50.935  36.999 17.041  1.00 24.59 ? 268 GLU A CA    1 
ATOM   2021 C  C     . GLU A 1 271 ? 49.622  36.340 16.630  1.00 20.89 ? 268 GLU A C     1 
ATOM   2022 O  O     . GLU A 1 271 ? 48.821  35.945 17.488  1.00 25.77 ? 268 GLU A O     1 
ATOM   2023 C  CB    . GLU A 1 271 ? 50.844  38.517 16.884  1.00 25.81 ? 268 GLU A CB    1 
ATOM   2024 N  N     . ILE A 1 272 ? 49.371  36.225 15.324  1.00 20.37 ? 269 ILE A N     1 
ATOM   2025 C  CA    . ILE A 1 272 ? 48.080  35.717 14.867  1.00 19.28 ? 269 ILE A CA    1 
ATOM   2026 C  C     . ILE A 1 272 ? 47.966  34.224 15.132  1.00 24.76 ? 269 ILE A C     1 
ATOM   2027 O  O     . ILE A 1 272 ? 46.908  33.727 15.531  1.00 22.87 ? 269 ILE A O     1 
ATOM   2028 C  CB    . ILE A 1 272 ? 47.868  36.042 13.376  1.00 21.95 ? 269 ILE A CB    1 
ATOM   2029 C  CG1   . ILE A 1 272 ? 47.677  37.554 13.191  1.00 30.23 ? 269 ILE A CG1   1 
ATOM   2030 C  CG2   . ILE A 1 272 ? 46.668  35.245 12.825  1.00 26.21 ? 269 ILE A CG2   1 
ATOM   2031 C  CD1   . ILE A 1 272 ? 47.822  38.030 11.769  1.00 26.89 ? 269 ILE A CD1   1 
ATOM   2032 N  N     . LEU A 1 273 ? 49.045  33.480 14.904  1.00 20.16 ? 270 LEU A N     1 
ATOM   2033 C  CA    . LEU A 1 273 ? 49.007  32.039 15.089  1.00 21.64 ? 270 LEU A CA    1 
ATOM   2034 C  C     . LEU A 1 273 ? 49.368  31.616 16.505  1.00 21.03 ? 270 LEU A C     1 
ATOM   2035 O  O     . LEU A 1 273 ? 49.056  30.484 16.899  1.00 25.38 ? 270 LEU A O     1 
ATOM   2036 C  CB    . LEU A 1 273 ? 49.948  31.369 14.084  1.00 20.93 ? 270 LEU A CB    1 
ATOM   2037 C  CG    . LEU A 1 273 ? 49.608  31.625 12.612  1.00 21.35 ? 270 LEU A CG    1 
ATOM   2038 C  CD1   . LEU A 1 273 ? 50.553  30.854 11.679  1.00 23.67 ? 270 LEU A CD1   1 
ATOM   2039 C  CD2   . LEU A 1 273 ? 48.162  31.252 12.335  1.00 20.52 ? 270 LEU A CD2   1 
ATOM   2040 N  N     . GLY A 1 274 ? 49.997  32.492 17.281  1.00 19.72 ? 271 GLY A N     1 
ATOM   2041 C  CA    . GLY A 1 274 ? 50.382  32.125 18.633  1.00 23.99 ? 271 GLY A CA    1 
ATOM   2042 C  C     . GLY A 1 274 ? 51.481  31.085 18.669  1.00 28.78 ? 271 GLY A C     1 
ATOM   2043 O  O     . GLY A 1 274 ? 51.462  30.194 19.526  1.00 22.37 ? 271 GLY A O     1 
ATOM   2044 N  N     . ILE A 1 275 ? 52.428  31.157 17.740  1.00 19.46 ? 272 ILE A N     1 
ATOM   2045 C  CA    . ILE A 1 275 ? 53.545  30.223 17.698  1.00 18.05 ? 272 ILE A CA    1 
ATOM   2046 C  C     . ILE A 1 275 ? 54.846  30.999 17.884  1.00 18.85 ? 272 ILE A C     1 
ATOM   2047 O  O     . ILE A 1 275 ? 54.877  32.228 17.834  1.00 17.61 ? 272 ILE A O     1 
ATOM   2048 C  CB    . ILE A 1 275 ? 53.574  29.416 16.388  1.00 17.74 ? 272 ILE A CB    1 
ATOM   2049 C  CG1   . ILE A 1 275 ? 53.711  30.355 15.187  1.00 18.90 ? 272 ILE A CG1   1 
ATOM   2050 C  CG2   . ILE A 1 275 ? 52.297  28.552 16.265  1.00 18.65 ? 272 ILE A CG2   1 
ATOM   2051 C  CD1   . ILE A 1 275 ? 53.825  29.597 13.843  1.00 21.72 ? 272 ILE A CD1   1 
ATOM   2052 N  N     . GLU A 1 276 ? 55.932  30.259 18.085  1.00 18.28 ? 273 GLU A N     1 
ATOM   2053 C  CA    . GLU A 1 276 ? 57.267  30.832 18.232  1.00 19.73 ? 273 GLU A CA    1 
ATOM   2054 C  C     . GLU A 1 276 ? 58.256  30.358 17.182  1.00 20.91 ? 273 GLU A C     1 
ATOM   2055 O  O     . GLU A 1 276 ? 59.149  31.118 16.790  1.00 17.32 ? 273 GLU A O     1 
ATOM   2056 C  CB    . GLU A 1 276 ? 57.865  30.466 19.600  1.00 23.41 ? 273 GLU A CB    1 
ATOM   2057 C  CG    . GLU A 1 276 ? 57.308  31.164 20.823  1.00 31.14 ? 273 GLU A CG    1 
ATOM   2058 C  CD    . GLU A 1 276 ? 58.038  30.707 22.094  1.00 34.61 ? 273 GLU A CD    1 
ATOM   2059 O  OE1   . GLU A 1 276 ? 57.791  29.571 22.553  1.00 48.36 ? 273 GLU A OE1   1 
ATOM   2060 O  OE2   . GLU A 1 276 ? 58.894  31.459 22.607  1.00 50.90 ? 273 GLU A OE2   1 
ATOM   2061 N  N     . TYR A 1 277 ? 58.148  29.115 16.736  1.00 18.70 ? 274 TYR A N     1 
ATOM   2062 C  CA    . TYR A 1 277 ? 59.226  28.495 15.994  1.00 15.80 ? 274 TYR A CA    1 
ATOM   2063 C  C     . TYR A 1 277 ? 58.769  28.123 14.594  1.00 17.49 ? 274 TYR A C     1 
ATOM   2064 O  O     . TYR A 1 277 ? 57.584  27.848 14.347  1.00 17.28 ? 274 TYR A O     1 
ATOM   2065 C  CB    . TYR A 1 277 ? 59.727  27.261 16.714  1.00 16.49 ? 274 TYR A CB    1 
ATOM   2066 C  CG    . TYR A 1 277 ? 60.184  27.530 18.125  1.00 18.34 ? 274 TYR A CG    1 
ATOM   2067 C  CD1   . TYR A 1 277 ? 61.250  28.387 18.374  1.00 15.16 ? 274 TYR A CD1   1 
ATOM   2068 C  CD2   . TYR A 1 277 ? 59.569  26.914 19.209  1.00 18.87 ? 274 TYR A CD2   1 
ATOM   2069 C  CE1   . TYR A 1 277 ? 61.685  28.640 19.654  1.00 24.26 ? 274 TYR A CE1   1 
ATOM   2070 C  CE2   . TYR A 1 277 ? 60.005  27.156 20.517  1.00 23.86 ? 274 TYR A CE2   1 
ATOM   2071 C  CZ    . TYR A 1 277 ? 61.065  28.018 20.725  1.00 29.72 ? 274 TYR A CZ    1 
ATOM   2072 O  OH    . TYR A 1 277 ? 61.516  28.281 21.999  1.00 26.47 ? 274 TYR A OH    1 
ATOM   2073 N  N     . MET A 1 278 ? 59.739  28.083 13.685  1.00 13.42 ? 275 MET A N     1 
ATOM   2074 C  CA    . MET A 1 278 ? 59.420  27.859 12.279  1.00 15.62 ? 275 MET A CA    1 
ATOM   2075 C  C     . MET A 1 278 ? 58.691  26.527 12.066  1.00 19.20 ? 275 MET A C     1 
ATOM   2076 O  O     . MET A 1 278 ? 57.756  26.442 11.254  1.00 15.71 ? 275 MET A O     1 
ATOM   2077 C  CB    . MET A 1 278 ? 60.715  27.929 11.464  1.00 15.31 ? 275 MET A CB    1 
ATOM   2078 C  CG    . MET A 1 278 ? 60.506  28.095 9.984   1.00 21.09 ? 275 MET A CG    1 
ATOM   2079 S  SD    . MET A 1 278 ? 59.734  29.695 9.641   1.00 22.07 ? 275 MET A SD    1 
ATOM   2080 C  CE    . MET A 1 278 ? 59.299  29.422 7.923   1.00 24.85 ? 275 MET A CE    1 
ATOM   2081 N  N     . GLY A 1 279 ? 59.075  25.488 12.810  1.00 18.80 ? 276 GLY A N     1 
ATOM   2082 C  CA    . GLY A 1 279 ? 58.486  24.173 12.594  1.00 14.86 ? 276 GLY A CA    1 
ATOM   2083 C  C     . GLY A 1 279 ? 57.005  24.120 12.917  1.00 18.42 ? 276 GLY A C     1 
ATOM   2084 O  O     . GLY A 1 279 ? 56.261  23.334 12.315  1.00 18.40 ? 276 GLY A O     1 
ATOM   2085 N  N     . GLU A 1 280 ? 56.555  24.955 13.859  1.00 16.42 ? 277 GLU A N     1 
ATOM   2086 C  CA    . GLU A 1 280 ? 55.150  24.964 14.253  1.00 16.17 ? 277 GLU A CA    1 
ATOM   2087 C  C     . GLU A 1 280 ? 54.234  25.352 13.105  1.00 20.30 ? 277 GLU A C     1 
ATOM   2088 O  O     . GLU A 1 280 ? 53.028  25.089 13.174  1.00 17.00 ? 277 GLU A O     1 
ATOM   2089 C  CB    . GLU A 1 280 ? 54.920  25.931 15.416  1.00 17.46 ? 277 GLU A CB    1 
ATOM   2090 C  CG    . GLU A 1 280 ? 55.649  25.560 16.704  1.00 17.58 ? 277 GLU A CG    1 
ATOM   2091 C  CD    . GLU A 1 280 ? 55.328  26.527 17.823  1.00 21.44 ? 277 GLU A CD    1 
ATOM   2092 O  OE1   . GLU A 1 280 ? 54.229  26.422 18.391  1.00 20.64 ? 277 GLU A OE1   1 
ATOM   2093 O  OE2   . GLU A 1 280 ? 56.155  27.404 18.115  1.00 20.05 ? 277 GLU A OE2   1 
ATOM   2094 N  N     . LEU A 1 281 ? 54.768  26.010 12.077  1.00 13.89 ? 278 LEU A N     1 
ATOM   2095 C  CA    . LEU A 1 281 ? 53.958  26.352 10.915  1.00 16.16 ? 278 LEU A CA    1 
ATOM   2096 C  C     . LEU A 1 281 ? 53.424  25.126 10.182  1.00 16.00 ? 278 LEU A C     1 
ATOM   2097 O  O     . LEU A 1 281 ? 52.449  25.250 9.439   1.00 16.10 ? 278 LEU A O     1 
ATOM   2098 C  CB    . LEU A 1 281 ? 54.783  27.219 9.962   1.00 16.33 ? 278 LEU A CB    1 
ATOM   2099 C  CG    . LEU A 1 281 ? 54.861  28.695 10.359  1.00 15.23 ? 278 LEU A CG    1 
ATOM   2100 C  CD1   . LEU A 1 281 ? 55.939  29.393 9.525   1.00 17.95 ? 278 LEU A CD1   1 
ATOM   2101 C  CD2   . LEU A 1 281 ? 53.485  29.367 10.151  1.00 16.65 ? 278 LEU A CD2   1 
ATOM   2102 N  N     . THR A 1 282 ? 54.054  23.954 10.336  1.00 15.33 ? 279 THR A N     1 
ATOM   2103 C  CA    . THR A 1 282 ? 53.605  22.804 9.552   1.00 14.56 ? 279 THR A CA    1 
ATOM   2104 C  C     . THR A 1 282 ? 52.177  22.380 9.891   1.00 15.41 ? 279 THR A C     1 
ATOM   2105 O  O     . THR A 1 282 ? 51.557  21.674 9.084   1.00 18.63 ? 279 THR A O     1 
ATOM   2106 C  CB    . THR A 1 282 ? 54.517  21.596 9.746   1.00 21.18 ? 279 THR A CB    1 
ATOM   2107 O  OG1   . THR A 1 282 ? 54.457  21.170 11.110  1.00 20.47 ? 279 THR A OG1   1 
ATOM   2108 C  CG2   . THR A 1 282 ? 55.957  21.926 9.356   1.00 18.65 ? 279 THR A CG2   1 
ATOM   2109 N  N     . GLN A 1 283 ? 51.652  22.787 11.056  1.00 17.34 ? 280 GLN A N     1 
ATOM   2110 C  CA    . GLN A 1 283 ? 50.345  22.319 11.515  1.00 21.33 ? 280 GLN A CA    1 
ATOM   2111 C  C     . GLN A 1 283 ? 49.189  22.975 10.780  1.00 26.91 ? 280 GLN A C     1 
ATOM   2112 O  O     . GLN A 1 283 ? 48.043  22.547 10.963  1.00 33.08 ? 280 GLN A O     1 
ATOM   2113 C  CB    . GLN A 1 283 ? 50.105  22.612 13.004  1.00 22.66 ? 280 GLN A CB    1 
ATOM   2114 C  CG    . GLN A 1 283 ? 51.111  22.133 14.007  1.00 34.82 ? 280 GLN A CG    1 
ATOM   2115 C  CD    . GLN A 1 283 ? 51.342  23.214 15.066  1.00 39.78 ? 280 GLN A CD    1 
ATOM   2116 O  OE1   . GLN A 1 283 ? 52.464  23.645 15.312  1.00 51.32 ? 280 GLN A OE1   1 
ATOM   2117 N  NE2   . GLN A 1 283 ? 50.258  23.659 15.689  1.00 46.44 ? 280 GLN A NE2   1 
ATOM   2118 N  N     . PHE A 1 284 ? 49.446  24.021 10.010  1.00 18.01 ? 281 PHE A N     1 
ATOM   2119 C  CA    . PHE A 1 284 ? 48.398  24.784 9.346   1.00 19.88 ? 281 PHE A CA    1 
ATOM   2120 C  C     . PHE A 1 284 ? 48.297  24.390 7.877   1.00 20.50 ? 281 PHE A C     1 
ATOM   2121 O  O     . PHE A 1 284 ? 49.281  23.974 7.260   1.00 20.15 ? 281 PHE A O     1 
ATOM   2122 C  CB    . PHE A 1 284 ? 48.660  26.288 9.485   1.00 17.36 ? 281 PHE A CB    1 
ATOM   2123 C  CG    . PHE A 1 284 ? 48.789  26.734 10.916  1.00 18.35 ? 281 PHE A CG    1 
ATOM   2124 C  CD1   . PHE A 1 284 ? 47.664  27.073 11.649  1.00 22.91 ? 281 PHE A CD1   1 
ATOM   2125 C  CD2   . PHE A 1 284 ? 50.027  26.769 11.541  1.00 18.95 ? 281 PHE A CD2   1 
ATOM   2126 C  CE1   . PHE A 1 284 ? 47.780  27.462 12.975  1.00 28.94 ? 281 PHE A CE1   1 
ATOM   2127 C  CE2   . PHE A 1 284 ? 50.149  27.157 12.880  1.00 19.95 ? 281 PHE A CE2   1 
ATOM   2128 C  CZ    . PHE A 1 284 ? 49.024  27.497 13.590  1.00 25.73 ? 281 PHE A CZ    1 
ATOM   2129 N  N     . THR A 1 285 ? 47.089  24.499 7.327   1.00 19.52 ? 282 THR A N     1 
ATOM   2130 C  CA    . THR A 1 285 ? 46.924  24.213 5.909   1.00 17.96 ? 282 THR A CA    1 
ATOM   2131 C  C     . THR A 1 285 ? 47.371  25.409 5.082   1.00 14.96 ? 282 THR A C     1 
ATOM   2132 O  O     . THR A 1 285 ? 47.463  26.536 5.570   1.00 16.33 ? 282 THR A O     1 
ATOM   2133 C  CB    . THR A 1 285 ? 45.468  23.878 5.567   1.00 20.68 ? 282 THR A CB    1 
ATOM   2134 O  OG1   . THR A 1 285 ? 44.677  25.069 5.656   1.00 19.42 ? 282 THR A OG1   1 
ATOM   2135 C  CG2   . THR A 1 285 ? 44.919  22.847 6.543   1.00 23.20 ? 282 THR A CG2   1 
ATOM   2136 N  N     . GLU A 1 286 ? 47.665  25.148 3.809   1.00 18.31 ? 283 GLU A N     1 
ATOM   2137 C  CA    . GLU A 1 286 ? 48.043  26.241 2.924   1.00 16.68 ? 283 GLU A CA    1 
ATOM   2138 C  C     . GLU A 1 286 ? 46.959  27.308 2.890   1.00 17.98 ? 283 GLU A C     1 
ATOM   2139 O  O     . GLU A 1 286 ? 47.255  28.505 2.960   1.00 16.82 ? 283 GLU A O     1 
ATOM   2140 C  CB    . GLU A 1 286 ? 48.325  25.712 1.521   1.00 18.72 ? 283 GLU A CB    1 
ATOM   2141 C  CG    . GLU A 1 286 ? 48.935  26.774 0.613   1.00 19.81 ? 283 GLU A CG    1 
ATOM   2142 C  CD    . GLU A 1 286 ? 49.377  26.207 -0.729  1.00 30.91 ? 283 GLU A CD    1 
ATOM   2143 O  OE1   . GLU A 1 286 ? 49.044  25.039 -1.008  1.00 30.01 ? 283 GLU A OE1   1 
ATOM   2144 O  OE2   . GLU A 1 286 ? 50.068  26.923 -1.492  1.00 30.53 ? 283 GLU A OE2   1 
ATOM   2145 N  N     . SER A 1 287 ? 45.692  26.889 2.819   1.00 19.33 ? 284 SER A N     1 
ATOM   2146 C  CA    . SER A 1 287 ? 44.599  27.856 2.791   1.00 15.64 ? 284 SER A CA    1 
ATOM   2147 C  C     . SER A 1 287 ? 44.555  28.695 4.063   1.00 21.15 ? 284 SER A C     1 
ATOM   2148 O  O     . SER A 1 287 ? 44.283  29.902 4.004   1.00 18.56 ? 284 SER A O     1 
ATOM   2149 C  CB    . SER A 1 287 ? 43.261  27.139 2.586   1.00 19.69 ? 284 SER A CB    1 
ATOM   2150 O  OG    . SER A 1 287 ? 43.278  26.404 1.385   1.00 27.87 ? 284 SER A OG    1 
ATOM   2151 N  N     . GLN A 1 288 ? 44.785  28.075 5.229   1.00 21.18 ? 285 GLN A N     1 
ATOM   2152 C  CA    . GLN A 1 288 ? 44.804  28.854 6.467   1.00 17.11 ? 285 GLN A CA    1 
ATOM   2153 C  C     . GLN A 1 288 ? 45.903  29.910 6.427   1.00 20.25 ? 285 GLN A C     1 
ATOM   2154 O  O     . GLN A 1 288 ? 45.700  31.052 6.849   1.00 18.61 ? 285 GLN A O     1 
ATOM   2155 C  CB    . GLN A 1 288 ? 45.007  27.943 7.681   1.00 18.47 ? 285 GLN A CB    1 
ATOM   2156 C  CG    . GLN A 1 288 ? 43.815  27.134 8.107   1.00 23.61 ? 285 GLN A CG    1 
ATOM   2157 C  CD    . GLN A 1 288 ? 44.163  26.191 9.242   1.00 27.05 ? 285 GLN A CD    1 
ATOM   2158 O  OE1   . GLN A 1 288 ? 45.123  25.437 9.159   1.00 20.97 ? 285 GLN A OE1   1 
ATOM   2159 N  NE2   . GLN A 1 288 ? 43.388  26.241 10.313  1.00 35.64 ? 285 GLN A NE2   1 
ATOM   2160 N  N     . LEU A 1 289 ? 47.081  29.547 5.929   1.00 17.21 ? 286 LEU A N     1 
ATOM   2161 C  CA    . LEU A 1 289 ? 48.170  30.515 5.910   1.00 18.78 ? 286 LEU A CA    1 
ATOM   2162 C  C     . LEU A 1 289 ? 47.898  31.608 4.889   1.00 18.30 ? 286 LEU A C     1 
ATOM   2163 O  O     . LEU A 1 289 ? 48.177  32.789 5.143   1.00 19.68 ? 286 LEU A O     1 
ATOM   2164 C  CB    . LEU A 1 289 ? 49.497  29.804 5.632   1.00 14.80 ? 286 LEU A CB    1 
ATOM   2165 C  CG    . LEU A 1 289 ? 49.899  28.806 6.733   1.00 15.03 ? 286 LEU A CG    1 
ATOM   2166 C  CD1   . LEU A 1 289 ? 51.106  27.942 6.318   1.00 18.10 ? 286 LEU A CD1   1 
ATOM   2167 C  CD2   . LEU A 1 289 ? 50.169  29.503 8.074   1.00 19.63 ? 286 LEU A CD2   1 
ATOM   2168 N  N     . GLN A 1 290 ? 47.310  31.244 3.746   1.00 18.89 ? 287 GLN A N     1 
ATOM   2169 C  CA    . GLN A 1 290 ? 46.954  32.254 2.756   1.00 17.04 ? 287 GLN A CA    1 
ATOM   2170 C  C     . GLN A 1 290 ? 45.895  33.207 3.293   1.00 21.71 ? 287 GLN A C     1 
ATOM   2171 O  O     . GLN A 1 290 ? 45.907  34.401 2.966   1.00 22.05 ? 287 GLN A O     1 
ATOM   2172 C  CB    . GLN A 1 290 ? 46.461  31.594 1.472   1.00 17.11 ? 287 GLN A CB    1 
ATOM   2173 C  CG    . GLN A 1 290 ? 47.554  30.865 0.701   1.00 19.87 ? 287 GLN A CG    1 
ATOM   2174 C  CD    . GLN A 1 290 ? 46.994  30.130 -0.491  1.00 30.93 ? 287 GLN A CD    1 
ATOM   2175 O  OE1   . GLN A 1 290 ? 45.892  29.580 -0.428  1.00 21.53 ? 287 GLN A OE1   1 
ATOM   2176 N  NE2   . GLN A 1 290 ? 47.747  30.108 -1.586  1.00 30.90 ? 287 GLN A NE2   1 
ATOM   2177 N  N     . SER A 1 291 ? 45.004  32.717 4.155   1.00 19.90 ? 288 SER A N     1 
ATOM   2178 C  CA    A SER A 1 291 ? 43.945  33.579 4.674   0.64 21.67 ? 288 SER A CA    1 
ATOM   2179 C  CA    B SER A 1 291 ? 43.952  33.588 4.661   0.36 21.64 ? 288 SER A CA    1 
ATOM   2180 C  C     . SER A 1 291 ? 44.494  34.610 5.649   1.00 24.04 ? 288 SER A C     1 
ATOM   2181 O  O     . SER A 1 291 ? 43.976  35.728 5.725   1.00 29.74 ? 288 SER A O     1 
ATOM   2182 C  CB    A SER A 1 291 ? 42.842  32.738 5.336   0.64 18.47 ? 288 SER A CB    1 
ATOM   2183 C  CB    B SER A 1 291 ? 42.845  32.759 5.306   0.36 18.53 ? 288 SER A CB    1 
ATOM   2184 O  OG    A SER A 1 291 ? 43.228  32.231 6.608   0.64 23.07 ? 288 SER A OG    1 
ATOM   2185 O  OG    B SER A 1 291 ? 41.787  33.605 5.699   0.36 17.38 ? 288 SER A OG    1 
ATOM   2186 N  N     . HIS A 1 292 ? 45.534  34.258 6.398   1.00 17.98 ? 289 HIS A N     1 
ATOM   2187 C  CA    . HIS A 1 292 ? 46.089  35.196 7.361   1.00 21.50 ? 289 HIS A CA    1 
ATOM   2188 C  C     . HIS A 1 292 ? 47.092  36.140 6.716   1.00 26.88 ? 289 HIS A C     1 
ATOM   2189 O  O     . HIS A 1 292 ? 47.162  37.317 7.086   1.00 28.37 ? 289 HIS A O     1 
ATOM   2190 C  CB    . HIS A 1 292 ? 46.755  34.435 8.503   1.00 24.53 ? 289 HIS A CB    1 
ATOM   2191 C  CG    . HIS A 1 292 ? 45.799  33.712 9.399   1.00 29.21 ? 289 HIS A CG    1 
ATOM   2192 N  ND1   . HIS A 1 292 ? 44.796  34.356 10.091  1.00 25.14 ? 289 HIS A ND1   1 
ATOM   2193 C  CD2   . HIS A 1 292 ? 45.711  32.403 9.739   1.00 29.49 ? 289 HIS A CD2   1 
ATOM   2194 C  CE1   . HIS A 1 292 ? 44.133  33.475 10.821  1.00 27.75 ? 289 HIS A CE1   1 
ATOM   2195 N  NE2   . HIS A 1 292 ? 44.666  32.282 10.621  1.00 31.55 ? 289 HIS A NE2   1 
ATOM   2196 N  N     . PHE A 1 293 ? 47.889  35.649 5.762   1.00 22.90 ? 290 PHE A N     1 
ATOM   2197 C  CA    . PHE A 1 293 ? 49.046  36.400 5.296   1.00 23.16 ? 290 PHE A CA    1 
ATOM   2198 C  C     . PHE A 1 293 ? 49.033  36.684 3.798   1.00 26.71 ? 290 PHE A C     1 
ATOM   2199 O  O     . PHE A 1 293 ? 49.983  37.290 3.283   1.00 27.91 ? 290 PHE A O     1 
ATOM   2200 C  CB    . PHE A 1 293 ? 50.324  35.649 5.718   1.00 20.98 ? 290 PHE A CB    1 
ATOM   2201 C  CG    . PHE A 1 293 ? 50.298  35.227 7.164   1.00 19.99 ? 290 PHE A CG    1 
ATOM   2202 C  CD1   . PHE A 1 293 ? 50.322  36.180 8.172   1.00 20.03 ? 290 PHE A CD1   1 
ATOM   2203 C  CD2   . PHE A 1 293 ? 50.210  33.885 7.511   1.00 20.21 ? 290 PHE A CD2   1 
ATOM   2204 C  CE1   . PHE A 1 293 ? 50.248  35.808 9.518   1.00 20.88 ? 290 PHE A CE1   1 
ATOM   2205 C  CE2   . PHE A 1 293 ? 50.155  33.490 8.847   1.00 19.43 ? 290 PHE A CE2   1 
ATOM   2206 C  CZ    . PHE A 1 293 ? 50.158  34.454 9.854   1.00 20.95 ? 290 PHE A CZ    1 
ATOM   2207 N  N     . GLY A 1 294 ? 47.980  36.306 3.090   1.00 24.31 ? 291 GLY A N     1 
ATOM   2208 C  CA    . GLY A 1 294 ? 47.924  36.545 1.666   1.00 22.76 ? 291 GLY A CA    1 
ATOM   2209 C  C     . GLY A 1 294 ? 48.347  35.328 0.867   1.00 27.66 ? 291 GLY A C     1 
ATOM   2210 O  O     . GLY A 1 294 ? 49.037  34.424 1.356   1.00 26.37 ? 291 GLY A O     1 
ATOM   2211 N  N     . GLU A 1 295 ? 47.920  35.316 -0.398  1.00 23.98 ? 292 GLU A N     1 
ATOM   2212 C  CA    . GLU A 1 295 ? 48.124  34.158 -1.260  1.00 20.45 ? 292 GLU A CA    1 
ATOM   2213 C  C     . GLU A 1 295 ? 49.604  33.852 -1.427  1.00 25.44 ? 292 GLU A C     1 
ATOM   2214 O  O     . GLU A 1 295 ? 50.036  32.707 -1.257  1.00 23.19 ? 292 GLU A O     1 
ATOM   2215 C  CB    . GLU A 1 295 ? 47.476  34.402 -2.619  1.00 25.83 ? 292 GLU A CB    1 
ATOM   2216 C  CG    . GLU A 1 295 ? 47.544  33.217 -3.533  1.00 30.22 ? 292 GLU A CG    1 
ATOM   2217 C  CD    . GLU A 1 295 ? 47.083  33.547 -4.935  1.00 47.68 ? 292 GLU A CD    1 
ATOM   2218 O  OE1   . GLU A 1 295 ? 47.785  33.149 -5.891  1.00 42.05 ? 292 GLU A OE1   1 
ATOM   2219 O  OE2   . GLU A 1 295 ? 46.029  34.215 -5.078  1.00 37.20 ? 292 GLU A OE2   1 
ATOM   2220 N  N     . LYS A 1 296 ? 50.404  34.871 -1.745  1.00 20.57 ? 293 LYS A N     1 
ATOM   2221 C  CA    . LYS A 1 296 ? 51.822  34.620 -2.007  1.00 22.13 ? 293 LYS A CA    1 
ATOM   2222 C  C     . LYS A 1 296 ? 52.558  34.261 -0.721  1.00 20.97 ? 293 LYS A C     1 
ATOM   2223 O  O     . LYS A 1 296 ? 53.279  33.254 -0.667  1.00 22.31 ? 293 LYS A O     1 
ATOM   2224 C  CB    . LYS A 1 296 ? 52.456  35.836 -2.710  1.00 31.36 ? 293 LYS A CB    1 
ATOM   2225 C  CG    . LYS A 1 296 ? 52.611  37.101 -1.877  0.58 26.34 ? 293 LYS A CG    1 
ATOM   2226 N  N     . ASN A 1 297 ? 52.328  35.033 0.345   1.00 20.69 ? 294 ASN A N     1 
ATOM   2227 C  CA    . ASN A 1 297 ? 52.980  34.766 1.626   1.00 24.97 ? 294 ASN A CA    1 
ATOM   2228 C  C     . ASN A 1 297 ? 52.581  33.412 2.198   1.00 21.48 ? 294 ASN A C     1 
ATOM   2229 O  O     . ASN A 1 297 ? 53.410  32.722 2.798   1.00 18.00 ? 294 ASN A O     1 
ATOM   2230 C  CB    . ASN A 1 297 ? 52.626  35.847 2.642   1.00 27.78 ? 294 ASN A CB    1 
ATOM   2231 C  CG    . ASN A 1 297 ? 53.390  37.135 2.433   1.00 31.41 ? 294 ASN A CG    1 
ATOM   2232 O  OD1   . ASN A 1 297 ? 54.441  37.157 1.798   1.00 31.73 ? 294 ASN A OD1   1 
ATOM   2233 N  ND2   . ASN A 1 297 ? 52.862  38.221 2.985   1.00 30.89 ? 294 ASN A ND2   1 
ATOM   2234 N  N     . GLY A 1 298 ? 51.303  33.048 2.093   1.00 22.08 ? 295 GLY A N     1 
ATOM   2235 C  CA    . GLY A 1 298 ? 50.859  31.787 2.672   1.00 21.71 ? 295 GLY A CA    1 
ATOM   2236 C  C     . GLY A 1 298 ? 51.406  30.576 1.935   1.00 22.72 ? 295 GLY A C     1 
ATOM   2237 O  O     . GLY A 1 298 ? 51.814  29.588 2.557   1.00 18.03 ? 295 GLY A O     1 
ATOM   2238 N  N     . SER A 1 299 ? 51.401  30.618 0.601   1.00 17.63 ? 296 SER A N     1 
ATOM   2239 C  CA    A SER A 1 299 ? 52.017  29.542 -0.159  0.67 19.45 ? 296 SER A CA    1 
ATOM   2240 C  CA    B SER A 1 299 ? 52.017  29.536 -0.154  0.33 19.52 ? 296 SER A CA    1 
ATOM   2241 C  C     . SER A 1 299 ? 53.508  29.452 0.144   1.00 21.50 ? 296 SER A C     1 
ATOM   2242 O  O     . SER A 1 299 ? 54.056  28.354 0.284   1.00 18.09 ? 296 SER A O     1 
ATOM   2243 C  CB    A SER A 1 299 ? 51.776  29.749 -1.654  0.67 24.90 ? 296 SER A CB    1 
ATOM   2244 C  CB    B SER A 1 299 ? 51.770  29.722 -1.651  0.33 24.83 ? 296 SER A CB    1 
ATOM   2245 O  OG    A SER A 1 299 ? 50.400  29.577 -1.962  0.67 19.35 ? 296 SER A OG    1 
ATOM   2246 O  OG    B SER A 1 299 ? 52.138  31.017 -2.079  0.33 23.04 ? 296 SER A OG    1 
ATOM   2247 N  N     . TRP A 1 300 ? 54.177  30.603 0.261   1.00 18.53 ? 297 TRP A N     1 
ATOM   2248 C  CA    . TRP A 1 300 ? 55.604  30.587 0.573   1.00 19.61 ? 297 TRP A CA    1 
ATOM   2249 C  C     . TRP A 1 300 ? 55.851  29.991 1.950   1.00 15.73 ? 297 TRP A C     1 
ATOM   2250 O  O     . TRP A 1 300 ? 56.739  29.139 2.114   1.00 16.69 ? 297 TRP A O     1 
ATOM   2251 C  CB    . TRP A 1 300 ? 56.186  31.996 0.485   1.00 24.26 ? 297 TRP A CB    1 
ATOM   2252 C  CG    . TRP A 1 300 ? 57.672  32.073 0.708   1.00 18.63 ? 297 TRP A CG    1 
ATOM   2253 C  CD1   . TRP A 1 300 ? 58.649  31.933 -0.232  1.00 23.12 ? 297 TRP A CD1   1 
ATOM   2254 C  CD2   . TRP A 1 300 ? 58.345  32.337 1.951   1.00 16.25 ? 297 TRP A CD2   1 
ATOM   2255 N  NE1   . TRP A 1 300 ? 59.890  32.090 0.349   1.00 28.67 ? 297 TRP A NE1   1 
ATOM   2256 C  CE2   . TRP A 1 300 ? 59.728  32.331 1.688   1.00 27.65 ? 297 TRP A CE2   1 
ATOM   2257 C  CE3   . TRP A 1 300 ? 57.907  32.566 3.259   1.00 19.89 ? 297 TRP A CE3   1 
ATOM   2258 C  CZ2   . TRP A 1 300 ? 60.681  32.564 2.684   1.00 18.57 ? 297 TRP A CZ2   1 
ATOM   2259 C  CZ3   . TRP A 1 300 ? 58.862  32.788 4.248   1.00 20.94 ? 297 TRP A CZ3   1 
ATOM   2260 C  CH2   . TRP A 1 300 ? 60.223  32.790 3.948   1.00 18.18 ? 297 TRP A CH2   1 
ATOM   2261 N  N     . LEU A 1 301 ? 55.063  30.421 2.954   1.00 14.93 ? 298 LEU A N     1 
ATOM   2262 C  CA    . LEU A 1 301 ? 55.233  29.908 4.313   1.00 20.63 ? 298 LEU A CA    1 
ATOM   2263 C  C     . LEU A 1 301 ? 54.937  28.421 4.392   1.00 20.27 ? 298 LEU A C     1 
ATOM   2264 O  O     . LEU A 1 301 ? 55.613  27.685 5.119   1.00 16.81 ? 298 LEU A O     1 
ATOM   2265 C  CB    . LEU A 1 301 ? 54.322  30.647 5.294   1.00 15.66 ? 298 LEU A CB    1 
ATOM   2266 C  CG    . LEU A 1 301 ? 54.710  32.086 5.664   1.00 17.76 ? 298 LEU A CG    1 
ATOM   2267 C  CD1   . LEU A 1 301 ? 53.571  32.816 6.373   1.00 18.30 ? 298 LEU A CD1   1 
ATOM   2268 C  CD2   . LEU A 1 301 ? 55.959  32.093 6.542   1.00 17.77 ? 298 LEU A CD2   1 
ATOM   2269 N  N     . TYR A 1 302 ? 53.903  27.965 3.684   1.00 17.68 ? 299 TYR A N     1 
ATOM   2270 C  CA    . TYR A 1 302 ? 53.561  26.550 3.738   1.00 17.25 ? 299 TYR A CA    1 
ATOM   2271 C  C     . TYR A 1 302 ? 54.730  25.697 3.264   1.00 17.95 ? 299 TYR A C     1 
ATOM   2272 O  O     . TYR A 1 302 ? 55.083  24.695 3.898   1.00 15.90 ? 299 TYR A O     1 
ATOM   2273 C  CB    . TYR A 1 302 ? 52.306  26.289 2.900   1.00 14.86 ? 299 TYR A CB    1 
ATOM   2274 C  CG    . TYR A 1 302 ? 51.886  24.849 2.897   1.00 17.73 ? 299 TYR A CG    1 
ATOM   2275 C  CD1   . TYR A 1 302 ? 51.041  24.363 3.886   1.00 17.82 ? 299 TYR A CD1   1 
ATOM   2276 C  CD2   . TYR A 1 302 ? 52.324  23.969 1.907   1.00 21.48 ? 299 TYR A CD2   1 
ATOM   2277 C  CE1   . TYR A 1 302 ? 50.648  23.029 3.903   1.00 19.70 ? 299 TYR A CE1   1 
ATOM   2278 C  CE2   . TYR A 1 302 ? 51.940  22.622 1.920   1.00 25.03 ? 299 TYR A CE2   1 
ATOM   2279 C  CZ    . TYR A 1 302 ? 51.090  22.171 2.922   1.00 26.11 ? 299 TYR A CZ    1 
ATOM   2280 O  OH    . TYR A 1 302 ? 50.688  20.854 2.962   1.00 30.01 ? 299 TYR A OH    1 
ATOM   2281 N  N     . ALA A 1 303 ? 55.376  26.104 2.177   1.00 16.48 ? 300 ALA A N     1 
ATOM   2282 C  CA    . ALA A 1 303 ? 56.481  25.304 1.668   1.00 16.84 ? 300 ALA A CA    1 
ATOM   2283 C  C     . ALA A 1 303 ? 57.743  25.520 2.507   1.00 14.95 ? 300 ALA A C     1 
ATOM   2284 O  O     . ALA A 1 303 ? 58.470  24.561 2.803   1.00 17.20 ? 300 ALA A O     1 
ATOM   2285 C  CB    . ALA A 1 303 ? 56.726  25.645 0.195   1.00 18.36 ? 300 ALA A CB    1 
ATOM   2286 N  N     . MET A 1 304 ? 57.977  26.756 2.956   1.00 15.00 ? 301 MET A N     1 
ATOM   2287 C  CA    . MET A 1 304 ? 59.236  27.078 3.634   1.00 17.48 ? 301 MET A CA    1 
ATOM   2288 C  C     . MET A 1 304 ? 59.359  26.354 4.968   1.00 15.10 ? 301 MET A C     1 
ATOM   2289 O  O     . MET A 1 304 ? 60.456  25.918 5.341   1.00 15.47 ? 301 MET A O     1 
ATOM   2290 C  CB    . MET A 1 304 ? 59.363  28.586 3.857   1.00 13.68 ? 301 MET A CB    1 
ATOM   2291 C  CG    . MET A 1 304 ? 60.775  29.029 4.305   1.00 17.95 ? 301 MET A CG    1 
ATOM   2292 S  SD    . MET A 1 304 ? 61.966  28.819 2.984   1.00 20.48 ? 301 MET A SD    1 
ATOM   2293 C  CE    . MET A 1 304 ? 62.916  27.388 3.568   1.00 18.21 ? 301 MET A CE    1 
ATOM   2294 N  N     . CYS A 1 305 ? 58.255  26.205 5.705   1.00 13.49 ? 302 CYS A N     1 
ATOM   2295 C  CA    . CYS A 1 305 ? 58.365  25.540 6.999   1.00 18.44 ? 302 CYS A CA    1 
ATOM   2296 C  C     . CYS A 1 305 ? 58.649  24.052 6.849   1.00 16.80 ? 302 CYS A C     1 
ATOM   2297 O  O     . CYS A 1 305 ? 58.998  23.401 7.836   1.00 16.60 ? 302 CYS A O     1 
ATOM   2298 C  CB    . CYS A 1 305 ? 57.092  25.764 7.824   1.00 14.90 ? 302 CYS A CB    1 
ATOM   2299 S  SG    . CYS A 1 305 ? 55.674  24.848 7.196   1.00 17.30 ? 302 CYS A SG    1 
ATOM   2300 N  N     . ARG A 1 306 ? 58.567  23.531 5.627   1.00 14.11 ? 303 ARG A N     1 
ATOM   2301 C  CA    . ARG A 1 306 ? 58.951  22.179 5.268   1.00 14.34 ? 303 ARG A CA    1 
ATOM   2302 C  C     . ARG A 1 306 ? 60.327  22.136 4.620   1.00 17.41 ? 303 ARG A C     1 
ATOM   2303 O  O     . ARG A 1 306 ? 60.744  21.076 4.148   1.00 18.67 ? 303 ARG A O     1 
ATOM   2304 C  CB    . ARG A 1 306 ? 57.899  21.580 4.328   1.00 16.34 ? 303 ARG A CB    1 
ATOM   2305 C  CG    . ARG A 1 306 ? 56.525  21.435 5.005   1.00 18.15 ? 303 ARG A CG    1 
ATOM   2306 C  CD    . ARG A 1 306 ? 55.345  21.110 4.040   1.00 18.34 ? 303 ARG A CD    1 
ATOM   2307 N  NE    . ARG A 1 306 ? 54.209  20.650 4.838   1.00 16.63 ? 303 ARG A NE    1 
ATOM   2308 C  CZ    . ARG A 1 306 ? 53.451  21.442 5.582   1.00 19.22 ? 303 ARG A CZ    1 
ATOM   2309 N  NH1   . ARG A 1 306 ? 53.663  22.752 5.578   1.00 22.44 ? 303 ARG A NH1   1 
ATOM   2310 N  NH2   . ARG A 1 306 ? 52.469  20.926 6.318   1.00 19.94 ? 303 ARG A NH2   1 
ATOM   2311 N  N     . GLY A 1 307 ? 61.033  23.266 4.596   1.00 16.85 ? 304 GLY A N     1 
ATOM   2312 C  CA    . GLY A 1 307 ? 62.350  23.354 3.995   1.00 15.98 ? 304 GLY A CA    1 
ATOM   2313 C  C     . GLY A 1 307 ? 62.344  23.557 2.499   1.00 14.70 ? 304 GLY A C     1 
ATOM   2314 O  O     . GLY A 1 307 ? 63.369  23.333 1.852   1.00 18.58 ? 304 GLY A O     1 
ATOM   2315 N  N     . ILE A 1 308 ? 61.217  23.971 1.923   1.00 17.23 ? 305 ILE A N     1 
ATOM   2316 C  CA    . ILE A 1 308 ? 61.050  24.040 0.475   1.00 16.78 ? 305 ILE A CA    1 
ATOM   2317 C  C     . ILE A 1 308 ? 60.870  25.494 0.067   1.00 16.01 ? 305 ILE A C     1 
ATOM   2318 O  O     . ILE A 1 308 ? 60.015  26.199 0.613   1.00 14.91 ? 305 ILE A O     1 
ATOM   2319 C  CB    . ILE A 1 308 ? 59.854  23.195 0.010   1.00 16.70 ? 305 ILE A CB    1 
ATOM   2320 C  CG1   . ILE A 1 308 ? 60.095  21.729 0.392   1.00 19.06 ? 305 ILE A CG1   1 
ATOM   2321 C  CG2   . ILE A 1 308 ? 59.649  23.361 -1.489  1.00 16.48 ? 305 ILE A CG2   1 
ATOM   2322 C  CD1   . ILE A 1 308 ? 58.928  20.831 0.080   1.00 23.02 ? 305 ILE A CD1   1 
ATOM   2323 N  N     . GLU A 1 309 ? 61.675  25.935 -0.897  1.00 16.38 ? 306 GLU A N     1 
ATOM   2324 C  CA    . GLU A 1 309 ? 61.616  27.303 -1.391  1.00 21.67 ? 306 GLU A CA    1 
ATOM   2325 C  C     . GLU A 1 309 ? 62.112  27.272 -2.827  1.00 29.55 ? 306 GLU A C     1 
ATOM   2326 O  O     . GLU A 1 309 ? 63.027  26.511 -3.144  1.00 25.65 ? 306 GLU A O     1 
ATOM   2327 C  CB    . GLU A 1 309 ? 62.494  28.254 -0.558  1.00 24.01 ? 306 GLU A CB    1 
ATOM   2328 C  CG    . GLU A 1 309 ? 62.059  29.697 -0.655  1.00 33.23 ? 306 GLU A CG    1 
ATOM   2329 C  CD    . GLU A 1 309 ? 63.200  30.689 -0.664  1.00 30.53 ? 306 GLU A CD    1 
ATOM   2330 O  OE1   . GLU A 1 309 ? 64.390  30.285 -0.747  1.00 30.47 ? 306 GLU A OE1   1 
ATOM   2331 O  OE2   . GLU A 1 309 ? 62.891  31.891 -0.603  1.00 38.88 ? 306 GLU A OE2   1 
ATOM   2332 N  N     . HIS A 1 310 ? 61.529  28.101 -3.691  1.00 28.20 ? 307 HIS A N     1 
ATOM   2333 C  CA    . HIS A 1 310 ? 61.876  28.040 -5.105  1.00 30.71 ? 307 HIS A CA    1 
ATOM   2334 C  C     . HIS A 1 310 ? 62.468  29.328 -5.664  1.00 29.59 ? 307 HIS A C     1 
ATOM   2335 O  O     . HIS A 1 310 ? 62.770  29.370 -6.862  1.00 28.00 ? 307 HIS A O     1 
ATOM   2336 C  CB    . HIS A 1 310 ? 60.642  27.627 -5.924  1.00 30.59 ? 307 HIS A CB    1 
ATOM   2337 C  CG    . HIS A 1 310 ? 60.072  26.309 -5.501  1.00 33.61 ? 307 HIS A CG    1 
ATOM   2338 N  ND1   . HIS A 1 310 ? 60.848  25.181 -5.350  1.00 39.76 ? 307 HIS A ND1   1 
ATOM   2339 C  CD2   . HIS A 1 310 ? 58.812  25.948 -5.160  1.00 44.58 ? 307 HIS A CD2   1 
ATOM   2340 C  CE1   . HIS A 1 310 ? 60.090  24.176 -4.946  1.00 31.35 ? 307 HIS A CE1   1 
ATOM   2341 N  NE2   . HIS A 1 310 ? 58.849  24.614 -4.829  1.00 39.56 ? 307 HIS A NE2   1 
ATOM   2342 N  N     . ASP A 1 311 ? 62.658  30.355 -4.843  1.00 23.90 ? 308 ASP A N     1 
ATOM   2343 C  CA    . ASP A 1 311 ? 63.274  31.601 -5.277  1.00 23.14 ? 308 ASP A CA    1 
ATOM   2344 C  C     . ASP A 1 311 ? 64.602  31.308 -5.977  1.00 29.07 ? 308 ASP A C     1 
ATOM   2345 O  O     . ASP A 1 311 ? 65.492  30.696 -5.368  1.00 24.47 ? 308 ASP A O     1 
ATOM   2346 C  CB    . ASP A 1 311 ? 63.495  32.524 -4.083  1.00 25.61 ? 308 ASP A CB    1 
ATOM   2347 C  CG    . ASP A 1 311 ? 64.084  33.868 -4.485  1.00 35.87 ? 308 ASP A CG    1 
ATOM   2348 O  OD1   . ASP A 1 311 ? 63.841  34.311 -5.631  1.00 39.61 ? 308 ASP A OD1   1 
ATOM   2349 O  OD2   . ASP A 1 311 ? 64.775  34.491 -3.654  1.00 43.46 ? 308 ASP A OD2   1 
ATOM   2350 N  N     . PRO A 1 312 ? 64.762  31.674 -7.245  1.00 20.28 ? 309 PRO A N     1 
ATOM   2351 C  CA    . PRO A 1 312 ? 65.986  31.293 -7.955  1.00 20.08 ? 309 PRO A CA    1 
ATOM   2352 C  C     . PRO A 1 312 ? 67.159  32.194 -7.600  1.00 20.91 ? 309 PRO A C     1 
ATOM   2353 O  O     . PRO A 1 312 ? 66.992  33.342 -7.175  1.00 23.14 ? 309 PRO A O     1 
ATOM   2354 C  CB    . PRO A 1 312 ? 65.598  31.443 -9.433  1.00 24.09 ? 309 PRO A CB    1 
ATOM   2355 C  CG    . PRO A 1 312 ? 64.584  32.548 -9.416  1.00 27.37 ? 309 PRO A CG    1 
ATOM   2356 C  CD    . PRO A 1 312 ? 63.800  32.352 -8.136  1.00 26.63 ? 309 PRO A CD    1 
ATOM   2357 N  N     . VAL A 1 313 ? 68.358  31.623 -7.722  1.00 20.54 ? 310 VAL A N     1 
ATOM   2358 C  CA    . VAL A 1 313 ? 69.590  32.412 -7.686  1.00 15.48 ? 310 VAL A CA    1 
ATOM   2359 C  C     . VAL A 1 313 ? 69.605  33.240 -8.965  1.00 21.65 ? 310 VAL A C     1 
ATOM   2360 O  O     . VAL A 1 313 ? 69.741  32.688 -10.060 1.00 22.78 ? 310 VAL A O     1 
ATOM   2361 C  CB    . VAL A 1 313 ? 70.835  31.524 -7.580  1.00 24.52 ? 310 VAL A CB    1 
ATOM   2362 C  CG1   . VAL A 1 313 ? 72.101  32.362 -7.666  1.00 22.12 ? 310 VAL A CG1   1 
ATOM   2363 C  CG2   . VAL A 1 313 ? 70.822  30.720 -6.283  1.00 16.75 ? 310 VAL A CG2   1 
ATOM   2364 N  N     . LYS A 1 314 ? 69.419  34.552 -8.836  1.00 25.75 ? 311 LYS A N     1 
ATOM   2365 C  CA    . LYS A 1 314 ? 69.354  35.370 -10.045 1.00 24.37 ? 311 LYS A CA    1 
ATOM   2366 C  C     . LYS A 1 314 ? 70.754  35.643 -10.586 1.00 26.58 ? 311 LYS A C     1 
ATOM   2367 O  O     . LYS A 1 314 ? 71.669  35.957 -9.820  1.00 23.76 ? 311 LYS A O     1 
ATOM   2368 C  CB    . LYS A 1 314 ? 68.637  36.681 -9.753  1.00 24.12 ? 311 LYS A CB    1 
ATOM   2369 C  CG    . LYS A 1 314 ? 67.189  36.477 -9.340  1.00 28.52 ? 311 LYS A CG    1 
ATOM   2370 C  CD    . LYS A 1 314 ? 66.604  37.722 -8.708  1.00 38.81 ? 311 LYS A CD    1 
ATOM   2371 C  CE    . LYS A 1 314 ? 65.127  37.529 -8.392  0.64 37.05 ? 311 LYS A CE    1 
ATOM   2372 N  NZ    . LYS A 1 314 ? 64.407  38.822 -8.538  0.58 36.67 ? 311 LYS A NZ    1 
ATOM   2373 N  N     . PRO A 1 315 ? 70.947  35.516 -11.882 1.00 24.23 ? 312 PRO A N     1 
ATOM   2374 C  CA    . PRO A 1 315 ? 72.248  35.846 -12.460 1.00 25.73 ? 312 PRO A CA    1 
ATOM   2375 C  C     . PRO A 1 315 ? 72.472  37.350 -12.478 1.00 30.66 ? 312 PRO A C     1 
ATOM   2376 O  O     . PRO A 1 315 ? 72.192  38.004 -13.486 1.00 30.78 ? 312 PRO A O     1 
ATOM   2377 C  CB    . PRO A 1 315 ? 72.152  35.268 -13.876 1.00 29.87 ? 312 PRO A CB    1 
ATOM   2378 C  CG    . PRO A 1 315 ? 70.680  35.367 -14.207 1.00 32.31 ? 312 PRO A CG    1 
ATOM   2379 C  CD    . PRO A 1 315 ? 69.965  35.095 -12.905 1.00 28.21 ? 312 PRO A CD    1 
ATOM   2380 N  N     . ARG A 1 316 ? 72.970  37.915 -11.379 1.00 27.71 ? 313 ARG A N     1 
ATOM   2381 C  CA    . ARG A 1 316 ? 73.115  39.368 -11.277 1.00 23.93 ? 313 ARG A CA    1 
ATOM   2382 C  C     . ARG A 1 316 ? 74.274  39.683 -10.342 1.00 28.19 ? 313 ARG A C     1 
ATOM   2383 O  O     . ARG A 1 316 ? 74.168  39.478 -9.128  1.00 24.58 ? 313 ARG A O     1 
ATOM   2384 C  CB    . ARG A 1 316 ? 71.826  40.017 -10.777 1.00 24.91 ? 313 ARG A CB    1 
ATOM   2385 C  CG    . ARG A 1 316 ? 71.710  41.479 -11.134 1.00 38.87 ? 313 ARG A CG    1 
ATOM   2386 C  CD    . ARG A 1 316 ? 71.080  42.311 -10.032 1.00 38.06 ? 313 ARG A CD    1 
ATOM   2387 N  NE    . ARG A 1 316 ? 69.887  41.713 -9.441  1.00 45.98 ? 313 ARG A NE    1 
ATOM   2388 C  CZ    . ARG A 1 316 ? 69.780  41.386 -8.155  1.00 48.36 ? 313 ARG A CZ    1 
ATOM   2389 N  NH1   . ARG A 1 316 ? 70.801  41.598 -7.328  1.00 44.76 ? 313 ARG A NH1   1 
ATOM   2390 N  NH2   . ARG A 1 316 ? 68.651  40.858 -7.691  1.00 39.26 ? 313 ARG A NH2   1 
ATOM   2391 N  N     . GLN A 1 317 ? 75.357  40.214 -10.906 1.00 25.76 ? 314 GLN A N     1 
ATOM   2392 C  CA    . GLN A 1 317 ? 76.534  40.617 -10.145 1.00 33.15 ? 314 GLN A CA    1 
ATOM   2393 C  C     . GLN A 1 317 ? 76.587  42.113 -9.852  1.00 35.24 ? 314 GLN A C     1 
ATOM   2394 O  O     . GLN A 1 317 ? 77.260  42.519 -8.899  1.00 41.22 ? 314 GLN A O     1 
ATOM   2395 C  CB    . GLN A 1 317 ? 77.803  40.218 -10.903 1.00 35.89 ? 314 GLN A CB    1 
ATOM   2396 C  CG    . GLN A 1 317 ? 78.616  39.169 -10.197 1.00 40.18 ? 314 GLN A CG    1 
ATOM   2397 C  CD    . GLN A 1 317 ? 79.852  38.760 -10.967 1.00 49.87 ? 314 GLN A CD    1 
ATOM   2398 O  OE1   . GLN A 1 317 ? 79.765  38.012 -11.943 1.00 48.92 ? 314 GLN A OE1   1 
ATOM   2399 N  NE2   . GLN A 1 317 ? 81.019  39.234 -10.522 1.00 44.31 ? 314 GLN A NE2   1 
ATOM   2400 N  N     . LEU A 1 318 ? 75.921  42.914 -10.621 1.00 31.60 ? 315 LEU A N     1 
ATOM   2401 C  CA    . LEU A 1 318 ? 75.903  44.366 -10.508 1.00 32.77 ? 315 LEU A CA    1 
ATOM   2402 C  C     . LEU A 1 318 ? 74.608  44.859 -9.877  1.00 34.17 ? 315 LEU A C     1 
ATOM   2403 O  O     . LEU A 1 318 ? 73.531  44.343 -10.188 1.00 33.50 ? 315 LEU A O     1 
ATOM   2404 C  CB    . LEU A 1 318 ? 76.038  45.013 -11.884 1.00 32.41 ? 315 LEU A CB    1 
ATOM   2405 C  CG    . LEU A 1 318 ? 77.279  44.677 -12.703 1.00 35.66 ? 315 LEU A CG    1 
ATOM   2406 C  CD1   . LEU A 1 318 ? 77.164  45.358 -14.056 1.00 39.39 ? 315 LEU A CD1   1 
ATOM   2407 C  CD2   . LEU A 1 318 ? 78.538  45.119 -11.975 1.00 39.58 ? 315 LEU A CD2   1 
ATOM   2408 N  N     . PRO A 1 319 ? 74.690  45.880 -9.026  1.00 34.84 ? 316 PRO A N     1 
ATOM   2409 C  CA    . PRO A 1 319 ? 73.470  46.562 -8.561  1.00 32.92 ? 316 PRO A CA    1 
ATOM   2410 C  C     . PRO A 1 319 ? 72.675  47.166 -9.719  1.00 30.86 ? 316 PRO A C     1 
ATOM   2411 O  O     . PRO A 1 319 ? 73.244  47.595 -10.722 1.00 39.01 ? 316 PRO A O     1 
ATOM   2412 C  CB    . PRO A 1 319 ? 74.010  47.654 -7.627  1.00 31.96 ? 316 PRO A CB    1 
ATOM   2413 C  CG    . PRO A 1 319 ? 75.366  47.148 -7.190  1.00 40.63 ? 316 PRO A CG    1 
ATOM   2414 C  CD    . PRO A 1 319 ? 75.909  46.384 -8.368  1.00 36.24 ? 316 PRO A CD    1 
ATOM   2415 N  N     . LYS A 1 320 ? 71.330  47.181 -9.576  1.00 26.39 ? 317 LYS A N     1 
ATOM   2416 C  CA    . LYS A 1 320 ? 70.399  47.801 -10.525 1.00 25.03 ? 317 LYS A CA    1 
ATOM   2417 C  C     . LYS A 1 320 ? 70.207  49.293 -10.282 1.00 26.01 ? 317 LYS A C     1 
ATOM   2418 O  O     . LYS A 1 320 ? 69.573  49.975 -11.094 1.00 28.84 ? 317 LYS A O     1 
ATOM   2419 C  CB    . LYS A 1 320 ? 68.993  47.180 -10.440 1.00 32.95 ? 317 LYS A CB    1 
ATOM   2420 C  CG    . LYS A 1 320 ? 68.853  45.709 -10.776 1.00 38.17 ? 317 LYS A CG    1 
ATOM   2421 C  CD    . LYS A 1 320 ? 67.364  45.311 -10.800 1.00 31.21 ? 317 LYS A CD    1 
ATOM   2422 C  CE    . LYS A 1 320 ? 67.179  43.832 -11.101 1.00 43.65 ? 317 LYS A CE    1 
ATOM   2423 N  NZ    . LYS A 1 320 ? 65.736  43.463 -11.236 1.00 42.92 ? 317 LYS A NZ    1 
ATOM   2424 N  N     . THR A 1 321 ? 70.642  49.784 -9.144  1.00 26.35 ? 318 THR A N     1 
ATOM   2425 C  CA    . THR A 1 321 ? 70.561  51.192 -8.818  1.00 22.89 ? 318 THR A CA    1 
ATOM   2426 C  C     . THR A 1 321 ? 71.901  51.561 -8.225  1.00 23.53 ? 318 THR A C     1 
ATOM   2427 O  O     . THR A 1 321 ? 72.629  50.699 -7.731  1.00 25.47 ? 318 THR A O     1 
ATOM   2428 C  CB    . THR A 1 321 ? 69.414  51.499 -7.823  1.00 26.00 ? 318 THR A CB    1 
ATOM   2429 O  OG1   . THR A 1 321 ? 69.623  50.775 -6.607  1.00 33.29 ? 318 THR A OG1   1 
ATOM   2430 C  CG2   . THR A 1 321 ? 68.072  51.107 -8.395  1.00 26.06 ? 318 THR A CG2   1 
ATOM   2431 N  N     . ILE A 1 322 ? 72.258  52.831 -8.349  1.00 21.99 ? 319 ILE A N     1 
ATOM   2432 C  CA    A ILE A 1 322 ? 73.461  53.382 -7.737  0.22 22.35 ? 319 ILE A CA    1 
ATOM   2433 C  CA    B ILE A 1 322 ? 73.455  53.370 -7.724  0.78 22.24 ? 319 ILE A CA    1 
ATOM   2434 C  C     . ILE A 1 322 ? 73.029  54.621 -6.972  1.00 23.01 ? 319 ILE A C     1 
ATOM   2435 O  O     . ILE A 1 322 ? 72.492  55.556 -7.571  1.00 22.13 ? 319 ILE A O     1 
ATOM   2436 C  CB    A ILE A 1 322 ? 74.534  53.732 -8.781  0.22 22.83 ? 319 ILE A CB    1 
ATOM   2437 C  CB    B ILE A 1 322 ? 74.557  53.686 -8.746  0.78 22.78 ? 319 ILE A CB    1 
ATOM   2438 C  CG1   A ILE A 1 322 ? 74.964  52.480 -9.550  0.22 25.00 ? 319 ILE A CG1   1 
ATOM   2439 C  CG1   B ILE A 1 322 ? 75.024  52.397 -9.436  0.78 24.97 ? 319 ILE A CG1   1 
ATOM   2440 C  CG2   A ILE A 1 322 ? 75.733  54.391 -8.112  0.22 23.39 ? 319 ILE A CG2   1 
ATOM   2441 C  CG2   B ILE A 1 322 ? 75.735  54.375 -8.062  0.78 23.37 ? 319 ILE A CG2   1 
ATOM   2442 C  CD1   A ILE A 1 322 ? 75.767  51.507 -8.724  0.22 24.43 ? 319 ILE A CD1   1 
ATOM   2443 C  CD1   B ILE A 1 322 ? 76.233  52.605 -10.329 0.78 25.87 ? 319 ILE A CD1   1 
ATOM   2444 N  N     . GLY A 1 323 ? 73.233  54.620 -5.661  1.00 21.34 ? 320 GLY A N     1 
ATOM   2445 C  CA    . GLY A 1 323 ? 72.683  55.657 -4.820  1.00 24.48 ? 320 GLY A CA    1 
ATOM   2446 C  C     . GLY A 1 323 ? 73.697  56.256 -3.873  1.00 22.52 ? 320 GLY A C     1 
ATOM   2447 O  O     . GLY A 1 323 ? 74.685  55.635 -3.479  1.00 22.00 ? 320 GLY A O     1 
ATOM   2448 N  N     . CYS A 1 324 ? 73.392  57.495 -3.486  1.00 21.09 ? 321 CYS A N     1 
ATOM   2449 C  CA    A CYS A 1 324 ? 74.219  58.303 -2.611  0.70 21.10 ? 321 CYS A CA    1 
ATOM   2450 C  CA    B CYS A 1 324 ? 74.222  58.310 -2.605  0.30 21.17 ? 321 CYS A CA    1 
ATOM   2451 C  C     . CYS A 1 324 ? 73.297  58.994 -1.617  1.00 21.04 ? 321 CYS A C     1 
ATOM   2452 O  O     . CYS A 1 324 ? 72.399  59.731 -2.026  1.00 23.73 ? 321 CYS A O     1 
ATOM   2453 C  CB    A CYS A 1 324 ? 74.996  59.323 -3.445  0.70 23.93 ? 321 CYS A CB    1 
ATOM   2454 C  CB    B CYS A 1 324 ? 75.015  59.370 -3.383  0.30 23.87 ? 321 CYS A CB    1 
ATOM   2455 S  SG    A CYS A 1 324 ? 76.032  60.366 -2.509  0.70 29.24 ? 321 CYS A SG    1 
ATOM   2456 S  SG    B CYS A 1 324 ? 76.480  58.792 -4.244  0.30 26.02 ? 321 CYS A SG    1 
ATOM   2457 N  N     . SER A 1 325 ? 73.498  58.756 -0.324  1.00 19.12 ? 322 SER A N     1 
ATOM   2458 C  CA    . SER A 1 325 ? 72.601  59.347 0.664   1.00 19.28 ? 322 SER A CA    1 
ATOM   2459 C  C     . SER A 1 325 ? 73.386  59.864 1.860   1.00 23.44 ? 322 SER A C     1 
ATOM   2460 O  O     . SER A 1 325 ? 74.506  59.426 2.137   1.00 21.38 ? 322 SER A O     1 
ATOM   2461 C  CB    . SER A 1 325 ? 71.534  58.344 1.146   1.00 25.59 ? 322 SER A CB    1 
ATOM   2462 O  OG    . SER A 1 325 ? 72.133  57.270 1.849   1.00 28.84 ? 322 SER A OG    1 
ATOM   2463 N  N     . LYS A 1 326 ? 72.775  60.808 2.577   1.00 22.38 ? 323 LYS A N     1 
ATOM   2464 C  CA    . LYS A 1 326 ? 73.359  61.304 3.817   1.00 17.79 ? 323 LYS A CA    1 
ATOM   2465 C  C     . LYS A 1 326 ? 72.261  61.769 4.761   1.00 24.06 ? 323 LYS A C     1 
ATOM   2466 O  O     . LYS A 1 326 ? 71.348  62.497 4.346   1.00 18.90 ? 323 LYS A O     1 
ATOM   2467 C  CB    . LYS A 1 326 ? 74.344  62.455 3.539   1.00 19.26 ? 323 LYS A CB    1 
ATOM   2468 C  CG    . LYS A 1 326 ? 74.969  63.026 4.799   1.00 24.03 ? 323 LYS A CG    1 
ATOM   2469 C  CD    . LYS A 1 326 ? 76.111  63.974 4.474   1.00 22.01 ? 323 LYS A CD    1 
ATOM   2470 C  CE    . LYS A 1 326 ? 76.665  64.605 5.751   1.00 27.47 ? 323 LYS A CE    1 
ATOM   2471 N  NZ    . LYS A 1 326 ? 77.315  63.590 6.608   1.00 24.05 ? 323 LYS A NZ    1 
ATOM   2472 N  N     . ASN A 1 327 ? 72.361  61.350 6.024   1.00 20.49 ? 324 ASN A N     1 
ATOM   2473 C  CA    . ASN A 1 327 ? 71.484  61.833 7.085   1.00 20.76 ? 324 ASN A CA    1 
ATOM   2474 C  C     . ASN A 1 327 ? 72.022  63.124 7.708   1.00 23.51 ? 324 ASN A C     1 
ATOM   2475 O  O     . ASN A 1 327 ? 73.229  63.375 7.737   1.00 21.37 ? 324 ASN A O     1 
ATOM   2476 C  CB    . ASN A 1 327 ? 71.322  60.783 8.186   1.00 25.71 ? 324 ASN A CB    1 
ATOM   2477 C  CG    . ASN A 1 327 ? 70.628  59.507 7.708   1.00 32.91 ? 324 ASN A CG    1 
ATOM   2478 O  OD1   . ASN A 1 327 ? 70.090  59.436 6.605   1.00 33.38 ? 324 ASN A OD1   1 
ATOM   2479 N  ND2   . ASN A 1 327 ? 70.629  58.492 8.564   1.00 38.53 ? 324 ASN A ND2   1 
ATOM   2480 N  N     . PHE A 1 328 ? 71.105  63.931 8.236   1.00 20.98 ? 325 PHE A N     1 
ATOM   2481 C  CA    . PHE A 1 328 ? 71.421  65.206 8.877   1.00 23.41 ? 325 PHE A CA    1 
ATOM   2482 C  C     . PHE A 1 328 ? 70.640  65.270 10.181  1.00 31.42 ? 325 PHE A C     1 
ATOM   2483 O  O     . PHE A 1 328 ? 69.626  65.977 10.285  1.00 27.60 ? 325 PHE A O     1 
ATOM   2484 C  CB    . PHE A 1 328 ? 71.089  66.376 7.958   1.00 23.71 ? 325 PHE A CB    1 
ATOM   2485 C  CG    . PHE A 1 328 ? 71.837  66.348 6.654   1.00 21.24 ? 325 PHE A CG    1 
ATOM   2486 C  CD1   . PHE A 1 328 ? 73.138  66.835 6.571   1.00 22.84 ? 325 PHE A CD1   1 
ATOM   2487 C  CD2   . PHE A 1 328 ? 71.246  65.831 5.512   1.00 21.55 ? 325 PHE A CD2   1 
ATOM   2488 C  CE1   . PHE A 1 328 ? 73.827  66.828 5.375   1.00 21.52 ? 325 PHE A CE1   1 
ATOM   2489 C  CE2   . PHE A 1 328 ? 71.935  65.808 4.304   1.00 17.51 ? 325 PHE A CE2   1 
ATOM   2490 C  CZ    . PHE A 1 328 ? 73.229  66.300 4.231   1.00 21.48 ? 325 PHE A CZ    1 
ATOM   2491 N  N     . PRO A 1 329 ? 71.093  64.551 11.203  1.00 28.34 ? 326 PRO A N     1 
ATOM   2492 C  CA    . PRO A 1 329 ? 70.280  64.378 12.407  1.00 37.03 ? 326 PRO A CA    1 
ATOM   2493 C  C     . PRO A 1 329 ? 70.321  65.591 13.327  1.00 32.64 ? 326 PRO A C     1 
ATOM   2494 O  O     . PRO A 1 329 ? 71.232  66.423 13.282  1.00 30.72 ? 326 PRO A O     1 
ATOM   2495 C  CB    . PRO A 1 329 ? 70.911  63.155 13.084  1.00 40.06 ? 326 PRO A CB    1 
ATOM   2496 C  CG    . PRO A 1 329 ? 72.342  63.172 12.626  1.00 37.87 ? 326 PRO A CG    1 
ATOM   2497 C  CD    . PRO A 1 329 ? 72.312  63.715 11.222  1.00 34.08 ? 326 PRO A CD    1 
ATOM   2498 N  N     . GLY A 1 330 ? 69.292  65.664 14.170  1.00 38.86 ? 327 GLY A N     1 
ATOM   2499 C  CA    . GLY A 1 330 ? 69.266  66.614 15.272  1.00 42.96 ? 327 GLY A CA    1 
ATOM   2500 C  C     . GLY A 1 330 ? 69.400  68.047 14.807  1.00 37.73 ? 327 GLY A C     1 
ATOM   2501 O  O     . GLY A 1 330 ? 68.710  68.502 13.885  1.00 32.88 ? 327 GLY A O     1 
ATOM   2502 N  N     . LYS A 1 331 ? 70.321  68.768 15.448  1.00 37.87 ? 328 LYS A N     1 
ATOM   2503 C  CA    . LYS A 1 331 ? 70.575  70.165 15.132  1.00 38.15 ? 328 LYS A CA    1 
ATOM   2504 C  C     . LYS A 1 331 ? 71.264  70.358 13.788  1.00 28.34 ? 328 LYS A C     1 
ATOM   2505 O  O     . LYS A 1 331 ? 71.367  71.497 13.332  1.00 37.38 ? 328 LYS A O     1 
ATOM   2506 C  CB    . LYS A 1 331 ? 71.417  70.809 16.239  1.00 39.45 ? 328 LYS A CB    1 
ATOM   2507 N  N     . THR A 1 332 ? 71.722  69.294 13.138  1.00 30.24 ? 329 THR A N     1 
ATOM   2508 C  CA    . THR A 1 332 ? 72.366  69.435 11.842  1.00 26.38 ? 329 THR A CA    1 
ATOM   2509 C  C     . THR A 1 332 ? 71.377  69.433 10.686  1.00 22.21 ? 329 THR A C     1 
ATOM   2510 O  O     . THR A 1 332 ? 71.807  69.579 9.538   1.00 31.19 ? 329 THR A O     1 
ATOM   2511 C  CB    . THR A 1 332 ? 73.405  68.329 11.615  1.00 32.68 ? 329 THR A CB    1 
ATOM   2512 O  OG1   . THR A 1 332 ? 72.756  67.059 11.495  1.00 28.78 ? 329 THR A OG1   1 
ATOM   2513 C  CG2   . THR A 1 332 ? 74.400  68.283 12.768  1.00 39.73 ? 329 THR A CG2   1 
ATOM   2514 N  N     . ALA A 1 333 ? 70.081  69.280 10.960  1.00 27.45 ? 330 ALA A N     1 
ATOM   2515 C  CA    . ALA A 1 333 ? 69.075  69.253 9.901   1.00 29.02 ? 330 ALA A CA    1 
ATOM   2516 C  C     . ALA A 1 333 ? 69.196  70.486 9.015   1.00 30.50 ? 330 ALA A C     1 
ATOM   2517 O  O     . ALA A 1 333 ? 69.483  71.585 9.495   1.00 34.05 ? 330 ALA A O     1 
ATOM   2518 C  CB    . ALA A 1 333 ? 67.673  69.168 10.508  1.00 27.36 ? 330 ALA A CB    1 
ATOM   2519 N  N     . LEU A 1 334 ? 68.998  70.302 7.712   1.00 24.14 ? 331 LEU A N     1 
ATOM   2520 C  CA    . LEU A 1 334 ? 69.223  71.399 6.778   1.00 22.02 ? 331 LEU A CA    1 
ATOM   2521 C  C     . LEU A 1 334 ? 68.035  72.353 6.802   1.00 23.88 ? 331 LEU A C     1 
ATOM   2522 O  O     . LEU A 1 334 ? 66.898  71.942 6.568   1.00 29.47 ? 331 LEU A O     1 
ATOM   2523 C  CB    . LEU A 1 334 ? 69.449  70.879 5.362   1.00 27.39 ? 331 LEU A CB    1 
ATOM   2524 C  CG    . LEU A 1 334 ? 70.499  69.775 5.204   1.00 25.68 ? 331 LEU A CG    1 
ATOM   2525 C  CD1   . LEU A 1 334 ? 70.707  69.479 3.726   1.00 22.10 ? 331 LEU A CD1   1 
ATOM   2526 C  CD2   . LEU A 1 334 ? 71.799  70.178 5.863   1.00 24.62 ? 331 LEU A CD2   1 
ATOM   2527 N  N     . ALA A 1 335 ? 68.312  73.632 7.046   1.00 25.63 ? 332 ALA A N     1 
ATOM   2528 C  CA    . ALA A 1 335 ? 67.269  74.610 7.333   1.00 31.38 ? 332 ALA A CA    1 
ATOM   2529 C  C     . ALA A 1 335 ? 67.359  75.869 6.474   1.00 37.50 ? 332 ALA A C     1 
ATOM   2530 O  O     . ALA A 1 335 ? 66.643  76.840 6.750   1.00 36.88 ? 332 ALA A O     1 
ATOM   2531 C  CB    . ALA A 1 335 ? 67.306  75.000 8.815   1.00 32.11 ? 332 ALA A CB    1 
ATOM   2532 N  N     . THR A 1 336 ? 68.227  75.897 5.462   1.00 24.59 ? 333 THR A N     1 
ATOM   2533 C  CA    . THR A 1 336 ? 68.282  77.013 4.524   1.00 33.08 ? 333 THR A CA    1 
ATOM   2534 C  C     . THR A 1 336 ? 68.390  76.464 3.108   1.00 36.27 ? 333 THR A C     1 
ATOM   2535 O  O     . THR A 1 336 ? 68.907  75.365 2.892   1.00 28.07 ? 333 THR A O     1 
ATOM   2536 C  CB    . THR A 1 336 ? 69.463  77.971 4.792   1.00 31.92 ? 333 THR A CB    1 
ATOM   2537 O  OG1   . THR A 1 336 ? 70.671  77.441 4.232   1.00 28.77 ? 333 THR A OG1   1 
ATOM   2538 C  CG2   . THR A 1 336 ? 69.666  78.221 6.302   1.00 31.91 ? 333 THR A CG2   1 
ATOM   2539 N  N     . ARG A 1 337 ? 67.912  77.250 2.138   1.00 35.84 ? 334 ARG A N     1 
ATOM   2540 C  CA    . ARG A 1 337 ? 67.973  76.821 0.741   1.00 34.90 ? 334 ARG A CA    1 
ATOM   2541 C  C     . ARG A 1 337 ? 69.413  76.608 0.280   1.00 32.71 ? 334 ARG A C     1 
ATOM   2542 O  O     . ARG A 1 337 ? 69.708  75.627 -0.415  1.00 30.28 ? 334 ARG A O     1 
ATOM   2543 C  CB    . ARG A 1 337 ? 67.267  77.839 -0.159  1.00 33.74 ? 334 ARG A CB    1 
ATOM   2544 N  N     . GLU A 1 338 ? 70.325  77.514 0.649   1.00 32.52 ? 335 GLU A N     1 
ATOM   2545 C  CA    . GLU A 1 338 ? 71.732  77.343 0.283   1.00 34.77 ? 335 GLU A CA    1 
ATOM   2546 C  C     . GLU A 1 338 ? 72.290  76.025 0.805   1.00 29.81 ? 335 GLU A C     1 
ATOM   2547 O  O     . GLU A 1 338 ? 73.078  75.360 0.117   1.00 30.43 ? 335 GLU A O     1 
ATOM   2548 C  CB    . GLU A 1 338 ? 72.576  78.501 0.818   1.00 28.08 ? 335 GLU A CB    1 
ATOM   2549 C  CG    . GLU A 1 338 ? 72.449  79.799 0.034   1.00 41.29 ? 335 GLU A CG    1 
ATOM   2550 C  CD    . GLU A 1 338 ? 73.295  79.807 -1.226  1.00 52.85 ? 335 GLU A CD    1 
ATOM   2551 O  OE1   . GLU A 1 338 ? 74.202  78.955 -1.343  0.68 48.04 ? 335 GLU A OE1   1 
ATOM   2552 O  OE2   . GLU A 1 338 ? 73.055  80.669 -2.099  0.47 51.68 ? 335 GLU A OE2   1 
ATOM   2553 N  N     . GLN A 1 339 ? 71.924  75.653 2.034   1.00 29.34 ? 336 GLN A N     1 
ATOM   2554 C  CA    . GLN A 1 339 ? 72.395  74.398 2.620   1.00 29.87 ? 336 GLN A CA    1 
ATOM   2555 C  C     . GLN A 1 339 ? 71.933  73.206 1.803   1.00 30.70 ? 336 GLN A C     1 
ATOM   2556 O  O     . GLN A 1 339 ? 72.730  72.333 1.433   1.00 27.26 ? 336 GLN A O     1 
ATOM   2557 C  CB    . GLN A 1 339 ? 71.868  74.258 4.041   1.00 37.32 ? 336 GLN A CB    1 
ATOM   2558 C  CG    . GLN A 1 339 ? 72.820  74.633 5.110   1.00 35.54 ? 336 GLN A CG    1 
ATOM   2559 C  CD    . GLN A 1 339 ? 72.282  74.251 6.461   1.00 29.10 ? 336 GLN A CD    1 
ATOM   2560 O  OE1   . GLN A 1 339 ? 71.101  74.453 6.762   1.00 27.25 ? 336 GLN A OE1   1 
ATOM   2561 N  NE2   . GLN A 1 339 ? 73.135  73.666 7.278   1.00 27.09 ? 336 GLN A NE2   1 
ATOM   2562 N  N     . VAL A 1 340 ? 70.627  73.137 1.554   1.00 23.79 ? 337 VAL A N     1 
ATOM   2563 C  CA    . VAL A 1 340 ? 70.071  72.058 0.749   1.00 30.73 ? 337 VAL A CA    1 
ATOM   2564 C  C     . VAL A 1 340 ? 70.769  71.997 -0.605  1.00 29.68 ? 337 VAL A C     1 
ATOM   2565 O  O     . VAL A 1 340 ? 71.174  70.923 -1.064  1.00 26.61 ? 337 VAL A O     1 
ATOM   2566 C  CB    . VAL A 1 340 ? 68.545  72.241 0.624   1.00 26.47 ? 337 VAL A CB    1 
ATOM   2567 C  CG1   . VAL A 1 340 ? 67.930  71.185 -0.277  1.00 22.19 ? 337 VAL A CG1   1 
ATOM   2568 C  CG2   . VAL A 1 340 ? 67.893  72.176 2.005   1.00 24.58 ? 337 VAL A CG2   1 
ATOM   2569 N  N     . GLN A 1 341 ? 70.975  73.148 -1.241  1.00 25.31 ? 338 GLN A N     1 
ATOM   2570 C  CA    . GLN A 1 341 ? 71.576  73.137 -2.571  1.00 27.00 ? 338 GLN A CA    1 
ATOM   2571 C  C     . GLN A 1 341 ? 73.036  72.711 -2.529  1.00 26.54 ? 338 GLN A C     1 
ATOM   2572 O  O     . GLN A 1 341 ? 73.503  72.004 -3.428  1.00 23.73 ? 338 GLN A O     1 
ATOM   2573 C  CB    . GLN A 1 341 ? 71.444  74.506 -3.227  1.00 34.37 ? 338 GLN A CB    1 
ATOM   2574 C  CG    . GLN A 1 341 ? 70.030  74.823 -3.646  1.00 25.16 ? 338 GLN A CG    1 
ATOM   2575 C  CD    . GLN A 1 341 ? 69.918  76.175 -4.316  1.00 34.29 ? 338 GLN A CD    1 
ATOM   2576 O  OE1   . GLN A 1 341 ? 70.629  77.112 -3.963  1.00 39.52 ? 338 GLN A OE1   1 
ATOM   2577 N  NE2   . GLN A 1 341 ? 69.032  76.278 -5.293  1.00 41.99 ? 338 GLN A NE2   1 
ATOM   2578 N  N     . TRP A 1 342 ? 73.776  73.127 -1.500  1.00 25.77 ? 339 TRP A N     1 
ATOM   2579 C  CA    . TRP A 1 342 ? 75.174  72.721 -1.405  1.00 27.53 ? 339 TRP A CA    1 
ATOM   2580 C  C     . TRP A 1 342 ? 75.309  71.212 -1.187  1.00 17.57 ? 339 TRP A C     1 
ATOM   2581 O  O     . TRP A 1 342 ? 76.130  70.556 -1.839  1.00 22.73 ? 339 TRP A O     1 
ATOM   2582 C  CB    . TRP A 1 342 ? 75.871  73.502 -0.288  1.00 24.79 ? 339 TRP A CB    1 
ATOM   2583 C  CG    . TRP A 1 342 ? 77.361  73.350 -0.327  1.00 27.76 ? 339 TRP A CG    1 
ATOM   2584 C  CD1   . TRP A 1 342 ? 78.241  74.013 -1.136  1.00 27.25 ? 339 TRP A CD1   1 
ATOM   2585 C  CD2   . TRP A 1 342 ? 78.136  72.468 0.471   1.00 25.16 ? 339 TRP A CD2   1 
ATOM   2586 N  NE1   . TRP A 1 342 ? 79.522  73.595 -0.886  1.00 28.66 ? 339 TRP A NE1   1 
ATOM   2587 C  CE2   . TRP A 1 342 ? 79.487  72.649 0.105   1.00 26.59 ? 339 TRP A CE2   1 
ATOM   2588 C  CE3   . TRP A 1 342 ? 77.821  71.539 1.469   1.00 24.18 ? 339 TRP A CE3   1 
ATOM   2589 C  CZ2   . TRP A 1 342 ? 80.521  71.928 0.695   1.00 31.41 ? 339 TRP A CZ2   1 
ATOM   2590 C  CZ3   . TRP A 1 342 ? 78.841  70.840 2.061   1.00 27.47 ? 339 TRP A CZ3   1 
ATOM   2591 C  CH2   . TRP A 1 342 ? 80.180  71.026 1.666   1.00 30.37 ? 339 TRP A CH2   1 
ATOM   2592 N  N     . TRP A 1 343 ? 74.494  70.639 -0.304  1.00 21.34 ? 340 TRP A N     1 
ATOM   2593 C  CA    . TRP A 1 343 ? 74.585  69.205 -0.036  1.00 20.77 ? 340 TRP A CA    1 
ATOM   2594 C  C     . TRP A 1 343 ? 74.102  68.363 -1.215  1.00 22.41 ? 340 TRP A C     1 
ATOM   2595 O  O     . TRP A 1 343 ? 74.674  67.301 -1.499  1.00 19.19 ? 340 TRP A O     1 
ATOM   2596 C  CB    . TRP A 1 343 ? 73.815  68.876 1.235   1.00 19.13 ? 340 TRP A CB    1 
ATOM   2597 C  CG    . TRP A 1 343 ? 74.656  69.198 2.442   1.00 23.19 ? 340 TRP A CG    1 
ATOM   2598 C  CD1   . TRP A 1 343 ? 74.480  70.222 3.329   1.00 22.33 ? 340 TRP A CD1   1 
ATOM   2599 C  CD2   . TRP A 1 343 ? 75.838  68.496 2.860   1.00 20.75 ? 340 TRP A CD2   1 
ATOM   2600 N  NE1   . TRP A 1 343 ? 75.483  70.191 4.288   1.00 23.35 ? 340 TRP A NE1   1 
ATOM   2601 C  CE2   . TRP A 1 343 ? 76.322  69.138 4.017   1.00 25.50 ? 340 TRP A CE2   1 
ATOM   2602 C  CE3   . TRP A 1 343 ? 76.527  67.375 2.368   1.00 20.35 ? 340 TRP A CE3   1 
ATOM   2603 C  CZ2   . TRP A 1 343 ? 77.461  68.694 4.694   1.00 22.81 ? 340 TRP A CZ2   1 
ATOM   2604 C  CZ3   . TRP A 1 343 ? 77.658  66.939 3.042   1.00 25.50 ? 340 TRP A CZ3   1 
ATOM   2605 C  CH2   . TRP A 1 343 ? 78.114  67.598 4.187   1.00 22.69 ? 340 TRP A CH2   1 
ATOM   2606 N  N     . LEU A 1 344 ? 73.055  68.800 -1.914  1.00 20.15 ? 341 LEU A N     1 
ATOM   2607 C  CA    . LEU A 1 344 ? 72.686  68.095 -3.141  1.00 21.43 ? 341 LEU A CA    1 
ATOM   2608 C  C     . LEU A 1 344 ? 73.836  68.112 -4.134  1.00 25.69 ? 341 LEU A C     1 
ATOM   2609 O  O     . LEU A 1 344 ? 74.094  67.120 -4.826  1.00 22.71 ? 341 LEU A O     1 
ATOM   2610 C  CB    . LEU A 1 344 ? 71.430  68.713 -3.762  1.00 17.41 ? 341 LEU A CB    1 
ATOM   2611 C  CG    . LEU A 1 344 ? 70.088  68.490 -3.061  1.00 18.64 ? 341 LEU A CG    1 
ATOM   2612 C  CD1   . LEU A 1 344 ? 69.007  69.387 -3.715  1.00 27.08 ? 341 LEU A CD1   1 
ATOM   2613 C  CD2   . LEU A 1 344 ? 69.669  67.039 -3.094  1.00 26.58 ? 341 LEU A CD2   1 
ATOM   2614 N  N     . LEU A 1 345 ? 74.568  69.223 -4.201  1.00 19.68 ? 342 LEU A N     1 
ATOM   2615 C  CA    . LEU A 1 345 ? 75.741  69.250 -5.063  1.00 19.85 ? 342 LEU A CA    1 
ATOM   2616 C  C     . LEU A 1 345 ? 76.808  68.265 -4.584  1.00 25.18 ? 342 LEU A C     1 
ATOM   2617 O  O     . LEU A 1 345 ? 77.420  67.566 -5.398  1.00 20.72 ? 342 LEU A O     1 
ATOM   2618 C  CB    . LEU A 1 345 ? 76.305  70.673 -5.137  1.00 22.15 ? 342 LEU A CB    1 
ATOM   2619 C  CG    . LEU A 1 345 ? 77.526  70.805 -6.052  1.00 25.88 ? 342 LEU A CG    1 
ATOM   2620 C  CD1   . LEU A 1 345 ? 77.186  70.368 -7.455  1.00 30.00 ? 342 LEU A CD1   1 
ATOM   2621 C  CD2   . LEU A 1 345 ? 78.088  72.238 -6.053  1.00 24.44 ? 342 LEU A CD2   1 
ATOM   2622 N  N     . GLN A 1 346 ? 77.041  68.187 -3.270  1.00 20.34 ? 343 GLN A N     1 
ATOM   2623 C  CA    . GLN A 1 346 ? 78.047  67.260 -2.761  1.00 19.09 ? 343 GLN A CA    1 
ATOM   2624 C  C     . GLN A 1 346 ? 77.672  65.811 -3.072  1.00 22.08 ? 343 GLN A C     1 
ATOM   2625 O  O     . GLN A 1 346 ? 78.516  65.020 -3.508  1.00 20.83 ? 343 GLN A O     1 
ATOM   2626 C  CB    . GLN A 1 346 ? 78.247  67.444 -1.253  1.00 23.42 ? 343 GLN A CB    1 
ATOM   2627 C  CG    . GLN A 1 346 ? 78.663  68.856 -0.819  1.00 25.13 ? 343 GLN A CG    1 
ATOM   2628 C  CD    . GLN A 1 346 ? 79.685  69.500 -1.737  1.00 25.20 ? 343 GLN A CD    1 
ATOM   2629 O  OE1   . GLN A 1 346 ? 80.844  69.095 -1.793  1.00 26.21 ? 343 GLN A OE1   1 
ATOM   2630 N  NE2   . GLN A 1 346 ? 79.256  70.526 -2.461  1.00 25.87 ? 343 GLN A NE2   1 
ATOM   2631 N  N     . LEU A 1 347 ? 76.413  65.438 -2.829  1.00 20.57 ? 344 LEU A N     1 
ATOM   2632 C  CA    . LEU A 1 347 ? 75.971  64.087 -3.183  1.00 20.12 ? 344 LEU A CA    1 
ATOM   2633 C  C     . LEU A 1 347 ? 76.056  63.845 -4.687  1.00 19.89 ? 344 LEU A C     1 
ATOM   2634 O  O     . LEU A 1 347 ? 76.436  62.755 -5.129  1.00 20.14 ? 344 LEU A O     1 
ATOM   2635 C  CB    . LEU A 1 347 ? 74.539  63.859 -2.702  1.00 17.76 ? 344 LEU A CB    1 
ATOM   2636 C  CG    . LEU A 1 347 ? 74.251  63.886 -1.201  1.00 26.43 ? 344 LEU A CG    1 
ATOM   2637 C  CD1   . LEU A 1 347 ? 72.815  63.421 -0.940  1.00 24.14 ? 344 LEU A CD1   1 
ATOM   2638 C  CD2   . LEU A 1 347 ? 75.205  63.018 -0.444  1.00 32.64 ? 344 LEU A CD2   1 
ATOM   2639 N  N     . ALA A 1 348 ? 75.676  64.843 -5.490  1.00 19.48 ? 345 ALA A N     1 
ATOM   2640 C  CA    . ALA A 1 348 ? 75.680  64.679 -6.936  1.00 21.55 ? 345 ALA A CA    1 
ATOM   2641 C  C     . ALA A 1 348 ? 77.089  64.522 -7.483  1.00 20.78 ? 345 ALA A C     1 
ATOM   2642 O  O     . ALA A 1 348 ? 77.288  63.806 -8.471  1.00 18.79 ? 345 ALA A O     1 
ATOM   2643 C  CB    . ALA A 1 348 ? 74.974  65.870 -7.601  1.00 20.65 ? 345 ALA A CB    1 
ATOM   2644 N  N     . GLN A 1 349 ? 78.078  65.179 -6.865  1.00 18.76 ? 346 GLN A N     1 
ATOM   2645 C  CA    . GLN A 1 349 ? 79.460  64.991 -7.288  1.00 22.33 ? 346 GLN A CA    1 
ATOM   2646 C  C     . GLN A 1 349 ? 79.951  63.578 -6.979  1.00 22.95 ? 346 GLN A C     1 
ATOM   2647 O  O     . GLN A 1 349 ? 80.640  62.965 -7.798  1.00 20.14 ? 346 GLN A O     1 
ATOM   2648 C  CB    . GLN A 1 349 ? 80.355  66.042 -6.625  1.00 23.11 ? 346 GLN A CB    1 
ATOM   2649 C  CG    . GLN A 1 349 ? 80.000  67.466 -7.004  1.00 29.59 ? 346 GLN A CG    1 
ATOM   2650 C  CD    . GLN A 1 349 ? 80.898  68.488 -6.353  1.00 34.64 ? 346 GLN A CD    1 
ATOM   2651 O  OE1   . GLN A 1 349 ? 81.422  68.262 -5.260  1.00 44.90 ? 346 GLN A OE1   1 
ATOM   2652 N  NE2   . GLN A 1 349 ? 81.072  69.632 -7.013  1.00 36.83 ? 346 GLN A NE2   1 
ATOM   2653 N  N     . GLU A 1 350 ? 79.624  63.049 -5.799  1.00 20.36 ? 347 GLU A N     1 
ATOM   2654 C  CA    . GLU A 1 350 ? 80.030  61.685 -5.490  1.00 23.76 ? 347 GLU A CA    1 
ATOM   2655 C  C     . GLU A 1 350 ? 79.325  60.693 -6.405  1.00 16.72 ? 347 GLU A C     1 
ATOM   2656 O  O     . GLU A 1 350 ? 79.920  59.696 -6.828  1.00 19.82 ? 347 GLU A O     1 
ATOM   2657 C  CB    . GLU A 1 350 ? 79.738  61.367 -4.022  1.00 24.87 ? 347 GLU A CB    1 
ATOM   2658 C  CG    . GLU A 1 350 ? 80.461  62.277 -3.022  1.00 34.45 ? 347 GLU A CG    1 
ATOM   2659 C  CD    . GLU A 1 350 ? 81.902  61.856 -2.758  1.00 41.28 ? 347 GLU A CD    1 
ATOM   2660 O  OE1   . GLU A 1 350 ? 82.112  60.767 -2.177  1.00 41.45 ? 347 GLU A OE1   1 
ATOM   2661 O  OE2   . GLU A 1 350 ? 82.822  62.619 -3.129  1.00 38.43 ? 347 GLU A OE2   1 
ATOM   2662 N  N     . LEU A 1 351 ? 78.051  60.954 -6.713  1.00 19.23 ? 348 LEU A N     1 
ATOM   2663 C  CA    . LEU A 1 351 ? 77.275  60.066 -7.579  1.00 17.81 ? 348 LEU A CA    1 
ATOM   2664 C  C     . LEU A 1 351 ? 77.812  60.074 -9.004  1.00 23.43 ? 348 LEU A C     1 
ATOM   2665 O  O     . LEU A 1 351 ? 77.968  59.016 -9.625  1.00 21.31 ? 348 LEU A O     1 
ATOM   2666 C  CB    . LEU A 1 351 ? 75.809  60.492 -7.563  1.00 17.82 ? 348 LEU A CB    1 
ATOM   2667 C  CG    . LEU A 1 351 ? 74.878  59.606 -8.401  1.00 17.46 ? 348 LEU A CG    1 
ATOM   2668 C  CD1   . LEU A 1 351 ? 75.019  58.152 -7.917  1.00 22.14 ? 348 LEU A CD1   1 
ATOM   2669 C  CD2   . LEU A 1 351 ? 73.437  60.082 -8.353  1.00 22.41 ? 348 LEU A CD2   1 
ATOM   2670 N  N     . GLU A 1 352 ? 78.065  61.269 -9.549  1.00 21.15 ? 349 GLU A N     1 
ATOM   2671 C  CA    . GLU A 1 352 ? 78.678  61.376 -10.871 1.00 21.76 ? 349 GLU A CA    1 
ATOM   2672 C  C     . GLU A 1 352 ? 79.954  60.555 -10.966 1.00 19.61 ? 349 GLU A C     1 
ATOM   2673 O  O     . GLU A 1 352 ? 80.174  59.856 -11.965 1.00 21.77 ? 349 GLU A O     1 
ATOM   2674 C  CB    . GLU A 1 352 ? 78.977  62.840 -11.213 1.00 23.29 ? 349 GLU A CB    1 
ATOM   2675 C  CG    . GLU A 1 352 ? 79.790  62.975 -12.502 1.00 28.48 ? 349 GLU A CG    1 
ATOM   2676 C  CD    . GLU A 1 352 ? 80.386  64.361 -12.710 1.00 39.20 ? 349 GLU A CD    1 
ATOM   2677 O  OE1   . GLU A 1 352 ? 79.832  65.351 -12.179 0.59 33.27 ? 349 GLU A OE1   1 
ATOM   2678 O  OE2   . GLU A 1 352 ? 81.415  64.457 -13.414 0.34 33.59 ? 349 GLU A OE2   1 
ATOM   2679 N  N     . GLU A 1 353 ? 80.809  60.624 -9.935  1.00 22.13 ? 350 GLU A N     1 
ATOM   2680 C  CA    . GLU A 1 353 ? 82.054  59.854 -9.938  1.00 19.46 ? 350 GLU A CA    1 
ATOM   2681 C  C     . GLU A 1 353 ? 81.776  58.358 -10.055 1.00 24.12 ? 350 GLU A C     1 
ATOM   2682 O  O     . GLU A 1 353 ? 82.405  57.663 -10.857 1.00 22.40 ? 350 GLU A O     1 
ATOM   2683 C  CB    . GLU A 1 353 ? 82.861  60.146 -8.671  1.00 23.48 ? 350 GLU A CB    1 
ATOM   2684 N  N     . ARG A 1 354 ? 80.847  57.842 -9.241  1.00 22.50 ? 351 ARG A N     1 
ATOM   2685 C  CA    . ARG A 1 354 ? 80.515  56.419 -9.301  1.00 21.63 ? 351 ARG A CA    1 
ATOM   2686 C  C     . ARG A 1 354 ? 79.871  56.057 -10.630 1.00 21.86 ? 351 ARG A C     1 
ATOM   2687 O  O     . ARG A 1 354 ? 80.123  54.973 -11.171 1.00 22.05 ? 351 ARG A O     1 
ATOM   2688 C  CB    . ARG A 1 354 ? 79.564  56.030 -8.161  1.00 19.71 ? 351 ARG A CB    1 
ATOM   2689 C  CG    . ARG A 1 354 ? 80.170  55.880 -6.793  1.00 25.88 ? 351 ARG A CG    1 
ATOM   2690 C  CD    . ARG A 1 354 ? 79.151  55.182 -5.851  1.00 23.55 ? 351 ARG A CD    1 
ATOM   2691 N  NE    . ARG A 1 354 ? 78.880  53.788 -6.207  1.00 28.59 ? 351 ARG A NE    1 
ATOM   2692 C  CZ    . ARG A 1 354 ? 77.912  53.053 -5.659  1.00 26.57 ? 351 ARG A CZ    1 
ATOM   2693 N  NH1   . ARG A 1 354 ? 77.112  53.580 -4.742  1.00 25.34 ? 351 ARG A NH1   1 
ATOM   2694 N  NH2   . ARG A 1 354 ? 77.737  51.797 -6.026  1.00 29.51 ? 351 ARG A NH2   1 
ATOM   2695 N  N     . LEU A 1 355 ? 78.991  56.925 -11.144 1.00 16.59 ? 352 LEU A N     1 
ATOM   2696 C  CA    . LEU A 1 355 ? 78.305  56.621 -12.395 1.00 17.80 ? 352 LEU A CA    1 
ATOM   2697 C  C     . LEU A 1 355 ? 79.280  56.581 -13.558 1.00 22.22 ? 352 LEU A C     1 
ATOM   2698 O  O     . LEU A 1 355 ? 79.162  55.732 -14.453 1.00 22.18 ? 352 LEU A O     1 
ATOM   2699 C  CB    . LEU A 1 355 ? 77.214  57.652 -12.674 1.00 18.63 ? 352 LEU A CB    1 
ATOM   2700 C  CG    . LEU A 1 355 ? 75.998  57.565 -11.765 1.00 23.02 ? 352 LEU A CG    1 
ATOM   2701 C  CD1   . LEU A 1 355 ? 75.040  58.699 -12.063 1.00 19.22 ? 352 LEU A CD1   1 
ATOM   2702 C  CD2   . LEU A 1 355 ? 75.313  56.209 -11.930 1.00 27.51 ? 352 LEU A CD2   1 
ATOM   2703 N  N     . THR A 1 356 ? 80.242  57.505 -13.568 1.00 22.65 ? 353 THR A N     1 
ATOM   2704 C  CA    . THR A 1 356 ? 81.204  57.538 -14.658 1.00 18.52 ? 353 THR A CA    1 
ATOM   2705 C  C     . THR A 1 356 ? 82.050  56.278 -14.665 1.00 22.67 ? 353 THR A C     1 
ATOM   2706 O  O     . THR A 1 356 ? 82.307  55.696 -15.726 1.00 22.98 ? 353 THR A O     1 
ATOM   2707 C  CB    . THR A 1 356 ? 82.081  58.789 -14.541 1.00 24.36 ? 353 THR A CB    1 
ATOM   2708 O  OG1   . THR A 1 356 ? 81.239  59.946 -14.537 1.00 26.90 ? 353 THR A OG1   1 
ATOM   2709 C  CG2   . THR A 1 356 ? 83.026  58.882 -15.719 1.00 26.26 ? 353 THR A CG2   1 
ATOM   2710 N  N     . LYS A 1 357 ? 82.486  55.840 -13.487 1.00 24.43 ? 354 LYS A N     1 
ATOM   2711 C  CA    . LYS A 1 357 ? 83.223  54.589 -13.397 1.00 20.36 ? 354 LYS A CA    1 
ATOM   2712 C  C     . LYS A 1 357 ? 82.345  53.421 -13.808 1.00 23.58 ? 354 LYS A C     1 
ATOM   2713 O  O     . LYS A 1 357 ? 82.789  52.523 -14.535 1.00 27.42 ? 354 LYS A O     1 
ATOM   2714 C  CB    . LYS A 1 357 ? 83.758  54.403 -11.978 1.00 27.87 ? 354 LYS A CB    1 
ATOM   2715 N  N     . ASP A 1 358 ? 81.081  53.438 -13.384 1.00 24.19 ? 355 ASP A N     1 
ATOM   2716 C  CA    . ASP A 1 358 ? 80.159  52.373 -13.758 1.00 26.20 ? 355 ASP A CA    1 
ATOM   2717 C  C     . ASP A 1 358 ? 79.992  52.285 -15.268 1.00 28.35 ? 355 ASP A C     1 
ATOM   2718 O  O     . ASP A 1 358 ? 79.953  51.185 -15.831 1.00 25.88 ? 355 ASP A O     1 
ATOM   2719 C  CB    . ASP A 1 358 ? 78.802  52.592 -13.083 1.00 26.26 ? 355 ASP A CB    1 
ATOM   2720 C  CG    . ASP A 1 358 ? 77.833  51.445 -13.341 1.00 31.83 ? 355 ASP A CG    1 
ATOM   2721 O  OD1   . ASP A 1 358 ? 77.999  50.381 -12.713 1.00 27.85 ? 355 ASP A OD1   1 
ATOM   2722 O  OD2   . ASP A 1 358 ? 76.912  51.609 -14.163 1.00 29.53 ? 355 ASP A OD2   1 
ATOM   2723 N  N     . ARG A 1 359 ? 79.895  53.432 -15.943 1.00 27.93 ? 356 ARG A N     1 
ATOM   2724 C  CA    . ARG A 1 359 ? 79.696  53.418 -17.389 1.00 22.57 ? 356 ARG A CA    1 
ATOM   2725 C  C     . ARG A 1 359 ? 80.930  52.893 -18.118 1.00 23.22 ? 356 ARG A C     1 
ATOM   2726 O  O     . ARG A 1 359 ? 80.805  52.176 -19.113 1.00 26.32 ? 356 ARG A O     1 
ATOM   2727 C  CB    . ARG A 1 359 ? 79.335  54.817 -17.883 1.00 27.71 ? 356 ARG A CB    1 
ATOM   2728 C  CG    . ARG A 1 359 ? 79.015  54.909 -19.370 1.00 30.54 ? 356 ARG A CG    1 
ATOM   2729 C  CD    . ARG A 1 359 ? 78.767  56.360 -19.768 1.00 32.37 ? 356 ARG A CD    1 
ATOM   2730 N  NE    . ARG A 1 359 ? 79.951  57.187 -19.551 1.00 30.35 ? 356 ARG A NE    1 
ATOM   2731 C  CZ    . ARG A 1 359 ? 79.940  58.516 -19.489 1.00 39.57 ? 356 ARG A CZ    1 
ATOM   2732 N  NH1   . ARG A 1 359 ? 78.795  59.182 -19.618 1.00 42.79 ? 356 ARG A NH1   1 
ATOM   2733 N  NH2   . ARG A 1 359 ? 81.075  59.177 -19.296 1.00 31.96 ? 356 ARG A NH2   1 
ATOM   2734 N  N     . ASN A 1 360 ? 82.130  53.232 -17.634 1.00 25.66 ? 357 ASN A N     1 
ATOM   2735 C  CA    . ASN A 1 360 ? 83.353  52.662 -18.200 1.00 24.69 ? 357 ASN A CA    1 
ATOM   2736 C  C     . ASN A 1 360 ? 83.483  51.180 -17.884 1.00 32.52 ? 357 ASN A C     1 
ATOM   2737 O  O     . ASN A 1 360 ? 83.882  50.385 -18.747 1.00 33.52 ? 357 ASN A O     1 
ATOM   2738 C  CB    . ASN A 1 360 ? 84.578  53.383 -17.656 1.00 19.10 ? 357 ASN A CB    1 
ATOM   2739 C  CG    . ASN A 1 360 ? 84.742  54.772 -18.223 1.00 28.87 ? 357 ASN A CG    1 
ATOM   2740 O  OD1   . ASN A 1 360 ? 84.399  55.031 -19.369 1.00 30.03 ? 357 ASN A OD1   1 
ATOM   2741 N  ND2   . ASN A 1 360 ? 85.302  55.665 -17.427 1.00 33.70 ? 357 ASN A ND2   1 
ATOM   2742 N  N     . ASP A 1 361 ? 83.200  50.800 -16.635 1.00 27.90 ? 358 ASP A N     1 
ATOM   2743 C  CA    . ASP A 1 361 ? 83.422  49.424 -16.200 1.00 28.74 ? 358 ASP A CA    1 
ATOM   2744 C  C     . ASP A 1 361 ? 82.401  48.472 -16.800 1.00 28.23 ? 358 ASP A C     1 
ATOM   2745 O  O     . ASP A 1 361 ? 82.752  47.371 -17.240 1.00 28.98 ? 358 ASP A O     1 
ATOM   2746 C  CB    . ASP A 1 361 ? 83.363  49.337 -14.674 1.00 31.56 ? 358 ASP A CB    1 
ATOM   2747 C  CG    . ASP A 1 361 ? 84.594  49.908 -13.999 1.00 44.68 ? 358 ASP A CG    1 
ATOM   2748 O  OD1   . ASP A 1 361 ? 85.554  50.305 -14.708 1.00 39.66 ? 358 ASP A OD1   1 
ATOM   2749 O  OD2   . ASP A 1 361 ? 84.595  49.954 -12.749 1.00 46.31 ? 358 ASP A OD2   1 
ATOM   2750 N  N     . ASN A 1 362 ? 81.130  48.866 -16.822 1.00 25.86 ? 359 ASN A N     1 
ATOM   2751 C  CA    . ASN A 1 362 ? 80.048  47.913 -17.033 1.00 34.63 ? 359 ASN A CA    1 
ATOM   2752 C  C     . ASN A 1 362 ? 79.188  48.228 -18.248 1.00 30.30 ? 359 ASN A C     1 
ATOM   2753 O  O     . ASN A 1 362 ? 78.158  47.583 -18.428 1.00 31.59 ? 359 ASN A O     1 
ATOM   2754 C  CB    . ASN A 1 362 ? 79.174  47.828 -15.775 1.00 29.52 ? 359 ASN A CB    1 
ATOM   2755 C  CG    . ASN A 1 362 ? 79.982  47.471 -14.539 1.00 37.46 ? 359 ASN A CG    1 
ATOM   2756 O  OD1   . ASN A 1 362 ? 80.762  46.521 -14.554 1.00 31.27 ? 359 ASN A OD1   1 
ATOM   2757 N  ND2   . ASN A 1 362 ? 79.813  48.243 -13.470 1.00 28.75 ? 359 ASN A ND2   1 
ATOM   2758 N  N     . ASP A 1 363 ? 79.578  49.193 -19.084 1.00 24.88 ? 360 ASP A N     1 
ATOM   2759 C  CA    . ASP A 1 363 ? 78.923  49.411 -20.379 1.00 22.71 ? 360 ASP A CA    1 
ATOM   2760 C  C     . ASP A 1 363 ? 77.421  49.654 -20.232 1.00 34.92 ? 360 ASP A C     1 
ATOM   2761 O  O     . ASP A 1 363 ? 76.602  49.007 -20.889 1.00 31.27 ? 360 ASP A O     1 
ATOM   2762 C  CB    . ASP A 1 363 ? 79.173  48.231 -21.327 1.00 34.26 ? 360 ASP A CB    1 
ATOM   2763 C  CG    . ASP A 1 363 ? 80.649  48.009 -21.613 1.00 38.13 ? 360 ASP A CG    1 
ATOM   2764 O  OD1   . ASP A 1 363 ? 81.281  48.906 -22.215 1.00 34.34 ? 360 ASP A OD1   1 
ATOM   2765 O  OD2   . ASP A 1 363 ? 81.167  46.936 -21.237 1.00 35.55 ? 360 ASP A OD2   1 
ATOM   2766 N  N     . ARG A 1 364 ? 77.055  50.594 -19.365 1.00 30.94 ? 361 ARG A N     1 
ATOM   2767 C  CA    . ARG A 1 364 ? 75.650  50.947 -19.205 1.00 32.24 ? 361 ARG A CA    1 
ATOM   2768 C  C     . ARG A 1 364 ? 75.543  52.399 -18.760 1.00 32.64 ? 361 ARG A C     1 
ATOM   2769 O  O     . ARG A 1 364 ? 76.505  52.975 -18.239 1.00 28.01 ? 361 ARG A O     1 
ATOM   2770 C  CB    . ARG A 1 364 ? 74.958  50.020 -18.201 1.00 31.52 ? 361 ARG A CB    1 
ATOM   2771 C  CG    . ARG A 1 364 ? 75.642  50.000 -16.837 1.00 32.18 ? 361 ARG A CG    1 
ATOM   2772 C  CD    . ARG A 1 364 ? 74.868  49.154 -15.842 1.00 27.68 ? 361 ARG A CD    1 
ATOM   2773 N  NE    . ARG A 1 364 ? 75.374  49.298 -14.475 1.00 31.98 ? 361 ARG A NE    1 
ATOM   2774 C  CZ    . ARG A 1 364 ? 74.809  48.727 -13.414 1.00 37.67 ? 361 ARG A CZ    1 
ATOM   2775 N  NH1   . ARG A 1 364 ? 73.730  47.974 -13.571 1.00 37.02 ? 361 ARG A NH1   1 
ATOM   2776 N  NH2   . ARG A 1 364 ? 75.320  48.903 -12.200 1.00 31.32 ? 361 ARG A NH2   1 
ATOM   2777 N  N     . VAL A 1 365 ? 74.353  52.978 -18.975 1.00 25.82 ? 362 VAL A N     1 
ATOM   2778 C  CA    . VAL A 1 365 ? 74.023  54.346 -18.574 1.00 27.31 ? 362 VAL A CA    1 
ATOM   2779 C  C     . VAL A 1 365 ? 72.714  54.332 -17.786 1.00 24.91 ? 362 VAL A C     1 
ATOM   2780 O  O     . VAL A 1 365 ? 71.763  53.626 -18.144 1.00 25.99 ? 362 VAL A O     1 
ATOM   2781 C  CB    . VAL A 1 365 ? 73.917  55.295 -19.800 1.00 31.96 ? 362 VAL A CB    1 
ATOM   2782 C  CG1   . VAL A 1 365 ? 72.673  55.013 -20.644 0.89 31.60 ? 362 VAL A CG1   1 
ATOM   2783 C  CG2   . VAL A 1 365 ? 73.919  56.753 -19.365 0.42 25.58 ? 362 VAL A CG2   1 
ATOM   2784 N  N     . ALA A 1 366 ? 72.669  55.105 -16.704 1.00 22.50 ? 363 ALA A N     1 
ATOM   2785 C  CA    . ALA A 1 366 ? 71.423  55.314 -15.976 1.00 23.18 ? 363 ALA A CA    1 
ATOM   2786 C  C     . ALA A 1 366 ? 70.593  56.384 -16.676 1.00 25.86 ? 363 ALA A C     1 
ATOM   2787 O  O     . ALA A 1 366 ? 71.138  57.346 -17.219 1.00 26.67 ? 363 ALA A O     1 
ATOM   2788 C  CB    . ALA A 1 366 ? 71.719  55.729 -14.536 1.00 24.40 ? 363 ALA A CB    1 
ATOM   2789 N  N     . THR A 1 367 ? 69.267  56.222 -16.654 1.00 23.72 ? 364 THR A N     1 
ATOM   2790 C  CA    . THR A 1 367 ? 68.371  57.121 -17.363 1.00 26.87 ? 364 THR A CA    1 
ATOM   2791 C  C     . THR A 1 367 ? 67.370  57.835 -16.468 1.00 25.26 ? 364 THR A C     1 
ATOM   2792 O  O     . THR A 1 367 ? 66.644  58.708 -16.955 1.00 24.55 ? 364 THR A O     1 
ATOM   2793 C  CB    . THR A 1 367 ? 67.596  56.353 -18.450 1.00 29.71 ? 364 THR A CB    1 
ATOM   2794 O  OG1   . THR A 1 367 ? 66.784  55.347 -17.835 1.00 30.09 ? 364 THR A OG1   1 
ATOM   2795 C  CG2   . THR A 1 367 ? 68.560  55.663 -19.396 1.00 31.33 ? 364 THR A CG2   1 
ATOM   2796 N  N     . GLN A 1 368 ? 67.285  57.478 -15.195 1.00 27.65 ? 365 GLN A N     1 
ATOM   2797 C  CA    . GLN A 1 368 ? 66.361  58.106 -14.266 1.00 22.73 ? 365 GLN A CA    1 
ATOM   2798 C  C     . GLN A 1 368 ? 67.118  58.487 -13.002 1.00 24.29 ? 365 GLN A C     1 
ATOM   2799 O  O     . GLN A 1 368 ? 67.991  57.750 -12.550 1.00 24.30 ? 365 GLN A O     1 
ATOM   2800 C  CB    . GLN A 1 368 ? 65.200  57.170 -13.924 1.00 28.84 ? 365 GLN A CB    1 
ATOM   2801 C  CG    . GLN A 1 368 ? 64.175  57.757 -12.966 1.00 30.81 ? 365 GLN A CG    1 
ATOM   2802 C  CD    . GLN A 1 368 ? 62.984  56.847 -12.774 1.00 39.16 ? 365 GLN A CD    1 
ATOM   2803 O  OE1   . GLN A 1 368 ? 63.095  55.784 -12.158 1.00 47.06 ? 365 GLN A OE1   1 
ATOM   2804 N  NE2   . GLN A 1 368 ? 61.834  57.253 -13.308 1.00 40.26 ? 365 GLN A NE2   1 
ATOM   2805 N  N     . LEU A 1 369 ? 66.789  59.648 -12.449 1.00 26.55 ? 366 LEU A N     1 
ATOM   2806 C  CA    . LEU A 1 369 ? 67.321  60.105 -11.173 1.00 24.81 ? 366 LEU A CA    1 
ATOM   2807 C  C     . LEU A 1 369 ? 66.179  60.170 -10.171 1.00 25.66 ? 366 LEU A C     1 
ATOM   2808 O  O     . LEU A 1 369 ? 65.182  60.862 -10.403 1.00 28.29 ? 366 LEU A O     1 
ATOM   2809 C  CB    . LEU A 1 369 ? 67.984  61.477 -11.324 1.00 29.20 ? 366 LEU A CB    1 
ATOM   2810 C  CG    . LEU A 1 369 ? 68.656  62.045 -10.072 1.00 32.31 ? 366 LEU A CG    1 
ATOM   2811 C  CD1   . LEU A 1 369 ? 69.767  61.109 -9.616  1.00 27.16 ? 366 LEU A CD1   1 
ATOM   2812 C  CD2   . LEU A 1 369 ? 69.196  63.440 -10.358 1.00 32.91 ? 366 LEU A CD2   1 
ATOM   2813 N  N     . VAL A 1 370 ? 66.314  59.444 -9.073  1.00 22.57 ? 367 VAL A N     1 
ATOM   2814 C  CA    . VAL A 1 370 ? 65.333  59.456 -7.999  1.00 21.54 ? 367 VAL A CA    1 
ATOM   2815 C  C     . VAL A 1 370 ? 65.879  60.316 -6.873  1.00 29.46 ? 367 VAL A C     1 
ATOM   2816 O  O     . VAL A 1 370 ? 67.034  60.149 -6.462  1.00 24.49 ? 367 VAL A O     1 
ATOM   2817 C  CB    . VAL A 1 370 ? 65.035  58.033 -7.507  1.00 25.08 ? 367 VAL A CB    1 
ATOM   2818 C  CG1   . VAL A 1 370 ? 64.087  58.079 -6.324  1.00 28.08 ? 367 VAL A CG1   1 
ATOM   2819 C  CG2   . VAL A 1 370 ? 64.440  57.218 -8.643  1.00 25.06 ? 367 VAL A CG2   1 
ATOM   2820 N  N     . VAL A 1 371 ? 65.056  61.234 -6.372  1.00 22.94 ? 368 VAL A N     1 
ATOM   2821 C  CA    . VAL A 1 371 ? 65.447  62.139 -5.298  1.00 27.27 ? 368 VAL A CA    1 
ATOM   2822 C  C     . VAL A 1 371 ? 64.528  61.857 -4.125  1.00 25.20 ? 368 VAL A C     1 
ATOM   2823 O  O     . VAL A 1 371 ? 63.299  61.905 -4.270  1.00 30.98 ? 368 VAL A O     1 
ATOM   2824 C  CB    . VAL A 1 371 ? 65.366  63.612 -5.730  1.00 30.76 ? 368 VAL A CB    1 
ATOM   2825 C  CG1   . VAL A 1 371 ? 65.981  64.533 -4.669  1.00 27.78 ? 368 VAL A CG1   1 
ATOM   2826 C  CG2   . VAL A 1 371 ? 66.057  63.801 -7.065  1.00 30.30 ? 368 VAL A CG2   1 
ATOM   2827 N  N     . SER A 1 372 ? 65.114  61.524 -2.980  1.00 24.33 ? 369 SER A N     1 
ATOM   2828 C  CA    . SER A 1 372 ? 64.362  61.200 -1.777  1.00 25.09 ? 369 SER A CA    1 
ATOM   2829 C  C     . SER A 1 372 ? 64.818  62.108 -0.645  1.00 24.51 ? 369 SER A C     1 
ATOM   2830 O  O     . SER A 1 372 ? 66.012  62.374 -0.500  1.00 29.64 ? 369 SER A O     1 
ATOM   2831 C  CB    . SER A 1 372 ? 64.558  59.729 -1.390  1.00 26.93 ? 369 SER A CB    1 
ATOM   2832 O  OG    . SER A 1 372 ? 63.791  59.395 -0.246  1.00 40.04 ? 369 SER A OG    1 
ATOM   2833 N  N     . ILE A 1 373 ? 63.872  62.602 0.150   1.00 19.74 ? 370 ILE A N     1 
ATOM   2834 C  CA    . ILE A 1 373 ? 64.208  63.426 1.302   1.00 24.22 ? 370 ILE A CA    1 
ATOM   2835 C  C     . ILE A 1 373 ? 63.441  62.921 2.517   1.00 32.06 ? 370 ILE A C     1 
ATOM   2836 O  O     . ILE A 1 373 ? 62.401  62.266 2.404   1.00 31.60 ? 370 ILE A O     1 
ATOM   2837 C  CB    . ILE A 1 373 ? 63.907  64.925 1.075   1.00 28.05 ? 370 ILE A CB    1 
ATOM   2838 C  CG1   . ILE A 1 373 ? 62.394  65.173 1.026   1.00 32.16 ? 370 ILE A CG1   1 
ATOM   2839 C  CG2   . ILE A 1 373 ? 64.588  65.440 -0.191  1.00 25.22 ? 370 ILE A CG2   1 
ATOM   2840 C  CD1   . ILE A 1 373 ? 62.052  66.616 0.759   1.00 33.40 ? 370 ILE A CD1   1 
ATOM   2841 N  N     . ARG A 1 374 ? 63.975  63.227 3.693   1.00 25.64 ? 371 ARG A N     1 
ATOM   2842 C  CA    . ARG A 1 374 ? 63.271  63.006 4.945   1.00 30.79 ? 371 ARG A CA    1 
ATOM   2843 C  C     . ARG A 1 374 ? 63.137  64.337 5.668   1.00 34.56 ? 371 ARG A C     1 
ATOM   2844 O  O     . ARG A 1 374 ? 64.062  65.156 5.665   1.00 29.16 ? 371 ARG A O     1 
ATOM   2845 C  CB    . ARG A 1 374 ? 63.982  61.986 5.841   1.00 26.37 ? 371 ARG A CB    1 
ATOM   2846 C  CG    . ARG A 1 374 ? 63.138  61.510 7.021   1.00 32.53 ? 371 ARG A CG    1 
ATOM   2847 C  CD    . ARG A 1 374 ? 63.943  60.574 7.903   1.00 39.49 ? 371 ARG A CD    1 
ATOM   2848 N  NE    . ARG A 1 374 ? 64.736  59.666 7.080   0.84 36.80 ? 371 ARG A NE    1 
ATOM   2849 C  CZ    . ARG A 1 374 ? 65.904  59.145 7.443   0.09 37.05 ? 371 ARG A CZ    1 
ATOM   2850 N  NH1   . ARG A 1 374 ? 66.425  59.440 8.624   1.00 43.22 ? 371 ARG A NH1   1 
ATOM   2851 N  NH2   . ARG A 1 374 ? 66.560  58.337 6.621   0.97 34.30 ? 371 ARG A NH2   1 
ATOM   2852 N  N     . VAL A 1 375 ? 61.977  64.550 6.268   1.00 32.12 ? 372 VAL A N     1 
ATOM   2853 C  CA    . VAL A 1 375 ? 61.656  65.796 6.949   1.00 35.32 ? 372 VAL A CA    1 
ATOM   2854 C  C     . VAL A 1 375 ? 61.707  65.552 8.450   1.00 26.09 ? 372 VAL A C     1 
ATOM   2855 O  O     . VAL A 1 375 ? 61.409  64.453 8.929   1.00 33.17 ? 372 VAL A O     1 
ATOM   2856 C  CB    . VAL A 1 375 ? 60.281  66.308 6.479   1.00 36.02 ? 372 VAL A CB    1 
ATOM   2857 C  CG1   . VAL A 1 375 ? 59.926  67.596 7.156   1.00 45.61 ? 372 VAL A CG1   1 
ATOM   2858 C  CG2   . VAL A 1 375 ? 60.300  66.496 4.965   1.00 39.94 ? 372 VAL A CG2   1 
ATOM   2859 N  N     . GLN A 1 376 ? 62.120  66.573 9.197   1.00 33.62 ? 373 GLN A N     1 
ATOM   2860 C  CA    . GLN A 1 376 ? 62.353  66.403 10.627  1.00 34.43 ? 373 GLN A CA    1 
ATOM   2861 C  C     . GLN A 1 376 ? 61.074  66.000 11.349  1.00 30.87 ? 373 GLN A C     1 
ATOM   2862 O  O     . GLN A 1 376 ? 60.020  66.613 11.163  1.00 40.47 ? 373 GLN A O     1 
ATOM   2863 C  CB    . GLN A 1 376 ? 62.914  67.693 11.223  1.00 34.63 ? 373 GLN A CB    1 
ATOM   2864 C  CG    . GLN A 1 376 ? 63.478  67.517 12.623  1.00 39.97 ? 373 GLN A CG    1 
ATOM   2865 C  CD    . GLN A 1 376 ? 64.640  68.449 12.900  1.00 41.63 ? 373 GLN A CD    1 
ATOM   2866 O  OE1   . GLN A 1 376 ? 64.557  69.649 12.652  1.00 39.63 ? 373 GLN A OE1   1 
ATOM   2867 N  NE2   . GLN A 1 376 ? 65.748  67.891 13.395  1.00 49.80 ? 373 GLN A NE2   1 
ATOM   2868 N  N     . GLY A 1 377 ? 61.180  64.970 12.186  1.00 39.77 ? 374 GLY A N     1 
ATOM   2869 C  CA    . GLY A 1 377 ? 60.053  64.448 12.930  1.00 43.88 ? 374 GLY A CA    1 
ATOM   2870 C  C     . GLY A 1 377 ? 59.314  63.308 12.265  1.00 48.69 ? 374 GLY A C     1 
ATOM   2871 O  O     . GLY A 1 377 ? 58.238  62.928 12.742  1.00 55.71 ? 374 GLY A O     1 
ATOM   2872 N  N     . ASP A 1 378 ? 59.847  62.753 11.182  1.00 43.72 ? 375 ASP A N     1 
ATOM   2873 C  CA    . ASP A 1 378 ? 59.210  61.666 10.449  1.00 39.80 ? 375 ASP A CA    1 
ATOM   2874 C  C     . ASP A 1 378 ? 60.040  60.406 10.665  1.00 51.14 ? 375 ASP A C     1 
ATOM   2875 O  O     . ASP A 1 378 ? 61.224  60.366 10.310  1.00 47.64 ? 375 ASP A O     1 
ATOM   2876 C  CB    . ASP A 1 378 ? 59.090  62.014 8.963   1.00 47.08 ? 375 ASP A CB    1 
ATOM   2877 C  CG    . ASP A 1 378 ? 58.196  61.047 8.187   1.00 50.84 ? 375 ASP A CG    1 
ATOM   2878 O  OD1   . ASP A 1 378 ? 57.913  59.931 8.681   1.00 45.85 ? 375 ASP A OD1   1 
ATOM   2879 O  OD2   . ASP A 1 378 ? 57.789  61.410 7.059   1.00 44.12 ? 375 ASP A OD2   1 
ATOM   2880 N  N     . LYS A 1 379 ? 59.424  59.390 11.268  1.00 52.44 ? 376 LYS A N     1 
ATOM   2881 C  CA    . LYS A 1 379 ? 60.144  58.162 11.581  1.00 60.25 ? 376 LYS A CA    1 
ATOM   2882 C  C     . LYS A 1 379 ? 60.412  57.302 10.351  1.00 59.25 ? 376 LYS A C     1 
ATOM   2883 O  O     . LYS A 1 379 ? 61.128  56.302 10.465  1.00 54.43 ? 376 LYS A O     1 
ATOM   2884 C  CB    . LYS A 1 379 ? 59.365  57.354 12.624  1.00 57.26 ? 376 LYS A CB    1 
ATOM   2885 N  N     . ARG A 1 380 ? 59.871  57.667 9.191   1.00 54.91 ? 377 ARG A N     1 
ATOM   2886 C  CA    . ARG A 1 380 ? 60.042  56.873 7.983   1.00 54.35 ? 377 ARG A CA    1 
ATOM   2887 C  C     . ARG A 1 380 ? 61.433  57.072 7.391   1.00 52.11 ? 377 ARG A C     1 
ATOM   2888 O  O     . ARG A 1 380 ? 62.056  58.124 7.553   1.00 46.82 ? 377 ARG A O     1 
ATOM   2889 C  CB    . ARG A 1 380 ? 58.983  57.242 6.944   1.00 49.69 ? 377 ARG A CB    1 
ATOM   2890 C  CG    . ARG A 1 380 ? 57.550  56.977 7.390   1.00 52.71 ? 377 ARG A CG    1 
ATOM   2891 C  CD    . ARG A 1 380 ? 56.554  57.450 6.343   1.00 56.87 ? 377 ARG A CD    1 
ATOM   2892 N  NE    . ARG A 1 380 ? 56.515  58.907 6.211   1.00 42.40 ? 377 ARG A NE    1 
ATOM   2893 C  CZ    . ARG A 1 380 ? 55.795  59.545 5.293   1.00 44.91 ? 377 ARG A CZ    1 
ATOM   2894 N  NH1   . ARG A 1 380 ? 55.063  58.847 4.432   1.00 44.28 ? 377 ARG A NH1   1 
ATOM   2895 N  NH2   . ARG A 1 380 ? 55.807  60.872 5.226   1.00 36.67 ? 377 ARG A NH2   1 
ATOM   2896 N  N     . LEU A 1 381 ? 61.923  56.037 6.703   1.00 39.51 ? 378 LEU A N     1 
ATOM   2897 C  CA    . LEU A 1 381 ? 63.197  56.162 6.005   1.00 47.41 ? 378 LEU A CA    1 
ATOM   2898 C  C     . LEU A 1 381 ? 63.154  57.303 4.995   1.00 48.76 ? 378 LEU A C     1 
ATOM   2899 O  O     . LEU A 1 381 ? 64.112  58.075 4.872   1.00 44.50 ? 378 LEU A O     1 
ATOM   2900 C  CB    . LEU A 1 381 ? 63.553  54.843 5.315   1.00 52.20 ? 378 LEU A CB    1 
ATOM   2901 N  N     . SER A 1 382 ? 62.045  57.435 4.275   1.00 42.92 ? 379 SER A N     1 
ATOM   2902 C  CA    . SER A 1 382 ? 61.874  58.497 3.297   1.00 45.21 ? 379 SER A CA    1 
ATOM   2903 C  C     . SER A 1 382 ? 60.542  59.180 3.528   1.00 38.10 ? 379 SER A C     1 
ATOM   2904 O  O     . SER A 1 382 ? 59.526  58.515 3.752   1.00 36.81 ? 379 SER A O     1 
ATOM   2905 C  CB    . SER A 1 382 ? 61.922  57.975 1.858   1.00 36.05 ? 379 SER A CB    1 
ATOM   2906 O  OG    . SER A 1 382 ? 61.370  58.944 0.974   1.00 41.48 ? 379 SER A OG    1 
ATOM   2907 N  N     . SER A 1 383 ? 60.559  60.510 3.481   1.00 34.98 ? 380 SER A N     1 
ATOM   2908 C  CA    . SER A 1 383 ? 59.334  61.298 3.531   1.00 28.90 ? 380 SER A CA    1 
ATOM   2909 C  C     . SER A 1 383 ? 58.728  61.507 2.160   1.00 39.85 ? 380 SER A C     1 
ATOM   2910 O  O     . SER A 1 383 ? 57.511  61.701 2.058   1.00 37.83 ? 380 SER A O     1 
ATOM   2911 C  CB    . SER A 1 383 ? 59.595  62.668 4.161   1.00 32.13 ? 380 SER A CB    1 
ATOM   2912 O  OG    . SER A 1 383 ? 59.818  62.558 5.555   1.00 33.79 ? 380 SER A OG    1 
ATOM   2913 N  N     . LEU A 1 384 ? 59.542  61.446 1.107   1.00 35.16 ? 381 LEU A N     1 
ATOM   2914 C  CA    . LEU A 1 384 ? 59.106  61.872 -0.213  1.00 33.29 ? 381 LEU A CA    1 
ATOM   2915 C  C     . LEU A 1 384 ? 60.104  61.400 -1.258  1.00 36.40 ? 381 LEU A C     1 
ATOM   2916 O  O     . LEU A 1 384 ? 61.313  61.514 -1.055  1.00 33.57 ? 381 LEU A O     1 
ATOM   2917 C  CB    . LEU A 1 384 ? 58.977  63.395 -0.262  1.00 28.36 ? 381 LEU A CB    1 
ATOM   2918 C  CG    . LEU A 1 384 ? 58.470  63.963 -1.580  1.00 35.53 ? 381 LEU A CG    1 
ATOM   2919 C  CD1   . LEU A 1 384 ? 57.161  64.710 -1.352  0.57 40.72 ? 381 LEU A CD1   1 
ATOM   2920 C  CD2   . LEU A 1 384 ? 59.502  64.873 -2.211  1.00 37.21 ? 381 LEU A CD2   1 
ATOM   2921 N  N     . ARG A 1 385 ? 59.589  60.879 -2.374  1.00 33.84 ? 382 ARG A N     1 
ATOM   2922 C  CA    . ARG A 1 385 ? 60.400  60.425 -3.498  1.00 30.38 ? 382 ARG A CA    1 
ATOM   2923 C  C     . ARG A 1 385 ? 59.851  61.047 -4.772  1.00 28.14 ? 382 ARG A C     1 
ATOM   2924 O  O     . ARG A 1 385 ? 58.644  60.988 -5.023  1.00 32.56 ? 382 ARG A O     1 
ATOM   2925 C  CB    . ARG A 1 385 ? 60.393  58.894 -3.624  1.00 33.93 ? 382 ARG A CB    1 
ATOM   2926 C  CG    . ARG A 1 385 ? 61.635  58.200 -3.097  1.00 40.51 ? 382 ARG A CG    1 
ATOM   2927 C  CD    . ARG A 1 385 ? 61.394  56.698 -2.839  1.00 40.93 ? 382 ARG A CD    1 
ATOM   2928 N  NE    . ARG A 1 385 ? 60.594  56.445 -1.637  1.00 39.63 ? 382 ARG A NE    1 
ATOM   2929 C  CZ    . ARG A 1 385 ? 60.325  55.233 -1.149  1.00 37.23 ? 382 ARG A CZ    1 
ATOM   2930 N  NH1   . ARG A 1 385 ? 60.781  54.137 -1.756  1.00 30.27 ? 382 ARG A NH1   1 
ATOM   2931 N  NH2   . ARG A 1 385 ? 59.591  55.116 -0.052  1.00 37.83 ? 382 ARG A NH2   1 
ATOM   2932 N  N     . ARG A 1 386 ? 60.729  61.656 -5.563  1.00 22.70 ? 383 ARG A N     1 
ATOM   2933 C  CA    . ARG A 1 386 ? 60.369  62.166 -6.875  1.00 24.02 ? 383 ARG A CA    1 
ATOM   2934 C  C     . ARG A 1 386 ? 61.454  61.767 -7.861  1.00 29.51 ? 383 ARG A C     1 
ATOM   2935 O  O     . ARG A 1 386 ? 62.584  61.478 -7.471  1.00 27.95 ? 383 ARG A O     1 
ATOM   2936 C  CB    . ARG A 1 386 ? 60.189  63.676 -6.847  1.00 25.27 ? 383 ARG A CB    1 
ATOM   2937 C  CG    . ARG A 1 386 ? 59.080  64.163 -5.942  1.00 29.41 ? 383 ARG A CG    1 
ATOM   2938 C  CD    . ARG A 1 386 ? 57.753  63.855 -6.576  1.00 29.19 ? 383 ARG A CD    1 
ATOM   2939 N  NE    . ARG A 1 386 ? 56.635  64.445 -5.853  1.00 25.76 ? 383 ARG A NE    1 
ATOM   2940 C  CZ    . ARG A 1 386 ? 56.005  63.853 -4.844  1.00 36.92 ? 383 ARG A CZ    1 
ATOM   2941 N  NH1   . ARG A 1 386 ? 56.394  62.657 -4.426  1.00 37.40 ? 383 ARG A NH1   1 
ATOM   2942 N  NH2   . ARG A 1 386 ? 54.984  64.461 -4.255  1.00 37.44 ? 383 ARG A NH2   1 
ATOM   2943 N  N     . CYS A 1 387 ? 61.113  61.748 -9.149  1.00 28.34 ? 384 CYS A N     1 
ATOM   2944 C  CA    A CYS A 1 387 ? 62.044  61.323 -10.184 0.57 30.92 ? 384 CYS A CA    1 
ATOM   2945 C  CA    B CYS A 1 387 ? 62.047  61.322 -10.179 0.43 30.93 ? 384 CYS A CA    1 
ATOM   2946 C  C     . CYS A 1 387 ? 62.139  62.374 -11.275 1.00 31.52 ? 384 CYS A C     1 
ATOM   2947 O  O     . CYS A 1 387 ? 61.264  63.226 -11.428 1.00 34.61 ? 384 CYS A O     1 
ATOM   2948 C  CB    A CYS A 1 387 ? 61.627  59.985 -10.803 0.57 34.26 ? 384 CYS A CB    1 
ATOM   2949 C  CB    B CYS A 1 387 ? 61.651  59.956 -10.780 0.43 34.23 ? 384 CYS A CB    1 
ATOM   2950 S  SG    A CYS A 1 387 ? 61.097  58.799 -9.587  0.57 36.34 ? 384 CYS A SG    1 
ATOM   2951 S  SG    B CYS A 1 387 ? 59.996  59.865 -11.519 0.43 41.38 ? 384 CYS A SG    1 
ATOM   2952 N  N     . CYS A 1 388 ? 63.222  62.304 -12.036 1.00 29.87 ? 385 CYS A N     1 
ATOM   2953 C  CA    . CYS A 1 388 ? 63.379  63.150 -13.206 1.00 34.26 ? 385 CYS A CA    1 
ATOM   2954 C  C     . CYS A 1 388 ? 64.337  62.456 -14.160 1.00 33.35 ? 385 CYS A C     1 
ATOM   2955 O  O     . CYS A 1 388 ? 64.993  61.467 -13.811 1.00 31.79 ? 385 CYS A O     1 
ATOM   2956 C  CB    . CYS A 1 388 ? 63.868  64.555 -12.830 1.00 34.65 ? 385 CYS A CB    1 
ATOM   2957 S  SG    . CYS A 1 388 ? 65.523  64.634 -12.128 1.00 38.68 ? 385 CYS A SG    1 
ATOM   2958 N  N     . ALA A 1 389 ? 64.404  62.976 -15.381 1.00 31.19 ? 386 ALA A N     1 
ATOM   2959 C  CA    . ALA A 1 389 ? 65.273  62.385 -16.386 1.00 35.54 ? 386 ALA A CA    1 
ATOM   2960 C  C     . ALA A 1 389 ? 66.736  62.575 -16.004 1.00 34.13 ? 386 ALA A C     1 
ATOM   2961 O  O     . ALA A 1 389 ? 67.141  63.640 -15.529 1.00 34.90 ? 386 ALA A O     1 
ATOM   2962 C  CB    . ALA A 1 389 ? 65.000  63.003 -17.757 1.00 35.25 ? 386 ALA A CB    1 
ATOM   2963 N  N     . LEU A 1 390 ? 67.524  61.529 -16.206 1.00 27.45 ? 387 LEU A N     1 
ATOM   2964 C  CA    . LEU A 1 390 ? 68.975  61.572 -16.044 1.00 34.24 ? 387 LEU A CA    1 
ATOM   2965 C  C     . LEU A 1 390 ? 69.580  61.447 -17.440 1.00 33.34 ? 387 LEU A C     1 
ATOM   2966 O  O     . LEU A 1 390 ? 69.664  60.345 -17.992 1.00 36.87 ? 387 LEU A O     1 
ATOM   2967 C  CB    . LEU A 1 390 ? 69.445  60.460 -15.108 1.00 27.07 ? 387 LEU A CB    1 
ATOM   2968 C  CG    . LEU A 1 390 ? 70.923  60.478 -14.727 1.00 34.05 ? 387 LEU A CG    1 
ATOM   2969 C  CD1   . LEU A 1 390 ? 71.269  61.855 -14.246 1.00 35.76 ? 387 LEU A CD1   1 
ATOM   2970 C  CD2   . LEU A 1 390 ? 71.229  59.444 -13.646 1.00 25.62 ? 387 LEU A CD2   1 
ATOM   2971 N  N     . THR A 1 391 ? 69.983  62.579 -18.018 1.00 33.71 ? 388 THR A N     1 
ATOM   2972 C  CA    . THR A 1 391 ? 70.461  62.620 -19.397 1.00 30.77 ? 388 THR A CA    1 
ATOM   2973 C  C     . THR A 1 391 ? 71.950  62.883 -19.526 1.00 37.08 ? 388 THR A C     1 
ATOM   2974 O  O     . THR A 1 391 ? 72.569  62.387 -20.469 1.00 48.33 ? 388 THR A O     1 
ATOM   2975 C  CB    . THR A 1 391 ? 69.709  63.694 -20.200 1.00 37.57 ? 388 THR A CB    1 
ATOM   2976 O  OG1   . THR A 1 391 ? 69.975  64.991 -19.648 1.00 39.27 ? 388 THR A OG1   1 
ATOM   2977 C  CG2   . THR A 1 391 ? 68.211  63.435 -20.181 1.00 36.57 ? 388 THR A CG2   1 
ATOM   2978 N  N     . ARG A 1 392 ? 72.536  63.665 -18.623 1.00 34.00 ? 389 ARG A N     1 
ATOM   2979 C  CA    . ARG A 1 392 ? 73.968  63.926 -18.625 1.00 40.67 ? 389 ARG A CA    1 
ATOM   2980 C  C     . ARG A 1 392 ? 74.527  63.592 -17.253 1.00 27.72 ? 389 ARG A C     1 
ATOM   2981 O  O     . ARG A 1 392 ? 73.905  63.889 -16.231 1.00 37.23 ? 389 ARG A O     1 
ATOM   2982 C  CB    . ARG A 1 392 ? 74.293  65.392 -18.976 1.00 41.13 ? 389 ARG A CB    1 
ATOM   2983 C  CG    . ARG A 1 392 ? 74.323  65.694 -20.469 1.00 47.61 ? 389 ARG A CG    1 
ATOM   2984 N  N     . TYR A 1 393 ? 75.688  62.947 -17.243 1.00 25.17 ? 390 TYR A N     1 
ATOM   2985 C  CA    . TYR A 1 393 ? 76.426  62.695 -16.006 1.00 29.65 ? 390 TYR A CA    1 
ATOM   2986 C  C     . TYR A 1 393 ? 77.196  63.957 -15.616 1.00 29.67 ? 390 TYR A C     1 
ATOM   2987 O  O     . TYR A 1 393 ? 78.425  64.029 -15.692 1.00 41.27 ? 390 TYR A O     1 
ATOM   2988 C  CB    . TYR A 1 393 ? 77.381  61.530 -16.186 1.00 31.27 ? 390 TYR A CB    1 
ATOM   2989 C  CG    . TYR A 1 393 ? 76.759  60.154 -16.149 1.00 27.51 ? 390 TYR A CG    1 
ATOM   2990 C  CD1   . TYR A 1 393 ? 75.379  59.977 -16.117 1.00 30.69 ? 390 TYR A CD1   1 
ATOM   2991 C  CD2   . TYR A 1 393 ? 77.573  59.035 -16.120 1.00 25.17 ? 390 TYR A CD2   1 
ATOM   2992 C  CE1   . TYR A 1 393 ? 74.827  58.697 -16.078 1.00 26.37 ? 390 TYR A CE1   1 
ATOM   2993 C  CE2   . TYR A 1 393 ? 77.045  57.769 -16.086 1.00 23.45 ? 390 TYR A CE2   1 
ATOM   2994 C  CZ    . TYR A 1 393 ? 75.674  57.600 -16.057 1.00 23.34 ? 390 TYR A CZ    1 
ATOM   2995 O  OH    . TYR A 1 393 ? 75.176  56.317 -16.008 1.00 25.65 ? 390 TYR A OH    1 
ATOM   2996 N  N     . ASP A 1 394 ? 76.449  64.976 -15.207 1.00 32.03 ? 391 ASP A N     1 
ATOM   2997 C  CA    . ASP A 1 394 ? 77.045  66.216 -14.726 1.00 31.27 ? 391 ASP A CA    1 
ATOM   2998 C  C     . ASP A 1 394 ? 76.450  66.554 -13.372 1.00 26.30 ? 391 ASP A C     1 
ATOM   2999 O  O     . ASP A 1 394 ? 75.232  66.718 -13.258 1.00 26.46 ? 391 ASP A O     1 
ATOM   3000 C  CB    . ASP A 1 394 ? 76.815  67.378 -15.687 1.00 38.71 ? 391 ASP A CB    1 
ATOM   3001 C  CG    . ASP A 1 394 ? 77.280  68.692 -15.093 1.00 31.98 ? 391 ASP A CG    1 
ATOM   3002 O  OD1   . ASP A 1 394 ? 78.510  68.890 -15.004 1.00 47.07 ? 391 ASP A OD1   1 
ATOM   3003 O  OD2   . ASP A 1 394 ? 76.425  69.492 -14.674 1.00 36.78 ? 391 ASP A OD2   1 
ATOM   3004 N  N     . ALA A 1 395 ? 77.314  66.704 -12.361 1.00 23.68 ? 392 ALA A N     1 
ATOM   3005 C  CA    . ALA A 1 395 ? 76.834  66.879 -10.990 1.00 24.90 ? 392 ALA A CA    1 
ATOM   3006 C  C     . ALA A 1 395 ? 76.036  68.170 -10.818 1.00 25.52 ? 392 ALA A C     1 
ATOM   3007 O  O     . ALA A 1 395 ? 75.033  68.190 -10.098 1.00 25.59 ? 392 ALA A O     1 
ATOM   3008 C  CB    . ALA A 1 395 ? 78.011  66.834 -10.017 1.00 23.33 ? 392 ALA A CB    1 
ATOM   3009 N  N     . HIS A 1 396 ? 76.482  69.271 -11.436 1.00 29.49 ? 393 HIS A N     1 
ATOM   3010 C  CA    . HIS A 1 396 ? 75.746  70.530 -11.302 1.00 29.44 ? 393 HIS A CA    1 
ATOM   3011 C  C     . HIS A 1 396 ? 74.338  70.394 -11.876 1.00 22.76 ? 393 HIS A C     1 
ATOM   3012 O  O     . HIS A 1 396 ? 73.365  70.867 -11.278 1.00 28.34 ? 393 HIS A O     1 
ATOM   3013 C  CB    . HIS A 1 396 ? 76.515  71.677 -11.980 1.00 30.23 ? 393 HIS A CB    1 
ATOM   3014 C  CG    . HIS A 1 396 ? 77.698  72.169 -11.187 1.00 31.12 ? 393 HIS A CG    1 
ATOM   3015 N  ND1   . HIS A 1 396 ? 78.960  71.617 -11.292 1.00 39.86 ? 393 HIS A ND1   1 
ATOM   3016 C  CD2   . HIS A 1 396 ? 77.803  73.173 -10.283 1.00 36.70 ? 393 HIS A CD2   1 
ATOM   3017 C  CE1   . HIS A 1 396 ? 79.788  72.258 -10.485 1.00 40.85 ? 393 HIS A CE1   1 
ATOM   3018 N  NE2   . HIS A 1 396 ? 79.111  73.208 -9.863  1.00 48.73 ? 393 HIS A NE2   1 
ATOM   3019 N  N     . LYS A 1 397 ? 74.197  69.680 -12.996 1.00 30.03 ? 394 LYS A N     1 
ATOM   3020 C  CA    . LYS A 1 397 ? 72.874  69.470 -13.577 1.00 29.97 ? 394 LYS A CA    1 
ATOM   3021 C  C     . LYS A 1 397 ? 72.003  68.570 -12.711 1.00 24.36 ? 394 LYS A C     1 
ATOM   3022 O  O     . LYS A 1 397 ? 70.814  68.849 -12.511 1.00 27.31 ? 394 LYS A O     1 
ATOM   3023 C  CB    . LYS A 1 397 ? 73.018  68.868 -14.966 1.00 28.65 ? 394 LYS A CB    1 
ATOM   3024 C  CG    . LYS A 1 397 ? 71.703  68.705 -15.664 1.00 36.91 ? 394 LYS A CG    1 
ATOM   3025 C  CD    . LYS A 1 397 ? 71.865  67.986 -16.996 1.00 30.12 ? 394 LYS A CD    1 
ATOM   3026 C  CE    . LYS A 1 397 ? 70.581  68.142 -17.807 1.00 40.04 ? 394 LYS A CE    1 
ATOM   3027 N  NZ    . LYS A 1 397 ? 69.445  67.628 -16.986 1.00 41.04 ? 394 LYS A NZ    1 
ATOM   3028 N  N     . MET A 1 398 ? 72.569  67.471 -12.214 1.00 25.27 ? 395 MET A N     1 
ATOM   3029 C  CA    . MET A 1 398 ? 71.798  66.557 -11.376 1.00 22.62 ? 395 MET A CA    1 
ATOM   3030 C  C     . MET A 1 398 ? 71.315  67.224 -10.099 1.00 24.23 ? 395 MET A C     1 
ATOM   3031 O  O     . MET A 1 398 ? 70.170  67.012 -9.674  1.00 25.34 ? 395 MET A O     1 
ATOM   3032 C  CB    . MET A 1 398 ? 72.644  65.322 -11.037 1.00 23.44 ? 395 MET A CB    1 
ATOM   3033 C  CG    . MET A 1 398 ? 72.830  64.401 -12.228 1.00 23.44 ? 395 MET A CG    1 
ATOM   3034 S  SD    . MET A 1 398 ? 73.545  62.807 -11.787 1.00 38.56 ? 395 MET A SD    1 
ATOM   3035 C  CE    . MET A 1 398 ? 75.267  63.237 -11.622 1.00 27.73 ? 395 MET A CE    1 
ATOM   3036 N  N     . SER A 1 399 ? 72.183  68.021 -9.458  1.00 24.46 ? 396 SER A N     1 
ATOM   3037 C  CA    . SER A 1 399 ? 71.806  68.682 -8.213  1.00 25.00 ? 396 SER A CA    1 
ATOM   3038 C  C     . SER A 1 399 ? 70.777  69.768 -8.469  1.00 26.19 ? 396 SER A C     1 
ATOM   3039 O  O     . SER A 1 399 ? 69.868  69.971 -7.659  1.00 24.78 ? 396 SER A O     1 
ATOM   3040 C  CB    . SER A 1 399 ? 73.041  69.269 -7.513  1.00 26.27 ? 396 SER A CB    1 
ATOM   3041 O  OG    . SER A 1 399 ? 73.711  70.212 -8.333  1.00 31.93 ? 396 SER A OG    1 
ATOM   3042 N  N     . HIS A 1 400 ? 70.894  70.465 -9.602  1.00 28.07 ? 397 HIS A N     1 
ATOM   3043 C  CA    . HIS A 1 400 ? 69.882  71.457 -9.952  1.00 25.65 ? 397 HIS A CA    1 
ATOM   3044 C  C     . HIS A 1 400 ? 68.542  70.792 -10.255 1.00 25.50 ? 397 HIS A C     1 
ATOM   3045 O  O     . HIS A 1 400 ? 67.487  71.275 -9.823  1.00 31.06 ? 397 HIS A O     1 
ATOM   3046 C  CB    . HIS A 1 400 ? 70.358  72.293 -11.138 1.00 32.05 ? 397 HIS A CB    1 
ATOM   3047 C  CG    . HIS A 1 400 ? 69.336  73.275 -11.620 1.00 42.80 ? 397 HIS A CG    1 
ATOM   3048 N  ND1   . HIS A 1 400 ? 68.372  72.948 -12.551 1.00 44.50 ? 397 HIS A ND1   1 
ATOM   3049 C  CD2   . HIS A 1 400 ? 69.114  74.567 -11.286 1.00 36.68 ? 397 HIS A CD2   1 
ATOM   3050 C  CE1   . HIS A 1 400 ? 67.602  73.999 -12.771 1.00 42.19 ? 397 HIS A CE1   1 
ATOM   3051 N  NE2   . HIS A 1 400 ? 68.031  74.994 -12.016 1.00 44.62 ? 397 HIS A NE2   1 
ATOM   3052 N  N     . ASP A 1 401 ? 68.571  69.672 -10.983 1.00 29.82 ? 398 ASP A N     1 
ATOM   3053 C  CA    . ASP A 1 401 ? 67.350  68.937 -11.294 1.00 28.63 ? 398 ASP A CA    1 
ATOM   3054 C  C     . ASP A 1 401 ? 66.701  68.391 -10.031 1.00 31.41 ? 398 ASP A C     1 
ATOM   3055 O  O     . ASP A 1 401 ? 65.473  68.425 -9.878  1.00 29.15 ? 398 ASP A O     1 
ATOM   3056 C  CB    . ASP A 1 401 ? 67.666  67.804 -12.273 1.00 30.06 ? 398 ASP A CB    1 
ATOM   3057 C  CG    . ASP A 1 401 ? 68.016  68.318 -13.662 1.00 32.67 ? 398 ASP A CG    1 
ATOM   3058 O  OD1   . ASP A 1 401 ? 67.767  69.515 -13.946 1.00 35.65 ? 398 ASP A OD1   1 
ATOM   3059 O  OD2   . ASP A 1 401 ? 68.538  67.531 -14.478 1.00 36.00 ? 398 ASP A OD2   1 
ATOM   3060 N  N     . ALA A 1 402 ? 67.518  67.871 -9.119  1.00 27.24 ? 399 ALA A N     1 
ATOM   3061 C  CA    . ALA A 1 402 ? 66.996  67.361 -7.860  1.00 23.70 ? 399 ALA A CA    1 
ATOM   3062 C  C     . ALA A 1 402 ? 66.343  68.463 -7.048  1.00 23.26 ? 399 ALA A C     1 
ATOM   3063 O  O     . ALA A 1 402 ? 65.292  68.255 -6.429  1.00 27.13 ? 399 ALA A O     1 
ATOM   3064 C  CB    . ALA A 1 402 ? 68.134  66.724 -7.062  1.00 27.50 ? 399 ALA A CB    1 
ATOM   3065 N  N     . PHE A 1 403 ? 66.972  69.632 -7.003  1.00 26.90 ? 400 PHE A N     1 
ATOM   3066 C  CA    . PHE A 1 403 ? 66.368  70.746 -6.295  1.00 28.01 ? 400 PHE A CA    1 
ATOM   3067 C  C     . PHE A 1 403 ? 65.028  71.108 -6.919  1.00 26.14 ? 400 PHE A C     1 
ATOM   3068 O  O     . PHE A 1 403 ? 64.011  71.196 -6.223  1.00 34.22 ? 400 PHE A O     1 
ATOM   3069 C  CB    . PHE A 1 403 ? 67.310  71.942 -6.299  1.00 30.32 ? 400 PHE A CB    1 
ATOM   3070 C  CG    . PHE A 1 403 ? 66.810  73.088 -5.487  1.00 35.35 ? 400 PHE A CG    1 
ATOM   3071 C  CD1   . PHE A 1 403 ? 66.884  73.051 -4.106  1.00 40.19 ? 400 PHE A CD1   1 
ATOM   3072 C  CD2   . PHE A 1 403 ? 66.234  74.188 -6.098  1.00 39.27 ? 400 PHE A CD2   1 
ATOM   3073 C  CE1   . PHE A 1 403 ? 66.407  74.106 -3.343  1.00 44.53 ? 400 PHE A CE1   1 
ATOM   3074 C  CE2   . PHE A 1 403 ? 65.761  75.243 -5.344  1.00 50.58 ? 400 PHE A CE2   1 
ATOM   3075 C  CZ    . PHE A 1 403 ? 65.846  75.200 -3.965  1.00 46.84 ? 400 PHE A CZ    1 
ATOM   3076 N  N     . THR A 1 404 ? 65.013  71.294 -8.243  1.00 33.37 ? 401 THR A N     1 
ATOM   3077 C  CA    . THR A 1 404 ? 63.784  71.659 -8.943  1.00 37.81 ? 401 THR A CA    1 
ATOM   3078 C  C     . THR A 1 404 ? 62.658  70.704 -8.595  1.00 35.45 ? 401 THR A C     1 
ATOM   3079 O  O     . THR A 1 404 ? 61.509  71.111 -8.396  1.00 35.30 ? 401 THR A O     1 
ATOM   3080 C  CB    . THR A 1 404 ? 64.020  71.655 -10.454 1.00 31.49 ? 401 THR A CB    1 
ATOM   3081 O  OG1   . THR A 1 404 ? 65.064  72.578 -10.789 1.00 39.42 ? 401 THR A OG1   1 
ATOM   3082 C  CG2   . THR A 1 404 ? 62.741  72.036 -11.201 1.00 44.49 ? 401 THR A CG2   1 
ATOM   3083 N  N     . VAL A 1 405 ? 62.988  69.423 -8.474  1.00 35.17 ? 402 VAL A N     1 
ATOM   3084 C  CA    . VAL A 1 405 ? 62.003  68.396 -8.235  1.00 31.63 ? 402 VAL A CA    1 
ATOM   3085 C  C     . VAL A 1 405 ? 61.480  68.398 -6.796  1.00 35.07 ? 402 VAL A C     1 
ATOM   3086 O  O     . VAL A 1 405 ? 60.340  67.976 -6.558  1.00 35.26 ? 402 VAL A O     1 
ATOM   3087 C  CB    . VAL A 1 405 ? 62.666  67.080 -8.687  1.00 38.79 ? 402 VAL A CB    1 
ATOM   3088 C  CG1   . VAL A 1 405 ? 62.147  65.962 -8.001  1.00 36.94 ? 402 VAL A CG1   1 
ATOM   3089 C  CG2   . VAL A 1 405 ? 62.487  66.888 -10.141 1.00 38.88 ? 402 VAL A CG2   1 
ATOM   3090 N  N     . ILE A 1 406 ? 62.246  68.912 -5.830  1.00 29.53 ? 403 ILE A N     1 
ATOM   3091 C  CA    . ILE A 1 406 ? 61.797  68.959 -4.440  1.00 29.02 ? 403 ILE A CA    1 
ATOM   3092 C  C     . ILE A 1 406 ? 61.504  70.372 -3.939  1.00 32.42 ? 403 ILE A C     1 
ATOM   3093 O  O     . ILE A 1 406 ? 61.026  70.509 -2.799  1.00 32.40 ? 403 ILE A O     1 
ATOM   3094 C  CB    . ILE A 1 406 ? 62.808  68.280 -3.489  1.00 33.33 ? 403 ILE A CB    1 
ATOM   3095 C  CG1   . ILE A 1 406 ? 64.095  69.098 -3.427  1.00 28.80 ? 403 ILE A CG1   1 
ATOM   3096 C  CG2   . ILE A 1 406 ? 63.071  66.837 -3.919  1.00 34.43 ? 403 ILE A CG2   1 
ATOM   3097 C  CD1   . ILE A 1 406 ? 65.045  68.678 -2.318  1.00 34.97 ? 403 ILE A CD1   1 
ATOM   3098 N  N     . LYS A 1 407 ? 61.783  71.414 -4.738  1.00 36.16 ? 404 LYS A N     1 
ATOM   3099 C  CA    . LYS A 1 407 ? 61.557  72.818 -4.367  1.00 40.35 ? 404 LYS A CA    1 
ATOM   3100 C  C     . LYS A 1 407 ? 60.300  73.070 -3.542  1.00 38.84 ? 404 LYS A C     1 
ATOM   3101 O  O     . LYS A 1 407 ? 60.335  73.776 -2.529  1.00 46.66 ? 404 LYS A O     1 
ATOM   3102 C  CB    . LYS A 1 407 ? 61.459  73.685 -5.631  1.00 43.21 ? 404 LYS A CB    1 
ATOM   3103 C  CG    . LYS A 1 407 ? 62.747  74.020 -6.302  1.00 45.84 ? 404 LYS A CG    1 
ATOM   3104 C  CD    . LYS A 1 407 ? 62.542  75.016 -7.436  1.00 41.77 ? 404 LYS A CD    1 
ATOM   3105 C  CE    . LYS A 1 407 ? 61.574  74.489 -8.478  1.00 51.43 ? 404 LYS A CE    1 
ATOM   3106 N  NZ    . LYS A 1 407 ? 61.570  75.355 -9.690  0.71 50.07 ? 404 LYS A NZ    1 
ATOM   3107 N  N     . ASN A 1 408 ? 59.168  72.550 -3.993  1.00 44.40 ? 405 ASN A N     1 
ATOM   3108 C  CA    . ASN A 1 408 ? 57.882  72.958 -3.450  1.00 44.44 ? 405 ASN A CA    1 
ATOM   3109 C  C     . ASN A 1 408 ? 57.476  72.165 -2.216  1.00 47.16 ? 405 ASN A C     1 
ATOM   3110 O  O     . ASN A 1 408 ? 56.414  72.435 -1.647  1.00 51.76 ? 405 ASN A O     1 
ATOM   3111 C  CB    . ASN A 1 408 ? 56.810  72.862 -4.539  1.00 43.11 ? 405 ASN A CB    1 
ATOM   3112 C  CG    . ASN A 1 408 ? 57.087  73.803 -5.701  0.80 36.32 ? 405 ASN A CG    1 
ATOM   3113 O  OD1   . ASN A 1 408 ? 57.452  73.371 -6.795  0.67 37.79 ? 405 ASN A OD1   1 
ATOM   3114 N  ND2   . ASN A 1 408 ? 56.926  75.101 -5.463  0.52 42.34 ? 405 ASN A ND2   1 
ATOM   3115 N  N     . CYS A 1 409 ? 58.293  71.207 -1.779  1.00 43.70 ? 406 CYS A N     1 
ATOM   3116 C  CA    . CYS A 1 409 ? 58.119  70.654 -0.443  1.00 45.32 ? 406 CYS A CA    1 
ATOM   3117 C  C     . CYS A 1 409 ? 58.505  71.650 0.636   1.00 43.24 ? 406 CYS A C     1 
ATOM   3118 O  O     . CYS A 1 409 ? 58.224  71.406 1.814   1.00 51.83 ? 406 CYS A O     1 
ATOM   3119 C  CB    . CYS A 1 409 ? 58.947  69.382 -0.280  1.00 44.65 ? 406 CYS A CB    1 
ATOM   3120 S  SG    . CYS A 1 409 ? 58.764  68.242 -1.647  1.00 63.83 ? 406 CYS A SG    1 
ATOM   3121 N  N     . ASN A 1 410 ? 59.145  72.753 0.257   1.00 38.28 ? 407 ASN A N     1 
ATOM   3122 C  CA    . ASN A 1 410 ? 59.532  73.801 1.190   1.00 38.78 ? 407 ASN A CA    1 
ATOM   3123 C  C     . ASN A 1 410 ? 58.316  74.661 1.511   1.00 50.55 ? 407 ASN A C     1 
ATOM   3124 O  O     . ASN A 1 410 ? 57.790  75.360 0.638   1.00 49.71 ? 407 ASN A O     1 
ATOM   3125 C  CB    . ASN A 1 410 ? 60.651  74.645 0.596   1.00 37.27 ? 407 ASN A CB    1 
ATOM   3126 C  CG    . ASN A 1 410 ? 61.115  75.730 1.536   1.00 34.33 ? 407 ASN A CG    1 
ATOM   3127 O  OD1   . ASN A 1 410 ? 60.712  75.772 2.696   1.00 37.88 ? 407 ASN A OD1   1 
ATOM   3128 N  ND2   . ASN A 1 410 ? 61.978  76.609 1.044   1.00 41.52 ? 407 ASN A ND2   1 
ATOM   3129 N  N     . THR A 1 411 ? 57.876  74.621 2.764   1.00 47.05 ? 408 THR A N     1 
ATOM   3130 C  CA    . THR A 1 411 ? 56.831  75.521 3.247   1.00 47.91 ? 408 THR A CA    1 
ATOM   3131 C  C     . THR A 1 411 ? 57.428  76.825 3.768   1.00 53.69 ? 408 THR A C     1 
ATOM   3132 O  O     . THR A 1 411 ? 57.069  77.311 4.839   1.00 66.60 ? 408 THR A O     1 
ATOM   3133 C  CB    . THR A 1 411 ? 56.003  74.826 4.318   1.00 46.59 ? 408 THR A CB    1 
ATOM   3134 O  OG1   . THR A 1 411 ? 56.782  74.684 5.511   1.00 47.61 ? 408 THR A OG1   1 
ATOM   3135 C  CG2   . THR A 1 411 ? 55.579  73.446 3.838   1.00 46.58 ? 408 THR A CG2   1 
ATOM   3136 N  N     . SER A 1 412 ? 58.362  77.380 2.995   1.00 51.64 ? 409 SER A N     1 
ATOM   3137 C  CA    A SER A 1 412 ? 59.023  78.649 3.305   0.75 53.48 ? 409 SER A CA    1 
ATOM   3138 C  CA    B SER A 1 412 ? 59.010  78.654 3.314   0.25 53.31 ? 409 SER A CA    1 
ATOM   3139 C  C     . SER A 1 412 ? 59.637  78.659 4.705   1.00 54.09 ? 409 SER A C     1 
ATOM   3140 O  O     . SER A 1 412 ? 60.504  79.487 5.002   1.00 45.33 ? 409 SER A O     1 
ATOM   3141 C  CB    A SER A 1 412 ? 58.043  79.818 3.154   0.75 46.14 ? 409 SER A CB    1 
ATOM   3142 C  CB    B SER A 1 412 ? 58.015  79.811 3.192   0.25 46.25 ? 409 SER A CB    1 
ATOM   3143 O  OG    A SER A 1 412 ? 57.413  80.126 4.385   0.75 45.74 ? 409 SER A OG    1 
ATOM   3144 O  OG    B SER A 1 412 ? 57.819  80.172 1.838   0.25 49.95 ? 409 SER A OG    1 
ATOM   3145 N  N     . THR A 1 416 ? 64.787  81.933 1.365   1.00 39.58 ? 413 THR A N     1 
ATOM   3146 C  CA    . THR A 1 416 ? 66.069  81.789 2.054   1.00 49.20 ? 413 THR A CA    1 
ATOM   3147 C  C     . THR A 1 416 ? 66.077  80.597 3.018   1.00 44.06 ? 413 THR A C     1 
ATOM   3148 O  O     . THR A 1 416 ? 67.101  79.934 3.182   1.00 41.07 ? 413 THR A O     1 
ATOM   3149 C  CB    . THR A 1 416 ? 66.442  83.075 2.832   1.00 48.48 ? 413 THR A CB    1 
ATOM   3150 O  OG1   . THR A 1 416 ? 67.679  82.881 3.527   1.00 61.28 ? 413 THR A OG1   1 
ATOM   3151 C  CG2   . THR A 1 416 ? 65.360  83.443 3.834   1.00 51.84 ? 413 THR A CG2   1 
ATOM   3152 N  N     . GLU A 1 417 ? 64.935  80.316 3.637   1.00 33.60 ? 414 GLU A N     1 
ATOM   3153 C  CA    . GLU A 1 417 ? 64.820  79.267 4.637   1.00 38.49 ? 414 GLU A CA    1 
ATOM   3154 C  C     . GLU A 1 417 ? 64.162  78.028 4.046   1.00 45.73 ? 414 GLU A C     1 
ATOM   3155 O  O     . GLU A 1 417 ? 63.426  78.092 3.056   1.00 45.72 ? 414 GLU A O     1 
ATOM   3156 C  CB    . GLU A 1 417 ? 64.010  79.747 5.844   1.00 43.01 ? 414 GLU A CB    1 
ATOM   3157 C  CG    . GLU A 1 417 ? 64.527  81.025 6.459   1.00 47.22 ? 414 GLU A CG    1 
ATOM   3158 C  CD    . GLU A 1 417 ? 65.966  80.906 6.907   1.00 42.58 ? 414 GLU A CD    1 
ATOM   3159 O  OE1   . GLU A 1 417 ? 66.294  79.931 7.623   1.00 47.61 ? 414 GLU A OE1   1 
ATOM   3160 O  OE2   . GLU A 1 417 ? 66.772  81.781 6.525   1.00 45.13 ? 414 GLU A OE2   1 
ATOM   3161 N  N     . TRP A 1 418 ? 64.431  76.890 4.679   1.00 33.78 ? 415 TRP A N     1 
ATOM   3162 C  CA    . TRP A 1 418 ? 63.786  75.634 4.335   1.00 32.94 ? 415 TRP A CA    1 
ATOM   3163 C  C     . TRP A 1 418 ? 63.062  75.109 5.563   1.00 39.52 ? 415 TRP A C     1 
ATOM   3164 O  O     . TRP A 1 418 ? 63.688  74.869 6.599   1.00 33.49 ? 415 TRP A O     1 
ATOM   3165 C  CB    . TRP A 1 418 ? 64.799  74.607 3.831   1.00 38.05 ? 415 TRP A CB    1 
ATOM   3166 C  CG    . TRP A 1 418 ? 64.134  73.489 3.150   1.00 30.08 ? 415 TRP A CG    1 
ATOM   3167 C  CD1   . TRP A 1 418 ? 63.468  72.460 3.729   1.00 34.99 ? 415 TRP A CD1   1 
ATOM   3168 C  CD2   . TRP A 1 418 ? 64.035  73.295 1.737   1.00 29.67 ? 415 TRP A CD2   1 
ATOM   3169 N  NE1   . TRP A 1 418 ? 62.956  71.629 2.763   1.00 29.28 ? 415 TRP A NE1   1 
ATOM   3170 C  CE2   . TRP A 1 418 ? 63.301  72.116 1.531   1.00 35.11 ? 415 TRP A CE2   1 
ATOM   3171 C  CE3   . TRP A 1 418 ? 64.506  74.000 0.629   1.00 35.54 ? 415 TRP A CE3   1 
ATOM   3172 C  CZ2   . TRP A 1 418 ? 63.022  71.621 0.253   1.00 32.21 ? 415 TRP A CZ2   1 
ATOM   3173 C  CZ3   . TRP A 1 418 ? 64.232  73.513 -0.633  1.00 36.82 ? 415 TRP A CZ3   1 
ATOM   3174 C  CH2   . TRP A 1 418 ? 63.499  72.335 -0.811  1.00 36.91 ? 415 TRP A CH2   1 
ATOM   3175 N  N     . SER A 1 419 ? 61.750  74.934 5.442   1.00 36.82 ? 416 SER A N     1 
ATOM   3176 C  CA    . SER A 1 419 ? 60.938  74.351 6.498   1.00 37.52 ? 416 SER A CA    1 
ATOM   3177 C  C     . SER A 1 419 ? 60.001  73.318 5.873   1.00 40.46 ? 416 SER A C     1 
ATOM   3178 O  O     . SER A 1 419 ? 59.440  73.557 4.804   1.00 50.16 ? 416 SER A O     1 
ATOM   3179 C  CB    . SER A 1 419 ? 60.137  75.432 7.243   1.00 38.51 ? 416 SER A CB    1 
ATOM   3180 N  N     . PRO A 1 420 ? 59.848  72.160 6.527   1.00 38.36 ? 417 PRO A N     1 
ATOM   3181 C  CA    . PRO A 1 420 ? 60.591  71.867 7.755   1.00 44.94 ? 417 PRO A CA    1 
ATOM   3182 C  C     . PRO A 1 420 ? 61.987  71.373 7.393   1.00 39.02 ? 417 PRO A C     1 
ATOM   3183 O  O     . PRO A 1 420 ? 62.176  70.956 6.252   1.00 43.06 ? 417 PRO A O     1 
ATOM   3184 C  CB    . PRO A 1 420 ? 59.744  70.775 8.429   1.00 44.05 ? 417 PRO A CB    1 
ATOM   3185 C  CG    . PRO A 1 420 ? 58.467  70.665 7.575   1.00 48.78 ? 417 PRO A CG    1 
ATOM   3186 C  CD    . PRO A 1 420 ? 58.898  71.086 6.213   1.00 47.19 ? 417 PRO A CD    1 
ATOM   3187 N  N     . PRO A 1 421 ? 62.942  71.452 8.319   1.00 39.92 ? 418 PRO A N     1 
ATOM   3188 C  CA    . PRO A 1 421 ? 64.320  71.080 7.978   1.00 35.73 ? 418 PRO A CA    1 
ATOM   3189 C  C     . PRO A 1 421 ? 64.412  69.646 7.482   1.00 35.37 ? 418 PRO A C     1 
ATOM   3190 O  O     . PRO A 1 421 ? 63.607  68.782 7.847   1.00 31.88 ? 418 PRO A O     1 
ATOM   3191 C  CB    . PRO A 1 421 ? 65.076  71.268 9.298   1.00 37.65 ? 418 PRO A CB    1 
ATOM   3192 C  CG    . PRO A 1 421 ? 64.272  72.302 10.034  1.00 38.60 ? 418 PRO A CG    1 
ATOM   3193 C  CD    . PRO A 1 421 ? 62.843  72.013 9.678   1.00 37.24 ? 418 PRO A CD    1 
ATOM   3194 N  N     . LEU A 1 422 ? 65.407  69.403 6.624   1.00 29.98 ? 419 LEU A N     1 
ATOM   3195 C  CA    . LEU A 1 422 ? 65.593  68.091 6.019   1.00 29.23 ? 419 LEU A CA    1 
ATOM   3196 C  C     . LEU A 1 422 ? 66.583  67.286 6.846   1.00 30.06 ? 419 LEU A C     1 
ATOM   3197 O  O     . LEU A 1 422 ? 67.687  67.759 7.138   1.00 27.98 ? 419 LEU A O     1 
ATOM   3198 C  CB    . LEU A 1 422 ? 66.092  68.217 4.578   1.00 32.23 ? 419 LEU A CB    1 
ATOM   3199 C  CG    . LEU A 1 422 ? 65.205  69.032 3.635   1.00 29.68 ? 419 LEU A CG    1 
ATOM   3200 C  CD1   . LEU A 1 422 ? 65.788  69.083 2.223   1.00 27.40 ? 419 LEU A CD1   1 
ATOM   3201 C  CD2   . LEU A 1 422 ? 63.800  68.453 3.641   1.00 32.01 ? 419 LEU A CD2   1 
ATOM   3202 N  N     . THR A 1 423 ? 66.184  66.081 7.233   1.00 23.86 ? 420 THR A N     1 
ATOM   3203 C  CA    . THR A 1 423 ? 67.070  65.209 7.980   1.00 24.16 ? 420 THR A CA    1 
ATOM   3204 C  C     . THR A 1 423 ? 67.696  64.121 7.114   1.00 24.75 ? 420 THR A C     1 
ATOM   3205 O  O     . THR A 1 423 ? 68.446  63.293 7.640   1.00 23.51 ? 420 THR A O     1 
ATOM   3206 C  CB    . THR A 1 423 ? 66.326  64.572 9.157   1.00 30.51 ? 420 THR A CB    1 
ATOM   3207 O  OG1   . THR A 1 423 ? 65.176  63.874 8.669   1.00 29.45 ? 420 THR A OG1   1 
ATOM   3208 C  CG2   . THR A 1 423 ? 65.880  65.638 10.150  1.00 33.82 ? 420 THR A CG2   1 
ATOM   3209 N  N     . MET A 1 424 ? 67.410  64.099 5.812   1.00 21.23 ? 421 MET A N     1 
ATOM   3210 C  CA    A MET A 1 424 ? 68.031  63.136 4.910   0.55 20.73 ? 421 MET A CA    1 
ATOM   3211 C  CA    B MET A 1 424 ? 68.039  63.142 4.913   0.45 20.76 ? 421 MET A CA    1 
ATOM   3212 C  C     . MET A 1 424 ? 67.905  63.634 3.478   1.00 22.41 ? 421 MET A C     1 
ATOM   3213 O  O     . MET A 1 424 ? 66.881  64.206 3.106   1.00 23.90 ? 421 MET A O     1 
ATOM   3214 C  CB    A MET A 1 424 ? 67.396  61.743 5.044   0.55 24.94 ? 421 MET A CB    1 
ATOM   3215 C  CB    B MET A 1 424 ? 67.420  61.744 5.062   0.45 24.96 ? 421 MET A CB    1 
ATOM   3216 C  CG    A MET A 1 424 ? 67.965  60.691 4.095   0.55 25.55 ? 421 MET A CG    1 
ATOM   3217 C  CG    B MET A 1 424 ? 68.204  60.631 4.382   0.45 25.95 ? 421 MET A CG    1 
ATOM   3218 S  SD    A MET A 1 424 ? 67.217  60.710 2.451   0.55 27.14 ? 421 MET A SD    1 
ATOM   3219 S  SD    B MET A 1 424 ? 67.186  59.670 3.250   0.45 39.99 ? 421 MET A SD    1 
ATOM   3220 C  CE    A MET A 1 424 ? 65.638  59.925 2.770   0.55 25.71 ? 421 MET A CE    1 
ATOM   3221 C  CE    B MET A 1 424 ? 68.195  58.222 2.975   0.45 33.18 ? 421 MET A CE    1 
ATOM   3222 N  N     . LEU A 1 425 ? 68.954  63.403 2.687   1.00 19.86 ? 422 LEU A N     1 
ATOM   3223 C  CA    . LEU A 1 425 ? 68.985  63.644 1.254   1.00 18.51 ? 422 LEU A CA    1 
ATOM   3224 C  C     . LEU A 1 425 ? 69.464  62.364 0.587   1.00 19.50 ? 422 LEU A C     1 
ATOM   3225 O  O     . LEU A 1 425 ? 70.389  61.721 1.074   1.00 22.02 ? 422 LEU A O     1 
ATOM   3226 C  CB    . LEU A 1 425 ? 69.918  64.803 0.864   1.00 17.33 ? 422 LEU A CB    1 
ATOM   3227 C  CG    . LEU A 1 425 ? 69.512  66.222 1.234   1.00 19.60 ? 422 LEU A CG    1 
ATOM   3228 C  CD1   . LEU A 1 425 ? 70.614  67.185 0.765   1.00 23.94 ? 422 LEU A CD1   1 
ATOM   3229 C  CD2   . LEU A 1 425 ? 68.167  66.599 0.612   1.00 25.80 ? 422 LEU A CD2   1 
ATOM   3230 N  N     . PHE A 1 426 ? 68.847  62.004 -0.534  1.00 22.14 ? 423 PHE A N     1 
ATOM   3231 C  CA    . PHE A 1 426 ? 69.145  60.731 -1.187  1.00 23.89 ? 423 PHE A CA    1 
ATOM   3232 C  C     . PHE A 1 426 ? 69.029  60.947 -2.685  1.00 28.66 ? 423 PHE A C     1 
ATOM   3233 O  O     . PHE A 1 426 ? 67.978  61.392 -3.155  1.00 26.28 ? 423 PHE A O     1 
ATOM   3234 C  CB    . PHE A 1 426 ? 68.153  59.652 -0.718  1.00 30.33 ? 423 PHE A CB    1 
ATOM   3235 C  CG    . PHE A 1 426 ? 68.615  58.224 -0.916  1.00 36.27 ? 423 PHE A CG    1 
ATOM   3236 C  CD1   . PHE A 1 426 ? 69.738  57.913 -1.676  1.00 32.50 ? 423 PHE A CD1   1 
ATOM   3237 C  CD2   . PHE A 1 426 ? 67.902  57.181 -0.337  1.00 38.90 ? 423 PHE A CD2   1 
ATOM   3238 C  CE1   . PHE A 1 426 ? 70.147  56.586 -1.834  1.00 38.40 ? 423 PHE A CE1   1 
ATOM   3239 C  CE2   . PHE A 1 426 ? 68.299  55.861 -0.499  1.00 42.26 ? 423 PHE A CE2   1 
ATOM   3240 C  CZ    . PHE A 1 426 ? 69.421  55.563 -1.253  1.00 43.72 ? 423 PHE A CZ    1 
ATOM   3241 N  N     . LEU A 1 427 ? 70.087  60.640 -3.429  1.00 19.16 ? 424 LEU A N     1 
ATOM   3242 C  CA    . LEU A 1 427 ? 70.052  60.650 -4.887  1.00 19.27 ? 424 LEU A CA    1 
ATOM   3243 C  C     . LEU A 1 427 ? 70.333  59.247 -5.391  1.00 20.64 ? 424 LEU A C     1 
ATOM   3244 O  O     . LEU A 1 427 ? 71.368  58.664 -5.054  1.00 22.37 ? 424 LEU A O     1 
ATOM   3245 C  CB    . LEU A 1 427 ? 71.091  61.603 -5.480  1.00 25.95 ? 424 LEU A CB    1 
ATOM   3246 C  CG    . LEU A 1 427 ? 71.007  63.091 -5.170  1.00 24.23 ? 424 LEU A CG    1 
ATOM   3247 C  CD1   . LEU A 1 427 ? 72.146  63.830 -5.871  1.00 22.57 ? 424 LEU A CD1   1 
ATOM   3248 C  CD2   . LEU A 1 427 ? 69.649  63.649 -5.586  1.00 24.45 ? 424 LEU A CD2   1 
ATOM   3249 N  N     . CYS A 1 428 ? 69.460  58.731 -6.247  1.00 22.06 ? 425 CYS A N     1 
ATOM   3250 C  CA    A CYS A 1 428 ? 69.606  57.375 -6.757  0.70 21.79 ? 425 CYS A CA    1 
ATOM   3251 C  CA    B CYS A 1 428 ? 69.573  57.366 -6.757  0.30 21.87 ? 425 CYS A CA    1 
ATOM   3252 C  C     . CYS A 1 428 ? 69.500  57.373 -8.274  1.00 23.21 ? 425 CYS A C     1 
ATOM   3253 O  O     . CYS A 1 428 ? 68.528  57.884 -8.838  1.00 26.94 ? 425 CYS A O     1 
ATOM   3254 C  CB    A CYS A 1 428 ? 68.553  56.448 -6.149  0.70 28.38 ? 425 CYS A CB    1 
ATOM   3255 C  CB    B CYS A 1 428 ? 68.456  56.466 -6.215  0.30 28.18 ? 425 CYS A CB    1 
ATOM   3256 S  SG    A CYS A 1 428 ? 68.894  54.728 -6.508  0.70 26.92 ? 425 CYS A SG    1 
ATOM   3257 S  SG    B CYS A 1 428 ? 68.260  56.452 -4.439  0.30 31.10 ? 425 CYS A SG    1 
ATOM   3258 N  N     . ALA A 1 429 ? 70.499  56.785 -8.930  1.00 19.62 ? 426 ALA A N     1 
ATOM   3259 C  CA    . ALA A 1 429 ? 70.485  56.617 -10.375 1.00 20.91 ? 426 ALA A CA    1 
ATOM   3260 C  C     . ALA A 1 429 ? 69.946  55.225 -10.698 1.00 20.02 ? 426 ALA A C     1 
ATOM   3261 O  O     . ALA A 1 429 ? 70.419  54.226 -10.133 1.00 19.78 ? 426 ALA A O     1 
ATOM   3262 C  CB    . ALA A 1 429 ? 71.887  56.802 -10.959 1.00 19.86 ? 426 ALA A CB    1 
ATOM   3263 N  N     . THR A 1 430 ? 68.958  55.163 -11.595 1.00 23.11 ? 427 THR A N     1 
ATOM   3264 C  CA    . THR A 1 430 ? 68.173  53.949 -11.840 1.00 23.15 ? 427 THR A CA    1 
ATOM   3265 C  C     . THR A 1 430 ? 67.870  53.828 -13.332 1.00 24.62 ? 427 THR A C     1 
ATOM   3266 O  O     . THR A 1 430 ? 68.209  54.703 -14.133 1.00 22.73 ? 427 THR A O     1 
ATOM   3267 C  CB    . THR A 1 430 ? 66.841  53.963 -11.073 1.00 29.56 ? 427 THR A CB    1 
ATOM   3268 O  OG1   . THR A 1 430 ? 65.971  54.913 -11.691 1.00 33.78 ? 427 THR A OG1   1 
ATOM   3269 C  CG2   . THR A 1 430 ? 67.017  54.366 -9.613  1.00 31.37 ? 427 THR A CG2   1 
ATOM   3270 N  N     . LYS A 1 431 ? 67.179  52.740 -13.699 1.00 25.60 ? 428 LYS A N     1 
ATOM   3271 C  CA    . LYS A 1 431 ? 66.744  52.482 -15.075 1.00 25.16 ? 428 LYS A CA    1 
ATOM   3272 C  C     . LYS A 1 431 ? 67.932  52.490 -16.045 1.00 21.99 ? 428 LYS A C     1 
ATOM   3273 O  O     . LYS A 1 431 ? 68.005  53.283 -16.980 1.00 27.30 ? 428 LYS A O     1 
ATOM   3274 C  CB    . LYS A 1 431 ? 65.661  53.479 -15.512 1.00 24.87 ? 428 LYS A CB    1 
ATOM   3275 N  N     . PHE A 1 432 ? 68.861  51.571 -15.808 1.00 25.34 ? 429 PHE A N     1 
ATOM   3276 C  CA    . PHE A 1 432 ? 70.068  51.498 -16.619 1.00 24.41 ? 429 PHE A CA    1 
ATOM   3277 C  C     . PHE A 1 432 ? 69.753  50.904 -17.986 1.00 33.62 ? 429 PHE A C     1 
ATOM   3278 O  O     . PHE A 1 432 ? 68.913  50.010 -18.116 1.00 27.68 ? 429 PHE A O     1 
ATOM   3279 C  CB    . PHE A 1 432 ? 71.142  50.657 -15.924 1.00 26.38 ? 429 PHE A CB    1 
ATOM   3280 C  CG    . PHE A 1 432 ? 71.859  51.376 -14.810 1.00 29.53 ? 429 PHE A CG    1 
ATOM   3281 C  CD1   . PHE A 1 432 ? 73.003  52.127 -15.070 1.00 27.50 ? 429 PHE A CD1   1 
ATOM   3282 C  CD2   . PHE A 1 432 ? 71.392  51.305 -13.506 1.00 31.59 ? 429 PHE A CD2   1 
ATOM   3283 C  CE1   . PHE A 1 432 ? 73.661  52.800 -14.044 1.00 22.95 ? 429 PHE A CE1   1 
ATOM   3284 C  CE2   . PHE A 1 432 ? 72.048  51.969 -12.474 1.00 34.07 ? 429 PHE A CE2   1 
ATOM   3285 C  CZ    . PHE A 1 432 ? 73.188  52.710 -12.744 1.00 31.09 ? 429 PHE A CZ    1 
ATOM   3286 N  N     . SER A 1 433 ? 70.441  51.403 -19.010 1.00 27.12 ? 430 SER A N     1 
ATOM   3287 C  CA    . SER A 1 433 ? 70.361  50.848 -20.351 1.00 34.65 ? 430 SER A CA    1 
ATOM   3288 C  C     . SER A 1 433 ? 71.769  50.547 -20.834 1.00 39.00 ? 430 SER A C     1 
ATOM   3289 O  O     . SER A 1 433 ? 72.731  51.222 -20.451 1.00 34.60 ? 430 SER A O     1 
ATOM   3290 C  CB    . SER A 1 433 ? 69.661  51.799 -21.330 1.00 32.76 ? 430 SER A CB    1 
ATOM   3291 O  OG    . SER A 1 433 ? 68.353  52.114 -20.892 1.00 51.47 ? 430 SER A OG    1 
ATOM   3292 N  N     . ALA A 1 434 ? 71.882  49.516 -21.666 1.00 31.18 ? 431 ALA A N     1 
ATOM   3293 C  CA    . ALA A 1 434 ? 73.181  49.143 -22.214 1.00 36.80 ? 431 ALA A CA    1 
ATOM   3294 C  C     . ALA A 1 434 ? 73.751  50.278 -23.058 1.00 38.32 ? 431 ALA A C     1 
ATOM   3295 O  O     . ALA A 1 434 ? 73.019  51.012 -23.724 1.00 34.46 ? 431 ALA A O     1 
ATOM   3296 C  CB    . ALA A 1 434 ? 73.058  47.876 -23.058 1.00 39.20 ? 431 ALA A CB    1 
ATOM   3297 N  N     . SER A 1 435 ? 75.075  50.424 -23.018 1.00 35.20 ? 432 SER A N     1 
ATOM   3298 C  CA    . SER A 1 435 ? 75.750  51.482 -23.775 1.00 43.13 ? 432 SER A CA    1 
ATOM   3299 C  C     . SER A 1 435 ? 77.171  51.084 -24.171 1.00 42.42 ? 432 SER A C     1 
ATOM   3300 O  O     . SER A 1 435 ? 77.985  51.933 -24.526 1.00 46.86 ? 432 SER A O     1 
ATOM   3301 C  CB    . SER A 1 435 ? 75.783  52.784 -22.971 1.00 44.97 ? 432 SER A CB    1 
ATOM   3302 O  OG    . SER A 1 435 ? 76.734  52.709 -21.922 1.00 43.85 ? 432 SER A OG    1 
ATOM   3303 O  OXT   . SER A 1 435 ? 77.550  49.913 -24.148 1.00 48.35 ? 432 SER A OXT   1 
ATOM   3304 O  "O3'" . DC  B 2 1   ? 67.752  63.175 14.692  1.00 62.61 ? 1   DC  T "O3'" 1 
ATOM   3305 P  P     . DA  B 2 2   ? 67.687  62.694 16.224  1.00 83.77 ? 2   DA  T P     1 
ATOM   3306 O  OP1   . DA  B 2 2   ? 66.447  61.896 16.387  1.00 79.41 ? 2   DA  T OP1   1 
ATOM   3307 O  OP2   . DA  B 2 2   ? 67.941  63.881 17.074  1.00 67.34 ? 2   DA  T OP2   1 
ATOM   3308 O  "O5'" . DA  B 2 2   ? 68.946  61.714 16.377  1.00 66.75 ? 2   DA  T "O5'" 1 
ATOM   3309 C  "C5'" . DA  B 2 2   ? 69.036  60.542 15.574  1.00 59.89 ? 2   DA  T "C5'" 1 
ATOM   3310 C  "C4'" . DA  B 2 2   ? 70.361  59.833 15.799  1.00 58.51 ? 2   DA  T "C4'" 1 
ATOM   3311 O  "O4'" . DA  B 2 2   ? 71.452  60.714 15.433  1.00 48.55 ? 2   DA  T "O4'" 1 
ATOM   3312 C  "C3'" . DA  B 2 2   ? 70.635  59.408 17.239  1.00 59.17 ? 2   DA  T "C3'" 1 
ATOM   3313 O  "O3'" . DA  B 2 2   ? 71.359  58.192 17.246  1.00 57.79 ? 2   DA  T "O3'" 1 
ATOM   3314 C  "C2'" . DA  B 2 2   ? 71.478  60.556 17.780  1.00 55.59 ? 2   DA  T "C2'" 1 
ATOM   3315 C  "C1'" . DA  B 2 2   ? 72.285  60.941 16.550  1.00 52.13 ? 2   DA  T "C1'" 1 
ATOM   3316 N  N9    . DA  B 2 2   ? 72.677  62.335 16.534  1.00 50.51 ? 2   DA  T N9    1 
ATOM   3317 C  C8    . DA  B 2 2   ? 72.044  63.379 17.149  1.00 44.72 ? 2   DA  T C8    1 
ATOM   3318 N  N7    . DA  B 2 2   ? 72.624  64.537 16.949  1.00 45.50 ? 2   DA  T N7    1 
ATOM   3319 C  C5    . DA  B 2 2   ? 73.712  64.228 16.145  1.00 44.25 ? 2   DA  T C5    1 
ATOM   3320 C  C6    . DA  B 2 2   ? 74.730  65.016 15.579  1.00 43.49 ? 2   DA  T C6    1 
ATOM   3321 N  N6    . DA  B 2 2   ? 74.819  66.342 15.750  1.00 48.19 ? 2   DA  T N6    1 
ATOM   3322 N  N1    . DA  B 2 2   ? 75.656  64.391 14.822  1.00 46.88 ? 2   DA  T N1    1 
ATOM   3323 C  C2    . DA  B 2 2   ? 75.564  63.068 14.649  1.00 41.45 ? 2   DA  T C2    1 
ATOM   3324 N  N3    . DA  B 2 2   ? 74.656  62.224 15.130  1.00 43.82 ? 2   DA  T N3    1 
ATOM   3325 C  C4    . DA  B 2 2   ? 73.752  62.874 15.878  1.00 43.92 ? 2   DA  T C4    1 
ATOM   3326 P  P     A DT  B 2 3   ? 70.694  56.875 17.876  0.54 62.09 ? 3   DT  T P     1 
ATOM   3327 P  P     B DT  B 2 3   ? 70.645  56.826 17.697  0.46 62.02 ? 3   DT  T P     1 
ATOM   3328 O  OP1   A DT  B 2 3   ? 69.417  57.280 18.505  0.54 60.05 ? 3   DT  T OP1   1 
ATOM   3329 O  OP1   B DT  B 2 3   ? 69.312  57.177 18.238  0.46 59.69 ? 3   DT  T OP1   1 
ATOM   3330 O  OP2   A DT  B 2 3   ? 71.731  56.185 18.676  0.54 59.59 ? 3   DT  T OP2   1 
ATOM   3331 O  OP2   B DT  B 2 3   ? 71.612  56.078 18.533  0.46 59.70 ? 3   DT  T OP2   1 
ATOM   3332 O  "O5'" A DT  B 2 3   ? 70.356  55.967 16.602  0.54 59.07 ? 3   DT  T "O5'" 1 
ATOM   3333 O  "O5'" B DT  B 2 3   ? 70.449  56.014 16.328  0.46 58.14 ? 3   DT  T "O5'" 1 
ATOM   3334 C  "C5'" A DT  B 2 3   ? 71.308  55.029 16.126  0.54 54.52 ? 3   DT  T "C5'" 1 
ATOM   3335 C  "C5'" B DT  B 2 3   ? 71.444  55.084 15.895  0.46 54.13 ? 3   DT  T "C5'" 1 
ATOM   3336 C  "C4'" A DT  B 2 3   ? 72.402  55.728 15.349  0.54 49.23 ? 3   DT  T "C4'" 1 
ATOM   3337 C  "C4'" B DT  B 2 3   ? 72.563  55.801 15.167  0.46 48.76 ? 3   DT  T "C4'" 1 
ATOM   3338 O  "O4'" A DT  B 2 3   ? 73.341  54.734 14.858  0.54 48.44 ? 3   DT  T "O4'" 1 
ATOM   3339 O  "O4'" B DT  B 2 3   ? 73.589  54.844 14.765  0.46 48.29 ? 3   DT  T "O4'" 1 
ATOM   3340 C  "C3'" A DT  B 2 3   ? 71.931  56.474 14.106  0.54 48.33 ? 3   DT  T "C3'" 1 
ATOM   3341 C  "C3'" B DT  B 2 3   ? 72.140  56.524 13.878  0.46 48.11 ? 3   DT  T "C3'" 1 
ATOM   3342 O  "O3'" A DT  B 2 3   ? 72.876  57.514 13.794  0.54 50.89 ? 3   DT  T "O3'" 1 
ATOM   3343 O  "O3'" B DT  B 2 3   ? 72.744  57.829 13.827  0.46 49.60 ? 3   DT  T "O3'" 1 
ATOM   3344 C  "C2'" A DT  B 2 3   ? 71.966  55.355 13.076  0.54 43.97 ? 3   DT  T "C2'" 1 
ATOM   3345 C  "C2'" B DT  B 2 3   ? 72.697  55.609 12.795  0.46 42.91 ? 3   DT  T "C2'" 1 
ATOM   3346 C  "C1'" A DT  B 2 3   ? 73.294  54.712 13.444  0.54 38.92 ? 3   DT  T "C1'" 1 
ATOM   3347 C  "C1'" B DT  B 2 3   ? 73.979  55.165 13.454  0.46 41.52 ? 3   DT  T "C1'" 1 
ATOM   3348 N  N1    A DT  B 2 3   ? 73.453  53.302 12.972  0.54 39.56 ? 3   DT  T N1    1 
ATOM   3349 N  N1    B DT  B 2 3   ? 74.637  53.981 12.792  0.46 40.43 ? 3   DT  T N1    1 
ATOM   3350 C  C2    A DT  B 2 3   ? 74.649  52.915 12.398  0.54 35.49 ? 3   DT  T C2    1 
ATOM   3351 C  C2    B DT  B 2 3   ? 75.926  54.113 12.317  0.46 38.91 ? 3   DT  T C2    1 
ATOM   3352 O  O2    A DT  B 2 3   ? 75.595  53.669 12.249  0.54 39.32 ? 3   DT  T O2    1 
ATOM   3353 O  O2    B DT  B 2 3   ? 76.575  55.143 12.422  0.46 36.44 ? 3   DT  T O2    1 
ATOM   3354 N  N3    A DT  B 2 3   ? 74.696  51.605 11.999  0.54 35.18 ? 3   DT  T N3    1 
ATOM   3355 N  N3    B DT  B 2 3   ? 76.436  52.988 11.719  0.46 34.50 ? 3   DT  T N3    1 
ATOM   3356 C  C4    A DT  B 2 3   ? 73.689  50.662 12.119  0.54 32.74 ? 3   DT  T C4    1 
ATOM   3357 C  C4    B DT  B 2 3   ? 75.796  51.773 11.541  0.46 31.94 ? 3   DT  T C4    1 
ATOM   3358 O  O4    A DT  B 2 3   ? 73.823  49.507 11.730  0.54 34.45 ? 3   DT  T O4    1 
ATOM   3359 O  O4    B DT  B 2 3   ? 76.338  50.827 10.980  0.46 27.40 ? 3   DT  T O4    1 
ATOM   3360 C  C5    A DT  B 2 3   ? 72.471  51.132 12.731  0.54 29.63 ? 3   DT  T C5    1 
ATOM   3361 C  C5    B DT  B 2 3   ? 74.444  51.702 12.056  0.46 35.47 ? 3   DT  T C5    1 
ATOM   3362 C  C7    A DT  B 2 3   ? 71.314  50.196 12.915  0.54 41.12 ? 3   DT  T C7    1 
ATOM   3363 C  C7    B DT  B 2 3   ? 73.649  50.433 11.932  0.46 32.69 ? 3   DT  T C7    1 
ATOM   3364 C  C6    A DT  B 2 3   ? 72.409  52.411 13.122  0.54 35.49 ? 3   DT  T C6    1 
ATOM   3365 C  C6    B DT  B 2 3   ? 73.936  52.799 12.646  0.46 37.73 ? 3   DT  T C6    1 
HETATM 3366 P  P     A 8OG B 2 4   ? 72.578  58.606 12.650  0.50 49.71 ? 4   8OG T P     1 
HETATM 3367 P  P     B 8OG B 2 4   ? 72.533  58.795 12.554  0.50 49.43 ? 4   8OG T P     1 
HETATM 3368 O  OP1   A 8OG B 2 4   ? 72.948  59.959 13.203  0.50 50.03 ? 4   8OG T OP1   1 
HETATM 3369 O  OP1   B 8OG B 2 4   ? 73.182  60.116 12.877  0.50 49.17 ? 4   8OG T OP1   1 
HETATM 3370 O  OP2   A 8OG B 2 4   ? 71.204  58.341 12.076  0.50 47.96 ? 4   8OG T OP2   1 
HETATM 3371 O  OP2   B 8OG B 2 4   ? 71.088  58.726 12.113  0.50 48.93 ? 4   8OG T OP2   1 
HETATM 3372 O  "O5'" A 8OG B 2 4   ? 73.648  58.273 11.496  0.50 43.72 ? 4   8OG T "O5'" 1 
HETATM 3373 O  "O5'" B 8OG B 2 4   ? 73.423  58.141 11.387  0.50 43.52 ? 4   8OG T "O5'" 1 
HETATM 3374 C  "C5'" A 8OG B 2 4   ? 73.424  57.126 10.688  0.50 37.77 ? 4   8OG T "C5'" 1 
HETATM 3375 C  "C5'" B 8OG B 2 4   ? 74.839  58.296 11.326  0.50 34.64 ? 4   8OG T "C5'" 1 
HETATM 3376 C  "C4'" A 8OG B 2 4   ? 74.588  56.886 9.755   0.50 34.43 ? 4   8OG T "C4'" 1 
HETATM 3377 C  "C4'" B 8OG B 2 4   ? 75.300  57.591 10.060  0.50 35.07 ? 4   8OG T "C4'" 1 
HETATM 3378 O  "O4'" A 8OG B 2 4   ? 74.858  55.488 9.703   0.50 29.53 ? 4   8OG T "O4'" 1 
HETATM 3379 O  "O4'" B 8OG B 2 4   ? 74.947  56.210 10.152  0.50 31.80 ? 4   8OG T "O4'" 1 
HETATM 3380 C  "C3'" A 8OG B 2 4   ? 74.174  57.300 8.367   0.50 30.28 ? 4   8OG T "C3'" 1 
HETATM 3381 C  "C3'" B 8OG B 2 4   ? 74.597  58.111 8.813   0.50 28.30 ? 4   8OG T "C3'" 1 
HETATM 3382 O  "O3'" A 8OG B 2 4   ? 75.311  57.870 7.728   0.50 25.11 ? 4   8OG T "O3'" 1 
HETATM 3383 O  "O3'" B 8OG B 2 4   ? 75.483  57.912 7.722   0.50 25.22 ? 4   8OG T "O3'" 1 
HETATM 3384 C  "C2'" A 8OG B 2 4   ? 73.789  56.008 7.675   0.50 28.21 ? 4   8OG T "C2'" 1 
HETATM 3385 C  "C2'" B 8OG B 2 4   ? 73.497  57.128 8.528   0.50 30.13 ? 4   8OG T "C2'" 1 
HETATM 3386 C  "C1'" A 8OG B 2 4   ? 74.662  54.984 8.379   0.50 27.03 ? 4   8OG T "C1'" 1 
HETATM 3387 C  "C1'" B 8OG B 2 4   ? 74.200  55.873 8.982   0.50 30.04 ? 4   8OG T "C1'" 1 
HETATM 3388 N  N9    A 8OG B 2 4   ? 74.076  53.624 8.481   0.50 27.15 ? 4   8OG T N9    1 
HETATM 3389 N  N9    B 8OG B 2 4   ? 73.253  54.772 9.220   0.50 32.72 ? 4   8OG T N9    1 
HETATM 3390 C  C8    A 8OG B 2 4   ? 74.634  52.481 8.068   0.50 28.45 ? 4   8OG T C8    1 
HETATM 3391 C  C8    B 8OG B 2 4   ? 72.018  54.717 9.721   0.50 32.18 ? 4   8OG T C8    1 
HETATM 3392 N  N7    A 8OG B 2 4   ? 73.940  51.360 8.274   0.50 26.55 ? 4   8OG T N7    1 
HETATM 3393 N  N7    B 8OG B 2 4   ? 71.463  53.497 9.769   0.50 30.39 ? 4   8OG T N7    1 
HETATM 3394 C  C5    A 8OG B 2 4   ? 72.825  51.786 8.885   0.50 28.05 ? 4   8OG T C5    1 
HETATM 3395 C  C5    B 8OG B 2 4   ? 72.406  52.701 9.241   0.50 29.14 ? 4   8OG T C5    1 
HETATM 3396 C  C6    A 8OG B 2 4   ? 71.610  51.129 9.410   0.50 27.70 ? 4   8OG T C6    1 
HETATM 3397 C  C6    B 8OG B 2 4   ? 72.562  51.266 8.946   0.50 28.10 ? 4   8OG T C6    1 
HETATM 3398 O  O6    A 8OG B 2 4   ? 71.473  49.892 9.320   0.50 29.64 ? 4   8OG T O6    1 
HETATM 3399 O  O6    B 8OG B 2 4   ? 71.651  50.456 9.215   0.50 28.65 ? 4   8OG T O6    1 
HETATM 3400 N  N1    A 8OG B 2 4   ? 70.663  51.895 9.972   0.50 33.16 ? 4   8OG T N1    1 
HETATM 3401 N  N1    B 8OG B 2 4   ? 73.722  50.866 8.397   0.50 27.28 ? 4   8OG T N1    1 
HETATM 3402 C  C2    A 8OG B 2 4   ? 70.796  53.233 10.077  0.50 30.54 ? 4   8OG T C2    1 
HETATM 3403 C  C2    B 8OG B 2 4   ? 74.734  51.703 8.093   0.50 25.69 ? 4   8OG T C2    1 
HETATM 3404 N  N2    A 8OG B 2 4   ? 69.793  53.934 10.659  0.50 34.98 ? 4   8OG T N2    1 
HETATM 3405 N  N2    B 8OG B 2 4   ? 75.882  51.244 7.543   0.50 27.73 ? 4   8OG T N2    1 
HETATM 3406 N  N3    A 8OG B 2 4   ? 71.886  53.907 9.621   0.50 30.21 ? 4   8OG T N3    1 
HETATM 3407 N  N3    B 8OG B 2 4   ? 74.663  53.021 8.337   0.50 29.12 ? 4   8OG T N3    1 
HETATM 3408 C  C4    A 8OG B 2 4   ? 72.910  53.259 9.023   0.50 27.76 ? 4   8OG T C4    1 
HETATM 3409 C  C4    B 8OG B 2 4   ? 73.556  53.544 8.884   0.50 28.22 ? 4   8OG T C4    1 
HETATM 3410 O  O8    A 8OG B 2 4   ? 75.779  52.462 7.490   0.50 28.30 ? 4   8OG T O8    1 
HETATM 3411 O  O8    B 8OG B 2 4   ? 71.390  55.756 10.147  0.50 36.44 ? 4   8OG T O8    1 
ATOM   3412 P  P     . DA  B 2 5   ? 75.156  58.528 6.278   1.00 25.07 ? 5   DA  T P     1 
ATOM   3413 O  OP1   . DA  B 2 5   ? 76.260  59.480 6.033   1.00 27.11 ? 5   DA  T OP1   1 
ATOM   3414 O  OP2   . DA  B 2 5   ? 73.735  58.918 6.154   1.00 21.88 ? 5   DA  T OP2   1 
ATOM   3415 O  "O5'" . DA  B 2 5   ? 75.360  57.307 5.272   1.00 23.01 ? 5   DA  T "O5'" 1 
ATOM   3416 C  "C5'" . DA  B 2 5   ? 76.634  56.699 5.159   1.00 23.17 ? 5   DA  T "C5'" 1 
ATOM   3417 C  "C4'" . DA  B 2 5   ? 76.602  55.603 4.120   1.00 23.28 ? 5   DA  T "C4'" 1 
ATOM   3418 O  "O4'" . DA  B 2 5   ? 75.847  54.487 4.636   1.00 22.19 ? 5   DA  T "O4'" 1 
ATOM   3419 C  "C3'" . DA  B 2 5   ? 75.963  55.987 2.786   1.00 18.63 ? 5   DA  T "C3'" 1 
ATOM   3420 O  "O3'" . DA  B 2 5   ? 76.803  55.539 1.750   1.00 22.16 ? 5   DA  T "O3'" 1 
ATOM   3421 C  "C2'" . DA  B 2 5   ? 74.611  55.257 2.801   1.00 23.06 ? 5   DA  T "C2'" 1 
ATOM   3422 C  "C1'" . DA  B 2 5   ? 74.927  54.043 3.668   1.00 21.70 ? 5   DA  T "C1'" 1 
ATOM   3423 N  N9    . DA  B 2 5   ? 73.783  53.484 4.391   1.00 19.55 ? 5   DA  T N9    1 
ATOM   3424 C  C8    . DA  B 2 5   ? 72.861  54.147 5.148   1.00 26.50 ? 5   DA  T C8    1 
ATOM   3425 N  N7    . DA  B 2 5   ? 71.974  53.352 5.713   1.00 24.74 ? 5   DA  T N7    1 
ATOM   3426 C  C5    . DA  B 2 5   ? 72.359  52.085 5.295   1.00 22.32 ? 5   DA  T C5    1 
ATOM   3427 C  C6    . DA  B 2 5   ? 71.829  50.801 5.539   1.00 25.73 ? 5   DA  T C6    1 
ATOM   3428 N  N6    . DA  B 2 5   ? 70.746  50.588 6.289   1.00 24.32 ? 5   DA  T N6    1 
ATOM   3429 N  N1    . DA  B 2 5   ? 72.456  49.745 4.975   1.00 21.09 ? 5   DA  T N1    1 
ATOM   3430 C  C2    . DA  B 2 5   ? 73.536  49.965 4.220   1.00 25.09 ? 5   DA  T C2    1 
ATOM   3431 N  N3    . DA  B 2 5   ? 74.122  51.132 3.917   1.00 21.80 ? 5   DA  T N3    1 
ATOM   3432 C  C4    . DA  B 2 5   ? 73.481  52.151 4.504   1.00 20.49 ? 5   DA  T C4    1 
ATOM   3433 P  P     . DT  B 2 6   ? 76.422  55.735 0.213   1.00 23.18 ? 6   DT  T P     1 
ATOM   3434 O  OP1   . DT  B 2 6   ? 77.638  55.424 -0.570  1.00 26.81 ? 6   DT  T OP1   1 
ATOM   3435 O  OP2   . DT  B 2 6   ? 75.725  57.017 0.058   1.00 25.25 ? 6   DT  T OP2   1 
ATOM   3436 O  "O5'" . DT  B 2 6   ? 75.433  54.520 -0.083  1.00 30.20 ? 6   DT  T "O5'" 1 
ATOM   3437 C  "C5'" . DT  B 2 6   ? 75.989  53.247 -0.096  1.00 27.86 ? 6   DT  T "C5'" 1 
ATOM   3438 C  "C4'" . DT  B 2 6   ? 74.949  52.173 -0.222  1.00 25.98 ? 6   DT  T "C4'" 1 
ATOM   3439 O  "O4'" . DT  B 2 6   ? 73.980  52.289 0.812   1.00 27.49 ? 6   DT  T "O4'" 1 
ATOM   3440 C  "C3'" . DT  B 2 6   ? 74.150  52.169 -1.518  1.00 28.84 ? 6   DT  T "C3'" 1 
ATOM   3441 O  "O3'" . DT  B 2 6   ? 74.742  51.208 -2.354  1.00 26.90 ? 6   DT  T "O3'" 1 
ATOM   3442 C  "C2'" . DT  B 2 6   ? 72.719  51.760 -1.049  1.00 28.97 ? 6   DT  T "C2'" 1 
ATOM   3443 C  "C1'" . DT  B 2 6   ? 72.961  51.427 0.430   1.00 30.00 ? 6   DT  T "C1'" 1 
ATOM   3444 N  N1    . DT  B 2 6   ? 71.794  51.582 1.348   1.00 24.41 ? 6   DT  T N1    1 
ATOM   3445 C  C2    . DT  B 2 6   ? 71.196  50.436 1.821   1.00 23.79 ? 6   DT  T C2    1 
ATOM   3446 O  O2    . DT  B 2 6   ? 71.573  49.325 1.511   1.00 23.09 ? 6   DT  T O2    1 
ATOM   3447 N  N3    . DT  B 2 6   ? 70.140  50.639 2.659   1.00 23.54 ? 6   DT  T N3    1 
ATOM   3448 C  C4    . DT  B 2 6   ? 69.631  51.847 3.081   1.00 23.03 ? 6   DT  T C4    1 
ATOM   3449 O  O4    . DT  B 2 6   ? 68.681  51.919 3.855   1.00 24.26 ? 6   DT  T O4    1 
ATOM   3450 C  C5    . DT  B 2 6   ? 70.310  53.017 2.571   1.00 22.43 ? 6   DT  T C5    1 
ATOM   3451 C  C7    . DT  B 2 6   ? 69.842  54.392 2.968   1.00 24.05 ? 6   DT  T C7    1 
ATOM   3452 C  C6    . DT  B 2 6   ? 71.355  52.828 1.734   1.00 27.54 ? 6   DT  T C6    1 
ATOM   3453 P  P     . DG  B 2 7   ? 74.395  51.089 -3.906  1.00 31.00 ? 7   DG  T P     1 
ATOM   3454 O  OP1   . DG  B 2 7   ? 75.554  50.418 -4.532  1.00 38.11 ? 7   DG  T OP1   1 
ATOM   3455 O  OP2   . DG  B 2 7   ? 73.831  52.351 -4.409  1.00 28.90 ? 7   DG  T OP2   1 
ATOM   3456 O  "O5'" . DG  B 2 7   ? 73.169  50.052 -3.938  1.00 38.59 ? 7   DG  T "O5'" 1 
ATOM   3457 C  "C5'" . DG  B 2 7   ? 73.367  48.716 -3.582  1.00 37.93 ? 7   DG  T "C5'" 1 
ATOM   3458 C  "C4'" . DG  B 2 7   ? 72.040  48.027 -3.359  1.00 22.99 ? 7   DG  T "C4'" 1 
ATOM   3459 O  "O4'" . DG  B 2 7   ? 71.405  48.558 -2.189  1.00 27.26 ? 7   DG  T "O4'" 1 
ATOM   3460 C  "C3'" . DG  B 2 7   ? 71.005  48.188 -4.490  1.00 23.22 ? 7   DG  T "C3'" 1 
ATOM   3461 O  "O3'" . DG  B 2 7   ? 70.940  46.987 -5.242  1.00 25.80 ? 7   DG  T "O3'" 1 
ATOM   3462 C  "C2'" . DG  B 2 7   ? 69.689  48.481 -3.748  1.00 28.59 ? 7   DG  T "C2'" 1 
ATOM   3463 C  "C1'" . DG  B 2 7   ? 70.064  48.206 -2.296  1.00 29.57 ? 7   DG  T "C1'" 1 
ATOM   3464 N  N9    . DG  B 2 7   ? 69.261  48.938 -1.331  1.00 27.23 ? 7   DG  T N9    1 
ATOM   3465 C  C8    . DG  B 2 7   ? 69.183  50.297 -1.147  1.00 23.74 ? 7   DG  T C8    1 
ATOM   3466 N  N7    . DG  B 2 7   ? 68.340  50.641 -0.212  1.00 27.33 ? 7   DG  T N7    1 
ATOM   3467 C  C5    . DG  B 2 7   ? 67.822  49.423 0.238   1.00 24.29 ? 7   DG  T C5    1 
ATOM   3468 C  C6    . DG  B 2 7   ? 66.853  49.150 1.234   1.00 22.85 ? 7   DG  T C6    1 
ATOM   3469 O  O6    . DG  B 2 7   ? 66.242  49.950 1.961   1.00 22.15 ? 7   DG  T O6    1 
ATOM   3470 N  N1    . DG  B 2 7   ? 66.615  47.780 1.353   1.00 23.11 ? 7   DG  T N1    1 
ATOM   3471 C  C2    . DG  B 2 7   ? 67.235  46.804 0.613   1.00 27.48 ? 7   DG  T C2    1 
ATOM   3472 N  N2    . DG  B 2 7   ? 66.873  45.536 0.877   1.00 27.18 ? 7   DG  T N2    1 
ATOM   3473 N  N3    . DG  B 2 7   ? 68.141  47.047 -0.327  1.00 22.26 ? 7   DG  T N3    1 
ATOM   3474 C  C4    . DG  B 2 7   ? 68.376  48.379 -0.455  1.00 24.33 ? 7   DG  T C4    1 
ATOM   3475 P  P     . DA  B 2 8   ? 69.935  46.804 -6.485  1.00 27.29 ? 8   DA  T P     1 
ATOM   3476 O  OP1   . DA  B 2 8   ? 70.653  46.033 -7.510  1.00 34.85 ? 8   DA  T OP1   1 
ATOM   3477 O  OP2   . DA  B 2 8   ? 69.203  48.049 -6.825  1.00 27.92 ? 8   DA  T OP2   1 
ATOM   3478 O  "O5'" . DA  B 2 8   ? 68.816  45.845 -5.883  1.00 27.49 ? 8   DA  T "O5'" 1 
ATOM   3479 C  "C5'" . DA  B 2 8   ? 69.202  44.672 -5.165  1.00 33.17 ? 8   DA  T "C5'" 1 
ATOM   3480 C  "C4'" . DA  B 2 8   ? 67.967  43.928 -4.721  1.00 23.96 ? 8   DA  T "C4'" 1 
ATOM   3481 O  "O4'" . DA  B 2 8   ? 67.436  44.581 -3.557  1.00 28.96 ? 8   DA  T "O4'" 1 
ATOM   3482 C  "C3'" . DA  B 2 8   ? 66.856  43.902 -5.775  1.00 30.06 ? 8   DA  T "C3'" 1 
ATOM   3483 O  "O3'" . DA  B 2 8   ? 66.462  42.565 -6.063  1.00 39.35 ? 8   DA  T "O3'" 1 
ATOM   3484 C  "C2'" . DA  B 2 8   ? 65.712  44.704 -5.174  1.00 34.36 ? 8   DA  T "C2'" 1 
ATOM   3485 C  "C1'" . DA  B 2 8   ? 66.059  44.804 -3.694  1.00 30.96 ? 8   DA  T "C1'" 1 
ATOM   3486 N  N9    . DA  B 2 8   ? 65.770  46.118 -3.158  1.00 27.41 ? 8   DA  T N9    1 
ATOM   3487 C  C8    . DA  B 2 8   ? 66.282  47.317 -3.587  1.00 27.54 ? 8   DA  T C8    1 
ATOM   3488 N  N7    . DA  B 2 8   ? 65.831  48.345 -2.922  1.00 23.13 ? 8   DA  T N7    1 
ATOM   3489 C  C5    . DA  B 2 8   ? 64.953  47.786 -2.002  1.00 26.11 ? 8   DA  T C5    1 
ATOM   3490 C  C6    . DA  B 2 8   ? 64.140  48.344 -1.002  1.00 29.16 ? 8   DA  T C6    1 
ATOM   3491 N  N6    . DA  B 2 8   ? 64.081  49.650 -0.744  1.00 25.93 ? 8   DA  T N6    1 
ATOM   3492 N  N1    . DA  B 2 8   ? 63.386  47.502 -0.265  1.00 24.24 ? 8   DA  T N1    1 
ATOM   3493 C  C2    . DA  B 2 8   ? 63.449  46.197 -0.514  1.00 21.08 ? 8   DA  T C2    1 
ATOM   3494 N  N3    . DA  B 2 8   ? 64.170  45.550 -1.425  1.00 25.45 ? 8   DA  T N3    1 
ATOM   3495 C  C4    . DA  B 2 8   ? 64.906  46.415 -2.144  1.00 29.18 ? 8   DA  T C4    1 
ATOM   3496 P  P     . DC  B 2 9   ? 65.409  42.259 -7.244  1.00 35.18 ? 9   DC  T P     1 
ATOM   3497 O  OP1   . DC  B 2 9   ? 65.597  40.836 -7.601  1.00 41.86 ? 9   DC  T OP1   1 
ATOM   3498 O  OP2   . DC  B 2 9   ? 65.451  43.283 -8.310  1.00 32.12 ? 9   DC  T OP2   1 
ATOM   3499 O  "O5'" . DC  B 2 9   ? 63.993  42.424 -6.525  1.00 32.73 ? 9   DC  T "O5'" 1 
ATOM   3500 C  "C5'" . DC  B 2 9   ? 63.727  41.670 -5.374  1.00 30.40 ? 9   DC  T "C5'" 1 
ATOM   3501 C  "C4'" . DC  B 2 9   ? 62.429  42.101 -4.741  1.00 29.20 ? 9   DC  T "C4'" 1 
ATOM   3502 O  "O4'" . DC  B 2 9   ? 62.596  43.404 -4.144  1.00 33.76 ? 9   DC  T "O4'" 1 
ATOM   3503 C  "C3'" . DC  B 2 9   ? 61.234  42.213 -5.702  1.00 35.72 ? 9   DC  T "C3'" 1 
ATOM   3504 O  "O3'" . DC  B 2 9   ? 60.174  41.397 -5.212  1.00 43.95 ? 9   DC  T "O3'" 1 
ATOM   3505 C  "C2'" . DC  B 2 9   ? 60.871  43.702 -5.659  1.00 28.56 ? 9   DC  T "C2'" 1 
ATOM   3506 C  "C1'" . DC  B 2 9   ? 61.409  44.121 -4.304  1.00 31.87 ? 9   DC  T "C1'" 1 
ATOM   3507 N  N1    . DC  B 2 9   ? 61.686  45.597 -4.189  1.00 26.15 ? 9   DC  T N1    1 
ATOM   3508 C  C2    . DC  B 2 9   ? 61.115  46.311 -3.146  1.00 26.96 ? 9   DC  T C2    1 
ATOM   3509 O  O2    . DC  B 2 9   ? 60.424  45.703 -2.319  1.00 26.78 ? 9   DC  T O2    1 
ATOM   3510 N  N3    . DC  B 2 9   ? 61.335  47.652 -3.064  1.00 29.27 ? 9   DC  T N3    1 
ATOM   3511 C  C4    . DC  B 2 9   ? 62.093  48.262 -3.978  1.00 29.06 ? 9   DC  T C4    1 
ATOM   3512 N  N4    . DC  B 2 9   ? 62.279  49.583 -3.861  1.00 28.85 ? 9   DC  T N4    1 
ATOM   3513 C  C5    . DC  B 2 9   ? 62.672  47.549 -5.063  1.00 26.90 ? 9   DC  T C5    1 
ATOM   3514 C  C6    . DC  B 2 9   ? 62.445  46.235 -5.132  1.00 31.02 ? 9   DC  T C6    1 
ATOM   3515 P  P     . DG  B 2 10  ? 58.796  41.228 -6.024  1.00 32.70 ? 10  DG  T P     1 
ATOM   3516 O  OP1   . DG  B 2 10  ? 58.555  39.778 -6.080  1.00 43.65 ? 10  DG  T OP1   1 
ATOM   3517 O  OP2   . DG  B 2 10  ? 58.757  42.047 -7.253  1.00 32.67 ? 10  DG  T OP2   1 
ATOM   3518 O  "O5'" . DG  B 2 10  ? 57.733  41.840 -5.017  1.00 33.52 ? 10  DG  T "O5'" 1 
ATOM   3519 C  "C5'" . DG  B 2 10  ? 57.799  41.481 -3.650  1.00 34.79 ? 10  DG  T "C5'" 1 
ATOM   3520 C  "C4'" . DG  B 2 10  ? 56.689  42.135 -2.868  1.00 27.39 ? 10  DG  T "C4'" 1 
ATOM   3521 O  "O4'" . DG  B 2 10  ? 57.044  43.505 -2.589  1.00 31.08 ? 10  DG  T "O4'" 1 
ATOM   3522 C  "C3'" . DG  B 2 10  ? 55.354  42.179 -3.590  1.00 32.73 ? 10  DG  T "C3'" 1 
ATOM   3523 O  "O3'" . DG  B 2 10  ? 54.301  42.010 -2.660  1.00 35.70 ? 10  DG  T "O3'" 1 
ATOM   3524 C  "C2'" . DG  B 2 10  ? 55.347  43.571 -4.225  1.00 26.80 ? 10  DG  T "C2'" 1 
ATOM   3525 C  "C1'" . DG  B 2 10  ? 56.140  44.388 -3.219  1.00 30.58 ? 10  DG  T "C1'" 1 
ATOM   3526 N  N9    . DG  B 2 10  ? 56.906  45.480 -3.819  1.00 27.55 ? 10  DG  T N9    1 
ATOM   3527 C  C8    . DG  B 2 10  ? 57.887  45.382 -4.782  1.00 27.51 ? 10  DG  T C8    1 
ATOM   3528 N  N7    . DG  B 2 10  ? 58.399  46.540 -5.120  1.00 29.50 ? 10  DG  T N7    1 
ATOM   3529 C  C5    . DG  B 2 10  ? 57.712  47.453 -4.326  1.00 27.96 ? 10  DG  T C5    1 
ATOM   3530 C  C6    . DG  B 2 10  ? 57.827  48.861 -4.239  1.00 21.97 ? 10  DG  T C6    1 
ATOM   3531 O  O6    . DG  B 2 10  ? 58.582  49.610 -4.865  1.00 26.35 ? 10  DG  T O6    1 
ATOM   3532 N  N1    . DG  B 2 10  ? 56.940  49.392 -3.309  1.00 26.31 ? 10  DG  T N1    1 
ATOM   3533 C  C2    . DG  B 2 10  ? 56.056  48.662 -2.546  1.00 25.32 ? 10  DG  T C2    1 
ATOM   3534 N  N2    . DG  B 2 10  ? 55.275  49.361 -1.697  1.00 24.74 ? 10  DG  T N2    1 
ATOM   3535 N  N3    . DG  B 2 10  ? 55.941  47.347 -2.609  1.00 25.01 ? 10  DG  T N3    1 
ATOM   3536 C  C4    . DG  B 2 10  ? 56.796  46.809 -3.520  1.00 23.40 ? 10  DG  T C4    1 
ATOM   3537 P  P     . DC  B 2 11  ? 52.790  41.897 -3.180  1.00 35.70 ? 11  DC  T P     1 
ATOM   3538 O  OP1   . DC  B 2 11  ? 52.045  41.007 -2.269  1.00 39.12 ? 11  DC  T OP1   1 
ATOM   3539 O  OP2   . DC  B 2 11  ? 52.786  41.602 -4.628  1.00 28.54 ? 11  DC  T OP2   1 
ATOM   3540 O  "O5'" . DC  B 2 11  ? 52.234  43.375 -3.019  1.00 30.85 ? 11  DC  T "O5'" 1 
ATOM   3541 C  "C5'" . DC  B 2 11  ? 52.143  43.954 -1.755  1.00 25.81 ? 11  DC  T "C5'" 1 
ATOM   3542 C  "C4'" . DC  B 2 11  ? 51.484  45.313 -1.865  1.00 27.97 ? 11  DC  T "C4'" 1 
ATOM   3543 O  "O4'" . DC  B 2 11  ? 52.402  46.243 -2.472  1.00 28.07 ? 11  DC  T "O4'" 1 
ATOM   3544 C  "C3'" . DC  B 2 11  ? 50.212  45.348 -2.714  1.00 23.16 ? 11  DC  T "C3'" 1 
ATOM   3545 O  "O3'" . DC  B 2 11  ? 49.185  45.987 -1.957  1.00 25.55 ? 11  DC  T "O3'" 1 
ATOM   3546 C  "C2'" . DC  B 2 11  ? 50.615  46.161 -3.967  1.00 23.17 ? 11  DC  T "C2'" 1 
ATOM   3547 C  "C1'" . DC  B 2 11  ? 51.727  47.040 -3.411  1.00 24.20 ? 11  DC  T "C1'" 1 
ATOM   3548 N  N1    . DC  B 2 11  ? 52.738  47.476 -4.405  1.00 23.26 ? 11  DC  T N1    1 
ATOM   3549 C  C2    . DC  B 2 11  ? 53.043  48.842 -4.528  1.00 21.87 ? 11  DC  T C2    1 
ATOM   3550 O  O2    . DC  B 2 11  ? 52.425  49.664 -3.835  1.00 25.26 ? 11  DC  T O2    1 
ATOM   3551 N  N3    . DC  B 2 11  ? 53.996  49.224 -5.425  1.00 21.54 ? 11  DC  T N3    1 
ATOM   3552 C  C4    . DC  B 2 11  ? 54.639  48.306 -6.150  1.00 24.87 ? 11  DC  T C4    1 
ATOM   3553 N  N4    . DC  B 2 11  ? 55.585  48.728 -7.013  1.00 22.24 ? 11  DC  T N4    1 
ATOM   3554 C  C5    . DC  B 2 11  ? 54.356  46.915 -6.017  1.00 24.74 ? 11  DC  T C5    1 
ATOM   3555 C  C6    . DC  B 2 11  ? 53.410  46.551 -5.136  1.00 21.42 ? 11  DC  T C6    1 
ATOM   3556 P  P     . DT  B 2 12  ? 47.674  45.978 -2.488  1.00 23.89 ? 12  DT  T P     1 
ATOM   3557 O  OP1   . DT  B 2 12  ? 46.777  46.077 -1.319  1.00 25.69 ? 12  DT  T OP1   1 
ATOM   3558 O  OP2   . DT  B 2 12  ? 47.550  44.843 -3.422  1.00 24.21 ? 12  DT  T OP2   1 
ATOM   3559 O  "O5'" . DT  B 2 12  ? 47.556  47.349 -3.298  1.00 25.46 ? 12  DT  T "O5'" 1 
ATOM   3560 C  "C5'" . DT  B 2 12  ? 47.615  48.570 -2.587  1.00 27.33 ? 12  DT  T "C5'" 1 
ATOM   3561 C  "C4'" . DT  B 2 12  ? 47.681  49.739 -3.540  1.00 26.57 ? 12  DT  T "C4'" 1 
ATOM   3562 O  "O4'" . DT  B 2 12  ? 48.979  49.753 -4.183  1.00 25.96 ? 12  DT  T "O4'" 1 
ATOM   3563 C  "C3'" . DT  B 2 12  ? 46.651  49.696 -4.681  1.00 32.15 ? 12  DT  T "C3'" 1 
ATOM   3564 O  "O3'" . DT  B 2 12  ? 45.742  50.795 -4.588  1.00 29.29 ? 12  DT  T "O3'" 1 
ATOM   3565 C  "C2'" . DT  B 2 12  ? 47.496  49.791 -5.955  1.00 35.39 ? 12  DT  T "C2'" 1 
ATOM   3566 C  "C1'" . DT  B 2 12  ? 48.818  50.338 -5.441  1.00 33.56 ? 12  DT  T "C1'" 1 
ATOM   3567 N  N1    . DT  B 2 12  ? 49.954  49.971 -6.307  1.00 28.44 ? 12  DT  T N1    1 
ATOM   3568 C  C2    . DT  B 2 12  ? 50.863  50.930 -6.667  1.00 27.82 ? 12  DT  T C2    1 
ATOM   3569 O  O2    . DT  B 2 12  ? 50.808  52.088 -6.277  1.00 32.16 ? 12  DT  T O2    1 
ATOM   3570 N  N3    . DT  B 2 12  ? 51.857  50.486 -7.503  1.00 24.01 ? 12  DT  T N3    1 
ATOM   3571 C  C4    . DT  B 2 12  ? 52.016  49.205 -8.003  1.00 27.40 ? 12  DT  T C4    1 
ATOM   3572 O  O4    . DT  B 2 12  ? 52.931  48.903 -8.751  1.00 31.25 ? 12  DT  T O4    1 
ATOM   3573 C  C5    . DT  B 2 12  ? 51.016  48.253 -7.590  1.00 27.37 ? 12  DT  T C5    1 
ATOM   3574 C  C7    . DT  B 2 12  ? 51.074  46.835 -8.070  1.00 31.79 ? 12  DT  T C7    1 
ATOM   3575 C  C6    . DT  B 2 12  ? 50.042  48.679 -6.782  1.00 28.54 ? 12  DT  T C6    1 
ATOM   3576 O  "O5'" . DA  C 3 1   ? 56.752  57.193 -12.381 1.00 43.69 ? 1   DA  P "O5'" 1 
ATOM   3577 C  "C5'" . DA  C 3 1   ? 55.549  57.841 -12.781 1.00 34.96 ? 1   DA  P "C5'" 1 
ATOM   3578 C  "C4'" . DA  C 3 1   ? 54.814  58.463 -11.598 1.00 33.19 ? 1   DA  P "C4'" 1 
ATOM   3579 O  "O4'" . DA  C 3 1   ? 53.930  57.493 -11.014 1.00 33.53 ? 1   DA  P "O4'" 1 
ATOM   3580 C  "C3'" . DA  C 3 1   ? 55.680  58.955 -10.447 1.00 30.14 ? 1   DA  P "C3'" 1 
ATOM   3581 O  "O3'" . DA  C 3 1   ? 55.016  59.998 -9.765  1.00 32.65 ? 1   DA  P "O3'" 1 
ATOM   3582 C  "C2'" . DA  C 3 1   ? 55.800  57.731 -9.555  1.00 31.76 ? 1   DA  P "C2'" 1 
ATOM   3583 C  "C1'" . DA  C 3 1   ? 54.520  56.945 -9.859  1.00 33.09 ? 1   DA  P "C1'" 1 
ATOM   3584 N  N9    . DA  C 3 1   ? 54.774  55.540 -10.116 1.00 32.32 ? 1   DA  P N9    1 
ATOM   3585 C  C8    . DA  C 3 1   ? 55.669  54.999 -10.993 1.00 27.84 ? 1   DA  P C8    1 
ATOM   3586 N  N7    . DA  C 3 1   ? 55.675  53.693 -11.000 1.00 29.50 ? 1   DA  P N7    1 
ATOM   3587 C  C5    . DA  C 3 1   ? 54.716  53.367 -10.055 1.00 26.95 ? 1   DA  P C5    1 
ATOM   3588 C  C6    . DA  C 3 1   ? 54.232  52.146 -9.582  1.00 31.19 ? 1   DA  P C6    1 
ATOM   3589 N  N6    . DA  C 3 1   ? 54.670  50.955 -10.014 1.00 28.87 ? 1   DA  P N6    1 
ATOM   3590 N  N1    . DA  C 3 1   ? 53.270  52.185 -8.642  1.00 37.82 ? 1   DA  P N1    1 
ATOM   3591 C  C2    . DA  C 3 1   ? 52.832  53.363 -8.212  1.00 27.55 ? 1   DA  P C2    1 
ATOM   3592 N  N3    . DA  C 3 1   ? 53.202  54.572 -8.587  1.00 30.06 ? 1   DA  P N3    1 
ATOM   3593 C  C4    . DA  C 3 1   ? 54.156  54.500 -9.515  1.00 29.44 ? 1   DA  P C4    1 
ATOM   3594 P  P     . DG  C 3 2   ? 55.812  60.875 -8.679  1.00 29.99 ? 2   DG  P P     1 
ATOM   3595 O  OP1   . DG  C 3 2   ? 55.084  62.147 -8.497  1.00 33.06 ? 2   DG  P OP1   1 
ATOM   3596 O  OP2   . DG  C 3 2   ? 57.244  60.788 -9.041  1.00 30.60 ? 2   DG  P OP2   1 
ATOM   3597 O  "O5'" . DG  C 3 2   ? 55.656  60.043 -7.334  1.00 30.86 ? 2   DG  P "O5'" 1 
ATOM   3598 C  "C5'" . DG  C 3 2   ? 54.461  60.121 -6.630  1.00 31.17 ? 2   DG  P "C5'" 1 
ATOM   3599 C  "C4'" . DG  C 3 2   ? 54.437  59.083 -5.542  1.00 27.03 ? 2   DG  P "C4'" 1 
ATOM   3600 O  "O4'" . DG  C 3 2   ? 54.571  57.770 -6.104  1.00 25.82 ? 2   DG  P "O4'" 1 
ATOM   3601 C  "C3'" . DG  C 3 2   ? 55.556  59.222 -4.507  1.00 29.11 ? 2   DG  P "C3'" 1 
ATOM   3602 O  "O3'" . DG  C 3 2   ? 54.947  59.482 -3.275  1.00 34.45 ? 2   DG  P "O3'" 1 
ATOM   3603 C  "C2'" . DG  C 3 2   ? 56.277  57.865 -4.538  1.00 29.13 ? 2   DG  P "C2'" 1 
ATOM   3604 C  "C1'" . DG  C 3 2   ? 55.216  56.968 -5.153  1.00 25.66 ? 2   DG  P "C1'" 1 
ATOM   3605 N  N9    . DG  C 3 2   ? 55.736  55.774 -5.801  1.00 27.95 ? 2   DG  P N9    1 
ATOM   3606 C  C8    . DG  C 3 2   ? 56.756  55.682 -6.723  1.00 28.00 ? 2   DG  P C8    1 
ATOM   3607 N  N7    . DG  C 3 2   ? 56.991  54.452 -7.109  1.00 29.01 ? 2   DG  P N7    1 
ATOM   3608 C  C5    . DG  C 3 2   ? 56.059  53.691 -6.400  1.00 24.82 ? 2   DG  P C5    1 
ATOM   3609 C  C6    . DG  C 3 2   ? 55.823  52.296 -6.398  1.00 25.27 ? 2   DG  P C6    1 
ATOM   3610 O  O6    . DG  C 3 2   ? 56.393  51.420 -7.056  1.00 25.75 ? 2   DG  P O6    1 
ATOM   3611 N  N1    . DG  C 3 2   ? 54.788  51.947 -5.529  1.00 24.23 ? 2   DG  P N1    1 
ATOM   3612 C  C2    . DG  C 3 2   ? 54.078  52.830 -4.763  1.00 22.46 ? 2   DG  P C2    1 
ATOM   3613 N  N2    . DG  C 3 2   ? 53.100  52.313 -3.990  1.00 26.11 ? 2   DG  P N2    1 
ATOM   3614 N  N3    . DG  C 3 2   ? 54.283  54.133 -4.762  1.00 26.91 ? 2   DG  P N3    1 
ATOM   3615 C  C4    . DG  C 3 2   ? 55.294  54.490 -5.593  1.00 26.33 ? 2   DG  P C4    1 
ATOM   3616 P  P     . DC  C 3 3   ? 55.772  59.575 -1.912  1.00 33.71 ? 3   DC  P P     1 
ATOM   3617 O  OP1   . DC  C 3 3   ? 55.146  60.691 -1.190  1.00 37.57 ? 3   DC  P OP1   1 
ATOM   3618 O  OP2   . DC  C 3 3   ? 57.242  59.525 -2.097  1.00 31.09 ? 3   DC  P OP2   1 
ATOM   3619 O  "O5'" . DC  C 3 3   ? 55.405  58.206 -1.171  1.00 40.09 ? 3   DC  P "O5'" 1 
ATOM   3620 C  "C5'" . DC  C 3 3   ? 54.049  57.892 -0.905  1.00 45.39 ? 3   DC  P "C5'" 1 
ATOM   3621 C  "C4'" . DC  C 3 3   ? 53.933  56.498 -0.328  1.00 35.37 ? 3   DC  P "C4'" 1 
ATOM   3622 O  "O4'" . DC  C 3 3   ? 54.346  55.529 -1.327  1.00 34.14 ? 3   DC  P "O4'" 1 
ATOM   3623 C  "C3'" . DC  C 3 3   ? 54.801  56.245 0.909   1.00 34.31 ? 3   DC  P "C3'" 1 
ATOM   3624 O  "O3'" . DC  C 3 3   ? 54.027  55.626 1.912   1.00 28.57 ? 3   DC  P "O3'" 1 
ATOM   3625 C  "C2'" . DC  C 3 3   ? 55.904  55.318 0.395   1.00 34.39 ? 3   DC  P "C2'" 1 
ATOM   3626 C  "C1'" . DC  C 3 3   ? 55.200  54.587 -0.735  1.00 32.44 ? 3   DC  P "C1'" 1 
ATOM   3627 N  N1    . DC  C 3 3   ? 56.137  54.072 -1.767  1.00 33.87 ? 3   DC  P N1    1 
ATOM   3628 C  C2    . DC  C 3 3   ? 56.131  52.713 -2.069  1.00 23.91 ? 3   DC  P C2    1 
ATOM   3629 O  O2    . DC  C 3 3   ? 55.335  51.974 -1.491  1.00 29.90 ? 3   DC  P O2    1 
ATOM   3630 N  N3    . DC  C 3 3   ? 56.989  52.243 -2.995  1.00 26.18 ? 3   DC  P N3    1 
ATOM   3631 C  C4    . DC  C 3 3   ? 57.835  53.062 -3.595  1.00 29.65 ? 3   DC  P C4    1 
ATOM   3632 N  N4    . DC  C 3 3   ? 58.666  52.535 -4.492  1.00 31.09 ? 3   DC  P N4    1 
ATOM   3633 C  C5    . DC  C 3 3   ? 57.867  54.464 -3.300  1.00 33.74 ? 3   DC  P C5    1 
ATOM   3634 C  C6    . DC  C 3 3   ? 57.005  54.919 -2.385  1.00 28.57 ? 3   DC  P C6    1 
ATOM   3635 P  P     . DG  C 3 4   ? 54.664  55.273 3.340   1.00 43.52 ? 4   DG  P P     1 
ATOM   3636 O  OP1   . DG  C 3 4   ? 53.630  55.531 4.363   1.00 38.75 ? 4   DG  P OP1   1 
ATOM   3637 O  OP2   . DG  C 3 4   ? 55.999  55.912 3.439   1.00 29.91 ? 4   DG  P OP2   1 
ATOM   3638 O  "O5'" . DG  C 3 4   ? 54.858  53.688 3.271   1.00 37.53 ? 4   DG  P "O5'" 1 
ATOM   3639 C  "C5'" . DG  C 3 4   ? 53.742  52.853 2.997   1.00 37.60 ? 4   DG  P "C5'" 1 
ATOM   3640 C  "C4'" . DG  C 3 4   ? 54.148  51.399 3.078   1.00 41.50 ? 4   DG  P "C4'" 1 
ATOM   3641 O  "O4'" . DG  C 3 4   ? 54.956  51.054 1.918   1.00 40.56 ? 4   DG  P "O4'" 1 
ATOM   3642 C  "C3'" . DG  C 3 4   ? 54.982  51.055 4.308   1.00 35.47 ? 4   DG  P "C3'" 1 
ATOM   3643 O  "O3'" . DG  C 3 4   ? 54.516  49.839 4.891   1.00 37.36 ? 4   DG  P "O3'" 1 
ATOM   3644 C  "C2'" . DG  C 3 4   ? 56.408  50.934 3.758   1.00 35.38 ? 4   DG  P "C2'" 1 
ATOM   3645 C  "C1'" . DG  C 3 4   ? 56.176  50.471 2.327   1.00 32.20 ? 4   DG  P "C1'" 1 
ATOM   3646 N  N9    . DG  C 3 4   ? 57.226  50.906 1.403   1.00 33.44 ? 4   DG  P N9    1 
ATOM   3647 C  C8    . DG  C 3 4   ? 57.657  52.195 1.188   1.00 30.77 ? 4   DG  P C8    1 
ATOM   3648 N  N7    . DG  C 3 4   ? 58.621  52.283 0.312   1.00 29.46 ? 4   DG  P N7    1 
ATOM   3649 C  C5    . DG  C 3 4   ? 58.840  50.960 -0.083  1.00 28.35 ? 4   DG  P C5    1 
ATOM   3650 C  C6    . DG  C 3 4   ? 59.765  50.424 -1.012  1.00 28.36 ? 4   DG  P C6    1 
ATOM   3651 O  O6    . DG  C 3 4   ? 60.595  51.023 -1.699  1.00 30.34 ? 4   DG  P O6    1 
ATOM   3652 N  N1    . DG  C 3 4   ? 59.662  49.035 -1.106  1.00 25.50 ? 4   DG  P N1    1 
ATOM   3653 C  C2    . DG  C 3 4   ? 58.773  48.272 -0.396  1.00 21.71 ? 4   DG  P C2    1 
ATOM   3654 N  N2    . DG  C 3 4   ? 58.827  46.954 -0.608  1.00 21.84 ? 4   DG  P N2    1 
ATOM   3655 N  N3    . DG  C 3 4   ? 57.912  48.757 0.476   1.00 28.29 ? 4   DG  P N3    1 
ATOM   3656 C  C4    . DG  C 3 4   ? 57.996  50.107 0.580   1.00 27.68 ? 4   DG  P C4    1 
ATOM   3657 P  P     . DT  C 3 5   ? 55.215  49.274 6.228   1.00 45.64 ? 5   DT  P P     1 
ATOM   3658 O  OP1   . DT  C 3 5   ? 54.150  48.740 7.098   1.00 47.63 ? 5   DT  P OP1   1 
ATOM   3659 O  OP2   . DT  C 3 5   ? 56.160  50.275 6.738   1.00 38.72 ? 5   DT  P OP2   1 
ATOM   3660 O  "O5'" . DT  C 3 5   ? 56.171  48.110 5.686   1.00 37.03 ? 5   DT  P "O5'" 1 
ATOM   3661 C  "C5'" . DT  C 3 5   ? 55.683  47.179 4.759   1.00 34.05 ? 5   DT  P "C5'" 1 
ATOM   3662 C  "C4'" . DT  C 3 5   ? 56.767  46.183 4.419   1.00 25.53 ? 5   DT  P "C4'" 1 
ATOM   3663 O  "O4'" . DT  C 3 5   ? 57.652  46.755 3.433   1.00 24.16 ? 5   DT  P "O4'" 1 
ATOM   3664 C  "C3'" . DT  C 3 5   ? 57.653  45.774 5.603   1.00 24.51 ? 5   DT  P "C3'" 1 
ATOM   3665 O  "O3'" . DT  C 3 5   ? 57.731  44.365 5.642   1.00 24.12 ? 5   DT  P "O3'" 1 
ATOM   3666 C  "C2'" . DT  C 3 5   ? 59.018  46.396 5.279   1.00 20.38 ? 5   DT  P "C2'" 1 
ATOM   3667 C  "C1'" . DT  C 3 5   ? 58.981  46.416 3.763   1.00 26.53 ? 5   DT  P "C1'" 1 
ATOM   3668 N  N1    . DT  C 3 5   ? 59.845  47.436 3.159   1.00 20.78 ? 5   DT  P N1    1 
ATOM   3669 C  C2    . DT  C 3 5   ? 60.792  47.065 2.254   1.00 20.34 ? 5   DT  P C2    1 
ATOM   3670 O  O2    . DT  C 3 5   ? 60.994  45.908 1.932   1.00 20.90 ? 5   DT  P O2    1 
ATOM   3671 N  N3    . DT  C 3 5   ? 61.524  48.105 1.736   1.00 24.96 ? 5   DT  P N3    1 
ATOM   3672 C  C4    . DT  C 3 5   ? 61.388  49.447 2.036   1.00 21.52 ? 5   DT  P C4    1 
ATOM   3673 O  O4    . DT  C 3 5   ? 62.098  50.309 1.522   1.00 25.47 ? 5   DT  P O4    1 
ATOM   3674 C  C5    . DT  C 3 5   ? 60.369  49.767 3.003   1.00 25.29 ? 5   DT  P C5    1 
ATOM   3675 C  C7    . DT  C 3 5   ? 60.127  51.191 3.408   1.00 30.39 ? 5   DT  P C7    1 
ATOM   3676 C  C6    . DT  C 3 5   ? 59.651  48.761 3.509   1.00 25.46 ? 5   DT  P C6    1 
ATOM   3677 P  P     . DC  C 3 6   ? 58.349  43.620 6.919   1.00 22.38 ? 6   DC  P P     1 
ATOM   3678 O  OP1   . DC  C 3 6   ? 57.620  42.320 7.037   1.00 24.39 ? 6   DC  P OP1   1 
ATOM   3679 O  OP2   . DC  C 3 6   ? 58.436  44.523 8.071   1.00 18.54 ? 6   DC  P OP2   1 
ATOM   3680 O  "O5'" . DC  C 3 6   ? 59.816  43.286 6.471   1.00 17.40 ? 6   DC  P "O5'" 1 
ATOM   3681 C  "C5'" . DC  C 3 6   ? 60.035  42.410 5.396   1.00 19.49 ? 6   DC  P "C5'" 1 
ATOM   3682 C  "C4'" . DC  C 3 6   ? 61.489  42.424 5.023   1.00 23.42 ? 6   DC  P "C4'" 1 
ATOM   3683 O  "O4'" . DC  C 3 6   ? 61.794  43.692 4.405   1.00 22.79 ? 6   DC  P "O4'" 1 
ATOM   3684 C  "C3'" . DC  C 3 6   ? 62.441  42.303 6.218   1.00 21.82 ? 6   DC  P "C3'" 1 
ATOM   3685 O  "O3'" . DC  C 3 6   ? 63.065  41.034 6.194   1.00 22.64 ? 6   DC  P "O3'" 1 
ATOM   3686 C  "C2'" . DC  C 3 6   ? 63.457  43.454 6.017   1.00 21.86 ? 6   DC  P "C2'" 1 
ATOM   3687 C  "C1'" . DC  C 3 6   ? 63.141  43.945 4.602   1.00 19.29 ? 6   DC  P "C1'" 1 
ATOM   3688 N  N1    . DC  C 3 6   ? 63.380  45.385 4.412   1.00 20.22 ? 6   DC  P N1    1 
ATOM   3689 C  C2    . DC  C 3 6   ? 64.220  45.795 3.379   1.00 22.38 ? 6   DC  P C2    1 
ATOM   3690 O  O2    . DC  C 3 6   ? 64.739  44.932 2.652   1.00 24.14 ? 6   DC  P O2    1 
ATOM   3691 N  N3    . DC  C 3 6   ? 64.457  47.126 3.213   1.00 21.43 ? 6   DC  P N3    1 
ATOM   3692 C  C4    . DC  C 3 6   ? 63.887  48.011 4.028   1.00 24.93 ? 6   DC  P C4    1 
ATOM   3693 N  N4    . DC  C 3 6   ? 64.151  49.308 3.821   1.00 23.70 ? 6   DC  P N4    1 
ATOM   3694 C  C5    . DC  C 3 6   ? 63.006  47.615 5.084   1.00 21.97 ? 6   DC  P C5    1 
ATOM   3695 C  C6    . DC  C 3 6   ? 62.788  46.303 5.247   1.00 17.71 ? 6   DC  P C6    1 
ATOM   3696 P  P     . DA  C 3 7   ? 64.160  40.628 7.302   1.00 18.88 ? 7   DA  P P     1 
ATOM   3697 O  OP1   . DA  C 3 7   ? 64.089  39.165 7.471   1.00 19.45 ? 7   DA  P OP1   1 
ATOM   3698 O  OP2   . DA  C 3 7   ? 64.027  41.498 8.476   1.00 16.64 ? 7   DA  P OP2   1 
ATOM   3699 O  "O5'" . DA  C 3 7   ? 65.550  41.049 6.637   1.00 21.77 ? 7   DA  P "O5'" 1 
ATOM   3700 C  "C5'" . DA  C 3 7   ? 66.029  40.403 5.497   1.00 29.92 ? 7   DA  P "C5'" 1 
ATOM   3701 C  "C4'" . DA  C 3 7   ? 67.151  41.217 4.853   1.00 25.15 ? 7   DA  P "C4'" 1 
ATOM   3702 O  "O4'" . DA  C 3 7   ? 66.671  42.507 4.460   1.00 24.75 ? 7   DA  P "O4'" 1 
ATOM   3703 C  "C3'" . DA  C 3 7   ? 68.331  41.573 5.740   1.00 23.42 ? 7   DA  P "C3'" 1 
ATOM   3704 O  "O3'" . DA  C 3 7   ? 69.176  40.434 5.930   1.00 28.30 ? 7   DA  P "O3'" 1 
ATOM   3705 C  "C2'" . DA  C 3 7   ? 69.008  42.665 4.898   1.00 23.22 ? 7   DA  P "C2'" 1 
ATOM   3706 C  "C1'" . DA  C 3 7   ? 67.820  43.319 4.193   1.00 21.51 ? 7   DA  P "C1'" 1 
ATOM   3707 N  N9    . DA  C 3 7   ? 67.565  44.663 4.651   1.00 22.39 ? 7   DA  P N9    1 
ATOM   3708 C  C8    . DA  C 3 7   ? 66.679  45.064 5.608   1.00 18.50 ? 7   DA  P C8    1 
ATOM   3709 N  N7    . DA  C 3 7   ? 66.673  46.360 5.806   1.00 23.32 ? 7   DA  P N7    1 
ATOM   3710 C  C5    . DA  C 3 7   ? 67.613  46.835 4.906   1.00 22.29 ? 7   DA  P C5    1 
ATOM   3711 C  C6    . DA  C 3 7   ? 68.070  48.127 4.616   1.00 19.58 ? 7   DA  P C6    1 
ATOM   3712 N  N6    . DA  C 3 7   ? 67.612  49.213 5.233   1.00 21.95 ? 7   DA  P N6    1 
ATOM   3713 N  N1    . DA  C 3 7   ? 69.020  48.257 3.671   1.00 22.74 ? 7   DA  P N1    1 
ATOM   3714 C  C2    . DA  C 3 7   ? 69.480  47.169 3.060   1.00 22.77 ? 7   DA  P C2    1 
ATOM   3715 N  N3    . DA  C 3 7   ? 69.127  45.891 3.250   1.00 27.21 ? 7   DA  P N3    1 
ATOM   3716 C  C4    . DA  C 3 7   ? 68.173  45.804 4.193   1.00 22.54 ? 7   DA  P C4    1 
ATOM   3717 P  P     A DT  C 3 8   ? 70.441  40.493 6.931   0.78 22.06 ? 8   DT  P P     1 
ATOM   3718 P  P     B DT  C 3 8   ? 69.900  39.704 4.694   0.22 21.16 ? 8   DT  P P     1 
ATOM   3719 O  OP1   A DT  C 3 8   ? 70.800  39.094 7.216   0.78 21.07 ? 8   DT  P OP1   1 
ATOM   3720 O  OP1   B DT  C 3 8   ? 69.023  39.375 3.545   0.22 25.02 ? 8   DT  P OP1   1 
ATOM   3721 O  OP2   A DT  C 3 8   ? 70.170  41.453 8.024   0.78 20.17 ? 8   DT  P OP2   1 
ATOM   3722 O  OP2   B DT  C 3 8   ? 70.632  38.677 5.423   0.22 26.37 ? 8   DT  P OP2   1 
ATOM   3723 O  "O5'" A DT  C 3 8   ? 71.601  41.149 6.056   0.78 21.49 ? 8   DT  P "O5'" 1 
ATOM   3724 O  "O5'" B DT  C 3 8   ? 71.068  40.682 4.251   0.22 22.40 ? 8   DT  P "O5'" 1 
ATOM   3725 C  "C5'" A DT  C 3 8   ? 71.914  40.638 4.776   0.78 23.19 ? 8   DT  P "C5'" 1 
ATOM   3726 C  "C5'" B DT  C 3 8   ? 72.231  40.725 5.023   0.22 23.54 ? 8   DT  P "C5'" 1 
ATOM   3727 C  "C4'" A DT  C 3 8   ? 73.058  41.428 4.166   0.78 22.10 ? 8   DT  P "C4'" 1 
ATOM   3728 C  "C4'" B DT  C 3 8   ? 73.307  41.490 4.304   0.22 22.33 ? 8   DT  P "C4'" 1 
ATOM   3729 O  "O4'" A DT  C 3 8   ? 72.642  42.801 3.975   0.78 20.56 ? 8   DT  P "O4'" 1 
ATOM   3730 O  "O4'" B DT  C 3 8   ? 72.827  42.831 4.033   0.22 21.04 ? 8   DT  P "O4'" 1 
ATOM   3731 C  "C3'" A DT  C 3 8   ? 74.324  41.481 5.015   0.78 23.92 ? 8   DT  P "C3'" 1 
ATOM   3732 C  "C3'" B DT  C 3 8   ? 74.591  41.658 5.095   0.22 23.93 ? 8   DT  P "C3'" 1 
ATOM   3733 O  "O3'" A DT  C 3 8   ? 75.468  41.432 4.170   0.78 27.08 ? 8   DT  P "O3'" 1 
ATOM   3734 O  "O3'" B DT  C 3 8   ? 75.686  41.733 4.210   0.22 25.22 ? 8   DT  P "O3'" 1 
ATOM   3735 C  "C2'" A DT  C 3 8   ? 74.206  42.834 5.729   0.78 24.37 ? 8   DT  P "C2'" 1 
ATOM   3736 C  "C2'" B DT  C 3 8   ? 74.358  42.984 5.806   0.22 23.65 ? 8   DT  P "C2'" 1 
ATOM   3737 C  "C1'" A DT  C 3 8   ? 73.495  43.677 4.678   0.78 20.94 ? 8   DT  P "C1'" 1 
ATOM   3738 C  "C1'" B DT  C 3 8   ? 73.614  43.770 4.734   0.22 21.14 ? 8   DT  P "C1'" 1 
ATOM   3739 N  N1    A DT  C 3 8   ? 72.665  44.758 5.250   0.78 21.50 ? 8   DT  P N1    1 
ATOM   3740 N  N1    B DT  C 3 8   ? 72.719  44.825 5.285   0.22 21.63 ? 8   DT  P N1    1 
ATOM   3741 C  C2    A DT  C 3 8   ? 72.857  46.058 4.817   0.78 24.18 ? 8   DT  P C2    1 
ATOM   3742 C  C2    B DT  C 3 8   ? 72.851  46.119 4.834   0.22 23.98 ? 8   DT  P C2    1 
ATOM   3743 O  O2    A DT  C 3 8   ? 73.680  46.369 3.971   0.78 23.90 ? 8   DT  P O2    1 
ATOM   3744 O  O2    B DT  C 3 8   ? 73.663  46.453 3.990   0.22 23.86 ? 8   DT  P O2    1 
ATOM   3745 N  N3    A DT  C 3 8   ? 72.046  46.981 5.411   0.78 21.36 ? 8   DT  P N3    1 
ATOM   3746 N  N3    B DT  C 3 8   ? 71.990  47.014 5.406   0.22 21.47 ? 8   DT  P N3    1 
ATOM   3747 C  C4    A DT  C 3 8   ? 71.077  46.741 6.371   0.78 22.79 ? 8   DT  P C4    1 
ATOM   3748 C  C4    B DT  C 3 8   ? 71.029  46.752 6.366   0.22 22.71 ? 8   DT  P C4    1 
ATOM   3749 O  O4    A DT  C 3 8   ? 70.392  47.630 6.847   0.78 20.73 ? 8   DT  P O4    1 
ATOM   3750 O  O4    B DT  C 3 8   ? 70.301  47.625 6.819   0.22 20.90 ? 8   DT  P O4    1 
ATOM   3751 C  C5    A DT  C 3 8   ? 70.936  45.363 6.784   0.78 22.38 ? 8   DT  P C5    1 
ATOM   3752 C  C5    B DT  C 3 8   ? 70.947  45.377 6.800   0.22 22.37 ? 8   DT  P C5    1 
ATOM   3753 C  C7    A DT  C 3 8   ? 69.918  44.995 7.822   0.78 22.33 ? 8   DT  P C7    1 
ATOM   3754 C  C7    B DT  C 3 8   ? 69.943  44.975 7.839   0.22 22.38 ? 8   DT  P C7    1 
ATOM   3755 C  C6    A DT  C 3 8   ? 71.727  44.454 6.216   0.78 20.31 ? 8   DT  P C6    1 
ATOM   3756 C  C6    B DT  C 3 8   ? 71.787  44.491 6.248   0.22 20.49 ? 8   DT  P C6    1 
HETATM 3757 C  C1    . GOL D 4 .   ? 58.426  20.666 14.932  1.00 19.69 ? 501 GOL A C1    1 
HETATM 3758 O  O1    . GOL D 4 .   ? 57.742  21.894 14.800  1.00 20.76 ? 501 GOL A O1    1 
HETATM 3759 C  C2    . GOL D 4 .   ? 59.175  20.365 13.627  1.00 18.01 ? 501 GOL A C2    1 
HETATM 3760 O  O2    . GOL D 4 .   ? 60.069  21.426 13.361  1.00 18.71 ? 501 GOL A O2    1 
HETATM 3761 C  C3    . GOL D 4 .   ? 58.227  20.162 12.449  1.00 23.75 ? 501 GOL A C3    1 
HETATM 3762 O  O3    . GOL D 4 .   ? 58.959  19.676 11.336  1.00 21.47 ? 501 GOL A O3    1 
HETATM 3763 CA CA    . CA  E 5 .   ? 79.413  39.609 6.593   1.00 15.61 ? 502 CA  A CA    1 
HETATM 3764 N  N1    . CTP F 6 .   ? 75.314  46.826 6.908   1.00 18.18 ? 101 CTP T N1    1 
HETATM 3765 C  C2    . CTP F 6 .   ? 74.759  48.052 7.182   1.00 21.20 ? 101 CTP T C2    1 
HETATM 3766 N  N3    . CTP F 6 .   ? 73.750  48.153 8.101   1.00 21.47 ? 101 CTP T N3    1 
HETATM 3767 C  C4    . CTP F 6 .   ? 73.356  47.076 8.850   1.00 22.64 ? 101 CTP T C4    1 
HETATM 3768 C  C5    . CTP F 6 .   ? 73.957  45.829 8.626   1.00 19.96 ? 101 CTP T C5    1 
HETATM 3769 C  C6    . CTP F 6 .   ? 74.973  45.733 7.674   1.00 18.68 ? 101 CTP T C6    1 
HETATM 3770 O  O2    . CTP F 6 .   ? 75.166  49.053 6.604   1.00 23.63 ? 101 CTP T O2    1 
HETATM 3771 N  N4    . CTP F 6 .   ? 72.410  47.261 9.764   1.00 23.65 ? 101 CTP T N4    1 
HETATM 3772 C  "C1'" . CTP F 6 .   ? 76.342  46.751 5.858   1.00 19.26 ? 101 CTP T "C1'" 1 
HETATM 3773 C  "C2'" . CTP F 6 .   ? 77.627  47.326 6.445   1.00 20.72 ? 101 CTP T "C2'" 1 
HETATM 3774 O  "O2'" . CTP F 6 .   ? 78.266  48.015 5.397   1.00 23.69 ? 101 CTP T "O2'" 1 
HETATM 3775 C  "C3'" . CTP F 6 .   ? 78.453  46.121 6.801   1.00 18.98 ? 101 CTP T "C3'" 1 
HETATM 3776 C  "C4'" . CTP F 6 .   ? 78.022  45.143 5.724   1.00 19.87 ? 101 CTP T "C4'" 1 
HETATM 3777 O  "O4'" . CTP F 6 .   ? 76.638  45.413 5.531   1.00 23.59 ? 101 CTP T "O4'" 1 
HETATM 3778 O  "O3'" . CTP F 6 .   ? 79.827  46.453 6.754   1.00 20.17 ? 101 CTP T "O3'" 1 
HETATM 3779 C  "C5'" . CTP F 6 .   ? 78.254  43.687 6.108   1.00 17.72 ? 101 CTP T "C5'" 1 
HETATM 3780 O  "O5'" . CTP F 6 .   ? 77.272  43.386 7.066   1.00 20.05 ? 101 CTP T "O5'" 1 
HETATM 3781 P  PA    . CTP F 6 .   ? 77.283  42.078 7.962   1.00 18.87 ? 101 CTP T PA    1 
HETATM 3782 O  O1A   . CTP F 6 .   ? 77.497  40.873 7.097   1.00 21.44 ? 101 CTP T O1A   1 
HETATM 3783 O  O2A   . CTP F 6 .   ? 75.978  42.070 8.737   1.00 21.24 ? 101 CTP T O2A   1 
HETATM 3784 O  O3A   . CTP F 6 .   ? 78.410  42.264 9.080   1.00 18.98 ? 101 CTP T O3A   1 
HETATM 3785 P  PB    . CTP F 6 .   ? 79.949  41.817 9.073   1.00 17.00 ? 101 CTP T PB    1 
HETATM 3786 O  O1B   . CTP F 6 .   ? 80.430  41.305 7.736   1.00 13.65 ? 101 CTP T O1B   1 
HETATM 3787 O  O2B   . CTP F 6 .   ? 80.687  43.033 9.588   1.00 17.92 ? 101 CTP T O2B   1 
HETATM 3788 O  O3B   . CTP F 6 .   ? 79.948  40.724 10.240  1.00 16.61 ? 101 CTP T O3B   1 
HETATM 3789 P  PG    . CTP F 6 .   ? 79.681  39.132 10.106  1.00 16.61 ? 101 CTP T PG    1 
HETATM 3790 O  O1G   . CTP F 6 .   ? 79.127  38.875 8.741   1.00 15.14 ? 101 CTP T O1G   1 
HETATM 3791 O  O2G   . CTP F 6 .   ? 80.981  38.441 10.406  1.00 16.32 ? 101 CTP T O2G   1 
HETATM 3792 O  O3G   . CTP F 6 .   ? 78.670  38.899 11.195  1.00 19.03 ? 101 CTP T O3G   1 
HETATM 3793 O  O     . HOH G 7 .   ? 88.593  19.590 -3.386  1.00 35.24 ? 601 HOH A O     1 
HETATM 3794 O  O     . HOH G 7 .   ? 90.304  50.310 -3.230  1.00 40.17 ? 602 HOH A O     1 
HETATM 3795 O  O     . HOH G 7 .   ? 85.159  36.312 -12.751 0.65 24.01 ? 603 HOH A O     1 
HETATM 3796 O  O     . HOH G 7 .   ? 79.477  46.396 -4.121  1.00 42.60 ? 604 HOH A O     1 
HETATM 3797 O  O     . HOH G 7 .   ? 70.131  18.443 -5.074  1.00 30.57 ? 605 HOH A O     1 
HETATM 3798 O  O     . HOH G 7 .   ? 68.458  28.714 -8.589  1.00 19.30 ? 606 HOH A O     1 
HETATM 3799 O  O     . HOH G 7 .   ? 51.854  28.920 21.468  1.00 32.43 ? 607 HOH A O     1 
HETATM 3800 O  O     . HOH G 7 .   ? 86.899  52.282 -14.529 1.00 43.28 ? 608 HOH A O     1 
HETATM 3801 O  O     . HOH G 7 .   ? 83.891  7.099  10.235  1.00 43.76 ? 609 HOH A O     1 
HETATM 3802 O  O     . HOH G 7 .   ? 69.755  57.373 5.422   1.00 36.21 ? 610 HOH A O     1 
HETATM 3803 O  O     . HOH G 7 .   ? 82.538  25.344 -11.155 1.00 38.26 ? 611 HOH A O     1 
HETATM 3804 O  O     . HOH G 7 .   ? 73.286  9.506  -0.517  1.00 44.79 ? 612 HOH A O     1 
HETATM 3805 O  O     . HOH G 7 .   ? 52.250  24.997 18.163  1.00 30.45 ? 613 HOH A O     1 
HETATM 3806 O  O     . HOH G 7 .   ? 80.846  26.704 15.149  1.00 37.27 ? 614 HOH A O     1 
HETATM 3807 O  O     . HOH G 7 .   ? 79.321  69.400 -12.739 1.00 37.69 ? 615 HOH A O     1 
HETATM 3808 O  O     . HOH G 7 .   ? 82.910  69.601 -3.829  1.00 43.11 ? 616 HOH A O     1 
HETATM 3809 O  O     . HOH G 7 .   ? 65.601  41.284 -12.375 1.00 37.55 ? 617 HOH A O     1 
HETATM 3810 O  O     . HOH G 7 .   ? 72.434  44.868 -12.344 1.00 31.22 ? 618 HOH A O     1 
HETATM 3811 O  O     . HOH G 7 .   ? 44.605  26.544 -0.703  1.00 33.93 ? 619 HOH A O     1 
HETATM 3812 O  O     . HOH G 7 .   ? 101.560 45.524 15.232  1.00 44.42 ? 620 HOH A O     1 
HETATM 3813 O  O     . HOH G 7 .   ? 74.504  76.556 -1.990  1.00 37.10 ? 621 HOH A O     1 
HETATM 3814 O  O     . HOH G 7 .   ? 82.133  21.431 17.270  0.58 35.75 ? 622 HOH A O     1 
HETATM 3815 O  O     . HOH G 7 .   ? 63.290  63.853 12.992  1.00 42.02 ? 623 HOH A O     1 
HETATM 3816 O  O     . HOH G 7 .   ? 72.487  47.177 -15.613 1.00 34.92 ? 624 HOH A O     1 
HETATM 3817 O  O     . HOH G 7 .   ? 76.543  7.399  10.027  1.00 34.13 ? 625 HOH A O     1 
HETATM 3818 O  O     . HOH G 7 .   ? 60.483  15.505 3.125   1.00 35.37 ? 626 HOH A O     1 
HETATM 3819 O  O     . HOH G 7 .   ? 90.889  40.042 14.218  1.00 25.81 ? 627 HOH A O     1 
HETATM 3820 O  O     . HOH G 7 .   ? 44.000  34.135 -3.572  1.00 31.72 ? 628 HOH A O     1 
HETATM 3821 O  O     . HOH G 7 .   ? 77.950  23.866 15.401  1.00 37.27 ? 629 HOH A O     1 
HETATM 3822 O  O     . HOH G 7 .   ? 86.589  53.943 1.074   1.00 20.83 ? 630 HOH A O     1 
HETATM 3823 O  O     . HOH G 7 .   ? 94.191  46.564 21.062  1.00 35.74 ? 631 HOH A O     1 
HETATM 3824 O  O     . HOH G 7 .   ? 78.506  45.156 10.200  1.00 22.37 ? 632 HOH A O     1 
HETATM 3825 O  O     . HOH G 7 .   ? 63.424  25.120 -7.308  1.00 37.61 ? 633 HOH A O     1 
HETATM 3826 O  O     . HOH G 7 .   ? 70.238  15.457 14.837  1.00 37.00 ? 634 HOH A O     1 
HETATM 3827 O  O     . HOH G 7 .   ? 86.313  50.244 30.740  0.60 25.67 ? 635 HOH A O     1 
HETATM 3828 O  O     . HOH G 7 .   ? 59.480  29.897 24.616  1.00 37.60 ? 636 HOH A O     1 
HETATM 3829 O  O     . HOH G 7 .   ? 65.772  29.545 -3.034  1.00 15.48 ? 637 HOH A O     1 
HETATM 3830 O  O     . HOH G 7 .   ? 86.339  51.119 -11.181 1.00 44.34 ? 638 HOH A O     1 
HETATM 3831 O  O     . HOH G 7 .   ? 76.489  53.553 21.862  1.00 23.06 ? 639 HOH A O     1 
HETATM 3832 O  O     . HOH G 7 .   ? 44.868  35.776 -6.836  0.57 27.43 ? 640 HOH A O     1 
HETATM 3833 O  O     . HOH G 7 .   ? 90.144  20.534 9.423   1.00 27.21 ? 641 HOH A O     1 
HETATM 3834 O  O     . HOH G 7 .   ? 92.370  37.132 -7.796  1.00 31.81 ? 642 HOH A O     1 
HETATM 3835 O  O     . HOH G 7 .   ? 79.790  29.834 15.099  1.00 40.57 ? 643 HOH A O     1 
HETATM 3836 O  O     . HOH G 7 .   ? 93.499  50.074 7.887   1.00 25.48 ? 644 HOH A O     1 
HETATM 3837 O  O     . HOH G 7 .   ? 81.615  55.888 -21.119 1.00 43.97 ? 645 HOH A O     1 
HETATM 3838 O  O     . HOH G 7 .   ? 66.544  24.345 16.486  0.86 31.83 ? 646 HOH A O     1 
HETATM 3839 O  O     . HOH G 7 .   ? 68.594  14.696 3.879   1.00 20.67 ? 647 HOH A O     1 
HETATM 3840 O  O     . HOH G 7 .   ? 88.714  39.095 22.661  1.00 26.79 ? 648 HOH A O     1 
HETATM 3841 O  O     . HOH G 7 .   ? 69.567  20.799 14.145  1.00 26.86 ? 649 HOH A O     1 
HETATM 3842 O  O     . HOH G 7 .   ? 55.478  18.743 11.056  1.00 31.11 ? 650 HOH A O     1 
HETATM 3843 O  O     . HOH G 7 .   ? 53.811  27.874 20.548  1.00 32.90 ? 651 HOH A O     1 
HETATM 3844 O  O     . HOH G 7 .   ? 93.234  48.791 1.285   1.00 29.75 ? 652 HOH A O     1 
HETATM 3845 O  O     . HOH G 7 .   ? 80.384  52.173 -7.654  1.00 36.29 ? 653 HOH A O     1 
HETATM 3846 O  O     . HOH G 7 .   ? 69.196  65.054 -13.846 1.00 32.71 ? 654 HOH A O     1 
HETATM 3847 O  O     . HOH G 7 .   ? 76.694  44.768 23.840  1.00 31.95 ? 655 HOH A O     1 
HETATM 3848 O  O     . HOH G 7 .   ? 90.039  46.253 -4.022  1.00 23.07 ? 656 HOH A O     1 
HETATM 3849 O  O     . HOH G 7 .   ? 56.031  51.178 10.727  1.00 47.50 ? 657 HOH A O     1 
HETATM 3850 O  O     . HOH G 7 .   ? 55.458  66.798 -5.522  1.00 50.65 ? 658 HOH A O     1 
HETATM 3851 O  O     . HOH G 7 .   ? 67.691  36.970 -2.399  1.00 37.16 ? 659 HOH A O     1 
HETATM 3852 O  O     . HOH G 7 .   ? 75.910  57.533 23.810  0.72 38.32 ? 660 HOH A O     1 
HETATM 3853 O  O     . HOH G 7 .   ? 88.061  20.495 -0.884  1.00 33.38 ? 661 HOH A O     1 
HETATM 3854 O  O     . HOH G 7 .   ? 79.188  18.962 14.213  1.00 22.06 ? 662 HOH A O     1 
HETATM 3855 O  O     . HOH G 7 .   ? 80.498  52.494 -21.741 0.92 41.29 ? 663 HOH A O     1 
HETATM 3856 O  O     . HOH G 7 .   ? 89.730  48.050 -1.888  1.00 23.13 ? 664 HOH A O     1 
HETATM 3857 O  O     . HOH G 7 .   ? 80.258  63.003 13.889  1.00 31.04 ? 665 HOH A O     1 
HETATM 3858 O  O     . HOH G 7 .   ? 58.197  17.647 9.781   1.00 29.41 ? 666 HOH A O     1 
HETATM 3859 O  O     . HOH G 7 .   ? 44.255  29.760 11.390  1.00 45.68 ? 667 HOH A O     1 
HETATM 3860 O  O     . HOH G 7 .   ? 84.717  58.245 -12.063 1.00 34.45 ? 668 HOH A O     1 
HETATM 3861 O  O     . HOH G 7 .   ? 60.803  17.081 -5.200  1.00 51.63 ? 669 HOH A O     1 
HETATM 3862 O  O     . HOH G 7 .   ? 49.515  35.509 20.039  1.00 42.71 ? 670 HOH A O     1 
HETATM 3863 O  O     . HOH G 7 .   ? 76.697  54.042 -15.787 1.00 28.68 ? 671 HOH A O     1 
HETATM 3864 O  O     . HOH G 7 .   ? 53.853  33.201 20.120  1.00 28.90 ? 672 HOH A O     1 
HETATM 3865 O  O     . HOH G 7 .   ? 85.681  24.319 13.932  1.00 37.52 ? 673 HOH A O     1 
HETATM 3866 O  O     . HOH G 7 .   ? 78.765  28.248 8.751   1.00 15.61 ? 674 HOH A O     1 
HETATM 3867 O  O     . HOH G 7 .   ? 68.583  33.537 8.040   1.00 24.98 ? 675 HOH A O     1 
HETATM 3868 O  O     . HOH G 7 .   ? 73.208  72.578 -6.041  1.00 29.75 ? 676 HOH A O     1 
HETATM 3869 O  O     . HOH G 7 .   ? 72.018  31.489 10.850  1.00 26.23 ? 677 HOH A O     1 
HETATM 3870 O  O     . HOH G 7 .   ? 76.226  22.910 12.762  1.00 26.31 ? 678 HOH A O     1 
HETATM 3871 O  O     . HOH G 7 .   ? 42.502  31.090 2.364   1.00 23.40 ? 679 HOH A O     1 
HETATM 3872 O  O     . HOH G 7 .   ? 51.902  24.473 6.863   1.00 22.53 ? 680 HOH A O     1 
HETATM 3873 O  O     . HOH G 7 .   ? 88.352  25.656 2.360   1.00 21.03 ? 681 HOH A O     1 
HETATM 3874 O  O     . HOH G 7 .   ? 58.418  23.595 16.786  1.00 14.90 ? 682 HOH A O     1 
HETATM 3875 O  O     . HOH G 7 .   ? 81.046  52.925 -9.664  1.00 28.50 ? 683 HOH A O     1 
HETATM 3876 O  O     . HOH G 7 .   ? 42.171  30.613 8.503   1.00 41.50 ? 684 HOH A O     1 
HETATM 3877 O  O     A HOH G 7 .   ? 85.002  56.587 25.945  0.68 20.53 ? 685 HOH A O     1 
HETATM 3878 O  O     B HOH G 7 .   ? 86.944  56.316 26.215  0.32 25.55 ? 685 HOH A O     1 
HETATM 3879 O  O     . HOH G 7 .   ? 44.979  23.014 10.362  1.00 37.15 ? 686 HOH A O     1 
HETATM 3880 O  O     . HOH G 7 .   ? 93.331  30.030 -6.051  1.00 29.02 ? 687 HOH A O     1 
HETATM 3881 O  O     . HOH G 7 .   ? 66.905  37.981 15.476  1.00 35.10 ? 688 HOH A O     1 
HETATM 3882 O  O     . HOH G 7 .   ? 92.443  31.545 10.359  1.00 42.57 ? 689 HOH A O     1 
HETATM 3883 O  O     . HOH G 7 .   ? 78.212  55.667 29.525  1.00 31.87 ? 690 HOH A O     1 
HETATM 3884 O  O     . HOH G 7 .   ? 87.335  53.252 28.366  1.00 31.42 ? 691 HOH A O     1 
HETATM 3885 O  O     . HOH G 7 .   ? 50.133  30.789 -4.383  1.00 43.09 ? 692 HOH A O     1 
HETATM 3886 O  O     . HOH G 7 .   ? 44.790  24.245 2.059   1.00 22.06 ? 693 HOH A O     1 
HETATM 3887 O  O     . HOH G 7 .   ? 78.722  36.686 12.989  1.00 38.11 ? 694 HOH A O     1 
HETATM 3888 O  O     . HOH G 7 .   ? 59.856  21.154 9.230   1.00 22.40 ? 695 HOH A O     1 
HETATM 3889 O  O     . HOH G 7 .   ? 98.603  43.056 14.761  1.00 34.08 ? 696 HOH A O     1 
HETATM 3890 O  O     . HOH G 7 .   ? 92.784  45.942 2.201   1.00 14.43 ? 697 HOH A O     1 
HETATM 3891 O  O     . HOH G 7 .   ? 87.202  34.985 9.793   1.00 19.69 ? 698 HOH A O     1 
HETATM 3892 O  O     . HOH G 7 .   ? 60.048  33.335 18.112  1.00 22.39 ? 699 HOH A O     1 
HETATM 3893 O  O     . HOH G 7 .   ? 76.698  25.491 -11.010 1.00 29.05 ? 700 HOH A O     1 
HETATM 3894 O  O     . HOH G 7 .   ? 64.838  27.801 20.715  1.00 34.13 ? 701 HOH A O     1 
HETATM 3895 O  O     . HOH G 7 .   ? 92.227  18.718 4.524   1.00 40.13 ? 702 HOH A O     1 
HETATM 3896 O  O     . HOH G 7 .   ? 70.688  42.969 -2.762  1.00 41.79 ? 703 HOH A O     1 
HETATM 3897 O  O     . HOH G 7 .   ? 69.792  47.759 -21.910 1.00 30.39 ? 704 HOH A O     1 
HETATM 3898 O  O     . HOH G 7 .   ? 58.938  40.184 8.269   1.00 15.55 ? 705 HOH A O     1 
HETATM 3899 O  O     . HOH G 7 .   ? 68.851  18.966 12.357  1.00 19.01 ? 706 HOH A O     1 
HETATM 3900 O  O     . HOH G 7 .   ? 69.095  16.775 1.426   1.00 18.30 ? 707 HOH A O     1 
HETATM 3901 O  O     . HOH G 7 .   ? 54.573  39.304 17.552  1.00 33.87 ? 708 HOH A O     1 
HETATM 3902 O  O     . HOH G 7 .   ? 89.716  39.157 -7.617  1.00 24.27 ? 709 HOH A O     1 
HETATM 3903 O  O     . HOH G 7 .   ? 75.724  38.816 7.732   1.00 28.97 ? 710 HOH A O     1 
HETATM 3904 O  O     . HOH G 7 .   ? 83.848  36.688 19.611  1.00 28.13 ? 711 HOH A O     1 
HETATM 3905 O  O     . HOH G 7 .   ? 80.223  43.656 -5.409  1.00 30.58 ? 712 HOH A O     1 
HETATM 3906 O  O     . HOH G 7 .   ? 75.510  61.848 8.040   1.00 26.54 ? 713 HOH A O     1 
HETATM 3907 O  O     . HOH G 7 .   ? 68.329  49.619 -13.536 1.00 29.12 ? 714 HOH A O     1 
HETATM 3908 O  O     . HOH G 7 .   ? 58.748  57.864 -0.139  1.00 41.00 ? 715 HOH A O     1 
HETATM 3909 O  O     . HOH G 7 .   ? 84.388  58.715 8.530   1.00 28.05 ? 716 HOH A O     1 
HETATM 3910 O  O     . HOH G 7 .   ? 54.485  12.618 -9.596  1.00 38.22 ? 717 HOH A O     1 
HETATM 3911 O  O     . HOH G 7 .   ? 88.344  45.688 -7.160  1.00 23.75 ? 718 HOH A O     1 
HETATM 3912 O  O     . HOH G 7 .   ? 98.341  33.836 -1.300  1.00 20.05 ? 719 HOH A O     1 
HETATM 3913 O  O     . HOH G 7 .   ? 89.071  39.651 11.195  1.00 27.14 ? 720 HOH A O     1 
HETATM 3914 O  O     . HOH G 7 .   ? 87.266  31.541 4.719   1.00 25.54 ? 721 HOH A O     1 
HETATM 3915 O  O     A HOH G 7 .   ? 53.060  26.163 -1.100  0.49 19.26 ? 722 HOH A O     1 
HETATM 3916 O  O     B HOH G 7 .   ? 53.952  23.777 -1.313  0.51 30.47 ? 722 HOH A O     1 
HETATM 3917 O  O     . HOH G 7 .   ? 89.989  32.975 11.732  1.00 30.33 ? 723 HOH A O     1 
HETATM 3918 O  O     . HOH G 7 .   ? 41.907  24.912 5.459   1.00 23.62 ? 724 HOH A O     1 
HETATM 3919 O  O     . HOH G 7 .   ? 56.896  38.333 2.372   0.54 27.21 ? 725 HOH A O     1 
HETATM 3920 O  O     . HOH G 7 .   ? 73.196  18.842 -9.008  0.65 26.94 ? 726 HOH A O     1 
HETATM 3921 O  O     . HOH G 7 .   ? 64.883  21.128 1.079   1.00 25.68 ? 727 HOH A O     1 
HETATM 3922 O  O     . HOH G 7 .   ? 83.040  37.026 25.904  1.00 33.43 ? 728 HOH A O     1 
HETATM 3923 O  O     . HOH G 7 .   ? 63.835  27.703 -8.826  1.00 41.07 ? 729 HOH A O     1 
HETATM 3924 O  O     . HOH G 7 .   ? 93.607  35.317 5.826   1.00 33.27 ? 730 HOH A O     1 
HETATM 3925 O  O     . HOH G 7 .   ? 65.646  16.693 11.502  1.00 17.81 ? 731 HOH A O     1 
HETATM 3926 O  O     . HOH G 7 .   ? 59.856  39.321 13.065  1.00 21.41 ? 732 HOH A O     1 
HETATM 3927 O  O     . HOH G 7 .   ? 55.134  21.274 14.009  1.00 24.98 ? 733 HOH A O     1 
HETATM 3928 O  O     . HOH G 7 .   ? 67.582  48.301 -19.883 1.00 34.46 ? 734 HOH A O     1 
HETATM 3929 O  O     . HOH G 7 .   ? 87.074  10.294 5.080   1.00 38.96 ? 735 HOH A O     1 
HETATM 3930 O  O     . HOH G 7 .   ? 92.022  40.459 -5.931  1.00 25.96 ? 736 HOH A O     1 
HETATM 3931 O  O     . HOH G 7 .   ? 66.069  38.244 13.037  0.74 27.84 ? 737 HOH A O     1 
HETATM 3932 O  O     . HOH G 7 .   ? 86.263  29.728 13.573  1.00 38.62 ? 738 HOH A O     1 
HETATM 3933 O  O     . HOH G 7 .   ? 85.751  60.904 20.720  1.00 39.49 ? 739 HOH A O     1 
HETATM 3934 O  O     . HOH G 7 .   ? 102.892 47.546 10.309  1.00 35.30 ? 740 HOH A O     1 
HETATM 3935 O  O     . HOH G 7 .   ? 70.734  52.304 -4.532  1.00 45.05 ? 741 HOH A O     1 
HETATM 3936 O  O     A HOH G 7 .   ? 86.433  55.295 -14.880 0.51 20.56 ? 742 HOH A O     1 
HETATM 3937 O  O     B HOH G 7 .   ? 85.693  56.955 -14.158 0.49 23.38 ? 742 HOH A O     1 
HETATM 3938 O  O     . HOH G 7 .   ? 93.927  38.664 -6.407  1.00 21.65 ? 743 HOH A O     1 
HETATM 3939 O  O     . HOH G 7 .   ? 54.335  17.841 4.883   1.00 41.36 ? 744 HOH A O     1 
HETATM 3940 O  O     . HOH G 7 .   ? 87.955  17.250 7.806   1.00 23.53 ? 745 HOH A O     1 
HETATM 3941 O  O     . HOH G 7 .   ? 71.192  16.155 10.312  1.00 20.66 ? 746 HOH A O     1 
HETATM 3942 O  O     . HOH G 7 .   ? 71.199  64.648 -16.049 1.00 30.53 ? 747 HOH A O     1 
HETATM 3943 O  O     . HOH G 7 .   ? 82.545  21.182 -11.116 1.00 32.64 ? 748 HOH A O     1 
HETATM 3944 O  O     . HOH G 7 .   ? 90.813  26.486 -4.478  1.00 23.18 ? 749 HOH A O     1 
HETATM 3945 O  O     . HOH G 7 .   ? 76.292  37.019 -11.914 0.95 42.40 ? 750 HOH A O     1 
HETATM 3946 O  O     . HOH G 7 .   ? 71.820  73.104 9.918   1.00 42.11 ? 751 HOH A O     1 
HETATM 3947 O  O     . HOH G 7 .   ? 53.450  43.092 12.779  1.00 29.99 ? 752 HOH A O     1 
HETATM 3948 O  O     . HOH G 7 .   ? 58.728  28.707 0.153   1.00 22.18 ? 753 HOH A O     1 
HETATM 3949 O  O     . HOH G 7 .   ? 91.209  37.333 8.224   1.00 33.64 ? 754 HOH A O     1 
HETATM 3950 O  O     . HOH G 7 .   ? 86.494  66.004 0.350   1.00 39.21 ? 755 HOH A O     1 
HETATM 3951 O  O     A HOH G 7 .   ? 65.104  24.204 -4.505  0.57 21.22 ? 756 HOH A O     1 
HETATM 3952 O  O     C HOH G 7 .   ? 63.948  24.114 -5.041  0.43 23.68 ? 756 HOH A O     1 
HETATM 3953 O  O     . HOH G 7 .   ? 49.370  37.420 -2.423  0.76 24.95 ? 757 HOH A O     1 
HETATM 3954 O  O     . HOH G 7 .   ? 54.568  32.250 -2.983  1.00 32.33 ? 758 HOH A O     1 
HETATM 3955 O  O     . HOH G 7 .   ? 91.182  53.508 7.213   1.00 31.77 ? 759 HOH A O     1 
HETATM 3956 O  O     . HOH G 7 .   ? 81.850  64.519 -9.840  0.95 39.16 ? 760 HOH A O     1 
HETATM 3957 O  O     . HOH G 7 .   ? 71.856  40.732 -14.233 1.00 35.70 ? 761 HOH A O     1 
HETATM 3958 O  O     . HOH G 7 .   ? 76.237  45.765 -17.356 1.00 42.17 ? 762 HOH A O     1 
HETATM 3959 O  O     . HOH G 7 .   ? 64.391  40.601 13.591  1.00 32.36 ? 763 HOH A O     1 
HETATM 3960 O  O     . HOH G 7 .   ? 77.147  20.466 13.186  1.00 34.46 ? 764 HOH A O     1 
HETATM 3961 O  O     . HOH G 7 .   ? 92.010  40.077 8.572   1.00 33.59 ? 765 HOH A O     1 
HETATM 3962 O  O     . HOH G 7 .   ? 87.697  23.766 14.923  1.00 43.76 ? 766 HOH A O     1 
HETATM 3963 O  O     . HOH G 7 .   ? 75.364  45.831 1.518   1.00 28.29 ? 767 HOH A O     1 
HETATM 3964 O  O     . HOH G 7 .   ? 72.709  18.711 7.664   1.00 13.58 ? 768 HOH A O     1 
HETATM 3965 O  O     . HOH G 7 .   ? 89.122  35.856 -11.131 1.00 34.69 ? 769 HOH A O     1 
HETATM 3966 O  O     . HOH G 7 .   ? 87.776  38.949 13.563  1.00 21.84 ? 770 HOH A O     1 
HETATM 3967 O  O     . HOH G 7 .   ? 77.115  28.370 -12.995 1.00 41.82 ? 771 HOH A O     1 
HETATM 3968 O  O     . HOH G 7 .   ? 87.660  32.752 2.263   1.00 21.83 ? 772 HOH A O     1 
HETATM 3969 O  O     . HOH G 7 .   ? 80.048  42.873 -8.233  1.00 40.29 ? 773 HOH A O     1 
HETATM 3970 O  O     . HOH G 7 .   ? 73.817  72.949 -9.270  1.00 42.71 ? 774 HOH A O     1 
HETATM 3971 O  O     . HOH G 7 .   ? 69.628  80.120 1.770   1.00 33.70 ? 775 HOH A O     1 
HETATM 3972 O  O     . HOH G 7 .   ? 77.817  50.426 -0.530  1.00 36.42 ? 776 HOH A O     1 
HETATM 3973 O  O     . HOH G 7 .   ? 46.755  28.876 16.161  1.00 35.75 ? 777 HOH A O     1 
HETATM 3974 O  O     . HOH G 7 .   ? 63.399  62.692 10.643  1.00 43.74 ? 778 HOH A O     1 
HETATM 3975 O  O     . HOH G 7 .   ? 62.608  17.154 5.941   1.00 18.36 ? 779 HOH A O     1 
HETATM 3976 O  O     . HOH G 7 .   ? 63.793  23.946 -1.900  1.00 18.09 ? 780 HOH A O     1 
HETATM 3977 O  O     . HOH G 7 .   ? 52.252  19.575 12.160  1.00 29.64 ? 781 HOH A O     1 
HETATM 3978 O  O     . HOH G 7 .   ? 79.915  18.363 11.642  1.00 19.33 ? 782 HOH A O     1 
HETATM 3979 O  O     . HOH G 7 .   ? 60.791  18.933 6.127   1.00 35.19 ? 783 HOH A O     1 
HETATM 3980 O  O     . HOH G 7 .   ? 66.256  49.702 -16.951 1.00 28.56 ? 784 HOH A O     1 
HETATM 3981 O  O     . HOH G 7 .   ? 86.928  58.014 18.021  1.00 38.46 ? 785 HOH A O     1 
HETATM 3982 O  O     . HOH G 7 .   ? 63.534  26.191 22.614  1.00 35.05 ? 786 HOH A O     1 
HETATM 3983 O  O     A HOH G 7 .   ? 99.599  38.971 4.847   0.55 22.25 ? 787 HOH A O     1 
HETATM 3984 O  O     B HOH G 7 .   ? 101.594 38.872 4.225   0.45 22.65 ? 787 HOH A O     1 
HETATM 3985 O  O     . HOH G 7 .   ? 70.792  37.443 2.184   1.00 30.55 ? 788 HOH A O     1 
HETATM 3986 O  O     . HOH G 7 .   ? 91.590  52.212 -0.643  1.00 32.42 ? 789 HOH A O     1 
HETATM 3987 O  O     . HOH G 7 .   ? 90.179  54.743 4.217   1.00 31.28 ? 790 HOH A O     1 
HETATM 3988 O  O     A HOH G 7 .   ? 94.426  51.902 9.739   0.64 19.38 ? 791 HOH A O     1 
HETATM 3989 O  O     B HOH G 7 .   ? 93.462  52.638 11.112  0.36 22.73 ? 791 HOH A O     1 
HETATM 3990 O  O     . HOH G 7 .   ? 87.589  53.693 3.835   1.00 18.64 ? 792 HOH A O     1 
HETATM 3991 O  O     . HOH G 7 .   ? 71.472  75.577 9.462   1.00 41.02 ? 793 HOH A O     1 
HETATM 3992 O  O     . HOH G 7 .   ? 60.896  35.186 16.282  1.00 23.14 ? 794 HOH A O     1 
HETATM 3993 O  O     . HOH G 7 .   ? 67.099  32.413 6.159   1.00 17.85 ? 795 HOH A O     1 
HETATM 3994 O  O     . HOH G 7 .   ? 79.579  60.220 14.550  1.00 30.57 ? 796 HOH A O     1 
HETATM 3995 O  O     . HOH G 7 .   ? 75.846  72.893 6.364   1.00 33.69 ? 797 HOH A O     1 
HETATM 3996 O  O     . HOH G 7 .   ? 101.009 49.324 9.223   1.00 31.60 ? 798 HOH A O     1 
HETATM 3997 O  O     . HOH G 7 .   ? 64.800  22.481 24.639  1.00 47.99 ? 799 HOH A O     1 
HETATM 3998 O  O     . HOH G 7 .   ? 81.750  58.317 -4.932  1.00 38.23 ? 800 HOH A O     1 
HETATM 3999 O  O     . HOH G 7 .   ? 99.665  38.783 9.516   1.00 38.46 ? 801 HOH A O     1 
HETATM 4000 O  O     . HOH G 7 .   ? 70.710  72.534 -6.400  1.00 34.98 ? 802 HOH A O     1 
HETATM 4001 O  O     . HOH G 7 .   ? 74.882  20.220 14.803  1.00 35.32 ? 803 HOH A O     1 
HETATM 4002 O  O     . HOH G 7 .   ? 89.042  30.148 3.382   0.50 23.77 ? 804 HOH A O     1 
HETATM 4003 O  O     . HOH G 7 .   ? 93.317  39.497 11.634  1.00 30.55 ? 805 HOH A O     1 
HETATM 4004 O  O     . HOH G 7 .   ? 47.286  22.432 2.634   1.00 35.46 ? 806 HOH A O     1 
HETATM 4005 O  O     . HOH G 7 .   ? 71.023  19.361 -7.237  1.00 27.35 ? 807 HOH A O     1 
HETATM 4006 O  O     . HOH G 7 .   ? 49.126  20.611 7.711   1.00 32.15 ? 808 HOH A O     1 
HETATM 4007 O  O     . HOH G 7 .   ? 68.164  8.928  -3.523  1.00 43.06 ? 809 HOH A O     1 
HETATM 4008 O  O     . HOH G 7 .   ? 78.806  26.424 -12.374 1.00 41.58 ? 810 HOH A O     1 
HETATM 4009 O  O     . HOH G 7 .   ? 61.761  35.152 21.075  1.00 36.64 ? 811 HOH A O     1 
HETATM 4010 O  O     . HOH G 7 .   ? 73.562  25.459 -11.639 1.00 30.48 ? 812 HOH A O     1 
HETATM 4011 O  O     . HOH G 7 .   ? 74.633  17.642 16.889  1.00 40.78 ? 813 HOH A O     1 
HETATM 4012 O  O     . HOH G 7 .   ? 63.133  17.574 -5.299  1.00 27.66 ? 814 HOH A O     1 
HETATM 4013 O  O     . HOH G 7 .   ? 77.368  43.806 15.750  1.00 26.94 ? 815 HOH A O     1 
HETATM 4014 O  O     . HOH G 7 .   ? 58.437  36.258 2.043   1.00 38.40 ? 816 HOH A O     1 
HETATM 4015 O  O     . HOH G 7 .   ? 60.512  37.402 17.516  1.00 32.32 ? 817 HOH A O     1 
HETATM 4016 O  O     . HOH G 7 .   ? 68.292  72.453 12.120  1.00 37.59 ? 818 HOH A O     1 
HETATM 4017 O  O     . HOH G 7 .   ? 44.422  25.597 13.068  1.00 42.09 ? 819 HOH A O     1 
HETATM 4018 O  O     . HOH G 7 .   ? 81.049  59.221 26.716  1.00 37.64 ? 820 HOH A O     1 
HETATM 4019 O  O     . HOH G 7 .   ? 72.764  10.246 3.301   1.00 39.64 ? 821 HOH A O     1 
HETATM 4020 O  O     . HOH G 7 .   ? 53.957  40.975 3.539   1.00 31.34 ? 822 HOH A O     1 
HETATM 4021 O  O     . HOH G 7 .   ? 89.022  60.701 5.002   1.00 31.62 ? 823 HOH A O     1 
HETATM 4022 O  O     . HOH G 7 .   ? 83.054  42.843 -11.846 1.00 36.60 ? 824 HOH A O     1 
HETATM 4023 O  O     . HOH G 7 .   ? 69.458  25.334 -10.878 1.00 41.06 ? 825 HOH A O     1 
HETATM 4024 O  O     . HOH G 7 .   ? 80.711  60.296 24.370  1.00 34.40 ? 826 HOH A O     1 
HETATM 4025 O  O     . HOH G 7 .   ? 48.721  22.189 -0.004  1.00 43.12 ? 827 HOH A O     1 
HETATM 4026 O  O     . HOH G 7 .   ? 88.473  59.548 7.157   1.00 37.90 ? 828 HOH A O     1 
HETATM 4027 O  O     . HOH G 7 .   ? 88.297  27.674 6.658   1.00 33.89 ? 829 HOH A O     1 
HETATM 4028 O  O     . HOH G 7 .   ? 90.724  16.467 7.739   1.00 44.77 ? 830 HOH A O     1 
HETATM 4029 O  O     . HOH G 7 .   ? 45.700  23.898 12.372  1.00 43.94 ? 831 HOH A O     1 
HETATM 4030 O  O     . HOH G 7 .   ? 91.778  47.339 -0.403  1.00 24.08 ? 832 HOH A O     1 
HETATM 4031 O  O     . HOH G 7 .   ? 58.384  39.618 3.870   1.00 24.56 ? 833 HOH A O     1 
HETATM 4032 O  O     . HOH G 7 .   ? 44.358  36.517 1.391   1.00 34.39 ? 834 HOH A O     1 
HETATM 4033 O  O     . HOH G 7 .   ? 75.404  34.722 7.676   1.00 36.83 ? 835 HOH A O     1 
HETATM 4034 O  O     . HOH G 7 .   ? 52.228  17.874 6.165   1.00 38.08 ? 836 HOH A O     1 
HETATM 4035 O  O     . HOH G 7 .   ? 77.035  48.543 -1.755  1.00 35.82 ? 837 HOH A O     1 
HETATM 4036 O  O     . HOH G 7 .   ? 69.433  38.480 -2.503  1.00 39.99 ? 838 HOH A O     1 
HETATM 4037 O  O     . HOH G 7 .   ? 81.458  72.082 -3.942  1.00 43.81 ? 839 HOH A O     1 
HETATM 4038 O  O     . HOH G 7 .   ? 86.856  56.727 20.919  1.00 34.87 ? 840 HOH A O     1 
HETATM 4039 O  O     . HOH G 7 .   ? 80.014  58.512 -2.082  1.00 33.93 ? 841 HOH A O     1 
HETATM 4040 O  O     . HOH G 7 .   ? 73.980  9.536  13.093  1.00 44.05 ? 842 HOH A O     1 
HETATM 4041 O  O     . HOH G 7 .   ? 72.230  13.081 20.062  1.00 43.57 ? 843 HOH A O     1 
HETATM 4042 O  O     . HOH G 7 .   ? 89.760  46.107 25.589  1.00 32.19 ? 844 HOH A O     1 
HETATM 4043 O  O     . HOH G 7 .   ? 69.395  12.093 -0.127  1.00 28.01 ? 845 HOH A O     1 
HETATM 4044 O  O     . HOH G 7 .   ? 84.999  60.660 -4.201  1.00 49.68 ? 846 HOH A O     1 
HETATM 4045 O  O     . HOH G 7 .   ? 85.357  65.125 3.481   1.00 28.09 ? 847 HOH A O     1 
HETATM 4046 O  O     . HOH G 7 .   ? 60.365  30.735 -8.336  0.77 31.20 ? 848 HOH A O     1 
HETATM 4047 O  O     . HOH G 7 .   ? 101.627 43.468 12.680  1.00 37.21 ? 849 HOH A O     1 
HETATM 4048 O  O     . HOH G 7 .   ? 66.528  71.919 13.573  1.00 45.92 ? 850 HOH A O     1 
HETATM 4049 O  O     . HOH G 7 .   ? 59.604  18.446 2.809   1.00 39.89 ? 851 HOH A O     1 
HETATM 4050 O  O     . HOH G 7 .   ? 79.859  44.284 -16.603 1.00 44.53 ? 852 HOH A O     1 
HETATM 4051 O  O     . HOH G 7 .   ? 56.789  35.691 0.238   1.00 40.15 ? 853 HOH A O     1 
HETATM 4052 O  O     . HOH G 7 .   ? 73.805  45.718 17.067  1.00 44.36 ? 854 HOH A O     1 
HETATM 4053 O  O     . HOH G 7 .   ? 60.610  54.615 3.748   1.00 39.47 ? 855 HOH A O     1 
HETATM 4054 O  O     . HOH G 7 .   ? 68.058  36.191 7.143   1.00 36.39 ? 856 HOH A O     1 
HETATM 4055 O  O     A HOH G 7 .   ? 67.777  28.324 17.879  0.53 27.88 ? 857 HOH A O     1 
HETATM 4056 O  O     B HOH G 7 .   ? 69.415  29.312 16.933  0.47 26.19 ? 857 HOH A O     1 
HETATM 4057 O  O     . HOH G 7 .   ? 63.742  17.642 17.167  1.00 34.98 ? 858 HOH A O     1 
HETATM 4058 O  O     . HOH G 7 .   ? 86.561  52.896 -20.504 1.00 37.11 ? 859 HOH A O     1 
HETATM 4059 O  O     . HOH G 7 .   ? 89.999  52.902 -2.386  1.00 43.81 ? 860 HOH A O     1 
HETATM 4060 O  O     . HOH G 7 .   ? 79.129  39.264 23.499  1.00 42.97 ? 861 HOH A O     1 
HETATM 4061 O  O     . HOH G 7 .   ? 76.907  34.158 12.869  1.00 47.17 ? 862 HOH A O     1 
HETATM 4062 O  O     . HOH G 7 .   ? 58.784  29.317 -2.315  1.00 33.45 ? 863 HOH A O     1 
HETATM 4063 O  O     . HOH G 7 .   ? 62.503  53.414 -4.487  1.00 46.54 ? 864 HOH A O     1 
HETATM 4064 O  O     . HOH G 7 .   ? 81.430  47.136 -10.785 1.00 45.81 ? 865 HOH A O     1 
HETATM 4065 O  O     . HOH G 7 .   ? 99.561  51.279 8.400   1.00 39.36 ? 866 HOH A O     1 
HETATM 4066 O  O     A HOH G 7 .   ? 92.642  28.918 -8.451  0.47 24.39 ? 867 HOH A O     1 
HETATM 4067 O  O     B HOH G 7 .   ? 90.752  28.502 -9.527  0.53 33.13 ? 867 HOH A O     1 
HETATM 4068 O  O     . HOH G 7 .   ? 83.207  28.592 13.655  1.00 45.42 ? 868 HOH A O     1 
HETATM 4069 O  O     . HOH G 7 .   ? 81.515  63.992 21.531  1.00 50.30 ? 869 HOH A O     1 
HETATM 4070 O  O     . HOH G 7 .   ? 69.606  67.297 -22.100 1.00 46.05 ? 870 HOH A O     1 
HETATM 4071 O  O     . HOH G 7 .   ? 46.642  33.162 18.877  1.00 42.86 ? 871 HOH A O     1 
HETATM 4072 O  O     . HOH G 7 .   ? 84.760  47.179 -10.767 1.00 51.10 ? 872 HOH A O     1 
HETATM 4073 O  O     A HOH G 7 .   ? 94.602  39.763 5.098   0.43 21.88 ? 873 HOH A O     1 
HETATM 4074 O  O     B HOH G 7 .   ? 92.345  40.436 6.241   0.27 13.59 ? 873 HOH A O     1 
HETATM 4075 O  O     C HOH G 7 .   ? 95.002  39.304 7.539   0.29 21.14 ? 873 HOH A O     1 
HETATM 4076 O  O     . HOH G 7 .   ? 61.939  26.276 24.756  1.00 32.37 ? 874 HOH A O     1 
HETATM 4077 O  O     . HOH G 7 .   ? 88.844  30.149 12.574  1.00 40.24 ? 875 HOH A O     1 
HETATM 4078 O  O     . HOH G 7 .   ? 79.826  37.110 16.894  1.00 37.10 ? 876 HOH A O     1 
HETATM 4079 O  O     . HOH G 7 .   ? 66.071  13.652 3.394   1.00 36.33 ? 877 HOH A O     1 
HETATM 4080 O  O     . HOH G 7 .   ? 62.460  76.086 -13.055 1.00 54.38 ? 878 HOH A O     1 
HETATM 4081 O  O     A HOH G 7 .   ? 65.654  15.865 -6.762  0.52 29.00 ? 879 HOH A O     1 
HETATM 4082 O  O     B HOH G 7 .   ? 64.618  14.989 -5.283  0.48 28.43 ? 879 HOH A O     1 
HETATM 4083 O  O     . HOH G 7 .   ? 88.716  37.387 9.944   1.00 36.69 ? 880 HOH A O     1 
HETATM 4084 O  O     . HOH G 7 .   ? 78.871  24.157 -14.496 1.00 43.46 ? 881 HOH A O     1 
HETATM 4085 O  O     A HOH G 7 .   ? 71.087  25.339 15.480  0.56 32.11 ? 882 HOH A O     1 
HETATM 4086 O  O     B HOH G 7 .   ? 71.916  23.688 15.462  0.44 27.27 ? 882 HOH A O     1 
HETATM 4087 O  O     . HOH G 7 .   ? 89.267  43.705 -8.680  1.00 40.78 ? 883 HOH A O     1 
HETATM 4088 O  O     A HOH G 7 .   ? 73.823  42.770 -13.575 0.63 26.50 ? 884 HOH A O     1 
HETATM 4089 O  O     B HOH G 7 .   ? 74.900  41.726 -13.349 0.37 24.18 ? 884 HOH A O     1 
HETATM 4090 O  O     . HOH G 7 .   ? 57.932  43.976 14.004  1.00 37.57 ? 885 HOH A O     1 
HETATM 4091 O  O     . HOH G 7 .   ? 87.652  35.885 18.742  1.00 41.50 ? 886 HOH A O     1 
HETATM 4092 O  O     . HOH G 7 .   ? 73.411  73.975 11.551  1.00 52.48 ? 887 HOH A O     1 
HETATM 4093 O  O     . HOH G 7 .   ? 70.990  33.849 9.363   1.00 31.45 ? 888 HOH A O     1 
HETATM 4094 O  O     . HOH G 7 .   ? 78.325  43.251 13.657  1.00 30.57 ? 889 HOH A O     1 
HETATM 4095 O  O     . HOH G 7 .   ? 93.133  28.080 -4.091  1.00 36.72 ? 890 HOH A O     1 
HETATM 4096 O  O     . HOH G 7 .   ? 85.290  27.656 15.047  1.00 39.80 ? 891 HOH A O     1 
HETATM 4097 O  O     . HOH G 7 .   ? 51.633  41.855 14.807  1.00 37.70 ? 892 HOH A O     1 
HETATM 4098 O  O     . HOH G 7 .   ? 89.096  27.850 3.550   1.00 34.79 ? 893 HOH A O     1 
HETATM 4099 O  O     . HOH G 7 .   ? 90.563  24.219 1.313   1.00 34.80 ? 894 HOH A O     1 
HETATM 4100 O  O     . HOH G 7 .   ? 53.456  41.819 17.204  1.00 38.20 ? 895 HOH A O     1 
HETATM 4101 O  O     A HOH G 7 .   ? 55.875  18.077 7.283   0.65 32.39 ? 896 HOH A O     1 
HETATM 4102 O  O     B HOH G 7 .   ? 55.064  16.269 7.324   0.35 28.01 ? 896 HOH A O     1 
HETATM 4103 O  O     . HOH G 7 .   ? 58.788  18.716 7.523   1.00 34.03 ? 897 HOH A O     1 
HETATM 4104 O  O     . HOH G 7 .   ? 71.504  7.893  7.227   1.00 41.57 ? 898 HOH A O     1 
HETATM 4105 O  O     . HOH G 7 .   ? 52.723  38.782 19.431  1.00 46.08 ? 899 HOH A O     1 
HETATM 4106 O  O     . HOH G 7 .   ? 79.864  20.166 16.629  1.00 35.98 ? 900 HOH A O     1 
HETATM 4107 O  O     . HOH G 7 .   ? 66.313  28.043 -10.117 1.00 28.10 ? 901 HOH A O     1 
HETATM 4108 O  O     . HOH G 7 .   ? 56.689  34.552 -2.597  1.00 43.29 ? 902 HOH A O     1 
HETATM 4109 O  O     . HOH G 7 .   ? 40.361  25.514 7.539   1.00 39.26 ? 903 HOH A O     1 
HETATM 4110 O  O     . HOH G 7 .   ? 86.995  47.525 -8.283  1.00 39.30 ? 904 HOH A O     1 
HETATM 4111 O  O     . HOH G 7 .   ? 88.807  36.893 21.663  1.00 40.67 ? 905 HOH A O     1 
HETATM 4112 O  O     A HOH G 7 .   ? 81.583  48.771 -7.100  0.31 24.68 ? 906 HOH A O     1 
HETATM 4113 O  O     B HOH G 7 .   ? 79.964  48.025 -6.438  0.37 23.15 ? 906 HOH A O     1 
HETATM 4114 O  O     C HOH G 7 .   ? 83.205  48.907 -7.060  0.32 19.27 ? 906 HOH A O     1 
HETATM 4115 O  O     . HOH G 7 .   ? 58.424  34.722 19.925  0.82 29.43 ? 907 HOH A O     1 
HETATM 4116 O  O     . HOH G 7 .   ? 55.980  34.478 21.275  1.00 38.63 ? 908 HOH A O     1 
HETATM 4117 O  O     . HOH G 7 .   ? 85.756  55.319 28.667  1.00 35.59 ? 909 HOH A O     1 
HETATM 4118 O  O     . HOH G 7 .   ? 85.359  9.887  6.659   1.00 43.91 ? 910 HOH A O     1 
HETATM 4119 O  O     A HOH G 7 .   ? 73.111  5.018  19.513  0.56 32.98 ? 911 HOH A O     1 
HETATM 4120 O  O     B HOH G 7 .   ? 74.034  6.183  19.502  0.44 36.21 ? 911 HOH A O     1 
HETATM 4121 O  O     . HOH G 7 .   ? 57.466  39.849 0.072   1.00 39.96 ? 912 HOH A O     1 
HETATM 4122 O  O     . HOH G 7 .   ? 92.257  42.350 -7.946  1.00 31.74 ? 913 HOH A O     1 
HETATM 4123 O  O     . HOH G 7 .   ? 87.926  35.782 12.692  1.00 38.18 ? 914 HOH A O     1 
HETATM 4124 O  O     . HOH G 7 .   ? 94.466  44.356 22.718  1.00 29.70 ? 915 HOH A O     1 
HETATM 4125 O  O     . HOH G 7 .   ? 75.241  35.343 10.538  1.00 32.02 ? 916 HOH A O     1 
HETATM 4126 O  O     . HOH G 7 .   ? 55.097  44.362 14.395  1.00 42.60 ? 917 HOH A O     1 
HETATM 4127 O  O     . HOH G 7 .   ? 79.702  62.916 24.276  1.00 42.79 ? 918 HOH A O     1 
HETATM 4128 O  O     . HOH H 7 .   ? 66.882  48.339 -6.613  1.00 40.80 ? 201 HOH T O     1 
HETATM 4129 O  O     . HOH H 7 .   ? 72.876  67.317 16.648  1.00 48.61 ? 202 HOH T O     1 
HETATM 4130 O  O     . HOH H 7 .   ? 69.087  50.272 10.798  0.93 42.01 ? 203 HOH T O     1 
HETATM 4131 O  O     . HOH H 7 .   ? 66.063  64.606 13.682  1.00 47.39 ? 204 HOH T O     1 
HETATM 4132 O  O     . HOH H 7 .   ? 77.755  53.023 6.113   1.00 32.33 ? 205 HOH T O     1 
HETATM 4133 O  O     . HOH H 7 .   ? 66.606  50.550 -3.771  1.00 32.49 ? 206 HOH T O     1 
HETATM 4134 O  O     . HOH H 7 .   ? 64.230  45.473 -7.857  1.00 39.64 ? 207 HOH T O     1 
HETATM 4135 O  O     . HOH H 7 .   ? 74.373  41.026 10.455  0.74 35.86 ? 208 HOH T O     1 
HETATM 4136 O  O     . HOH H 7 .   ? 59.958  49.550 -7.054  1.00 38.49 ? 209 HOH T O     1 
HETATM 4137 O  O     . HOH H 7 .   ? 77.466  48.060 2.926   1.00 34.97 ? 210 HOH T O     1 
HETATM 4138 O  O     . HOH H 7 .   ? 77.674  50.540 5.155   1.00 31.98 ? 211 HOH T O     1 
HETATM 4139 O  O     . HOH H 7 .   ? 80.212  55.816 -0.660  1.00 21.19 ? 212 HOH T O     1 
HETATM 4140 O  O     . HOH H 7 .   ? 77.306  40.702 12.502  1.00 26.26 ? 213 HOH T O     1 
HETATM 4141 O  O     . HOH H 7 .   ? 76.026  54.980 15.791  1.00 42.94 ? 214 HOH T O     1 
HETATM 4142 O  O     . HOH H 7 .   ? 76.456  50.708 2.738   1.00 33.03 ? 215 HOH T O     1 
HETATM 4143 O  O     . HOH H 7 .   ? 77.843  65.176 13.544  0.98 47.84 ? 216 HOH T O     1 
HETATM 4144 O  O     . HOH H 7 .   ? 72.537  58.059 20.373  0.88 48.07 ? 217 HOH T O     1 
HETATM 4145 O  O     . HOH H 7 .   ? 47.843  42.210 -3.010  1.00 34.01 ? 218 HOH T O     1 
HETATM 4146 O  O     . HOH H 7 .   ? 80.874  43.476 12.233  1.00 17.44 ? 219 HOH T O     1 
HETATM 4147 O  O     . HOH H 7 .   ? 71.992  57.500 4.640   1.00 26.26 ? 220 HOH T O     1 
HETATM 4148 O  O     A HOH H 7 .   ? 68.935  56.512 10.789  0.58 32.63 ? 221 HOH T O     1 
HETATM 4149 O  O     B HOH H 7 .   ? 68.473  56.195 8.813   0.42 32.12 ? 221 HOH T O     1 
HETATM 4150 O  O     . HOH H 7 .   ? 59.831  46.974 -7.398  1.00 33.48 ? 222 HOH T O     1 
HETATM 4151 O  O     . HOH H 7 .   ? 52.386  43.572 -6.484  1.00 30.71 ? 223 HOH T O     1 
HETATM 4152 O  O     . HOH H 7 .   ? 81.719  44.674 7.657   1.00 15.54 ? 224 HOH T O     1 
HETATM 4153 O  O     . HOH H 7 .   ? 69.970  54.229 19.761  1.00 54.94 ? 225 HOH T O     1 
HETATM 4154 O  O     . HOH H 7 .   ? 44.879  53.369 -3.998  1.00 37.91 ? 226 HOH T O     1 
HETATM 4155 O  O     . HOH H 7 .   ? 50.754  50.671 -1.855  1.00 37.90 ? 227 HOH T O     1 
HETATM 4156 O  O     . HOH H 7 .   ? 77.475  56.047 -3.279  1.00 27.05 ? 228 HOH T O     1 
HETATM 4157 O  O     . HOH H 7 .   ? 60.717  43.175 -1.131  1.00 31.34 ? 229 HOH T O     1 
HETATM 4158 O  O     . HOH H 7 .   ? 65.349  52.096 -1.405  1.00 39.44 ? 230 HOH T O     1 
HETATM 4159 O  O     . HOH H 7 .   ? 71.600  44.821 11.034  1.00 40.49 ? 231 HOH T O     1 
HETATM 4160 O  O     . HOH H 7 .   ? 67.242  62.105 12.036  1.00 50.60 ? 232 HOH T O     1 
HETATM 4161 O  O     . HOH H 7 .   ? 76.219  38.054 9.852   1.00 35.40 ? 233 HOH T O     1 
HETATM 4162 O  O     . HOH H 7 .   ? 69.655  54.580 6.996   1.00 44.76 ? 234 HOH T O     1 
HETATM 4163 O  O     A HOH H 7 .   ? 64.104  42.646 -1.059  0.63 22.63 ? 235 HOH T O     1 
HETATM 4164 O  O     B HOH H 7 .   ? 65.387  41.778 -1.937  0.37 22.51 ? 235 HOH T O     1 
HETATM 4165 O  O     A HOH H 7 .   ? 72.462  44.176 -6.069  0.50 32.00 ? 236 HOH T O     1 
HETATM 4166 O  O     B HOH H 7 .   ? 72.836  43.814 -4.096  0.50 30.09 ? 236 HOH T O     1 
HETATM 4167 O  O     . HOH H 7 .   ? 72.581  55.340 -0.473  0.63 20.35 ? 237 HOH T O     1 
HETATM 4168 O  O     . HOH H 7 .   ? 72.963  46.762 -0.262  1.00 45.29 ? 238 HOH T O     1 
HETATM 4169 O  O     . HOH H 7 .   ? 57.210  46.585 -8.498  1.00 41.32 ? 239 HOH T O     1 
HETATM 4170 O  O     . HOH H 7 .   ? 68.067  43.169 -0.853  1.00 39.64 ? 240 HOH T O     1 
HETATM 4171 O  O     . HOH H 7 .   ? 44.370  49.944 -1.807  1.00 41.49 ? 241 HOH T O     1 
HETATM 4172 O  O     A HOH H 7 .   ? 49.897  55.272 -5.866  0.40 24.41 ? 242 HOH T O     1 
HETATM 4173 O  O     B HOH H 7 .   ? 48.699  56.399 -5.215  0.60 25.69 ? 242 HOH T O     1 
HETATM 4174 O  O     . HOH H 7 .   ? 74.999  48.245 0.575   0.84 40.60 ? 243 HOH T O     1 
HETATM 4175 O  O     . HOH H 7 .   ? 75.939  62.065 11.127  1.00 41.04 ? 244 HOH T O     1 
HETATM 4176 O  O     . HOH H 7 .   ? 53.642  41.640 1.231   1.00 37.43 ? 245 HOH T O     1 
HETATM 4177 O  O     . HOH H 7 .   ? 77.234  59.760 12.888  1.00 45.22 ? 246 HOH T O     1 
HETATM 4178 O  O     . HOH H 7 .   ? 74.539  38.787 11.836  1.00 40.72 ? 247 HOH T O     1 
HETATM 4179 O  O     . HOH H 7 .   ? 69.276  51.669 15.316  1.00 47.85 ? 248 HOH T O     1 
HETATM 4180 O  O     . HOH I 7 .   ? 58.603  62.223 -10.078 1.00 37.12 ? 101 HOH P O     1 
HETATM 4181 O  O     . HOH I 7 .   ? 68.323  42.096 9.470   1.00 40.01 ? 102 HOH P O     1 
HETATM 4182 O  O     . HOH I 7 .   ? 63.370  43.726 9.574   1.00 27.80 ? 103 HOH P O     1 
HETATM 4183 O  O     A HOH I 7 .   ? 58.440  59.191 -7.370  0.58 21.72 ? 104 HOH P O     1 
HETATM 4184 O  O     B HOH I 7 .   ? 59.250  58.335 -9.070  0.42 24.09 ? 104 HOH P O     1 
HETATM 4185 O  O     . HOH I 7 .   ? 68.596  48.144 8.716   1.00 29.68 ? 105 HOH P O     1 
HETATM 4186 O  O     . HOH I 7 .   ? 58.401  55.558 2.458   1.00 41.56 ? 106 HOH P O     1 
HETATM 4187 O  O     . HOH I 7 .   ? 70.534  43.996 2.079   1.00 26.71 ? 107 HOH P O     1 
HETATM 4188 O  O     . HOH I 7 .   ? 60.305  43.393 1.450   1.00 30.95 ? 108 HOH P O     1 
HETATM 4189 O  O     . HOH I 7 .   ? 65.571  37.695 9.228   1.00 23.98 ? 109 HOH P O     1 
HETATM 4190 O  O     . HOH I 7 .   ? 58.851  54.162 -9.145  1.00 41.64 ? 110 HOH P O     1 
HETATM 4191 O  O     . HOH I 7 .   ? 55.828  64.517 -9.745  1.00 32.53 ? 111 HOH P O     1 
HETATM 4192 O  O     . HOH I 7 .   ? 64.522  42.344 1.654   1.00 30.32 ? 112 HOH P O     1 
HETATM 4193 O  O     . HOH I 7 .   ? 72.284  42.634 9.450   0.78 37.33 ? 113 HOH P O     1 
HETATM 4194 O  O     . HOH I 7 .   ? 56.608  41.528 4.479   1.00 25.49 ? 114 HOH P O     1 
HETATM 4195 O  O     . HOH I 7 .   ? 52.651  51.954 -0.469  1.00 38.50 ? 115 HOH P O     1 
HETATM 4196 O  O     . HOH I 7 .   ? 65.433  47.845 8.251   1.00 47.74 ? 116 HOH P O     1 
HETATM 4197 O  O     . HOH I 7 .   ? 57.261  43.343 2.532   1.00 34.08 ? 117 HOH P O     1 
HETATM 4198 O  O     . HOH I 7 .   ? 65.216  49.970 7.628   1.00 36.99 ? 118 HOH P O     1 
HETATM 4199 O  O     . HOH I 7 .   ? 63.211  40.279 2.569   1.00 31.23 ? 119 HOH P O     1 
HETATM 4200 O  O     . HOH I 7 .   ? 60.318  40.653 2.142   1.00 29.23 ? 120 HOH P O     1 
HETATM 4201 O  O     A HOH I 7 .   ? 61.339  55.311 -6.822  0.62 34.52 ? 121 HOH P O     1 
HETATM 4202 O  O     B HOH I 7 .   ? 60.450  56.547 -7.146  0.38 23.53 ? 121 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 ?   ?   ?   A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 ?   ?   ?   A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 ?   ?   ?   A . n 
A 1 414 ILE 414 411 ?   ?   ?   A . n 
A 1 415 GLN 415 412 ?   ?   ?   A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   8OG 4   4   4   8OG 8OG T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 GOL 1   501 2   GOL GOL A . 
E 5 CA  1   502 1   CA  CA  A . 
F 6 CTP 1   101 1   CTP CTP T . 
G 7 HOH 1   601 340 HOH HOH A . 
G 7 HOH 2   602 324 HOH HOH A . 
G 7 HOH 3   603 331 HOH HOH A . 
G 7 HOH 4   604 426 HOH HOH A . 
G 7 HOH 5   605 287 HOH HOH A . 
G 7 HOH 6   606 27  HOH WAT A . 
G 7 HOH 7   607 532 HOH HOH A . 
G 7 HOH 8   608 92  HOH WAT A . 
G 7 HOH 9   609 339 HOH HOH A . 
G 7 HOH 10  610 488 HOH HOH A . 
G 7 HOH 11  611 477 HOH HOH A . 
G 7 HOH 12  612 478 HOH HOH A . 
G 7 HOH 13  613 294 HOH HOH A . 
G 7 HOH 14  614 409 HOH HOH A . 
G 7 HOH 15  615 421 HOH HOH A . 
G 7 HOH 16  616 269 HOH WAT A . 
G 7 HOH 17  617 493 HOH HOH A . 
G 7 HOH 18  618 127 HOH WAT A . 
G 7 HOH 19  619 160 HOH WAT A . 
G 7 HOH 20  620 297 HOH HOH A . 
G 7 HOH 21  621 489 HOH HOH A . 
G 7 HOH 22  622 411 HOH HOH A . 
G 7 HOH 23  623 466 HOH HOH A . 
G 7 HOH 24  624 161 HOH WAT A . 
G 7 HOH 25  625 338 HOH HOH A . 
G 7 HOH 26  626 271 HOH WAT A . 
G 7 HOH 27  627 291 HOH HOH A . 
G 7 HOH 28  628 315 HOH HOH A . 
G 7 HOH 29  629 256 HOH WAT A . 
G 7 HOH 30  630 19  HOH WAT A . 
G 7 HOH 31  631 412 HOH HOH A . 
G 7 HOH 32  632 534 HOH HOH A . 
G 7 HOH 33  633 289 HOH HOH A . 
G 7 HOH 34  634 414 HOH HOH A . 
G 7 HOH 35  635 418 HOH HOH A . 
G 7 HOH 36  636 360 HOH HOH A . 
G 7 HOH 37  637 8   HOH WAT A . 
G 7 HOH 38  638 400 HOH HOH A . 
G 7 HOH 39  639 186 HOH WAT A . 
G 7 HOH 40  640 455 HOH HOH A . 
G 7 HOH 41  641 95  HOH WAT A . 
G 7 HOH 42  642 329 HOH HOH A . 
G 7 HOH 43  643 274 HOH WAT A . 
G 7 HOH 44  644 56  HOH WAT A . 
G 7 HOH 45  645 385 HOH HOH A . 
G 7 HOH 46  646 384 HOH HOH A . 
G 7 HOH 47  647 21  HOH WAT A . 
G 7 HOH 48  648 63  HOH WAT A . 
G 7 HOH 49  649 155 HOH WAT A . 
G 7 HOH 50  650 449 HOH HOH A . 
G 7 HOH 51  651 533 HOH HOH A . 
G 7 HOH 52  652 254 HOH WAT A . 
G 7 HOH 53  653 273 HOH WAT A . 
G 7 HOH 54  654 182 HOH WAT A . 
G 7 HOH 55  655 82  HOH WAT A . 
G 7 HOH 56  656 54  HOH WAT A . 
G 7 HOH 57  657 514 HOH HOH A . 
G 7 HOH 58  658 434 HOH HOH A . 
G 7 HOH 59  659 415 HOH HOH A . 
G 7 HOH 60  660 498 HOH HOH A . 
G 7 HOH 61  661 153 HOH WAT A . 
G 7 HOH 62  662 152 HOH WAT A . 
G 7 HOH 63  663 522 HOH HOH A . 
G 7 HOH 64  664 194 HOH WAT A . 
G 7 HOH 65  665 228 HOH WAT A . 
G 7 HOH 66  666 188 HOH WAT A . 
G 7 HOH 67  667 462 HOH HOH A . 
G 7 HOH 68  668 167 HOH WAT A . 
G 7 HOH 69  669 129 HOH WAT A . 
G 7 HOH 70  670 387 HOH HOH A . 
G 7 HOH 71  671 149 HOH WAT A . 
G 7 HOH 72  672 391 HOH HOH A . 
G 7 HOH 73  673 506 HOH HOH A . 
G 7 HOH 74  674 14  HOH WAT A . 
G 7 HOH 75  675 138 HOH WAT A . 
G 7 HOH 76  676 399 HOH HOH A . 
G 7 HOH 77  677 72  HOH WAT A . 
G 7 HOH 78  678 336 HOH HOH A . 
G 7 HOH 79  679 51  HOH WAT A . 
G 7 HOH 80  680 36  HOH WAT A . 
G 7 HOH 81  681 61  HOH WAT A . 
G 7 HOH 82  682 29  HOH WAT A . 
G 7 HOH 83  683 218 HOH WAT A . 
G 7 HOH 84  684 487 HOH HOH A . 
G 7 HOH 85  685 253 HOH WAT A . 
G 7 HOH 86  686 393 HOH HOH A . 
G 7 HOH 87  687 147 HOH WAT A . 
G 7 HOH 88  688 365 HOH HOH A . 
G 7 HOH 89  689 504 HOH HOH A . 
G 7 HOH 90  690 310 HOH HOH A . 
G 7 HOH 91  691 311 HOH HOH A . 
G 7 HOH 92  692 146 HOH WAT A . 
G 7 HOH 93  693 83  HOH WAT A . 
G 7 HOH 94  694 217 HOH WAT A . 
G 7 HOH 95  695 284 HOH WAT A . 
G 7 HOH 96  696 495 HOH HOH A . 
G 7 HOH 97  697 12  HOH WAT A . 
G 7 HOH 98  698 22  HOH WAT A . 
G 7 HOH 99  699 20  HOH WAT A . 
G 7 HOH 100 700 140 HOH WAT A . 
G 7 HOH 101 701 451 HOH HOH A . 
G 7 HOH 102 702 261 HOH WAT A . 
G 7 HOH 103 703 468 HOH HOH A . 
G 7 HOH 104 704 166 HOH WAT A . 
G 7 HOH 105 705 15  HOH WAT A . 
G 7 HOH 106 706 17  HOH WAT A . 
G 7 HOH 107 707 41  HOH WAT A . 
G 7 HOH 108 708 208 HOH WAT A . 
G 7 HOH 109 709 165 HOH WAT A . 
G 7 HOH 110 710 68  HOH WAT A . 
G 7 HOH 111 711 303 HOH HOH A . 
G 7 HOH 112 712 270 HOH WAT A . 
G 7 HOH 113 713 98  HOH WAT A . 
G 7 HOH 114 714 395 HOH HOH A . 
G 7 HOH 115 715 134 HOH WAT A . 
G 7 HOH 116 716 101 HOH WAT A . 
G 7 HOH 117 717 425 HOH HOH A . 
G 7 HOH 118 718 326 HOH HOH A . 
G 7 HOH 119 719 67  HOH WAT A . 
G 7 HOH 120 720 290 HOH HOH A . 
G 7 HOH 121 721 282 HOH WAT A . 
G 7 HOH 122 722 464 HOH HOH A . 
G 7 HOH 123 723 145 HOH WAT A . 
G 7 HOH 124 724 89  HOH WAT A . 
G 7 HOH 125 725 480 HOH HOH A . 
G 7 HOH 126 726 525 HOH HOH A . 
G 7 HOH 127 727 53  HOH WAT A . 
G 7 HOH 128 728 306 HOH HOH A . 
G 7 HOH 129 729 446 HOH HOH A . 
G 7 HOH 130 730 293 HOH HOH A . 
G 7 HOH 131 731 13  HOH WAT A . 
G 7 HOH 132 732 97  HOH WAT A . 
G 7 HOH 133 733 295 HOH HOH A . 
G 7 HOH 134 734 79  HOH WAT A . 
G 7 HOH 135 735 206 HOH WAT A . 
G 7 HOH 136 736 58  HOH WAT A . 
G 7 HOH 137 737 458 HOH HOH A . 
G 7 HOH 138 738 131 HOH WAT A . 
G 7 HOH 139 739 492 HOH HOH A . 
G 7 HOH 140 740 420 HOH HOH A . 
G 7 HOH 141 741 119 HOH WAT A . 
G 7 HOH 142 742 170 HOH WAT A . 
G 7 HOH 143 743 328 HOH HOH A . 
G 7 HOH 144 744 382 HOH HOH A . 
G 7 HOH 145 745 76  HOH WAT A . 
G 7 HOH 146 746 28  HOH WAT A . 
G 7 HOH 147 747 156 HOH WAT A . 
G 7 HOH 148 748 334 HOH HOH A . 
G 7 HOH 149 749 55  HOH WAT A . 
G 7 HOH 150 750 474 HOH HOH A . 
G 7 HOH 151 751 397 HOH HOH A . 
G 7 HOH 152 752 190 HOH WAT A . 
G 7 HOH 153 753 66  HOH WAT A . 
G 7 HOH 154 754 292 HOH HOH A . 
G 7 HOH 155 755 448 HOH HOH A . 
G 7 HOH 156 756 32  HOH WAT A . 
G 7 HOH 157 757 536 HOH HOH A . 
G 7 HOH 158 758 40  HOH WAT A . 
G 7 HOH 159 759 202 HOH WAT A . 
G 7 HOH 160 760 524 HOH HOH A . 
G 7 HOH 161 761 157 HOH WAT A . 
G 7 HOH 162 762 513 HOH HOH A . 
G 7 HOH 163 763 364 HOH HOH A . 
G 7 HOH 164 764 286 HOH WAT A . 
G 7 HOH 165 765 457 HOH HOH A . 
G 7 HOH 166 766 505 HOH HOH A . 
G 7 HOH 167 767 77  HOH WAT A . 
G 7 HOH 168 768 39  HOH WAT A . 
G 7 HOH 169 769 330 HOH HOH A . 
G 7 HOH 170 770 35  HOH WAT A . 
G 7 HOH 171 771 469 HOH HOH A . 
G 7 HOH 172 772 73  HOH WAT A . 
G 7 HOH 173 773 475 HOH HOH A . 
G 7 HOH 174 774 404 HOH HOH A . 
G 7 HOH 175 775 431 HOH HOH A . 
G 7 HOH 176 776 428 HOH HOH A . 
G 7 HOH 177 777 389 HOH HOH A . 
G 7 HOH 178 778 503 HOH HOH A . 
G 7 HOH 179 779 25  HOH WAT A . 
G 7 HOH 180 780 43  HOH WAT A . 
G 7 HOH 181 781 91  HOH WAT A . 
G 7 HOH 182 782 46  HOH WAT A . 
G 7 HOH 183 783 417 HOH HOH A . 
G 7 HOH 184 784 197 HOH WAT A . 
G 7 HOH 185 785 476 HOH HOH A . 
G 7 HOH 186 786 416 HOH HOH A . 
G 7 HOH 187 787 124 HOH WAT A . 
G 7 HOH 188 788 352 HOH HOH A . 
G 7 HOH 189 789 257 HOH WAT A . 
G 7 HOH 190 790 59  HOH WAT A . 
G 7 HOH 191 791 80  HOH WAT A . 
G 7 HOH 192 792 24  HOH WAT A . 
G 7 HOH 193 793 224 HOH WAT A . 
G 7 HOH 194 794 48  HOH WAT A . 
G 7 HOH 195 795 18  HOH WAT A . 
G 7 HOH 196 796 69  HOH WAT A . 
G 7 HOH 197 797 114 HOH WAT A . 
G 7 HOH 198 798 226 HOH WAT A . 
G 7 HOH 199 799 436 HOH HOH A . 
G 7 HOH 200 800 518 HOH HOH A . 
G 7 HOH 201 801 435 HOH HOH A . 
G 7 HOH 202 802 511 HOH HOH A . 
G 7 HOH 203 803 75  HOH WAT A . 
G 7 HOH 204 804 419 HOH HOH A . 
G 7 HOH 205 805 52  HOH WAT A . 
G 7 HOH 206 806 158 HOH WAT A . 
G 7 HOH 207 807 81  HOH WAT A . 
G 7 HOH 208 808 96  HOH WAT A . 
G 7 HOH 209 809 437 HOH HOH A . 
G 7 HOH 210 810 491 HOH HOH A . 
G 7 HOH 211 811 386 HOH HOH A . 
G 7 HOH 212 812 90  HOH WAT A . 
G 7 HOH 213 813 483 HOH HOH A . 
G 7 HOH 214 814 84  HOH WAT A . 
G 7 HOH 215 815 528 HOH HOH A . 
G 7 HOH 216 816 358 HOH HOH A . 
G 7 HOH 217 817 363 HOH HOH A . 
G 7 HOH 218 818 396 HOH HOH A . 
G 7 HOH 219 819 496 HOH HOH A . 
G 7 HOH 220 820 301 HOH HOH A . 
G 7 HOH 221 821 445 HOH HOH A . 
G 7 HOH 222 822 357 HOH HOH A . 
G 7 HOH 223 823 316 HOH HOH A . 
G 7 HOH 224 824 332 HOH HOH A . 
G 7 HOH 225 825 442 HOH HOH A . 
G 7 HOH 226 826 300 HOH HOH A . 
G 7 HOH 227 827 221 HOH WAT A . 
G 7 HOH 228 828 317 HOH HOH A . 
G 7 HOH 229 829 344 HOH HOH A . 
G 7 HOH 230 830 219 HOH WAT A . 
G 7 HOH 231 831 497 HOH HOH A . 
G 7 HOH 232 832 85  HOH WAT A . 
G 7 HOH 233 833 64  HOH WAT A . 
G 7 HOH 234 834 196 HOH WAT A . 
G 7 HOH 235 835 454 HOH HOH A . 
G 7 HOH 236 836 154 HOH WAT A . 
G 7 HOH 237 837 427 HOH HOH A . 
G 7 HOH 238 838 353 HOH HOH A . 
G 7 HOH 239 839 500 HOH HOH A . 
G 7 HOH 240 840 259 HOH WAT A . 
G 7 HOH 241 841 319 HOH HOH A . 
G 7 HOH 242 842 444 HOH HOH A . 
G 7 HOH 243 843 485 HOH HOH A . 
G 7 HOH 244 844 258 HOH WAT A . 
G 7 HOH 245 845 132 HOH WAT A . 
G 7 HOH 246 846 229 HOH WAT A . 
G 7 HOH 247 847 318 HOH HOH A . 
G 7 HOH 248 848 527 HOH HOH A . 
G 7 HOH 249 849 199 HOH WAT A . 
G 7 HOH 250 850 459 HOH HOH A . 
G 7 HOH 251 851 288 HOH HOH A . 
G 7 HOH 252 852 521 HOH HOH A . 
G 7 HOH 253 853 359 HOH HOH A . 
G 7 HOH 254 854 450 HOH HOH A . 
G 7 HOH 255 855 401 HOH HOH A . 
G 7 HOH 256 856 11  HOH WAT A . 
G 7 HOH 257 857 213 HOH WAT A . 
G 7 HOH 258 858 383 HOH HOH A . 
G 7 HOH 259 859 362 HOH HOH A . 
G 7 HOH 260 860 323 HOH HOH A . 
G 7 HOH 261 861 307 HOH HOH A . 
G 7 HOH 262 862 465 HOH HOH A . 
G 7 HOH 263 863 394 HOH HOH A . 
G 7 HOH 264 864 517 HOH HOH A . 
G 7 HOH 265 865 460 HOH HOH A . 
G 7 HOH 266 866 220 HOH WAT A . 
G 7 HOH 267 867 346 HOH HOH A . 
G 7 HOH 268 868 102 HOH WAT A . 
G 7 HOH 269 869 298 HOH HOH A . 
G 7 HOH 270 870 277 HOH WAT A . 
G 7 HOH 271 871 388 HOH HOH A . 
G 7 HOH 272 872 508 HOH HOH A . 
G 7 HOH 273 873 523 HOH HOH A . 
G 7 HOH 274 874 296 HOH HOH A . 
G 7 HOH 275 875 470 HOH HOH A . 
G 7 HOH 276 876 305 HOH HOH A . 
G 7 HOH 277 877 486 HOH HOH A . 
G 7 HOH 278 878 471 HOH HOH A . 
G 7 HOH 279 879 200 HOH WAT A . 
G 7 HOH 280 880 99  HOH WAT A . 
G 7 HOH 281 881 333 HOH HOH A . 
G 7 HOH 282 882 482 HOH HOH A . 
G 7 HOH 283 883 472 HOH HOH A . 
G 7 HOH 284 884 216 HOH WAT A . 
G 7 HOH 285 885 453 HOH HOH A . 
G 7 HOH 286 886 304 HOH HOH A . 
G 7 HOH 287 887 192 HOH WAT A . 
G 7 HOH 288 888 191 HOH WAT A . 
G 7 HOH 289 889 529 HOH HOH A . 
G 7 HOH 290 890 347 HOH HOH A . 
G 7 HOH 291 891 408 HOH HOH A . 
G 7 HOH 292 892 441 HOH HOH A . 
G 7 HOH 293 893 345 HOH HOH A . 
G 7 HOH 294 894 342 HOH HOH A . 
G 7 HOH 295 895 275 HOH WAT A . 
G 7 HOH 296 896 380 HOH HOH A . 
G 7 HOH 297 897 379 HOH HOH A . 
G 7 HOH 298 898 438 HOH HOH A . 
G 7 HOH 299 899 424 HOH HOH A . 
G 7 HOH 300 900 337 HOH HOH A . 
G 7 HOH 301 901 214 HOH WAT A . 
G 7 HOH 302 902 535 HOH HOH A . 
G 7 HOH 303 903 429 HOH HOH A . 
G 7 HOH 304 904 507 HOH HOH A . 
G 7 HOH 305 905 267 HOH WAT A . 
G 7 HOH 306 906 325 HOH HOH A . 
G 7 HOH 307 907 361 HOH HOH A . 
G 7 HOH 308 908 423 HOH HOH A . 
G 7 HOH 309 909 312 HOH HOH A . 
G 7 HOH 310 910 335 HOH HOH A . 
G 7 HOH 311 911 343 HOH HOH A . 
G 7 HOH 312 912 481 HOH HOH A . 
G 7 HOH 313 913 327 HOH HOH A . 
G 7 HOH 314 914 278 HOH WAT A . 
G 7 HOH 315 915 314 HOH HOH A . 
G 7 HOH 316 916 348 HOH HOH A . 
G 7 HOH 317 917 452 HOH HOH A . 
G 7 HOH 318 918 299 HOH HOH A . 
H 7 HOH 1   201 510 HOH HOH T . 
H 7 HOH 2   202 502 HOH HOH T . 
H 7 HOH 3   203 201 HOH WAT T . 
H 7 HOH 4   204 467 HOH HOH T . 
H 7 HOH 5   205 93  HOH WAT T . 
H 7 HOH 6   206 371 HOH HOH T . 
H 7 HOH 7   207 375 HOH HOH T . 
H 7 HOH 8   208 501 HOH HOH T . 
H 7 HOH 9   209 372 HOH HOH T . 
H 7 HOH 10  210 285 HOH WAT T . 
H 7 HOH 11  211 322 HOH HOH T . 
H 7 HOH 12  212 30  HOH WAT T . 
H 7 HOH 13  213 137 HOH WAT T . 
H 7 HOH 14  214 308 HOH HOH T . 
H 7 HOH 15  215 204 HOH WAT T . 
H 7 HOH 16  216 264 HOH WAT T . 
H 7 HOH 17  217 302 HOH HOH T . 
H 7 HOH 18  218 432 HOH HOH T . 
H 7 HOH 19  219 112 HOH WAT T . 
H 7 HOH 20  220 225 HOH WAT T . 
H 7 HOH 21  221 369 HOH HOH T . 
H 7 HOH 22  222 373 HOH HOH T . 
H 7 HOH 23  223 433 HOH HOH T . 
H 7 HOH 24  224 70  HOH WAT T . 
H 7 HOH 25  225 526 HOH HOH T . 
H 7 HOH 26  226 398 HOH HOH T . 
H 7 HOH 27  227 175 HOH WAT T . 
H 7 HOH 28  228 320 HOH HOH T . 
H 7 HOH 29  229 249 HOH WAT T . 
H 7 HOH 30  230 490 HOH HOH T . 
H 7 HOH 31  231 350 HOH HOH T . 
H 7 HOH 32  232 519 HOH HOH T . 
H 7 HOH 33  233 351 HOH HOH T . 
H 7 HOH 34  234 368 HOH HOH T . 
H 7 HOH 35  235 244 HOH WAT T . 
H 7 HOH 36  236 499 HOH HOH T . 
H 7 HOH 37  237 370 HOH HOH T . 
H 7 HOH 38  238 406 HOH HOH T . 
H 7 HOH 39  239 374 HOH HOH T . 
H 7 HOH 40  240 461 HOH HOH T . 
H 7 HOH 41  241 7   HOH WAT T . 
H 7 HOH 42  242 242 HOH WAT T . 
H 7 HOH 43  243 509 HOH HOH T . 
H 7 HOH 44  244 110 HOH WAT T . 
H 7 HOH 45  245 26  HOH WAT T . 
H 7 HOH 46  246 405 HOH HOH T . 
H 7 HOH 47  247 349 HOH HOH T . 
H 7 HOH 48  248 309 HOH HOH T . 
I 7 HOH 1   101 378 HOH HOH P . 
I 7 HOH 2   102 366 HOH HOH P . 
I 7 HOH 3   103 151 HOH WAT P . 
I 7 HOH 4   104 150 HOH WAT P . 
I 7 HOH 5   105 195 HOH WAT P . 
I 7 HOH 6   106 402 HOH HOH P . 
I 7 HOH 7   107 265 HOH WAT P . 
I 7 HOH 8   108 355 HOH HOH P . 
I 7 HOH 9   109 78  HOH WAT P . 
I 7 HOH 10  110 376 HOH HOH P . 
I 7 HOH 11  111 430 HOH HOH P . 
I 7 HOH 12  112 181 HOH WAT P . 
I 7 HOH 13  113 531 HOH HOH P . 
I 7 HOH 14  114 130 HOH WAT P . 
I 7 HOH 15  115 177 HOH WAT P . 
I 7 HOH 16  116 512 HOH HOH P . 
I 7 HOH 17  117 356 HOH HOH P . 
I 7 HOH 18  118 367 HOH HOH P . 
I 7 HOH 19  119 354 HOH HOH P . 
I 7 HOH 20  120 227 HOH WAT P . 
I 7 HOH 21  121 377 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6000  ? 
1 MORE         -41   ? 
1 'SSA (A^2)'  20550 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O   ? A MET 17  ? A MET 14  ? 1_555 85.3  ? 
2  OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 OD2 ? A ASP 118 ? A ASP 115 ? 1_555 94.7  ? 
3  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 OD2 ? A ASP 118 ? A ASP 115 ? 1_555 87.8  ? 
4  OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G ? F CTP .   ? T CTP 101 ? 1_555 98.0  ? 
5  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G ? F CTP .   ? T CTP 101 ? 1_555 92.6  ? 
6  OD2 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G ? F CTP .   ? T CTP 101 ? 1_555 167.3 ? 
7  OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A ? F CTP .   ? T CTP 101 ? 1_555 101.7 ? 
8  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A ? F CTP .   ? T CTP 101 ? 1_555 171.9 ? 
9  OD2 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A ? F CTP .   ? T CTP 101 ? 1_555 95.5  ? 
10 O1G ? F CTP .   ? T CTP 101 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A ? F CTP .   ? T CTP 101 ? 1_555 82.5  ? 
11 OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B ? F CTP .   ? T CTP 101 ? 1_555 175.7 ? 
12 O   ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B ? F CTP .   ? T CTP 101 ? 1_555 91.1  ? 
13 OD2 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B ? F CTP .   ? T CTP 101 ? 1_555 87.4  ? 
14 O1G ? F CTP .   ? T CTP 101 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B ? F CTP .   ? T CTP 101 ? 1_555 79.9  ? 
15 O1A ? F CTP .   ? T CTP 101 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B ? F CTP .   ? T CTP 101 ? 1_555 81.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-01-13 
2 'Structure model' 1 1 2016-01-20 
3 'Structure model' 1 2 2016-03-02 
4 'Structure model' 1 3 2017-09-13 
5 'Structure model' 1 4 2019-12-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' pdbx_audit_support    
3 4 'Structure model' pdbx_struct_oper_list 
4 5 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 5 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.10_2155 1 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot     ? ? ? .         2 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .         3 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .         4 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .         5 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? ARP      ? ? ? .         6 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DT 3 ? B "C1'" T DT 3 ? B N1 T DT 3 ? B 110.58 108.30 2.28 0.30 N 
2 1 "O4'" T DG 7 ? ? "C1'" T DG 7 ? ? N9 T DG 7 ? ? 110.75 108.30 2.45 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 19.37   67.70   
2 1 TYR A 39  ? ? 65.87   -174.30 
3 1 LYS A 40  ? ? -162.78 -34.64  
4 1 SER A 62  ? ? 80.30   -13.43  
5 1 GLN A 133 ? ? -42.64  -85.26  
6 1 SER A 217 ? ? -155.91 -156.66 
7 1 SER A 257 ? ? 93.07   -6.93   
8 1 THR A 408 ? ? -88.28  45.36   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A MET 1   ? CG    ? A MET 4   CG    
2   1 Y 1 A MET 1   ? SD    ? A MET 4   SD    
3   1 Y 1 A MET 1   ? CE    ? A MET 4   CE    
4   1 Y 1 A LYS 40  ? CG    ? A LYS 43  CG    
5   1 Y 1 A LYS 40  ? CD    ? A LYS 43  CD    
6   1 Y 1 A LYS 40  ? CE    ? A LYS 43  CE    
7   1 Y 1 A LYS 40  ? NZ    ? A LYS 43  NZ    
8   1 Y 1 A VAL 108 ? CG1   ? A VAL 111 CG1   
9   1 Y 1 A VAL 108 ? CG2   ? A VAL 111 CG2   
10  1 Y 1 A GLN 126 ? CD    ? A GLN 129 CD    
11  1 Y 1 A GLN 126 ? OE1   ? A GLN 129 OE1   
12  1 Y 1 A GLN 126 ? NE2   ? A GLN 129 NE2   
13  1 Y 1 A GLU 127 ? CG    ? A GLU 130 CG    
14  1 Y 1 A GLU 127 ? CD    ? A GLU 130 CD    
15  1 Y 1 A GLU 127 ? OE1   ? A GLU 130 OE1   
16  1 Y 1 A GLU 127 ? OE2   ? A GLU 130 OE2   
17  1 Y 1 A GLN 130 ? CG    ? A GLN 133 CG    
18  1 Y 1 A GLN 130 ? CD    ? A GLN 133 CD    
19  1 Y 1 A GLN 130 ? OE1   ? A GLN 133 OE1   
20  1 Y 1 A GLN 130 ? NE2   ? A GLN 133 NE2   
21  1 Y 1 A LYS 131 ? CG    ? A LYS 134 CG    
22  1 Y 1 A LYS 131 ? CD    ? A LYS 134 CD    
23  1 Y 1 A LYS 131 ? CE    ? A LYS 134 CE    
24  1 Y 1 A LYS 131 ? NZ    ? A LYS 134 NZ    
25  1 Y 1 A LEU 132 ? CG    ? A LEU 135 CG    
26  1 Y 1 A LEU 132 ? CD1   ? A LEU 135 CD1   
27  1 Y 1 A LEU 132 ? CD2   ? A LEU 135 CD2   
28  1 Y 1 A GLN 133 ? CG    ? A GLN 136 CG    
29  1 Y 1 A GLN 133 ? CD    ? A GLN 136 CD    
30  1 Y 1 A GLN 133 ? OE1   ? A GLN 136 OE1   
31  1 Y 1 A GLN 133 ? NE2   ? A GLN 136 NE2   
32  1 Y 1 A GLN 135 ? CG    ? A GLN 138 CG    
33  1 Y 1 A GLN 135 ? CD    ? A GLN 138 CD    
34  1 Y 1 A GLN 135 ? OE1   ? A GLN 138 OE1   
35  1 Y 1 A GLN 135 ? NE2   ? A GLN 138 NE2   
36  1 Y 1 A VAL 161 ? CB    ? A VAL 164 CB    
37  1 Y 1 A VAL 161 ? CG1   ? A VAL 164 CG1   
38  1 Y 1 A VAL 161 ? CG2   ? A VAL 164 CG2   
39  1 Y 1 A GLN 162 ? CG    ? A GLN 165 CG    
40  1 Y 1 A GLN 162 ? CD    ? A GLN 165 CD    
41  1 Y 1 A GLN 162 ? OE1   ? A GLN 165 OE1   
42  1 Y 1 A GLN 162 ? NE2   ? A GLN 165 NE2   
43  1 Y 1 A LYS 168 ? CE    ? A LYS 171 CE    
44  1 Y 1 A LYS 168 ? NZ    ? A LYS 171 NZ    
45  1 Y 1 A GLN 169 ? CG    ? A GLN 172 CG    
46  1 Y 1 A GLN 169 ? CD    ? A GLN 172 CD    
47  1 Y 1 A GLN 169 ? OE1   ? A GLN 172 OE1   
48  1 Y 1 A GLN 169 ? NE2   ? A GLN 172 NE2   
49  1 Y 1 A GLN 179 ? CG    ? A GLN 182 CG    
50  1 Y 1 A GLN 179 ? CD    ? A GLN 182 CD    
51  1 Y 1 A GLN 179 ? OE1   ? A GLN 182 OE1   
52  1 Y 1 A GLN 179 ? NE2   ? A GLN 182 NE2   
53  1 Y 1 A ASP 181 ? CG    ? A ASP 184 CG    
54  1 Y 1 A ASP 181 ? OD1   ? A ASP 184 OD1   
55  1 Y 1 A ASP 181 ? OD2   ? A ASP 184 OD2   
56  1 Y 1 A GLU 268 ? CG    ? A GLU 271 CG    
57  1 Y 1 A GLU 268 ? CD    ? A GLU 271 CD    
58  1 Y 1 A GLU 268 ? OE1   ? A GLU 271 OE1   
59  1 Y 1 A GLU 268 ? OE2   ? A GLU 271 OE2   
60  1 Y 1 A LYS 293 ? CD    ? A LYS 296 CD    
61  1 Y 1 A LYS 293 ? CE    ? A LYS 296 CE    
62  1 Y 1 A LYS 293 ? NZ    ? A LYS 296 NZ    
63  1 Y 1 A LYS 328 ? CG    ? A LYS 331 CG    
64  1 Y 1 A LYS 328 ? CD    ? A LYS 331 CD    
65  1 Y 1 A LYS 328 ? CE    ? A LYS 331 CE    
66  1 Y 1 A LYS 328 ? NZ    ? A LYS 331 NZ    
67  1 Y 1 A ARG 334 ? CG    ? A ARG 337 CG    
68  1 Y 1 A ARG 334 ? CD    ? A ARG 337 CD    
69  1 Y 1 A ARG 334 ? NE    ? A ARG 337 NE    
70  1 Y 1 A ARG 334 ? CZ    ? A ARG 337 CZ    
71  1 Y 1 A ARG 334 ? NH1   ? A ARG 337 NH1   
72  1 Y 1 A ARG 334 ? NH2   ? A ARG 337 NH2   
73  1 Y 1 A GLU 350 ? CG    ? A GLU 353 CG    
74  1 Y 1 A GLU 350 ? CD    ? A GLU 353 CD    
75  1 Y 1 A GLU 350 ? OE1   ? A GLU 353 OE1   
76  1 Y 1 A GLU 350 ? OE2   ? A GLU 353 OE2   
77  1 Y 1 A LYS 354 ? CG    ? A LYS 357 CG    
78  1 Y 1 A LYS 354 ? CD    ? A LYS 357 CD    
79  1 Y 1 A LYS 354 ? CE    ? A LYS 357 CE    
80  1 Y 1 A LYS 354 ? NZ    ? A LYS 357 NZ    
81  1 Y 1 A LYS 376 ? CG    ? A LYS 379 CG    
82  1 Y 1 A LYS 376 ? CD    ? A LYS 379 CD    
83  1 Y 1 A LYS 376 ? CE    ? A LYS 379 CE    
84  1 Y 1 A LYS 376 ? NZ    ? A LYS 379 NZ    
85  1 Y 1 A LEU 378 ? CG    ? A LEU 381 CG    
86  1 Y 1 A LEU 378 ? CD1   ? A LEU 381 CD1   
87  1 Y 1 A LEU 378 ? CD2   ? A LEU 381 CD2   
88  1 Y 1 A ARG 389 ? CD    ? A ARG 392 CD    
89  1 Y 1 A ARG 389 ? NE    ? A ARG 392 NE    
90  1 Y 1 A ARG 389 ? CZ    ? A ARG 392 CZ    
91  1 Y 1 A ARG 389 ? NH1   ? A ARG 392 NH1   
92  1 Y 1 A ARG 389 ? NH2   ? A ARG 392 NH2   
93  1 Y 1 A SER 416 ? OG    ? A SER 419 OG    
94  1 Y 1 A LYS 428 ? CG    ? A LYS 431 CG    
95  1 Y 1 A LYS 428 ? CD    ? A LYS 431 CD    
96  1 Y 1 A LYS 428 ? CE    ? A LYS 431 CE    
97  1 Y 1 A LYS 428 ? NZ    ? A LYS 431 NZ    
98  1 Y 1 T DC  1   ? "O5'" ? B DC  1   "O5'" 
99  1 Y 1 T DC  1   ? "C5'" ? B DC  1   "C5'" 
100 1 Y 1 T DC  1   ? "C4'" ? B DC  1   "C4'" 
101 1 Y 1 T DC  1   ? "O4'" ? B DC  1   "O4'" 
102 1 Y 1 T DC  1   ? "C3'" ? B DC  1   "C3'" 
103 1 Y 1 T DC  1   ? "C2'" ? B DC  1   "C2'" 
104 1 Y 1 T DC  1   ? "C1'" ? B DC  1   "C1'" 
105 1 Y 1 T DC  1   ? N1    ? B DC  1   N1    
106 1 Y 1 T DC  1   ? C2    ? B DC  1   C2    
107 1 Y 1 T DC  1   ? O2    ? B DC  1   O2    
108 1 Y 1 T DC  1   ? N3    ? B DC  1   N3    
109 1 Y 1 T DC  1   ? C4    ? B DC  1   C4    
110 1 Y 1 T DC  1   ? N4    ? B DC  1   N4    
111 1 Y 1 T DC  1   ? C5    ? B DC  1   C5    
112 1 Y 1 T DC  1   ? C6    ? B DC  1   C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 154 ? A PRO 157 
2  1 Y 1 A THR 155 ? A THR 158 
3  1 Y 1 A THR 156 ? A THR 159 
4  1 Y 1 A ALA 157 ? A ALA 160 
5  1 Y 1 A GLU 158 ? A GLU 161 
6  1 Y 1 A GLU 159 ? A GLU 162 
7  1 Y 1 A THR 160 ? A THR 163 
8  1 Y 1 A GLY 410 ? A GLY 413 
9  1 Y 1 A ILE 411 ? A ILE 414 
10 1 Y 1 A GLN 412 ? A GLN 415 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5EWF 'double helix'        
5EWF 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 0.298  -0.073 -0.204 -14.249 -4.928 1.080  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 -0.018 -0.089 0.226  -0.454  -8.275 6.011  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.268 -0.152 -0.428 -4.546  -2.014 -0.884 3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.182  -0.113 0.142  6.417   -1.614 3.831  4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.267  -0.048 -0.321 12.564  -4.981 4.265  5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.287 -0.154 -0.153 -3.542  -1.966 2.795  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.047  -0.182 0.259  -2.695  -1.655 -0.739 7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.260 -0.363 -0.403 16.339  -3.931 9.382  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 1.125  -0.913 3.050 -3.487 3.995 26.387 -2.875 -3.214 2.716 8.641 7.541   
26.905 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.323 -1.098 3.417 5.374  4.744 27.472 -3.341 1.909  3.071 9.779 -11.079 
28.374 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.318 -0.526 3.118 -4.030 1.471 34.968 -1.079 -0.046 3.110 2.437 6.675   
35.222 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.482  -0.826 3.300 4.518  0.558 28.720 -1.769 0.048  3.319 1.115 -9.037  
29.071 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.309 -0.596 3.790 -3.170 4.451 36.295 -1.649 -0.009 3.707 7.096 5.054   
36.691 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.286 -0.641 3.381 -2.196 1.023 35.727 -1.195 0.139  3.373 1.666 3.574   
35.806 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.510  -0.358 2.917 2.998  1.593 24.654 -1.260 -0.375 2.929 3.709 -6.980  
24.883 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of Environmental Health Sciences (NIH/NIEHS)' 'United States' 'R01 ES010375' 1 
'National Institutes of Health/National Cancer Institute (NIH/NCI)'                             'United States' 'P01 CA160032' 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 GLYCEROL                   GOL 
5 'CALCIUM ION'              CA  
6 "CYTIDINE-5'-TRIPHOSPHATE" CTP 
7 water                      HOH 
#