data_5EWL
# 
_entry.id   5EWL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5EWL         
WWPDB D_1000215615 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5EWJ unspecified 
PDB . 5EWM unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5EWL 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_audit_author.name           'Pandit, J.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Mol.Pharmacol. 
_citation.journal_id_ASTM           MOPMA3 
_citation.journal_id_CSD            0197 
_citation.journal_id_ISSN           1521-0111 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            89 
_citation.language                  ? 
_citation.page_first                541 
_citation.page_last                 551 
_citation.title                     
'A Novel Binding Mode Reveals Two Distinct Classes of NMDA Receptor GluN2B-selective Antagonists.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1124/mol.115.103036 
_citation.pdbx_database_id_PubMed   26912815 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Stroebel, D.'  1 ? 
primary 'Buhl, D.L.'    2 ? 
primary 'Knafels, J.D.' 3 ? 
primary 'Chanda, P.K.'  4 ? 
primary 'Green, M.'     5 ? 
primary 'Sciabola, S.'  6 ? 
primary 'Mony, L.'      7 ? 
primary 'Paoletti, P.'  8 ? 
primary 'Pandit, J.'    9 ? 
# 
_cell.entry_id           5EWL 
_cell.length_a           268.880 
_cell.length_b           59.940 
_cell.length_c           144.450 
_cell.angle_alpha        90.00 
_cell.angle_beta         116.51 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5EWL 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'NMDA glutamate receptor subunit' 43757.977 2   ? N61Q,N371Q 'Amino Terminal Domain (UNP residues 23-408)' ? 
2 polymer     man 'Glutamate receptor ionotropic, NMDA 2B' 41351.902 2   ? N348D      
'Amino Terminal Domain (UNP residues 31-394)' ? 
3 branched    man 
;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
910.823   1   ? ?          ?                                             ? 
4 non-polymer syn 'SODIUM ION' 22.990    6   ? ?          ?                                             ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   6   ? ?          ? ? 
6 non-polymer syn 
'~{N}-[(1~{S},3~{S})-3-[3-[(4-methylphenyl)methyl]-1,2,4-oxadiazol-5-yl]cyclopentyl]-1~{H}-pyrazolo[3,4-d]pyrimidin-4-amine' 
375.427   2   ? ?          ?                                             ? 
7 water       nat water 18.015    269 ? ?          ?                                             ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
;GluN2B,Glutamate [NMDA] receptor subunit epsilon-2,N-methyl D-aspartate receptor subtype 2B,NR2B,N-methyl-D-aspartate receptor subunit 3,hNR3
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DPKIVNIGAVLSTKKHEQIFREAVNQANKRHFTRKIQLQATSVTHRPNAIQMALSVCEDLISSQVYAILVSHPPAPTDHL
TPTPISYTAGFYRIPVIGLTTRMSIYSDKSIHLSFLRTVPPYSHQALVWFEMMRLFNWNHVILIVSDDHEGRAAQKKLET
LLEGKESKSKKRNYENLDQLSYDNKRGPKADKVLQFEPGTKNLTALLLEAKELEARVIILSASEDDATAVYKSAAMLDMT
GAGYVWLVGEREISGSALRYAPDGIIGLQLINGKNESAHISDAVAVVAQAIHELFEMENITDPPRGCVGNTNIWKTGPLF
KRVLMSSKYPDGVTGRIEFNEDGDRKFAQYSIMNLQNRKLVQVGIFNGSYIIQNDRKIIWPGGETELVPR
;
;DPKIVNIGAVLSTKKHEQIFREAVNQANKRHFTRKIQLQATSVTHRPNAIQMALSVCEDLISSQVYAILVSHPPAPTDHL
TPTPISYTAGFYRIPVIGLTTRMSIYSDKSIHLSFLRTVPPYSHQALVWFEMMRLFNWNHVILIVSDDHEGRAAQKKLET
LLEGKESKSKKRNYENLDQLSYDNKRGPKADKVLQFEPGTKNLTALLLEAKELEARVIILSASEDDATAVYKSAAMLDMT
GAGYVWLVGEREISGSALRYAPDGIIGLQLINGKNESAHISDAVAVVAQAIHELFEMENITDPPRGCVGNTNIWKTGPLF
KRVLMSSKYPDGVTGRIEFNEDGDRKFAQYSIMNLQNRKLVQVGIFNGSYIIQNDRKIIWPGGETELVPR
;
A,C ? 
2 'polypeptide(L)' no no 
;SPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQ
ILDFISAQTLTPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTI
ENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDTDTVP
AEFPTGLISVSYDEWDYGLPARVRDGIAIITTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRDLS
FSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQMKYYVWPRM
;
;SPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQ
ILDFISAQTLTPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTI
ENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDTDTVP
AEFPTGLISVSYDEWDYGLPARVRDGIAIITTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRDLS
FSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQMKYYVWPRM
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   PRO n 
1 3   LYS n 
1 4   ILE n 
1 5   VAL n 
1 6   ASN n 
1 7   ILE n 
1 8   GLY n 
1 9   ALA n 
1 10  VAL n 
1 11  LEU n 
1 12  SER n 
1 13  THR n 
1 14  LYS n 
1 15  LYS n 
1 16  HIS n 
1 17  GLU n 
1 18  GLN n 
1 19  ILE n 
1 20  PHE n 
1 21  ARG n 
1 22  GLU n 
1 23  ALA n 
1 24  VAL n 
1 25  ASN n 
1 26  GLN n 
1 27  ALA n 
1 28  ASN n 
1 29  LYS n 
1 30  ARG n 
1 31  HIS n 
1 32  PHE n 
1 33  THR n 
1 34  ARG n 
1 35  LYS n 
1 36  ILE n 
1 37  GLN n 
1 38  LEU n 
1 39  GLN n 
1 40  ALA n 
1 41  THR n 
1 42  SER n 
1 43  VAL n 
1 44  THR n 
1 45  HIS n 
1 46  ARG n 
1 47  PRO n 
1 48  ASN n 
1 49  ALA n 
1 50  ILE n 
1 51  GLN n 
1 52  MET n 
1 53  ALA n 
1 54  LEU n 
1 55  SER n 
1 56  VAL n 
1 57  CYS n 
1 58  GLU n 
1 59  ASP n 
1 60  LEU n 
1 61  ILE n 
1 62  SER n 
1 63  SER n 
1 64  GLN n 
1 65  VAL n 
1 66  TYR n 
1 67  ALA n 
1 68  ILE n 
1 69  LEU n 
1 70  VAL n 
1 71  SER n 
1 72  HIS n 
1 73  PRO n 
1 74  PRO n 
1 75  ALA n 
1 76  PRO n 
1 77  THR n 
1 78  ASP n 
1 79  HIS n 
1 80  LEU n 
1 81  THR n 
1 82  PRO n 
1 83  THR n 
1 84  PRO n 
1 85  ILE n 
1 86  SER n 
1 87  TYR n 
1 88  THR n 
1 89  ALA n 
1 90  GLY n 
1 91  PHE n 
1 92  TYR n 
1 93  ARG n 
1 94  ILE n 
1 95  PRO n 
1 96  VAL n 
1 97  ILE n 
1 98  GLY n 
1 99  LEU n 
1 100 THR n 
1 101 THR n 
1 102 ARG n 
1 103 MET n 
1 104 SER n 
1 105 ILE n 
1 106 TYR n 
1 107 SER n 
1 108 ASP n 
1 109 LYS n 
1 110 SER n 
1 111 ILE n 
1 112 HIS n 
1 113 LEU n 
1 114 SER n 
1 115 PHE n 
1 116 LEU n 
1 117 ARG n 
1 118 THR n 
1 119 VAL n 
1 120 PRO n 
1 121 PRO n 
1 122 TYR n 
1 123 SER n 
1 124 HIS n 
1 125 GLN n 
1 126 ALA n 
1 127 LEU n 
1 128 VAL n 
1 129 TRP n 
1 130 PHE n 
1 131 GLU n 
1 132 MET n 
1 133 MET n 
1 134 ARG n 
1 135 LEU n 
1 136 PHE n 
1 137 ASN n 
1 138 TRP n 
1 139 ASN n 
1 140 HIS n 
1 141 VAL n 
1 142 ILE n 
1 143 LEU n 
1 144 ILE n 
1 145 VAL n 
1 146 SER n 
1 147 ASP n 
1 148 ASP n 
1 149 HIS n 
1 150 GLU n 
1 151 GLY n 
1 152 ARG n 
1 153 ALA n 
1 154 ALA n 
1 155 GLN n 
1 156 LYS n 
1 157 LYS n 
1 158 LEU n 
1 159 GLU n 
1 160 THR n 
1 161 LEU n 
1 162 LEU n 
1 163 GLU n 
1 164 GLY n 
1 165 LYS n 
1 166 GLU n 
1 167 SER n 
1 168 LYS n 
1 169 SER n 
1 170 LYS n 
1 171 LYS n 
1 172 ARG n 
1 173 ASN n 
1 174 TYR n 
1 175 GLU n 
1 176 ASN n 
1 177 LEU n 
1 178 ASP n 
1 179 GLN n 
1 180 LEU n 
1 181 SER n 
1 182 TYR n 
1 183 ASP n 
1 184 ASN n 
1 185 LYS n 
1 186 ARG n 
1 187 GLY n 
1 188 PRO n 
1 189 LYS n 
1 190 ALA n 
1 191 ASP n 
1 192 LYS n 
1 193 VAL n 
1 194 LEU n 
1 195 GLN n 
1 196 PHE n 
1 197 GLU n 
1 198 PRO n 
1 199 GLY n 
1 200 THR n 
1 201 LYS n 
1 202 ASN n 
1 203 LEU n 
1 204 THR n 
1 205 ALA n 
1 206 LEU n 
1 207 LEU n 
1 208 LEU n 
1 209 GLU n 
1 210 ALA n 
1 211 LYS n 
1 212 GLU n 
1 213 LEU n 
1 214 GLU n 
1 215 ALA n 
1 216 ARG n 
1 217 VAL n 
1 218 ILE n 
1 219 ILE n 
1 220 LEU n 
1 221 SER n 
1 222 ALA n 
1 223 SER n 
1 224 GLU n 
1 225 ASP n 
1 226 ASP n 
1 227 ALA n 
1 228 THR n 
1 229 ALA n 
1 230 VAL n 
1 231 TYR n 
1 232 LYS n 
1 233 SER n 
1 234 ALA n 
1 235 ALA n 
1 236 MET n 
1 237 LEU n 
1 238 ASP n 
1 239 MET n 
1 240 THR n 
1 241 GLY n 
1 242 ALA n 
1 243 GLY n 
1 244 TYR n 
1 245 VAL n 
1 246 TRP n 
1 247 LEU n 
1 248 VAL n 
1 249 GLY n 
1 250 GLU n 
1 251 ARG n 
1 252 GLU n 
1 253 ILE n 
1 254 SER n 
1 255 GLY n 
1 256 SER n 
1 257 ALA n 
1 258 LEU n 
1 259 ARG n 
1 260 TYR n 
1 261 ALA n 
1 262 PRO n 
1 263 ASP n 
1 264 GLY n 
1 265 ILE n 
1 266 ILE n 
1 267 GLY n 
1 268 LEU n 
1 269 GLN n 
1 270 LEU n 
1 271 ILE n 
1 272 ASN n 
1 273 GLY n 
1 274 LYS n 
1 275 ASN n 
1 276 GLU n 
1 277 SER n 
1 278 ALA n 
1 279 HIS n 
1 280 ILE n 
1 281 SER n 
1 282 ASP n 
1 283 ALA n 
1 284 VAL n 
1 285 ALA n 
1 286 VAL n 
1 287 VAL n 
1 288 ALA n 
1 289 GLN n 
1 290 ALA n 
1 291 ILE n 
1 292 HIS n 
1 293 GLU n 
1 294 LEU n 
1 295 PHE n 
1 296 GLU n 
1 297 MET n 
1 298 GLU n 
1 299 ASN n 
1 300 ILE n 
1 301 THR n 
1 302 ASP n 
1 303 PRO n 
1 304 PRO n 
1 305 ARG n 
1 306 GLY n 
1 307 CYS n 
1 308 VAL n 
1 309 GLY n 
1 310 ASN n 
1 311 THR n 
1 312 ASN n 
1 313 ILE n 
1 314 TRP n 
1 315 LYS n 
1 316 THR n 
1 317 GLY n 
1 318 PRO n 
1 319 LEU n 
1 320 PHE n 
1 321 LYS n 
1 322 ARG n 
1 323 VAL n 
1 324 LEU n 
1 325 MET n 
1 326 SER n 
1 327 SER n 
1 328 LYS n 
1 329 TYR n 
1 330 PRO n 
1 331 ASP n 
1 332 GLY n 
1 333 VAL n 
1 334 THR n 
1 335 GLY n 
1 336 ARG n 
1 337 ILE n 
1 338 GLU n 
1 339 PHE n 
1 340 ASN n 
1 341 GLU n 
1 342 ASP n 
1 343 GLY n 
1 344 ASP n 
1 345 ARG n 
1 346 LYS n 
1 347 PHE n 
1 348 ALA n 
1 349 GLN n 
1 350 TYR n 
1 351 SER n 
1 352 ILE n 
1 353 MET n 
1 354 ASN n 
1 355 LEU n 
1 356 GLN n 
1 357 ASN n 
1 358 ARG n 
1 359 LYS n 
1 360 LEU n 
1 361 VAL n 
1 362 GLN n 
1 363 VAL n 
1 364 GLY n 
1 365 ILE n 
1 366 PHE n 
1 367 ASN n 
1 368 GLY n 
1 369 SER n 
1 370 TYR n 
1 371 ILE n 
1 372 ILE n 
1 373 GLN n 
1 374 ASN n 
1 375 ASP n 
1 376 ARG n 
1 377 LYS n 
1 378 ILE n 
1 379 ILE n 
1 380 TRP n 
1 381 PRO n 
1 382 GLY n 
1 383 GLY n 
1 384 GLU n 
1 385 THR n 
1 386 GLU n 
1 387 LEU n 
1 388 VAL n 
1 389 PRO n 
1 390 ARG n 
2 1   SER n 
2 2   PRO n 
2 3   PRO n 
2 4   SER n 
2 5   ILE n 
2 6   GLY n 
2 7   ILE n 
2 8   ALA n 
2 9   VAL n 
2 10  ILE n 
2 11  LEU n 
2 12  VAL n 
2 13  GLY n 
2 14  THR n 
2 15  SER n 
2 16  ASP n 
2 17  GLU n 
2 18  VAL n 
2 19  ALA n 
2 20  ILE n 
2 21  LYS n 
2 22  ASP n 
2 23  ALA n 
2 24  HIS n 
2 25  GLU n 
2 26  LYS n 
2 27  ASP n 
2 28  ASP n 
2 29  PHE n 
2 30  HIS n 
2 31  HIS n 
2 32  LEU n 
2 33  SER n 
2 34  VAL n 
2 35  VAL n 
2 36  PRO n 
2 37  ARG n 
2 38  VAL n 
2 39  GLU n 
2 40  LEU n 
2 41  VAL n 
2 42  ALA n 
2 43  MET n 
2 44  ASN n 
2 45  GLU n 
2 46  THR n 
2 47  ASP n 
2 48  PRO n 
2 49  LYS n 
2 50  SER n 
2 51  ILE n 
2 52  ILE n 
2 53  THR n 
2 54  ARG n 
2 55  ILE n 
2 56  CYS n 
2 57  ASP n 
2 58  LEU n 
2 59  MET n 
2 60  SER n 
2 61  ASP n 
2 62  ARG n 
2 63  LYS n 
2 64  ILE n 
2 65  GLN n 
2 66  GLY n 
2 67  VAL n 
2 68  VAL n 
2 69  PHE n 
2 70  ALA n 
2 71  ASP n 
2 72  ASP n 
2 73  THR n 
2 74  ASP n 
2 75  GLN n 
2 76  GLU n 
2 77  ALA n 
2 78  ILE n 
2 79  ALA n 
2 80  GLN n 
2 81  ILE n 
2 82  LEU n 
2 83  ASP n 
2 84  PHE n 
2 85  ILE n 
2 86  SER n 
2 87  ALA n 
2 88  GLN n 
2 89  THR n 
2 90  LEU n 
2 91  THR n 
2 92  PRO n 
2 93  ILE n 
2 94  LEU n 
2 95  GLY n 
2 96  ILE n 
2 97  HIS n 
2 98  GLY n 
2 99  GLY n 
2 100 SER n 
2 101 SER n 
2 102 MET n 
2 103 ILE n 
2 104 MET n 
2 105 ALA n 
2 106 ASP n 
2 107 LYS n 
2 108 ASP n 
2 109 GLU n 
2 110 SER n 
2 111 SER n 
2 112 MET n 
2 113 PHE n 
2 114 PHE n 
2 115 GLN n 
2 116 PHE n 
2 117 GLY n 
2 118 PRO n 
2 119 SER n 
2 120 ILE n 
2 121 GLU n 
2 122 GLN n 
2 123 GLN n 
2 124 ALA n 
2 125 SER n 
2 126 VAL n 
2 127 MET n 
2 128 LEU n 
2 129 ASN n 
2 130 ILE n 
2 131 MET n 
2 132 GLU n 
2 133 GLU n 
2 134 TYR n 
2 135 ASP n 
2 136 TRP n 
2 137 TYR n 
2 138 ILE n 
2 139 PHE n 
2 140 SER n 
2 141 ILE n 
2 142 VAL n 
2 143 THR n 
2 144 THR n 
2 145 TYR n 
2 146 PHE n 
2 147 PRO n 
2 148 GLY n 
2 149 TYR n 
2 150 GLN n 
2 151 ASP n 
2 152 PHE n 
2 153 VAL n 
2 154 ASN n 
2 155 LYS n 
2 156 ILE n 
2 157 ARG n 
2 158 SER n 
2 159 THR n 
2 160 ILE n 
2 161 GLU n 
2 162 ASN n 
2 163 SER n 
2 164 PHE n 
2 165 VAL n 
2 166 GLY n 
2 167 TRP n 
2 168 GLU n 
2 169 LEU n 
2 170 GLU n 
2 171 GLU n 
2 172 VAL n 
2 173 LEU n 
2 174 LEU n 
2 175 LEU n 
2 176 ASP n 
2 177 MET n 
2 178 SER n 
2 179 LEU n 
2 180 ASP n 
2 181 ASP n 
2 182 GLY n 
2 183 ASP n 
2 184 SER n 
2 185 LYS n 
2 186 ILE n 
2 187 GLN n 
2 188 ASN n 
2 189 GLN n 
2 190 LEU n 
2 191 LYS n 
2 192 LYS n 
2 193 LEU n 
2 194 GLN n 
2 195 SER n 
2 196 PRO n 
2 197 ILE n 
2 198 ILE n 
2 199 LEU n 
2 200 LEU n 
2 201 TYR n 
2 202 CYS n 
2 203 THR n 
2 204 LYS n 
2 205 GLU n 
2 206 GLU n 
2 207 ALA n 
2 208 THR n 
2 209 TYR n 
2 210 ILE n 
2 211 PHE n 
2 212 GLU n 
2 213 VAL n 
2 214 ALA n 
2 215 ASN n 
2 216 SER n 
2 217 VAL n 
2 218 GLY n 
2 219 LEU n 
2 220 THR n 
2 221 GLY n 
2 222 TYR n 
2 223 GLY n 
2 224 TYR n 
2 225 THR n 
2 226 TRP n 
2 227 ILE n 
2 228 VAL n 
2 229 PRO n 
2 230 SER n 
2 231 LEU n 
2 232 VAL n 
2 233 ALA n 
2 234 GLY n 
2 235 ASP n 
2 236 THR n 
2 237 ASP n 
2 238 THR n 
2 239 VAL n 
2 240 PRO n 
2 241 ALA n 
2 242 GLU n 
2 243 PHE n 
2 244 PRO n 
2 245 THR n 
2 246 GLY n 
2 247 LEU n 
2 248 ILE n 
2 249 SER n 
2 250 VAL n 
2 251 SER n 
2 252 TYR n 
2 253 ASP n 
2 254 GLU n 
2 255 TRP n 
2 256 ASP n 
2 257 TYR n 
2 258 GLY n 
2 259 LEU n 
2 260 PRO n 
2 261 ALA n 
2 262 ARG n 
2 263 VAL n 
2 264 ARG n 
2 265 ASP n 
2 266 GLY n 
2 267 ILE n 
2 268 ALA n 
2 269 ILE n 
2 270 ILE n 
2 271 THR n 
2 272 THR n 
2 273 ALA n 
2 274 ALA n 
2 275 SER n 
2 276 ASP n 
2 277 MET n 
2 278 LEU n 
2 279 SER n 
2 280 GLU n 
2 281 HIS n 
2 282 SER n 
2 283 PHE n 
2 284 ILE n 
2 285 PRO n 
2 286 GLU n 
2 287 PRO n 
2 288 LYS n 
2 289 SER n 
2 290 SER n 
2 291 CYS n 
2 292 TYR n 
2 293 ASN n 
2 294 THR n 
2 295 HIS n 
2 296 GLU n 
2 297 LYS n 
2 298 ARG n 
2 299 ILE n 
2 300 TYR n 
2 301 GLN n 
2 302 SER n 
2 303 ASN n 
2 304 MET n 
2 305 LEU n 
2 306 ASN n 
2 307 ARG n 
2 308 TYR n 
2 309 LEU n 
2 310 ILE n 
2 311 ASN n 
2 312 VAL n 
2 313 THR n 
2 314 PHE n 
2 315 GLU n 
2 316 GLY n 
2 317 ARG n 
2 318 ASP n 
2 319 LEU n 
2 320 SER n 
2 321 PHE n 
2 322 SER n 
2 323 GLU n 
2 324 ASP n 
2 325 GLY n 
2 326 TYR n 
2 327 GLN n 
2 328 MET n 
2 329 HIS n 
2 330 PRO n 
2 331 LYS n 
2 332 LEU n 
2 333 VAL n 
2 334 ILE n 
2 335 ILE n 
2 336 LEU n 
2 337 LEU n 
2 338 ASN n 
2 339 LYS n 
2 340 GLU n 
2 341 ARG n 
2 342 LYS n 
2 343 TRP n 
2 344 GLU n 
2 345 ARG n 
2 346 VAL n 
2 347 GLY n 
2 348 LYS n 
2 349 TRP n 
2 350 LYS n 
2 351 ASP n 
2 352 LYS n 
2 353 SER n 
2 354 LEU n 
2 355 GLN n 
2 356 MET n 
2 357 LYS n 
2 358 TYR n 
2 359 TYR n 
2 360 VAL n 
2 361 TRP n 
2 362 PRO n 
2 363 ARG n 
2 364 MET n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 390 'African clawed frog' ? 'grin1, NR1'      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 364 Human                 ? 'GRIN2B, NMDAR2B' ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q91977_XENLA Q91977 ? 1 
;DPKIVNIGAVLSTKKHEQIFREAVNQANKRHFTRKIQLNATSVTHRPNAIQMALSVCEDLISSQVYAILVSHPPAPTDHL
TPTPISYTAGFYRIPVIGLTTRMSIYSDKSIHLSFLRTVPPYSHQALVWFEMMRLFNWNHVILIVSDDHEGRAAQKKLET
LLEGKESKSKKRNYENLDQLSYDNKRGPKADKVLQFEPGTKNLTALLLEAKELEARVIILSASEDDATAVYKSAAMLDMT
GAGYVWLVGEREISGSALRYAPDGIIGLQLINGKNESAHISDAVAVVAQAIHELFEMENITDPPRGCVGNTNIWKTGPLF
KRVLMSSKYPDGVTGRIEFNEDGDRKFANYSIMNLQNRKLVQVGIFNGSYIIQNDRKIIWPGGETE
;
23 
2 UNP NMDE2_HUMAN  Q13224 ? 2 
;SPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQ
ILDFISAQTLTPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTI
ENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDTDTVP
AEFPTGLISVSYDEWDYGLPARVRDGIAIITTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLS
FSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQMKYYVWPRM
;
31 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5EWL A 1 ? 386 ? Q91977 23 ? 408 ? 23 408 
2 2 5EWL B 1 ? 364 ? Q13224 31 ? 394 ? 31 394 
3 1 5EWL C 1 ? 386 ? Q91977 23 ? 408 ? 23 408 
4 2 5EWL D 1 ? 364 ? Q13224 31 ? 394 ? 31 394 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5EWL GLN A 39  ? UNP Q91977 ASN 61  'engineered mutation' 61  1  
1 5EWL GLN A 349 ? UNP Q91977 ASN 371 'engineered mutation' 371 2  
1 5EWL LEU A 387 ? UNP Q91977 ?   ?   'expression tag'      409 3  
1 5EWL VAL A 388 ? UNP Q91977 ?   ?   'expression tag'      410 4  
1 5EWL PRO A 389 ? UNP Q91977 ?   ?   'expression tag'      411 5  
1 5EWL ARG A 390 ? UNP Q91977 ?   ?   'expression tag'      412 6  
2 5EWL ASP B 318 ? UNP Q13224 ASN 348 'engineered mutation' 348 7  
3 5EWL GLN C 39  ? UNP Q91977 ASN 61  'engineered mutation' 61  8  
3 5EWL GLN C 349 ? UNP Q91977 ASN 371 'engineered mutation' 371 9  
3 5EWL LEU C 387 ? UNP Q91977 ?   ?   'expression tag'      409 10 
3 5EWL VAL C 388 ? UNP Q91977 ?   ?   'expression tag'      410 11 
3 5EWL PRO C 389 ? UNP Q91977 ?   ?   'expression tag'      411 12 
3 5EWL ARG C 390 ? UNP Q91977 ?   ?   'expression tag'      412 13 
4 5EWL ASP D 318 ? UNP Q13224 ASN 348 'engineered mutation' 348 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5SL non-polymer                   . 
'~{N}-[(1~{S},3~{S})-3-[3-[(4-methylphenyl)methyl]-1,2,4-oxadiazol-5-yl]cyclopentyl]-1~{H}-pyrazolo[3,4-d]pyrimidin-4-amine' ? 
'C20 H21 N7 O'   375.427 
ALA 'L-peptide linking'           y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer                   . 'SODIUM ION' ? 'Na 1'           22.990  
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5EWL 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.06 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.79 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '3.6M Na Formate, 0.1 M Hepes pH 7.0' 
_exptl_crystal_grow.pdbx_pH_range   6.8-7.2 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-08-20 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            80.340 
_reflns.entry_id                         5EWL 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.980 
_reflns.d_resolution_low                 120.310 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       41141 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.200 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.600 
_reflns.pdbx_Rmerge_I_obs                0.054 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.038 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         106198 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.980 4.210   ? 7.500  59218 ? ? 26085 ? 95.200 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 2.300 ? ? ? ? ? 0.086 0 1 1 0.985 ? 
4.210 120.310 ? 26.100 46980 ? ? 15056 ? 97.900 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 3.100 ? ? ? ? ? 0.024 0 2 1 0.999 ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5EWL 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     40941 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.04 
_refine.ls_d_res_high                            2.98 
_refine.ls_percent_reflns_obs                    95.85 
_refine.ls_R_factor_obs                          0.1644 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1618 
_refine.ls_R_factor_R_free                       0.2166 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_number_reflns_R_free                  2068 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9424 
_refine.correlation_coeff_Fo_to_Fc_free          0.9000 
_refine.B_iso_mean                               72.87 
_refine.aniso_B[1][1]                            1.6582 
_refine.aniso_B[2][2]                            -6.3482 
_refine.aniso_B[3][3]                            4.6900 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            11.9576 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3QEL 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.339 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        5EWL 
_refine_analyze.Luzzati_coordinate_error_obs    0.308 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11017 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         207 
_refine_hist.number_atoms_solvent             269 
_refine_hist.number_atoms_total               11493 
_refine_hist.d_res_high                       2.98 
_refine_hist.d_res_low                        30.04 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  11479 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.18  ? 2.00  15634 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  3911  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  266   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  1703  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 11479 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? 5.00  2     'X-RAY DIFFRACTION' SEMIHARMONIC 
t_omega_torsion           2.98  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_other_torsion           21.38 ? ?     ?     'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  1604  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  13400 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.98 
_refine_ls_shell.d_res_low                        3.06 
_refine_ls_shell.number_reflns_R_work             2638 
_refine_ls_shell.R_factor_R_work                  0.2278 
_refine_ls_shell.percent_reflns_obs               89.03 
_refine_ls_shell.R_factor_R_free                  0.3064 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.38 
_refine_ls_shell.number_reflns_R_free             150 
_refine_ls_shell.number_reflns_all                2788 
_refine_ls_shell.R_factor_all                     0.2321 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5EWL 
_struct.title                        
'CRYSTAL STRUCTURE OF AMINO TERMINAL DOMAINS OF THE NMDA RECEPTOR SUBUNIT GLUN1 AND GLUN2B IN COMPLEX WITH MK-22' 
_struct.pdbx_descriptor              'NMDA glutamate receptor subunit, Glutamate receptor ionotropic, NMDA 2B' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5EWL 
_struct_keywords.text            'NMDA Receptor, allosteric inhibition, GluN2B subunit, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 5 ? 
Q N N 6 ? 
R N N 5 ? 
S N N 5 ? 
T N N 7 ? 
U N N 7 ? 
V N N 7 ? 
W N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 13  ? HIS A 31  ? THR A 35  HIS A 53  1 ? 19 
HELX_P HELX_P2  AA2 ASN A 48  ? LEU A 60  ? ASN A 70  LEU A 82  1 ? 13 
HELX_P HELX_P3  AA3 ILE A 61  ? SER A 63  ? ILE A 83  SER A 85  5 ? 3  
HELX_P HELX_P4  AA4 PRO A 82  ? TYR A 92  ? PRO A 104 TYR A 114 1 ? 11 
HELX_P HELX_P5  AA5 MET A 103 ? ASP A 108 ? MET A 125 ASP A 130 5 ? 6  
HELX_P HELX_P6  AA6 PRO A 121 ? HIS A 124 ? PRO A 143 HIS A 146 5 ? 4  
HELX_P HELX_P7  AA7 GLN A 125 ? ASN A 137 ? GLN A 147 ASN A 159 1 ? 13 
HELX_P HELX_P8  AA8 ASP A 148 ? GLU A 163 ? ASP A 170 GLU A 185 1 ? 16 
HELX_P HELX_P9  AA9 LEU A 203 ? GLU A 212 ? LEU A 225 GLU A 234 1 ? 10 
HELX_P HELX_P10 AB1 SER A 223 ? LEU A 237 ? SER A 245 LEU A 259 1 ? 15 
HELX_P HELX_P11 AB2 GLU A 250 ? SER A 254 ? GLU A 272 SER A 276 5 ? 5  
HELX_P HELX_P12 AB3 GLY A 255 ? ALA A 261 ? GLY A 277 ALA A 283 1 ? 7  
HELX_P HELX_P13 AB4 ASN A 275 ? PHE A 295 ? ASN A 297 PHE A 317 1 ? 21 
HELX_P HELX_P14 AB5 THR A 316 ? SER A 326 ? THR A 338 SER A 348 1 ? 11 
HELX_P HELX_P15 AB6 ASP B 16  ? LYS B 21  ? ASP B 46  LYS B 51  1 ? 6  
HELX_P HELX_P16 AB7 ASP B 47  ? LYS B 63  ? ASP B 77  LYS B 93  1 ? 17 
HELX_P HELX_P17 AB8 GLU B 76  ? LEU B 90  ? GLU B 106 LEU B 120 1 ? 15 
HELX_P HELX_P18 AB9 GLY B 98  ? MET B 102 ? GLY B 128 MET B 132 5 ? 5  
HELX_P HELX_P19 AC1 SER B 119 ? ASP B 135 ? SER B 149 ASP B 165 1 ? 17 
HELX_P HELX_P20 AC2 GLY B 148 ? GLU B 161 ? GLY B 178 GLU B 191 1 ? 14 
HELX_P HELX_P21 AC3 SER B 184 ? LYS B 191 ? SER B 214 LYS B 221 1 ? 8  
HELX_P HELX_P22 AC4 THR B 203 ? VAL B 217 ? THR B 233 VAL B 247 1 ? 15 
HELX_P HELX_P23 AC5 PRO B 229 ? GLY B 234 ? PRO B 259 GLY B 264 1 ? 6  
HELX_P HELX_P24 AC6 GLY B 258 ? SER B 282 ? GLY B 288 SER B 312 1 ? 25 
HELX_P HELX_P25 AC7 LYS B 297 ? GLN B 301 ? LYS B 327 GLN B 331 5 ? 5  
HELX_P HELX_P26 AC8 LEU B 305 ? ILE B 310 ? LEU B 335 ILE B 340 1 ? 6  
HELX_P HELX_P27 AC9 THR C 13  ? HIS C 31  ? THR C 35  HIS C 53  1 ? 19 
HELX_P HELX_P28 AD1 ASN C 48  ? LEU C 60  ? ASN C 70  LEU C 82  1 ? 13 
HELX_P HELX_P29 AD2 ILE C 61  ? SER C 63  ? ILE C 83  SER C 85  5 ? 3  
HELX_P HELX_P30 AD3 PRO C 82  ? TYR C 92  ? PRO C 104 TYR C 114 1 ? 11 
HELX_P HELX_P31 AD4 MET C 103 ? ASP C 108 ? MET C 125 ASP C 130 5 ? 6  
HELX_P HELX_P32 AD5 PRO C 121 ? HIS C 124 ? PRO C 143 HIS C 146 5 ? 4  
HELX_P HELX_P33 AD6 GLN C 125 ? ASN C 137 ? GLN C 147 ASN C 159 1 ? 13 
HELX_P HELX_P34 AD7 ASP C 148 ? GLU C 163 ? ASP C 170 GLU C 185 1 ? 16 
HELX_P HELX_P35 AD8 LEU C 203 ? GLU C 212 ? LEU C 225 GLU C 234 1 ? 10 
HELX_P HELX_P36 AD9 SER C 223 ? LEU C 237 ? SER C 245 LEU C 259 1 ? 15 
HELX_P HELX_P37 AE1 GLU C 250 ? SER C 254 ? GLU C 272 SER C 276 5 ? 5  
HELX_P HELX_P38 AE2 GLY C 255 ? ALA C 261 ? GLY C 277 ALA C 283 1 ? 7  
HELX_P HELX_P39 AE3 ASN C 275 ? PHE C 295 ? ASN C 297 PHE C 317 1 ? 21 
HELX_P HELX_P40 AE4 THR C 316 ? SER C 326 ? THR C 338 SER C 348 1 ? 11 
HELX_P HELX_P41 AE5 ASP D 16  ? LYS D 21  ? ASP D 46  LYS D 51  1 ? 6  
HELX_P HELX_P42 AE6 ASP D 47  ? ARG D 62  ? ASP D 77  ARG D 92  1 ? 16 
HELX_P HELX_P43 AE7 GLU D 76  ? LEU D 90  ? GLU D 106 LEU D 120 1 ? 15 
HELX_P HELX_P44 AE8 GLY D 98  ? MET D 102 ? GLY D 128 MET D 132 5 ? 5  
HELX_P HELX_P45 AE9 SER D 119 ? ASP D 135 ? SER D 149 ASP D 165 1 ? 17 
HELX_P HELX_P46 AF1 GLY D 148 ? ASN D 162 ? GLY D 178 ASN D 192 1 ? 15 
HELX_P HELX_P47 AF2 SER D 184 ? LYS D 191 ? SER D 214 LYS D 221 1 ? 8  
HELX_P HELX_P48 AF3 THR D 203 ? VAL D 217 ? THR D 233 VAL D 247 1 ? 15 
HELX_P HELX_P49 AF4 PRO D 229 ? GLY D 234 ? PRO D 259 GLY D 264 1 ? 6  
HELX_P HELX_P50 AF5 GLY D 258 ? SER D 282 ? GLY D 288 SER D 312 1 ? 25 
HELX_P HELX_P51 AF6 ASN D 293 ? GLN D 301 ? ASN D 323 GLN D 331 5 ? 9  
HELX_P HELX_P52 AF7 LEU D 305 ? ILE D 310 ? LEU D 335 ILE D 340 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 57  SG  ? ? ? 1_555 A CYS 307 SG ? ? A CYS 79  A CYS 329 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf2  disulf ?    ? B CYS 56  SG  ? ? ? 1_555 B CYS 291 SG ? ? B CYS 86  B CYS 321 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf3  disulf ?    ? C CYS 57  SG  ? ? ? 1_555 C CYS 307 SG ? ? C CYS 79  C CYS 329 1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf4  disulf ?    ? D CYS 56  SG  ? ? ? 1_555 D CYS 291 SG ? ? D CYS 86  D CYS 321 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
covale1  covale one  ? A ASN 275 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 297 A NAG 502 1_555 ? ? ? ? ? ? ? 1.433 ? N-Glycosylation 
covale2  covale one  ? A ASN 367 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 389 E NAG 1   1_555 ? ? ? ? ? ? ? 1.434 ? N-Glycosylation 
covale3  covale one  ? B ASN 44  ND2 ? ? ? 1_555 K NAG .   C1 ? ? B ASN 74  B NAG 501 1_555 ? ? ? ? ? ? ? 1.429 ? N-Glycosylation 
covale4  covale one  ? B ASN 311 ND2 ? ? ? 1_555 L NAG .   C1 ? ? B ASN 341 B NAG 502 1_555 ? ? ? ? ? ? ? 1.433 ? N-Glycosylation 
covale5  covale one  ? C ASN 275 ND2 ? ? ? 1_555 P NAG .   C1 ? ? C ASN 297 C NAG 502 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
covale6  covale one  ? D ASN 44  ND2 ? ? ? 1_555 R NAG .   C1 ? ? D ASN 74  D NAG 501 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale7  covale one  ? D ASN 311 ND2 ? ? ? 1_555 S NAG .   C1 ? ? D ASN 341 D NAG 502 1_555 ? ? ? ? ? ? ? 1.433 ? N-Glycosylation 
covale8  covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.395 ? ?               
covale9  covale both ? E NAG .   O4  ? ? ? 1_555 E BMA .   C1 ? ? E NAG 2   E BMA 3   1_555 ? ? ? ? ? ? ? 1.403 ? ?               
covale10 covale one  ? E BMA .   O3  ? ? ? 1_555 E MAN .   C1 ? ? E BMA 3   E MAN 4   1_555 ? ? ? ? ? ? ? 1.458 ? ?               
covale11 covale one  ? E BMA .   O6  ? ? ? 1_555 E MAN .   C1 ? ? E BMA 3   E MAN 5   1_555 ? ? ? ? ? ? ? 1.405 ? ?               
metalc1  metalc ?    ? A ASN 28  O   ? ? ? 1_555 I NA  .   NA ? ? A ASN 50  A NA  509 1_555 ? ? ? ? ? ? ? 2.422 ? ?               
metalc2  metalc ?    ? A LYS 29  O   ? ? ? 1_555 I NA  .   NA ? ? A LYS 51  A NA  509 1_555 ? ? ? ? ? ? ? 3.170 ? ?               
metalc3  metalc ?    ? A HIS 31  O   ? ? ? 1_555 I NA  .   NA ? ? A HIS 53  A NA  509 1_555 ? ? ? ? ? ? ? 2.788 ? ?               
metalc4  metalc ?    ? A PHE 115 O   ? ? ? 1_555 F NA  .   NA ? ? A PHE 137 A NA  501 1_555 ? ? ? ? ? ? ? 2.625 ? ?               
metalc5  metalc ?    ? A ASP 342 O   ? ? ? 1_555 F NA  .   NA ? ? A ASP 364 A NA  501 1_555 ? ? ? ? ? ? ? 2.501 ? ?               
metalc6  metalc ?    ? A VAL 363 O   ? ? ? 1_555 J NA  .   NA ? ? A VAL 385 A NA  510 1_555 ? ? ? ? ? ? ? 2.475 ? ?               
metalc7  metalc ?    ? A GLN 373 O   ? ? ? 1_555 I NA  .   NA ? ? A GLN 395 A NA  509 4_554 ? ? ? ? ? ? ? 2.707 ? ?               
metalc8  metalc ?    ? A ASN 374 O   ? ? ? 1_555 J NA  .   NA ? ? A ASN 396 A NA  510 1_555 ? ? ? ? ? ? ? 2.287 ? ?               
metalc9  metalc ?    ? A ASN 374 OD1 ? ? ? 1_555 J NA  .   NA ? ? A ASN 396 A NA  510 1_555 ? ? ? ? ? ? ? 2.887 ? ?               
metalc10 metalc ?    ? A ARG 376 O   ? ? ? 1_555 J NA  .   NA ? ? A ARG 398 A NA  510 1_555 ? ? ? ? ? ? ? 2.462 ? ?               
metalc11 metalc ?    ? F NA  .   NA  ? ? ? 1_555 T HOH .   O  ? ? A NA  501 A HOH 638 1_555 ? ? ? ? ? ? ? 2.724 ? ?               
metalc12 metalc ?    ? B SER 282 O   ? ? ? 1_555 M NA  .   NA ? ? B SER 312 B NA  503 1_555 ? ? ? ? ? ? ? 2.238 ? ?               
metalc13 metalc ?    ? B ARG 298 O   ? ? ? 1_555 N NA  .   NA ? ? B ARG 328 B NA  504 1_555 ? ? ? ? ? ? ? 2.446 ? ?               
metalc14 metalc ?    ? B GLN 301 O   ? ? ? 1_555 N NA  .   NA ? ? B GLN 331 B NA  504 1_555 ? ? ? ? ? ? ? 2.481 ? ?               
metalc15 metalc ?    ? M NA  .   NA  ? ? ? 1_555 U HOH .   O  ? ? B NA  503 B HOH 658 1_555 ? ? ? ? ? ? ? 2.865 ? ?               
metalc16 metalc ?    ? M NA  .   NA  ? ? ? 1_555 D ARG 298 O  ? ? B NA  503 D ARG 328 1_555 ? ? ? ? ? ? ? 2.626 ? ?               
metalc17 metalc ?    ? M NA  .   NA  ? ? ? 1_555 D GLN 301 O  ? ? B NA  503 D GLN 331 1_555 ? ? ? ? ? ? ? 2.515 ? ?               
metalc18 metalc ?    ? N NA  .   NA  ? ? ? 1_555 D SER 282 O  ? ? B NA  504 D SER 312 1_555 ? ? ? ? ? ? ? 2.238 ? ?               
metalc19 metalc ?    ? C PHE 115 O   ? ? ? 1_555 O NA  .   NA ? ? C PHE 137 C NA  501 1_555 ? ? ? ? ? ? ? 2.563 ? ?               
metalc20 metalc ?    ? C ASP 342 O   ? ? ? 1_555 O NA  .   NA ? ? C ASP 364 C NA  501 1_555 ? ? ? ? ? ? ? 3.018 ? ?               
metalc21 metalc ?    ? O NA  .   NA  ? ? ? 1_555 V HOH .   O  ? ? C NA  501 C HOH 603 1_555 ? ? ? ? ? ? ? 2.636 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 5 ? 
AA6 ? 8 ? 
AA7 ? 2 ? 
AA8 ? 5 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 3 ? 
AB3 ? 5 ? 
AB4 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA6 5 6 ? anti-parallel 
AA6 6 7 ? anti-parallel 
AA6 7 8 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? parallel      
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
AB4 1 2 ? parallel      
AB4 2 3 ? parallel      
AB4 3 4 ? parallel      
AB4 4 5 ? parallel      
AB4 5 6 ? anti-parallel 
AB4 6 7 ? anti-parallel 
AB4 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 36  ? THR A 44  ? ILE A 58  THR A 66  
AA1 2 LYS A 3   ? LEU A 11  ? LYS A 25  LEU A 33  
AA1 3 VAL A 65  ? VAL A 70  ? VAL A 87  VAL A 92  
AA1 4 VAL A 96  ? GLY A 98  ? VAL A 118 GLY A 120 
AA1 5 PHE A 115 ? ARG A 117 ? PHE A 137 ARG A 139 
AA2 1 LYS A 189 ? PHE A 196 ? LYS A 211 PHE A 218 
AA2 2 HIS A 140 ? SER A 146 ? HIS A 162 SER A 168 
AA2 3 VAL A 217 ? SER A 221 ? VAL A 239 SER A 243 
AA2 4 VAL A 245 ? VAL A 248 ? VAL A 267 VAL A 270 
AA3 1 ILE A 266 ? LEU A 270 ? ILE A 288 LEU A 292 
AA3 2 TYR A 350 ? GLN A 356 ? TYR A 372 GLN A 378 
AA3 3 LYS A 359 ? PHE A 366 ? LYS A 381 PHE A 388 
AA3 4 ILE A 371 ? GLN A 373 ? ILE A 393 GLN A 395 
AA4 1 TYR A 329 ? GLY A 332 ? TYR A 351 GLY A 354 
AA4 2 GLY A 335 ? PHE A 339 ? GLY A 357 PHE A 361 
AA4 3 ARG A 345 ? LYS A 346 ? ARG A 367 LYS A 368 
AA5 1 VAL B 35  ? MET B 43  ? VAL B 65  MET B 73  
AA5 2 SER B 4   ? VAL B 12  ? SER B 34  VAL B 42  
AA5 3 GLY B 66  ? ALA B 70  ? GLY B 96  ALA B 100 
AA5 4 ILE B 93  ? HIS B 97  ? ILE B 123 HIS B 127 
AA5 5 PHE B 113 ? GLN B 115 ? PHE B 143 GLN B 145 
AA6 1 GLU B 168 ? LEU B 174 ? GLU B 198 LEU B 204 
AA6 2 ILE B 138 ? THR B 143 ? ILE B 168 THR B 173 
AA6 3 ILE B 197 ? TYR B 201 ? ILE B 227 TYR B 231 
AA6 4 THR B 225 ? VAL B 228 ? THR B 255 VAL B 258 
AA6 5 ILE B 248 ? TYR B 252 ? ILE B 278 TYR B 282 
AA6 6 LEU B 332 ? LEU B 337 ? LEU B 362 LEU B 367 
AA6 7 TRP B 343 ? TRP B 349 ? TRP B 373 TRP B 379 
AA6 8 LEU B 354 ? MET B 356 ? LEU B 384 MET B 386 
AA7 1 THR B 313 ? PHE B 314 ? THR B 343 PHE B 344 
AA7 2 ARG B 317 ? ASP B 318 ? ARG B 347 ASP B 348 
AA8 1 ILE C 36  ? THR C 44  ? ILE C 58  THR C 66  
AA8 2 LYS C 3   ? LEU C 11  ? LYS C 25  LEU C 33  
AA8 3 VAL C 65  ? VAL C 70  ? VAL C 87  VAL C 92  
AA8 4 VAL C 96  ? GLY C 98  ? VAL C 118 GLY C 120 
AA8 5 PHE C 115 ? ARG C 117 ? PHE C 137 ARG C 139 
AA9 1 LYS C 189 ? PHE C 196 ? LYS C 211 PHE C 218 
AA9 2 HIS C 140 ? SER C 146 ? HIS C 162 SER C 168 
AA9 3 VAL C 217 ? SER C 221 ? VAL C 239 SER C 243 
AA9 4 VAL C 245 ? VAL C 248 ? VAL C 267 VAL C 270 
AB1 1 ILE C 266 ? LEU C 270 ? ILE C 288 LEU C 292 
AB1 2 TYR C 350 ? GLN C 356 ? TYR C 372 GLN C 378 
AB1 3 LYS C 359 ? PHE C 366 ? LYS C 381 PHE C 388 
AB1 4 ILE C 371 ? GLN C 373 ? ILE C 393 GLN C 395 
AB2 1 TYR C 329 ? GLY C 332 ? TYR C 351 GLY C 354 
AB2 2 GLY C 335 ? PHE C 339 ? GLY C 357 PHE C 361 
AB2 3 ARG C 345 ? LYS C 346 ? ARG C 367 LYS C 368 
AB3 1 VAL D 35  ? MET D 43  ? VAL D 65  MET D 73  
AB3 2 SER D 4   ? VAL D 12  ? SER D 34  VAL D 42  
AB3 3 GLY D 66  ? ALA D 70  ? GLY D 96  ALA D 100 
AB3 4 ILE D 93  ? HIS D 97  ? ILE D 123 HIS D 127 
AB3 5 PHE D 113 ? GLN D 115 ? PHE D 143 GLN D 145 
AB4 1 GLU D 168 ? LEU D 174 ? GLU D 198 LEU D 204 
AB4 2 ILE D 138 ? THR D 143 ? ILE D 168 THR D 173 
AB4 3 ILE D 197 ? TYR D 201 ? ILE D 227 TYR D 231 
AB4 4 THR D 225 ? VAL D 228 ? THR D 255 VAL D 258 
AB4 5 ILE D 248 ? TYR D 252 ? ILE D 278 TYR D 282 
AB4 6 LEU D 332 ? LEU D 337 ? LEU D 362 LEU D 367 
AB4 7 TRP D 343 ? TRP D 349 ? TRP D 373 TRP D 379 
AB4 8 LEU D 354 ? MET D 356 ? LEU D 384 MET D 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLN A 37  ? O GLN A 59  N LYS A 3   ? N LYS A 25  
AA1 2 3 N GLY A 8   ? N GLY A 30  O ALA A 67  ? O ALA A 89  
AA1 3 4 N VAL A 70  ? N VAL A 92  O ILE A 97  ? O ILE A 119 
AA1 4 5 N GLY A 98  ? N GLY A 120 O LEU A 116 ? O LEU A 138 
AA2 1 2 O LEU A 194 ? O LEU A 216 N LEU A 143 ? N LEU A 165 
AA2 2 3 N ILE A 144 ? N ILE A 166 O ILE A 219 ? O ILE A 241 
AA2 3 4 N ILE A 218 ? N ILE A 240 O VAL A 245 ? O VAL A 267 
AA3 1 2 N GLY A 267 ? N GLY A 289 O MET A 353 ? O MET A 375 
AA3 2 3 N ILE A 352 ? N ILE A 374 O VAL A 363 ? O VAL A 385 
AA3 3 4 N ILE A 365 ? N ILE A 387 O ILE A 372 ? O ILE A 394 
AA4 1 2 N TYR A 329 ? N TYR A 351 O ILE A 337 ? O ILE A 359 
AA4 2 3 N GLU A 338 ? N GLU A 360 O LYS A 346 ? O LYS A 368 
AA5 1 2 O VAL B 41  ? O VAL B 71  N VAL B 9   ? N VAL B 39  
AA5 2 3 N ALA B 8   ? N ALA B 38  O VAL B 68  ? O VAL B 98  
AA5 3 4 N PHE B 69  ? N PHE B 99  O LEU B 94  ? O LEU B 124 
AA5 4 5 N GLY B 95  ? N GLY B 125 O PHE B 114 ? O PHE B 144 
AA6 1 2 O LEU B 173 ? O LEU B 203 N THR B 143 ? N THR B 173 
AA6 2 3 N SER B 140 ? N SER B 170 O LEU B 199 ? O LEU B 229 
AA6 3 4 N ILE B 198 ? N ILE B 228 O THR B 225 ? O THR B 255 
AA6 4 5 N TRP B 226 ? N TRP B 256 O ILE B 248 ? O ILE B 278 
AA6 5 6 N SER B 249 ? N SER B 279 O ILE B 335 ? O ILE B 365 
AA6 6 7 N ILE B 334 ? N ILE B 364 O VAL B 346 ? O VAL B 376 
AA6 7 8 N LYS B 348 ? N LYS B 378 O GLN B 355 ? O GLN B 385 
AA7 1 2 N PHE B 314 ? N PHE B 344 O ARG B 317 ? O ARG B 347 
AA8 1 2 O GLN C 37  ? O GLN C 59  N LYS C 3   ? N LYS C 25  
AA8 2 3 N GLY C 8   ? N GLY C 30  O ALA C 67  ? O ALA C 89  
AA8 3 4 N VAL C 70  ? N VAL C 92  O ILE C 97  ? O ILE C 119 
AA8 4 5 N VAL C 96  ? N VAL C 118 O LEU C 116 ? O LEU C 138 
AA9 1 2 O LEU C 194 ? O LEU C 216 N LEU C 143 ? N LEU C 165 
AA9 2 3 N ILE C 144 ? N ILE C 166 O ILE C 219 ? O ILE C 241 
AA9 3 4 N ILE C 218 ? N ILE C 240 O VAL C 245 ? O VAL C 267 
AB1 1 2 N GLN C 269 ? N GLN C 291 O SER C 351 ? O SER C 373 
AB1 2 3 N ILE C 352 ? N ILE C 374 O VAL C 363 ? O VAL C 385 
AB1 3 4 N ILE C 365 ? N ILE C 387 O ILE C 372 ? O ILE C 394 
AB2 1 2 N TYR C 329 ? N TYR C 351 O ILE C 337 ? O ILE C 359 
AB2 2 3 N GLU C 338 ? N GLU C 360 O LYS C 346 ? O LYS C 368 
AB3 1 2 O VAL D 41  ? O VAL D 71  N VAL D 9   ? N VAL D 39  
AB3 2 3 N ALA D 8   ? N ALA D 38  O VAL D 68  ? O VAL D 98  
AB3 3 4 N PHE D 69  ? N PHE D 99  O LEU D 94  ? O LEU D 124 
AB3 4 5 N GLY D 95  ? N GLY D 125 O PHE D 114 ? O PHE D 144 
AB4 1 2 O LEU D 173 ? O LEU D 203 N THR D 143 ? N THR D 173 
AB4 2 3 N SER D 140 ? N SER D 170 O LEU D 199 ? O LEU D 229 
AB4 3 4 N ILE D 198 ? N ILE D 228 O THR D 225 ? O THR D 255 
AB4 4 5 N TRP D 226 ? N TRP D 256 O ILE D 248 ? O ILE D 278 
AB4 5 6 N SER D 249 ? N SER D 279 O ILE D 335 ? O ILE D 365 
AB4 6 7 N LEU D 332 ? N LEU D 362 O TRP D 349 ? O TRP D 379 
AB4 7 8 N LYS D 348 ? N LYS D 378 O GLN D 355 ? O GLN D 385 
# 
_atom_sites.entry_id                    5EWL 
_atom_sites.fract_transf_matrix[1][1]   0.003719 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001855 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016683 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007736 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ASP A 1 1   ? 108.594 -22.040 -40.382 1.00 78.08  ? 23  ASP A N   1 
ATOM   2     C  CA  . ASP A 1 1   ? 107.573 -21.576 -39.441 1.00 75.89  ? 23  ASP A CA  1 
ATOM   3     C  C   . ASP A 1 1   ? 107.503 -20.006 -39.347 1.00 76.10  ? 23  ASP A C   1 
ATOM   4     O  O   . ASP A 1 1   ? 108.112 -19.409 -38.445 1.00 76.81  ? 23  ASP A O   1 
ATOM   5     C  CB  . ASP A 1 1   ? 107.743 -22.251 -38.066 1.00 78.78  ? 23  ASP A CB  1 
ATOM   6     N  N   . PRO A 1 2   ? 106.783 -19.319 -40.281 1.00 66.99  ? 24  PRO A N   1 
ATOM   7     C  CA  . PRO A 1 2   ? 106.678 -17.858 -40.188 1.00 63.27  ? 24  PRO A CA  1 
ATOM   8     C  C   . PRO A 1 2   ? 105.584 -17.438 -39.209 1.00 63.21  ? 24  PRO A C   1 
ATOM   9     O  O   . PRO A 1 2   ? 104.837 -18.283 -38.706 1.00 62.78  ? 24  PRO A O   1 
ATOM   10    C  CB  . PRO A 1 2   ? 106.337 -17.441 -41.622 1.00 63.40  ? 24  PRO A CB  1 
ATOM   11    C  CG  . PRO A 1 2   ? 105.595 -18.572 -42.166 1.00 69.19  ? 24  PRO A CG  1 
ATOM   12    C  CD  . PRO A 1 2   ? 105.992 -19.829 -41.418 1.00 67.34  ? 24  PRO A CD  1 
ATOM   13    N  N   . LYS A 1 3   ? 105.503 -16.121 -38.951 1.00 56.80  ? 25  LYS A N   1 
ATOM   14    C  CA  . LYS A 1 3   ? 104.522 -15.478 -38.097 1.00 54.91  ? 25  LYS A CA  1 
ATOM   15    C  C   . LYS A 1 3   ? 103.260 -15.199 -38.936 1.00 60.27  ? 25  LYS A C   1 
ATOM   16    O  O   . LYS A 1 3   ? 103.332 -14.529 -39.985 1.00 60.51  ? 25  LYS A O   1 
ATOM   17    C  CB  . LYS A 1 3   ? 105.090 -14.169 -37.541 1.00 55.18  ? 25  LYS A CB  1 
ATOM   18    C  CG  . LYS A 1 3   ? 104.135 -13.442 -36.609 1.00 58.05  ? 25  LYS A CG  1 
ATOM   19    C  CD  . LYS A 1 3   ? 104.528 -11.988 -36.439 1.00 62.76  ? 25  LYS A CD  1 
ATOM   20    C  CE  . LYS A 1 3   ? 103.502 -11.210 -35.648 1.00 68.03  ? 25  LYS A CE  1 
ATOM   21    N  NZ  . LYS A 1 3   ? 103.407 -11.643 -34.231 1.00 63.53  ? 25  LYS A NZ  1 
ATOM   22    N  N   . ILE A 1 4   ? 102.100 -15.689 -38.475 1.00 54.32  ? 26  ILE A N   1 
ATOM   23    C  CA  . ILE A 1 4   ? 100.879 -15.447 -39.226 1.00 50.37  ? 26  ILE A CA  1 
ATOM   24    C  C   . ILE A 1 4   ? 100.230 -14.148 -38.793 1.00 49.34  ? 26  ILE A C   1 
ATOM   25    O  O   . ILE A 1 4   ? 99.772  -14.025 -37.661 1.00 49.46  ? 26  ILE A O   1 
ATOM   26    C  CB  . ILE A 1 4   ? 99.928  -16.661 -39.204 1.00 53.35  ? 26  ILE A CB  1 
ATOM   27    C  CG1 . ILE A 1 4   ? 100.521 -17.822 -40.020 1.00 53.78  ? 26  ILE A CG1 1 
ATOM   28    C  CG2 . ILE A 1 4   ? 98.535  -16.258 -39.698 1.00 53.51  ? 26  ILE A CG2 1 
ATOM   29    C  CD1 . ILE A 1 4   ? 99.679  -19.102 -40.008 1.00 68.27  ? 26  ILE A CD1 1 
ATOM   30    N  N   . VAL A 1 5   ? 100.220 -13.179 -39.715 1.00 44.48  ? 27  VAL A N   1 
ATOM   31    C  CA  . VAL A 1 5   ? 99.645  -11.823 -39.626 1.00 42.36  ? 27  VAL A CA  1 
ATOM   32    C  C   . VAL A 1 5   ? 98.327  -11.841 -40.393 1.00 47.27  ? 27  VAL A C   1 
ATOM   33    O  O   . VAL A 1 5   ? 98.332  -12.025 -41.613 1.00 47.02  ? 27  VAL A O   1 
ATOM   34    C  CB  . VAL A 1 5   ? 100.629 -10.741 -40.164 1.00 44.07  ? 27  VAL A CB  1 
ATOM   35    C  CG1 . VAL A 1 5   ? 99.972  -9.385  -40.364 1.00 41.09  ? 27  VAL A CG1 1 
ATOM   36    C  CG2 . VAL A 1 5   ? 101.879 -10.642 -39.289 1.00 45.20  ? 27  VAL A CG2 1 
ATOM   37    N  N   . ASN A 1 6   ? 97.197  -11.713 -39.665 1.00 43.56  ? 28  ASN A N   1 
ATOM   38    C  CA  . ASN A 1 6   ? 95.863  -11.767 -40.269 1.00 41.93  ? 28  ASN A CA  1 
ATOM   39    C  C   . ASN A 1 6   ? 95.411  -10.449 -40.825 1.00 47.18  ? 28  ASN A C   1 
ATOM   40    O  O   . ASN A 1 6   ? 95.628  -9.398  -40.218 1.00 47.62  ? 28  ASN A O   1 
ATOM   41    C  CB  . ASN A 1 6   ? 94.810  -12.263 -39.278 1.00 38.08  ? 28  ASN A CB  1 
ATOM   42    C  CG  . ASN A 1 6   ? 95.041  -13.638 -38.755 1.00 58.41  ? 28  ASN A CG  1 
ATOM   43    O  OD1 . ASN A 1 6   ? 94.626  -14.616 -39.371 1.00 48.22  ? 28  ASN A OD1 1 
ATOM   44    N  ND2 . ASN A 1 6   ? 95.630  -13.739 -37.568 1.00 56.12  ? 28  ASN A ND2 1 
ATOM   45    N  N   . ILE A 1 7   ? 94.737  -10.513 -41.978 1.00 44.27  ? 29  ILE A N   1 
ATOM   46    C  CA  . ILE A 1 7   ? 94.094  -9.375  -42.634 1.00 42.67  ? 29  ILE A CA  1 
ATOM   47    C  C   . ILE A 1 7   ? 92.606  -9.729  -42.680 1.00 49.17  ? 29  ILE A C   1 
ATOM   48    O  O   . ILE A 1 7   ? 92.248  -10.847 -43.061 1.00 49.91  ? 29  ILE A O   1 
ATOM   49    C  CB  . ILE A 1 7   ? 94.725  -9.061  -43.996 1.00 44.56  ? 29  ILE A CB  1 
ATOM   50    C  CG1 . ILE A 1 7   ? 96.133  -8.480  -43.763 1.00 46.61  ? 29  ILE A CG1 1 
ATOM   51    C  CG2 . ILE A 1 7   ? 93.870  -8.088  -44.823 1.00 42.02  ? 29  ILE A CG2 1 
ATOM   52    C  CD1 . ILE A 1 7   ? 97.020  -8.463  -44.942 1.00 63.67  ? 29  ILE A CD1 1 
ATOM   53    N  N   . GLY A 1 8   ? 91.777  -8.816  -42.187 1.00 45.03  ? 30  GLY A N   1 
ATOM   54    C  CA  . GLY A 1 8   ? 90.336  -8.998  -42.144 1.00 44.01  ? 30  GLY A CA  1 
ATOM   55    C  C   . GLY A 1 8   ? 89.603  -8.285  -43.254 1.00 44.72  ? 30  GLY A C   1 
ATOM   56    O  O   . GLY A 1 8   ? 90.141  -7.349  -43.853 1.00 43.17  ? 30  GLY A O   1 
ATOM   57    N  N   . ALA A 1 9   ? 88.374  -8.740  -43.540 1.00 39.96  ? 31  ALA A N   1 
ATOM   58    C  CA  . ALA A 1 9   ? 87.526  -8.124  -44.546 1.00 39.25  ? 31  ALA A CA  1 
ATOM   59    C  C   . ALA A 1 9   ? 86.017  -8.319  -44.289 1.00 44.65  ? 31  ALA A C   1 
ATOM   60    O  O   . ALA A 1 9   ? 85.596  -9.381  -43.822 1.00 47.17  ? 31  ALA A O   1 
ATOM   61    C  CB  . ALA A 1 9   ? 87.897  -8.613  -45.933 1.00 39.60  ? 31  ALA A CB  1 
ATOM   62    N  N   . VAL A 1 10  ? 85.214  -7.280  -44.593 1.00 37.37  ? 32  VAL A N   1 
ATOM   63    C  CA  . VAL A 1 10  ? 83.757  -7.297  -44.545 1.00 36.31  ? 32  VAL A CA  1 
ATOM   64    C  C   . VAL A 1 10  ? 83.359  -7.034  -45.989 1.00 40.23  ? 32  VAL A C   1 
ATOM   65    O  O   . VAL A 1 10  ? 83.484  -5.906  -46.466 1.00 39.70  ? 32  VAL A O   1 
ATOM   66    C  CB  . VAL A 1 10  ? 83.146  -6.254  -43.586 1.00 39.54  ? 32  VAL A CB  1 
ATOM   67    C  CG1 . VAL A 1 10  ? 81.626  -6.400  -43.565 1.00 39.20  ? 32  VAL A CG1 1 
ATOM   68    C  CG2 . VAL A 1 10  ? 83.750  -6.346  -42.169 1.00 39.02  ? 32  VAL A CG2 1 
ATOM   69    N  N   . LEU A 1 11  ? 82.984  -8.098  -46.713 1.00 37.32  ? 33  LEU A N   1 
ATOM   70    C  CA  . LEU A 1 11  ? 82.717  -8.066  -48.156 1.00 35.80  ? 33  LEU A CA  1 
ATOM   71    C  C   . LEU A 1 11  ? 81.302  -8.383  -48.531 1.00 40.49  ? 33  LEU A C   1 
ATOM   72    O  O   . LEU A 1 11  ? 80.543  -8.846  -47.696 1.00 40.48  ? 33  LEU A O   1 
ATOM   73    C  CB  . LEU A 1 11  ? 83.705  -9.007  -48.866 1.00 35.68  ? 33  LEU A CB  1 
ATOM   74    C  CG  . LEU A 1 11  ? 85.205  -8.695  -48.601 1.00 37.51  ? 33  LEU A CG  1 
ATOM   75    C  CD1 . LEU A 1 11  ? 86.068  -9.761  -49.186 1.00 37.51  ? 33  LEU A CD1 1 
ATOM   76    C  CD2 . LEU A 1 11  ? 85.609  -7.294  -49.117 1.00 35.01  ? 33  LEU A CD2 1 
ATOM   77    N  N   . SER A 1 12  ? 80.919  -8.109  -49.783 1.00 39.38  ? 34  SER A N   1 
ATOM   78    C  CA  . SER A 1 12  ? 79.527  -8.295  -50.233 1.00 39.61  ? 34  SER A CA  1 
ATOM   79    C  C   . SER A 1 12  ? 79.058  -9.707  -50.313 1.00 46.66  ? 34  SER A C   1 
ATOM   80    O  O   . SER A 1 12  ? 77.987  -9.961  -49.802 1.00 50.24  ? 34  SER A O   1 
ATOM   81    C  CB  . SER A 1 12  ? 79.267  -7.602  -51.558 1.00 39.15  ? 34  SER A CB  1 
ATOM   82    O  OG  . SER A 1 12  ? 79.295  -6.198  -51.335 1.00 45.90  ? 34  SER A OG  1 
ATOM   83    N  N   . THR A 1 13  ? 79.843  -10.631 -50.884 1.00 41.53  ? 35  THR A N   1 
ATOM   84    C  CA  . THR A 1 13  ? 79.444  -12.015 -51.133 1.00 41.79  ? 35  THR A CA  1 
ATOM   85    C  C   . THR A 1 13  ? 80.540  -13.061 -50.785 1.00 48.01  ? 35  THR A C   1 
ATOM   86    O  O   . THR A 1 13  ? 81.683  -12.702 -50.485 1.00 46.54  ? 35  THR A O   1 
ATOM   87    C  CB  . THR A 1 13  ? 79.202  -12.155 -52.643 1.00 43.02  ? 35  THR A CB  1 
ATOM   88    O  OG1 . THR A 1 13  ? 80.437  -11.888 -53.320 1.00 49.24  ? 35  THR A OG1 1 
ATOM   89    C  CG2 . THR A 1 13  ? 78.166  -11.223 -53.161 1.00 35.40  ? 35  THR A CG2 1 
ATOM   90    N  N   . LYS A 1 14  ? 80.188  -14.379 -50.905 1.00 45.69  ? 36  LYS A N   1 
ATOM   91    C  CA  . LYS A 1 14  ? 81.147  -15.457 -50.734 1.00 43.91  ? 36  LYS A CA  1 
ATOM   92    C  C   . LYS A 1 14  ? 82.154  -15.449 -51.943 1.00 47.12  ? 36  LYS A C   1 
ATOM   93    O  O   . LYS A 1 14  ? 83.333  -15.745 -51.703 1.00 48.44  ? 36  LYS A O   1 
ATOM   94    C  CB  . LYS A 1 14  ? 80.453  -16.798 -50.509 1.00 44.80  ? 36  LYS A CB  1 
ATOM   95    N  N   . LYS A 1 15  ? 81.718  -15.032 -53.212 1.00 39.47  ? 37  LYS A N   1 
ATOM   96    C  CA  . LYS A 1 15  ? 82.629  -14.924 -54.389 1.00 37.89  ? 37  LYS A CA  1 
ATOM   97    C  C   . LYS A 1 15  ? 83.692  -13.914 -54.044 1.00 45.21  ? 37  LYS A C   1 
ATOM   98    O  O   . LYS A 1 15  ? 84.879  -14.140 -54.328 1.00 45.77  ? 37  LYS A O   1 
ATOM   99    C  CB  . LYS A 1 15  ? 81.949  -14.478 -55.703 1.00 36.57  ? 37  LYS A CB  1 
ATOM   100   N  N   . HIS A 1 16  ? 83.263  -12.804 -53.389 1.00 40.81  ? 38  HIS A N   1 
ATOM   101   C  CA  . HIS A 1 16  ? 84.189  -11.770 -52.991 1.00 39.30  ? 38  HIS A CA  1 
ATOM   102   C  C   . HIS A 1 16  ? 85.065  -12.259 -51.873 1.00 43.29  ? 38  HIS A C   1 
ATOM   103   O  O   . HIS A 1 16  ? 86.243  -11.894 -51.815 1.00 43.60  ? 38  HIS A O   1 
ATOM   104   C  CB  . HIS A 1 16  ? 83.473  -10.468 -52.682 1.00 39.02  ? 38  HIS A CB  1 
ATOM   105   C  CG  . HIS A 1 16  ? 82.865  -9.882  -53.910 1.00 43.48  ? 38  HIS A CG  1 
ATOM   106   N  ND1 . HIS A 1 16  ? 81.557  -9.442  -53.933 1.00 46.00  ? 38  HIS A ND1 1 
ATOM   107   C  CD2 . HIS A 1 16  ? 83.409  -9.690  -55.138 1.00 46.00  ? 38  HIS A CD2 1 
ATOM   108   C  CE1 . HIS A 1 16  ? 81.360  -8.963  -55.152 1.00 45.31  ? 38  HIS A CE1 1 
ATOM   109   N  NE2 . HIS A 1 16  ? 82.449  -9.095  -55.912 1.00 45.59  ? 38  HIS A NE2 1 
ATOM   110   N  N   . GLU A 1 17  ? 84.534  -13.163 -51.033 1.00 38.58  ? 39  GLU A N   1 
ATOM   111   C  CA  . GLU A 1 17  ? 85.343  -13.681 -49.943 1.00 38.01  ? 39  GLU A CA  1 
ATOM   112   C  C   . GLU A 1 17  ? 86.442  -14.547 -50.531 1.00 44.97  ? 39  GLU A C   1 
ATOM   113   O  O   . GLU A 1 17  ? 87.592  -14.435 -50.099 1.00 43.33  ? 39  GLU A O   1 
ATOM   114   C  CB  . GLU A 1 17  ? 84.500  -14.440 -48.931 1.00 39.48  ? 39  GLU A CB  1 
ATOM   115   C  CG  . GLU A 1 17  ? 83.798  -13.580 -47.899 1.00 43.84  ? 39  GLU A CG  1 
ATOM   116   C  CD  . GLU A 1 17  ? 83.230  -14.395 -46.749 1.00 66.44  ? 39  GLU A CD  1 
ATOM   117   O  OE1 . GLU A 1 17  ? 83.879  -14.441 -45.682 1.00 67.93  ? 39  GLU A OE1 1 
ATOM   118   O  OE2 . GLU A 1 17  ? 82.167  -15.035 -46.927 1.00 60.11  ? 39  GLU A OE2 1 
ATOM   119   N  N   . GLN A 1 18  ? 86.101  -15.334 -51.606 1.00 43.76  ? 40  GLN A N   1 
ATOM   120   C  CA  . GLN A 1 18  ? 87.057  -16.202 -52.291 1.00 43.14  ? 40  GLN A CA  1 
ATOM   121   C  C   . GLN A 1 18  ? 88.128  -15.378 -53.051 1.00 43.83  ? 40  GLN A C   1 
ATOM   122   O  O   . GLN A 1 18  ? 89.321  -15.680 -52.921 1.00 43.55  ? 40  GLN A O   1 
ATOM   123   C  CB  . GLN A 1 18  ? 86.353  -17.251 -53.146 1.00 45.48  ? 40  GLN A CB  1 
ATOM   124   C  CG  . GLN A 1 18  ? 87.307  -18.257 -53.808 1.00 70.76  ? 40  GLN A CG  1 
ATOM   125   C  CD  . GLN A 1 18  ? 88.398  -18.849 -52.922 1.00 90.03  ? 40  GLN A CD  1 
ATOM   126   O  OE1 . GLN A 1 18  ? 88.127  -19.442 -51.860 1.00 95.97  ? 40  GLN A OE1 1 
ATOM   127   N  NE2 . GLN A 1 18  ? 89.656  -18.728 -53.360 1.00 60.88  ? 40  GLN A NE2 1 
ATOM   128   N  N   . ILE A 1 19  ? 87.714  -14.296 -53.748 1.00 37.82  ? 41  ILE A N   1 
ATOM   129   C  CA  . ILE A 1 19  ? 88.605  -13.321 -54.410 1.00 35.97  ? 41  ILE A CA  1 
ATOM   130   C  C   . ILE A 1 19  ? 89.630  -12.738 -53.386 1.00 43.52  ? 41  ILE A C   1 
ATOM   131   O  O   . ILE A 1 19  ? 90.800  -12.582 -53.738 1.00 43.57  ? 41  ILE A O   1 
ATOM   132   C  CB  . ILE A 1 19  ? 87.748  -12.200 -55.042 1.00 36.47  ? 41  ILE A CB  1 
ATOM   133   C  CG1 . ILE A 1 19  ? 87.093  -12.678 -56.338 1.00 35.53  ? 41  ILE A CG1 1 
ATOM   134   C  CG2 . ILE A 1 19  ? 88.520  -10.885 -55.240 1.00 35.61  ? 41  ILE A CG2 1 
ATOM   135   C  CD1 . ILE A 1 19  ? 85.960  -11.887 -56.724 1.00 26.41  ? 41  ILE A CD1 1 
ATOM   136   N  N   . PHE A 1 20  ? 89.183  -12.435 -52.126 1.00 40.63  ? 42  PHE A N   1 
ATOM   137   C  CA  . PHE A 1 20  ? 90.037  -11.903 -51.058 1.00 39.31  ? 42  PHE A CA  1 
ATOM   138   C  C   . PHE A 1 20  ? 91.049  -12.935 -50.631 1.00 44.39  ? 42  PHE A C   1 
ATOM   139   O  O   . PHE A 1 20  ? 92.225  -12.636 -50.522 1.00 44.39  ? 42  PHE A O   1 
ATOM   140   C  CB  . PHE A 1 20  ? 89.191  -11.443 -49.857 1.00 40.15  ? 42  PHE A CB  1 
ATOM   141   C  CG  . PHE A 1 20  ? 89.951  -11.056 -48.595 1.00 41.12  ? 42  PHE A CG  1 
ATOM   142   C  CD1 . PHE A 1 20  ? 90.832  -9.969  -48.591 1.00 40.64  ? 42  PHE A CD1 1 
ATOM   143   C  CD2 . PHE A 1 20  ? 89.724  -11.728 -47.387 1.00 42.86  ? 42  PHE A CD2 1 
ATOM   144   C  CE1 . PHE A 1 20  ? 91.498  -9.596  -47.420 1.00 39.74  ? 42  PHE A CE1 1 
ATOM   145   C  CE2 . PHE A 1 20  ? 90.360  -11.311 -46.201 1.00 43.15  ? 42  PHE A CE2 1 
ATOM   146   C  CZ  . PHE A 1 20  ? 91.252  -10.267 -46.233 1.00 38.91  ? 42  PHE A CZ  1 
ATOM   147   N  N   . ARG A 1 21  ? 90.584  -14.148 -50.389 1.00 43.06  ? 43  ARG A N   1 
ATOM   148   C  CA  . ARG A 1 21  ? 91.383  -15.295 -49.973 1.00 43.81  ? 43  ARG A CA  1 
ATOM   149   C  C   . ARG A 1 21  ? 92.460  -15.571 -51.063 1.00 49.58  ? 43  ARG A C   1 
ATOM   150   O  O   . ARG A 1 21  ? 93.616  -15.855 -50.734 1.00 51.41  ? 43  ARG A O   1 
ATOM   151   C  CB  . ARG A 1 21  ? 90.429  -16.465 -49.794 1.00 41.26  ? 43  ARG A CB  1 
ATOM   152   C  CG  . ARG A 1 21  ? 90.930  -17.616 -48.981 1.00 60.45  ? 43  ARG A CG  1 
ATOM   153   C  CD  . ARG A 1 21  ? 89.799  -18.377 -48.266 1.00 87.72  ? 43  ARG A CD  1 
ATOM   154   N  NE  . ARG A 1 21  ? 88.607  -18.643 -49.093 1.00 95.84  ? 43  ARG A NE  1 
ATOM   155   C  CZ  . ARG A 1 21  ? 87.411  -18.090 -48.892 1.00 94.15  ? 43  ARG A CZ  1 
ATOM   156   N  NH1 . ARG A 1 21  ? 87.228  -17.231 -47.896 1.00 68.70  ? 43  ARG A NH1 1 
ATOM   157   N  NH2 . ARG A 1 21  ? 86.395  -18.384 -49.693 1.00 73.73  ? 43  ARG A NH2 1 
ATOM   158   N  N   . GLU A 1 22  ? 92.101  -15.385 -52.344 1.00 44.09  ? 44  GLU A N   1 
ATOM   159   C  CA  . GLU A 1 22  ? 93.041  -15.575 -53.446 1.00 43.90  ? 44  GLU A CA  1 
ATOM   160   C  C   . GLU A 1 22  ? 94.088  -14.439 -53.531 1.00 46.67  ? 44  GLU A C   1 
ATOM   161   O  O   . GLU A 1 22  ? 95.263  -14.700 -53.768 1.00 48.00  ? 44  GLU A O   1 
ATOM   162   C  CB  . GLU A 1 22  ? 92.298  -15.757 -54.783 1.00 44.68  ? 44  GLU A CB  1 
ATOM   163   C  CG  . GLU A 1 22  ? 93.166  -16.351 -55.876 1.00 53.47  ? 44  GLU A CG  1 
ATOM   164   C  CD  . GLU A 1 22  ? 93.981  -17.599 -55.561 1.00 84.00  ? 44  GLU A CD  1 
ATOM   165   O  OE1 . GLU A 1 22  ? 93.449  -18.526 -54.901 1.00 75.46  ? 44  GLU A OE1 1 
ATOM   166   O  OE2 . GLU A 1 22  ? 95.154  -17.656 -56.004 1.00 82.52  ? 44  GLU A OE2 1 
ATOM   167   N  N   . ALA A 1 23  ? 93.649  -13.191 -53.333 1.00 39.38  ? 45  ALA A N   1 
ATOM   168   C  CA  . ALA A 1 23  ? 94.483  -12.003 -53.371 1.00 36.15  ? 45  ALA A CA  1 
ATOM   169   C  C   . ALA A 1 23  ? 95.540  -12.123 -52.295 1.00 42.12  ? 45  ALA A C   1 
ATOM   170   O  O   . ALA A 1 23  ? 96.707  -11.915 -52.589 1.00 44.44  ? 45  ALA A O   1 
ATOM   171   C  CB  . ALA A 1 23  ? 93.627  -10.766 -53.147 1.00 34.65  ? 45  ALA A CB  1 
ATOM   172   N  N   . VAL A 1 24  ? 95.155  -12.548 -51.081 1.00 38.67  ? 46  VAL A N   1 
ATOM   173   C  CA  . VAL A 1 24  ? 96.093  -12.724 -49.983 1.00 39.21  ? 46  VAL A CA  1 
ATOM   174   C  C   . VAL A 1 24  ? 97.053  -13.856 -50.320 1.00 45.74  ? 46  VAL A C   1 
ATOM   175   O  O   . VAL A 1 24  ? 98.252  -13.696 -50.141 1.00 45.54  ? 46  VAL A O   1 
ATOM   176   C  CB  . VAL A 1 24  ? 95.404  -12.902 -48.602 1.00 42.07  ? 46  VAL A CB  1 
ATOM   177   C  CG1 . VAL A 1 24  ? 96.398  -13.401 -47.541 1.00 43.07  ? 46  VAL A CG1 1 
ATOM   178   C  CG2 . VAL A 1 24  ? 94.726  -11.609 -48.147 1.00 39.49  ? 46  VAL A CG2 1 
ATOM   179   N  N   . ASN A 1 25  ? 96.541  -14.964 -50.867 1.00 44.87  ? 47  ASN A N   1 
ATOM   180   C  CA  . ASN A 1 25  ? 97.397  -16.088 -51.246 1.00 47.11  ? 47  ASN A CA  1 
ATOM   181   C  C   . ASN A 1 25  ? 98.499  -15.640 -52.197 1.00 52.78  ? 47  ASN A C   1 
ATOM   182   O  O   . ASN A 1 25  ? 99.681  -15.803 -51.880 1.00 53.88  ? 47  ASN A O   1 
ATOM   183   C  CB  . ASN A 1 25  ? 96.587  -17.218 -51.855 1.00 48.52  ? 47  ASN A CB  1 
ATOM   184   C  CG  . ASN A 1 25  ? 97.363  -18.499 -51.919 1.00 83.36  ? 47  ASN A CG  1 
ATOM   185   O  OD1 . ASN A 1 25  ? 97.738  -18.969 -53.001 1.00 83.20  ? 47  ASN A OD1 1 
ATOM   186   N  ND2 . ASN A 1 25  ? 97.654  -19.070 -50.756 1.00 79.31  ? 47  ASN A ND2 1 
ATOM   187   N  N   . GLN A 1 26  ? 98.102  -14.996 -53.314 1.00 48.14  ? 48  GLN A N   1 
ATOM   188   C  CA  . GLN A 1 26  ? 98.999  -14.453 -54.321 1.00 47.96  ? 48  GLN A CA  1 
ATOM   189   C  C   . GLN A 1 26  ? 100.038 -13.536 -53.717 1.00 51.55  ? 48  GLN A C   1 
ATOM   190   O  O   . GLN A 1 26  ? 101.210 -13.683 -54.059 1.00 53.22  ? 48  GLN A O   1 
ATOM   191   C  CB  . GLN A 1 26  ? 98.223  -13.769 -55.446 1.00 48.44  ? 48  GLN A CB  1 
ATOM   192   C  CG  . GLN A 1 26  ? 97.766  -14.784 -56.504 1.00 65.01  ? 48  GLN A CG  1 
ATOM   193   C  CD  . GLN A 1 26  ? 96.567  -14.351 -57.315 1.00 78.66  ? 48  GLN A CD  1 
ATOM   194   O  OE1 . GLN A 1 26  ? 96.390  -13.169 -57.656 1.00 74.80  ? 48  GLN A OE1 1 
ATOM   195   N  NE2 . GLN A 1 26  ? 95.732  -15.319 -57.664 1.00 59.79  ? 48  GLN A NE2 1 
ATOM   196   N  N   . ALA A 1 27  ? 99.635  -12.639 -52.775 1.00 44.93  ? 49  ALA A N   1 
ATOM   197   C  CA  . ALA A 1 27  ? 100.552 -11.738 -52.045 1.00 43.47  ? 49  ALA A CA  1 
ATOM   198   C  C   . ALA A 1 27  ? 101.709 -12.549 -51.377 1.00 48.12  ? 49  ALA A C   1 
ATOM   199   O  O   . ALA A 1 27  ? 102.898 -12.246 -51.610 1.00 49.21  ? 49  ALA A O   1 
ATOM   200   C  CB  . ALA A 1 27  ? 99.785  -10.944 -50.995 1.00 42.43  ? 49  ALA A CB  1 
ATOM   201   N  N   . ASN A 1 28  ? 101.333 -13.639 -50.630 1.00 40.50  ? 50  ASN A N   1 
ATOM   202   C  CA  . ASN A 1 28  ? 102.235 -14.554 -49.970 1.00 39.60  ? 50  ASN A CA  1 
ATOM   203   C  C   . ASN A 1 28  ? 103.099 -15.224 -51.000 1.00 44.30  ? 50  ASN A C   1 
ATOM   204   O  O   . ASN A 1 28  ? 104.289 -15.408 -50.800 1.00 44.84  ? 50  ASN A O   1 
ATOM   205   C  CB  . ASN A 1 28  ? 101.449 -15.569 -49.184 1.00 38.19  ? 50  ASN A CB  1 
ATOM   206   C  CG  . ASN A 1 28  ? 100.962 -15.061 -47.854 1.00 57.54  ? 50  ASN A CG  1 
ATOM   207   O  OD1 . ASN A 1 28  ? 101.519 -14.118 -47.254 1.00 56.64  ? 50  ASN A OD1 1 
ATOM   208   N  ND2 . ASN A 1 28  ? 99.908  -15.686 -47.358 1.00 39.82  ? 50  ASN A ND2 1 
ATOM   209   N  N   . LYS A 1 29  ? 102.529 -15.503 -52.153 1.00 42.52  ? 51  LYS A N   1 
ATOM   210   C  CA  . LYS A 1 29  ? 103.296 -16.093 -53.257 1.00 43.40  ? 51  LYS A CA  1 
ATOM   211   C  C   . LYS A 1 29  ? 104.380 -15.117 -53.756 1.00 46.77  ? 51  LYS A C   1 
ATOM   212   O  O   . LYS A 1 29  ? 105.531 -15.512 -53.842 1.00 46.92  ? 51  LYS A O   1 
ATOM   213   C  CB  . LYS A 1 29  ? 102.366 -16.536 -54.417 1.00 43.49  ? 51  LYS A CB  1 
ATOM   214   C  CG  . LYS A 1 29  ? 101.549 -17.773 -54.102 1.00 42.22  ? 51  LYS A CG  1 
ATOM   215   C  CD  . LYS A 1 29  ? 101.579 -18.789 -55.239 1.00 50.66  ? 51  LYS A CD  1 
ATOM   216   C  CE  . LYS A 1 29  ? 100.196 -19.197 -55.687 1.00 63.11  ? 51  LYS A CE  1 
ATOM   217   N  NZ  . LYS A 1 29  ? 100.205 -19.800 -57.057 1.00 70.75  ? 51  LYS A NZ  1 
ATOM   218   N  N   . ARG A 1 30  ? 104.009 -13.830 -53.990 1.00 42.34  ? 52  ARG A N   1 
ATOM   219   C  CA  . ARG A 1 30  ? 104.857 -12.792 -54.557 1.00 42.71  ? 52  ARG A CA  1 
ATOM   220   C  C   . ARG A 1 30  ? 105.878 -12.146 -53.538 1.00 51.17  ? 52  ARG A C   1 
ATOM   221   O  O   . ARG A 1 30  ? 106.897 -11.593 -53.976 1.00 51.77  ? 52  ARG A O   1 
ATOM   222   C  CB  . ARG A 1 30  ? 103.965 -11.743 -55.287 1.00 37.80  ? 52  ARG A CB  1 
ATOM   223   C  CG  . ARG A 1 30  ? 103.743 -10.402 -54.608 1.00 41.03  ? 52  ARG A CG  1 
ATOM   224   C  CD  . ARG A 1 30  ? 102.872 -9.481  -55.466 1.00 51.81  ? 52  ARG A CD  1 
ATOM   225   N  NE  . ARG A 1 30  ? 101.436 -9.702  -55.249 1.00 52.55  ? 52  ARG A NE  1 
ATOM   226   C  CZ  . ARG A 1 30  ? 100.662 -9.009  -54.406 1.00 78.86  ? 52  ARG A CZ  1 
ATOM   227   N  NH1 . ARG A 1 30  ? 101.184 -8.026  -53.656 1.00 74.18  ? 52  ARG A NH1 1 
ATOM   228   N  NH2 . ARG A 1 30  ? 99.381  -9.329  -54.261 1.00 62.10  ? 52  ARG A NH2 1 
ATOM   229   N  N   . HIS A 1 31  ? 105.635 -12.257 -52.217 1.00 48.64  ? 53  HIS A N   1 
ATOM   230   C  CA  . HIS A 1 31  ? 106.523 -11.679 -51.205 1.00 48.91  ? 53  HIS A CA  1 
ATOM   231   C  C   . HIS A 1 31  ? 107.402 -12.701 -50.540 1.00 52.63  ? 53  HIS A C   1 
ATOM   232   O  O   . HIS A 1 31  ? 107.124 -13.907 -50.619 1.00 53.28  ? 53  HIS A O   1 
ATOM   233   C  CB  . HIS A 1 31  ? 105.690 -11.001 -50.119 1.00 49.23  ? 53  HIS A CB  1 
ATOM   234   C  CG  . HIS A 1 31  ? 105.118 -9.683  -50.501 1.00 52.07  ? 53  HIS A CG  1 
ATOM   235   N  ND1 . HIS A 1 31  ? 105.818 -8.524  -50.274 1.00 54.30  ? 53  HIS A ND1 1 
ATOM   236   C  CD2 . HIS A 1 31  ? 103.897 -9.378  -51.003 1.00 53.76  ? 53  HIS A CD2 1 
ATOM   237   C  CE1 . HIS A 1 31  ? 105.020 -7.543  -50.665 1.00 53.54  ? 53  HIS A CE1 1 
ATOM   238   N  NE2 . HIS A 1 31  ? 103.845 -8.011  -51.106 1.00 53.33  ? 53  HIS A NE2 1 
ATOM   239   N  N   . PHE A 1 32  ? 108.459 -12.214 -49.860 1.00 48.91  ? 54  PHE A N   1 
ATOM   240   C  CA  . PHE A 1 32  ? 109.326 -13.062 -49.062 1.00 50.26  ? 54  PHE A CA  1 
ATOM   241   C  C   . PHE A 1 32  ? 108.583 -13.220 -47.752 1.00 57.12  ? 54  PHE A C   1 
ATOM   242   O  O   . PHE A 1 32  ? 108.372 -12.247 -47.009 1.00 55.21  ? 54  PHE A O   1 
ATOM   243   C  CB  . PHE A 1 32  ? 110.686 -12.424 -48.850 1.00 52.96  ? 54  PHE A CB  1 
ATOM   244   C  CG  . PHE A 1 32  ? 111.643 -13.281 -48.048 1.00 55.85  ? 54  PHE A CG  1 
ATOM   245   C  CD1 . PHE A 1 32  ? 112.290 -14.361 -48.636 1.00 60.22  ? 54  PHE A CD1 1 
ATOM   246   C  CD2 . PHE A 1 32  ? 111.932 -12.973 -46.719 1.00 56.80  ? 54  PHE A CD2 1 
ATOM   247   C  CE1 . PHE A 1 32  ? 113.161 -15.154 -47.890 1.00 63.80  ? 54  PHE A CE1 1 
ATOM   248   C  CE2 . PHE A 1 32  ? 112.810 -13.756 -45.978 1.00 61.82  ? 54  PHE A CE2 1 
ATOM   249   C  CZ  . PHE A 1 32  ? 113.433 -14.831 -46.569 1.00 62.60  ? 54  PHE A CZ  1 
ATOM   250   N  N   . THR A 1 33  ? 108.092 -14.440 -47.523 1.00 56.33  ? 55  THR A N   1 
ATOM   251   C  CA  . THR A 1 33  ? 107.241 -14.761 -46.383 1.00 54.75  ? 55  THR A CA  1 
ATOM   252   C  C   . THR A 1 33  ? 107.875 -15.806 -45.458 1.00 58.66  ? 55  THR A C   1 
ATOM   253   O  O   . THR A 1 33  ? 107.151 -16.652 -44.911 1.00 59.64  ? 55  THR A O   1 
ATOM   254   C  CB  . THR A 1 33  ? 105.809 -15.158 -46.891 1.00 59.66  ? 55  THR A CB  1 
ATOM   255   O  OG1 . THR A 1 33  ? 105.879 -16.280 -47.793 1.00 62.73  ? 55  THR A OG1 1 
ATOM   256   C  CG2 . THR A 1 33  ? 105.060 -13.993 -47.547 1.00 50.16  ? 55  THR A CG2 1 
ATOM   257   N  N   . ARG A 1 34  ? 109.214 -15.758 -45.281 1.00 55.40  ? 56  ARG A N   1 
ATOM   258   C  CA  . ARG A 1 34  ? 109.911 -16.677 -44.356 1.00 57.10  ? 56  ARG A CA  1 
ATOM   259   C  C   . ARG A 1 34  ? 109.604 -16.246 -42.927 1.00 60.46  ? 56  ARG A C   1 
ATOM   260   O  O   . ARG A 1 34  ? 109.385 -17.093 -42.085 1.00 61.11  ? 56  ARG A O   1 
ATOM   261   C  CB  . ARG A 1 34  ? 111.435 -16.662 -44.565 1.00 58.95  ? 56  ARG A CB  1 
ATOM   262   C  CG  . ARG A 1 34  ? 112.220 -17.629 -43.644 1.00 80.79  ? 56  ARG A CG  1 
ATOM   263   C  CD  . ARG A 1 34  ? 113.748 -17.510 -43.714 1.00 92.79  ? 56  ARG A CD  1 
ATOM   264   N  NE  . ARG A 1 34  ? 114.182 -16.132 -43.468 1.00 105.57 ? 56  ARG A NE  1 
ATOM   265   C  CZ  . ARG A 1 34  ? 115.402 -15.664 -43.710 1.00 118.36 ? 56  ARG A CZ  1 
ATOM   266   N  NH1 . ARG A 1 34  ? 116.346 -16.466 -44.192 1.00 100.63 ? 56  ARG A NH1 1 
ATOM   267   N  NH2 . ARG A 1 34  ? 115.687 -14.389 -43.476 1.00 104.59 ? 56  ARG A NH2 1 
ATOM   268   N  N   . LYS A 1 35  ? 109.565 -14.926 -42.687 1.00 55.87  ? 57  LYS A N   1 
ATOM   269   C  CA  . LYS A 1 35  ? 109.366 -14.268 -41.413 1.00 55.55  ? 57  LYS A CA  1 
ATOM   270   C  C   . LYS A 1 35  ? 107.889 -13.989 -41.126 1.00 58.23  ? 57  LYS A C   1 
ATOM   271   O  O   . LYS A 1 35  ? 107.424 -14.226 -39.999 1.00 57.62  ? 57  LYS A O   1 
ATOM   272   C  CB  . LYS A 1 35  ? 110.183 -12.949 -41.402 1.00 58.57  ? 57  LYS A CB  1 
ATOM   273   C  CG  . LYS A 1 35  ? 110.056 -12.107 -40.131 1.00 70.59  ? 57  LYS A CG  1 
ATOM   274   C  CD  . LYS A 1 35  ? 110.464 -10.663 -40.327 1.00 71.99  ? 57  LYS A CD  1 
ATOM   275   C  CE  . LYS A 1 35  ? 110.186 -9.918  -39.048 1.00 85.19  ? 57  LYS A CE  1 
ATOM   276   N  NZ  . LYS A 1 35  ? 110.958 -8.657  -38.964 1.00 99.36  ? 57  LYS A NZ  1 
ATOM   277   N  N   . ILE A 1 36  ? 107.190 -13.349 -42.077 1.00 53.79  ? 58  ILE A N   1 
ATOM   278   C  CA  . ILE A 1 36  ? 105.787 -13.019 -41.848 1.00 52.27  ? 58  ILE A CA  1 
ATOM   279   C  C   . ILE A 1 36  ? 104.938 -13.485 -43.050 1.00 54.27  ? 58  ILE A C   1 
ATOM   280   O  O   . ILE A 1 36  ? 105.298 -13.265 -44.201 1.00 52.82  ? 58  ILE A O   1 
ATOM   281   C  CB  . ILE A 1 36  ? 105.497 -11.535 -41.403 1.00 54.35  ? 58  ILE A CB  1 
ATOM   282   C  CG1 . ILE A 1 36  ? 105.515 -10.592 -42.555 1.00 55.23  ? 58  ILE A CG1 1 
ATOM   283   C  CG2 . ILE A 1 36  ? 106.374 -10.999 -40.262 1.00 54.54  ? 58  ILE A CG2 1 
ATOM   284   C  CD1 . ILE A 1 36  ? 104.104 -10.213 -42.948 1.00 74.16  ? 58  ILE A CD1 1 
ATOM   285   N  N   . GLN A 1 37  ? 103.831 -14.151 -42.762 1.00 50.84  ? 59  GLN A N   1 
ATOM   286   C  CA  . GLN A 1 37  ? 102.912 -14.660 -43.775 1.00 50.40  ? 59  GLN A CA  1 
ATOM   287   C  C   . GLN A 1 37  ? 101.499 -14.194 -43.462 1.00 54.78  ? 59  GLN A C   1 
ATOM   288   O  O   . GLN A 1 37  ? 101.045 -14.304 -42.323 1.00 55.66  ? 59  GLN A O   1 
ATOM   289   C  CB  . GLN A 1 37  ? 102.954 -16.198 -43.803 1.00 53.19  ? 59  GLN A CB  1 
ATOM   290   C  CG  . GLN A 1 37  ? 102.085 -16.841 -44.870 1.00 55.57  ? 59  GLN A CG  1 
ATOM   291   C  CD  . GLN A 1 37  ? 101.902 -18.310 -44.637 1.00 65.77  ? 59  GLN A CD  1 
ATOM   292   O  OE1 . GLN A 1 37  ? 100.993 -18.716 -43.935 1.00 59.81  ? 59  GLN A OE1 1 
ATOM   293   N  NE2 . GLN A 1 37  ? 102.727 -19.139 -45.246 1.00 66.94  ? 59  GLN A NE2 1 
ATOM   294   N  N   . LEU A 1 38  ? 100.779 -13.744 -44.490 1.00 50.19  ? 60  LEU A N   1 
ATOM   295   C  CA  . LEU A 1 38  ? 99.413  -13.270 -44.336 1.00 48.80  ? 60  LEU A CA  1 
ATOM   296   C  C   . LEU A 1 38  ? 98.372  -14.370 -44.309 1.00 53.77  ? 60  LEU A C   1 
ATOM   297   O  O   . LEU A 1 38  ? 98.559  -15.440 -44.898 1.00 55.00  ? 60  LEU A O   1 
ATOM   298   C  CB  . LEU A 1 38  ? 99.064  -12.235 -45.413 1.00 47.52  ? 60  LEU A CB  1 
ATOM   299   C  CG  . LEU A 1 38  ? 99.994  -11.037 -45.524 1.00 51.95  ? 60  LEU A CG  1 
ATOM   300   C  CD1 . LEU A 1 38  ? 99.679  -10.253 -46.726 1.00 51.53  ? 60  LEU A CD1 1 
ATOM   301   C  CD2 . LEU A 1 38  ? 99.963  -10.174 -44.292 1.00 52.20  ? 60  LEU A CD2 1 
ATOM   302   N  N   . GLN A 1 39  ? 97.267  -14.096 -43.616 1.00 48.87  ? 61  GLN A N   1 
ATOM   303   C  CA  . GLN A 1 39  ? 96.126  -14.994 -43.515 1.00 48.92  ? 61  GLN A CA  1 
ATOM   304   C  C   . GLN A 1 39  ? 94.880  -14.191 -43.645 1.00 52.10  ? 61  GLN A C   1 
ATOM   305   O  O   . GLN A 1 39  ? 94.671  -13.250 -42.877 1.00 50.98  ? 61  GLN A O   1 
ATOM   306   C  CB  . GLN A 1 39  ? 96.124  -15.782 -42.199 1.00 50.84  ? 61  GLN A CB  1 
ATOM   307   C  CG  . GLN A 1 39  ? 94.944  -16.747 -42.054 1.00 50.26  ? 61  GLN A CG  1 
ATOM   308   C  CD  . GLN A 1 39  ? 95.258  -17.857 -41.102 1.00 85.26  ? 61  GLN A CD  1 
ATOM   309   O  OE1 . GLN A 1 39  ? 96.001  -18.794 -41.443 1.00 89.97  ? 61  GLN A OE1 1 
ATOM   310   N  NE2 . GLN A 1 39  ? 94.728  -17.763 -39.878 1.00 75.20  ? 61  GLN A NE2 1 
ATOM   311   N  N   . ALA A 1 40  ? 94.045  -14.555 -44.620 1.00 48.82  ? 62  ALA A N   1 
ATOM   312   C  CA  . ALA A 1 40  ? 92.799  -13.851 -44.844 1.00 47.05  ? 62  ALA A CA  1 
ATOM   313   C  C   . ALA A 1 40  ? 91.743  -14.369 -43.877 1.00 49.48  ? 62  ALA A C   1 
ATOM   314   O  O   . ALA A 1 40  ? 91.649  -15.569 -43.678 1.00 51.22  ? 62  ALA A O   1 
ATOM   315   C  CB  . ALA A 1 40  ? 92.354  -14.051 -46.275 1.00 47.90  ? 62  ALA A CB  1 
ATOM   316   N  N   . THR A 1 41  ? 90.999  -13.455 -43.241 1.00 44.10  ? 63  THR A N   1 
ATOM   317   C  CA  . THR A 1 41  ? 89.885  -13.680 -42.307 1.00 43.83  ? 63  THR A CA  1 
ATOM   318   C  C   . THR A 1 41  ? 88.785  -12.797 -42.860 1.00 48.26  ? 63  THR A C   1 
ATOM   319   O  O   . THR A 1 41  ? 89.053  -11.631 -43.160 1.00 49.39  ? 63  THR A O   1 
ATOM   320   C  CB  . THR A 1 41  ? 90.260  -13.187 -40.891 1.00 48.63  ? 63  THR A CB  1 
ATOM   321   O  OG1 . THR A 1 41  ? 91.518  -13.729 -40.471 1.00 58.77  ? 63  THR A OG1 1 
ATOM   322   C  CG2 . THR A 1 41  ? 89.218  -13.517 -39.874 1.00 39.07  ? 63  THR A CG2 1 
ATOM   323   N  N   . SER A 1 42  ? 87.573  -13.316 -43.050 1.00 45.34  ? 64  SER A N   1 
ATOM   324   C  CA  . SER A 1 42  ? 86.509  -12.470 -43.608 1.00 45.05  ? 64  SER A CA  1 
ATOM   325   C  C   . SER A 1 42  ? 85.116  -12.894 -43.254 1.00 51.33  ? 64  SER A C   1 
ATOM   326   O  O   . SER A 1 42  ? 84.893  -14.045 -42.861 1.00 53.24  ? 64  SER A O   1 
ATOM   327   C  CB  . SER A 1 42  ? 86.624  -12.327 -45.126 1.00 46.94  ? 64  SER A CB  1 
ATOM   328   O  OG  . SER A 1 42  ? 86.332  -13.544 -45.780 1.00 51.88  ? 64  SER A OG  1 
ATOM   329   N  N   . VAL A 1 43  ? 84.173  -11.932 -43.412 1.00 46.09  ? 65  VAL A N   1 
ATOM   330   C  CA  . VAL A 1 43  ? 82.724  -12.069 -43.226 1.00 44.90  ? 65  VAL A CA  1 
ATOM   331   C  C   . VAL A 1 43  ? 82.021  -11.239 -44.304 1.00 46.24  ? 65  VAL A C   1 
ATOM   332   O  O   . VAL A 1 43  ? 82.652  -10.396 -44.942 1.00 44.25  ? 65  VAL A O   1 
ATOM   333   C  CB  . VAL A 1 43  ? 82.244  -11.654 -41.812 1.00 47.39  ? 65  VAL A CB  1 
ATOM   334   C  CG1 . VAL A 1 43  ? 82.904  -12.479 -40.736 1.00 46.76  ? 65  VAL A CG1 1 
ATOM   335   C  CG2 . VAL A 1 43  ? 82.432  -10.169 -41.554 1.00 46.46  ? 65  VAL A CG2 1 
ATOM   336   N  N   . THR A 1 44  ? 80.729  -11.473 -44.495 1.00 43.13  ? 66  THR A N   1 
ATOM   337   C  CA  . THR A 1 44  ? 79.886  -10.681 -45.384 1.00 42.91  ? 66  THR A CA  1 
ATOM   338   C  C   . THR A 1 44  ? 79.106  -9.709  -44.511 1.00 48.32  ? 66  THR A C   1 
ATOM   339   O  O   . THR A 1 44  ? 79.052  -9.920  -43.291 1.00 51.27  ? 66  THR A O   1 
ATOM   340   C  CB  . THR A 1 44  ? 78.975  -11.563 -46.252 1.00 55.72  ? 66  THR A CB  1 
ATOM   341   O  OG1 . THR A 1 44  ? 78.453  -12.646 -45.490 1.00 64.41  ? 66  THR A OG1 1 
ATOM   342   C  CG2 . THR A 1 44  ? 79.682  -12.097 -47.459 1.00 52.48  ? 66  THR A CG2 1 
ATOM   343   N  N   . HIS A 1 45  ? 78.512  -8.650  -45.095 1.00 43.46  ? 67  HIS A N   1 
ATOM   344   C  CA  . HIS A 1 45  ? 77.747  -7.687  -44.293 1.00 44.30  ? 67  HIS A CA  1 
ATOM   345   C  C   . HIS A 1 45  ? 76.582  -8.304  -43.507 1.00 49.05  ? 67  HIS A C   1 
ATOM   346   O  O   . HIS A 1 45  ? 75.932  -9.241  -43.992 1.00 50.82  ? 67  HIS A O   1 
ATOM   347   C  CB  . HIS A 1 45  ? 77.260  -6.525  -45.136 1.00 45.42  ? 67  HIS A CB  1 
ATOM   348   C  CG  . HIS A 1 45  ? 78.363  -5.790  -45.789 1.00 48.78  ? 67  HIS A CG  1 
ATOM   349   N  ND1 . HIS A 1 45  ? 78.764  -6.090  -47.082 1.00 51.35  ? 67  HIS A ND1 1 
ATOM   350   C  CD2 . HIS A 1 45  ? 79.142  -4.804  -45.297 1.00 50.56  ? 67  HIS A CD2 1 
ATOM   351   C  CE1 . HIS A 1 45  ? 79.777  -5.283  -47.335 1.00 50.17  ? 67  HIS A CE1 1 
ATOM   352   N  NE2 . HIS A 1 45  ? 80.049  -4.497  -46.278 1.00 50.28  ? 67  HIS A NE2 1 
ATOM   353   N  N   . ARG A 1 46  ? 76.354  -7.804  -42.283 1.00 44.64  ? 68  ARG A N   1 
ATOM   354   C  CA  . ARG A 1 46  ? 75.261  -8.276  -41.415 1.00 46.20  ? 68  ARG A CA  1 
ATOM   355   C  C   . ARG A 1 46  ? 73.952  -7.532  -41.716 1.00 51.68  ? 68  ARG A C   1 
ATOM   356   O  O   . ARG A 1 46  ? 73.981  -6.522  -42.428 1.00 50.67  ? 68  ARG A O   1 
ATOM   357   C  CB  . ARG A 1 46  ? 75.631  -8.260  -39.919 1.00 45.18  ? 68  ARG A CB  1 
ATOM   358   C  CG  . ARG A 1 46  ? 76.750  -9.251  -39.572 1.00 59.82  ? 68  ARG A CG  1 
ATOM   359   C  CD  . ARG A 1 46  ? 76.308  -10.702 -39.696 1.00 83.45  ? 68  ARG A CD  1 
ATOM   360   N  NE  . ARG A 1 46  ? 77.343  -11.523 -40.333 1.00 98.92  ? 68  ARG A NE  1 
ATOM   361   C  CZ  . ARG A 1 46  ? 77.241  -12.069 -41.544 1.00 109.49 ? 68  ARG A CZ  1 
ATOM   362   N  NH1 . ARG A 1 46  ? 76.141  -11.888 -42.274 1.00 87.84  ? 68  ARG A NH1 1 
ATOM   363   N  NH2 . ARG A 1 46  ? 78.233  -12.810 -42.030 1.00 92.42  ? 68  ARG A NH2 1 
ATOM   364   N  N   . PRO A 1 47  ? 72.779  -8.063  -41.305 1.00 49.71  ? 69  PRO A N   1 
ATOM   365   C  CA  . PRO A 1 47  ? 71.510  -7.394  -41.663 1.00 49.15  ? 69  PRO A CA  1 
ATOM   366   C  C   . PRO A 1 47  ? 71.366  -5.983  -41.095 1.00 52.13  ? 69  PRO A C   1 
ATOM   367   O  O   . PRO A 1 47  ? 70.723  -5.135  -41.717 1.00 53.28  ? 69  PRO A O   1 
ATOM   368   C  CB  . PRO A 1 47  ? 70.430  -8.320  -41.099 1.00 52.59  ? 69  PRO A CB  1 
ATOM   369   C  CG  . PRO A 1 47  ? 71.116  -9.559  -40.718 1.00 58.71  ? 69  PRO A CG  1 
ATOM   370   C  CD  . PRO A 1 47  ? 72.549  -9.260  -40.476 1.00 53.14  ? 69  PRO A CD  1 
ATOM   371   N  N   . ASN A 1 48  ? 71.926  -5.754  -39.895 1.00 46.01  ? 70  ASN A N   1 
ATOM   372   C  CA  . ASN A 1 48  ? 71.872  -4.477  -39.219 1.00 44.83  ? 70  ASN A CA  1 
ATOM   373   C  C   . ASN A 1 48  ? 73.226  -4.105  -38.585 1.00 48.08  ? 70  ASN A C   1 
ATOM   374   O  O   . ASN A 1 48  ? 74.130  -4.969  -38.497 1.00 48.36  ? 70  ASN A O   1 
ATOM   375   C  CB  . ASN A 1 48  ? 70.738  -4.463  -38.218 1.00 45.29  ? 70  ASN A CB  1 
ATOM   376   C  CG  . ASN A 1 48  ? 70.916  -5.341  -37.026 1.00 55.34  ? 70  ASN A CG  1 
ATOM   377   O  OD1 . ASN A 1 48  ? 71.955  -5.333  -36.372 1.00 35.44  ? 70  ASN A OD1 1 
ATOM   378   N  ND2 . ASN A 1 48  ? 69.841  -6.011  -36.638 1.00 57.63  ? 70  ASN A ND2 1 
ATOM   379   N  N   . ALA A 1 49  ? 73.353  -2.819  -38.144 1.00 40.92  ? 71  ALA A N   1 
ATOM   380   C  CA  . ALA A 1 49  ? 74.570  -2.254  -37.569 1.00 38.87  ? 71  ALA A CA  1 
ATOM   381   C  C   . ALA A 1 49  ? 75.050  -2.892  -36.279 1.00 42.63  ? 71  ALA A C   1 
ATOM   382   O  O   . ALA A 1 49  ? 76.265  -3.055  -36.120 1.00 41.15  ? 71  ALA A O   1 
ATOM   383   C  CB  . ALA A 1 49  ? 74.399  -0.771  -37.365 1.00 39.64  ? 71  ALA A CB  1 
ATOM   384   N  N   . ILE A 1 50  ? 74.129  -3.229  -35.342 1.00 41.16  ? 72  ILE A N   1 
ATOM   385   C  CA  . ILE A 1 50  ? 74.521  -3.875  -34.073 1.00 41.79  ? 72  ILE A CA  1 
ATOM   386   C  C   . ILE A 1 50  ? 75.186  -5.227  -34.383 1.00 48.98  ? 72  ILE A C   1 
ATOM   387   O  O   . ILE A 1 50  ? 76.318  -5.454  -33.972 1.00 49.97  ? 72  ILE A O   1 
ATOM   388   C  CB  . ILE A 1 50  ? 73.366  -3.970  -33.042 1.00 45.02  ? 72  ILE A CB  1 
ATOM   389   C  CG1 . ILE A 1 50  ? 73.051  -2.610  -32.458 1.00 44.17  ? 72  ILE A CG1 1 
ATOM   390   C  CG2 . ILE A 1 50  ? 73.698  -4.946  -31.925 1.00 47.40  ? 72  ILE A CG2 1 
ATOM   391   C  CD1 . ILE A 1 50  ? 71.712  -2.534  -31.849 1.00 45.43  ? 72  ILE A CD1 1 
ATOM   392   N  N   . GLN A 1 51  ? 74.516  -6.070  -35.177 1.00 46.89  ? 73  GLN A N   1 
ATOM   393   C  CA  . GLN A 1 51  ? 75.019  -7.367  -35.605 1.00 47.53  ? 73  GLN A CA  1 
ATOM   394   C  C   . GLN A 1 51  ? 76.375  -7.218  -36.337 1.00 52.00  ? 73  GLN A C   1 
ATOM   395   O  O   . GLN A 1 51  ? 77.288  -8.012  -36.071 1.00 53.99  ? 73  GLN A O   1 
ATOM   396   C  CB  . GLN A 1 51  ? 73.999  -8.045  -36.513 1.00 49.69  ? 73  GLN A CB  1 
ATOM   397   C  CG  . GLN A 1 51  ? 72.882  -8.778  -35.796 1.00 65.29  ? 73  GLN A CG  1 
ATOM   398   C  CD  . GLN A 1 51  ? 72.058  -9.545  -36.819 1.00 95.13  ? 73  GLN A CD  1 
ATOM   399   O  OE1 . GLN A 1 51  ? 70.895  -9.206  -37.107 1.00 91.56  ? 73  GLN A OE1 1 
ATOM   400   N  NE2 . GLN A 1 51  ? 72.657  -10.577 -37.428 1.00 88.53  ? 73  GLN A NE2 1 
ATOM   401   N  N   . MET A 1 52  ? 76.514  -6.199  -37.228 1.00 44.03  ? 74  MET A N   1 
ATOM   402   C  CA  . MET A 1 52  ? 77.761  -5.950  -37.941 1.00 41.48  ? 74  MET A CA  1 
ATOM   403   C  C   . MET A 1 52  ? 78.902  -5.634  -36.966 1.00 47.46  ? 74  MET A C   1 
ATOM   404   O  O   . MET A 1 52  ? 79.981  -6.216  -37.094 1.00 49.52  ? 74  MET A O   1 
ATOM   405   C  CB  . MET A 1 52  ? 77.602  -4.832  -38.983 1.00 42.09  ? 74  MET A CB  1 
ATOM   406   C  CG  . MET A 1 52  ? 78.797  -4.693  -39.932 1.00 43.47  ? 74  MET A CG  1 
ATOM   407   S  SD  . MET A 1 52  ? 79.021  -6.139  -40.986 1.00 47.16  ? 74  MET A SD  1 
ATOM   408   C  CE  . MET A 1 52  ? 80.477  -6.905  -40.254 1.00 43.80  ? 74  MET A CE  1 
ATOM   409   N  N   . ALA A 1 53  ? 78.663  -4.744  -35.983 1.00 42.09  ? 75  ALA A N   1 
ATOM   410   C  CA  . ALA A 1 53  ? 79.671  -4.383  -34.987 1.00 41.48  ? 75  ALA A CA  1 
ATOM   411   C  C   . ALA A 1 53  ? 80.106  -5.621  -34.211 1.00 44.72  ? 75  ALA A C   1 
ATOM   412   O  O   . ALA A 1 53  ? 81.293  -5.833  -33.973 1.00 44.50  ? 75  ALA A O   1 
ATOM   413   C  CB  . ALA A 1 53  ? 79.109  -3.347  -34.025 1.00 42.77  ? 75  ALA A CB  1 
ATOM   414   N  N   . LEU A 1 54  ? 79.130  -6.457  -33.845 1.00 39.69  ? 76  LEU A N   1 
ATOM   415   C  CA  . LEU A 1 54  ? 79.359  -7.669  -33.075 1.00 37.72  ? 76  LEU A CA  1 
ATOM   416   C  C   . LEU A 1 54  ? 80.166  -8.653  -33.887 1.00 43.93  ? 76  LEU A C   1 
ATOM   417   O  O   . LEU A 1 54  ? 81.045  -9.300  -33.339 1.00 45.00  ? 76  LEU A O   1 
ATOM   418   C  CB  . LEU A 1 54  ? 78.017  -8.267  -32.593 1.00 36.47  ? 76  LEU A CB  1 
ATOM   419   C  CG  . LEU A 1 54  ? 77.350  -7.521  -31.461 1.00 37.76  ? 76  LEU A CG  1 
ATOM   420   C  CD1 . LEU A 1 54  ? 75.936  -7.837  -31.369 1.00 35.56  ? 76  LEU A CD1 1 
ATOM   421   C  CD2 . LEU A 1 54  ? 78.101  -7.704  -30.135 1.00 44.68  ? 76  LEU A CD2 1 
ATOM   422   N  N   . SER A 1 55  ? 79.902  -8.709  -35.204 1.00 40.75  ? 77  SER A N   1 
ATOM   423   C  CA  . SER A 1 55  ? 80.579  -9.579  -36.144 1.00 40.79  ? 77  SER A CA  1 
ATOM   424   C  C   . SER A 1 55  ? 82.060  -9.207  -36.203 1.00 44.28  ? 77  SER A C   1 
ATOM   425   O  O   . SER A 1 55  ? 82.900  -10.102 -36.151 1.00 44.41  ? 77  SER A O   1 
ATOM   426   C  CB  . SER A 1 55  ? 79.936  -9.460  -37.520 1.00 45.57  ? 77  SER A CB  1 
ATOM   427   O  OG  . SER A 1 55  ? 80.487  -10.388 -38.439 1.00 63.12  ? 77  SER A OG  1 
ATOM   428   N  N   . VAL A 1 56  ? 82.387  -7.897  -36.258 1.00 38.46  ? 78  VAL A N   1 
ATOM   429   C  CA  . VAL A 1 56  ? 83.774  -7.432  -36.310 1.00 37.35  ? 78  VAL A CA  1 
ATOM   430   C  C   . VAL A 1 56  ? 84.563  -8.007  -35.115 1.00 46.89  ? 78  VAL A C   1 
ATOM   431   O  O   . VAL A 1 56  ? 85.636  -8.570  -35.307 1.00 46.73  ? 78  VAL A O   1 
ATOM   432   C  CB  . VAL A 1 56  ? 83.858  -5.882  -36.409 1.00 38.22  ? 78  VAL A CB  1 
ATOM   433   C  CG1 . VAL A 1 56  ? 85.294  -5.382  -36.273 1.00 37.07  ? 78  VAL A CG1 1 
ATOM   434   C  CG2 . VAL A 1 56  ? 83.239  -5.395  -37.713 1.00 36.99  ? 78  VAL A CG2 1 
ATOM   435   N  N   . CYS A 1 57  ? 83.992  -7.907  -33.905 1.00 46.19  ? 79  CYS A N   1 
ATOM   436   C  CA  . CYS A 1 57  ? 84.575  -8.385  -32.665 1.00 47.80  ? 79  CYS A CA  1 
ATOM   437   C  C   . CYS A 1 57  ? 84.746  -9.891  -32.660 1.00 52.21  ? 79  CYS A C   1 
ATOM   438   O  O   . CYS A 1 57  ? 85.837  -10.381 -32.353 1.00 54.02  ? 79  CYS A O   1 
ATOM   439   C  CB  . CYS A 1 57  ? 83.734  -7.929  -31.477 1.00 49.91  ? 79  CYS A CB  1 
ATOM   440   S  SG  . CYS A 1 57  ? 83.888  -6.169  -31.093 1.00 53.54  ? 79  CYS A SG  1 
ATOM   441   N  N   . GLU A 1 58  ? 83.658  -10.620 -32.961 1.00 46.73  ? 80  GLU A N   1 
ATOM   442   C  CA  . GLU A 1 58  ? 83.575  -12.069 -32.920 1.00 46.54  ? 80  GLU A CA  1 
ATOM   443   C  C   . GLU A 1 58  ? 84.328  -12.748 -34.011 1.00 52.65  ? 80  GLU A C   1 
ATOM   444   O  O   . GLU A 1 58  ? 84.872  -13.825 -33.793 1.00 56.78  ? 80  GLU A O   1 
ATOM   445   C  CB  . GLU A 1 58  ? 82.115  -12.520 -32.969 1.00 48.27  ? 80  GLU A CB  1 
ATOM   446   C  CG  . GLU A 1 58  ? 81.413  -12.456 -31.626 1.00 66.76  ? 80  GLU A CG  1 
ATOM   447   C  CD  . GLU A 1 58  ? 79.896  -12.480 -31.659 1.00 101.36 ? 80  GLU A CD  1 
ATOM   448   O  OE1 . GLU A 1 58  ? 79.320  -13.099 -32.585 1.00 113.92 ? 80  GLU A OE1 1 
ATOM   449   O  OE2 . GLU A 1 58  ? 79.280  -11.875 -30.751 1.00 96.10  ? 80  GLU A OE2 1 
ATOM   450   N  N   . ASP A 1 59  ? 84.316  -12.185 -35.202 1.00 47.01  ? 81  ASP A N   1 
ATOM   451   C  CA  . ASP A 1 59  ? 84.894  -12.853 -36.350 1.00 46.31  ? 81  ASP A CA  1 
ATOM   452   C  C   . ASP A 1 59  ? 86.207  -12.288 -36.829 1.00 48.94  ? 81  ASP A C   1 
ATOM   453   O  O   . ASP A 1 59  ? 86.999  -13.055 -37.346 1.00 50.45  ? 81  ASP A O   1 
ATOM   454   C  CB  . ASP A 1 59  ? 83.877  -12.881 -37.486 1.00 48.34  ? 81  ASP A CB  1 
ATOM   455   C  CG  . ASP A 1 59  ? 82.539  -13.518 -37.118 1.00 65.05  ? 81  ASP A CG  1 
ATOM   456   O  OD1 . ASP A 1 59  ? 82.542  -14.708 -36.678 1.00 69.11  ? 81  ASP A OD1 1 
ATOM   457   O  OD2 . ASP A 1 59  ? 81.485  -12.828 -37.260 1.00 64.47  ? 81  ASP A OD2 1 
ATOM   458   N  N   . LEU A 1 60  ? 86.471  -10.984 -36.649 1.00 43.44  ? 82  LEU A N   1 
ATOM   459   C  CA  . LEU A 1 60  ? 87.727  -10.416 -37.128 1.00 40.51  ? 82  LEU A CA  1 
ATOM   460   C  C   . LEU A 1 60  ? 88.712  -10.032 -36.019 1.00 43.17  ? 82  LEU A C   1 
ATOM   461   O  O   . LEU A 1 60  ? 89.855  -10.489 -36.078 1.00 44.99  ? 82  LEU A O   1 
ATOM   462   C  CB  . LEU A 1 60  ? 87.494  -9.253  -38.088 1.00 38.39  ? 82  LEU A CB  1 
ATOM   463   C  CG  . LEU A 1 60  ? 86.437  -9.466  -39.160 1.00 42.40  ? 82  LEU A CG  1 
ATOM   464   C  CD1 . LEU A 1 60  ? 86.119  -8.182  -39.842 1.00 42.47  ? 82  LEU A CD1 1 
ATOM   465   C  CD2 . LEU A 1 60  ? 86.846  -10.516 -40.161 1.00 42.97  ? 82  LEU A CD2 1 
ATOM   466   N  N   . ILE A 1 61  ? 88.308  -9.219  -35.021 1.00 36.73  ? 83  ILE A N   1 
ATOM   467   C  CA  . ILE A 1 61  ? 89.234  -8.770  -33.954 1.00 36.01  ? 83  ILE A CA  1 
ATOM   468   C  C   . ILE A 1 61  ? 89.624  -9.956  -33.101 1.00 45.62  ? 83  ILE A C   1 
ATOM   469   O  O   . ILE A 1 61  ? 90.753  -10.003 -32.595 1.00 48.71  ? 83  ILE A O   1 
ATOM   470   C  CB  . ILE A 1 61  ? 88.722  -7.525  -33.168 1.00 36.72  ? 83  ILE A CB  1 
ATOM   471   C  CG1 . ILE A 1 61  ? 88.600  -6.299  -34.141 1.00 34.97  ? 83  ILE A CG1 1 
ATOM   472   C  CG2 . ILE A 1 61  ? 89.576  -7.199  -31.943 1.00 33.58  ? 83  ILE A CG2 1 
ATOM   473   C  CD1 . ILE A 1 61  ? 87.886  -5.092  -33.608 1.00 39.49  ? 83  ILE A CD1 1 
ATOM   474   N  N   . SER A 1 62  ? 88.762  -10.987 -33.084 1.00 43.22  ? 84  SER A N   1 
ATOM   475   C  CA  . SER A 1 62  ? 89.023  -12.249 -32.392 1.00 44.25  ? 84  SER A CA  1 
ATOM   476   C  C   . SER A 1 62  ? 90.233  -12.960 -33.016 1.00 50.10  ? 84  SER A C   1 
ATOM   477   O  O   . SER A 1 62  ? 90.904  -13.743 -32.351 1.00 51.31  ? 84  SER A O   1 
ATOM   478   C  CB  . SER A 1 62  ? 87.799  -13.149 -32.469 1.00 47.18  ? 84  SER A CB  1 
ATOM   479   O  OG  . SER A 1 62  ? 87.600  -13.616 -33.790 1.00 58.65  ? 84  SER A OG  1 
ATOM   480   N  N   . SER A 1 63  ? 90.511  -12.667 -34.295 1.00 47.49  ? 85  SER A N   1 
ATOM   481   C  CA  . SER A 1 63  ? 91.607  -13.259 -35.037 1.00 47.83  ? 85  SER A CA  1 
ATOM   482   C  C   . SER A 1 63  ? 92.811  -12.349 -35.070 1.00 53.10  ? 85  SER A C   1 
ATOM   483   O  O   . SER A 1 63  ? 93.772  -12.673 -35.771 1.00 56.22  ? 85  SER A O   1 
ATOM   484   C  CB  . SER A 1 63  ? 91.158  -13.617 -36.450 1.00 50.42  ? 85  SER A CB  1 
ATOM   485   O  OG  . SER A 1 63  ? 90.098  -14.559 -36.421 1.00 62.48  ? 85  SER A OG  1 
ATOM   486   N  N   . GLN A 1 64  ? 92.806  -11.238 -34.288 1.00 47.25  ? 86  GLN A N   1 
ATOM   487   C  CA  . GLN A 1 64  ? 93.912  -10.249 -34.253 1.00 46.09  ? 86  GLN A CA  1 
ATOM   488   C  C   . GLN A 1 64  ? 94.319  -9.722  -35.655 1.00 47.96  ? 86  GLN A C   1 
ATOM   489   O  O   . GLN A 1 64  ? 95.480  -9.835  -36.049 1.00 46.80  ? 86  GLN A O   1 
ATOM   490   C  CB  . GLN A 1 64  ? 95.141  -10.795 -33.552 1.00 47.87  ? 86  GLN A CB  1 
ATOM   491   C  CG  . GLN A 1 64  ? 94.962  -10.872 -32.095 1.00 53.21  ? 86  GLN A CG  1 
ATOM   492   C  CD  . GLN A 1 64  ? 96.070  -11.658 -31.507 1.00 56.30  ? 86  GLN A CD  1 
ATOM   493   O  OE1 . GLN A 1 64  ? 96.123  -12.882 -31.624 1.00 51.68  ? 86  GLN A OE1 1 
ATOM   494   N  NE2 . GLN A 1 64  ? 97.015  -10.951 -30.948 1.00 48.45  ? 86  GLN A NE2 1 
ATOM   495   N  N   . VAL A 1 65  ? 93.344  -9.182  -36.399 1.00 42.18  ? 87  VAL A N   1 
ATOM   496   C  CA  . VAL A 1 65  ? 93.543  -8.635  -37.732 1.00 40.59  ? 87  VAL A CA  1 
ATOM   497   C  C   . VAL A 1 65  ? 94.356  -7.351  -37.616 1.00 45.24  ? 87  VAL A C   1 
ATOM   498   O  O   . VAL A 1 65  ? 94.237  -6.640  -36.621 1.00 45.45  ? 87  VAL A O   1 
ATOM   499   C  CB  . VAL A 1 65  ? 92.200  -8.453  -38.504 1.00 43.20  ? 87  VAL A CB  1 
ATOM   500   C  CG1 . VAL A 1 65  ? 91.624  -9.800  -38.884 1.00 43.38  ? 87  VAL A CG1 1 
ATOM   501   C  CG2 . VAL A 1 65  ? 91.165  -7.649  -37.693 1.00 42.19  ? 87  VAL A CG2 1 
ATOM   502   N  N   . TYR A 1 66  ? 95.214  -7.086  -38.597 1.00 41.59  ? 88  TYR A N   1 
ATOM   503   C  CA  . TYR A 1 66  ? 96.065  -5.892  -38.646 1.00 39.88  ? 88  TYR A CA  1 
ATOM   504   C  C   . TYR A 1 66  ? 95.374  -4.724  -39.340 1.00 43.34  ? 88  TYR A C   1 
ATOM   505   O  O   . TYR A 1 66  ? 95.716  -3.578  -39.084 1.00 44.34  ? 88  TYR A O   1 
ATOM   506   C  CB  . TYR A 1 66  ? 97.405  -6.230  -39.312 1.00 40.23  ? 88  TYR A CB  1 
ATOM   507   C  CG  . TYR A 1 66  ? 98.398  -6.831  -38.339 1.00 41.80  ? 88  TYR A CG  1 
ATOM   508   C  CD1 . TYR A 1 66  ? 98.160  -8.072  -37.742 1.00 45.27  ? 88  TYR A CD1 1 
ATOM   509   C  CD2 . TYR A 1 66  ? 99.560  -6.152  -37.991 1.00 41.34  ? 88  TYR A CD2 1 
ATOM   510   C  CE1 . TYR A 1 66  ? 99.053  -8.618  -36.819 1.00 45.62  ? 88  TYR A CE1 1 
ATOM   511   C  CE2 . TYR A 1 66  ? 100.450 -6.680  -37.059 1.00 43.59  ? 88  TYR A CE2 1 
ATOM   512   C  CZ  . TYR A 1 66  ? 100.188 -7.910  -36.470 1.00 53.22  ? 88  TYR A CZ  1 
ATOM   513   O  OH  . TYR A 1 66  ? 101.069 -8.443  -35.566 1.00 57.83  ? 88  TYR A OH  1 
ATOM   514   N  N   . ALA A 1 67  ? 94.400  -5.026  -40.209 1.00 37.90  ? 89  ALA A N   1 
ATOM   515   C  CA  . ALA A 1 67  ? 93.598  -4.092  -40.999 1.00 35.80  ? 89  ALA A CA  1 
ATOM   516   C  C   . ALA A 1 67  ? 92.304  -4.785  -41.393 1.00 38.94  ? 89  ALA A C   1 
ATOM   517   O  O   . ALA A 1 67  ? 92.232  -6.026  -41.398 1.00 40.31  ? 89  ALA A O   1 
ATOM   518   C  CB  . ALA A 1 67  ? 94.356  -3.657  -42.258 1.00 35.77  ? 89  ALA A CB  1 
ATOM   519   N  N   . ILE A 1 68  ? 91.278  -3.997  -41.704 1.00 32.56  ? 90  ILE A N   1 
ATOM   520   C  CA  . ILE A 1 68  ? 90.001  -4.540  -42.151 1.00 32.53  ? 90  ILE A CA  1 
ATOM   521   C  C   . ILE A 1 68  ? 89.633  -3.867  -43.477 1.00 38.92  ? 90  ILE A C   1 
ATOM   522   O  O   . ILE A 1 68  ? 89.552  -2.638  -43.556 1.00 39.90  ? 90  ILE A O   1 
ATOM   523   C  CB  . ILE A 1 68  ? 88.851  -4.408  -41.096 1.00 34.94  ? 90  ILE A CB  1 
ATOM   524   C  CG1 . ILE A 1 68  ? 89.251  -5.024  -39.721 1.00 35.66  ? 90  ILE A CG1 1 
ATOM   525   C  CG2 . ILE A 1 68  ? 87.506  -4.967  -41.637 1.00 32.08  ? 90  ILE A CG2 1 
ATOM   526   C  CD1 . ILE A 1 68  ? 88.278  -4.751  -38.546 1.00 38.81  ? 90  ILE A CD1 1 
ATOM   527   N  N   . LEU A 1 69  ? 89.411  -4.671  -44.504 1.00 34.89  ? 91  LEU A N   1 
ATOM   528   C  CA  . LEU A 1 69  ? 88.957  -4.192  -45.794 1.00 33.91  ? 91  LEU A CA  1 
ATOM   529   C  C   . LEU A 1 69  ? 87.428  -4.148  -45.721 1.00 41.56  ? 91  LEU A C   1 
ATOM   530   O  O   . LEU A 1 69  ? 86.827  -5.048  -45.142 1.00 43.51  ? 91  LEU A O   1 
ATOM   531   C  CB  . LEU A 1 69  ? 89.418  -5.169  -46.882 1.00 32.80  ? 91  LEU A CB  1 
ATOM   532   C  CG  . LEU A 1 69  ? 90.812  -4.915  -47.464 1.00 33.34  ? 91  LEU A CG  1 
ATOM   533   C  CD1 . LEU A 1 69  ? 91.884  -5.058  -46.427 1.00 30.16  ? 91  LEU A CD1 1 
ATOM   534   C  CD2 . LEU A 1 69  ? 91.071  -5.862  -48.634 1.00 34.71  ? 91  LEU A CD2 1 
ATOM   535   N  N   . VAL A 1 70  ? 86.795  -3.085  -46.222 1.00 37.92  ? 92  VAL A N   1 
ATOM   536   C  CA  . VAL A 1 70  ? 85.328  -2.974  -46.163 1.00 37.04  ? 92  VAL A CA  1 
ATOM   537   C  C   . VAL A 1 70  ? 84.820  -2.531  -47.493 1.00 45.16  ? 92  VAL A C   1 
ATOM   538   O  O   . VAL A 1 70  ? 85.210  -1.455  -47.962 1.00 44.36  ? 92  VAL A O   1 
ATOM   539   C  CB  . VAL A 1 70  ? 84.811  -1.985  -45.089 1.00 38.73  ? 92  VAL A CB  1 
ATOM   540   C  CG1 . VAL A 1 70  ? 83.303  -2.030  -44.994 1.00 37.32  ? 92  VAL A CG1 1 
ATOM   541   C  CG2 . VAL A 1 70  ? 85.444  -2.231  -43.736 1.00 39.28  ? 92  VAL A CG2 1 
ATOM   542   N  N   . SER A 1 71  ? 83.900  -3.311  -48.071 1.00 44.71  ? 93  SER A N   1 
ATOM   543   C  CA  . SER A 1 71  ? 83.226  -2.940  -49.300 1.00 45.41  ? 93  SER A CA  1 
ATOM   544   C  C   . SER A 1 71  ? 81.928  -2.299  -48.879 1.00 55.59  ? 93  SER A C   1 
ATOM   545   O  O   . SER A 1 71  ? 81.420  -2.648  -47.835 1.00 53.27  ? 93  SER A O   1 
ATOM   546   C  CB  . SER A 1 71  ? 82.941  -4.166  -50.141 1.00 48.71  ? 93  SER A CB  1 
ATOM   547   O  OG  . SER A 1 71  ? 82.047  -5.044  -49.480 1.00 64.50  ? 93  SER A OG  1 
ATOM   548   N  N   . HIS A 1 72  ? 81.392  -1.352  -49.664 1.00 61.53  ? 94  HIS A N   1 
ATOM   549   C  CA  . HIS A 1 72  ? 80.104  -0.720  -49.377 1.00 64.48  ? 94  HIS A CA  1 
ATOM   550   C  C   . HIS A 1 72  ? 78.993  -1.794  -49.543 1.00 69.82  ? 94  HIS A C   1 
ATOM   551   O  O   . HIS A 1 72  ? 78.949  -2.472  -50.580 1.00 66.09  ? 94  HIS A O   1 
ATOM   552   C  CB  . HIS A 1 72  ? 79.855  0.501   -50.285 1.00 66.39  ? 94  HIS A CB  1 
ATOM   553   C  CG  . HIS A 1 72  ? 78.897  1.478   -49.691 1.00 71.01  ? 94  HIS A CG  1 
ATOM   554   N  ND1 . HIS A 1 72  ? 79.330  2.689   -49.184 1.00 73.33  ? 94  HIS A ND1 1 
ATOM   555   C  CD2 . HIS A 1 72  ? 77.570  1.353   -49.462 1.00 74.03  ? 94  HIS A CD2 1 
ATOM   556   C  CE1 . HIS A 1 72  ? 78.259  3.262   -48.667 1.00 73.77  ? 94  HIS A CE1 1 
ATOM   557   N  NE2 . HIS A 1 72  ? 77.176  2.487   -48.801 1.00 74.48  ? 94  HIS A NE2 1 
ATOM   558   N  N   . PRO A 1 73  ? 78.157  -2.001  -48.484 1.00 72.22  ? 95  PRO A N   1 
ATOM   559   C  CA  . PRO A 1 73  ? 77.139  -3.086  -48.525 1.00 74.71  ? 95  PRO A CA  1 
ATOM   560   C  C   . PRO A 1 73  ? 76.154  -3.060  -49.699 1.00 83.89  ? 95  PRO A C   1 
ATOM   561   O  O   . PRO A 1 73  ? 75.777  -1.965  -50.133 1.00 83.94  ? 95  PRO A O   1 
ATOM   562   C  CB  . PRO A 1 73  ? 76.402  -2.952  -47.183 1.00 76.39  ? 95  PRO A CB  1 
ATOM   563   C  CG  . PRO A 1 73  ? 76.802  -1.613  -46.627 1.00 79.11  ? 95  PRO A CG  1 
ATOM   564   C  CD  . PRO A 1 73  ? 78.156  -1.311  -47.171 1.00 73.65  ? 95  PRO A CD  1 
ATOM   565   N  N   . PRO A 1 74  ? 75.712  -4.239  -50.216 1.00 82.73  ? 96  PRO A N   1 
ATOM   566   C  CA  . PRO A 1 74  ? 74.753  -4.252  -51.349 1.00 89.81  ? 96  PRO A CA  1 
ATOM   567   C  C   . PRO A 1 74  ? 73.378  -3.624  -51.079 1.00 131.58 ? 96  PRO A C   1 
ATOM   568   O  O   . PRO A 1 74  ? 72.706  -3.128  -51.989 1.00 91.80  ? 96  PRO A O   1 
ATOM   569   C  CB  . PRO A 1 74  ? 74.631  -5.742  -51.689 1.00 91.77  ? 96  PRO A CB  1 
ATOM   570   C  CG  . PRO A 1 74  ? 75.006  -6.450  -50.434 1.00 94.09  ? 96  PRO A CG  1 
ATOM   571   C  CD  . PRO A 1 74  ? 76.093  -5.609  -49.825 1.00 86.69  ? 96  PRO A CD  1 
ATOM   572   N  N   . LEU A 1 80  ? 72.580  0.236   -43.973 1.00 60.85  ? 102 LEU A N   1 
ATOM   573   C  CA  . LEU A 1 80  ? 73.895  -0.322  -43.639 1.00 60.68  ? 102 LEU A CA  1 
ATOM   574   C  C   . LEU A 1 80  ? 75.073  0.468   -44.292 1.00 62.40  ? 102 LEU A C   1 
ATOM   575   O  O   . LEU A 1 80  ? 75.008  0.799   -45.477 1.00 62.46  ? 102 LEU A O   1 
ATOM   576   C  CB  . LEU A 1 80  ? 73.974  -1.816  -43.970 1.00 61.03  ? 102 LEU A CB  1 
ATOM   577   N  N   . THR A 1 81  ? 76.122  0.782   -43.494 1.00 54.86  ? 103 THR A N   1 
ATOM   578   C  CA  . THR A 1 81  ? 77.290  1.574   -43.891 1.00 52.38  ? 103 THR A CA  1 
ATOM   579   C  C   . THR A 1 81  ? 78.588  1.053   -43.282 1.00 53.68  ? 103 THR A C   1 
ATOM   580   O  O   . THR A 1 81  ? 78.534  0.352   -42.268 1.00 53.95  ? 103 THR A O   1 
ATOM   581   C  CB  . THR A 1 81  ? 77.149  3.004   -43.378 1.00 62.74  ? 103 THR A CB  1 
ATOM   582   O  OG1 . THR A 1 81  ? 76.559  3.030   -42.075 1.00 66.39  ? 103 THR A OG1 1 
ATOM   583   C  CG2 . THR A 1 81  ? 76.427  3.894   -44.334 1.00 66.15  ? 103 THR A CG2 1 
ATOM   584   N  N   . PRO A 1 82  ? 79.781  1.458   -43.781 1.00 47.61  ? 104 PRO A N   1 
ATOM   585   C  CA  . PRO A 1 82  ? 81.032  1.005   -43.129 1.00 46.34  ? 104 PRO A CA  1 
ATOM   586   C  C   . PRO A 1 82  ? 81.229  1.534   -41.701 1.00 46.23  ? 104 PRO A C   1 
ATOM   587   O  O   . PRO A 1 82  ? 82.158  1.080   -41.043 1.00 46.17  ? 104 PRO A O   1 
ATOM   588   C  CB  . PRO A 1 82  ? 82.138  1.547   -44.057 1.00 46.78  ? 104 PRO A CB  1 
ATOM   589   C  CG  . PRO A 1 82  ? 81.471  1.863   -45.305 1.00 50.39  ? 104 PRO A CG  1 
ATOM   590   C  CD  . PRO A 1 82  ? 80.084  2.281   -44.968 1.00 46.94  ? 104 PRO A CD  1 
ATOM   591   N  N   . THR A 1 83  ? 80.359  2.458   -41.222 1.00 39.47  ? 105 THR A N   1 
ATOM   592   C  CA  . THR A 1 83  ? 80.504  3.117   -39.922 1.00 39.28  ? 105 THR A CA  1 
ATOM   593   C  C   . THR A 1 83  ? 80.625  2.122   -38.735 1.00 43.81  ? 105 THR A C   1 
ATOM   594   O  O   . THR A 1 83  ? 81.617  2.266   -38.015 1.00 44.33  ? 105 THR A O   1 
ATOM   595   C  CB  . THR A 1 83  ? 79.442  4.185   -39.710 1.00 40.65  ? 105 THR A CB  1 
ATOM   596   O  OG1 . THR A 1 83  ? 79.739  5.248   -40.615 1.00 43.66  ? 105 THR A OG1 1 
ATOM   597   C  CG2 . THR A 1 83  ? 79.441  4.722   -38.300 1.00 30.77  ? 105 THR A CG2 1 
ATOM   598   N  N   . PRO A 1 84  ? 79.733  1.102   -38.511 1.00 37.19  ? 106 PRO A N   1 
ATOM   599   C  CA  . PRO A 1 84  ? 79.958  0.169   -37.394 1.00 36.25  ? 106 PRO A CA  1 
ATOM   600   C  C   . PRO A 1 84  ? 81.331  -0.492  -37.461 1.00 40.01  ? 106 PRO A C   1 
ATOM   601   O  O   . PRO A 1 84  ? 81.960  -0.677  -36.411 1.00 43.08  ? 106 PRO A O   1 
ATOM   602   C  CB  . PRO A 1 84  ? 78.839  -0.832  -37.551 1.00 37.58  ? 106 PRO A CB  1 
ATOM   603   C  CG  . PRO A 1 84  ? 77.804  -0.074  -38.222 1.00 41.72  ? 106 PRO A CG  1 
ATOM   604   C  CD  . PRO A 1 84  ? 78.491  0.760   -39.210 1.00 36.95  ? 106 PRO A CD  1 
ATOM   605   N  N   . ILE A 1 85  ? 81.835  -0.756  -38.682 1.00 31.99  ? 107 ILE A N   1 
ATOM   606   C  CA  . ILE A 1 85  ? 83.159  -1.336  -38.864 1.00 32.36  ? 107 ILE A CA  1 
ATOM   607   C  C   . ILE A 1 85  ? 84.237  -0.298  -38.458 1.00 39.76  ? 107 ILE A C   1 
ATOM   608   O  O   . ILE A 1 85  ? 85.144  -0.594  -37.661 1.00 40.10  ? 107 ILE A O   1 
ATOM   609   C  CB  . ILE A 1 85  ? 83.371  -1.885  -40.305 1.00 34.49  ? 107 ILE A CB  1 
ATOM   610   C  CG1 . ILE A 1 85  ? 82.305  -2.935  -40.664 1.00 34.15  ? 107 ILE A CG1 1 
ATOM   611   C  CG2 . ILE A 1 85  ? 84.765  -2.509  -40.402 1.00 36.66  ? 107 ILE A CG2 1 
ATOM   612   C  CD1 . ILE A 1 85  ? 81.777  -2.820  -41.913 1.00 30.53  ? 107 ILE A CD1 1 
ATOM   613   N  N   . SER A 1 86  ? 84.109  0.917   -39.004 1.00 36.80  ? 108 SER A N   1 
ATOM   614   C  CA  . SER A 1 86  ? 84.993  2.043   -38.752 1.00 36.72  ? 108 SER A CA  1 
ATOM   615   C  C   . SER A 1 86  ? 85.079  2.362   -37.246 1.00 45.14  ? 108 SER A C   1 
ATOM   616   O  O   . SER A 1 86  ? 86.189  2.514   -36.748 1.00 48.71  ? 108 SER A O   1 
ATOM   617   C  CB  . SER A 1 86  ? 84.510  3.265   -39.523 1.00 37.00  ? 108 SER A CB  1 
ATOM   618   O  OG  . SER A 1 86  ? 85.326  4.379   -39.225 1.00 37.90  ? 108 SER A OG  1 
ATOM   619   N  N   . TYR A 1 87  ? 83.942  2.413   -36.521 1.00 38.97  ? 109 TYR A N   1 
ATOM   620   C  CA  . TYR A 1 87  ? 83.939  2.674   -35.092 1.00 39.24  ? 109 TYR A CA  1 
ATOM   621   C  C   . TYR A 1 87  ? 84.593  1.543   -34.262 1.00 41.38  ? 109 TYR A C   1 
ATOM   622   O  O   . TYR A 1 87  ? 85.473  1.830   -33.445 1.00 39.01  ? 109 TYR A O   1 
ATOM   623   C  CB  . TYR A 1 87  ? 82.513  2.943   -34.602 1.00 42.34  ? 109 TYR A CB  1 
ATOM   624   C  CG  . TYR A 1 87  ? 81.925  4.283   -34.982 1.00 44.50  ? 109 TYR A CG  1 
ATOM   625   C  CD1 . TYR A 1 87  ? 82.656  5.205   -35.732 1.00 46.05  ? 109 TYR A CD1 1 
ATOM   626   C  CD2 . TYR A 1 87  ? 80.629  4.626   -34.608 1.00 45.15  ? 109 TYR A CD2 1 
ATOM   627   C  CE1 . TYR A 1 87  ? 82.103  6.428   -36.110 1.00 46.00  ? 109 TYR A CE1 1 
ATOM   628   C  CE2 . TYR A 1 87  ? 80.071  5.851   -34.970 1.00 45.65  ? 109 TYR A CE2 1 
ATOM   629   C  CZ  . TYR A 1 87  ? 80.814  6.749   -35.714 1.00 53.41  ? 109 TYR A CZ  1 
ATOM   630   O  OH  . TYR A 1 87  ? 80.248  7.938   -36.078 1.00 58.75  ? 109 TYR A OH  1 
ATOM   631   N  N   . THR A 1 88  ? 84.184  0.272   -34.483 1.00 38.66  ? 110 THR A N   1 
ATOM   632   C  CA  . THR A 1 88  ? 84.751  -0.873  -33.754 1.00 39.85  ? 110 THR A CA  1 
ATOM   633   C  C   . THR A 1 88  ? 86.279  -0.982  -33.952 1.00 46.79  ? 110 THR A C   1 
ATOM   634   O  O   . THR A 1 88  ? 87.031  -1.137  -32.977 1.00 49.10  ? 110 THR A O   1 
ATOM   635   C  CB  . THR A 1 88  ? 84.055  -2.172  -34.143 1.00 44.13  ? 110 THR A CB  1 
ATOM   636   O  OG1 . THR A 1 88  ? 82.643  -1.978  -34.154 1.00 44.16  ? 110 THR A OG1 1 
ATOM   637   C  CG2 . THR A 1 88  ? 84.393  -3.278  -33.205 1.00 43.59  ? 110 THR A CG2 1 
ATOM   638   N  N   . ALA A 1 89  ? 86.724  -0.896  -35.218 1.00 41.54  ? 111 ALA A N   1 
ATOM   639   C  CA  . ALA A 1 89  ? 88.127  -0.974  -35.551 1.00 41.07  ? 111 ALA A CA  1 
ATOM   640   C  C   . ALA A 1 89  ? 88.869  0.275   -35.050 1.00 46.56  ? 111 ALA A C   1 
ATOM   641   O  O   . ALA A 1 89  ? 89.978  0.147   -34.524 1.00 49.86  ? 111 ALA A O   1 
ATOM   642   C  CB  . ALA A 1 89  ? 88.282  -1.139  -37.042 1.00 41.14  ? 111 ALA A CB  1 
ATOM   643   N  N   . GLY A 1 90  ? 88.230  1.447   -35.165 1.00 39.71  ? 112 GLY A N   1 
ATOM   644   C  CA  . GLY A 1 90  ? 88.784  2.728   -34.740 1.00 38.85  ? 112 GLY A CA  1 
ATOM   645   C  C   . GLY A 1 90  ? 89.079  2.770   -33.257 1.00 44.31  ? 112 GLY A C   1 
ATOM   646   O  O   . GLY A 1 90  ? 90.119  3.297   -32.834 1.00 44.76  ? 112 GLY A O   1 
ATOM   647   N  N   . PHE A 1 91  ? 88.175  2.167   -32.460 1.00 39.96  ? 113 PHE A N   1 
ATOM   648   C  CA  . PHE A 1 91  ? 88.293  2.024   -31.018 1.00 39.82  ? 113 PHE A CA  1 
ATOM   649   C  C   . PHE A 1 91  ? 89.660  1.451   -30.637 1.00 45.05  ? 113 PHE A C   1 
ATOM   650   O  O   . PHE A 1 91  ? 90.224  1.887   -29.634 1.00 48.10  ? 113 PHE A O   1 
ATOM   651   C  CB  . PHE A 1 91  ? 87.173  1.103   -30.514 1.00 41.73  ? 113 PHE A CB  1 
ATOM   652   C  CG  . PHE A 1 91  ? 87.144  0.862   -29.028 1.00 44.08  ? 113 PHE A CG  1 
ATOM   653   C  CD1 . PHE A 1 91  ? 86.405  1.679   -28.190 1.00 47.38  ? 113 PHE A CD1 1 
ATOM   654   C  CD2 . PHE A 1 91  ? 87.809  -0.217  -28.471 1.00 46.27  ? 113 PHE A CD2 1 
ATOM   655   C  CE1 . PHE A 1 91  ? 86.339  1.423   -26.819 1.00 48.76  ? 113 PHE A CE1 1 
ATOM   656   C  CE2 . PHE A 1 91  ? 87.752  -0.463  -27.104 1.00 49.57  ? 113 PHE A CE2 1 
ATOM   657   C  CZ  . PHE A 1 91  ? 87.007  0.354   -26.289 1.00 48.14  ? 113 PHE A CZ  1 
ATOM   658   N  N   . TYR A 1 92  ? 90.185  0.475   -31.430 1.00 38.69  ? 114 TYR A N   1 
ATOM   659   C  CA  . TYR A 1 92  ? 91.481  -0.166  -31.189 1.00 37.77  ? 114 TYR A CA  1 
ATOM   660   C  C   . TYR A 1 92  ? 92.579  0.388   -32.065 1.00 45.23  ? 114 TYR A C   1 
ATOM   661   O  O   . TYR A 1 92  ? 93.736  -0.018  -31.904 1.00 49.87  ? 114 TYR A O   1 
ATOM   662   C  CB  . TYR A 1 92  ? 91.395  -1.692  -31.357 1.00 37.53  ? 114 TYR A CB  1 
ATOM   663   C  CG  . TYR A 1 92  ? 90.418  -2.366  -30.414 1.00 37.27  ? 114 TYR A CG  1 
ATOM   664   C  CD1 . TYR A 1 92  ? 90.739  -2.572  -29.076 1.00 39.25  ? 114 TYR A CD1 1 
ATOM   665   C  CD2 . TYR A 1 92  ? 89.160  -2.766  -30.851 1.00 37.54  ? 114 TYR A CD2 1 
ATOM   666   C  CE1 . TYR A 1 92  ? 89.838  -3.174  -28.200 1.00 39.70  ? 114 TYR A CE1 1 
ATOM   667   C  CE2 . TYR A 1 92  ? 88.252  -3.367  -29.984 1.00 38.91  ? 114 TYR A CE2 1 
ATOM   668   C  CZ  . TYR A 1 92  ? 88.594  -3.562  -28.659 1.00 45.07  ? 114 TYR A CZ  1 
ATOM   669   O  OH  . TYR A 1 92  ? 87.691  -4.101  -27.796 1.00 47.76  ? 114 TYR A OH  1 
ATOM   670   N  N   . ARG A 1 93  ? 92.247  1.339   -32.974 1.00 37.65  ? 115 ARG A N   1 
ATOM   671   C  CA  . ARG A 1 93  ? 93.182  1.998   -33.912 1.00 35.08  ? 115 ARG A CA  1 
ATOM   672   C  C   . ARG A 1 93  ? 93.655  1.036   -34.995 1.00 41.73  ? 115 ARG A C   1 
ATOM   673   O  O   . ARG A 1 93  ? 94.751  1.180   -35.547 1.00 43.44  ? 115 ARG A O   1 
ATOM   674   C  CB  . ARG A 1 93  ? 94.358  2.705   -33.212 1.00 28.53  ? 115 ARG A CB  1 
ATOM   675   C  CG  . ARG A 1 93  ? 93.965  3.711   -32.160 1.00 34.12  ? 115 ARG A CG  1 
ATOM   676   C  CD  . ARG A 1 93  ? 93.487  5.033   -32.722 1.00 45.81  ? 115 ARG A CD  1 
ATOM   677   N  NE  . ARG A 1 93  ? 93.450  6.069   -31.686 1.00 58.74  ? 115 ARG A NE  1 
ATOM   678   C  CZ  . ARG A 1 93  ? 92.446  6.229   -30.818 1.00 82.57  ? 115 ARG A CZ  1 
ATOM   679   N  NH1 . ARG A 1 93  ? 91.377  5.428   -30.863 1.00 50.09  ? 115 ARG A NH1 1 
ATOM   680   N  NH2 . ARG A 1 93  ? 92.497  7.196   -29.911 1.00 86.22  ? 115 ARG A NH2 1 
ATOM   681   N  N   . ILE A 1 94  ? 92.794  0.055   -35.310 1.00 38.82  ? 116 ILE A N   1 
ATOM   682   C  CA  . ILE A 1 94  ? 92.988  -0.910  -36.384 1.00 38.57  ? 116 ILE A CA  1 
ATOM   683   C  C   . ILE A 1 94  ? 92.535  -0.210  -37.685 1.00 42.82  ? 116 ILE A C   1 
ATOM   684   O  O   . ILE A 1 94  ? 91.358  0.200   -37.800 1.00 42.09  ? 116 ILE A O   1 
ATOM   685   C  CB  . ILE A 1 94  ? 92.234  -2.255  -36.161 1.00 41.36  ? 116 ILE A CB  1 
ATOM   686   C  CG1 . ILE A 1 94  ? 92.734  -2.960  -34.892 1.00 42.65  ? 116 ILE A CG1 1 
ATOM   687   C  CG2 . ILE A 1 94  ? 92.381  -3.170  -37.377 1.00 42.29  ? 116 ILE A CG2 1 
ATOM   688   C  CD1 . ILE A 1 94  ? 91.692  -3.811  -34.254 1.00 50.03  ? 116 ILE A CD1 1 
ATOM   689   N  N   . PRO A 1 95  ? 93.478  -0.042  -38.653 1.00 38.08  ? 117 PRO A N   1 
ATOM   690   C  CA  . PRO A 1 95  ? 93.131  0.608   -39.923 1.00 36.54  ? 117 PRO A CA  1 
ATOM   691   C  C   . PRO A 1 95  ? 92.040  -0.108  -40.715 1.00 41.07  ? 117 PRO A C   1 
ATOM   692   O  O   . PRO A 1 95  ? 91.997  -1.338  -40.784 1.00 39.68  ? 117 PRO A O   1 
ATOM   693   C  CB  . PRO A 1 95  ? 94.451  0.593   -40.682 1.00 38.04  ? 117 PRO A CB  1 
ATOM   694   C  CG  . PRO A 1 95  ? 95.483  0.551   -39.606 1.00 43.37  ? 117 PRO A CG  1 
ATOM   695   C  CD  . PRO A 1 95  ? 94.911  -0.381  -38.613 1.00 39.37  ? 117 PRO A CD  1 
ATOM   696   N  N   . VAL A 1 96  ? 91.154  0.692   -41.318 1.00 39.62  ? 118 VAL A N   1 
ATOM   697   C  CA  . VAL A 1 96  ? 90.063  0.237   -42.180 1.00 39.09  ? 118 VAL A CA  1 
ATOM   698   C  C   . VAL A 1 96  ? 90.328  0.762   -43.607 1.00 44.55  ? 118 VAL A C   1 
ATOM   699   O  O   . VAL A 1 96  ? 90.749  1.922   -43.774 1.00 44.96  ? 118 VAL A O   1 
ATOM   700   C  CB  . VAL A 1 96  ? 88.694  0.640   -41.609 1.00 41.38  ? 118 VAL A CB  1 
ATOM   701   C  CG1 . VAL A 1 96  ? 87.584  0.499   -42.631 1.00 40.14  ? 118 VAL A CG1 1 
ATOM   702   C  CG2 . VAL A 1 96  ? 88.390  -0.210  -40.393 1.00 42.19  ? 118 VAL A CG2 1 
ATOM   703   N  N   . ILE A 1 97  ? 90.153  -0.127  -44.613 1.00 37.58  ? 119 ILE A N   1 
ATOM   704   C  CA  . ILE A 1 97  ? 90.343  0.206   -45.997 1.00 36.22  ? 119 ILE A CA  1 
ATOM   705   C  C   . ILE A 1 97  ? 88.991  0.071   -46.711 1.00 43.33  ? 119 ILE A C   1 
ATOM   706   O  O   . ILE A 1 97  ? 88.529  -1.046  -46.970 1.00 42.80  ? 119 ILE A O   1 
ATOM   707   C  CB  . ILE A 1 97  ? 91.465  -0.614  -46.700 1.00 39.33  ? 119 ILE A CB  1 
ATOM   708   C  CG1 . ILE A 1 97  ? 92.689  -0.949  -45.774 1.00 39.85  ? 119 ILE A CG1 1 
ATOM   709   C  CG2 . ILE A 1 97  ? 91.911  0.065   -48.020 1.00 40.05  ? 119 ILE A CG2 1 
ATOM   710   C  CD1 . ILE A 1 97  ? 93.562  0.195   -45.290 1.00 53.80  ? 119 ILE A CD1 1 
ATOM   711   N  N   . GLY A 1 98  ? 88.371  1.217   -47.010 1.00 41.49  ? 120 GLY A N   1 
ATOM   712   C  CA  . GLY A 1 98  ? 87.119  1.300   -47.753 1.00 40.65  ? 120 GLY A CA  1 
ATOM   713   C  C   . GLY A 1 98  ? 87.407  0.994   -49.204 1.00 45.14  ? 120 GLY A C   1 
ATOM   714   O  O   . GLY A 1 98  ? 88.350  1.542   -49.784 1.00 46.05  ? 120 GLY A O   1 
ATOM   715   N  N   . LEU A 1 99  ? 86.643  0.077   -49.796 1.00 39.93  ? 121 LEU A N   1 
ATOM   716   C  CA  . LEU A 1 99  ? 86.880  -0.315  -51.191 1.00 37.07  ? 121 LEU A CA  1 
ATOM   717   C  C   . LEU A 1 99  ? 85.950  0.382   -52.128 1.00 44.51  ? 121 LEU A C   1 
ATOM   718   O  O   . LEU A 1 99  ? 86.359  0.623   -53.256 1.00 47.58  ? 121 LEU A O   1 
ATOM   719   C  CB  . LEU A 1 99  ? 86.742  -1.836  -51.425 1.00 35.56  ? 121 LEU A CB  1 
ATOM   720   C  CG  . LEU A 1 99  ? 87.380  -2.790  -50.472 1.00 38.46  ? 121 LEU A CG  1 
ATOM   721   C  CD1 . LEU A 1 99  ? 87.068  -4.178  -50.857 1.00 37.96  ? 121 LEU A CD1 1 
ATOM   722   C  CD2 . LEU A 1 99  ? 88.881  -2.567  -50.388 1.00 42.19  ? 121 LEU A CD2 1 
ATOM   723   N  N   . THR A 1 100 ? 84.679  0.629   -51.740 1.00 40.63  ? 122 THR A N   1 
ATOM   724   C  CA  . THR A 1 100 ? 83.735  1.227   -52.678 1.00 40.87  ? 122 THR A CA  1 
ATOM   725   C  C   . THR A 1 100 ? 82.928  2.392   -52.120 1.00 45.64  ? 122 THR A C   1 
ATOM   726   O  O   . THR A 1 100 ? 82.180  2.990   -52.884 1.00 46.59  ? 122 THR A O   1 
ATOM   727   C  CB  . THR A 1 100 ? 82.816  0.158   -53.298 1.00 47.07  ? 122 THR A CB  1 
ATOM   728   O  OG1 . THR A 1 100 ? 82.099  -0.527  -52.267 1.00 37.59  ? 122 THR A OG1 1 
ATOM   729   C  CG2 . THR A 1 100 ? 83.570  -0.825  -54.267 1.00 40.60  ? 122 THR A CG2 1 
ATOM   730   N  N   . THR A 1 101 ? 83.117  2.770   -50.853 1.00 43.77  ? 123 THR A N   1 
ATOM   731   C  CA  . THR A 1 101 ? 82.415  3.913   -50.216 1.00 44.55  ? 123 THR A CA  1 
ATOM   732   C  C   . THR A 1 101 ? 82.917  5.247   -50.727 1.00 49.78  ? 123 THR A C   1 
ATOM   733   O  O   . THR A 1 101 ? 84.089  5.605   -50.524 1.00 48.80  ? 123 THR A O   1 
ATOM   734   C  CB  . THR A 1 101 ? 82.552  3.891   -48.707 1.00 48.68  ? 123 THR A CB  1 
ATOM   735   O  OG1 . THR A 1 101 ? 82.160  2.597   -48.272 1.00 47.09  ? 123 THR A OG1 1 
ATOM   736   C  CG2 . THR A 1 101 ? 81.698  4.975   -48.046 1.00 47.79  ? 123 THR A CG2 1 
ATOM   737   N  N   . ARG A 1 102 ? 82.000  6.016   -51.320 1.00 46.83  ? 124 ARG A N   1 
ATOM   738   C  CA  . ARG A 1 102 ? 82.337  7.307   -51.935 1.00 45.74  ? 124 ARG A CA  1 
ATOM   739   C  C   . ARG A 1 102 ? 81.900  8.521   -51.146 1.00 47.73  ? 124 ARG A C   1 
ATOM   740   O  O   . ARG A 1 102 ? 82.256  9.638   -51.506 1.00 47.58  ? 124 ARG A O   1 
ATOM   741   C  CB  . ARG A 1 102 ? 81.748  7.398   -53.355 1.00 41.77  ? 124 ARG A CB  1 
ATOM   742   C  CG  . ARG A 1 102 ? 82.160  6.292   -54.297 1.00 36.31  ? 124 ARG A CG  1 
ATOM   743   C  CD  . ARG A 1 102 ? 83.513  6.488   -54.917 1.00 29.55  ? 124 ARG A CD  1 
ATOM   744   N  NE  . ARG A 1 102 ? 83.613  7.722   -55.703 1.00 37.09  ? 124 ARG A NE  1 
ATOM   745   C  CZ  . ARG A 1 102 ? 83.049  7.920   -56.891 1.00 47.15  ? 124 ARG A CZ  1 
ATOM   746   N  NH1 . ARG A 1 102 ? 82.304  6.972   -57.451 1.00 46.10  ? 124 ARG A NH1 1 
ATOM   747   N  NH2 . ARG A 1 102 ? 83.216  9.068   -57.522 1.00 27.88  ? 124 ARG A NH2 1 
ATOM   748   N  N   . MET A 1 103 ? 81.099  8.323   -50.109 1.00 43.29  ? 125 MET A N   1 
ATOM   749   C  CA  . MET A 1 103 ? 80.592  9.420   -49.309 1.00 43.04  ? 125 MET A CA  1 
ATOM   750   C  C   . MET A 1 103 ? 81.734  10.171  -48.632 1.00 49.25  ? 125 MET A C   1 
ATOM   751   O  O   . MET A 1 103 ? 82.612  9.548   -48.017 1.00 49.40  ? 125 MET A O   1 
ATOM   752   C  CB  . MET A 1 103 ? 79.534  8.919   -48.334 1.00 45.22  ? 125 MET A CB  1 
ATOM   753   C  CG  . MET A 1 103 ? 78.258  8.413   -49.026 1.00 49.26  ? 125 MET A CG  1 
ATOM   754   S  SD  . MET A 1 103 ? 77.530  9.551   -50.244 1.00 54.76  ? 125 MET A SD  1 
ATOM   755   C  CE  . MET A 1 103 ? 76.730  10.687  -49.242 1.00 52.35  ? 125 MET A CE  1 
ATOM   756   N  N   . SER A 1 104 ? 81.752  11.509  -48.793 1.00 45.47  ? 126 SER A N   1 
ATOM   757   C  CA  . SER A 1 104 ? 82.821  12.367  -48.271 1.00 44.11  ? 126 SER A CA  1 
ATOM   758   C  C   . SER A 1 104 ? 82.971  12.345  -46.727 1.00 45.95  ? 126 SER A C   1 
ATOM   759   O  O   . SER A 1 104 ? 84.068  12.610  -46.226 1.00 45.33  ? 126 SER A O   1 
ATOM   760   C  CB  . SER A 1 104 ? 82.672  13.790  -48.804 1.00 45.77  ? 126 SER A CB  1 
ATOM   761   O  OG  . SER A 1 104 ? 82.758  13.765  -50.221 1.00 46.34  ? 126 SER A OG  1 
ATOM   762   N  N   . ILE A 1 105 ? 81.910  11.974  -45.983 1.00 40.84  ? 127 ILE A N   1 
ATOM   763   C  CA  . ILE A 1 105 ? 81.990  11.926  -44.514 1.00 39.54  ? 127 ILE A CA  1 
ATOM   764   C  C   . ILE A 1 105 ? 83.085  11.002  -44.014 1.00 43.83  ? 127 ILE A C   1 
ATOM   765   O  O   . ILE A 1 105 ? 83.666  11.292  -42.964 1.00 44.50  ? 127 ILE A O   1 
ATOM   766   C  CB  . ILE A 1 105 ? 80.628  11.621  -43.846 1.00 41.93  ? 127 ILE A CB  1 
ATOM   767   C  CG1 . ILE A 1 105 ? 80.638  11.931  -42.347 1.00 42.12  ? 127 ILE A CG1 1 
ATOM   768   C  CG2 . ILE A 1 105 ? 80.125  10.191  -44.124 1.00 40.11  ? 127 ILE A CG2 1 
ATOM   769   C  CD1 . ILE A 1 105 ? 81.044  13.330  -41.986 1.00 50.39  ? 127 ILE A CD1 1 
ATOM   770   N  N   . TYR A 1 106 ? 83.404  9.911   -44.758 1.00 39.40  ? 128 TYR A N   1 
ATOM   771   C  CA  . TYR A 1 106 ? 84.496  9.029   -44.322 1.00 38.54  ? 128 TYR A CA  1 
ATOM   772   C  C   . TYR A 1 106 ? 85.857  9.709   -44.444 1.00 42.59  ? 128 TYR A C   1 
ATOM   773   O  O   . TYR A 1 106 ? 86.841  9.150   -43.948 1.00 46.69  ? 128 TYR A O   1 
ATOM   774   C  CB  . TYR A 1 106 ? 84.452  7.641   -44.980 1.00 38.77  ? 128 TYR A CB  1 
ATOM   775   C  CG  . TYR A 1 106 ? 83.150  6.960   -44.644 1.00 40.34  ? 128 TYR A CG  1 
ATOM   776   C  CD1 . TYR A 1 106 ? 83.040  6.145   -43.520 1.00 41.57  ? 128 TYR A CD1 1 
ATOM   777   C  CD2 . TYR A 1 106 ? 81.984  7.267   -45.345 1.00 41.85  ? 128 TYR A CD2 1 
ATOM   778   C  CE1 . TYR A 1 106 ? 81.811  5.609   -43.133 1.00 42.83  ? 128 TYR A CE1 1 
ATOM   779   C  CE2 . TYR A 1 106 ? 80.754  6.739   -44.971 1.00 43.33  ? 128 TYR A CE2 1 
ATOM   780   C  CZ  . TYR A 1 106 ? 80.669  5.915   -43.859 1.00 51.23  ? 128 TYR A CZ  1 
ATOM   781   O  OH  . TYR A 1 106 ? 79.443  5.406   -43.505 1.00 52.27  ? 128 TYR A OH  1 
ATOM   782   N  N   . SER A 1 107 ? 85.910  10.961  -44.969 1.00 35.40  ? 129 SER A N   1 
ATOM   783   C  CA  . SER A 1 107 ? 87.178  11.683  -45.014 1.00 35.66  ? 129 SER A CA  1 
ATOM   784   C  C   . SER A 1 107 ? 87.406  12.438  -43.695 1.00 41.34  ? 129 SER A C   1 
ATOM   785   O  O   . SER A 1 107 ? 88.474  13.057  -43.530 1.00 43.26  ? 129 SER A O   1 
ATOM   786   C  CB  . SER A 1 107 ? 87.281  12.616  -46.223 1.00 39.30  ? 129 SER A CB  1 
ATOM   787   O  OG  . SER A 1 107 ? 87.026  12.012  -47.486 1.00 44.07  ? 129 SER A OG  1 
ATOM   788   N  N   . ASP A 1 108 ? 86.422  12.352  -42.733 1.00 36.24  ? 130 ASP A N   1 
ATOM   789   C  CA  . ASP A 1 108 ? 86.485  13.027  -41.441 1.00 36.16  ? 130 ASP A CA  1 
ATOM   790   C  C   . ASP A 1 108 ? 87.335  12.269  -40.392 1.00 45.71  ? 130 ASP A C   1 
ATOM   791   O  O   . ASP A 1 108 ? 86.836  11.404  -39.669 1.00 45.90  ? 130 ASP A O   1 
ATOM   792   C  CB  . ASP A 1 108 ? 85.092  13.349  -40.935 1.00 37.69  ? 130 ASP A CB  1 
ATOM   793   C  CG  . ASP A 1 108 ? 85.043  14.225  -39.694 1.00 57.12  ? 130 ASP A CG  1 
ATOM   794   O  OD1 . ASP A 1 108 ? 86.124  14.475  -39.081 1.00 56.67  ? 130 ASP A OD1 1 
ATOM   795   O  OD2 . ASP A 1 108 ? 83.927  14.650  -39.317 1.00 70.40  ? 130 ASP A OD2 1 
ATOM   796   N  N   . LYS A 1 109 ? 88.622  12.679  -40.281 1.00 45.09  ? 131 LYS A N   1 
ATOM   797   C  CA  . LYS A 1 109 ? 89.676  12.159  -39.405 1.00 45.08  ? 131 LYS A CA  1 
ATOM   798   C  C   . LYS A 1 109 ? 89.284  12.103  -37.922 1.00 50.90  ? 131 LYS A C   1 
ATOM   799   O  O   . LYS A 1 109 ? 89.910  11.339  -37.158 1.00 52.69  ? 131 LYS A O   1 
ATOM   800   C  CB  . LYS A 1 109 ? 90.938  13.022  -39.562 1.00 48.71  ? 131 LYS A CB  1 
ATOM   801   C  CG  . LYS A 1 109 ? 92.250  12.223  -39.668 1.00 67.60  ? 131 LYS A CG  1 
ATOM   802   C  CD  . LYS A 1 109 ? 93.585  13.049  -39.581 1.00 70.69  ? 131 LYS A CD  1 
ATOM   803   C  CE  . LYS A 1 109 ? 93.637  14.323  -40.406 1.00 85.70  ? 131 LYS A CE  1 
ATOM   804   N  NZ  . LYS A 1 109 ? 93.306  14.130  -41.851 1.00 103.41 ? 131 LYS A NZ  1 
ATOM   805   N  N   . SER A 1 110 ? 88.310  12.965  -37.501 1.00 45.59  ? 132 SER A N   1 
ATOM   806   C  CA  . SER A 1 110 ? 87.814  13.050  -36.122 1.00 45.02  ? 132 SER A CA  1 
ATOM   807   C  C   . SER A 1 110 ? 86.937  11.823  -35.778 1.00 49.46  ? 132 SER A C   1 
ATOM   808   O  O   . SER A 1 110 ? 87.092  11.212  -34.720 1.00 50.70  ? 132 SER A O   1 
ATOM   809   C  CB  . SER A 1 110 ? 86.940  14.281  -35.935 1.00 47.27  ? 132 SER A CB  1 
ATOM   810   O  OG  . SER A 1 110 ? 87.535  15.562  -35.919 1.00 55.50  ? 132 SER A OG  1 
ATOM   811   N  N   . ILE A 1 111 ? 86.022  11.476  -36.681 1.00 42.86  ? 133 ILE A N   1 
ATOM   812   C  CA  . ILE A 1 111 ? 85.043  10.422  -36.530 1.00 41.03  ? 133 ILE A CA  1 
ATOM   813   C  C   . ILE A 1 111 ? 85.586  9.054   -37.122 1.00 43.03  ? 133 ILE A C   1 
ATOM   814   O  O   . ILE A 1 111 ? 85.514  7.983   -36.468 1.00 41.82  ? 133 ILE A O   1 
ATOM   815   C  CB  . ILE A 1 111 ? 83.753  11.047  -37.174 1.00 43.35  ? 133 ILE A CB  1 
ATOM   816   C  CG1 . ILE A 1 111 ? 82.920  11.723  -36.108 1.00 45.63  ? 133 ILE A CG1 1 
ATOM   817   C  CG2 . ILE A 1 111 ? 82.897  10.112  -37.947 1.00 41.05  ? 133 ILE A CG2 1 
ATOM   818   C  CD1 . ILE A 1 111 ? 83.171  13.175  -35.911 1.00 60.06  ? 133 ILE A CD1 1 
ATOM   819   N  N   . HIS A 1 112 ? 86.216  9.138   -38.304 1.00 37.14  ? 134 HIS A N   1 
ATOM   820   C  CA  . HIS A 1 112 ? 86.814  8.019   -39.006 1.00 36.06  ? 134 HIS A CA  1 
ATOM   821   C  C   . HIS A 1 112 ? 88.329  8.177   -38.874 1.00 42.75  ? 134 HIS A C   1 
ATOM   822   O  O   . HIS A 1 112 ? 89.022  8.658   -39.793 1.00 44.97  ? 134 HIS A O   1 
ATOM   823   C  CB  . HIS A 1 112 ? 86.256  7.974   -40.435 1.00 35.80  ? 134 HIS A CB  1 
ATOM   824   C  CG  . HIS A 1 112 ? 84.761  7.771   -40.424 1.00 39.38  ? 134 HIS A CG  1 
ATOM   825   N  ND1 . HIS A 1 112 ? 84.181  6.673   -39.800 1.00 40.81  ? 134 HIS A ND1 1 
ATOM   826   C  CD2 . HIS A 1 112 ? 83.773  8.570   -40.884 1.00 41.56  ? 134 HIS A CD2 1 
ATOM   827   C  CE1 . HIS A 1 112 ? 82.878  6.818   -39.936 1.00 40.59  ? 134 HIS A CE1 1 
ATOM   828   N  NE2 . HIS A 1 112 ? 82.578  7.943   -40.578 1.00 41.24  ? 134 HIS A NE2 1 
ATOM   829   N  N   . LEU A 1 113 ? 88.826  7.810   -37.669 1.00 38.50  ? 135 LEU A N   1 
ATOM   830   C  CA  . LEU A 1 113 ? 90.185  8.072   -37.181 1.00 39.22  ? 135 LEU A CA  1 
ATOM   831   C  C   . LEU A 1 113 ? 91.248  7.086   -37.635 1.00 47.01  ? 135 LEU A C   1 
ATOM   832   O  O   . LEU A 1 113 ? 92.432  7.288   -37.306 1.00 48.80  ? 135 LEU A O   1 
ATOM   833   C  CB  . LEU A 1 113 ? 90.259  8.284   -35.634 1.00 38.94  ? 135 LEU A CB  1 
ATOM   834   C  CG  . LEU A 1 113 ? 90.080  7.087   -34.732 1.00 42.10  ? 135 LEU A CG  1 
ATOM   835   C  CD1 . LEU A 1 113 ? 90.421  7.419   -33.368 1.00 40.67  ? 135 LEU A CD1 1 
ATOM   836   C  CD2 . LEU A 1 113 ? 88.649  6.542   -34.767 1.00 51.87  ? 135 LEU A CD2 1 
ATOM   837   N  N   . SER A 1 114 ? 90.863  6.053   -38.383 1.00 44.80  ? 136 SER A N   1 
ATOM   838   C  CA  . SER A 1 114 ? 91.834  5.110   -38.971 1.00 45.53  ? 136 SER A CA  1 
ATOM   839   C  C   . SER A 1 114 ? 91.265  4.483   -40.232 1.00 49.02  ? 136 SER A C   1 
ATOM   840   O  O   . SER A 1 114 ? 91.018  3.268   -40.271 1.00 52.41  ? 136 SER A O   1 
ATOM   841   C  CB  . SER A 1 114 ? 92.317  4.070   -37.971 1.00 48.52  ? 136 SER A CB  1 
ATOM   842   O  OG  . SER A 1 114 ? 93.711  3.940   -38.194 1.00 55.51  ? 136 SER A OG  1 
ATOM   843   N  N   . PHE A 1 115 ? 91.020  5.337   -41.257 1.00 38.08  ? 137 PHE A N   1 
ATOM   844   C  CA  . PHE A 1 115 ? 90.320  4.924   -42.448 1.00 34.74  ? 137 PHE A CA  1 
ATOM   845   C  C   . PHE A 1 115 ? 91.012  5.416   -43.718 1.00 42.05  ? 137 PHE A C   1 
ATOM   846   O  O   . PHE A 1 115 ? 91.387  6.578   -43.830 1.00 43.95  ? 137 PHE A O   1 
ATOM   847   C  CB  . PHE A 1 115 ? 88.895  5.472   -42.330 1.00 34.80  ? 137 PHE A CB  1 
ATOM   848   C  CG  . PHE A 1 115 ? 87.861  4.944   -43.280 1.00 34.95  ? 137 PHE A CG  1 
ATOM   849   C  CD1 . PHE A 1 115 ? 87.845  5.352   -44.618 1.00 35.95  ? 137 PHE A CD1 1 
ATOM   850   C  CD2 . PHE A 1 115 ? 86.833  4.118   -42.824 1.00 36.65  ? 137 PHE A CD2 1 
ATOM   851   C  CE1 . PHE A 1 115 ? 86.870  4.892   -45.492 1.00 35.99  ? 137 PHE A CE1 1 
ATOM   852   C  CE2 . PHE A 1 115 ? 85.844  3.656   -43.702 1.00 38.73  ? 137 PHE A CE2 1 
ATOM   853   C  CZ  . PHE A 1 115 ? 85.878  4.038   -45.034 1.00 36.17  ? 137 PHE A CZ  1 
ATOM   854   N  N   . LEU A 1 116 ? 91.166  4.523   -44.683 1.00 39.04  ? 138 LEU A N   1 
ATOM   855   C  CA  . LEU A 1 116 ? 91.812  4.784   -45.967 1.00 38.94  ? 138 LEU A CA  1 
ATOM   856   C  C   . LEU A 1 116 ? 90.923  4.186   -46.992 1.00 43.07  ? 138 LEU A C   1 
ATOM   857   O  O   . LEU A 1 116 ? 90.181  3.269   -46.647 1.00 43.78  ? 138 LEU A O   1 
ATOM   858   C  CB  . LEU A 1 116 ? 93.217  4.144   -46.031 1.00 39.57  ? 138 LEU A CB  1 
ATOM   859   C  CG  . LEU A 1 116 ? 94.270  4.862   -45.161 1.00 45.41  ? 138 LEU A CG  1 
ATOM   860   C  CD1 . LEU A 1 116 ? 94.398  4.230   -43.818 1.00 44.53  ? 138 LEU A CD1 1 
ATOM   861   C  CD2 . LEU A 1 116 ? 95.610  4.826   -45.806 1.00 52.37  ? 138 LEU A CD2 1 
ATOM   862   N  N   . ARG A 1 117 ? 90.893  4.741   -48.219 1.00 38.54  ? 139 ARG A N   1 
ATOM   863   C  CA  . ARG A 1 117 ? 89.999  4.179   -49.230 1.00 37.48  ? 139 ARG A CA  1 
ATOM   864   C  C   . ARG A 1 117 ? 90.631  4.170   -50.566 1.00 43.79  ? 139 ARG A C   1 
ATOM   865   O  O   . ARG A 1 117 ? 91.333  5.113   -50.892 1.00 44.85  ? 139 ARG A O   1 
ATOM   866   C  CB  . ARG A 1 117 ? 88.595  4.819   -49.260 1.00 32.96  ? 139 ARG A CB  1 
ATOM   867   C  CG  . ARG A 1 117 ? 88.531  6.335   -49.074 1.00 33.38  ? 139 ARG A CG  1 
ATOM   868   C  CD  . ARG A 1 117 ? 87.115  6.796   -49.386 1.00 32.32  ? 139 ARG A CD  1 
ATOM   869   N  NE  . ARG A 1 117 ? 86.801  8.085   -48.773 1.00 33.73  ? 139 ARG A NE  1 
ATOM   870   C  CZ  . ARG A 1 117 ? 85.568  8.536   -48.555 1.00 41.47  ? 139 ARG A CZ  1 
ATOM   871   N  NH1 . ARG A 1 117 ? 84.513  7.812   -48.910 1.00 31.96  ? 139 ARG A NH1 1 
ATOM   872   N  NH2 . ARG A 1 117 ? 85.381  9.703   -47.967 1.00 27.07  ? 139 ARG A NH2 1 
ATOM   873   N  N   . THR A 1 118 ? 90.426  3.075   -51.331 1.00 40.87  ? 140 THR A N   1 
ATOM   874   C  CA  . THR A 1 118 ? 90.972  2.888   -52.680 1.00 40.52  ? 140 THR A CA  1 
ATOM   875   C  C   . THR A 1 118 ? 90.130  3.609   -53.753 1.00 48.17  ? 140 THR A C   1 
ATOM   876   O  O   . THR A 1 118 ? 90.507  3.601   -54.936 1.00 50.59  ? 140 THR A O   1 
ATOM   877   C  CB  . THR A 1 118 ? 91.188  1.413   -52.992 1.00 34.37  ? 140 THR A CB  1 
ATOM   878   O  OG1 . THR A 1 118 ? 89.956  0.736   -52.847 1.00 44.63  ? 140 THR A OG1 1 
ATOM   879   C  CG2 . THR A 1 118 ? 92.216  0.783   -52.131 1.00 20.91  ? 140 THR A CG2 1 
ATOM   880   N  N   . VAL A 1 119 ? 88.988  4.233   -53.334 1.00 42.85  ? 141 VAL A N   1 
ATOM   881   C  CA  . VAL A 1 119 ? 88.089  5.051   -54.165 1.00 40.31  ? 141 VAL A CA  1 
ATOM   882   C  C   . VAL A 1 119 ? 88.100  6.484   -53.606 1.00 43.12  ? 141 VAL A C   1 
ATOM   883   O  O   . VAL A 1 119 ? 88.141  6.662   -52.387 1.00 42.47  ? 141 VAL A O   1 
ATOM   884   C  CB  . VAL A 1 119 ? 86.640  4.526   -54.328 1.00 41.93  ? 141 VAL A CB  1 
ATOM   885   C  CG1 . VAL A 1 119 ? 86.586  3.324   -55.231 1.00 41.59  ? 141 VAL A CG1 1 
ATOM   886   C  CG2 . VAL A 1 119 ? 85.971  4.231   -52.997 1.00 41.58  ? 141 VAL A CG2 1 
ATOM   887   N  N   . PRO A 1 120 ? 88.070  7.520   -54.456 1.00 38.37  ? 142 PRO A N   1 
ATOM   888   C  CA  . PRO A 1 120 ? 88.026  8.890   -53.905 1.00 37.66  ? 142 PRO A CA  1 
ATOM   889   C  C   . PRO A 1 120 ? 86.627  9.259   -53.417 1.00 40.30  ? 142 PRO A C   1 
ATOM   890   O  O   . PRO A 1 120 ? 85.652  8.674   -53.899 1.00 40.37  ? 142 PRO A O   1 
ATOM   891   C  CB  . PRO A 1 120 ? 88.415  9.757   -55.092 1.00 40.16  ? 142 PRO A CB  1 
ATOM   892   C  CG  . PRO A 1 120 ? 87.978  8.947   -56.297 1.00 45.05  ? 142 PRO A CG  1 
ATOM   893   C  CD  . PRO A 1 120 ? 88.064  7.505   -55.936 1.00 39.68  ? 142 PRO A CD  1 
ATOM   894   N  N   . PRO A 1 121 ? 86.445  10.240  -52.503 1.00 36.20  ? 143 PRO A N   1 
ATOM   895   C  CA  . PRO A 1 121 ? 85.061  10.630  -52.159 1.00 35.34  ? 143 PRO A CA  1 
ATOM   896   C  C   . PRO A 1 121 ? 84.431  11.386  -53.345 1.00 39.51  ? 143 PRO A C   1 
ATOM   897   O  O   . PRO A 1 121 ? 85.169  11.915  -54.171 1.00 41.51  ? 143 PRO A O   1 
ATOM   898   C  CB  . PRO A 1 121 ? 85.248  11.533  -50.943 1.00 37.07  ? 143 PRO A CB  1 
ATOM   899   C  CG  . PRO A 1 121 ? 86.601  12.076  -51.070 1.00 40.96  ? 143 PRO A CG  1 
ATOM   900   C  CD  . PRO A 1 121 ? 87.438  11.092  -51.810 1.00 36.47  ? 143 PRO A CD  1 
ATOM   901   N  N   . TYR A 1 122 ? 83.100  11.477  -53.442 1.00 33.51  ? 144 TYR A N   1 
ATOM   902   C  CA  . TYR A 1 122 ? 82.484  12.234  -54.543 1.00 31.29  ? 144 TYR A CA  1 
ATOM   903   C  C   . TYR A 1 122 ? 83.011  13.671  -54.665 1.00 41.64  ? 144 TYR A C   1 
ATOM   904   O  O   . TYR A 1 122 ? 83.015  14.208  -55.770 1.00 45.57  ? 144 TYR A O   1 
ATOM   905   C  CB  . TYR A 1 122 ? 80.983  12.312  -54.384 1.00 28.78  ? 144 TYR A CB  1 
ATOM   906   C  CG  . TYR A 1 122 ? 80.281  11.002  -54.532 1.00 30.16  ? 144 TYR A CG  1 
ATOM   907   C  CD1 . TYR A 1 122 ? 80.326  10.292  -55.742 1.00 32.68  ? 144 TYR A CD1 1 
ATOM   908   C  CD2 . TYR A 1 122 ? 79.512  10.482  -53.490 1.00 30.81  ? 144 TYR A CD2 1 
ATOM   909   C  CE1 . TYR A 1 122 ? 79.634  9.084   -55.900 1.00 35.82  ? 144 TYR A CE1 1 
ATOM   910   C  CE2 . TYR A 1 122 ? 78.849  9.264   -53.621 1.00 32.68  ? 144 TYR A CE2 1 
ATOM   911   C  CZ  . TYR A 1 122 ? 78.888  8.578   -54.836 1.00 48.74  ? 144 TYR A CZ  1 
ATOM   912   O  OH  . TYR A 1 122 ? 78.195  7.396   -54.960 1.00 54.45  ? 144 TYR A OH  1 
ATOM   913   N  N   . SER A 1 123 ? 83.415  14.309  -53.544 1.00 36.96  ? 145 SER A N   1 
ATOM   914   C  CA  . SER A 1 123 ? 83.869  15.682  -53.533 1.00 37.73  ? 145 SER A CA  1 
ATOM   915   C  C   . SER A 1 123 ? 85.061  15.911  -54.441 1.00 44.32  ? 145 SER A C   1 
ATOM   916   O  O   . SER A 1 123 ? 85.259  17.022  -54.930 1.00 43.44  ? 145 SER A O   1 
ATOM   917   C  CB  . SER A 1 123 ? 84.183  16.118  -52.109 1.00 42.52  ? 145 SER A CB  1 
ATOM   918   O  OG  . SER A 1 123 ? 85.129  15.253  -51.499 1.00 54.39  ? 145 SER A OG  1 
ATOM   919   N  N   . HIS A 1 124 ? 85.838  14.847  -54.688 1.00 44.65  ? 146 HIS A N   1 
ATOM   920   C  CA  . HIS A 1 124 ? 87.061  14.873  -55.487 1.00 45.76  ? 146 HIS A CA  1 
ATOM   921   C  C   . HIS A 1 124 ? 86.813  15.049  -57.001 1.00 50.01  ? 146 HIS A C   1 
ATOM   922   O  O   . HIS A 1 124 ? 87.772  15.376  -57.721 1.00 51.96  ? 146 HIS A O   1 
ATOM   923   C  CB  . HIS A 1 124 ? 87.925  13.652  -55.191 1.00 46.04  ? 146 HIS A CB  1 
ATOM   924   C  CG  . HIS A 1 124 ? 88.733  13.785  -53.940 1.00 50.37  ? 146 HIS A CG  1 
ATOM   925   N  ND1 . HIS A 1 124 ? 89.948  13.118  -53.791 1.00 52.76  ? 146 HIS A ND1 1 
ATOM   926   C  CD2 . HIS A 1 124 ? 88.500  14.524  -52.827 1.00 52.80  ? 146 HIS A CD2 1 
ATOM   927   C  CE1 . HIS A 1 124 ? 90.397  13.459  -52.594 1.00 52.46  ? 146 HIS A CE1 1 
ATOM   928   N  NE2 . HIS A 1 124 ? 89.559  14.302  -51.975 1.00 53.02  ? 146 HIS A NE2 1 
ATOM   929   N  N   . GLN A 1 125 ? 85.534  14.928  -57.467 1.00 41.29  ? 147 GLN A N   1 
ATOM   930   C  CA  . GLN A 1 125 ? 85.157  15.154  -58.862 1.00 40.68  ? 147 GLN A CA  1 
ATOM   931   C  C   . GLN A 1 125 ? 85.398  16.625  -59.224 1.00 50.58  ? 147 GLN A C   1 
ATOM   932   O  O   . GLN A 1 125 ? 85.534  16.961  -60.403 1.00 53.01  ? 147 GLN A O   1 
ATOM   933   C  CB  . GLN A 1 125 ? 83.706  14.768  -59.097 1.00 41.05  ? 147 GLN A CB  1 
ATOM   934   C  CG  . GLN A 1 125 ? 83.467  13.296  -58.858 1.00 46.37  ? 147 GLN A CG  1 
ATOM   935   C  CD  . GLN A 1 125 ? 82.010  12.947  -58.891 1.00 52.21  ? 147 GLN A CD  1 
ATOM   936   O  OE1 . GLN A 1 125 ? 81.520  12.417  -59.868 1.00 46.17  ? 147 GLN A OE1 1 
ATOM   937   N  NE2 . GLN A 1 125 ? 81.301  13.140  -57.787 1.00 39.30  ? 147 GLN A NE2 1 
ATOM   938   N  N   . ALA A 1 126 ? 85.515  17.495  -58.200 1.00 48.17  ? 148 ALA A N   1 
ATOM   939   C  CA  . ALA A 1 126 ? 85.827  18.911  -58.350 1.00 49.30  ? 148 ALA A CA  1 
ATOM   940   C  C   . ALA A 1 126 ? 87.183  19.076  -59.031 1.00 52.31  ? 148 ALA A C   1 
ATOM   941   O  O   . ALA A 1 126 ? 87.350  20.068  -59.742 1.00 53.51  ? 148 ALA A O   1 
ATOM   942   C  CB  . ALA A 1 126 ? 85.820  19.597  -56.989 1.00 50.44  ? 148 ALA A CB  1 
ATOM   943   N  N   . LEU A 1 127 ? 88.121  18.076  -58.869 1.00 46.52  ? 149 LEU A N   1 
ATOM   944   C  CA  . LEU A 1 127 ? 89.447  18.067  -59.531 1.00 47.79  ? 149 LEU A CA  1 
ATOM   945   C  C   . LEU A 1 127 ? 89.271  17.914  -61.038 1.00 55.15  ? 149 LEU A C   1 
ATOM   946   O  O   . LEU A 1 127 ? 90.050  18.477  -61.814 1.00 58.12  ? 149 LEU A O   1 
ATOM   947   C  CB  . LEU A 1 127 ? 90.367  16.925  -59.068 1.00 46.76  ? 149 LEU A CB  1 
ATOM   948   C  CG  . LEU A 1 127 ? 90.705  16.816  -57.593 1.00 50.43  ? 149 LEU A CG  1 
ATOM   949   C  CD1 . LEU A 1 127 ? 91.254  15.486  -57.301 1.00 50.46  ? 149 LEU A CD1 1 
ATOM   950   C  CD2 . LEU A 1 127 ? 91.655  17.866  -57.153 1.00 49.99  ? 149 LEU A CD2 1 
ATOM   951   N  N   . VAL A 1 128 ? 88.249  17.143  -61.448 1.00 48.57  ? 150 VAL A N   1 
ATOM   952   C  CA  . VAL A 1 128 ? 87.964  16.922  -62.852 1.00 46.89  ? 150 VAL A CA  1 
ATOM   953   C  C   . VAL A 1 128 ? 87.329  18.146  -63.421 1.00 53.64  ? 150 VAL A C   1 
ATOM   954   O  O   . VAL A 1 128 ? 87.781  18.590  -64.472 1.00 55.97  ? 150 VAL A O   1 
ATOM   955   C  CB  . VAL A 1 128 ? 87.141  15.652  -63.141 1.00 47.03  ? 150 VAL A CB  1 
ATOM   956   C  CG1 . VAL A 1 128 ? 87.269  15.252  -64.608 1.00 45.46  ? 150 VAL A CG1 1 
ATOM   957   C  CG2 . VAL A 1 128 ? 87.572  14.507  -62.223 1.00 45.55  ? 150 VAL A CG2 1 
ATOM   958   N  N   . TRP A 1 129 ? 86.321  18.729  -62.720 1.00 49.39  ? 151 TRP A N   1 
ATOM   959   C  CA  . TRP A 1 129 ? 85.595  19.922  -63.186 1.00 49.58  ? 151 TRP A CA  1 
ATOM   960   C  C   . TRP A 1 129 ? 86.537  21.075  -63.395 1.00 55.41  ? 151 TRP A C   1 
ATOM   961   O  O   . TRP A 1 129 ? 86.359  21.853  -64.330 1.00 55.83  ? 151 TRP A O   1 
ATOM   962   C  CB  . TRP A 1 129 ? 84.511  20.343  -62.193 1.00 47.74  ? 151 TRP A CB  1 
ATOM   963   C  CG  . TRP A 1 129 ? 83.464  19.312  -61.909 1.00 47.27  ? 151 TRP A CG  1 
ATOM   964   C  CD1 . TRP A 1 129 ? 83.032  18.313  -62.741 1.00 49.23  ? 151 TRP A CD1 1 
ATOM   965   C  CD2 . TRP A 1 129 ? 82.673  19.212  -60.713 1.00 46.40  ? 151 TRP A CD2 1 
ATOM   966   N  NE1 . TRP A 1 129 ? 82.037  17.585  -62.129 1.00 47.64  ? 151 TRP A NE1 1 
ATOM   967   C  CE2 . TRP A 1 129 ? 81.790  18.119  -60.885 1.00 49.45  ? 151 TRP A CE2 1 
ATOM   968   C  CE3 . TRP A 1 129 ? 82.631  19.933  -59.504 1.00 47.07  ? 151 TRP A CE3 1 
ATOM   969   C  CZ2 . TRP A 1 129 ? 80.889  17.718  -59.878 1.00 47.97  ? 151 TRP A CZ2 1 
ATOM   970   C  CZ3 . TRP A 1 129 ? 81.722  19.549  -58.523 1.00 47.34  ? 151 TRP A CZ3 1 
ATOM   971   C  CH2 . TRP A 1 129 ? 80.866  18.456  -58.711 1.00 47.07  ? 151 TRP A CH2 1 
ATOM   972   N  N   . PHE A 1 130 ? 87.552  21.175  -62.521 1.00 53.01  ? 152 PHE A N   1 
ATOM   973   C  CA  . PHE A 1 130 ? 88.558  22.220  -62.560 1.00 54.26  ? 152 PHE A CA  1 
ATOM   974   C  C   . PHE A 1 130 ? 89.412  22.122  -63.825 1.00 59.18  ? 152 PHE A C   1 
ATOM   975   O  O   . PHE A 1 130 ? 89.618  23.130  -64.502 1.00 59.67  ? 152 PHE A O   1 
ATOM   976   C  CB  . PHE A 1 130 ? 89.411  22.144  -61.312 1.00 56.00  ? 152 PHE A CB  1 
ATOM   977   C  CG  . PHE A 1 130 ? 90.436  23.231  -61.250 1.00 59.81  ? 152 PHE A CG  1 
ATOM   978   C  CD1 . PHE A 1 130 ? 90.057  24.572  -61.324 1.00 65.32  ? 152 PHE A CD1 1 
ATOM   979   C  CD2 . PHE A 1 130 ? 91.781  22.926  -61.107 1.00 61.50  ? 152 PHE A CD2 1 
ATOM   980   C  CE1 . PHE A 1 130 ? 91.009  25.584  -61.267 1.00 67.54  ? 152 PHE A CE1 1 
ATOM   981   C  CE2 . PHE A 1 130 ? 92.732  23.938  -61.050 1.00 66.29  ? 152 PHE A CE2 1 
ATOM   982   C  CZ  . PHE A 1 130 ? 92.339  25.261  -61.133 1.00 66.33  ? 152 PHE A CZ  1 
ATOM   983   N  N   . GLU A 1 131 ? 89.855  20.895  -64.170 1.00 55.03  ? 153 GLU A N   1 
ATOM   984   C  CA  . GLU A 1 131 ? 90.648  20.606  -65.362 1.00 55.07  ? 153 GLU A CA  1 
ATOM   985   C  C   . GLU A 1 131 ? 89.838  20.867  -66.612 1.00 59.17  ? 153 GLU A C   1 
ATOM   986   O  O   . GLU A 1 131 ? 90.364  21.390  -67.593 1.00 59.38  ? 153 GLU A O   1 
ATOM   987   C  CB  . GLU A 1 131 ? 91.163  19.159  -65.316 1.00 55.57  ? 153 GLU A CB  1 
ATOM   988   C  CG  . GLU A 1 131 ? 92.245  18.924  -64.264 1.00 68.59  ? 153 GLU A CG  1 
ATOM   989   C  CD  . GLU A 1 131 ? 93.447  19.852  -64.308 1.00 89.88  ? 153 GLU A CD  1 
ATOM   990   O  OE1 . GLU A 1 131 ? 94.121  19.921  -65.364 1.00 107.97 ? 153 GLU A OE1 1 
ATOM   991   O  OE2 . GLU A 1 131 ? 93.697  20.529  -63.287 1.00 67.69  ? 153 GLU A OE2 1 
ATOM   992   N  N   . MET A 1 132 ? 88.539  20.537  -66.546 1.00 57.17  ? 154 MET A N   1 
ATOM   993   C  CA  . MET A 1 132 ? 87.536  20.726  -67.581 1.00 58.19  ? 154 MET A CA  1 
ATOM   994   C  C   . MET A 1 132 ? 87.377  22.214  -67.828 1.00 61.50  ? 154 MET A C   1 
ATOM   995   O  O   . MET A 1 132 ? 87.399  22.635  -68.981 1.00 62.08  ? 154 MET A O   1 
ATOM   996   C  CB  . MET A 1 132 ? 86.223  20.132  -67.102 1.00 60.87  ? 154 MET A CB  1 
ATOM   997   C  CG  . MET A 1 132 ? 85.292  19.801  -68.202 1.00 67.86  ? 154 MET A CG  1 
ATOM   998   S  SD  . MET A 1 132 ? 85.639  18.198  -68.927 1.00 74.30  ? 154 MET A SD  1 
ATOM   999   C  CE  . MET A 1 132 ? 85.489  17.172  -67.425 1.00 69.68  ? 154 MET A CE  1 
ATOM   1000  N  N   . MET A 1 133 ? 87.266  23.013  -66.741 1.00 56.73  ? 155 MET A N   1 
ATOM   1001  C  CA  . MET A 1 133 ? 87.156  24.469  -66.797 1.00 57.41  ? 155 MET A CA  1 
ATOM   1002  C  C   . MET A 1 133 ? 88.374  25.086  -67.455 1.00 60.60  ? 155 MET A C   1 
ATOM   1003  O  O   . MET A 1 133 ? 88.223  26.011  -68.253 1.00 62.03  ? 155 MET A O   1 
ATOM   1004  C  CB  . MET A 1 133 ? 86.982  25.056  -65.404 1.00 59.88  ? 155 MET A CB  1 
ATOM   1005  C  CG  . MET A 1 133 ? 85.567  24.985  -64.900 1.00 62.85  ? 155 MET A CG  1 
ATOM   1006  S  SD  . MET A 1 133 ? 85.550  24.918  -63.093 1.00 65.83  ? 155 MET A SD  1 
ATOM   1007  C  CE  . MET A 1 133 ? 85.850  26.614  -62.726 1.00 64.90  ? 155 MET A CE  1 
ATOM   1008  N  N   . ARG A 1 134 ? 89.571  24.567  -67.146 1.00 56.10  ? 156 ARG A N   1 
ATOM   1009  C  CA  . ARG A 1 134 ? 90.829  25.030  -67.736 1.00 58.01  ? 156 ARG A CA  1 
ATOM   1010  C  C   . ARG A 1 134 ? 90.901  24.733  -69.237 1.00 65.85  ? 156 ARG A C   1 
ATOM   1011  O  O   . ARG A 1 134 ? 91.255  25.616  -70.032 1.00 68.51  ? 156 ARG A O   1 
ATOM   1012  C  CB  . ARG A 1 134 ? 92.034  24.454  -66.987 1.00 56.60  ? 156 ARG A CB  1 
ATOM   1013  C  CG  . ARG A 1 134 ? 92.327  25.213  -65.694 1.00 68.78  ? 156 ARG A CG  1 
ATOM   1014  C  CD  . ARG A 1 134 ? 92.999  24.354  -64.646 1.00 79.42  ? 156 ARG A CD  1 
ATOM   1015  N  NE  . ARG A 1 134 ? 94.453  24.463  -64.703 1.00 98.14  ? 156 ARG A NE  1 
ATOM   1016  C  CZ  . ARG A 1 134 ? 95.257  23.617  -65.344 1.00 120.84 ? 156 ARG A CZ  1 
ATOM   1017  N  NH1 . ARG A 1 134 ? 94.755  22.570  -65.991 1.00 100.99 ? 156 ARG A NH1 1 
ATOM   1018  N  NH2 . ARG A 1 134 ? 96.570  23.810  -65.343 1.00 119.64 ? 156 ARG A NH2 1 
ATOM   1019  N  N   . LEU A 1 135 ? 90.475  23.516  -69.617 1.00 62.41  ? 157 LEU A N   1 
ATOM   1020  C  CA  . LEU A 1 135 ? 90.437  23.024  -70.993 1.00 62.68  ? 157 LEU A CA  1 
ATOM   1021  C  C   . LEU A 1 135 ? 89.438  23.770  -71.910 1.00 67.35  ? 157 LEU A C   1 
ATOM   1022  O  O   . LEU A 1 135 ? 89.794  24.136  -73.033 1.00 68.13  ? 157 LEU A O   1 
ATOM   1023  C  CB  . LEU A 1 135 ? 90.151  21.511  -70.986 1.00 60.58  ? 157 LEU A CB  1 
ATOM   1024  C  CG  . LEU A 1 135 ? 90.512  20.729  -72.251 1.00 65.32  ? 157 LEU A CG  1 
ATOM   1025  C  CD1 . LEU A 1 135 ? 91.992  20.434  -72.319 1.00 65.20  ? 157 LEU A CD1 1 
ATOM   1026  C  CD2 . LEU A 1 135 ? 89.781  19.428  -72.286 1.00 68.31  ? 157 LEU A CD2 1 
ATOM   1027  N  N   . PHE A 1 136 ? 88.202  23.966  -71.446 1.00 63.01  ? 158 PHE A N   1 
ATOM   1028  C  CA  . PHE A 1 136 ? 87.152  24.593  -72.246 1.00 63.76  ? 158 PHE A CA  1 
ATOM   1029  C  C   . PHE A 1 136 ? 87.005  26.087  -71.990 1.00 71.69  ? 158 PHE A C   1 
ATOM   1030  O  O   . PHE A 1 136 ? 86.140  26.740  -72.587 1.00 74.74  ? 158 PHE A O   1 
ATOM   1031  C  CB  . PHE A 1 136 ? 85.822  23.844  -72.059 1.00 63.50  ? 158 PHE A CB  1 
ATOM   1032  C  CG  . PHE A 1 136 ? 85.857  22.446  -72.614 1.00 62.30  ? 158 PHE A CG  1 
ATOM   1033  C  CD1 . PHE A 1 136 ? 86.326  21.391  -71.850 1.00 62.17  ? 158 PHE A CD1 1 
ATOM   1034  C  CD2 . PHE A 1 136 ? 85.470  22.194  -73.918 1.00 63.82  ? 158 PHE A CD2 1 
ATOM   1035  C  CE1 . PHE A 1 136 ? 86.386  20.114  -72.372 1.00 61.79  ? 158 PHE A CE1 1 
ATOM   1036  C  CE2 . PHE A 1 136 ? 85.543  20.919  -74.443 1.00 65.36  ? 158 PHE A CE2 1 
ATOM   1037  C  CZ  . PHE A 1 136 ? 85.998  19.885  -73.666 1.00 61.90  ? 158 PHE A CZ  1 
ATOM   1038  N  N   . ASN A 1 137 ? 87.899  26.631  -71.157 1.00 67.86  ? 159 ASN A N   1 
ATOM   1039  C  CA  . ASN A 1 137 ? 87.982  28.041  -70.785 1.00 69.78  ? 159 ASN A CA  1 
ATOM   1040  C  C   . ASN A 1 137 ? 86.653  28.581  -70.279 1.00 73.61  ? 159 ASN A C   1 
ATOM   1041  O  O   . ASN A 1 137 ? 86.087  29.550  -70.806 1.00 74.50  ? 159 ASN A O   1 
ATOM   1042  C  CB  . ASN A 1 137 ? 88.605  28.894  -71.882 1.00 72.02  ? 159 ASN A CB  1 
ATOM   1043  C  CG  . ASN A 1 137 ? 90.045  28.500  -72.087 1.00 94.11  ? 159 ASN A CG  1 
ATOM   1044  O  OD1 . ASN A 1 137 ? 90.387  27.868  -73.098 1.00 73.46  ? 159 ASN A OD1 1 
ATOM   1045  N  ND2 . ASN A 1 137 ? 90.891  28.740  -71.066 1.00 91.41  ? 159 ASN A ND2 1 
ATOM   1046  N  N   . TRP A 1 138 ? 86.165  27.890  -69.233 1.00 68.00  ? 160 TRP A N   1 
ATOM   1047  C  CA  . TRP A 1 138 ? 84.985  28.212  -68.452 1.00 66.86  ? 160 TRP A CA  1 
ATOM   1048  C  C   . TRP A 1 138 ? 85.541  28.913  -67.219 1.00 70.79  ? 160 TRP A C   1 
ATOM   1049  O  O   . TRP A 1 138 ? 85.825  28.288  -66.185 1.00 67.12  ? 160 TRP A O   1 
ATOM   1050  C  CB  . TRP A 1 138 ? 84.227  26.941  -68.084 1.00 63.25  ? 160 TRP A CB  1 
ATOM   1051  C  CG  . TRP A 1 138 ? 83.714  26.177  -69.258 1.00 64.02  ? 160 TRP A CG  1 
ATOM   1052  C  CD1 . TRP A 1 138 ? 83.276  26.684  -70.448 1.00 68.21  ? 160 TRP A CD1 1 
ATOM   1053  C  CD2 . TRP A 1 138 ? 83.486  24.770  -69.314 1.00 62.33  ? 160 TRP A CD2 1 
ATOM   1054  N  NE1 . TRP A 1 138 ? 82.825  25.672  -71.255 1.00 66.48  ? 160 TRP A NE1 1 
ATOM   1055  C  CE2 . TRP A 1 138 ? 82.918  24.488  -70.574 1.00 66.58  ? 160 TRP A CE2 1 
ATOM   1056  C  CE3 . TRP A 1 138 ? 83.703  23.713  -68.419 1.00 61.82  ? 160 TRP A CE3 1 
ATOM   1057  C  CZ2 . TRP A 1 138 ? 82.575  23.196  -70.959 1.00 64.94  ? 160 TRP A CZ2 1 
ATOM   1058  C  CZ3 . TRP A 1 138 ? 83.359  22.434  -68.806 1.00 62.02  ? 160 TRP A CZ3 1 
ATOM   1059  C  CH2 . TRP A 1 138 ? 82.818  22.181  -70.065 1.00 63.14  ? 160 TRP A CH2 1 
ATOM   1060  N  N   . ASN A 1 139 ? 85.796  30.214  -67.393 1.00 70.84  ? 161 ASN A N   1 
ATOM   1061  C  CA  . ASN A 1 139 ? 86.391  31.068  -66.383 1.00 72.08  ? 161 ASN A CA  1 
ATOM   1062  C  C   . ASN A 1 139 ? 85.373  31.598  -65.366 1.00 78.90  ? 161 ASN A C   1 
ATOM   1063  O  O   . ASN A 1 139 ? 85.775  32.028  -64.280 1.00 78.86  ? 161 ASN A O   1 
ATOM   1064  C  CB  . ASN A 1 139 ? 87.190  32.168  -67.046 1.00 71.50  ? 161 ASN A CB  1 
ATOM   1065  C  CG  . ASN A 1 139 ? 88.405  31.602  -67.737 1.00 94.54  ? 161 ASN A CG  1 
ATOM   1066  O  OD1 . ASN A 1 139 ? 89.393  31.216  -67.100 1.00 95.53  ? 161 ASN A OD1 1 
ATOM   1067  N  ND2 . ASN A 1 139 ? 88.328  31.456  -69.048 1.00 85.33  ? 161 ASN A ND2 1 
ATOM   1068  N  N   . HIS A 1 140 ? 84.060  31.512  -65.689 1.00 76.02  ? 162 HIS A N   1 
ATOM   1069  C  CA  . HIS A 1 140 ? 82.975  31.932  -64.794 1.00 76.09  ? 162 HIS A CA  1 
ATOM   1070  C  C   . HIS A 1 140 ? 81.932  30.828  -64.680 1.00 78.12  ? 162 HIS A C   1 
ATOM   1071  O  O   . HIS A 1 140 ? 81.329  30.436  -65.695 1.00 79.40  ? 162 HIS A O   1 
ATOM   1072  C  CB  . HIS A 1 140 ? 82.344  33.251  -65.265 1.00 79.35  ? 162 HIS A CB  1 
ATOM   1073  C  CG  . HIS A 1 140 ? 83.303  34.397  -65.279 1.00 84.51  ? 162 HIS A CG  1 
ATOM   1074  N  ND1 . HIS A 1 140 ? 83.821  34.918  -64.108 1.00 86.31  ? 162 HIS A ND1 1 
ATOM   1075  C  CD2 . HIS A 1 140 ? 83.823  35.071  -66.329 1.00 87.89  ? 162 HIS A CD2 1 
ATOM   1076  C  CE1 . HIS A 1 140 ? 84.639  35.883  -64.482 1.00 87.83  ? 162 HIS A CE1 1 
ATOM   1077  N  NE2 . HIS A 1 140 ? 84.671  36.014  -65.808 1.00 89.19  ? 162 HIS A NE2 1 
ATOM   1078  N  N   . VAL A 1 141 ? 81.747  30.289  -63.456 1.00 69.23  ? 163 VAL A N   1 
ATOM   1079  C  CA  . VAL A 1 141 ? 80.810  29.177  -63.229 1.00 64.46  ? 163 VAL A CA  1 
ATOM   1080  C  C   . VAL A 1 141 ? 79.818  29.473  -62.107 1.00 67.20  ? 163 VAL A C   1 
ATOM   1081  O  O   . VAL A 1 141 ? 80.096  30.282  -61.226 1.00 66.23  ? 163 VAL A O   1 
ATOM   1082  C  CB  . VAL A 1 141 ? 81.530  27.806  -63.011 1.00 63.52  ? 163 VAL A CB  1 
ATOM   1083  C  CG1 . VAL A 1 141 ? 82.395  27.418  -64.201 1.00 61.68  ? 163 VAL A CG1 1 
ATOM   1084  C  CG2 . VAL A 1 141 ? 82.355  27.793  -61.728 1.00 62.67  ? 163 VAL A CG2 1 
ATOM   1085  N  N   . ILE A 1 142 ? 78.659  28.818  -62.163 1.00 64.38  ? 164 ILE A N   1 
ATOM   1086  C  CA  . ILE A 1 142 ? 77.623  28.872  -61.134 1.00 65.19  ? 164 ILE A CA  1 
ATOM   1087  C  C   . ILE A 1 142 ? 77.641  27.479  -60.503 1.00 68.46  ? 164 ILE A C   1 
ATOM   1088  O  O   . ILE A 1 142 ? 77.536  26.467  -61.211 1.00 67.58  ? 164 ILE A O   1 
ATOM   1089  C  CB  . ILE A 1 142 ? 76.198  29.240  -61.654 1.00 69.30  ? 164 ILE A CB  1 
ATOM   1090  C  CG1 . ILE A 1 142 ? 76.184  30.617  -62.349 1.00 71.85  ? 164 ILE A CG1 1 
ATOM   1091  C  CG2 . ILE A 1 142 ? 75.175  29.199  -60.497 1.00 69.65  ? 164 ILE A CG2 1 
ATOM   1092  C  CD1 . ILE A 1 142 ? 75.042  30.834  -63.316 1.00 80.71  ? 164 ILE A CD1 1 
ATOM   1093  N  N   . LEU A 1 143 ? 77.794  27.426  -59.185 1.00 62.88  ? 165 LEU A N   1 
ATOM   1094  C  CA  . LEU A 1 143 ? 77.820  26.154  -58.500 1.00 59.91  ? 165 LEU A CA  1 
ATOM   1095  C  C   . LEU A 1 143 ? 76.545  25.973  -57.690 1.00 61.85  ? 165 LEU A C   1 
ATOM   1096  O  O   . LEU A 1 143 ? 76.249  26.808  -56.849 1.00 63.09  ? 165 LEU A O   1 
ATOM   1097  C  CB  . LEU A 1 143 ? 79.086  26.057  -57.624 1.00 59.27  ? 165 LEU A CB  1 
ATOM   1098  C  CG  . LEU A 1 143 ? 79.244  24.817  -56.734 1.00 62.63  ? 165 LEU A CG  1 
ATOM   1099  C  CD1 . LEU A 1 143 ? 79.457  23.539  -57.548 1.00 61.13  ? 165 LEU A CD1 1 
ATOM   1100  C  CD2 . LEU A 1 143 ? 80.383  25.012  -55.755 1.00 65.95  ? 165 LEU A CD2 1 
ATOM   1101  N  N   . ILE A 1 144 ? 75.783  24.903  -57.977 1.00 54.80  ? 166 ILE A N   1 
ATOM   1102  C  CA  . ILE A 1 144 ? 74.558  24.536  -57.258 1.00 53.99  ? 166 ILE A CA  1 
ATOM   1103  C  C   . ILE A 1 144 ? 74.853  23.264  -56.456 1.00 56.40  ? 166 ILE A C   1 
ATOM   1104  O  O   . ILE A 1 144 ? 75.264  22.246  -57.015 1.00 55.38  ? 166 ILE A O   1 
ATOM   1105  C  CB  . ILE A 1 144 ? 73.327  24.356  -58.186 1.00 57.41  ? 166 ILE A CB  1 
ATOM   1106  C  CG1 . ILE A 1 144 ? 73.065  25.614  -59.030 1.00 58.67  ? 166 ILE A CG1 1 
ATOM   1107  C  CG2 . ILE A 1 144 ? 72.080  23.926  -57.380 1.00 58.80  ? 166 ILE A CG2 1 
ATOM   1108  C  CD1 . ILE A 1 144 ? 72.174  25.351  -60.217 1.00 57.39  ? 166 ILE A CD1 1 
ATOM   1109  N  N   . VAL A 1 145 ? 74.655  23.323  -55.156 1.00 52.81  ? 167 VAL A N   1 
ATOM   1110  C  CA  . VAL A 1 145 ? 74.941  22.201  -54.263 1.00 51.23  ? 167 VAL A CA  1 
ATOM   1111  C  C   . VAL A 1 145 ? 73.778  21.981  -53.310 1.00 58.84  ? 167 VAL A C   1 
ATOM   1112  O  O   . VAL A 1 145 ? 73.054  22.923  -52.982 1.00 60.95  ? 167 VAL A O   1 
ATOM   1113  C  CB  . VAL A 1 145 ? 76.282  22.362  -53.475 1.00 54.15  ? 167 VAL A CB  1 
ATOM   1114  C  CG1 . VAL A 1 145 ? 77.485  22.386  -54.403 1.00 53.47  ? 167 VAL A CG1 1 
ATOM   1115  C  CG2 . VAL A 1 145 ? 76.275  23.601  -52.569 1.00 55.81  ? 167 VAL A CG2 1 
ATOM   1116  N  N   . SER A 1 146 ? 73.626  20.751  -52.826 1.00 54.55  ? 168 SER A N   1 
ATOM   1117  C  CA  . SER A 1 146 ? 72.617  20.437  -51.829 1.00 54.39  ? 168 SER A CA  1 
ATOM   1118  C  C   . SER A 1 146 ? 73.187  20.868  -50.473 1.00 55.62  ? 168 SER A C   1 
ATOM   1119  O  O   . SER A 1 146 ? 74.402  20.849  -50.298 1.00 52.79  ? 168 SER A O   1 
ATOM   1120  C  CB  . SER A 1 146 ? 72.293  18.945  -51.850 1.00 57.47  ? 168 SER A CB  1 
ATOM   1121  O  OG  . SER A 1 146 ? 73.430  18.146  -52.142 1.00 59.51  ? 168 SER A OG  1 
ATOM   1122  N  N   . ASP A 1 147 ? 72.336  21.337  -49.552 1.00 54.59  ? 169 ASP A N   1 
ATOM   1123  C  CA  . ASP A 1 147 ? 72.822  21.771  -48.242 1.00 55.90  ? 169 ASP A CA  1 
ATOM   1124  C  C   . ASP A 1 147 ? 72.849  20.569  -47.276 1.00 59.52  ? 169 ASP A C   1 
ATOM   1125  O  O   . ASP A 1 147 ? 72.054  20.436  -46.327 1.00 59.98  ? 169 ASP A O   1 
ATOM   1126  C  CB  . ASP A 1 147 ? 72.088  23.022  -47.694 1.00 60.55  ? 169 ASP A CB  1 
ATOM   1127  C  CG  . ASP A 1 147 ? 72.727  23.646  -46.452 1.00 80.82  ? 169 ASP A CG  1 
ATOM   1128  O  OD1 . ASP A 1 147 ? 73.981  23.707  -46.386 1.00 80.10  ? 169 ASP A OD1 1 
ATOM   1129  O  OD2 . ASP A 1 147 ? 71.973  24.080  -45.547 1.00 95.70  ? 169 ASP A OD2 1 
ATOM   1130  N  N   . ASP A 1 148 ? 73.771  19.662  -47.595 1.00 53.81  ? 170 ASP A N   1 
ATOM   1131  C  CA  . ASP A 1 148 ? 74.089  18.449  -46.869 1.00 52.04  ? 170 ASP A CA  1 
ATOM   1132  C  C   . ASP A 1 148 ? 75.605  18.325  -46.873 1.00 54.95  ? 170 ASP A C   1 
ATOM   1133  O  O   . ASP A 1 148 ? 76.283  19.091  -47.558 1.00 51.27  ? 170 ASP A O   1 
ATOM   1134  C  CB  . ASP A 1 148 ? 73.403  17.210  -47.477 1.00 53.11  ? 170 ASP A CB  1 
ATOM   1135  C  CG  . ASP A 1 148 ? 73.529  17.032  -48.978 1.00 68.18  ? 170 ASP A CG  1 
ATOM   1136  O  OD1 . ASP A 1 148 ? 74.251  17.832  -49.617 1.00 70.50  ? 170 ASP A OD1 1 
ATOM   1137  O  OD2 . ASP A 1 148 ? 72.900  16.095  -49.518 1.00 73.88  ? 170 ASP A OD2 1 
ATOM   1138  N  N   . HIS A 1 149 ? 76.138  17.377  -46.089 1.00 54.27  ? 171 HIS A N   1 
ATOM   1139  C  CA  . HIS A 1 149 ? 77.567  17.176  -45.950 1.00 54.11  ? 171 HIS A CA  1 
ATOM   1140  C  C   . HIS A 1 149 ? 78.222  16.997  -47.282 1.00 58.91  ? 171 HIS A C   1 
ATOM   1141  O  O   . HIS A 1 149 ? 79.268  17.601  -47.521 1.00 60.76  ? 171 HIS A O   1 
ATOM   1142  C  CB  . HIS A 1 149 ? 77.874  15.992  -45.036 1.00 54.45  ? 171 HIS A CB  1 
ATOM   1143  C  CG  . HIS A 1 149 ? 79.333  15.844  -44.784 1.00 57.78  ? 171 HIS A CG  1 
ATOM   1144  N  ND1 . HIS A 1 149 ? 80.153  15.179  -45.671 1.00 59.46  ? 171 HIS A ND1 1 
ATOM   1145  C  CD2 . HIS A 1 149 ? 80.084  16.339  -43.786 1.00 59.77  ? 171 HIS A CD2 1 
ATOM   1146  C  CE1 . HIS A 1 149 ? 81.370  15.278  -45.177 1.00 58.28  ? 171 HIS A CE1 1 
ATOM   1147  N  NE2 . HIS A 1 149 ? 81.373  15.957  -44.041 1.00 59.22  ? 171 HIS A NE2 1 
ATOM   1148  N  N   . GLU A 1 150 ? 77.594  16.190  -48.159 1.00 53.30  ? 172 GLU A N   1 
ATOM   1149  C  CA  . GLU A 1 150 ? 78.084  15.862  -49.499 1.00 50.97  ? 172 GLU A CA  1 
ATOM   1150  C  C   . GLU A 1 150 ? 78.223  17.078  -50.391 1.00 53.64  ? 172 GLU A C   1 
ATOM   1151  O  O   . GLU A 1 150 ? 79.314  17.310  -50.903 1.00 53.51  ? 172 GLU A O   1 
ATOM   1152  C  CB  . GLU A 1 150 ? 77.200  14.784  -50.139 1.00 51.30  ? 172 GLU A CB  1 
ATOM   1153  C  CG  . GLU A 1 150 ? 77.916  13.852  -51.089 1.00 52.96  ? 172 GLU A CG  1 
ATOM   1154  C  CD  . GLU A 1 150 ? 79.312  13.441  -50.683 1.00 63.46  ? 172 GLU A CD  1 
ATOM   1155  O  OE1 . GLU A 1 150 ? 79.438  12.777  -49.623 1.00 48.29  ? 172 GLU A OE1 1 
ATOM   1156  O  OE2 . GLU A 1 150 ? 80.273  13.829  -51.400 1.00 44.95  ? 172 GLU A OE2 1 
ATOM   1157  N  N   . GLY A 1 151 ? 77.147  17.850  -50.531 1.00 49.59  ? 173 GLY A N   1 
ATOM   1158  C  CA  . GLY A 1 151 ? 77.120  19.059  -51.338 1.00 51.25  ? 173 GLY A CA  1 
ATOM   1159  C  C   . GLY A 1 151 ? 78.129  20.102  -50.885 1.00 57.96  ? 173 GLY A C   1 
ATOM   1160  O  O   . GLY A 1 151 ? 78.816  20.715  -51.708 1.00 59.23  ? 173 GLY A O   1 
ATOM   1161  N  N   . ARG A 1 152 ? 78.254  20.289  -49.571 1.00 54.48  ? 174 ARG A N   1 
ATOM   1162  C  CA  . ARG A 1 152 ? 79.199  21.252  -49.000 1.00 54.42  ? 174 ARG A CA  1 
ATOM   1163  C  C   . ARG A 1 152 ? 80.624  20.775  -49.204 1.00 55.38  ? 174 ARG A C   1 
ATOM   1164  O  O   . ARG A 1 152 ? 81.481  21.598  -49.495 1.00 56.82  ? 174 ARG A O   1 
ATOM   1165  C  CB  . ARG A 1 152 ? 78.886  21.534  -47.522 1.00 54.43  ? 174 ARG A CB  1 
ATOM   1166  C  CG  . ARG A 1 152 ? 77.519  22.220  -47.336 1.00 65.97  ? 174 ARG A CG  1 
ATOM   1167  C  CD  . ARG A 1 152 ? 77.160  22.500  -45.886 1.00 76.37  ? 174 ARG A CD  1 
ATOM   1168  N  NE  . ARG A 1 152 ? 77.246  21.326  -45.001 1.00 78.02  ? 174 ARG A NE  1 
ATOM   1169  C  CZ  . ARG A 1 152 ? 76.198  20.717  -44.450 1.00 82.45  ? 174 ARG A CZ  1 
ATOM   1170  N  NH1 . ARG A 1 152 ? 74.965  21.141  -44.701 1.00 71.42  ? 174 ARG A NH1 1 
ATOM   1171  N  NH2 . ARG A 1 152 ? 76.376  19.677  -43.647 1.00 53.70  ? 174 ARG A NH2 1 
ATOM   1172  N  N   . ALA A 1 153 ? 80.864  19.444  -49.153 1.00 48.16  ? 175 ALA A N   1 
ATOM   1173  C  CA  . ALA A 1 153 ? 82.188  18.848  -49.404 1.00 46.22  ? 175 ALA A CA  1 
ATOM   1174  C  C   . ALA A 1 153 ? 82.696  19.223  -50.801 1.00 49.66  ? 175 ALA A C   1 
ATOM   1175  O  O   . ALA A 1 153 ? 83.834  19.659  -50.937 1.00 49.63  ? 175 ALA A O   1 
ATOM   1176  C  CB  . ALA A 1 153 ? 82.126  17.336  -49.250 1.00 45.36  ? 175 ALA A CB  1 
ATOM   1177  N  N   . ALA A 1 154 ? 81.802  19.159  -51.814 1.00 45.15  ? 176 ALA A N   1 
ATOM   1178  C  CA  . ALA A 1 154 ? 82.121  19.484  -53.193 1.00 44.50  ? 176 ALA A CA  1 
ATOM   1179  C  C   . ALA A 1 154 ? 82.417  20.955  -53.324 1.00 51.21  ? 176 ALA A C   1 
ATOM   1180  O  O   . ALA A 1 154 ? 83.361  21.334  -54.026 1.00 52.84  ? 176 ALA A O   1 
ATOM   1181  C  CB  . ALA A 1 154 ? 80.973  19.094  -54.109 1.00 44.65  ? 176 ALA A CB  1 
ATOM   1182  N  N   . GLN A 1 155 ? 81.610  21.789  -52.673 1.00 48.11  ? 177 GLN A N   1 
ATOM   1183  C  CA  . GLN A 1 155 ? 81.817  23.230  -52.714 1.00 50.13  ? 177 GLN A CA  1 
ATOM   1184  C  C   . GLN A 1 155 ? 83.186  23.575  -52.085 1.00 53.13  ? 177 GLN A C   1 
ATOM   1185  O  O   . GLN A 1 155 ? 84.043  24.154  -52.749 1.00 51.53  ? 177 GLN A O   1 
ATOM   1186  C  CB  . GLN A 1 155 ? 80.681  23.955  -51.983 1.00 52.63  ? 177 GLN A CB  1 
ATOM   1187  C  CG  . GLN A 1 155 ? 80.881  25.463  -51.969 1.00 54.36  ? 177 GLN A CG  1 
ATOM   1188  C  CD  . GLN A 1 155 ? 79.966  26.191  -51.036 1.00 66.92  ? 177 GLN A CD  1 
ATOM   1189  O  OE1 . GLN A 1 155 ? 78.973  25.657  -50.521 1.00 59.93  ? 177 GLN A OE1 1 
ATOM   1190  N  NE2 . GLN A 1 155 ? 80.232  27.475  -50.878 1.00 63.59  ? 177 GLN A NE2 1 
ATOM   1191  N  N   . LYS A 1 156 ? 83.373  23.192  -50.809 1.00 49.58  ? 178 LYS A N   1 
ATOM   1192  C  CA  . LYS A 1 156 ? 84.601  23.397  -50.065 1.00 48.68  ? 178 LYS A CA  1 
ATOM   1193  C  C   . LYS A 1 156 ? 85.807  22.967  -50.953 1.00 54.09  ? 178 LYS A C   1 
ATOM   1194  O  O   . LYS A 1 156 ? 86.728  23.776  -51.121 1.00 57.32  ? 178 LYS A O   1 
ATOM   1195  C  CB  . LYS A 1 156 ? 84.548  22.718  -48.667 1.00 46.67  ? 178 LYS A CB  1 
ATOM   1196  N  N   . LYS A 1 157 ? 85.723  21.798  -51.647 1.00 46.48  ? 179 LYS A N   1 
ATOM   1197  C  CA  . LYS A 1 157 ? 86.813  21.313  -52.502 1.00 44.47  ? 179 LYS A CA  1 
ATOM   1198  C  C   . LYS A 1 157 ? 86.995  22.168  -53.798 1.00 48.53  ? 179 LYS A C   1 
ATOM   1199  O  O   . LYS A 1 157 ? 88.115  22.603  -54.093 1.00 46.54  ? 179 LYS A O   1 
ATOM   1200  C  CB  . LYS A 1 157 ? 86.680  19.803  -52.788 1.00 43.15  ? 179 LYS A CB  1 
ATOM   1201  C  CG  . LYS A 1 157 ? 87.664  19.244  -53.826 1.00 48.67  ? 179 LYS A CG  1 
ATOM   1202  C  CD  . LYS A 1 157 ? 89.080  19.122  -53.327 1.00 51.29  ? 179 LYS A CD  1 
ATOM   1203  C  CE  . LYS A 1 157 ? 89.842  18.039  -54.038 1.00 64.26  ? 179 LYS A CE  1 
ATOM   1204  N  NZ  . LYS A 1 157 ? 91.111  17.712  -53.320 1.00 81.23  ? 179 LYS A NZ  1 
ATOM   1205  N  N   . LEU A 1 158 ? 85.911  22.422  -54.548 1.00 47.05  ? 180 LEU A N   1 
ATOM   1206  C  CA  . LEU A 1 158 ? 86.015  23.255  -55.761 1.00 48.38  ? 180 LEU A CA  1 
ATOM   1207  C  C   . LEU A 1 158 ? 86.598  24.649  -55.423 1.00 54.19  ? 180 LEU A C   1 
ATOM   1208  O  O   . LEU A 1 158 ? 87.565  25.084  -56.051 1.00 54.88  ? 180 LEU A O   1 
ATOM   1209  C  CB  . LEU A 1 158 ? 84.669  23.351  -56.541 1.00 47.90  ? 180 LEU A CB  1 
ATOM   1210  C  CG  . LEU A 1 158 ? 84.714  24.191  -57.822 1.00 51.98  ? 180 LEU A CG  1 
ATOM   1211  C  CD1 . LEU A 1 158 ? 85.631  23.548  -58.919 1.00 51.04  ? 180 LEU A CD1 1 
ATOM   1212  C  CD2 . LEU A 1 158 ? 83.345  24.430  -58.338 1.00 52.71  ? 180 LEU A CD2 1 
ATOM   1213  N  N   . GLU A 1 159 ? 86.078  25.265  -54.353 1.00 50.75  ? 181 GLU A N   1 
ATOM   1214  C  CA  . GLU A 1 159 ? 86.530  26.555  -53.840 1.00 51.91  ? 181 GLU A CA  1 
ATOM   1215  C  C   . GLU A 1 159 ? 88.032  26.583  -53.511 1.00 56.76  ? 181 GLU A C   1 
ATOM   1216  O  O   . GLU A 1 159 ? 88.716  27.546  -53.839 1.00 57.36  ? 181 GLU A O   1 
ATOM   1217  C  CB  . GLU A 1 159 ? 85.677  26.975  -52.648 1.00 53.39  ? 181 GLU A CB  1 
ATOM   1218  C  CG  . GLU A 1 159 ? 84.281  27.442  -53.053 1.00 60.06  ? 181 GLU A CG  1 
ATOM   1219  C  CD  . GLU A 1 159 ? 83.432  28.027  -51.935 1.00 80.84  ? 181 GLU A CD  1 
ATOM   1220  O  OE1 . GLU A 1 159 ? 83.574  27.583  -50.772 1.00 76.41  ? 181 GLU A OE1 1 
ATOM   1221  O  OE2 . GLU A 1 159 ? 82.612  28.927  -52.229 1.00 72.23  ? 181 GLU A OE2 1 
ATOM   1222  N  N   . THR A 1 160 ? 88.540  25.492  -52.931 1.00 54.25  ? 182 THR A N   1 
ATOM   1223  C  CA  . THR A 1 160 ? 89.950  25.288  -52.589 1.00 54.46  ? 182 THR A CA  1 
ATOM   1224  C  C   . THR A 1 160 ? 90.806  25.398  -53.844 1.00 58.60  ? 182 THR A C   1 
ATOM   1225  O  O   . THR A 1 160 ? 91.742  26.183  -53.864 1.00 59.68  ? 182 THR A O   1 
ATOM   1226  C  CB  . THR A 1 160 ? 90.094  23.973  -51.801 1.00 63.83  ? 182 THR A CB  1 
ATOM   1227  O  OG1 . THR A 1 160 ? 90.002  24.264  -50.399 1.00 65.24  ? 182 THR A OG1 1 
ATOM   1228  C  CG2 . THR A 1 160 ? 91.378  23.212  -52.108 1.00 63.21  ? 182 THR A CG2 1 
ATOM   1229  N  N   . LEU A 1 161 ? 90.434  24.660  -54.907 1.00 55.07  ? 183 LEU A N   1 
ATOM   1230  C  CA  . LEU A 1 161 ? 91.123  24.634  -56.209 1.00 54.09  ? 183 LEU A CA  1 
ATOM   1231  C  C   . LEU A 1 161 ? 91.078  25.991  -56.898 1.00 61.76  ? 183 LEU A C   1 
ATOM   1232  O  O   . LEU A 1 161 ? 92.052  26.362  -57.548 1.00 63.79  ? 183 LEU A O   1 
ATOM   1233  C  CB  . LEU A 1 161 ? 90.540  23.543  -57.143 1.00 50.79  ? 183 LEU A CB  1 
ATOM   1234  C  CG  . LEU A 1 161 ? 90.514  22.133  -56.610 1.00 49.79  ? 183 LEU A CG  1 
ATOM   1235  C  CD1 . LEU A 1 161 ? 89.654  21.293  -57.454 1.00 49.64  ? 183 LEU A CD1 1 
ATOM   1236  C  CD2 . LEU A 1 161 ? 91.882  21.528  -56.581 1.00 46.15  ? 183 LEU A CD2 1 
ATOM   1237  N  N   . LEU A 1 162 ? 89.967  26.728  -56.736 1.00 58.55  ? 184 LEU A N   1 
ATOM   1238  C  CA  . LEU A 1 162 ? 89.799  28.055  -57.325 1.00 60.43  ? 184 LEU A CA  1 
ATOM   1239  C  C   . LEU A 1 162 ? 90.525  29.187  -56.552 1.00 69.38  ? 184 LEU A C   1 
ATOM   1240  O  O   . LEU A 1 162 ? 90.729  30.259  -57.118 1.00 71.68  ? 184 LEU A O   1 
ATOM   1241  C  CB  . LEU A 1 162 ? 88.306  28.379  -57.517 1.00 59.63  ? 184 LEU A CB  1 
ATOM   1242  C  CG  . LEU A 1 162 ? 87.463  27.389  -58.322 1.00 59.88  ? 184 LEU A CG  1 
ATOM   1243  C  CD1 . LEU A 1 162 ? 86.021  27.809  -58.330 1.00 58.64  ? 184 LEU A CD1 1 
ATOM   1244  C  CD2 . LEU A 1 162 ? 87.989  27.218  -59.730 1.00 61.14  ? 184 LEU A CD2 1 
ATOM   1245  N  N   . GLU A 1 163 ? 90.922  28.932  -55.274 1.00 66.90  ? 185 GLU A N   1 
ATOM   1246  C  CA  . GLU A 1 163 ? 91.648  29.841  -54.368 1.00 67.20  ? 185 GLU A CA  1 
ATOM   1247  C  C   . GLU A 1 163 ? 92.995  29.212  -53.930 1.00 110.41 ? 185 GLU A C   1 
ATOM   1248  O  O   . GLU A 1 163 ? 93.734  28.616  -54.726 1.00 71.47  ? 185 GLU A O   1 
ATOM   1249  C  CB  . GLU A 1 163 ? 90.798  30.129  -53.119 1.00 68.11  ? 185 GLU A CB  1 
ATOM   1250  N  N   . GLY A 1 187 ? 92.455  33.296  -62.484 1.00 97.12  ? 209 GLY A N   1 
ATOM   1251  C  CA  . GLY A 1 187 ? 92.144  32.133  -63.308 1.00 95.10  ? 209 GLY A CA  1 
ATOM   1252  C  C   . GLY A 1 187 ? 90.654  31.866  -63.410 1.00 97.37  ? 209 GLY A C   1 
ATOM   1253  O  O   . GLY A 1 187 ? 89.887  32.813  -63.627 1.00 99.09  ? 209 GLY A O   1 
ATOM   1254  N  N   . PRO A 1 188 ? 90.192  30.593  -63.250 1.00 89.60  ? 210 PRO A N   1 
ATOM   1255  C  CA  . PRO A 1 188 ? 88.739  30.333  -63.292 1.00 87.41  ? 210 PRO A CA  1 
ATOM   1256  C  C   . PRO A 1 188 ? 88.113  30.575  -61.920 1.00 88.73  ? 210 PRO A C   1 
ATOM   1257  O  O   . PRO A 1 188 ? 88.708  30.195  -60.905 1.00 87.56  ? 210 PRO A O   1 
ATOM   1258  C  CB  . PRO A 1 188 ? 88.643  28.878  -63.751 1.00 87.01  ? 210 PRO A CB  1 
ATOM   1259  C  CG  . PRO A 1 188 ? 89.981  28.268  -63.431 1.00 91.48  ? 210 PRO A CG  1 
ATOM   1260  C  CD  . PRO A 1 188 ? 90.945  29.351  -62.984 1.00 89.11  ? 210 PRO A CD  1 
ATOM   1261  N  N   . LYS A 1 189 ? 86.948  31.265  -61.885 1.00 83.75  ? 211 LYS A N   1 
ATOM   1262  C  CA  . LYS A 1 189 ? 86.239  31.658  -60.658 1.00 81.94  ? 211 LYS A CA  1 
ATOM   1263  C  C   . LYS A 1 189 ? 84.769  31.243  -60.654 1.00 80.79  ? 211 LYS A C   1 
ATOM   1264  O  O   . LYS A 1 189 ? 84.156  31.120  -61.717 1.00 79.48  ? 211 LYS A O   1 
ATOM   1265  C  CB  . LYS A 1 189 ? 86.336  33.182  -60.476 1.00 86.82  ? 211 LYS A CB  1 
ATOM   1266  N  N   . ALA A 1 190 ? 84.195  31.043  -59.451 1.00 74.61  ? 212 ALA A N   1 
ATOM   1267  C  CA  . ALA A 1 190 ? 82.773  30.704  -59.302 1.00 72.20  ? 212 ALA A CA  1 
ATOM   1268  C  C   . ALA A 1 190 ? 81.990  31.964  -58.942 1.00 76.07  ? 212 ALA A C   1 
ATOM   1269  O  O   . ALA A 1 190 ? 82.035  32.438  -57.801 1.00 76.69  ? 212 ALA A O   1 
ATOM   1270  C  CB  . ALA A 1 190 ? 82.565  29.600  -58.261 1.00 70.55  ? 212 ALA A CB  1 
ATOM   1271  N  N   . ASP A 1 191 ? 81.319  32.539  -59.949 1.00 72.06  ? 213 ASP A N   1 
ATOM   1272  C  CA  . ASP A 1 191 ? 80.513  33.759  -59.834 1.00 73.16  ? 213 ASP A CA  1 
ATOM   1273  C  C   . ASP A 1 191 ? 79.492  33.712  -58.683 1.00 76.09  ? 213 ASP A C   1 
ATOM   1274  O  O   . ASP A 1 191 ? 79.305  34.712  -57.996 1.00 77.74  ? 213 ASP A O   1 
ATOM   1275  C  CB  . ASP A 1 191 ? 79.828  34.067  -61.175 1.00 75.29  ? 213 ASP A CB  1 
ATOM   1276  C  CG  . ASP A 1 191 ? 80.725  34.686  -62.243 1.00 82.11  ? 213 ASP A CG  1 
ATOM   1277  O  OD1 . ASP A 1 191 ? 81.953  34.833  -61.989 1.00 79.41  ? 213 ASP A OD1 1 
ATOM   1278  O  OD2 . ASP A 1 191 ? 80.195  35.047  -63.330 1.00 89.04  ? 213 ASP A OD2 1 
ATOM   1279  N  N   . LYS A 1 192 ? 78.855  32.550  -58.466 1.00 69.67  ? 214 LYS A N   1 
ATOM   1280  C  CA  . LYS A 1 192 ? 77.890  32.340  -57.393 1.00 68.52  ? 214 LYS A CA  1 
ATOM   1281  C  C   . LYS A 1 192 ? 77.815  30.877  -57.014 1.00 70.87  ? 214 LYS A C   1 
ATOM   1282  O  O   . LYS A 1 192 ? 77.993  29.998  -57.866 1.00 70.88  ? 214 LYS A O   1 
ATOM   1283  C  CB  . LYS A 1 192 ? 76.488  32.841  -57.776 1.00 71.21  ? 214 LYS A CB  1 
ATOM   1284  N  N   . VAL A 1 193 ? 77.534  30.628  -55.724 1.00 64.81  ? 215 VAL A N   1 
ATOM   1285  C  CA  . VAL A 1 193 ? 77.291  29.313  -55.148 1.00 61.28  ? 215 VAL A CA  1 
ATOM   1286  C  C   . VAL A 1 193 ? 75.881  29.338  -54.560 1.00 66.58  ? 215 VAL A C   1 
ATOM   1287  O  O   . VAL A 1 193 ? 75.541  30.241  -53.797 1.00 68.88  ? 215 VAL A O   1 
ATOM   1288  C  CB  . VAL A 1 193 ? 78.342  28.854  -54.118 1.00 62.73  ? 215 VAL A CB  1 
ATOM   1289  C  CG1 . VAL A 1 193 ? 78.051  27.423  -53.648 1.00 60.32  ? 215 VAL A CG1 1 
ATOM   1290  C  CG2 . VAL A 1 193 ? 79.753  28.956  -54.692 1.00 61.98  ? 215 VAL A CG2 1 
ATOM   1291  N  N   . LEU A 1 194 ? 75.043  28.388  -54.963 1.00 61.59  ? 216 LEU A N   1 
ATOM   1292  C  CA  . LEU A 1 194 ? 73.678  28.306  -54.481 1.00 62.01  ? 216 LEU A CA  1 
ATOM   1293  C  C   . LEU A 1 194 ? 73.454  26.959  -53.818 1.00 66.26  ? 216 LEU A C   1 
ATOM   1294  O  O   . LEU A 1 194 ? 73.757  25.918  -54.393 1.00 65.98  ? 216 LEU A O   1 
ATOM   1295  C  CB  . LEU A 1 194 ? 72.670  28.551  -55.613 1.00 62.84  ? 216 LEU A CB  1 
ATOM   1296  C  CG  . LEU A 1 194 ? 72.894  29.786  -56.500 1.00 68.68  ? 216 LEU A CG  1 
ATOM   1297  C  CD1 . LEU A 1 194 ? 71.975  29.776  -57.692 1.00 69.36  ? 216 LEU A CD1 1 
ATOM   1298  C  CD2 . LEU A 1 194 ? 72.726  31.058  -55.731 1.00 73.22  ? 216 LEU A CD2 1 
ATOM   1299  N  N   . GLN A 1 195 ? 72.968  26.983  -52.587 1.00 62.84  ? 217 GLN A N   1 
ATOM   1300  C  CA  . GLN A 1 195 ? 72.706  25.774  -51.815 1.00 60.62  ? 217 GLN A CA  1 
ATOM   1301  C  C   . GLN A 1 195 ? 71.218  25.655  -51.707 1.00 64.65  ? 217 GLN A C   1 
ATOM   1302  O  O   . GLN A 1 195 ? 70.545  26.678  -51.647 1.00 67.53  ? 217 GLN A O   1 
ATOM   1303  C  CB  . GLN A 1 195 ? 73.324  25.857  -50.406 1.00 61.75  ? 217 GLN A CB  1 
ATOM   1304  C  CG  . GLN A 1 195 ? 74.640  26.626  -50.304 1.00 73.97  ? 217 GLN A CG  1 
ATOM   1305  C  CD  . GLN A 1 195 ? 75.286  26.452  -48.957 1.00 107.20 ? 217 GLN A CD  1 
ATOM   1306  O  OE1 . GLN A 1 195 ? 74.688  26.736  -47.908 1.00 110.50 ? 217 GLN A OE1 1 
ATOM   1307  N  NE2 . GLN A 1 195 ? 76.528  25.977  -48.959 1.00 99.73  ? 217 GLN A NE2 1 
ATOM   1308  N  N   . PHE A 1 196 ? 70.695  24.441  -51.672 1.00 59.56  ? 218 PHE A N   1 
ATOM   1309  C  CA  . PHE A 1 196 ? 69.263  24.230  -51.539 1.00 62.01  ? 218 PHE A CA  1 
ATOM   1310  C  C   . PHE A 1 196 ? 68.997  23.139  -50.491 1.00 67.08  ? 218 PHE A C   1 
ATOM   1311  O  O   . PHE A 1 196 ? 69.879  22.331  -50.202 1.00 64.80  ? 218 PHE A O   1 
ATOM   1312  C  CB  . PHE A 1 196 ? 68.626  23.887  -52.901 1.00 65.34  ? 218 PHE A CB  1 
ATOM   1313  C  CG  . PHE A 1 196 ? 69.121  22.587  -53.503 1.00 66.85  ? 218 PHE A CG  1 
ATOM   1314  C  CD1 . PHE A 1 196 ? 68.612  21.358  -53.073 1.00 69.36  ? 218 PHE A CD1 1 
ATOM   1315  C  CD2 . PHE A 1 196 ? 70.118  22.588  -54.472 1.00 69.37  ? 218 PHE A CD2 1 
ATOM   1316  C  CE1 . PHE A 1 196 ? 69.121  20.160  -53.573 1.00 69.42  ? 218 PHE A CE1 1 
ATOM   1317  C  CE2 . PHE A 1 196 ? 70.616  21.392  -54.982 1.00 70.79  ? 218 PHE A CE2 1 
ATOM   1318  C  CZ  . PHE A 1 196 ? 70.115  20.185  -54.530 1.00 68.59  ? 218 PHE A CZ  1 
ATOM   1319  N  N   . GLU A 1 197 ? 67.789  23.103  -49.922 1.00 65.91  ? 219 GLU A N   1 
ATOM   1320  C  CA  . GLU A 1 197 ? 67.486  22.086  -48.921 1.00 64.29  ? 219 GLU A CA  1 
ATOM   1321  C  C   . GLU A 1 197 ? 67.260  20.738  -49.580 1.00 64.10  ? 219 GLU A C   1 
ATOM   1322  O  O   . GLU A 1 197 ? 66.389  20.620  -50.442 1.00 62.72  ? 219 GLU A O   1 
ATOM   1323  C  CB  . GLU A 1 197 ? 66.242  22.473  -48.096 1.00 67.66  ? 219 GLU A CB  1 
ATOM   1324  C  CG  . GLU A 1 197 ? 66.475  22.584  -46.595 1.00 77.08  ? 219 GLU A CG  1 
ATOM   1325  C  CD  . GLU A 1 197 ? 66.851  21.325  -45.841 1.00 94.39  ? 219 GLU A CD  1 
ATOM   1326  O  OE1 . GLU A 1 197 ? 67.864  21.369  -45.106 1.00 94.27  ? 219 GLU A OE1 1 
ATOM   1327  O  OE2 . GLU A 1 197 ? 66.104  20.325  -45.921 1.00 89.90  ? 219 GLU A OE2 1 
ATOM   1328  N  N   . PRO A 1 198 ? 67.997  19.686  -49.174 1.00 59.80  ? 220 PRO A N   1 
ATOM   1329  C  CA  . PRO A 1 198 ? 67.726  18.348  -49.732 1.00 58.69  ? 220 PRO A CA  1 
ATOM   1330  C  C   . PRO A 1 198 ? 66.261  17.948  -49.492 1.00 65.14  ? 220 PRO A C   1 
ATOM   1331  O  O   . PRO A 1 198 ? 65.748  18.108  -48.380 1.00 66.10  ? 220 PRO A O   1 
ATOM   1332  C  CB  . PRO A 1 198 ? 68.723  17.450  -48.985 1.00 58.23  ? 220 PRO A CB  1 
ATOM   1333  C  CG  . PRO A 1 198 ? 69.791  18.371  -48.519 1.00 62.38  ? 220 PRO A CG  1 
ATOM   1334  C  CD  . PRO A 1 198 ? 69.070  19.627  -48.165 1.00 60.13  ? 220 PRO A CD  1 
ATOM   1335  N  N   . GLY A 1 199 ? 65.587  17.528  -50.560 1.00 62.62  ? 221 GLY A N   1 
ATOM   1336  C  CA  . GLY A 1 199 ? 64.180  17.138  -50.522 1.00 64.28  ? 221 GLY A CA  1 
ATOM   1337  C  C   . GLY A 1 199 ? 63.225  18.169  -51.093 1.00 71.37  ? 221 GLY A C   1 
ATOM   1338  O  O   . GLY A 1 199 ? 62.031  17.886  -51.238 1.00 71.94  ? 221 GLY A O   1 
ATOM   1339  N  N   . THR A 1 200 ? 63.737  19.386  -51.398 1.00 69.43  ? 222 THR A N   1 
ATOM   1340  C  CA  . THR A 1 200 ? 62.962  20.464  -52.024 1.00 71.67  ? 222 THR A CA  1 
ATOM   1341  C  C   . THR A 1 200 ? 62.638  20.026  -53.465 1.00 77.53  ? 222 THR A C   1 
ATOM   1342  O  O   . THR A 1 200 ? 63.556  19.697  -54.235 1.00 77.01  ? 222 THR A O   1 
ATOM   1343  C  CB  . THR A 1 200 ? 63.762  21.772  -52.016 1.00 79.28  ? 222 THR A CB  1 
ATOM   1344  O  OG1 . THR A 1 200 ? 64.119  22.099  -50.678 1.00 80.70  ? 222 THR A OG1 1 
ATOM   1345  C  CG2 . THR A 1 200 ? 63.020  22.920  -52.648 1.00 80.50  ? 222 THR A CG2 1 
ATOM   1346  N  N   . LYS A 1 201 ? 61.341  19.971  -53.804 1.00 75.01  ? 223 LYS A N   1 
ATOM   1347  C  CA  . LYS A 1 201 ? 60.923  19.562  -55.137 1.00 74.97  ? 223 LYS A CA  1 
ATOM   1348  C  C   . LYS A 1 201 ? 60.782  20.760  -56.088 1.00 80.73  ? 223 LYS A C   1 
ATOM   1349  O  O   . LYS A 1 201 ? 61.063  20.609  -57.287 1.00 79.60  ? 223 LYS A O   1 
ATOM   1350  C  CB  . LYS A 1 201 ? 59.668  18.674  -55.093 1.00 78.43  ? 223 LYS A CB  1 
ATOM   1351  C  CG  . LYS A 1 201 ? 59.940  17.161  -55.188 1.00 85.28  ? 223 LYS A CG  1 
ATOM   1352  C  CD  . LYS A 1 201 ? 60.811  16.586  -54.052 1.00 97.41  ? 223 LYS A CD  1 
ATOM   1353  C  CE  . LYS A 1 201 ? 61.985  15.741  -54.547 1.00 109.86 ? 223 LYS A CE  1 
ATOM   1354  N  NZ  . LYS A 1 201 ? 63.308  16.433  -54.420 1.00 112.30 ? 223 LYS A NZ  1 
ATOM   1355  N  N   . ASN A 1 202 ? 60.415  21.954  -55.558 1.00 79.76  ? 224 ASN A N   1 
ATOM   1356  C  CA  . ASN A 1 202 ? 60.316  23.160  -56.390 1.00 82.01  ? 224 ASN A CA  1 
ATOM   1357  C  C   . ASN A 1 202 ? 61.496  24.097  -56.130 1.00 85.88  ? 224 ASN A C   1 
ATOM   1358  O  O   . ASN A 1 202 ? 61.541  24.805  -55.113 1.00 86.93  ? 224 ASN A O   1 
ATOM   1359  C  CB  . ASN A 1 202 ? 58.946  23.877  -56.268 1.00 88.61  ? 224 ASN A CB  1 
ATOM   1360  C  CG  . ASN A 1 202 ? 58.428  24.511  -57.560 1.00 117.13 ? 224 ASN A CG  1 
ATOM   1361  O  OD1 . ASN A 1 202 ? 59.035  24.407  -58.636 1.00 111.76 ? 224 ASN A OD1 1 
ATOM   1362  N  ND2 . ASN A 1 202 ? 57.257  25.143  -57.495 1.00 109.39 ? 224 ASN A ND2 1 
ATOM   1363  N  N   . LEU A 1 203 ? 62.444  24.112  -57.083 1.00 80.28  ? 225 LEU A N   1 
ATOM   1364  C  CA  . LEU A 1 203 ? 63.670  24.915  -56.990 1.00 78.72  ? 225 LEU A CA  1 
ATOM   1365  C  C   . LEU A 1 203 ? 63.725  26.032  -58.039 1.00 84.05  ? 225 LEU A C   1 
ATOM   1366  O  O   . LEU A 1 203 ? 64.822  26.445  -58.436 1.00 82.80  ? 225 LEU A O   1 
ATOM   1367  C  CB  . LEU A 1 203 ? 64.910  23.996  -57.108 1.00 75.68  ? 225 LEU A CB  1 
ATOM   1368  C  CG  . LEU A 1 203 ? 64.942  22.776  -56.194 1.00 77.82  ? 225 LEU A CG  1 
ATOM   1369  C  CD1 . LEU A 1 203 ? 65.429  21.582  -56.936 1.00 76.07  ? 225 LEU A CD1 1 
ATOM   1370  C  CD2 . LEU A 1 203 ? 65.776  23.026  -54.969 1.00 78.56  ? 225 LEU A CD2 1 
ATOM   1371  N  N   . THR A 1 204 ? 62.553  26.550  -58.470 1.00 82.45  ? 226 THR A N   1 
ATOM   1372  C  CA  . THR A 1 204 ? 62.560  27.592  -59.498 1.00 83.57  ? 226 THR A CA  1 
ATOM   1373  C  C   . THR A 1 204 ? 62.996  28.942  -58.903 1.00 86.16  ? 226 THR A C   1 
ATOM   1374  O  O   . THR A 1 204 ? 63.448  29.804  -59.650 1.00 86.10  ? 226 THR A O   1 
ATOM   1375  C  CB  . THR A 1 204 ? 61.262  27.644  -60.339 1.00 97.59  ? 226 THR A CB  1 
ATOM   1376  O  OG1 . THR A 1 204 ? 60.308  28.566  -59.787 1.00 98.09  ? 226 THR A OG1 1 
ATOM   1377  C  CG2 . THR A 1 204 ? 60.649  26.261  -60.571 1.00 95.73  ? 226 THR A CG2 1 
ATOM   1378  N  N   . ALA A 1 205 ? 62.939  29.097  -57.576 1.00 81.99  ? 227 ALA A N   1 
ATOM   1379  C  CA  . ALA A 1 205 ? 63.423  30.316  -56.931 1.00 83.16  ? 227 ALA A CA  1 
ATOM   1380  C  C   . ALA A 1 205 ? 64.977  30.313  -56.956 1.00 85.28  ? 227 ALA A C   1 
ATOM   1381  O  O   . ALA A 1 205 ? 65.604  31.338  -57.272 1.00 85.77  ? 227 ALA A O   1 
ATOM   1382  C  CB  . ALA A 1 205 ? 62.908  30.383  -55.505 1.00 84.63  ? 227 ALA A CB  1 
ATOM   1383  N  N   . LEU A 1 206 ? 65.574  29.130  -56.672 1.00 78.37  ? 228 LEU A N   1 
ATOM   1384  C  CA  . LEU A 1 206 ? 67.008  28.887  -56.707 1.00 76.58  ? 228 LEU A CA  1 
ATOM   1385  C  C   . LEU A 1 206 ? 67.518  29.058  -58.144 1.00 83.00  ? 228 LEU A C   1 
ATOM   1386  O  O   . LEU A 1 206 ? 68.485  29.777  -58.387 1.00 83.96  ? 228 LEU A O   1 
ATOM   1387  C  CB  . LEU A 1 206 ? 67.260  27.449  -56.241 1.00 73.96  ? 228 LEU A CB  1 
ATOM   1388  C  CG  . LEU A 1 206 ? 68.695  26.954  -56.224 1.00 76.00  ? 228 LEU A CG  1 
ATOM   1389  C  CD1 . LEU A 1 206 ? 69.286  27.113  -54.836 1.00 75.70  ? 228 LEU A CD1 1 
ATOM   1390  C  CD2 . LEU A 1 206 ? 68.761  25.493  -56.635 1.00 75.74  ? 228 LEU A CD2 1 
ATOM   1391  N  N   . LEU A 1 207 ? 66.848  28.382  -59.089 1.00 79.27  ? 229 LEU A N   1 
ATOM   1392  C  CA  . LEU A 1 207 ? 67.214  28.392  -60.494 1.00 78.63  ? 229 LEU A CA  1 
ATOM   1393  C  C   . LEU A 1 207 ? 66.956  29.719  -61.190 1.00 84.80  ? 229 LEU A C   1 
ATOM   1394  O  O   . LEU A 1 207 ? 67.649  30.014  -62.163 1.00 85.05  ? 229 LEU A O   1 
ATOM   1395  C  CB  . LEU A 1 207 ? 66.548  27.233  -61.241 1.00 77.37  ? 229 LEU A CB  1 
ATOM   1396  C  CG  . LEU A 1 207 ? 67.140  25.856  -61.009 1.00 77.80  ? 229 LEU A CG  1 
ATOM   1397  C  CD1 . LEU A 1 207 ? 66.177  24.800  -61.419 1.00 76.30  ? 229 LEU A CD1 1 
ATOM   1398  C  CD2 . LEU A 1 207 ? 68.467  25.692  -61.744 1.00 78.65  ? 229 LEU A CD2 1 
ATOM   1399  N  N   . LEU A 1 208 ? 65.998  30.531  -60.704 1.00 82.87  ? 230 LEU A N   1 
ATOM   1400  C  CA  . LEU A 1 208 ? 65.758  31.843  -61.318 1.00 84.76  ? 230 LEU A CA  1 
ATOM   1401  C  C   . LEU A 1 208 ? 66.866  32.791  -60.947 1.00 88.02  ? 230 LEU A C   1 
ATOM   1402  O  O   . LEU A 1 208 ? 67.296  33.593  -61.778 1.00 87.55  ? 230 LEU A O   1 
ATOM   1403  C  CB  . LEU A 1 208 ? 64.415  32.428  -60.932 1.00 86.85  ? 230 LEU A CB  1 
ATOM   1404  C  CG  . LEU A 1 208 ? 63.418  32.416  -62.052 1.00 92.45  ? 230 LEU A CG  1 
ATOM   1405  C  CD1 . LEU A 1 208 ? 62.021  32.194  -61.514 1.00 93.89  ? 230 LEU A CD1 1 
ATOM   1406  C  CD2 . LEU A 1 208 ? 63.530  33.681  -62.890 1.00 96.48  ? 230 LEU A CD2 1 
ATOM   1407  N  N   . GLU A 1 209 ? 67.359  32.654  -59.701 1.00 84.16  ? 231 GLU A N   1 
ATOM   1408  C  CA  . GLU A 1 209 ? 68.499  33.392  -59.159 1.00 84.42  ? 231 GLU A CA  1 
ATOM   1409  C  C   . GLU A 1 209 ? 69.749  33.119  -60.028 1.00 87.63  ? 231 GLU A C   1 
ATOM   1410  O  O   . GLU A 1 209 ? 70.492  34.048  -60.355 1.00 87.46  ? 231 GLU A O   1 
ATOM   1411  C  CB  . GLU A 1 209 ? 68.743  32.958  -57.710 1.00 84.71  ? 231 GLU A CB  1 
ATOM   1412  C  CG  . GLU A 1 209 ? 69.385  34.028  -56.845 1.00 98.37  ? 231 GLU A CG  1 
ATOM   1413  C  CD  . GLU A 1 209 ? 69.533  33.653  -55.383 1.00 126.61 ? 231 GLU A CD  1 
ATOM   1414  O  OE1 . GLU A 1 209 ? 70.686  33.611  -54.896 1.00 135.52 ? 231 GLU A OE1 1 
ATOM   1415  O  OE2 . GLU A 1 209 ? 68.498  33.409  -54.721 1.00 117.31 ? 231 GLU A OE2 1 
ATOM   1416  N  N   . ALA A 1 210 ? 69.935  31.839  -60.432 1.00 82.72  ? 232 ALA A N   1 
ATOM   1417  C  CA  . ALA A 1 210 ? 71.012  31.357  -61.293 1.00 80.54  ? 232 ALA A CA  1 
ATOM   1418  C  C   . ALA A 1 210 ? 70.861  31.861  -62.749 1.00 84.79  ? 232 ALA A C   1 
ATOM   1419  O  O   . ALA A 1 210 ? 71.862  32.172  -63.397 1.00 85.04  ? 232 ALA A O   1 
ATOM   1420  C  CB  . ALA A 1 210 ? 71.036  29.835  -61.266 1.00 78.72  ? 232 ALA A CB  1 
ATOM   1421  N  N   . LYS A 1 211 ? 69.622  31.917  -63.264 1.00 81.03  ? 233 LYS A N   1 
ATOM   1422  C  CA  . LYS A 1 211 ? 69.327  32.363  -64.632 1.00 81.89  ? 233 LYS A CA  1 
ATOM   1423  C  C   . LYS A 1 211 ? 69.688  33.849  -64.869 1.00 90.07  ? 233 LYS A C   1 
ATOM   1424  O  O   . LYS A 1 211 ? 70.096  34.220  -65.976 1.00 91.07  ? 233 LYS A O   1 
ATOM   1425  C  CB  . LYS A 1 211 ? 67.844  32.131  -64.948 1.00 82.94  ? 233 LYS A CB  1 
ATOM   1426  C  CG  . LYS A 1 211 ? 67.562  32.055  -66.435 1.00 69.70  ? 233 LYS A CG  1 
ATOM   1427  C  CD  . LYS A 1 211 ? 66.113  31.793  -66.712 1.00 67.59  ? 233 LYS A CD  1 
ATOM   1428  C  CE  . LYS A 1 211 ? 65.888  31.641  -68.184 1.00 73.65  ? 233 LYS A CE  1 
ATOM   1429  N  NZ  . LYS A 1 211 ? 64.438  31.610  -68.500 1.00 91.94  ? 233 LYS A NZ  1 
ATOM   1430  N  N   . GLU A 1 212 ? 69.521  34.687  -63.821 1.00 87.48  ? 234 GLU A N   1 
ATOM   1431  C  CA  . GLU A 1 212 ? 69.794  36.123  -63.833 1.00 89.07  ? 234 GLU A CA  1 
ATOM   1432  C  C   . GLU A 1 212 ? 71.278  36.469  -64.065 1.00 92.34  ? 234 GLU A C   1 
ATOM   1433  O  O   . GLU A 1 212 ? 71.573  37.538  -64.603 1.00 95.14  ? 234 GLU A O   1 
ATOM   1434  C  CB  . GLU A 1 212 ? 69.276  36.775  -62.541 1.00 91.44  ? 234 GLU A CB  1 
ATOM   1435  N  N   . LEU A 1 213 ? 72.201  35.569  -63.666 1.00 84.70  ? 235 LEU A N   1 
ATOM   1436  C  CA  . LEU A 1 213 ? 73.650  35.757  -63.808 1.00 83.49  ? 235 LEU A CA  1 
ATOM   1437  C  C   . LEU A 1 213 ? 74.159  35.610  -65.244 1.00 87.35  ? 235 LEU A C   1 
ATOM   1438  O  O   . LEU A 1 213 ? 73.534  34.934  -66.072 1.00 86.36  ? 235 LEU A O   1 
ATOM   1439  C  CB  . LEU A 1 213 ? 74.410  34.813  -62.874 1.00 80.87  ? 235 LEU A CB  1 
ATOM   1440  C  CG  . LEU A 1 213 ? 74.040  34.914  -61.408 1.00 85.87  ? 235 LEU A CG  1 
ATOM   1441  C  CD1 . LEU A 1 213 ? 74.095  33.561  -60.744 1.00 85.08  ? 235 LEU A CD1 1 
ATOM   1442  C  CD2 . LEU A 1 213 ? 74.912  35.908  -60.686 1.00 87.05  ? 235 LEU A CD2 1 
ATOM   1443  N  N   . GLU A 1 214 ? 75.312  36.251  -65.530 1.00 84.86  ? 236 GLU A N   1 
ATOM   1444  C  CA  . GLU A 1 214 ? 75.967  36.235  -66.844 1.00 84.89  ? 236 GLU A CA  1 
ATOM   1445  C  C   . GLU A 1 214 ? 76.520  34.863  -67.159 1.00 84.58  ? 236 GLU A C   1 
ATOM   1446  O  O   . GLU A 1 214 ? 76.445  34.442  -68.315 1.00 84.44  ? 236 GLU A O   1 
ATOM   1447  C  CB  . GLU A 1 214 ? 77.078  37.298  -66.937 1.00 88.41  ? 236 GLU A CB  1 
ATOM   1448  C  CG  . GLU A 1 214 ? 77.200  37.915  -68.325 1.00 107.49 ? 236 GLU A CG  1 
ATOM   1449  C  CD  . GLU A 1 214 ? 78.247  38.998  -68.519 1.00 148.18 ? 236 GLU A CD  1 
ATOM   1450  O  OE1 . GLU A 1 214 ? 78.638  39.234  -69.686 1.00 149.13 ? 236 GLU A OE1 1 
ATOM   1451  O  OE2 . GLU A 1 214 ? 78.659  39.628  -67.516 1.00 151.74 ? 236 GLU A OE2 1 
ATOM   1452  N  N   . ALA A 1 215 ? 77.038  34.150  -66.126 1.00 78.24  ? 237 ALA A N   1 
ATOM   1453  C  CA  . ALA A 1 215 ? 77.576  32.788  -66.260 1.00 74.86  ? 237 ALA A CA  1 
ATOM   1454  C  C   . ALA A 1 215 ? 76.513  31.794  -66.705 1.00 76.04  ? 237 ALA A C   1 
ATOM   1455  O  O   . ALA A 1 215 ? 75.379  31.828  -66.223 1.00 75.09  ? 237 ALA A O   1 
ATOM   1456  C  CB  . ALA A 1 215 ? 78.216  32.323  -64.962 1.00 73.98  ? 237 ALA A CB  1 
ATOM   1457  N  N   . ARG A 1 216 ? 76.883  30.958  -67.678 1.00 71.62  ? 238 ARG A N   1 
ATOM   1458  C  CA  . ARG A 1 216 ? 76.027  29.932  -68.236 1.00 70.73  ? 238 ARG A CA  1 
ATOM   1459  C  C   . ARG A 1 216 ? 76.581  28.513  -67.990 1.00 71.92  ? 238 ARG A C   1 
ATOM   1460  O  O   . ARG A 1 216 ? 75.995  27.533  -68.450 1.00 72.44  ? 238 ARG A O   1 
ATOM   1461  C  CB  . ARG A 1 216 ? 75.734  30.222  -69.711 1.00 74.17  ? 238 ARG A CB  1 
ATOM   1462  C  CG  . ARG A 1 216 ? 74.399  30.940  -69.869 1.00 94.74  ? 238 ARG A CG  1 
ATOM   1463  C  CD  . ARG A 1 216 ? 74.202  31.604  -71.227 1.00 112.75 ? 238 ARG A CD  1 
ATOM   1464  N  NE  . ARG A 1 216 ? 73.072  32.535  -71.207 1.00 123.72 ? 238 ARG A NE  1 
ATOM   1465  C  CZ  . ARG A 1 216 ? 73.112  33.754  -70.676 1.00 144.34 ? 238 ARG A CZ  1 
ATOM   1466  N  NH1 . ARG A 1 216 ? 74.226  34.203  -70.106 1.00 128.53 ? 238 ARG A NH1 1 
ATOM   1467  N  NH2 . ARG A 1 216 ? 72.032  34.523  -70.687 1.00 138.95 ? 238 ARG A NH2 1 
ATOM   1468  N  N   . VAL A 1 217 ? 77.685  28.399  -67.245 1.00 65.03  ? 239 VAL A N   1 
ATOM   1469  C  CA  . VAL A 1 217 ? 78.235  27.095  -66.888 1.00 62.25  ? 239 VAL A CA  1 
ATOM   1470  C  C   . VAL A 1 217 ? 77.707  26.792  -65.494 1.00 67.35  ? 239 VAL A C   1 
ATOM   1471  O  O   . VAL A 1 217 ? 78.008  27.515  -64.545 1.00 69.67  ? 239 VAL A O   1 
ATOM   1472  C  CB  . VAL A 1 217 ? 79.784  26.973  -66.987 1.00 64.55  ? 239 VAL A CB  1 
ATOM   1473  C  CG1 . VAL A 1 217 ? 80.247  25.564  -66.624 1.00 61.48  ? 239 VAL A CG1 1 
ATOM   1474  C  CG2 . VAL A 1 217 ? 80.279  27.345  -68.379 1.00 65.48  ? 239 VAL A CG2 1 
ATOM   1475  N  N   . ILE A 1 218 ? 76.872  25.765  -65.390 1.00 61.68  ? 240 ILE A N   1 
ATOM   1476  C  CA  . ILE A 1 218 ? 76.265  25.347  -64.138 1.00 60.27  ? 240 ILE A CA  1 
ATOM   1477  C  C   . ILE A 1 218 ? 76.896  24.012  -63.738 1.00 60.34  ? 240 ILE A C   1 
ATOM   1478  O  O   . ILE A 1 218 ? 76.924  23.084  -64.545 1.00 59.21  ? 240 ILE A O   1 
ATOM   1479  C  CB  . ILE A 1 218 ? 74.726  25.259  -64.278 1.00 64.18  ? 240 ILE A CB  1 
ATOM   1480  C  CG1 . ILE A 1 218 ? 74.127  26.609  -64.685 1.00 67.48  ? 240 ILE A CG1 1 
ATOM   1481  C  CG2 . ILE A 1 218 ? 74.078  24.729  -63.009 1.00 64.02  ? 240 ILE A CG2 1 
ATOM   1482  C  CD1 . ILE A 1 218 ? 72.873  26.479  -65.544 1.00 77.56  ? 240 ILE A CD1 1 
ATOM   1483  N  N   . ILE A 1 219 ? 77.444  23.952  -62.515 1.00 53.61  ? 241 ILE A N   1 
ATOM   1484  C  CA  . ILE A 1 219 ? 78.043  22.774  -61.907 1.00 50.44  ? 241 ILE A CA  1 
ATOM   1485  C  C   . ILE A 1 219 ? 77.058  22.357  -60.815 1.00 55.46  ? 241 ILE A C   1 
ATOM   1486  O  O   . ILE A 1 219 ? 76.588  23.213  -60.063 1.00 56.52  ? 241 ILE A O   1 
ATOM   1487  C  CB  . ILE A 1 219 ? 79.487  23.036  -61.355 1.00 52.41  ? 241 ILE A CB  1 
ATOM   1488  C  CG1 . ILE A 1 219 ? 80.445  23.563  -62.467 1.00 52.82  ? 241 ILE A CG1 1 
ATOM   1489  C  CG2 . ILE A 1 219 ? 80.057  21.768  -60.711 1.00 49.58  ? 241 ILE A CG2 1 
ATOM   1490  C  CD1 . ILE A 1 219 ? 81.813  23.993  -62.013 1.00 51.72  ? 241 ILE A CD1 1 
ATOM   1491  N  N   . LEU A 1 220 ? 76.742  21.058  -60.729 1.00 50.82  ? 242 LEU A N   1 
ATOM   1492  C  CA  . LEU A 1 220 ? 75.771  20.548  -59.762 1.00 49.63  ? 242 LEU A CA  1 
ATOM   1493  C  C   . LEU A 1 220 ? 76.285  19.433  -58.898 1.00 52.29  ? 242 LEU A C   1 
ATOM   1494  O  O   . LEU A 1 220 ? 76.829  18.448  -59.403 1.00 51.94  ? 242 LEU A O   1 
ATOM   1495  C  CB  . LEU A 1 220 ? 74.470  20.104  -60.486 1.00 49.51  ? 242 LEU A CB  1 
ATOM   1496  C  CG  . LEU A 1 220 ? 73.391  19.399  -59.663 1.00 52.14  ? 242 LEU A CG  1 
ATOM   1497  C  CD1 . LEU A 1 220 ? 72.591  20.394  -58.831 1.00 53.61  ? 242 LEU A CD1 1 
ATOM   1498  C  CD2 . LEU A 1 220 ? 72.488  18.598  -60.540 1.00 52.43  ? 242 LEU A CD2 1 
ATOM   1499  N  N   . SER A 1 221 ? 76.030  19.552  -57.593 1.00 47.78  ? 243 SER A N   1 
ATOM   1500  C  CA  . SER A 1 221 ? 76.366  18.523  -56.611 1.00 45.95  ? 243 SER A CA  1 
ATOM   1501  C  C   . SER A 1 221 ? 75.106  18.210  -55.807 1.00 50.72  ? 243 SER A C   1 
ATOM   1502  O  O   . SER A 1 221 ? 74.646  19.043  -55.045 1.00 53.29  ? 243 SER A O   1 
ATOM   1503  C  CB  . SER A 1 221 ? 77.510  18.976  -55.719 1.00 49.30  ? 243 SER A CB  1 
ATOM   1504  O  OG  . SER A 1 221 ? 77.694  18.016  -54.694 1.00 61.97  ? 243 SER A OG  1 
ATOM   1505  N  N   . ALA A 1 222 ? 74.498  17.056  -56.044 1.00 46.63  ? 244 ALA A N   1 
ATOM   1506  C  CA  . ALA A 1 222 ? 73.220  16.651  -55.432 1.00 47.31  ? 244 ALA A CA  1 
ATOM   1507  C  C   . ALA A 1 222 ? 73.009  15.146  -55.575 1.00 50.87  ? 244 ALA A C   1 
ATOM   1508  O  O   . ALA A 1 222 ? 73.508  14.536  -56.534 1.00 51.31  ? 244 ALA A O   1 
ATOM   1509  C  CB  . ALA A 1 222 ? 72.048  17.391  -56.112 1.00 49.00  ? 244 ALA A CB  1 
ATOM   1510  N  N   . SER A 1 223 ? 72.226  14.561  -54.660 1.00 46.10  ? 245 SER A N   1 
ATOM   1511  C  CA  . SER A 1 223 ? 71.902  13.149  -54.750 1.00 46.22  ? 245 SER A CA  1 
ATOM   1512  C  C   . SER A 1 223 ? 71.022  12.926  -55.993 1.00 55.77  ? 245 SER A C   1 
ATOM   1513  O  O   . SER A 1 223 ? 70.468  13.880  -56.541 1.00 56.22  ? 245 SER A O   1 
ATOM   1514  C  CB  . SER A 1 223 ? 71.198  12.676  -53.481 1.00 48.37  ? 245 SER A CB  1 
ATOM   1515  O  OG  . SER A 1 223 ? 69.846  13.095  -53.385 1.00 55.81  ? 245 SER A OG  1 
ATOM   1516  N  N   . GLU A 1 224 ? 70.910  11.677  -56.433 1.00 55.10  ? 246 GLU A N   1 
ATOM   1517  C  CA  . GLU A 1 224 ? 70.116  11.253  -57.592 1.00 55.96  ? 246 GLU A CA  1 
ATOM   1518  C  C   . GLU A 1 224 ? 68.676  11.850  -57.577 1.00 60.33  ? 246 GLU A C   1 
ATOM   1519  O  O   . GLU A 1 224 ? 68.274  12.488  -58.552 1.00 60.22  ? 246 GLU A O   1 
ATOM   1520  C  CB  . GLU A 1 224 ? 70.173  9.711   -57.671 1.00 56.73  ? 246 GLU A CB  1 
ATOM   1521  C  CG  . GLU A 1 224 ? 68.980  8.997   -58.261 1.00 71.69  ? 246 GLU A CG  1 
ATOM   1522  C  CD  . GLU A 1 224 ? 69.085  7.488   -58.158 1.00 95.80  ? 246 GLU A CD  1 
ATOM   1523  O  OE1 . GLU A 1 224 ? 68.018  6.827   -58.115 1.00 92.00  ? 246 GLU A OE1 1 
ATOM   1524  O  OE2 . GLU A 1 224 ? 70.232  6.969   -58.139 1.00 75.36  ? 246 GLU A OE2 1 
ATOM   1525  N  N   . ASP A 1 225 ? 67.953  11.726  -56.453 1.00 58.30  ? 247 ASP A N   1 
ATOM   1526  C  CA  . ASP A 1 225 ? 66.583  12.257  -56.319 1.00 59.45  ? 247 ASP A CA  1 
ATOM   1527  C  C   . ASP A 1 225 ? 66.525  13.788  -56.295 1.00 63.70  ? 247 ASP A C   1 
ATOM   1528  O  O   . ASP A 1 225 ? 65.550  14.349  -56.798 1.00 64.69  ? 247 ASP A O   1 
ATOM   1529  C  CB  . ASP A 1 225 ? 65.842  11.656  -55.116 1.00 61.70  ? 247 ASP A CB  1 
ATOM   1530  C  CG  . ASP A 1 225 ? 65.686  10.144  -55.144 1.00 82.69  ? 247 ASP A CG  1 
ATOM   1531  O  OD1 . ASP A 1 225 ? 65.386  9.585   -56.243 1.00 85.57  ? 247 ASP A OD1 1 
ATOM   1532  O  OD2 . ASP A 1 225 ? 65.825  9.515   -54.066 1.00 94.34  ? 247 ASP A OD2 1 
ATOM   1533  N  N   . ASP A 1 226 ? 67.569  14.464  -55.743 1.00 58.95  ? 248 ASP A N   1 
ATOM   1534  C  CA  . ASP A 1 226 ? 67.646  15.926  -55.724 1.00 59.63  ? 248 ASP A CA  1 
ATOM   1535  C  C   . ASP A 1 226 ? 68.077  16.474  -57.093 1.00 61.99  ? 248 ASP A C   1 
ATOM   1536  O  O   . ASP A 1 226 ? 67.639  17.549  -57.504 1.00 61.15  ? 248 ASP A O   1 
ATOM   1537  C  CB  . ASP A 1 226 ? 68.552  16.430  -54.587 1.00 62.30  ? 248 ASP A CB  1 
ATOM   1538  C  CG  . ASP A 1 226 ? 67.910  16.415  -53.197 1.00 85.82  ? 248 ASP A CG  1 
ATOM   1539  O  OD1 . ASP A 1 226 ? 66.686  16.715  -53.096 1.00 89.95  ? 248 ASP A OD1 1 
ATOM   1540  O  OD2 . ASP A 1 226 ? 68.637  16.141  -52.204 1.00 93.48  ? 248 ASP A OD2 1 
ATOM   1541  N  N   . ALA A 1 227 ? 68.907  15.706  -57.820 1.00 58.64  ? 249 ALA A N   1 
ATOM   1542  C  CA  . ALA A 1 227 ? 69.376  16.065  -59.163 1.00 57.44  ? 249 ALA A CA  1 
ATOM   1543  C  C   . ALA A 1 227 ? 68.175  16.096  -60.098 1.00 56.41  ? 249 ALA A C   1 
ATOM   1544  O  O   . ALA A 1 227 ? 68.060  17.038  -60.883 1.00 55.70  ? 249 ALA A O   1 
ATOM   1545  C  CB  . ALA A 1 227 ? 70.438  15.078  -59.654 1.00 56.75  ? 249 ALA A CB  1 
ATOM   1546  N  N   . THR A 1 228 ? 67.241  15.126  -59.940 1.00 50.45  ? 250 THR A N   1 
ATOM   1547  C  CA  . THR A 1 228 ? 65.994  15.051  -60.721 1.00 50.79  ? 250 THR A CA  1 
ATOM   1548  C  C   . THR A 1 228 ? 65.178  16.347  -60.531 1.00 55.27  ? 250 THR A C   1 
ATOM   1549  O  O   . THR A 1 228 ? 64.746  16.971  -61.511 1.00 55.28  ? 250 THR A O   1 
ATOM   1550  C  CB  . THR A 1 228 ? 65.166  13.821  -60.328 1.00 54.20  ? 250 THR A CB  1 
ATOM   1551  O  OG1 . THR A 1 228 ? 65.954  12.625  -60.359 1.00 54.31  ? 250 THR A OG1 1 
ATOM   1552  C  CG2 . THR A 1 228 ? 63.975  13.646  -61.194 1.00 51.61  ? 250 THR A CG2 1 
ATOM   1553  N  N   . ALA A 1 229 ? 65.022  16.768  -59.259 1.00 52.45  ? 251 ALA A N   1 
ATOM   1554  C  CA  . ALA A 1 229 ? 64.298  17.983  -58.879 1.00 53.57  ? 251 ALA A CA  1 
ATOM   1555  C  C   . ALA A 1 229 ? 64.820  19.205  -59.633 1.00 59.15  ? 251 ALA A C   1 
ATOM   1556  O  O   . ALA A 1 229 ? 64.027  19.936  -60.225 1.00 60.17  ? 251 ALA A O   1 
ATOM   1557  C  CB  . ALA A 1 229 ? 64.367  18.194  -57.375 1.00 53.57  ? 251 ALA A CB  1 
ATOM   1558  N  N   . VAL A 1 230 ? 66.162  19.373  -59.666 1.00 56.07  ? 252 VAL A N   1 
ATOM   1559  C  CA  . VAL A 1 230 ? 66.872  20.475  -60.355 1.00 55.17  ? 252 VAL A CA  1 
ATOM   1560  C  C   . VAL A 1 230 ? 66.614  20.385  -61.852 1.00 58.91  ? 252 VAL A C   1 
ATOM   1561  O  O   . VAL A 1 230 ? 66.212  21.377  -62.462 1.00 60.30  ? 252 VAL A O   1 
ATOM   1562  C  CB  . VAL A 1 230 ? 68.403  20.486  -60.061 1.00 54.26  ? 252 VAL A CB  1 
ATOM   1563  C  CG1 . VAL A 1 230 ? 69.105  21.606  -60.847 1.00 53.59  ? 252 VAL A CG1 1 
ATOM   1564  C  CG2 . VAL A 1 230 ? 68.681  20.573  -58.553 1.00 52.26  ? 252 VAL A CG2 1 
ATOM   1565  N  N   . TYR A 1 231 ? 66.837  19.182  -62.422 1.00 53.03  ? 253 TYR A N   1 
ATOM   1566  C  CA  . TYR A 1 231 ? 66.670  18.891  -63.841 1.00 53.10  ? 253 TYR A CA  1 
ATOM   1567  C  C   . TYR A 1 231 ? 65.323  19.301  -64.405 1.00 60.91  ? 253 TYR A C   1 
ATOM   1568  O  O   . TYR A 1 231 ? 65.301  19.984  -65.435 1.00 62.48  ? 253 TYR A O   1 
ATOM   1569  C  CB  . TYR A 1 231 ? 66.967  17.415  -64.148 1.00 51.27  ? 253 TYR A CB  1 
ATOM   1570  C  CG  . TYR A 1 231 ? 68.432  17.068  -64.032 1.00 49.09  ? 253 TYR A CG  1 
ATOM   1571  C  CD1 . TYR A 1 231 ? 69.421  18.052  -64.154 1.00 50.23  ? 253 TYR A CD1 1 
ATOM   1572  C  CD2 . TYR A 1 231 ? 68.837  15.762  -63.799 1.00 47.97  ? 253 TYR A CD2 1 
ATOM   1573  C  CE1 . TYR A 1 231 ? 70.768  17.739  -64.019 1.00 49.03  ? 253 TYR A CE1 1 
ATOM   1574  C  CE2 . TYR A 1 231 ? 70.183  15.436  -63.666 1.00 47.05  ? 253 TYR A CE2 1 
ATOM   1575  C  CZ  . TYR A 1 231 ? 71.143  16.426  -63.772 1.00 53.85  ? 253 TYR A CZ  1 
ATOM   1576  O  OH  . TYR A 1 231 ? 72.457  16.079  -63.628 1.00 54.53  ? 253 TYR A OH  1 
ATOM   1577  N  N   . LYS A 1 232 ? 64.218  18.924  -63.707 1.00 57.61  ? 254 LYS A N   1 
ATOM   1578  C  CA  . LYS A 1 232 ? 62.840  19.238  -64.080 1.00 58.77  ? 254 LYS A CA  1 
ATOM   1579  C  C   . LYS A 1 232 ? 62.605  20.752  -64.072 1.00 66.10  ? 254 LYS A C   1 
ATOM   1580  O  O   . LYS A 1 232 ? 62.148  21.307  -65.083 1.00 68.70  ? 254 LYS A O   1 
ATOM   1581  C  CB  . LYS A 1 232 ? 61.863  18.524  -63.141 1.00 60.74  ? 254 LYS A CB  1 
ATOM   1582  C  CG  . LYS A 1 232 ? 61.845  17.001  -63.268 1.00 62.01  ? 254 LYS A CG  1 
ATOM   1583  C  CD  . LYS A 1 232 ? 61.020  16.415  -62.153 1.00 62.35  ? 254 LYS A CD  1 
ATOM   1584  C  CE  . LYS A 1 232 ? 60.674  14.980  -62.377 1.00 70.89  ? 254 LYS A CE  1 
ATOM   1585  N  NZ  . LYS A 1 232 ? 60.440  14.278  -61.089 1.00 89.81  ? 254 LYS A NZ  1 
ATOM   1586  N  N   . SER A 1 233 ? 62.948  21.427  -62.967 1.00 62.76  ? 255 SER A N   1 
ATOM   1587  C  CA  . SER A 1 233 ? 62.773  22.875  -62.841 1.00 65.34  ? 255 SER A CA  1 
ATOM   1588  C  C   . SER A 1 233 ? 63.653  23.649  -63.843 1.00 70.11  ? 255 SER A C   1 
ATOM   1589  O  O   . SER A 1 233 ? 63.214  24.657  -64.378 1.00 71.38  ? 255 SER A O   1 
ATOM   1590  C  CB  . SER A 1 233 ? 63.021  23.364  -61.406 1.00 71.27  ? 255 SER A CB  1 
ATOM   1591  O  OG  . SER A 1 233 ? 62.770  22.437  -60.355 1.00 83.87  ? 255 SER A OG  1 
ATOM   1592  N  N   . ALA A 1 234 ? 64.870  23.185  -64.116 1.00 66.53  ? 256 ALA A N   1 
ATOM   1593  C  CA  . ALA A 1 234 ? 65.732  23.901  -65.056 1.00 68.04  ? 256 ALA A CA  1 
ATOM   1594  C  C   . ALA A 1 234 ? 65.162  23.848  -66.470 1.00 74.98  ? 256 ALA A C   1 
ATOM   1595  O  O   . ALA A 1 234 ? 65.301  24.807  -67.224 1.00 76.52  ? 256 ALA A O   1 
ATOM   1596  C  CB  . ALA A 1 234 ? 67.132  23.327  -65.032 1.00 66.92  ? 256 ALA A CB  1 
ATOM   1597  N  N   . ALA A 1 235 ? 64.499  22.734  -66.807 1.00 71.14  ? 257 ALA A N   1 
ATOM   1598  C  CA  . ALA A 1 235 ? 63.861  22.512  -68.083 1.00 71.95  ? 257 ALA A CA  1 
ATOM   1599  C  C   . ALA A 1 235 ? 62.652  23.430  -68.184 1.00 83.16  ? 257 ALA A C   1 
ATOM   1600  O  O   . ALA A 1 235 ? 62.457  24.079  -69.220 1.00 85.02  ? 257 ALA A O   1 
ATOM   1601  C  CB  . ALA A 1 235 ? 63.441  21.062  -68.192 1.00 71.19  ? 257 ALA A CB  1 
ATOM   1602  N  N   . MET A 1 236 ? 61.870  23.533  -67.086 1.00 82.36  ? 258 MET A N   1 
ATOM   1603  C  CA  . MET A 1 236 ? 60.698  24.412  -67.045 1.00 85.25  ? 258 MET A CA  1 
ATOM   1604  C  C   . MET A 1 236 ? 61.067  25.883  -67.184 1.00 86.66  ? 258 MET A C   1 
ATOM   1605  O  O   . MET A 1 236 ? 60.282  26.654  -67.714 1.00 88.69  ? 258 MET A O   1 
ATOM   1606  C  CB  . MET A 1 236 ? 59.855  24.166  -65.789 1.00 89.27  ? 258 MET A CB  1 
ATOM   1607  C  CG  . MET A 1 236 ? 59.049  22.860  -65.846 1.00 94.69  ? 258 MET A CG  1 
ATOM   1608  S  SD  . MET A 1 236 ? 58.236  22.433  -67.449 1.00 102.41 ? 258 MET A SD  1 
ATOM   1609  C  CE  . MET A 1 236 ? 56.867  23.754  -67.530 1.00 102.11 ? 258 MET A CE  1 
ATOM   1610  N  N   . LEU A 1 237 ? 62.273  26.260  -66.747 1.00 80.47  ? 259 LEU A N   1 
ATOM   1611  C  CA  . LEU A 1 237 ? 62.806  27.619  -66.848 1.00 80.71  ? 259 LEU A CA  1 
ATOM   1612  C  C   . LEU A 1 237 ? 63.631  27.812  -68.137 1.00 83.17  ? 259 LEU A C   1 
ATOM   1613  O  O   . LEU A 1 237 ? 64.305  28.833  -68.284 1.00 83.06  ? 259 LEU A O   1 
ATOM   1614  C  CB  . LEU A 1 237 ? 63.655  27.969  -65.615 1.00 79.83  ? 259 LEU A CB  1 
ATOM   1615  C  CG  . LEU A 1 237 ? 62.926  28.102  -64.285 1.00 85.83  ? 259 LEU A CG  1 
ATOM   1616  C  CD1 . LEU A 1 237 ? 63.896  28.001  -63.143 1.00 84.62  ? 259 LEU A CD1 1 
ATOM   1617  C  CD2 . LEU A 1 237 ? 62.197  29.425  -64.173 1.00 90.74  ? 259 LEU A CD2 1 
ATOM   1618  N  N   . ASP A 1 238 ? 63.565  26.840  -69.072 1.00 78.73  ? 260 ASP A N   1 
ATOM   1619  C  CA  . ASP A 1 238 ? 64.262  26.858  -70.363 1.00 79.46  ? 260 ASP A CA  1 
ATOM   1620  C  C   . ASP A 1 238 ? 65.784  27.135  -70.223 1.00 81.89  ? 260 ASP A C   1 
ATOM   1621  O  O   . ASP A 1 238 ? 66.366  27.890  -70.999 1.00 83.26  ? 260 ASP A O   1 
ATOM   1622  C  CB  . ASP A 1 238 ? 63.560  27.840  -71.334 1.00 85.17  ? 260 ASP A CB  1 
ATOM   1623  C  CG  . ASP A 1 238 ? 62.067  27.597  -71.598 1.00 106.88 ? 260 ASP A CG  1 
ATOM   1624  O  OD1 . ASP A 1 238 ? 61.485  26.678  -70.968 1.00 107.69 ? 260 ASP A OD1 1 
ATOM   1625  O  OD2 . ASP A 1 238 ? 61.484  28.327  -72.437 1.00 119.69 ? 260 ASP A OD2 1 
ATOM   1626  N  N   . MET A 1 239 ? 66.410  26.513  -69.207 1.00 75.25  ? 261 MET A N   1 
ATOM   1627  C  CA  . MET A 1 239 ? 67.828  26.647  -68.846 1.00 72.74  ? 261 MET A CA  1 
ATOM   1628  C  C   . MET A 1 239 ? 68.663  25.397  -69.212 1.00 75.56  ? 261 MET A C   1 
ATOM   1629  O  O   . MET A 1 239 ? 69.857  25.329  -68.889 1.00 73.70  ? 261 MET A O   1 
ATOM   1630  C  CB  . MET A 1 239 ? 67.940  26.934  -67.347 1.00 73.93  ? 261 MET A CB  1 
ATOM   1631  C  CG  . MET A 1 239 ? 67.628  28.352  -66.990 1.00 79.33  ? 261 MET A CG  1 
ATOM   1632  S  SD  . MET A 1 239 ? 67.474  28.597  -65.210 1.00 83.50  ? 261 MET A SD  1 
ATOM   1633  C  CE  . MET A 1 239 ? 69.186  28.493  -64.714 1.00 78.31  ? 261 MET A CE  1 
ATOM   1634  N  N   . THR A 1 240 ? 68.029  24.416  -69.889 1.00 71.84  ? 262 THR A N   1 
ATOM   1635  C  CA  . THR A 1 240 ? 68.636  23.149  -70.304 1.00 69.39  ? 262 THR A CA  1 
ATOM   1636  C  C   . THR A 1 240 ? 68.971  23.157  -71.809 1.00 74.89  ? 262 THR A C   1 
ATOM   1637  O  O   . THR A 1 240 ? 69.475  22.159  -72.344 1.00 73.32  ? 262 THR A O   1 
ATOM   1638  C  CB  . THR A 1 240 ? 67.710  21.995  -69.936 1.00 73.36  ? 262 THR A CB  1 
ATOM   1639  O  OG1 . THR A 1 240 ? 66.442  22.240  -70.535 1.00 78.68  ? 262 THR A OG1 1 
ATOM   1640  C  CG2 . THR A 1 240 ? 67.568  21.812  -68.431 1.00 70.63  ? 262 THR A CG2 1 
ATOM   1641  N  N   . GLY A 1 241 ? 68.708  24.288  -72.463 1.00 74.56  ? 263 GLY A N   1 
ATOM   1642  C  CA  . GLY A 1 241 ? 68.930  24.457  -73.894 1.00 76.14  ? 263 GLY A CA  1 
ATOM   1643  C  C   . GLY A 1 241 ? 70.226  25.136  -74.274 1.00 79.63  ? 263 GLY A C   1 
ATOM   1644  O  O   . GLY A 1 241 ? 71.130  25.248  -73.441 1.00 78.83  ? 263 GLY A O   1 
ATOM   1645  N  N   . ALA A 1 242 ? 70.326  25.587  -75.555 1.00 75.10  ? 264 ALA A N   1 
ATOM   1646  C  CA  . ALA A 1 242 ? 71.509  26.260  -76.079 1.00 74.23  ? 264 ALA A CA  1 
ATOM   1647  C  C   . ALA A 1 242 ? 71.869  27.480  -75.253 1.00 79.38  ? 264 ALA A C   1 
ATOM   1648  O  O   . ALA A 1 242 ? 70.976  28.188  -74.785 1.00 80.54  ? 264 ALA A O   1 
ATOM   1649  C  CB  . ALA A 1 242 ? 71.305  26.639  -77.520 1.00 76.52  ? 264 ALA A CB  1 
ATOM   1650  N  N   . GLY A 1 243 ? 73.170  27.665  -75.027 1.00 75.54  ? 265 GLY A N   1 
ATOM   1651  C  CA  . GLY A 1 243 ? 73.731  28.759  -74.234 1.00 75.89  ? 265 GLY A CA  1 
ATOM   1652  C  C   . GLY A 1 243 ? 74.342  28.288  -72.924 1.00 77.10  ? 265 GLY A C   1 
ATOM   1653  O  O   . GLY A 1 243 ? 75.426  28.740  -72.537 1.00 77.49  ? 265 GLY A O   1 
ATOM   1654  N  N   . TYR A 1 244 ? 73.648  27.348  -72.253 1.00 69.35  ? 266 TYR A N   1 
ATOM   1655  C  CA  . TYR A 1 244 ? 74.033  26.752  -70.979 1.00 65.27  ? 266 TYR A CA  1 
ATOM   1656  C  C   . TYR A 1 244 ? 74.894  25.499  -71.139 1.00 66.72  ? 266 TYR A C   1 
ATOM   1657  O  O   . TYR A 1 244 ? 74.754  24.757  -72.116 1.00 65.00  ? 266 TYR A O   1 
ATOM   1658  C  CB  . TYR A 1 244 ? 72.780  26.421  -70.149 1.00 64.86  ? 266 TYR A CB  1 
ATOM   1659  C  CG  . TYR A 1 244 ? 71.985  27.643  -69.748 1.00 68.08  ? 266 TYR A CG  1 
ATOM   1660  C  CD1 . TYR A 1 244 ? 72.278  28.335  -68.574 1.00 70.78  ? 266 TYR A CD1 1 
ATOM   1661  C  CD2 . TYR A 1 244 ? 70.933  28.106  -70.533 1.00 69.72  ? 266 TYR A CD2 1 
ATOM   1662  C  CE1 . TYR A 1 244 ? 71.547  29.466  -68.195 1.00 73.24  ? 266 TYR A CE1 1 
ATOM   1663  C  CE2 . TYR A 1 244 ? 70.199  29.236  -70.166 1.00 72.37  ? 266 TYR A CE2 1 
ATOM   1664  C  CZ  . TYR A 1 244 ? 70.516  29.921  -68.999 1.00 82.62  ? 266 TYR A CZ  1 
ATOM   1665  O  OH  . TYR A 1 244 ? 69.808  31.047  -68.625 1.00 89.50  ? 266 TYR A OH  1 
ATOM   1666  N  N   . VAL A 1 245 ? 75.785  25.279  -70.148 1.00 62.51  ? 267 VAL A N   1 
ATOM   1667  C  CA  . VAL A 1 245 ? 76.647  24.104  -69.973 1.00 60.13  ? 267 VAL A CA  1 
ATOM   1668  C  C   . VAL A 1 245 ? 76.310  23.510  -68.604 1.00 62.12  ? 267 VAL A C   1 
ATOM   1669  O  O   . VAL A 1 245 ? 76.265  24.242  -67.619 1.00 60.87  ? 267 VAL A O   1 
ATOM   1670  C  CB  . VAL A 1 245 ? 78.176  24.392  -70.132 1.00 62.92  ? 267 VAL A CB  1 
ATOM   1671  C  CG1 . VAL A 1 245 ? 79.036  23.195  -69.696 1.00 59.72  ? 267 VAL A CG1 1 
ATOM   1672  C  CG2 . VAL A 1 245 ? 78.511  24.793  -71.565 1.00 63.98  ? 267 VAL A CG2 1 
ATOM   1673  N  N   . TRP A 1 246 ? 76.036  22.196  -68.559 1.00 58.56  ? 268 TRP A N   1 
ATOM   1674  C  CA  . TRP A 1 246 ? 75.751  21.465  -67.322 1.00 56.78  ? 268 TRP A CA  1 
ATOM   1675  C  C   . TRP A 1 246 ? 76.890  20.498  -67.035 1.00 60.21  ? 268 TRP A C   1 
ATOM   1676  O  O   . TRP A 1 246 ? 77.168  19.599  -67.824 1.00 61.63  ? 268 TRP A O   1 
ATOM   1677  C  CB  . TRP A 1 246 ? 74.388  20.772  -67.384 1.00 54.81  ? 268 TRP A CB  1 
ATOM   1678  C  CG  . TRP A 1 246 ? 73.247  21.729  -67.245 1.00 57.32  ? 268 TRP A CG  1 
ATOM   1679  C  CD1 . TRP A 1 246 ? 72.730  22.552  -68.209 1.00 61.63  ? 268 TRP A CD1 1 
ATOM   1680  C  CD2 . TRP A 1 246 ? 72.503  21.988  -66.050 1.00 57.46  ? 268 TRP A CD2 1 
ATOM   1681  N  NE1 . TRP A 1 246 ? 71.687  23.287  -67.694 1.00 61.83  ? 268 TRP A NE1 1 
ATOM   1682  C  CE2 . TRP A 1 246 ? 71.533  22.970  -66.367 1.00 62.82  ? 268 TRP A CE2 1 
ATOM   1683  C  CE3 . TRP A 1 246 ? 72.542  21.460  -64.740 1.00 57.49  ? 268 TRP A CE3 1 
ATOM   1684  C  CZ2 . TRP A 1 246 ? 70.626  23.450  -65.417 1.00 63.22  ? 268 TRP A CZ2 1 
ATOM   1685  C  CZ3 . TRP A 1 246 ? 71.640  21.930  -63.803 1.00 59.83  ? 268 TRP A CZ3 1 
ATOM   1686  C  CH2 . TRP A 1 246 ? 70.699  22.916  -64.139 1.00 62.52  ? 268 TRP A CH2 1 
ATOM   1687  N  N   . LEU A 1 247 ? 77.621  20.761  -65.968 1.00 54.12  ? 269 LEU A N   1 
ATOM   1688  C  CA  . LEU A 1 247 ? 78.753  19.953  -65.546 1.00 52.34  ? 269 LEU A CA  1 
ATOM   1689  C  C   . LEU A 1 247 ? 78.351  19.325  -64.220 1.00 53.08  ? 269 LEU A C   1 
ATOM   1690  O  O   . LEU A 1 247 ? 77.800  19.991  -63.347 1.00 53.02  ? 269 LEU A O   1 
ATOM   1691  C  CB  . LEU A 1 247 ? 80.016  20.820  -65.472 1.00 53.47  ? 269 LEU A CB  1 
ATOM   1692  C  CG  . LEU A 1 247 ? 81.334  20.146  -65.173 1.00 58.58  ? 269 LEU A CG  1 
ATOM   1693  C  CD1 . LEU A 1 247 ? 81.652  19.019  -66.162 1.00 58.64  ? 269 LEU A CD1 1 
ATOM   1694  C  CD2 . LEU A 1 247 ? 82.435  21.162  -65.140 1.00 62.36  ? 269 LEU A CD2 1 
ATOM   1695  N  N   . VAL A 1 248 ? 78.538  18.016  -64.109 1.00 46.88  ? 270 VAL A N   1 
ATOM   1696  C  CA  . VAL A 1 248 ? 77.985  17.247  -63.008 1.00 43.64  ? 270 VAL A CA  1 
ATOM   1697  C  C   . VAL A 1 248 ? 78.841  16.002  -62.627 1.00 44.91  ? 270 VAL A C   1 
ATOM   1698  O  O   . VAL A 1 248 ? 79.803  15.680  -63.321 1.00 45.71  ? 270 VAL A O   1 
ATOM   1699  C  CB  . VAL A 1 248 ? 76.549  16.935  -63.544 1.00 45.92  ? 270 VAL A CB  1 
ATOM   1700  C  CG1 . VAL A 1 248 ? 76.284  15.467  -63.845 1.00 44.27  ? 270 VAL A CG1 1 
ATOM   1701  C  CG2 . VAL A 1 248 ? 75.484  17.563  -62.692 1.00 46.09  ? 270 VAL A CG2 1 
ATOM   1702  N  N   . GLY A 1 249 ? 78.481  15.326  -61.539 1.00 38.89  ? 271 GLY A N   1 
ATOM   1703  C  CA  . GLY A 1 249 ? 79.183  14.131  -61.086 1.00 37.78  ? 271 GLY A CA  1 
ATOM   1704  C  C   . GLY A 1 249 ? 78.575  12.802  -61.519 1.00 43.05  ? 271 GLY A C   1 
ATOM   1705  O  O   . GLY A 1 249 ? 77.897  12.716  -62.557 1.00 43.92  ? 271 GLY A O   1 
ATOM   1706  N  N   . GLU A 1 250 ? 78.823  11.739  -60.720 1.00 36.45  ? 272 GLU A N   1 
ATOM   1707  C  CA  . GLU A 1 250 ? 78.316  10.407  -61.031 1.00 33.41  ? 272 GLU A CA  1 
ATOM   1708  C  C   . GLU A 1 250 ? 76.886  10.297  -60.546 1.00 42.03  ? 272 GLU A C   1 
ATOM   1709  O  O   . GLU A 1 250 ? 76.017  9.991   -61.349 1.00 46.23  ? 272 GLU A O   1 
ATOM   1710  C  CB  . GLU A 1 250 ? 79.208  9.325   -60.427 1.00 32.32  ? 272 GLU A CB  1 
ATOM   1711  C  CG  . GLU A 1 250 ? 79.110  7.964   -61.077 1.00 34.37  ? 272 GLU A CG  1 
ATOM   1712  C  CD  . GLU A 1 250 ? 80.289  7.064   -60.788 1.00 60.28  ? 272 GLU A CD  1 
ATOM   1713  O  OE1 . GLU A 1 250 ? 81.349  7.609   -60.400 1.00 46.53  ? 272 GLU A OE1 1 
ATOM   1714  O  OE2 . GLU A 1 250 ? 80.172  5.828   -60.986 1.00 56.66  ? 272 GLU A OE2 1 
ATOM   1715  N  N   . ARG A 1 251 ? 76.608  10.594  -59.269 1.00 37.79  ? 273 ARG A N   1 
ATOM   1716  C  CA  . ARG A 1 251 ? 75.249  10.501  -58.739 1.00 38.16  ? 273 ARG A CA  1 
ATOM   1717  C  C   . ARG A 1 251 ? 74.179  11.184  -59.599 1.00 43.26  ? 273 ARG A C   1 
ATOM   1718  O  O   . ARG A 1 251 ? 73.100  10.634  -59.774 1.00 43.91  ? 273 ARG A O   1 
ATOM   1719  C  CB  . ARG A 1 251 ? 75.219  11.084  -57.329 1.00 41.26  ? 273 ARG A CB  1 
ATOM   1720  C  CG  . ARG A 1 251 ? 75.458  10.076  -56.229 1.00 48.40  ? 273 ARG A CG  1 
ATOM   1721  C  CD  . ARG A 1 251 ? 76.281  10.616  -55.098 1.00 52.09  ? 273 ARG A CD  1 
ATOM   1722  N  NE  . ARG A 1 251 ? 75.919  11.931  -54.558 1.00 50.61  ? 273 ARG A NE  1 
ATOM   1723  C  CZ  . ARG A 1 251 ? 75.186  12.152  -53.479 1.00 55.61  ? 273 ARG A CZ  1 
ATOM   1724  N  NH1 . ARG A 1 251 ? 74.685  11.134  -52.786 1.00 38.14  ? 273 ARG A NH1 1 
ATOM   1725  N  NH2 . ARG A 1 251 ? 74.964  13.390  -53.065 1.00 40.40  ? 273 ARG A NH2 1 
ATOM   1726  N  N   . GLU A 1 252 ? 74.498  12.362  -60.158 1.00 41.05  ? 274 GLU A N   1 
ATOM   1727  C  CA  . GLU A 1 252 ? 73.590  13.214  -60.941 1.00 43.18  ? 274 GLU A CA  1 
ATOM   1728  C  C   . GLU A 1 252 ? 73.282  12.681  -62.358 1.00 48.43  ? 274 GLU A C   1 
ATOM   1729  O  O   . GLU A 1 252 ? 72.453  13.278  -63.068 1.00 49.79  ? 274 GLU A O   1 
ATOM   1730  C  CB  . GLU A 1 252 ? 74.100  14.665  -60.993 1.00 44.86  ? 274 GLU A CB  1 
ATOM   1731  C  CG  . GLU A 1 252 ? 74.416  15.277  -59.637 1.00 52.37  ? 274 GLU A CG  1 
ATOM   1732  C  CD  . GLU A 1 252 ? 75.769  14.986  -59.022 1.00 60.83  ? 274 GLU A CD  1 
ATOM   1733  O  OE1 . GLU A 1 252 ? 76.080  15.608  -57.989 1.00 73.62  ? 274 GLU A OE1 1 
ATOM   1734  O  OE2 . GLU A 1 252 ? 76.517  14.138  -59.552 1.00 61.21  ? 274 GLU A OE2 1 
ATOM   1735  N  N   . ILE A 1 253 ? 73.955  11.585  -62.772 1.00 42.47  ? 275 ILE A N   1 
ATOM   1736  C  CA  . ILE A 1 253 ? 73.724  10.919  -64.050 1.00 41.89  ? 275 ILE A CA  1 
ATOM   1737  C  C   . ILE A 1 253 ? 73.459  9.436   -63.823 1.00 50.31  ? 275 ILE A C   1 
ATOM   1738  O  O   . ILE A 1 253 ? 73.697  8.629   -64.717 1.00 51.50  ? 275 ILE A O   1 
ATOM   1739  C  CB  . ILE A 1 253 ? 74.787  11.193  -65.137 1.00 43.15  ? 275 ILE A CB  1 
ATOM   1740  C  CG1 . ILE A 1 253 ? 76.197  10.914  -64.637 1.00 40.73  ? 275 ILE A CG1 1 
ATOM   1741  C  CG2 . ILE A 1 253 ? 74.627  12.609  -65.708 1.00 45.96  ? 275 ILE A CG2 1 
ATOM   1742  C  CD1 . ILE A 1 253 ? 77.180  10.461  -65.683 1.00 35.04  ? 275 ILE A CD1 1 
ATOM   1743  N  N   . SER A 1 254 ? 72.926  9.092   -62.633 1.00 49.02  ? 276 SER A N   1 
ATOM   1744  C  CA  . SER A 1 254 ? 72.631  7.729   -62.192 1.00 50.40  ? 276 SER A CA  1 
ATOM   1745  C  C   . SER A 1 254 ? 71.181  7.592   -61.802 1.00 61.63  ? 276 SER A C   1 
ATOM   1746  O  O   . SER A 1 254 ? 70.623  8.510   -61.206 1.00 64.77  ? 276 SER A O   1 
ATOM   1747  C  CB  . SER A 1 254 ? 73.501  7.383   -60.994 1.00 56.47  ? 276 SER A CB  1 
ATOM   1748  O  OG  . SER A 1 254 ? 74.889  7.542   -61.256 1.00 69.48  ? 276 SER A OG  1 
ATOM   1749  N  N   . GLY A 1 255 ? 70.565  6.469   -62.169 1.00 61.45  ? 277 GLY A N   1 
ATOM   1750  C  CA  . GLY A 1 255 ? 69.166  6.154   -61.872 1.00 62.95  ? 277 GLY A CA  1 
ATOM   1751  C  C   . GLY A 1 255 ? 68.153  7.162   -62.371 1.00 70.43  ? 277 GLY A C   1 
ATOM   1752  O  O   . GLY A 1 255 ? 68.173  7.518   -63.553 1.00 72.02  ? 277 GLY A O   1 
ATOM   1753  N  N   . SER A 1 256 ? 67.262  7.635   -61.468 1.00 68.39  ? 278 SER A N   1 
ATOM   1754  C  CA  . SER A 1 256 ? 66.205  8.610   -61.799 1.00 70.02  ? 278 SER A CA  1 
ATOM   1755  C  C   . SER A 1 256 ? 66.762  9.953   -62.291 1.00 74.61  ? 278 SER A C   1 
ATOM   1756  O  O   . SER A 1 256 ? 66.071  10.663  -63.037 1.00 77.71  ? 278 SER A O   1 
ATOM   1757  C  CB  . SER A 1 256 ? 65.258  8.828   -60.619 1.00 74.40  ? 278 SER A CB  1 
ATOM   1758  O  OG  . SER A 1 256 ? 65.828  9.510   -59.510 1.00 79.08  ? 278 SER A OG  1 
ATOM   1759  N  N   . ALA A 1 257 ? 68.019  10.302  -61.877 1.00 65.85  ? 279 ALA A N   1 
ATOM   1760  C  CA  . ALA A 1 257 ? 68.648  11.552  -62.264 1.00 64.00  ? 279 ALA A CA  1 
ATOM   1761  C  C   . ALA A 1 257 ? 68.897  11.544  -63.762 1.00 68.24  ? 279 ALA A C   1 
ATOM   1762  O  O   . ALA A 1 257 ? 68.758  12.573  -64.425 1.00 68.80  ? 279 ALA A O   1 
ATOM   1763  C  CB  . ALA A 1 257 ? 69.938  11.732  -61.511 1.00 63.27  ? 279 ALA A CB  1 
ATOM   1764  N  N   . LEU A 1 258 ? 69.179  10.355  -64.305 1.00 63.55  ? 280 LEU A N   1 
ATOM   1765  C  CA  . LEU A 1 258 ? 69.420  10.164  -65.721 1.00 62.54  ? 280 LEU A CA  1 
ATOM   1766  C  C   . LEU A 1 258 ? 68.134  10.247  -66.574 1.00 69.28  ? 280 LEU A C   1 
ATOM   1767  O  O   . LEU A 1 258 ? 68.210  10.676  -67.743 1.00 72.06  ? 280 LEU A O   1 
ATOM   1768  C  CB  . LEU A 1 258 ? 70.181  8.854   -65.942 1.00 60.62  ? 280 LEU A CB  1 
ATOM   1769  C  CG  . LEU A 1 258 ? 70.901  8.700   -67.259 1.00 64.33  ? 280 LEU A CG  1 
ATOM   1770  C  CD1 . LEU A 1 258 ? 71.707  9.940   -67.622 1.00 64.60  ? 280 LEU A CD1 1 
ATOM   1771  C  CD2 . LEU A 1 258 ? 71.751  7.481   -67.248 1.00 63.89  ? 280 LEU A CD2 1 
ATOM   1772  N  N   . ARG A 1 259 ? 66.957  9.882   -65.996 1.00 63.60  ? 281 ARG A N   1 
ATOM   1773  C  CA  . ARG A 1 259 ? 65.675  9.927   -66.736 1.00 64.21  ? 281 ARG A CA  1 
ATOM   1774  C  C   . ARG A 1 259 ? 65.190  11.339  -67.030 1.00 66.67  ? 281 ARG A C   1 
ATOM   1775  O  O   . ARG A 1 259 ? 64.492  11.512  -68.023 1.00 68.82  ? 281 ARG A O   1 
ATOM   1776  C  CB  . ARG A 1 259 ? 64.568  9.102   -66.059 1.00 63.69  ? 281 ARG A CB  1 
ATOM   1777  N  N   . TYR A 1 260 ? 65.562  12.341  -66.210 1.00 60.63  ? 282 TYR A N   1 
ATOM   1778  C  CA  . TYR A 1 260 ? 65.108  13.722  -66.426 1.00 61.37  ? 282 TYR A CA  1 
ATOM   1779  C  C   . TYR A 1 260 ? 66.239  14.707  -66.795 1.00 63.95  ? 282 TYR A C   1 
ATOM   1780  O  O   . TYR A 1 260 ? 65.970  15.905  -67.012 1.00 64.66  ? 282 TYR A O   1 
ATOM   1781  C  CB  . TYR A 1 260 ? 64.297  14.219  -65.213 1.00 63.65  ? 282 TYR A CB  1 
ATOM   1782  C  CG  . TYR A 1 260 ? 62.996  13.458  -65.010 1.00 67.20  ? 282 TYR A CG  1 
ATOM   1783  C  CD1 . TYR A 1 260 ? 61.840  13.811  -65.706 1.00 70.66  ? 282 TYR A CD1 1 
ATOM   1784  C  CD2 . TYR A 1 260 ? 62.934  12.352  -64.160 1.00 67.41  ? 282 TYR A CD2 1 
ATOM   1785  C  CE1 . TYR A 1 260 ? 60.653  13.088  -65.556 1.00 72.60  ? 282 TYR A CE1 1 
ATOM   1786  C  CE2 . TYR A 1 260 ? 61.742  11.652  -63.965 1.00 69.57  ? 282 TYR A CE2 1 
ATOM   1787  C  CZ  . TYR A 1 260 ? 60.602  12.022  -64.667 1.00 80.31  ? 282 TYR A CZ  1 
ATOM   1788  O  OH  . TYR A 1 260 ? 59.425  11.335  -64.464 1.00 81.62  ? 282 TYR A OH  1 
ATOM   1789  N  N   . ALA A 1 261 ? 67.492  14.177  -66.913 1.00 56.90  ? 283 ALA A N   1 
ATOM   1790  C  CA  . ALA A 1 261 ? 68.705  14.923  -67.235 1.00 54.69  ? 283 ALA A CA  1 
ATOM   1791  C  C   . ALA A 1 261 ? 68.613  15.555  -68.596 1.00 58.98  ? 283 ALA A C   1 
ATOM   1792  O  O   . ALA A 1 261 ? 68.143  14.890  -69.524 1.00 59.95  ? 283 ALA A O   1 
ATOM   1793  C  CB  . ALA A 1 261 ? 69.911  14.019  -67.179 1.00 53.61  ? 283 ALA A CB  1 
ATOM   1794  N  N   . PRO A 1 262 ? 69.066  16.837  -68.732 1.00 54.19  ? 284 PRO A N   1 
ATOM   1795  C  CA  . PRO A 1 262 ? 69.041  17.497  -70.030 1.00 54.96  ? 284 PRO A CA  1 
ATOM   1796  C  C   . PRO A 1 262 ? 70.018  16.872  -71.031 1.00 61.64  ? 284 PRO A C   1 
ATOM   1797  O  O   . PRO A 1 262 ? 71.167  16.563  -70.683 1.00 59.43  ? 284 PRO A O   1 
ATOM   1798  C  CB  . PRO A 1 262 ? 69.470  18.928  -69.687 1.00 56.81  ? 284 PRO A CB  1 
ATOM   1799  C  CG  . PRO A 1 262 ? 70.267  18.833  -68.495 1.00 59.31  ? 284 PRO A CG  1 
ATOM   1800  C  CD  . PRO A 1 262 ? 69.649  17.730  -67.711 1.00 54.72  ? 284 PRO A CD  1 
ATOM   1801  N  N   . ASP A 1 263 ? 69.580  16.719  -72.289 1.00 61.79  ? 285 ASP A N   1 
ATOM   1802  C  CA  . ASP A 1 263 ? 70.464  16.220  -73.336 1.00 61.95  ? 285 ASP A CA  1 
ATOM   1803  C  C   . ASP A 1 263 ? 71.582  17.265  -73.482 1.00 64.93  ? 285 ASP A C   1 
ATOM   1804  O  O   . ASP A 1 263 ? 71.314  18.476  -73.444 1.00 65.36  ? 285 ASP A O   1 
ATOM   1805  C  CB  . ASP A 1 263 ? 69.678  16.047  -74.648 1.00 66.14  ? 285 ASP A CB  1 
ATOM   1806  C  CG  . ASP A 1 263 ? 69.495  14.619  -75.129 1.00 77.62  ? 285 ASP A CG  1 
ATOM   1807  O  OD1 . ASP A 1 263 ? 68.988  13.778  -74.334 1.00 79.44  ? 285 ASP A OD1 1 
ATOM   1808  O  OD2 . ASP A 1 263 ? 69.785  14.360  -76.315 1.00 78.73  ? 285 ASP A OD2 1 
ATOM   1809  N  N   . GLY A 1 264 ? 72.814  16.782  -73.532 1.00 59.74  ? 286 GLY A N   1 
ATOM   1810  C  CA  . GLY A 1 264 ? 74.003  17.618  -73.630 1.00 58.66  ? 286 GLY A CA  1 
ATOM   1811  C  C   . GLY A 1 264 ? 74.784  17.752  -72.342 1.00 59.21  ? 286 GLY A C   1 
ATOM   1812  O  O   . GLY A 1 264 ? 75.887  18.287  -72.354 1.00 60.98  ? 286 GLY A O   1 
ATOM   1813  N  N   . ILE A 1 265 ? 74.242  17.266  -71.227 1.00 51.05  ? 287 ILE A N   1 
ATOM   1814  C  CA  . ILE A 1 265 ? 74.916  17.282  -69.929 1.00 47.42  ? 287 ILE A CA  1 
ATOM   1815  C  C   . ILE A 1 265 ? 76.300  16.620  -69.985 1.00 49.48  ? 287 ILE A C   1 
ATOM   1816  O  O   . ILE A 1 265 ? 76.544  15.783  -70.844 1.00 47.35  ? 287 ILE A O   1 
ATOM   1817  C  CB  . ILE A 1 265 ? 73.993  16.613  -68.863 1.00 49.21  ? 287 ILE A CB  1 
ATOM   1818  C  CG1 . ILE A 1 265 ? 74.392  16.989  -67.442 1.00 49.10  ? 287 ILE A CG1 1 
ATOM   1819  C  CG2 . ILE A 1 265 ? 73.875  15.094  -69.025 1.00 47.54  ? 287 ILE A CG2 1 
ATOM   1820  C  CD1 . ILE A 1 265 ? 73.277  17.334  -66.607 1.00 54.65  ? 287 ILE A CD1 1 
ATOM   1821  N  N   . ILE A 1 266 ? 77.192  16.993  -69.063 1.00 48.78  ? 288 ILE A N   1 
ATOM   1822  C  CA  . ILE A 1 266 ? 78.512  16.375  -68.906 1.00 48.21  ? 288 ILE A CA  1 
ATOM   1823  C  C   . ILE A 1 266 ? 78.553  15.802  -67.498 1.00 54.45  ? 288 ILE A C   1 
ATOM   1824  O  O   . ILE A 1 266 ? 78.457  16.550  -66.522 1.00 55.70  ? 288 ILE A O   1 
ATOM   1825  C  CB  . ILE A 1 266 ? 79.723  17.314  -69.161 1.00 50.71  ? 288 ILE A CB  1 
ATOM   1826  C  CG1 . ILE A 1 266 ? 79.695  17.998  -70.580 1.00 51.66  ? 288 ILE A CG1 1 
ATOM   1827  C  CG2 . ILE A 1 266 ? 81.030  16.552  -68.893 1.00 49.55  ? 288 ILE A CG2 1 
ATOM   1828  C  CD1 . ILE A 1 266 ? 80.107  17.163  -71.758 1.00 54.57  ? 288 ILE A CD1 1 
ATOM   1829  N  N   . GLY A 1 267 ? 78.686  14.487  -67.408 1.00 50.44  ? 289 GLY A N   1 
ATOM   1830  C  CA  . GLY A 1 267 ? 78.777  13.790  -66.125 1.00 49.23  ? 289 GLY A CA  1 
ATOM   1831  C  C   . GLY A 1 267 ? 80.084  13.045  -65.982 1.00 50.36  ? 289 GLY A C   1 
ATOM   1832  O  O   . GLY A 1 267 ? 80.931  13.121  -66.864 1.00 49.59  ? 289 GLY A O   1 
ATOM   1833  N  N   . LEU A 1 268 ? 80.263  12.327  -64.876 1.00 45.72  ? 290 LEU A N   1 
ATOM   1834  C  CA  . LEU A 1 268 ? 81.489  11.550  -64.618 1.00 43.61  ? 290 LEU A CA  1 
ATOM   1835  C  C   . LEU A 1 268 ? 81.155  10.144  -64.195 1.00 46.10  ? 290 LEU A C   1 
ATOM   1836  O  O   . LEU A 1 268 ? 80.044  9.884   -63.732 1.00 46.36  ? 290 LEU A O   1 
ATOM   1837  C  CB  . LEU A 1 268 ? 82.391  12.228  -63.549 1.00 42.59  ? 290 LEU A CB  1 
ATOM   1838  C  CG  . LEU A 1 268 ? 82.894  13.649  -63.891 1.00 46.38  ? 290 LEU A CG  1 
ATOM   1839  C  CD1 . LEU A 1 268 ? 83.494  14.317  -62.700 1.00 45.79  ? 290 LEU A CD1 1 
ATOM   1840  C  CD2 . LEU A 1 268 ? 83.847  13.662  -65.102 1.00 45.69  ? 290 LEU A CD2 1 
ATOM   1841  N  N   . GLN A 1 269 ? 82.101  9.229   -64.377 1.00 41.04  ? 291 GLN A N   1 
ATOM   1842  C  CA  . GLN A 1 269 ? 81.985  7.842   -63.924 1.00 38.88  ? 291 GLN A CA  1 
ATOM   1843  C  C   . GLN A 1 269 ? 83.323  7.353   -63.448 1.00 42.18  ? 291 GLN A C   1 
ATOM   1844  O  O   . GLN A 1 269 ? 84.252  7.285   -64.225 1.00 43.53  ? 291 GLN A O   1 
ATOM   1845  C  CB  . GLN A 1 269 ? 81.430  6.953   -65.004 1.00 39.55  ? 291 GLN A CB  1 
ATOM   1846  C  CG  . GLN A 1 269 ? 79.968  6.698   -64.782 1.00 51.29  ? 291 GLN A CG  1 
ATOM   1847  C  CD  . GLN A 1 269 ? 79.300  6.184   -66.011 1.00 62.04  ? 291 GLN A CD  1 
ATOM   1848  O  OE1 . GLN A 1 269 ? 79.816  5.325   -66.722 1.00 57.39  ? 291 GLN A OE1 1 
ATOM   1849  N  NE2 . GLN A 1 269 ? 78.113  6.674   -66.261 1.00 56.49  ? 291 GLN A NE2 1 
ATOM   1850  N  N   . LEU A 1 270 ? 83.466  7.120   -62.162 1.00 38.10  ? 292 LEU A N   1 
ATOM   1851  C  CA  . LEU A 1 270 ? 84.731  6.629   -61.611 1.00 37.07  ? 292 LEU A CA  1 
ATOM   1852  C  C   . LEU A 1 270 ? 84.970  5.241   -62.193 1.00 43.32  ? 292 LEU A C   1 
ATOM   1853  O  O   . LEU A 1 270 ? 84.160  4.348   -61.956 1.00 44.41  ? 292 LEU A O   1 
ATOM   1854  C  CB  . LEU A 1 270 ? 84.668  6.555   -60.065 1.00 34.46  ? 292 LEU A CB  1 
ATOM   1855  C  CG  . LEU A 1 270 ? 85.907  6.076   -59.395 1.00 34.60  ? 292 LEU A CG  1 
ATOM   1856  C  CD1 . LEU A 1 270 ? 87.011  7.091   -59.530 1.00 34.35  ? 292 LEU A CD1 1 
ATOM   1857  C  CD2 . LEU A 1 270 ? 85.641  5.755   -57.969 1.00 33.28  ? 292 LEU A CD2 1 
ATOM   1858  N  N   . ILE A 1 271 ? 86.023  5.093   -63.005 1.00 40.28  ? 293 ILE A N   1 
ATOM   1859  C  CA  . ILE A 1 271 ? 86.378  3.834   -63.677 1.00 40.18  ? 293 ILE A CA  1 
ATOM   1860  C  C   . ILE A 1 271 ? 86.680  2.799   -62.601 1.00 46.51  ? 293 ILE A C   1 
ATOM   1861  O  O   . ILE A 1 271 ? 87.436  3.101   -61.664 1.00 48.71  ? 293 ILE A O   1 
ATOM   1862  C  CB  . ILE A 1 271 ? 87.545  4.048   -64.700 1.00 42.57  ? 293 ILE A CB  1 
ATOM   1863  C  CG1 . ILE A 1 271 ? 87.082  4.865   -65.930 1.00 41.95  ? 293 ILE A CG1 1 
ATOM   1864  C  CG2 . ILE A 1 271 ? 88.168  2.737   -65.126 1.00 42.69  ? 293 ILE A CG2 1 
ATOM   1865  C  CD1 . ILE A 1 271 ? 88.084  5.649   -66.500 1.00 41.76  ? 293 ILE A CD1 1 
ATOM   1866  N  N   . ASN A 1 272 ? 86.007  1.631   -62.679 1.00 41.75  ? 294 ASN A N   1 
ATOM   1867  C  CA  . ASN A 1 272 ? 86.100  0.490   -61.731 1.00 41.58  ? 294 ASN A CA  1 
ATOM   1868  C  C   . ASN A 1 272 ? 85.552  0.754   -60.323 1.00 45.57  ? 294 ASN A C   1 
ATOM   1869  O  O   . ASN A 1 272 ? 85.669  -0.134  -59.448 1.00 47.21  ? 294 ASN A O   1 
ATOM   1870  C  CB  . ASN A 1 272 ? 87.534  -0.056  -61.612 1.00 38.47  ? 294 ASN A CB  1 
ATOM   1871  C  CG  . ASN A 1 272 ? 87.950  -0.927  -62.729 1.00 55.86  ? 294 ASN A CG  1 
ATOM   1872  O  OD1 . ASN A 1 272 ? 87.197  -1.838  -63.156 1.00 42.44  ? 294 ASN A OD1 1 
ATOM   1873  N  ND2 . ASN A 1 272 ? 89.173  -0.652  -63.207 1.00 55.36  ? 294 ASN A ND2 1 
ATOM   1874  N  N   . GLY A 1 273 ? 84.969  1.941   -60.120 1.00 37.87  ? 295 GLY A N   1 
ATOM   1875  C  CA  . GLY A 1 273 ? 84.457  2.392   -58.833 1.00 36.09  ? 295 GLY A CA  1 
ATOM   1876  C  C   . GLY A 1 273 ? 83.465  1.476   -58.142 1.00 37.79  ? 295 GLY A C   1 
ATOM   1877  O  O   . GLY A 1 273 ? 83.236  1.584   -56.922 1.00 39.00  ? 295 GLY A O   1 
ATOM   1878  N  N   . LYS A 1 274 ? 82.848  0.584   -58.912 1.00 31.74  ? 296 LYS A N   1 
ATOM   1879  C  CA  . LYS A 1 274 ? 81.879  -0.337  -58.336 1.00 31.18  ? 296 LYS A CA  1 
ATOM   1880  C  C   . LYS A 1 274 ? 82.406  -1.786  -58.397 1.00 41.76  ? 296 LYS A C   1 
ATOM   1881  O  O   . LYS A 1 274 ? 81.718  -2.716  -57.936 1.00 45.17  ? 296 LYS A O   1 
ATOM   1882  C  CB  . LYS A 1 274 ? 80.513  -0.176  -59.015 1.00 30.86  ? 296 LYS A CB  1 
ATOM   1883  C  CG  . LYS A 1 274 ? 79.975  1.255   -59.083 1.00 20.55  ? 296 LYS A CG  1 
ATOM   1884  C  CD  . LYS A 1 274 ? 78.486  1.325   -58.847 1.00 32.07  ? 296 LYS A CD  1 
ATOM   1885  C  CE  . LYS A 1 274 ? 77.803  2.531   -59.446 1.00 32.47  ? 296 LYS A CE  1 
ATOM   1886  N  NZ  . LYS A 1 274 ? 77.424  2.264   -60.848 1.00 57.60  ? 296 LYS A NZ  1 
ATOM   1887  N  N   . ASN A 1 275 ? 83.667  -1.964  -58.904 1.00 37.75  ? 297 ASN A N   1 
ATOM   1888  C  CA  . ASN A 1 275 ? 84.295  -3.270  -59.057 1.00 36.90  ? 297 ASN A CA  1 
ATOM   1889  C  C   . ASN A 1 275 ? 84.951  -3.693  -57.789 1.00 40.80  ? 297 ASN A C   1 
ATOM   1890  O  O   . ASN A 1 275 ? 86.143  -3.494  -57.634 1.00 42.72  ? 297 ASN A O   1 
ATOM   1891  C  CB  . ASN A 1 275 ? 85.250  -3.322  -60.259 1.00 35.20  ? 297 ASN A CB  1 
ATOM   1892  C  CG  . ASN A 1 275 ? 85.648  -4.730  -60.622 1.00 60.79  ? 297 ASN A CG  1 
ATOM   1893  O  OD1 . ASN A 1 275 ? 85.509  -5.659  -59.808 1.00 61.70  ? 297 ASN A OD1 1 
ATOM   1894  N  ND2 . ASN A 1 275 ? 86.162  -4.941  -61.839 1.00 53.75  ? 297 ASN A ND2 1 
ATOM   1895  N  N   . GLU A 1 276 ? 84.185  -4.300  -56.890 1.00 36.73  ? 298 GLU A N   1 
ATOM   1896  C  CA  . GLU A 1 276 ? 84.662  -4.763  -55.592 1.00 37.85  ? 298 GLU A CA  1 
ATOM   1897  C  C   . GLU A 1 276 ? 85.850  -5.726  -55.773 1.00 46.87  ? 298 GLU A C   1 
ATOM   1898  O  O   . GLU A 1 276 ? 86.801  -5.675  -54.981 1.00 47.48  ? 298 GLU A O   1 
ATOM   1899  C  CB  . GLU A 1 276 ? 83.521  -5.458  -54.836 1.00 39.51  ? 298 GLU A CB  1 
ATOM   1900  C  CG  . GLU A 1 276 ? 83.816  -5.834  -53.393 1.00 42.50  ? 298 GLU A CG  1 
ATOM   1901  C  CD  . GLU A 1 276 ? 82.619  -6.382  -52.637 1.00 62.06  ? 298 GLU A CD  1 
ATOM   1902  O  OE1 . GLU A 1 276 ? 81.472  -6.035  -53.005 1.00 62.31  ? 298 GLU A OE1 1 
ATOM   1903  O  OE2 . GLU A 1 276 ? 82.830  -7.095  -51.628 1.00 46.74  ? 298 GLU A OE2 1 
ATOM   1904  N  N   . SER A 1 277 ? 85.807  -6.576  -56.836 1.00 44.30  ? 299 SER A N   1 
ATOM   1905  C  CA  . SER A 1 277 ? 86.873  -7.523  -57.146 1.00 44.65  ? 299 SER A CA  1 
ATOM   1906  C  C   . SER A 1 277 ? 88.185  -6.791  -57.447 1.00 46.72  ? 299 SER A C   1 
ATOM   1907  O  O   . SER A 1 277 ? 89.205  -7.172  -56.887 1.00 47.81  ? 299 SER A O   1 
ATOM   1908  C  CB  . SER A 1 277 ? 86.476  -8.430  -58.301 1.00 50.92  ? 299 SER A CB  1 
ATOM   1909  O  OG  . SER A 1 277 ? 87.574  -9.218  -58.731 1.00 67.67  ? 299 SER A OG  1 
ATOM   1910  N  N   . ALA A 1 278 ? 88.164  -5.736  -58.289 1.00 40.43  ? 300 ALA A N   1 
ATOM   1911  C  CA  . ALA A 1 278 ? 89.360  -4.949  -58.608 1.00 39.45  ? 300 ALA A CA  1 
ATOM   1912  C  C   . ALA A 1 278 ? 89.917  -4.259  -57.357 1.00 46.45  ? 300 ALA A C   1 
ATOM   1913  O  O   . ALA A 1 278 ? 91.135  -4.246  -57.149 1.00 49.47  ? 300 ALA A O   1 
ATOM   1914  C  CB  . ALA A 1 278 ? 89.048  -3.920  -59.672 1.00 39.18  ? 300 ALA A CB  1 
ATOM   1915  N  N   . HIS A 1 279 ? 89.028  -3.733  -56.501 1.00 40.16  ? 301 HIS A N   1 
ATOM   1916  C  CA  . HIS A 1 279 ? 89.435  -3.050  -55.293 1.00 38.81  ? 301 HIS A CA  1 
ATOM   1917  C  C   . HIS A 1 279 ? 89.920  -3.996  -54.205 1.00 43.89  ? 301 HIS A C   1 
ATOM   1918  O  O   . HIS A 1 279 ? 90.762  -3.589  -53.394 1.00 44.92  ? 301 HIS A O   1 
ATOM   1919  C  CB  . HIS A 1 279 ? 88.344  -2.122  -54.822 1.00 38.93  ? 301 HIS A CB  1 
ATOM   1920  C  CG  . HIS A 1 279 ? 88.283  -0.904  -55.676 1.00 42.45  ? 301 HIS A CG  1 
ATOM   1921  N  ND1 . HIS A 1 279 ? 89.113  0.176   -55.439 1.00 43.95  ? 301 HIS A ND1 1 
ATOM   1922  C  CD2 . HIS A 1 279 ? 87.569  -0.675  -56.808 1.00 45.05  ? 301 HIS A CD2 1 
ATOM   1923  C  CE1 . HIS A 1 279 ? 88.862  1.037   -56.408 1.00 44.43  ? 301 HIS A CE1 1 
ATOM   1924  N  NE2 . HIS A 1 279 ? 87.930  0.572   -57.256 1.00 45.05  ? 301 HIS A NE2 1 
ATOM   1925  N  N   . ILE A 1 280 ? 89.452  -5.270  -54.210 1.00 39.26  ? 302 ILE A N   1 
ATOM   1926  C  CA  . ILE A 1 280 ? 89.951  -6.279  -53.272 1.00 38.70  ? 302 ILE A CA  1 
ATOM   1927  C  C   . ILE A 1 280 ? 91.418  -6.530  -53.628 1.00 46.91  ? 302 ILE A C   1 
ATOM   1928  O  O   . ILE A 1 280 ? 92.263  -6.492  -52.744 1.00 49.46  ? 302 ILE A O   1 
ATOM   1929  C  CB  . ILE A 1 280 ? 89.126  -7.586  -53.293 1.00 40.72  ? 302 ILE A CB  1 
ATOM   1930  C  CG1 . ILE A 1 280 ? 87.763  -7.403  -52.557 1.00 40.96  ? 302 ILE A CG1 1 
ATOM   1931  C  CG2 . ILE A 1 280 ? 89.940  -8.758  -52.706 1.00 38.70  ? 302 ILE A CG2 1 
ATOM   1932  C  CD1 . ILE A 1 280 ? 86.704  -8.498  -52.851 1.00 44.85  ? 302 ILE A CD1 1 
ATOM   1933  N  N   . SER A 1 281 ? 91.724  -6.710  -54.933 1.00 43.69  ? 303 SER A N   1 
ATOM   1934  C  CA  . SER A 1 281 ? 93.076  -6.944  -55.440 1.00 44.29  ? 303 SER A CA  1 
ATOM   1935  C  C   . SER A 1 281 ? 94.030  -5.872  -54.975 1.00 47.68  ? 303 SER A C   1 
ATOM   1936  O  O   . SER A 1 281 ? 94.990  -6.153  -54.236 1.00 46.62  ? 303 SER A O   1 
ATOM   1937  C  CB  . SER A 1 281 ? 93.086  -7.007  -56.958 1.00 49.25  ? 303 SER A CB  1 
ATOM   1938  O  OG  . SER A 1 281 ? 92.264  -8.078  -57.392 1.00 72.57  ? 303 SER A OG  1 
ATOM   1939  N  N   . ASP A 1 282 ? 93.690  -4.636  -55.320 1.00 43.49  ? 304 ASP A N   1 
ATOM   1940  C  CA  . ASP A 1 282 ? 94.469  -3.453  -55.027 1.00 43.07  ? 304 ASP A CA  1 
ATOM   1941  C  C   . ASP A 1 282 ? 94.651  -3.210  -53.552 1.00 43.19  ? 304 ASP A C   1 
ATOM   1942  O  O   . ASP A 1 282 ? 95.796  -3.073  -53.148 1.00 43.64  ? 304 ASP A O   1 
ATOM   1943  C  CB  . ASP A 1 282 ? 93.888  -2.243  -55.773 1.00 45.64  ? 304 ASP A CB  1 
ATOM   1944  C  CG  . ASP A 1 282 ? 94.185  -2.332  -57.276 1.00 62.23  ? 304 ASP A CG  1 
ATOM   1945  O  OD1 . ASP A 1 282 ? 94.787  -3.365  -57.718 1.00 66.24  ? 304 ASP A OD1 1 
ATOM   1946  O  OD2 . ASP A 1 282 ? 93.873  -1.367  -58.001 1.00 60.04  ? 304 ASP A OD2 1 
ATOM   1947  N  N   . ALA A 1 283 ? 93.580  -3.278  -52.731 1.00 37.73  ? 305 ALA A N   1 
ATOM   1948  C  CA  . ALA A 1 283 ? 93.705  -3.076  -51.281 1.00 36.44  ? 305 ALA A CA  1 
ATOM   1949  C  C   . ALA A 1 283 ? 94.622  -4.085  -50.644 1.00 38.15  ? 305 ALA A C   1 
ATOM   1950  O  O   . ALA A 1 283 ? 95.462  -3.703  -49.864 1.00 39.25  ? 305 ALA A O   1 
ATOM   1951  C  CB  . ALA A 1 283 ? 92.351  -3.120  -50.623 1.00 37.20  ? 305 ALA A CB  1 
ATOM   1952  N  N   . VAL A 1 284 ? 94.505  -5.369  -51.021 1.00 33.19  ? 306 VAL A N   1 
ATOM   1953  C  CA  . VAL A 1 284 ? 95.351  -6.452  -50.536 1.00 31.00  ? 306 VAL A CA  1 
ATOM   1954  C  C   . VAL A 1 284 ? 96.802  -6.180  -50.953 1.00 39.01  ? 306 VAL A C   1 
ATOM   1955  O  O   . VAL A 1 284 ? 97.667  -6.253  -50.101 1.00 42.68  ? 306 VAL A O   1 
ATOM   1956  C  CB  . VAL A 1 284 ? 94.865  -7.861  -50.945 1.00 32.51  ? 306 VAL A CB  1 
ATOM   1957  C  CG1 . VAL A 1 284 ? 95.873  -8.921  -50.516 1.00 33.65  ? 306 VAL A CG1 1 
ATOM   1958  C  CG2 . VAL A 1 284 ? 93.523  -8.175  -50.327 1.00 31.24  ? 306 VAL A CG2 1 
ATOM   1959  N  N   . ALA A 1 285 ? 97.066  -5.810  -52.216 1.00 36.41  ? 307 ALA A N   1 
ATOM   1960  C  CA  . ALA A 1 285 ? 98.433  -5.540  -52.707 1.00 37.82  ? 307 ALA A CA  1 
ATOM   1961  C  C   . ALA A 1 285 ? 99.133  -4.488  -51.833 1.00 46.22  ? 307 ALA A C   1 
ATOM   1962  O  O   . ALA A 1 285 ? 100.274 -4.703  -51.389 1.00 48.25  ? 307 ALA A O   1 
ATOM   1963  C  CB  . ALA A 1 285 ? 98.395  -5.076  -54.155 1.00 37.75  ? 307 ALA A CB  1 
ATOM   1964  N  N   . VAL A 1 286 ? 98.401  -3.386  -51.556 1.00 41.83  ? 308 VAL A N   1 
ATOM   1965  C  CA  . VAL A 1 286 ? 98.792  -2.235  -50.748 1.00 41.72  ? 308 VAL A CA  1 
ATOM   1966  C  C   . VAL A 1 286 ? 99.030  -2.667  -49.283 1.00 47.70  ? 308 VAL A C   1 
ATOM   1967  O  O   . VAL A 1 286 ? 100.097 -2.383  -48.727 1.00 49.57  ? 308 VAL A O   1 
ATOM   1968  C  CB  . VAL A 1 286 ? 97.709  -1.123  -50.898 1.00 44.12  ? 308 VAL A CB  1 
ATOM   1969  C  CG1 . VAL A 1 286 ? 97.837  -0.026  -49.840 1.00 43.71  ? 308 VAL A CG1 1 
ATOM   1970  C  CG2 . VAL A 1 286 ? 97.766  -0.530  -52.295 1.00 43.95  ? 308 VAL A CG2 1 
ATOM   1971  N  N   . VAL A 1 287 ? 98.048  -3.367  -48.675 1.00 40.76  ? 309 VAL A N   1 
ATOM   1972  C  CA  . VAL A 1 287 ? 98.141  -3.829  -47.306 1.00 38.62  ? 309 VAL A CA  1 
ATOM   1973  C  C   . VAL A 1 287 ? 99.315  -4.803  -47.149 1.00 42.85  ? 309 VAL A C   1 
ATOM   1974  O  O   . VAL A 1 287 ? 100.108 -4.653  -46.202 1.00 44.74  ? 309 VAL A O   1 
ATOM   1975  C  CB  . VAL A 1 287 ? 96.802  -4.368  -46.748 1.00 39.59  ? 309 VAL A CB  1 
ATOM   1976  C  CG1 . VAL A 1 287 ? 96.984  -4.855  -45.316 1.00 40.17  ? 309 VAL A CG1 1 
ATOM   1977  C  CG2 . VAL A 1 287 ? 95.728  -3.285  -46.776 1.00 37.45  ? 309 VAL A CG2 1 
ATOM   1978  N  N   . ALA A 1 288 ? 99.477  -5.729  -48.098 1.00 36.78  ? 310 ALA A N   1 
ATOM   1979  C  CA  . ALA A 1 288 ? 100.541 -6.730  -48.044 1.00 38.48  ? 310 ALA A CA  1 
ATOM   1980  C  C   . ALA A 1 288 ? 101.935 -6.093  -48.016 1.00 46.12  ? 310 ALA A C   1 
ATOM   1981  O  O   . ALA A 1 288 ? 102.789 -6.496  -47.215 1.00 46.41  ? 310 ALA A O   1 
ATOM   1982  C  CB  . ALA A 1 288 ? 100.428 -7.665  -49.212 1.00 39.41  ? 310 ALA A CB  1 
ATOM   1983  N  N   . GLN A 1 289 ? 102.133 -5.055  -48.859 1.00 41.41  ? 311 GLN A N   1 
ATOM   1984  C  CA  . GLN A 1 289 ? 103.367 -4.280  -48.984 1.00 40.18  ? 311 GLN A CA  1 
ATOM   1985  C  C   . GLN A 1 289 ? 103.651 -3.590  -47.651 1.00 48.92  ? 311 GLN A C   1 
ATOM   1986  O  O   . GLN A 1 289 ? 104.744 -3.757  -47.091 1.00 51.90  ? 311 GLN A O   1 
ATOM   1987  C  CB  . GLN A 1 289 ? 103.151 -3.208  -50.040 1.00 39.61  ? 311 GLN A CB  1 
ATOM   1988  C  CG  . GLN A 1 289 ? 104.386 -2.808  -50.769 1.00 45.16  ? 311 GLN A CG  1 
ATOM   1989  C  CD  . GLN A 1 289 ? 104.127 -1.644  -51.678 1.00 59.94  ? 311 GLN A CD  1 
ATOM   1990  O  OE1 . GLN A 1 289 ? 104.138 -1.820  -52.898 1.00 55.15  ? 311 GLN A OE1 1 
ATOM   1991  N  NE2 . GLN A 1 289 ? 103.887 -0.438  -51.109 1.00 55.24  ? 311 GLN A NE2 1 
ATOM   1992  N  N   . ALA A 1 290 ? 102.641 -2.834  -47.135 1.00 44.46  ? 312 ALA A N   1 
ATOM   1993  C  CA  . ALA A 1 290 ? 102.666 -2.106  -45.874 1.00 43.48  ? 312 ALA A CA  1 
ATOM   1994  C  C   . ALA A 1 290 ? 102.974 -3.043  -44.703 1.00 48.97  ? 312 ALA A C   1 
ATOM   1995  O  O   . ALA A 1 290 ? 103.802 -2.687  -43.863 1.00 50.24  ? 312 ALA A O   1 
ATOM   1996  C  CB  . ALA A 1 290 ? 101.347 -1.412  -45.654 1.00 42.55  ? 312 ALA A CB  1 
ATOM   1997  N  N   . ILE A 1 291 ? 102.360 -4.247  -44.660 1.00 43.83  ? 313 ILE A N   1 
ATOM   1998  C  CA  . ILE A 1 291 ? 102.648 -5.183  -43.570 1.00 43.83  ? 313 ILE A CA  1 
ATOM   1999  C  C   . ILE A 1 291 ? 104.141 -5.490  -43.533 1.00 48.50  ? 313 ILE A C   1 
ATOM   2000  O  O   . ILE A 1 291 ? 104.770 -5.364  -42.475 1.00 49.61  ? 313 ILE A O   1 
ATOM   2001  C  CB  . ILE A 1 291 ? 101.801 -6.489  -43.652 1.00 46.44  ? 313 ILE A CB  1 
ATOM   2002  C  CG1 . ILE A 1 291 ? 100.265 -6.208  -43.594 1.00 45.92  ? 313 ILE A CG1 1 
ATOM   2003  C  CG2 . ILE A 1 291 ? 102.246 -7.526  -42.598 1.00 44.55  ? 313 ILE A CG2 1 
ATOM   2004  C  CD1 . ILE A 1 291 ? 99.685  -5.964  -42.245 1.00 52.51  ? 313 ILE A CD1 1 
ATOM   2005  N  N   . HIS A 1 292 ? 104.698 -5.886  -44.707 1.00 43.26  ? 314 HIS A N   1 
ATOM   2006  C  CA  . HIS A 1 292 ? 106.096 -6.247  -44.890 1.00 41.87  ? 314 HIS A CA  1 
ATOM   2007  C  C   . HIS A 1 292 ? 107.017 -5.085  -44.599 1.00 45.91  ? 314 HIS A C   1 
ATOM   2008  O  O   . HIS A 1 292 ? 108.047 -5.291  -43.947 1.00 47.71  ? 314 HIS A O   1 
ATOM   2009  C  CB  . HIS A 1 292 ? 106.308 -6.856  -46.278 1.00 41.76  ? 314 HIS A CB  1 
ATOM   2010  C  CG  . HIS A 1 292 ? 105.820 -8.266  -46.354 1.00 45.24  ? 314 HIS A CG  1 
ATOM   2011  N  ND1 . HIS A 1 292 ? 104.718 -8.611  -47.120 1.00 46.36  ? 314 HIS A ND1 1 
ATOM   2012  C  CD2 . HIS A 1 292 ? 106.280 -9.375  -45.723 1.00 48.43  ? 314 HIS A CD2 1 
ATOM   2013  C  CE1 . HIS A 1 292 ? 104.540 -9.914  -46.929 1.00 46.63  ? 314 HIS A CE1 1 
ATOM   2014  N  NE2 . HIS A 1 292 ? 105.467 -10.418 -46.102 1.00 48.16  ? 314 HIS A NE2 1 
ATOM   2015  N  N   . GLU A 1 293 ? 106.611 -3.856  -44.997 1.00 40.92  ? 315 GLU A N   1 
ATOM   2016  C  CA  . GLU A 1 293 ? 107.328 -2.611  -44.686 1.00 41.63  ? 315 GLU A CA  1 
ATOM   2017  C  C   . GLU A 1 293 ? 107.343 -2.392  -43.171 1.00 45.01  ? 315 GLU A C   1 
ATOM   2018  O  O   . GLU A 1 293 ? 108.411 -2.136  -42.625 1.00 43.50  ? 315 GLU A O   1 
ATOM   2019  C  CB  . GLU A 1 293 ? 106.668 -1.416  -45.382 1.00 42.71  ? 315 GLU A CB  1 
ATOM   2020  C  CG  . GLU A 1 293 ? 107.541 -0.173  -45.433 1.00 60.81  ? 315 GLU A CG  1 
ATOM   2021  C  CD  . GLU A 1 293 ? 106.885 1.103   -45.927 1.00 98.67  ? 315 GLU A CD  1 
ATOM   2022  O  OE1 . GLU A 1 293 ? 106.175 1.065   -46.962 1.00 100.91 ? 315 GLU A OE1 1 
ATOM   2023  O  OE2 . GLU A 1 293 ? 107.115 2.156   -45.286 1.00 100.41 ? 315 GLU A OE2 1 
ATOM   2024  N  N   . LEU A 1 294 ? 106.158 -2.559  -42.491 1.00 42.73  ? 316 LEU A N   1 
ATOM   2025  C  CA  . LEU A 1 294 ? 105.976 -2.435  -41.037 1.00 42.73  ? 316 LEU A CA  1 
ATOM   2026  C  C   . LEU A 1 294 ? 106.923 -3.319  -40.276 1.00 49.80  ? 316 LEU A C   1 
ATOM   2027  O  O   . LEU A 1 294 ? 107.575 -2.832  -39.361 1.00 51.21  ? 316 LEU A O   1 
ATOM   2028  C  CB  . LEU A 1 294 ? 104.532 -2.735  -40.614 1.00 41.53  ? 316 LEU A CB  1 
ATOM   2029  C  CG  . LEU A 1 294 ? 104.189 -2.630  -39.101 1.00 46.21  ? 316 LEU A CG  1 
ATOM   2030  C  CD1 . LEU A 1 294 ? 103.991 -1.187  -38.677 1.00 47.12  ? 316 LEU A CD1 1 
ATOM   2031  C  CD2 . LEU A 1 294 ? 102.929 -3.413  -38.768 1.00 43.76  ? 316 LEU A CD2 1 
ATOM   2032  N  N   . PHE A 1 295 ? 107.019 -4.611  -40.650 1.00 48.60  ? 317 PHE A N   1 
ATOM   2033  C  CA  . PHE A 1 295 ? 107.889 -5.571  -39.947 1.00 50.45  ? 317 PHE A CA  1 
ATOM   2034  C  C   . PHE A 1 295 ? 109.378 -5.359  -40.198 1.00 58.08  ? 317 PHE A C   1 
ATOM   2035  O  O   . PHE A 1 295 ? 110.176 -6.096  -39.607 1.00 60.76  ? 317 PHE A O   1 
ATOM   2036  C  CB  . PHE A 1 295 ? 107.487 -7.027  -40.198 1.00 51.54  ? 317 PHE A CB  1 
ATOM   2037  C  CG  . PHE A 1 295 ? 106.307 -7.411  -39.354 1.00 50.60  ? 317 PHE A CG  1 
ATOM   2038  C  CD1 . PHE A 1 295 ? 106.481 -7.837  -38.043 1.00 52.38  ? 317 PHE A CD1 1 
ATOM   2039  C  CD2 . PHE A 1 295 ? 105.012 -7.256  -39.839 1.00 51.61  ? 317 PHE A CD2 1 
ATOM   2040  C  CE1 . PHE A 1 295 ? 105.382 -8.154  -37.240 1.00 53.78  ? 317 PHE A CE1 1 
ATOM   2041  C  CE2 . PHE A 1 295 ? 103.907 -7.549  -39.032 1.00 54.43  ? 317 PHE A CE2 1 
ATOM   2042  C  CZ  . PHE A 1 295 ? 104.096 -8.003  -37.733 1.00 53.26  ? 317 PHE A CZ  1 
ATOM   2043  N  N   . GLU A 1 296 ? 109.762 -4.320  -41.008 1.00 53.72  ? 318 GLU A N   1 
ATOM   2044  C  CA  . GLU A 1 296 ? 111.164 -3.914  -41.181 1.00 54.65  ? 318 GLU A CA  1 
ATOM   2045  C  C   . GLU A 1 296 ? 111.547 -3.129  -39.911 1.00 57.85  ? 318 GLU A C   1 
ATOM   2046  O  O   . GLU A 1 296 ? 112.701 -3.126  -39.537 1.00 59.56  ? 318 GLU A O   1 
ATOM   2047  C  CB  . GLU A 1 296 ? 111.368 -3.016  -42.407 1.00 55.86  ? 318 GLU A CB  1 
ATOM   2048  C  CG  . GLU A 1 296 ? 111.411 -3.684  -43.766 1.00 70.61  ? 318 GLU A CG  1 
ATOM   2049  C  CD  . GLU A 1 296 ? 111.152 -2.696  -44.899 1.00 111.59 ? 318 GLU A CD  1 
ATOM   2050  O  OE1 . GLU A 1 296 ? 111.480 -1.496  -44.734 1.00 110.77 ? 318 GLU A OE1 1 
ATOM   2051  O  OE2 . GLU A 1 296 ? 110.596 -3.113  -45.944 1.00 109.86 ? 318 GLU A OE2 1 
ATOM   2052  N  N   . MET A 1 297 ? 110.566 -2.481  -39.250 1.00 54.35  ? 319 MET A N   1 
ATOM   2053  C  CA  . MET A 1 297 ? 110.734 -1.749  -37.996 1.00 55.75  ? 319 MET A CA  1 
ATOM   2054  C  C   . MET A 1 297 ? 110.779 -2.693  -36.802 1.00 64.04  ? 319 MET A C   1 
ATOM   2055  O  O   . MET A 1 297 ? 110.420 -3.868  -36.905 1.00 64.31  ? 319 MET A O   1 
ATOM   2056  C  CB  . MET A 1 297 ? 109.607 -0.742  -37.791 1.00 56.84  ? 319 MET A CB  1 
ATOM   2057  C  CG  . MET A 1 297 ? 109.897 0.607   -38.345 1.00 61.40  ? 319 MET A CG  1 
ATOM   2058  S  SD  . MET A 1 297 ? 108.455 1.185   -39.230 1.00 65.29  ? 319 MET A SD  1 
ATOM   2059  C  CE  . MET A 1 297 ? 108.874 0.696   -40.874 1.00 62.75  ? 319 MET A CE  1 
ATOM   2060  N  N   . GLU A 1 298 ? 111.218 -2.165  -35.660 1.00 64.26  ? 320 GLU A N   1 
ATOM   2061  C  CA  . GLU A 1 298 ? 111.351 -2.917  -34.420 1.00 66.33  ? 320 GLU A CA  1 
ATOM   2062  C  C   . GLU A 1 298 ? 110.192 -2.653  -33.444 1.00 69.97  ? 320 GLU A C   1 
ATOM   2063  O  O   . GLU A 1 298 ? 109.450 -1.650  -33.557 1.00 68.11  ? 320 GLU A O   1 
ATOM   2064  C  CB  . GLU A 1 298 ? 112.707 -2.613  -33.763 1.00 70.45  ? 320 GLU A CB  1 
ATOM   2065  C  CG  . GLU A 1 298 ? 113.576 -3.841  -33.551 1.00 91.97  ? 320 GLU A CG  1 
ATOM   2066  C  CD  . GLU A 1 298 ? 114.123 -3.989  -32.140 1.00 133.19 ? 320 GLU A CD  1 
ATOM   2067  O  OE1 . GLU A 1 298 ? 115.277 -3.562  -31.903 1.00 134.10 ? 320 GLU A OE1 1 
ATOM   2068  O  OE2 . GLU A 1 298 ? 113.403 -4.538  -31.272 1.00 133.75 ? 320 GLU A OE2 1 
ATOM   2069  N  N   . ASN A 1 299 ? 110.041 -3.597  -32.496 1.00 67.01  ? 321 ASN A N   1 
ATOM   2070  C  CA  . ASN A 1 299 ? 109.049 -3.598  -31.420 1.00 66.09  ? 321 ASN A CA  1 
ATOM   2071  C  C   . ASN A 1 299 ? 107.564 -3.480  -31.938 1.00 64.06  ? 321 ASN A C   1 
ATOM   2072  O  O   . ASN A 1 299 ? 106.749 -2.749  -31.366 1.00 61.64  ? 321 ASN A O   1 
ATOM   2073  C  CB  . ASN A 1 299 ? 109.416 -2.520  -30.372 1.00 70.61  ? 321 ASN A CB  1 
ATOM   2074  C  CG  . ASN A 1 299 ? 110.810 -2.644  -29.794 1.00 103.21 ? 321 ASN A CG  1 
ATOM   2075  O  OD1 . ASN A 1 299 ? 111.264 -3.726  -29.403 1.00 101.81 ? 321 ASN A OD1 1 
ATOM   2076  N  ND2 . ASN A 1 299 ? 111.505 -1.525  -29.685 1.00 99.10  ? 321 ASN A ND2 1 
ATOM   2077  N  N   . ILE A 1 300 ? 107.226 -4.232  -33.012 1.00 57.48  ? 322 ILE A N   1 
ATOM   2078  C  CA  . ILE A 1 300 ? 105.872 -4.264  -33.602 1.00 53.40  ? 322 ILE A CA  1 
ATOM   2079  C  C   . ILE A 1 300 ? 105.013 -5.152  -32.706 1.00 57.80  ? 322 ILE A C   1 
ATOM   2080  O  O   . ILE A 1 300 ? 105.272 -6.339  -32.587 1.00 59.60  ? 322 ILE A O   1 
ATOM   2081  C  CB  . ILE A 1 300 ? 105.873 -4.787  -35.075 1.00 53.98  ? 322 ILE A CB  1 
ATOM   2082  C  CG1 . ILE A 1 300 ? 106.770 -3.943  -36.042 1.00 53.63  ? 322 ILE A CG1 1 
ATOM   2083  C  CG2 . ILE A 1 300 ? 104.470 -4.959  -35.624 1.00 52.04  ? 322 ILE A CG2 1 
ATOM   2084  C  CD1 . ILE A 1 300 ? 106.671 -2.449  -35.980 1.00 62.81  ? 322 ILE A CD1 1 
ATOM   2085  N  N   . THR A 1 301 ? 104.021 -4.578  -32.065 1.00 53.45  ? 323 THR A N   1 
ATOM   2086  C  CA  . THR A 1 301 ? 103.093 -5.288  -31.186 1.00 52.95  ? 323 THR A CA  1 
ATOM   2087  C  C   . THR A 1 301 ? 101.917 -5.852  -31.999 1.00 58.86  ? 323 THR A C   1 
ATOM   2088  O  O   . THR A 1 301 ? 101.572 -5.305  -33.055 1.00 57.35  ? 323 THR A O   1 
ATOM   2089  C  CB  . THR A 1 301 ? 102.612 -4.360  -30.050 1.00 48.18  ? 323 THR A CB  1 
ATOM   2090  O  OG1 . THR A 1 301 ? 101.614 -3.461  -30.545 1.00 52.17  ? 323 THR A OG1 1 
ATOM   2091  C  CG2 . THR A 1 301 ? 103.745 -3.564  -29.422 1.00 37.29  ? 323 THR A CG2 1 
ATOM   2092  N  N   . ASP A 1 302 ? 101.302 -6.938  -31.496 1.00 57.50  ? 324 ASP A N   1 
ATOM   2093  C  CA  . ASP A 1 302 ? 100.139 -7.551  -32.129 1.00 57.14  ? 324 ASP A CA  1 
ATOM   2094  C  C   . ASP A 1 302 ? 98.880  -6.773  -31.751 1.00 61.23  ? 324 ASP A C   1 
ATOM   2095  O  O   . ASP A 1 302 ? 98.844  -6.210  -30.649 1.00 63.23  ? 324 ASP A O   1 
ATOM   2096  C  CB  . ASP A 1 302 ? 99.962  -9.006  -31.674 1.00 59.89  ? 324 ASP A CB  1 
ATOM   2097  C  CG  . ASP A 1 302 ? 101.029 -9.958  -32.136 1.00 79.08  ? 324 ASP A CG  1 
ATOM   2098  O  OD1 . ASP A 1 302 ? 101.378 -9.923  -33.341 1.00 81.29  ? 324 ASP A OD1 1 
ATOM   2099  O  OD2 . ASP A 1 302 ? 101.484 -10.777 -31.309 1.00 89.47  ? 324 ASP A OD2 1 
ATOM   2100  N  N   . PRO A 1 303 ? 97.810  -6.780  -32.586 1.00 55.10  ? 325 PRO A N   1 
ATOM   2101  C  CA  . PRO A 1 303 ? 96.572  -6.120  -32.176 1.00 54.49  ? 325 PRO A CA  1 
ATOM   2102  C  C   . PRO A 1 303 ? 95.929  -6.916  -31.030 1.00 61.08  ? 325 PRO A C   1 
ATOM   2103  O  O   . PRO A 1 303 ? 96.352  -8.056  -30.774 1.00 61.21  ? 325 PRO A O   1 
ATOM   2104  C  CB  . PRO A 1 303 ? 95.710  -6.167  -33.458 1.00 54.85  ? 325 PRO A CB  1 
ATOM   2105  C  CG  . PRO A 1 303 ? 96.640  -6.571  -34.552 1.00 58.79  ? 325 PRO A CG  1 
ATOM   2106  C  CD  . PRO A 1 303 ? 97.637  -7.428  -33.899 1.00 55.58  ? 325 PRO A CD  1 
ATOM   2107  N  N   . PRO A 1 304 ? 94.915  -6.365  -30.323 1.00 58.71  ? 326 PRO A N   1 
ATOM   2108  C  CA  . PRO A 1 304 ? 94.253  -7.156  -29.263 1.00 58.98  ? 326 PRO A CA  1 
ATOM   2109  C  C   . PRO A 1 304 ? 93.524  -8.383  -29.802 1.00 60.06  ? 326 PRO A C   1 
ATOM   2110  O  O   . PRO A 1 304 ? 93.011  -8.332  -30.928 1.00 58.80  ? 326 PRO A O   1 
ATOM   2111  C  CB  . PRO A 1 304 ? 93.251  -6.171  -28.668 1.00 60.77  ? 326 PRO A CB  1 
ATOM   2112  C  CG  . PRO A 1 304 ? 92.990  -5.209  -29.766 1.00 64.33  ? 326 PRO A CG  1 
ATOM   2113  C  CD  . PRO A 1 304 ? 94.294  -5.032  -30.460 1.00 59.57  ? 326 PRO A CD  1 
ATOM   2114  N  N   . ARG A 1 305 ? 93.508  -9.494  -29.021 1.00 55.91  ? 327 ARG A N   1 
ATOM   2115  C  CA  . ARG A 1 305 ? 92.794  -10.713 -29.429 1.00 54.86  ? 327 ARG A CA  1 
ATOM   2116  C  C   . ARG A 1 305 ? 91.381  -10.584 -28.911 1.00 57.75  ? 327 ARG A C   1 
ATOM   2117  O  O   . ARG A 1 305 ? 91.157  -10.709 -27.696 1.00 58.57  ? 327 ARG A O   1 
ATOM   2118  C  CB  . ARG A 1 305 ? 93.493  -11.987 -28.924 1.00 54.57  ? 327 ARG A CB  1 
ATOM   2119  C  CG  . ARG A 1 305 ? 93.202  -13.247 -29.744 1.00 61.04  ? 327 ARG A CG  1 
ATOM   2120  C  CD  . ARG A 1 305 ? 93.487  -14.527 -28.977 1.00 82.11  ? 327 ARG A CD  1 
ATOM   2121  N  NE  . ARG A 1 305 ? 92.938  -15.707 -29.657 1.00 96.18  ? 327 ARG A NE  1 
ATOM   2122  C  CZ  . ARG A 1 305 ? 93.120  -16.960 -29.244 1.00 109.25 ? 327 ARG A CZ  1 
ATOM   2123  N  NH1 . ARG A 1 305 ? 93.861  -17.212 -28.174 1.00 103.72 ? 327 ARG A NH1 1 
ATOM   2124  N  NH2 . ARG A 1 305 ? 92.576  -17.972 -29.910 1.00 85.87  ? 327 ARG A NH2 1 
ATOM   2125  N  N   . GLY A 1 306 ? 90.476  -10.192 -29.810 1.00 52.56  ? 328 GLY A N   1 
ATOM   2126  C  CA  . GLY A 1 306 ? 89.066  -9.967  -29.498 1.00 53.71  ? 328 GLY A CA  1 
ATOM   2127  C  C   . GLY A 1 306 ? 88.719  -8.654  -28.800 1.00 58.09  ? 328 GLY A C   1 
ATOM   2128  O  O   . GLY A 1 306 ? 89.615  -7.891  -28.409 1.00 57.55  ? 328 GLY A O   1 
ATOM   2129  N  N   . CYS A 1 307 ? 87.393  -8.373  -28.661 1.00 52.13  ? 329 CYS A N   1 
ATOM   2130  C  CA  . CYS A 1 307 ? 86.924  -7.140  -28.043 1.00 50.36  ? 329 CYS A CA  1 
ATOM   2131  C  C   . CYS A 1 307 ? 86.780  -7.266  -26.547 1.00 49.16  ? 329 CYS A C   1 
ATOM   2132  O  O   . CYS A 1 307 ? 87.213  -6.381  -25.822 1.00 46.82  ? 329 CYS A O   1 
ATOM   2133  C  CB  . CYS A 1 307 ? 85.621  -6.652  -28.677 1.00 51.14  ? 329 CYS A CB  1 
ATOM   2134  S  SG  . CYS A 1 307 ? 85.780  -5.983  -30.361 1.00 54.03  ? 329 CYS A SG  1 
ATOM   2135  N  N   . VAL A 1 308 ? 86.139  -8.348  -26.080 1.00 45.75  ? 330 VAL A N   1 
ATOM   2136  C  CA  . VAL A 1 308 ? 85.804  -8.572  -24.657 1.00 45.84  ? 330 VAL A CA  1 
ATOM   2137  C  C   . VAL A 1 308 ? 87.001  -8.392  -23.715 1.00 52.19  ? 330 VAL A C   1 
ATOM   2138  O  O   . VAL A 1 308 ? 88.021  -9.063  -23.851 1.00 54.57  ? 330 VAL A O   1 
ATOM   2139  C  CB  . VAL A 1 308 ? 85.081  -9.916  -24.426 1.00 48.18  ? 330 VAL A CB  1 
ATOM   2140  C  CG1 . VAL A 1 308 ? 84.845  -10.166 -22.961 1.00 48.38  ? 330 VAL A CG1 1 
ATOM   2141  C  CG2 . VAL A 1 308 ? 83.760  -9.954  -25.177 1.00 47.34  ? 330 VAL A CG2 1 
ATOM   2142  N  N   . GLY A 1 309 ? 86.865  -7.454  -22.797 1.00 48.71  ? 331 GLY A N   1 
ATOM   2143  C  CA  . GLY A 1 309 ? 87.900  -7.174  -21.817 1.00 50.79  ? 331 GLY A CA  1 
ATOM   2144  C  C   . GLY A 1 309 ? 89.089  -6.383  -22.319 1.00 56.43  ? 331 GLY A C   1 
ATOM   2145  O  O   . GLY A 1 309 ? 90.076  -6.240  -21.588 1.00 60.24  ? 331 GLY A O   1 
ATOM   2146  N  N   . ASN A 1 310 ? 88.994  -5.839  -23.534 1.00 48.96  ? 332 ASN A N   1 
ATOM   2147  C  CA  . ASN A 1 310 ? 90.056  -5.034  -24.102 1.00 48.56  ? 332 ASN A CA  1 
ATOM   2148  C  C   . ASN A 1 310 ? 89.577  -3.632  -24.370 1.00 52.09  ? 332 ASN A C   1 
ATOM   2149  O  O   . ASN A 1 310 ? 88.712  -3.420  -25.230 1.00 51.14  ? 332 ASN A O   1 
ATOM   2150  C  CB  . ASN A 1 310 ? 90.611  -5.671  -25.392 1.00 51.27  ? 332 ASN A CB  1 
ATOM   2151  C  CG  . ASN A 1 310 ? 91.223  -7.012  -25.177 1.00 56.76  ? 332 ASN A CG  1 
ATOM   2152  O  OD1 . ASN A 1 310 ? 91.908  -7.249  -24.186 1.00 46.57  ? 332 ASN A OD1 1 
ATOM   2153  N  ND2 . ASN A 1 310 ? 91.018  -7.901  -26.125 1.00 48.67  ? 332 ASN A ND2 1 
ATOM   2154  N  N   . THR A 1 311 ? 90.137  -2.669  -23.633 1.00 49.49  ? 333 THR A N   1 
ATOM   2155  C  CA  . THR A 1 311 ? 89.797  -1.252  -23.790 1.00 48.81  ? 333 THR A CA  1 
ATOM   2156  C  C   . THR A 1 311 ? 91.036  -0.408  -24.145 1.00 55.81  ? 333 THR A C   1 
ATOM   2157  O  O   . THR A 1 311 ? 90.952  0.834   -24.234 1.00 57.59  ? 333 THR A O   1 
ATOM   2158  C  CB  . THR A 1 311 ? 89.030  -0.726  -22.592 1.00 47.22  ? 333 THR A CB  1 
ATOM   2159  O  OG1 . THR A 1 311 ? 89.762  -1.012  -21.401 1.00 57.44  ? 333 THR A OG1 1 
ATOM   2160  C  CG2 . THR A 1 311 ? 87.612  -1.252  -22.524 1.00 34.57  ? 333 THR A CG2 1 
ATOM   2161  N  N   . ASN A 1 312 ? 92.169  -1.085  -24.403 1.00 51.31  ? 334 ASN A N   1 
ATOM   2162  C  CA  . ASN A 1 312 ? 93.379  -0.385  -24.793 1.00 50.60  ? 334 ASN A CA  1 
ATOM   2163  C  C   . ASN A 1 312 ? 93.574  -0.446  -26.255 1.00 52.38  ? 334 ASN A C   1 
ATOM   2164  O  O   . ASN A 1 312 ? 93.329  -1.491  -26.851 1.00 52.54  ? 334 ASN A O   1 
ATOM   2165  C  CB  . ASN A 1 312 ? 94.600  -0.897  -24.072 1.00 48.84  ? 334 ASN A CB  1 
ATOM   2166  C  CG  . ASN A 1 312 ? 94.773  -0.251  -22.731 1.00 67.14  ? 334 ASN A CG  1 
ATOM   2167  O  OD1 . ASN A 1 312 ? 94.497  0.945   -22.527 1.00 72.16  ? 334 ASN A OD1 1 
ATOM   2168  N  ND2 . ASN A 1 312 ? 95.263  -1.024  -21.797 1.00 50.73  ? 334 ASN A ND2 1 
ATOM   2169  N  N   . ILE A 1 313 ? 94.007  0.681   -26.839 1.00 46.25  ? 335 ILE A N   1 
ATOM   2170  C  CA  . ILE A 1 313 ? 94.289  0.774   -28.257 1.00 44.30  ? 335 ILE A CA  1 
ATOM   2171  C  C   . ILE A 1 313 ? 95.482  -0.124  -28.617 1.00 48.64  ? 335 ILE A C   1 
ATOM   2172  O  O   . ILE A 1 313 ? 96.287  -0.473  -27.749 1.00 47.55  ? 335 ILE A O   1 
ATOM   2173  C  CB  . ILE A 1 313 ? 94.522  2.236   -28.734 1.00 46.18  ? 335 ILE A CB  1 
ATOM   2174  C  CG1 . ILE A 1 313 ? 95.817  2.846   -28.188 1.00 46.90  ? 335 ILE A CG1 1 
ATOM   2175  C  CG2 . ILE A 1 313 ? 93.350  3.118   -28.457 1.00 47.04  ? 335 ILE A CG2 1 
ATOM   2176  C  CD1 . ILE A 1 313 ? 96.812  3.286   -29.262 1.00 47.32  ? 335 ILE A CD1 1 
ATOM   2177  N  N   . TRP A 1 314 ? 95.584  -0.481  -29.902 1.00 45.91  ? 336 TRP A N   1 
ATOM   2178  C  CA  . TRP A 1 314 ? 96.712  -1.215  -30.424 1.00 46.36  ? 336 TRP A CA  1 
ATOM   2179  C  C   . TRP A 1 314 ? 97.882  -0.183  -30.540 1.00 52.68  ? 336 TRP A C   1 
ATOM   2180  O  O   . TRP A 1 314 ? 97.807  0.759   -31.340 1.00 51.07  ? 336 TRP A O   1 
ATOM   2181  C  CB  . TRP A 1 314 ? 96.338  -1.832  -31.772 1.00 43.07  ? 336 TRP A CB  1 
ATOM   2182  C  CG  . TRP A 1 314 ? 97.466  -2.486  -32.521 1.00 43.79  ? 336 TRP A CG  1 
ATOM   2183  C  CD1 . TRP A 1 314 ? 98.507  -3.193  -31.992 1.00 47.85  ? 336 TRP A CD1 1 
ATOM   2184  C  CD2 . TRP A 1 314 ? 97.562  -2.635  -33.947 1.00 42.73  ? 336 TRP A CD2 1 
ATOM   2185  N  NE1 . TRP A 1 314 ? 99.268  -3.740  -32.998 1.00 47.81  ? 336 TRP A NE1 1 
ATOM   2186  C  CE2 . TRP A 1 314 ? 98.715  -3.406  -34.211 1.00 47.81  ? 336 TRP A CE2 1 
ATOM   2187  C  CE3 . TRP A 1 314 ? 96.783  -2.185  -35.029 1.00 42.65  ? 336 TRP A CE3 1 
ATOM   2188  C  CZ2 . TRP A 1 314 ? 99.151  -3.677  -35.512 1.00 46.45  ? 336 TRP A CZ2 1 
ATOM   2189  C  CZ3 . TRP A 1 314 ? 97.223  -2.435  -36.317 1.00 44.04  ? 336 TRP A CZ3 1 
ATOM   2190  C  CH2 . TRP A 1 314 ? 98.388  -3.181  -36.552 1.00 45.54  ? 336 TRP A CH2 1 
ATOM   2191  N  N   . LYS A 1 315 ? 98.925  -0.336  -29.685 1.00 49.59  ? 337 LYS A N   1 
ATOM   2192  C  CA  . LYS A 1 315 ? 100.082 0.556   -29.674 1.00 48.74  ? 337 LYS A CA  1 
ATOM   2193  C  C   . LYS A 1 315 ? 100.750 0.704   -31.068 1.00 56.63  ? 337 LYS A C   1 
ATOM   2194  O  O   . LYS A 1 315 ? 101.211 1.802   -31.402 1.00 59.09  ? 337 LYS A O   1 
ATOM   2195  C  CB  . LYS A 1 315 ? 101.077 0.113   -28.611 1.00 50.45  ? 337 LYS A CB  1 
ATOM   2196  N  N   . THR A 1 316 ? 100.741 -0.360  -31.911 1.00 52.24  ? 338 THR A N   1 
ATOM   2197  C  CA  . THR A 1 316 ? 101.356 -0.312  -33.247 1.00 51.25  ? 338 THR A CA  1 
ATOM   2198  C  C   . THR A 1 316 ? 100.415 0.303   -34.289 1.00 54.65  ? 338 THR A C   1 
ATOM   2199  O  O   . THR A 1 316 ? 100.882 0.709   -35.365 1.00 55.55  ? 338 THR A O   1 
ATOM   2200  C  CB  . THR A 1 316 ? 101.904 -1.683  -33.653 1.00 52.36  ? 338 THR A CB  1 
ATOM   2201  O  OG1 . THR A 1 316 ? 102.795 -2.121  -32.628 1.00 51.91  ? 338 THR A OG1 1 
ATOM   2202  C  CG2 . THR A 1 316 ? 102.651 -1.652  -34.977 1.00 47.39  ? 338 THR A CG2 1 
ATOM   2203  N  N   . GLY A 1 317 ? 99.120  0.385   -33.952 1.00 48.54  ? 339 GLY A N   1 
ATOM   2204  C  CA  . GLY A 1 317 ? 98.074  0.976   -34.793 1.00 46.05  ? 339 GLY A CA  1 
ATOM   2205  C  C   . GLY A 1 317 ? 98.494  2.270   -35.452 1.00 48.75  ? 339 GLY A C   1 
ATOM   2206  O  O   . GLY A 1 317 ? 98.666  2.278   -36.664 1.00 48.65  ? 339 GLY A O   1 
ATOM   2207  N  N   . PRO A 1 318 ? 98.803  3.347   -34.684 1.00 46.00  ? 340 PRO A N   1 
ATOM   2208  C  CA  . PRO A 1 318 ? 99.245  4.610   -35.305 1.00 45.47  ? 340 PRO A CA  1 
ATOM   2209  C  C   . PRO A 1 318 ? 100.456 4.554   -36.255 1.00 46.68  ? 340 PRO A C   1 
ATOM   2210  O  O   . PRO A 1 318 ? 100.484 5.323   -37.220 1.00 45.95  ? 340 PRO A O   1 
ATOM   2211  C  CB  . PRO A 1 318 ? 99.535  5.486   -34.093 1.00 47.94  ? 340 PRO A CB  1 
ATOM   2212  C  CG  . PRO A 1 318 ? 98.606  4.978   -33.070 1.00 51.18  ? 340 PRO A CG  1 
ATOM   2213  C  CD  . PRO A 1 318 ? 98.688  3.516   -33.220 1.00 46.70  ? 340 PRO A CD  1 
ATOM   2214  N  N   . LEU A 1 319 ? 101.450 3.686   -35.995 1.00 43.21  ? 341 LEU A N   1 
ATOM   2215  C  CA  . LEU A 1 319 ? 102.620 3.571   -36.889 1.00 43.49  ? 341 LEU A CA  1 
ATOM   2216  C  C   . LEU A 1 319 ? 102.193 2.897   -38.181 1.00 48.29  ? 341 LEU A C   1 
ATOM   2217  O  O   . LEU A 1 319 ? 102.507 3.390   -39.262 1.00 47.35  ? 341 LEU A O   1 
ATOM   2218  C  CB  . LEU A 1 319 ? 103.790 2.819   -36.230 1.00 44.27  ? 341 LEU A CB  1 
ATOM   2219  C  CG  . LEU A 1 319 ? 104.867 2.263   -37.158 1.00 48.34  ? 341 LEU A CG  1 
ATOM   2220  C  CD1 . LEU A 1 319 ? 105.656 3.367   -37.831 1.00 49.59  ? 341 LEU A CD1 1 
ATOM   2221  C  CD2 . LEU A 1 319 ? 105.787 1.321   -36.425 1.00 47.04  ? 341 LEU A CD2 1 
ATOM   2222  N  N   . PHE A 1 320 ? 101.428 1.795   -38.051 1.00 45.42  ? 342 PHE A N   1 
ATOM   2223  C  CA  . PHE A 1 320 ? 100.892 1.063   -39.169 1.00 43.94  ? 342 PHE A CA  1 
ATOM   2224  C  C   . PHE A 1 320 ? 100.020 1.988   -40.049 1.00 52.59  ? 342 PHE A C   1 
ATOM   2225  O  O   . PHE A 1 320 ? 100.090 1.893   -41.290 1.00 55.30  ? 342 PHE A O   1 
ATOM   2226  C  CB  . PHE A 1 320 ? 100.174 -0.214  -38.714 1.00 44.00  ? 342 PHE A CB  1 
ATOM   2227  C  CG  . PHE A 1 320 ? 99.733  -1.055  -39.890 1.00 44.81  ? 342 PHE A CG  1 
ATOM   2228  C  CD1 . PHE A 1 320 ? 100.551 -1.198  -41.022 1.00 46.74  ? 342 PHE A CD1 1 
ATOM   2229  C  CD2 . PHE A 1 320 ? 98.493  -1.685  -39.887 1.00 45.41  ? 342 PHE A CD2 1 
ATOM   2230  C  CE1 . PHE A 1 320 ? 100.124 -1.922  -42.126 1.00 45.98  ? 342 PHE A CE1 1 
ATOM   2231  C  CE2 . PHE A 1 320 ? 98.072  -2.434  -40.993 1.00 46.18  ? 342 PHE A CE2 1 
ATOM   2232  C  CZ  . PHE A 1 320 ? 98.887  -2.536  -42.105 1.00 44.34  ? 342 PHE A CZ  1 
ATOM   2233  N  N   . LYS A 1 321 ? 99.268  2.932   -39.420 1.00 48.35  ? 343 LYS A N   1 
ATOM   2234  C  CA  . LYS A 1 321 ? 98.480  3.933   -40.155 1.00 46.87  ? 343 LYS A CA  1 
ATOM   2235  C  C   . LYS A 1 321 ? 99.457  4.797   -40.970 1.00 52.74  ? 343 LYS A C   1 
ATOM   2236  O  O   . LYS A 1 321 ? 99.294  4.839   -42.182 1.00 54.01  ? 343 LYS A O   1 
ATOM   2237  C  CB  . LYS A 1 321 ? 97.570  4.803   -39.255 1.00 46.31  ? 343 LYS A CB  1 
ATOM   2238  C  CG  . LYS A 1 321 ? 96.762  5.795   -40.087 1.00 39.78  ? 343 LYS A CG  1 
ATOM   2239  C  CD  . LYS A 1 321 ? 95.779  6.677   -39.315 1.00 44.56  ? 343 LYS A CD  1 
ATOM   2240  C  CE  . LYS A 1 321 ? 95.313  7.848   -40.168 1.00 42.37  ? 343 LYS A CE  1 
ATOM   2241  N  NZ  . LYS A 1 321 ? 93.931  8.324   -39.852 1.00 51.21  ? 343 LYS A NZ  1 
ATOM   2242  N  N   . ARG A 1 322 ? 100.507 5.400   -40.332 1.00 48.12  ? 344 ARG A N   1 
ATOM   2243  C  CA  . ARG A 1 322 ? 101.520 6.200   -41.044 1.00 48.42  ? 344 ARG A CA  1 
ATOM   2244  C  C   . ARG A 1 322 ? 102.096 5.442   -42.279 1.00 52.61  ? 344 ARG A C   1 
ATOM   2245  O  O   . ARG A 1 322 ? 102.096 6.003   -43.372 1.00 51.30  ? 344 ARG A O   1 
ATOM   2246  C  CB  . ARG A 1 322 ? 102.654 6.663   -40.113 1.00 47.03  ? 344 ARG A CB  1 
ATOM   2247  C  CG  . ARG A 1 322 ? 103.698 7.509   -40.832 1.00 59.40  ? 344 ARG A CG  1 
ATOM   2248  C  CD  . ARG A 1 322 ? 104.774 8.100   -39.945 1.00 77.66  ? 344 ARG A CD  1 
ATOM   2249  N  NE  . ARG A 1 322 ? 104.280 9.057   -38.943 1.00 93.23  ? 344 ARG A NE  1 
ATOM   2250  C  CZ  . ARG A 1 322 ? 104.132 10.362  -39.159 1.00 110.13 ? 344 ARG A CZ  1 
ATOM   2251  N  NH1 . ARG A 1 322 ? 104.400 10.881  -40.352 1.00 99.79  ? 344 ARG A NH1 1 
ATOM   2252  N  NH2 . ARG A 1 322 ? 103.710 11.159  -38.184 1.00 94.83  ? 344 ARG A NH2 1 
ATOM   2253  N  N   . VAL A 1 323 ? 102.526 4.162   -42.092 1.00 48.29  ? 345 VAL A N   1 
ATOM   2254  C  CA  . VAL A 1 323 ? 103.062 3.272   -43.124 1.00 46.59  ? 345 VAL A CA  1 
ATOM   2255  C  C   . VAL A 1 323 ? 102.074 3.168   -44.287 1.00 51.58  ? 345 VAL A C   1 
ATOM   2256  O  O   . VAL A 1 323 ? 102.480 3.392   -45.438 1.00 54.71  ? 345 VAL A O   1 
ATOM   2257  C  CB  . VAL A 1 323 ? 103.448 1.878   -42.558 1.00 49.21  ? 345 VAL A CB  1 
ATOM   2258  C  CG1 . VAL A 1 323 ? 103.870 0.929   -43.666 1.00 48.42  ? 345 VAL A CG1 1 
ATOM   2259  C  CG2 . VAL A 1 323 ? 104.554 1.979   -41.499 1.00 50.17  ? 345 VAL A CG2 1 
ATOM   2260  N  N   . LEU A 1 324 ? 100.781 2.869   -43.988 1.00 43.85  ? 346 LEU A N   1 
ATOM   2261  C  CA  . LEU A 1 324 ? 99.713  2.736   -44.998 1.00 40.99  ? 346 LEU A CA  1 
ATOM   2262  C  C   . LEU A 1 324 ? 99.469  4.026   -45.782 1.00 47.57  ? 346 LEU A C   1 
ATOM   2263  O  O   . LEU A 1 324 ? 99.484  4.005   -47.002 1.00 47.17  ? 346 LEU A O   1 
ATOM   2264  C  CB  . LEU A 1 324 ? 98.405  2.278   -44.347 1.00 37.93  ? 346 LEU A CB  1 
ATOM   2265  C  CG  . LEU A 1 324 ? 98.229  0.790   -44.127 1.00 37.85  ? 346 LEU A CG  1 
ATOM   2266  C  CD1 . LEU A 1 324 ? 97.075  0.538   -43.226 1.00 37.36  ? 346 LEU A CD1 1 
ATOM   2267  C  CD2 . LEU A 1 324 ? 98.009  0.039   -45.427 1.00 30.42  ? 346 LEU A CD2 1 
ATOM   2268  N  N   . MET A 1 325 ? 99.280  5.136   -45.072 1.00 46.12  ? 347 MET A N   1 
ATOM   2269  C  CA  . MET A 1 325 ? 99.031  6.481   -45.568 1.00 47.21  ? 347 MET A CA  1 
ATOM   2270  C  C   . MET A 1 325 ? 100.070 6.907   -46.580 1.00 54.65  ? 347 MET A C   1 
ATOM   2271  O  O   . MET A 1 325 ? 99.747  7.616   -47.530 1.00 55.61  ? 347 MET A O   1 
ATOM   2272  C  CB  . MET A 1 325 ? 99.098  7.459   -44.390 1.00 50.95  ? 347 MET A CB  1 
ATOM   2273  C  CG  . MET A 1 325 ? 97.890  7.462   -43.506 1.00 55.03  ? 347 MET A CG  1 
ATOM   2274  S  SD  . MET A 1 325 ? 96.693  8.496   -44.306 1.00 61.71  ? 347 MET A SD  1 
ATOM   2275  C  CE  . MET A 1 325 ? 96.845  9.985   -43.360 1.00 60.33  ? 347 MET A CE  1 
ATOM   2276  N  N   . SER A 1 326 ? 101.330 6.495   -46.362 1.00 52.64  ? 348 SER A N   1 
ATOM   2277  C  CA  . SER A 1 326 ? 102.485 6.831   -47.188 1.00 52.46  ? 348 SER A CA  1 
ATOM   2278  C  C   . SER A 1 326 ? 102.865 5.694   -48.157 1.00 58.53  ? 348 SER A C   1 
ATOM   2279  O  O   . SER A 1 326 ? 103.986 5.671   -48.679 1.00 59.65  ? 348 SER A O   1 
ATOM   2280  C  CB  . SER A 1 326 ? 103.648 7.217   -46.290 1.00 55.56  ? 348 SER A CB  1 
ATOM   2281  O  OG  . SER A 1 326 ? 104.033 6.119   -45.479 1.00 65.55  ? 348 SER A OG  1 
ATOM   2282  N  N   . SER A 1 327 ? 101.916 4.756   -48.411 1.00 55.26  ? 349 SER A N   1 
ATOM   2283  C  CA  . SER A 1 327 ? 102.125 3.641   -49.333 1.00 54.65  ? 349 SER A CA  1 
ATOM   2284  C  C   . SER A 1 327 ? 101.760 4.016   -50.736 1.00 59.48  ? 349 SER A C   1 
ATOM   2285  O  O   . SER A 1 327 ? 100.756 4.703   -50.946 1.00 61.23  ? 349 SER A O   1 
ATOM   2286  C  CB  . SER A 1 327 ? 101.383 2.388   -48.886 1.00 55.23  ? 349 SER A CB  1 
ATOM   2287  O  OG  . SER A 1 327 ? 102.253 1.589   -48.095 1.00 68.33  ? 349 SER A OG  1 
ATOM   2288  N  N   . LYS A 1 328 ? 102.610 3.598   -51.701 1.00 54.06  ? 350 LYS A N   1 
ATOM   2289  C  CA  . LYS A 1 328 ? 102.435 3.788   -53.145 1.00 51.50  ? 350 LYS A CA  1 
ATOM   2290  C  C   . LYS A 1 328 ? 102.533 2.414   -53.806 1.00 56.64  ? 350 LYS A C   1 
ATOM   2291  O  O   . LYS A 1 328 ? 103.476 1.670   -53.547 1.00 58.52  ? 350 LYS A O   1 
ATOM   2292  C  CB  . LYS A 1 328 ? 103.512 4.706   -53.752 1.00 52.53  ? 350 LYS A CB  1 
ATOM   2293  C  CG  . LYS A 1 328 ? 103.706 6.044   -53.069 1.00 71.33  ? 350 LYS A CG  1 
ATOM   2294  C  CD  . LYS A 1 328 ? 104.765 6.879   -53.766 1.00 85.99  ? 350 LYS A CD  1 
ATOM   2295  C  CE  . LYS A 1 328 ? 105.133 8.107   -52.960 1.00 102.21 ? 350 LYS A CE  1 
ATOM   2296  N  NZ  . LYS A 1 328 ? 105.970 9.060   -53.738 1.00 116.60 ? 350 LYS A NZ  1 
ATOM   2297  N  N   . TYR A 1 329 ? 101.557 2.076   -54.642 1.00 52.49  ? 351 TYR A N   1 
ATOM   2298  C  CA  . TYR A 1 329 ? 101.509 0.841   -55.426 1.00 52.93  ? 351 TYR A CA  1 
ATOM   2299  C  C   . TYR A 1 329 ? 101.067 1.294   -56.802 1.00 62.17  ? 351 TYR A C   1 
ATOM   2300  O  O   . TYR A 1 329 ? 99.902  1.676   -56.951 1.00 63.87  ? 351 TYR A O   1 
ATOM   2301  C  CB  . TYR A 1 329 ? 100.515 -0.160  -54.830 1.00 51.67  ? 351 TYR A CB  1 
ATOM   2302  C  CG  . TYR A 1 329 ? 100.589 -1.519  -55.479 1.00 51.74  ? 351 TYR A CG  1 
ATOM   2303  C  CD1 . TYR A 1 329 ? 101.601 -2.420  -55.147 1.00 52.54  ? 351 TYR A CD1 1 
ATOM   2304  C  CD2 . TYR A 1 329 ? 99.650  -1.910  -56.428 1.00 53.20  ? 351 TYR A CD2 1 
ATOM   2305  C  CE1 . TYR A 1 329 ? 101.679 -3.678  -55.746 1.00 52.68  ? 351 TYR A CE1 1 
ATOM   2306  C  CE2 . TYR A 1 329 ? 99.714  -3.167  -57.034 1.00 55.54  ? 351 TYR A CE2 1 
ATOM   2307  C  CZ  . TYR A 1 329 ? 100.730 -4.050  -56.685 1.00 69.27  ? 351 TYR A CZ  1 
ATOM   2308  O  OH  . TYR A 1 329 ? 100.800 -5.303  -57.250 1.00 81.19  ? 351 TYR A OH  1 
ATOM   2309  N  N   . PRO A 1 330 ? 101.970 1.364   -57.800 1.00 60.45  ? 352 PRO A N   1 
ATOM   2310  C  CA  . PRO A 1 330 ? 101.585 1.957   -59.101 1.00 60.84  ? 352 PRO A CA  1 
ATOM   2311  C  C   . PRO A 1 330 ? 100.948 1.024   -60.119 1.00 67.93  ? 352 PRO A C   1 
ATOM   2312  O  O   . PRO A 1 330 ? 100.234 1.489   -61.007 1.00 67.12  ? 352 PRO A O   1 
ATOM   2313  C  CB  . PRO A 1 330 ? 102.896 2.539   -59.627 1.00 63.75  ? 352 PRO A CB  1 
ATOM   2314  C  CG  . PRO A 1 330 ? 103.983 2.045   -58.686 1.00 68.81  ? 352 PRO A CG  1 
ATOM   2315  C  CD  . PRO A 1 330 ? 103.398 1.014   -57.778 1.00 63.06  ? 352 PRO A CD  1 
ATOM   2316  N  N   . ASP A 1 331 ? 101.206 -0.285  -59.991 1.00 68.34  ? 353 ASP A N   1 
ATOM   2317  C  CA  . ASP A 1 331 ? 100.709 -1.326  -60.894 1.00 69.85  ? 353 ASP A CA  1 
ATOM   2318  C  C   . ASP A 1 331 ? 99.362  -1.949  -60.410 1.00 70.35  ? 353 ASP A C   1 
ATOM   2319  O  O   . ASP A 1 331 ? 99.112  -3.155  -60.584 1.00 71.59  ? 353 ASP A O   1 
ATOM   2320  C  CB  . ASP A 1 331 ? 101.803 -2.403  -61.160 1.00 75.10  ? 353 ASP A CB  1 
ATOM   2321  C  CG  . ASP A 1 331 ? 103.133 -2.274  -60.383 1.00 102.17 ? 353 ASP A CG  1 
ATOM   2322  O  OD1 . ASP A 1 331 ? 103.088 -2.149  -59.118 1.00 102.71 ? 353 ASP A OD1 1 
ATOM   2323  O  OD2 . ASP A 1 331 ? 104.221 -2.350  -61.035 1.00 114.43 ? 353 ASP A OD2 1 
ATOM   2324  N  N   . GLY A 1 332 ? 98.507  -1.114  -59.824 1.00 61.08  ? 354 GLY A N   1 
ATOM   2325  C  CA  . GLY A 1 332 ? 97.207  -1.557  -59.349 1.00 58.41  ? 354 GLY A CA  1 
ATOM   2326  C  C   . GLY A 1 332 ? 96.245  -1.726  -60.501 1.00 59.77  ? 354 GLY A C   1 
ATOM   2327  O  O   . GLY A 1 332 ? 96.381  -1.048  -61.521 1.00 61.59  ? 354 GLY A O   1 
ATOM   2328  N  N   . VAL A 1 333 ? 95.273  -2.634  -60.348 1.00 52.06  ? 355 VAL A N   1 
ATOM   2329  C  CA  . VAL A 1 333 ? 94.211  -2.945  -61.325 1.00 49.85  ? 355 VAL A CA  1 
ATOM   2330  C  C   . VAL A 1 333 ? 93.423  -1.660  -61.662 1.00 49.89  ? 355 VAL A C   1 
ATOM   2331  O  O   . VAL A 1 333 ? 93.062  -1.444  -62.814 1.00 49.25  ? 355 VAL A O   1 
ATOM   2332  C  CB  . VAL A 1 333 ? 93.270  -4.050  -60.774 1.00 52.97  ? 355 VAL A CB  1 
ATOM   2333  C  CG1 . VAL A 1 333 ? 92.102  -4.275  -61.690 1.00 53.61  ? 355 VAL A CG1 1 
ATOM   2334  C  CG2 . VAL A 1 333 ? 94.004  -5.355  -60.567 1.00 53.69  ? 355 VAL A CG2 1 
ATOM   2335  N  N   . THR A 1 334 ? 93.159  -0.828  -60.639 1.00 44.01  ? 356 THR A N   1 
ATOM   2336  C  CA  . THR A 1 334 ? 92.403  0.428   -60.728 1.00 41.92  ? 356 THR A CA  1 
ATOM   2337  C  C   . THR A 1 334 ? 93.354  1.645   -60.891 1.00 42.77  ? 356 THR A C   1 
ATOM   2338  O  O   . THR A 1 334 ? 92.912  2.786   -60.775 1.00 41.13  ? 356 THR A O   1 
ATOM   2339  C  CB  . THR A 1 334 ? 91.425  0.561   -59.540 1.00 42.80  ? 356 THR A CB  1 
ATOM   2340  O  OG1 . THR A 1 334 ? 92.151  0.667   -58.322 1.00 39.52  ? 356 THR A OG1 1 
ATOM   2341  C  CG2 . THR A 1 334 ? 90.459  -0.606  -59.427 1.00 43.58  ? 356 THR A CG2 1 
ATOM   2342  N  N   . GLY A 1 335 ? 94.635  1.376   -61.164 1.00 37.51  ? 357 GLY A N   1 
ATOM   2343  C  CA  . GLY A 1 335 ? 95.625  2.418   -61.389 1.00 38.84  ? 357 GLY A CA  1 
ATOM   2344  C  C   . GLY A 1 335 ? 96.704  2.601   -60.344 1.00 46.79  ? 357 GLY A C   1 
ATOM   2345  O  O   . GLY A 1 335 ? 97.108  1.655   -59.656 1.00 46.02  ? 357 GLY A O   1 
ATOM   2346  N  N   . ARG A 1 336 ? 97.208  3.839   -60.265 1.00 45.54  ? 358 ARG A N   1 
ATOM   2347  C  CA  . ARG A 1 336 ? 98.265  4.274   -59.349 1.00 46.41  ? 358 ARG A CA  1 
ATOM   2348  C  C   . ARG A 1 336 ? 97.635  4.512   -57.971 1.00 52.79  ? 358 ARG A C   1 
ATOM   2349  O  O   . ARG A 1 336 ? 96.866  5.467   -57.805 1.00 54.48  ? 358 ARG A O   1 
ATOM   2350  C  CB  . ARG A 1 336 ? 98.889  5.575   -59.911 1.00 46.44  ? 358 ARG A CB  1 
ATOM   2351  C  CG  . ARG A 1 336 ? 99.990  6.237   -59.101 1.00 54.39  ? 358 ARG A CG  1 
ATOM   2352  C  CD  . ARG A 1 336 ? 100.686 7.252   -59.976 1.00 52.48  ? 358 ARG A CD  1 
ATOM   2353  N  NE  . ARG A 1 336 ? 101.710 8.019   -59.269 1.00 62.65  ? 358 ARG A NE  1 
ATOM   2354  C  CZ  . ARG A 1 336 ? 101.998 9.285   -59.560 1.00 91.56  ? 358 ARG A CZ  1 
ATOM   2355  N  NH1 . ARG A 1 336 ? 101.323 9.926   -60.509 1.00 95.71  ? 358 ARG A NH1 1 
ATOM   2356  N  NH2 . ARG A 1 336 ? 102.942 9.929   -58.887 1.00 74.62  ? 358 ARG A NH2 1 
ATOM   2357  N  N   . ILE A 1 337 ? 97.922  3.637   -56.999 1.00 47.18  ? 359 ILE A N   1 
ATOM   2358  C  CA  . ILE A 1 337 ? 97.371  3.795   -55.659 1.00 44.22  ? 359 ILE A CA  1 
ATOM   2359  C  C   . ILE A 1 337 ? 98.292  4.632   -54.796 1.00 48.33  ? 359 ILE A C   1 
ATOM   2360  O  O   . ILE A 1 337 ? 99.431  4.253   -54.545 1.00 50.31  ? 359 ILE A O   1 
ATOM   2361  C  CB  . ILE A 1 337 ? 96.979  2.451   -55.014 1.00 45.79  ? 359 ILE A CB  1 
ATOM   2362  C  CG1 . ILE A 1 337 ? 95.830  1.787   -55.791 1.00 46.20  ? 359 ILE A CG1 1 
ATOM   2363  C  CG2 . ILE A 1 337 ? 96.567  2.662   -53.565 1.00 44.57  ? 359 ILE A CG2 1 
ATOM   2364  C  CD1 . ILE A 1 337 ? 96.236  0.714   -56.621 1.00 58.33  ? 359 ILE A CD1 1 
ATOM   2365  N  N   . GLU A 1 338 ? 97.784  5.768   -54.341 1.00 43.12  ? 360 GLU A N   1 
ATOM   2366  C  CA  . GLU A 1 338 ? 98.424  6.691   -53.408 1.00 43.34  ? 360 GLU A CA  1 
ATOM   2367  C  C   . GLU A 1 338 ? 97.309  7.308   -52.576 1.00 46.56  ? 360 GLU A C   1 
ATOM   2368  O  O   . GLU A 1 338 ? 96.160  7.345   -53.029 1.00 45.41  ? 360 GLU A O   1 
ATOM   2369  C  CB  . GLU A 1 338 ? 99.191  7.780   -54.136 1.00 45.82  ? 360 GLU A CB  1 
ATOM   2370  C  CG  . GLU A 1 338 ? 100.600 7.376   -54.511 1.00 60.63  ? 360 GLU A CG  1 
ATOM   2371  C  CD  . GLU A 1 338 ? 101.526 8.510   -54.906 1.00 82.06  ? 360 GLU A CD  1 
ATOM   2372  O  OE1 . GLU A 1 338 ? 101.623 9.492   -54.129 1.00 77.27  ? 360 GLU A OE1 1 
ATOM   2373  O  OE2 . GLU A 1 338 ? 102.184 8.396   -55.971 1.00 65.03  ? 360 GLU A OE2 1 
ATOM   2374  N  N   . PHE A 1 339 ? 97.624  7.769   -51.361 1.00 42.93  ? 361 PHE A N   1 
ATOM   2375  C  CA  . PHE A 1 339 ? 96.609  8.359   -50.480 1.00 41.83  ? 361 PHE A CA  1 
ATOM   2376  C  C   . PHE A 1 339 ? 96.922  9.773   -50.106 1.00 44.87  ? 361 PHE A C   1 
ATOM   2377  O  O   . PHE A 1 339 ? 98.083  10.112  -49.837 1.00 47.59  ? 361 PHE A O   1 
ATOM   2378  C  CB  . PHE A 1 339 ? 96.389  7.509   -49.215 1.00 43.32  ? 361 PHE A CB  1 
ATOM   2379  C  CG  . PHE A 1 339 ? 96.090  6.060   -49.529 1.00 43.91  ? 361 PHE A CG  1 
ATOM   2380  C  CD1 . PHE A 1 339 ? 94.849  5.682   -50.020 1.00 45.86  ? 361 PHE A CD1 1 
ATOM   2381  C  CD2 . PHE A 1 339 ? 97.067  5.083   -49.377 1.00 45.78  ? 361 PHE A CD2 1 
ATOM   2382  C  CE1 . PHE A 1 339 ? 94.575  4.348   -50.308 1.00 47.21  ? 361 PHE A CE1 1 
ATOM   2383  C  CE2 . PHE A 1 339 ? 96.799  3.752   -49.685 1.00 48.87  ? 361 PHE A CE2 1 
ATOM   2384  C  CZ  . PHE A 1 339 ? 95.552  3.391   -50.145 1.00 47.02  ? 361 PHE A CZ  1 
ATOM   2385  N  N   . ASN A 1 340 ? 95.886  10.590  -50.022 1.00 38.63  ? 362 ASN A N   1 
ATOM   2386  C  CA  . ASN A 1 340 ? 96.068  11.966  -49.655 1.00 39.49  ? 362 ASN A CA  1 
ATOM   2387  C  C   . ASN A 1 340 ? 96.112  12.131  -48.143 1.00 49.24  ? 362 ASN A C   1 
ATOM   2388  O  O   . ASN A 1 340 ? 96.088  11.153  -47.386 1.00 49.72  ? 362 ASN A O   1 
ATOM   2389  C  CB  . ASN A 1 340 ? 95.040  12.878  -50.347 1.00 36.07  ? 362 ASN A CB  1 
ATOM   2390  C  CG  . ASN A 1 340 ? 93.704  12.924  -49.722 1.00 51.00  ? 362 ASN A CG  1 
ATOM   2391  O  OD1 . ASN A 1 340 ? 93.435  12.231  -48.762 1.00 51.41  ? 362 ASN A OD1 1 
ATOM   2392  N  ND2 . ASN A 1 340 ? 92.816  13.698  -50.285 1.00 46.82  ? 362 ASN A ND2 1 
ATOM   2393  N  N   . GLU A 1 341 ? 96.218  13.387  -47.716 1.00 49.70  ? 363 GLU A N   1 
ATOM   2394  C  CA  . GLU A 1 341 ? 96.267  13.850  -46.336 1.00 50.25  ? 363 GLU A CA  1 
ATOM   2395  C  C   . GLU A 1 341 ? 95.072  13.314  -45.515 1.00 51.94  ? 363 GLU A C   1 
ATOM   2396  O  O   . GLU A 1 341 ? 95.181  13.232  -44.307 1.00 52.51  ? 363 GLU A O   1 
ATOM   2397  C  CB  . GLU A 1 341 ? 96.428  15.402  -46.278 1.00 53.70  ? 363 GLU A CB  1 
ATOM   2398  C  CG  . GLU A 1 341 ? 95.541  16.255  -47.212 1.00 74.55  ? 363 GLU A CG  1 
ATOM   2399  C  CD  . GLU A 1 341 ? 95.794  16.333  -48.724 1.00 102.18 ? 363 GLU A CD  1 
ATOM   2400  O  OE1 . GLU A 1 341 ? 96.866  15.880  -49.195 1.00 101.98 ? 363 GLU A OE1 1 
ATOM   2401  O  OE2 . GLU A 1 341 ? 94.907  16.860  -49.439 1.00 83.83  ? 363 GLU A OE2 1 
ATOM   2402  N  N   . ASP A 1 342 ? 93.980  12.870  -46.176 1.00 48.02  ? 364 ASP A N   1 
ATOM   2403  C  CA  . ASP A 1 342 ? 92.776  12.286  -45.548 1.00 47.08  ? 364 ASP A CA  1 
ATOM   2404  C  C   . ASP A 1 342 ? 92.683  10.756  -45.778 1.00 51.17  ? 364 ASP A C   1 
ATOM   2405  O  O   . ASP A 1 342 ? 91.656  10.140  -45.455 1.00 52.23  ? 364 ASP A O   1 
ATOM   2406  C  CB  . ASP A 1 342 ? 91.471  12.979  -46.014 1.00 48.89  ? 364 ASP A CB  1 
ATOM   2407  C  CG  . ASP A 1 342 ? 91.468  14.506  -46.137 1.00 71.23  ? 364 ASP A CG  1 
ATOM   2408  O  OD1 . ASP A 1 342 ? 91.793  15.189  -45.132 1.00 73.69  ? 364 ASP A OD1 1 
ATOM   2409  O  OD2 . ASP A 1 342 ? 91.051  15.017  -47.215 1.00 81.00  ? 364 ASP A OD2 1 
ATOM   2410  N  N   . GLY A 1 343 ? 93.764  10.152  -46.292 1.00 45.99  ? 365 GLY A N   1 
ATOM   2411  C  CA  . GLY A 1 343 ? 93.837  8.725   -46.604 1.00 43.16  ? 365 GLY A CA  1 
ATOM   2412  C  C   . GLY A 1 343 ? 92.909  8.341   -47.735 1.00 42.34  ? 365 GLY A C   1 
ATOM   2413  O  O   . GLY A 1 343 ? 92.587  7.163   -47.878 1.00 40.74  ? 365 GLY A O   1 
ATOM   2414  N  N   . ASP A 1 344 ? 92.421  9.344   -48.520 1.00 38.10  ? 366 ASP A N   1 
ATOM   2415  C  CA  . ASP A 1 344 ? 91.566  9.133   -49.702 1.00 37.54  ? 366 ASP A CA  1 
ATOM   2416  C  C   . ASP A 1 344 ? 92.445  8.893   -50.926 1.00 44.65  ? 366 ASP A C   1 
ATOM   2417  O  O   . ASP A 1 344 ? 93.523  9.453   -51.054 1.00 44.75  ? 366 ASP A O   1 
ATOM   2418  C  CB  . ASP A 1 344 ? 90.634  10.316  -50.003 1.00 38.31  ? 366 ASP A CB  1 
ATOM   2419  C  CG  . ASP A 1 344 ? 89.627  10.683  -48.947 1.00 48.59  ? 366 ASP A CG  1 
ATOM   2420  O  OD1 . ASP A 1 344 ? 89.087  9.755   -48.275 1.00 48.82  ? 366 ASP A OD1 1 
ATOM   2421  O  OD2 . ASP A 1 344 ? 89.361  11.892  -48.790 1.00 56.70  ? 366 ASP A OD2 1 
ATOM   2422  N  N   . ARG A 1 345 ? 91.941  8.105   -51.850 1.00 44.02  ? 367 ARG A N   1 
ATOM   2423  C  CA  . ARG A 1 345 ? 92.631  7.752   -53.066 1.00 44.63  ? 367 ARG A CA  1 
ATOM   2424  C  C   . ARG A 1 345 ? 92.966  8.945   -53.944 1.00 51.40  ? 367 ARG A C   1 
ATOM   2425  O  O   . ARG A 1 345 ? 92.088  9.760   -54.277 1.00 52.02  ? 367 ARG A O   1 
ATOM   2426  C  CB  . ARG A 1 345 ? 91.813  6.713   -53.842 1.00 42.72  ? 367 ARG A CB  1 
ATOM   2427  C  CG  . ARG A 1 345 ? 92.345  6.450   -55.230 1.00 51.74  ? 367 ARG A CG  1 
ATOM   2428  C  CD  . ARG A 1 345 ? 93.561  5.585   -55.191 1.00 58.50  ? 367 ARG A CD  1 
ATOM   2429  N  NE  . ARG A 1 345 ? 93.305  4.364   -55.931 1.00 59.28  ? 367 ARG A NE  1 
ATOM   2430  C  CZ  . ARG A 1 345 ? 93.580  4.209   -57.211 1.00 61.26  ? 367 ARG A CZ  1 
ATOM   2431  N  NH1 . ARG A 1 345 ? 94.129  5.196   -57.900 1.00 43.43  ? 367 ARG A NH1 1 
ATOM   2432  N  NH2 . ARG A 1 345 ? 93.330  3.059   -57.810 1.00 49.11  ? 367 ARG A NH2 1 
ATOM   2433  N  N   . LYS A 1 346 ? 94.252  9.008   -54.335 1.00 48.44  ? 368 LYS A N   1 
ATOM   2434  C  CA  . LYS A 1 346 ? 94.815  9.969   -55.277 1.00 48.51  ? 368 LYS A CA  1 
ATOM   2435  C  C   . LYS A 1 346 ? 94.950  9.234   -56.605 1.00 52.79  ? 368 LYS A C   1 
ATOM   2436  O  O   . LYS A 1 346 ? 95.137  8.011   -56.619 1.00 52.31  ? 368 LYS A O   1 
ATOM   2437  C  CB  . LYS A 1 346 ? 96.206  10.400  -54.833 1.00 50.85  ? 368 LYS A CB  1 
ATOM   2438  C  CG  . LYS A 1 346 ? 96.214  11.412  -53.710 1.00 55.99  ? 368 LYS A CG  1 
ATOM   2439  C  CD  . LYS A 1 346 ? 97.630  11.667  -53.213 1.00 50.29  ? 368 LYS A CD  1 
ATOM   2440  C  CE  . LYS A 1 346 ? 98.470  12.392  -54.209 1.00 50.90  ? 368 LYS A CE  1 
ATOM   2441  N  NZ  . LYS A 1 346 ? 99.900  12.354  -53.823 1.00 74.03  ? 368 LYS A NZ  1 
ATOM   2442  N  N   . PHE A 1 347 ? 94.899  9.986   -57.711 1.00 49.56  ? 369 PHE A N   1 
ATOM   2443  C  CA  . PHE A 1 347 ? 95.067  9.516   -59.092 1.00 49.02  ? 369 PHE A CA  1 
ATOM   2444  C  C   . PHE A 1 347 ? 93.981  8.532   -59.537 1.00 50.23  ? 369 PHE A C   1 
ATOM   2445  O  O   . PHE A 1 347 ? 94.262  7.531   -60.212 1.00 50.63  ? 369 PHE A O   1 
ATOM   2446  C  CB  . PHE A 1 347 ? 96.483  8.962   -59.365 1.00 51.33  ? 369 PHE A CB  1 
ATOM   2447  C  CG  . PHE A 1 347 ? 97.598  9.782   -58.761 1.00 54.15  ? 369 PHE A CG  1 
ATOM   2448  C  CD1 . PHE A 1 347 ? 97.732  11.137  -59.056 1.00 57.24  ? 369 PHE A CD1 1 
ATOM   2449  C  CD2 . PHE A 1 347 ? 98.501  9.210   -57.890 1.00 55.48  ? 369 PHE A CD2 1 
ATOM   2450  C  CE1 . PHE A 1 347 ? 98.743  11.892  -58.489 1.00 57.91  ? 369 PHE A CE1 1 
ATOM   2451  C  CE2 . PHE A 1 347 ? 99.519  9.969   -57.334 1.00 58.17  ? 369 PHE A CE2 1 
ATOM   2452  C  CZ  . PHE A 1 347 ? 99.633  11.301  -57.639 1.00 56.71  ? 369 PHE A CZ  1 
ATOM   2453  N  N   . ALA A 1 348 ? 92.732  8.858   -59.205 1.00 43.01  ? 370 ALA A N   1 
ATOM   2454  C  CA  . ALA A 1 348 ? 91.599  8.065   -59.641 1.00 41.52  ? 370 ALA A CA  1 
ATOM   2455  C  C   . ALA A 1 348 ? 91.277  8.465   -61.085 1.00 45.22  ? 370 ALA A C   1 
ATOM   2456  O  O   . ALA A 1 348 ? 91.541  9.607   -61.500 1.00 44.22  ? 370 ALA A O   1 
ATOM   2457  C  CB  . ALA A 1 348 ? 90.406  8.330   -58.744 1.00 41.52  ? 370 ALA A CB  1 
ATOM   2458  N  N   . GLN A 1 349 ? 90.731  7.507   -61.846 1.00 40.17  ? 371 GLN A N   1 
ATOM   2459  C  CA  . GLN A 1 349 ? 90.372  7.708   -63.235 1.00 39.36  ? 371 GLN A CA  1 
ATOM   2460  C  C   . GLN A 1 349 ? 88.872  7.693   -63.434 1.00 42.18  ? 371 GLN A C   1 
ATOM   2461  O  O   . GLN A 1 349 ? 88.162  6.871   -62.845 1.00 40.82  ? 371 GLN A O   1 
ATOM   2462  C  CB  . GLN A 1 349 ? 91.078  6.710   -64.132 1.00 40.87  ? 371 GLN A CB  1 
ATOM   2463  C  CG  . GLN A 1 349 ? 92.556  6.571   -63.817 1.00 49.89  ? 371 GLN A CG  1 
ATOM   2464  C  CD  . GLN A 1 349 ? 93.215  5.621   -64.758 1.00 75.39  ? 371 GLN A CD  1 
ATOM   2465  O  OE1 . GLN A 1 349 ? 92.702  4.531   -65.033 1.00 75.43  ? 371 GLN A OE1 1 
ATOM   2466  N  NE2 . GLN A 1 349 ? 94.375  6.010   -65.273 1.00 68.55  ? 371 GLN A NE2 1 
ATOM   2467  N  N   . TYR A 1 350 ? 88.402  8.645   -64.246 1.00 39.59  ? 372 TYR A N   1 
ATOM   2468  C  CA  . TYR A 1 350 ? 86.997  8.878   -64.519 1.00 39.61  ? 372 TYR A CA  1 
ATOM   2469  C  C   . TYR A 1 350 ? 86.712  8.894   -66.013 1.00 46.65  ? 372 TYR A C   1 
ATOM   2470  O  O   . TYR A 1 350 ? 87.563  9.330   -66.796 1.00 49.39  ? 372 TYR A O   1 
ATOM   2471  C  CB  . TYR A 1 350 ? 86.589  10.261  -63.968 1.00 39.77  ? 372 TYR A CB  1 
ATOM   2472  C  CG  . TYR A 1 350 ? 86.814  10.490  -62.493 1.00 39.12  ? 372 TYR A CG  1 
ATOM   2473  C  CD1 . TYR A 1 350 ? 88.033  10.948  -62.022 1.00 40.13  ? 372 TYR A CD1 1 
ATOM   2474  C  CD2 . TYR A 1 350 ? 85.768  10.363  -61.580 1.00 38.84  ? 372 TYR A CD2 1 
ATOM   2475  C  CE1 . TYR A 1 350 ? 88.219  11.255  -60.678 1.00 39.93  ? 372 TYR A CE1 1 
ATOM   2476  C  CE2 . TYR A 1 350 ? 85.945  10.655  -60.227 1.00 38.02  ? 372 TYR A CE2 1 
ATOM   2477  C  CZ  . TYR A 1 350 ? 87.170  11.112  -59.780 1.00 41.31  ? 372 TYR A CZ  1 
ATOM   2478  O  OH  . TYR A 1 350 ? 87.350  11.400  -58.438 1.00 35.61  ? 372 TYR A OH  1 
ATOM   2479  N  N   . SER A 1 351 ? 85.487  8.498   -66.398 1.00 41.94  ? 373 SER A N   1 
ATOM   2480  C  CA  . SER A 1 351 ? 84.962  8.572   -67.764 1.00 41.71  ? 373 SER A CA  1 
ATOM   2481  C  C   . SER A 1 351 ? 84.225  9.890   -67.852 1.00 45.20  ? 373 SER A C   1 
ATOM   2482  O  O   . SER A 1 351 ? 83.387  10.156  -66.992 1.00 46.31  ? 373 SER A O   1 
ATOM   2483  C  CB  . SER A 1 351 ? 83.968  7.447   -68.036 1.00 42.92  ? 373 SER A CB  1 
ATOM   2484  O  OG  . SER A 1 351 ? 84.607  6.195   -68.227 1.00 53.63  ? 373 SER A OG  1 
ATOM   2485  N  N   . ILE A 1 352 ? 84.551  10.726  -68.845 1.00 39.35  ? 374 ILE A N   1 
ATOM   2486  C  CA  . ILE A 1 352 ? 83.829  11.965  -69.064 1.00 38.97  ? 374 ILE A CA  1 
ATOM   2487  C  C   . ILE A 1 352 ? 82.627  11.610  -69.994 1.00 44.15  ? 374 ILE A C   1 
ATOM   2488  O  O   . ILE A 1 352 ? 82.777  11.331  -71.194 1.00 44.44  ? 374 ILE A O   1 
ATOM   2489  C  CB  . ILE A 1 352 ? 84.736  13.104  -69.554 1.00 42.44  ? 374 ILE A CB  1 
ATOM   2490  C  CG1 . ILE A 1 352 ? 85.900  13.303  -68.571 1.00 43.71  ? 374 ILE A CG1 1 
ATOM   2491  C  CG2 . ILE A 1 352 ? 83.933  14.399  -69.712 1.00 40.63  ? 374 ILE A CG2 1 
ATOM   2492  C  CD1 . ILE A 1 352 ? 87.253  13.686  -69.192 1.00 53.23  ? 374 ILE A CD1 1 
ATOM   2493  N  N   . MET A 1 353 ? 81.461  11.495  -69.381 1.00 38.45  ? 375 MET A N   1 
ATOM   2494  C  CA  . MET A 1 353 ? 80.236  11.106  -70.037 1.00 37.40  ? 375 MET A CA  1 
ATOM   2495  C  C   . MET A 1 353 ? 79.446  12.316  -70.544 1.00 45.04  ? 375 MET A C   1 
ATOM   2496  O  O   . MET A 1 353 ? 79.371  13.355  -69.868 1.00 47.30  ? 375 MET A O   1 
ATOM   2497  C  CB  . MET A 1 353 ? 79.415  10.288  -69.045 1.00 38.26  ? 375 MET A CB  1 
ATOM   2498  C  CG  . MET A 1 353 ? 80.160  9.083   -68.471 1.00 40.10  ? 375 MET A CG  1 
ATOM   2499  S  SD  . MET A 1 353 ? 80.692  7.860   -69.705 1.00 44.34  ? 375 MET A SD  1 
ATOM   2500  C  CE  . MET A 1 353 ? 79.118  7.615   -70.654 1.00 42.50  ? 375 MET A CE  1 
ATOM   2501  N  N   . ASN A 1 354 ? 78.870  12.194  -71.732 1.00 41.48  ? 376 ASN A N   1 
ATOM   2502  C  CA  . ASN A 1 354 ? 78.052  13.246  -72.335 1.00 42.26  ? 376 ASN A CA  1 
ATOM   2503  C  C   . ASN A 1 354 ? 76.715  12.624  -72.785 1.00 47.66  ? 376 ASN A C   1 
ATOM   2504  O  O   . ASN A 1 354 ? 76.717  11.629  -73.532 1.00 47.37  ? 376 ASN A O   1 
ATOM   2505  C  CB  . ASN A 1 354 ? 78.806  13.927  -73.500 1.00 37.77  ? 376 ASN A CB  1 
ATOM   2506  C  CG  . ASN A 1 354 ? 78.085  15.045  -74.252 1.00 52.33  ? 376 ASN A CG  1 
ATOM   2507  O  OD1 . ASN A 1 354 ? 77.539  15.995  -73.694 1.00 40.29  ? 376 ASN A OD1 1 
ATOM   2508  N  ND2 . ASN A 1 354 ? 78.152  15.017  -75.560 1.00 49.55  ? 376 ASN A ND2 1 
ATOM   2509  N  N   . LEU A 1 355 ? 75.576  13.178  -72.301 1.00 43.83  ? 377 LEU A N   1 
ATOM   2510  C  CA  . LEU A 1 355 ? 74.268  12.644  -72.710 1.00 44.32  ? 377 LEU A CA  1 
ATOM   2511  C  C   . LEU A 1 355 ? 73.920  13.121  -74.124 1.00 50.70  ? 377 LEU A C   1 
ATOM   2512  O  O   . LEU A 1 355 ? 73.607  14.302  -74.314 1.00 51.79  ? 377 LEU A O   1 
ATOM   2513  C  CB  . LEU A 1 355 ? 73.160  12.999  -71.685 1.00 43.74  ? 377 LEU A CB  1 
ATOM   2514  C  CG  . LEU A 1 355 ? 71.785  12.321  -71.832 1.00 47.27  ? 377 LEU A CG  1 
ATOM   2515  C  CD1 . LEU A 1 355 ? 71.851  10.835  -71.651 1.00 44.26  ? 377 LEU A CD1 1 
ATOM   2516  C  CD2 . LEU A 1 355 ? 70.862  12.844  -70.802 1.00 53.11  ? 377 LEU A CD2 1 
ATOM   2517  N  N   . GLN A 1 356 ? 74.051  12.232  -75.125 1.00 47.38  ? 378 GLN A N   1 
ATOM   2518  C  CA  . GLN A 1 356 ? 73.765  12.600  -76.528 1.00 48.69  ? 378 GLN A CA  1 
ATOM   2519  C  C   . GLN A 1 356 ? 72.573  11.796  -77.034 1.00 56.56  ? 378 GLN A C   1 
ATOM   2520  O  O   . GLN A 1 356 ? 72.653  10.555  -77.098 1.00 56.85  ? 378 GLN A O   1 
ATOM   2521  C  CB  . GLN A 1 356 ? 74.963  12.327  -77.429 1.00 49.10  ? 378 GLN A CB  1 
ATOM   2522  C  CG  . GLN A 1 356 ? 76.236  13.009  -77.043 1.00 50.50  ? 378 GLN A CG  1 
ATOM   2523  C  CD  . GLN A 1 356 ? 77.328  12.602  -77.964 1.00 65.72  ? 378 GLN A CD  1 
ATOM   2524  O  OE1 . GLN A 1 356 ? 77.087  12.082  -79.045 1.00 64.46  ? 378 GLN A OE1 1 
ATOM   2525  N  NE2 . GLN A 1 356 ? 78.553  12.855  -77.580 1.00 64.87  ? 378 GLN A NE2 1 
ATOM   2526  N  N   . ASN A 1 357 ? 71.478  12.498  -77.409 1.00 54.90  ? 379 ASN A N   1 
ATOM   2527  C  CA  . ASN A 1 357 ? 70.217  11.889  -77.862 1.00 56.44  ? 379 ASN A CA  1 
ATOM   2528  C  C   . ASN A 1 357 ? 69.764  10.792  -76.863 1.00 60.48  ? 379 ASN A C   1 
ATOM   2529  O  O   . ASN A 1 357 ? 69.601  9.626   -77.215 1.00 61.52  ? 379 ASN A O   1 
ATOM   2530  C  CB  . ASN A 1 357 ? 70.259  11.419  -79.340 1.00 55.07  ? 379 ASN A CB  1 
ATOM   2531  N  N   . ARG A 1 358 ? 69.645  11.183  -75.601 1.00 54.93  ? 380 ARG A N   1 
ATOM   2532  C  CA  . ARG A 1 358 ? 69.206  10.346  -74.479 1.00 54.40  ? 380 ARG A CA  1 
ATOM   2533  C  C   . ARG A 1 358 ? 70.093  9.062   -74.249 1.00 59.24  ? 380 ARG A C   1 
ATOM   2534  O  O   . ARG A 1 358 ? 69.688  8.166   -73.502 1.00 59.31  ? 380 ARG A O   1 
ATOM   2535  C  CB  . ARG A 1 358 ? 67.703  10.017  -74.567 1.00 51.91  ? 380 ARG A CB  1 
ATOM   2536  C  CG  . ARG A 1 358 ? 66.808  11.252  -74.810 1.00 59.28  ? 380 ARG A CG  1 
ATOM   2537  C  CD  . ARG A 1 358 ? 65.930  11.680  -73.639 1.00 73.13  ? 380 ARG A CD  1 
ATOM   2538  N  NE  . ARG A 1 358 ? 66.696  11.909  -72.412 1.00 100.00 ? 380 ARG A NE  1 
ATOM   2539  C  CZ  . ARG A 1 358 ? 66.177  12.362  -71.274 1.00 124.72 ? 380 ARG A CZ  1 
ATOM   2540  N  NH1 . ARG A 1 358 ? 64.884  12.669  -71.199 1.00 113.04 ? 380 ARG A NH1 1 
ATOM   2541  N  NH2 . ARG A 1 358 ? 66.946  12.512  -70.199 1.00 111.12 ? 380 ARG A NH2 1 
ATOM   2542  N  N   . LYS A 1 359 ? 71.346  9.061   -74.775 1.00 53.12  ? 381 LYS A N   1 
ATOM   2543  C  CA  . LYS A 1 359 ? 72.320  7.987   -74.615 1.00 50.55  ? 381 LYS A CA  1 
ATOM   2544  C  C   . LYS A 1 359 ? 73.574  8.543   -73.957 1.00 52.00  ? 381 LYS A C   1 
ATOM   2545  O  O   . LYS A 1 359 ? 74.086  9.599   -74.349 1.00 50.58  ? 381 LYS A O   1 
ATOM   2546  C  CB  . LYS A 1 359 ? 72.660  7.369   -75.987 1.00 53.64  ? 381 LYS A CB  1 
ATOM   2547  N  N   . LEU A 1 360 ? 74.053  7.848   -72.937 1.00 47.95  ? 382 LEU A N   1 
ATOM   2548  C  CA  . LEU A 1 360 ? 75.259  8.252   -72.219 1.00 46.70  ? 382 LEU A CA  1 
ATOM   2549  C  C   . LEU A 1 360 ? 76.486  7.778   -73.014 1.00 51.73  ? 382 LEU A C   1 
ATOM   2550  O  O   . LEU A 1 360 ? 76.864  6.592   -72.956 1.00 51.27  ? 382 LEU A O   1 
ATOM   2551  C  CB  . LEU A 1 360 ? 75.287  7.636   -70.807 1.00 45.08  ? 382 LEU A CB  1 
ATOM   2552  C  CG  . LEU A 1 360 ? 75.069  8.483   -69.590 1.00 47.31  ? 382 LEU A CG  1 
ATOM   2553  C  CD1 . LEU A 1 360 ? 75.760  7.843   -68.420 1.00 44.53  ? 382 LEU A CD1 1 
ATOM   2554  C  CD2 . LEU A 1 360 ? 75.638  9.876   -69.763 1.00 51.58  ? 382 LEU A CD2 1 
ATOM   2555  N  N   . VAL A 1 361 ? 77.108  8.730   -73.741 1.00 48.39  ? 383 VAL A N   1 
ATOM   2556  C  CA  . VAL A 1 361 ? 78.286  8.557   -74.620 1.00 46.83  ? 383 VAL A CA  1 
ATOM   2557  C  C   . VAL A 1 361 ? 79.531  9.060   -73.918 1.00 46.72  ? 383 VAL A C   1 
ATOM   2558  O  O   . VAL A 1 361 ? 79.544  10.229  -73.558 1.00 47.17  ? 383 VAL A O   1 
ATOM   2559  C  CB  . VAL A 1 361 ? 78.068  9.348   -75.946 1.00 50.77  ? 383 VAL A CB  1 
ATOM   2560  C  CG1 . VAL A 1 361 ? 79.337  9.437   -76.787 1.00 50.17  ? 383 VAL A CG1 1 
ATOM   2561  C  CG2 . VAL A 1 361 ? 76.911  8.771   -76.746 1.00 51.40  ? 383 VAL A CG2 1 
ATOM   2562  N  N   . GLN A 1 362 ? 80.578  8.206   -73.757 1.00 40.22  ? 384 GLN A N   1 
ATOM   2563  C  CA  . GLN A 1 362 ? 81.878  8.603   -73.208 1.00 38.99  ? 384 GLN A CA  1 
ATOM   2564  C  C   . GLN A 1 362 ? 82.601  9.458   -74.281 1.00 46.34  ? 384 GLN A C   1 
ATOM   2565  O  O   . GLN A 1 362 ? 82.696  9.074   -75.450 1.00 45.25  ? 384 GLN A O   1 
ATOM   2566  C  CB  . GLN A 1 362 ? 82.739  7.392   -72.827 1.00 38.82  ? 384 GLN A CB  1 
ATOM   2567  C  CG  . GLN A 1 362 ? 84.131  7.785   -72.340 1.00 51.38  ? 384 GLN A CG  1 
ATOM   2568  C  CD  . GLN A 1 362 ? 84.951  6.640   -71.837 1.00 63.72  ? 384 GLN A CD  1 
ATOM   2569  O  OE1 . GLN A 1 362 ? 86.141  6.546   -72.140 1.00 52.58  ? 384 GLN A OE1 1 
ATOM   2570  N  NE2 . GLN A 1 362 ? 84.345  5.774   -71.027 1.00 60.31  ? 384 GLN A NE2 1 
ATOM   2571  N  N   . VAL A 1 363 ? 83.071  10.635  -73.870 1.00 45.13  ? 385 VAL A N   1 
ATOM   2572  C  CA  . VAL A 1 363 ? 83.732  11.611  -74.745 1.00 44.80  ? 385 VAL A CA  1 
ATOM   2573  C  C   . VAL A 1 363 ? 85.234  11.805  -74.329 1.00 51.75  ? 385 VAL A C   1 
ATOM   2574  O  O   . VAL A 1 363 ? 86.001  12.443  -75.017 1.00 53.82  ? 385 VAL A O   1 
ATOM   2575  C  CB  . VAL A 1 363 ? 82.915  12.946  -74.813 1.00 45.77  ? 385 VAL A CB  1 
ATOM   2576  C  CG1 . VAL A 1 363 ? 81.496  12.712  -75.330 1.00 44.00  ? 385 VAL A CG1 1 
ATOM   2577  C  CG2 . VAL A 1 363 ? 82.907  13.689  -73.465 1.00 44.25  ? 385 VAL A CG2 1 
ATOM   2578  N  N   . GLY A 1 364 ? 85.634  11.213  -73.229 1.00 47.97  ? 386 GLY A N   1 
ATOM   2579  C  CA  . GLY A 1 364 ? 87.005  11.316  -72.764 1.00 47.62  ? 386 GLY A CA  1 
ATOM   2580  C  C   . GLY A 1 364 ? 87.223  10.651  -71.417 1.00 50.10  ? 386 GLY A C   1 
ATOM   2581  O  O   . GLY A 1 364 ? 86.317  10.006  -70.867 1.00 47.53  ? 386 GLY A O   1 
ATOM   2582  N  N   . ILE A 1 365 ? 88.458  10.771  -70.908 1.00 46.26  ? 387 ILE A N   1 
ATOM   2583  C  CA  . ILE A 1 365 ? 88.882  10.192  -69.641 1.00 44.51  ? 387 ILE A CA  1 
ATOM   2584  C  C   . ILE A 1 365 ? 89.761  11.147  -68.871 1.00 45.95  ? 387 ILE A C   1 
ATOM   2585  O  O   . ILE A 1 365 ? 90.571  11.861  -69.471 1.00 47.29  ? 387 ILE A O   1 
ATOM   2586  C  CB  . ILE A 1 365 ? 89.542  8.773   -69.774 1.00 47.73  ? 387 ILE A CB  1 
ATOM   2587  C  CG1 . ILE A 1 365 ? 90.967  8.812   -70.272 1.00 50.13  ? 387 ILE A CG1 1 
ATOM   2588  C  CG2 . ILE A 1 365 ? 88.743  7.794   -70.575 1.00 48.72  ? 387 ILE A CG2 1 
ATOM   2589  C  CD1 . ILE A 1 365 ? 91.835  8.094   -69.369 1.00 57.07  ? 387 ILE A CD1 1 
ATOM   2590  N  N   . PHE A 1 366 ? 89.607  11.166  -67.545 1.00 40.50  ? 388 PHE A N   1 
ATOM   2591  C  CA  . PHE A 1 366 ? 90.515  11.910  -66.687 1.00 41.13  ? 388 PHE A CA  1 
ATOM   2592  C  C   . PHE A 1 366 ? 91.402  10.809  -66.144 1.00 47.79  ? 388 PHE A C   1 
ATOM   2593  O  O   . PHE A 1 366 ? 90.947  9.982   -65.365 1.00 46.47  ? 388 PHE A O   1 
ATOM   2594  C  CB  . PHE A 1 366 ? 89.786  12.655  -65.579 1.00 41.70  ? 388 PHE A CB  1 
ATOM   2595  C  CG  . PHE A 1 366 ? 90.758  13.409  -64.723 1.00 41.87  ? 388 PHE A CG  1 
ATOM   2596  C  CD1 . PHE A 1 366 ? 91.273  14.632  -65.140 1.00 46.50  ? 388 PHE A CD1 1 
ATOM   2597  C  CD2 . PHE A 1 366 ? 91.168  12.900  -63.505 1.00 42.36  ? 388 PHE A CD2 1 
ATOM   2598  C  CE1 . PHE A 1 366 ? 92.194  15.330  -64.352 1.00 48.36  ? 388 PHE A CE1 1 
ATOM   2599  C  CE2 . PHE A 1 366 ? 92.088  13.594  -62.714 1.00 46.94  ? 388 PHE A CE2 1 
ATOM   2600  C  CZ  . PHE A 1 366 ? 92.605  14.802  -63.147 1.00 46.69  ? 388 PHE A CZ  1 
ATOM   2601  N  N   . ASN A 1 367 ? 92.633  10.725  -66.651 1.00 48.07  ? 389 ASN A N   1 
ATOM   2602  C  CA  . ASN A 1 367 ? 93.563  9.617   -66.396 1.00 48.28  ? 389 ASN A CA  1 
ATOM   2603  C  C   . ASN A 1 367 ? 94.213  9.601   -65.021 1.00 53.40  ? 389 ASN A C   1 
ATOM   2604  O  O   . ASN A 1 367 ? 95.032  8.726   -64.755 1.00 56.50  ? 389 ASN A O   1 
ATOM   2605  C  CB  . ASN A 1 367 ? 94.643  9.558   -67.504 1.00 49.57  ? 389 ASN A CB  1 
ATOM   2606  C  CG  . ASN A 1 367 ? 95.853  10.408  -67.264 1.00 67.51  ? 389 ASN A CG  1 
ATOM   2607  O  OD1 . ASN A 1 367 ? 95.793  11.429  -66.551 1.00 50.01  ? 389 ASN A OD1 1 
ATOM   2608  N  ND2 . ASN A 1 367 ? 96.965  9.967   -67.868 1.00 68.58  ? 389 ASN A ND2 1 
ATOM   2609  N  N   . GLY A 1 368 ? 93.869  10.549  -64.176 1.00 47.31  ? 390 GLY A N   1 
ATOM   2610  C  CA  . GLY A 1 368 ? 94.436  10.644  -62.846 1.00 45.86  ? 390 GLY A CA  1 
ATOM   2611  C  C   . GLY A 1 368 ? 95.123  11.968  -62.630 1.00 51.62  ? 390 GLY A C   1 
ATOM   2612  O  O   . GLY A 1 368 ? 95.310  12.394  -61.483 1.00 53.65  ? 390 GLY A O   1 
ATOM   2613  N  N   . SER A 1 369 ? 95.440  12.654  -63.729 1.00 48.02  ? 391 SER A N   1 
ATOM   2614  C  CA  . SER A 1 369 ? 96.110  13.943  -63.703 1.00 48.69  ? 391 SER A CA  1 
ATOM   2615  C  C   . SER A 1 369 ? 95.778  14.842  -64.905 1.00 56.46  ? 391 SER A C   1 
ATOM   2616  O  O   . SER A 1 369 ? 95.812  16.073  -64.773 1.00 58.21  ? 391 SER A O   1 
ATOM   2617  C  CB  . SER A 1 369 ? 97.614  13.733  -63.596 1.00 50.47  ? 391 SER A CB  1 
ATOM   2618  O  OG  . SER A 1 369 ? 98.088  12.927  -64.660 1.00 60.54  ? 391 SER A OG  1 
ATOM   2619  N  N   . TYR A 1 370 ? 95.456  14.229  -66.068 1.00 54.47  ? 392 TYR A N   1 
ATOM   2620  C  CA  . TYR A 1 370 ? 95.221  14.912  -67.347 1.00 55.97  ? 392 TYR A CA  1 
ATOM   2621  C  C   . TYR A 1 370 ? 93.876  14.496  -67.969 1.00 59.73  ? 392 TYR A C   1 
ATOM   2622  O  O   . TYR A 1 370 ? 93.403  13.373  -67.740 1.00 58.98  ? 392 TYR A O   1 
ATOM   2623  C  CB  . TYR A 1 370 ? 96.363  14.480  -68.298 1.00 58.95  ? 392 TYR A CB  1 
ATOM   2624  C  CG  . TYR A 1 370 ? 97.044  15.511  -69.174 1.00 64.65  ? 392 TYR A CG  1 
ATOM   2625  C  CD1 . TYR A 1 370 ? 98.080  16.296  -68.678 1.00 67.70  ? 392 TYR A CD1 1 
ATOM   2626  C  CD2 . TYR A 1 370 ? 96.813  15.542  -70.555 1.00 67.09  ? 392 TYR A CD2 1 
ATOM   2627  C  CE1 . TYR A 1 370 ? 98.793  17.170  -69.510 1.00 72.71  ? 392 TYR A CE1 1 
ATOM   2628  C  CE2 . TYR A 1 370 ? 97.502  16.425  -71.394 1.00 69.72  ? 392 TYR A CE2 1 
ATOM   2629  C  CZ  . TYR A 1 370 ? 98.502  17.232  -70.871 1.00 78.52  ? 392 TYR A CZ  1 
ATOM   2630  O  OH  . TYR A 1 370 ? 99.214  18.085  -71.700 1.00 74.64  ? 392 TYR A OH  1 
ATOM   2631  N  N   . ILE A 1 371 ? 93.276  15.398  -68.784 1.00 56.26  ? 393 ILE A N   1 
ATOM   2632  C  CA  . ILE A 1 371 ? 92.052  15.106  -69.538 1.00 55.10  ? 393 ILE A CA  1 
ATOM   2633  C  C   . ILE A 1 371 ? 92.442  14.636  -70.946 1.00 59.28  ? 393 ILE A C   1 
ATOM   2634  O  O   . ILE A 1 371 ? 93.126  15.363  -71.675 1.00 60.95  ? 393 ILE A O   1 
ATOM   2635  C  CB  . ILE A 1 371 ? 91.044  16.287  -69.579 1.00 57.90  ? 393 ILE A CB  1 
ATOM   2636  C  CG1 . ILE A 1 371 ? 90.399  16.476  -68.197 1.00 56.90  ? 393 ILE A CG1 1 
ATOM   2637  C  CG2 . ILE A 1 371 ? 89.983  16.064  -70.689 1.00 57.51  ? 393 ILE A CG2 1 
ATOM   2638  C  CD1 . ILE A 1 371 ? 89.267  17.486  -68.129 1.00 64.76  ? 393 ILE A CD1 1 
ATOM   2639  N  N   . ILE A 1 372 ? 91.992  13.438  -71.327 1.00 53.01  ? 394 ILE A N   1 
ATOM   2640  C  CA  . ILE A 1 372 ? 92.275  12.875  -72.643 1.00 52.00  ? 394 ILE A CA  1 
ATOM   2641  C  C   . ILE A 1 372 ? 90.974  12.779  -73.377 1.00 51.88  ? 394 ILE A C   1 
ATOM   2642  O  O   . ILE A 1 372 ? 90.182  11.907  -73.063 1.00 51.83  ? 394 ILE A O   1 
ATOM   2643  C  CB  . ILE A 1 372 ? 92.959  11.488  -72.554 1.00 54.78  ? 394 ILE A CB  1 
ATOM   2644  C  CG1 . ILE A 1 372 ? 94.131  11.493  -71.535 1.00 57.02  ? 394 ILE A CG1 1 
ATOM   2645  C  CG2 . ILE A 1 372 ? 93.405  11.045  -73.924 1.00 53.85  ? 394 ILE A CG2 1 
ATOM   2646  C  CD1 . ILE A 1 372 ? 94.596  10.129  -71.077 1.00 69.92  ? 394 ILE A CD1 1 
ATOM   2647  N  N   . GLN A 1 373 ? 90.742  13.661  -74.351 1.00 46.63  ? 395 GLN A N   1 
ATOM   2648  C  CA  . GLN A 1 373 ? 89.525  13.643  -75.174 1.00 45.50  ? 395 GLN A CA  1 
ATOM   2649  C  C   . GLN A 1 373 ? 89.579  12.508  -76.174 1.00 53.50  ? 395 GLN A C   1 
ATOM   2650  O  O   . GLN A 1 373 ? 90.649  12.233  -76.693 1.00 57.18  ? 395 GLN A O   1 
ATOM   2651  C  CB  . GLN A 1 373 ? 89.344  14.963  -75.924 1.00 46.13  ? 395 GLN A CB  1 
ATOM   2652  C  CG  . GLN A 1 373 ? 89.131  16.156  -75.015 1.00 45.36  ? 395 GLN A CG  1 
ATOM   2653  C  CD  . GLN A 1 373 ? 88.345  17.228  -75.711 1.00 62.59  ? 395 GLN A CD  1 
ATOM   2654  O  OE1 . GLN A 1 373 ? 87.209  16.990  -76.167 1.00 65.63  ? 395 GLN A OE1 1 
ATOM   2655  N  NE2 . GLN A 1 373 ? 88.936  18.428  -75.824 1.00 38.24  ? 395 GLN A NE2 1 
ATOM   2656  N  N   . ASN A 1 374 ? 88.459  11.833  -76.433 1.00 49.76  ? 396 ASN A N   1 
ATOM   2657  C  CA  . ASN A 1 374 ? 88.407  10.764  -77.442 1.00 49.61  ? 396 ASN A CA  1 
ATOM   2658  C  C   . ASN A 1 374 ? 87.818  11.317  -78.728 1.00 54.58  ? 396 ASN A C   1 
ATOM   2659  O  O   . ASN A 1 374 ? 87.285  12.431  -78.704 1.00 53.63  ? 396 ASN A O   1 
ATOM   2660  C  CB  . ASN A 1 374 ? 87.641  9.524   -76.960 1.00 45.69  ? 396 ASN A CB  1 
ATOM   2661  C  CG  . ASN A 1 374 ? 86.161  9.702   -76.738 1.00 57.86  ? 396 ASN A CG  1 
ATOM   2662  O  OD1 . ASN A 1 374 ? 85.491  10.570  -77.332 1.00 46.77  ? 396 ASN A OD1 1 
ATOM   2663  N  ND2 . ASN A 1 374 ? 85.626  8.890   -75.845 1.00 46.74  ? 396 ASN A ND2 1 
ATOM   2664  N  N   . ASP A 1 375 ? 87.851  10.520  -79.824 1.00 52.70  ? 397 ASP A N   1 
ATOM   2665  C  CA  . ASP A 1 375 ? 87.339  10.939  -81.137 1.00 53.79  ? 397 ASP A CA  1 
ATOM   2666  C  C   . ASP A 1 375 ? 85.811  11.175  -81.228 1.00 55.73  ? 397 ASP A C   1 
ATOM   2667  O  O   . ASP A 1 375 ? 85.368  11.579  -82.299 1.00 53.99  ? 397 ASP A O   1 
ATOM   2668  C  CB  . ASP A 1 375 ? 87.802  9.972   -82.219 1.00 57.04  ? 397 ASP A CB  1 
ATOM   2669  C  CG  . ASP A 1 375 ? 89.286  10.130  -82.549 1.00 79.49  ? 397 ASP A CG  1 
ATOM   2670  O  OD1 . ASP A 1 375 ? 90.090  10.415  -81.599 1.00 80.97  ? 397 ASP A OD1 1 
ATOM   2671  O  OD2 . ASP A 1 375 ? 89.657  9.953   -83.754 1.00 85.52  ? 397 ASP A OD2 1 
ATOM   2672  N  N   . ARG A 1 376 ? 85.019  10.986  -80.107 1.00 52.92  ? 398 ARG A N   1 
ATOM   2673  C  CA  . ARG A 1 376 ? 83.552  11.235  -80.054 1.00 52.71  ? 398 ARG A CA  1 
ATOM   2674  C  C   . ARG A 1 376 ? 83.324  12.699  -79.716 1.00 56.08  ? 398 ARG A C   1 
ATOM   2675  O  O   . ARG A 1 376 ? 83.821  13.151  -78.695 1.00 57.30  ? 398 ARG A O   1 
ATOM   2676  C  CB  . ARG A 1 376 ? 82.795  10.343  -79.018 1.00 51.87  ? 398 ARG A CB  1 
ATOM   2677  C  CG  . ARG A 1 376 ? 82.660  8.833   -79.317 1.00 68.14  ? 398 ARG A CG  1 
ATOM   2678  C  CD  . ARG A 1 376 ? 81.947  8.474   -80.631 1.00 91.64  ? 398 ARG A CD  1 
ATOM   2679  N  NE  . ARG A 1 376 ? 80.624  9.098   -80.754 1.00 106.28 ? 398 ARG A NE  1 
ATOM   2680  C  CZ  . ARG A 1 376 ? 79.489  8.550   -80.326 1.00 120.74 ? 398 ARG A CZ  1 
ATOM   2681  N  NH1 . ARG A 1 376 ? 79.496  7.354   -79.747 1.00 109.99 ? 398 ARG A NH1 1 
ATOM   2682  N  NH2 . ARG A 1 376 ? 78.336  9.194   -80.477 1.00 101.15 ? 398 ARG A NH2 1 
ATOM   2683  N  N   . LYS A 1 377 ? 82.614  13.445  -80.574 1.00 52.19  ? 399 LYS A N   1 
ATOM   2684  C  CA  . LYS A 1 377 ? 82.367  14.868  -80.376 1.00 51.76  ? 399 LYS A CA  1 
ATOM   2685  C  C   . LYS A 1 377 ? 81.348  15.153  -79.298 1.00 56.58  ? 399 LYS A C   1 
ATOM   2686  O  O   . LYS A 1 377 ? 80.350  14.449  -79.200 1.00 57.80  ? 399 LYS A O   1 
ATOM   2687  C  CB  . LYS A 1 377 ? 81.999  15.577  -81.684 1.00 53.44  ? 399 LYS A CB  1 
ATOM   2688  C  CG  . LYS A 1 377 ? 82.460  17.020  -81.647 1.00 64.40  ? 399 LYS A CG  1 
ATOM   2689  C  CD  . LYS A 1 377 ? 81.345  17.969  -81.919 1.00 88.53  ? 399 LYS A CD  1 
ATOM   2690  C  CE  . LYS A 1 377 ? 81.452  18.577  -83.320 1.00 116.87 ? 399 LYS A CE  1 
ATOM   2691  N  NZ  . LYS A 1 377 ? 81.065  17.639  -84.419 1.00 126.49 ? 399 LYS A NZ  1 
ATOM   2692  N  N   . ILE A 1 378 ? 81.598  16.187  -78.475 1.00 51.89  ? 400 ILE A N   1 
ATOM   2693  C  CA  . ILE A 1 378 ? 80.662  16.624  -77.441 1.00 49.63  ? 400 ILE A CA  1 
ATOM   2694  C  C   . ILE A 1 378 ? 79.515  17.407  -78.100 1.00 57.70  ? 400 ILE A C   1 
ATOM   2695  O  O   . ILE A 1 378 ? 79.764  18.341  -78.872 1.00 61.65  ? 400 ILE A O   1 
ATOM   2696  C  CB  . ILE A 1 378 ? 81.338  17.476  -76.348 1.00 50.19  ? 400 ILE A CB  1 
ATOM   2697  C  CG1 . ILE A 1 378 ? 82.356  16.637  -75.561 1.00 50.03  ? 400 ILE A CG1 1 
ATOM   2698  C  CG2 . ILE A 1 378 ? 80.287  18.093  -75.426 1.00 47.38  ? 400 ILE A CG2 1 
ATOM   2699  C  CD1 . ILE A 1 378 ? 83.435  17.429  -74.720 1.00 55.22  ? 400 ILE A CD1 1 
ATOM   2700  N  N   . ILE A 1 379 ? 78.271  17.021  -77.794 1.00 51.28  ? 401 ILE A N   1 
ATOM   2701  C  CA  . ILE A 1 379 ? 77.090  17.759  -78.191 1.00 50.96  ? 401 ILE A CA  1 
ATOM   2702  C  C   . ILE A 1 379 ? 76.706  18.518  -76.912 1.00 58.28  ? 401 ILE A C   1 
ATOM   2703  O  O   . ILE A 1 379 ? 76.482  17.897  -75.873 1.00 57.21  ? 401 ILE A O   1 
ATOM   2704  C  CB  . ILE A 1 379 ? 75.988  16.834  -78.740 1.00 52.23  ? 401 ILE A CB  1 
ATOM   2705  C  CG1 . ILE A 1 379 ? 76.325  16.381  -80.147 1.00 51.65  ? 401 ILE A CG1 1 
ATOM   2706  C  CG2 . ILE A 1 379 ? 74.626  17.503  -78.699 1.00 53.19  ? 401 ILE A CG2 1 
ATOM   2707  C  CD1 . ILE A 1 379 ? 75.782  15.034  -80.478 1.00 52.90  ? 401 ILE A CD1 1 
ATOM   2708  N  N   . TRP A 1 380 ? 76.729  19.849  -76.962 1.00 58.41  ? 402 TRP A N   1 
ATOM   2709  C  CA  . TRP A 1 380 ? 76.423  20.677  -75.798 1.00 59.22  ? 402 TRP A CA  1 
ATOM   2710  C  C   . TRP A 1 380 ? 74.913  20.859  -75.731 1.00 64.67  ? 402 TRP A C   1 
ATOM   2711  O  O   . TRP A 1 380 ? 74.286  20.667  -76.765 1.00 63.39  ? 402 TRP A O   1 
ATOM   2712  C  CB  . TRP A 1 380 ? 77.139  22.044  -75.935 1.00 59.52  ? 402 TRP A CB  1 
ATOM   2713  C  CG  . TRP A 1 380 ? 78.630  21.917  -76.017 1.00 60.09  ? 402 TRP A CG  1 
ATOM   2714  C  CD1 . TRP A 1 380 ? 79.389  21.946  -77.147 1.00 63.67  ? 402 TRP A CD1 1 
ATOM   2715  C  CD2 . TRP A 1 380 ? 79.525  21.597  -74.941 1.00 58.65  ? 402 TRP A CD2 1 
ATOM   2716  N  NE1 . TRP A 1 380 ? 80.710  21.702  -76.839 1.00 62.35  ? 402 TRP A NE1 1 
ATOM   2717  C  CE2 . TRP A 1 380 ? 80.825  21.502  -75.489 1.00 62.21  ? 402 TRP A CE2 1 
ATOM   2718  C  CE3 . TRP A 1 380 ? 79.362  21.411  -73.559 1.00 59.00  ? 402 TRP A CE3 1 
ATOM   2719  C  CZ2 . TRP A 1 380 ? 81.956  21.215  -74.705 1.00 60.06  ? 402 TRP A CZ2 1 
ATOM   2720  C  CZ3 . TRP A 1 380 ? 80.482  21.122  -72.786 1.00 59.22  ? 402 TRP A CZ3 1 
ATOM   2721  C  CH2 . TRP A 1 380 ? 81.762  21.037  -73.363 1.00 59.56  ? 402 TRP A CH2 1 
ATOM   2722  N  N   . PRO A 1 381 ? 74.293  21.217  -74.566 1.00 63.17  ? 403 PRO A N   1 
ATOM   2723  C  CA  . PRO A 1 381 ? 72.841  21.495  -74.562 1.00 65.38  ? 403 PRO A CA  1 
ATOM   2724  C  C   . PRO A 1 381 ? 72.483  22.360  -75.787 1.00 77.04  ? 403 PRO A C   1 
ATOM   2725  O  O   . PRO A 1 381 ? 72.981  23.479  -75.877 1.00 79.55  ? 403 PRO A O   1 
ATOM   2726  C  CB  . PRO A 1 381 ? 72.656  22.236  -73.234 1.00 66.71  ? 403 PRO A CB  1 
ATOM   2727  C  CG  . PRO A 1 381 ? 73.695  21.659  -72.347 1.00 68.32  ? 403 PRO A CG  1 
ATOM   2728  C  CD  . PRO A 1 381 ? 74.886  21.474  -73.234 1.00 63.30  ? 403 PRO A CD  1 
ATOM   2729  N  N   . GLY A 1 382 ? 71.760  21.775  -76.765 1.00 76.15  ? 404 GLY A N   1 
ATOM   2730  C  CA  . GLY A 1 382 ? 71.487  22.328  -78.096 1.00 77.45  ? 404 GLY A CA  1 
ATOM   2731  C  C   . GLY A 1 382 ? 72.369  21.640  -79.156 1.00 81.42  ? 404 GLY A C   1 
ATOM   2732  O  O   . GLY A 1 382 ? 72.082  20.501  -79.555 1.00 77.43  ? 404 GLY A O   1 
ATOM   2733  N  N   . GLY A 1 383 ? 73.485  22.305  -79.552 1.00 81.05  ? 405 GLY A N   1 
ATOM   2734  C  CA  . GLY A 1 383 ? 74.476  21.835  -80.542 1.00 81.47  ? 405 GLY A CA  1 
ATOM   2735  C  C   . GLY A 1 383 ? 75.966  21.951  -80.166 1.00 85.87  ? 405 GLY A C   1 
ATOM   2736  O  O   . GLY A 1 383 ? 76.511  20.991  -79.611 1.00 83.06  ? 405 GLY A O   1 
ATOM   2737  N  N   . GLU A 1 384 ? 76.675  23.117  -80.484 1.00 84.63  ? 406 GLU A N   1 
ATOM   2738  C  CA  . GLU A 1 384 ? 78.121  23.335  -80.138 1.00 83.73  ? 406 GLU A CA  1 
ATOM   2739  C  C   . GLU A 1 384 ? 78.556  24.775  -79.641 1.00 88.69  ? 406 GLU A C   1 
ATOM   2740  O  O   . GLU A 1 384 ? 79.469  25.365  -80.230 1.00 89.13  ? 406 GLU A O   1 
ATOM   2741  C  CB  . GLU A 1 384 ? 79.054  22.920  -81.276 1.00 84.87  ? 406 GLU A CB  1 
ATOM   2742  C  CG  . GLU A 1 384 ? 79.541  21.502  -81.129 1.00 87.87  ? 406 GLU A CG  1 
ATOM   2743  C  CD  . GLU A 1 384 ? 78.767  20.541  -82.007 1.00 100.91 ? 406 GLU A CD  1 
ATOM   2744  O  OE1 . GLU A 1 384 ? 78.666  20.802  -83.227 1.00 87.41  ? 406 GLU A OE1 1 
ATOM   2745  O  OE2 . GLU A 1 384 ? 78.312  19.497  -81.488 1.00 92.54  ? 406 GLU A OE2 1 
ATOM   2746  N  N   . THR A 1 385 ? 77.986  25.256  -78.492 1.00 84.71  ? 407 THR A N   1 
ATOM   2747  C  CA  . THR A 1 385 ? 78.229  26.530  -77.758 1.00 96.49  ? 407 THR A CA  1 
ATOM   2748  C  C   . THR A 1 385 ? 78.021  27.810  -78.587 1.00 119.46 ? 407 THR A C   1 
ATOM   2749  O  O   . THR A 1 385 ? 77.890  28.903  -78.017 1.00 76.73  ? 407 THR A O   1 
ATOM   2750  C  CB  . THR A 1 385 ? 79.608  26.577  -77.051 1.00 99.80  ? 407 THR A CB  1 
ATOM   2751  O  OG1 . THR A 1 385 ? 80.596  25.907  -77.838 1.00 99.07  ? 407 THR A OG1 1 
ATOM   2752  C  CG2 . THR A 1 385 ? 79.570  26.041  -75.589 1.00 91.73  ? 407 THR A CG2 1 
ATOM   2753  N  N   . PRO B 2 2   ? 48.591  2.545   -11.688 1.00 99.06  ? 32  PRO B N   1 
ATOM   2754  C  CA  . PRO B 2 2   ? 49.320  2.931   -12.904 1.00 96.24  ? 32  PRO B CA  1 
ATOM   2755  C  C   . PRO B 2 2   ? 50.124  1.795   -13.561 1.00 97.37  ? 32  PRO B C   1 
ATOM   2756  O  O   . PRO B 2 2   ? 50.623  0.904   -12.865 1.00 97.08  ? 32  PRO B O   1 
ATOM   2757  C  CB  . PRO B 2 2   ? 50.243  4.062   -12.419 1.00 96.86  ? 32  PRO B CB  1 
ATOM   2758  C  CG  . PRO B 2 2   ? 50.458  3.799   -10.957 1.00 102.19 ? 32  PRO B CG  1 
ATOM   2759  C  CD  . PRO B 2 2   ? 49.348  2.882   -10.463 1.00 100.48 ? 32  PRO B CD  1 
ATOM   2760  N  N   . PRO B 2 3   ? 50.315  1.832   -14.899 1.00 91.32  ? 33  PRO B N   1 
ATOM   2761  C  CA  . PRO B 2 3   ? 51.161  0.816   -15.555 1.00 88.85  ? 33  PRO B CA  1 
ATOM   2762  C  C   . PRO B 2 3   ? 52.644  0.950   -15.155 1.00 89.32  ? 33  PRO B C   1 
ATOM   2763  O  O   . PRO B 2 3   ? 53.050  1.979   -14.599 1.00 90.16  ? 33  PRO B O   1 
ATOM   2764  C  CB  . PRO B 2 3   ? 50.957  1.103   -17.044 1.00 89.74  ? 33  PRO B CB  1 
ATOM   2765  C  CG  . PRO B 2 3   ? 50.629  2.545   -17.101 1.00 95.01  ? 33  PRO B CG  1 
ATOM   2766  C  CD  . PRO B 2 3   ? 49.833  2.836   -15.868 1.00 93.00  ? 33  PRO B CD  1 
ATOM   2767  N  N   . SER B 2 4   ? 53.443  -0.091  -15.402 1.00 81.24  ? 34  SER B N   1 
ATOM   2768  C  CA  . SER B 2 4   ? 54.848  -0.035  -15.025 1.00 78.58  ? 34  SER B CA  1 
ATOM   2769  C  C   . SER B 2 4   ? 55.779  0.050   -16.226 1.00 80.35  ? 34  SER B C   1 
ATOM   2770  O  O   . SER B 2 4   ? 55.439  -0.453  -17.311 1.00 80.91  ? 34  SER B O   1 
ATOM   2771  C  CB  . SER B 2 4   ? 55.226  -1.214  -14.131 1.00 82.04  ? 34  SER B CB  1 
ATOM   2772  N  N   . ILE B 2 5   ? 56.953  0.697   -16.034 1.00 72.17  ? 35  ILE B N   1 
ATOM   2773  C  CA  . ILE B 2 5   ? 57.985  0.828   -17.055 1.00 68.58  ? 35  ILE B CA  1 
ATOM   2774  C  C   . ILE B 2 5   ? 59.265  0.249   -16.531 1.00 72.56  ? 35  ILE B C   1 
ATOM   2775  O  O   . ILE B 2 5   ? 59.628  0.503   -15.385 1.00 73.16  ? 35  ILE B O   1 
ATOM   2776  C  CB  . ILE B 2 5   ? 58.157  2.250   -17.662 1.00 70.07  ? 35  ILE B CB  1 
ATOM   2777  C  CG1 . ILE B 2 5   ? 58.405  3.338   -16.612 1.00 69.25  ? 35  ILE B CG1 1 
ATOM   2778  C  CG2 . ILE B 2 5   ? 56.977  2.605   -18.553 1.00 73.69  ? 35  ILE B CG2 1 
ATOM   2779  C  CD1 . ILE B 2 5   ? 59.179  4.527   -17.154 1.00 65.73  ? 35  ILE B CD1 1 
ATOM   2780  N  N   . GLY B 2 6   ? 59.922  -0.555  -17.351 1.00 67.81  ? 36  GLY B N   1 
ATOM   2781  C  CA  . GLY B 2 6   ? 61.186  -1.172  -16.981 1.00 66.01  ? 36  GLY B CA  1 
ATOM   2782  C  C   . GLY B 2 6   ? 62.354  -0.253  -17.252 1.00 65.48  ? 36  GLY B C   1 
ATOM   2783  O  O   . GLY B 2 6   ? 62.541  0.163   -18.391 1.00 62.47  ? 36  GLY B O   1 
ATOM   2784  N  N   . ILE B 2 7   ? 63.123  0.091   -16.196 1.00 61.72  ? 37  ILE B N   1 
ATOM   2785  C  CA  . ILE B 2 7   ? 64.318  0.953   -16.259 1.00 59.51  ? 37  ILE B CA  1 
ATOM   2786  C  C   . ILE B 2 7   ? 65.548  0.163   -15.756 1.00 62.99  ? 37  ILE B C   1 
ATOM   2787  O  O   . ILE B 2 7   ? 65.532  -0.337  -14.633 1.00 64.05  ? 37  ILE B O   1 
ATOM   2788  C  CB  . ILE B 2 7   ? 64.134  2.326   -15.521 1.00 62.09  ? 37  ILE B CB  1 
ATOM   2789  C  CG1 . ILE B 2 7   ? 62.932  3.120   -16.079 1.00 61.93  ? 37  ILE B CG1 1 
ATOM   2790  C  CG2 . ILE B 2 7   ? 65.426  3.165   -15.567 1.00 61.62  ? 37  ILE B CG2 1 
ATOM   2791  C  CD1 . ILE B 2 7   ? 62.555  4.347   -15.270 1.00 64.18  ? 37  ILE B CD1 1 
ATOM   2792  N  N   . ALA B 2 8   ? 66.594  0.035   -16.598 1.00 56.98  ? 38  ALA B N   1 
ATOM   2793  C  CA  . ALA B 2 8   ? 67.815  -0.666  -16.219 1.00 55.33  ? 38  ALA B CA  1 
ATOM   2794  C  C   . ALA B 2 8   ? 68.883  0.352   -15.826 1.00 60.34  ? 38  ALA B C   1 
ATOM   2795  O  O   . ALA B 2 8   ? 69.142  1.297   -16.582 1.00 60.77  ? 38  ALA B O   1 
ATOM   2796  C  CB  . ALA B 2 8   ? 68.308  -1.527  -17.363 1.00 54.64  ? 38  ALA B CB  1 
ATOM   2797  N  N   . VAL B 2 9   ? 69.476  0.177   -14.633 1.00 55.31  ? 39  VAL B N   1 
ATOM   2798  C  CA  . VAL B 2 9   ? 70.532  1.048   -14.133 1.00 53.09  ? 39  VAL B CA  1 
ATOM   2799  C  C   . VAL B 2 9   ? 71.847  0.260   -14.200 1.00 53.10  ? 39  VAL B C   1 
ATOM   2800  O  O   . VAL B 2 9   ? 72.131  -0.551  -13.319 1.00 51.58  ? 39  VAL B O   1 
ATOM   2801  C  CB  . VAL B 2 9   ? 70.250  1.641   -12.717 1.00 58.35  ? 39  VAL B CB  1 
ATOM   2802  C  CG1 . VAL B 2 9   ? 71.421  2.499   -12.235 1.00 57.97  ? 39  VAL B CG1 1 
ATOM   2803  C  CG2 . VAL B 2 9   ? 68.954  2.446   -12.689 1.00 58.73  ? 39  VAL B CG2 1 
ATOM   2804  N  N   . ILE B 2 10  ? 72.634  0.497   -15.265 1.00 47.97  ? 40  ILE B N   1 
ATOM   2805  C  CA  . ILE B 2 10  ? 73.920  -0.156  -15.456 1.00 46.35  ? 40  ILE B CA  1 
ATOM   2806  C  C   . ILE B 2 10  ? 74.994  0.628   -14.726 1.00 54.01  ? 40  ILE B C   1 
ATOM   2807  O  O   . ILE B 2 10  ? 75.160  1.831   -14.957 1.00 54.90  ? 40  ILE B O   1 
ATOM   2808  C  CB  . ILE B 2 10  ? 74.240  -0.422  -16.944 1.00 47.65  ? 40  ILE B CB  1 
ATOM   2809  C  CG1 . ILE B 2 10  ? 73.161  -1.321  -17.575 1.00 48.00  ? 40  ILE B CG1 1 
ATOM   2810  C  CG2 . ILE B 2 10  ? 75.615  -1.095  -17.086 1.00 48.62  ? 40  ILE B CG2 1 
ATOM   2811  C  CD1 . ILE B 2 10  ? 73.063  -1.248  -19.028 1.00 48.27  ? 40  ILE B CD1 1 
ATOM   2812  N  N   . LEU B 2 11  ? 75.720  -0.066  -13.832 1.00 52.13  ? 41  LEU B N   1 
ATOM   2813  C  CA  . LEU B 2 11  ? 76.787  0.517   -13.026 1.00 51.77  ? 41  LEU B CA  1 
ATOM   2814  C  C   . LEU B 2 11  ? 78.118  -0.185  -13.246 1.00 57.36  ? 41  LEU B C   1 
ATOM   2815  O  O   . LEU B 2 11  ? 78.383  -1.253  -12.674 1.00 55.18  ? 41  LEU B O   1 
ATOM   2816  C  CB  . LEU B 2 11  ? 76.426  0.532   -11.524 1.00 52.49  ? 41  LEU B CB  1 
ATOM   2817  C  CG  . LEU B 2 11  ? 75.167  1.249   -11.102 1.00 56.23  ? 41  LEU B CG  1 
ATOM   2818  C  CD1 . LEU B 2 11  ? 74.622  0.661   -9.812  1.00 55.81  ? 41  LEU B CD1 1 
ATOM   2819  C  CD2 . LEU B 2 11  ? 75.378  2.771   -11.052 1.00 59.04  ? 41  LEU B CD2 1 
ATOM   2820  N  N   . VAL B 2 12  ? 78.963  0.433   -14.080 1.00 57.66  ? 42  VAL B N   1 
ATOM   2821  C  CA  . VAL B 2 12  ? 80.319  -0.054  -14.346 1.00 58.64  ? 42  VAL B CA  1 
ATOM   2822  C  C   . VAL B 2 12  ? 81.193  0.415   -13.184 1.00 67.37  ? 42  VAL B C   1 
ATOM   2823  O  O   . VAL B 2 12  ? 81.216  1.609   -12.866 1.00 66.51  ? 42  VAL B O   1 
ATOM   2824  C  CB  . VAL B 2 12  ? 80.875  0.454   -15.699 1.00 60.28  ? 42  VAL B CB  1 
ATOM   2825  C  CG1 . VAL B 2 12  ? 82.375  0.215   -15.797 1.00 59.64  ? 42  VAL B CG1 1 
ATOM   2826  C  CG2 . VAL B 2 12  ? 80.144  -0.171  -16.877 1.00 59.34  ? 42  VAL B CG2 1 
ATOM   2827  N  N   . GLY B 2 13  ? 81.890  -0.525  -12.571 1.00 69.02  ? 43  GLY B N   1 
ATOM   2828  C  CA  . GLY B 2 13  ? 82.794  -0.224  -11.469 1.00 72.22  ? 43  GLY B CA  1 
ATOM   2829  C  C   . GLY B 2 13  ? 82.175  -0.305  -10.096 1.00 83.38  ? 43  GLY B C   1 
ATOM   2830  O  O   . GLY B 2 13  ? 81.009  -0.696  -9.968  1.00 84.88  ? 43  GLY B O   1 
ATOM   2831  N  N   . THR B 2 14  ? 82.976  0.047   -9.060  1.00 83.70  ? 44  THR B N   1 
ATOM   2832  C  CA  . THR B 2 14  ? 82.582  -0.017  -7.643  1.00 86.93  ? 44  THR B CA  1 
ATOM   2833  C  C   . THR B 2 14  ? 81.528  1.035   -7.315  1.00 93.81  ? 44  THR B C   1 
ATOM   2834  O  O   . THR B 2 14  ? 81.730  2.224   -7.607  1.00 94.68  ? 44  THR B O   1 
ATOM   2835  C  CB  . THR B 2 14  ? 83.787  0.064   -6.679  1.00 96.34  ? 44  THR B CB  1 
ATOM   2836  O  OG1 . THR B 2 14  ? 84.127  1.433   -6.442  1.00 96.74  ? 44  THR B OG1 1 
ATOM   2837  C  CG2 . THR B 2 14  ? 84.992  -0.761  -7.143  1.00 93.30  ? 44  THR B CG2 1 
ATOM   2838  N  N   . SER B 2 15  ? 80.404  0.590   -6.717  1.00 89.56  ? 45  SER B N   1 
ATOM   2839  C  CA  . SER B 2 15  ? 79.294  1.470   -6.372  1.00 88.70  ? 45  SER B CA  1 
ATOM   2840  C  C   . SER B 2 15  ? 78.552  0.975   -5.137  1.00 93.82  ? 45  SER B C   1 
ATOM   2841  O  O   . SER B 2 15  ? 78.491  -0.241  -4.890  1.00 93.77  ? 45  SER B O   1 
ATOM   2842  C  CB  . SER B 2 15  ? 78.337  1.592   -7.555  1.00 89.18  ? 45  SER B CB  1 
ATOM   2843  O  OG  . SER B 2 15  ? 78.030  0.314   -8.088  1.00 93.66  ? 45  SER B OG  1 
ATOM   2844  N  N   . ASP B 2 16  ? 78.005  1.926   -4.342  1.00 90.21  ? 46  ASP B N   1 
ATOM   2845  C  CA  . ASP B 2 16  ? 77.216  1.570   -3.161  1.00 90.74  ? 46  ASP B CA  1 
ATOM   2846  C  C   . ASP B 2 16  ? 75.776  1.411   -3.620  1.00 91.49  ? 46  ASP B C   1 
ATOM   2847  O  O   . ASP B 2 16  ? 75.041  2.394   -3.707  1.00 90.59  ? 46  ASP B O   1 
ATOM   2848  C  CB  . ASP B 2 16  ? 77.356  2.585   -2.004  1.00 93.31  ? 46  ASP B CB  1 
ATOM   2849  N  N   . GLU B 2 17  ? 75.404  0.168   -3.980  1.00 85.83  ? 47  GLU B N   1 
ATOM   2850  C  CA  . GLU B 2 17  ? 74.073  -0.178  -4.451  1.00 84.84  ? 47  GLU B CA  1 
ATOM   2851  C  C   . GLU B 2 17  ? 72.987  0.141   -3.383  1.00 87.00  ? 47  GLU B C   1 
ATOM   2852  O  O   . GLU B 2 17  ? 71.875  0.535   -3.747  1.00 85.94  ? 47  GLU B O   1 
ATOM   2853  C  CB  . GLU B 2 17  ? 74.041  -1.640  -4.927  1.00 86.26  ? 47  GLU B CB  1 
ATOM   2854  N  N   . VAL B 2 18  ? 73.342  0.041   -2.081  1.00 83.21  ? 48  VAL B N   1 
ATOM   2855  C  CA  . VAL B 2 18  ? 72.451  0.362   -0.953  1.00 84.51  ? 48  VAL B CA  1 
ATOM   2856  C  C   . VAL B 2 18  ? 72.180  1.870   -0.886  1.00 88.75  ? 48  VAL B C   1 
ATOM   2857  O  O   . VAL B 2 18  ? 71.022  2.264   -0.725  1.00 90.67  ? 48  VAL B O   1 
ATOM   2858  C  CB  . VAL B 2 18  ? 72.920  -0.210  0.416   1.00 89.29  ? 48  VAL B CB  1 
ATOM   2859  N  N   . ALA B 2 19  ? 73.235  2.709   -1.038  1.00 82.72  ? 49  ALA B N   1 
ATOM   2860  C  CA  . ALA B 2 19  ? 73.121  4.174   -1.032  1.00 82.03  ? 49  ALA B CA  1 
ATOM   2861  C  C   . ALA B 2 19  ? 72.313  4.650   -2.233  1.00 85.47  ? 49  ALA B C   1 
ATOM   2862  O  O   . ALA B 2 19  ? 71.520  5.587   -2.103  1.00 86.49  ? 49  ALA B O   1 
ATOM   2863  C  CB  . ALA B 2 19  ? 74.501  4.808   -1.054  1.00 81.80  ? 49  ALA B CB  1 
ATOM   2864  N  N   . ILE B 2 20  ? 72.526  3.978   -3.403  1.00 79.11  ? 50  ILE B N   1 
ATOM   2865  C  CA  . ILE B 2 20  ? 71.850  4.195   -4.679  1.00 76.70  ? 50  ILE B CA  1 
ATOM   2866  C  C   . ILE B 2 20  ? 70.373  3.847   -4.484  1.00 83.62  ? 50  ILE B C   1 
ATOM   2867  O  O   . ILE B 2 20  ? 69.505  4.590   -4.956  1.00 84.79  ? 50  ILE B O   1 
ATOM   2868  C  CB  . ILE B 2 20  ? 72.566  3.422   -5.830  1.00 77.13  ? 50  ILE B CB  1 
ATOM   2869  C  CG1 . ILE B 2 20  ? 73.857  4.175   -6.238  1.00 75.51  ? 50  ILE B CG1 1 
ATOM   2870  C  CG2 . ILE B 2 20  ? 71.653  3.212   -7.056  1.00 76.51  ? 50  ILE B CG2 1 
ATOM   2871  C  CD1 . ILE B 2 20  ? 74.937  3.352   -6.833  1.00 76.80  ? 50  ILE B CD1 1 
ATOM   2872  N  N   . LYS B 2 21  ? 70.087  2.768   -3.718  1.00 80.44  ? 51  LYS B N   1 
ATOM   2873  C  CA  . LYS B 2 21  ? 68.722  2.386   -3.354  1.00 80.70  ? 51  LYS B CA  1 
ATOM   2874  C  C   . LYS B 2 21  ? 68.274  3.318   -2.198  1.00 87.49  ? 51  LYS B C   1 
ATOM   2875  O  O   . LYS B 2 21  ? 68.235  2.905   -1.029  1.00 89.43  ? 51  LYS B O   1 
ATOM   2876  C  CB  . LYS B 2 21  ? 68.644  0.895   -2.969  1.00 82.36  ? 51  LYS B CB  1 
ATOM   2877  C  CG  . LYS B 2 21  ? 68.641  -0.057  -4.155  1.00 85.96  ? 51  LYS B CG  1 
ATOM   2878  C  CD  . LYS B 2 21  ? 69.172  -1.461  -3.795  1.00 94.50  ? 51  LYS B CD  1 
ATOM   2879  C  CE  . LYS B 2 21  ? 69.007  -2.468  -4.927  1.00 99.27  ? 51  LYS B CE  1 
ATOM   2880  N  NZ  . LYS B 2 21  ? 70.280  -3.159  -5.294  1.00 97.92  ? 51  LYS B NZ  1 
ATOM   2881  N  N   . ASP B 2 22  ? 68.049  4.620   -2.539  1.00 83.37  ? 52  ASP B N   1 
ATOM   2882  C  CA  . ASP B 2 22  ? 67.553  5.724   -1.684  1.00 101.86 ? 52  ASP B CA  1 
ATOM   2883  C  C   . ASP B 2 22  ? 67.570  7.066   -2.427  1.00 93.03  ? 52  ASP B C   1 
ATOM   2884  O  O   . ASP B 2 22  ? 66.695  7.340   -3.253  1.00 49.40  ? 52  ASP B O   1 
ATOM   2885  C  CB  . ASP B 2 22  ? 68.295  5.838   -0.337  1.00 104.73 ? 52  ASP B CB  1 
ATOM   2886  N  N   . LEU B 2 32  ? 52.441  10.205  -10.836 1.00 93.21  ? 62  LEU B N   1 
ATOM   2887  C  CA  . LEU B 2 32  ? 52.527  10.109  -12.296 1.00 91.58  ? 62  LEU B CA  1 
ATOM   2888  C  C   . LEU B 2 32  ? 51.615  9.042   -12.950 1.00 96.35  ? 62  LEU B C   1 
ATOM   2889  O  O   . LEU B 2 32  ? 51.101  8.145   -12.265 1.00 96.78  ? 62  LEU B O   1 
ATOM   2890  C  CB  . LEU B 2 32  ? 53.982  9.906   -12.778 1.00 88.54  ? 62  LEU B CB  1 
ATOM   2891  C  CG  . LEU B 2 32  ? 54.986  11.044  -12.540 1.00 91.52  ? 62  LEU B CG  1 
ATOM   2892  C  CD1 . LEU B 2 32  ? 56.337  10.667  -13.055 1.00 87.50  ? 62  LEU B CD1 1 
ATOM   2893  C  CD2 . LEU B 2 32  ? 54.581  12.324  -13.252 1.00 96.35  ? 62  LEU B CD2 1 
ATOM   2894  N  N   . SER B 2 33  ? 51.445  9.156   -14.303 1.00 92.34  ? 63  SER B N   1 
ATOM   2895  C  CA  . SER B 2 33  ? 50.624  8.285   -15.164 1.00 92.13  ? 63  SER B CA  1 
ATOM   2896  C  C   . SER B 2 33  ? 51.191  6.858   -15.291 1.00 95.96  ? 63  SER B C   1 
ATOM   2897  O  O   . SER B 2 33  ? 50.439  5.931   -15.617 1.00 96.96  ? 63  SER B O   1 
ATOM   2898  C  CB  . SER B 2 33  ? 50.442  8.911   -16.546 1.00 92.63  ? 63  SER B CB  1 
ATOM   2899  N  N   . VAL B 2 34  ? 52.515  6.695   -15.039 1.00 89.74  ? 64  VAL B N   1 
ATOM   2900  C  CA  . VAL B 2 34  ? 53.253  5.428   -15.121 1.00 87.50  ? 64  VAL B CA  1 
ATOM   2901  C  C   . VAL B 2 34  ? 54.219  5.281   -13.918 1.00 89.61  ? 64  VAL B C   1 
ATOM   2902  O  O   . VAL B 2 34  ? 54.574  6.285   -13.286 1.00 90.52  ? 64  VAL B O   1 
ATOM   2903  C  CB  . VAL B 2 34  ? 53.957  5.301   -16.502 1.00 89.61  ? 64  VAL B CB  1 
ATOM   2904  C  CG1 . VAL B 2 34  ? 55.369  5.895   -16.499 1.00 87.46  ? 64  VAL B CG1 1 
ATOM   2905  C  CG2 . VAL B 2 34  ? 53.980  3.862   -16.972 1.00 88.94  ? 64  VAL B CG2 1 
ATOM   2906  N  N   . VAL B 2 35  ? 54.649  4.049   -13.610 1.00 82.95  ? 65  VAL B N   1 
ATOM   2907  C  CA  . VAL B 2 35  ? 55.518  3.809   -12.458 1.00 80.94  ? 65  VAL B CA  1 
ATOM   2908  C  C   . VAL B 2 35  ? 56.816  3.026   -12.848 1.00 81.79  ? 65  VAL B C   1 
ATOM   2909  O  O   . VAL B 2 35  ? 56.754  2.122   -13.684 1.00 81.58  ? 65  VAL B O   1 
ATOM   2910  C  CB  . VAL B 2 35  ? 54.686  3.158   -11.317 1.00 85.76  ? 65  VAL B CB  1 
ATOM   2911  C  CG1 . VAL B 2 35  ? 54.988  1.672   -11.107 1.00 84.98  ? 65  VAL B CG1 1 
ATOM   2912  C  CG2 . VAL B 2 35  ? 54.811  3.952   -10.028 1.00 86.31  ? 65  VAL B CG2 1 
ATOM   2913  N  N   . PRO B 2 36  ? 58.005  3.375   -12.292 1.00 74.44  ? 66  PRO B N   1 
ATOM   2914  C  CA  . PRO B 2 36  ? 59.218  2.646   -12.684 1.00 70.85  ? 66  PRO B CA  1 
ATOM   2915  C  C   . PRO B 2 36  ? 59.393  1.321   -11.965 1.00 73.33  ? 66  PRO B C   1 
ATOM   2916  O  O   . PRO B 2 36  ? 59.049  1.201   -10.787 1.00 75.57  ? 66  PRO B O   1 
ATOM   2917  C  CB  . PRO B 2 36  ? 60.339  3.605   -12.299 1.00 71.54  ? 66  PRO B CB  1 
ATOM   2918  C  CG  . PRO B 2 36  ? 59.794  4.402   -11.164 1.00 78.03  ? 66  PRO B CG  1 
ATOM   2919  C  CD  . PRO B 2 36  ? 58.303  4.428   -11.295 1.00 76.01  ? 66  PRO B CD  1 
ATOM   2920  N  N   . ARG B 2 37  ? 59.957  0.338   -12.678 1.00 65.91  ? 67  ARG B N   1 
ATOM   2921  C  CA  . ARG B 2 37  ? 60.352  -0.968  -12.162 1.00 64.80  ? 67  ARG B CA  1 
ATOM   2922  C  C   . ARG B 2 37  ? 61.848  -1.079  -12.480 1.00 64.32  ? 67  ARG B C   1 
ATOM   2923  O  O   . ARG B 2 37  ? 62.252  -1.631  -13.502 1.00 61.53  ? 67  ARG B O   1 
ATOM   2924  C  CB  . ARG B 2 37  ? 59.517  -2.120  -12.738 1.00 64.70  ? 67  ARG B CB  1 
ATOM   2925  N  N   . VAL B 2 38  ? 62.652  -0.443  -11.623 1.00 60.70  ? 68  VAL B N   1 
ATOM   2926  C  CA  . VAL B 2 38  ? 64.115  -0.347  -11.693 1.00 59.72  ? 68  VAL B CA  1 
ATOM   2927  C  C   . VAL B 2 38  ? 64.834  -1.695  -11.429 1.00 68.93  ? 68  VAL B C   1 
ATOM   2928  O  O   . VAL B 2 38  ? 64.334  -2.520  -10.651 1.00 72.76  ? 68  VAL B O   1 
ATOM   2929  C  CB  . VAL B 2 38  ? 64.606  0.748   -10.721 1.00 62.47  ? 68  VAL B CB  1 
ATOM   2930  C  CG1 . VAL B 2 38  ? 66.105  0.983   -10.848 1.00 60.33  ? 68  VAL B CG1 1 
ATOM   2931  C  CG2 . VAL B 2 38  ? 63.839  2.047   -10.941 1.00 62.75  ? 68  VAL B CG2 1 
ATOM   2932  N  N   . GLU B 2 39  ? 65.993  -1.919  -12.087 1.00 63.70  ? 69  GLU B N   1 
ATOM   2933  C  CA  . GLU B 2 39  ? 66.819  -3.106  -11.892 1.00 64.48  ? 69  GLU B CA  1 
ATOM   2934  C  C   . GLU B 2 39  ? 68.261  -2.673  -11.948 1.00 69.43  ? 69  GLU B C   1 
ATOM   2935  O  O   . GLU B 2 39  ? 68.718  -2.242  -13.008 1.00 69.35  ? 69  GLU B O   1 
ATOM   2936  C  CB  . GLU B 2 39  ? 66.589  -4.194  -12.963 1.00 66.16  ? 69  GLU B CB  1 
ATOM   2937  C  CG  . GLU B 2 39  ? 65.150  -4.604  -13.240 1.00 87.21  ? 69  GLU B CG  1 
ATOM   2938  C  CD  . GLU B 2 39  ? 64.695  -4.300  -14.660 1.00 112.58 ? 69  GLU B CD  1 
ATOM   2939  O  OE1 . GLU B 2 39  ? 65.377  -4.740  -15.618 1.00 122.00 ? 69  GLU B OE1 1 
ATOM   2940  O  OE2 . GLU B 2 39  ? 63.648  -3.629  -14.814 1.00 85.95  ? 69  GLU B OE2 1 
ATOM   2941  N  N   . LEU B 2 40  ? 68.989  -2.777  -10.824 1.00 66.82  ? 70  LEU B N   1 
ATOM   2942  C  CA  . LEU B 2 40  ? 70.411  -2.410  -10.807 1.00 65.14  ? 70  LEU B CA  1 
ATOM   2943  C  C   . LEU B 2 40  ? 71.213  -3.540  -11.408 1.00 69.28  ? 70  LEU B C   1 
ATOM   2944  O  O   . LEU B 2 40  ? 71.042  -4.700  -11.041 1.00 69.99  ? 70  LEU B O   1 
ATOM   2945  C  CB  . LEU B 2 40  ? 70.901  -2.061  -9.402  1.00 65.56  ? 70  LEU B CB  1 
ATOM   2946  C  CG  . LEU B 2 40  ? 71.033  -0.579  -9.068  1.00 69.34  ? 70  LEU B CG  1 
ATOM   2947  C  CD1 . LEU B 2 40  ? 69.700  0.157   -9.170  1.00 68.64  ? 70  LEU B CD1 1 
ATOM   2948  C  CD2 . LEU B 2 40  ? 71.593  -0.416  -7.667  1.00 75.46  ? 70  LEU B CD2 1 
ATOM   2949  N  N   . VAL B 2 41  ? 72.032  -3.198  -12.389 1.00 65.19  ? 71  VAL B N   1 
ATOM   2950  C  CA  . VAL B 2 41  ? 72.855  -4.129  -13.147 1.00 64.50  ? 71  VAL B CA  1 
ATOM   2951  C  C   . VAL B 2 41  ? 74.325  -3.745  -12.973 1.00 68.08  ? 71  VAL B C   1 
ATOM   2952  O  O   . VAL B 2 41  ? 74.691  -2.585  -13.158 1.00 67.03  ? 71  VAL B O   1 
ATOM   2953  C  CB  . VAL B 2 41  ? 72.403  -4.087  -14.628 1.00 67.86  ? 71  VAL B CB  1 
ATOM   2954  C  CG1 . VAL B 2 41  ? 73.438  -4.682  -15.565 1.00 66.43  ? 71  VAL B CG1 1 
ATOM   2955  C  CG2 . VAL B 2 41  ? 71.053  -4.764  -14.808 1.00 69.22  ? 71  VAL B CG2 1 
ATOM   2956  N  N   . ALA B 2 42  ? 75.165  -4.706  -12.601 1.00 65.45  ? 72  ALA B N   1 
ATOM   2957  C  CA  . ALA B 2 42  ? 76.584  -4.423  -12.479 1.00 64.74  ? 72  ALA B CA  1 
ATOM   2958  C  C   . ALA B 2 42  ? 77.294  -4.925  -13.728 1.00 68.80  ? 72  ALA B C   1 
ATOM   2959  O  O   . ALA B 2 42  ? 77.128  -6.083  -14.125 1.00 69.41  ? 72  ALA B O   1 
ATOM   2960  C  CB  . ALA B 2 42  ? 77.151  -5.074  -11.244 1.00 66.94  ? 72  ALA B CB  1 
ATOM   2961  N  N   . MET B 2 43  ? 78.030  -4.031  -14.386 1.00 64.25  ? 73  MET B N   1 
ATOM   2962  C  CA  . MET B 2 43  ? 78.760  -4.378  -15.582 1.00 63.02  ? 73  MET B CA  1 
ATOM   2963  C  C   . MET B 2 43  ? 80.254  -4.366  -15.312 1.00 67.38  ? 73  MET B C   1 
ATOM   2964  O  O   . MET B 2 43  ? 80.794  -3.383  -14.803 1.00 65.70  ? 73  MET B O   1 
ATOM   2965  C  CB  . MET B 2 43  ? 78.373  -3.474  -16.740 1.00 64.12  ? 73  MET B CB  1 
ATOM   2966  C  CG  . MET B 2 43  ? 79.248  -3.672  -17.936 1.00 67.15  ? 73  MET B CG  1 
ATOM   2967  S  SD  . MET B 2 43  ? 78.356  -3.661  -19.471 1.00 70.56  ? 73  MET B SD  1 
ATOM   2968  C  CE  . MET B 2 43  ? 78.175  -1.968  -19.673 1.00 66.76  ? 73  MET B CE  1 
ATOM   2969  N  N   . ASN B 2 44  ? 80.913  -5.471  -15.669 1.00 66.46  ? 74  ASN B N   1 
ATOM   2970  C  CA  . ASN B 2 44  ? 82.341  -5.678  -15.456 1.00 68.15  ? 74  ASN B CA  1 
ATOM   2971  C  C   . ASN B 2 44  ? 83.241  -5.012  -16.514 1.00 68.63  ? 74  ASN B C   1 
ATOM   2972  O  O   . ASN B 2 44  ? 84.238  -4.378  -16.154 1.00 68.59  ? 74  ASN B O   1 
ATOM   2973  C  CB  . ASN B 2 44  ? 82.650  -7.207  -15.364 1.00 80.16  ? 74  ASN B CB  1 
ATOM   2974  C  CG  . ASN B 2 44  ? 81.909  -7.964  -14.268 1.00 132.13 ? 74  ASN B CG  1 
ATOM   2975  O  OD1 . ASN B 2 44  ? 80.771  -7.658  -13.907 1.00 131.70 ? 74  ASN B OD1 1 
ATOM   2976  N  ND2 . ASN B 2 44  ? 82.499  -8.968  -13.716 1.00 131.47 ? 74  ASN B ND2 1 
ATOM   2977  N  N   . GLU B 2 45  ? 82.910  -5.182  -17.808 1.00 60.86  ? 75  GLU B N   1 
ATOM   2978  C  CA  . GLU B 2 45  ? 83.735  -4.699  -18.922 1.00 57.40  ? 75  GLU B CA  1 
ATOM   2979  C  C   . GLU B 2 45  ? 83.159  -3.490  -19.676 1.00 54.41  ? 75  GLU B C   1 
ATOM   2980  O  O   . GLU B 2 45  ? 81.942  -3.319  -19.692 1.00 53.36  ? 75  GLU B O   1 
ATOM   2981  C  CB  . GLU B 2 45  ? 84.018  -5.880  -19.882 1.00 58.54  ? 75  GLU B CB  1 
ATOM   2982  C  CG  . GLU B 2 45  ? 84.659  -7.088  -19.211 1.00 61.78  ? 75  GLU B CG  1 
ATOM   2983  C  CD  . GLU B 2 45  ? 86.005  -6.878  -18.531 1.00 79.78  ? 75  GLU B CD  1 
ATOM   2984  O  OE1 . GLU B 2 45  ? 86.678  -5.849  -18.785 1.00 76.13  ? 75  GLU B OE1 1 
ATOM   2985  O  OE2 . GLU B 2 45  ? 86.402  -7.782  -17.762 1.00 74.53  ? 75  GLU B OE2 1 
ATOM   2986  N  N   . THR B 2 46  ? 84.031  -2.666  -20.311 1.00 47.05  ? 76  THR B N   1 
ATOM   2987  C  CA  . THR B 2 46  ? 83.583  -1.466  -21.045 1.00 44.62  ? 76  THR B CA  1 
ATOM   2988  C  C   . THR B 2 46  ? 83.982  -1.405  -22.530 1.00 46.12  ? 76  THR B C   1 
ATOM   2989  O  O   . THR B 2 46  ? 83.900  -0.329  -23.134 1.00 44.57  ? 76  THR B O   1 
ATOM   2990  C  CB  . THR B 2 46  ? 83.981  -0.168  -20.352 1.00 44.21  ? 76  THR B CB  1 
ATOM   2991  O  OG1 . THR B 2 46  ? 85.359  -0.178  -20.049 1.00 40.86  ? 76  THR B OG1 1 
ATOM   2992  C  CG2 . THR B 2 46  ? 83.182  0.090   -19.135 1.00 44.88  ? 76  THR B CG2 1 
ATOM   2993  N  N   . ASP B 2 47  ? 84.362  -2.548  -23.129 1.00 41.75  ? 77  ASP B N   1 
ATOM   2994  C  CA  . ASP B 2 47  ? 84.697  -2.646  -24.554 1.00 40.20  ? 77  ASP B CA  1 
ATOM   2995  C  C   . ASP B 2 47  ? 83.366  -2.628  -25.418 1.00 45.00  ? 77  ASP B C   1 
ATOM   2996  O  O   . ASP B 2 47  ? 82.275  -2.828  -24.838 1.00 43.42  ? 77  ASP B O   1 
ATOM   2997  C  CB  . ASP B 2 47  ? 85.476  -3.923  -24.779 1.00 41.82  ? 77  ASP B CB  1 
ATOM   2998  C  CG  . ASP B 2 47  ? 84.644  -5.145  -24.486 1.00 56.65  ? 77  ASP B CG  1 
ATOM   2999  O  OD1 . ASP B 2 47  ? 84.094  -5.726  -25.442 1.00 58.34  ? 77  ASP B OD1 1 
ATOM   3000  O  OD2 . ASP B 2 47  ? 84.503  -5.487  -23.298 1.00 63.84  ? 77  ASP B OD2 1 
ATOM   3001  N  N   . PRO B 2 48  ? 83.423  -2.396  -26.778 1.00 41.43  ? 78  PRO B N   1 
ATOM   3002  C  CA  . PRO B 2 48  ? 82.172  -2.343  -27.554 1.00 40.66  ? 78  PRO B CA  1 
ATOM   3003  C  C   . PRO B 2 48  ? 81.304  -3.585  -27.408 1.00 45.67  ? 78  PRO B C   1 
ATOM   3004  O  O   . PRO B 2 48  ? 80.108  -3.425  -27.109 1.00 46.71  ? 78  PRO B O   1 
ATOM   3005  C  CB  . PRO B 2 48  ? 82.642  -2.116  -29.000 1.00 41.61  ? 78  PRO B CB  1 
ATOM   3006  C  CG  . PRO B 2 48  ? 84.001  -1.587  -28.903 1.00 45.44  ? 78  PRO B CG  1 
ATOM   3007  C  CD  . PRO B 2 48  ? 84.597  -2.124  -27.644 1.00 41.92  ? 78  PRO B CD  1 
ATOM   3008  N  N   . LYS B 2 49  ? 81.904  -4.808  -27.543 1.00 40.88  ? 79  LYS B N   1 
ATOM   3009  C  CA  . LYS B 2 49  ? 81.143  -6.064  -27.453 1.00 40.97  ? 79  LYS B CA  1 
ATOM   3010  C  C   . LYS B 2 49  ? 80.413  -6.218  -26.134 1.00 44.41  ? 79  LYS B C   1 
ATOM   3011  O  O   . LYS B 2 49  ? 79.214  -6.493  -26.143 1.00 44.52  ? 79  LYS B O   1 
ATOM   3012  C  CB  . LYS B 2 49  ? 81.977  -7.319  -27.771 1.00 43.14  ? 79  LYS B CB  1 
ATOM   3013  C  CG  . LYS B 2 49  ? 81.083  -8.553  -27.960 1.00 44.87  ? 79  LYS B CG  1 
ATOM   3014  C  CD  . LYS B 2 49  ? 81.827  -9.812  -28.361 1.00 57.64  ? 79  LYS B CD  1 
ATOM   3015  C  CE  . LYS B 2 49  ? 81.197  -11.059 -27.790 1.00 68.58  ? 79  LYS B CE  1 
ATOM   3016  N  NZ  . LYS B 2 49  ? 79.730  -11.169 -28.079 1.00 72.95  ? 79  LYS B NZ  1 
ATOM   3017  N  N   . SER B 2 50  ? 81.111  -5.999  -25.014 1.00 40.73  ? 80  SER B N   1 
ATOM   3018  C  CA  . SER B 2 50  ? 80.519  -6.129  -23.687 1.00 41.13  ? 80  SER B CA  1 
ATOM   3019  C  C   . SER B 2 50  ? 79.324  -5.213  -23.463 1.00 47.73  ? 80  SER B C   1 
ATOM   3020  O  O   . SER B 2 50  ? 78.246  -5.706  -23.128 1.00 49.10  ? 80  SER B O   1 
ATOM   3021  C  CB  . SER B 2 50  ? 81.573  -5.935  -22.622 1.00 42.19  ? 80  SER B CB  1 
ATOM   3022  O  OG  . SER B 2 50  ? 82.486  -7.010  -22.766 1.00 46.51  ? 80  SER B OG  1 
ATOM   3023  N  N   . ILE B 2 51  ? 79.488  -3.910  -23.723 1.00 43.01  ? 81  ILE B N   1 
ATOM   3024  C  CA  . ILE B 2 51  ? 78.406  -2.947  -23.570 1.00 42.82  ? 81  ILE B CA  1 
ATOM   3025  C  C   . ILE B 2 51  ? 77.222  -3.281  -24.531 1.00 46.71  ? 81  ILE B C   1 
ATOM   3026  O  O   . ILE B 2 51  ? 76.072  -3.309  -24.085 1.00 46.95  ? 81  ILE B O   1 
ATOM   3027  C  CB  . ILE B 2 51  ? 78.934  -1.484  -23.718 1.00 45.20  ? 81  ILE B CB  1 
ATOM   3028  C  CG1 . ILE B 2 51  ? 80.122  -1.216  -22.757 1.00 44.80  ? 81  ILE B CG1 1 
ATOM   3029  C  CG2 . ILE B 2 51  ? 77.798  -0.456  -23.545 1.00 46.43  ? 81  ILE B CG2 1 
ATOM   3030  C  CD1 . ILE B 2 51  ? 80.652  0.191   -22.696 1.00 39.99  ? 81  ILE B CD1 1 
ATOM   3031  N  N   . ILE B 2 52  ? 77.501  -3.550  -25.823 1.00 41.35  ? 82  ILE B N   1 
ATOM   3032  C  CA  . ILE B 2 52  ? 76.422  -3.847  -26.770 1.00 41.65  ? 82  ILE B CA  1 
ATOM   3033  C  C   . ILE B 2 52  ? 75.658  -5.070  -26.282 1.00 50.71  ? 82  ILE B C   1 
ATOM   3034  O  O   . ILE B 2 52  ? 74.447  -4.989  -26.113 1.00 51.23  ? 82  ILE B O   1 
ATOM   3035  C  CB  . ILE B 2 52  ? 76.891  -3.969  -28.262 1.00 43.19  ? 82  ILE B CB  1 
ATOM   3036  C  CG1 . ILE B 2 52  ? 77.403  -2.619  -28.819 1.00 42.18  ? 82  ILE B CG1 1 
ATOM   3037  C  CG2 . ILE B 2 52  ? 75.770  -4.513  -29.140 1.00 42.16  ? 82  ILE B CG2 1 
ATOM   3038  C  CD1 . ILE B 2 52  ? 78.284  -2.718  -30.083 1.00 45.60  ? 82  ILE B CD1 1 
ATOM   3039  N  N   . THR B 2 53  ? 76.393  -6.173  -25.980 1.00 49.19  ? 83  THR B N   1 
ATOM   3040  C  CA  . THR B 2 53  ? 75.860  -7.446  -25.481 1.00 49.51  ? 83  THR B CA  1 
ATOM   3041  C  C   . THR B 2 53  ? 75.057  -7.294  -24.183 1.00 51.74  ? 83  THR B C   1 
ATOM   3042  O  O   . THR B 2 53  ? 73.947  -7.797  -24.121 1.00 50.92  ? 83  THR B O   1 
ATOM   3043  C  CB  . THR B 2 53  ? 76.971  -8.460  -25.373 1.00 54.17  ? 83  THR B CB  1 
ATOM   3044  O  OG1 . THR B 2 53  ? 77.343  -8.762  -26.699 1.00 55.50  ? 83  THR B OG1 1 
ATOM   3045  C  CG2 . THR B 2 53  ? 76.542  -9.728  -24.710 1.00 54.46  ? 83  THR B CG2 1 
ATOM   3046  N  N   . ARG B 2 54  ? 75.593  -6.587  -23.184 1.00 47.79  ? 84  ARG B N   1 
ATOM   3047  C  CA  . ARG B 2 54  ? 74.896  -6.382  -21.928 1.00 47.91  ? 84  ARG B CA  1 
ATOM   3048  C  C   . ARG B 2 54  ? 73.552  -5.731  -22.121 1.00 53.73  ? 84  ARG B C   1 
ATOM   3049  O  O   . ARG B 2 54  ? 72.560  -6.305  -21.672 1.00 56.09  ? 84  ARG B O   1 
ATOM   3050  C  CB  . ARG B 2 54  ? 75.745  -5.593  -20.914 1.00 45.96  ? 84  ARG B CB  1 
ATOM   3051  C  CG  . ARG B 2 54  ? 75.300  -5.772  -19.453 1.00 58.85  ? 84  ARG B CG  1 
ATOM   3052  C  CD  . ARG B 2 54  ? 75.388  -7.229  -18.984 1.00 64.05  ? 84  ARG B CD  1 
ATOM   3053  N  NE  . ARG B 2 54  ? 75.502  -7.347  -17.533 1.00 64.56  ? 84  ARG B NE  1 
ATOM   3054  C  CZ  . ARG B 2 54  ? 74.507  -7.732  -16.746 1.00 92.70  ? 84  ARG B CZ  1 
ATOM   3055  N  NH1 . ARG B 2 54  ? 73.315  -8.018  -17.261 1.00 76.01  ? 84  ARG B NH1 1 
ATOM   3056  N  NH2 . ARG B 2 54  ? 74.689  -7.826  -15.434 1.00 96.84  ? 84  ARG B NH2 1 
ATOM   3057  N  N   . ILE B 2 55  ? 73.498  -4.571  -22.810 1.00 49.84  ? 85  ILE B N   1 
ATOM   3058  C  CA  . ILE B 2 55  ? 72.250  -3.831  -23.027 1.00 50.05  ? 85  ILE B CA  1 
ATOM   3059  C  C   . ILE B 2 55  ? 71.250  -4.679  -23.824 1.00 59.96  ? 85  ILE B C   1 
ATOM   3060  O  O   . ILE B 2 55  ? 70.086  -4.751  -23.446 1.00 60.43  ? 85  ILE B O   1 
ATOM   3061  C  CB  . ILE B 2 55  ? 72.478  -2.405  -23.612 1.00 50.64  ? 85  ILE B CB  1 
ATOM   3062  C  CG1 . ILE B 2 55  ? 73.246  -1.539  -22.598 1.00 49.95  ? 85  ILE B CG1 1 
ATOM   3063  C  CG2 . ILE B 2 55  ? 71.161  -1.718  -23.949 1.00 50.64  ? 85  ILE B CG2 1 
ATOM   3064  C  CD1 . ILE B 2 55  ? 73.926  -0.302  -23.148 1.00 53.26  ? 85  ILE B CD1 1 
ATOM   3065  N  N   . CYS B 2 56  ? 71.725  -5.392  -24.839 1.00 61.38  ? 86  CYS B N   1 
ATOM   3066  C  CA  . CYS B 2 56  ? 70.895  -6.227  -25.691 1.00 65.03  ? 86  CYS B CA  1 
ATOM   3067  C  C   . CYS B 2 56  ? 70.255  -7.412  -24.967 1.00 68.94  ? 86  CYS B C   1 
ATOM   3068  O  O   . CYS B 2 56  ? 69.123  -7.768  -25.287 1.00 69.16  ? 86  CYS B O   1 
ATOM   3069  C  CB  . CYS B 2 56  ? 71.673  -6.658  -26.925 1.00 67.57  ? 86  CYS B CB  1 
ATOM   3070  S  SG  . CYS B 2 56  ? 71.956  -5.305  -28.097 1.00 72.36  ? 86  CYS B SG  1 
ATOM   3071  N  N   . ASP B 2 57  ? 70.946  -7.985  -23.972 1.00 65.79  ? 87  ASP B N   1 
ATOM   3072  C  CA  . ASP B 2 57  ? 70.442  -9.097  -23.173 1.00 66.69  ? 87  ASP B CA  1 
ATOM   3073  C  C   . ASP B 2 57  ? 69.407  -8.589  -22.193 1.00 71.82  ? 87  ASP B C   1 
ATOM   3074  O  O   . ASP B 2 57  ? 68.375  -9.240  -22.012 1.00 73.21  ? 87  ASP B O   1 
ATOM   3075  C  CB  . ASP B 2 57  ? 71.583  -9.844  -22.465 1.00 68.77  ? 87  ASP B CB  1 
ATOM   3076  C  CG  . ASP B 2 57  ? 72.559  -10.551 -23.406 1.00 81.87  ? 87  ASP B CG  1 
ATOM   3077  O  OD1 . ASP B 2 57  ? 72.265  -10.628 -24.629 1.00 81.19  ? 87  ASP B OD1 1 
ATOM   3078  O  OD2 . ASP B 2 57  ? 73.640  -10.988 -22.929 1.00 89.46  ? 87  ASP B OD2 1 
ATOM   3079  N  N   . LEU B 2 58  ? 69.634  -7.387  -21.625 1.00 66.94  ? 88  LEU B N   1 
ATOM   3080  C  CA  . LEU B 2 58  ? 68.686  -6.742  -20.716 1.00 67.35  ? 88  LEU B CA  1 
ATOM   3081  C  C   . LEU B 2 58  ? 67.369  -6.416  -21.428 1.00 73.57  ? 88  LEU B C   1 
ATOM   3082  O  O   . LEU B 2 58  ? 66.316  -6.440  -20.795 1.00 75.94  ? 88  LEU B O   1 
ATOM   3083  C  CB  . LEU B 2 58  ? 69.275  -5.453  -20.125 1.00 66.25  ? 88  LEU B CB  1 
ATOM   3084  C  CG  . LEU B 2 58  ? 70.484  -5.558  -19.208 1.00 70.86  ? 88  LEU B CG  1 
ATOM   3085  C  CD1 . LEU B 2 58  ? 70.749  -4.236  -18.556 1.00 71.09  ? 88  LEU B CD1 1 
ATOM   3086  C  CD2 . LEU B 2 58  ? 70.292  -6.593  -18.124 1.00 75.20  ? 88  LEU B CD2 1 
ATOM   3087  N  N   . MET B 2 59  ? 67.439  -6.066  -22.725 1.00 69.66  ? 89  MET B N   1 
ATOM   3088  C  CA  . MET B 2 59  ? 66.288  -5.728  -23.558 1.00 70.07  ? 89  MET B CA  1 
ATOM   3089  C  C   . MET B 2 59  ? 65.488  -6.975  -23.811 1.00 78.21  ? 89  MET B C   1 
ATOM   3090  O  O   . MET B 2 59  ? 64.257  -6.942  -23.701 1.00 80.30  ? 89  MET B O   1 
ATOM   3091  C  CB  . MET B 2 59  ? 66.734  -5.120  -24.897 1.00 70.63  ? 89  MET B CB  1 
ATOM   3092  C  CG  . MET B 2 59  ? 67.188  -3.686  -24.780 1.00 73.22  ? 89  MET B CG  1 
ATOM   3093  S  SD  . MET B 2 59  ? 67.756  -2.996  -26.357 1.00 76.67  ? 89  MET B SD  1 
ATOM   3094  C  CE  . MET B 2 59  ? 68.317  -1.388  -25.799 1.00 72.54  ? 89  MET B CE  1 
ATOM   3095  N  N   . SER B 2 60  ? 66.212  -8.082  -24.119 1.00 75.03  ? 90  SER B N   1 
ATOM   3096  C  CA  . SER B 2 60  ? 65.714  -9.420  -24.437 1.00 76.07  ? 90  SER B CA  1 
ATOM   3097  C  C   . SER B 2 60  ? 64.894  -10.041 -23.322 1.00 81.87  ? 90  SER B C   1 
ATOM   3098  O  O   . SER B 2 60  ? 63.959  -10.781 -23.624 1.00 82.62  ? 90  SER B O   1 
ATOM   3099  C  CB  . SER B 2 60  ? 66.866  -10.331 -24.864 1.00 79.33  ? 90  SER B CB  1 
ATOM   3100  O  OG  . SER B 2 60  ? 66.752  -11.678 -24.427 1.00 91.34  ? 90  SER B OG  1 
ATOM   3101  N  N   . ASP B 2 61  ? 65.239  -9.759  -22.046 1.00 79.50  ? 91  ASP B N   1 
ATOM   3102  C  CA  . ASP B 2 61  ? 64.501  -10.309 -20.909 1.00 81.55  ? 91  ASP B CA  1 
ATOM   3103  C  C   . ASP B 2 61  ? 63.453  -9.363  -20.366 1.00 86.09  ? 91  ASP B C   1 
ATOM   3104  O  O   . ASP B 2 61  ? 62.268  -9.653  -20.486 1.00 87.73  ? 91  ASP B O   1 
ATOM   3105  C  CB  . ASP B 2 61  ? 65.401  -10.792 -19.746 1.00 84.26  ? 91  ASP B CB  1 
ATOM   3106  C  CG  . ASP B 2 61  ? 66.814  -11.216 -20.083 1.00 102.70 ? 91  ASP B CG  1 
ATOM   3107  O  OD1 . ASP B 2 61  ? 67.027  -11.749 -21.203 1.00 105.40 ? 91  ASP B OD1 1 
ATOM   3108  O  OD2 . ASP B 2 61  ? 67.714  -11.031 -19.218 1.00 109.29 ? 91  ASP B OD2 1 
ATOM   3109  N  N   . ARG B 2 62  ? 63.877  -8.255  -19.749 1.00 81.11  ? 92  ARG B N   1 
ATOM   3110  C  CA  . ARG B 2 62  ? 62.961  -7.374  -19.054 1.00 81.36  ? 92  ARG B CA  1 
ATOM   3111  C  C   . ARG B 2 62  ? 62.076  -6.484  -19.921 1.00 83.28  ? 92  ARG B C   1 
ATOM   3112  O  O   . ARG B 2 62  ? 60.987  -6.134  -19.458 1.00 84.88  ? 92  ARG B O   1 
ATOM   3113  C  CB  . ARG B 2 62  ? 63.699  -6.516  -18.009 1.00 82.25  ? 92  ARG B CB  1 
ATOM   3114  C  CG  . ARG B 2 62  ? 62.828  -6.226  -16.766 1.00 93.96  ? 92  ARG B CG  1 
ATOM   3115  C  CD  . ARG B 2 62  ? 62.044  -4.916  -16.873 1.00 106.28 ? 92  ARG B CD  1 
ATOM   3116  N  NE  . ARG B 2 62  ? 61.040  -4.759  -15.816 1.00 116.97 ? 92  ARG B NE  1 
ATOM   3117  C  CZ  . ARG B 2 62  ? 59.778  -4.389  -16.023 1.00 125.63 ? 92  ARG B CZ  1 
ATOM   3118  N  NH1 . ARG B 2 62  ? 59.346  -4.129  -17.251 1.00 119.33 ? 92  ARG B NH1 1 
ATOM   3119  N  NH2 . ARG B 2 62  ? 58.939  -4.278  -15.005 1.00 101.56 ? 92  ARG B NH2 1 
ATOM   3120  N  N   . LYS B 2 63  ? 62.469  -6.127  -21.139 1.00 77.59  ? 93  LYS B N   1 
ATOM   3121  C  CA  . LYS B 2 63  ? 61.656  -5.167  -21.925 1.00 77.64  ? 93  LYS B CA  1 
ATOM   3122  C  C   . LYS B 2 63  ? 61.815  -3.794  -21.215 1.00 78.00  ? 93  LYS B C   1 
ATOM   3123  O  O   . LYS B 2 63  ? 61.033  -3.410  -20.319 1.00 77.22  ? 93  LYS B O   1 
ATOM   3124  C  CB  . LYS B 2 63  ? 60.155  -5.570  -22.093 1.00 81.27  ? 93  LYS B CB  1 
ATOM   3125  N  N   . ILE B 2 64  ? 62.900  -3.107  -21.608 1.00 69.70  ? 94  ILE B N   1 
ATOM   3126  C  CA  . ILE B 2 64  ? 63.388  -1.879  -21.015 1.00 66.91  ? 94  ILE B CA  1 
ATOM   3127  C  C   . ILE B 2 64  ? 62.938  -0.633  -21.779 1.00 67.24  ? 94  ILE B C   1 
ATOM   3128  O  O   . ILE B 2 64  ? 63.214  -0.468  -22.964 1.00 66.11  ? 94  ILE B O   1 
ATOM   3129  C  CB  . ILE B 2 64  ? 64.948  -2.029  -20.870 1.00 67.75  ? 94  ILE B CB  1 
ATOM   3130  C  CG1 . ILE B 2 64  ? 65.331  -3.103  -19.810 1.00 67.46  ? 94  ILE B CG1 1 
ATOM   3131  C  CG2 . ILE B 2 64  ? 65.680  -0.704  -20.628 1.00 67.72  ? 94  ILE B CG2 1 
ATOM   3132  C  CD1 . ILE B 2 64  ? 64.887  -2.830  -18.334 1.00 73.56  ? 94  ILE B CD1 1 
ATOM   3133  N  N   . GLN B 2 65  ? 62.281  0.254   -21.060 1.00 63.58  ? 95  GLN B N   1 
ATOM   3134  C  CA  . GLN B 2 65  ? 61.758  1.533   -21.535 1.00 64.14  ? 95  GLN B CA  1 
ATOM   3135  C  C   . GLN B 2 65  ? 62.879  2.585   -21.714 1.00 65.22  ? 95  GLN B C   1 
ATOM   3136  O  O   . GLN B 2 65  ? 62.788  3.433   -22.601 1.00 65.61  ? 95  GLN B O   1 
ATOM   3137  C  CB  . GLN B 2 65  ? 60.650  2.030   -20.572 1.00 67.63  ? 95  GLN B CB  1 
ATOM   3138  C  CG  . GLN B 2 65  ? 59.630  3.028   -21.134 1.00 76.84  ? 95  GLN B CG  1 
ATOM   3139  C  CD  . GLN B 2 65  ? 58.974  2.583   -22.419 1.00 96.76  ? 95  GLN B CD  1 
ATOM   3140  O  OE1 . GLN B 2 65  ? 58.051  1.754   -22.444 1.00 86.70  ? 95  GLN B OE1 1 
ATOM   3141  N  NE2 . GLN B 2 65  ? 59.487  3.102   -23.521 1.00 95.82  ? 95  GLN B NE2 1 
ATOM   3142  N  N   . GLY B 2 66  ? 63.922  2.481   -20.901 1.00 58.40  ? 96  GLY B N   1 
ATOM   3143  C  CA  . GLY B 2 66  ? 65.084  3.362   -20.919 1.00 56.47  ? 96  GLY B CA  1 
ATOM   3144  C  C   . GLY B 2 66  ? 66.209  2.855   -20.027 1.00 57.01  ? 96  GLY B C   1 
ATOM   3145  O  O   . GLY B 2 66  ? 65.960  2.091   -19.077 1.00 56.78  ? 96  GLY B O   1 
ATOM   3146  N  N   . VAL B 2 67  ? 67.463  3.284   -20.322 1.00 48.98  ? 97  VAL B N   1 
ATOM   3147  C  CA  . VAL B 2 67  ? 68.653  2.886   -19.566 1.00 46.91  ? 97  VAL B CA  1 
ATOM   3148  C  C   . VAL B 2 67  ? 69.282  4.096   -18.844 1.00 50.84  ? 97  VAL B C   1 
ATOM   3149  O  O   . VAL B 2 67  ? 69.411  5.163   -19.435 1.00 52.09  ? 97  VAL B O   1 
ATOM   3150  C  CB  . VAL B 2 67  ? 69.694  2.146   -20.486 1.00 47.62  ? 97  VAL B CB  1 
ATOM   3151  C  CG1 . VAL B 2 67  ? 70.949  1.747   -19.722 1.00 46.13  ? 97  VAL B CG1 1 
ATOM   3152  C  CG2 . VAL B 2 67  ? 69.085  0.924   -21.170 1.00 47.06  ? 97  VAL B CG2 1 
ATOM   3153  N  N   . VAL B 2 68  ? 69.691  3.916   -17.588 1.00 46.05  ? 98  VAL B N   1 
ATOM   3154  C  CA  . VAL B 2 68  ? 70.475  4.891   -16.819 1.00 45.41  ? 98  VAL B CA  1 
ATOM   3155  C  C   . VAL B 2 68  ? 71.908  4.286   -16.714 1.00 51.47  ? 98  VAL B C   1 
ATOM   3156  O  O   . VAL B 2 68  ? 72.083  3.225   -16.107 1.00 52.93  ? 98  VAL B O   1 
ATOM   3157  C  CB  . VAL B 2 68  ? 69.856  5.203   -15.436 1.00 48.83  ? 98  VAL B CB  1 
ATOM   3158  C  CG1 . VAL B 2 68  ? 70.801  6.026   -14.574 1.00 47.62  ? 98  VAL B CG1 1 
ATOM   3159  C  CG2 . VAL B 2 68  ? 68.531  5.923   -15.597 1.00 49.71  ? 98  VAL B CG2 1 
ATOM   3160  N  N   . PHE B 2 69  ? 72.910  4.920   -17.344 1.00 47.26  ? 99  PHE B N   1 
ATOM   3161  C  CA  . PHE B 2 69  ? 74.290  4.407   -17.350 1.00 46.69  ? 99  PHE B CA  1 
ATOM   3162  C  C   . PHE B 2 69  ? 75.288  5.264   -16.573 1.00 52.92  ? 99  PHE B C   1 
ATOM   3163  O  O   . PHE B 2 69  ? 75.373  6.486   -16.804 1.00 53.99  ? 99  PHE B O   1 
ATOM   3164  C  CB  . PHE B 2 69  ? 74.784  4.244   -18.800 1.00 46.99  ? 99  PHE B CB  1 
ATOM   3165  C  CG  . PHE B 2 69  ? 75.973  3.328   -18.979 1.00 47.18  ? 99  PHE B CG  1 
ATOM   3166  C  CD1 . PHE B 2 69  ? 77.268  3.794   -18.787 1.00 49.34  ? 99  PHE B CD1 1 
ATOM   3167  C  CD2 . PHE B 2 69  ? 75.803  2.017   -19.397 1.00 47.77  ? 99  PHE B CD2 1 
ATOM   3168  C  CE1 . PHE B 2 69  ? 78.361  2.947   -18.960 1.00 48.72  ? 99  PHE B CE1 1 
ATOM   3169  C  CE2 . PHE B 2 69  ? 76.903  1.181   -19.593 1.00 48.51  ? 99  PHE B CE2 1 
ATOM   3170  C  CZ  . PHE B 2 69  ? 78.167  1.647   -19.366 1.00 45.95  ? 99  PHE B CZ  1 
ATOM   3171  N  N   . ALA B 2 70  ? 76.112  4.604   -15.722 1.00 48.21  ? 100 ALA B N   1 
ATOM   3172  C  CA  . ALA B 2 70  ? 77.172  5.263   -14.963 1.00 47.46  ? 100 ALA B CA  1 
ATOM   3173  C  C   . ALA B 2 70  ? 78.424  4.424   -14.943 1.00 53.07  ? 100 ALA B C   1 
ATOM   3174  O  O   . ALA B 2 70  ? 78.355  3.217   -14.704 1.00 55.37  ? 100 ALA B O   1 
ATOM   3175  C  CB  . ALA B 2 70  ? 76.721  5.530   -13.537 1.00 48.94  ? 100 ALA B CB  1 
ATOM   3176  N  N   . ASP B 2 71  ? 79.573  5.059   -15.157 1.00 48.76  ? 101 ASP B N   1 
ATOM   3177  C  CA  . ASP B 2 71  ? 80.871  4.395   -15.043 1.00 48.56  ? 101 ASP B CA  1 
ATOM   3178  C  C   . ASP B 2 71  ? 81.877  5.268   -14.278 1.00 54.26  ? 101 ASP B C   1 
ATOM   3179  O  O   . ASP B 2 71  ? 81.663  6.484   -14.126 1.00 51.63  ? 101 ASP B O   1 
ATOM   3180  C  CB  . ASP B 2 71  ? 81.415  3.964   -16.410 1.00 49.43  ? 101 ASP B CB  1 
ATOM   3181  C  CG  . ASP B 2 71  ? 81.678  5.124   -17.321 1.00 61.37  ? 101 ASP B CG  1 
ATOM   3182  O  OD1 . ASP B 2 71  ? 82.737  5.766   -17.167 1.00 60.07  ? 101 ASP B OD1 1 
ATOM   3183  O  OD2 . ASP B 2 71  ? 80.791  5.439   -18.144 1.00 73.04  ? 101 ASP B OD2 1 
ATOM   3184  N  N   . ASP B 2 72  ? 82.983  4.621   -13.809 1.00 54.07  ? 102 ASP B N   1 
ATOM   3185  C  CA  . ASP B 2 72  ? 84.092  5.188   -13.033 1.00 54.91  ? 102 ASP B CA  1 
ATOM   3186  C  C   . ASP B 2 72  ? 85.370  5.391   -13.877 1.00 55.87  ? 102 ASP B C   1 
ATOM   3187  O  O   . ASP B 2 72  ? 86.439  5.680   -13.309 1.00 55.81  ? 102 ASP B O   1 
ATOM   3188  C  CB  . ASP B 2 72  ? 84.406  4.217   -11.876 1.00 58.99  ? 102 ASP B CB  1 
ATOM   3189  C  CG  . ASP B 2 72  ? 84.930  2.851   -12.325 1.00 80.89  ? 102 ASP B CG  1 
ATOM   3190  O  OD1 . ASP B 2 72  ? 84.312  2.242   -13.251 1.00 82.13  ? 102 ASP B OD1 1 
ATOM   3191  O  OD2 . ASP B 2 72  ? 85.951  2.380   -11.745 1.00 90.18  ? 102 ASP B OD2 1 
ATOM   3192  N  N   . THR B 2 73  ? 85.260  5.190   -15.211 1.00 49.15  ? 103 THR B N   1 
ATOM   3193  C  CA  . THR B 2 73  ? 86.350  5.174   -16.200 1.00 47.50  ? 103 THR B CA  1 
ATOM   3194  C  C   . THR B 2 73  ? 86.693  6.529   -16.813 1.00 50.05  ? 103 THR B C   1 
ATOM   3195  O  O   . THR B 2 73  ? 85.938  7.477   -16.646 1.00 50.10  ? 103 THR B O   1 
ATOM   3196  C  CB  . THR B 2 73  ? 86.005  4.197   -17.333 1.00 47.68  ? 103 THR B CB  1 
ATOM   3197  O  OG1 . THR B 2 73  ? 85.051  4.818   -18.186 1.00 53.80  ? 103 THR B OG1 1 
ATOM   3198  C  CG2 . THR B 2 73  ? 85.438  2.908   -16.845 1.00 39.02  ? 103 THR B CG2 1 
ATOM   3199  N  N   . ASP B 2 74  ? 87.834  6.597   -17.528 1.00 45.79  ? 104 ASP B N   1 
ATOM   3200  C  CA  . ASP B 2 74  ? 88.302  7.758   -18.284 1.00 46.05  ? 104 ASP B CA  1 
ATOM   3201  C  C   . ASP B 2 74  ? 88.169  7.353   -19.751 1.00 48.52  ? 104 ASP B C   1 
ATOM   3202  O  O   . ASP B 2 74  ? 89.040  7.674   -20.598 1.00 49.43  ? 104 ASP B O   1 
ATOM   3203  C  CB  . ASP B 2 74  ? 89.786  8.039   -17.995 1.00 49.33  ? 104 ASP B CB  1 
ATOM   3204  C  CG  . ASP B 2 74  ? 90.099  8.551   -16.620 1.00 63.86  ? 104 ASP B CG  1 
ATOM   3205  O  OD1 . ASP B 2 74  ? 89.734  9.707   -16.337 1.00 64.19  ? 104 ASP B OD1 1 
ATOM   3206  O  OD2 . ASP B 2 74  ? 90.820  7.832   -15.861 1.00 69.90  ? 104 ASP B OD2 1 
ATOM   3207  N  N   . GLN B 2 75  ? 87.084  6.604   -20.040 1.00 39.93  ? 105 GLN B N   1 
ATOM   3208  C  CA  . GLN B 2 75  ? 86.846  6.045   -21.343 1.00 37.71  ? 105 GLN B CA  1 
ATOM   3209  C  C   . GLN B 2 75  ? 85.688  6.714   -22.034 1.00 42.74  ? 105 GLN B C   1 
ATOM   3210  O  O   . GLN B 2 75  ? 84.562  6.192   -22.050 1.00 43.33  ? 105 GLN B O   1 
ATOM   3211  C  CB  . GLN B 2 75  ? 86.629  4.572   -21.166 1.00 39.05  ? 105 GLN B CB  1 
ATOM   3212  C  CG  . GLN B 2 75  ? 87.102  3.741   -22.325 1.00 67.15  ? 105 GLN B CG  1 
ATOM   3213  C  CD  . GLN B 2 75  ? 86.681  2.345   -22.026 1.00 75.68  ? 105 GLN B CD  1 
ATOM   3214  O  OE1 . GLN B 2 75  ? 87.026  1.804   -20.939 1.00 67.20  ? 105 GLN B OE1 1 
ATOM   3215  N  NE2 . GLN B 2 75  ? 85.825  1.801   -22.933 1.00 52.46  ? 105 GLN B NE2 1 
ATOM   3216  N  N   . GLU B 2 76  ? 85.980  7.898   -22.613 1.00 38.47  ? 106 GLU B N   1 
ATOM   3217  C  CA  . GLU B 2 76  ? 85.031  8.772   -23.295 1.00 37.47  ? 106 GLU B CA  1 
ATOM   3218  C  C   . GLU B 2 76  ? 84.316  8.113   -24.502 1.00 42.86  ? 106 GLU B C   1 
ATOM   3219  O  O   . GLU B 2 76  ? 83.289  8.639   -24.938 1.00 43.78  ? 106 GLU B O   1 
ATOM   3220  C  CB  . GLU B 2 76  ? 85.689  10.110  -23.681 1.00 38.20  ? 106 GLU B CB  1 
ATOM   3221  C  CG  . GLU B 2 76  ? 86.590  10.109  -24.903 1.00 42.00  ? 106 GLU B CG  1 
ATOM   3222  C  CD  . GLU B 2 76  ? 87.841  9.257   -24.832 1.00 71.29  ? 106 GLU B CD  1 
ATOM   3223  O  OE1 . GLU B 2 76  ? 88.410  9.089   -23.726 1.00 79.94  ? 106 GLU B OE1 1 
ATOM   3224  O  OE2 . GLU B 2 76  ? 88.252  8.752   -25.901 1.00 66.04  ? 106 GLU B OE2 1 
ATOM   3225  N  N   . ALA B 2 77  ? 84.829  6.970   -25.014 1.00 38.81  ? 107 ALA B N   1 
ATOM   3226  C  CA  . ALA B 2 77  ? 84.207  6.260   -26.134 1.00 37.99  ? 107 ALA B CA  1 
ATOM   3227  C  C   . ALA B 2 77  ? 82.919  5.633   -25.732 1.00 43.25  ? 107 ALA B C   1 
ATOM   3228  O  O   . ALA B 2 77  ? 82.073  5.395   -26.603 1.00 44.59  ? 107 ALA B O   1 
ATOM   3229  C  CB  . ALA B 2 77  ? 85.128  5.201   -26.689 1.00 38.98  ? 107 ALA B CB  1 
ATOM   3230  N  N   . ILE B 2 78  ? 82.723  5.412   -24.410 1.00 39.38  ? 108 ILE B N   1 
ATOM   3231  C  CA  . ILE B 2 78  ? 81.466  4.873   -23.866 1.00 37.22  ? 108 ILE B CA  1 
ATOM   3232  C  C   . ILE B 2 78  ? 80.318  5.772   -24.326 1.00 40.45  ? 108 ILE B C   1 
ATOM   3233  O  O   . ILE B 2 78  ? 79.278  5.247   -24.669 1.00 40.95  ? 108 ILE B O   1 
ATOM   3234  C  CB  . ILE B 2 78  ? 81.511  4.666   -22.339 1.00 38.86  ? 108 ILE B CB  1 
ATOM   3235  C  CG1 . ILE B 2 78  ? 82.578  3.633   -21.969 1.00 38.36  ? 108 ILE B CG1 1 
ATOM   3236  C  CG2 . ILE B 2 78  ? 80.146  4.253   -21.820 1.00 38.38  ? 108 ILE B CG2 1 
ATOM   3237  C  CD1 . ILE B 2 78  ? 82.958  3.602   -20.510 1.00 45.22  ? 108 ILE B CD1 1 
ATOM   3238  N  N   . ALA B 2 79  ? 80.540  7.108   -24.438 1.00 36.46  ? 109 ALA B N   1 
ATOM   3239  C  CA  . ALA B 2 79  ? 79.537  8.044   -24.950 1.00 35.27  ? 109 ALA B CA  1 
ATOM   3240  C  C   . ALA B 2 79  ? 79.158  7.605   -26.372 1.00 40.51  ? 109 ALA B C   1 
ATOM   3241  O  O   . ALA B 2 79  ? 77.988  7.323   -26.601 1.00 41.46  ? 109 ALA B O   1 
ATOM   3242  C  CB  . ALA B 2 79  ? 80.091  9.453   -24.949 1.00 35.43  ? 109 ALA B CB  1 
ATOM   3243  N  N   . GLN B 2 80  ? 80.159  7.375   -27.273 1.00 36.53  ? 110 GLN B N   1 
ATOM   3244  C  CA  . GLN B 2 80  ? 79.906  6.930   -28.651 1.00 35.31  ? 110 GLN B CA  1 
ATOM   3245  C  C   . GLN B 2 80  ? 79.194  5.571   -28.697 1.00 37.93  ? 110 GLN B C   1 
ATOM   3246  O  O   . GLN B 2 80  ? 78.108  5.510   -29.272 1.00 38.10  ? 110 GLN B O   1 
ATOM   3247  C  CB  . GLN B 2 80  ? 81.159  6.965   -29.530 1.00 35.69  ? 110 GLN B CB  1 
ATOM   3248  C  CG  . GLN B 2 80  ? 80.828  6.875   -31.035 1.00 41.89  ? 110 GLN B CG  1 
ATOM   3249  C  CD  . GLN B 2 80  ? 80.187  8.106   -31.627 1.00 58.99  ? 110 GLN B CD  1 
ATOM   3250  O  OE1 . GLN B 2 80  ? 79.015  8.095   -31.979 1.00 67.11  ? 110 GLN B OE1 1 
ATOM   3251  N  NE2 . GLN B 2 80  ? 80.947  9.177   -31.823 1.00 44.08  ? 110 GLN B NE2 1 
ATOM   3252  N  N   . ILE B 2 81  ? 79.745  4.521   -28.043 1.00 32.11  ? 111 ILE B N   1 
ATOM   3253  C  CA  . ILE B 2 81  ? 79.093  3.204   -27.937 1.00 31.86  ? 111 ILE B CA  1 
ATOM   3254  C  C   . ILE B 2 81  ? 77.593  3.380   -27.545 1.00 41.64  ? 111 ILE B C   1 
ATOM   3255  O  O   . ILE B 2 81  ? 76.692  2.824   -28.204 1.00 43.11  ? 111 ILE B O   1 
ATOM   3256  C  CB  . ILE B 2 81  ? 79.789  2.317   -26.885 1.00 34.28  ? 111 ILE B CB  1 
ATOM   3257  C  CG1 . ILE B 2 81  ? 81.309  2.155   -27.192 1.00 34.92  ? 111 ILE B CG1 1 
ATOM   3258  C  CG2 . ILE B 2 81  ? 79.083  0.981   -26.834 1.00 35.28  ? 111 ILE B CG2 1 
ATOM   3259  C  CD1 . ILE B 2 81  ? 82.205  1.289   -26.280 1.00 33.96  ? 111 ILE B CD1 1 
ATOM   3260  N  N   . LEU B 2 82  ? 77.338  4.178   -26.476 1.00 38.12  ? 112 LEU B N   1 
ATOM   3261  C  CA  . LEU B 2 82  ? 75.998  4.382   -25.958 1.00 37.68  ? 112 LEU B CA  1 
ATOM   3262  C  C   . LEU B 2 82  ? 75.120  5.152   -26.908 1.00 43.32  ? 112 LEU B C   1 
ATOM   3263  O  O   . LEU B 2 82  ? 73.923  4.851   -26.996 1.00 43.53  ? 112 LEU B O   1 
ATOM   3264  C  CB  . LEU B 2 82  ? 75.995  4.999   -24.563 1.00 37.30  ? 112 LEU B CB  1 
ATOM   3265  C  CG  . LEU B 2 82  ? 76.464  4.120   -23.415 1.00 40.88  ? 112 LEU B CG  1 
ATOM   3266  C  CD1 . LEU B 2 82  ? 76.542  4.926   -22.156 1.00 41.82  ? 112 LEU B CD1 1 
ATOM   3267  C  CD2 . LEU B 2 82  ? 75.578  2.923   -23.212 1.00 40.96  ? 112 LEU B CD2 1 
ATOM   3268  N  N   . ASP B 2 83  ? 75.701  6.107   -27.651 1.00 40.05  ? 113 ASP B N   1 
ATOM   3269  C  CA  . ASP B 2 83  ? 74.918  6.840   -28.640 1.00 40.77  ? 113 ASP B CA  1 
ATOM   3270  C  C   . ASP B 2 83  ? 74.495  5.862   -29.745 1.00 46.35  ? 113 ASP B C   1 
ATOM   3271  O  O   . ASP B 2 83  ? 73.313  5.805   -30.103 1.00 46.00  ? 113 ASP B O   1 
ATOM   3272  C  CB  . ASP B 2 83  ? 75.714  8.020   -29.204 1.00 42.80  ? 113 ASP B CB  1 
ATOM   3273  C  CG  . ASP B 2 83  ? 74.926  8.879   -30.178 1.00 53.44  ? 113 ASP B CG  1 
ATOM   3274  O  OD1 . ASP B 2 83  ? 74.018  9.606   -29.718 1.00 53.54  ? 113 ASP B OD1 1 
ATOM   3275  O  OD2 . ASP B 2 83  ? 75.227  8.823   -31.410 1.00 54.38  ? 113 ASP B OD2 1 
ATOM   3276  N  N   . PHE B 2 84  ? 75.456  5.031   -30.211 1.00 43.70  ? 114 PHE B N   1 
ATOM   3277  C  CA  . PHE B 2 84  ? 75.232  4.000   -31.227 1.00 42.93  ? 114 PHE B CA  1 
ATOM   3278  C  C   . PHE B 2 84  ? 74.105  3.063   -30.748 1.00 49.12  ? 114 PHE B C   1 
ATOM   3279  O  O   . PHE B 2 84  ? 73.092  2.946   -31.442 1.00 49.43  ? 114 PHE B O   1 
ATOM   3280  C  CB  . PHE B 2 84  ? 76.539  3.242   -31.539 1.00 42.67  ? 114 PHE B CB  1 
ATOM   3281  C  CG  . PHE B 2 84  ? 76.401  2.042   -32.441 1.00 43.36  ? 114 PHE B CG  1 
ATOM   3282  C  CD1 . PHE B 2 84  ? 76.427  2.184   -33.818 1.00 45.03  ? 114 PHE B CD1 1 
ATOM   3283  C  CD2 . PHE B 2 84  ? 76.247  0.759   -31.909 1.00 45.15  ? 114 PHE B CD2 1 
ATOM   3284  C  CE1 . PHE B 2 84  ? 76.292  1.063   -34.657 1.00 45.56  ? 114 PHE B CE1 1 
ATOM   3285  C  CE2 . PHE B 2 84  ? 76.103  -0.352  -32.747 1.00 46.96  ? 114 PHE B CE2 1 
ATOM   3286  C  CZ  . PHE B 2 84  ? 76.143  -0.193  -34.116 1.00 44.34  ? 114 PHE B CZ  1 
ATOM   3287  N  N   . ILE B 2 85  ? 74.243  2.466   -29.539 1.00 45.31  ? 115 ILE B N   1 
ATOM   3288  C  CA  . ILE B 2 85  ? 73.209  1.567   -29.007 1.00 45.00  ? 115 ILE B CA  1 
ATOM   3289  C  C   . ILE B 2 85  ? 71.843  2.266   -28.972 1.00 50.90  ? 115 ILE B C   1 
ATOM   3290  O  O   . ILE B 2 85  ? 70.859  1.713   -29.480 1.00 51.94  ? 115 ILE B O   1 
ATOM   3291  C  CB  . ILE B 2 85  ? 73.597  0.924   -27.653 1.00 46.60  ? 115 ILE B CB  1 
ATOM   3292  C  CG1 . ILE B 2 85  ? 74.835  0.042   -27.819 1.00 45.80  ? 115 ILE B CG1 1 
ATOM   3293  C  CG2 . ILE B 2 85  ? 72.424  0.115   -27.085 1.00 46.24  ? 115 ILE B CG2 1 
ATOM   3294  C  CD1 . ILE B 2 85  ? 75.590  -0.185  -26.562 1.00 50.62  ? 115 ILE B CD1 1 
ATOM   3295  N  N   . SER B 2 86  ? 71.823  3.509   -28.440 1.00 46.93  ? 116 SER B N   1 
ATOM   3296  C  CA  . SER B 2 86  ? 70.638  4.350   -28.300 1.00 46.57  ? 116 SER B CA  1 
ATOM   3297  C  C   . SER B 2 86  ? 69.904  4.572   -29.611 1.00 50.32  ? 116 SER B C   1 
ATOM   3298  O  O   . SER B 2 86  ? 68.711  4.338   -29.661 1.00 48.28  ? 116 SER B O   1 
ATOM   3299  C  CB  . SER B 2 86  ? 71.009  5.691   -27.694 1.00 48.33  ? 116 SER B CB  1 
ATOM   3300  O  OG  . SER B 2 86  ? 69.826  6.458   -27.634 1.00 59.32  ? 116 SER B OG  1 
ATOM   3301  N  N   . ALA B 2 87  ? 70.612  5.027   -30.670 1.00 48.79  ? 117 ALA B N   1 
ATOM   3302  C  CA  . ALA B 2 87  ? 70.008  5.294   -31.988 1.00 48.10  ? 117 ALA B CA  1 
ATOM   3303  C  C   . ALA B 2 87  ? 69.526  4.030   -32.708 1.00 50.78  ? 117 ALA B C   1 
ATOM   3304  O  O   . ALA B 2 87  ? 68.413  4.034   -33.222 1.00 51.64  ? 117 ALA B O   1 
ATOM   3305  C  CB  . ALA B 2 87  ? 70.957  6.086   -32.857 1.00 47.85  ? 117 ALA B CB  1 
ATOM   3306  N  N   . GLN B 2 88  ? 70.327  2.944   -32.695 1.00 45.23  ? 118 GLN B N   1 
ATOM   3307  C  CA  . GLN B 2 88  ? 69.989  1.669   -33.327 1.00 45.05  ? 118 GLN B CA  1 
ATOM   3308  C  C   . GLN B 2 88  ? 68.733  1.016   -32.740 1.00 50.16  ? 118 GLN B C   1 
ATOM   3309  O  O   . GLN B 2 88  ? 67.875  0.546   -33.486 1.00 50.00  ? 118 GLN B O   1 
ATOM   3310  C  CB  . GLN B 2 88  ? 71.163  0.683   -33.216 1.00 45.88  ? 118 GLN B CB  1 
ATOM   3311  C  CG  . GLN B 2 88  ? 72.394  1.013   -34.057 1.00 56.61  ? 118 GLN B CG  1 
ATOM   3312  C  CD  . GLN B 2 88  ? 72.054  1.252   -35.489 1.00 64.75  ? 118 GLN B CD  1 
ATOM   3313  O  OE1 . GLN B 2 88  ? 72.292  2.343   -35.999 1.00 55.91  ? 118 GLN B OE1 1 
ATOM   3314  N  NE2 . GLN B 2 88  ? 71.409  0.274   -36.136 1.00 58.15  ? 118 GLN B NE2 1 
ATOM   3315  N  N   . THR B 2 89  ? 68.637  0.964   -31.401 1.00 46.45  ? 119 THR B N   1 
ATOM   3316  C  CA  . THR B 2 89  ? 67.510  0.336   -30.706 1.00 45.98  ? 119 THR B CA  1 
ATOM   3317  C  C   . THR B 2 89  ? 66.402  1.323   -30.421 1.00 50.67  ? 119 THR B C   1 
ATOM   3318  O  O   . THR B 2 89  ? 65.299  0.900   -30.082 1.00 52.89  ? 119 THR B O   1 
ATOM   3319  C  CB  . THR B 2 89  ? 67.977  -0.333  -29.394 1.00 46.68  ? 119 THR B CB  1 
ATOM   3320  O  OG1 . THR B 2 89  ? 68.403  0.663   -28.476 1.00 42.83  ? 119 THR B OG1 1 
ATOM   3321  C  CG2 . THR B 2 89  ? 69.084  -1.346  -29.602 1.00 43.53  ? 119 THR B CG2 1 
ATOM   3322  N  N   . LEU B 2 90  ? 66.669  2.635   -30.570 1.00 45.23  ? 120 LEU B N   1 
ATOM   3323  C  CA  . LEU B 2 90  ? 65.713  3.714   -30.275 1.00 44.30  ? 120 LEU B CA  1 
ATOM   3324  C  C   . LEU B 2 90  ? 65.182  3.587   -28.843 1.00 52.43  ? 120 LEU B C   1 
ATOM   3325  O  O   . LEU B 2 90  ? 63.980  3.548   -28.608 1.00 55.40  ? 120 LEU B O   1 
ATOM   3326  C  CB  . LEU B 2 90  ? 64.610  3.819   -31.334 1.00 43.42  ? 120 LEU B CB  1 
ATOM   3327  C  CG  . LEU B 2 90  ? 65.032  4.395   -32.658 1.00 43.73  ? 120 LEU B CG  1 
ATOM   3328  C  CD1 . LEU B 2 90  ? 64.152  3.907   -33.711 1.00 43.97  ? 120 LEU B CD1 1 
ATOM   3329  C  CD2 . LEU B 2 90  ? 65.056  5.928   -32.635 1.00 42.16  ? 120 LEU B CD2 1 
ATOM   3330  N  N   . THR B 2 91  ? 66.120  3.442   -27.908 1.00 50.78  ? 121 THR B N   1 
ATOM   3331  C  CA  . THR B 2 91  ? 65.935  3.314   -26.466 1.00 52.89  ? 121 THR B CA  1 
ATOM   3332  C  C   . THR B 2 91  ? 66.648  4.481   -25.780 1.00 59.34  ? 121 THR B C   1 
ATOM   3333  O  O   . THR B 2 91  ? 67.851  4.696   -26.017 1.00 60.79  ? 121 THR B O   1 
ATOM   3334  C  CB  . THR B 2 91  ? 66.552  1.997   -25.970 1.00 67.39  ? 121 THR B CB  1 
ATOM   3335  O  OG1 . THR B 2 91  ? 66.190  0.959   -26.868 1.00 77.17  ? 121 THR B OG1 1 
ATOM   3336  C  CG2 . THR B 2 91  ? 66.135  1.642   -24.547 1.00 66.21  ? 121 THR B CG2 1 
ATOM   3337  N  N   . PRO B 2 92  ? 65.952  5.220   -24.901 1.00 54.93  ? 122 PRO B N   1 
ATOM   3338  C  CA  . PRO B 2 92  ? 66.619  6.327   -24.191 1.00 54.36  ? 122 PRO B CA  1 
ATOM   3339  C  C   . PRO B 2 92  ? 67.760  5.832   -23.299 1.00 54.60  ? 122 PRO B C   1 
ATOM   3340  O  O   . PRO B 2 92  ? 67.611  4.825   -22.606 1.00 56.22  ? 122 PRO B O   1 
ATOM   3341  C  CB  . PRO B 2 92  ? 65.489  6.950   -23.354 1.00 57.97  ? 122 PRO B CB  1 
ATOM   3342  C  CG  . PRO B 2 92  ? 64.225  6.460   -23.980 1.00 63.28  ? 122 PRO B CG  1 
ATOM   3343  C  CD  . PRO B 2 92  ? 64.542  5.098   -24.506 1.00 57.78  ? 122 PRO B CD  1 
ATOM   3344  N  N   . ILE B 2 93  ? 68.918  6.477   -23.379 1.00 46.52  ? 123 ILE B N   1 
ATOM   3345  C  CA  . ILE B 2 93  ? 70.068  6.122   -22.548 1.00 44.66  ? 123 ILE B CA  1 
ATOM   3346  C  C   . ILE B 2 93  ? 70.562  7.396   -21.927 1.00 51.62  ? 123 ILE B C   1 
ATOM   3347  O  O   . ILE B 2 93  ? 70.741  8.392   -22.633 1.00 51.51  ? 123 ILE B O   1 
ATOM   3348  C  CB  . ILE B 2 93  ? 71.195  5.343   -23.284 1.00 44.69  ? 123 ILE B CB  1 
ATOM   3349  C  CG1 . ILE B 2 93  ? 70.688  3.979   -23.785 1.00 43.39  ? 123 ILE B CG1 1 
ATOM   3350  C  CG2 . ILE B 2 93  ? 72.404  5.150   -22.375 1.00 43.74  ? 123 ILE B CG2 1 
ATOM   3351  C  CD1 . ILE B 2 93  ? 71.611  3.232   -24.748 1.00 37.38  ? 123 ILE B CD1 1 
ATOM   3352  N  N   . LEU B 2 94  ? 70.742  7.383   -20.602 1.00 49.95  ? 124 LEU B N   1 
ATOM   3353  C  CA  . LEU B 2 94  ? 71.248  8.544   -19.876 1.00 50.17  ? 124 LEU B CA  1 
ATOM   3354  C  C   . LEU B 2 94  ? 72.641  8.264   -19.332 1.00 52.48  ? 124 LEU B C   1 
ATOM   3355  O  O   . LEU B 2 94  ? 72.806  7.338   -18.536 1.00 51.06  ? 124 LEU B O   1 
ATOM   3356  C  CB  . LEU B 2 94  ? 70.294  8.977   -18.749 1.00 51.88  ? 124 LEU B CB  1 
ATOM   3357  C  CG  . LEU B 2 94  ? 68.815  9.191   -19.111 1.00 57.74  ? 124 LEU B CG  1 
ATOM   3358  C  CD1 . LEU B 2 94  ? 67.996  9.368   -17.881 1.00 59.61  ? 124 LEU B CD1 1 
ATOM   3359  C  CD2 . LEU B 2 94  ? 68.620  10.385  -20.021 1.00 59.20  ? 124 LEU B CD2 1 
ATOM   3360  N  N   . GLY B 2 95  ? 73.636  9.016   -19.821 1.00 49.31  ? 125 GLY B N   1 
ATOM   3361  C  CA  . GLY B 2 95  ? 75.032  8.909   -19.382 1.00 48.97  ? 125 GLY B CA  1 
ATOM   3362  C  C   . GLY B 2 95  ? 75.167  9.844   -18.210 1.00 53.87  ? 125 GLY B C   1 
ATOM   3363  O  O   . GLY B 2 95  ? 75.303  11.056  -18.399 1.00 53.86  ? 125 GLY B O   1 
ATOM   3364  N  N   . ILE B 2 96  ? 74.986  9.304   -16.995 1.00 50.52  ? 126 ILE B N   1 
ATOM   3365  C  CA  . ILE B 2 96  ? 74.891  10.102  -15.763 1.00 50.93  ? 126 ILE B CA  1 
ATOM   3366  C  C   . ILE B 2 96  ? 76.228  10.379  -15.061 1.00 57.36  ? 126 ILE B C   1 
ATOM   3367  O  O   . ILE B 2 96  ? 76.241  11.193  -14.129 1.00 57.51  ? 126 ILE B O   1 
ATOM   3368  C  CB  . ILE B 2 96  ? 73.883  9.461   -14.779 1.00 53.85  ? 126 ILE B CB  1 
ATOM   3369  C  CG1 . ILE B 2 96  ? 74.444  8.179   -14.134 1.00 53.28  ? 126 ILE B CG1 1 
ATOM   3370  C  CG2 . ILE B 2 96  ? 72.545  9.189   -15.467 1.00 54.45  ? 126 ILE B CG2 1 
ATOM   3371  C  CD1 . ILE B 2 96  ? 74.008  7.925   -12.750 1.00 57.97  ? 126 ILE B CD1 1 
ATOM   3372  N  N   . HIS B 2 97  ? 77.324  9.670   -15.462 1.00 52.75  ? 127 HIS B N   1 
ATOM   3373  C  CA  . HIS B 2 97  ? 78.614  9.789   -14.804 1.00 52.88  ? 127 HIS B CA  1 
ATOM   3374  C  C   . HIS B 2 97  ? 79.712  9.001   -15.510 1.00 52.79  ? 127 HIS B C   1 
ATOM   3375  O  O   . HIS B 2 97  ? 79.468  7.885   -15.947 1.00 53.30  ? 127 HIS B O   1 
ATOM   3376  C  CB  . HIS B 2 97  ? 78.502  9.297   -13.341 1.00 55.96  ? 127 HIS B CB  1 
ATOM   3377  C  CG  . HIS B 2 97  ? 79.775  9.371   -12.561 1.00 60.79  ? 127 HIS B CG  1 
ATOM   3378  N  ND1 . HIS B 2 97  ? 80.455  10.564  -12.392 1.00 62.93  ? 127 HIS B ND1 1 
ATOM   3379  C  CD2 . HIS B 2 97  ? 80.447  8.389   -11.922 1.00 64.07  ? 127 HIS B CD2 1 
ATOM   3380  C  CE1 . HIS B 2 97  ? 81.525  10.262  -11.679 1.00 63.31  ? 127 HIS B CE1 1 
ATOM   3381  N  NE2 . HIS B 2 97  ? 81.548  8.975   -11.349 1.00 64.18  ? 127 HIS B NE2 1 
ATOM   3382  N  N   . GLY B 2 98  ? 80.916  9.574   -15.529 1.00 45.31  ? 128 GLY B N   1 
ATOM   3383  C  CA  . GLY B 2 98  ? 82.110  8.985   -16.102 1.00 43.16  ? 128 GLY B CA  1 
ATOM   3384  C  C   . GLY B 2 98  ? 82.217  9.208   -17.580 1.00 45.46  ? 128 GLY B C   1 
ATOM   3385  O  O   . GLY B 2 98  ? 81.746  10.227  -18.084 1.00 45.44  ? 128 GLY B O   1 
ATOM   3386  N  N   . GLY B 2 99  ? 82.843  8.244   -18.255 1.00 43.27  ? 129 GLY B N   1 
ATOM   3387  C  CA  . GLY B 2 99  ? 83.031  8.184   -19.703 1.00 43.64  ? 129 GLY B CA  1 
ATOM   3388  C  C   . GLY B 2 99  ? 81.746  8.362   -20.497 1.00 49.48  ? 129 GLY B C   1 
ATOM   3389  O  O   . GLY B 2 99  ? 81.757  9.003   -21.557 1.00 50.04  ? 129 GLY B O   1 
ATOM   3390  N  N   . SER B 2 100 ? 80.613  7.867   -19.934 1.00 44.91  ? 130 SER B N   1 
ATOM   3391  C  CA  . SER B 2 100 ? 79.291  7.990   -20.525 1.00 45.42  ? 130 SER B CA  1 
ATOM   3392  C  C   . SER B 2 100 ? 78.771  9.426   -20.567 1.00 52.02  ? 130 SER B C   1 
ATOM   3393  O  O   . SER B 2 100 ? 78.015  9.761   -21.460 1.00 53.27  ? 130 SER B O   1 
ATOM   3394  C  CB  . SER B 2 100 ? 78.292  7.072   -19.831 1.00 50.71  ? 130 SER B CB  1 
ATOM   3395  O  OG  . SER B 2 100 ? 78.167  7.325   -18.443 1.00 63.88  ? 130 SER B OG  1 
ATOM   3396  N  N   . SER B 2 101 ? 79.200  10.284  -19.650 1.00 49.02  ? 131 SER B N   1 
ATOM   3397  C  CA  . SER B 2 101 ? 78.757  11.668  -19.600 1.00 48.76  ? 131 SER B CA  1 
ATOM   3398  C  C   . SER B 2 101 ? 79.748  12.617  -20.311 1.00 53.71  ? 131 SER B C   1 
ATOM   3399  O  O   . SER B 2 101 ? 79.498  13.829  -20.347 1.00 52.52  ? 131 SER B O   1 
ATOM   3400  C  CB  . SER B 2 101 ? 78.592  12.078  -18.143 1.00 51.71  ? 131 SER B CB  1 
ATOM   3401  O  OG  . SER B 2 101 ? 79.879  12.158  -17.554 1.00 60.03  ? 131 SER B OG  1 
ATOM   3402  N  N   . MET B 2 102 ? 80.876  12.090  -20.854 1.00 52.46  ? 132 MET B N   1 
ATOM   3403  C  CA  . MET B 2 102 ? 81.902  12.946  -21.475 1.00 53.65  ? 132 MET B CA  1 
ATOM   3404  C  C   . MET B 2 102 ? 81.498  13.479  -22.863 1.00 54.06  ? 132 MET B C   1 
ATOM   3405  O  O   . MET B 2 102 ? 80.691  12.875  -23.550 1.00 54.37  ? 132 MET B O   1 
ATOM   3406  C  CB  . MET B 2 102 ? 83.280  12.251  -21.501 1.00 56.97  ? 132 MET B CB  1 
ATOM   3407  C  CG  . MET B 2 102 ? 84.147  12.495  -20.252 1.00 64.21  ? 132 MET B CG  1 
ATOM   3408  S  SD  . MET B 2 102 ? 85.090  10.939  -19.923 1.00 72.69  ? 132 MET B SD  1 
ATOM   3409  C  CE  . MET B 2 102 ? 86.465  11.499  -18.927 1.00 69.93  ? 132 MET B CE  1 
ATOM   3410  N  N   . ILE B 2 103 ? 82.038  14.628  -23.257 1.00 49.27  ? 133 ILE B N   1 
ATOM   3411  C  CA  . ILE B 2 103 ? 81.774  15.262  -24.557 1.00 48.88  ? 133 ILE B CA  1 
ATOM   3412  C  C   . ILE B 2 103 ? 82.117  14.318  -25.691 1.00 54.48  ? 133 ILE B C   1 
ATOM   3413  O  O   . ILE B 2 103 ? 83.077  13.554  -25.641 1.00 54.21  ? 133 ILE B O   1 
ATOM   3414  C  CB  . ILE B 2 103 ? 82.401  16.672  -24.723 1.00 52.51  ? 133 ILE B CB  1 
ATOM   3415  C  CG1 . ILE B 2 103 ? 83.882  16.704  -24.332 1.00 52.90  ? 133 ILE B CG1 1 
ATOM   3416  C  CG2 . ILE B 2 103 ? 81.620  17.682  -23.904 1.00 54.37  ? 133 ILE B CG2 1 
ATOM   3417  C  CD1 . ILE B 2 103 ? 84.673  17.784  -24.943 1.00 60.96  ? 133 ILE B CD1 1 
ATOM   3418  N  N   . MET B 2 104 ? 81.288  14.376  -26.715 1.00 52.21  ? 134 MET B N   1 
ATOM   3419  C  CA  . MET B 2 104 ? 81.193  13.463  -27.847 1.00 49.84  ? 134 MET B CA  1 
ATOM   3420  C  C   . MET B 2 104 ? 81.203  14.157  -29.191 1.00 52.84  ? 134 MET B C   1 
ATOM   3421  O  O   . MET B 2 104 ? 81.022  15.387  -29.296 1.00 52.73  ? 134 MET B O   1 
ATOM   3422  C  CB  . MET B 2 104 ? 79.759  12.883  -27.748 1.00 51.44  ? 134 MET B CB  1 
ATOM   3423  C  CG  . MET B 2 104 ? 79.668  11.478  -27.403 1.00 53.76  ? 134 MET B CG  1 
ATOM   3424  S  SD  . MET B 2 104 ? 78.100  10.853  -28.038 1.00 58.22  ? 134 MET B SD  1 
ATOM   3425  C  CE  . MET B 2 104 ? 78.499  10.617  -29.759 1.00 53.30  ? 134 MET B CE  1 
ATOM   3426  N  N   . ALA B 2 105 ? 81.204  13.302  -30.241 1.00 47.33  ? 135 ALA B N   1 
ATOM   3427  C  CA  . ALA B 2 105 ? 80.979  13.686  -31.614 1.00 46.69  ? 135 ALA B CA  1 
ATOM   3428  C  C   . ALA B 2 105 ? 79.462  14.058  -31.768 1.00 52.10  ? 135 ALA B C   1 
ATOM   3429  O  O   . ALA B 2 105 ? 78.691  14.046  -30.801 1.00 52.74  ? 135 ALA B O   1 
ATOM   3430  C  CB  . ALA B 2 105 ? 81.317  12.520  -32.516 1.00 46.99  ? 135 ALA B CB  1 
ATOM   3431  N  N   . ASP B 2 106 ? 79.045  14.449  -32.958 1.00 50.01  ? 136 ASP B N   1 
ATOM   3432  C  CA  . ASP B 2 106 ? 77.641  14.786  -33.150 1.00 50.17  ? 136 ASP B CA  1 
ATOM   3433  C  C   . ASP B 2 106 ? 76.874  13.499  -32.992 1.00 49.73  ? 136 ASP B C   1 
ATOM   3434  O  O   . ASP B 2 106 ? 77.214  12.466  -33.593 1.00 49.86  ? 136 ASP B O   1 
ATOM   3435  C  CB  . ASP B 2 106 ? 77.370  15.461  -34.523 1.00 54.03  ? 136 ASP B CB  1 
ATOM   3436  C  CG  . ASP B 2 106 ? 77.829  16.923  -34.680 1.00 79.64  ? 136 ASP B CG  1 
ATOM   3437  O  OD1 . ASP B 2 106 ? 78.367  17.498  -33.695 1.00 83.68  ? 136 ASP B OD1 1 
ATOM   3438  O  OD2 . ASP B 2 106 ? 77.661  17.486  -35.792 1.00 88.47  ? 136 ASP B OD2 1 
ATOM   3439  N  N   . LYS B 2 107 ? 75.912  13.534  -32.077 1.00 43.42  ? 137 LYS B N   1 
ATOM   3440  C  CA  . LYS B 2 107 ? 75.032  12.406  -31.796 1.00 41.39  ? 137 LYS B CA  1 
ATOM   3441  C  C   . LYS B 2 107 ? 74.204  12.092  -33.082 1.00 44.00  ? 137 LYS B C   1 
ATOM   3442  O  O   . LYS B 2 107 ? 74.043  12.958  -33.957 1.00 43.60  ? 137 LYS B O   1 
ATOM   3443  C  CB  . LYS B 2 107 ? 74.144  12.726  -30.594 1.00 42.22  ? 137 LYS B CB  1 
ATOM   3444  C  CG  . LYS B 2 107 ? 74.898  12.799  -29.284 1.00 41.34  ? 137 LYS B CG  1 
ATOM   3445  C  CD  . LYS B 2 107 ? 73.991  13.110  -28.084 1.00 37.09  ? 137 LYS B CD  1 
ATOM   3446  C  CE  . LYS B 2 107 ? 74.754  13.267  -26.793 1.00 38.74  ? 137 LYS B CE  1 
ATOM   3447  N  NZ  . LYS B 2 107 ? 75.703  14.410  -26.839 1.00 56.99  ? 137 LYS B NZ  1 
ATOM   3448  N  N   . ASP B 2 108 ? 73.714  10.867  -33.200 1.00 39.10  ? 138 ASP B N   1 
ATOM   3449  C  CA  . ASP B 2 108 ? 72.977  10.430  -34.383 1.00 40.24  ? 138 ASP B CA  1 
ATOM   3450  C  C   . ASP B 2 108 ? 71.704  11.240  -34.602 1.00 49.22  ? 138 ASP B C   1 
ATOM   3451  O  O   . ASP B 2 108 ? 71.218  11.865  -33.651 1.00 49.99  ? 138 ASP B O   1 
ATOM   3452  C  CB  . ASP B 2 108 ? 72.653  8.930   -34.288 1.00 41.71  ? 138 ASP B CB  1 
ATOM   3453  C  CG  . ASP B 2 108 ? 72.285  8.288   -35.608 1.00 57.61  ? 138 ASP B CG  1 
ATOM   3454  O  OD1 . ASP B 2 108 ? 73.196  8.030   -36.417 1.00 58.82  ? 138 ASP B OD1 1 
ATOM   3455  O  OD2 . ASP B 2 108 ? 71.079  8.063   -35.840 1.00 70.25  ? 138 ASP B OD2 1 
ATOM   3456  N  N   . GLU B 2 109 ? 71.185  11.274  -35.866 1.00 47.51  ? 139 GLU B N   1 
ATOM   3457  C  CA  . GLU B 2 109 ? 69.938  11.969  -36.149 1.00 49.96  ? 139 GLU B CA  1 
ATOM   3458  C  C   . GLU B 2 109 ? 68.844  11.278  -35.311 1.00 58.81  ? 139 GLU B C   1 
ATOM   3459  O  O   . GLU B 2 109 ? 67.991  11.943  -34.712 1.00 60.78  ? 139 GLU B O   1 
ATOM   3460  C  CB  . GLU B 2 109 ? 69.590  11.940  -37.653 1.00 51.94  ? 139 GLU B CB  1 
ATOM   3461  N  N   . SER B 2 110 ? 68.949  9.941   -35.193 1.00 55.84  ? 140 SER B N   1 
ATOM   3462  C  CA  . SER B 2 110 ? 67.982  9.124   -34.484 1.00 56.14  ? 140 SER B CA  1 
ATOM   3463  C  C   . SER B 2 110 ? 68.363  8.817   -33.051 1.00 60.58  ? 140 SER B C   1 
ATOM   3464  O  O   . SER B 2 110 ? 67.782  7.900   -32.460 1.00 63.37  ? 140 SER B O   1 
ATOM   3465  C  CB  . SER B 2 110 ? 67.705  7.851   -35.270 1.00 58.24  ? 140 SER B CB  1 
ATOM   3466  O  OG  . SER B 2 110 ? 66.702  8.128   -36.234 1.00 65.83  ? 140 SER B OG  1 
ATOM   3467  N  N   . SER B 2 111 ? 69.281  9.603   -32.461 1.00 52.99  ? 141 SER B N   1 
ATOM   3468  C  CA  . SER B 2 111 ? 69.732  9.349   -31.091 1.00 50.91  ? 141 SER B CA  1 
ATOM   3469  C  C   . SER B 2 111 ? 68.700  9.692   -30.032 1.00 57.67  ? 141 SER B C   1 
ATOM   3470  O  O   . SER B 2 111 ? 67.850  10.567  -30.232 1.00 61.27  ? 141 SER B O   1 
ATOM   3471  C  CB  . SER B 2 111 ? 71.028  10.086  -30.803 1.00 51.91  ? 141 SER B CB  1 
ATOM   3472  O  OG  . SER B 2 111 ? 71.401  9.900   -29.449 1.00 59.65  ? 141 SER B OG  1 
ATOM   3473  N  N   . MET B 2 112 ? 68.787  8.988   -28.897 1.00 52.02  ? 142 MET B N   1 
ATOM   3474  C  CA  . MET B 2 112 ? 67.966  9.158   -27.691 1.00 51.24  ? 142 MET B CA  1 
ATOM   3475  C  C   . MET B 2 112 ? 68.909  9.137   -26.477 1.00 50.94  ? 142 MET B C   1 
ATOM   3476  O  O   . MET B 2 112 ? 68.490  8.789   -25.373 1.00 50.81  ? 142 MET B O   1 
ATOM   3477  C  CB  . MET B 2 112 ? 66.911  8.059   -27.593 1.00 54.32  ? 142 MET B CB  1 
ATOM   3478  C  CG  . MET B 2 112 ? 65.972  8.043   -28.782 1.00 59.16  ? 142 MET B CG  1 
ATOM   3479  S  SD  . MET B 2 112 ? 64.495  7.071   -28.488 1.00 64.81  ? 142 MET B SD  1 
ATOM   3480  C  CE  . MET B 2 112 ? 63.649  8.127   -27.327 1.00 62.25  ? 142 MET B CE  1 
ATOM   3481  N  N   . PHE B 2 113 ? 70.207  9.501   -26.715 1.00 43.66  ? 143 PHE B N   1 
ATOM   3482  C  CA  . PHE B 2 113 ? 71.291  9.588   -25.729 1.00 41.71  ? 143 PHE B CA  1 
ATOM   3483  C  C   . PHE B 2 113 ? 71.404  10.997  -25.145 1.00 49.26  ? 143 PHE B C   1 
ATOM   3484  O  O   . PHE B 2 113 ? 71.538  11.978  -25.889 1.00 51.04  ? 143 PHE B O   1 
ATOM   3485  C  CB  . PHE B 2 113 ? 72.626  9.175   -26.353 1.00 41.08  ? 143 PHE B CB  1 
ATOM   3486  C  CG  . PHE B 2 113 ? 73.781  9.055   -25.389 1.00 40.63  ? 143 PHE B CG  1 
ATOM   3487  C  CD1 . PHE B 2 113 ? 73.629  8.412   -24.168 1.00 43.10  ? 143 PHE B CD1 1 
ATOM   3488  C  CD2 . PHE B 2 113 ? 75.038  9.527   -25.729 1.00 41.66  ? 143 PHE B CD2 1 
ATOM   3489  C  CE1 . PHE B 2 113 ? 74.702  8.310   -23.278 1.00 43.77  ? 143 PHE B CE1 1 
ATOM   3490  C  CE2 . PHE B 2 113 ? 76.110  9.415   -24.839 1.00 43.60  ? 143 PHE B CE2 1 
ATOM   3491  C  CZ  . PHE B 2 113 ? 75.939  8.792   -23.630 1.00 41.57  ? 143 PHE B CZ  1 
ATOM   3492  N  N   . PHE B 2 114 ? 71.308  11.090  -23.811 1.00 45.58  ? 144 PHE B N   1 
ATOM   3493  C  CA  . PHE B 2 114 ? 71.363  12.328  -23.047 1.00 45.49  ? 144 PHE B CA  1 
ATOM   3494  C  C   . PHE B 2 114 ? 72.386  12.160  -21.947 1.00 55.11  ? 144 PHE B C   1 
ATOM   3495  O  O   . PHE B 2 114 ? 72.381  11.138  -21.242 1.00 56.34  ? 144 PHE B O   1 
ATOM   3496  C  CB  . PHE B 2 114 ? 70.000  12.628  -22.447 1.00 47.56  ? 144 PHE B CB  1 
ATOM   3497  C  CG  . PHE B 2 114 ? 68.894  12.863  -23.454 1.00 49.23  ? 144 PHE B CG  1 
ATOM   3498  C  CD1 . PHE B 2 114 ? 68.595  14.142  -23.895 1.00 53.78  ? 144 PHE B CD1 1 
ATOM   3499  C  CD2 . PHE B 2 114 ? 68.108  11.810  -23.911 1.00 49.93  ? 144 PHE B CD2 1 
ATOM   3500  C  CE1 . PHE B 2 114 ? 67.551  14.356  -24.800 1.00 55.78  ? 144 PHE B CE1 1 
ATOM   3501  C  CE2 . PHE B 2 114 ? 67.076  12.025  -24.817 1.00 53.13  ? 144 PHE B CE2 1 
ATOM   3502  C  CZ  . PHE B 2 114 ? 66.802  13.293  -25.254 1.00 53.22  ? 144 PHE B CZ  1 
ATOM   3503  N  N   . GLN B 2 115 ? 73.269  13.173  -21.787 1.00 52.43  ? 145 GLN B N   1 
ATOM   3504  C  CA  . GLN B 2 115 ? 74.392  13.141  -20.844 1.00 51.14  ? 145 GLN B CA  1 
ATOM   3505  C  C   . GLN B 2 115 ? 74.319  14.178  -19.756 1.00 57.58  ? 145 GLN B C   1 
ATOM   3506  O  O   . GLN B 2 115 ? 73.945  15.309  -20.010 1.00 58.93  ? 145 GLN B O   1 
ATOM   3507  C  CB  . GLN B 2 115 ? 75.701  13.293  -21.612 1.00 50.64  ? 145 GLN B CB  1 
ATOM   3508  C  CG  . GLN B 2 115 ? 75.729  12.420  -22.850 1.00 47.97  ? 145 GLN B CG  1 
ATOM   3509  C  CD  . GLN B 2 115 ? 76.984  12.601  -23.601 1.00 56.86  ? 145 GLN B CD  1 
ATOM   3510  O  OE1 . GLN B 2 115 ? 77.009  13.289  -24.584 1.00 53.78  ? 145 GLN B OE1 1 
ATOM   3511  N  NE2 . GLN B 2 115 ? 78.061  11.993  -23.148 1.00 49.25  ? 145 GLN B NE2 1 
ATOM   3512  N  N   . PHE B 2 116 ? 74.720  13.809  -18.554 1.00 55.44  ? 146 PHE B N   1 
ATOM   3513  C  CA  . PHE B 2 116 ? 74.707  14.718  -17.422 1.00 57.16  ? 146 PHE B CA  1 
ATOM   3514  C  C   . PHE B 2 116 ? 75.841  15.755  -17.441 1.00 66.16  ? 146 PHE B C   1 
ATOM   3515  O  O   . PHE B 2 116 ? 75.768  16.750  -16.716 1.00 71.37  ? 146 PHE B O   1 
ATOM   3516  C  CB  . PHE B 2 116 ? 74.687  13.924  -16.102 1.00 58.64  ? 146 PHE B CB  1 
ATOM   3517  C  CG  . PHE B 2 116 ? 73.315  13.442  -15.667 1.00 60.46  ? 146 PHE B CG  1 
ATOM   3518  C  CD1 . PHE B 2 116 ? 72.293  13.256  -16.597 1.00 61.78  ? 146 PHE B CD1 1 
ATOM   3519  C  CD2 . PHE B 2 116 ? 73.051  13.157  -14.332 1.00 62.84  ? 146 PHE B CD2 1 
ATOM   3520  C  CE1 . PHE B 2 116 ? 71.045  12.798  -16.197 1.00 62.31  ? 146 PHE B CE1 1 
ATOM   3521  C  CE2 . PHE B 2 116 ? 71.798  12.698  -13.933 1.00 64.87  ? 146 PHE B CE2 1 
ATOM   3522  C  CZ  . PHE B 2 116 ? 70.807  12.526  -14.867 1.00 62.31  ? 146 PHE B CZ  1 
ATOM   3523  N  N   . GLY B 2 117 ? 76.853  15.542  -18.264 1.00 60.16  ? 147 GLY B N   1 
ATOM   3524  C  CA  . GLY B 2 117 ? 77.995  16.441  -18.352 1.00 60.00  ? 147 GLY B CA  1 
ATOM   3525  C  C   . GLY B 2 117 ? 77.781  17.726  -19.126 1.00 64.24  ? 147 GLY B C   1 
ATOM   3526  O  O   . GLY B 2 117 ? 76.796  17.864  -19.856 1.00 63.08  ? 147 GLY B O   1 
ATOM   3527  N  N   . PRO B 2 118 ? 78.715  18.697  -18.994 1.00 62.84  ? 148 PRO B N   1 
ATOM   3528  C  CA  . PRO B 2 118 ? 78.576  19.953  -19.769 1.00 63.51  ? 148 PRO B CA  1 
ATOM   3529  C  C   . PRO B 2 118 ? 79.039  19.759  -21.209 1.00 64.32  ? 148 PRO B C   1 
ATOM   3530  O  O   . PRO B 2 118 ? 79.804  18.819  -21.484 1.00 63.15  ? 148 PRO B O   1 
ATOM   3531  C  CB  . PRO B 2 118 ? 79.494  20.928  -19.036 1.00 66.56  ? 148 PRO B CB  1 
ATOM   3532  C  CG  . PRO B 2 118 ? 80.557  20.036  -18.404 1.00 70.12  ? 148 PRO B CG  1 
ATOM   3533  C  CD  . PRO B 2 118 ? 79.938  18.695  -18.151 1.00 64.75  ? 148 PRO B CD  1 
ATOM   3534  N  N   . SER B 2 119 ? 78.573  20.633  -22.125 1.00 58.20  ? 149 SER B N   1 
ATOM   3535  C  CA  . SER B 2 119 ? 78.913  20.587  -23.553 1.00 55.22  ? 149 SER B CA  1 
ATOM   3536  C  C   . SER B 2 119 ? 80.308  21.161  -23.834 1.00 58.21  ? 149 SER B C   1 
ATOM   3537  O  O   . SER B 2 119 ? 80.959  21.674  -22.923 1.00 59.01  ? 149 SER B O   1 
ATOM   3538  C  CB  . SER B 2 119 ? 77.875  21.356  -24.349 1.00 57.50  ? 149 SER B CB  1 
ATOM   3539  O  OG  . SER B 2 119 ? 78.046  22.746  -24.143 1.00 64.68  ? 149 SER B OG  1 
ATOM   3540  N  N   . ILE B 2 120 ? 80.749  21.101  -25.108 1.00 53.60  ? 150 ILE B N   1 
ATOM   3541  C  CA  . ILE B 2 120 ? 82.027  21.617  -25.635 1.00 52.53  ? 150 ILE B CA  1 
ATOM   3542  C  C   . ILE B 2 120 ? 81.992  23.135  -25.437 1.00 60.78  ? 150 ILE B C   1 
ATOM   3543  O  O   . ILE B 2 120 ? 82.840  23.686  -24.734 1.00 63.07  ? 150 ILE B O   1 
ATOM   3544  C  CB  . ILE B 2 120 ? 82.210  21.231  -27.161 1.00 54.13  ? 150 ILE B CB  1 
ATOM   3545  C  CG1 . ILE B 2 120 ? 82.461  19.725  -27.417 1.00 52.70  ? 150 ILE B CG1 1 
ATOM   3546  C  CG2 . ILE B 2 120 ? 83.276  22.037  -27.848 1.00 55.43  ? 150 ILE B CG2 1 
ATOM   3547  C  CD1 . ILE B 2 120 ? 81.179  18.892  -27.576 1.00 64.57  ? 150 ILE B CD1 1 
ATOM   3548  N  N   . GLU B 2 121 ? 80.964  23.789  -26.008 1.00 58.16  ? 151 GLU B N   1 
ATOM   3549  C  CA  . GLU B 2 121 ? 80.747  25.233  -25.996 1.00 59.30  ? 151 GLU B CA  1 
ATOM   3550  C  C   . GLU B 2 121 ? 80.564  25.810  -24.556 1.00 64.66  ? 151 GLU B C   1 
ATOM   3551  O  O   . GLU B 2 121 ? 81.068  26.911  -24.277 1.00 65.46  ? 151 GLU B O   1 
ATOM   3552  C  CB  . GLU B 2 121 ? 79.589  25.619  -26.954 1.00 60.64  ? 151 GLU B CB  1 
ATOM   3553  N  N   . GLN B 2 122 ? 79.883  25.067  -23.647 1.00 59.76  ? 152 GLN B N   1 
ATOM   3554  C  CA  . GLN B 2 122 ? 79.658  25.495  -22.254 1.00 59.78  ? 152 GLN B CA  1 
ATOM   3555  C  C   . GLN B 2 122 ? 80.992  25.590  -21.549 1.00 62.21  ? 152 GLN B C   1 
ATOM   3556  O  O   . GLN B 2 122 ? 81.277  26.601  -20.895 1.00 63.30  ? 152 GLN B O   1 
ATOM   3557  C  CB  . GLN B 2 122 ? 78.824  24.448  -21.515 1.00 60.80  ? 152 GLN B CB  1 
ATOM   3558  C  CG  . GLN B 2 122 ? 77.589  24.969  -20.810 1.00 78.89  ? 152 GLN B CG  1 
ATOM   3559  C  CD  . GLN B 2 122 ? 76.485  23.918  -20.749 1.00 104.62 ? 152 GLN B CD  1 
ATOM   3560  O  OE1 . GLN B 2 122 ? 75.443  24.144  -20.129 1.00 110.56 ? 152 GLN B OE1 1 
ATOM   3561  N  NE2 . GLN B 2 122 ? 76.646  22.758  -21.409 1.00 80.03  ? 152 GLN B NE2 1 
ATOM   3562  N  N   . GLN B 2 123 ? 81.808  24.513  -21.676 1.00 54.89  ? 153 GLN B N   1 
ATOM   3563  C  CA  . GLN B 2 123 ? 83.127  24.404  -21.070 1.00 53.43  ? 153 GLN B CA  1 
ATOM   3564  C  C   . GLN B 2 123 ? 84.050  25.495  -21.590 1.00 59.15  ? 153 GLN B C   1 
ATOM   3565  O  O   . GLN B 2 123 ? 84.612  26.230  -20.788 1.00 60.45  ? 153 GLN B O   1 
ATOM   3566  C  CB  . GLN B 2 123 ? 83.692  23.009  -21.283 1.00 52.24  ? 153 GLN B CB  1 
ATOM   3567  C  CG  . GLN B 2 123 ? 83.066  22.034  -20.316 1.00 49.74  ? 153 GLN B CG  1 
ATOM   3568  C  CD  . GLN B 2 123 ? 83.663  20.681  -20.439 1.00 66.22  ? 153 GLN B CD  1 
ATOM   3569  O  OE1 . GLN B 2 123 ? 84.800  20.455  -20.077 1.00 69.19  ? 153 GLN B OE1 1 
ATOM   3570  N  NE2 . GLN B 2 123 ? 82.906  19.745  -20.937 1.00 66.98  ? 153 GLN B NE2 1 
ATOM   3571  N  N   . ALA B 2 124 ? 84.112  25.670  -22.920 1.00 54.94  ? 154 ALA B N   1 
ATOM   3572  C  CA  . ALA B 2 124 ? 84.874  26.722  -23.585 1.00 55.54  ? 154 ALA B CA  1 
ATOM   3573  C  C   . ALA B 2 124 ? 84.583  28.107  -22.991 1.00 60.10  ? 154 ALA B C   1 
ATOM   3574  O  O   . ALA B 2 124 ? 85.501  28.904  -22.853 1.00 61.56  ? 154 ALA B O   1 
ATOM   3575  C  CB  . ALA B 2 124 ? 84.552  26.725  -25.072 1.00 56.38  ? 154 ALA B CB  1 
ATOM   3576  N  N   . SER B 2 125 ? 83.327  28.388  -22.623 1.00 57.77  ? 155 SER B N   1 
ATOM   3577  C  CA  . SER B 2 125 ? 82.954  29.682  -22.058 1.00 60.31  ? 155 SER B CA  1 
ATOM   3578  C  C   . SER B 2 125 ? 83.475  29.796  -20.638 1.00 64.73  ? 155 SER B C   1 
ATOM   3579  O  O   . SER B 2 125 ? 84.076  30.815  -20.289 1.00 65.66  ? 155 SER B O   1 
ATOM   3580  C  CB  . SER B 2 125 ? 81.447  29.896  -22.125 1.00 67.15  ? 155 SER B CB  1 
ATOM   3581  O  OG  . SER B 2 125 ? 80.819  29.330  -20.988 1.00 85.59  ? 155 SER B OG  1 
ATOM   3582  N  N   . VAL B 2 126 ? 83.304  28.720  -19.849 1.00 60.67  ? 156 VAL B N   1 
ATOM   3583  C  CA  . VAL B 2 126 ? 83.790  28.607  -18.466 1.00 61.29  ? 156 VAL B CA  1 
ATOM   3584  C  C   . VAL B 2 126 ? 85.303  28.906  -18.433 1.00 62.44  ? 156 VAL B C   1 
ATOM   3585  O  O   . VAL B 2 126 ? 85.754  29.637  -17.557 1.00 62.14  ? 156 VAL B O   1 
ATOM   3586  C  CB  . VAL B 2 126 ? 83.445  27.205  -17.875 1.00 65.05  ? 156 VAL B CB  1 
ATOM   3587  C  CG1 . VAL B 2 126 ? 84.117  26.968  -16.526 1.00 65.35  ? 156 VAL B CG1 1 
ATOM   3588  C  CG2 . VAL B 2 126 ? 81.939  27.015  -17.757 1.00 65.38  ? 156 VAL B CG2 1 
ATOM   3589  N  N   . MET B 2 127 ? 86.057  28.392  -19.432 1.00 57.57  ? 157 MET B N   1 
ATOM   3590  C  CA  . MET B 2 127 ? 87.497  28.586  -19.581 1.00 57.60  ? 157 MET B CA  1 
ATOM   3591  C  C   . MET B 2 127 ? 87.852  30.054  -19.774 1.00 63.05  ? 157 MET B C   1 
ATOM   3592  O  O   . MET B 2 127 ? 88.798  30.534  -19.140 1.00 64.47  ? 157 MET B O   1 
ATOM   3593  C  CB  . MET B 2 127 ? 88.063  27.698  -20.685 1.00 58.69  ? 157 MET B CB  1 
ATOM   3594  C  CG  . MET B 2 127 ? 88.132  26.256  -20.276 1.00 62.21  ? 157 MET B CG  1 
ATOM   3595  S  SD  . MET B 2 127 ? 88.405  25.082  -21.630 1.00 67.09  ? 157 MET B SD  1 
ATOM   3596  C  CE  . MET B 2 127 ? 90.148  25.278  -21.910 1.00 64.34  ? 157 MET B CE  1 
ATOM   3597  N  N   . LEU B 2 128 ? 87.056  30.783  -20.586 1.00 58.49  ? 158 LEU B N   1 
ATOM   3598  C  CA  . LEU B 2 128 ? 87.252  32.217  -20.822 1.00 59.51  ? 158 LEU B CA  1 
ATOM   3599  C  C   . LEU B 2 128 ? 86.836  33.032  -19.601 1.00 64.74  ? 158 LEU B C   1 
ATOM   3600  O  O   . LEU B 2 128 ? 87.452  34.053  -19.314 1.00 64.09  ? 158 LEU B O   1 
ATOM   3601  C  CB  . LEU B 2 128 ? 86.510  32.684  -22.079 1.00 59.74  ? 158 LEU B CB  1 
ATOM   3602  C  CG  . LEU B 2 128 ? 87.104  32.238  -23.420 1.00 63.62  ? 158 LEU B CG  1 
ATOM   3603  C  CD1 . LEU B 2 128 ? 86.051  32.227  -24.503 1.00 62.58  ? 158 LEU B CD1 1 
ATOM   3604  C  CD2 . LEU B 2 128 ? 88.267  33.121  -23.834 1.00 68.39  ? 158 LEU B CD2 1 
ATOM   3605  N  N   . ASN B 2 129 ? 85.818  32.559  -18.858 1.00 62.73  ? 159 ASN B N   1 
ATOM   3606  C  CA  . ASN B 2 129 ? 85.364  33.214  -17.634 1.00 64.26  ? 159 ASN B CA  1 
ATOM   3607  C  C   . ASN B 2 129 ? 86.492  33.218  -16.593 1.00 70.02  ? 159 ASN B C   1 
ATOM   3608  O  O   . ASN B 2 129 ? 86.700  34.252  -15.936 1.00 72.65  ? 159 ASN B O   1 
ATOM   3609  C  CB  . ASN B 2 129 ? 84.113  32.550  -17.086 1.00 63.66  ? 159 ASN B CB  1 
ATOM   3610  C  CG  . ASN B 2 129 ? 82.860  33.045  -17.738 1.00 82.46  ? 159 ASN B CG  1 
ATOM   3611  O  OD1 . ASN B 2 129 ? 82.281  34.054  -17.345 1.00 83.34  ? 159 ASN B OD1 1 
ATOM   3612  N  ND2 . ASN B 2 129 ? 82.382  32.314  -18.712 1.00 73.09  ? 159 ASN B ND2 1 
ATOM   3613  N  N   . ILE B 2 130 ? 87.253  32.083  -16.491 1.00 63.24  ? 160 ILE B N   1 
ATOM   3614  C  CA  . ILE B 2 130 ? 88.428  31.930  -15.624 1.00 62.86  ? 160 ILE B CA  1 
ATOM   3615  C  C   . ILE B 2 130 ? 89.475  32.967  -16.055 1.00 69.49  ? 160 ILE B C   1 
ATOM   3616  O  O   . ILE B 2 130 ? 89.997  33.708  -15.213 1.00 71.59  ? 160 ILE B O   1 
ATOM   3617  C  CB  . ILE B 2 130 ? 88.979  30.485  -15.697 1.00 63.56  ? 160 ILE B CB  1 
ATOM   3618  C  CG1 . ILE B 2 130 ? 88.026  29.495  -15.008 1.00 63.16  ? 160 ILE B CG1 1 
ATOM   3619  C  CG2 . ILE B 2 130 ? 90.400  30.374  -15.113 1.00 63.69  ? 160 ILE B CG2 1 
ATOM   3620  C  CD1 . ILE B 2 130 ? 88.039  28.080  -15.617 1.00 61.96  ? 160 ILE B CD1 1 
ATOM   3621  N  N   . MET B 2 131 ? 89.727  33.053  -17.372 1.00 65.46  ? 161 MET B N   1 
ATOM   3622  C  CA  . MET B 2 131 ? 90.699  33.970  -17.949 1.00 66.64  ? 161 MET B CA  1 
ATOM   3623  C  C   . MET B 2 131 ? 90.351  35.441  -17.711 1.00 75.31  ? 161 MET B C   1 
ATOM   3624  O  O   . MET B 2 131 ? 91.233  36.215  -17.329 1.00 77.34  ? 161 MET B O   1 
ATOM   3625  C  CB  . MET B 2 131 ? 90.886  33.672  -19.422 1.00 67.82  ? 161 MET B CB  1 
ATOM   3626  C  CG  . MET B 2 131 ? 91.716  32.428  -19.710 1.00 69.40  ? 161 MET B CG  1 
ATOM   3627  S  SD  . MET B 2 131 ? 91.943  32.220  -21.504 1.00 72.11  ? 161 MET B SD  1 
ATOM   3628  C  CE  . MET B 2 131 ? 90.569  31.312  -21.836 1.00 67.43  ? 161 MET B CE  1 
ATOM   3629  N  N   . GLU B 2 132 ? 89.068  35.822  -17.874 1.00 73.02  ? 162 GLU B N   1 
ATOM   3630  C  CA  . GLU B 2 132 ? 88.619  37.207  -17.646 1.00 75.05  ? 162 GLU B CA  1 
ATOM   3631  C  C   . GLU B 2 132 ? 88.855  37.631  -16.214 1.00 79.91  ? 162 GLU B C   1 
ATOM   3632  O  O   . GLU B 2 132 ? 89.275  38.763  -15.998 1.00 81.64  ? 162 GLU B O   1 
ATOM   3633  C  CB  . GLU B 2 132 ? 87.140  37.405  -18.011 1.00 76.65  ? 162 GLU B CB  1 
ATOM   3634  N  N   . GLU B 2 133 ? 88.630  36.706  -15.246 1.00 76.01  ? 163 GLU B N   1 
ATOM   3635  C  CA  . GLU B 2 133 ? 88.787  36.891  -13.789 1.00 76.82  ? 163 GLU B CA  1 
ATOM   3636  C  C   . GLU B 2 133 ? 90.211  37.279  -13.369 1.00 80.55  ? 163 GLU B C   1 
ATOM   3637  O  O   . GLU B 2 133 ? 90.380  38.223  -12.586 1.00 82.92  ? 163 GLU B O   1 
ATOM   3638  C  CB  . GLU B 2 133 ? 88.321  35.625  -13.031 1.00 76.67  ? 163 GLU B CB  1 
ATOM   3639  C  CG  . GLU B 2 133 ? 88.307  35.735  -11.512 1.00 86.78  ? 163 GLU B CG  1 
ATOM   3640  C  CD  . GLU B 2 133 ? 87.155  36.518  -10.910 1.00 107.80 ? 163 GLU B CD  1 
ATOM   3641  O  OE1 . GLU B 2 133 ? 87.405  37.626  -10.381 1.00 101.03 ? 163 GLU B OE1 1 
ATOM   3642  O  OE2 . GLU B 2 133 ? 86.012  36.005  -10.930 1.00 103.34 ? 163 GLU B OE2 1 
ATOM   3643  N  N   . TYR B 2 134 ? 91.223  36.558  -13.886 1.00 73.60  ? 164 TYR B N   1 
ATOM   3644  C  CA  . TYR B 2 134 ? 92.621  36.822  -13.541 1.00 73.32  ? 164 TYR B CA  1 
ATOM   3645  C  C   . TYR B 2 134 ? 93.341  37.658  -14.586 1.00 77.73  ? 164 TYR B C   1 
ATOM   3646  O  O   . TYR B 2 134 ? 94.556  37.837  -14.504 1.00 76.60  ? 164 TYR B O   1 
ATOM   3647  C  CB  . TYR B 2 134 ? 93.348  35.509  -13.244 1.00 71.78  ? 164 TYR B CB  1 
ATOM   3648  C  CG  . TYR B 2 134 ? 92.673  34.698  -12.162 1.00 71.92  ? 164 TYR B CG  1 
ATOM   3649  C  CD1 . TYR B 2 134 ? 92.779  35.060  -10.824 1.00 75.53  ? 164 TYR B CD1 1 
ATOM   3650  C  CD2 . TYR B 2 134 ? 91.872  33.606  -12.477 1.00 70.26  ? 164 TYR B CD2 1 
ATOM   3651  C  CE1 . TYR B 2 134 ? 92.126  34.337  -9.821  1.00 75.72  ? 164 TYR B CE1 1 
ATOM   3652  C  CE2 . TYR B 2 134 ? 91.203  32.883  -11.483 1.00 70.10  ? 164 TYR B CE2 1 
ATOM   3653  C  CZ  . TYR B 2 134 ? 91.348  33.242  -10.154 1.00 76.72  ? 164 TYR B CZ  1 
ATOM   3654  O  OH  . TYR B 2 134 ? 90.773  32.490  -9.162  1.00 77.08  ? 164 TYR B OH  1 
ATOM   3655  N  N   . ASP B 2 135 ? 92.566  38.214  -15.543 1.00 76.54  ? 165 ASP B N   1 
ATOM   3656  C  CA  . ASP B 2 135 ? 93.018  39.057  -16.654 1.00 77.34  ? 165 ASP B CA  1 
ATOM   3657  C  C   . ASP B 2 135 ? 94.112  38.358  -17.451 1.00 79.35  ? 165 ASP B C   1 
ATOM   3658  O  O   . ASP B 2 135 ? 95.238  38.837  -17.566 1.00 80.27  ? 165 ASP B O   1 
ATOM   3659  C  CB  . ASP B 2 135 ? 93.400  40.472  -16.179 1.00 81.71  ? 165 ASP B CB  1 
ATOM   3660  C  CG  . ASP B 2 135 ? 92.310  41.203  -15.403 1.00 95.80  ? 165 ASP B CG  1 
ATOM   3661  O  OD1 . ASP B 2 135 ? 91.121  41.130  -15.820 1.00 94.97  ? 165 ASP B OD1 1 
ATOM   3662  O  OD2 . ASP B 2 135 ? 92.648  41.886  -14.401 1.00 106.03 ? 165 ASP B OD2 1 
ATOM   3663  N  N   . TRP B 2 136 ? 93.765  37.178  -17.933 1.00 73.60  ? 166 TRP B N   1 
ATOM   3664  C  CA  . TRP B 2 136 ? 94.607  36.298  -18.727 1.00 72.99  ? 166 TRP B CA  1 
ATOM   3665  C  C   . TRP B 2 136 ? 94.085  36.396  -20.144 1.00 77.07  ? 166 TRP B C   1 
ATOM   3666  O  O   . TRP B 2 136 ? 93.432  35.477  -20.627 1.00 75.78  ? 166 TRP B O   1 
ATOM   3667  C  CB  . TRP B 2 136 ? 94.490  34.855  -18.191 1.00 69.77  ? 166 TRP B CB  1 
ATOM   3668  C  CG  . TRP B 2 136 ? 95.124  34.652  -16.835 1.00 70.94  ? 166 TRP B CG  1 
ATOM   3669  C  CD1 . TRP B 2 136 ? 95.955  35.512  -16.171 1.00 75.29  ? 166 TRP B CD1 1 
ATOM   3670  C  CD2 . TRP B 2 136 ? 95.007  33.489  -16.007 1.00 69.41  ? 166 TRP B CD2 1 
ATOM   3671  N  NE1 . TRP B 2 136 ? 96.339  34.968  -14.971 1.00 74.15  ? 166 TRP B NE1 1 
ATOM   3672  C  CE2 . TRP B 2 136 ? 95.786  33.720  -14.850 1.00 74.22  ? 166 TRP B CE2 1 
ATOM   3673  C  CE3 . TRP B 2 136 ? 94.294  32.284  -16.116 1.00 68.58  ? 166 TRP B CE3 1 
ATOM   3674  C  CZ2 . TRP B 2 136 ? 95.866  32.790  -13.805 1.00 73.10  ? 166 TRP B CZ2 1 
ATOM   3675  C  CZ3 . TRP B 2 136 ? 94.385  31.360  -15.091 1.00 69.61  ? 166 TRP B CZ3 1 
ATOM   3676  C  CH2 . TRP B 2 136 ? 95.171  31.612  -13.956 1.00 71.60  ? 166 TRP B CH2 1 
ATOM   3677  N  N   . TYR B 2 137 ? 94.327  37.547  -20.788 1.00 74.14  ? 167 TYR B N   1 
ATOM   3678  C  CA  . TYR B 2 137 ? 93.815  37.868  -22.117 1.00 72.86  ? 167 TYR B CA  1 
ATOM   3679  C  C   . TYR B 2 137 ? 94.683  37.372  -23.269 1.00 75.22  ? 167 TYR B C   1 
ATOM   3680  O  O   . TYR B 2 137 ? 94.175  37.235  -24.378 1.00 74.55  ? 167 TYR B O   1 
ATOM   3681  C  CB  . TYR B 2 137 ? 93.551  39.382  -22.230 1.00 75.76  ? 167 TYR B CB  1 
ATOM   3682  C  CG  . TYR B 2 137 ? 92.587  39.891  -21.179 1.00 77.75  ? 167 TYR B CG  1 
ATOM   3683  C  CD1 . TYR B 2 137 ? 91.305  39.363  -21.066 1.00 79.19  ? 167 TYR B CD1 1 
ATOM   3684  C  CD2 . TYR B 2 137 ? 92.962  40.885  -20.282 1.00 80.16  ? 167 TYR B CD2 1 
ATOM   3685  C  CE1 . TYR B 2 137 ? 90.424  39.800  -20.075 1.00 81.22  ? 167 TYR B CE1 1 
ATOM   3686  C  CE2 . TYR B 2 137 ? 92.078  41.354  -19.308 1.00 81.95  ? 167 TYR B CE2 1 
ATOM   3687  C  CZ  . TYR B 2 137 ? 90.809  40.805  -19.206 1.00 86.52  ? 167 TYR B CZ  1 
ATOM   3688  O  OH  . TYR B 2 137 ? 89.918  41.232  -18.249 1.00 87.07  ? 167 TYR B OH  1 
ATOM   3689  N  N   . ILE B 2 138 ? 95.967  37.081  -23.019 1.00 71.23  ? 168 ILE B N   1 
ATOM   3690  C  CA  . ILE B 2 138 ? 96.863  36.592  -24.065 1.00 70.10  ? 168 ILE B CA  1 
ATOM   3691  C  C   . ILE B 2 138 ? 97.027  35.091  -23.908 1.00 74.07  ? 168 ILE B C   1 
ATOM   3692  O  O   . ILE B 2 138 ? 97.467  34.634  -22.840 1.00 75.46  ? 168 ILE B O   1 
ATOM   3693  C  CB  . ILE B 2 138 ? 98.182  37.378  -24.073 1.00 74.13  ? 168 ILE B CB  1 
ATOM   3694  C  CG1 . ILE B 2 138 ? 97.951  38.766  -24.679 1.00 75.01  ? 168 ILE B CG1 1 
ATOM   3695  C  CG2 . ILE B 2 138 ? 99.274  36.617  -24.813 1.00 74.82  ? 168 ILE B CG2 1 
ATOM   3696  C  CD1 . ILE B 2 138 ? 98.681  39.822  -24.015 1.00 72.25  ? 168 ILE B CD1 1 
ATOM   3697  N  N   . PHE B 2 139 ? 96.627  34.323  -24.964 1.00 66.68  ? 169 PHE B N   1 
ATOM   3698  C  CA  . PHE B 2 139 ? 96.617  32.864  -24.944 1.00 63.06  ? 169 PHE B CA  1 
ATOM   3699  C  C   . PHE B 2 139 ? 96.718  32.173  -26.323 1.00 67.56  ? 169 PHE B C   1 
ATOM   3700  O  O   . PHE B 2 139 ? 96.601  32.808  -27.367 1.00 67.98  ? 169 PHE B O   1 
ATOM   3701  C  CB  . PHE B 2 139 ? 95.329  32.411  -24.234 1.00 62.96  ? 169 PHE B CB  1 
ATOM   3702  C  CG  . PHE B 2 139 ? 94.050  32.654  -25.022 1.00 63.81  ? 169 PHE B CG  1 
ATOM   3703  C  CD1 . PHE B 2 139 ? 93.454  33.916  -25.052 1.00 67.81  ? 169 PHE B CD1 1 
ATOM   3704  C  CD2 . PHE B 2 139 ? 93.421  31.611  -25.714 1.00 61.07  ? 169 PHE B CD2 1 
ATOM   3705  C  CE1 . PHE B 2 139 ? 92.259  34.126  -25.763 1.00 66.71  ? 169 PHE B CE1 1 
ATOM   3706  C  CE2 . PHE B 2 139 ? 92.217  31.824  -26.402 1.00 61.06  ? 169 PHE B CE2 1 
ATOM   3707  C  CZ  . PHE B 2 139 ? 91.643  33.072  -26.416 1.00 60.42  ? 169 PHE B CZ  1 
ATOM   3708  N  N   . SER B 2 140 ? 96.878  30.848  -26.303 1.00 64.85  ? 170 SER B N   1 
ATOM   3709  C  CA  . SER B 2 140 ? 96.903  29.969  -27.486 1.00 64.56  ? 170 SER B CA  1 
ATOM   3710  C  C   . SER B 2 140 ? 95.988  28.728  -27.258 1.00 66.20  ? 170 SER B C   1 
ATOM   3711  O  O   . SER B 2 140 ? 95.648  28.401  -26.117 1.00 66.83  ? 170 SER B O   1 
ATOM   3712  C  CB  . SER B 2 140 ? 98.327  29.530  -27.832 1.00 68.56  ? 170 SER B CB  1 
ATOM   3713  O  OG  . SER B 2 140 ? 99.113  30.594  -28.350 1.00 77.37  ? 170 SER B OG  1 
ATOM   3714  N  N   . ILE B 2 141 ? 95.562  28.082  -28.339 1.00 58.96  ? 171 ILE B N   1 
ATOM   3715  C  CA  . ILE B 2 141 ? 94.707  26.906  -28.276 1.00 55.86  ? 171 ILE B CA  1 
ATOM   3716  C  C   . ILE B 2 141 ? 95.492  25.770  -28.919 1.00 59.41  ? 171 ILE B C   1 
ATOM   3717  O  O   . ILE B 2 141 ? 96.172  25.984  -29.919 1.00 58.99  ? 171 ILE B O   1 
ATOM   3718  C  CB  . ILE B 2 141 ? 93.337  27.142  -28.978 1.00 57.85  ? 171 ILE B CB  1 
ATOM   3719  C  CG1 . ILE B 2 141 ? 92.528  28.265  -28.287 1.00 58.31  ? 171 ILE B CG1 1 
ATOM   3720  C  CG2 . ILE B 2 141 ? 92.514  25.852  -29.016 1.00 57.71  ? 171 ILE B CG2 1 
ATOM   3721  C  CD1 . ILE B 2 141 ? 91.247  28.751  -29.028 1.00 56.24  ? 171 ILE B CD1 1 
ATOM   3722  N  N   . VAL B 2 142 ? 95.434  24.574  -28.326 1.00 55.00  ? 172 VAL B N   1 
ATOM   3723  C  CA  . VAL B 2 142 ? 96.088  23.392  -28.859 1.00 53.71  ? 172 VAL B CA  1 
ATOM   3724  C  C   . VAL B 2 142 ? 95.058  22.318  -28.805 1.00 58.64  ? 172 VAL B C   1 
ATOM   3725  O  O   . VAL B 2 142 ? 94.650  21.931  -27.711 1.00 59.66  ? 172 VAL B O   1 
ATOM   3726  C  CB  . VAL B 2 142 ? 97.339  22.966  -28.060 1.00 57.20  ? 172 VAL B CB  1 
ATOM   3727  C  CG1 . VAL B 2 142 ? 97.837  21.585  -28.508 1.00 56.29  ? 172 VAL B CG1 1 
ATOM   3728  C  CG2 . VAL B 2 142 ? 98.440  23.995  -28.180 1.00 58.25  ? 172 VAL B CG2 1 
ATOM   3729  N  N   . THR B 2 143 ? 94.639  21.818  -29.961 1.00 54.56  ? 173 THR B N   1 
ATOM   3730  C  CA  . THR B 2 143 ? 93.670  20.718  -29.987 1.00 53.15  ? 173 THR B CA  1 
ATOM   3731  C  C   . THR B 2 143 ? 94.237  19.548  -30.770 1.00 55.32  ? 173 THR B C   1 
ATOM   3732  O  O   . THR B 2 143 ? 95.189  19.691  -31.559 1.00 54.10  ? 173 THR B O   1 
ATOM   3733  C  CB  . THR B 2 143 ? 92.272  21.126  -30.582 1.00 60.02  ? 173 THR B CB  1 
ATOM   3734  O  OG1 . THR B 2 143 ? 92.352  21.351  -31.987 1.00 56.42  ? 173 THR B OG1 1 
ATOM   3735  C  CG2 . THR B 2 143 ? 91.665  22.320  -29.918 1.00 62.29  ? 173 THR B CG2 1 
ATOM   3736  N  N   . THR B 2 144 ? 93.620  18.391  -30.560 1.00 50.54  ? 174 THR B N   1 
ATOM   3737  C  CA  . THR B 2 144 ? 93.861  17.213  -31.371 1.00 49.39  ? 174 THR B CA  1 
ATOM   3738  C  C   . THR B 2 144 ? 92.647  17.176  -32.315 1.00 48.91  ? 174 THR B C   1 
ATOM   3739  O  O   . THR B 2 144 ? 91.948  18.191  -32.446 1.00 46.69  ? 174 THR B O   1 
ATOM   3740  C  CB  . THR B 2 144 ? 93.990  15.973  -30.514 1.00 58.28  ? 174 THR B CB  1 
ATOM   3741  O  OG1 . THR B 2 144 ? 92.804  15.829  -29.734 1.00 57.17  ? 174 THR B OG1 1 
ATOM   3742  C  CG2 . THR B 2 144 ? 95.222  16.008  -29.650 1.00 55.87  ? 174 THR B CG2 1 
ATOM   3743  N  N   . TYR B 2 145 ? 92.390  16.034  -32.954 1.00 44.62  ? 175 TYR B N   1 
ATOM   3744  C  CA  . TYR B 2 145 ? 91.233  15.907  -33.853 1.00 44.06  ? 175 TYR B CA  1 
ATOM   3745  C  C   . TYR B 2 145 ? 90.017  15.415  -33.107 1.00 44.07  ? 175 TYR B C   1 
ATOM   3746  O  O   . TYR B 2 145 ? 89.008  15.173  -33.731 1.00 44.40  ? 175 TYR B O   1 
ATOM   3747  C  CB  . TYR B 2 145 ? 91.530  15.018  -35.089 1.00 45.29  ? 175 TYR B CB  1 
ATOM   3748  C  CG  . TYR B 2 145 ? 92.298  15.724  -36.178 1.00 48.99  ? 175 TYR B CG  1 
ATOM   3749  C  CD1 . TYR B 2 145 ? 93.686  15.831  -36.123 1.00 52.00  ? 175 TYR B CD1 1 
ATOM   3750  C  CD2 . TYR B 2 145 ? 91.645  16.252  -37.285 1.00 51.72  ? 175 TYR B CD2 1 
ATOM   3751  C  CE1 . TYR B 2 145 ? 94.404  16.471  -37.135 1.00 55.61  ? 175 TYR B CE1 1 
ATOM   3752  C  CE2 . TYR B 2 145 ? 92.351  16.880  -38.313 1.00 54.68  ? 175 TYR B CE2 1 
ATOM   3753  C  CZ  . TYR B 2 145 ? 93.731  16.994  -38.231 1.00 63.99  ? 175 TYR B CZ  1 
ATOM   3754  O  OH  . TYR B 2 145 ? 94.415  17.648  -39.229 1.00 64.69  ? 175 TYR B OH  1 
ATOM   3755  N  N   . PHE B 2 146 ? 90.099  15.268  -31.781 1.00 38.66  ? 176 PHE B N   1 
ATOM   3756  C  CA  . PHE B 2 146 ? 88.976  14.806  -30.970 1.00 37.35  ? 176 PHE B CA  1 
ATOM   3757  C  C   . PHE B 2 146 ? 87.663  15.513  -31.358 1.00 38.84  ? 176 PHE B C   1 
ATOM   3758  O  O   . PHE B 2 146 ? 87.636  16.745  -31.443 1.00 38.30  ? 176 PHE B O   1 
ATOM   3759  C  CB  . PHE B 2 146 ? 89.262  14.945  -29.457 1.00 39.52  ? 176 PHE B CB  1 
ATOM   3760  C  CG  . PHE B 2 146 ? 88.167  14.285  -28.657 1.00 39.85  ? 176 PHE B CG  1 
ATOM   3761  C  CD1 . PHE B 2 146 ? 88.063  12.899  -28.607 1.00 40.60  ? 176 PHE B CD1 1 
ATOM   3762  C  CD2 . PHE B 2 146 ? 87.175  15.044  -28.054 1.00 41.75  ? 176 PHE B CD2 1 
ATOM   3763  C  CE1 . PHE B 2 146 ? 87.036  12.292  -27.915 1.00 40.92  ? 176 PHE B CE1 1 
ATOM   3764  C  CE2 . PHE B 2 146 ? 86.140  14.436  -27.367 1.00 44.34  ? 176 PHE B CE2 1 
ATOM   3765  C  CZ  . PHE B 2 146 ? 86.088  13.063  -27.287 1.00 41.83  ? 176 PHE B CZ  1 
ATOM   3766  N  N   . PRO B 2 147 ? 86.580  14.752  -31.645 1.00 35.06  ? 177 PRO B N   1 
ATOM   3767  C  CA  . PRO B 2 147 ? 85.338  15.395  -32.108 1.00 34.17  ? 177 PRO B CA  1 
ATOM   3768  C  C   . PRO B 2 147 ? 84.896  16.641  -31.338 1.00 40.41  ? 177 PRO B C   1 
ATOM   3769  O  O   . PRO B 2 147 ? 84.721  16.618  -30.115 1.00 40.93  ? 177 PRO B O   1 
ATOM   3770  C  CB  . PRO B 2 147 ? 84.309  14.278  -32.011 1.00 34.12  ? 177 PRO B CB  1 
ATOM   3771  C  CG  . PRO B 2 147 ? 85.068  13.048  -32.124 1.00 38.44  ? 177 PRO B CG  1 
ATOM   3772  C  CD  . PRO B 2 147 ? 86.432  13.280  -31.607 1.00 35.18  ? 177 PRO B CD  1 
ATOM   3773  N  N   . GLY B 2 148 ? 84.727  17.719  -32.091 1.00 38.98  ? 178 GLY B N   1 
ATOM   3774  C  CA  . GLY B 2 148 ? 84.230  19.002  -31.620 1.00 40.27  ? 178 GLY B CA  1 
ATOM   3775  C  C   . GLY B 2 148 ? 85.308  20.038  -31.493 1.00 48.19  ? 178 GLY B C   1 
ATOM   3776  O  O   . GLY B 2 148 ? 85.023  21.160  -31.075 1.00 49.37  ? 178 GLY B O   1 
ATOM   3777  N  N   . TYR B 2 149 ? 86.559  19.665  -31.830 1.00 45.76  ? 179 TYR B N   1 
ATOM   3778  C  CA  . TYR B 2 149 ? 87.701  20.560  -31.731 1.00 46.77  ? 179 TYR B CA  1 
ATOM   3779  C  C   . TYR B 2 149 ? 87.449  21.873  -32.469 1.00 52.12  ? 179 TYR B C   1 
ATOM   3780  O  O   . TYR B 2 149 ? 87.788  22.923  -31.947 1.00 53.17  ? 179 TYR B O   1 
ATOM   3781  C  CB  . TYR B 2 149 ? 88.984  19.867  -32.171 1.00 47.80  ? 179 TYR B CB  1 
ATOM   3782  C  CG  . TYR B 2 149 ? 89.108  19.715  -33.664 1.00 48.99  ? 179 TYR B CG  1 
ATOM   3783  C  CD1 . TYR B 2 149 ? 89.736  20.692  -34.432 1.00 51.66  ? 179 TYR B CD1 1 
ATOM   3784  C  CD2 . TYR B 2 149 ? 88.648  18.577  -34.304 1.00 49.91  ? 179 TYR B CD2 1 
ATOM   3785  C  CE1 . TYR B 2 149 ? 89.896  20.541  -35.807 1.00 53.61  ? 179 TYR B CE1 1 
ATOM   3786  C  CE2 . TYR B 2 149 ? 88.779  18.424  -35.687 1.00 52.57  ? 179 TYR B CE2 1 
ATOM   3787  C  CZ  . TYR B 2 149 ? 89.411  19.407  -36.434 1.00 61.76  ? 179 TYR B CZ  1 
ATOM   3788  O  OH  . TYR B 2 149 ? 89.544  19.256  -37.790 1.00 64.66  ? 179 TYR B OH  1 
ATOM   3789  N  N   . GLN B 2 150 ? 86.791  21.819  -33.633 1.00 49.25  ? 180 GLN B N   1 
ATOM   3790  C  CA  . GLN B 2 150 ? 86.407  23.006  -34.401 1.00 49.73  ? 180 GLN B CA  1 
ATOM   3791  C  C   . GLN B 2 150 ? 85.336  23.792  -33.669 1.00 52.60  ? 180 GLN B C   1 
ATOM   3792  O  O   . GLN B 2 150 ? 85.458  25.004  -33.577 1.00 51.35  ? 180 GLN B O   1 
ATOM   3793  C  CB  . GLN B 2 150 ? 85.968  22.668  -35.839 1.00 50.68  ? 180 GLN B CB  1 
ATOM   3794  C  CG  . GLN B 2 150 ? 87.000  23.062  -36.903 1.00 67.46  ? 180 GLN B CG  1 
ATOM   3795  C  CD  . GLN B 2 150 ? 87.385  24.544  -36.910 1.00 79.78  ? 180 GLN B CD  1 
ATOM   3796  O  OE1 . GLN B 2 150 ? 88.240  24.999  -36.135 1.00 57.89  ? 180 GLN B OE1 1 
ATOM   3797  N  NE2 . GLN B 2 150 ? 86.788  25.321  -37.815 1.00 89.71  ? 180 GLN B NE2 1 
ATOM   3798  N  N   . ASP B 2 151 ? 84.348  23.100  -33.055 1.00 50.68  ? 181 ASP B N   1 
ATOM   3799  C  CA  . ASP B 2 151 ? 83.280  23.739  -32.270 1.00 52.24  ? 181 ASP B CA  1 
ATOM   3800  C  C   . ASP B 2 151 ? 83.867  24.450  -31.052 1.00 57.05  ? 181 ASP B C   1 
ATOM   3801  O  O   . ASP B 2 151 ? 83.435  25.562  -30.732 1.00 59.36  ? 181 ASP B O   1 
ATOM   3802  C  CB  . ASP B 2 151 ? 82.179  22.735  -31.869 1.00 54.27  ? 181 ASP B CB  1 
ATOM   3803  C  CG  . ASP B 2 151 ? 81.267  22.224  -32.996 1.00 68.07  ? 181 ASP B CG  1 
ATOM   3804  O  OD1 . ASP B 2 151 ? 81.346  22.772  -34.136 1.00 68.81  ? 181 ASP B OD1 1 
ATOM   3805  O  OD2 . ASP B 2 151 ? 80.437  21.308  -32.726 1.00 72.36  ? 181 ASP B OD2 1 
ATOM   3806  N  N   . PHE B 2 152 ? 84.916  23.856  -30.434 1.00 50.93  ? 182 PHE B N   1 
ATOM   3807  C  CA  . PHE B 2 152 ? 85.647  24.447  -29.315 1.00 49.83  ? 182 PHE B CA  1 
ATOM   3808  C  C   . PHE B 2 152 ? 86.332  25.745  -29.760 1.00 54.22  ? 182 PHE B C   1 
ATOM   3809  O  O   . PHE B 2 152 ? 86.036  26.787  -29.177 1.00 54.96  ? 182 PHE B O   1 
ATOM   3810  C  CB  . PHE B 2 152 ? 86.654  23.447  -28.735 1.00 50.28  ? 182 PHE B CB  1 
ATOM   3811  C  CG  . PHE B 2 152 ? 87.464  23.985  -27.581 1.00 52.46  ? 182 PHE B CG  1 
ATOM   3812  C  CD1 . PHE B 2 152 ? 86.934  24.025  -26.296 1.00 55.40  ? 182 PHE B CD1 1 
ATOM   3813  C  CD2 . PHE B 2 152 ? 88.761  24.458  -27.777 1.00 53.87  ? 182 PHE B CD2 1 
ATOM   3814  C  CE1 . PHE B 2 152 ? 87.682  24.539  -25.231 1.00 55.64  ? 182 PHE B CE1 1 
ATOM   3815  C  CE2 . PHE B 2 152 ? 89.506  24.966  -26.708 1.00 56.08  ? 182 PHE B CE2 1 
ATOM   3816  C  CZ  . PHE B 2 152 ? 88.962  24.990  -25.445 1.00 54.19  ? 182 PHE B CZ  1 
ATOM   3817  N  N   . VAL B 2 153 ? 87.192  25.691  -30.817 1.00 50.82  ? 183 VAL B N   1 
ATOM   3818  C  CA  . VAL B 2 153 ? 87.906  26.863  -31.370 1.00 52.83  ? 183 VAL B CA  1 
ATOM   3819  C  C   . VAL B 2 153 ? 86.911  27.953  -31.811 1.00 57.95  ? 183 VAL B C   1 
ATOM   3820  O  O   . VAL B 2 153 ? 87.067  29.117  -31.449 1.00 58.84  ? 183 VAL B O   1 
ATOM   3821  C  CB  . VAL B 2 153 ? 88.939  26.525  -32.494 1.00 56.79  ? 183 VAL B CB  1 
ATOM   3822  C  CG1 . VAL B 2 153 ? 89.724  27.774  -32.906 1.00 58.03  ? 183 VAL B CG1 1 
ATOM   3823  C  CG2 . VAL B 2 153 ? 89.916  25.440  -32.043 1.00 55.94  ? 183 VAL B CG2 1 
ATOM   3824  N  N   . ASN B 2 154 ? 85.865  27.554  -32.539 1.00 53.50  ? 184 ASN B N   1 
ATOM   3825  C  CA  . ASN B 2 154 ? 84.827  28.459  -33.006 1.00 54.47  ? 184 ASN B CA  1 
ATOM   3826  C  C   . ASN B 2 154 ? 84.095  29.157  -31.858 1.00 60.04  ? 184 ASN B C   1 
ATOM   3827  O  O   . ASN B 2 154 ? 83.803  30.359  -31.969 1.00 62.93  ? 184 ASN B O   1 
ATOM   3828  C  CB  . ASN B 2 154 ? 83.845  27.737  -33.929 1.00 53.90  ? 184 ASN B CB  1 
ATOM   3829  C  CG  . ASN B 2 154 ? 84.425  27.313  -35.263 1.00 68.61  ? 184 ASN B CG  1 
ATOM   3830  O  OD1 . ASN B 2 154 ? 85.440  27.858  -35.778 1.00 49.21  ? 184 ASN B OD1 1 
ATOM   3831  N  ND2 . ASN B 2 154 ? 83.783  26.301  -35.841 1.00 64.56  ? 184 ASN B ND2 1 
ATOM   3832  N  N   . LYS B 2 155 ? 83.838  28.435  -30.740 1.00 53.42  ? 185 LYS B N   1 
ATOM   3833  C  CA  . LYS B 2 155 ? 83.182  29.064  -29.593 1.00 52.80  ? 185 LYS B CA  1 
ATOM   3834  C  C   . LYS B 2 155 ? 84.058  30.161  -29.035 1.00 57.34  ? 185 LYS B C   1 
ATOM   3835  O  O   . LYS B 2 155 ? 83.582  31.280  -28.886 1.00 58.01  ? 185 LYS B O   1 
ATOM   3836  C  CB  . LYS B 2 155 ? 82.786  28.054  -28.505 1.00 52.69  ? 185 LYS B CB  1 
ATOM   3837  C  CG  . LYS B 2 155 ? 81.971  28.673  -27.360 1.00 53.01  ? 185 LYS B CG  1 
ATOM   3838  C  CD  . LYS B 2 155 ? 80.772  29.507  -27.805 1.00 54.47  ? 185 LYS B CD  1 
ATOM   3839  C  CE  . LYS B 2 155 ? 80.141  30.212  -26.630 1.00 83.00  ? 185 LYS B CE  1 
ATOM   3840  N  NZ  . LYS B 2 155 ? 78.976  29.461  -26.086 1.00 95.78  ? 185 LYS B NZ  1 
ATOM   3841  N  N   . ILE B 2 156 ? 85.345  29.855  -28.779 1.00 54.14  ? 186 ILE B N   1 
ATOM   3842  C  CA  . ILE B 2 156 ? 86.324  30.811  -28.256 1.00 55.02  ? 186 ILE B CA  1 
ATOM   3843  C  C   . ILE B 2 156 ? 86.338  32.004  -29.188 1.00 61.01  ? 186 ILE B C   1 
ATOM   3844  O  O   . ILE B 2 156 ? 86.017  33.093  -28.751 1.00 62.96  ? 186 ILE B O   1 
ATOM   3845  C  CB  . ILE B 2 156 ? 87.751  30.187  -28.105 1.00 57.10  ? 186 ILE B CB  1 
ATOM   3846  C  CG1 . ILE B 2 156 ? 87.758  28.836  -27.309 1.00 55.24  ? 186 ILE B CG1 1 
ATOM   3847  C  CG2 . ILE B 2 156 ? 88.736  31.197  -27.532 1.00 59.28  ? 186 ILE B CG2 1 
ATOM   3848  C  CD1 . ILE B 2 156 ? 87.378  28.858  -25.827 1.00 60.98  ? 186 ILE B CD1 1 
ATOM   3849  N  N   . ARG B 2 157 ? 86.613  31.772  -30.486 1.00 58.05  ? 187 ARG B N   1 
ATOM   3850  C  CA  . ARG B 2 157 ? 86.706  32.797  -31.527 1.00 59.87  ? 187 ARG B CA  1 
ATOM   3851  C  C   . ARG B 2 157 ? 85.489  33.690  -31.610 1.00 66.55  ? 187 ARG B C   1 
ATOM   3852  O  O   . ARG B 2 157 ? 85.656  34.910  -31.680 1.00 69.16  ? 187 ARG B O   1 
ATOM   3853  C  CB  . ARG B 2 157 ? 87.018  32.188  -32.890 1.00 59.24  ? 187 ARG B CB  1 
ATOM   3854  C  CG  . ARG B 2 157 ? 88.457  31.773  -33.047 1.00 64.82  ? 187 ARG B CG  1 
ATOM   3855  C  CD  . ARG B 2 157 ? 88.866  31.779  -34.494 1.00 67.52  ? 187 ARG B CD  1 
ATOM   3856  N  NE  . ARG B 2 157 ? 90.301  32.035  -34.599 1.00 80.63  ? 187 ARG B NE  1 
ATOM   3857  C  CZ  . ARG B 2 157 ? 91.181  31.194  -35.134 1.00 88.95  ? 187 ARG B CZ  1 
ATOM   3858  N  NH1 . ARG B 2 157 ? 90.772  30.040  -35.668 1.00 57.53  ? 187 ARG B NH1 1 
ATOM   3859  N  NH2 . ARG B 2 157 ? 92.475  31.510  -35.167 1.00 74.04  ? 187 ARG B NH2 1 
ATOM   3860  N  N   . SER B 2 158 ? 84.273  33.111  -31.576 1.00 62.03  ? 188 SER B N   1 
ATOM   3861  C  CA  . SER B 2 158 ? 83.061  33.926  -31.654 1.00 63.68  ? 188 SER B CA  1 
ATOM   3862  C  C   . SER B 2 158 ? 82.939  34.828  -30.423 1.00 70.44  ? 188 SER B C   1 
ATOM   3863  O  O   . SER B 2 158 ? 82.758  36.044  -30.580 1.00 72.55  ? 188 SER B O   1 
ATOM   3864  C  CB  . SER B 2 158 ? 81.824  33.061  -31.851 1.00 66.17  ? 188 SER B CB  1 
ATOM   3865  O  OG  . SER B 2 158 ? 81.243  32.701  -30.611 1.00 79.08  ? 188 SER B OG  1 
ATOM   3866  N  N   . THR B 2 159 ? 83.129  34.234  -29.209 1.00 65.60  ? 189 THR B N   1 
ATOM   3867  C  CA  . THR B 2 159 ? 83.089  34.908  -27.903 1.00 65.99  ? 189 THR B CA  1 
ATOM   3868  C  C   . THR B 2 159 ? 84.072  36.088  -27.840 1.00 70.58  ? 189 THR B C   1 
ATOM   3869  O  O   . THR B 2 159 ? 83.707  37.181  -27.411 1.00 71.73  ? 189 THR B O   1 
ATOM   3870  C  CB  . THR B 2 159 ? 83.366  33.886  -26.788 1.00 70.55  ? 189 THR B CB  1 
ATOM   3871  O  OG1 . THR B 2 159 ? 82.455  32.803  -26.907 1.00 64.28  ? 189 THR B OG1 1 
ATOM   3872  C  CG2 . THR B 2 159 ? 83.246  34.476  -25.410 1.00 73.65  ? 189 THR B CG2 1 
ATOM   3873  N  N   . ILE B 2 160 ? 85.315  35.821  -28.250 1.00 66.52  ? 190 ILE B N   1 
ATOM   3874  C  CA  . ILE B 2 160 ? 86.457  36.713  -28.279 1.00 68.03  ? 190 ILE B CA  1 
ATOM   3875  C  C   . ILE B 2 160 ? 86.222  37.909  -29.170 1.00 78.23  ? 190 ILE B C   1 
ATOM   3876  O  O   . ILE B 2 160 ? 86.490  39.032  -28.745 1.00 79.63  ? 190 ILE B O   1 
ATOM   3877  C  CB  . ILE B 2 160 ? 87.707  35.868  -28.670 1.00 69.13  ? 190 ILE B CB  1 
ATOM   3878  C  CG1 . ILE B 2 160 ? 88.637  35.708  -27.518 1.00 69.39  ? 190 ILE B CG1 1 
ATOM   3879  C  CG2 . ILE B 2 160 ? 88.454  36.320  -29.902 1.00 71.06  ? 190 ILE B CG2 1 
ATOM   3880  C  CD1 . ILE B 2 160 ? 88.183  34.772  -26.596 1.00 83.59  ? 190 ILE B CD1 1 
ATOM   3881  N  N   . GLU B 2 161 ? 85.687  37.679  -30.388 1.00 78.52  ? 191 GLU B N   1 
ATOM   3882  C  CA  . GLU B 2 161 ? 85.473  38.730  -31.382 1.00 81.95  ? 191 GLU B CA  1 
ATOM   3883  C  C   . GLU B 2 161 ? 84.272  39.656  -31.104 1.00 91.80  ? 191 GLU B C   1 
ATOM   3884  O  O   . GLU B 2 161 ? 84.063  40.589  -31.876 1.00 95.35  ? 191 GLU B O   1 
ATOM   3885  C  CB  . GLU B 2 161 ? 85.392  38.137  -32.787 1.00 82.46  ? 191 GLU B CB  1 
ATOM   3886  C  CG  . GLU B 2 161 ? 86.731  37.655  -33.310 1.00 92.65  ? 191 GLU B CG  1 
ATOM   3887  C  CD  . GLU B 2 161 ? 86.676  36.383  -34.136 1.00 113.87 ? 191 GLU B CD  1 
ATOM   3888  O  OE1 . GLU B 2 161 ? 85.725  36.217  -34.941 1.00 97.94  ? 191 GLU B OE1 1 
ATOM   3889  O  OE2 . GLU B 2 161 ? 87.577  35.532  -33.949 1.00 109.41 ? 191 GLU B OE2 1 
ATOM   3890  N  N   . ASN B 2 162 ? 83.518  39.449  -30.005 1.00 89.15  ? 192 ASN B N   1 
ATOM   3891  C  CA  . ASN B 2 162 ? 82.389  40.328  -29.661 1.00 91.26  ? 192 ASN B CA  1 
ATOM   3892  C  C   . ASN B 2 162 ? 82.556  41.004  -28.276 1.00 96.61  ? 192 ASN B C   1 
ATOM   3893  O  O   . ASN B 2 162 ? 81.820  41.937  -27.925 1.00 98.79  ? 192 ASN B O   1 
ATOM   3894  C  CB  . ASN B 2 162 ? 81.069  39.587  -29.810 1.00 90.52  ? 192 ASN B CB  1 
ATOM   3895  C  CG  . ASN B 2 162 ? 80.739  39.369  -31.269 1.00 117.19 ? 192 ASN B CG  1 
ATOM   3896  O  OD1 . ASN B 2 162 ? 80.809  38.245  -31.790 1.00 104.85 ? 192 ASN B OD1 1 
ATOM   3897  N  ND2 . ASN B 2 162 ? 80.459  40.463  -31.985 1.00 114.93 ? 192 ASN B ND2 1 
ATOM   3898  N  N   . SER B 2 163 ? 83.591  40.559  -27.547 1.00 90.84  ? 193 SER B N   1 
ATOM   3899  C  CA  . SER B 2 163 ? 84.047  41.001  -26.234 1.00 90.40  ? 193 SER B CA  1 
ATOM   3900  C  C   . SER B 2 163 ? 84.813  42.304  -26.451 1.00 94.32  ? 193 SER B C   1 
ATOM   3901  O  O   . SER B 2 163 ? 85.791  42.318  -27.213 1.00 93.57  ? 193 SER B O   1 
ATOM   3902  C  CB  . SER B 2 163 ? 84.984  39.931  -25.666 1.00 91.78  ? 193 SER B CB  1 
ATOM   3903  O  OG  . SER B 2 163 ? 85.182  39.957  -24.263 1.00 101.24 ? 193 SER B OG  1 
ATOM   3904  N  N   . PHE B 2 164 ? 84.371  43.407  -25.813 1.00 91.99  ? 194 PHE B N   1 
ATOM   3905  C  CA  . PHE B 2 164 ? 85.074  44.689  -25.961 1.00 93.75  ? 194 PHE B CA  1 
ATOM   3906  C  C   . PHE B 2 164 ? 86.378  44.688  -25.125 1.00 95.64  ? 194 PHE B C   1 
ATOM   3907  O  O   . PHE B 2 164 ? 86.912  45.732  -24.705 1.00 97.52  ? 194 PHE B O   1 
ATOM   3908  C  CB  . PHE B 2 164 ? 84.159  45.901  -25.696 1.00 98.54  ? 194 PHE B CB  1 
ATOM   3909  C  CG  . PHE B 2 164 ? 83.489  46.032  -24.344 1.00 101.63 ? 194 PHE B CG  1 
ATOM   3910  C  CD1 . PHE B 2 164 ? 84.243  46.231  -23.185 1.00 106.03 ? 194 PHE B CD1 1 
ATOM   3911  C  CD2 . PHE B 2 164 ? 82.104  46.100  -24.242 1.00 105.14 ? 194 PHE B CD2 1 
ATOM   3912  C  CE1 . PHE B 2 164 ? 83.623  46.430  -21.942 1.00 108.07 ? 194 PHE B CE1 1 
ATOM   3913  C  CE2 . PHE B 2 164 ? 81.483  46.308  -23.000 1.00 109.34 ? 194 PHE B CE2 1 
ATOM   3914  C  CZ  . PHE B 2 164 ? 82.248  46.469  -21.858 1.00 107.90 ? 194 PHE B CZ  1 
ATOM   3915  N  N   . VAL B 2 165 ? 86.882  43.469  -24.914 1.00 86.81  ? 195 VAL B N   1 
ATOM   3916  C  CA  . VAL B 2 165 ? 88.080  43.151  -24.167 1.00 84.44  ? 195 VAL B CA  1 
ATOM   3917  C  C   . VAL B 2 165 ? 89.202  42.875  -25.186 1.00 86.20  ? 195 VAL B C   1 
ATOM   3918  O  O   . VAL B 2 165 ? 88.948  42.416  -26.307 1.00 83.42  ? 195 VAL B O   1 
ATOM   3919  C  CB  . VAL B 2 165 ? 87.800  41.951  -23.217 1.00 84.78  ? 195 VAL B CB  1 
ATOM   3920  C  CG1 . VAL B 2 165 ? 89.029  41.561  -22.431 1.00 83.26  ? 195 VAL B CG1 1 
ATOM   3921  C  CG2 . VAL B 2 165 ? 86.643  42.251  -22.272 1.00 85.39  ? 195 VAL B CG2 1 
ATOM   3922  N  N   . GLY B 2 166 ? 90.423  43.164  -24.749 1.00 82.89  ? 196 GLY B N   1 
ATOM   3923  C  CA  . GLY B 2 166 ? 91.674  43.016  -25.478 1.00 81.86  ? 196 GLY B CA  1 
ATOM   3924  C  C   . GLY B 2 166 ? 92.271  41.624  -25.448 1.00 81.48  ? 196 GLY B C   1 
ATOM   3925  O  O   . GLY B 2 166 ? 93.448  41.443  -25.106 1.00 79.53  ? 196 GLY B O   1 
ATOM   3926  N  N   . TRP B 2 167 ? 91.455  40.632  -25.847 1.00 76.25  ? 197 TRP B N   1 
ATOM   3927  C  CA  . TRP B 2 167 ? 91.854  39.234  -25.979 1.00 73.23  ? 197 TRP B CA  1 
ATOM   3928  C  C   . TRP B 2 167 ? 92.799  39.115  -27.162 1.00 75.46  ? 197 TRP B C   1 
ATOM   3929  O  O   . TRP B 2 167 ? 92.635  39.814  -28.166 1.00 77.76  ? 197 TRP B O   1 
ATOM   3930  C  CB  . TRP B 2 167 ? 90.645  38.363  -26.297 1.00 70.73  ? 197 TRP B CB  1 
ATOM   3931  C  CG  . TRP B 2 167 ? 89.621  38.242  -25.222 1.00 71.86  ? 197 TRP B CG  1 
ATOM   3932  C  CD1 . TRP B 2 167 ? 88.368  38.781  -25.220 1.00 75.52  ? 197 TRP B CD1 1 
ATOM   3933  C  CD2 . TRP B 2 167 ? 89.696  37.383  -24.075 1.00 70.96  ? 197 TRP B CD2 1 
ATOM   3934  N  NE1 . TRP B 2 167 ? 87.676  38.359  -24.111 1.00 74.94  ? 197 TRP B NE1 1 
ATOM   3935  C  CE2 . TRP B 2 167 ? 88.466  37.490  -23.392 1.00 75.34  ? 197 TRP B CE2 1 
ATOM   3936  C  CE3 . TRP B 2 167 ? 90.704  36.551  -23.539 1.00 71.11  ? 197 TRP B CE3 1 
ATOM   3937  C  CZ2 . TRP B 2 167 ? 88.224  36.822  -22.180 1.00 73.76  ? 197 TRP B CZ2 1 
ATOM   3938  C  CZ3 . TRP B 2 167 ? 90.455  35.876  -22.359 1.00 71.78  ? 197 TRP B CZ3 1 
ATOM   3939  C  CH2 . TRP B 2 167 ? 89.232  36.022  -21.687 1.00 72.85  ? 197 TRP B CH2 1 
ATOM   3940  N  N   . GLU B 2 168 ? 93.766  38.230  -27.061 1.00 68.90  ? 198 GLU B N   1 
ATOM   3941  C  CA  . GLU B 2 168 ? 94.741  38.018  -28.119 1.00 68.03  ? 198 GLU B CA  1 
ATOM   3942  C  C   . GLU B 2 168 ? 95.053  36.517  -28.243 1.00 69.70  ? 198 GLU B C   1 
ATOM   3943  O  O   . GLU B 2 168 ? 95.821  35.958  -27.447 1.00 69.12  ? 198 GLU B O   1 
ATOM   3944  C  CB  . GLU B 2 168 ? 96.012  38.888  -27.917 1.00 70.87  ? 198 GLU B CB  1 
ATOM   3945  N  N   . LEU B 2 169 ? 94.397  35.869  -29.221 1.00 63.62  ? 199 LEU B N   1 
ATOM   3946  C  CA  . LEU B 2 169 ? 94.583  34.457  -29.534 1.00 60.82  ? 199 LEU B CA  1 
ATOM   3947  C  C   . LEU B 2 169 ? 95.786  34.337  -30.484 1.00 66.21  ? 199 LEU B C   1 
ATOM   3948  O  O   . LEU B 2 169 ? 95.646  34.435  -31.713 1.00 66.93  ? 199 LEU B O   1 
ATOM   3949  C  CB  . LEU B 2 169 ? 93.277  33.828  -30.099 1.00 58.90  ? 199 LEU B CB  1 
ATOM   3950  C  CG  . LEU B 2 169 ? 93.325  32.406  -30.706 1.00 60.92  ? 199 LEU B CG  1 
ATOM   3951  C  CD1 . LEU B 2 169 ? 93.952  31.384  -29.758 1.00 60.13  ? 199 LEU B CD1 1 
ATOM   3952  C  CD2 . LEU B 2 169 ? 91.946  31.961  -31.130 1.00 60.91  ? 199 LEU B CD2 1 
ATOM   3953  N  N   . GLU B 2 170 ? 96.976  34.137  -29.879 1.00 62.33  ? 200 GLU B N   1 
ATOM   3954  C  CA  . GLU B 2 170 ? 98.287  34.058  -30.532 1.00 62.19  ? 200 GLU B CA  1 
ATOM   3955  C  C   . GLU B 2 170 ? 98.453  32.906  -31.543 1.00 66.00  ? 200 GLU B C   1 
ATOM   3956  O  O   . GLU B 2 170 ? 98.918  33.142  -32.661 1.00 66.23  ? 200 GLU B O   1 
ATOM   3957  C  CB  . GLU B 2 170 ? 99.398  34.016  -29.486 1.00 63.45  ? 200 GLU B CB  1 
ATOM   3958  C  CG  . GLU B 2 170 ? 99.383  35.214  -28.555 1.00 70.38  ? 200 GLU B CG  1 
ATOM   3959  C  CD  . GLU B 2 170 ? 100.734 35.518  -27.958 1.00 90.50  ? 200 GLU B CD  1 
ATOM   3960  O  OE1 . GLU B 2 170 ? 101.035 34.955  -26.882 1.00 90.96  ? 200 GLU B OE1 1 
ATOM   3961  O  OE2 . GLU B 2 170 ? 101.524 36.250  -28.600 1.00 80.70  ? 200 GLU B OE2 1 
ATOM   3962  N  N   . GLU B 2 171 ? 98.090  31.673  -31.157 1.00 61.73  ? 201 GLU B N   1 
ATOM   3963  C  CA  . GLU B 2 171 ? 98.210  30.493  -32.027 1.00 60.09  ? 201 GLU B CA  1 
ATOM   3964  C  C   . GLU B 2 171 ? 97.112  29.473  -31.797 1.00 60.45  ? 201 GLU B C   1 
ATOM   3965  O  O   . GLU B 2 171 ? 96.505  29.452  -30.729 1.00 60.30  ? 201 GLU B O   1 
ATOM   3966  C  CB  . GLU B 2 171 ? 99.595  29.824  -31.878 1.00 61.44  ? 201 GLU B CB  1 
ATOM   3967  C  CG  . GLU B 2 171 ? 100.573 30.181  -32.989 1.00 73.76  ? 201 GLU B CG  1 
ATOM   3968  C  CD  . GLU B 2 171 ? 100.459 29.417  -34.304 1.00 113.85 ? 201 GLU B CD  1 
ATOM   3969  O  OE1 . GLU B 2 171 ? 99.329  29.061  -34.726 1.00 112.96 ? 201 GLU B OE1 1 
ATOM   3970  O  OE2 . GLU B 2 171 ? 101.518 29.219  -34.942 1.00 115.73 ? 201 GLU B OE2 1 
ATOM   3971  N  N   . VAL B 2 172 ? 96.830  28.653  -32.817 1.00 54.27  ? 202 VAL B N   1 
ATOM   3972  C  CA  . VAL B 2 172 ? 95.852  27.557  -32.742 1.00 51.25  ? 202 VAL B CA  1 
ATOM   3973  C  C   . VAL B 2 172 ? 96.548  26.364  -33.378 1.00 57.37  ? 202 VAL B C   1 
ATOM   3974  O  O   . VAL B 2 172 ? 96.757  26.366  -34.598 1.00 60.86  ? 202 VAL B O   1 
ATOM   3975  C  CB  . VAL B 2 172 ? 94.471  27.837  -33.408 1.00 51.49  ? 202 VAL B CB  1 
ATOM   3976  C  CG1 . VAL B 2 172 ? 93.538  26.661  -33.222 1.00 48.69  ? 202 VAL B CG1 1 
ATOM   3977  C  CG2 . VAL B 2 172 ? 93.827  29.100  -32.862 1.00 52.21  ? 202 VAL B CG2 1 
ATOM   3978  N  N   . LEU B 2 173 ? 96.952  25.384  -32.572 1.00 50.98  ? 203 LEU B N   1 
ATOM   3979  C  CA  . LEU B 2 173 ? 97.595  24.204  -33.125 1.00 50.53  ? 203 LEU B CA  1 
ATOM   3980  C  C   . LEU B 2 173 ? 96.643  23.010  -33.255 1.00 56.34  ? 203 LEU B C   1 
ATOM   3981  O  O   . LEU B 2 173 ? 95.757  22.798  -32.406 1.00 53.44  ? 203 LEU B O   1 
ATOM   3982  C  CB  . LEU B 2 173 ? 98.848  23.797  -32.351 1.00 50.54  ? 203 LEU B CB  1 
ATOM   3983  C  CG  . LEU B 2 173 ? 99.905  24.849  -32.090 1.00 56.63  ? 203 LEU B CG  1 
ATOM   3984  C  CD1 . LEU B 2 173 ? 101.035 24.254  -31.299 1.00 57.78  ? 203 LEU B CD1 1 
ATOM   3985  C  CD2 . LEU B 2 173 ? 100.450 25.440  -33.362 1.00 58.97  ? 203 LEU B CD2 1 
ATOM   3986  N  N   . LEU B 2 174 ? 96.826  22.258  -34.364 1.00 55.65  ? 204 LEU B N   1 
ATOM   3987  C  CA  . LEU B 2 174 ? 96.087  21.040  -34.650 1.00 53.93  ? 204 LEU B CA  1 
ATOM   3988  C  C   . LEU B 2 174 ? 97.087  19.940  -34.724 1.00 57.90  ? 204 LEU B C   1 
ATOM   3989  O  O   . LEU B 2 174 ? 97.946  19.932  -35.622 1.00 57.93  ? 204 LEU B O   1 
ATOM   3990  C  CB  . LEU B 2 174 ? 95.230  21.115  -35.916 1.00 53.43  ? 204 LEU B CB  1 
ATOM   3991  C  CG  . LEU B 2 174 ? 94.247  19.955  -36.111 1.00 57.32  ? 204 LEU B CG  1 
ATOM   3992  C  CD1 . LEU B 2 174 ? 93.347  19.758  -34.899 1.00 57.69  ? 204 LEU B CD1 1 
ATOM   3993  C  CD2 . LEU B 2 174 ? 93.366  20.184  -37.289 1.00 58.97  ? 204 LEU B CD2 1 
ATOM   3994  N  N   . LEU B 2 175 ? 97.011  19.043  -33.724 1.00 53.78  ? 205 LEU B N   1 
ATOM   3995  C  CA  . LEU B 2 175 ? 97.905  17.892  -33.607 1.00 53.15  ? 205 LEU B CA  1 
ATOM   3996  C  C   . LEU B 2 175 ? 97.246  16.587  -34.119 1.00 56.30  ? 205 LEU B C   1 
ATOM   3997  O  O   . LEU B 2 175 ? 96.144  16.281  -33.696 1.00 56.56  ? 205 LEU B O   1 
ATOM   3998  C  CB  . LEU B 2 175 ? 98.425  17.725  -32.155 1.00 52.30  ? 205 LEU B CB  1 
ATOM   3999  C  CG  . LEU B 2 175 ? 98.938  18.971  -31.381 1.00 55.63  ? 205 LEU B CG  1 
ATOM   4000  C  CD1 . LEU B 2 175 ? 99.533  18.564  -30.073 1.00 55.08  ? 205 LEU B CD1 1 
ATOM   4001  C  CD2 . LEU B 2 175 ? 99.935  19.794  -32.164 1.00 54.34  ? 205 LEU B CD2 1 
ATOM   4002  N  N   . ASP B 2 176 ? 97.902  15.848  -35.039 1.00 51.84  ? 206 ASP B N   1 
ATOM   4003  C  CA  . ASP B 2 176 ? 97.381  14.574  -35.520 1.00 51.35  ? 206 ASP B CA  1 
ATOM   4004  C  C   . ASP B 2 176 ? 97.989  13.478  -34.662 1.00 59.91  ? 206 ASP B C   1 
ATOM   4005  O  O   . ASP B 2 176 ? 99.172  13.116  -34.805 1.00 62.11  ? 206 ASP B O   1 
ATOM   4006  C  CB  . ASP B 2 176 ? 97.674  14.319  -37.007 1.00 53.49  ? 206 ASP B CB  1 
ATOM   4007  C  CG  . ASP B 2 176 ? 96.984  13.111  -37.637 1.00 62.84  ? 206 ASP B CG  1 
ATOM   4008  O  OD1 . ASP B 2 176 ? 96.542  12.211  -36.886 1.00 59.78  ? 206 ASP B OD1 1 
ATOM   4009  O  OD2 . ASP B 2 176 ? 96.914  13.053  -38.885 1.00 74.74  ? 206 ASP B OD2 1 
ATOM   4010  N  N   . MET B 2 177 ? 97.150  12.945  -33.779 1.00 56.25  ? 207 MET B N   1 
ATOM   4011  C  CA  . MET B 2 177 ? 97.513  11.897  -32.859 1.00 56.31  ? 207 MET B CA  1 
ATOM   4012  C  C   . MET B 2 177 ? 97.364  10.505  -33.427 1.00 57.17  ? 207 MET B C   1 
ATOM   4013  O  O   . MET B 2 177 ? 97.970  9.576   -32.882 1.00 57.90  ? 207 MET B O   1 
ATOM   4014  C  CB  . MET B 2 177 ? 96.711  12.052  -31.581 1.00 59.45  ? 207 MET B CB  1 
ATOM   4015  C  CG  . MET B 2 177 ? 97.155  13.242  -30.758 1.00 65.31  ? 207 MET B CG  1 
ATOM   4016  S  SD  . MET B 2 177 ? 98.766  13.024  -29.984 1.00 71.93  ? 207 MET B SD  1 
ATOM   4017  C  CE  . MET B 2 177 ? 99.310  14.638  -30.075 1.00 70.88  ? 207 MET B CE  1 
ATOM   4018  N  N   . SER B 2 178 ? 96.622  10.362  -34.546 1.00 52.33  ? 208 SER B N   1 
ATOM   4019  C  CA  . SER B 2 178 ? 96.355  9.084   -35.230 1.00 51.47  ? 208 SER B CA  1 
ATOM   4020  C  C   . SER B 2 178 ? 97.610  8.429   -35.850 1.00 53.63  ? 208 SER B C   1 
ATOM   4021  O  O   . SER B 2 178 ? 97.568  7.244   -36.206 1.00 52.28  ? 208 SER B O   1 
ATOM   4022  C  CB  . SER B 2 178 ? 95.249  9.246   -36.267 1.00 54.93  ? 208 SER B CB  1 
ATOM   4023  O  OG  . SER B 2 178 ? 95.757  9.770   -37.482 1.00 63.02  ? 208 SER B OG  1 
ATOM   4024  N  N   . LEU B 2 179 ? 98.726  9.195   -35.937 1.00 49.22  ? 209 LEU B N   1 
ATOM   4025  C  CA  . LEU B 2 179 ? 99.991  8.731   -36.502 1.00 49.47  ? 209 LEU B CA  1 
ATOM   4026  C  C   . LEU B 2 179 ? 101.045 8.601   -35.447 1.00 59.25  ? 209 LEU B C   1 
ATOM   4027  O  O   . LEU B 2 179 ? 100.895 9.186   -34.377 1.00 59.70  ? 209 LEU B O   1 
ATOM   4028  C  CB  . LEU B 2 179 ? 100.463 9.671   -37.626 1.00 48.73  ? 209 LEU B CB  1 
ATOM   4029  C  CG  . LEU B 2 179 ? 99.433  9.984   -38.717 1.00 50.32  ? 209 LEU B CG  1 
ATOM   4030  C  CD1 . LEU B 2 179 ? 99.859  11.136  -39.524 1.00 50.81  ? 209 LEU B CD1 1 
ATOM   4031  C  CD2 . LEU B 2 179 ? 99.106  8.780   -39.579 1.00 49.83  ? 209 LEU B CD2 1 
ATOM   4032  N  N   . ASP B 2 180 ? 102.119 7.835   -35.729 1.00 60.84  ? 210 ASP B N   1 
ATOM   4033  C  CA  . ASP B 2 180 ? 103.219 7.689   -34.772 1.00 63.80  ? 210 ASP B CA  1 
ATOM   4034  C  C   . ASP B 2 180 ? 104.021 8.988   -34.787 1.00 74.85  ? 210 ASP B C   1 
ATOM   4035  O  O   . ASP B 2 180 ? 104.176 9.596   -35.858 1.00 75.31  ? 210 ASP B O   1 
ATOM   4036  C  CB  . ASP B 2 180 ? 104.129 6.486   -35.111 1.00 66.69  ? 210 ASP B CB  1 
ATOM   4037  C  CG  . ASP B 2 180 ? 105.123 6.699   -36.247 1.00 84.52  ? 210 ASP B CG  1 
ATOM   4038  O  OD1 . ASP B 2 180 ? 104.755 6.457   -37.398 1.00 87.18  ? 210 ASP B OD1 1 
ATOM   4039  O  OD2 . ASP B 2 180 ? 106.273 7.115   -35.970 1.00 93.36  ? 210 ASP B OD2 1 
ATOM   4040  N  N   . ASP B 2 181 ? 104.527 9.417   -33.617 1.00 75.20  ? 211 ASP B N   1 
ATOM   4041  C  CA  . ASP B 2 181 ? 105.347 10.621  -33.567 1.00 77.64  ? 211 ASP B CA  1 
ATOM   4042  C  C   . ASP B 2 181 ? 106.806 10.242  -33.374 1.00 88.54  ? 211 ASP B C   1 
ATOM   4043  O  O   . ASP B 2 181 ? 107.340 10.344  -32.264 1.00 90.21  ? 211 ASP B O   1 
ATOM   4044  C  CB  . ASP B 2 181 ? 104.851 11.638  -32.521 1.00 78.44  ? 211 ASP B CB  1 
ATOM   4045  C  CG  . ASP B 2 181 ? 105.455 13.026  -32.679 1.00 82.24  ? 211 ASP B CG  1 
ATOM   4046  O  OD1 . ASP B 2 181 ? 105.114 13.713  -33.666 1.00 81.22  ? 211 ASP B OD1 1 
ATOM   4047  O  OD2 . ASP B 2 181 ? 106.246 13.433  -31.803 1.00 87.77  ? 211 ASP B OD2 1 
ATOM   4048  N  N   . GLY B 2 182 ? 107.417 9.762   -34.458 1.00 88.00  ? 212 GLY B N   1 
ATOM   4049  C  CA  . GLY B 2 182 ? 108.827 9.383   -34.492 1.00 90.77  ? 212 GLY B CA  1 
ATOM   4050  C  C   . GLY B 2 182 ? 109.686 10.494  -35.063 1.00 98.72  ? 212 GLY B C   1 
ATOM   4051  O  O   . GLY B 2 182 ? 110.843 10.682  -34.662 1.00 101.07 ? 212 GLY B O   1 
ATOM   4052  N  N   . ASP B 2 183 ? 109.082 11.245  -36.002 1.00 95.08  ? 213 ASP B N   1 
ATOM   4053  C  CA  . ASP B 2 183 ? 109.599 12.394  -36.760 1.00 95.40  ? 213 ASP B CA  1 
ATOM   4054  C  C   . ASP B 2 183 ? 109.697 13.672  -35.914 1.00 96.02  ? 213 ASP B C   1 
ATOM   4055  O  O   . ASP B 2 183 ? 110.276 14.664  -36.372 1.00 95.83  ? 213 ASP B O   1 
ATOM   4056  C  CB  . ASP B 2 183 ? 108.646 12.654  -37.957 1.00 97.07  ? 213 ASP B CB  1 
ATOM   4057  C  CG  . ASP B 2 183 ? 107.133 12.647  -37.651 1.00 103.30 ? 213 ASP B CG  1 
ATOM   4058  O  OD1 . ASP B 2 183 ? 106.755 12.717  -36.447 1.00 101.20 ? 213 ASP B OD1 1 
ATOM   4059  O  OD2 . ASP B 2 183 ? 106.334 12.596  -38.611 1.00 108.58 ? 213 ASP B OD2 1 
ATOM   4060  N  N   . SER B 2 184 ? 109.086 13.649  -34.700 1.00 89.38  ? 214 SER B N   1 
ATOM   4061  C  CA  . SER B 2 184 ? 109.007 14.752  -33.735 1.00 87.66  ? 214 SER B CA  1 
ATOM   4062  C  C   . SER B 2 184 ? 108.226 15.948  -34.316 1.00 84.26  ? 214 SER B C   1 
ATOM   4063  O  O   . SER B 2 184 ? 108.646 17.093  -34.150 1.00 84.11  ? 214 SER B O   1 
ATOM   4064  C  CB  . SER B 2 184 ? 110.393 15.165  -33.221 1.00 94.89  ? 214 SER B CB  1 
ATOM   4065  O  OG  . SER B 2 184 ? 111.161 14.088  -32.705 1.00 107.69 ? 214 SER B OG  1 
ATOM   4066  N  N   . LYS B 2 185 ? 107.085 15.670  -35.003 1.00 74.58  ? 215 LYS B N   1 
ATOM   4067  C  CA  . LYS B 2 185 ? 106.228 16.715  -35.570 1.00 71.82  ? 215 LYS B CA  1 
ATOM   4068  C  C   . LYS B 2 185 ? 105.525 17.492  -34.450 1.00 71.66  ? 215 LYS B C   1 
ATOM   4069  O  O   . LYS B 2 185 ? 105.545 18.728  -34.465 1.00 72.36  ? 215 LYS B O   1 
ATOM   4070  C  CB  . LYS B 2 185 ? 105.215 16.149  -36.586 1.00 72.30  ? 215 LYS B CB  1 
ATOM   4071  C  CG  . LYS B 2 185 ? 104.196 17.186  -37.085 1.00 85.00  ? 215 LYS B CG  1 
ATOM   4072  C  CD  . LYS B 2 185 ? 104.104 17.295  -38.605 1.00 99.12  ? 215 LYS B CD  1 
ATOM   4073  C  CE  . LYS B 2 185 ? 103.205 18.446  -39.020 1.00 113.13 ? 215 LYS B CE  1 
ATOM   4074  N  NZ  . LYS B 2 185 ? 102.934 18.449  -40.478 1.00 129.45 ? 215 LYS B NZ  1 
ATOM   4075  N  N   . ILE B 2 186 ? 104.922 16.774  -33.479 1.00 63.34  ? 216 ILE B N   1 
ATOM   4076  C  CA  . ILE B 2 186 ? 104.246 17.398  -32.343 1.00 60.69  ? 216 ILE B CA  1 
ATOM   4077  C  C   . ILE B 2 186 ? 105.211 18.339  -31.609 1.00 65.68  ? 216 ILE B C   1 
ATOM   4078  O  O   . ILE B 2 186 ? 104.841 19.487  -31.359 1.00 64.80  ? 216 ILE B O   1 
ATOM   4079  C  CB  . ILE B 2 186 ? 103.532 16.352  -31.420 1.00 60.79  ? 216 ILE B CB  1 
ATOM   4080  C  CG1 . ILE B 2 186 ? 102.206 15.924  -32.036 1.00 58.01  ? 216 ILE B CG1 1 
ATOM   4081  C  CG2 . ILE B 2 186 ? 103.300 16.871  -29.984 1.00 59.64  ? 216 ILE B CG2 1 
ATOM   4082  C  CD1 . ILE B 2 186 ? 102.173 14.555  -32.360 1.00 66.06  ? 216 ILE B CD1 1 
ATOM   4083  N  N   . GLN B 2 187 ? 106.459 17.874  -31.331 1.00 64.33  ? 217 GLN B N   1 
ATOM   4084  C  CA  . GLN B 2 187 ? 107.492 18.664  -30.648 1.00 66.14  ? 217 GLN B CA  1 
ATOM   4085  C  C   . GLN B 2 187 ? 107.763 19.980  -31.384 1.00 74.04  ? 217 GLN B C   1 
ATOM   4086  O  O   . GLN B 2 187 ? 107.843 21.030  -30.750 1.00 75.45  ? 217 GLN B O   1 
ATOM   4087  C  CB  . GLN B 2 187 ? 108.782 17.856  -30.470 1.00 68.17  ? 217 GLN B CB  1 
ATOM   4088  C  CG  . GLN B 2 187 ? 109.923 18.662  -29.846 1.00 76.01  ? 217 GLN B CG  1 
ATOM   4089  C  CD  . GLN B 2 187 ? 111.252 17.965  -29.784 1.00 86.55  ? 217 GLN B CD  1 
ATOM   4090  O  OE1 . GLN B 2 187 ? 111.808 17.783  -28.704 1.00 75.91  ? 217 GLN B OE1 1 
ATOM   4091  N  NE2 . GLN B 2 187 ? 111.816 17.608  -30.943 1.00 81.76  ? 217 GLN B NE2 1 
ATOM   4092  N  N   . ASN B 2 188 ? 107.863 19.922  -32.715 1.00 71.67  ? 218 ASN B N   1 
ATOM   4093  C  CA  . ASN B 2 188 ? 108.109 21.099  -33.533 1.00 73.12  ? 218 ASN B CA  1 
ATOM   4094  C  C   . ASN B 2 188 ? 106.908 22.044  -33.537 1.00 75.65  ? 218 ASN B C   1 
ATOM   4095  O  O   . ASN B 2 188 ? 107.091 23.265  -33.522 1.00 78.41  ? 218 ASN B O   1 
ATOM   4096  C  CB  . ASN B 2 188 ? 108.574 20.704  -34.934 1.00 76.54  ? 218 ASN B CB  1 
ATOM   4097  C  CG  . ASN B 2 188 ? 109.930 20.024  -34.937 1.00 117.96 ? 218 ASN B CG  1 
ATOM   4098  O  OD1 . ASN B 2 188 ? 110.871 20.428  -34.231 1.00 115.66 ? 218 ASN B OD1 1 
ATOM   4099  N  ND2 . ASN B 2 188 ? 110.060 18.967  -35.728 1.00 116.25 ? 218 ASN B ND2 1 
ATOM   4100  N  N   . GLN B 2 189 ? 105.697 21.493  -33.471 1.00 67.20  ? 219 GLN B N   1 
ATOM   4101  C  CA  . GLN B 2 189 ? 104.498 22.309  -33.407 1.00 65.17  ? 219 GLN B CA  1 
ATOM   4102  C  C   . GLN B 2 189 ? 104.432 22.984  -32.059 1.00 69.21  ? 219 GLN B C   1 
ATOM   4103  O  O   . GLN B 2 189 ? 104.240 24.187  -32.004 1.00 71.25  ? 219 GLN B O   1 
ATOM   4104  C  CB  . GLN B 2 189 ? 103.244 21.466  -33.634 1.00 64.46  ? 219 GLN B CB  1 
ATOM   4105  C  CG  . GLN B 2 189 ? 103.047 21.066  -35.071 1.00 68.82  ? 219 GLN B CG  1 
ATOM   4106  C  CD  . GLN B 2 189 ? 101.860 20.176  -35.190 1.00 79.46  ? 219 GLN B CD  1 
ATOM   4107  O  OE1 . GLN B 2 189 ? 100.763 20.626  -35.528 1.00 71.28  ? 219 GLN B OE1 1 
ATOM   4108  N  NE2 . GLN B 2 189 ? 102.049 18.896  -34.905 1.00 78.68  ? 219 GLN B NE2 1 
ATOM   4109  N  N   . LEU B 2 190 ? 104.652 22.234  -30.977 1.00 64.54  ? 220 LEU B N   1 
ATOM   4110  C  CA  . LEU B 2 190 ? 104.591 22.771  -29.621 1.00 64.55  ? 220 LEU B CA  1 
ATOM   4111  C  C   . LEU B 2 190 ? 105.626 23.858  -29.369 1.00 70.87  ? 220 LEU B C   1 
ATOM   4112  O  O   . LEU B 2 190 ? 105.363 24.750  -28.567 1.00 72.82  ? 220 LEU B O   1 
ATOM   4113  C  CB  . LEU B 2 190 ? 104.660 21.660  -28.553 1.00 63.46  ? 220 LEU B CB  1 
ATOM   4114  C  CG  . LEU B 2 190 ? 103.504 20.648  -28.503 1.00 65.57  ? 220 LEU B CG  1 
ATOM   4115  C  CD1 . LEU B 2 190 ? 103.599 19.809  -27.279 1.00 66.08  ? 220 LEU B CD1 1 
ATOM   4116  C  CD2 . LEU B 2 190 ? 102.168 21.326  -28.443 1.00 66.45  ? 220 LEU B CD2 1 
ATOM   4117  N  N   . LYS B 2 191 ? 106.765 23.829  -30.101 1.00 66.95  ? 221 LYS B N   1 
ATOM   4118  C  CA  . LYS B 2 191 ? 107.828 24.841  -30.003 1.00 67.68  ? 221 LYS B CA  1 
ATOM   4119  C  C   . LYS B 2 191 ? 107.336 26.191  -30.545 1.00 70.93  ? 221 LYS B C   1 
ATOM   4120  O  O   . LYS B 2 191 ? 107.871 27.229  -30.155 1.00 72.21  ? 221 LYS B O   1 
ATOM   4121  C  CB  . LYS B 2 191 ? 109.125 24.375  -30.690 1.00 69.84  ? 221 LYS B CB  1 
ATOM   4122  N  N   . LYS B 2 192 ? 106.271 26.174  -31.388 1.00 65.23  ? 222 LYS B N   1 
ATOM   4123  C  CA  . LYS B 2 192 ? 105.630 27.368  -31.952 1.00 64.81  ? 222 LYS B CA  1 
ATOM   4124  C  C   . LYS B 2 192 ? 104.943 28.217  -30.848 1.00 66.97  ? 222 LYS B C   1 
ATOM   4125  O  O   . LYS B 2 192 ? 104.923 29.452  -30.950 1.00 66.91  ? 222 LYS B O   1 
ATOM   4126  C  CB  . LYS B 2 192 ? 104.664 27.010  -33.109 1.00 64.85  ? 222 LYS B CB  1 
ATOM   4127  N  N   . LEU B 2 193 ? 104.438 27.556  -29.775 1.00 61.65  ? 223 LEU B N   1 
ATOM   4128  C  CA  . LEU B 2 193 ? 103.769 28.203  -28.637 1.00 61.58  ? 223 LEU B CA  1 
ATOM   4129  C  C   . LEU B 2 193 ? 104.671 29.176  -27.869 1.00 70.63  ? 223 LEU B C   1 
ATOM   4130  O  O   . LEU B 2 193 ? 105.813 28.827  -27.513 1.00 72.77  ? 223 LEU B O   1 
ATOM   4131  C  CB  . LEU B 2 193 ? 103.204 27.162  -27.666 1.00 59.79  ? 223 LEU B CB  1 
ATOM   4132  C  CG  . LEU B 2 193 ? 102.164 26.192  -28.211 1.00 63.02  ? 223 LEU B CG  1 
ATOM   4133  C  CD1 . LEU B 2 193 ? 101.827 25.142  -27.167 1.00 62.17  ? 223 LEU B CD1 1 
ATOM   4134  C  CD2 . LEU B 2 193 ? 100.902 26.922  -28.678 1.00 63.97  ? 223 LEU B CD2 1 
ATOM   4135  N  N   . GLN B 2 194 ? 104.144 30.399  -27.606 1.00 66.48  ? 224 GLN B N   1 
ATOM   4136  C  CA  . GLN B 2 194 ? 104.835 31.481  -26.896 1.00 66.58  ? 224 GLN B CA  1 
ATOM   4137  C  C   . GLN B 2 194 ? 103.967 32.098  -25.767 1.00 70.90  ? 224 GLN B C   1 
ATOM   4138  O  O   . GLN B 2 194 ? 104.495 32.850  -24.937 1.00 75.14  ? 224 GLN B O   1 
ATOM   4139  C  CB  . GLN B 2 194 ? 105.257 32.594  -27.886 1.00 69.25  ? 224 GLN B CB  1 
ATOM   4140  C  CG  . GLN B 2 194 ? 106.137 32.173  -29.073 1.00 89.10  ? 224 GLN B CG  1 
ATOM   4141  C  CD  . GLN B 2 194 ? 107.620 32.060  -28.756 1.00 129.69 ? 224 GLN B CD  1 
ATOM   4142  O  OE1 . GLN B 2 194 ? 108.233 32.921  -28.086 1.00 132.14 ? 224 GLN B OE1 1 
ATOM   4143  N  NE2 . GLN B 2 194 ? 108.255 31.025  -29.301 1.00 121.45 ? 224 GLN B NE2 1 
ATOM   4144  N  N   . SER B 2 195 ? 102.644 31.828  -25.762 1.00 63.44  ? 225 SER B N   1 
ATOM   4145  C  CA  . SER B 2 195 ? 101.659 32.368  -24.813 1.00 62.34  ? 225 SER B CA  1 
ATOM   4146  C  C   . SER B 2 195 ? 101.823 31.896  -23.369 1.00 64.56  ? 225 SER B C   1 
ATOM   4147  O  O   . SER B 2 195 ? 102.170 30.731  -23.163 1.00 60.64  ? 225 SER B O   1 
ATOM   4148  C  CB  . SER B 2 195 ? 100.232 32.047  -25.258 1.00 64.08  ? 225 SER B CB  1 
ATOM   4149  O  OG  . SER B 2 195 ? 99.970  32.489  -26.579 1.00 77.60  ? 225 SER B OG  1 
ATOM   4150  N  N   . PRO B 2 196 ? 101.501 32.767  -22.350 1.00 63.20  ? 226 PRO B N   1 
ATOM   4151  C  CA  . PRO B 2 196 ? 101.532 32.301  -20.953 1.00 62.22  ? 226 PRO B CA  1 
ATOM   4152  C  C   . PRO B 2 196 ? 100.361 31.342  -20.616 1.00 65.97  ? 226 PRO B C   1 
ATOM   4153  O  O   . PRO B 2 196 ? 100.485 30.567  -19.668 1.00 64.86  ? 226 PRO B O   1 
ATOM   4154  C  CB  . PRO B 2 196 ? 101.420 33.600  -20.168 1.00 64.92  ? 226 PRO B CB  1 
ATOM   4155  C  CG  . PRO B 2 196 ? 100.646 34.503  -21.034 1.00 69.20  ? 226 PRO B CG  1 
ATOM   4156  C  CD  . PRO B 2 196 ? 101.068 34.186  -22.423 1.00 65.13  ? 226 PRO B CD  1 
ATOM   4157  N  N   . ILE B 2 197 ? 99.226  31.404  -21.377 1.00 62.09  ? 227 ILE B N   1 
ATOM   4158  C  CA  . ILE B 2 197 ? 98.052  30.553  -21.164 1.00 60.68  ? 227 ILE B CA  1 
ATOM   4159  C  C   . ILE B 2 197 ? 97.774  29.671  -22.381 1.00 66.26  ? 227 ILE B C   1 
ATOM   4160  O  O   . ILE B 2 197 ? 97.727  30.166  -23.503 1.00 69.87  ? 227 ILE B O   1 
ATOM   4161  C  CB  . ILE B 2 197 ? 96.816  31.377  -20.714 1.00 63.67  ? 227 ILE B CB  1 
ATOM   4162  C  CG1 . ILE B 2 197 ? 96.937  31.767  -19.233 1.00 64.67  ? 227 ILE B CG1 1 
ATOM   4163  C  CG2 . ILE B 2 197 ? 95.499  30.625  -20.944 1.00 62.45  ? 227 ILE B CG2 1 
ATOM   4164  C  CD1 . ILE B 2 197 ? 97.530  33.066  -19.022 1.00 71.46  ? 227 ILE B CD1 1 
ATOM   4165  N  N   . ILE B 2 198 ? 97.606  28.369  -22.165 1.00 58.50  ? 228 ILE B N   1 
ATOM   4166  C  CA  . ILE B 2 198 ? 97.318  27.437  -23.246 1.00 55.78  ? 228 ILE B CA  1 
ATOM   4167  C  C   . ILE B 2 198 ? 96.036  26.658  -22.924 1.00 59.17  ? 228 ILE B C   1 
ATOM   4168  O  O   . ILE B 2 198 ? 95.943  26.007  -21.879 1.00 58.26  ? 228 ILE B O   1 
ATOM   4169  C  CB  . ILE B 2 198 ? 98.523  26.491  -23.515 1.00 57.62  ? 228 ILE B CB  1 
ATOM   4170  C  CG1 . ILE B 2 198 ? 99.800  27.282  -23.816 1.00 59.81  ? 228 ILE B CG1 1 
ATOM   4171  C  CG2 . ILE B 2 198 ? 98.224  25.536  -24.642 1.00 55.28  ? 228 ILE B CG2 1 
ATOM   4172  C  CD1 . ILE B 2 198 ? 100.944 26.895  -22.935 1.00 73.89  ? 228 ILE B CD1 1 
ATOM   4173  N  N   . LEU B 2 199 ? 95.057  26.715  -23.832 1.00 54.96  ? 229 LEU B N   1 
ATOM   4174  C  CA  . LEU B 2 199 ? 93.805  25.962  -23.703 1.00 52.02  ? 229 LEU B CA  1 
ATOM   4175  C  C   . LEU B 2 199 ? 94.007  24.682  -24.492 1.00 53.86  ? 229 LEU B C   1 
ATOM   4176  O  O   . LEU B 2 199 ? 94.326  24.736  -25.684 1.00 52.88  ? 229 LEU B O   1 
ATOM   4177  C  CB  . LEU B 2 199 ? 92.588  26.756  -24.216 1.00 51.18  ? 229 LEU B CB  1 
ATOM   4178  C  CG  . LEU B 2 199 ? 92.408  28.167  -23.660 1.00 55.59  ? 229 LEU B CG  1 
ATOM   4179  C  CD1 . LEU B 2 199 ? 91.153  28.773  -24.167 1.00 55.43  ? 229 LEU B CD1 1 
ATOM   4180  C  CD2 . LEU B 2 199 ? 92.402  28.182  -22.174 1.00 57.73  ? 229 LEU B CD2 1 
ATOM   4181  N  N   . LEU B 2 200 ? 93.946  23.541  -23.804 1.00 49.65  ? 230 LEU B N   1 
ATOM   4182  C  CA  . LEU B 2 200 ? 94.178  22.271  -24.461 1.00 49.16  ? 230 LEU B CA  1 
ATOM   4183  C  C   . LEU B 2 200 ? 92.889  21.456  -24.562 1.00 52.98  ? 230 LEU B C   1 
ATOM   4184  O  O   . LEU B 2 200 ? 92.281  21.167  -23.549 1.00 53.17  ? 230 LEU B O   1 
ATOM   4185  C  CB  . LEU B 2 200 ? 95.324  21.503  -23.768 1.00 49.49  ? 230 LEU B CB  1 
ATOM   4186  C  CG  . LEU B 2 200 ? 95.531  20.042  -24.162 1.00 53.61  ? 230 LEU B CG  1 
ATOM   4187  C  CD1 . LEU B 2 200 ? 96.350  19.904  -25.424 1.00 53.66  ? 230 LEU B CD1 1 
ATOM   4188  C  CD2 . LEU B 2 200 ? 96.206  19.297  -23.056 1.00 58.82  ? 230 LEU B CD2 1 
ATOM   4189  N  N   . TYR B 2 201 ? 92.462  21.126  -25.791 1.00 50.21  ? 231 TYR B N   1 
ATOM   4190  C  CA  . TYR B 2 201 ? 91.260  20.327  -26.095 1.00 48.80  ? 231 TYR B CA  1 
ATOM   4191  C  C   . TYR B 2 201 ? 91.696  19.010  -26.758 1.00 53.47  ? 231 TYR B C   1 
ATOM   4192  O  O   . TYR B 2 201 ? 92.200  19.005  -27.894 1.00 53.88  ? 231 TYR B O   1 
ATOM   4193  C  CB  . TYR B 2 201 ? 90.294  21.095  -27.003 1.00 47.77  ? 231 TYR B CB  1 
ATOM   4194  C  CG  . TYR B 2 201 ? 89.033  20.339  -27.325 1.00 46.43  ? 231 TYR B CG  1 
ATOM   4195  C  CD1 . TYR B 2 201 ? 88.983  19.446  -28.388 1.00 47.29  ? 231 TYR B CD1 1 
ATOM   4196  C  CD2 . TYR B 2 201 ? 87.867  20.558  -26.604 1.00 47.61  ? 231 TYR B CD2 1 
ATOM   4197  C  CE1 . TYR B 2 201 ? 87.816  18.748  -28.690 1.00 47.53  ? 231 TYR B CE1 1 
ATOM   4198  C  CE2 . TYR B 2 201 ? 86.686  19.888  -26.913 1.00 47.56  ? 231 TYR B CE2 1 
ATOM   4199  C  CZ  . TYR B 2 201 ? 86.663  18.981  -27.955 1.00 54.63  ? 231 TYR B CZ  1 
ATOM   4200  O  OH  . TYR B 2 201 ? 85.492  18.315  -28.243 1.00 58.10  ? 231 TYR B OH  1 
ATOM   4201  N  N   . CYS B 2 202 ? 91.534  17.912  -26.019 1.00 47.65  ? 232 CYS B N   1 
ATOM   4202  C  CA  . CYS B 2 202 ? 91.928  16.587  -26.442 1.00 47.48  ? 232 CYS B CA  1 
ATOM   4203  C  C   . CYS B 2 202 ? 91.412  15.609  -25.403 1.00 54.02  ? 232 CYS B C   1 
ATOM   4204  O  O   . CYS B 2 202 ? 90.620  16.032  -24.555 1.00 54.56  ? 232 CYS B O   1 
ATOM   4205  C  CB  . CYS B 2 202 ? 93.447  16.506  -26.592 1.00 48.44  ? 232 CYS B CB  1 
ATOM   4206  S  SG  . CYS B 2 202 ? 94.371  16.657  -25.043 1.00 53.17  ? 232 CYS B SG  1 
ATOM   4207  N  N   . THR B 2 203 ? 91.827  14.300  -25.479 1.00 49.79  ? 233 THR B N   1 
ATOM   4208  C  CA  . THR B 2 203 ? 91.442  13.266  -24.510 1.00 48.41  ? 233 THR B CA  1 
ATOM   4209  C  C   . THR B 2 203 ? 92.504  13.179  -23.408 1.00 51.94  ? 233 THR B C   1 
ATOM   4210  O  O   . THR B 2 203 ? 93.613  13.697  -23.577 1.00 51.29  ? 233 THR B O   1 
ATOM   4211  C  CB  . THR B 2 203 ? 91.205  11.914  -25.183 1.00 49.00  ? 233 THR B CB  1 
ATOM   4212  O  OG1 . THR B 2 203 ? 92.391  11.443  -25.810 1.00 49.15  ? 233 THR B OG1 1 
ATOM   4213  C  CG2 . THR B 2 203 ? 90.140  11.978  -26.193 1.00 47.86  ? 233 THR B CG2 1 
ATOM   4214  N  N   . LYS B 2 204 ? 92.168  12.515  -22.291 1.00 47.48  ? 234 LYS B N   1 
ATOM   4215  C  CA  . LYS B 2 204 ? 93.101  12.311  -21.196 1.00 47.68  ? 234 LYS B CA  1 
ATOM   4216  C  C   . LYS B 2 204 ? 94.324  11.534  -21.701 1.00 52.17  ? 234 LYS B C   1 
ATOM   4217  O  O   . LYS B 2 204 ? 95.444  11.855  -21.319 1.00 53.80  ? 234 LYS B O   1 
ATOM   4218  C  CB  . LYS B 2 204 ? 92.415  11.560  -20.047 1.00 49.69  ? 234 LYS B CB  1 
ATOM   4219  C  CG  . LYS B 2 204 ? 93.254  11.426  -18.773 1.00 47.82  ? 234 LYS B CG  1 
ATOM   4220  C  CD  . LYS B 2 204 ? 92.333  11.065  -17.647 1.00 45.03  ? 234 LYS B CD  1 
ATOM   4221  C  CE  . LYS B 2 204 ? 93.015  10.839  -16.352 1.00 43.02  ? 234 LYS B CE  1 
ATOM   4222  N  NZ  . LYS B 2 204 ? 92.023  10.780  -15.239 1.00 48.35  ? 234 LYS B NZ  1 
ATOM   4223  N  N   . GLU B 2 205 ? 94.109  10.548  -22.592 1.00 46.86  ? 235 GLU B N   1 
ATOM   4224  C  CA  . GLU B 2 205 ? 95.182  9.729   -23.146 1.00 45.40  ? 235 GLU B CA  1 
ATOM   4225  C  C   . GLU B 2 205 ? 96.125  10.570  -24.029 1.00 45.93  ? 235 GLU B C   1 
ATOM   4226  O  O   . GLU B 2 205 ? 97.344  10.480  -23.898 1.00 45.29  ? 235 GLU B O   1 
ATOM   4227  C  CB  . GLU B 2 205 ? 94.602  8.482   -23.844 1.00 46.20  ? 235 GLU B CB  1 
ATOM   4228  C  CG  . GLU B 2 205 ? 95.642  7.400   -24.148 1.00 72.26  ? 235 GLU B CG  1 
ATOM   4229  C  CD  . GLU B 2 205 ? 96.488  6.847   -23.002 1.00 118.76 ? 235 GLU B CD  1 
ATOM   4230  O  OE1 . GLU B 2 205 ? 95.908  6.235   -22.074 1.00 127.93 ? 235 GLU B OE1 1 
ATOM   4231  O  OE2 . GLU B 2 205 ? 97.735  6.983   -23.058 1.00 111.15 ? 235 GLU B OE2 1 
ATOM   4232  N  N   . GLU B 2 206 ? 95.547  11.442  -24.861 1.00 41.29  ? 236 GLU B N   1 
ATOM   4233  C  CA  . GLU B 2 206 ? 96.260  12.337  -25.774 1.00 40.51  ? 236 GLU B CA  1 
ATOM   4234  C  C   . GLU B 2 206 ? 97.031  13.399  -24.971 1.00 50.15  ? 236 GLU B C   1 
ATOM   4235  O  O   . GLU B 2 206 ? 98.183  13.721  -25.276 1.00 49.72  ? 236 GLU B O   1 
ATOM   4236  C  CB  . GLU B 2 206 ? 95.247  13.021  -26.698 1.00 40.05  ? 236 GLU B CB  1 
ATOM   4237  C  CG  . GLU B 2 206 ? 94.796  12.151  -27.839 1.00 49.17  ? 236 GLU B CG  1 
ATOM   4238  C  CD  . GLU B 2 206 ? 93.744  12.757  -28.737 1.00 66.12  ? 236 GLU B CD  1 
ATOM   4239  O  OE1 . GLU B 2 206 ? 92.950  13.589  -28.240 1.00 53.21  ? 236 GLU B OE1 1 
ATOM   4240  O  OE2 . GLU B 2 206 ? 93.691  12.372  -29.928 1.00 56.27  ? 236 GLU B OE2 1 
ATOM   4241  N  N   . ALA B 2 207 ? 96.373  13.940  -23.937 1.00 49.47  ? 237 ALA B N   1 
ATOM   4242  C  CA  . ALA B 2 207 ? 96.942  14.952  -23.077 1.00 50.48  ? 237 ALA B CA  1 
ATOM   4243  C  C   . ALA B 2 207 ? 98.206  14.448  -22.380 1.00 57.47  ? 237 ALA B C   1 
ATOM   4244  O  O   . ALA B 2 207 ? 99.151  15.235  -22.255 1.00 58.90  ? 237 ALA B O   1 
ATOM   4245  C  CB  . ALA B 2 207 ? 95.906  15.412  -22.066 1.00 50.71  ? 237 ALA B CB  1 
ATOM   4246  N  N   . THR B 2 208 ? 98.256  13.138  -21.962 1.00 53.61  ? 238 THR B N   1 
ATOM   4247  C  CA  . THR B 2 208 ? 99.460  12.593  -21.292 1.00 53.75  ? 238 THR B CA  1 
ATOM   4248  C  C   . THR B 2 208 ? 100.664 12.675  -22.242 1.00 55.36  ? 238 THR B C   1 
ATOM   4249  O  O   . THR B 2 208 ? 101.717 13.160  -21.828 1.00 53.84  ? 238 THR B O   1 
ATOM   4250  C  CB  . THR B 2 208 ? 99.269  11.199  -20.682 1.00 59.74  ? 238 THR B CB  1 
ATOM   4251  O  OG1 . THR B 2 208 ? 99.371  10.229  -21.696 1.00 71.63  ? 238 THR B OG1 1 
ATOM   4252  C  CG2 . THR B 2 208 ? 97.961  11.024  -19.987 1.00 55.90  ? 238 THR B CG2 1 
ATOM   4253  N  N   . TYR B 2 209 ? 100.467 12.309  -23.542 1.00 50.68  ? 239 TYR B N   1 
ATOM   4254  C  CA  . TYR B 2 209 ? 101.527 12.414  -24.544 1.00 50.55  ? 239 TYR B CA  1 
ATOM   4255  C  C   . TYR B 2 209 ? 101.961 13.852  -24.748 1.00 51.86  ? 239 TYR B C   1 
ATOM   4256  O  O   . TYR B 2 209 ? 103.136 14.160  -24.552 1.00 49.54  ? 239 TYR B O   1 
ATOM   4257  C  CB  . TYR B 2 209 ? 101.148 11.779  -25.888 1.00 52.02  ? 239 TYR B CB  1 
ATOM   4258  C  CG  . TYR B 2 209 ? 102.299 11.815  -26.873 1.00 56.05  ? 239 TYR B CG  1 
ATOM   4259  C  CD1 . TYR B 2 209 ? 103.473 11.097  -26.632 1.00 58.21  ? 239 TYR B CD1 1 
ATOM   4260  C  CD2 . TYR B 2 209 ? 102.245 12.619  -28.012 1.00 58.46  ? 239 TYR B CD2 1 
ATOM   4261  C  CE1 . TYR B 2 209 ? 104.554 11.163  -27.504 1.00 59.48  ? 239 TYR B CE1 1 
ATOM   4262  C  CE2 . TYR B 2 209 ? 103.318 12.677  -28.906 1.00 61.25  ? 239 TYR B CE2 1 
ATOM   4263  C  CZ  . TYR B 2 209 ? 104.466 11.937  -28.648 1.00 71.48  ? 239 TYR B CZ  1 
ATOM   4264  O  OH  . TYR B 2 209 ? 105.530 11.955  -29.512 1.00 76.17  ? 239 TYR B OH  1 
ATOM   4265  N  N   . ILE B 2 210 ? 100.994 14.729  -25.125 1.00 49.64  ? 240 ILE B N   1 
ATOM   4266  C  CA  . ILE B 2 210 ? 101.162 16.180  -25.333 1.00 49.81  ? 240 ILE B CA  1 
ATOM   4267  C  C   . ILE B 2 210 ? 101.956 16.847  -24.185 1.00 57.03  ? 240 ILE B C   1 
ATOM   4268  O  O   . ILE B 2 210 ? 102.888 17.600  -24.462 1.00 58.02  ? 240 ILE B O   1 
ATOM   4269  C  CB  . ILE B 2 210 ? 99.786  16.843  -25.562 1.00 50.34  ? 240 ILE B CB  1 
ATOM   4270  C  CG1 . ILE B 2 210 ? 99.233  16.417  -26.935 1.00 49.99  ? 240 ILE B CG1 1 
ATOM   4271  C  CG2 . ILE B 2 210 ? 99.842  18.377  -25.405 1.00 48.54  ? 240 ILE B CG2 1 
ATOM   4272  C  CD1 . ILE B 2 210 ? 97.668  16.503  -27.099 1.00 49.16  ? 240 ILE B CD1 1 
ATOM   4273  N  N   . PHE B 2 211 ? 101.598 16.541  -22.918 1.00 54.04  ? 241 PHE B N   1 
ATOM   4274  C  CA  . PHE B 2 211 ? 102.253 17.091  -21.744 1.00 55.79  ? 241 PHE B CA  1 
ATOM   4275  C  C   . PHE B 2 211 ? 103.708 16.635  -21.613 1.00 63.36  ? 241 PHE B C   1 
ATOM   4276  O  O   . PHE B 2 211 ? 104.572 17.447  -21.279 1.00 63.93  ? 241 PHE B O   1 
ATOM   4277  C  CB  . PHE B 2 211 ? 101.450 16.792  -20.471 1.00 56.75  ? 241 PHE B CB  1 
ATOM   4278  C  CG  . PHE B 2 211 ? 100.268 17.705  -20.245 1.00 56.61  ? 241 PHE B CG  1 
ATOM   4279  C  CD1 . PHE B 2 211 ? 100.381 19.074  -20.432 1.00 58.71  ? 241 PHE B CD1 1 
ATOM   4280  C  CD2 . PHE B 2 211 ? 99.054  17.199  -19.803 1.00 57.11  ? 241 PHE B CD2 1 
ATOM   4281  C  CE1 . PHE B 2 211 ? 99.282  19.909  -20.247 1.00 58.68  ? 241 PHE B CE1 1 
ATOM   4282  C  CE2 . PHE B 2 211 ? 97.963  18.042  -19.597 1.00 58.88  ? 241 PHE B CE2 1 
ATOM   4283  C  CZ  . PHE B 2 211 ? 98.082  19.388  -19.835 1.00 56.92  ? 241 PHE B CZ  1 
ATOM   4284  N  N   . GLU B 2 212 ? 103.980 15.348  -21.901 1.00 60.79  ? 242 GLU B N   1 
ATOM   4285  C  CA  . GLU B 2 212 ? 105.328 14.769  -21.881 1.00 61.28  ? 242 GLU B CA  1 
ATOM   4286  C  C   . GLU B 2 212 ? 106.178 15.528  -22.882 1.00 65.51  ? 242 GLU B C   1 
ATOM   4287  O  O   . GLU B 2 212 ? 107.266 15.955  -22.530 1.00 67.48  ? 242 GLU B O   1 
ATOM   4288  C  CB  . GLU B 2 212 ? 105.271 13.275  -22.208 1.00 62.14  ? 242 GLU B CB  1 
ATOM   4289  C  CG  . GLU B 2 212 ? 106.617 12.598  -22.340 1.00 76.42  ? 242 GLU B CG  1 
ATOM   4290  C  CD  . GLU B 2 212 ? 106.498 11.125  -22.667 1.00 102.57 ? 242 GLU B CD  1 
ATOM   4291  O  OE1 . GLU B 2 212 ? 105.982 10.807  -23.763 1.00 92.87  ? 242 GLU B OE1 1 
ATOM   4292  O  OE2 . GLU B 2 212 ? 106.918 10.289  -21.832 1.00 99.36  ? 242 GLU B OE2 1 
ATOM   4293  N  N   . VAL B 2 213 ? 105.634 15.808  -24.073 1.00 61.65  ? 243 VAL B N   1 
ATOM   4294  C  CA  . VAL B 2 213 ? 106.282 16.602  -25.117 1.00 62.59  ? 243 VAL B CA  1 
ATOM   4295  C  C   . VAL B 2 213 ? 106.490 18.057  -24.673 1.00 68.04  ? 243 VAL B C   1 
ATOM   4296  O  O   . VAL B 2 213 ? 107.605 18.565  -24.765 1.00 68.59  ? 243 VAL B O   1 
ATOM   4297  C  CB  . VAL B 2 213 ? 105.482 16.566  -26.424 1.00 65.76  ? 243 VAL B CB  1 
ATOM   4298  C  CG1 . VAL B 2 213 ? 106.148 17.447  -27.472 1.00 66.58  ? 243 VAL B CG1 1 
ATOM   4299  C  CG2 . VAL B 2 213 ? 105.323 15.134  -26.928 1.00 65.14  ? 243 VAL B CG2 1 
ATOM   4300  N  N   . ALA B 2 214 ? 105.404 18.736  -24.248 1.00 65.19  ? 244 ALA B N   1 
ATOM   4301  C  CA  . ALA B 2 214 ? 105.411 20.125  -23.789 1.00 66.26  ? 244 ALA B CA  1 
ATOM   4302  C  C   . ALA B 2 214 ? 106.438 20.323  -22.687 1.00 73.21  ? 244 ALA B C   1 
ATOM   4303  O  O   . ALA B 2 214 ? 107.118 21.351  -22.693 1.00 75.84  ? 244 ALA B O   1 
ATOM   4304  C  CB  . ALA B 2 214 ? 104.034 20.540  -23.309 1.00 65.97  ? 244 ALA B CB  1 
ATOM   4305  N  N   . ASN B 2 215 ? 106.612 19.327  -21.783 1.00 68.56  ? 245 ASN B N   1 
ATOM   4306  C  CA  . ASN B 2 215 ? 107.654 19.438  -20.765 1.00 69.45  ? 245 ASN B CA  1 
ATOM   4307  C  C   . ASN B 2 215 ? 109.037 19.483  -21.415 1.00 74.85  ? 245 ASN B C   1 
ATOM   4308  O  O   . ASN B 2 215 ? 109.799 20.377  -21.046 1.00 77.59  ? 245 ASN B O   1 
ATOM   4309  C  CB  . ASN B 2 215 ? 107.578 18.376  -19.674 1.00 68.30  ? 245 ASN B CB  1 
ATOM   4310  C  CG  . ASN B 2 215 ? 108.810 18.365  -18.785 1.00 110.73 ? 245 ASN B CG  1 
ATOM   4311  O  OD1 . ASN B 2 215 ? 109.236 19.381  -18.215 1.00 106.00 ? 245 ASN B OD1 1 
ATOM   4312  N  ND2 . ASN B 2 215 ? 109.469 17.226  -18.719 1.00 112.02 ? 245 ASN B ND2 1 
ATOM   4313  N  N   . SER B 2 216 ? 109.348 18.574  -22.399 1.00 68.94  ? 246 SER B N   1 
ATOM   4314  C  CA  . SER B 2 216 ? 110.637 18.530  -23.125 1.00 69.58  ? 246 SER B CA  1 
ATOM   4315  C  C   . SER B 2 216 ? 111.016 19.872  -23.707 1.00 73.85  ? 246 SER B C   1 
ATOM   4316  O  O   . SER B 2 216 ? 112.194 20.197  -23.728 1.00 74.77  ? 246 SER B O   1 
ATOM   4317  C  CB  . SER B 2 216 ? 110.642 17.513  -24.267 1.00 73.37  ? 246 SER B CB  1 
ATOM   4318  O  OG  . SER B 2 216 ? 109.539 16.627  -24.336 1.00 86.39  ? 246 SER B OG  1 
ATOM   4319  N  N   . VAL B 2 217 ? 110.018 20.624  -24.200 1.00 70.68  ? 247 VAL B N   1 
ATOM   4320  C  CA  . VAL B 2 217 ? 110.130 21.933  -24.848 1.00 72.07  ? 247 VAL B CA  1 
ATOM   4321  C  C   . VAL B 2 217 ? 110.043 23.080  -23.792 1.00 78.07  ? 247 VAL B C   1 
ATOM   4322  O  O   . VAL B 2 217 ? 110.167 24.258  -24.138 1.00 78.27  ? 247 VAL B O   1 
ATOM   4323  C  CB  . VAL B 2 217 ? 109.081 22.000  -26.005 1.00 75.22  ? 247 VAL B CB  1 
ATOM   4324  C  CG1 . VAL B 2 217 ? 108.974 23.384  -26.630 1.00 76.69  ? 247 VAL B CG1 1 
ATOM   4325  C  CG2 . VAL B 2 217 ? 109.413 20.980  -27.085 1.00 74.31  ? 247 VAL B CG2 1 
ATOM   4326  N  N   . GLY B 2 218 ? 109.911 22.696  -22.515 1.00 75.87  ? 248 GLY B N   1 
ATOM   4327  C  CA  . GLY B 2 218 ? 109.873 23.583  -21.351 1.00 77.15  ? 248 GLY B CA  1 
ATOM   4328  C  C   . GLY B 2 218 ? 108.631 24.435  -21.226 1.00 80.68  ? 248 GLY B C   1 
ATOM   4329  O  O   . GLY B 2 218 ? 108.719 25.607  -20.860 1.00 80.04  ? 248 GLY B O   1 
ATOM   4330  N  N   . LEU B 2 219 ? 107.464 23.844  -21.497 1.00 77.86  ? 249 LEU B N   1 
ATOM   4331  C  CA  . LEU B 2 219 ? 106.189 24.560  -21.511 1.00 77.96  ? 249 LEU B CA  1 
ATOM   4332  C  C   . LEU B 2 219 ? 105.242 24.232  -20.365 1.00 81.96  ? 249 LEU B C   1 
ATOM   4333  O  O   . LEU B 2 219 ? 104.177 24.841  -20.270 1.00 78.70  ? 249 LEU B O   1 
ATOM   4334  C  CB  . LEU B 2 219 ? 105.488 24.330  -22.851 1.00 77.02  ? 249 LEU B CB  1 
ATOM   4335  C  CG  . LEU B 2 219 ? 106.154 24.907  -24.085 1.00 82.54  ? 249 LEU B CG  1 
ATOM   4336  C  CD1 . LEU B 2 219 ? 105.727 24.121  -25.291 1.00 82.62  ? 249 LEU B CD1 1 
ATOM   4337  C  CD2 . LEU B 2 219 ? 105.813 26.389  -24.263 1.00 83.41  ? 249 LEU B CD2 1 
ATOM   4338  N  N   . THR B 2 220 ? 105.629 23.288  -19.493 1.00 82.65  ? 250 THR B N   1 
ATOM   4339  C  CA  . THR B 2 220 ? 104.802 22.877  -18.356 1.00 83.56  ? 250 THR B CA  1 
ATOM   4340  C  C   . THR B 2 220 ? 105.125 23.653  -17.050 1.00 94.02  ? 250 THR B C   1 
ATOM   4341  O  O   . THR B 2 220 ? 104.287 23.663  -16.118 1.00 94.90  ? 250 THR B O   1 
ATOM   4342  C  CB  . THR B 2 220 ? 104.845 21.354  -18.157 1.00 87.13  ? 250 THR B CB  1 
ATOM   4343  O  OG1 . THR B 2 220 ? 106.186 20.913  -17.985 1.00 86.81  ? 250 THR B OG1 1 
ATOM   4344  C  CG2 . THR B 2 220 ? 104.181 20.603  -19.287 1.00 85.21  ? 250 THR B CG2 1 
ATOM   4345  N  N   . GLY B 2 221 ? 106.298 24.318  -17.030 1.00 92.81  ? 251 GLY B N   1 
ATOM   4346  C  CA  . GLY B 2 221 ? 106.824 25.078  -15.905 1.00 94.69  ? 251 GLY B CA  1 
ATOM   4347  C  C   . GLY B 2 221 ? 106.065 26.323  -15.490 1.00 99.63  ? 251 GLY B C   1 
ATOM   4348  O  O   . GLY B 2 221 ? 104.891 26.507  -15.835 1.00 98.46  ? 251 GLY B O   1 
ATOM   4349  N  N   . TYR B 2 222 ? 106.743 27.174  -14.685 1.00 97.60  ? 252 TYR B N   1 
ATOM   4350  C  CA  . TYR B 2 222 ? 106.185 28.431  -14.169 1.00 97.69  ? 252 TYR B CA  1 
ATOM   4351  C  C   . TYR B 2 222 ? 106.067 29.410  -15.338 1.00 98.00  ? 252 TYR B C   1 
ATOM   4352  O  O   . TYR B 2 222 ? 106.870 29.354  -16.277 1.00 96.98  ? 252 TYR B O   1 
ATOM   4353  C  CB  . TYR B 2 222 ? 107.042 29.056  -13.036 1.00 101.74 ? 252 TYR B CB  1 
ATOM   4354  C  CG  . TYR B 2 222 ? 107.520 28.128  -11.926 1.00 104.53 ? 252 TYR B CG  1 
ATOM   4355  C  CD1 . TYR B 2 222 ? 106.617 27.370  -11.182 1.00 105.22 ? 252 TYR B CD1 1 
ATOM   4356  C  CD2 . TYR B 2 222 ? 108.864 28.087  -11.552 1.00 107.21 ? 252 TYR B CD2 1 
ATOM   4357  C  CE1 . TYR B 2 222 ? 107.053 26.506  -10.169 1.00 105.65 ? 252 TYR B CE1 1 
ATOM   4358  C  CE2 . TYR B 2 222 ? 109.311 27.238  -10.534 1.00 108.58 ? 252 TYR B CE2 1 
ATOM   4359  C  CZ  . TYR B 2 222 ? 108.401 26.452  -9.843  1.00 112.59 ? 252 TYR B CZ  1 
ATOM   4360  O  OH  . TYR B 2 222 ? 108.845 25.628  -8.838  1.00 110.96 ? 252 TYR B OH  1 
ATOM   4361  N  N   . GLY B 2 223 ? 105.058 30.273  -15.284 1.00 92.88  ? 253 GLY B N   1 
ATOM   4362  C  CA  . GLY B 2 223 ? 104.795 31.249  -16.343 1.00 92.81  ? 253 GLY B CA  1 
ATOM   4363  C  C   . GLY B 2 223 ? 104.002 30.704  -17.522 1.00 94.39  ? 253 GLY B C   1 
ATOM   4364  O  O   . GLY B 2 223 ? 103.752 31.414  -18.508 1.00 94.41  ? 253 GLY B O   1 
ATOM   4365  N  N   . TYR B 2 224 ? 103.630 29.410  -17.420 1.00 87.82  ? 254 TYR B N   1 
ATOM   4366  C  CA  . TYR B 2 224 ? 102.845 28.648  -18.380 1.00 84.34  ? 254 TYR B CA  1 
ATOM   4367  C  C   . TYR B 2 224 ? 101.712 27.996  -17.625 1.00 82.59  ? 254 TYR B C   1 
ATOM   4368  O  O   . TYR B 2 224 ? 101.964 27.251  -16.671 1.00 83.39  ? 254 TYR B O   1 
ATOM   4369  C  CB  . TYR B 2 224 ? 103.710 27.591  -19.091 1.00 85.41  ? 254 TYR B CB  1 
ATOM   4370  C  CG  . TYR B 2 224 ? 104.654 28.157  -20.131 1.00 89.38  ? 254 TYR B CG  1 
ATOM   4371  C  CD1 . TYR B 2 224 ? 104.170 28.832  -21.251 1.00 91.40  ? 254 TYR B CD1 1 
ATOM   4372  C  CD2 . TYR B 2 224 ? 106.032 28.004  -20.008 1.00 91.66  ? 254 TYR B CD2 1 
ATOM   4373  C  CE1 . TYR B 2 224 ? 105.036 29.367  -22.205 1.00 93.94  ? 254 TYR B CE1 1 
ATOM   4374  C  CE2 . TYR B 2 224 ? 106.908 28.521  -20.966 1.00 93.80  ? 254 TYR B CE2 1 
ATOM   4375  C  CZ  . TYR B 2 224 ? 106.406 29.202  -22.063 1.00 101.71 ? 254 TYR B CZ  1 
ATOM   4376  O  OH  . TYR B 2 224 ? 107.264 29.705  -23.014 1.00 104.20 ? 254 TYR B OH  1 
ATOM   4377  N  N   . THR B 2 225 ? 100.466 28.338  -17.997 1.00 73.81  ? 255 THR B N   1 
ATOM   4378  C  CA  . THR B 2 225 ? 99.249  27.800  -17.378 1.00 70.39  ? 255 THR B CA  1 
ATOM   4379  C  C   . THR B 2 225 ? 98.441  27.093  -18.440 1.00 68.55  ? 255 THR B C   1 
ATOM   4380  O  O   . THR B 2 225 ? 98.226  27.641  -19.523 1.00 67.94  ? 255 THR B O   1 
ATOM   4381  C  CB  . THR B 2 225 ? 98.405  28.898  -16.704 1.00 76.18  ? 255 THR B CB  1 
ATOM   4382  O  OG1 . THR B 2 225 ? 99.246  29.883  -16.108 1.00 79.54  ? 255 THR B OG1 1 
ATOM   4383  C  CG2 . THR B 2 225 ? 97.460  28.337  -15.669 1.00 71.40  ? 255 THR B CG2 1 
ATOM   4384  N  N   . TRP B 2 226 ? 97.994  25.880  -18.126 1.00 61.71  ? 256 TRP B N   1 
ATOM   4385  C  CA  . TRP B 2 226 ? 97.200  25.054  -19.027 1.00 58.80  ? 256 TRP B CA  1 
ATOM   4386  C  C   . TRP B 2 226 ? 95.794  24.887  -18.503 1.00 61.59  ? 256 TRP B C   1 
ATOM   4387  O  O   . TRP B 2 226 ? 95.598  24.336  -17.420 1.00 62.97  ? 256 TRP B O   1 
ATOM   4388  C  CB  . TRP B 2 226 ? 97.848  23.675  -19.246 1.00 55.92  ? 256 TRP B CB  1 
ATOM   4389  C  CG  . TRP B 2 226 ? 99.145  23.720  -19.996 1.00 57.57  ? 256 TRP B CG  1 
ATOM   4390  C  CD1 . TRP B 2 226 ? 100.348 24.167  -19.536 1.00 61.58  ? 256 TRP B CD1 1 
ATOM   4391  C  CD2 . TRP B 2 226 ? 99.372  23.265  -21.334 1.00 57.33  ? 256 TRP B CD2 1 
ATOM   4392  N  NE1 . TRP B 2 226 ? 101.308 24.031  -20.508 1.00 61.25  ? 256 TRP B NE1 1 
ATOM   4393  C  CE2 . TRP B 2 226 ? 100.739 23.485  -21.625 1.00 61.87  ? 256 TRP B CE2 1 
ATOM   4394  C  CE3 . TRP B 2 226 ? 98.551  22.685  -22.322 1.00 57.64  ? 256 TRP B CE3 1 
ATOM   4395  C  CZ2 . TRP B 2 226 ? 101.307 23.151  -22.864 1.00 61.13  ? 256 TRP B CZ2 1 
ATOM   4396  C  CZ3 . TRP B 2 226 ? 99.123  22.322  -23.534 1.00 59.06  ? 256 TRP B CZ3 1 
ATOM   4397  C  CH2 . TRP B 2 226 ? 100.481 22.576  -23.803 1.00 60.79  ? 256 TRP B CH2 1 
ATOM   4398  N  N   . ILE B 2 227 ? 94.813  25.382  -19.260 1.00 55.29  ? 257 ILE B N   1 
ATOM   4399  C  CA  . ILE B 2 227 ? 93.410  25.178  -18.932 1.00 52.41  ? 257 ILE B CA  1 
ATOM   4400  C  C   . ILE B 2 227 ? 92.937  24.042  -19.834 1.00 53.87  ? 257 ILE B C   1 
ATOM   4401  O  O   . ILE B 2 227 ? 93.271  23.977  -21.019 1.00 52.34  ? 257 ILE B O   1 
ATOM   4402  C  CB  . ILE B 2 227 ? 92.543  26.454  -18.939 1.00 55.34  ? 257 ILE B CB  1 
ATOM   4403  C  CG1 . ILE B 2 227 ? 93.271  27.581  -18.154 1.00 57.50  ? 257 ILE B CG1 1 
ATOM   4404  C  CG2 . ILE B 2 227 ? 91.163  26.161  -18.322 1.00 53.78  ? 257 ILE B CG2 1 
ATOM   4405  C  CD1 . ILE B 2 227 ? 92.845  29.024  -18.457 1.00 63.39  ? 257 ILE B CD1 1 
ATOM   4406  N  N   . VAL B 2 228 ? 92.237  23.096  -19.235 1.00 51.50  ? 258 VAL B N   1 
ATOM   4407  C  CA  . VAL B 2 228 ? 91.811  21.869  -19.900 1.00 50.92  ? 258 VAL B CA  1 
ATOM   4408  C  C   . VAL B 2 228 ? 90.291  21.547  -19.668 1.00 54.91  ? 258 VAL B C   1 
ATOM   4409  O  O   . VAL B 2 228 ? 89.740  21.970  -18.645 1.00 54.17  ? 258 VAL B O   1 
ATOM   4410  C  CB  . VAL B 2 228 ? 92.802  20.792  -19.350 1.00 54.38  ? 258 VAL B CB  1 
ATOM   4411  C  CG1 . VAL B 2 228 ? 92.127  19.686  -18.550 1.00 53.73  ? 258 VAL B CG1 1 
ATOM   4412  C  CG2 . VAL B 2 228 ? 93.743  20.265  -20.421 1.00 53.24  ? 258 VAL B CG2 1 
ATOM   4413  N  N   . PRO B 2 229 ? 89.593  20.813  -20.566 1.00 52.91  ? 259 PRO B N   1 
ATOM   4414  C  CA  . PRO B 2 229 ? 88.179  20.475  -20.286 1.00 52.72  ? 259 PRO B CA  1 
ATOM   4415  C  C   . PRO B 2 229 ? 88.037  19.197  -19.439 1.00 56.84  ? 259 PRO B C   1 
ATOM   4416  O  O   . PRO B 2 229 ? 88.968  18.403  -19.321 1.00 58.51  ? 259 PRO B O   1 
ATOM   4417  C  CB  . PRO B 2 229 ? 87.551  20.320  -21.701 1.00 53.19  ? 259 PRO B CB  1 
ATOM   4418  C  CG  . PRO B 2 229 ? 88.721  20.069  -22.640 1.00 57.48  ? 259 PRO B CG  1 
ATOM   4419  C  CD  . PRO B 2 229 ? 90.028  20.193  -21.837 1.00 54.13  ? 259 PRO B CD  1 
ATOM   4420  N  N   . SER B 2 230 ? 86.855  19.006  -18.862 1.00 51.97  ? 260 SER B N   1 
ATOM   4421  C  CA  . SER B 2 230 ? 86.396  17.882  -18.033 1.00 50.44  ? 260 SER B CA  1 
ATOM   4422  C  C   . SER B 2 230 ? 86.993  16.513  -18.354 1.00 54.40  ? 260 SER B C   1 
ATOM   4423  O  O   . SER B 2 230 ? 87.400  15.796  -17.447 1.00 55.03  ? 260 SER B O   1 
ATOM   4424  C  CB  . SER B 2 230 ? 84.879  17.780  -18.122 1.00 53.77  ? 260 SER B CB  1 
ATOM   4425  O  OG  . SER B 2 230 ? 84.326  17.267  -16.924 1.00 68.88  ? 260 SER B OG  1 
ATOM   4426  N  N   . LEU B 2 231 ? 87.030  16.146  -19.636 1.00 51.39  ? 261 LEU B N   1 
ATOM   4427  C  CA  . LEU B 2 231 ? 87.468  14.841  -20.095 1.00 50.90  ? 261 LEU B CA  1 
ATOM   4428  C  C   . LEU B 2 231 ? 88.946  14.603  -19.872 1.00 55.52  ? 261 LEU B C   1 
ATOM   4429  O  O   . LEU B 2 231 ? 89.323  13.451  -19.612 1.00 57.76  ? 261 LEU B O   1 
ATOM   4430  C  CB  . LEU B 2 231 ? 87.030  14.565  -21.558 1.00 50.93  ? 261 LEU B CB  1 
ATOM   4431  C  CG  . LEU B 2 231 ? 87.876  15.047  -22.727 1.00 56.84  ? 261 LEU B CG  1 
ATOM   4432  C  CD1 . LEU B 2 231 ? 87.527  14.284  -23.957 1.00 57.14  ? 261 LEU B CD1 1 
ATOM   4433  C  CD2 . LEU B 2 231 ? 87.692  16.522  -22.993 1.00 59.42  ? 261 LEU B CD2 1 
ATOM   4434  N  N   . VAL B 2 232 ? 89.781  15.665  -19.917 1.00 49.76  ? 262 VAL B N   1 
ATOM   4435  C  CA  . VAL B 2 232 ? 91.221  15.509  -19.636 1.00 48.40  ? 262 VAL B CA  1 
ATOM   4436  C  C   . VAL B 2 232 ? 91.459  15.183  -18.136 1.00 51.32  ? 262 VAL B C   1 
ATOM   4437  O  O   . VAL B 2 232 ? 92.321  14.358  -17.810 1.00 49.75  ? 262 VAL B O   1 
ATOM   4438  C  CB  . VAL B 2 232 ? 92.084  16.677  -20.150 1.00 50.85  ? 262 VAL B CB  1 
ATOM   4439  C  CG1 . VAL B 2 232 ? 93.516  16.532  -19.676 1.00 50.56  ? 262 VAL B CG1 1 
ATOM   4440  C  CG2 . VAL B 2 232 ? 92.041  16.749  -21.671 1.00 50.13  ? 262 VAL B CG2 1 
ATOM   4441  N  N   . ALA B 2 233 ? 90.673  15.802  -17.243 1.00 48.62  ? 263 ALA B N   1 
ATOM   4442  C  CA  . ALA B 2 233 ? 90.793  15.513  -15.824 1.00 50.22  ? 263 ALA B CA  1 
ATOM   4443  C  C   . ALA B 2 233 ? 90.232  14.111  -15.563 1.00 57.19  ? 263 ALA B C   1 
ATOM   4444  O  O   . ALA B 2 233 ? 90.933  13.284  -14.963 1.00 57.88  ? 263 ALA B O   1 
ATOM   4445  C  CB  . ALA B 2 233 ? 90.052  16.555  -15.008 1.00 51.68  ? 263 ALA B CB  1 
ATOM   4446  N  N   . GLY B 2 234 ? 89.012  13.858  -16.071 1.00 53.88  ? 264 GLY B N   1 
ATOM   4447  C  CA  . GLY B 2 234 ? 88.284  12.598  -15.949 1.00 53.34  ? 264 GLY B CA  1 
ATOM   4448  C  C   . GLY B 2 234 ? 88.176  12.137  -14.516 1.00 61.22  ? 264 GLY B C   1 
ATOM   4449  O  O   . GLY B 2 234 ? 87.800  12.926  -13.633 1.00 63.88  ? 264 GLY B O   1 
ATOM   4450  N  N   . ASP B 2 235 ? 88.556  10.869  -14.264 1.00 57.14  ? 265 ASP B N   1 
ATOM   4451  C  CA  . ASP B 2 235 ? 88.615  10.288  -12.924 1.00 57.47  ? 265 ASP B CA  1 
ATOM   4452  C  C   . ASP B 2 235 ? 89.708  11.061  -12.198 1.00 63.21  ? 265 ASP B C   1 
ATOM   4453  O  O   . ASP B 2 235 ? 90.892  10.923  -12.557 1.00 63.36  ? 265 ASP B O   1 
ATOM   4454  C  CB  . ASP B 2 235 ? 88.957  8.789   -12.981 1.00 58.34  ? 265 ASP B CB  1 
ATOM   4455  C  CG  . ASP B 2 235 ? 89.073  8.098   -11.630 1.00 72.01  ? 265 ASP B CG  1 
ATOM   4456  O  OD1 . ASP B 2 235 ? 88.422  8.568   -10.646 1.00 72.83  ? 265 ASP B OD1 1 
ATOM   4457  O  OD2 . ASP B 2 235 ? 89.768  7.071   -11.556 1.00 82.51  ? 265 ASP B OD2 1 
ATOM   4458  N  N   . THR B 2 236 ? 89.300  11.954  -11.252 1.00 59.34  ? 266 THR B N   1 
ATOM   4459  C  CA  . THR B 2 236 ? 90.239  12.807  -10.505 1.00 58.33  ? 266 THR B CA  1 
ATOM   4460  C  C   . THR B 2 236 ? 91.192  12.001  -9.628  1.00 59.96  ? 266 THR B C   1 
ATOM   4461  O  O   . THR B 2 236 ? 92.222  12.522  -9.218  1.00 59.47  ? 266 THR B O   1 
ATOM   4462  C  CB  . THR B 2 236 ? 89.528  13.921  -9.742  1.00 60.05  ? 266 THR B CB  1 
ATOM   4463  O  OG1 . THR B 2 236 ? 88.332  13.434  -9.142  1.00 64.18  ? 266 THR B OG1 1 
ATOM   4464  C  CG2 . THR B 2 236 ? 89.212  15.100  -10.632 1.00 54.15  ? 266 THR B CG2 1 
ATOM   4465  N  N   . ASP B 2 237 ? 90.887  10.715  -9.428  1.00 56.36  ? 267 ASP B N   1 
ATOM   4466  C  CA  . ASP B 2 237 ? 91.690  9.777   -8.651  1.00 57.72  ? 267 ASP B CA  1 
ATOM   4467  C  C   . ASP B 2 237 ? 92.768  9.108   -9.488  1.00 62.06  ? 267 ASP B C   1 
ATOM   4468  O  O   . ASP B 2 237 ? 93.633  8.434   -8.931  1.00 65.72  ? 267 ASP B O   1 
ATOM   4469  C  CB  . ASP B 2 237 ? 90.797  8.751   -7.925  1.00 60.30  ? 267 ASP B CB  1 
ATOM   4470  C  CG  . ASP B 2 237 ? 89.890  9.363   -6.864  1.00 69.82  ? 267 ASP B CG  1 
ATOM   4471  O  OD1 . ASP B 2 237 ? 90.396  10.141  -6.022  1.00 70.37  ? 267 ASP B OD1 1 
ATOM   4472  O  OD2 . ASP B 2 237 ? 88.679  9.063   -6.875  1.00 77.84  ? 267 ASP B OD2 1 
ATOM   4473  N  N   . THR B 2 238 ? 92.742  9.312   -10.817 1.00 55.51  ? 268 THR B N   1 
ATOM   4474  C  CA  . THR B 2 238 ? 93.763  8.806   -11.733 1.00 53.30  ? 268 THR B CA  1 
ATOM   4475  C  C   . THR B 2 238 ? 94.459  10.010  -12.292 1.00 55.85  ? 268 THR B C   1 
ATOM   4476  O  O   . THR B 2 238 ? 93.911  10.704  -13.159 1.00 54.83  ? 268 THR B O   1 
ATOM   4477  C  CB  . THR B 2 238 ? 93.209  7.848   -12.775 1.00 56.37  ? 268 THR B CB  1 
ATOM   4478  O  OG1 . THR B 2 238 ? 92.622  6.743   -12.097 1.00 63.86  ? 268 THR B OG1 1 
ATOM   4479  C  CG2 . THR B 2 238 ? 94.287  7.321   -13.689 1.00 54.48  ? 268 THR B CG2 1 
ATOM   4480  N  N   . VAL B 2 239 ? 95.637  10.317  -11.716 1.00 51.42  ? 269 VAL B N   1 
ATOM   4481  C  CA  . VAL B 2 239 ? 96.412  11.474  -12.139 1.00 50.15  ? 269 VAL B CA  1 
ATOM   4482  C  C   . VAL B 2 239 ? 97.685  11.044  -12.867 1.00 57.99  ? 269 VAL B C   1 
ATOM   4483  O  O   . VAL B 2 239 ? 98.646  10.645  -12.225 1.00 62.38  ? 269 VAL B O   1 
ATOM   4484  C  CB  . VAL B 2 239 ? 96.672  12.455  -10.981 1.00 52.56  ? 269 VAL B CB  1 
ATOM   4485  C  CG1 . VAL B 2 239 ? 97.535  13.631  -11.425 1.00 51.72  ? 269 VAL B CG1 1 
ATOM   4486  C  CG2 . VAL B 2 239 ? 95.358  12.935  -10.376 1.00 51.96  ? 269 VAL B CG2 1 
ATOM   4487  N  N   . PRO B 2 240 ? 97.730  11.115  -14.205 1.00 53.45  ? 270 PRO B N   1 
ATOM   4488  C  CA  . PRO B 2 240 ? 98.975  10.750  -14.913 1.00 53.16  ? 270 PRO B CA  1 
ATOM   4489  C  C   . PRO B 2 240 ? 100.169 11.570  -14.436 1.00 59.38  ? 270 PRO B C   1 
ATOM   4490  O  O   . PRO B 2 240 ? 100.052 12.766  -14.177 1.00 60.06  ? 270 PRO B O   1 
ATOM   4491  C  CB  . PRO B 2 240 ? 98.641  11.050  -16.376 1.00 53.61  ? 270 PRO B CB  1 
ATOM   4492  C  CG  . PRO B 2 240 ? 97.107  10.920  -16.424 1.00 57.08  ? 270 PRO B CG  1 
ATOM   4493  C  CD  . PRO B 2 240 ? 96.666  11.529  -15.149 1.00 53.62  ? 270 PRO B CD  1 
ATOM   4494  N  N   . ALA B 2 241 ? 101.311 10.915  -14.269 1.00 56.90  ? 271 ALA B N   1 
ATOM   4495  C  CA  . ALA B 2 241 ? 102.542 11.562  -13.830 1.00 57.41  ? 271 ALA B CA  1 
ATOM   4496  C  C   . ALA B 2 241 ? 102.943 12.745  -14.738 1.00 61.59  ? 271 ALA B C   1 
ATOM   4497  O  O   . ALA B 2 241 ? 103.510 13.741  -14.272 1.00 63.98  ? 271 ALA B O   1 
ATOM   4498  C  CB  . ALA B 2 241 ? 103.649 10.541  -13.814 1.00 58.84  ? 271 ALA B CB  1 
ATOM   4499  N  N   . GLU B 2 242 ? 102.636 12.630  -16.035 1.00 55.19  ? 272 GLU B N   1 
ATOM   4500  C  CA  . GLU B 2 242 ? 103.002 13.613  -17.041 1.00 54.06  ? 272 GLU B CA  1 
ATOM   4501  C  C   . GLU B 2 242 ? 102.133 14.892  -16.971 1.00 59.40  ? 272 GLU B C   1 
ATOM   4502  O  O   . GLU B 2 242 ? 102.520 15.912  -17.550 1.00 58.73  ? 272 GLU B O   1 
ATOM   4503  C  CB  . GLU B 2 242 ? 103.058 12.986  -18.443 1.00 53.77  ? 272 GLU B CB  1 
ATOM   4504  C  CG  . GLU B 2 242 ? 102.168 11.768  -18.601 1.00 67.71  ? 272 GLU B CG  1 
ATOM   4505  C  CD  . GLU B 2 242 ? 102.742 10.405  -18.250 1.00 89.53  ? 272 GLU B CD  1 
ATOM   4506  O  OE1 . GLU B 2 242 ? 103.839 10.082  -18.761 1.00 96.27  ? 272 GLU B OE1 1 
ATOM   4507  O  OE2 . GLU B 2 242 ? 102.051 9.626   -17.548 1.00 68.96  ? 272 GLU B OE2 1 
ATOM   4508  N  N   . PHE B 2 243 ? 101.028 14.880  -16.191 1.00 56.50  ? 273 PHE B N   1 
ATOM   4509  C  CA  . PHE B 2 243 ? 100.192 16.074  -16.007 1.00 56.17  ? 273 PHE B CA  1 
ATOM   4510  C  C   . PHE B 2 243 ? 100.990 17.148  -15.246 1.00 62.80  ? 273 PHE B C   1 
ATOM   4511  O  O   . PHE B 2 243 ? 101.686 16.808  -14.278 1.00 65.92  ? 273 PHE B O   1 
ATOM   4512  C  CB  . PHE B 2 243 ? 98.886  15.722  -15.272 1.00 57.60  ? 273 PHE B CB  1 
ATOM   4513  C  CG  . PHE B 2 243 ? 97.774  15.159  -16.128 1.00 59.15  ? 273 PHE B CG  1 
ATOM   4514  C  CD1 . PHE B 2 243 ? 98.053  14.507  -17.328 1.00 62.99  ? 273 PHE B CD1 1 
ATOM   4515  C  CD2 . PHE B 2 243 ? 96.451  15.294  -15.745 1.00 62.08  ? 273 PHE B CD2 1 
ATOM   4516  C  CE1 . PHE B 2 243 ? 97.028  14.035  -18.141 1.00 63.47  ? 273 PHE B CE1 1 
ATOM   4517  C  CE2 . PHE B 2 243 ? 95.420  14.813  -16.555 1.00 65.30  ? 273 PHE B CE2 1 
ATOM   4518  C  CZ  . PHE B 2 243 ? 95.715  14.172  -17.741 1.00 63.20  ? 273 PHE B CZ  1 
ATOM   4519  N  N   . PRO B 2 244 ? 100.998 18.422  -15.695 1.00 57.84  ? 274 PRO B N   1 
ATOM   4520  C  CA  . PRO B 2 244 ? 101.778 19.435  -14.969 1.00 58.03  ? 274 PRO B CA  1 
ATOM   4521  C  C   . PRO B 2 244 ? 101.097 19.926  -13.698 1.00 64.67  ? 274 PRO B C   1 
ATOM   4522  O  O   . PRO B 2 244 ? 99.886  20.152  -13.698 1.00 65.77  ? 274 PRO B O   1 
ATOM   4523  C  CB  . PRO B 2 244 ? 101.930 20.558  -15.990 1.00 59.41  ? 274 PRO B CB  1 
ATOM   4524  C  CG  . PRO B 2 244 ? 100.787 20.416  -16.915 1.00 62.78  ? 274 PRO B CG  1 
ATOM   4525  C  CD  . PRO B 2 244 ? 100.250 19.020  -16.822 1.00 58.43  ? 274 PRO B CD  1 
ATOM   4526  N  N   . THR B 2 245 ? 101.866 20.103  -12.611 1.00 62.51  ? 275 THR B N   1 
ATOM   4527  C  CA  . THR B 2 245 ? 101.349 20.671  -11.353 1.00 62.31  ? 275 THR B CA  1 
ATOM   4528  C  C   . THR B 2 245 ? 100.948 22.126  -11.692 1.00 65.45  ? 275 THR B C   1 
ATOM   4529  O  O   . THR B 2 245 ? 101.711 22.825  -12.366 1.00 67.07  ? 275 THR B O   1 
ATOM   4530  C  CB  . THR B 2 245 ? 102.415 20.537  -10.238 1.00 66.67  ? 275 THR B CB  1 
ATOM   4531  O  OG1 . THR B 2 245 ? 102.478 19.171  -9.823  1.00 57.86  ? 275 THR B OG1 1 
ATOM   4532  C  CG2 . THR B 2 245 ? 102.115 21.404  -9.019  1.00 69.47  ? 275 THR B CG2 1 
ATOM   4533  N  N   . GLY B 2 246 ? 99.740  22.523  -11.308 1.00 59.47  ? 276 GLY B N   1 
ATOM   4534  C  CA  . GLY B 2 246 ? 99.197  23.840  -11.625 1.00 59.41  ? 276 GLY B CA  1 
ATOM   4535  C  C   . GLY B 2 246 ? 98.257  23.785  -12.813 1.00 66.16  ? 276 GLY B C   1 
ATOM   4536  O  O   . GLY B 2 246 ? 97.901  24.824  -13.379 1.00 68.73  ? 276 GLY B O   1 
ATOM   4537  N  N   . LEU B 2 247 ? 97.853  22.559  -13.215 1.00 61.25  ? 277 LEU B N   1 
ATOM   4538  C  CA  . LEU B 2 247 ? 96.929  22.336  -14.325 1.00 59.71  ? 277 LEU B CA  1 
ATOM   4539  C  C   . LEU B 2 247 ? 95.526  22.683  -13.842 1.00 63.13  ? 277 LEU B C   1 
ATOM   4540  O  O   . LEU B 2 247 ? 95.120  22.221  -12.764 1.00 64.28  ? 277 LEU B O   1 
ATOM   4541  C  CB  . LEU B 2 247 ? 97.004  20.860  -14.821 1.00 58.14  ? 277 LEU B CB  1 
ATOM   4542  C  CG  . LEU B 2 247 ? 96.026  20.410  -15.919 1.00 59.84  ? 277 LEU B CG  1 
ATOM   4543  C  CD1 . LEU B 2 247 ? 96.273  21.136  -17.192 1.00 59.57  ? 277 LEU B CD1 1 
ATOM   4544  C  CD2 . LEU B 2 247 ? 96.166  18.951  -16.188 1.00 60.44  ? 277 LEU B CD2 1 
ATOM   4545  N  N   . ILE B 2 248 ? 94.811  23.523  -14.620 1.00 56.63  ? 278 ILE B N   1 
ATOM   4546  C  CA  . ILE B 2 248 ? 93.445  23.949  -14.301 1.00 54.92  ? 278 ILE B CA  1 
ATOM   4547  C  C   . ILE B 2 248 ? 92.481  23.166  -15.167 1.00 56.46  ? 278 ILE B C   1 
ATOM   4548  O  O   . ILE B 2 248 ? 92.716  23.010  -16.360 1.00 55.47  ? 278 ILE B O   1 
ATOM   4549  C  CB  . ILE B 2 248 ? 93.224  25.493  -14.424 1.00 58.26  ? 278 ILE B CB  1 
ATOM   4550  C  CG1 . ILE B 2 248 ? 94.262  26.291  -13.589 1.00 59.99  ? 278 ILE B CG1 1 
ATOM   4551  C  CG2 . ILE B 2 248 ? 91.779  25.897  -14.048 1.00 57.14  ? 278 ILE B CG2 1 
ATOM   4552  C  CD1 . ILE B 2 248 ? 94.341  27.784  -13.930 1.00 64.46  ? 278 ILE B CD1 1 
ATOM   4553  N  N   . SER B 2 249 ? 91.394  22.673  -14.565 1.00 52.51  ? 279 SER B N   1 
ATOM   4554  C  CA  . SER B 2 249 ? 90.377  21.946  -15.291 1.00 51.59  ? 279 SER B CA  1 
ATOM   4555  C  C   . SER B 2 249 ? 89.001  22.284  -14.760 1.00 60.43  ? 279 SER B C   1 
ATOM   4556  O  O   . SER B 2 249 ? 88.867  22.851  -13.682 1.00 61.78  ? 279 SER B O   1 
ATOM   4557  C  CB  . SER B 2 249 ? 90.627  20.442  -15.201 1.00 52.80  ? 279 SER B CB  1 
ATOM   4558  O  OG  . SER B 2 249 ? 89.799  19.693  -16.083 1.00 55.57  ? 279 SER B OG  1 
ATOM   4559  N  N   . VAL B 2 250 ? 87.980  21.943  -15.533 1.00 59.83  ? 280 VAL B N   1 
ATOM   4560  C  CA  . VAL B 2 250 ? 86.551  22.040  -15.240 1.00 61.52  ? 280 VAL B CA  1 
ATOM   4561  C  C   . VAL B 2 250 ? 86.172  20.596  -14.869 1.00 68.34  ? 280 VAL B C   1 
ATOM   4562  O  O   . VAL B 2 250 ? 86.718  19.669  -15.461 1.00 67.20  ? 280 VAL B O   1 
ATOM   4563  C  CB  . VAL B 2 250 ? 85.788  22.474  -16.533 1.00 65.53  ? 280 VAL B CB  1 
ATOM   4564  C  CG1 . VAL B 2 250 ? 84.279  22.422  -16.337 1.00 65.66  ? 280 VAL B CG1 1 
ATOM   4565  C  CG2 . VAL B 2 250 ? 86.233  23.857  -17.027 1.00 66.21  ? 280 VAL B CG2 1 
ATOM   4566  N  N   . SER B 2 251 ? 85.274  20.389  -13.906 1.00 68.42  ? 281 SER B N   1 
ATOM   4567  C  CA  . SER B 2 251 ? 84.827  19.045  -13.550 1.00 68.94  ? 281 SER B CA  1 
ATOM   4568  C  C   . SER B 2 251 ? 83.364  19.062  -13.195 1.00 81.22  ? 281 SER B C   1 
ATOM   4569  O  O   . SER B 2 251 ? 82.894  20.023  -12.592 1.00 81.34  ? 281 SER B O   1 
ATOM   4570  C  CB  . SER B 2 251 ? 85.656  18.441  -12.422 1.00 69.25  ? 281 SER B CB  1 
ATOM   4571  N  N   . TYR B 2 252 ? 82.623  18.017  -13.597 1.00 84.36  ? 282 TYR B N   1 
ATOM   4572  C  CA  . TYR B 2 252 ? 81.231  17.975  -13.183 1.00 88.23  ? 282 TYR B CA  1 
ATOM   4573  C  C   . TYR B 2 252 ? 81.184  17.428  -11.757 1.00 100.41 ? 282 TYR B C   1 
ATOM   4574  O  O   . TYR B 2 252 ? 81.617  16.281  -11.541 1.00 101.07 ? 282 TYR B O   1 
ATOM   4575  C  CB  . TYR B 2 252 ? 80.345  17.159  -14.114 1.00 88.88  ? 282 TYR B CB  1 
ATOM   4576  C  CG  . TYR B 2 252 ? 78.877  17.373  -13.820 1.00 92.76  ? 282 TYR B CG  1 
ATOM   4577  C  CD1 . TYR B 2 252 ? 78.395  18.623  -13.435 1.00 96.49  ? 282 TYR B CD1 1 
ATOM   4578  C  CD2 . TYR B 2 252 ? 77.961  16.338  -13.961 1.00 93.68  ? 282 TYR B CD2 1 
ATOM   4579  C  CE1 . TYR B 2 252 ? 77.046  18.823  -13.160 1.00 99.28  ? 282 TYR B CE1 1 
ATOM   4580  C  CE2 . TYR B 2 252 ? 76.608  16.528  -13.690 1.00 95.57  ? 282 TYR B CE2 1 
ATOM   4581  C  CZ  . TYR B 2 252 ? 76.157  17.774  -13.300 1.00 106.83 ? 282 TYR B CZ  1 
ATOM   4582  O  OH  . TYR B 2 252 ? 74.831  17.967  -13.051 1.00 115.44 ? 282 TYR B OH  1 
ATOM   4583  N  N   . ASP B 2 253 ? 80.709  18.298  -10.793 1.00 99.97  ? 283 ASP B N   1 
ATOM   4584  C  CA  . ASP B 2 253 ? 80.548  18.143  -9.336  1.00 101.41 ? 283 ASP B CA  1 
ATOM   4585  C  C   . ASP B 2 253 ? 80.294  16.712  -8.856  1.00 106.02 ? 283 ASP B C   1 
ATOM   4586  O  O   . ASP B 2 253 ? 79.153  16.402  -8.486  1.00 106.10 ? 283 ASP B O   1 
ATOM   4587  C  CB  . ASP B 2 253 ? 79.423  19.087  -8.809  1.00 105.22 ? 283 ASP B CB  1 
ATOM   4588  C  CG  . ASP B 2 253 ? 79.483  19.462  -7.313  1.00 120.18 ? 283 ASP B CG  1 
ATOM   4589  O  OD1 . ASP B 2 253 ? 80.302  18.873  -6.584  1.00 120.98 ? 283 ASP B OD1 1 
ATOM   4590  O  OD2 . ASP B 2 253 ? 78.752  20.403  -6.895  1.00 124.50 ? 283 ASP B OD2 1 
ATOM   4591  N  N   . GLU B 2 254 ? 81.367  15.844  -8.835  1.00 102.07 ? 284 GLU B N   1 
ATOM   4592  C  CA  . GLU B 2 254 ? 81.318  14.449  -8.353  1.00 100.92 ? 284 GLU B CA  1 
ATOM   4593  C  C   . GLU B 2 254 ? 81.155  14.569  -6.828  1.00 106.73 ? 284 GLU B C   1 
ATOM   4594  O  O   . GLU B 2 254 ? 80.654  13.657  -6.166  1.00 106.57 ? 284 GLU B O   1 
ATOM   4595  C  CB  . GLU B 2 254 ? 82.639  13.707  -8.672  1.00 101.02 ? 284 GLU B CB  1 
ATOM   4596  C  CG  . GLU B 2 254 ? 82.999  13.571  -10.147 1.00 108.10 ? 284 GLU B CG  1 
ATOM   4597  C  CD  . GLU B 2 254 ? 84.481  13.629  -10.504 1.00 131.63 ? 284 GLU B CD  1 
ATOM   4598  O  OE1 . GLU B 2 254 ? 84.965  14.755  -10.756 1.00 145.92 ? 284 GLU B OE1 1 
ATOM   4599  O  OE2 . GLU B 2 254 ? 85.142  12.565  -10.610 1.00 111.99 ? 284 GLU B OE2 1 
ATOM   4600  N  N   . TRP B 2 255 ? 81.561  15.752  -6.305  1.00 104.39 ? 285 TRP B N   1 
ATOM   4601  C  CA  . TRP B 2 255 ? 81.558  16.189  -4.912  1.00 106.19 ? 285 TRP B CA  1 
ATOM   4602  C  C   . TRP B 2 255 ? 80.145  16.285  -4.285  1.00 106.69 ? 285 TRP B C   1 
ATOM   4603  O  O   . TRP B 2 255 ? 79.877  15.564  -3.319  1.00 107.15 ? 285 TRP B O   1 
ATOM   4604  C  CB  . TRP B 2 255 ? 82.307  17.542  -4.784  1.00 106.78 ? 285 TRP B CB  1 
ATOM   4605  C  CG  . TRP B 2 255 ? 83.779  17.530  -5.126  1.00 107.80 ? 285 TRP B CG  1 
ATOM   4606  C  CD1 . TRP B 2 255 ? 84.820  17.566  -4.240  1.00 111.67 ? 285 TRP B CD1 1 
ATOM   4607  C  CD2 . TRP B 2 255 ? 84.371  17.574  -6.443  1.00 106.28 ? 285 TRP B CD2 1 
ATOM   4608  N  NE1 . TRP B 2 255 ? 86.021  17.593  -4.919  1.00 110.20 ? 285 TRP B NE1 1 
ATOM   4609  C  CE2 . TRP B 2 255 ? 85.778  17.577  -6.269  1.00 109.94 ? 285 TRP B CE2 1 
ATOM   4610  C  CE3 . TRP B 2 255 ? 83.851  17.574  -7.754  1.00 106.31 ? 285 TRP B CE3 1 
ATOM   4611  C  CZ2 . TRP B 2 255 ? 86.668  17.545  -7.347  1.00 107.90 ? 285 TRP B CZ2 1 
ATOM   4612  C  CZ3 . TRP B 2 255 ? 84.738  17.544  -8.825  1.00 106.73 ? 285 TRP B CZ3 1 
ATOM   4613  C  CH2 . TRP B 2 255 ? 86.129  17.526  -8.616  1.00 107.43 ? 285 TRP B CH2 1 
ATOM   4614  N  N   . ASP B 2 256 ? 79.253  17.164  -4.823  1.00 99.18  ? 286 ASP B N   1 
ATOM   4615  C  CA  . ASP B 2 256 ? 77.905  17.404  -4.279  1.00 98.49  ? 286 ASP B CA  1 
ATOM   4616  C  C   . ASP B 2 256 ? 76.756  16.709  -5.009  1.00 93.98  ? 286 ASP B C   1 
ATOM   4617  O  O   . ASP B 2 256 ? 75.696  16.479  -4.400  1.00 95.51  ? 286 ASP B O   1 
ATOM   4618  C  CB  . ASP B 2 256 ? 77.607  18.897  -4.164  1.00 102.57 ? 286 ASP B CB  1 
ATOM   4619  C  CG  . ASP B 2 256 ? 78.541  19.608  -3.211  1.00 118.84 ? 286 ASP B CG  1 
ATOM   4620  O  OD1 . ASP B 2 256 ? 78.263  19.597  -1.980  1.00 119.55 ? 286 ASP B OD1 1 
ATOM   4621  O  OD2 . ASP B 2 256 ? 79.556  20.163  -3.688  1.00 127.58 ? 286 ASP B OD2 1 
ATOM   4622  N  N   . TYR B 2 257 ? 76.945  16.402  -6.306  1.00 81.27  ? 287 TYR B N   1 
ATOM   4623  C  CA  . TYR B 2 257 ? 75.944  15.682  -7.091  1.00 76.14  ? 287 TYR B CA  1 
ATOM   4624  C  C   . TYR B 2 257 ? 76.455  14.252  -7.210  1.00 74.69  ? 287 TYR B C   1 
ATOM   4625  O  O   . TYR B 2 257 ? 77.076  13.873  -8.199  1.00 72.38  ? 287 TYR B O   1 
ATOM   4626  C  CB  . TYR B 2 257 ? 75.701  16.366  -8.444  1.00 74.23  ? 287 TYR B CB  1 
ATOM   4627  C  CG  . TYR B 2 257 ? 74.485  15.891  -9.214  1.00 73.77  ? 287 TYR B CG  1 
ATOM   4628  C  CD1 . TYR B 2 257 ? 73.386  15.341  -8.558  1.00 76.25  ? 287 TYR B CD1 1 
ATOM   4629  C  CD2 . TYR B 2 257 ? 74.409  16.042  -10.598 1.00 72.83  ? 287 TYR B CD2 1 
ATOM   4630  C  CE1 . TYR B 2 257 ? 72.258  14.915  -9.265  1.00 75.80  ? 287 TYR B CE1 1 
ATOM   4631  C  CE2 . TYR B 2 257 ? 73.291  15.614  -11.314 1.00 72.96  ? 287 TYR B CE2 1 
ATOM   4632  C  CZ  . TYR B 2 257 ? 72.217  15.057  -10.642 1.00 80.98  ? 287 TYR B CZ  1 
ATOM   4633  O  OH  . TYR B 2 257 ? 71.125  14.625  -11.345 1.00 83.48  ? 287 TYR B OH  1 
ATOM   4634  N  N   . GLY B 2 258 ? 76.336  13.524  -6.103  1.00 69.25  ? 288 GLY B N   1 
ATOM   4635  C  CA  . GLY B 2 258 ? 76.792  12.147  -5.976  1.00 67.27  ? 288 GLY B CA  1 
ATOM   4636  C  C   . GLY B 2 258 ? 75.973  11.202  -6.803  1.00 68.44  ? 288 GLY B C   1 
ATOM   4637  O  O   . GLY B 2 258 ? 74.897  11.555  -7.285  1.00 68.56  ? 288 GLY B O   1 
ATOM   4638  N  N   . LEU B 2 259 ? 76.481  10.011  -6.984  1.00 64.23  ? 289 LEU B N   1 
ATOM   4639  C  CA  . LEU B 2 259 ? 75.867  8.979   -7.816  1.00 64.10  ? 289 LEU B CA  1 
ATOM   4640  C  C   . LEU B 2 259 ? 74.403  8.643   -7.446  1.00 70.28  ? 289 LEU B C   1 
ATOM   4641  O  O   . LEU B 2 259 ? 73.585  8.624   -8.372  1.00 70.43  ? 289 LEU B O   1 
ATOM   4642  C  CB  . LEU B 2 259 ? 76.740  7.730   -7.833  1.00 63.54  ? 289 LEU B CB  1 
ATOM   4643  C  CG  . LEU B 2 259 ? 76.468  6.706   -8.889  1.00 67.01  ? 289 LEU B CG  1 
ATOM   4644  C  CD1 . LEU B 2 259 ? 76.763  7.254   -10.268 1.00 66.69  ? 289 LEU B CD1 1 
ATOM   4645  C  CD2 . LEU B 2 259 ? 77.326  5.499   -8.641  1.00 68.50  ? 289 LEU B CD2 1 
ATOM   4646  N  N   . PRO B 2 260 ? 74.015  8.453   -6.150  1.00 67.25  ? 290 PRO B N   1 
ATOM   4647  C  CA  . PRO B 2 260 ? 72.599  8.137   -5.848  1.00 67.40  ? 290 PRO B CA  1 
ATOM   4648  C  C   . PRO B 2 260 ? 71.594  9.203   -6.298  1.00 71.33  ? 290 PRO B C   1 
ATOM   4649  O  O   . PRO B 2 260 ? 70.523  8.854   -6.816  1.00 71.92  ? 290 PRO B O   1 
ATOM   4650  C  CB  . PRO B 2 260 ? 72.596  7.925   -4.337  1.00 70.42  ? 290 PRO B CB  1 
ATOM   4651  C  CG  . PRO B 2 260 ? 74.003  7.562   -4.014  1.00 74.70  ? 290 PRO B CG  1 
ATOM   4652  C  CD  . PRO B 2 260 ? 74.821  8.432   -4.914  1.00 69.06  ? 290 PRO B CD  1 
ATOM   4653  N  N   . ALA B 2 261 ? 71.955  10.496  -6.154  1.00 66.23  ? 291 ALA B N   1 
ATOM   4654  C  CA  . ALA B 2 261 ? 71.119  11.602  -6.611  1.00 65.39  ? 291 ALA B CA  1 
ATOM   4655  C  C   . ALA B 2 261 ? 70.952  11.515  -8.134  1.00 68.53  ? 291 ALA B C   1 
ATOM   4656  O  O   . ALA B 2 261 ? 69.827  11.617  -8.634  1.00 69.45  ? 291 ALA B O   1 
ATOM   4657  C  CB  . ALA B 2 261 ? 71.762  12.920  -6.232  1.00 66.25  ? 291 ALA B CB  1 
ATOM   4658  N  N   . ARG B 2 262 ? 72.075  11.260  -8.862  1.00 62.06  ? 292 ARG B N   1 
ATOM   4659  C  CA  . ARG B 2 262 ? 72.098  11.130  -10.321 1.00 58.89  ? 292 ARG B CA  1 
ATOM   4660  C  C   . ARG B 2 262 ? 71.225  9.989   -10.786 1.00 60.44  ? 292 ARG B C   1 
ATOM   4661  O  O   . ARG B 2 262 ? 70.466  10.182  -11.735 1.00 61.84  ? 292 ARG B O   1 
ATOM   4662  C  CB  . ARG B 2 262 ? 73.524  10.952  -10.851 1.00 54.48  ? 292 ARG B CB  1 
ATOM   4663  C  CG  . ARG B 2 262 ? 74.331  12.219  -10.887 1.00 58.72  ? 292 ARG B CG  1 
ATOM   4664  C  CD  . ARG B 2 262 ? 75.786  11.893  -11.004 1.00 58.84  ? 292 ARG B CD  1 
ATOM   4665  N  NE  . ARG B 2 262 ? 76.629  13.044  -10.694 1.00 57.51  ? 292 ARG B NE  1 
ATOM   4666  C  CZ  . ARG B 2 262 ? 77.508  13.591  -11.536 1.00 74.17  ? 292 ARG B CZ  1 
ATOM   4667  N  NH1 . ARG B 2 262 ? 77.657  13.110  -12.763 1.00 55.90  ? 292 ARG B NH1 1 
ATOM   4668  N  NH2 . ARG B 2 262 ? 78.256  14.617  -11.148 1.00 62.32  ? 292 ARG B NH2 1 
ATOM   4669  N  N   . VAL B 2 263 ? 71.314  8.810   -10.126 1.00 52.73  ? 293 VAL B N   1 
ATOM   4670  C  CA  . VAL B 2 263 ? 70.505  7.653   -10.500 1.00 50.99  ? 293 VAL B CA  1 
ATOM   4671  C  C   . VAL B 2 263 ? 69.008  8.009   -10.326 1.00 59.42  ? 293 VAL B C   1 
ATOM   4672  O  O   . VAL B 2 263 ? 68.231  7.822   -11.268 1.00 60.18  ? 293 VAL B O   1 
ATOM   4673  C  CB  . VAL B 2 263 ? 70.913  6.338   -9.793  1.00 52.58  ? 293 VAL B CB  1 
ATOM   4674  C  CG1 . VAL B 2 263 ? 70.016  5.192   -10.225 1.00 51.59  ? 293 VAL B CG1 1 
ATOM   4675  C  CG2 . VAL B 2 263 ? 72.364  5.986   -10.083 1.00 50.89  ? 293 VAL B CG2 1 
ATOM   4676  N  N   . ARG B 2 264 ? 68.632  8.595   -9.162  1.00 56.69  ? 294 ARG B N   1 
ATOM   4677  C  CA  . ARG B 2 264 ? 67.271  9.022   -8.844  1.00 57.75  ? 294 ARG B CA  1 
ATOM   4678  C  C   . ARG B 2 264 ? 66.760  9.971   -9.932  1.00 63.50  ? 294 ARG B C   1 
ATOM   4679  O  O   . ARG B 2 264 ? 65.659  9.764   -10.466 1.00 63.99  ? 294 ARG B O   1 
ATOM   4680  C  CB  . ARG B 2 264 ? 67.262  9.683   -7.465  1.00 60.49  ? 294 ARG B CB  1 
ATOM   4681  C  CG  . ARG B 2 264 ? 65.952  10.388  -7.028  1.00 74.52  ? 294 ARG B CG  1 
ATOM   4682  C  CD  . ARG B 2 264 ? 66.198  11.481  -5.990  1.00 85.04  ? 294 ARG B CD  1 
ATOM   4683  N  NE  . ARG B 2 264 ? 67.188  12.437  -6.511  1.00 99.72  ? 294 ARG B NE  1 
ATOM   4684  C  CZ  . ARG B 2 264 ? 67.509  13.600  -5.956  1.00 116.98 ? 294 ARG B CZ  1 
ATOM   4685  N  NH1 . ARG B 2 264 ? 66.916  13.996  -4.832  1.00 115.54 ? 294 ARG B NH1 1 
ATOM   4686  N  NH2 . ARG B 2 264 ? 68.421  14.383  -6.523  1.00 87.15  ? 294 ARG B NH2 1 
ATOM   4687  N  N   . ASP B 2 265 ? 67.587  10.970  -10.299 1.00 61.66  ? 295 ASP B N   1 
ATOM   4688  C  CA  . ASP B 2 265 ? 67.245  11.948  -11.330 1.00 63.21  ? 295 ASP B CA  1 
ATOM   4689  C  C   . ASP B 2 265 ? 67.111  11.294  -12.714 1.00 67.44  ? 295 ASP B C   1 
ATOM   4690  O  O   . ASP B 2 265 ? 66.183  11.618  -13.466 1.00 68.68  ? 295 ASP B O   1 
ATOM   4691  C  CB  . ASP B 2 265 ? 68.222  13.126  -11.312 1.00 65.56  ? 295 ASP B CB  1 
ATOM   4692  C  CG  . ASP B 2 265 ? 68.071  14.017  -10.101 1.00 87.93  ? 295 ASP B CG  1 
ATOM   4693  O  OD1 . ASP B 2 265 ? 67.181  13.738  -9.259  1.00 90.81  ? 295 ASP B OD1 1 
ATOM   4694  O  OD2 . ASP B 2 265 ? 68.819  15.009  -10.001 1.00 100.20 ? 295 ASP B OD2 1 
ATOM   4695  N  N   . GLY B 2 266 ? 67.977  10.324  -12.988 1.00 60.43  ? 296 GLY B N   1 
ATOM   4696  C  CA  . GLY B 2 266 ? 67.910  9.541   -14.207 1.00 58.29  ? 296 GLY B CA  1 
ATOM   4697  C  C   . GLY B 2 266 ? 66.598  8.777   -14.282 1.00 60.87  ? 296 GLY B C   1 
ATOM   4698  O  O   . GLY B 2 266 ? 65.916  8.837   -15.310 1.00 61.26  ? 296 GLY B O   1 
ATOM   4699  N  N   . ILE B 2 267 ? 66.198  8.103   -13.166 1.00 55.18  ? 297 ILE B N   1 
ATOM   4700  C  CA  . ILE B 2 267 ? 64.938  7.345   -13.088 1.00 54.83  ? 297 ILE B CA  1 
ATOM   4701  C  C   . ILE B 2 267 ? 63.734  8.278   -13.233 1.00 59.70  ? 297 ILE B C   1 
ATOM   4702  O  O   . ILE B 2 267 ? 62.763  7.921   -13.909 1.00 57.85  ? 297 ILE B O   1 
ATOM   4703  C  CB  . ILE B 2 267 ? 64.833  6.460   -11.826 1.00 57.49  ? 297 ILE B CB  1 
ATOM   4704  C  CG1 . ILE B 2 267 ? 66.030  5.502   -11.734 1.00 55.63  ? 297 ILE B CG1 1 
ATOM   4705  C  CG2 . ILE B 2 267 ? 63.487  5.687   -11.813 1.00 57.98  ? 297 ILE B CG2 1 
ATOM   4706  C  CD1 . ILE B 2 267 ? 66.271  4.969   -10.349 1.00 56.14  ? 297 ILE B CD1 1 
ATOM   4707  N  N   . ALA B 2 268 ? 63.834  9.485   -12.629 1.00 58.01  ? 298 ALA B N   1 
ATOM   4708  C  CA  . ALA B 2 268 ? 62.808  10.529  -12.700 1.00 59.95  ? 298 ALA B CA  1 
ATOM   4709  C  C   . ALA B 2 268 ? 62.553  10.992  -14.126 1.00 62.39  ? 298 ALA B C   1 
ATOM   4710  O  O   . ALA B 2 268 ? 61.394  11.142  -14.506 1.00 61.54  ? 298 ALA B O   1 
ATOM   4711  C  CB  . ALA B 2 268 ? 63.233  11.724  -11.867 1.00 61.62  ? 298 ALA B CB  1 
ATOM   4712  N  N   . ILE B 2 269 ? 63.644  11.220  -14.911 1.00 57.51  ? 299 ILE B N   1 
ATOM   4713  C  CA  . ILE B 2 269 ? 63.586  11.696  -16.291 1.00 55.64  ? 299 ILE B CA  1 
ATOM   4714  C  C   . ILE B 2 269 ? 62.802  10.725  -17.170 1.00 59.28  ? 299 ILE B C   1 
ATOM   4715  O  O   . ILE B 2 269 ? 61.825  11.149  -17.808 1.00 59.57  ? 299 ILE B O   1 
ATOM   4716  C  CB  . ILE B 2 269 ? 64.992  12.042  -16.846 1.00 56.15  ? 299 ILE B CB  1 
ATOM   4717  C  CG1 . ILE B 2 269 ? 65.565  13.297  -16.148 1.00 55.93  ? 299 ILE B CG1 1 
ATOM   4718  C  CG2 . ILE B 2 269 ? 64.956  12.243  -18.371 1.00 56.60  ? 299 ILE B CG2 1 
ATOM   4719  C  CD1 . ILE B 2 269 ? 67.120  13.332  -15.980 1.00 50.58  ? 299 ILE B CD1 1 
ATOM   4720  N  N   . ILE B 2 270 ? 63.203  9.427   -17.164 1.00 53.54  ? 300 ILE B N   1 
ATOM   4721  C  CA  . ILE B 2 270 ? 62.564  8.389   -17.976 1.00 52.53  ? 300 ILE B CA  1 
ATOM   4722  C  C   . ILE B 2 270 ? 61.090  8.216   -17.588 1.00 60.19  ? 300 ILE B C   1 
ATOM   4723  O  O   . ILE B 2 270 ? 60.233  8.225   -18.464 1.00 61.90  ? 300 ILE B O   1 
ATOM   4724  C  CB  . ILE B 2 270 ? 63.366  7.074   -17.964 1.00 53.65  ? 300 ILE B CB  1 
ATOM   4725  C  CG1 . ILE B 2 270 ? 64.795  7.311   -18.536 1.00 52.44  ? 300 ILE B CG1 1 
ATOM   4726  C  CG2 . ILE B 2 270 ? 62.627  5.974   -18.734 1.00 53.04  ? 300 ILE B CG2 1 
ATOM   4727  C  CD1 . ILE B 2 270 ? 65.815  6.209   -18.276 1.00 55.22  ? 300 ILE B CD1 1 
ATOM   4728  N  N   . THR B 2 271 ? 60.794  8.146   -16.288 1.00 57.67  ? 301 THR B N   1 
ATOM   4729  C  CA  . THR B 2 271 ? 59.437  7.992   -15.770 1.00 59.16  ? 301 THR B CA  1 
ATOM   4730  C  C   . THR B 2 271 ? 58.544  9.191   -16.155 1.00 64.85  ? 301 THR B C   1 
ATOM   4731  O  O   . THR B 2 271 ? 57.447  8.963   -16.686 1.00 66.29  ? 301 THR B O   1 
ATOM   4732  C  CB  . THR B 2 271 ? 59.465  7.683   -14.259 1.00 65.62  ? 301 THR B CB  1 
ATOM   4733  O  OG1 . THR B 2 271 ? 60.300  6.558   -14.055 1.00 61.88  ? 301 THR B OG1 1 
ATOM   4734  C  CG2 . THR B 2 271 ? 58.098  7.338   -13.703 1.00 68.97  ? 301 THR B CG2 1 
ATOM   4735  N  N   . THR B 2 272 ? 59.012  10.449  -15.928 1.00 60.83  ? 302 THR B N   1 
ATOM   4736  C  CA  . THR B 2 272 ? 58.254  11.662  -16.276 1.00 62.10  ? 302 THR B CA  1 
ATOM   4737  C  C   . THR B 2 272 ? 57.964  11.707  -17.775 1.00 67.74  ? 302 THR B C   1 
ATOM   4738  O  O   . THR B 2 272 ? 56.808  11.876  -18.157 1.00 68.74  ? 302 THR B O   1 
ATOM   4739  C  CB  . THR B 2 272 ? 59.015  12.901  -15.883 1.00 66.11  ? 302 THR B CB  1 
ATOM   4740  O  OG1 . THR B 2 272 ? 59.180  12.909  -14.476 1.00 68.80  ? 302 THR B OG1 1 
ATOM   4741  C  CG2 . THR B 2 272 ? 58.327  14.167  -16.340 1.00 65.66  ? 302 THR B CG2 1 
ATOM   4742  N  N   . ALA B 2 273 ? 59.021  11.531  -18.614 1.00 62.25  ? 303 ALA B N   1 
ATOM   4743  C  CA  . ALA B 2 273 ? 58.936  11.524  -20.062 1.00 60.49  ? 303 ALA B CA  1 
ATOM   4744  C  C   . ALA B 2 273 ? 57.866  10.539  -20.510 1.00 65.18  ? 303 ALA B C   1 
ATOM   4745  O  O   . ALA B 2 273 ? 56.982  10.935  -21.269 1.00 66.03  ? 303 ALA B O   1 
ATOM   4746  C  CB  . ALA B 2 273 ? 60.281  11.159  -20.662 1.00 58.97  ? 303 ALA B CB  1 
ATOM   4747  N  N   . ALA B 2 274 ? 57.904  9.282   -19.994 1.00 61.71  ? 304 ALA B N   1 
ATOM   4748  C  CA  . ALA B 2 274 ? 56.928  8.228   -20.309 1.00 62.64  ? 304 ALA B CA  1 
ATOM   4749  C  C   . ALA B 2 274 ? 55.511  8.623   -19.853 1.00 71.87  ? 304 ALA B C   1 
ATOM   4750  O  O   . ALA B 2 274 ? 54.579  8.529   -20.656 1.00 73.78  ? 304 ALA B O   1 
ATOM   4751  C  CB  . ALA B 2 274 ? 57.344  6.911   -19.676 1.00 62.64  ? 304 ALA B CB  1 
ATOM   4752  N  N   . SER B 2 275 ? 55.353  9.114   -18.591 1.00 68.47  ? 305 SER B N   1 
ATOM   4753  C  CA  . SER B 2 275 ? 54.062  9.561   -18.071 1.00 70.11  ? 305 SER B CA  1 
ATOM   4754  C  C   . SER B 2 275 ? 53.461  10.659  -18.977 1.00 74.21  ? 305 SER B C   1 
ATOM   4755  O  O   . SER B 2 275 ? 52.281  10.593  -19.311 1.00 76.52  ? 305 SER B O   1 
ATOM   4756  C  CB  . SER B 2 275 ? 54.196  10.032  -16.620 1.00 74.34  ? 305 SER B CB  1 
ATOM   4757  O  OG  . SER B 2 275 ? 53.270  11.048  -16.255 1.00 84.17  ? 305 SER B OG  1 
ATOM   4758  N  N   . ASP B 2 276 ? 54.291  11.605  -19.432 1.00 68.97  ? 306 ASP B N   1 
ATOM   4759  C  CA  . ASP B 2 276 ? 53.875  12.721  -20.277 1.00 70.17  ? 306 ASP B CA  1 
ATOM   4760  C  C   . ASP B 2 276 ? 53.364  12.278  -21.650 1.00 75.90  ? 306 ASP B C   1 
ATOM   4761  O  O   . ASP B 2 276 ? 52.255  12.657  -22.039 1.00 77.27  ? 306 ASP B O   1 
ATOM   4762  C  CB  . ASP B 2 276 ? 54.991  13.770  -20.390 1.00 71.00  ? 306 ASP B CB  1 
ATOM   4763  C  CG  . ASP B 2 276 ? 55.413  14.424  -19.072 1.00 87.98  ? 306 ASP B CG  1 
ATOM   4764  O  OD1 . ASP B 2 276 ? 54.604  14.392  -18.091 1.00 90.27  ? 306 ASP B OD1 1 
ATOM   4765  O  OD2 . ASP B 2 276 ? 56.555  14.960  -19.011 1.00 94.09  ? 306 ASP B OD2 1 
ATOM   4766  N  N   . MET B 2 277 ? 54.135  11.429  -22.346 1.00 71.80  ? 307 MET B N   1 
ATOM   4767  C  CA  . MET B 2 277 ? 53.776  10.881  -23.653 1.00 71.60  ? 307 MET B CA  1 
ATOM   4768  C  C   . MET B 2 277 ? 52.485  10.076  -23.569 1.00 77.23  ? 307 MET B C   1 
ATOM   4769  O  O   . MET B 2 277 ? 51.665  10.171  -24.478 1.00 79.67  ? 307 MET B O   1 
ATOM   4770  C  CB  . MET B 2 277 ? 54.906  10.007  -24.198 1.00 71.84  ? 307 MET B CB  1 
ATOM   4771  C  CG  . MET B 2 277 ? 54.712  9.662   -25.637 1.00 75.85  ? 307 MET B CG  1 
ATOM   4772  S  SD  . MET B 2 277 ? 56.000  8.575   -26.225 1.00 78.03  ? 307 MET B SD  1 
ATOM   4773  C  CE  . MET B 2 277 ? 55.216  7.899   -27.589 1.00 74.62  ? 307 MET B CE  1 
ATOM   4774  N  N   . LEU B 2 278 ? 52.297  9.307   -22.467 1.00 71.66  ? 308 LEU B N   1 
ATOM   4775  C  CA  . LEU B 2 278 ? 51.108  8.482   -22.186 1.00 70.98  ? 308 LEU B CA  1 
ATOM   4776  C  C   . LEU B 2 278 ? 49.904  9.362   -21.924 1.00 77.97  ? 308 LEU B C   1 
ATOM   4777  O  O   . LEU B 2 278 ? 48.863  9.160   -22.545 1.00 77.77  ? 308 LEU B O   1 
ATOM   4778  C  CB  . LEU B 2 278 ? 51.397  7.584   -20.961 1.00 69.33  ? 308 LEU B CB  1 
ATOM   4779  C  CG  . LEU B 2 278 ? 50.565  6.345   -20.663 1.00 72.12  ? 308 LEU B CG  1 
ATOM   4780  C  CD1 . LEU B 2 278 ? 49.687  6.550   -19.516 1.00 73.88  ? 308 LEU B CD1 1 
ATOM   4781  C  CD2 . LEU B 2 278 ? 49.946  5.703   -21.888 1.00 72.44  ? 308 LEU B CD2 1 
ATOM   4782  N  N   . SER B 2 279 ? 50.050  10.365  -21.029 1.00 78.33  ? 309 SER B N   1 
ATOM   4783  C  CA  . SER B 2 279 ? 48.948  11.259  -20.657 1.00 82.21  ? 309 SER B CA  1 
ATOM   4784  C  C   . SER B 2 279 ? 48.672  12.346  -21.729 1.00 88.01  ? 309 SER B C   1 
ATOM   4785  O  O   . SER B 2 279 ? 47.950  13.317  -21.456 1.00 90.28  ? 309 SER B O   1 
ATOM   4786  C  CB  . SER B 2 279 ? 49.159  11.841  -19.253 1.00 87.21  ? 309 SER B CB  1 
ATOM   4787  O  OG  . SER B 2 279 ? 50.105  12.895  -19.187 1.00 95.56  ? 309 SER B OG  1 
ATOM   4788  N  N   . GLU B 2 280 ? 49.190  12.132  -22.970 1.00 81.93  ? 310 GLU B N   1 
ATOM   4789  C  CA  . GLU B 2 280 ? 49.012  13.047  -24.098 1.00 81.08  ? 310 GLU B CA  1 
ATOM   4790  C  C   . GLU B 2 280 ? 48.702  12.343  -25.383 1.00 81.02  ? 310 GLU B C   1 
ATOM   4791  O  O   . GLU B 2 280 ? 47.914  12.854  -26.173 1.00 82.47  ? 310 GLU B O   1 
ATOM   4792  C  CB  . GLU B 2 280 ? 50.239  13.928  -24.283 1.00 81.06  ? 310 GLU B CB  1 
ATOM   4793  C  CG  . GLU B 2 280 ? 49.887  15.381  -24.512 1.00 98.17  ? 310 GLU B CG  1 
ATOM   4794  C  CD  . GLU B 2 280 ? 50.327  15.903  -25.861 1.00 129.95 ? 310 GLU B CD  1 
ATOM   4795  O  OE1 . GLU B 2 280 ? 51.532  16.221  -26.014 1.00 120.07 ? 310 GLU B OE1 1 
ATOM   4796  O  OE2 . GLU B 2 280 ? 49.459  16.008  -26.760 1.00 130.33 ? 310 GLU B OE2 1 
ATOM   4797  N  N   . HIS B 2 281 ? 49.312  11.182  -25.602 1.00 74.59  ? 311 HIS B N   1 
ATOM   4798  C  CA  . HIS B 2 281 ? 49.134  10.413  -26.827 1.00 74.25  ? 311 HIS B CA  1 
ATOM   4799  C  C   . HIS B 2 281 ? 48.418  9.086   -26.635 1.00 79.00  ? 311 HIS B C   1 
ATOM   4800  O  O   . HIS B 2 281 ? 48.185  8.369   -27.619 1.00 79.12  ? 311 HIS B O   1 
ATOM   4801  C  CB  . HIS B 2 281 ? 50.479  10.218  -27.528 1.00 72.51  ? 311 HIS B CB  1 
ATOM   4802  C  CG  . HIS B 2 281 ? 51.007  11.480  -28.105 1.00 75.85  ? 311 HIS B CG  1 
ATOM   4803  N  ND1 . HIS B 2 281 ? 52.128  12.092  -27.586 1.00 76.41  ? 311 HIS B ND1 1 
ATOM   4804  C  CD2 . HIS B 2 281 ? 50.516  12.235  -29.113 1.00 78.91  ? 311 HIS B CD2 1 
ATOM   4805  C  CE1 . HIS B 2 281 ? 52.305  13.182  -28.315 1.00 76.21  ? 311 HIS B CE1 1 
ATOM   4806  N  NE2 . HIS B 2 281 ? 51.353  13.316  -29.233 1.00 78.15  ? 311 HIS B NE2 1 
ATOM   4807  N  N   . SER B 2 282 ? 48.052  8.770   -25.374 1.00 75.60  ? 312 SER B N   1 
ATOM   4808  C  CA  . SER B 2 282 ? 47.359  7.544   -24.965 1.00 75.85  ? 312 SER B CA  1 
ATOM   4809  C  C   . SER B 2 282 ? 48.188  6.278   -25.291 1.00 75.95  ? 312 SER B C   1 
ATOM   4810  O  O   . SER B 2 282 ? 47.637  5.194   -25.484 1.00 75.55  ? 312 SER B O   1 
ATOM   4811  C  CB  . SER B 2 282 ? 45.941  7.499   -25.537 1.00 82.46  ? 312 SER B CB  1 
ATOM   4812  O  OG  . SER B 2 282 ? 45.215  8.673   -25.204 1.00 95.10  ? 312 SER B OG  1 
ATOM   4813  N  N   . PHE B 2 283 ? 49.528  6.438   -25.324 1.00 69.76  ? 313 PHE B N   1 
ATOM   4814  C  CA  . PHE B 2 283 ? 50.498  5.387   -25.610 1.00 67.51  ? 313 PHE B CA  1 
ATOM   4815  C  C   . PHE B 2 283 ? 51.927  5.824   -25.306 1.00 72.51  ? 313 PHE B C   1 
ATOM   4816  O  O   . PHE B 2 283 ? 52.220  7.021   -25.221 1.00 72.59  ? 313 PHE B O   1 
ATOM   4817  C  CB  . PHE B 2 283 ? 50.386  4.874   -27.062 1.00 68.17  ? 313 PHE B CB  1 
ATOM   4818  C  CG  . PHE B 2 283 ? 51.134  5.668   -28.107 1.00 67.31  ? 313 PHE B CG  1 
ATOM   4819  C  CD1 . PHE B 2 283 ? 50.549  6.762   -28.723 1.00 70.26  ? 313 PHE B CD1 1 
ATOM   4820  C  CD2 . PHE B 2 283 ? 52.407  5.290   -28.510 1.00 67.06  ? 313 PHE B CD2 1 
ATOM   4821  C  CE1 . PHE B 2 283 ? 51.233  7.483   -29.707 1.00 69.46  ? 313 PHE B CE1 1 
ATOM   4822  C  CE2 . PHE B 2 283 ? 53.086  6.006   -29.500 1.00 68.08  ? 313 PHE B CE2 1 
ATOM   4823  C  CZ  . PHE B 2 283 ? 52.492  7.101   -30.090 1.00 66.41  ? 313 PHE B CZ  1 
ATOM   4824  N  N   . ILE B 2 284 ? 52.818  4.829   -25.171 1.00 68.69  ? 314 ILE B N   1 
ATOM   4825  C  CA  . ILE B 2 284 ? 54.260  4.967   -24.952 1.00 66.00  ? 314 ILE B CA  1 
ATOM   4826  C  C   . ILE B 2 284 ? 54.966  4.074   -25.983 1.00 72.06  ? 314 ILE B C   1 
ATOM   4827  O  O   . ILE B 2 284 ? 54.319  3.204   -26.583 1.00 72.43  ? 314 ILE B O   1 
ATOM   4828  C  CB  . ILE B 2 284 ? 54.713  4.681   -23.488 1.00 67.89  ? 314 ILE B CB  1 
ATOM   4829  C  CG1 . ILE B 2 284 ? 54.227  3.305   -22.975 1.00 68.60  ? 314 ILE B CG1 1 
ATOM   4830  C  CG2 . ILE B 2 284 ? 54.306  5.820   -22.561 1.00 68.92  ? 314 ILE B CG2 1 
ATOM   4831  C  CD1 . ILE B 2 284 ? 54.962  2.736   -21.775 1.00 67.51  ? 314 ILE B CD1 1 
ATOM   4832  N  N   . PRO B 2 285 ? 56.266  4.271   -26.275 1.00 69.76  ? 315 PRO B N   1 
ATOM   4833  C  CA  . PRO B 2 285 ? 56.899  3.394   -27.266 1.00 68.36  ? 315 PRO B CA  1 
ATOM   4834  C  C   . PRO B 2 285 ? 57.144  2.021   -26.672 1.00 72.00  ? 315 PRO B C   1 
ATOM   4835  O  O   . PRO B 2 285 ? 57.483  1.896   -25.495 1.00 70.72  ? 315 PRO B O   1 
ATOM   4836  C  CB  . PRO B 2 285 ? 58.188  4.130   -27.634 1.00 68.18  ? 315 PRO B CB  1 
ATOM   4837  C  CG  . PRO B 2 285 ? 58.146  5.452   -26.879 1.00 73.46  ? 315 PRO B CG  1 
ATOM   4838  C  CD  . PRO B 2 285 ? 57.244  5.231   -25.721 1.00 70.60  ? 315 PRO B CD  1 
ATOM   4839  N  N   . GLU B 2 286 ? 56.888  0.992   -27.464 1.00 69.99  ? 316 GLU B N   1 
ATOM   4840  C  CA  . GLU B 2 286 ? 57.084  -0.363  -27.001 1.00 70.08  ? 316 GLU B CA  1 
ATOM   4841  C  C   . GLU B 2 286 ? 58.546  -0.770  -26.926 1.00 73.95  ? 316 GLU B C   1 
ATOM   4842  O  O   . GLU B 2 286 ? 59.236  -0.764  -27.943 1.00 71.84  ? 316 GLU B O   1 
ATOM   4843  C  CB  . GLU B 2 286 ? 56.288  -1.360  -27.827 1.00 72.10  ? 316 GLU B CB  1 
ATOM   4844  C  CG  . GLU B 2 286 ? 56.216  -2.716  -27.167 1.00 78.89  ? 316 GLU B CG  1 
ATOM   4845  C  CD  . GLU B 2 286 ? 55.674  -3.822  -28.035 1.00 96.78  ? 316 GLU B CD  1 
ATOM   4846  O  OE1 . GLU B 2 286 ? 55.815  -3.743  -29.276 1.00 71.68  ? 316 GLU B OE1 1 
ATOM   4847  O  OE2 . GLU B 2 286 ? 55.139  -4.796  -27.461 1.00 107.02 ? 316 GLU B OE2 1 
ATOM   4848  N  N   . PRO B 2 287 ? 59.013  -1.170  -25.723 1.00 72.80  ? 317 PRO B N   1 
ATOM   4849  C  CA  . PRO B 2 287 ? 60.377  -1.678  -25.603 1.00 71.47  ? 317 PRO B CA  1 
ATOM   4850  C  C   . PRO B 2 287 ? 60.541  -2.945  -26.435 1.00 75.07  ? 317 PRO B C   1 
ATOM   4851  O  O   . PRO B 2 287 ? 59.942  -3.987  -26.173 1.00 74.35  ? 317 PRO B O   1 
ATOM   4852  C  CB  . PRO B 2 287 ? 60.518  -1.958  -24.099 1.00 74.05  ? 317 PRO B CB  1 
ATOM   4853  C  CG  . PRO B 2 287 ? 59.405  -1.203  -23.436 1.00 79.85  ? 317 PRO B CG  1 
ATOM   4854  C  CD  . PRO B 2 287 ? 58.303  -1.262  -24.427 1.00 76.43  ? 317 PRO B CD  1 
ATOM   4855  N  N   . LYS B 2 288 ? 61.273  -2.779  -27.516 1.00 73.13  ? 318 LYS B N   1 
ATOM   4856  C  CA  . LYS B 2 288 ? 61.694  -3.767  -28.495 1.00 74.12  ? 318 LYS B CA  1 
ATOM   4857  C  C   . LYS B 2 288 ? 62.578  -4.775  -27.749 1.00 78.30  ? 318 LYS B C   1 
ATOM   4858  O  O   . LYS B 2 288 ? 63.467  -4.392  -26.972 1.00 76.12  ? 318 LYS B O   1 
ATOM   4859  C  CB  . LYS B 2 288 ? 62.465  -3.067  -29.642 1.00 77.73  ? 318 LYS B CB  1 
ATOM   4860  C  CG  . LYS B 2 288 ? 63.544  -2.003  -29.219 1.00 95.03  ? 318 LYS B CG  1 
ATOM   4861  C  CD  . LYS B 2 288 ? 62.964  -0.609  -28.849 1.00 102.22 ? 318 LYS B CD  1 
ATOM   4862  C  CE  . LYS B 2 288 ? 63.372  -0.193  -27.461 1.00 111.12 ? 318 LYS B CE  1 
ATOM   4863  N  NZ  . LYS B 2 288 ? 62.747  1.089   -27.052 1.00 120.92 ? 318 LYS B NZ  1 
ATOM   4864  N  N   . SER B 2 289 ? 62.261  -6.058  -27.920 1.00 77.24  ? 319 SER B N   1 
ATOM   4865  C  CA  . SER B 2 289 ? 62.913  -7.150  -27.206 1.00 77.68  ? 319 SER B CA  1 
ATOM   4866  C  C   . SER B 2 289 ? 64.102  -7.729  -27.941 1.00 80.47  ? 319 SER B C   1 
ATOM   4867  O  O   . SER B 2 289 ? 64.610  -8.776  -27.528 1.00 81.88  ? 319 SER B O   1 
ATOM   4868  C  CB  . SER B 2 289 ? 61.896  -8.238  -26.851 1.00 84.32  ? 319 SER B CB  1 
ATOM   4869  O  OG  . SER B 2 289 ? 61.287  -8.771  -28.018 1.00 97.55  ? 319 SER B OG  1 
ATOM   4870  N  N   . SER B 2 290 ? 64.567  -7.062  -29.015 1.00 74.29  ? 320 SER B N   1 
ATOM   4871  C  CA  . SER B 2 290 ? 65.720  -7.545  -29.775 1.00 72.81  ? 320 SER B CA  1 
ATOM   4872  C  C   . SER B 2 290 ? 66.561  -6.440  -30.386 1.00 78.38  ? 320 SER B C   1 
ATOM   4873  O  O   . SER B 2 290 ? 66.040  -5.374  -30.749 1.00 79.29  ? 320 SER B O   1 
ATOM   4874  C  CB  . SER B 2 290 ? 65.288  -8.517  -30.867 1.00 73.54  ? 320 SER B CB  1 
ATOM   4875  O  OG  . SER B 2 290 ? 66.377  -9.346  -31.233 1.00 77.13  ? 320 SER B OG  1 
ATOM   4876  N  N   . CYS B 2 291 ? 67.874  -6.716  -30.506 1.00 73.45  ? 321 CYS B N   1 
ATOM   4877  C  CA  . CYS B 2 291 ? 68.849  -5.861  -31.155 1.00 71.32  ? 321 CYS B CA  1 
ATOM   4878  C  C   . CYS B 2 291 ? 69.090  -6.448  -32.543 1.00 78.77  ? 321 CYS B C   1 
ATOM   4879  O  O   . CYS B 2 291 ? 69.720  -5.819  -33.385 1.00 78.68  ? 321 CYS B O   1 
ATOM   4880  C  CB  . CYS B 2 291 ? 70.139  -5.863  -30.353 1.00 70.30  ? 321 CYS B CB  1 
ATOM   4881  S  SG  . CYS B 2 291 ? 70.076  -4.927  -28.802 1.00 73.67  ? 321 CYS B SG  1 
ATOM   4882  N  N   . TYR B 2 292 ? 68.608  -7.668  -32.770 1.00 78.80  ? 322 TYR B N   1 
ATOM   4883  C  CA  . TYR B 2 292 ? 68.848  -8.444  -33.976 1.00 80.74  ? 322 TYR B CA  1 
ATOM   4884  C  C   . TYR B 2 292 ? 67.688  -8.373  -34.985 1.00 88.84  ? 322 TYR B C   1 
ATOM   4885  O  O   . TYR B 2 292 ? 67.731  -9.040  -36.029 1.00 89.76  ? 322 TYR B O   1 
ATOM   4886  C  CB  . TYR B 2 292 ? 69.214  -9.880  -33.545 1.00 84.04  ? 322 TYR B CB  1 
ATOM   4887  C  CG  . TYR B 2 292 ? 70.136  -9.866  -32.333 1.00 88.93  ? 322 TYR B CG  1 
ATOM   4888  C  CD1 . TYR B 2 292 ? 71.371  -9.199  -32.371 1.00 90.53  ? 322 TYR B CD1 1 
ATOM   4889  C  CD2 . TYR B 2 292 ? 69.731  -10.415 -31.117 1.00 91.08  ? 322 TYR B CD2 1 
ATOM   4890  C  CE1 . TYR B 2 292 ? 72.186  -9.106  -31.238 1.00 89.62  ? 322 TYR B CE1 1 
ATOM   4891  C  CE2 . TYR B 2 292 ? 70.547  -10.338 -29.980 1.00 91.99  ? 322 TYR B CE2 1 
ATOM   4892  C  CZ  . TYR B 2 292 ? 71.776  -9.689  -30.049 1.00 96.58  ? 322 TYR B CZ  1 
ATOM   4893  O  OH  . TYR B 2 292 ? 72.592  -9.628  -28.945 1.00 94.24  ? 322 TYR B OH  1 
ATOM   4894  N  N   . ASN B 2 293 ? 66.705  -7.482  -34.713 1.00 86.51  ? 323 ASN B N   1 
ATOM   4895  C  CA  . ASN B 2 293 ? 65.516  -7.251  -35.535 1.00 86.80  ? 323 ASN B CA  1 
ATOM   4896  C  C   . ASN B 2 293 ? 65.377  -5.762  -35.908 1.00 90.51  ? 323 ASN B C   1 
ATOM   4897  O  O   . ASN B 2 293 ? 64.471  -5.419  -36.667 1.00 90.86  ? 323 ASN B O   1 
ATOM   4898  C  CB  . ASN B 2 293 ? 64.263  -7.731  -34.784 1.00 86.03  ? 323 ASN B CB  1 
ATOM   4899  N  N   . THR B 2 294 ? 66.273  -4.883  -35.380 1.00 85.99  ? 324 THR B N   1 
ATOM   4900  C  CA  . THR B 2 294 ? 66.262  -3.413  -35.579 1.00 85.18  ? 324 THR B CA  1 
ATOM   4901  C  C   . THR B 2 294 ? 65.916  -2.985  -37.016 1.00 90.00  ? 324 THR B C   1 
ATOM   4902  O  O   . THR B 2 294 ? 65.087  -2.091  -37.189 1.00 91.51  ? 324 THR B O   1 
ATOM   4903  C  CB  . THR B 2 294 ? 67.564  -2.715  -35.093 1.00 84.31  ? 324 THR B CB  1 
ATOM   4904  O  OG1 . THR B 2 294 ? 68.688  -3.224  -35.790 1.00 83.81  ? 324 THR B OG1 1 
ATOM   4905  C  CG2 . THR B 2 294 ? 67.795  -2.844  -33.602 1.00 79.04  ? 324 THR B CG2 1 
ATOM   4906  N  N   . HIS B 2 295 ? 66.512  -3.649  -38.026 1.00 85.03  ? 325 HIS B N   1 
ATOM   4907  C  CA  . HIS B 2 295 ? 66.323  -3.398  -39.462 1.00 84.43  ? 325 HIS B CA  1 
ATOM   4908  C  C   . HIS B 2 295 ? 64.868  -3.565  -39.939 1.00 87.23  ? 325 HIS B C   1 
ATOM   4909  O  O   . HIS B 2 295 ? 64.343  -2.699  -40.647 1.00 86.01  ? 325 HIS B O   1 
ATOM   4910  C  CB  . HIS B 2 295 ? 67.277  -4.292  -40.274 1.00 85.04  ? 325 HIS B CB  1 
ATOM   4911  C  CG  . HIS B 2 295 ? 67.157  -5.755  -39.976 1.00 88.87  ? 325 HIS B CG  1 
ATOM   4912  N  ND1 . HIS B 2 295 ? 67.514  -6.272  -38.742 1.00 90.32  ? 325 HIS B ND1 1 
ATOM   4913  C  CD2 . HIS B 2 295 ? 66.732  -6.765  -40.769 1.00 91.45  ? 325 HIS B CD2 1 
ATOM   4914  C  CE1 . HIS B 2 295 ? 67.299  -7.573  -38.826 1.00 90.63  ? 325 HIS B CE1 1 
ATOM   4915  N  NE2 . HIS B 2 295 ? 66.828  -7.915  -40.028 1.00 91.73  ? 325 HIS B NE2 1 
ATOM   4916  N  N   . GLU B 2 296 ? 64.220  -4.656  -39.455 1.00 84.20  ? 326 GLU B N   1 
ATOM   4917  C  CA  . GLU B 2 296 ? 62.844  -5.090  -39.735 1.00 84.81  ? 326 GLU B CA  1 
ATOM   4918  C  C   . GLU B 2 296 ? 61.796  -4.135  -39.202 1.00 85.67  ? 326 GLU B C   1 
ATOM   4919  O  O   . GLU B 2 296 ? 60.860  -3.773  -39.927 1.00 86.66  ? 326 GLU B O   1 
ATOM   4920  C  CB  . GLU B 2 296 ? 62.560  -6.486  -39.121 1.00 87.05  ? 326 GLU B CB  1 
ATOM   4921  C  CG  . GLU B 2 296 ? 63.345  -7.655  -39.698 1.00 100.65 ? 326 GLU B CG  1 
ATOM   4922  C  CD  . GLU B 2 296 ? 63.293  -8.909  -38.841 1.00 130.68 ? 326 GLU B CD  1 
ATOM   4923  O  OE1 . GLU B 2 296 ? 62.209  -9.535  -38.760 1.00 129.66 ? 326 GLU B OE1 1 
ATOM   4924  O  OE2 . GLU B 2 296 ? 64.338  -9.265  -38.248 1.00 125.93 ? 326 GLU B OE2 1 
ATOM   4925  N  N   . LYS B 2 297 ? 61.924  -3.753  -37.934 1.00 78.33  ? 327 LYS B N   1 
ATOM   4926  C  CA  . LYS B 2 297 ? 60.891  -2.967  -37.302 1.00 77.71  ? 327 LYS B CA  1 
ATOM   4927  C  C   . LYS B 2 297 ? 61.191  -1.466  -37.148 1.00 77.76  ? 327 LYS B C   1 
ATOM   4928  O  O   . LYS B 2 297 ? 60.578  -0.846  -36.301 1.00 78.41  ? 327 LYS B O   1 
ATOM   4929  C  CB  . LYS B 2 297 ? 60.541  -3.618  -35.950 1.00 80.79  ? 327 LYS B CB  1 
ATOM   4930  C  CG  . LYS B 2 297 ? 59.820  -4.962  -36.116 1.00 98.95  ? 327 LYS B CG  1 
ATOM   4931  C  CD  . LYS B 2 297 ? 59.463  -5.642  -34.790 1.00 109.30 ? 327 LYS B CD  1 
ATOM   4932  C  CE  . LYS B 2 297 ? 58.848  -7.015  -34.990 1.00 118.54 ? 327 LYS B CE  1 
ATOM   4933  N  NZ  . LYS B 2 297 ? 58.432  -7.642  -33.700 1.00 125.26 ? 327 LYS B NZ  1 
ATOM   4934  N  N   . ARG B 2 298 ? 62.018  -0.849  -37.988 1.00 71.78  ? 328 ARG B N   1 
ATOM   4935  C  CA  . ARG B 2 298 ? 62.275  0.584   -37.818 1.00 70.98  ? 328 ARG B CA  1 
ATOM   4936  C  C   . ARG B 2 298 ? 61.117  1.502   -38.277 1.00 72.97  ? 328 ARG B C   1 
ATOM   4937  O  O   . ARG B 2 298 ? 60.956  2.575   -37.680 1.00 71.80  ? 328 ARG B O   1 
ATOM   4938  C  CB  . ARG B 2 298 ? 63.602  1.017   -38.454 1.00 72.78  ? 328 ARG B CB  1 
ATOM   4939  C  CG  . ARG B 2 298 ? 64.247  2.152   -37.645 1.00 96.25  ? 328 ARG B CG  1 
ATOM   4940  C  CD  . ARG B 2 298 ? 65.701  2.434   -37.981 1.00 120.58 ? 328 ARG B CD  1 
ATOM   4941  N  NE  . ARG B 2 298 ? 66.601  1.392   -37.473 1.00 136.92 ? 328 ARG B NE  1 
ATOM   4942  C  CZ  . ARG B 2 298 ? 67.552  1.581   -36.564 1.00 143.07 ? 328 ARG B CZ  1 
ATOM   4943  N  NH1 . ARG B 2 298 ? 67.754  2.789   -36.040 1.00 114.25 ? 328 ARG B NH1 1 
ATOM   4944  N  NH2 . ARG B 2 298 ? 68.321  0.569   -36.184 1.00 131.34 ? 328 ARG B NH2 1 
ATOM   4945  N  N   . ILE B 2 299 ? 60.299  1.083   -39.293 1.00 68.01  ? 329 ILE B N   1 
ATOM   4946  C  CA  . ILE B 2 299 ? 59.137  1.878   -39.757 1.00 67.85  ? 329 ILE B CA  1 
ATOM   4947  C  C   . ILE B 2 299 ? 58.093  2.022   -38.654 1.00 70.56  ? 329 ILE B C   1 
ATOM   4948  O  O   . ILE B 2 299 ? 57.183  2.822   -38.795 1.00 72.15  ? 329 ILE B O   1 
ATOM   4949  C  CB  . ILE B 2 299 ? 58.416  1.330   -41.011 1.00 71.88  ? 329 ILE B CB  1 
ATOM   4950  C  CG1 . ILE B 2 299 ? 58.831  -0.099  -41.320 1.00 72.45  ? 329 ILE B CG1 1 
ATOM   4951  C  CG2 . ILE B 2 299 ? 58.528  2.250   -42.216 1.00 71.88  ? 329 ILE B CG2 1 
ATOM   4952  C  CD1 . ILE B 2 299 ? 57.658  -0.945  -41.753 1.00 87.21  ? 329 ILE B CD1 1 
ATOM   4953  N  N   . TYR B 2 300 ? 58.195  1.215   -37.599 1.00 64.28  ? 330 TYR B N   1 
ATOM   4954  C  CA  . TYR B 2 300 ? 57.271  1.169   -36.483 1.00 64.43  ? 330 TYR B CA  1 
ATOM   4955  C  C   . TYR B 2 300 ? 57.762  1.917   -35.277 1.00 65.05  ? 330 TYR B C   1 
ATOM   4956  O  O   . TYR B 2 300 ? 56.990  2.146   -34.355 1.00 64.93  ? 330 TYR B O   1 
ATOM   4957  C  CB  . TYR B 2 300 ? 57.011  -0.291  -36.115 1.00 66.98  ? 330 TYR B CB  1 
ATOM   4958  C  CG  . TYR B 2 300 ? 56.562  -1.132  -37.288 1.00 71.67  ? 330 TYR B CG  1 
ATOM   4959  C  CD1 . TYR B 2 300 ? 55.459  -0.764  -38.055 1.00 75.45  ? 330 TYR B CD1 1 
ATOM   4960  C  CD2 . TYR B 2 300 ? 57.236  -2.300  -37.629 1.00 72.78  ? 330 TYR B CD2 1 
ATOM   4961  C  CE1 . TYR B 2 300 ? 55.033  -1.544  -39.127 1.00 78.77  ? 330 TYR B CE1 1 
ATOM   4962  C  CE2 . TYR B 2 300 ? 56.820  -3.088  -38.701 1.00 75.22  ? 330 TYR B CE2 1 
ATOM   4963  C  CZ  . TYR B 2 300 ? 55.707  -2.716  -39.436 1.00 85.31  ? 330 TYR B CZ  1 
ATOM   4964  O  OH  . TYR B 2 300 ? 55.323  -3.489  -40.503 1.00 88.96  ? 330 TYR B OH  1 
ATOM   4965  N  N   . GLN B 2 301 ? 59.045  2.282   -35.272 1.00 60.94  ? 331 GLN B N   1 
ATOM   4966  C  CA  . GLN B 2 301 ? 59.733  2.969   -34.170 1.00 59.73  ? 331 GLN B CA  1 
ATOM   4967  C  C   . GLN B 2 301 ? 60.151  4.381   -34.566 1.00 63.61  ? 331 GLN B C   1 
ATOM   4968  O  O   . GLN B 2 301 ? 60.303  4.663   -35.761 1.00 65.34  ? 331 GLN B O   1 
ATOM   4969  C  CB  . GLN B 2 301 ? 60.989  2.185   -33.728 1.00 59.12  ? 331 GLN B CB  1 
ATOM   4970  C  CG  . GLN B 2 301 ? 60.910  0.658   -33.787 1.00 67.52  ? 331 GLN B CG  1 
ATOM   4971  C  CD  . GLN B 2 301 ? 62.121  0.012   -33.170 1.00 96.76  ? 331 GLN B CD  1 
ATOM   4972  O  OE1 . GLN B 2 301 ? 62.240  -0.023  -31.944 1.00 94.26  ? 331 GLN B OE1 1 
ATOM   4973  N  NE2 . GLN B 2 301 ? 63.064  -0.492  -33.981 1.00 91.38  ? 331 GLN B NE2 1 
ATOM   4974  N  N   . SER B 2 302 ? 60.369  5.258   -33.559 1.00 57.64  ? 332 SER B N   1 
ATOM   4975  C  CA  . SER B 2 302 ? 60.815  6.652   -33.720 1.00 56.96  ? 332 SER B CA  1 
ATOM   4976  C  C   . SER B 2 302 ? 61.440  7.184   -32.413 1.00 60.69  ? 332 SER B C   1 
ATOM   4977  O  O   . SER B 2 302 ? 61.375  6.508   -31.380 1.00 60.66  ? 332 SER B O   1 
ATOM   4978  C  CB  . SER B 2 302 ? 59.660  7.548   -34.161 1.00 62.68  ? 332 SER B CB  1 
ATOM   4979  O  OG  . SER B 2 302 ? 58.775  7.871   -33.099 1.00 74.43  ? 332 SER B OG  1 
ATOM   4980  N  N   . ASN B 2 303 ? 62.043  8.391   -32.452 1.00 55.78  ? 333 ASN B N   1 
ATOM   4981  C  CA  . ASN B 2 303 ? 62.635  8.991   -31.252 1.00 54.21  ? 333 ASN B CA  1 
ATOM   4982  C  C   . ASN B 2 303 ? 61.657  10.000  -30.611 1.00 60.02  ? 333 ASN B C   1 
ATOM   4983  O  O   . ASN B 2 303 ? 62.082  10.999  -30.031 1.00 60.15  ? 333 ASN B O   1 
ATOM   4984  C  CB  . ASN B 2 303 ? 64.010  9.610   -31.565 1.00 47.23  ? 333 ASN B CB  1 
ATOM   4985  C  CG  . ASN B 2 303 ? 64.010  10.695  -32.607 1.00 66.36  ? 333 ASN B CG  1 
ATOM   4986  O  OD1 . ASN B 2 303 ? 63.062  10.855  -33.385 1.00 67.68  ? 333 ASN B OD1 1 
ATOM   4987  N  ND2 . ASN B 2 303 ? 65.109  11.433  -32.672 1.00 61.85  ? 333 ASN B ND2 1 
ATOM   4988  N  N   . MET B 2 304 ? 60.351  9.708   -30.697 1.00 57.34  ? 334 MET B N   1 
ATOM   4989  C  CA  . MET B 2 304 ? 59.263  10.553  -30.203 1.00 58.78  ? 334 MET B CA  1 
ATOM   4990  C  C   . MET B 2 304 ? 59.423  10.937  -28.741 1.00 60.65  ? 334 MET B C   1 
ATOM   4991  O  O   . MET B 2 304 ? 59.181  12.088  -28.409 1.00 62.14  ? 334 MET B O   1 
ATOM   4992  C  CB  . MET B 2 304 ? 57.880  9.910   -30.486 1.00 62.95  ? 334 MET B CB  1 
ATOM   4993  C  CG  . MET B 2 304 ? 56.723  10.737  -29.998 1.00 68.94  ? 334 MET B CG  1 
ATOM   4994  S  SD  . MET B 2 304 ? 55.067  10.217  -30.473 1.00 75.94  ? 334 MET B SD  1 
ATOM   4995  C  CE  . MET B 2 304 ? 55.011  10.832  -32.150 1.00 73.56  ? 334 MET B CE  1 
ATOM   4996  N  N   . LEU B 2 305 ? 59.871  10.019  -27.888 1.00 54.90  ? 335 LEU B N   1 
ATOM   4997  C  CA  . LEU B 2 305 ? 60.065  10.297  -26.460 1.00 54.90  ? 335 LEU B CA  1 
ATOM   4998  C  C   . LEU B 2 305 ? 61.022  11.445  -26.153 1.00 57.72  ? 335 LEU B C   1 
ATOM   4999  O  O   . LEU B 2 305 ? 60.958  11.986  -25.059 1.00 57.77  ? 335 LEU B O   1 
ATOM   5000  C  CB  . LEU B 2 305 ? 60.571  9.048   -25.730 1.00 54.60  ? 335 LEU B CB  1 
ATOM   5001  C  CG  . LEU B 2 305 ? 59.710  8.447   -24.629 1.00 62.16  ? 335 LEU B CG  1 
ATOM   5002  C  CD1 . LEU B 2 305 ? 60.554  7.562   -23.727 1.00 62.07  ? 335 LEU B CD1 1 
ATOM   5003  C  CD2 . LEU B 2 305 ? 59.053  9.512   -23.770 1.00 67.31  ? 335 LEU B CD2 1 
ATOM   5004  N  N   . ASN B 2 306 ? 61.940  11.787  -27.075 1.00 54.47  ? 336 ASN B N   1 
ATOM   5005  C  CA  . ASN B 2 306 ? 62.944  12.847  -26.885 1.00 53.80  ? 336 ASN B CA  1 
ATOM   5006  C  C   . ASN B 2 306 ? 62.334  14.179  -26.545 1.00 60.64  ? 336 ASN B C   1 
ATOM   5007  O  O   . ASN B 2 306 ? 62.942  14.925  -25.772 1.00 61.40  ? 336 ASN B O   1 
ATOM   5008  C  CB  . ASN B 2 306 ? 63.854  13.017  -28.109 1.00 47.57  ? 336 ASN B CB  1 
ATOM   5009  C  CG  . ASN B 2 306 ? 64.906  11.982  -28.227 1.00 58.51  ? 336 ASN B CG  1 
ATOM   5010  O  OD1 . ASN B 2 306 ? 64.893  10.962  -27.545 1.00 56.24  ? 336 ASN B OD1 1 
ATOM   5011  N  ND2 . ASN B 2 306 ? 65.851  12.225  -29.099 1.00 51.13  ? 336 ASN B ND2 1 
ATOM   5012  N  N   . ARG B 2 307 ? 61.161  14.505  -27.133 1.00 57.39  ? 337 ARG B N   1 
ATOM   5013  C  CA  . ARG B 2 307 ? 60.524  15.780  -26.843 1.00 59.27  ? 337 ARG B CA  1 
ATOM   5014  C  C   . ARG B 2 307 ? 60.062  15.866  -25.391 1.00 63.25  ? 337 ARG B C   1 
ATOM   5015  O  O   . ARG B 2 307 ? 60.002  16.958  -24.824 1.00 64.34  ? 337 ARG B O   1 
ATOM   5016  C  CB  . ARG B 2 307 ? 59.417  16.121  -27.842 1.00 61.44  ? 337 ARG B CB  1 
ATOM   5017  C  CG  . ARG B 2 307 ? 58.292  15.131  -27.984 1.00 73.41  ? 337 ARG B CG  1 
ATOM   5018  C  CD  . ARG B 2 307 ? 57.416  15.600  -29.119 1.00 90.18  ? 337 ARG B CD  1 
ATOM   5019  N  NE  . ARG B 2 307 ? 57.625  14.816  -30.339 1.00 91.74  ? 337 ARG B NE  1 
ATOM   5020  C  CZ  . ARG B 2 307 ? 56.657  14.185  -30.970 1.00 107.77 ? 337 ARG B CZ  1 
ATOM   5021  N  NH1 . ARG B 2 307 ? 55.416  14.214  -30.495 1.00 101.69 ? 337 ARG B NH1 1 
ATOM   5022  N  NH2 . ARG B 2 307 ? 56.921  13.481  -32.062 1.00 90.81  ? 337 ARG B NH2 1 
ATOM   5023  N  N   . TYR B 2 308 ? 59.824  14.703  -24.777 1.00 58.22  ? 338 TYR B N   1 
ATOM   5024  C  CA  . TYR B 2 308 ? 59.443  14.609  -23.375 1.00 58.41  ? 338 TYR B CA  1 
ATOM   5025  C  C   . TYR B 2 308 ? 60.660  14.478  -22.472 1.00 63.53  ? 338 TYR B C   1 
ATOM   5026  O  O   . TYR B 2 308 ? 60.655  15.056  -21.400 1.00 66.07  ? 338 TYR B O   1 
ATOM   5027  C  CB  . TYR B 2 308 ? 58.408  13.500  -23.142 1.00 58.36  ? 338 TYR B CB  1 
ATOM   5028  C  CG  . TYR B 2 308 ? 57.141  13.729  -23.931 1.00 60.43  ? 338 TYR B CG  1 
ATOM   5029  C  CD1 . TYR B 2 308 ? 56.232  14.711  -23.554 1.00 63.64  ? 338 TYR B CD1 1 
ATOM   5030  C  CD2 . TYR B 2 308 ? 56.878  13.006  -25.096 1.00 61.35  ? 338 TYR B CD2 1 
ATOM   5031  C  CE1 . TYR B 2 308 ? 55.083  14.956  -24.299 1.00 65.44  ? 338 TYR B CE1 1 
ATOM   5032  C  CE2 . TYR B 2 308 ? 55.721  13.236  -25.846 1.00 63.48  ? 338 TYR B CE2 1 
ATOM   5033  C  CZ  . TYR B 2 308 ? 54.823  14.208  -25.434 1.00 71.34  ? 338 TYR B CZ  1 
ATOM   5034  O  OH  . TYR B 2 308 ? 53.688  14.480  -26.147 1.00 74.94  ? 338 TYR B OH  1 
ATOM   5035  N  N   . LEU B 2 309 ? 61.713  13.778  -22.921 1.00 57.93  ? 339 LEU B N   1 
ATOM   5036  C  CA  . LEU B 2 309 ? 62.961  13.536  -22.188 1.00 56.25  ? 339 LEU B CA  1 
ATOM   5037  C  C   . LEU B 2 309 ? 63.848  14.773  -21.965 1.00 62.84  ? 339 LEU B C   1 
ATOM   5038  O  O   . LEU B 2 309 ? 64.673  14.795  -21.055 1.00 60.09  ? 339 LEU B O   1 
ATOM   5039  C  CB  . LEU B 2 309 ? 63.774  12.528  -22.999 1.00 53.70  ? 339 LEU B CB  1 
ATOM   5040  C  CG  . LEU B 2 309 ? 63.399  11.087  -22.886 1.00 57.07  ? 339 LEU B CG  1 
ATOM   5041  C  CD1 . LEU B 2 309 ? 64.087  10.316  -23.936 1.00 55.43  ? 339 LEU B CD1 1 
ATOM   5042  C  CD2 . LEU B 2 309 ? 63.787  10.514  -21.519 1.00 59.48  ? 339 LEU B CD2 1 
ATOM   5043  N  N   . ILE B 2 310 ? 63.725  15.749  -22.868 1.00 64.80  ? 340 ILE B N   1 
ATOM   5044  C  CA  . ILE B 2 310 ? 64.547  16.956  -23.007 1.00 65.85  ? 340 ILE B CA  1 
ATOM   5045  C  C   . ILE B 2 310 ? 64.196  18.046  -22.049 1.00 75.73  ? 340 ILE B C   1 
ATOM   5046  O  O   . ILE B 2 310 ? 64.956  19.002  -21.937 1.00 76.00  ? 340 ILE B O   1 
ATOM   5047  C  CB  . ILE B 2 310 ? 64.468  17.458  -24.493 1.00 68.01  ? 340 ILE B CB  1 
ATOM   5048  C  CG1 . ILE B 2 310 ? 65.706  18.256  -24.902 1.00 67.47  ? 340 ILE B CG1 1 
ATOM   5049  C  CG2 . ILE B 2 310 ? 63.180  18.219  -24.794 1.00 68.65  ? 340 ILE B CG2 1 
ATOM   5050  C  CD1 . ILE B 2 310 ? 65.958  18.301  -26.378 1.00 73.61  ? 340 ILE B CD1 1 
ATOM   5051  N  N   . ASN B 2 311 ? 63.027  17.964  -21.422 1.00 77.23  ? 341 ASN B N   1 
ATOM   5052  C  CA  . ASN B 2 311 ? 62.550  19.058  -20.585 1.00 80.60  ? 341 ASN B CA  1 
ATOM   5053  C  C   . ASN B 2 311 ? 61.669  18.519  -19.448 1.00 87.25  ? 341 ASN B C   1 
ATOM   5054  O  O   . ASN B 2 311 ? 60.468  18.813  -19.365 1.00 89.19  ? 341 ASN B O   1 
ATOM   5055  C  CB  . ASN B 2 311 ? 61.887  20.131  -21.491 1.00 86.34  ? 341 ASN B CB  1 
ATOM   5056  C  CG  . ASN B 2 311 ? 61.042  21.173  -20.833 1.00 142.42 ? 341 ASN B CG  1 
ATOM   5057  O  OD1 . ASN B 2 311 ? 61.493  21.914  -19.938 1.00 142.19 ? 341 ASN B OD1 1 
ATOM   5058  N  ND2 . ASN B 2 311 ? 59.789  21.198  -21.311 1.00 145.41 ? 341 ASN B ND2 1 
ATOM   5059  N  N   . VAL B 2 312 ? 62.299  17.681  -18.585 1.00 82.41  ? 342 VAL B N   1 
ATOM   5060  C  CA  . VAL B 2 312 ? 61.686  17.078  -17.397 1.00 82.86  ? 342 VAL B CA  1 
ATOM   5061  C  C   . VAL B 2 312 ? 61.995  17.965  -16.177 1.00 88.68  ? 342 VAL B C   1 
ATOM   5062  O  O   . VAL B 2 312 ? 63.139  18.366  -15.959 1.00 87.77  ? 342 VAL B O   1 
ATOM   5063  C  CB  . VAL B 2 312 ? 62.156  15.605  -17.163 1.00 84.72  ? 342 VAL B CB  1 
ATOM   5064  C  CG1 . VAL B 2 312 ? 61.849  15.116  -15.744 1.00 85.20  ? 342 VAL B CG1 1 
ATOM   5065  C  CG2 . VAL B 2 312 ? 61.575  14.653  -18.197 1.00 83.88  ? 342 VAL B CG2 1 
ATOM   5066  N  N   . THR B 2 313 ? 60.980  18.253  -15.378 1.00 87.28  ? 343 THR B N   1 
ATOM   5067  C  CA  . THR B 2 313 ? 61.196  18.977  -14.139 1.00 87.70  ? 343 THR B CA  1 
ATOM   5068  C  C   . THR B 2 313 ? 60.666  18.064  -13.014 1.00 90.34  ? 343 THR B C   1 
ATOM   5069  O  O   . THR B 2 313 ? 59.606  17.444  -13.158 1.00 91.09  ? 343 THR B O   1 
ATOM   5070  C  CB  . THR B 2 313 ? 60.707  20.423  -14.220 1.00 97.45  ? 343 THR B CB  1 
ATOM   5071  O  OG1 . THR B 2 313 ? 60.879  21.050  -12.950 1.00 100.63 ? 343 THR B OG1 1 
ATOM   5072  C  CG2 . THR B 2 313 ? 59.279  20.548  -14.723 1.00 97.40  ? 343 THR B CG2 1 
ATOM   5073  N  N   . PHE B 2 314 ? 61.487  17.867  -11.970 1.00 84.37  ? 344 PHE B N   1 
ATOM   5074  C  CA  . PHE B 2 314 ? 61.188  16.972  -10.851 1.00 83.85  ? 344 PHE B CA  1 
ATOM   5075  C  C   . PHE B 2 314 ? 61.729  17.532  -9.532  1.00 89.00  ? 344 PHE B C   1 
ATOM   5076  O  O   . PHE B 2 314 ? 62.920  17.877  -9.449  1.00 86.28  ? 344 PHE B O   1 
ATOM   5077  C  CB  . PHE B 2 314 ? 61.732  15.576  -11.164 1.00 82.86  ? 344 PHE B CB  1 
ATOM   5078  C  CG  . PHE B 2 314 ? 61.904  14.607  -10.023 1.00 83.41  ? 344 PHE B CG  1 
ATOM   5079  C  CD1 . PHE B 2 314 ? 63.140  14.462  -9.393  1.00 85.32  ? 344 PHE B CD1 1 
ATOM   5080  C  CD2 . PHE B 2 314 ? 60.865  13.768  -9.646  1.00 84.59  ? 344 PHE B CD2 1 
ATOM   5081  C  CE1 . PHE B 2 314 ? 63.329  13.504  -8.402  1.00 85.75  ? 344 PHE B CE1 1 
ATOM   5082  C  CE2 . PHE B 2 314 ? 61.048  12.823  -8.647  1.00 87.54  ? 344 PHE B CE2 1 
ATOM   5083  C  CZ  . PHE B 2 314 ? 62.278  12.698  -8.028  1.00 85.33  ? 344 PHE B CZ  1 
ATOM   5084  N  N   . GLU B 2 315 ? 60.827  17.620  -8.501  1.00 88.75  ? 345 GLU B N   1 
ATOM   5085  C  CA  . GLU B 2 315 ? 61.070  18.208  -7.166  1.00 90.15  ? 345 GLU B CA  1 
ATOM   5086  C  C   . GLU B 2 315 ? 61.585  19.643  -7.384  1.00 94.37  ? 345 GLU B C   1 
ATOM   5087  O  O   . GLU B 2 315 ? 62.588  20.046  -6.788  1.00 94.03  ? 345 GLU B O   1 
ATOM   5088  C  CB  . GLU B 2 315 ? 62.056  17.372  -6.290  1.00 90.33  ? 345 GLU B CB  1 
ATOM   5089  C  CG  . GLU B 2 315 ? 61.575  15.983  -5.888  1.00 100.14 ? 345 GLU B CG  1 
ATOM   5090  C  CD  . GLU B 2 315 ? 62.628  15.012  -5.367  1.00 123.29 ? 345 GLU B CD  1 
ATOM   5091  O  OE1 . GLU B 2 315 ? 63.801  15.075  -5.809  1.00 116.16 ? 345 GLU B OE1 1 
ATOM   5092  O  OE2 . GLU B 2 315 ? 62.249  14.127  -4.566  1.00 117.18 ? 345 GLU B OE2 1 
ATOM   5093  N  N   . GLY B 2 316 ? 60.950  20.355  -8.317  1.00 90.91  ? 346 GLY B N   1 
ATOM   5094  C  CA  . GLY B 2 316 ? 61.324  21.716  -8.676  1.00 91.65  ? 346 GLY B CA  1 
ATOM   5095  C  C   . GLY B 2 316 ? 62.658  21.861  -9.382  1.00 95.82  ? 346 GLY B C   1 
ATOM   5096  O  O   . GLY B 2 316 ? 62.919  22.914  -9.973  1.00 96.44  ? 346 GLY B O   1 
ATOM   5097  N  N   . ARG B 2 317 ? 63.524  20.825  -9.314  1.00 91.45  ? 347 ARG B N   1 
ATOM   5098  C  CA  . ARG B 2 317 ? 64.827  20.822  -9.979  1.00 89.71  ? 347 ARG B CA  1 
ATOM   5099  C  C   . ARG B 2 317 ? 64.620  20.685  -11.517 1.00 95.02  ? 347 ARG B C   1 
ATOM   5100  O  O   . ARG B 2 317 ? 63.940  19.762  -11.968 1.00 94.35  ? 347 ARG B O   1 
ATOM   5101  C  CB  . ARG B 2 317 ? 65.724  19.716  -9.401  1.00 86.10  ? 347 ARG B CB  1 
ATOM   5102  N  N   . ASP B 2 318 ? 65.114  21.668  -12.295 1.00 92.77  ? 348 ASP B N   1 
ATOM   5103  C  CA  . ASP B 2 318 ? 64.997  21.703  -13.762 1.00 92.40  ? 348 ASP B CA  1 
ATOM   5104  C  C   . ASP B 2 318 ? 66.096  20.817  -14.390 1.00 92.14  ? 348 ASP B C   1 
ATOM   5105  O  O   . ASP B 2 318 ? 67.231  21.269  -14.593 1.00 91.66  ? 348 ASP B O   1 
ATOM   5106  C  CB  . ASP B 2 318 ? 65.033  23.167  -14.282 1.00 96.12  ? 348 ASP B CB  1 
ATOM   5107  C  CG  . ASP B 2 318 ? 65.104  23.344  -15.797 1.00 106.62 ? 348 ASP B CG  1 
ATOM   5108  O  OD1 . ASP B 2 318 ? 64.057  23.181  -16.465 1.00 107.26 ? 348 ASP B OD1 1 
ATOM   5109  O  OD2 . ASP B 2 318 ? 66.201  23.687  -16.306 1.00 110.69 ? 348 ASP B OD2 1 
ATOM   5110  N  N   . LEU B 2 319 ? 65.746  19.547  -14.682 1.00 84.46  ? 349 LEU B N   1 
ATOM   5111  C  CA  . LEU B 2 319 ? 66.662  18.550  -15.244 1.00 80.30  ? 349 LEU B CA  1 
ATOM   5112  C  C   . LEU B 2 319 ? 66.667  18.569  -16.792 1.00 82.85  ? 349 LEU B C   1 
ATOM   5113  O  O   . LEU B 2 319 ? 66.991  17.558  -17.422 1.00 81.78  ? 349 LEU B O   1 
ATOM   5114  C  CB  . LEU B 2 319 ? 66.332  17.132  -14.722 1.00 78.95  ? 349 LEU B CB  1 
ATOM   5115  C  CG  . LEU B 2 319 ? 65.722  16.964  -13.337 1.00 84.01  ? 349 LEU B CG  1 
ATOM   5116  C  CD1 . LEU B 2 319 ? 64.778  15.799  -13.322 1.00 84.50  ? 349 LEU B CD1 1 
ATOM   5117  C  CD2 . LEU B 2 319 ? 66.776  16.738  -12.291 1.00 85.12  ? 349 LEU B CD2 1 
ATOM   5118  N  N   . SER B 2 320 ? 66.319  19.712  -17.406 1.00 78.80  ? 350 SER B N   1 
ATOM   5119  C  CA  . SER B 2 320 ? 66.258  19.809  -18.870 1.00 77.32  ? 350 SER B CA  1 
ATOM   5120  C  C   . SER B 2 320 ? 67.639  19.658  -19.548 1.00 75.64  ? 350 SER B C   1 
ATOM   5121  O  O   . SER B 2 320 ? 68.661  19.942  -18.932 1.00 74.96  ? 350 SER B O   1 
ATOM   5122  C  CB  . SER B 2 320 ? 65.534  21.079  -19.316 1.00 83.68  ? 350 SER B CB  1 
ATOM   5123  O  OG  . SER B 2 320 ? 66.084  22.256  -18.751 1.00 97.88  ? 350 SER B OG  1 
ATOM   5124  N  N   . PHE B 2 321 ? 67.656  19.144  -20.790 1.00 68.15  ? 351 PHE B N   1 
ATOM   5125  C  CA  . PHE B 2 321 ? 68.847  18.895  -21.600 1.00 64.43  ? 351 PHE B CA  1 
ATOM   5126  C  C   . PHE B 2 321 ? 68.885  19.839  -22.802 1.00 66.04  ? 351 PHE B C   1 
ATOM   5127  O  O   . PHE B 2 321 ? 67.841  20.292  -23.261 1.00 66.67  ? 351 PHE B O   1 
ATOM   5128  C  CB  . PHE B 2 321 ? 68.831  17.446  -22.101 1.00 64.68  ? 351 PHE B CB  1 
ATOM   5129  C  CG  . PHE B 2 321 ? 69.102  16.382  -21.065 1.00 65.46  ? 351 PHE B CG  1 
ATOM   5130  C  CD1 . PHE B 2 321 ? 70.394  16.161  -20.590 1.00 67.12  ? 351 PHE B CD1 1 
ATOM   5131  C  CD2 . PHE B 2 321 ? 68.089  15.541  -20.626 1.00 67.13  ? 351 PHE B CD2 1 
ATOM   5132  C  CE1 . PHE B 2 321 ? 70.653  15.143  -19.665 1.00 66.80  ? 351 PHE B CE1 1 
ATOM   5133  C  CE2 . PHE B 2 321 ? 68.355  14.523  -19.697 1.00 68.93  ? 351 PHE B CE2 1 
ATOM   5134  C  CZ  . PHE B 2 321 ? 69.633  14.338  -19.220 1.00 65.69  ? 351 PHE B CZ  1 
ATOM   5135  N  N   . SER B 2 322 ? 70.085  20.119  -23.320 1.00 60.14  ? 352 SER B N   1 
ATOM   5136  C  CA  . SER B 2 322 ? 70.323  20.980  -24.474 1.00 59.57  ? 352 SER B CA  1 
ATOM   5137  C  C   . SER B 2 322 ? 69.867  20.335  -25.804 1.00 64.69  ? 352 SER B C   1 
ATOM   5138  O  O   . SER B 2 322 ? 69.482  19.164  -25.840 1.00 61.97  ? 352 SER B O   1 
ATOM   5139  C  CB  . SER B 2 322 ? 71.787  21.435  -24.509 1.00 60.40  ? 352 SER B CB  1 
ATOM   5140  O  OG  . SER B 2 322 ? 72.697  20.627  -25.241 1.00 61.35  ? 352 SER B OG  1 
ATOM   5141  N  N   . GLU B 2 323 ? 69.892  21.099  -26.898 1.00 65.33  ? 353 GLU B N   1 
ATOM   5142  C  CA  . GLU B 2 323 ? 69.491  20.568  -28.203 1.00 66.42  ? 353 GLU B CA  1 
ATOM   5143  C  C   . GLU B 2 323 ? 70.440  19.425  -28.630 1.00 69.05  ? 353 GLU B C   1 
ATOM   5144  O  O   . GLU B 2 323 ? 70.049  18.570  -29.416 1.00 68.17  ? 353 GLU B O   1 
ATOM   5145  C  CB  . GLU B 2 323 ? 69.475  21.698  -29.247 1.00 69.56  ? 353 GLU B CB  1 
ATOM   5146  C  CG  . GLU B 2 323 ? 68.310  21.632  -30.219 1.00 91.78  ? 353 GLU B CG  1 
ATOM   5147  C  CD  . GLU B 2 323 ? 68.533  22.296  -31.571 1.00 130.81 ? 353 GLU B CD  1 
ATOM   5148  O  OE1 . GLU B 2 323 ? 68.539  21.564  -32.587 1.00 133.79 ? 353 GLU B OE1 1 
ATOM   5149  O  OE2 . GLU B 2 323 ? 68.714  23.537  -31.618 1.00 127.67 ? 353 GLU B OE2 1 
ATOM   5150  N  N   . ASP B 2 324 ? 71.680  19.417  -28.083 1.00 65.71  ? 354 ASP B N   1 
ATOM   5151  C  CA  . ASP B 2 324 ? 72.729  18.429  -28.371 1.00 63.67  ? 354 ASP B CA  1 
ATOM   5152  C  C   . ASP B 2 324 ? 72.825  17.289  -27.344 1.00 64.75  ? 354 ASP B C   1 
ATOM   5153  O  O   . ASP B 2 324 ? 73.674  16.417  -27.484 1.00 63.65  ? 354 ASP B O   1 
ATOM   5154  C  CB  . ASP B 2 324 ? 74.087  19.114  -28.569 1.00 65.08  ? 354 ASP B CB  1 
ATOM   5155  C  CG  . ASP B 2 324 ? 74.098  20.077  -29.743 1.00 83.63  ? 354 ASP B CG  1 
ATOM   5156  O  OD1 . ASP B 2 324 ? 73.481  19.751  -30.793 1.00 83.02  ? 354 ASP B OD1 1 
ATOM   5157  O  OD2 . ASP B 2 324 ? 74.709  21.163  -29.613 1.00 97.04  ? 354 ASP B OD2 1 
ATOM   5158  N  N   . GLY B 2 325 ? 71.953  17.279  -26.348 1.00 59.70  ? 355 GLY B N   1 
ATOM   5159  C  CA  . GLY B 2 325 ? 71.905  16.200  -25.382 1.00 58.06  ? 355 GLY B CA  1 
ATOM   5160  C  C   . GLY B 2 325 ? 72.804  16.305  -24.182 1.00 62.48  ? 355 GLY B C   1 
ATOM   5161  O  O   . GLY B 2 325 ? 72.990  15.295  -23.499 1.00 62.97  ? 355 GLY B O   1 
ATOM   5162  N  N   . TYR B 2 326 ? 73.368  17.500  -23.893 1.00 58.46  ? 356 TYR B N   1 
ATOM   5163  C  CA  . TYR B 2 326 ? 74.149  17.685  -22.656 1.00 57.42  ? 356 TYR B CA  1 
ATOM   5164  C  C   . TYR B 2 326 ? 73.236  18.446  -21.681 1.00 61.33  ? 356 TYR B C   1 
ATOM   5165  O  O   . TYR B 2 326 ? 72.244  19.013  -22.109 1.00 60.87  ? 356 TYR B O   1 
ATOM   5166  C  CB  . TYR B 2 326 ? 75.508  18.398  -22.878 1.00 58.28  ? 356 TYR B CB  1 
ATOM   5167  C  CG  . TYR B 2 326 ? 76.375  17.779  -23.958 1.00 59.17  ? 356 TYR B CG  1 
ATOM   5168  C  CD1 . TYR B 2 326 ? 76.263  18.187  -25.285 1.00 60.85  ? 356 TYR B CD1 1 
ATOM   5169  C  CD2 . TYR B 2 326 ? 77.318  16.789  -23.653 1.00 58.60  ? 356 TYR B CD2 1 
ATOM   5170  C  CE1 . TYR B 2 326 ? 77.029  17.597  -26.293 1.00 60.81  ? 356 TYR B CE1 1 
ATOM   5171  C  CE2 . TYR B 2 326 ? 78.112  16.208  -24.655 1.00 58.14  ? 356 TYR B CE2 1 
ATOM   5172  C  CZ  . TYR B 2 326 ? 77.949  16.606  -25.981 1.00 66.72  ? 356 TYR B CZ  1 
ATOM   5173  O  OH  . TYR B 2 326 ? 78.663  16.045  -27.025 1.00 66.16  ? 356 TYR B OH  1 
ATOM   5174  N  N   . GLN B 2 327 ? 73.521  18.404  -20.380 1.00 59.49  ? 357 GLN B N   1 
ATOM   5175  C  CA  . GLN B 2 327 ? 72.737  19.098  -19.364 1.00 61.28  ? 357 GLN B CA  1 
ATOM   5176  C  C   . GLN B 2 327 ? 72.709  20.618  -19.671 1.00 69.88  ? 357 GLN B C   1 
ATOM   5177  O  O   . GLN B 2 327 ? 73.723  21.199  -20.085 1.00 68.04  ? 357 GLN B O   1 
ATOM   5178  C  CB  . GLN B 2 327 ? 73.291  18.805  -17.955 1.00 62.58  ? 357 GLN B CB  1 
ATOM   5179  C  CG  . GLN B 2 327 ? 72.247  18.986  -16.842 1.00 87.23  ? 357 GLN B CG  1 
ATOM   5180  C  CD  . GLN B 2 327 ? 72.087  17.778  -15.933 1.00 98.81  ? 357 GLN B CD  1 
ATOM   5181  O  OE1 . GLN B 2 327 ? 73.038  17.392  -15.229 1.00 88.02  ? 357 GLN B OE1 1 
ATOM   5182  N  NE2 . GLN B 2 327 ? 70.857  17.194  -15.884 1.00 80.06  ? 357 GLN B NE2 1 
ATOM   5183  N  N   . MET B 2 328 ? 71.517  21.232  -19.536 1.00 71.10  ? 358 MET B N   1 
ATOM   5184  C  CA  . MET B 2 328 ? 71.290  22.648  -19.819 1.00 73.22  ? 358 MET B CA  1 
ATOM   5185  C  C   . MET B 2 328 ? 71.980  23.553  -18.805 1.00 81.66  ? 358 MET B C   1 
ATOM   5186  O  O   . MET B 2 328 ? 72.646  24.513  -19.199 1.00 81.69  ? 358 MET B O   1 
ATOM   5187  C  CB  . MET B 2 328 ? 69.784  22.963  -19.853 1.00 76.92  ? 358 MET B CB  1 
ATOM   5188  C  CG  . MET B 2 328 ? 69.186  22.995  -21.231 1.00 80.46  ? 358 MET B CG  1 
ATOM   5189  S  SD  . MET B 2 328 ? 69.880  24.313  -22.245 1.00 85.15  ? 358 MET B SD  1 
ATOM   5190  C  CE  . MET B 2 328 ? 68.884  24.177  -23.727 1.00 81.94  ? 358 MET B CE  1 
ATOM   5191  N  N   . HIS B 2 329 ? 71.774  23.286  -17.504 1.00 80.31  ? 359 HIS B N   1 
ATOM   5192  C  CA  . HIS B 2 329 ? 72.357  24.118  -16.475 1.00 82.36  ? 359 HIS B CA  1 
ATOM   5193  C  C   . HIS B 2 329 ? 73.145  23.279  -15.483 1.00 88.82  ? 359 HIS B C   1 
ATOM   5194  O  O   . HIS B 2 329 ? 72.603  22.863  -14.449 1.00 91.33  ? 359 HIS B O   1 
ATOM   5195  C  CB  . HIS B 2 329 ? 71.287  24.989  -15.793 1.00 85.85  ? 359 HIS B CB  1 
ATOM   5196  C  CG  . HIS B 2 329 ? 70.409  25.705  -16.767 1.00 90.87  ? 359 HIS B CG  1 
ATOM   5197  N  ND1 . HIS B 2 329 ? 70.896  26.735  -17.555 1.00 93.46  ? 359 HIS B ND1 1 
ATOM   5198  C  CD2 . HIS B 2 329 ? 69.123  25.461  -17.108 1.00 93.65  ? 359 HIS B CD2 1 
ATOM   5199  C  CE1 . HIS B 2 329 ? 69.889  27.095  -18.333 1.00 93.96  ? 359 HIS B CE1 1 
ATOM   5200  N  NE2 . HIS B 2 329 ? 68.801  26.359  -18.096 1.00 94.46  ? 359 HIS B NE2 1 
ATOM   5201  N  N   . PRO B 2 330 ? 74.437  23.000  -15.756 1.00 83.31  ? 360 PRO B N   1 
ATOM   5202  C  CA  . PRO B 2 330 ? 75.217  22.201  -14.801 1.00 81.98  ? 360 PRO B CA  1 
ATOM   5203  C  C   . PRO B 2 330 ? 76.064  23.081  -13.848 1.00 85.22  ? 360 PRO B C   1 
ATOM   5204  O  O   . PRO B 2 330 ? 76.609  24.125  -14.246 1.00 85.49  ? 360 PRO B O   1 
ATOM   5205  C  CB  . PRO B 2 330 ? 76.068  21.315  -15.721 1.00 81.82  ? 360 PRO B CB  1 
ATOM   5206  C  CG  . PRO B 2 330 ? 76.150  22.107  -17.069 1.00 85.97  ? 360 PRO B CG  1 
ATOM   5207  C  CD  . PRO B 2 330 ? 75.247  23.325  -16.947 1.00 83.55  ? 360 PRO B CD  1 
ATOM   5208  N  N   . LYS B 2 331 ? 76.144  22.674  -12.575 1.00 79.72  ? 361 LYS B N   1 
ATOM   5209  C  CA  . LYS B 2 331 ? 76.959  23.374  -11.589 1.00 79.17  ? 361 LYS B CA  1 
ATOM   5210  C  C   . LYS B 2 331 ? 78.355  22.746  -11.681 1.00 79.35  ? 361 LYS B C   1 
ATOM   5211  O  O   . LYS B 2 331 ? 78.633  21.699  -11.077 1.00 80.01  ? 361 LYS B O   1 
ATOM   5212  C  CB  . LYS B 2 331 ? 76.374  23.267  -10.163 1.00 83.13  ? 361 LYS B CB  1 
ATOM   5213  C  CG  . LYS B 2 331 ? 75.108  24.097  -9.945  1.00 107.77 ? 361 LYS B CG  1 
ATOM   5214  C  CD  . LYS B 2 331 ? 74.387  23.723  -8.637  1.00 121.94 ? 361 LYS B CD  1 
ATOM   5215  C  CE  . LYS B 2 331 ? 73.044  24.409  -8.489  1.00 130.65 ? 361 LYS B CE  1 
ATOM   5216  N  NZ  . LYS B 2 331 ? 72.223  23.803  -7.400  1.00 134.22 ? 361 LYS B NZ  1 
ATOM   5217  N  N   . LEU B 2 332 ? 79.208  23.358  -12.501 1.00 70.31  ? 362 LEU B N   1 
ATOM   5218  C  CA  . LEU B 2 332 ? 80.575  22.899  -12.712 1.00 66.01  ? 362 LEU B CA  1 
ATOM   5219  C  C   . LEU B 2 332 ? 81.486  23.314  -11.575 1.00 66.52  ? 362 LEU B C   1 
ATOM   5220  O  O   . LEU B 2 332 ? 81.144  24.189  -10.786 1.00 68.37  ? 362 LEU B O   1 
ATOM   5221  C  CB  . LEU B 2 332 ? 81.100  23.371  -14.069 1.00 64.31  ? 362 LEU B CB  1 
ATOM   5222  C  CG  . LEU B 2 332 ? 80.193  23.070  -15.235 1.00 65.31  ? 362 LEU B CG  1 
ATOM   5223  C  CD1 . LEU B 2 332 ? 80.763  23.590  -16.493 1.00 63.49  ? 362 LEU B CD1 1 
ATOM   5224  C  CD2 . LEU B 2 332 ? 79.932  21.610  -15.337 1.00 66.40  ? 362 LEU B CD2 1 
ATOM   5225  N  N   . VAL B 2 333 ? 82.625  22.638  -11.463 1.00 58.41  ? 363 VAL B N   1 
ATOM   5226  C  CA  . VAL B 2 333 ? 83.590  22.813  -10.395 1.00 56.86  ? 363 VAL B CA  1 
ATOM   5227  C  C   . VAL B 2 333 ? 84.950  23.010  -11.039 1.00 59.70  ? 363 VAL B C   1 
ATOM   5228  O  O   . VAL B 2 333 ? 85.344  22.236  -11.902 1.00 56.50  ? 363 VAL B O   1 
ATOM   5229  C  CB  . VAL B 2 333 ? 83.477  21.570  -9.473  1.00 59.53  ? 363 VAL B CB  1 
ATOM   5230  C  CG1 . VAL B 2 333 ? 84.666  21.392  -8.545  1.00 59.90  ? 363 VAL B CG1 1 
ATOM   5231  C  CG2 . VAL B 2 333 ? 82.194  21.624  -8.676  1.00 60.31  ? 363 VAL B CG2 1 
ATOM   5232  N  N   . ILE B 2 334 ? 85.631  24.110  -10.682 1.00 59.38  ? 364 ILE B N   1 
ATOM   5233  C  CA  . ILE B 2 334 ? 86.959  24.420  -11.212 1.00 58.70  ? 364 ILE B CA  1 
ATOM   5234  C  C   . ILE B 2 334 ? 87.970  23.775  -10.302 1.00 63.32  ? 364 ILE B C   1 
ATOM   5235  O  O   . ILE B 2 334 ? 87.889  23.927  -9.076  1.00 64.80  ? 364 ILE B O   1 
ATOM   5236  C  CB  . ILE B 2 334 ? 87.176  25.930  -11.446 1.00 62.26  ? 364 ILE B CB  1 
ATOM   5237  C  CG1 . ILE B 2 334 ? 86.210  26.434  -12.544 1.00 61.92  ? 364 ILE B CG1 1 
ATOM   5238  C  CG2 . ILE B 2 334 ? 88.624  26.214  -11.853 1.00 62.87  ? 364 ILE B CG2 1 
ATOM   5239  C  CD1 . ILE B 2 334 ? 84.868  26.808  -12.088 1.00 70.02  ? 364 ILE B CD1 1 
ATOM   5240  N  N   . ILE B 2 335 ? 88.859  22.975  -10.888 1.00 57.87  ? 365 ILE B N   1 
ATOM   5241  C  CA  . ILE B 2 335 ? 89.831  22.229  -10.102 1.00 58.17  ? 365 ILE B CA  1 
ATOM   5242  C  C   . ILE B 2 335 ? 91.272  22.523  -10.489 1.00 61.35  ? 365 ILE B C   1 
ATOM   5243  O  O   . ILE B 2 335 ? 91.565  22.798  -11.650 1.00 61.94  ? 365 ILE B O   1 
ATOM   5244  C  CB  . ILE B 2 335 ? 89.510  20.716  -10.107 1.00 60.39  ? 365 ILE B CB  1 
ATOM   5245  C  CG1 . ILE B 2 335 ? 89.388  20.154  -11.536 1.00 59.84  ? 365 ILE B CG1 1 
ATOM   5246  C  CG2 . ILE B 2 335 ? 88.229  20.471  -9.314  1.00 61.89  ? 365 ILE B CG2 1 
ATOM   5247  C  CD1 . ILE B 2 335 ? 89.336  18.656  -11.619 1.00 71.56  ? 365 ILE B CD1 1 
ATOM   5248  N  N   . LEU B 2 336 ? 92.164  22.458  -9.504  1.00 56.75  ? 366 LEU B N   1 
ATOM   5249  C  CA  . LEU B 2 336 ? 93.589  22.689  -9.677  1.00 56.72  ? 366 LEU B CA  1 
ATOM   5250  C  C   . LEU B 2 336 ? 94.379  21.478  -9.197  1.00 63.54  ? 366 LEU B C   1 
ATOM   5251  O  O   . LEU B 2 336 ? 94.112  20.956  -8.107  1.00 64.95  ? 366 LEU B O   1 
ATOM   5252  C  CB  . LEU B 2 336 ? 94.001  23.938  -8.887  1.00 57.57  ? 366 LEU B CB  1 
ATOM   5253  C  CG  . LEU B 2 336 ? 95.443  24.388  -8.989  1.00 60.61  ? 366 LEU B CG  1 
ATOM   5254  C  CD1 . LEU B 2 336 ? 95.747  24.947  -10.376 1.00 59.81  ? 366 LEU B CD1 1 
ATOM   5255  C  CD2 . LEU B 2 336 ? 95.711  25.425  -7.959  1.00 62.00  ? 366 LEU B CD2 1 
ATOM   5256  N  N   . LEU B 2 337 ? 95.335  21.022  -10.021 1.00 59.45  ? 367 LEU B N   1 
ATOM   5257  C  CA  . LEU B 2 337 ? 96.191  19.885  -9.684  1.00 59.32  ? 367 LEU B CA  1 
ATOM   5258  C  C   . LEU B 2 337 ? 97.347  20.401  -8.805  1.00 64.70  ? 367 LEU B C   1 
ATOM   5259  O  O   . LEU B 2 337 ? 98.276  21.018  -9.332  1.00 65.41  ? 367 LEU B O   1 
ATOM   5260  C  CB  . LEU B 2 337 ? 96.692  19.220  -10.990 1.00 57.92  ? 367 LEU B CB  1 
ATOM   5261  C  CG  . LEU B 2 337 ? 97.646  18.026  -10.874 1.00 61.74  ? 367 LEU B CG  1 
ATOM   5262  C  CD1 . LEU B 2 337 ? 97.039  16.884  -10.068 1.00 60.68  ? 367 LEU B CD1 1 
ATOM   5263  C  CD2 . LEU B 2 337 ? 98.051  17.556  -12.222 1.00 62.93  ? 367 LEU B CD2 1 
ATOM   5264  N  N   . ASN B 2 338 ? 97.270  20.181  -7.470  1.00 61.99  ? 368 ASN B N   1 
ATOM   5265  C  CA  . ASN B 2 338 ? 98.260  20.699  -6.509  1.00 64.09  ? 368 ASN B CA  1 
ATOM   5266  C  C   . ASN B 2 338 ? 99.634  19.953  -6.476  1.00 68.17  ? 368 ASN B C   1 
ATOM   5267  O  O   . ASN B 2 338 ? 99.866  19.022  -7.249  1.00 65.43  ? 368 ASN B O   1 
ATOM   5268  C  CB  . ASN B 2 338 ? 97.667  20.796  -5.097  1.00 66.73  ? 368 ASN B CB  1 
ATOM   5269  C  CG  . ASN B 2 338 ? 97.240  19.494  -4.455  1.00 84.37  ? 368 ASN B CG  1 
ATOM   5270  O  OD1 . ASN B 2 338 ? 97.815  18.413  -4.678  1.00 66.75  ? 368 ASN B OD1 1 
ATOM   5271  N  ND2 . ASN B 2 338 ? 96.230  19.588  -3.599  1.00 78.73  ? 368 ASN B ND2 1 
ATOM   5272  N  N   . LYS B 2 339 ? 100.547 20.425  -5.589  1.00 67.49  ? 369 LYS B N   1 
ATOM   5273  C  CA  . LYS B 2 339 ? 101.898 19.892  -5.378  1.00 67.60  ? 369 LYS B CA  1 
ATOM   5274  C  C   . LYS B 2 339 ? 101.863 18.419  -4.936  1.00 69.81  ? 369 LYS B C   1 
ATOM   5275  O  O   . LYS B 2 339 ? 102.681 17.628  -5.400  1.00 69.01  ? 369 LYS B O   1 
ATOM   5276  C  CB  . LYS B 2 339 ? 102.670 20.767  -4.368  1.00 71.17  ? 369 LYS B CB  1 
ATOM   5277  N  N   . GLU B 2 340 ? 100.885 18.042  -4.093  1.00 65.75  ? 370 GLU B N   1 
ATOM   5278  C  CA  . GLU B 2 340 ? 100.704 16.660  -3.629  1.00 65.62  ? 370 GLU B CA  1 
ATOM   5279  C  C   . GLU B 2 340 ? 99.997  15.821  -4.739  1.00 68.26  ? 370 GLU B C   1 
ATOM   5280  O  O   . GLU B 2 340 ? 99.368  14.794  -4.459  1.00 68.11  ? 370 GLU B O   1 
ATOM   5281  C  CB  . GLU B 2 340 ? 99.905  16.606  -2.298  1.00 67.99  ? 370 GLU B CB  1 
ATOM   5282  C  CG  . GLU B 2 340 ? 100.612 17.189  -1.092  1.00 85.51  ? 370 GLU B CG  1 
ATOM   5283  C  CD  . GLU B 2 340 ? 100.324 18.656  -0.836  1.00 125.87 ? 370 GLU B CD  1 
ATOM   5284  O  OE1 . GLU B 2 340 ? 100.763 19.505  -1.647  1.00 136.74 ? 370 GLU B OE1 1 
ATOM   5285  O  OE2 . GLU B 2 340 ? 99.677  18.960  0.192   1.00 127.15 ? 370 GLU B OE2 1 
ATOM   5286  N  N   . ARG B 2 341 ? 100.089 16.288  -5.988  1.00 63.27  ? 371 ARG B N   1 
ATOM   5287  C  CA  . ARG B 2 341 ? 99.545  15.675  -7.206  1.00 61.48  ? 371 ARG B CA  1 
ATOM   5288  C  C   . ARG B 2 341 ? 98.083  15.167  -7.050  1.00 66.11  ? 371 ARG B C   1 
ATOM   5289  O  O   . ARG B 2 341 ? 97.726  14.077  -7.516  1.00 64.03  ? 371 ARG B O   1 
ATOM   5290  C  CB  . ARG B 2 341 ? 100.502 14.603  -7.713  1.00 58.47  ? 371 ARG B CB  1 
ATOM   5291  C  CG  . ARG B 2 341 ? 101.769 15.230  -8.266  1.00 61.33  ? 371 ARG B CG  1 
ATOM   5292  C  CD  . ARG B 2 341 ? 102.435 14.396  -9.335  1.00 68.29  ? 371 ARG B CD  1 
ATOM   5293  N  NE  . ARG B 2 341 ? 101.588 14.186  -10.505 1.00 72.78  ? 371 ARG B NE  1 
ATOM   5294  C  CZ  . ARG B 2 341 ? 101.383 15.089  -11.457 1.00 89.55  ? 371 ARG B CZ  1 
ATOM   5295  N  NH1 . ARG B 2 341 ? 101.948 16.291  -11.377 1.00 63.31  ? 371 ARG B NH1 1 
ATOM   5296  N  NH2 . ARG B 2 341 ? 100.608 14.807  -12.487 1.00 87.16  ? 371 ARG B NH2 1 
ATOM   5297  N  N   . LYS B 2 342 ? 97.247  16.006  -6.390  1.00 63.90  ? 372 LYS B N   1 
ATOM   5298  C  CA  . LYS B 2 342 ? 95.831  15.781  -6.089  1.00 62.20  ? 372 LYS B CA  1 
ATOM   5299  C  C   . LYS B 2 342 ? 94.996  16.940  -6.611  1.00 64.77  ? 372 LYS B C   1 
ATOM   5300  O  O   . LYS B 2 342 ? 95.447  18.087  -6.619  1.00 66.29  ? 372 LYS B O   1 
ATOM   5301  C  CB  . LYS B 2 342 ? 95.626  15.591  -4.570  1.00 65.71  ? 372 LYS B CB  1 
ATOM   5302  C  CG  . LYS B 2 342 ? 95.963  14.175  -4.078  1.00 79.61  ? 372 LYS B CG  1 
ATOM   5303  C  CD  . LYS B 2 342 ? 95.940  14.059  -2.571  1.00 100.84 ? 372 LYS B CD  1 
ATOM   5304  C  CE  . LYS B 2 342 ? 97.332  13.891  -1.990  1.00 125.08 ? 372 LYS B CE  1 
ATOM   5305  N  NZ  . LYS B 2 342 ? 97.465  14.457  -0.611  1.00 136.83 ? 372 LYS B NZ  1 
ATOM   5306  N  N   . TRP B 2 343 ? 93.785  16.643  -7.067  1.00 58.72  ? 373 TRP B N   1 
ATOM   5307  C  CA  . TRP B 2 343 ? 92.899  17.671  -7.595  1.00 57.28  ? 373 TRP B CA  1 
ATOM   5308  C  C   . TRP B 2 343 ? 92.190  18.387  -6.450  1.00 62.36  ? 373 TRP B C   1 
ATOM   5309  O  O   . TRP B 2 343 ? 91.623  17.753  -5.565  1.00 61.23  ? 373 TRP B O   1 
ATOM   5310  C  CB  . TRP B 2 343 ? 91.918  17.069  -8.587  1.00 53.99  ? 373 TRP B CB  1 
ATOM   5311  C  CG  . TRP B 2 343 ? 92.537  16.713  -9.896  1.00 53.98  ? 373 TRP B CG  1 
ATOM   5312  C  CD1 . TRP B 2 343 ? 92.868  15.469  -10.333 1.00 56.09  ? 373 TRP B CD1 1 
ATOM   5313  C  CD2 . TRP B 2 343 ? 92.870  17.617  -10.960 1.00 54.10  ? 373 TRP B CD2 1 
ATOM   5314  N  NE1 . TRP B 2 343 ? 93.359  15.533  -11.620 1.00 55.15  ? 373 TRP B NE1 1 
ATOM   5315  C  CE2 . TRP B 2 343 ? 93.379  16.845  -12.024 1.00 56.93  ? 373 TRP B CE2 1 
ATOM   5316  C  CE3 . TRP B 2 343 ? 92.806  19.014  -11.114 1.00 56.34  ? 373 TRP B CE3 1 
ATOM   5317  C  CZ2 . TRP B 2 343 ? 93.794  17.421  -13.233 1.00 55.65  ? 373 TRP B CZ2 1 
ATOM   5318  C  CZ3 . TRP B 2 343 ? 93.209  19.579  -12.315 1.00 56.56  ? 373 TRP B CZ3 1 
ATOM   5319  C  CH2 . TRP B 2 343 ? 93.705  18.788  -13.351 1.00 55.95  ? 373 TRP B CH2 1 
ATOM   5320  N  N   . GLU B 2 344 ? 92.275  19.716  -6.456  1.00 61.20  ? 374 GLU B N   1 
ATOM   5321  C  CA  . GLU B 2 344 ? 91.738  20.609  -5.436  1.00 62.97  ? 374 GLU B CA  1 
ATOM   5322  C  C   . GLU B 2 344 ? 90.640  21.477  -6.030  1.00 69.89  ? 374 GLU B C   1 
ATOM   5323  O  O   . GLU B 2 344 ? 90.781  21.913  -7.166  1.00 71.58  ? 374 GLU B O   1 
ATOM   5324  C  CB  . GLU B 2 344 ? 92.896  21.493  -4.949  1.00 65.67  ? 374 GLU B CB  1 
ATOM   5325  C  CG  . GLU B 2 344 ? 92.573  22.460  -3.826  1.00 83.93  ? 374 GLU B CG  1 
ATOM   5326  C  CD  . GLU B 2 344 ? 93.750  23.287  -3.341  1.00 113.55 ? 374 GLU B CD  1 
ATOM   5327  O  OE1 . GLU B 2 344 ? 93.576  24.521  -3.181  1.00 97.37  ? 374 GLU B OE1 1 
ATOM   5328  O  OE2 . GLU B 2 344 ? 94.824  22.699  -3.063  1.00 105.99 ? 374 GLU B OE2 1 
ATOM   5329  N  N   . ARG B 2 345 ? 89.562  21.752  -5.278  1.00 67.14  ? 375 ARG B N   1 
ATOM   5330  C  CA  . ARG B 2 345 ? 88.486  22.649  -5.733  1.00 66.96  ? 375 ARG B CA  1 
ATOM   5331  C  C   . ARG B 2 345 ? 88.994  24.092  -5.571  1.00 70.21  ? 375 ARG B C   1 
ATOM   5332  O  O   . ARG B 2 345 ? 89.481  24.453  -4.499  1.00 71.96  ? 375 ARG B O   1 
ATOM   5333  C  CB  . ARG B 2 345 ? 87.223  22.477  -4.886  1.00 69.75  ? 375 ARG B CB  1 
ATOM   5334  C  CG  . ARG B 2 345 ? 86.537  21.151  -5.072  1.00 83.60  ? 375 ARG B CG  1 
ATOM   5335  C  CD  . ARG B 2 345 ? 85.334  21.027  -4.157  1.00 95.59  ? 375 ARG B CD  1 
ATOM   5336  N  NE  . ARG B 2 345 ? 84.109  21.518  -4.791  1.00 104.38 ? 375 ARG B NE  1 
ATOM   5337  C  CZ  . ARG B 2 345 ? 82.888  21.252  -4.342  1.00 118.13 ? 375 ARG B CZ  1 
ATOM   5338  N  NH1 . ARG B 2 345 ? 82.721  20.504  -3.257  1.00 111.58 ? 375 ARG B NH1 1 
ATOM   5339  N  NH2 . ARG B 2 345 ? 81.823  21.730  -4.975  1.00 96.74  ? 375 ARG B NH2 1 
ATOM   5340  N  N   . VAL B 2 346 ? 88.921  24.897  -6.638  1.00 63.85  ? 376 VAL B N   1 
ATOM   5341  C  CA  . VAL B 2 346 ? 89.403  26.275  -6.609  1.00 63.93  ? 376 VAL B CA  1 
ATOM   5342  C  C   . VAL B 2 346 ? 88.346  27.296  -7.083  1.00 66.98  ? 376 VAL B C   1 
ATOM   5343  O  O   . VAL B 2 346 ? 88.618  28.503  -7.105  1.00 67.34  ? 376 VAL B O   1 
ATOM   5344  C  CB  . VAL B 2 346 ? 90.754  26.435  -7.355  1.00 67.51  ? 376 VAL B CB  1 
ATOM   5345  C  CG1 . VAL B 2 346 ? 91.897  25.781  -6.575  1.00 67.33  ? 376 VAL B CG1 1 
ATOM   5346  C  CG2 . VAL B 2 346 ? 90.689  25.921  -8.802  1.00 65.48  ? 376 VAL B CG2 1 
ATOM   5347  N  N   . GLY B 2 347 ? 87.157  26.795  -7.411  1.00 63.60  ? 377 GLY B N   1 
ATOM   5348  C  CA  . GLY B 2 347 ? 86.031  27.592  -7.881  1.00 64.63  ? 377 GLY B CA  1 
ATOM   5349  C  C   . GLY B 2 347 ? 84.802  26.792  -8.276  1.00 69.60  ? 377 GLY B C   1 
ATOM   5350  O  O   . GLY B 2 347 ? 84.836  25.554  -8.331  1.00 67.52  ? 377 GLY B O   1 
ATOM   5351  N  N   . LYS B 2 348 ? 83.714  27.517  -8.581  1.00 69.21  ? 378 LYS B N   1 
ATOM   5352  C  CA  . LYS B 2 348 ? 82.412  26.979  -8.955  1.00 70.76  ? 378 LYS B CA  1 
ATOM   5353  C  C   . LYS B 2 348 ? 81.789  27.835  -10.038 1.00 81.23  ? 378 LYS B C   1 
ATOM   5354  O  O   . LYS B 2 348 ? 81.940  29.052  -10.010 1.00 82.25  ? 378 LYS B O   1 
ATOM   5355  C  CB  . LYS B 2 348 ? 81.473  26.978  -7.732  1.00 75.79  ? 378 LYS B CB  1 
ATOM   5356  C  CG  . LYS B 2 348 ? 81.635  25.776  -6.798  1.00 106.51 ? 378 LYS B CG  1 
ATOM   5357  C  CD  . LYS B 2 348 ? 82.650  25.989  -5.651  1.00 122.77 ? 378 LYS B CD  1 
ATOM   5358  C  CE  . LYS B 2 348 ? 83.519  24.766  -5.419  1.00 132.12 ? 378 LYS B CE  1 
ATOM   5359  N  NZ  . LYS B 2 348 ? 84.446  24.943  -4.270  1.00 143.62 ? 378 LYS B NZ  1 
ATOM   5360  N  N   . TRP B 2 349 ? 81.073  27.198  -10.978 1.00 82.34  ? 379 TRP B N   1 
ATOM   5361  C  CA  . TRP B 2 349 ? 80.348  27.833  -12.081 1.00 85.64  ? 379 TRP B CA  1 
ATOM   5362  C  C   . TRP B 2 349 ? 78.926  27.330  -11.970 1.00 93.06  ? 379 TRP B C   1 
ATOM   5363  O  O   . TRP B 2 349 ? 78.654  26.169  -12.275 1.00 90.65  ? 379 TRP B O   1 
ATOM   5364  C  CB  . TRP B 2 349 ? 80.960  27.431  -13.421 1.00 84.06  ? 379 TRP B CB  1 
ATOM   5365  C  CG  . TRP B 2 349 ? 80.115  27.758  -14.613 1.00 85.83  ? 379 TRP B CG  1 
ATOM   5366  C  CD1 . TRP B 2 349 ? 79.209  26.945  -15.231 1.00 88.05  ? 379 TRP B CD1 1 
ATOM   5367  C  CD2 . TRP B 2 349 ? 80.157  28.962  -15.372 1.00 86.96  ? 379 TRP B CD2 1 
ATOM   5368  N  NE1 . TRP B 2 349 ? 78.669  27.581  -16.323 1.00 88.16  ? 379 TRP B NE1 1 
ATOM   5369  C  CE2 . TRP B 2 349 ? 79.243  28.817  -16.443 1.00 90.66  ? 379 TRP B CE2 1 
ATOM   5370  C  CE3 . TRP B 2 349 ? 80.884  30.157  -15.256 1.00 89.79  ? 379 TRP B CE3 1 
ATOM   5371  C  CZ2 . TRP B 2 349 ? 79.051  29.811  -17.398 1.00 90.74  ? 379 TRP B CZ2 1 
ATOM   5372  C  CZ3 . TRP B 2 349 ? 80.670  31.153  -16.187 1.00 92.35  ? 379 TRP B CZ3 1 
ATOM   5373  C  CH2 . TRP B 2 349 ? 79.776  30.970  -17.254 1.00 92.59  ? 379 TRP B CH2 1 
ATOM   5374  N  N   . LYS B 2 350 ? 78.029  28.186  -11.495 1.00 95.25  ? 380 LYS B N   1 
ATOM   5375  C  CA  . LYS B 2 350 ? 76.652  27.794  -11.212 1.00 97.11  ? 380 LYS B CA  1 
ATOM   5376  C  C   . LYS B 2 350 ? 75.643  28.182  -12.292 1.00 104.11 ? 380 LYS B C   1 
ATOM   5377  O  O   . LYS B 2 350 ? 74.959  27.311  -12.848 1.00 103.36 ? 380 LYS B O   1 
ATOM   5378  C  CB  . LYS B 2 350 ? 76.192  28.312  -9.825  1.00 102.15 ? 380 LYS B CB  1 
ATOM   5379  C  CG  . LYS B 2 350 ? 77.250  29.053  -8.989  1.00 123.23 ? 380 LYS B CG  1 
ATOM   5380  C  CD  . LYS B 2 350 ? 77.248  30.564  -9.256  1.00 137.41 ? 380 LYS B CD  1 
ATOM   5381  C  CE  . LYS B 2 350 ? 78.330  31.285  -8.495  1.00 149.31 ? 380 LYS B CE  1 
ATOM   5382  N  NZ  . LYS B 2 350 ? 78.250  32.755  -8.697  1.00 160.17 ? 380 LYS B NZ  1 
ATOM   5383  N  N   . ASP B 2 351 ? 75.524  29.487  -12.562 1.00 103.11 ? 381 ASP B N   1 
ATOM   5384  C  CA  . ASP B 2 351 ? 74.528  30.021  -13.491 1.00 103.74 ? 381 ASP B CA  1 
ATOM   5385  C  C   . ASP B 2 351 ? 75.080  31.267  -14.145 1.00 106.34 ? 381 ASP B C   1 
ATOM   5386  O  O   . ASP B 2 351 ? 74.917  32.373  -13.600 1.00 108.11 ? 381 ASP B O   1 
ATOM   5387  C  CB  . ASP B 2 351 ? 73.229  30.340  -12.710 1.00 108.03 ? 381 ASP B CB  1 
ATOM   5388  C  CG  . ASP B 2 351 ? 73.459  30.580  -11.222 1.00 118.18 ? 381 ASP B CG  1 
ATOM   5389  O  OD1 . ASP B 2 351 ? 74.331  31.417  -10.883 1.00 118.40 ? 381 ASP B OD1 1 
ATOM   5390  O  OD2 . ASP B 2 351 ? 72.834  29.861  -10.399 1.00 124.20 ? 381 ASP B OD2 1 
ATOM   5391  N  N   . LYS B 2 352 ? 75.799  31.072  -15.284 1.00 99.18  ? 382 LYS B N   1 
ATOM   5392  C  CA  . LYS B 2 352 ? 76.479  32.114  -16.068 1.00 98.54  ? 382 LYS B CA  1 
ATOM   5393  C  C   . LYS B 2 352 ? 77.617  32.849  -15.258 1.00 98.16  ? 382 LYS B C   1 
ATOM   5394  O  O   . LYS B 2 352 ? 78.435  33.547  -15.870 1.00 97.47  ? 382 LYS B O   1 
ATOM   5395  C  CB  . LYS B 2 352 ? 75.453  33.109  -16.705 1.00 104.13 ? 382 LYS B CB  1 
ATOM   5396  C  CG  . LYS B 2 352 ? 75.167  34.434  -15.915 1.00 125.45 ? 382 LYS B CG  1 
ATOM   5397  C  CD  . LYS B 2 352 ? 73.783  35.057  -16.192 1.00 132.54 ? 382 LYS B CD  1 
ATOM   5398  C  CE  . LYS B 2 352 ? 73.696  35.803  -17.506 1.00 138.60 ? 382 LYS B CE  1 
ATOM   5399  N  NZ  . LYS B 2 352 ? 72.287  36.062  -17.903 1.00 146.57 ? 382 LYS B NZ  1 
ATOM   5400  N  N   . SER B 2 353 ? 77.657  32.678  -13.898 1.00 91.02  ? 383 SER B N   1 
ATOM   5401  C  CA  . SER B 2 353 ? 78.601  33.317  -12.975 1.00 89.36  ? 383 SER B CA  1 
ATOM   5402  C  C   . SER B 2 353 ? 79.623  32.377  -12.309 1.00 85.19  ? 383 SER B C   1 
ATOM   5403  O  O   . SER B 2 353 ? 79.288  31.300  -11.800 1.00 82.82  ? 383 SER B O   1 
ATOM   5404  C  CB  . SER B 2 353 ? 77.856  34.102  -11.910 1.00 96.01  ? 383 SER B CB  1 
ATOM   5405  O  OG  . SER B 2 353 ? 78.758  34.980  -11.256 1.00 111.07 ? 383 SER B OG  1 
ATOM   5406  N  N   . LEU B 2 354 ? 80.880  32.845  -12.299 1.00 77.52  ? 384 LEU B N   1 
ATOM   5407  C  CA  . LEU B 2 354 ? 82.059  32.175  -11.752 1.00 74.02  ? 384 LEU B CA  1 
ATOM   5408  C  C   . LEU B 2 354 ? 82.408  32.720  -10.371 1.00 74.81  ? 384 LEU B C   1 
ATOM   5409  O  O   . LEU B 2 354 ? 82.465  33.935  -10.143 1.00 75.57  ? 384 LEU B O   1 
ATOM   5410  C  CB  . LEU B 2 354 ? 83.244  32.352  -12.725 1.00 73.15  ? 384 LEU B CB  1 
ATOM   5411  C  CG  . LEU B 2 354 ? 84.532  31.577  -12.471 1.00 76.45  ? 384 LEU B CG  1 
ATOM   5412  C  CD1 . LEU B 2 354 ? 84.453  30.169  -13.056 1.00 73.80  ? 384 LEU B CD1 1 
ATOM   5413  C  CD2 . LEU B 2 354 ? 85.697  32.292  -13.099 1.00 79.10  ? 384 LEU B CD2 1 
ATOM   5414  N  N   . GLN B 2 355 ? 82.610  31.809  -9.442  1.00 69.02  ? 385 GLN B N   1 
ATOM   5415  C  CA  . GLN B 2 355 ? 82.959  32.186  -8.097  1.00 70.05  ? 385 GLN B CA  1 
ATOM   5416  C  C   . GLN B 2 355 ? 84.194  31.433  -7.745  1.00 69.96  ? 385 GLN B C   1 
ATOM   5417  O  O   . GLN B 2 355 ? 84.148  30.225  -7.594  1.00 68.41  ? 385 GLN B O   1 
ATOM   5418  C  CB  . GLN B 2 355 ? 81.790  31.979  -7.109  1.00 73.14  ? 385 GLN B CB  1 
ATOM   5419  C  CG  . GLN B 2 355 ? 81.965  32.733  -5.764  1.00 114.55 ? 385 GLN B CG  1 
ATOM   5420  C  CD  . GLN B 2 355 ? 82.414  34.191  -5.867  1.00 145.36 ? 385 GLN B CD  1 
ATOM   5421  O  OE1 . GLN B 2 355 ? 83.488  34.571  -5.376  1.00 140.34 ? 385 GLN B OE1 1 
ATOM   5422  N  NE2 . GLN B 2 355 ? 81.608  35.040  -6.503  1.00 143.42 ? 385 GLN B NE2 1 
ATOM   5423  N  N   . MET B 2 356 ? 85.331  32.123  -7.764  1.00 66.02  ? 386 MET B N   1 
ATOM   5424  C  CA  . MET B 2 356 ? 86.630  31.518  -7.504  1.00 63.80  ? 386 MET B CA  1 
ATOM   5425  C  C   . MET B 2 356 ? 86.989  31.632  -6.051  1.00 70.25  ? 386 MET B C   1 
ATOM   5426  O  O   . MET B 2 356 ? 86.417  32.461  -5.326  1.00 73.09  ? 386 MET B O   1 
ATOM   5427  C  CB  . MET B 2 356 ? 87.729  32.127  -8.384  1.00 65.09  ? 386 MET B CB  1 
ATOM   5428  C  CG  . MET B 2 356 ? 87.491  31.955  -9.885  1.00 66.14  ? 386 MET B CG  1 
ATOM   5429  S  SD  . MET B 2 356 ? 87.332  30.247  -10.438 1.00 66.68  ? 386 MET B SD  1 
ATOM   5430  C  CE  . MET B 2 356 ? 89.077  29.721  -10.416 1.00 62.55  ? 386 MET B CE  1 
ATOM   5431  N  N   . LYS B 2 357 ? 87.938  30.785  -5.626  1.00 64.44  ? 387 LYS B N   1 
ATOM   5432  C  CA  . LYS B 2 357 ? 88.444  30.729  -4.262  1.00 64.62  ? 387 LYS B CA  1 
ATOM   5433  C  C   . LYS B 2 357 ? 89.478  31.860  -4.040  1.00 72.30  ? 387 LYS B C   1 
ATOM   5434  O  O   . LYS B 2 357 ? 89.336  32.640  -3.094  1.00 74.75  ? 387 LYS B O   1 
ATOM   5435  C  CB  . LYS B 2 357 ? 89.051  29.338  -4.000  1.00 63.95  ? 387 LYS B CB  1 
ATOM   5436  C  CG  . LYS B 2 357 ? 89.462  29.069  -2.574  1.00 64.88  ? 387 LYS B CG  1 
ATOM   5437  C  CD  . LYS B 2 357 ? 90.443  27.922  -2.489  1.00 71.63  ? 387 LYS B CD  1 
ATOM   5438  C  CE  . LYS B 2 357 ? 91.012  27.788  -1.088  1.00 86.78  ? 387 LYS B CE  1 
ATOM   5439  N  NZ  . LYS B 2 357 ? 92.115  26.783  -1.012  1.00 94.07  ? 387 LYS B NZ  1 
ATOM   5440  N  N   . TYR B 2 358 ? 90.476  31.972  -4.943  1.00 68.19  ? 388 TYR B N   1 
ATOM   5441  C  CA  . TYR B 2 358 ? 91.575  32.918  -4.856  1.00 69.00  ? 388 TYR B CA  1 
ATOM   5442  C  C   . TYR B 2 358 ? 91.445  34.179  -5.662  1.00 74.71  ? 388 TYR B C   1 
ATOM   5443  O  O   . TYR B 2 358 ? 90.899  34.160  -6.758  1.00 74.17  ? 388 TYR B O   1 
ATOM   5444  C  CB  . TYR B 2 358 ? 92.867  32.221  -5.292  1.00 69.50  ? 388 TYR B CB  1 
ATOM   5445  C  CG  . TYR B 2 358 ? 93.191  30.931  -4.569  1.00 71.59  ? 388 TYR B CG  1 
ATOM   5446  C  CD1 . TYR B 2 358 ? 93.660  30.940  -3.252  1.00 74.91  ? 388 TYR B CD1 1 
ATOM   5447  C  CD2 . TYR B 2 358 ? 93.134  29.716  -5.230  1.00 70.86  ? 388 TYR B CD2 1 
ATOM   5448  C  CE1 . TYR B 2 358 ? 93.997  29.761  -2.596  1.00 75.05  ? 388 TYR B CE1 1 
ATOM   5449  C  CE2 . TYR B 2 358 ? 93.494  28.535  -4.594  1.00 71.75  ? 388 TYR B CE2 1 
ATOM   5450  C  CZ  . TYR B 2 358 ? 93.928  28.562  -3.276  1.00 82.66  ? 388 TYR B CZ  1 
ATOM   5451  O  OH  . TYR B 2 358 ? 94.289  27.403  -2.630  1.00 85.97  ? 388 TYR B OH  1 
ATOM   5452  N  N   . TYR B 2 359 ? 92.047  35.269  -5.178  1.00 74.60  ? 389 TYR B N   1 
ATOM   5453  C  CA  . TYR B 2 359 ? 92.103  36.465  -6.011  1.00 75.70  ? 389 TYR B CA  1 
ATOM   5454  C  C   . TYR B 2 359 ? 93.389  36.353  -6.835  1.00 79.55  ? 389 TYR B C   1 
ATOM   5455  O  O   . TYR B 2 359 ? 93.378  36.563  -8.036  1.00 79.25  ? 389 TYR B O   1 
ATOM   5456  C  CB  . TYR B 2 359 ? 92.056  37.756  -5.194  1.00 79.07  ? 389 TYR B CB  1 
ATOM   5457  C  CG  . TYR B 2 359 ? 92.231  39.000  -6.037  1.00 81.52  ? 389 TYR B CG  1 
ATOM   5458  C  CD1 . TYR B 2 359 ? 91.196  39.480  -6.831  1.00 82.76  ? 389 TYR B CD1 1 
ATOM   5459  C  CD2 . TYR B 2 359 ? 93.428  39.704  -6.031  1.00 84.33  ? 389 TYR B CD2 1 
ATOM   5460  C  CE1 . TYR B 2 359 ? 91.354  40.629  -7.606  1.00 86.41  ? 389 TYR B CE1 1 
ATOM   5461  C  CE2 . TYR B 2 359 ? 93.592  40.866  -6.783  1.00 86.81  ? 389 TYR B CE2 1 
ATOM   5462  C  CZ  . TYR B 2 359 ? 92.553  41.330  -7.567  1.00 95.46  ? 389 TYR B CZ  1 
ATOM   5463  O  OH  . TYR B 2 359 ? 92.744  42.478  -8.307  1.00 97.56  ? 389 TYR B OH  1 
ATOM   5464  N  N   . VAL B 2 360 ? 94.478  35.998  -6.173  1.00 76.25  ? 390 VAL B N   1 
ATOM   5465  C  CA  . VAL B 2 360 ? 95.797  35.771  -6.744  1.00 75.33  ? 390 VAL B CA  1 
ATOM   5466  C  C   . VAL B 2 360 ? 96.038  34.276  -6.554  1.00 79.40  ? 390 VAL B C   1 
ATOM   5467  O  O   . VAL B 2 360 ? 95.794  33.783  -5.457  1.00 79.22  ? 390 VAL B O   1 
ATOM   5468  C  CB  . VAL B 2 360 ? 96.821  36.612  -5.937  1.00 80.90  ? 390 VAL B CB  1 
ATOM   5469  C  CG1 . VAL B 2 360 ? 98.262  36.208  -6.233  1.00 80.52  ? 390 VAL B CG1 1 
ATOM   5470  C  CG2 . VAL B 2 360 ? 96.608  38.097  -6.165  1.00 82.43  ? 390 VAL B CG2 1 
ATOM   5471  N  N   . TRP B 2 361 ? 96.554  33.559  -7.558  1.00 75.82  ? 391 TRP B N   1 
ATOM   5472  C  CA  . TRP B 2 361 ? 96.849  32.133  -7.431  1.00 74.88  ? 391 TRP B CA  1 
ATOM   5473  C  C   . TRP B 2 361 ? 98.111  31.831  -6.607  1.00 82.78  ? 391 TRP B C   1 
ATOM   5474  O  O   . TRP B 2 361 ? 99.160  32.406  -6.906  1.00 84.72  ? 391 TRP B O   1 
ATOM   5475  C  CB  . TRP B 2 361 ? 97.050  31.551  -8.800  1.00 72.11  ? 391 TRP B CB  1 
ATOM   5476  C  CG  . TRP B 2 361 ? 95.797  31.504  -9.590  1.00 72.62  ? 391 TRP B CG  1 
ATOM   5477  C  CD1 . TRP B 2 361 ? 95.297  32.492  -10.379 1.00 76.16  ? 391 TRP B CD1 1 
ATOM   5478  C  CD2 . TRP B 2 361 ? 94.882  30.397  -9.696  1.00 70.96  ? 391 TRP B CD2 1 
ATOM   5479  N  NE1 . TRP B 2 361 ? 94.148  32.065  -10.998 1.00 74.63  ? 391 TRP B NE1 1 
ATOM   5480  C  CE2 . TRP B 2 361 ? 93.851  30.792  -10.575 1.00 74.65  ? 391 TRP B CE2 1 
ATOM   5481  C  CE3 . TRP B 2 361 ? 94.812  29.122  -9.105  1.00 71.02  ? 391 TRP B CE3 1 
ATOM   5482  C  CZ2 . TRP B 2 361 ? 92.775  29.950  -10.898 1.00 71.98  ? 391 TRP B CZ2 1 
ATOM   5483  C  CZ3 . TRP B 2 361 ? 93.757  28.284  -9.442  1.00 70.57  ? 391 TRP B CZ3 1 
ATOM   5484  C  CH2 . TRP B 2 361 ? 92.746  28.706  -10.311 1.00 70.58  ? 391 TRP B CH2 1 
ATOM   5485  N  N   . PRO B 2 362 ? 98.088  30.892  -5.622  1.00 79.01  ? 392 PRO B N   1 
ATOM   5486  C  CA  . PRO B 2 362 ? 99.320  30.593  -4.863  1.00 77.90  ? 392 PRO B CA  1 
ATOM   5487  C  C   . PRO B 2 362 ? 100.041 29.361  -5.434  1.00 114.02 ? 392 PRO B C   1 
ATOM   5488  O  O   . PRO B 2 362 ? 101.261 29.331  -5.600  1.00 73.82  ? 392 PRO B O   1 
ATOM   5489  C  CB  . PRO B 2 362 ? 98.795  30.334  -3.451  1.00 79.80  ? 392 PRO B CB  1 
ATOM   5490  C  CG  . PRO B 2 362 ? 97.333  29.996  -3.618  1.00 83.26  ? 392 PRO B CG  1 
ATOM   5491  C  CD  . PRO B 2 362 ? 96.954  30.122  -5.077  1.00 78.54  ? 392 PRO B CD  1 
ATOM   5492  N  N   . ASP C 1 1   ? 12.069  -39.238 -20.686 1.00 116.28 ? 23  ASP C N   1 
ATOM   5493  C  CA  . ASP C 1 1   ? 12.891  -38.501 -21.642 1.00 114.15 ? 23  ASP C CA  1 
ATOM   5494  C  C   . ASP C 1 1   ? 12.386  -37.026 -21.860 1.00 113.17 ? 23  ASP C C   1 
ATOM   5495  O  O   . ASP C 1 1   ? 11.611  -36.759 -22.792 1.00 112.45 ? 23  ASP C O   1 
ATOM   5496  C  CB  . ASP C 1 1   ? 13.056  -39.287 -22.973 1.00 117.88 ? 23  ASP C CB  1 
ATOM   5497  C  CG  . ASP C 1 1   ? 13.954  -38.620 -24.014 1.00 129.66 ? 23  ASP C CG  1 
ATOM   5498  O  OD1 . ASP C 1 1   ? 15.086  -38.207 -23.655 1.00 129.61 ? 23  ASP C OD1 1 
ATOM   5499  O  OD2 . ASP C 1 1   ? 13.534  -38.528 -25.189 1.00 136.34 ? 23  ASP C OD2 1 
ATOM   5500  N  N   . PRO C 1 2   ? 12.821  -36.056 -21.009 1.00 105.07 ? 24  PRO C N   1 
ATOM   5501  C  CA  . PRO C 1 2   ? 12.391  -34.671 -21.220 1.00 101.17 ? 24  PRO C CA  1 
ATOM   5502  C  C   . PRO C 1 2   ? 13.297  -33.971 -22.227 1.00 101.23 ? 24  PRO C C   1 
ATOM   5503  O  O   . PRO C 1 2   ? 14.305  -34.542 -22.655 1.00 101.71 ? 24  PRO C O   1 
ATOM   5504  C  CB  . PRO C 1 2   ? 12.524  -34.051 -19.828 1.00 102.14 ? 24  PRO C CB  1 
ATOM   5505  C  CG  . PRO C 1 2   ? 13.649  -34.796 -19.188 1.00 108.21 ? 24  PRO C CG  1 
ATOM   5506  C  CD  . PRO C 1 2   ? 13.742  -36.158 -19.851 1.00 106.48 ? 24  PRO C CD  1 
ATOM   5507  N  N   . LYS C 1 3   ? 12.938  -32.728 -22.587 1.00 94.02  ? 25  LYS C N   1 
ATOM   5508  C  CA  . LYS C 1 3   ? 13.681  -31.874 -23.503 1.00 91.17  ? 25  LYS C CA  1 
ATOM   5509  C  C   . LYS C 1 3   ? 14.723  -31.096 -22.714 1.00 93.62  ? 25  LYS C C   1 
ATOM   5510  O  O   . LYS C 1 3   ? 14.375  -30.413 -21.749 1.00 92.72  ? 25  LYS C O   1 
ATOM   5511  C  CB  . LYS C 1 3   ? 12.717  -30.915 -24.216 1.00 91.43  ? 25  LYS C CB  1 
ATOM   5512  C  CG  . LYS C 1 3   ? 13.395  -30.023 -25.237 1.00 97.03  ? 25  LYS C CG  1 
ATOM   5513  C  CD  . LYS C 1 3   ? 12.508  -28.848 -25.571 1.00 101.28 ? 25  LYS C CD  1 
ATOM   5514  C  CE  . LYS C 1 3   ? 13.214  -27.819 -26.407 1.00 106.66 ? 25  LYS C CE  1 
ATOM   5515  N  NZ  . LYS C 1 3   ? 13.487  -28.326 -27.775 1.00 114.60 ? 25  LYS C NZ  1 
ATOM   5516  N  N   . ILE C 1 4   ? 15.995  -31.193 -23.112 1.00 90.07  ? 26  ILE C N   1 
ATOM   5517  C  CA  . ILE C 1 4   ? 17.038  -30.465 -22.399 1.00 88.37  ? 26  ILE C CA  1 
ATOM   5518  C  C   . ILE C 1 4   ? 17.205  -29.052 -22.964 1.00 89.49  ? 26  ILE C C   1 
ATOM   5519  O  O   . ILE C 1 4   ? 17.629  -28.874 -24.112 1.00 88.25  ? 26  ILE C O   1 
ATOM   5520  C  CB  . ILE C 1 4   ? 18.359  -31.247 -22.288 1.00 92.62  ? 26  ILE C CB  1 
ATOM   5521  C  CG1 . ILE C 1 4   ? 18.166  -32.457 -21.347 1.00 95.17  ? 26  ILE C CG1 1 
ATOM   5522  C  CG2 . ILE C 1 4   ? 19.505  -30.327 -21.815 1.00 91.36  ? 26  ILE C CG2 1 
ATOM   5523  C  CD1 . ILE C 1 4   ? 19.385  -33.359 -21.185 1.00 108.79 ? 26  ILE C CD1 1 
ATOM   5524  N  N   . VAL C 1 5   ? 16.857  -28.066 -22.127 1.00 84.78  ? 27  VAL C N   1 
ATOM   5525  C  CA  . VAL C 1 5   ? 16.926  -26.619 -22.367 1.00 82.64  ? 27  VAL C CA  1 
ATOM   5526  C  C   . VAL C 1 5   ? 18.125  -26.072 -21.602 1.00 83.95  ? 27  VAL C C   1 
ATOM   5527  O  O   . VAL C 1 5   ? 18.141  -26.112 -20.370 1.00 84.15  ? 27  VAL C O   1 
ATOM   5528  C  CB  . VAL C 1 5   ? 15.605  -25.894 -21.991 1.00 86.90  ? 27  VAL C CB  1 
ATOM   5529  C  CG1 . VAL C 1 5   ? 14.642  -25.909 -23.166 1.00 87.12  ? 27  VAL C CG1 1 
ATOM   5530  C  CG2 . VAL C 1 5   ? 14.943  -26.495 -20.757 1.00 88.55  ? 27  VAL C CG2 1 
ATOM   5531  N  N   . ASN C 1 6   ? 19.146  -25.610 -22.329 1.00 78.03  ? 28  ASN C N   1 
ATOM   5532  C  CA  . ASN C 1 6   ? 20.370  -25.114 -21.717 1.00 76.39  ? 28  ASN C CA  1 
ATOM   5533  C  C   . ASN C 1 6   ? 20.305  -23.663 -21.304 1.00 76.63  ? 28  ASN C C   1 
ATOM   5534  O  O   . ASN C 1 6   ? 19.754  -22.827 -22.018 1.00 74.51  ? 28  ASN C O   1 
ATOM   5535  C  CB  . ASN C 1 6   ? 21.573  -25.302 -22.643 1.00 79.04  ? 28  ASN C CB  1 
ATOM   5536  C  CG  . ASN C 1 6   ? 21.856  -26.724 -23.033 1.00 104.99 ? 28  ASN C CG  1 
ATOM   5537  O  OD1 . ASN C 1 6   ? 21.389  -27.206 -24.070 1.00 107.08 ? 28  ASN C OD1 1 
ATOM   5538  N  ND2 . ASN C 1 6   ? 22.632  -27.425 -22.240 1.00 92.63  ? 28  ASN C ND2 1 
ATOM   5539  N  N   . ILE C 1 7   ? 20.929  -23.365 -20.164 1.00 72.71  ? 29  ILE C N   1 
ATOM   5540  C  CA  . ILE C 1 7   ? 21.097  -22.015 -19.636 1.00 70.85  ? 29  ILE C CA  1 
ATOM   5541  C  C   . ILE C 1 7   ? 22.597  -21.790 -19.560 1.00 72.64  ? 29  ILE C C   1 
ATOM   5542  O  O   . ILE C 1 7   ? 23.316  -22.658 -19.059 1.00 72.83  ? 29  ILE C O   1 
ATOM   5543  C  CB  . ILE C 1 7   ? 20.351  -21.806 -18.293 1.00 74.35  ? 29  ILE C CB  1 
ATOM   5544  C  CG1 . ILE C 1 7   ? 18.844  -21.806 -18.558 1.00 76.21  ? 29  ILE C CG1 1 
ATOM   5545  C  CG2 . ILE C 1 7   ? 20.771  -20.505 -17.582 1.00 73.05  ? 29  ILE C CG2 1 
ATOM   5546  C  CD1 . ILE C 1 7   ? 18.024  -22.003 -17.346 1.00 94.10  ? 29  ILE C CD1 1 
ATOM   5547  N  N   . GLY C 1 8   ? 23.052  -20.680 -20.144 1.00 66.36  ? 30  GLY C N   1 
ATOM   5548  C  CA  . GLY C 1 8   ? 24.462  -20.323 -20.182 1.00 64.98  ? 30  GLY C CA  1 
ATOM   5549  C  C   . GLY C 1 8   ? 24.843  -19.272 -19.160 1.00 65.82  ? 30  GLY C C   1 
ATOM   5550  O  O   . GLY C 1 8   ? 23.976  -18.536 -18.665 1.00 64.80  ? 30  GLY C O   1 
ATOM   5551  N  N   . ALA C 1 9   ? 26.154  -19.204 -18.835 1.00 59.37  ? 31  ALA C N   1 
ATOM   5552  C  CA  . ALA C 1 9   ? 26.694  -18.216 -17.913 1.00 57.39  ? 31  ALA C CA  1 
ATOM   5553  C  C   . ALA C 1 9   ? 28.168  -17.891 -18.149 1.00 62.79  ? 31  ALA C C   1 
ATOM   5554  O  O   . ALA C 1 9   ? 28.953  -18.769 -18.502 1.00 64.63  ? 31  ALA C O   1 
ATOM   5555  C  CB  . ALA C 1 9   ? 26.477  -18.653 -16.477 1.00 58.58  ? 31  ALA C CB  1 
ATOM   5556  N  N   . VAL C 1 10  ? 28.537  -16.616 -17.952 1.00 58.49  ? 32  VAL C N   1 
ATOM   5557  C  CA  . VAL C 1 10  ? 29.911  -16.105 -18.012 1.00 58.39  ? 32  VAL C CA  1 
ATOM   5558  C  C   . VAL C 1 10  ? 30.132  -15.566 -16.606 1.00 62.63  ? 32  VAL C C   1 
ATOM   5559  O  O   . VAL C 1 10  ? 29.604  -14.510 -16.254 1.00 60.96  ? 32  VAL C O   1 
ATOM   5560  C  CB  . VAL C 1 10  ? 30.141  -15.014 -19.082 1.00 61.67  ? 32  VAL C CB  1 
ATOM   5561  C  CG1 . VAL C 1 10  ? 31.607  -14.606 -19.098 1.00 61.72  ? 32  VAL C CG1 1 
ATOM   5562  C  CG2 . VAL C 1 10  ? 29.664  -15.460 -20.474 1.00 61.67  ? 32  VAL C CG2 1 
ATOM   5563  N  N   . LEU C 1 11  ? 30.833  -16.343 -15.773 1.00 61.82  ? 33  LEU C N   1 
ATOM   5564  C  CA  . LEU C 1 11  ? 31.013  -16.061 -14.350 1.00 61.91  ? 33  LEU C CA  1 
ATOM   5565  C  C   . LEU C 1 11  ? 32.446  -15.799 -13.943 1.00 71.37  ? 33  LEU C C   1 
ATOM   5566  O  O   . LEU C 1 11  ? 33.348  -16.042 -14.727 1.00 73.27  ? 33  LEU C O   1 
ATOM   5567  C  CB  . LEU C 1 11  ? 30.398  -17.203 -13.531 1.00 62.06  ? 33  LEU C CB  1 
ATOM   5568  C  CG  . LEU C 1 11  ? 28.913  -17.484 -13.817 1.00 64.17  ? 33  LEU C CG  1 
ATOM   5569  C  CD1 . LEU C 1 11  ? 28.470  -18.730 -13.131 1.00 65.33  ? 33  LEU C CD1 1 
ATOM   5570  C  CD2 . LEU C 1 11  ? 28.019  -16.287 -13.458 1.00 61.39  ? 33  LEU C CD2 1 
ATOM   5571  N  N   . SER C 1 12  ? 32.666  -15.288 -12.722 1.00 69.44  ? 34  SER C N   1 
ATOM   5572  C  CA  . SER C 1 12  ? 34.002  -14.922 -12.255 1.00 69.47  ? 34  SER C CA  1 
ATOM   5573  C  C   . SER C 1 12  ? 34.937  -16.050 -11.999 1.00 74.08  ? 34  SER C C   1 
ATOM   5574  O  O   . SER C 1 12  ? 36.052  -16.008 -12.492 1.00 74.78  ? 34  SER C O   1 
ATOM   5575  C  CB  . SER C 1 12  ? 33.930  -14.053 -11.009 1.00 73.11  ? 34  SER C CB  1 
ATOM   5576  O  OG  . SER C 1 12  ? 33.420  -12.778 -11.362 1.00 86.49  ? 34  SER C OG  1 
ATOM   5577  N  N   . THR C 1 13  ? 34.544  -16.994 -11.140 1.00 70.72  ? 35  THR C N   1 
ATOM   5578  C  CA  . THR C 1 13  ? 35.421  -18.072 -10.697 1.00 71.43  ? 35  THR C CA  1 
ATOM   5579  C  C   . THR C 1 13  ? 34.873  -19.459 -11.025 1.00 74.98  ? 35  THR C C   1 
ATOM   5580  O  O   . THR C 1 13  ? 33.680  -19.613 -11.291 1.00 72.57  ? 35  THR C O   1 
ATOM   5581  C  CB  . THR C 1 13  ? 35.665  -17.936 -9.173  1.00 76.06  ? 35  THR C CB  1 
ATOM   5582  O  OG1 . THR C 1 13  ? 34.442  -18.152 -8.482  1.00 78.72  ? 35  THR C OG1 1 
ATOM   5583  C  CG2 . THR C 1 13  ? 36.191  -16.584 -8.766  1.00 71.69  ? 35  THR C CG2 1 
ATOM   5584  N  N   . LYS C 1 14  ? 35.753  -20.479 -10.930 1.00 74.64  ? 36  LYS C N   1 
ATOM   5585  C  CA  . LYS C 1 14  ? 35.431  -21.892 -11.129 1.00 76.72  ? 36  LYS C CA  1 
ATOM   5586  C  C   . LYS C 1 14  ? 34.416  -22.372 -10.048 1.00 81.57  ? 36  LYS C C   1 
ATOM   5587  O  O   . LYS C 1 14  ? 33.653  -23.322 -10.290 1.00 81.91  ? 36  LYS C O   1 
ATOM   5588  C  CB  . LYS C 1 14  ? 36.719  -22.746 -11.129 1.00 81.07  ? 36  LYS C CB  1 
ATOM   5589  C  CG  . LYS C 1 14  ? 36.606  -24.001 -11.983 1.00 92.54  ? 36  LYS C CG  1 
ATOM   5590  C  CD  . LYS C 1 14  ? 37.947  -24.678 -12.248 1.00 103.88 ? 36  LYS C CD  1 
ATOM   5591  C  CE  . LYS C 1 14  ? 37.878  -25.598 -13.455 1.00 117.08 ? 36  LYS C CE  1 
ATOM   5592  N  NZ  . LYS C 1 14  ? 38.705  -26.833 -13.300 1.00 124.86 ? 36  LYS C NZ  1 
ATOM   5593  N  N   . LYS C 1 15  ? 34.383  -21.665 -8.888  1.00 76.62  ? 37  LYS C N   1 
ATOM   5594  C  CA  . LYS C 1 15  ? 33.476  -21.923 -7.768  1.00 76.66  ? 37  LYS C CA  1 
ATOM   5595  C  C   . LYS C 1 15  ? 32.128  -21.303 -8.037  1.00 79.83  ? 37  LYS C C   1 
ATOM   5596  O  O   . LYS C 1 15  ? 31.127  -21.795 -7.524  1.00 80.97  ? 37  LYS C O   1 
ATOM   5597  C  CB  . LYS C 1 15  ? 34.052  -21.394 -6.451  1.00 79.68  ? 37  LYS C CB  1 
ATOM   5598  C  CG  . LYS C 1 15  ? 35.577  -21.619 -6.295  1.00 107.38 ? 37  LYS C CG  1 
ATOM   5599  C  CD  . LYS C 1 15  ? 35.998  -23.103 -6.107  1.00 118.48 ? 37  LYS C CD  1 
ATOM   5600  C  CE  . LYS C 1 15  ? 37.492  -23.279 -5.939  1.00 124.16 ? 37  LYS C CE  1 
ATOM   5601  N  NZ  . LYS C 1 15  ? 37.984  -22.772 -4.626  1.00 127.69 ? 37  LYS C NZ  1 
ATOM   5602  N  N   . HIS C 1 16  ? 32.085  -20.221 -8.842  1.00 74.09  ? 38  HIS C N   1 
ATOM   5603  C  CA  . HIS C 1 16  ? 30.830  -19.571 -9.198  1.00 72.29  ? 38  HIS C CA  1 
ATOM   5604  C  C   . HIS C 1 16  ? 30.135  -20.435 -10.207 1.00 77.49  ? 38  HIS C C   1 
ATOM   5605  O  O   . HIS C 1 16  ? 28.926  -20.636 -10.107 1.00 77.70  ? 38  HIS C O   1 
ATOM   5606  C  CB  . HIS C 1 16  ? 31.049  -18.139 -9.698  1.00 71.12  ? 38  HIS C CB  1 
ATOM   5607  C  CG  . HIS C 1 16  ? 31.278  -17.170 -8.575  1.00 74.08  ? 38  HIS C CG  1 
ATOM   5608  N  ND1 . HIS C 1 16  ? 32.380  -16.330 -8.556  1.00 75.08  ? 38  HIS C ND1 1 
ATOM   5609  C  CD2 . HIS C 1 16  ? 30.555  -16.969 -7.445  1.00 75.42  ? 38  HIS C CD2 1 
ATOM   5610  C  CE1 . HIS C 1 16  ? 32.274  -15.634 -7.438  1.00 73.97  ? 38  HIS C CE1 1 
ATOM   5611  N  NE2 . HIS C 1 16  ? 31.188  -15.980 -6.741  1.00 74.56  ? 38  HIS C NE2 1 
ATOM   5612  N  N   . GLU C 1 17  ? 30.918  -21.031 -11.132 1.00 74.64  ? 39  GLU C N   1 
ATOM   5613  C  CA  . GLU C 1 17  ? 30.421  -22.002 -12.107 1.00 74.70  ? 39  GLU C CA  1 
ATOM   5614  C  C   . GLU C 1 17  ? 29.830  -23.189 -11.300 1.00 81.20  ? 39  GLU C C   1 
ATOM   5615  O  O   . GLU C 1 17  ? 28.753  -23.687 -11.631 1.00 80.99  ? 39  GLU C O   1 
ATOM   5616  C  CB  . GLU C 1 17  ? 31.559  -22.477 -13.022 1.00 76.36  ? 39  GLU C CB  1 
ATOM   5617  C  CG  . GLU C 1 17  ? 32.064  -21.443 -14.013 1.00 81.14  ? 39  GLU C CG  1 
ATOM   5618  C  CD  . GLU C 1 17  ? 32.970  -22.041 -15.078 1.00 103.65 ? 39  GLU C CD  1 
ATOM   5619  O  OE1 . GLU C 1 17  ? 32.449  -22.456 -16.142 1.00 76.76  ? 39  GLU C OE1 1 
ATOM   5620  O  OE2 . GLU C 1 17  ? 34.192  -22.158 -14.818 1.00 99.49  ? 39  GLU C OE2 1 
ATOM   5621  N  N   . GLN C 1 18  ? 30.510  -23.572 -10.189 1.00 79.42  ? 40  GLN C N   1 
ATOM   5622  C  CA  . GLN C 1 18  ? 30.059  -24.622 -9.269  1.00 81.06  ? 40  GLN C CA  1 
ATOM   5623  C  C   . GLN C 1 18  ? 28.677  -24.225 -8.695  1.00 79.88  ? 40  GLN C C   1 
ATOM   5624  O  O   . GLN C 1 18  ? 27.736  -25.022 -8.763  1.00 79.19  ? 40  GLN C O   1 
ATOM   5625  C  CB  . GLN C 1 18  ? 31.117  -24.914 -8.151  1.00 84.40  ? 40  GLN C CB  1 
ATOM   5626  C  CG  . GLN C 1 18  ? 32.092  -26.085 -8.424  1.00 107.05 ? 40  GLN C CG  1 
ATOM   5627  C  CD  . GLN C 1 18  ? 33.529  -25.859 -7.936  1.00 133.15 ? 40  GLN C CD  1 
ATOM   5628  O  OE1 . GLN C 1 18  ? 33.801  -25.628 -6.747  1.00 128.96 ? 40  GLN C OE1 1 
ATOM   5629  N  NE2 . GLN C 1 18  ? 34.499  -25.974 -8.840  1.00 124.82 ? 40  GLN C NE2 1 
ATOM   5630  N  N   . ILE C 1 19  ? 28.555  -22.971 -8.206  1.00 72.64  ? 41  ILE C N   1 
ATOM   5631  C  CA  . ILE C 1 19  ? 27.319  -22.419 -7.648  1.00 71.71  ? 41  ILE C CA  1 
ATOM   5632  C  C   . ILE C 1 19  ? 26.170  -22.392 -8.711  1.00 76.34  ? 41  ILE C C   1 
ATOM   5633  O  O   . ILE C 1 19  ? 25.023  -22.702 -8.375  1.00 76.30  ? 41  ILE C O   1 
ATOM   5634  C  CB  . ILE C 1 19  ? 27.613  -21.044 -6.999  1.00 73.27  ? 41  ILE C CB  1 
ATOM   5635  C  CG1 . ILE C 1 19  ? 28.481  -21.203 -5.746  1.00 73.58  ? 41  ILE C CG1 1 
ATOM   5636  C  CG2 . ILE C 1 19  ? 26.328  -20.216 -6.716  1.00 74.66  ? 41  ILE C CG2 1 
ATOM   5637  C  CD1 . ILE C 1 19  ? 29.208  -19.938 -5.332  1.00 72.20  ? 41  ILE C CD1 1 
ATOM   5638  N  N   . PHE C 1 20  ? 26.492  -22.061 -9.985  1.00 72.91  ? 42  PHE C N   1 
ATOM   5639  C  CA  . PHE C 1 20  ? 25.537  -22.049 -11.098 1.00 72.43  ? 42  PHE C CA  1 
ATOM   5640  C  C   . PHE C 1 20  ? 24.944  -23.472 -11.302 1.00 83.57  ? 42  PHE C C   1 
ATOM   5641  O  O   . PHE C 1 20  ? 23.717  -23.641 -11.298 1.00 84.00  ? 42  PHE C O   1 
ATOM   5642  C  CB  . PHE C 1 20  ? 26.241  -21.546 -12.363 1.00 72.03  ? 42  PHE C CB  1 
ATOM   5643  C  CG  . PHE C 1 20  ? 25.441  -21.462 -13.644 1.00 72.39  ? 42  PHE C CG  1 
ATOM   5644  C  CD1 . PHE C 1 20  ? 24.315  -20.656 -13.729 1.00 74.15  ? 42  PHE C CD1 1 
ATOM   5645  C  CD2 . PHE C 1 20  ? 25.888  -22.091 -14.804 1.00 74.44  ? 42  PHE C CD2 1 
ATOM   5646  C  CE1 . PHE C 1 20  ? 23.606  -20.544 -14.935 1.00 74.47  ? 42  PHE C CE1 1 
ATOM   5647  C  CE2 . PHE C 1 20  ? 25.186  -21.970 -16.007 1.00 75.93  ? 42  PHE C CE2 1 
ATOM   5648  C  CZ  . PHE C 1 20  ? 24.049  -21.202 -16.065 1.00 73.13  ? 42  PHE C CZ  1 
ATOM   5649  N  N   . ARG C 1 21  ? 25.825  -24.496 -11.398 1.00 83.27  ? 43  ARG C N   1 
ATOM   5650  C  CA  . ARG C 1 21  ? 25.446  -25.891 -11.569 1.00 85.73  ? 43  ARG C CA  1 
ATOM   5651  C  C   . ARG C 1 21  ? 24.407  -26.320 -10.536 1.00 93.08  ? 43  ARG C C   1 
ATOM   5652  O  O   . ARG C 1 21  ? 23.441  -26.988 -10.910 1.00 95.59  ? 43  ARG C O   1 
ATOM   5653  C  CB  . ARG C 1 21  ? 26.685  -26.788 -11.476 1.00 89.29  ? 43  ARG C CB  1 
ATOM   5654  C  CG  . ARG C 1 21  ? 27.270  -27.182 -12.819 1.00 101.91 ? 43  ARG C CG  1 
ATOM   5655  C  CD  . ARG C 1 21  ? 28.501  -28.053 -12.653 1.00 115.46 ? 43  ARG C CD  1 
ATOM   5656  N  NE  . ARG C 1 21  ? 29.723  -27.249 -12.646 1.00 128.05 ? 43  ARG C NE  1 
ATOM   5657  C  CZ  . ARG C 1 21  ? 30.602  -27.220 -11.649 1.00 147.15 ? 43  ARG C CZ  1 
ATOM   5658  N  NH1 . ARG C 1 21  ? 30.406  -27.953 -10.555 1.00 130.96 ? 43  ARG C NH1 1 
ATOM   5659  N  NH2 . ARG C 1 21  ? 31.687  -26.458 -11.736 1.00 136.31 ? 43  ARG C NH2 1 
ATOM   5660  N  N   . GLU C 1 22  ? 24.586  -25.916 -9.249  1.00 89.20  ? 44  GLU C N   1 
ATOM   5661  C  CA  . GLU C 1 22  ? 23.677  -26.236 -8.136  1.00 90.16  ? 44  GLU C CA  1 
ATOM   5662  C  C   . GLU C 1 22  ? 22.344  -25.498 -8.262  1.00 92.00  ? 44  GLU C C   1 
ATOM   5663  O  O   . GLU C 1 22  ? 21.285  -26.132 -8.158  1.00 92.20  ? 44  GLU C O   1 
ATOM   5664  C  CB  . GLU C 1 22  ? 24.319  -25.915 -6.775  1.00 92.29  ? 44  GLU C CB  1 
ATOM   5665  C  CG  . GLU C 1 22  ? 23.861  -26.825 -5.643  1.00 109.01 ? 44  GLU C CG  1 
ATOM   5666  C  CD  . GLU C 1 22  ? 22.382  -26.869 -5.292  1.00 141.02 ? 44  GLU C CD  1 
ATOM   5667  O  OE1 . GLU C 1 22  ? 21.785  -25.784 -5.106  1.00 152.82 ? 44  GLU C OE1 1 
ATOM   5668  O  OE2 . GLU C 1 22  ? 21.816  -27.986 -5.218  1.00 130.74 ? 44  GLU C OE2 1 
ATOM   5669  N  N   . ALA C 1 23  ? 22.402  -24.153 -8.463  1.00 85.66  ? 45  ALA C N   1 
ATOM   5670  C  CA  . ALA C 1 23  ? 21.231  -23.287 -8.637  1.00 83.44  ? 45  ALA C CA  1 
ATOM   5671  C  C   . ALA C 1 23  ? 20.341  -23.863 -9.741  1.00 86.47  ? 45  ALA C C   1 
ATOM   5672  O  O   . ALA C 1 23  ? 19.129  -23.979 -9.548  1.00 87.32  ? 45  ALA C O   1 
ATOM   5673  C  CB  . ALA C 1 23  ? 21.666  -21.866 -8.979  1.00 81.58  ? 45  ALA C CB  1 
ATOM   5674  N  N   . VAL C 1 24  ? 20.969  -24.308 -10.855 1.00 81.25  ? 46  VAL C N   1 
ATOM   5675  C  CA  . VAL C 1 24  ? 20.308  -24.952 -11.992 1.00 80.54  ? 46  VAL C CA  1 
ATOM   5676  C  C   . VAL C 1 24  ? 19.664  -26.264 -11.550 1.00 83.43  ? 46  VAL C C   1 
ATOM   5677  O  O   . VAL C 1 24  ? 18.558  -26.549 -12.001 1.00 83.50  ? 46  VAL C O   1 
ATOM   5678  C  CB  . VAL C 1 24  ? 21.240  -25.086 -13.236 1.00 83.93  ? 46  VAL C CB  1 
ATOM   5679  C  CG1 . VAL C 1 24  ? 20.656  -26.022 -14.306 1.00 84.33  ? 46  VAL C CG1 1 
ATOM   5680  C  CG2 . VAL C 1 24  ? 21.557  -23.705 -13.830 1.00 81.37  ? 46  VAL C CG2 1 
ATOM   5681  N  N   . ASN C 1 25  ? 20.292  -27.026 -10.634 1.00 79.62  ? 47  ASN C N   1 
ATOM   5682  C  CA  . ASN C 1 25  ? 19.619  -28.235 -10.189 1.00 81.68  ? 47  ASN C CA  1 
ATOM   5683  C  C   . ASN C 1 25  ? 18.473  -27.959 -9.202  1.00 85.72  ? 47  ASN C C   1 
ATOM   5684  O  O   . ASN C 1 25  ? 17.452  -28.646 -9.269  1.00 86.28  ? 47  ASN C O   1 
ATOM   5685  C  CB  . ASN C 1 25  ? 20.547  -29.297 -9.657  1.00 84.83  ? 47  ASN C CB  1 
ATOM   5686  C  CG  . ASN C 1 25  ? 19.807  -30.626 -9.609  1.00 114.64 ? 47  ASN C CG  1 
ATOM   5687  O  OD1 . ASN C 1 25  ? 19.413  -31.193 -10.649 1.00 108.18 ? 47  ASN C OD1 1 
ATOM   5688  N  ND2 . ASN C 1 25  ? 19.430  -31.048 -8.405  1.00 104.26 ? 47  ASN C ND2 1 
ATOM   5689  N  N   . GLN C 1 26  ? 18.620  -26.944 -8.315  1.00 80.50  ? 48  GLN C N   1 
ATOM   5690  C  CA  . GLN C 1 26  ? 17.577  -26.571 -7.351  1.00 80.07  ? 48  GLN C CA  1 
ATOM   5691  C  C   . GLN C 1 26  ? 16.280  -26.210 -8.098  1.00 84.22  ? 48  GLN C C   1 
ATOM   5692  O  O   . GLN C 1 26  ? 15.171  -26.461 -7.598  1.00 84.62  ? 48  GLN C O   1 
ATOM   5693  C  CB  . GLN C 1 26  ? 18.060  -25.427 -6.446  1.00 79.64  ? 48  GLN C CB  1 
ATOM   5694  C  CG  . GLN C 1 26  ? 18.391  -25.856 -5.009  1.00 91.40  ? 48  GLN C CG  1 
ATOM   5695  C  CD  . GLN C 1 26  ? 17.167  -26.185 -4.173  1.00 123.61 ? 48  GLN C CD  1 
ATOM   5696  O  OE1 . GLN C 1 26  ? 16.177  -25.435 -4.143  1.00 120.75 ? 48  GLN C OE1 1 
ATOM   5697  N  NE2 . GLN C 1 26  ? 17.216  -27.308 -3.449  1.00 120.52 ? 48  GLN C NE2 1 
ATOM   5698  N  N   . ALA C 1 27  ? 16.447  -25.662 -9.332  1.00 80.02  ? 49  ALA C N   1 
ATOM   5699  C  CA  . ALA C 1 27  ? 15.381  -25.315 -10.268 1.00 79.55  ? 49  ALA C CA  1 
ATOM   5700  C  C   . ALA C 1 27  ? 14.690  -26.599 -10.679 1.00 87.21  ? 49  ALA C C   1 
ATOM   5701  O  O   . ALA C 1 27  ? 13.498  -26.719 -10.447 1.00 89.64  ? 49  ALA C O   1 
ATOM   5702  C  CB  . ALA C 1 27  ? 15.951  -24.601 -11.485 1.00 78.13  ? 49  ALA C CB  1 
ATOM   5703  N  N   . ASN C 1 28  ? 15.445  -27.606 -11.161 1.00 83.98  ? 50  ASN C N   1 
ATOM   5704  C  CA  . ASN C 1 28  ? 14.892  -28.901 -11.543 1.00 85.26  ? 50  ASN C CA  1 
ATOM   5705  C  C   . ASN C 1 28  ? 14.235  -29.594 -10.348 1.00 91.91  ? 50  ASN C C   1 
ATOM   5706  O  O   . ASN C 1 28  ? 13.196  -30.232 -10.517 1.00 93.39  ? 50  ASN C O   1 
ATOM   5707  C  CB  . ASN C 1 28  ? 15.964  -29.780 -12.165 1.00 85.46  ? 50  ASN C CB  1 
ATOM   5708  C  CG  . ASN C 1 28  ? 16.628  -29.182 -13.380 1.00 99.33  ? 50  ASN C CG  1 
ATOM   5709  O  OD1 . ASN C 1 28  ? 16.000  -28.939 -14.430 1.00 86.97  ? 50  ASN C OD1 1 
ATOM   5710  N  ND2 . ASN C 1 28  ? 17.930  -28.970 -13.264 1.00 90.36  ? 50  ASN C ND2 1 
ATOM   5711  N  N   . LYS C 1 29  ? 14.810  -29.421 -9.139  1.00 89.74  ? 51  LYS C N   1 
ATOM   5712  C  CA  . LYS C 1 29  ? 14.297  -29.977 -7.890  1.00 92.34  ? 51  LYS C CA  1 
ATOM   5713  C  C   . LYS C 1 29  ? 12.865  -29.436 -7.618  1.00 98.96  ? 51  LYS C C   1 
ATOM   5714  O  O   . LYS C 1 29  ? 11.927  -30.230 -7.478  1.00 101.39 ? 51  LYS C O   1 
ATOM   5715  C  CB  . LYS C 1 29  ? 15.245  -29.596 -6.733  1.00 93.64  ? 51  LYS C CB  1 
ATOM   5716  C  CG  . LYS C 1 29  ? 16.244  -30.646 -6.271  1.00 88.68  ? 51  LYS C CG  1 
ATOM   5717  C  CD  . LYS C 1 29  ? 16.591  -30.426 -4.797  1.00 89.60  ? 51  LYS C CD  1 
ATOM   5718  C  CE  . LYS C 1 29  ? 15.549  -31.017 -3.853  1.00 107.54 ? 51  LYS C CE  1 
ATOM   5719  N  NZ  . LYS C 1 29  ? 15.914  -30.900 -2.416  1.00 120.81 ? 51  LYS C NZ  1 
ATOM   5720  N  N   . ARG C 1 30  ? 12.703  -28.087 -7.622  1.00 93.86  ? 52  ARG C N   1 
ATOM   5721  C  CA  . ARG C 1 30  ? 11.463  -27.381 -7.290  1.00 93.97  ? 52  ARG C CA  1 
ATOM   5722  C  C   . ARG C 1 30  ? 10.406  -27.311 -8.440  1.00 98.35  ? 52  ARG C C   1 
ATOM   5723  O  O   . ARG C 1 30  ? 9.231   -27.073 -8.153  1.00 98.67  ? 52  ARG C O   1 
ATOM   5724  C  CB  . ARG C 1 30  ? 11.792  -25.988 -6.708  1.00 90.53  ? 52  ARG C CB  1 
ATOM   5725  C  CG  . ARG C 1 30  ? 11.710  -24.784 -7.627  1.00 88.89  ? 52  ARG C CG  1 
ATOM   5726  C  CD  . ARG C 1 30  ? 12.254  -23.533 -6.939  1.00 92.95  ? 52  ARG C CD  1 
ATOM   5727  N  NE  . ARG C 1 30  ? 13.712  -23.394 -7.067  1.00 108.39 ? 52  ARG C NE  1 
ATOM   5728  C  CZ  . ARG C 1 30  ? 14.310  -22.730 -8.058  1.00 126.31 ? 52  ARG C CZ  1 
ATOM   5729  N  NH1 . ARG C 1 30  ? 13.586  -22.107 -8.978  1.00 110.65 ? 52  ARG C NH1 1 
ATOM   5730  N  NH2 . ARG C 1 30  ? 15.639  -22.641 -8.106  1.00 112.57 ? 52  ARG C NH2 1 
ATOM   5731  N  N   . HIS C 1 31  ? 10.802  -27.558 -9.701  1.00 94.98  ? 53  HIS C N   1 
ATOM   5732  C  CA  . HIS C 1 31  ? 9.911   -27.544 -10.868 1.00 95.79  ? 53  HIS C CA  1 
ATOM   5733  C  C   . HIS C 1 31  ? 9.609   -28.942 -11.409 1.00 108.39 ? 53  HIS C C   1 
ATOM   5734  O  O   . HIS C 1 31  ? 10.159  -29.931 -10.921 1.00 109.38 ? 53  HIS C O   1 
ATOM   5735  C  CB  . HIS C 1 31  ? 10.558  -26.775 -12.014 1.00 93.43  ? 53  HIS C CB  1 
ATOM   5736  C  CG  . HIS C 1 31  ? 10.578  -25.298 -11.839 1.00 94.60  ? 53  HIS C CG  1 
ATOM   5737  N  ND1 . HIS C 1 31  ? 9.527   -24.504 -12.255 1.00 95.64  ? 53  HIS C ND1 1 
ATOM   5738  C  CD2 . HIS C 1 31  ? 11.565  -24.504 -11.368 1.00 94.79  ? 53  HIS C CD2 1 
ATOM   5739  C  CE1 . HIS C 1 31  ? 9.889   -23.263 -11.981 1.00 93.17  ? 53  HIS C CE1 1 
ATOM   5740  N  NE2 . HIS C 1 31  ? 11.112  -23.213 -11.455 1.00 92.96  ? 53  HIS C NE2 1 
ATOM   5741  N  N   . PHE C 1 32  ? 8.808   -29.018 -12.507 1.00 110.03 ? 54  PHE C N   1 
ATOM   5742  C  CA  . PHE C 1 32  ? 8.512   -30.304 -13.146 1.00 114.03 ? 54  PHE C CA  1 
ATOM   5743  C  C   . PHE C 1 32  ? 9.582   -30.684 -14.178 1.00 119.04 ? 54  PHE C C   1 
ATOM   5744  O  O   . PHE C 1 32  ? 9.506   -30.305 -15.357 1.00 117.69 ? 54  PHE C O   1 
ATOM   5745  C  CB  . PHE C 1 32  ? 7.084   -30.375 -13.716 1.00 117.61 ? 54  PHE C CB  1 
ATOM   5746  C  CG  . PHE C 1 32  ? 6.380   -31.694 -13.469 1.00 123.18 ? 54  PHE C CG  1 
ATOM   5747  C  CD1 . PHE C 1 32  ? 6.200   -32.178 -12.173 1.00 129.09 ? 54  PHE C CD1 1 
ATOM   5748  C  CD2 . PHE C 1 32  ? 5.848   -32.427 -14.527 1.00 127.33 ? 54  PHE C CD2 1 
ATOM   5749  C  CE1 . PHE C 1 32  ? 5.525   -33.387 -11.944 1.00 133.49 ? 54  PHE C CE1 1 
ATOM   5750  C  CE2 . PHE C 1 32  ? 5.166   -33.636 -14.297 1.00 133.41 ? 54  PHE C CE2 1 
ATOM   5751  C  CZ  . PHE C 1 32  ? 5.003   -34.102 -13.007 1.00 133.59 ? 54  PHE C CZ  1 
ATOM   5752  N  N   . THR C 1 33  ? 10.592  -31.439 -13.690 1.00 116.83 ? 55  THR C N   1 
ATOM   5753  C  CA  . THR C 1 33  ? 11.747  -31.978 -14.418 1.00 116.38 ? 55  THR C CA  1 
ATOM   5754  C  C   . THR C 1 33  ? 11.294  -32.824 -15.621 1.00 120.57 ? 55  THR C C   1 
ATOM   5755  O  O   . THR C 1 33  ? 12.013  -32.896 -16.620 1.00 119.40 ? 55  THR C O   1 
ATOM   5756  C  CB  . THR C 1 33  ? 12.600  -32.837 -13.463 1.00 128.02 ? 55  THR C CB  1 
ATOM   5757  O  OG1 . THR C 1 33  ? 12.441  -32.382 -12.116 1.00 130.43 ? 55  THR C OG1 1 
ATOM   5758  C  CG2 . THR C 1 33  ? 14.074  -32.873 -13.851 1.00 123.75 ? 55  THR C CG2 1 
ATOM   5759  N  N   . ARG C 1 34  ? 10.108  -33.471 -15.501 1.00 118.21 ? 56  ARG C N   1 
ATOM   5760  C  CA  . ARG C 1 34  ? 9.470   -34.299 -16.532 1.00 118.90 ? 56  ARG C CA  1 
ATOM   5761  C  C   . ARG C 1 34  ? 8.904   -33.378 -17.617 1.00 119.82 ? 56  ARG C C   1 
ATOM   5762  O  O   . ARG C 1 34  ? 8.339   -32.329 -17.285 1.00 118.73 ? 56  ARG C O   1 
ATOM   5763  C  CB  . ARG C 1 34  ? 8.356   -35.170 -15.921 1.00 121.73 ? 56  ARG C CB  1 
ATOM   5764  C  CG  . ARG C 1 34  ? 8.803   -36.008 -14.713 1.00 133.89 ? 56  ARG C CG  1 
ATOM   5765  C  CD  . ARG C 1 34  ? 8.147   -37.376 -14.658 1.00 142.76 ? 56  ARG C CD  1 
ATOM   5766  N  NE  . ARG C 1 34  ? 6.858   -37.353 -13.967 1.00 152.78 ? 56  ARG C NE  1 
ATOM   5767  C  CZ  . ARG C 1 34  ? 5.675   -37.252 -14.572 1.00 169.91 ? 56  ARG C CZ  1 
ATOM   5768  N  NH1 . ARG C 1 34  ? 5.603   -37.152 -15.895 1.00 153.07 ? 56  ARG C NH1 1 
ATOM   5769  N  NH2 . ARG C 1 34  ? 4.556   -37.256 -13.858 1.00 161.77 ? 56  ARG C NH2 1 
ATOM   5770  N  N   . LYS C 1 35  ? 9.109   -33.750 -18.907 1.00 114.70 ? 57  LYS C N   1 
ATOM   5771  C  CA  . LYS C 1 35  ? 8.718   -33.046 -20.154 1.00 112.56 ? 57  LYS C CA  1 
ATOM   5772  C  C   . LYS C 1 35  ? 9.740   -31.979 -20.616 1.00 110.73 ? 57  LYS C C   1 
ATOM   5773  O  O   . LYS C 1 35  ? 10.012  -31.906 -21.812 1.00 110.29 ? 57  LYS C O   1 
ATOM   5774  C  CB  . LYS C 1 35  ? 7.284   -32.453 -20.123 1.00 115.83 ? 57  LYS C CB  1 
ATOM   5775  C  CG  . LYS C 1 35  ? 6.652   -32.259 -21.515 1.00 132.83 ? 57  LYS C CG  1 
ATOM   5776  C  CD  . LYS C 1 35  ? 5.112   -32.313 -21.502 1.00 142.87 ? 57  LYS C CD  1 
ATOM   5777  C  CE  . LYS C 1 35  ? 4.512   -32.207 -22.893 1.00 147.05 ? 57  LYS C CE  1 
ATOM   5778  N  NZ  . LYS C 1 35  ? 3.032   -32.027 -22.860 1.00 151.06 ? 57  LYS C NZ  1 
ATOM   5779  N  N   . ILE C 1 36  ? 10.301  -31.175 -19.690 1.00 103.08 ? 58  ILE C N   1 
ATOM   5780  C  CA  . ILE C 1 36  ? 11.269  -30.104 -19.986 1.00 99.40  ? 58  ILE C CA  1 
ATOM   5781  C  C   . ILE C 1 36  ? 12.259  -29.951 -18.780 1.00 100.63 ? 58  ILE C C   1 
ATOM   5782  O  O   . ILE C 1 36  ? 11.802  -29.889 -17.635 1.00 101.25 ? 58  ILE C O   1 
ATOM   5783  C  CB  . ILE C 1 36  ? 10.495  -28.817 -20.423 1.00 100.87 ? 58  ILE C CB  1 
ATOM   5784  C  CG1 . ILE C 1 36  ? 11.448  -27.652 -20.753 1.00 99.28  ? 58  ILE C CG1 1 
ATOM   5785  C  CG2 . ILE C 1 36  ? 9.386   -28.413 -19.428 1.00 102.10 ? 58  ILE C CG2 1 
ATOM   5786  C  CD1 . ILE C 1 36  ? 11.325  -26.392 -19.872 1.00 109.19 ? 58  ILE C CD1 1 
ATOM   5787  N  N   . GLN C 1 37  ? 13.604  -29.966 -19.038 1.00 93.66  ? 59  GLN C N   1 
ATOM   5788  C  CA  . GLN C 1 37  ? 14.642  -29.976 -17.995 1.00 92.19  ? 59  GLN C CA  1 
ATOM   5789  C  C   . GLN C 1 37  ? 15.835  -29.079 -18.326 1.00 91.27  ? 59  GLN C C   1 
ATOM   5790  O  O   . GLN C 1 37  ? 16.352  -29.138 -19.441 1.00 90.73  ? 59  GLN C O   1 
ATOM   5791  C  CB  . GLN C 1 37  ? 15.134  -31.423 -17.784 1.00 95.87  ? 59  GLN C CB  1 
ATOM   5792  C  CG  . GLN C 1 37  ? 16.149  -31.595 -16.663 1.00 102.60 ? 59  GLN C CG  1 
ATOM   5793  C  CD  . GLN C 1 37  ? 16.785  -32.945 -16.694 1.00 108.93 ? 59  GLN C CD  1 
ATOM   5794  O  OE1 . GLN C 1 37  ? 16.153  -33.958 -16.377 1.00 99.33  ? 59  GLN C OE1 1 
ATOM   5795  N  NE2 . GLN C 1 37  ? 18.061  -32.982 -17.035 1.00 102.22 ? 59  GLN C NE2 1 
ATOM   5796  N  N   . LEU C 1 38  ? 16.316  -28.318 -17.330 1.00 83.66  ? 60  LEU C N   1 
ATOM   5797  C  CA  . LEU C 1 38  ? 17.436  -27.405 -17.512 1.00 80.43  ? 60  LEU C CA  1 
ATOM   5798  C  C   . LEU C 1 38  ? 18.803  -28.057 -17.421 1.00 82.93  ? 60  LEU C C   1 
ATOM   5799  O  O   . LEU C 1 38  ? 18.969  -29.074 -16.755 1.00 84.15  ? 60  LEU C O   1 
ATOM   5800  C  CB  . LEU C 1 38  ? 17.355  -26.219 -16.553 1.00 78.74  ? 60  LEU C CB  1 
ATOM   5801  C  CG  . LEU C 1 38  ? 16.070  -25.418 -16.577 1.00 82.27  ? 60  LEU C CG  1 
ATOM   5802  C  CD1 . LEU C 1 38  ? 16.039  -24.461 -15.434 1.00 81.82  ? 60  LEU C CD1 1 
ATOM   5803  C  CD2 . LEU C 1 38  ? 15.861  -24.715 -17.910 1.00 81.97  ? 60  LEU C CD2 1 
ATOM   5804  N  N   . GLN C 1 39  ? 19.781  -27.455 -18.111 1.00 76.65  ? 61  GLN C N   1 
ATOM   5805  C  CA  . GLN C 1 39  ? 21.163  -27.885 -18.123 1.00 76.36  ? 61  GLN C CA  1 
ATOM   5806  C  C   . GLN C 1 39  ? 22.041  -26.665 -18.098 1.00 78.25  ? 61  GLN C C   1 
ATOM   5807  O  O   . GLN C 1 39  ? 21.930  -25.798 -18.960 1.00 77.65  ? 61  GLN C O   1 
ATOM   5808  C  CB  . GLN C 1 39  ? 21.474  -28.763 -19.341 1.00 79.18  ? 61  GLN C CB  1 
ATOM   5809  C  CG  . GLN C 1 39  ? 22.926  -29.239 -19.402 1.00 98.42  ? 61  GLN C CG  1 
ATOM   5810  C  CD  . GLN C 1 39  ? 23.043  -30.487 -20.225 1.00 121.84 ? 61  GLN C CD  1 
ATOM   5811  O  OE1 . GLN C 1 39  ? 22.681  -31.585 -19.787 1.00 121.90 ? 61  GLN C OE1 1 
ATOM   5812  N  NE2 . GLN C 1 39  ? 23.549  -30.344 -21.436 1.00 113.32 ? 61  GLN C NE2 1 
ATOM   5813  N  N   . ALA C 1 40  ? 22.913  -26.593 -17.109 1.00 74.93  ? 62  ALA C N   1 
ATOM   5814  C  CA  . ALA C 1 40  ? 23.846  -25.487 -16.964 1.00 73.21  ? 62  ALA C CA  1 
ATOM   5815  C  C   . ALA C 1 40  ? 25.033  -25.679 -17.903 1.00 78.77  ? 62  ALA C C   1 
ATOM   5816  O  O   . ALA C 1 40  ? 25.554  -26.793 -18.024 1.00 81.07  ? 62  ALA C O   1 
ATOM   5817  C  CB  . ALA C 1 40  ? 24.330  -25.405 -15.529 1.00 74.05  ? 62  ALA C CB  1 
ATOM   5818  N  N   . THR C 1 41  ? 25.424  -24.593 -18.589 1.00 73.65  ? 63  THR C N   1 
ATOM   5819  C  CA  . THR C 1 41  ? 26.562  -24.478 -19.506 1.00 73.56  ? 63  THR C CA  1 
ATOM   5820  C  C   . THR C 1 41  ? 27.240  -23.194 -19.052 1.00 76.26  ? 63  THR C C   1 
ATOM   5821  O  O   . THR C 1 41  ? 26.550  -22.187 -18.880 1.00 75.67  ? 63  THR C O   1 
ATOM   5822  C  CB  . THR C 1 41  ? 26.085  -24.320 -20.976 1.00 84.13  ? 63  THR C CB  1 
ATOM   5823  O  OG1 . THR C 1 41  ? 25.135  -25.334 -21.323 1.00 89.27  ? 63  THR C OG1 1 
ATOM   5824  C  CG2 . THR C 1 41  ? 27.236  -24.343 -21.966 1.00 82.28  ? 63  THR C CG2 1 
ATOM   5825  N  N   . SER C 1 42  ? 28.556  -23.203 -18.827 1.00 72.07  ? 64  SER C N   1 
ATOM   5826  C  CA  . SER C 1 42  ? 29.221  -21.973 -18.374 1.00 69.83  ? 64  SER C CA  1 
ATOM   5827  C  C   . SER C 1 42  ? 30.691  -21.907 -18.693 1.00 74.00  ? 64  SER C C   1 
ATOM   5828  O  O   . SER C 1 42  ? 31.328  -22.932 -18.971 1.00 77.29  ? 64  SER C O   1 
ATOM   5829  C  CB  . SER C 1 42  ? 29.015  -21.735 -16.874 1.00 72.68  ? 64  SER C CB  1 
ATOM   5830  O  OG  . SER C 1 42  ? 29.715  -22.689 -16.086 1.00 84.17  ? 64  SER C OG  1 
ATOM   5831  N  N   . VAL C 1 43  ? 31.232  -20.676 -18.611 1.00 66.00  ? 65  VAL C N   1 
ATOM   5832  C  CA  . VAL C 1 43  ? 32.633  -20.304 -18.795 1.00 64.28  ? 65  VAL C CA  1 
ATOM   5833  C  C   . VAL C 1 43  ? 32.944  -19.172 -17.819 1.00 68.78  ? 65  VAL C C   1 
ATOM   5834  O  O   . VAL C 1 43  ? 32.030  -18.550 -17.276 1.00 67.52  ? 65  VAL C O   1 
ATOM   5835  C  CB  . VAL C 1 43  ? 32.983  -19.886 -20.255 1.00 66.26  ? 65  VAL C CB  1 
ATOM   5836  C  CG1 . VAL C 1 43  ? 32.705  -21.002 -21.242 1.00 67.35  ? 65  VAL C CG1 1 
ATOM   5837  C  CG2 . VAL C 1 43  ? 32.283  -18.595 -20.674 1.00 63.61  ? 65  VAL C CG2 1 
ATOM   5838  N  N   . THR C 1 44  ? 34.233  -18.902 -17.607 1.00 66.87  ? 66  THR C N   1 
ATOM   5839  C  CA  . THR C 1 44  ? 34.709  -17.773 -16.812 1.00 65.73  ? 66  THR C CA  1 
ATOM   5840  C  C   . THR C 1 44  ? 35.121  -16.685 -17.792 1.00 70.06  ? 66  THR C C   1 
ATOM   5841  O  O   . THR C 1 44  ? 35.283  -16.983 -18.983 1.00 69.79  ? 66  THR C O   1 
ATOM   5842  C  CB  . THR C 1 44  ? 35.833  -18.171 -15.864 1.00 74.10  ? 66  THR C CB  1 
ATOM   5843  O  OG1 . THR C 1 44  ? 36.718  -19.082 -16.526 1.00 78.42  ? 66  THR C OG1 1 
ATOM   5844  C  CG2 . THR C 1 44  ? 35.307  -18.779 -14.577 1.00 73.15  ? 66  THR C CG2 1 
ATOM   5845  N  N   . HIS C 1 45  ? 35.277  -15.431 -17.328 1.00 67.31  ? 67  HIS C N   1 
ATOM   5846  C  CA  . HIS C 1 45  ? 35.671  -14.341 -18.223 1.00 67.47  ? 67  HIS C CA  1 
ATOM   5847  C  C   . HIS C 1 45  ? 36.995  -14.582 -18.938 1.00 72.97  ? 67  HIS C C   1 
ATOM   5848  O  O   . HIS C 1 45  ? 37.915  -15.173 -18.352 1.00 76.29  ? 67  HIS C O   1 
ATOM   5849  C  CB  . HIS C 1 45  ? 35.685  -13.001 -17.506 1.00 67.64  ? 67  HIS C CB  1 
ATOM   5850  C  CG  . HIS C 1 45  ? 34.364  -12.647 -16.945 1.00 70.80  ? 67  HIS C CG  1 
ATOM   5851  N  ND1 . HIS C 1 45  ? 34.043  -12.942 -15.631 1.00 73.46  ? 67  HIS C ND1 1 
ATOM   5852  C  CD2 . HIS C 1 45  ? 33.305  -12.057 -17.546 1.00 72.65  ? 67  HIS C CD2 1 
ATOM   5853  C  CE1 . HIS C 1 45  ? 32.799  -12.523 -15.471 1.00 72.79  ? 67  HIS C CE1 1 
ATOM   5854  N  NE2 . HIS C 1 45  ? 32.310  -11.987 -16.605 1.00 72.49  ? 67  HIS C NE2 1 
ATOM   5855  N  N   . ARG C 1 46  ? 37.073  -14.157 -20.211 1.00 67.35  ? 68  ARG C N   1 
ATOM   5856  C  CA  . ARG C 1 46  ? 38.280  -14.306 -21.016 1.00 68.71  ? 68  ARG C CA  1 
ATOM   5857  C  C   . ARG C 1 46  ? 39.241  -13.133 -20.786 1.00 73.11  ? 68  ARG C C   1 
ATOM   5858  O  O   . ARG C 1 46  ? 38.827  -12.136 -20.178 1.00 70.40  ? 68  ARG C O   1 
ATOM   5859  C  CB  . ARG C 1 46  ? 37.966  -14.564 -22.503 1.00 69.84  ? 68  ARG C CB  1 
ATOM   5860  C  CG  . ARG C 1 46  ? 37.299  -15.922 -22.752 1.00 82.12  ? 68  ARG C CG  1 
ATOM   5861  C  CD  . ARG C 1 46  ? 38.222  -17.097 -22.485 1.00 98.58  ? 68  ARG C CD  1 
ATOM   5862  N  NE  . ARG C 1 46  ? 37.534  -18.164 -21.759 1.00 113.97 ? 68  ARG C NE  1 
ATOM   5863  C  CZ  . ARG C 1 46  ? 37.793  -18.517 -20.502 1.00 131.37 ? 68  ARG C CZ  1 
ATOM   5864  N  NH1 . ARG C 1 46  ? 38.735  -17.887 -19.806 1.00 113.42 ? 68  ARG C NH1 1 
ATOM   5865  N  NH2 . ARG C 1 46  ? 37.122  -19.511 -19.934 1.00 121.96 ? 68  ARG C NH2 1 
ATOM   5866  N  N   . PRO C 1 47  ? 40.548  -13.258 -21.154 1.00 72.50  ? 69  PRO C N   1 
ATOM   5867  C  CA  . PRO C 1 47  ? 41.490  -12.154 -20.882 1.00 72.44  ? 69  PRO C CA  1 
ATOM   5868  C  C   . PRO C 1 47  ? 41.146  -10.845 -21.579 1.00 74.13  ? 69  PRO C C   1 
ATOM   5869  O  O   . PRO C 1 47  ? 41.415  -9.781  -21.018 1.00 74.11  ? 69  PRO C O   1 
ATOM   5870  C  CB  . PRO C 1 47  ? 42.831  -12.693 -21.366 1.00 76.43  ? 69  PRO C CB  1 
ATOM   5871  C  CG  . PRO C 1 47  ? 42.628  -14.146 -21.582 1.00 81.49  ? 69  PRO C CG  1 
ATOM   5872  C  CD  . PRO C 1 47  ? 41.214  -14.368 -21.865 1.00 75.55  ? 69  PRO C CD  1 
ATOM   5873  N  N   . ASN C 1 48  ? 40.554  -10.930 -22.784 1.00 67.76  ? 70  ASN C N   1 
ATOM   5874  C  CA  . ASN C 1 48  ? 40.158  -9.777  -23.564 1.00 65.93  ? 70  ASN C CA  1 
ATOM   5875  C  C   . ASN C 1 48  ? 38.777  -9.973  -24.233 1.00 67.23  ? 70  ASN C C   1 
ATOM   5876  O  O   . ASN C 1 48  ? 38.255  -11.100 -24.245 1.00 67.34  ? 70  ASN C O   1 
ATOM   5877  C  CB  . ASN C 1 48  ? 41.257  -9.435  -24.575 1.00 69.74  ? 70  ASN C CB  1 
ATOM   5878  C  CG  . ASN C 1 48  ? 41.445  -10.426 -25.693 1.00 89.59  ? 70  ASN C CG  1 
ATOM   5879  O  OD1 . ASN C 1 48  ? 40.496  -10.851 -26.363 1.00 82.58  ? 70  ASN C OD1 1 
ATOM   5880  N  ND2 . ASN C 1 48  ? 42.694  -10.710 -25.997 1.00 83.53  ? 70  ASN C ND2 1 
ATOM   5881  N  N   . ALA C 1 49  ? 38.220  -8.878  -24.819 1.00 60.29  ? 71  ALA C N   1 
ATOM   5882  C  CA  . ALA C 1 49  ? 36.902  -8.835  -25.449 1.00 58.54  ? 71  ALA C CA  1 
ATOM   5883  C  C   . ALA C 1 49  ? 36.733  -9.721  -26.665 1.00 66.07  ? 71  ALA C C   1 
ATOM   5884  O  O   . ALA C 1 49  ? 35.662  -10.326 -26.807 1.00 66.46  ? 71  ALA C O   1 
ATOM   5885  C  CB  . ALA C 1 49  ? 36.528  -7.416  -25.793 1.00 58.05  ? 71  ALA C CB  1 
ATOM   5886  N  N   . ILE C 1 50  ? 37.750  -9.787  -27.563 1.00 64.13  ? 72  ILE C N   1 
ATOM   5887  C  CA  . ILE C 1 50  ? 37.645  -10.645 -28.760 1.00 64.49  ? 72  ILE C CA  1 
ATOM   5888  C  C   . ILE C 1 50  ? 37.490  -12.105 -28.322 1.00 71.70  ? 72  ILE C C   1 
ATOM   5889  O  O   . ILE C 1 50  ? 36.530  -12.763 -28.713 1.00 70.72  ? 72  ILE C O   1 
ATOM   5890  C  CB  . ILE C 1 50  ? 38.781  -10.415 -29.794 1.00 67.47  ? 72  ILE C CB  1 
ATOM   5891  C  CG1 . ILE C 1 50  ? 38.592  -9.077  -30.497 1.00 66.60  ? 72  ILE C CG1 1 
ATOM   5892  C  CG2 . ILE C 1 50  ? 38.852  -11.543 -30.822 1.00 67.97  ? 72  ILE C CG2 1 
ATOM   5893  C  CD1 . ILE C 1 50  ? 39.814  -8.567  -31.125 1.00 74.54  ? 72  ILE C CD1 1 
ATOM   5894  N  N   . GLN C 1 51  ? 38.391  -12.568 -27.443 1.00 71.92  ? 73  GLN C N   1 
ATOM   5895  C  CA  . GLN C 1 51  ? 38.373  -13.916 -26.883 1.00 73.15  ? 73  GLN C CA  1 
ATOM   5896  C  C   . GLN C 1 51  ? 37.035  -14.206 -26.182 1.00 74.28  ? 73  GLN C C   1 
ATOM   5897  O  O   . GLN C 1 51  ? 36.486  -15.294 -26.375 1.00 76.08  ? 73  GLN C O   1 
ATOM   5898  C  CB  . GLN C 1 51  ? 39.536  -14.092 -25.906 1.00 75.27  ? 73  GLN C CB  1 
ATOM   5899  C  CG  . GLN C 1 51  ? 40.855  -14.448 -26.553 1.00 94.05  ? 73  GLN C CG  1 
ATOM   5900  C  CD  . GLN C 1 51  ? 41.866  -14.780 -25.486 1.00 118.12 ? 73  GLN C CD  1 
ATOM   5901  O  OE1 . GLN C 1 51  ? 42.815  -14.027 -25.247 1.00 116.59 ? 73  GLN C OE1 1 
ATOM   5902  N  NE2 . GLN C 1 51  ? 41.662  -15.899 -24.790 1.00 109.78 ? 73  GLN C NE2 1 
ATOM   5903  N  N   . MET C 1 52  ? 36.504  -13.232 -25.402 1.00 65.60  ? 74  MET C N   1 
ATOM   5904  C  CA  . MET C 1 52  ? 35.225  -13.380 -24.720 1.00 63.30  ? 74  MET C CA  1 
ATOM   5905  C  C   . MET C 1 52  ? 34.083  -13.590 -25.714 1.00 66.95  ? 74  MET C C   1 
ATOM   5906  O  O   . MET C 1 52  ? 33.292  -14.513 -25.529 1.00 66.92  ? 74  MET C O   1 
ATOM   5907  C  CB  . MET C 1 52  ? 34.945  -12.185 -23.799 1.00 64.15  ? 74  MET C CB  1 
ATOM   5908  C  CG  . MET C 1 52  ? 33.754  -12.387 -22.869 1.00 66.86  ? 74  MET C CG  1 
ATOM   5909  S  SD  . MET C 1 52  ? 34.042  -13.719 -21.667 1.00 71.10  ? 74  MET C SD  1 
ATOM   5910  C  CE  . MET C 1 52  ? 32.971  -15.009 -22.322 1.00 68.91  ? 74  MET C CE  1 
ATOM   5911  N  N   . ALA C 1 53  ? 34.015  -12.772 -26.785 1.00 63.59  ? 75  ALA C N   1 
ATOM   5912  C  CA  . ALA C 1 53  ? 32.985  -12.899 -27.830 1.00 63.43  ? 75  ALA C CA  1 
ATOM   5913  C  C   . ALA C 1 53  ? 33.061  -14.275 -28.478 1.00 68.37  ? 75  ALA C C   1 
ATOM   5914  O  O   . ALA C 1 53  ? 32.045  -14.925 -28.684 1.00 69.11  ? 75  ALA C O   1 
ATOM   5915  C  CB  . ALA C 1 53  ? 33.179  -11.824 -28.891 1.00 64.47  ? 75  ALA C CB  1 
ATOM   5916  N  N   . LEU C 1 54  ? 34.279  -14.723 -28.769 1.00 65.76  ? 76  LEU C N   1 
ATOM   5917  C  CA  . LEU C 1 54  ? 34.540  -16.009 -29.396 1.00 67.02  ? 76  LEU C CA  1 
ATOM   5918  C  C   . LEU C 1 54  ? 34.107  -17.142 -28.490 1.00 74.61  ? 76  LEU C C   1 
ATOM   5919  O  O   . LEU C 1 54  ? 33.533  -18.125 -28.973 1.00 76.27  ? 76  LEU C O   1 
ATOM   5920  C  CB  . LEU C 1 54  ? 36.023  -16.131 -29.804 1.00 67.21  ? 76  LEU C CB  1 
ATOM   5921  C  CG  . LEU C 1 54  ? 36.416  -15.301 -31.013 1.00 69.82  ? 76  LEU C CG  1 
ATOM   5922  C  CD1 . LEU C 1 54  ? 37.865  -15.083 -31.070 1.00 69.60  ? 76  LEU C CD1 1 
ATOM   5923  C  CD2 . LEU C 1 54  ? 35.884  -15.897 -32.308 1.00 73.02  ? 76  LEU C CD2 1 
ATOM   5924  N  N   . SER C 1 55  ? 34.324  -16.967 -27.172 1.00 70.52  ? 77  SER C N   1 
ATOM   5925  C  CA  . SER C 1 55  ? 33.971  -17.930 -26.143 1.00 70.79  ? 77  SER C CA  1 
ATOM   5926  C  C   . SER C 1 55  ? 32.466  -18.117 -26.112 1.00 74.28  ? 77  SER C C   1 
ATOM   5927  O  O   . SER C 1 55  ? 32.018  -19.254 -26.065 1.00 76.01  ? 77  SER C O   1 
ATOM   5928  C  CB  . SER C 1 55  ? 34.487  -17.464 -24.787 1.00 74.09  ? 77  SER C CB  1 
ATOM   5929  O  OG  . SER C 1 55  ? 34.303  -18.447 -23.783 1.00 86.63  ? 77  SER C OG  1 
ATOM   5930  N  N   . VAL C 1 56  ? 31.685  -17.022 -26.195 1.00 68.22  ? 78  VAL C N   1 
ATOM   5931  C  CA  . VAL C 1 56  ? 30.218  -17.086 -26.200 1.00 67.24  ? 78  VAL C CA  1 
ATOM   5932  C  C   . VAL C 1 56  ? 29.734  -18.022 -27.325 1.00 74.35  ? 78  VAL C C   1 
ATOM   5933  O  O   . VAL C 1 56  ? 28.938  -18.923 -27.070 1.00 74.29  ? 78  VAL C O   1 
ATOM   5934  C  CB  . VAL C 1 56  ? 29.571  -15.674 -26.259 1.00 69.02  ? 78  VAL C CB  1 
ATOM   5935  C  CG1 . VAL C 1 56  ? 28.063  -15.745 -26.429 1.00 67.98  ? 78  VAL C CG1 1 
ATOM   5936  C  CG2 . VAL C 1 56  ? 29.921  -14.866 -25.019 1.00 67.91  ? 78  VAL C CG2 1 
ATOM   5937  N  N   . CYS C 1 57  ? 30.273  -17.841 -28.535 1.00 74.03  ? 79  CYS C N   1 
ATOM   5938  C  CA  . CYS C 1 57  ? 29.949  -18.626 -29.721 1.00 77.40  ? 79  CYS C CA  1 
ATOM   5939  C  C   . CYS C 1 57  ? 30.329  -20.098 -29.563 1.00 85.54  ? 79  CYS C C   1 
ATOM   5940  O  O   . CYS C 1 57  ? 29.506  -20.986 -29.801 1.00 86.64  ? 79  CYS C O   1 
ATOM   5941  C  CB  . CYS C 1 57  ? 30.622  -18.023 -30.955 1.00 79.07  ? 79  CYS C CB  1 
ATOM   5942  S  SG  . CYS C 1 57  ? 29.864  -16.491 -31.552 1.00 81.92  ? 79  CYS C SG  1 
ATOM   5943  N  N   . GLU C 1 58  ? 31.593  -20.338 -29.202 1.00 83.51  ? 80  GLU C N   1 
ATOM   5944  C  CA  . GLU C 1 58  ? 32.188  -21.654 -29.082 1.00 85.91  ? 80  GLU C CA  1 
ATOM   5945  C  C   . GLU C 1 58  ? 31.704  -22.451 -27.910 1.00 90.78  ? 80  GLU C C   1 
ATOM   5946  O  O   . GLU C 1 58  ? 31.608  -23.674 -28.005 1.00 93.23  ? 80  GLU C O   1 
ATOM   5947  C  CB  . GLU C 1 58  ? 33.715  -21.532 -28.999 1.00 88.65  ? 80  GLU C CB  1 
ATOM   5948  C  CG  . GLU C 1 58  ? 34.388  -21.357 -30.353 1.00 101.79 ? 80  GLU C CG  1 
ATOM   5949  C  CD  . GLU C 1 58  ? 35.804  -20.818 -30.324 1.00 121.88 ? 80  GLU C CD  1 
ATOM   5950  O  OE1 . GLU C 1 58  ? 36.537  -21.099 -29.349 1.00 132.25 ? 80  GLU C OE1 1 
ATOM   5951  O  OE2 . GLU C 1 58  ? 36.184  -20.115 -31.288 1.00 109.75 ? 80  GLU C OE2 1 
ATOM   5952  N  N   . ASP C 1 59  ? 31.465  -21.795 -26.787 1.00 85.47  ? 81  ASP C N   1 
ATOM   5953  C  CA  . ASP C 1 59  ? 31.130  -22.500 -25.564 1.00 85.10  ? 81  ASP C CA  1 
ATOM   5954  C  C   . ASP C 1 59  ? 29.682  -22.403 -25.138 1.00 84.69  ? 81  ASP C C   1 
ATOM   5955  O  O   . ASP C 1 59  ? 29.192  -23.351 -24.520 1.00 85.77  ? 81  ASP C O   1 
ATOM   5956  C  CB  . ASP C 1 59  ? 32.056  -22.051 -24.433 1.00 86.86  ? 81  ASP C CB  1 
ATOM   5957  C  CG  . ASP C 1 59  ? 33.539  -22.202 -24.753 1.00 102.66 ? 81  ASP C CG  1 
ATOM   5958  O  OD1 . ASP C 1 59  ? 33.971  -23.341 -25.058 1.00 105.28 ? 81  ASP C OD1 1 
ATOM   5959  O  OD2 . ASP C 1 59  ? 34.268  -21.181 -24.697 1.00 110.44 ? 81  ASP C OD2 1 
ATOM   5960  N  N   . LEU C 1 60  ? 28.983  -21.313 -25.469 1.00 75.96  ? 82  LEU C N   1 
ATOM   5961  C  CA  . LEU C 1 60  ? 27.590  -21.203 -25.035 1.00 73.30  ? 82  LEU C CA  1 
ATOM   5962  C  C   . LEU C 1 60  ? 26.558  -21.323 -26.165 1.00 78.62  ? 82  LEU C C   1 
ATOM   5963  O  O   . LEU C 1 60  ? 25.661  -22.160 -26.049 1.00 80.05  ? 82  LEU C O   1 
ATOM   5964  C  CB  . LEU C 1 60  ? 27.354  -19.925 -24.210 1.00 70.04  ? 82  LEU C CB  1 
ATOM   5965  C  CG  . LEU C 1 60  ? 28.378  -19.630 -23.117 1.00 71.41  ? 82  LEU C CG  1 
ATOM   5966  C  CD1 . LEU C 1 60  ? 28.177  -18.259 -22.583 1.00 69.07  ? 82  LEU C CD1 1 
ATOM   5967  C  CD2 . LEU C 1 60  ? 28.352  -20.664 -22.003 1.00 70.50  ? 82  LEU C CD2 1 
ATOM   5968  N  N   . ILE C 1 61  ? 26.668  -20.517 -27.247 1.00 73.59  ? 83  ILE C N   1 
ATOM   5969  C  CA  . ILE C 1 61  ? 25.689  -20.555 -28.343 1.00 73.06  ? 83  ILE C CA  1 
ATOM   5970  C  C   . ILE C 1 61  ? 25.784  -21.902 -29.061 1.00 79.25  ? 83  ILE C C   1 
ATOM   5971  O  O   . ILE C 1 61  ? 24.768  -22.411 -29.554 1.00 80.14  ? 83  ILE C O   1 
ATOM   5972  C  CB  . ILE C 1 61  ? 25.758  -19.298 -29.266 1.00 74.89  ? 83  ILE C CB  1 
ATOM   5973  C  CG1 . ILE C 1 61  ? 25.374  -18.030 -28.449 1.00 72.82  ? 83  ILE C CG1 1 
ATOM   5974  C  CG2 . ILE C 1 61  ? 24.862  -19.437 -30.508 1.00 75.82  ? 83  ILE C CG2 1 
ATOM   5975  C  CD1 . ILE C 1 61  ? 25.636  -16.697 -29.113 1.00 80.74  ? 83  ILE C CD1 1 
ATOM   5976  N  N   . SER C 1 62  ? 26.964  -22.542 -28.979 1.00 77.21  ? 84  SER C N   1 
ATOM   5977  C  CA  . SER C 1 62  ? 27.207  -23.881 -29.522 1.00 79.65  ? 84  SER C CA  1 
ATOM   5978  C  C   . SER C 1 62  ? 26.323  -24.919 -28.824 1.00 85.05  ? 84  SER C C   1 
ATOM   5979  O  O   . SER C 1 62  ? 26.012  -25.960 -29.408 1.00 87.57  ? 84  SER C O   1 
ATOM   5980  C  CB  . SER C 1 62  ? 28.668  -24.262 -29.353 1.00 84.13  ? 84  SER C CB  1 
ATOM   5981  O  OG  . SER C 1 62  ? 28.973  -24.471 -27.985 1.00 92.29  ? 84  SER C OG  1 
ATOM   5982  N  N   . SER C 1 63  ? 25.915  -24.619 -27.578 1.00 79.10  ? 85  SER C N   1 
ATOM   5983  C  CA  . SER C 1 63  ? 25.074  -25.485 -26.769 1.00 78.78  ? 85  SER C CA  1 
ATOM   5984  C  C   . SER C 1 63  ? 23.617  -25.085 -26.830 1.00 82.03  ? 85  SER C C   1 
ATOM   5985  O  O   . SER C 1 63  ? 22.822  -25.658 -26.096 1.00 82.42  ? 85  SER C O   1 
ATOM   5986  C  CB  . SER C 1 63  ? 25.567  -25.502 -25.326 1.00 81.47  ? 85  SER C CB  1 
ATOM   5987  O  OG  . SER C 1 63  ? 26.906  -25.967 -25.263 1.00 93.92  ? 85  SER C OG  1 
ATOM   5988  N  N   . GLN C 1 64  ? 23.243  -24.136 -27.712 1.00 78.82  ? 86  GLN C N   1 
ATOM   5989  C  CA  . GLN C 1 64  ? 21.858  -23.630 -27.840 1.00 78.29  ? 86  GLN C CA  1 
ATOM   5990  C  C   . GLN C 1 64  ? 21.244  -23.134 -26.519 1.00 80.22  ? 86  GLN C C   1 
ATOM   5991  O  O   . GLN C 1 64  ? 20.176  -23.620 -26.104 1.00 80.93  ? 86  GLN C O   1 
ATOM   5992  C  CB  . GLN C 1 64  ? 20.926  -24.658 -28.481 1.00 81.08  ? 86  GLN C CB  1 
ATOM   5993  C  CG  . GLN C 1 64  ? 21.174  -24.815 -29.931 1.00 92.47  ? 86  GLN C CG  1 
ATOM   5994  C  CD  . GLN C 1 64  ? 20.435  -25.998 -30.425 1.00 105.23 ? 86  GLN C CD  1 
ATOM   5995  O  OE1 . GLN C 1 64  ? 20.837  -27.144 -30.199 1.00 100.71 ? 86  GLN C OE1 1 
ATOM   5996  N  NE2 . GLN C 1 64  ? 19.307  -25.739 -31.055 1.00 98.39  ? 86  GLN C NE2 1 
ATOM   5997  N  N   . VAL C 1 65  ? 21.939  -22.193 -25.853 1.00 72.62  ? 87  VAL C N   1 
ATOM   5998  C  CA  . VAL C 1 65  ? 21.503  -21.607 -24.585 1.00 69.74  ? 87  VAL C CA  1 
ATOM   5999  C  C   . VAL C 1 65  ? 20.284  -20.724 -24.824 1.00 70.39  ? 87  VAL C C   1 
ATOM   6000  O  O   . VAL C 1 65  ? 20.171  -20.126 -25.884 1.00 68.20  ? 87  VAL C O   1 
ATOM   6001  C  CB  . VAL C 1 65  ? 22.653  -20.879 -23.841 1.00 72.04  ? 87  VAL C CB  1 
ATOM   6002  C  CG1 . VAL C 1 65  ? 23.664  -21.882 -23.327 1.00 73.25  ? 87  VAL C CG1 1 
ATOM   6003  C  CG2 . VAL C 1 65  ? 23.347  -19.847 -24.726 1.00 70.79  ? 87  VAL C CG2 1 
ATOM   6004  N  N   . TYR C 1 66  ? 19.358  -20.688 -23.867 1.00 67.38  ? 88  TYR C N   1 
ATOM   6005  C  CA  . TYR C 1 66  ? 18.125  -19.885 -23.944 1.00 66.43  ? 88  TYR C CA  1 
ATOM   6006  C  C   . TYR C 1 66  ? 18.318  -18.473 -23.391 1.00 68.87  ? 88  TYR C C   1 
ATOM   6007  O  O   . TYR C 1 66  ? 17.600  -17.557 -23.777 1.00 68.22  ? 88  TYR C O   1 
ATOM   6008  C  CB  . TYR C 1 66  ? 16.959  -20.614 -23.249 1.00 67.48  ? 88  TYR C CB  1 
ATOM   6009  C  CG  . TYR C 1 66  ? 16.292  -21.628 -24.151 1.00 70.40  ? 88  TYR C CG  1 
ATOM   6010  C  CD1 . TYR C 1 66  ? 16.982  -22.751 -24.605 1.00 74.25  ? 88  TYR C CD1 1 
ATOM   6011  C  CD2 . TYR C 1 66  ? 14.983  -21.451 -24.581 1.00 71.10  ? 88  TYR C CD2 1 
ATOM   6012  C  CE1 . TYR C 1 66  ? 16.384  -23.667 -25.472 1.00 76.90  ? 88  TYR C CE1 1 
ATOM   6013  C  CE2 . TYR C 1 66  ? 14.375  -22.360 -25.447 1.00 73.15  ? 88  TYR C CE2 1 
ATOM   6014  C  CZ  . TYR C 1 66  ? 15.083  -23.463 -25.895 1.00 81.72  ? 88  TYR C CZ  1 
ATOM   6015  O  OH  . TYR C 1 66  ? 14.494  -24.366 -26.740 1.00 86.73  ? 88  TYR C OH  1 
ATOM   6016  N  N   . ALA C 1 67  ? 19.295  -18.313 -22.495 1.00 64.74  ? 89  ALA C N   1 
ATOM   6017  C  CA  . ALA C 1 67  ? 19.685  -17.070 -21.836 1.00 63.05  ? 89  ALA C CA  1 
ATOM   6018  C  C   . ALA C 1 67  ? 21.122  -17.212 -21.351 1.00 67.58  ? 89  ALA C C   1 
ATOM   6019  O  O   . ALA C 1 67  ? 21.628  -18.336 -21.193 1.00 69.41  ? 89  ALA C O   1 
ATOM   6020  C  CB  . ALA C 1 67  ? 18.779  -16.792 -20.650 1.00 63.44  ? 89  ALA C CB  1 
ATOM   6021  N  N   . ILE C 1 68  ? 21.792  -16.071 -21.149 1.00 61.51  ? 90  ILE C N   1 
ATOM   6022  C  CA  . ILE C 1 68  ? 23.164  -16.054 -20.660 1.00 60.38  ? 90  ILE C CA  1 
ATOM   6023  C  C   . ILE C 1 68  ? 23.223  -15.160 -19.427 1.00 63.93  ? 90  ILE C C   1 
ATOM   6024  O  O   . ILE C 1 68  ? 22.836  -13.991 -19.479 1.00 62.82  ? 90  ILE C O   1 
ATOM   6025  C  CB  . ILE C 1 68  ? 24.217  -15.633 -21.739 1.00 62.29  ? 90  ILE C CB  1 
ATOM   6026  C  CG1 . ILE C 1 68  ? 24.113  -16.497 -23.025 1.00 62.43  ? 90  ILE C CG1 1 
ATOM   6027  C  CG2 . ILE C 1 68  ? 25.659  -15.620 -21.149 1.00 62.70  ? 90  ILE C CG2 1 
ATOM   6028  C  CD1 . ILE C 1 68  ? 24.945  -16.004 -24.236 1.00 58.25  ? 90  ILE C CD1 1 
ATOM   6029  N  N   . LEU C 1 69  ? 23.709  -15.712 -18.327 1.00 60.52  ? 91  LEU C N   1 
ATOM   6030  C  CA  . LEU C 1 69  ? 23.909  -14.964 -17.092 1.00 59.26  ? 91  LEU C CA  1 
ATOM   6031  C  C   . LEU C 1 69  ? 25.308  -14.384 -17.181 1.00 64.53  ? 91  LEU C C   1 
ATOM   6032  O  O   . LEU C 1 69  ? 26.204  -15.064 -17.662 1.00 65.39  ? 91  LEU C O   1 
ATOM   6033  C  CB  . LEU C 1 69  ? 23.787  -15.911 -15.884 1.00 59.32  ? 91  LEU C CB  1 
ATOM   6034  C  CG  . LEU C 1 69  ? 22.374  -16.115 -15.332 1.00 61.58  ? 91  LEU C CG  1 
ATOM   6035  C  CD1 . LEU C 1 69  ? 21.457  -16.767 -16.344 1.00 60.36  ? 91  LEU C CD1 1 
ATOM   6036  C  CD2 . LEU C 1 69  ? 22.421  -16.931 -14.092 1.00 63.70  ? 91  LEU C CD2 1 
ATOM   6037  N  N   . VAL C 1 70  ? 25.491  -13.117 -16.808 1.00 61.64  ? 92  VAL C N   1 
ATOM   6038  C  CA  . VAL C 1 70  ? 26.805  -12.484 -16.879 1.00 62.21  ? 92  VAL C CA  1 
ATOM   6039  C  C   . VAL C 1 70  ? 27.090  -11.749 -15.601 1.00 70.33  ? 92  VAL C C   1 
ATOM   6040  O  O   . VAL C 1 70  ? 26.339  -10.829 -15.251 1.00 70.25  ? 92  VAL C O   1 
ATOM   6041  C  CB  . VAL C 1 70  ? 26.968  -11.506 -18.064 1.00 64.80  ? 92  VAL C CB  1 
ATOM   6042  C  CG1 . VAL C 1 70  ? 28.406  -11.015 -18.157 1.00 64.88  ? 92  VAL C CG1 1 
ATOM   6043  C  CG2 . VAL C 1 70  ? 26.545  -12.131 -19.372 1.00 65.07  ? 92  VAL C CG2 1 
ATOM   6044  N  N   . SER C 1 71  ? 28.208  -12.091 -14.951 1.00 69.65  ? 93  SER C N   1 
ATOM   6045  C  CA  . SER C 1 71  ? 28.661  -11.375 -13.776 1.00 71.27  ? 93  SER C CA  1 
ATOM   6046  C  C   . SER C 1 71  ? 29.657  -10.348 -14.271 1.00 79.87  ? 93  SER C C   1 
ATOM   6047  O  O   . SER C 1 71  ? 30.285  -10.584 -15.298 1.00 79.28  ? 93  SER C O   1 
ATOM   6048  C  CB  . SER C 1 71  ? 29.345  -12.327 -12.807 1.00 75.95  ? 93  SER C CB  1 
ATOM   6049  O  OG  . SER C 1 71  ? 30.518  -12.895 -13.367 1.00 81.38  ? 93  SER C OG  1 
ATOM   6050  N  N   . HIS C 1 72  ? 29.797  -9.209  -13.570 1.00 81.10  ? 94  HIS C N   1 
ATOM   6051  C  CA  . HIS C 1 72  ? 30.783  -8.189  -13.932 1.00 82.82  ? 94  HIS C CA  1 
ATOM   6052  C  C   . HIS C 1 72  ? 32.196  -8.775  -13.661 1.00 88.79  ? 94  HIS C C   1 
ATOM   6053  O  O   . HIS C 1 72  ? 32.436  -9.288  -12.561 1.00 88.02  ? 94  HIS C O   1 
ATOM   6054  C  CB  . HIS C 1 72  ? 30.559  -6.874  -13.167 1.00 84.09  ? 94  HIS C CB  1 
ATOM   6055  C  CG  . HIS C 1 72  ? 31.131  -5.694  -13.875 1.00 88.03  ? 94  HIS C CG  1 
ATOM   6056  N  ND1 . HIS C 1 72  ? 30.316  -4.766  -14.500 1.00 90.10  ? 94  HIS C ND1 1 
ATOM   6057  C  CD2 . HIS C 1 72  ? 32.421  -5.365  -14.106 1.00 90.78  ? 94  HIS C CD2 1 
ATOM   6058  C  CE1 . HIS C 1 72  ? 31.125  -3.896  -15.078 1.00 89.53  ? 94  HIS C CE1 1 
ATOM   6059  N  NE2 . HIS C 1 72  ? 32.405  -4.218  -14.873 1.00 90.46  ? 94  HIS C NE2 1 
ATOM   6060  N  N   . PRO C 1 73  ? 33.097  -8.777  -14.688 1.00 87.36  ? 95  PRO C N   1 
ATOM   6061  C  CA  . PRO C 1 73  ? 34.427  -9.427  -14.527 1.00 93.22  ? 95  PRO C CA  1 
ATOM   6062  C  C   . PRO C 1 73  ? 35.285  -8.965  -13.349 1.00 129.28 ? 95  PRO C C   1 
ATOM   6063  O  O   . PRO C 1 73  ? 35.202  -7.811  -12.965 1.00 111.17 ? 95  PRO C O   1 
ATOM   6064  C  CB  . PRO C 1 73  ? 35.128  -9.154  -15.870 1.00 94.22  ? 95  PRO C CB  1 
ATOM   6065  C  CG  . PRO C 1 73  ? 34.287  -8.118  -16.578 1.00 95.11  ? 95  PRO C CG  1 
ATOM   6066  C  CD  . PRO C 1 73  ? 32.903  -8.276  -16.071 1.00 89.20  ? 95  PRO C CD  1 
ATOM   6067  N  N   . LEU C 1 80  ? 37.558  -5.081  -19.472 1.00 69.88  ? 102 LEU C N   1 
ATOM   6068  C  CA  . LEU C 1 80  ? 36.597  -6.160  -19.726 1.00 70.01  ? 102 LEU C CA  1 
ATOM   6069  C  C   . LEU C 1 80  ? 35.203  -5.803  -19.156 1.00 76.84  ? 102 LEU C C   1 
ATOM   6070  O  O   . LEU C 1 80  ? 35.105  -5.365  -18.004 1.00 77.84  ? 102 LEU C O   1 
ATOM   6071  C  CB  . LEU C 1 80  ? 37.096  -7.519  -19.191 1.00 70.39  ? 102 LEU C CB  1 
ATOM   6072  N  N   . THR C 1 81  ? 34.133  -5.974  -19.979 1.00 72.61  ? 103 THR C N   1 
ATOM   6073  C  CA  . THR C 1 81  ? 32.738  -5.635  -19.657 1.00 70.74  ? 103 THR C CA  1 
ATOM   6074  C  C   . THR C 1 81  ? 31.740  -6.660  -20.206 1.00 72.63  ? 103 THR C C   1 
ATOM   6075  O  O   . THR C 1 81  ? 32.084  -7.386  -21.142 1.00 73.01  ? 103 THR C O   1 
ATOM   6076  C  CB  . THR C 1 81  ? 32.361  -4.303  -20.326 1.00 76.74  ? 103 THR C CB  1 
ATOM   6077  O  OG1 . THR C 1 81  ? 32.944  -4.208  -21.632 1.00 74.73  ? 103 THR C OG1 1 
ATOM   6078  C  CG2 . THR C 1 81  ? 32.682  -3.122  -19.474 1.00 76.66  ? 103 THR C CG2 1 
ATOM   6079  N  N   . PRO C 1 82  ? 30.455  -6.652  -19.753 1.00 65.37  ? 104 PRO C N   1 
ATOM   6080  C  CA  . PRO C 1 82  ? 29.476  -7.583  -20.342 1.00 63.32  ? 104 PRO C CA  1 
ATOM   6081  C  C   . PRO C 1 82  ? 29.143  -7.316  -21.812 1.00 62.47  ? 104 PRO C C   1 
ATOM   6082  O  O   . PRO C 1 82  ? 28.460  -8.131  -22.414 1.00 60.33  ? 104 PRO C O   1 
ATOM   6083  C  CB  . PRO C 1 82  ? 28.230  -7.379  -19.471 1.00 63.95  ? 104 PRO C CB  1 
ATOM   6084  C  CG  . PRO C 1 82  ? 28.706  -6.726  -18.254 1.00 68.44  ? 104 PRO C CG  1 
ATOM   6085  C  CD  . PRO C 1 82  ? 29.848  -5.882  -18.647 1.00 65.26  ? 104 PRO C CD  1 
ATOM   6086  N  N   . THR C 1 83  ? 29.630  -6.200  -22.385 1.00 58.63  ? 105 THR C N   1 
ATOM   6087  C  CA  . THR C 1 83  ? 29.300  -5.767  -23.755 1.00 58.53  ? 105 THR C CA  1 
ATOM   6088  C  C   . THR C 1 83  ? 29.598  -6.843  -24.839 1.00 62.92  ? 105 THR C C   1 
ATOM   6089  O  O   . THR C 1 83  ? 28.652  -7.147  -25.570 1.00 64.21  ? 105 THR C O   1 
ATOM   6090  C  CB  . THR C 1 83  ? 29.894  -4.402  -24.089 1.00 55.72  ? 105 THR C CB  1 
ATOM   6091  O  OG1 . THR C 1 83  ? 29.205  -3.437  -23.298 1.00 56.37  ? 105 THR C OG1 1 
ATOM   6092  C  CG2 . THR C 1 83  ? 29.705  -4.044  -25.523 1.00 45.35  ? 105 THR C CG2 1 
ATOM   6093  N  N   . PRO C 1 84  ? 30.798  -7.468  -24.962 1.00 56.95  ? 106 PRO C N   1 
ATOM   6094  C  CA  . PRO C 1 84  ? 30.973  -8.521  -25.981 1.00 57.22  ? 106 PRO C CA  1 
ATOM   6095  C  C   . PRO C 1 84  ? 29.944  -9.633  -25.842 1.00 60.42  ? 106 PRO C C   1 
ATOM   6096  O  O   . PRO C 1 84  ? 29.474  -10.128 -26.864 1.00 59.79  ? 106 PRO C O   1 
ATOM   6097  C  CB  . PRO C 1 84  ? 32.387  -9.032  -25.716 1.00 59.66  ? 106 PRO C CB  1 
ATOM   6098  C  CG  . PRO C 1 84  ? 33.052  -7.902  -25.117 1.00 63.55  ? 106 PRO C CG  1 
ATOM   6099  C  CD  . PRO C 1 84  ? 32.049  -7.264  -24.224 1.00 57.88  ? 106 PRO C CD  1 
ATOM   6100  N  N   . ILE C 1 85  ? 29.542  -9.968  -24.589 1.00 57.53  ? 107 ILE C N   1 
ATOM   6101  C  CA  . ILE C 1 85  ? 28.505  -10.972 -24.324 1.00 57.57  ? 107 ILE C CA  1 
ATOM   6102  C  C   . ILE C 1 85  ? 27.139  -10.445 -24.834 1.00 62.32  ? 107 ILE C C   1 
ATOM   6103  O  O   . ILE C 1 85  ? 26.446  -11.132 -25.601 1.00 64.08  ? 107 ILE C O   1 
ATOM   6104  C  CB  . ILE C 1 85  ? 28.457  -11.408 -22.837 1.00 59.64  ? 107 ILE C CB  1 
ATOM   6105  C  CG1 . ILE C 1 85  ? 29.818  -11.939 -22.388 1.00 60.86  ? 107 ILE C CG1 1 
ATOM   6106  C  CG2 . ILE C 1 85  ? 27.383  -12.479 -22.655 1.00 59.96  ? 107 ILE C CG2 1 
ATOM   6107  C  CD1 . ILE C 1 85  ? 30.221  -11.502 -21.122 1.00 67.13  ? 107 ILE C CD1 1 
ATOM   6108  N  N   . SER C 1 86  ? 26.790  -9.208  -24.424 1.00 55.74  ? 108 SER C N   1 
ATOM   6109  C  CA  . SER C 1 86  ? 25.563  -8.521  -24.791 1.00 53.51  ? 108 SER C CA  1 
ATOM   6110  C  C   . SER C 1 86  ? 25.416  -8.412  -26.306 1.00 58.62  ? 108 SER C C   1 
ATOM   6111  O  O   . SER C 1 86  ? 24.356  -8.732  -26.818 1.00 60.18  ? 108 SER C O   1 
ATOM   6112  C  CB  . SER C 1 86  ? 25.526  -7.149  -24.148 1.00 54.71  ? 108 SER C CB  1 
ATOM   6113  O  OG  . SER C 1 86  ? 24.342  -6.484  -24.541 1.00 63.99  ? 108 SER C OG  1 
ATOM   6114  N  N   . TYR C 1 87  ? 26.463  -8.020  -27.025 1.00 55.65  ? 109 TYR C N   1 
ATOM   6115  C  CA  . TYR C 1 87  ? 26.424  -7.921  -28.481 1.00 57.46  ? 109 TYR C CA  1 
ATOM   6116  C  C   . TYR C 1 87  ? 26.266  -9.284  -29.182 1.00 62.95  ? 109 TYR C C   1 
ATOM   6117  O  O   . TYR C 1 87  ? 25.375  -9.419  -30.020 1.00 63.55  ? 109 TYR C O   1 
ATOM   6118  C  CB  . TYR C 1 87  ? 27.649  -7.170  -29.014 1.00 60.38  ? 109 TYR C CB  1 
ATOM   6119  C  CG  . TYR C 1 87  ? 27.669  -5.674  -28.760 1.00 63.49  ? 109 TYR C CG  1 
ATOM   6120  C  CD1 . TYR C 1 87  ? 26.628  -5.041  -28.077 1.00 63.61  ? 109 TYR C CD1 1 
ATOM   6121  C  CD2 . TYR C 1 87  ? 28.737  -4.894  -29.186 1.00 66.29  ? 109 TYR C CD2 1 
ATOM   6122  C  CE1 . TYR C 1 87  ? 26.659  -3.671  -27.816 1.00 64.30  ? 109 TYR C CE1 1 
ATOM   6123  C  CE2 . TYR C 1 87  ? 28.771  -3.519  -28.948 1.00 67.55  ? 109 TYR C CE2 1 
ATOM   6124  C  CZ  . TYR C 1 87  ? 27.731  -2.912  -28.262 1.00 76.64  ? 109 TYR C CZ  1 
ATOM   6125  O  OH  . TYR C 1 87  ? 27.800  -1.562  -28.022 1.00 80.56  ? 109 TYR C OH  1 
ATOM   6126  N  N   . THR C 1 88  ? 27.099  -10.297 -28.830 1.00 60.34  ? 110 THR C N   1 
ATOM   6127  C  CA  . THR C 1 88  ? 27.019  -11.635 -29.440 1.00 61.43  ? 110 THR C CA  1 
ATOM   6128  C  C   . THR C 1 88  ? 25.619  -12.275 -29.219 1.00 64.54  ? 110 THR C C   1 
ATOM   6129  O  O   . THR C 1 88  ? 24.993  -12.769 -30.168 1.00 64.49  ? 110 THR C O   1 
ATOM   6130  C  CB  . THR C 1 88  ? 28.127  -12.545 -28.925 1.00 66.77  ? 110 THR C CB  1 
ATOM   6131  O  OG1 . THR C 1 88  ? 29.366  -11.851 -28.946 1.00 70.67  ? 110 THR C OG1 1 
ATOM   6132  C  CG2 . THR C 1 88  ? 28.254  -13.791 -29.750 1.00 62.83  ? 110 THR C CG2 1 
ATOM   6133  N  N   . ALA C 1 89  ? 25.141  -12.245 -27.968 1.00 57.85  ? 111 ALA C N   1 
ATOM   6134  C  CA  . ALA C 1 89  ? 23.843  -12.780 -27.625 1.00 56.64  ? 111 ALA C CA  1 
ATOM   6135  C  C   . ALA C 1 89  ? 22.714  -11.943 -28.258 1.00 63.65  ? 111 ALA C C   1 
ATOM   6136  O  O   . ALA C 1 89  ? 21.738  -12.510 -28.763 1.00 65.47  ? 111 ALA C O   1 
ATOM   6137  C  CB  . ALA C 1 89  ? 23.693  -12.818 -26.126 1.00 55.86  ? 111 ALA C CB  1 
ATOM   6138  N  N   . GLY C 1 90  ? 22.879  -10.615 -28.265 1.00 58.60  ? 112 GLY C N   1 
ATOM   6139  C  CA  . GLY C 1 90  ? 21.921  -9.673  -28.834 1.00 56.88  ? 112 GLY C CA  1 
ATOM   6140  C  C   . GLY C 1 90  ? 21.713  -9.885  -30.317 1.00 60.14  ? 112 GLY C C   1 
ATOM   6141  O  O   . GLY C 1 90  ? 20.587  -9.793  -30.802 1.00 61.33  ? 112 GLY C O   1 
ATOM   6142  N  N   . PHE C 1 91  ? 22.798  -10.210 -31.039 1.00 55.10  ? 113 PHE C N   1 
ATOM   6143  C  CA  . PHE C 1 91  ? 22.797  -10.524 -32.461 1.00 55.09  ? 113 PHE C CA  1 
ATOM   6144  C  C   . PHE C 1 91  ? 21.732  -11.598 -32.786 1.00 61.29  ? 113 PHE C C   1 
ATOM   6145  O  O   . PHE C 1 91  ? 21.078  -11.505 -33.835 1.00 61.13  ? 113 PHE C O   1 
ATOM   6146  C  CB  . PHE C 1 91  ? 24.189  -11.020 -32.861 1.00 56.12  ? 113 PHE C CB  1 
ATOM   6147  C  CG  . PHE C 1 91  ? 24.367  -11.392 -34.305 1.00 57.64  ? 113 PHE C CG  1 
ATOM   6148  C  CD1 . PHE C 1 91  ? 24.793  -10.454 -35.230 1.00 60.73  ? 113 PHE C CD1 1 
ATOM   6149  C  CD2 . PHE C 1 91  ? 24.164  -12.696 -34.732 1.00 60.38  ? 113 PHE C CD2 1 
ATOM   6150  C  CE1 . PHE C 1 91  ? 24.992  -10.812 -36.571 1.00 63.91  ? 113 PHE C CE1 1 
ATOM   6151  C  CE2 . PHE C 1 91  ? 24.346  -13.051 -36.072 1.00 65.67  ? 113 PHE C CE2 1 
ATOM   6152  C  CZ  . PHE C 1 91  ? 24.774  -12.111 -36.981 1.00 64.53  ? 113 PHE C CZ  1 
ATOM   6153  N  N   . TYR C 1 92  ? 21.569  -12.608 -31.887 1.00 58.60  ? 114 TYR C N   1 
ATOM   6154  C  CA  . TYR C 1 92  ? 20.597  -13.701 -32.043 1.00 59.43  ? 114 TYR C CA  1 
ATOM   6155  C  C   . TYR C 1 92  ? 19.330  -13.490 -31.221 1.00 62.96  ? 114 TYR C C   1 
ATOM   6156  O  O   . TYR C 1 92  ? 18.406  -14.284 -31.329 1.00 63.48  ? 114 TYR C O   1 
ATOM   6157  C  CB  . TYR C 1 92  ? 21.215  -15.069 -31.709 1.00 60.59  ? 114 TYR C CB  1 
ATOM   6158  C  CG  . TYR C 1 92  ? 22.394  -15.430 -32.572 1.00 61.88  ? 114 TYR C CG  1 
ATOM   6159  C  CD1 . TYR C 1 92  ? 22.216  -15.882 -33.876 1.00 64.80  ? 114 TYR C CD1 1 
ATOM   6160  C  CD2 . TYR C 1 92  ? 23.699  -15.300 -32.094 1.00 61.19  ? 114 TYR C CD2 1 
ATOM   6161  C  CE1 . TYR C 1 92  ? 23.304  -16.215 -34.681 1.00 65.36  ? 114 TYR C CE1 1 
ATOM   6162  C  CE2 . TYR C 1 92  ? 24.794  -15.617 -32.894 1.00 62.41  ? 114 TYR C CE2 1 
ATOM   6163  C  CZ  . TYR C 1 92  ? 24.589  -16.070 -34.189 1.00 68.94  ? 114 TYR C CZ  1 
ATOM   6164  O  OH  . TYR C 1 92  ? 25.650  -16.351 -35.002 1.00 69.85  ? 114 TYR C OH  1 
ATOM   6165  N  N   . ARG C 1 93  ? 19.273  -12.417 -30.435 1.00 58.31  ? 115 ARG C N   1 
ATOM   6166  C  CA  . ARG C 1 93  ? 18.138  -12.040 -29.585 1.00 57.72  ? 115 ARG C CA  1 
ATOM   6167  C  C   . ARG C 1 93  ? 17.991  -12.978 -28.397 1.00 62.75  ? 115 ARG C C   1 
ATOM   6168  O  O   . ARG C 1 93  ? 16.881  -13.152 -27.850 1.00 62.22  ? 115 ARG C O   1 
ATOM   6169  C  CB  . ARG C 1 93  ? 16.821  -11.856 -30.356 1.00 56.44  ? 115 ARG C CB  1 
ATOM   6170  C  CG  . ARG C 1 93  ? 16.884  -10.887 -31.515 1.00 59.72  ? 115 ARG C CG  1 
ATOM   6171  C  CD  . ARG C 1 93  ? 16.851  -9.432  -31.101 1.00 65.87  ? 115 ARG C CD  1 
ATOM   6172  N  NE  . ARG C 1 93  ? 16.574  -8.557  -32.248 1.00 87.41  ? 115 ARG C NE  1 
ATOM   6173  C  CZ  . ARG C 1 93  ? 17.489  -8.123  -33.117 1.00 97.18  ? 115 ARG C CZ  1 
ATOM   6174  N  NH1 . ARG C 1 93  ? 18.758  -8.477  -32.988 1.00 76.06  ? 115 ARG C NH1 1 
ATOM   6175  N  NH2 . ARG C 1 93  ? 17.139  -7.330  -34.117 1.00 88.05  ? 115 ARG C NH2 1 
ATOM   6176  N  N   . ILE C 1 94  ? 19.146  -13.537 -27.968 1.00 59.45  ? 116 ILE C N   1 
ATOM   6177  C  CA  . ILE C 1 94  ? 19.261  -14.384 -26.781 1.00 59.24  ? 116 ILE C CA  1 
ATOM   6178  C  C   . ILE C 1 94  ? 19.382  -13.438 -25.571 1.00 62.91  ? 116 ILE C C   1 
ATOM   6179  O  O   . ILE C 1 94  ? 20.326  -12.638 -25.504 1.00 63.63  ? 116 ILE C O   1 
ATOM   6180  C  CB  . ILE C 1 94  ? 20.450  -15.392 -26.853 1.00 62.60  ? 116 ILE C CB  1 
ATOM   6181  C  CG1 . ILE C 1 94  ? 20.296  -16.361 -28.037 1.00 64.70  ? 116 ILE C CG1 1 
ATOM   6182  C  CG2 . ILE C 1 94  ? 20.616  -16.158 -25.529 1.00 61.95  ? 116 ILE C CG2 1 
ATOM   6183  C  CD1 . ILE C 1 94  ? 21.599  -16.833 -28.581 1.00 76.86  ? 116 ILE C CD1 1 
ATOM   6184  N  N   . PRO C 1 95  ? 18.423  -13.516 -24.626 1.00 58.33  ? 117 PRO C N   1 
ATOM   6185  C  CA  . PRO C 1 95  ? 18.471  -12.652 -23.437 1.00 56.75  ? 117 PRO C CA  1 
ATOM   6186  C  C   . PRO C 1 95  ? 19.715  -12.836 -22.564 1.00 61.58  ? 117 PRO C C   1 
ATOM   6187  O  O   . PRO C 1 95  ? 20.205  -13.950 -22.369 1.00 62.79  ? 117 PRO C O   1 
ATOM   6188  C  CB  . PRO C 1 95  ? 17.214  -13.054 -22.670 1.00 58.78  ? 117 PRO C CB  1 
ATOM   6189  C  CG  . PRO C 1 95  ? 16.297  -13.604 -23.720 1.00 64.83  ? 117 PRO C CG  1 
ATOM   6190  C  CD  . PRO C 1 95  ? 17.215  -14.365 -24.611 1.00 61.09  ? 117 PRO C CD  1 
ATOM   6191  N  N   . VAL C 1 96  ? 20.223  -11.713 -22.051 1.00 56.50  ? 118 VAL C N   1 
ATOM   6192  C  CA  . VAL C 1 96  ? 21.367  -11.649 -21.157 1.00 55.74  ? 118 VAL C CA  1 
ATOM   6193  C  C   . VAL C 1 96  ? 20.897  -11.108 -19.800 1.00 61.58  ? 118 VAL C C   1 
ATOM   6194  O  O   . VAL C 1 96  ? 20.080  -10.177 -19.748 1.00 60.83  ? 118 VAL C O   1 
ATOM   6195  C  CB  . VAL C 1 96  ? 22.532  -10.853 -21.778 1.00 58.09  ? 118 VAL C CB  1 
ATOM   6196  C  CG1 . VAL C 1 96  ? 23.579  -10.449 -20.746 1.00 56.83  ? 118 VAL C CG1 1 
ATOM   6197  C  CG2 . VAL C 1 96  ? 23.170  -11.653 -22.897 1.00 58.67  ? 118 VAL C CG2 1 
ATOM   6198  N  N   . ILE C 1 97  ? 21.358  -11.755 -18.711 1.00 58.84  ? 119 ILE C N   1 
ATOM   6199  C  CA  . ILE C 1 97  ? 21.017  -11.372 -17.352 1.00 58.07  ? 119 ILE C CA  1 
ATOM   6200  C  C   . ILE C 1 97  ? 22.291  -10.932 -16.638 1.00 62.76  ? 119 ILE C C   1 
ATOM   6201  O  O   . ILE C 1 97  ? 23.100  -11.778 -16.253 1.00 62.54  ? 119 ILE C O   1 
ATOM   6202  C  CB  . ILE C 1 97  ? 20.237  -12.466 -16.547 1.00 61.02  ? 119 ILE C CB  1 
ATOM   6203  C  CG1 . ILE C 1 97  ? 19.252  -13.309 -17.429 1.00 61.62  ? 119 ILE C CG1 1 
ATOM   6204  C  CG2 . ILE C 1 97  ? 19.534  -11.856 -15.324 1.00 60.30  ? 119 ILE C CG2 1 
ATOM   6205  C  CD1 . ILE C 1 97  ? 18.022  -12.601 -18.051 1.00 72.42  ? 119 ILE C CD1 1 
ATOM   6206  N  N   . GLY C 1 98  ? 22.450  -9.613  -16.486 1.00 60.06  ? 120 GLY C N   1 
ATOM   6207  C  CA  . GLY C 1 98  ? 23.540  -8.999  -15.743 1.00 60.07  ? 120 GLY C CA  1 
ATOM   6208  C  C   . GLY C 1 98  ? 23.349  -9.254  -14.257 1.00 65.08  ? 120 GLY C C   1 
ATOM   6209  O  O   . GLY C 1 98  ? 22.253  -9.042  -13.717 1.00 64.30  ? 120 GLY C O   1 
ATOM   6210  N  N   . LEU C 1 99  ? 24.389  -9.762  -13.587 1.00 62.14  ? 121 LEU C N   1 
ATOM   6211  C  CA  . LEU C 1 99  ? 24.263  -10.062 -12.156 1.00 62.42  ? 121 LEU C CA  1 
ATOM   6212  C  C   . LEU C 1 99  ? 24.840  -8.985  -11.287 1.00 67.49  ? 121 LEU C C   1 
ATOM   6213  O  O   . LEU C 1 99  ? 24.319  -8.785  -10.197 1.00 67.60  ? 121 LEU C O   1 
ATOM   6214  C  CB  . LEU C 1 99  ? 24.916  -11.393 -11.753 1.00 62.71  ? 121 LEU C CB  1 
ATOM   6215  C  CG  . LEU C 1 99  ? 24.689  -12.607 -12.607 1.00 66.68  ? 121 LEU C CG  1 
ATOM   6216  C  CD1 . LEU C 1 99  ? 25.480  -13.751 -12.074 1.00 67.93  ? 121 LEU C CD1 1 
ATOM   6217  C  CD2 . LEU C 1 99  ? 23.232  -12.954 -12.698 1.00 66.93  ? 121 LEU C CD2 1 
ATOM   6218  N  N   . THR C 1 100 ? 25.953  -8.340  -11.707 1.00 64.76  ? 122 THR C N   1 
ATOM   6219  C  CA  . THR C 1 100 ? 26.590  -7.351  -10.833 1.00 65.24  ? 122 THR C CA  1 
ATOM   6220  C  C   . THR C 1 100 ? 26.961  -6.036  -11.506 1.00 67.10  ? 122 THR C C   1 
ATOM   6221  O  O   . THR C 1 100 ? 27.404  -5.126  -10.815 1.00 64.27  ? 122 THR C O   1 
ATOM   6222  C  CB  . THR C 1 100 ? 27.814  -7.951  -10.102 1.00 79.34  ? 122 THR C CB  1 
ATOM   6223  O  OG1 . THR C 1 100 ? 28.744  -8.462  -11.059 1.00 80.87  ? 122 THR C OG1 1 
ATOM   6224  C  CG2 . THR C 1 100 ? 27.430  -9.022  -9.032  1.00 78.40  ? 122 THR C CG2 1 
ATOM   6225  N  N   . THR C 1 101 ? 26.724  -5.917  -12.822 1.00 65.59  ? 123 THR C N   1 
ATOM   6226  C  CA  . THR C 1 101 ? 26.983  -4.715  -13.648 1.00 64.88  ? 123 THR C CA  1 
ATOM   6227  C  C   . THR C 1 101 ? 25.991  -3.596  -13.332 1.00 68.40  ? 123 THR C C   1 
ATOM   6228  O  O   . THR C 1 101 ? 24.791  -3.769  -13.555 1.00 68.23  ? 123 THR C O   1 
ATOM   6229  C  CB  . THR C 1 101 ? 26.950  -5.124  -15.113 1.00 70.29  ? 123 THR C CB  1 
ATOM   6230  O  OG1 . THR C 1 101 ? 27.625  -6.394  -15.235 1.00 76.05  ? 123 THR C OG1 1 
ATOM   6231  C  CG2 . THR C 1 101 ? 27.534  -4.068  -16.016 1.00 61.04  ? 123 THR C CG2 1 
ATOM   6232  N  N   . ARG C 1 102 ? 26.486  -2.458  -12.812 1.00 65.02  ? 124 ARG C N   1 
ATOM   6233  C  CA  . ARG C 1 102 ? 25.647  -1.330  -12.344 1.00 64.47  ? 124 ARG C CA  1 
ATOM   6234  C  C   . ARG C 1 102 ? 25.611  -0.130  -13.263 1.00 66.44  ? 124 ARG C C   1 
ATOM   6235  O  O   . ARG C 1 102 ? 24.865  0.820   -13.010 1.00 67.39  ? 124 ARG C O   1 
ATOM   6236  C  CB  . ARG C 1 102 ? 26.117  -0.863  -10.951 1.00 63.81  ? 124 ARG C CB  1 
ATOM   6237  C  CG  . ARG C 1 102 ? 26.136  -1.926  -9.877  1.00 68.59  ? 124 ARG C CG  1 
ATOM   6238  C  CD  . ARG C 1 102 ? 24.774  -2.168  -9.250  1.00 69.57  ? 124 ARG C CD  1 
ATOM   6239  N  NE  . ARG C 1 102 ? 24.205  -0.979  -8.617  1.00 60.01  ? 124 ARG C NE  1 
ATOM   6240  C  CZ  . ARG C 1 102 ? 24.626  -0.466  -7.473  1.00 71.58  ? 124 ARG C CZ  1 
ATOM   6241  N  NH1 . ARG C 1 102 ? 25.646  -1.015  -6.828  1.00 68.69  ? 124 ARG C NH1 1 
ATOM   6242  N  NH2 . ARG C 1 102 ? 24.032  0.605   -6.961  1.00 56.15  ? 124 ARG C NH2 1 
ATOM   6243  N  N   . MET C 1 103 ? 26.448  -0.134  -14.286 1.00 60.77  ? 125 MET C N   1 
ATOM   6244  C  CA  . MET C 1 103 ? 26.512  0.982   -15.212 1.00 59.99  ? 125 MET C CA  1 
ATOM   6245  C  C   . MET C 1 103 ? 25.189  1.177   -15.934 1.00 66.26  ? 125 MET C C   1 
ATOM   6246  O  O   . MET C 1 103 ? 24.610  0.220   -16.460 1.00 65.43  ? 125 MET C O   1 
ATOM   6247  C  CB  . MET C 1 103 ? 27.697  0.828   -16.173 1.00 61.73  ? 125 MET C CB  1 
ATOM   6248  C  CG  . MET C 1 103 ? 29.050  0.906   -15.474 1.00 65.34  ? 125 MET C CG  1 
ATOM   6249  S  SD  . MET C 1 103 ? 29.294  2.345   -14.381 1.00 69.68  ? 125 MET C SD  1 
ATOM   6250  C  CE  . MET C 1 103 ? 29.632  3.566   -15.540 1.00 66.34  ? 125 MET C CE  1 
ATOM   6251  N  N   . SER C 1 104 ? 24.687  2.421   -15.890 1.00 65.03  ? 126 SER C N   1 
ATOM   6252  C  CA  . SER C 1 104 ? 23.422  2.849   -16.479 1.00 65.74  ? 126 SER C CA  1 
ATOM   6253  C  C   . SER C 1 104 ? 23.294  2.629   -17.993 1.00 71.20  ? 126 SER C C   1 
ATOM   6254  O  O   . SER C 1 104 ? 22.165  2.527   -18.482 1.00 72.98  ? 126 SER C O   1 
ATOM   6255  C  CB  . SER C 1 104 ? 23.142  4.304   -16.132 1.00 69.07  ? 126 SER C CB  1 
ATOM   6256  O  OG  . SER C 1 104 ? 22.875  4.445   -14.746 1.00 75.32  ? 126 SER C OG  1 
ATOM   6257  N  N   . ILE C 1 105 ? 24.413  2.517   -18.728 1.00 65.98  ? 127 ILE C N   1 
ATOM   6258  C  CA  . ILE C 1 105 ? 24.373  2.292   -20.170 1.00 65.62  ? 127 ILE C CA  1 
ATOM   6259  C  C   . ILE C 1 105 ? 23.734  0.973   -20.562 1.00 67.17  ? 127 ILE C C   1 
ATOM   6260  O  O   . ILE C 1 105 ? 23.113  0.919   -21.622 1.00 67.65  ? 127 ILE C O   1 
ATOM   6261  C  CB  . ILE C 1 105 ? 25.725  2.466   -20.867 1.00 69.74  ? 127 ILE C CB  1 
ATOM   6262  C  CG1 . ILE C 1 105 ? 26.736  3.232   -19.936 1.00 72.03  ? 127 ILE C CG1 1 
ATOM   6263  C  CG2 . ILE C 1 105 ? 25.468  3.160   -22.242 1.00 68.50  ? 127 ILE C CG2 1 
ATOM   6264  C  CD1 . ILE C 1 105 ? 28.110  3.821   -20.605 1.00 89.72  ? 127 ILE C CD1 1 
ATOM   6265  N  N   . TYR C 1 106 ? 23.818  -0.071  -19.697 1.00 60.62  ? 128 TYR C N   1 
ATOM   6266  C  CA  . TYR C 1 106 ? 23.241  -1.390  -19.967 1.00 58.96  ? 128 TYR C CA  1 
ATOM   6267  C  C   . TYR C 1 106 ? 21.690  -1.346  -19.970 1.00 63.03  ? 128 TYR C C   1 
ATOM   6268  O  O   . TYR C 1 106 ? 21.036  -2.329  -20.335 1.00 64.54  ? 128 TYR C O   1 
ATOM   6269  C  CB  . TYR C 1 106 ? 23.848  -2.456  -19.033 1.00 60.07  ? 128 TYR C CB  1 
ATOM   6270  C  CG  . TYR C 1 106 ? 25.329  -2.684  -19.314 1.00 63.00  ? 128 TYR C CG  1 
ATOM   6271  C  CD1 . TYR C 1 106 ? 25.744  -3.484  -20.380 1.00 64.61  ? 128 TYR C CD1 1 
ATOM   6272  C  CD2 . TYR C 1 106 ? 26.312  -2.006  -18.593 1.00 64.17  ? 128 TYR C CD2 1 
ATOM   6273  C  CE1 . TYR C 1 106 ? 27.097  -3.615  -20.714 1.00 63.11  ? 128 TYR C CE1 1 
ATOM   6274  C  CE2 . TYR C 1 106 ? 27.670  -2.138  -18.911 1.00 65.33  ? 128 TYR C CE2 1 
ATOM   6275  C  CZ  . TYR C 1 106 ? 28.062  -2.972  -19.954 1.00 70.97  ? 128 TYR C CZ  1 
ATOM   6276  O  OH  . TYR C 1 106 ? 29.403  -3.147  -20.259 1.00 67.91  ? 128 TYR C OH  1 
ATOM   6277  N  N   . SER C 1 107 ? 21.106  -0.160  -19.691 1.00 57.80  ? 129 SER C N   1 
ATOM   6278  C  CA  . SER C 1 107 ? 19.655  0.058   -19.737 1.00 56.55  ? 129 SER C CA  1 
ATOM   6279  C  C   . SER C 1 107 ? 19.261  0.605   -21.118 1.00 59.66  ? 129 SER C C   1 
ATOM   6280  O  O   . SER C 1 107 ? 18.069  0.816   -21.365 1.00 59.41  ? 129 SER C O   1 
ATOM   6281  C  CB  . SER C 1 107 ? 19.208  1.032   -18.646 1.00 57.63  ? 129 SER C CB  1 
ATOM   6282  O  OG  . SER C 1 107 ? 19.661  0.703   -17.347 1.00 60.03  ? 129 SER C OG  1 
ATOM   6283  N  N   . ASP C 1 108 ? 20.260  0.885   -22.002 1.00 55.84  ? 130 ASP C N   1 
ATOM   6284  C  CA  . ASP C 1 108 ? 20.005  1.400   -23.357 1.00 55.60  ? 130 ASP C CA  1 
ATOM   6285  C  C   . ASP C 1 108 ? 19.496  0.283   -24.290 1.00 62.54  ? 130 ASP C C   1 
ATOM   6286  O  O   . ASP C 1 108 ? 20.297  -0.437  -24.900 1.00 64.42  ? 130 ASP C O   1 
ATOM   6287  C  CB  . ASP C 1 108 ? 21.226  2.100   -23.940 1.00 55.37  ? 130 ASP C CB  1 
ATOM   6288  C  CG  . ASP C 1 108 ? 20.976  2.799   -25.253 1.00 65.03  ? 130 ASP C CG  1 
ATOM   6289  O  OD1 . ASP C 1 108 ? 19.884  2.606   -25.833 1.00 65.52  ? 130 ASP C OD1 1 
ATOM   6290  O  OD2 . ASP C 1 108 ? 21.868  3.545   -25.705 1.00 74.91  ? 130 ASP C OD2 1 
ATOM   6291  N  N   . LYS C 1 109 ? 18.153  0.196   -24.424 1.00 56.92  ? 131 LYS C N   1 
ATOM   6292  C  CA  . LYS C 1 109 ? 17.372  -0.778  -25.192 1.00 56.34  ? 131 LYS C CA  1 
ATOM   6293  C  C   . LYS C 1 109 ? 17.792  -0.863  -26.654 1.00 60.41  ? 131 LYS C C   1 
ATOM   6294  O  O   . LYS C 1 109 ? 17.531  -1.885  -27.298 1.00 60.44  ? 131 LYS C O   1 
ATOM   6295  C  CB  . LYS C 1 109 ? 15.879  -0.393  -25.113 1.00 59.81  ? 131 LYS C CB  1 
ATOM   6296  C  CG  . LYS C 1 109 ? 14.912  -1.556  -24.957 1.00 81.36  ? 131 LYS C CG  1 
ATOM   6297  C  CD  . LYS C 1 109 ? 13.402  -1.155  -25.061 1.00 96.43  ? 131 LYS C CD  1 
ATOM   6298  C  CE  . LYS C 1 109 ? 12.958  0.046   -24.241 1.00 114.18 ? 131 LYS C CE  1 
ATOM   6299  N  NZ  . LYS C 1 109 ? 13.300  -0.079  -22.794 1.00 127.16 ? 131 LYS C NZ  1 
ATOM   6300  N  N   . SER C 1 110 ? 18.378  0.239   -27.191 1.00 55.75  ? 132 SER C N   1 
ATOM   6301  C  CA  . SER C 1 110 ? 18.813  0.380   -28.574 1.00 54.95  ? 132 SER C CA  1 
ATOM   6302  C  C   . SER C 1 110 ? 20.112  -0.431  -28.834 1.00 58.28  ? 132 SER C C   1 
ATOM   6303  O  O   . SER C 1 110 ? 20.179  -1.159  -29.812 1.00 57.61  ? 132 SER C O   1 
ATOM   6304  C  CB  . SER C 1 110 ? 18.982  1.863   -28.879 1.00 58.29  ? 132 SER C CB  1 
ATOM   6305  O  OG  . SER C 1 110 ? 19.665  2.102   -30.089 1.00 73.31  ? 132 SER C OG  1 
ATOM   6306  N  N   . ILE C 1 111 ? 21.126  -0.310  -27.958 1.00 55.54  ? 133 ILE C N   1 
ATOM   6307  C  CA  . ILE C 1 111 ? 22.413  -1.006  -28.110 1.00 56.43  ? 133 ILE C CA  1 
ATOM   6308  C  C   . ILE C 1 111 ? 22.455  -2.369  -27.326 1.00 60.79  ? 133 ILE C C   1 
ATOM   6309  O  O   . ILE C 1 111 ? 23.022  -3.352  -27.827 1.00 60.39  ? 133 ILE C O   1 
ATOM   6310  C  CB  . ILE C 1 111 ? 23.624  -0.072  -27.805 1.00 59.51  ? 133 ILE C CB  1 
ATOM   6311  C  CG1 . ILE C 1 111 ? 23.643  0.387   -26.335 1.00 58.69  ? 133 ILE C CG1 1 
ATOM   6312  C  CG2 . ILE C 1 111 ? 23.587  1.133   -28.750 1.00 61.25  ? 133 ILE C CG2 1 
ATOM   6313  C  CD1 . ILE C 1 111 ? 24.877  0.995   -25.870 1.00 59.78  ? 133 ILE C CD1 1 
ATOM   6314  N  N   . HIS C 1 112 ? 21.808  -2.429  -26.138 1.00 56.67  ? 134 HIS C N   1 
ATOM   6315  C  CA  . HIS C 1 112 ? 21.699  -3.630  -25.304 1.00 55.90  ? 134 HIS C CA  1 
ATOM   6316  C  C   . HIS C 1 112 ? 20.248  -4.090  -25.367 1.00 61.12  ? 134 HIS C C   1 
ATOM   6317  O  O   . HIS C 1 112 ? 19.522  -3.967  -24.392 1.00 60.58  ? 134 HIS C O   1 
ATOM   6318  C  CB  . HIS C 1 112 ? 22.154  -3.306  -23.868 1.00 55.41  ? 134 HIS C CB  1 
ATOM   6319  C  CG  . HIS C 1 112 ? 23.590  -2.891  -23.795 1.00 57.85  ? 134 HIS C CG  1 
ATOM   6320  N  ND1 . HIS C 1 112 ? 24.606  -3.803  -23.942 1.00 59.33  ? 134 HIS C ND1 1 
ATOM   6321  C  CD2 . HIS C 1 112 ? 24.126  -1.661  -23.641 1.00 59.59  ? 134 HIS C CD2 1 
ATOM   6322  C  CE1 . HIS C 1 112 ? 25.726  -3.106  -23.884 1.00 59.28  ? 134 HIS C CE1 1 
ATOM   6323  N  NE2 . HIS C 1 112 ? 25.485  -1.808  -23.723 1.00 59.48  ? 134 HIS C NE2 1 
ATOM   6324  N  N   . LEU C 1 113 ? 19.855  -4.643  -26.527 1.00 60.65  ? 135 LEU C N   1 
ATOM   6325  C  CA  . LEU C 1 113 ? 18.487  -4.958  -26.975 1.00 62.68  ? 135 LEU C CA  1 
ATOM   6326  C  C   . LEU C 1 113 ? 17.827  -6.213  -26.433 1.00 68.71  ? 135 LEU C C   1 
ATOM   6327  O  O   . LEU C 1 113 ? 16.711  -6.521  -26.865 1.00 69.15  ? 135 LEU C O   1 
ATOM   6328  C  CB  . LEU C 1 113 ? 18.406  -4.984  -28.530 1.00 64.27  ? 135 LEU C CB  1 
ATOM   6329  C  CG  . LEU C 1 113 ? 19.319  -5.951  -29.346 1.00 69.52  ? 135 LEU C CG  1 
ATOM   6330  C  CD1 . LEU C 1 113 ? 19.188  -7.372  -28.910 1.00 69.79  ? 135 LEU C CD1 1 
ATOM   6331  C  CD2 . LEU C 1 113 ? 19.086  -5.799  -30.814 1.00 72.11  ? 135 LEU C CD2 1 
ATOM   6332  N  N   . SER C 1 114 ? 18.471  -6.922  -25.508 1.00 67.51  ? 136 SER C N   1 
ATOM   6333  C  CA  . SER C 1 114 ? 17.921  -8.138  -24.872 1.00 68.72  ? 136 SER C CA  1 
ATOM   6334  C  C   . SER C 1 114 ? 18.750  -8.325  -23.649 1.00 70.63  ? 136 SER C C   1 
ATOM   6335  O  O   . SER C 1 114 ? 19.569  -9.238  -23.611 1.00 70.49  ? 136 SER C O   1 
ATOM   6336  C  CB  . SER C 1 114 ? 18.029  -9.364  -25.792 1.00 74.59  ? 136 SER C CB  1 
ATOM   6337  O  OG  . SER C 1 114 ? 16.931  -10.252 -25.618 1.00 85.61  ? 136 SER C OG  1 
ATOM   6338  N  N   . PHE C 1 115 ? 18.610  -7.385  -22.690 1.00 65.50  ? 137 PHE C N   1 
ATOM   6339  C  CA  . PHE C 1 115 ? 19.416  -7.335  -21.464 1.00 63.48  ? 137 PHE C CA  1 
ATOM   6340  C  C   . PHE C 1 115 ? 18.618  -6.931  -20.233 1.00 64.78  ? 137 PHE C C   1 
ATOM   6341  O  O   . PHE C 1 115 ? 18.185  -5.782  -20.109 1.00 64.45  ? 137 PHE C O   1 
ATOM   6342  C  CB  . PHE C 1 115 ? 20.653  -6.402  -21.654 1.00 64.11  ? 137 PHE C CB  1 
ATOM   6343  C  CG  . PHE C 1 115 ? 21.705  -6.380  -20.555 1.00 64.82  ? 137 PHE C CG  1 
ATOM   6344  C  CD1 . PHE C 1 115 ? 21.447  -5.773  -19.328 1.00 67.53  ? 137 PHE C CD1 1 
ATOM   6345  C  CD2 . PHE C 1 115 ? 22.980  -6.886  -20.780 1.00 65.96  ? 137 PHE C CD2 1 
ATOM   6346  C  CE1 . PHE C 1 115 ? 22.418  -5.751  -18.323 1.00 67.90  ? 137 PHE C CE1 1 
ATOM   6347  C  CE2 . PHE C 1 115 ? 23.958  -6.833  -19.786 1.00 68.19  ? 137 PHE C CE2 1 
ATOM   6348  C  CZ  . PHE C 1 115 ? 23.673  -6.265  -18.564 1.00 66.15  ? 137 PHE C CZ  1 
ATOM   6349  N  N   . LEU C 1 116 ? 18.498  -7.872  -19.296 1.00 60.32  ? 138 LEU C N   1 
ATOM   6350  C  CA  . LEU C 1 116 ? 17.869  -7.702  -17.979 1.00 59.36  ? 138 LEU C CA  1 
ATOM   6351  C  C   . LEU C 1 116 ? 19.003  -7.802  -16.959 1.00 60.27  ? 138 LEU C C   1 
ATOM   6352  O  O   . LEU C 1 116 ? 20.091  -8.267  -17.308 1.00 58.40  ? 138 LEU C O   1 
ATOM   6353  C  CB  . LEU C 1 116 ? 16.857  -8.831  -17.696 1.00 59.94  ? 138 LEU C CB  1 
ATOM   6354  C  CG  . LEU C 1 116 ? 15.559  -8.862  -18.467 1.00 63.82  ? 138 LEU C CG  1 
ATOM   6355  C  CD1 . LEU C 1 116 ? 15.737  -9.476  -19.818 1.00 62.98  ? 138 LEU C CD1 1 
ATOM   6356  C  CD2 . LEU C 1 116 ? 14.597  -9.713  -17.748 1.00 68.91  ? 138 LEU C CD2 1 
ATOM   6357  N  N   . ARG C 1 117 ? 18.758  -7.367  -15.715 1.00 55.75  ? 139 ARG C N   1 
ATOM   6358  C  CA  . ARG C 1 117 ? 19.743  -7.449  -14.642 1.00 54.91  ? 139 ARG C CA  1 
ATOM   6359  C  C   . ARG C 1 117 ? 19.086  -7.438  -13.257 1.00 60.01  ? 139 ARG C C   1 
ATOM   6360  O  O   . ARG C 1 117 ? 18.082  -6.754  -13.052 1.00 60.22  ? 139 ARG C O   1 
ATOM   6361  C  CB  . ARG C 1 117 ? 20.867  -6.396  -14.774 1.00 52.98  ? 139 ARG C CB  1 
ATOM   6362  C  CG  . ARG C 1 117 ? 20.418  -4.947  -14.793 1.00 58.75  ? 139 ARG C CG  1 
ATOM   6363  C  CD  . ARG C 1 117 ? 21.602  -3.999  -14.722 1.00 54.15  ? 139 ARG C CD  1 
ATOM   6364  N  NE  . ARG C 1 117 ? 21.338  -2.767  -15.471 1.00 56.87  ? 139 ARG C NE  1 
ATOM   6365  C  CZ  . ARG C 1 117 ? 22.232  -1.807  -15.658 1.00 64.94  ? 139 ARG C CZ  1 
ATOM   6366  N  NH1 . ARG C 1 117 ? 23.448  -1.916  -15.141 1.00 56.71  ? 139 ARG C NH1 1 
ATOM   6367  N  NH2 . ARG C 1 117 ? 21.918  -0.726  -16.357 1.00 44.04  ? 139 ARG C NH2 1 
ATOM   6368  N  N   . THR C 1 118 ? 19.658  -8.212  -12.318 1.00 56.79  ? 140 THR C N   1 
ATOM   6369  C  CA  . THR C 1 118 ? 19.154  -8.384  -10.948 1.00 57.49  ? 140 THR C CA  1 
ATOM   6370  C  C   . THR C 1 118 ? 19.632  -7.256  -9.992  1.00 63.01  ? 140 THR C C   1 
ATOM   6371  O  O   . THR C 1 118 ? 19.210  -7.173  -8.828  1.00 63.65  ? 140 THR C O   1 
ATOM   6372  C  CB  . THR C 1 118 ? 19.509  -9.795  -10.451 1.00 60.77  ? 140 THR C CB  1 
ATOM   6373  O  OG1 . THR C 1 118 ? 20.905  -9.970  -10.631 1.00 67.81  ? 140 THR C OG1 1 
ATOM   6374  C  CG2 . THR C 1 118 ? 18.791  -10.892 -11.208 1.00 52.53  ? 140 THR C CG2 1 
ATOM   6375  N  N   . VAL C 1 119 ? 20.532  -6.410  -10.488 1.00 59.60  ? 141 VAL C N   1 
ATOM   6376  C  CA  . VAL C 1 119 ? 21.042  -5.245  -9.766  1.00 59.61  ? 141 VAL C CA  1 
ATOM   6377  C  C   . VAL C 1 119 ? 20.526  -3.990  -10.469 1.00 64.09  ? 141 VAL C C   1 
ATOM   6378  O  O   . VAL C 1 119 ? 20.474  -3.964  -11.706 1.00 62.87  ? 141 VAL C O   1 
ATOM   6379  C  CB  . VAL C 1 119 ? 22.594  -5.186  -9.575  1.00 62.64  ? 141 VAL C CB  1 
ATOM   6380  C  CG1 . VAL C 1 119 ? 23.061  -6.182  -8.539  1.00 63.30  ? 141 VAL C CG1 1 
ATOM   6381  C  CG2 . VAL C 1 119 ? 23.366  -5.354  -10.881 1.00 61.37  ? 141 VAL C CG2 1 
ATOM   6382  N  N   . PRO C 1 120 ? 20.148  -2.931  -9.730  1.00 60.64  ? 142 PRO C N   1 
ATOM   6383  C  CA  . PRO C 1 120 ? 19.709  -1.703  -10.418 1.00 59.87  ? 142 PRO C CA  1 
ATOM   6384  C  C   . PRO C 1 120 ? 20.894  -0.900  -10.979 1.00 62.74  ? 142 PRO C C   1 
ATOM   6385  O  O   . PRO C 1 120 ? 21.999  -1.029  -10.469 1.00 61.23  ? 142 PRO C O   1 
ATOM   6386  C  CB  . PRO C 1 120 ? 19.011  -0.922  -9.313  1.00 62.46  ? 142 PRO C CB  1 
ATOM   6387  C  CG  . PRO C 1 120 ? 19.682  -1.374  -8.058  1.00 67.08  ? 142 PRO C CG  1 
ATOM   6388  C  CD  . PRO C 1 120 ? 20.114  -2.783  -8.261  1.00 62.13  ? 142 PRO C CD  1 
ATOM   6389  N  N   . PRO C 1 121 ? 20.722  -0.025  -11.998 1.00 60.51  ? 143 PRO C N   1 
ATOM   6390  C  CA  . PRO C 1 121 ? 21.869  0.815   -12.409 1.00 58.54  ? 143 PRO C CA  1 
ATOM   6391  C  C   . PRO C 1 121 ? 22.154  1.866   -11.332 1.00 61.07  ? 143 PRO C C   1 
ATOM   6392  O  O   . PRO C 1 121 ? 21.264  2.167   -10.537 1.00 63.02  ? 143 PRO C O   1 
ATOM   6393  C  CB  . PRO C 1 121 ? 21.385  1.462   -13.706 1.00 59.72  ? 143 PRO C CB  1 
ATOM   6394  C  CG  . PRO C 1 121 ? 19.902  1.483   -13.594 1.00 65.44  ? 143 PRO C CG  1 
ATOM   6395  C  CD  . PRO C 1 121 ? 19.487  0.322   -12.750 1.00 62.03  ? 143 PRO C CD  1 
ATOM   6396  N  N   . TYR C 1 122 ? 23.355  2.440   -11.288 1.00 55.55  ? 144 TYR C N   1 
ATOM   6397  C  CA  . TYR C 1 122 ? 23.636  3.485   -10.286 1.00 55.43  ? 144 TYR C CA  1 
ATOM   6398  C  C   . TYR C 1 122 ? 22.629  4.652   -10.289 1.00 62.57  ? 144 TYR C C   1 
ATOM   6399  O  O   . TYR C 1 122 ? 22.430  5.282   -9.253  1.00 64.78  ? 144 TYR C O   1 
ATOM   6400  C  CB  . TYR C 1 122 ? 25.017  4.076   -10.466 1.00 54.52  ? 144 TYR C CB  1 
ATOM   6401  C  CG  . TYR C 1 122 ? 26.140  3.121   -10.209 1.00 55.63  ? 144 TYR C CG  1 
ATOM   6402  C  CD1 . TYR C 1 122 ? 26.354  2.591   -8.938  1.00 56.45  ? 144 TYR C CD1 1 
ATOM   6403  C  CD2 . TYR C 1 122 ? 27.065  2.825   -11.204 1.00 57.79  ? 144 TYR C CD2 1 
ATOM   6404  C  CE1 . TYR C 1 122 ? 27.430  1.748   -8.677  1.00 55.44  ? 144 TYR C CE1 1 
ATOM   6405  C  CE2 . TYR C 1 122 ? 28.137  1.962   -10.962 1.00 59.30  ? 144 TYR C CE2 1 
ATOM   6406  C  CZ  . TYR C 1 122 ? 28.327  1.444   -9.690  1.00 67.04  ? 144 TYR C CZ  1 
ATOM   6407  O  OH  . TYR C 1 122 ? 29.405  0.619   -9.461  1.00 71.70  ? 144 TYR C OH  1 
ATOM   6408  N  N   . SER C 1 123 ? 22.026  4.955   -11.444 1.00 58.91  ? 145 SER C N   1 
ATOM   6409  C  CA  . SER C 1 123 ? 21.093  6.068   -11.585 1.00 60.20  ? 145 SER C CA  1 
ATOM   6410  C  C   . SER C 1 123 ? 19.896  5.941   -10.666 1.00 64.87  ? 145 SER C C   1 
ATOM   6411  O  O   . SER C 1 123 ? 19.306  6.953   -10.292 1.00 65.60  ? 145 SER C O   1 
ATOM   6412  C  CB  . SER C 1 123 ? 20.634  6.212   -13.034 1.00 63.87  ? 145 SER C CB  1 
ATOM   6413  O  OG  . SER C 1 123 ? 20.063  5.009   -13.526 1.00 73.21  ? 145 SER C OG  1 
ATOM   6414  N  N   . HIS C 1 124 ? 19.561  4.699   -10.281 1.00 61.64  ? 146 HIS C N   1 
ATOM   6415  C  CA  . HIS C 1 124 ? 18.406  4.376   -9.444  1.00 63.39  ? 146 HIS C CA  1 
ATOM   6416  C  C   . HIS C 1 124 ? 18.557  4.813   -7.976  1.00 65.93  ? 146 HIS C C   1 
ATOM   6417  O  O   . HIS C 1 124 ? 17.554  4.867   -7.265  1.00 66.60  ? 146 HIS C O   1 
ATOM   6418  C  CB  . HIS C 1 124 ? 18.064  2.889   -9.578  1.00 65.28  ? 146 HIS C CB  1 
ATOM   6419  C  CG  . HIS C 1 124 ? 17.266  2.571   -10.801 1.00 70.38  ? 146 HIS C CG  1 
ATOM   6420  N  ND1 . HIS C 1 124 ? 16.397  1.490   -10.834 1.00 73.71  ? 146 HIS C ND1 1 
ATOM   6421  C  CD2 . HIS C 1 124 ? 17.206  3.216   -11.993 1.00 73.60  ? 146 HIS C CD2 1 
ATOM   6422  C  CE1 . HIS C 1 124 ? 15.846  1.509   -12.039 1.00 73.74  ? 146 HIS C CE1 1 
ATOM   6423  N  NE2 . HIS C 1 124 ? 16.298  2.533   -12.771 1.00 73.82  ? 146 HIS C NE2 1 
ATOM   6424  N  N   . GLN C 1 125 ? 19.780  5.199   -7.547  1.00 60.60  ? 147 GLN C N   1 
ATOM   6425  C  CA  . GLN C 1 125 ? 20.054  5.711   -6.196  1.00 60.84  ? 147 GLN C CA  1 
ATOM   6426  C  C   . GLN C 1 125 ? 19.316  7.031   -5.972  1.00 65.56  ? 147 GLN C C   1 
ATOM   6427  O  O   . GLN C 1 125 ? 19.087  7.423   -4.827  1.00 66.44  ? 147 GLN C O   1 
ATOM   6428  C  CB  . GLN C 1 125 ? 21.562  5.883   -5.966  1.00 61.18  ? 147 GLN C CB  1 
ATOM   6429  C  CG  . GLN C 1 125 ? 22.307  4.577   -6.066  1.00 58.18  ? 147 GLN C CG  1 
ATOM   6430  C  CD  . GLN C 1 125 ? 23.776  4.774   -6.009  1.00 58.07  ? 147 GLN C CD  1 
ATOM   6431  O  OE1 . GLN C 1 125 ? 24.435  5.058   -7.001  1.00 52.96  ? 147 GLN C OE1 1 
ATOM   6432  N  NE2 . GLN C 1 125 ? 24.315  4.517   -4.854  1.00 47.07  ? 147 GLN C NE2 1 
ATOM   6433  N  N   . ALA C 1 126 ? 18.884  7.679   -7.073  1.00 62.99  ? 148 ALA C N   1 
ATOM   6434  C  CA  . ALA C 1 126 ? 18.092  8.911   -7.065  1.00 64.42  ? 148 ALA C CA  1 
ATOM   6435  C  C   . ALA C 1 126 ? 16.767  8.671   -6.348  1.00 71.84  ? 148 ALA C C   1 
ATOM   6436  O  O   . ALA C 1 126 ? 16.256  9.609   -5.728  1.00 73.24  ? 148 ALA C O   1 
ATOM   6437  C  CB  . ALA C 1 126 ? 17.851  9.396   -8.481  1.00 64.55  ? 148 ALA C CB  1 
ATOM   6438  N  N   . LEU C 1 127 ? 16.241  7.401   -6.375  1.00 68.97  ? 149 LEU C N   1 
ATOM   6439  C  CA  . LEU C 1 127 ? 15.015  6.984   -5.653  1.00 70.11  ? 149 LEU C CA  1 
ATOM   6440  C  C   . LEU C 1 127 ? 15.238  7.088   -4.153  1.00 76.36  ? 149 LEU C C   1 
ATOM   6441  O  O   . LEU C 1 127 ? 14.308  7.432   -3.410  1.00 79.20  ? 149 LEU C O   1 
ATOM   6442  C  CB  . LEU C 1 127 ? 14.584  5.530   -5.970  1.00 69.10  ? 149 LEU C CB  1 
ATOM   6443  C  CG  . LEU C 1 127 ? 14.289  5.152   -7.407  1.00 72.33  ? 149 LEU C CG  1 
ATOM   6444  C  CD1 . LEU C 1 127 ? 14.236  3.686   -7.546  1.00 71.47  ? 149 LEU C CD1 1 
ATOM   6445  C  CD2 . LEU C 1 127 ? 13.006  5.771   -7.892  1.00 75.78  ? 149 LEU C CD2 1 
ATOM   6446  N  N   . VAL C 1 128 ? 16.467  6.769   -3.710  1.00 71.18  ? 150 VAL C N   1 
ATOM   6447  C  CA  . VAL C 1 128 ? 16.822  6.814   -2.307  1.00 72.38  ? 150 VAL C CA  1 
ATOM   6448  C  C   . VAL C 1 128 ? 16.987  8.235   -1.878  1.00 79.99  ? 150 VAL C C   1 
ATOM   6449  O  O   . VAL C 1 128 ? 16.418  8.606   -0.855  1.00 83.83  ? 150 VAL C O   1 
ATOM   6450  C  CB  . VAL C 1 128 ? 18.039  5.948   -1.931  1.00 74.72  ? 150 VAL C CB  1 
ATOM   6451  C  CG1 . VAL C 1 128 ? 18.061  5.682   -0.424  1.00 76.22  ? 150 VAL C CG1 1 
ATOM   6452  C  CG2 . VAL C 1 128 ? 18.038  4.636   -2.716  1.00 73.03  ? 150 VAL C CG2 1 
ATOM   6453  N  N   . TRP C 1 129 ? 17.719  9.049   -2.665  1.00 75.57  ? 151 TRP C N   1 
ATOM   6454  C  CA  . TRP C 1 129 ? 17.973  10.464  -2.356  1.00 76.48  ? 151 TRP C CA  1 
ATOM   6455  C  C   . TRP C 1 129 ? 16.689  11.240  -2.227  1.00 82.76  ? 151 TRP C C   1 
ATOM   6456  O  O   . TRP C 1 129 ? 16.584  12.126  -1.382  1.00 83.94  ? 151 TRP C O   1 
ATOM   6457  C  CB  . TRP C 1 129 ? 18.834  11.122  -3.433  1.00 73.87  ? 151 TRP C CB  1 
ATOM   6458  C  CG  . TRP C 1 129 ? 20.172  10.496  -3.650  1.00 73.26  ? 151 TRP C CG  1 
ATOM   6459  C  CD1 . TRP C 1 129 ? 20.930  9.824   -2.738  1.00 76.26  ? 151 TRP C CD1 1 
ATOM   6460  C  CD2 . TRP C 1 129 ? 20.940  10.547  -4.852  1.00 71.78  ? 151 TRP C CD2 1 
ATOM   6461  N  NE1 . TRP C 1 129 ? 22.115  9.429   -3.306  1.00 74.75  ? 151 TRP C NE1 1 
ATOM   6462  C  CE2 . TRP C 1 129 ? 22.152  9.863   -4.604  1.00 75.43  ? 151 TRP C CE2 1 
ATOM   6463  C  CE3 . TRP C 1 129 ? 20.719  11.105  -6.129  1.00 72.61  ? 151 TRP C CE3 1 
ATOM   6464  C  CZ2 . TRP C 1 129 ? 23.134  9.701   -5.590  1.00 73.62  ? 151 TRP C CZ2 1 
ATOM   6465  C  CZ3 . TRP C 1 129 ? 21.694  10.951  -7.103  1.00 72.89  ? 151 TRP C CZ3 1 
ATOM   6466  C  CH2 . TRP C 1 129 ? 22.887  10.263  -6.830  1.00 72.95  ? 151 TRP C CH2 1 
ATOM   6467  N  N   . PHE C 1 130 ? 15.709  10.890  -3.064  1.00 80.23  ? 152 PHE C N   1 
ATOM   6468  C  CA  . PHE C 1 130 ? 14.403  11.511  -3.085  1.00 82.32  ? 152 PHE C CA  1 
ATOM   6469  C  C   . PHE C 1 130 ? 13.645  11.265  -1.784  1.00 90.29  ? 152 PHE C C   1 
ATOM   6470  O  O   . PHE C 1 130 ? 13.101  12.206  -1.203  1.00 91.67  ? 152 PHE C O   1 
ATOM   6471  C  CB  . PHE C 1 130 ? 13.621  11.013  -4.296  1.00 83.20  ? 152 PHE C CB  1 
ATOM   6472  C  CG  . PHE C 1 130 ? 12.273  11.666  -4.424  1.00 86.90  ? 152 PHE C CG  1 
ATOM   6473  C  CD1 . PHE C 1 130 ? 12.157  13.051  -4.491  1.00 91.47  ? 152 PHE C CD1 1 
ATOM   6474  C  CD2 . PHE C 1 130 ? 11.120  10.904  -4.466  1.00 89.88  ? 152 PHE C CD2 1 
ATOM   6475  C  CE1 . PHE C 1 130 ? 10.915  13.657  -4.601  1.00 94.58  ? 152 PHE C CE1 1 
ATOM   6476  C  CE2 . PHE C 1 130 ? 9.877   11.511  -4.577  1.00 95.38  ? 152 PHE C CE2 1 
ATOM   6477  C  CZ  . PHE C 1 130 ? 9.782   12.886  -4.644  1.00 95.06  ? 152 PHE C CZ  1 
ATOM   6478  N  N   . GLU C 1 131 ? 13.658  10.008  -1.310  1.00 89.02  ? 153 GLU C N   1 
ATOM   6479  C  CA  . GLU C 1 131 ? 13.017  9.584   -0.059  1.00 91.98  ? 153 GLU C CA  1 
ATOM   6480  C  C   . GLU C 1 131 ? 13.702  10.241  1.137   1.00 96.96  ? 153 GLU C C   1 
ATOM   6481  O  O   . GLU C 1 131 ? 13.038  10.664  2.080   1.00 99.58  ? 153 GLU C O   1 
ATOM   6482  C  CB  . GLU C 1 131 ? 13.031  8.049   0.061   1.00 92.99  ? 153 GLU C CB  1 
ATOM   6483  C  CG  . GLU C 1 131 ? 12.105  7.347   -0.924  1.00 108.12 ? 153 GLU C CG  1 
ATOM   6484  C  CD  . GLU C 1 131 ? 10.658  7.804   -0.917  1.00 141.02 ? 153 GLU C CD  1 
ATOM   6485  O  OE1 . GLU C 1 131 ? 10.014  7.753   0.155   1.00 143.04 ? 153 GLU C OE1 1 
ATOM   6486  O  OE2 . GLU C 1 131 ? 10.177  8.243   -1.986  1.00 141.94 ? 153 GLU C OE2 1 
ATOM   6487  N  N   . MET C 1 132 ? 15.027  10.370  1.050   1.00 91.13  ? 154 MET C N   1 
ATOM   6488  C  CA  . MET C 1 132 ? 15.897  11.010  2.015   1.00 91.65  ? 154 MET C CA  1 
ATOM   6489  C  C   . MET C 1 132 ? 15.533  12.480  2.112   1.00 95.65  ? 154 MET C C   1 
ATOM   6490  O  O   . MET C 1 132 ? 15.383  12.993  3.217   1.00 97.05  ? 154 MET C O   1 
ATOM   6491  C  CB  . MET C 1 132 ? 17.337  10.867  1.544   1.00 92.09  ? 154 MET C CB  1 
ATOM   6492  C  CG  . MET C 1 132 ? 18.334  10.996  2.641   1.00 96.66  ? 154 MET C CG  1 
ATOM   6493  S  SD  . MET C 1 132 ? 18.580  9.469   3.526   1.00 101.08 ? 154 MET C SD  1 
ATOM   6494  C  CE  . MET C 1 132 ? 19.060  8.383   2.138   1.00 95.04  ? 154 MET C CE  1 
ATOM   6495  N  N   . MET C 1 133 ? 15.352  13.144  0.952   1.00 91.59  ? 155 MET C N   1 
ATOM   6496  C  CA  . MET C 1 133 ? 14.950  14.550  0.861   1.00 92.89  ? 155 MET C CA  1 
ATOM   6497  C  C   . MET C 1 133 ? 13.599  14.774  1.516   1.00 98.45  ? 155 MET C C   1 
ATOM   6498  O  O   . MET C 1 133 ? 13.426  15.782  2.201   1.00 100.08 ? 155 MET C O   1 
ATOM   6499  C  CB  . MET C 1 133 ? 14.894  15.010  -0.591  1.00 93.87  ? 155 MET C CB  1 
ATOM   6500  C  CG  . MET C 1 133 ? 16.224  15.390  -1.137  1.00 96.27  ? 155 MET C CG  1 
ATOM   6501  S  SD  . MET C 1 133 ? 16.240  15.146  -2.913  1.00 99.01  ? 155 MET C SD  1 
ATOM   6502  C  CE  . MET C 1 133 ? 15.373  16.577  -3.439  1.00 97.21  ? 155 MET C CE  1 
ATOM   6503  N  N   . ARG C 1 134 ? 12.655  13.829  1.321   1.00 93.97  ? 156 ARG C N   1 
ATOM   6504  C  CA  . ARG C 1 134 ? 11.317  13.894  1.903   1.00 96.29  ? 156 ARG C CA  1 
ATOM   6505  C  C   . ARG C 1 134 ? 11.362  13.752  3.425   1.00 101.02 ? 156 ARG C C   1 
ATOM   6506  O  O   . ARG C 1 134 ? 10.714  14.521  4.146   1.00 102.68 ? 156 ARG C O   1 
ATOM   6507  C  CB  . ARG C 1 134 ? 10.392  12.856  1.251   1.00 96.94  ? 156 ARG C CB  1 
ATOM   6508  C  CG  . ARG C 1 134 ? 9.845   13.332  -0.094  1.00 108.19 ? 156 ARG C CG  1 
ATOM   6509  C  CD  . ARG C 1 134 ? 9.510   12.190  -1.025  1.00 120.45 ? 156 ARG C CD  1 
ATOM   6510  N  NE  . ARG C 1 134 ? 8.102   11.807  -0.942  1.00 136.96 ? 156 ARG C NE  1 
ATOM   6511  C  CZ  . ARG C 1 134 ? 7.643   10.800  -0.208  1.00 158.46 ? 156 ARG C CZ  1 
ATOM   6512  N  NH1 . ARG C 1 134 ? 8.477   10.064  0.521   1.00 150.63 ? 156 ARG C NH1 1 
ATOM   6513  N  NH2 . ARG C 1 134 ? 6.348   10.516  -0.199  1.00 145.64 ? 156 ARG C NH2 1 
ATOM   6514  N  N   . LEU C 1 135 ? 12.193  12.822  3.901   1.00 96.50  ? 157 LEU C N   1 
ATOM   6515  C  CA  . LEU C 1 135 ? 12.405  12.519  5.318   1.00 98.10  ? 157 LEU C CA  1 
ATOM   6516  C  C   . LEU C 1 135 ? 13.088  13.649  6.110   1.00 102.75 ? 157 LEU C C   1 
ATOM   6517  O  O   . LEU C 1 135 ? 12.630  13.987  7.200   1.00 105.11 ? 157 LEU C O   1 
ATOM   6518  C  CB  . LEU C 1 135 ? 13.209  11.202  5.442   1.00 96.35  ? 157 LEU C CB  1 
ATOM   6519  C  CG  . LEU C 1 135 ? 13.145  10.462  6.765   1.00 102.92 ? 157 LEU C CG  1 
ATOM   6520  C  CD1 . LEU C 1 135 ? 11.841  9.691   6.900   1.00 104.93 ? 157 LEU C CD1 1 
ATOM   6521  C  CD2 . LEU C 1 135 ? 14.285  9.500   6.885   1.00 102.58 ? 157 LEU C CD2 1 
ATOM   6522  N  N   . PHE C 1 136 ? 14.182  14.209  5.583   1.00 98.32  ? 158 PHE C N   1 
ATOM   6523  C  CA  . PHE C 1 136 ? 14.950  15.247  6.270   1.00 100.11 ? 158 PHE C CA  1 
ATOM   6524  C  C   . PHE C 1 136 ? 14.563  16.672  5.865   1.00 107.07 ? 158 PHE C C   1 
ATOM   6525  O  O   . PHE C 1 136 ? 15.151  17.644  6.356   1.00 106.86 ? 158 PHE C O   1 
ATOM   6526  C  CB  . PHE C 1 136 ? 16.449  14.995  6.105   1.00 99.69  ? 158 PHE C CB  1 
ATOM   6527  C  CG  . PHE C 1 136 ? 16.902  13.729  6.794   1.00 101.56 ? 158 PHE C CG  1 
ATOM   6528  C  CD1 . PHE C 1 136 ? 16.830  12.501  6.148   1.00 103.88 ? 158 PHE C CD1 1 
ATOM   6529  C  CD2 . PHE C 1 136 ? 17.348  13.754  8.110   1.00 105.92 ? 158 PHE C CD2 1 
ATOM   6530  C  CE1 . PHE C 1 136 ? 17.221  11.322  6.801   1.00 104.96 ? 158 PHE C CE1 1 
ATOM   6531  C  CE2 . PHE C 1 136 ? 17.719  12.570  8.767   1.00 108.65 ? 158 PHE C CE2 1 
ATOM   6532  C  CZ  . PHE C 1 136 ? 17.655  11.365  8.110   1.00 105.04 ? 158 PHE C CZ  1 
ATOM   6533  N  N   . ASN C 1 137 ? 13.521  16.784  5.017   1.00 105.35 ? 159 ASN C N   1 
ATOM   6534  C  CA  . ASN C 1 137 ? 12.938  18.024  4.496   1.00 105.96 ? 159 ASN C CA  1 
ATOM   6535  C  C   . ASN C 1 137 ? 13.989  18.931  3.887   1.00 107.89 ? 159 ASN C C   1 
ATOM   6536  O  O   . ASN C 1 137 ? 14.196  20.083  4.299   1.00 108.05 ? 159 ASN C O   1 
ATOM   6537  C  CB  . ASN C 1 137 ? 12.059  18.709  5.521   1.00 108.51 ? 159 ASN C CB  1 
ATOM   6538  C  CG  . ASN C 1 137 ? 10.852  17.868  5.812   1.00 131.66 ? 159 ASN C CG  1 
ATOM   6539  O  OD1 . ASN C 1 137 ? 10.745  17.266  6.881   1.00 133.47 ? 159 ASN C OD1 1 
ATOM   6540  N  ND2 . ASN C 1 137 ? 9.977   17.704  4.820   1.00 119.63 ? 159 ASN C ND2 1 
ATOM   6541  N  N   . TRP C 1 138 ? 14.671  18.342  2.896   1.00 102.44 ? 160 TRP C N   1 
ATOM   6542  C  CA  . TRP C 1 138 ? 15.668  18.970  2.049   1.00 100.99 ? 160 TRP C CA  1 
ATOM   6543  C  C   . TRP C 1 138 ? 14.899  19.306  0.781   1.00 105.59 ? 160 TRP C C   1 
ATOM   6544  O  O   . TRP C 1 138 ? 14.843  18.513  -0.172  1.00 104.45 ? 160 TRP C O   1 
ATOM   6545  C  CB  . TRP C 1 138 ? 16.835  18.011  1.776   1.00 96.55  ? 160 TRP C CB  1 
ATOM   6546  C  CG  . TRP C 1 138 ? 17.597  17.603  3.001   1.00 97.47  ? 160 TRP C CG  1 
ATOM   6547  C  CD1 . TRP C 1 138 ? 17.839  18.357  4.113   1.00 102.51 ? 160 TRP C CD1 1 
ATOM   6548  C  CD2 . TRP C 1 138 ? 18.306  16.378  3.186   1.00 95.32  ? 160 TRP C CD2 1 
ATOM   6549  N  NE1 . TRP C 1 138 ? 18.618  17.654  5.001   1.00 101.70 ? 160 TRP C NE1 1 
ATOM   6550  C  CE2 . TRP C 1 138 ? 18.943  16.446  4.446   1.00 100.67 ? 160 TRP C CE2 1 
ATOM   6551  C  CE3 . TRP C 1 138 ? 18.464  15.221  2.409   1.00 93.76  ? 160 TRP C CE3 1 
ATOM   6552  C  CZ2 . TRP C 1 138 ? 19.713  15.395  4.951   1.00 98.86  ? 160 TRP C CZ2 1 
ATOM   6553  C  CZ3 . TRP C 1 138 ? 19.231  14.189  2.907   1.00 94.05  ? 160 TRP C CZ3 1 
ATOM   6554  C  CH2 . TRP C 1 138 ? 19.830  14.271  4.173   1.00 96.16  ? 160 TRP C CH2 1 
ATOM   6555  N  N   . ASN C 1 139 ? 14.213  20.455  0.831   1.00 102.93 ? 161 ASN C N   1 
ATOM   6556  C  CA  . ASN C 1 139 ? 13.351  20.928  -0.240  1.00 102.29 ? 161 ASN C CA  1 
ATOM   6557  C  C   . ASN C 1 139 ? 14.109  21.656  -1.346  1.00 102.74 ? 161 ASN C C   1 
ATOM   6558  O  O   . ASN C 1 139 ? 13.572  21.809  -2.446  1.00 102.86 ? 161 ASN C O   1 
ATOM   6559  C  CB  . ASN C 1 139 ? 12.217  21.760  0.338   1.00 106.24 ? 161 ASN C CB  1 
ATOM   6560  C  CG  . ASN C 1 139 ? 11.283  20.906  1.151   1.00 133.50 ? 161 ASN C CG  1 
ATOM   6561  O  OD1 . ASN C 1 139 ? 10.480  20.147  0.606   1.00 131.19 ? 161 ASN C OD1 1 
ATOM   6562  N  ND2 . ASN C 1 139 ? 11.431  20.935  2.466   1.00 127.54 ? 161 ASN C ND2 1 
ATOM   6563  N  N   . HIS C 1 140 ? 15.364  22.058  -1.072  1.00 96.18  ? 162 HIS C N   1 
ATOM   6564  C  CA  . HIS C 1 140 ? 16.235  22.731  -2.039  1.00 93.97  ? 162 HIS C CA  1 
ATOM   6565  C  C   . HIS C 1 140 ? 17.597  22.051  -2.076  1.00 91.62  ? 162 HIS C C   1 
ATOM   6566  O  O   . HIS C 1 140 ? 18.304  22.011  -1.053  1.00 91.76  ? 162 HIS C O   1 
ATOM   6567  C  CB  . HIS C 1 140 ? 16.370  24.233  -1.728  1.00 97.47  ? 162 HIS C CB  1 
ATOM   6568  C  CG  . HIS C 1 140 ? 15.073  24.974  -1.802  1.00 103.49 ? 162 HIS C CG  1 
ATOM   6569  N  ND1 . HIS C 1 140 ? 14.410  25.151  -3.004  1.00 104.98 ? 162 HIS C ND1 1 
ATOM   6570  C  CD2 . HIS C 1 140 ? 14.349  25.541  -0.812  1.00 108.17 ? 162 HIS C CD2 1 
ATOM   6571  C  CE1 . HIS C 1 140 ? 13.314  25.823  -2.706  1.00 107.37 ? 162 HIS C CE1 1 
ATOM   6572  N  NE2 . HIS C 1 140 ? 13.233  26.078  -1.399  1.00 109.69 ? 162 HIS C NE2 1 
ATOM   6573  N  N   . VAL C 1 141 ? 17.946  21.473  -3.246  1.00 81.87  ? 163 VAL C N   1 
ATOM   6574  C  CA  . VAL C 1 141 ? 19.212  20.750  -3.394  1.00 77.14  ? 163 VAL C CA  1 
ATOM   6575  C  C   . VAL C 1 141 ? 20.034  21.259  -4.571  1.00 76.34  ? 163 VAL C C   1 
ATOM   6576  O  O   . VAL C 1 141 ? 19.479  21.814  -5.520  1.00 75.98  ? 163 VAL C O   1 
ATOM   6577  C  CB  . VAL C 1 141 ? 19.028  19.202  -3.447  1.00 78.14  ? 163 VAL C CB  1 
ATOM   6578  C  CG1 . VAL C 1 141 ? 18.380  18.662  -2.177  1.00 79.11  ? 163 VAL C CG1 1 
ATOM   6579  C  CG2 . VAL C 1 141 ? 18.238  18.772  -4.678  1.00 76.84  ? 163 VAL C CG2 1 
ATOM   6580  N  N   . ILE C 1 142 ? 21.356  21.069  -4.494  1.00 70.09  ? 164 ILE C N   1 
ATOM   6581  C  CA  . ILE C 1 142 ? 22.300  21.358  -5.573  1.00 68.75  ? 164 ILE C CA  1 
ATOM   6582  C  C   . ILE C 1 142 ? 22.751  19.985  -6.073  1.00 70.72  ? 164 ILE C C   1 
ATOM   6583  O  O   . ILE C 1 142 ? 23.198  19.152  -5.279  1.00 70.05  ? 164 ILE C O   1 
ATOM   6584  C  CB  . ILE C 1 142 ? 23.514  22.243  -5.163  1.00 72.03  ? 164 ILE C CB  1 
ATOM   6585  C  CG1 . ILE C 1 142 ? 23.070  23.599  -4.600  1.00 74.63  ? 164 ILE C CG1 1 
ATOM   6586  C  CG2 . ILE C 1 142 ? 24.473  22.431  -6.351  1.00 71.26  ? 164 ILE C CG2 1 
ATOM   6587  C  CD1 . ILE C 1 142 ? 24.103  24.285  -3.696  1.00 75.77  ? 164 ILE C CD1 1 
ATOM   6588  N  N   . LEU C 1 143 ? 22.603  19.736  -7.370  1.00 66.28  ? 165 LEU C N   1 
ATOM   6589  C  CA  . LEU C 1 143 ? 23.003  18.463  -7.933  1.00 64.37  ? 165 LEU C CA  1 
ATOM   6590  C  C   . LEU C 1 143 ? 24.250  18.654  -8.783  1.00 67.84  ? 165 LEU C C   1 
ATOM   6591  O  O   . LEU C 1 143 ? 24.229  19.447  -9.730  1.00 67.14  ? 165 LEU C O   1 
ATOM   6592  C  CB  . LEU C 1 143 ? 21.847  17.841  -8.744  1.00 63.92  ? 165 LEU C CB  1 
ATOM   6593  C  CG  . LEU C 1 143 ? 22.133  16.527  -9.494  1.00 66.14  ? 165 LEU C CG  1 
ATOM   6594  C  CD1 . LEU C 1 143 ? 22.370  15.362  -8.544  1.00 63.29  ? 165 LEU C CD1 1 
ATOM   6595  C  CD2 . LEU C 1 143 ? 21.025  16.208  -10.463 1.00 71.09  ? 165 LEU C CD2 1 
ATOM   6596  N  N   . ILE C 1 144 ? 25.343  17.952  -8.416  1.00 62.92  ? 166 ILE C N   1 
ATOM   6597  C  CA  . ILE C 1 144 ? 26.610  17.970  -9.146  1.00 61.79  ? 166 ILE C CA  1 
ATOM   6598  C  C   . ILE C 1 144 ? 26.766  16.610  -9.810  1.00 67.47  ? 166 ILE C C   1 
ATOM   6599  O  O   . ILE C 1 144 ? 26.722  15.577  -9.139  1.00 68.27  ? 166 ILE C O   1 
ATOM   6600  C  CB  . ILE C 1 144 ? 27.832  18.332  -8.265  1.00 64.32  ? 166 ILE C CB  1 
ATOM   6601  C  CG1 . ILE C 1 144 ? 27.646  19.672  -7.558  1.00 65.83  ? 166 ILE C CG1 1 
ATOM   6602  C  CG2 . ILE C 1 144 ? 29.137  18.287  -9.083  1.00 63.87  ? 166 ILE C CG2 1 
ATOM   6603  C  CD1 . ILE C 1 144 ? 28.570  19.874  -6.404  1.00 73.49  ? 166 ILE C CD1 1 
ATOM   6604  N  N   . VAL C 1 145 ? 26.932  16.608  -11.123 1.00 64.50  ? 167 VAL C N   1 
ATOM   6605  C  CA  . VAL C 1 145 ? 27.069  15.375  -11.890 1.00 63.99  ? 167 VAL C CA  1 
ATOM   6606  C  C   . VAL C 1 145 ? 28.235  15.481  -12.864 1.00 69.43  ? 167 VAL C C   1 
ATOM   6607  O  O   . VAL C 1 145 ? 28.566  16.580  -13.328 1.00 71.61  ? 167 VAL C O   1 
ATOM   6608  C  CB  . VAL C 1 145 ? 25.750  14.973  -12.634 1.00 67.41  ? 167 VAL C CB  1 
ATOM   6609  C  CG1 . VAL C 1 145 ? 24.617  14.659  -11.657 1.00 66.57  ? 167 VAL C CG1 1 
ATOM   6610  C  CG2 . VAL C 1 145 ? 25.319  16.035  -13.671 1.00 68.16  ? 167 VAL C CG2 1 
ATOM   6611  N  N   . SER C 1 146 ? 28.823  14.340  -13.212 1.00 62.96  ? 168 SER C N   1 
ATOM   6612  C  CA  . SER C 1 146 ? 29.871  14.305  -14.213 1.00 61.92  ? 168 SER C CA  1 
ATOM   6613  C  C   . SER C 1 146 ? 29.175  14.374  -15.587 1.00 67.15  ? 168 SER C C   1 
ATOM   6614  O  O   . SER C 1 146 ? 28.034  13.910  -15.714 1.00 66.02  ? 168 SER C O   1 
ATOM   6615  C  CB  . SER C 1 146 ? 30.699  13.037  -14.057 1.00 63.69  ? 168 SER C CB  1 
ATOM   6616  O  OG  . SER C 1 146 ? 29.920  11.925  -13.643 1.00 71.24  ? 168 SER C OG  1 
ATOM   6617  N  N   . ASP C 1 147 ? 29.811  15.015  -16.587 1.00 65.29  ? 169 ASP C N   1 
ATOM   6618  C  CA  . ASP C 1 147 ? 29.204  15.103  -17.915 1.00 65.89  ? 169 ASP C CA  1 
ATOM   6619  C  C   . ASP C 1 147 ? 29.591  13.868  -18.752 1.00 66.54  ? 169 ASP C C   1 
ATOM   6620  O  O   . ASP C 1 147 ? 30.364  13.924  -19.724 1.00 65.97  ? 169 ASP C O   1 
ATOM   6621  C  CB  . ASP C 1 147 ? 29.452  16.460  -18.620 1.00 70.18  ? 169 ASP C CB  1 
ATOM   6622  C  CG  . ASP C 1 147 ? 28.615  16.687  -19.888 1.00 88.75  ? 169 ASP C CG  1 
ATOM   6623  O  OD1 . ASP C 1 147 ? 27.418  16.292  -19.899 1.00 91.85  ? 169 ASP C OD1 1 
ATOM   6624  O  OD2 . ASP C 1 147 ? 29.152  17.267  -20.863 1.00 93.63  ? 169 ASP C OD2 1 
ATOM   6625  N  N   . ASP C 1 148 ? 29.054  12.731  -18.302 1.00 61.22  ? 170 ASP C N   1 
ATOM   6626  C  CA  . ASP C 1 148 ? 29.185  11.412  -18.895 1.00 60.74  ? 170 ASP C CA  1 
ATOM   6627  C  C   . ASP C 1 148 ? 27.830  10.759  -18.810 1.00 64.40  ? 170 ASP C C   1 
ATOM   6628  O  O   . ASP C 1 148 ? 26.931  11.308  -18.165 1.00 64.51  ? 170 ASP C O   1 
ATOM   6629  C  CB  . ASP C 1 148 ? 30.264  10.566  -18.195 1.00 62.99  ? 170 ASP C CB  1 
ATOM   6630  C  CG  . ASP C 1 148 ? 30.218  10.524  -16.678 1.00 79.50  ? 170 ASP C CG  1 
ATOM   6631  O  OD1 . ASP C 1 148 ? 29.261  11.079  -16.094 1.00 78.60  ? 170 ASP C OD1 1 
ATOM   6632  O  OD2 . ASP C 1 148 ? 31.145  9.932   -16.073 1.00 92.96  ? 170 ASP C OD2 1 
ATOM   6633  N  N   . HIS C 1 149 ? 27.662  9.607   -19.478 1.00 60.55  ? 171 HIS C N   1 
ATOM   6634  C  CA  . HIS C 1 149 ? 26.398  8.887   -19.526 1.00 60.03  ? 171 HIS C CA  1 
ATOM   6635  C  C   . HIS C 1 149 ? 25.868  8.621   -18.143 1.00 66.34  ? 171 HIS C C   1 
ATOM   6636  O  O   . HIS C 1 149 ? 24.692  8.828   -17.913 1.00 67.83  ? 171 HIS C O   1 
ATOM   6637  C  CB  . HIS C 1 149 ? 26.541  7.593   -20.310 1.00 60.65  ? 171 HIS C CB  1 
ATOM   6638  C  CG  . HIS C 1 149 ? 25.247  6.891   -20.465 1.00 65.31  ? 171 HIS C CG  1 
ATOM   6639  N  ND1 . HIS C 1 149 ? 24.745  6.077   -19.469 1.00 67.99  ? 171 HIS C ND1 1 
ATOM   6640  C  CD2 . HIS C 1 149 ? 24.347  6.957   -21.465 1.00 68.91  ? 171 HIS C CD2 1 
ATOM   6641  C  CE1 . HIS C 1 149 ? 23.561  5.668   -19.898 1.00 68.02  ? 171 HIS C CE1 1 
ATOM   6642  N  NE2 . HIS C 1 149 ? 23.285  6.164   -21.096 1.00 68.84  ? 171 HIS C NE2 1 
ATOM   6643  N  N   . GLU C 1 150 ? 26.741  8.197   -17.219 1.00 64.27  ? 172 GLU C N   1 
ATOM   6644  C  CA  . GLU C 1 150 ? 26.419  7.871   -15.833 1.00 64.07  ? 172 GLU C CA  1 
ATOM   6645  C  C   . GLU C 1 150 ? 25.845  9.047   -15.080 1.00 68.36  ? 172 GLU C C   1 
ATOM   6646  O  O   . GLU C 1 150 ? 24.751  8.925   -14.555 1.00 70.77  ? 172 GLU C O   1 
ATOM   6647  C  CB  . GLU C 1 150 ? 27.648  7.267   -15.106 1.00 65.11  ? 172 GLU C CB  1 
ATOM   6648  C  CG  . GLU C 1 150 ? 27.322  6.269   -14.006 1.00 71.09  ? 172 GLU C CG  1 
ATOM   6649  C  CD  . GLU C 1 150 ? 26.190  5.318   -14.324 1.00 82.16  ? 172 GLU C CD  1 
ATOM   6650  O  OE1 . GLU C 1 150 ? 26.332  4.543   -15.299 1.00 74.70  ? 172 GLU C OE1 1 
ATOM   6651  O  OE2 . GLU C 1 150 ? 25.135  5.407   -13.650 1.00 63.82  ? 172 GLU C OE2 1 
ATOM   6652  N  N   . GLY C 1 151 ? 26.566  10.163  -15.057 1.00 63.54  ? 173 GLY C N   1 
ATOM   6653  C  CA  . GLY C 1 151 ? 26.161  11.384  -14.379 1.00 64.34  ? 173 GLY C CA  1 
ATOM   6654  C  C   . GLY C 1 151 ? 24.852  11.937  -14.890 1.00 71.48  ? 173 GLY C C   1 
ATOM   6655  O  O   . GLY C 1 151 ? 24.000  12.344  -14.096 1.00 74.59  ? 173 GLY C O   1 
ATOM   6656  N  N   . ARG C 1 152 ? 24.661  11.926  -16.215 1.00 66.08  ? 174 ARG C N   1 
ATOM   6657  C  CA  . ARG C 1 152 ? 23.432  12.418  -16.829 1.00 65.15  ? 174 ARG C CA  1 
ATOM   6658  C  C   . ARG C 1 152 ? 22.265  11.479  -16.515 1.00 67.84  ? 174 ARG C C   1 
ATOM   6659  O  O   . ARG C 1 152 ? 21.162  11.957  -16.267 1.00 68.78  ? 174 ARG C O   1 
ATOM   6660  C  CB  . ARG C 1 152 ? 23.627  12.628  -18.332 1.00 66.25  ? 174 ARG C CB  1 
ATOM   6661  C  CG  . ARG C 1 152 ? 24.655  13.735  -18.652 1.00 79.88  ? 174 ARG C CG  1 
ATOM   6662  C  CD  . ARG C 1 152 ? 24.880  13.987  -20.136 1.00 88.40  ? 174 ARG C CD  1 
ATOM   6663  N  NE  . ARG C 1 152 ? 25.214  12.770  -20.887 1.00 96.37  ? 174 ARG C NE  1 
ATOM   6664  C  CZ  . ARG C 1 152 ? 26.404  12.507  -21.420 1.00 103.91 ? 174 ARG C CZ  1 
ATOM   6665  N  NH1 . ARG C 1 152 ? 27.410  13.363  -21.275 1.00 79.07  ? 174 ARG C NH1 1 
ATOM   6666  N  NH2 . ARG C 1 152 ? 26.598  11.386  -22.105 1.00 93.27  ? 174 ARG C NH2 1 
ATOM   6667  N  N   . ALA C 1 153 ? 22.522  10.158  -16.419 1.00 62.44  ? 175 ALA C N   1 
ATOM   6668  C  CA  . ALA C 1 153 ? 21.508  9.154   -16.070 1.00 61.37  ? 175 ALA C CA  1 
ATOM   6669  C  C   . ALA C 1 153 ? 20.884  9.475   -14.703 1.00 66.40  ? 175 ALA C C   1 
ATOM   6670  O  O   . ALA C 1 153 ? 19.649  9.516   -14.580 1.00 67.88  ? 175 ALA C O   1 
ATOM   6671  C  CB  . ALA C 1 153 ? 22.129  7.762   -16.055 1.00 60.41  ? 175 ALA C CB  1 
ATOM   6672  N  N   . ALA C 1 154 ? 21.757  9.739   -13.700 1.00 59.92  ? 176 ALA C N   1 
ATOM   6673  C  CA  . ALA C 1 154 ? 21.441  10.145  -12.344 1.00 59.11  ? 176 ALA C CA  1 
ATOM   6674  C  C   . ALA C 1 154 ? 20.553  11.376  -12.378 1.00 64.43  ? 176 ALA C C   1 
ATOM   6675  O  O   . ALA C 1 154 ? 19.460  11.350  -11.803 1.00 65.01  ? 176 ALA C O   1 
ATOM   6676  C  CB  . ALA C 1 154 ? 22.719  10.477  -11.612 1.00 59.13  ? 176 ALA C CB  1 
ATOM   6677  N  N   . GLN C 1 155 ? 21.006  12.440  -13.091 1.00 60.76  ? 177 GLN C N   1 
ATOM   6678  C  CA  . GLN C 1 155 ? 20.289  13.709  -13.233 1.00 60.94  ? 177 GLN C CA  1 
ATOM   6679  C  C   . GLN C 1 155 ? 18.906  13.464  -13.810 1.00 65.25  ? 177 GLN C C   1 
ATOM   6680  O  O   . GLN C 1 155 ? 17.922  13.808  -13.154 1.00 66.67  ? 177 GLN C O   1 
ATOM   6681  C  CB  . GLN C 1 155 ? 21.083  14.702  -14.096 1.00 61.87  ? 177 GLN C CB  1 
ATOM   6682  C  CG  . GLN C 1 155 ? 20.378  16.035  -14.246 1.00 70.34  ? 177 GLN C CG  1 
ATOM   6683  C  CD  . GLN C 1 155 ? 20.952  16.922  -15.307 1.00 86.34  ? 177 GLN C CD  1 
ATOM   6684  O  OE1 . GLN C 1 155 ? 22.050  16.717  -15.826 1.00 84.19  ? 177 GLN C OE1 1 
ATOM   6685  N  NE2 . GLN C 1 155 ? 20.249  17.997  -15.578 1.00 85.83  ? 177 GLN C NE2 1 
ATOM   6686  N  N   . LYS C 1 156 ? 18.829  12.778  -14.976 1.00 60.40  ? 178 LYS C N   1 
ATOM   6687  C  CA  . LYS C 1 156 ? 17.564  12.471  -15.656 1.00 61.04  ? 178 LYS C CA  1 
ATOM   6688  C  C   . LYS C 1 156 ? 16.593  11.684  -14.770 1.00 64.13  ? 178 LYS C C   1 
ATOM   6689  O  O   . LYS C 1 156 ? 15.397  11.957  -14.810 1.00 64.34  ? 178 LYS C O   1 
ATOM   6690  C  CB  . LYS C 1 156 ? 17.796  11.778  -17.015 1.00 63.41  ? 178 LYS C CB  1 
ATOM   6691  N  N   . LYS C 1 157 ? 17.108  10.752  -13.938 1.00 59.73  ? 179 LYS C N   1 
ATOM   6692  C  CA  . LYS C 1 157 ? 16.272  9.981   -13.016 1.00 59.69  ? 179 LYS C CA  1 
ATOM   6693  C  C   . LYS C 1 157 ? 15.799  10.840  -11.809 1.00 67.15  ? 179 LYS C C   1 
ATOM   6694  O  O   . LYS C 1 157 ? 14.614  10.827  -11.498 1.00 68.98  ? 179 LYS C O   1 
ATOM   6695  C  CB  . LYS C 1 157 ? 16.956  8.672   -12.602 1.00 59.30  ? 179 LYS C CB  1 
ATOM   6696  C  CG  . LYS C 1 157 ? 16.125  7.791   -11.690 1.00 68.48  ? 179 LYS C CG  1 
ATOM   6697  C  CD  . LYS C 1 157 ? 15.533  6.573   -12.398 1.00 80.90  ? 179 LYS C CD  1 
ATOM   6698  C  CE  . LYS C 1 157 ? 14.547  5.809   -11.524 1.00 93.81  ? 179 LYS C CE  1 
ATOM   6699  N  NZ  . LYS C 1 157 ? 13.318  6.607   -11.201 1.00 100.63 ? 179 LYS C NZ  1 
ATOM   6700  N  N   . LEU C 1 158 ? 16.696  11.604  -11.163 1.00 63.87  ? 180 LEU C N   1 
ATOM   6701  C  CA  . LEU C 1 158 ? 16.307  12.448  -10.041 1.00 65.28  ? 180 LEU C CA  1 
ATOM   6702  C  C   . LEU C 1 158 ? 15.293  13.494  -10.525 1.00 74.45  ? 180 LEU C C   1 
ATOM   6703  O  O   . LEU C 1 158 ? 14.220  13.604  -9.926  1.00 77.18  ? 180 LEU C O   1 
ATOM   6704  C  CB  . LEU C 1 158 ? 17.540  13.092  -9.355  1.00 64.54  ? 180 LEU C CB  1 
ATOM   6705  C  CG  . LEU C 1 158 ? 17.279  14.078  -8.187  1.00 69.99  ? 180 LEU C CG  1 
ATOM   6706  C  CD1 . LEU C 1 158 ? 16.867  13.362  -6.905  1.00 70.94  ? 180 LEU C CD1 1 
ATOM   6707  C  CD2 . LEU C 1 158 ? 18.477  14.949  -7.926  1.00 69.08  ? 180 LEU C CD2 1 
ATOM   6708  N  N   . GLU C 1 159 ? 15.599  14.198  -11.645 1.00 71.14  ? 181 GLU C N   1 
ATOM   6709  C  CA  . GLU C 1 159 ? 14.731  15.214  -12.260 1.00 72.65  ? 181 GLU C CA  1 
ATOM   6710  C  C   . GLU C 1 159 ? 13.320  14.694  -12.532 1.00 77.82  ? 181 GLU C C   1 
ATOM   6711  O  O   . GLU C 1 159 ? 12.352  15.412  -12.302 1.00 77.83  ? 181 GLU C O   1 
ATOM   6712  C  CB  . GLU C 1 159 ? 15.361  15.788  -13.537 1.00 73.37  ? 181 GLU C CB  1 
ATOM   6713  C  CG  . GLU C 1 159 ? 16.488  16.769  -13.255 1.00 83.93  ? 181 GLU C CG  1 
ATOM   6714  C  CD  . GLU C 1 159 ? 17.060  17.485  -14.462 1.00 102.38 ? 181 GLU C CD  1 
ATOM   6715  O  OE1 . GLU C 1 159 ? 17.095  16.875  -15.558 1.00 89.28  ? 181 GLU C OE1 1 
ATOM   6716  O  OE2 . GLU C 1 159 ? 17.503  18.648  -14.300 1.00 93.04  ? 181 GLU C OE2 1 
ATOM   6717  N  N   . THR C 1 160 ? 13.215  13.427  -12.974 1.00 75.22  ? 182 THR C N   1 
ATOM   6718  C  CA  . THR C 1 160 ? 11.963  12.712  -13.241 1.00 75.93  ? 182 THR C CA  1 
ATOM   6719  C  C   . THR C 1 160 ? 11.103  12.695  -11.963 1.00 82.74  ? 182 THR C C   1 
ATOM   6720  O  O   . THR C 1 160 ? 9.952   13.124  -12.001 1.00 84.43  ? 182 THR C O   1 
ATOM   6721  C  CB  . THR C 1 160 ? 12.303  11.312  -13.810 1.00 76.30  ? 182 THR C CB  1 
ATOM   6722  O  OG1 . THR C 1 160 ? 12.380  11.390  -15.220 1.00 73.26  ? 182 THR C OG1 1 
ATOM   6723  C  CG2 . THR C 1 160 ? 11.315  10.246  -13.424 1.00 76.60  ? 182 THR C CG2 1 
ATOM   6724  N  N   . LEU C 1 161 ? 11.699  12.258  -10.831 1.00 79.15  ? 183 LEU C N   1 
ATOM   6725  C  CA  . LEU C 1 161 ? 11.052  12.160  -9.521  1.00 80.47  ? 183 LEU C CA  1 
ATOM   6726  C  C   . LEU C 1 161 ? 10.637  13.527  -8.994  1.00 85.07  ? 183 LEU C C   1 
ATOM   6727  O  O   . LEU C 1 161 ? 9.593   13.633  -8.352  1.00 86.62  ? 183 LEU C O   1 
ATOM   6728  C  CB  . LEU C 1 161 ? 11.968  11.453  -8.499  1.00 79.78  ? 183 LEU C CB  1 
ATOM   6729  C  CG  . LEU C 1 161 ? 12.516  10.073  -8.884  1.00 83.08  ? 183 LEU C CG  1 
ATOM   6730  C  CD1 . LEU C 1 161 ? 13.684  9.693   -8.024  1.00 81.90  ? 183 LEU C CD1 1 
ATOM   6731  C  CD2 . LEU C 1 161 ? 11.460  9.027   -8.802  1.00 87.68  ? 183 LEU C CD2 1 
ATOM   6732  N  N   . LEU C 1 162 ? 11.437  14.571  -9.281  1.00 79.81  ? 184 LEU C N   1 
ATOM   6733  C  CA  . LEU C 1 162 ? 11.155  15.935  -8.841  1.00 81.30  ? 184 LEU C CA  1 
ATOM   6734  C  C   . LEU C 1 162 ? 10.114  16.663  -9.715  1.00 89.17  ? 184 LEU C C   1 
ATOM   6735  O  O   . LEU C 1 162 ? 9.602   17.705  -9.290  1.00 91.86  ? 184 LEU C O   1 
ATOM   6736  C  CB  . LEU C 1 162 ? 12.455  16.755  -8.738  1.00 80.18  ? 184 LEU C CB  1 
ATOM   6737  C  CG  . LEU C 1 162 ? 13.578  16.213  -7.858  1.00 81.93  ? 184 LEU C CG  1 
ATOM   6738  C  CD1 . LEU C 1 162 ? 14.794  17.088  -7.944  1.00 80.69  ? 184 LEU C CD1 1 
ATOM   6739  C  CD2 . LEU C 1 162 ? 13.130  16.065  -6.418  1.00 84.95  ? 184 LEU C CD2 1 
ATOM   6740  N  N   . GLU C 1 163 ? 9.815   16.125  -10.935 1.00 85.42  ? 185 GLU C N   1 
ATOM   6741  C  CA  . GLU C 1 163 ? 8.841   16.638  -11.924 1.00 86.58  ? 185 GLU C CA  1 
ATOM   6742  C  C   . GLU C 1 163 ? 7.792   15.566  -12.242 1.00 106.67 ? 185 GLU C C   1 
ATOM   6743  O  O   . GLU C 1 163 ? 7.292   14.886  -11.343 1.00 75.91  ? 185 GLU C O   1 
ATOM   6744  C  CB  . GLU C 1 163 ? 9.548   17.070  -13.222 1.00 86.55  ? 185 GLU C CB  1 
ATOM   6745  N  N   . GLY C 1 187 ? 6.840   20.497  -3.943  1.00 107.36 ? 209 GLY C N   1 
ATOM   6746  C  CA  . GLY C 1 187 ? 7.564   19.567  -3.084  1.00 105.77 ? 209 GLY C CA  1 
ATOM   6747  C  C   . GLY C 1 187 ? 9.053   19.848  -3.060  1.00 107.88 ? 209 GLY C C   1 
ATOM   6748  O  O   . GLY C 1 187 ? 9.447   21.018  -2.997  1.00 108.81 ? 209 GLY C O   1 
ATOM   6749  N  N   . PRO C 1 188 ? 9.925   18.810  -3.107  1.00 101.57 ? 210 PRO C N   1 
ATOM   6750  C  CA  . PRO C 1 188 ? 11.375  19.078  -3.127  1.00 99.42  ? 210 PRO C CA  1 
ATOM   6751  C  C   . PRO C 1 188 ? 11.861  19.359  -4.557  1.00 100.95 ? 210 PRO C C   1 
ATOM   6752  O  O   . PRO C 1 188 ? 11.432  18.680  -5.499  1.00 99.97  ? 210 PRO C O   1 
ATOM   6753  C  CB  . PRO C 1 188 ? 11.983  17.812  -2.523  1.00 99.46  ? 210 PRO C CB  1 
ATOM   6754  C  CG  . PRO C 1 188 ? 10.946  16.739  -2.724  1.00 104.22 ? 210 PRO C CG  1 
ATOM   6755  C  CD  . PRO C 1 188 ? 9.651   17.362  -3.187  1.00 101.86 ? 210 PRO C CD  1 
ATOM   6756  N  N   . LYS C 1 189 ? 12.718  20.400  -4.719  1.00 95.49  ? 211 LYS C N   1 
ATOM   6757  C  CA  . LYS C 1 189 ? 13.243  20.875  -6.004  1.00 92.29  ? 211 LYS C CA  1 
ATOM   6758  C  C   . LYS C 1 189 ? 14.765  21.000  -6.019  1.00 91.89  ? 211 LYS C C   1 
ATOM   6759  O  O   . LYS C 1 189 ? 15.387  21.214  -4.971  1.00 92.38  ? 211 LYS C O   1 
ATOM   6760  C  CB  . LYS C 1 189 ? 12.610  22.234  -6.344  1.00 96.60  ? 211 LYS C CB  1 
ATOM   6761  N  N   . ALA C 1 190 ? 15.365  20.887  -7.216  1.00 84.52  ? 212 ALA C N   1 
ATOM   6762  C  CA  . ALA C 1 190 ? 16.812  21.047  -7.378  1.00 81.82  ? 212 ALA C CA  1 
ATOM   6763  C  C   . ALA C 1 190 ? 17.103  22.462  -7.903  1.00 84.41  ? 212 ALA C C   1 
ATOM   6764  O  O   . ALA C 1 190 ? 16.884  22.760  -9.088  1.00 82.80  ? 212 ALA C O   1 
ATOM   6765  C  CB  . ALA C 1 190 ? 17.388  19.978  -8.305  1.00 79.77  ? 212 ALA C CB  1 
ATOM   6766  N  N   . ASP C 1 191 ? 17.549  23.345  -6.983  1.00 81.03  ? 213 ASP C N   1 
ATOM   6767  C  CA  . ASP C 1 191 ? 17.880  24.746  -7.240  1.00 81.49  ? 213 ASP C CA  1 
ATOM   6768  C  C   . ASP C 1 191 ? 18.845  24.934  -8.413  1.00 84.35  ? 213 ASP C C   1 
ATOM   6769  O  O   . ASP C 1 191 ? 18.687  25.873  -9.197  1.00 85.57  ? 213 ASP C O   1 
ATOM   6770  C  CB  . ASP C 1 191 ? 18.434  25.406  -5.971  1.00 84.20  ? 213 ASP C CB  1 
ATOM   6771  C  CG  . ASP C 1 191 ? 17.389  25.785  -4.934  1.00 95.30  ? 213 ASP C CG  1 
ATOM   6772  O  OD1 . ASP C 1 191 ? 16.180  25.465  -5.151  1.00 96.41  ? 213 ASP C OD1 1 
ATOM   6773  O  OD2 . ASP C 1 191 ? 17.770  26.416  -3.909  1.00 99.42  ? 213 ASP C OD2 1 
ATOM   6774  N  N   . LYS C 1 192 ? 19.833  24.038  -8.538  1.00 78.54  ? 214 LYS C N   1 
ATOM   6775  C  CA  . LYS C 1 192 ? 20.805  24.067  -9.628  1.00 76.57  ? 214 LYS C CA  1 
ATOM   6776  C  C   . LYS C 1 192 ? 21.372  22.688  -9.873  1.00 73.75  ? 214 LYS C C   1 
ATOM   6777  O  O   . LYS C 1 192 ? 21.510  21.896  -8.935  1.00 70.47  ? 214 LYS C O   1 
ATOM   6778  C  CB  . LYS C 1 192 ? 21.967  25.053  -9.340  1.00 80.44  ? 214 LYS C CB  1 
ATOM   6779  C  CG  . LYS C 1 192 ? 22.198  26.121  -10.416 1.00 91.79  ? 214 LYS C CG  1 
ATOM   6780  C  CD  . LYS C 1 192 ? 22.758  25.600  -11.735 1.00 94.62  ? 214 LYS C CD  1 
ATOM   6781  C  CE  . LYS C 1 192 ? 23.014  26.718  -12.721 1.00 100.65 ? 214 LYS C CE  1 
ATOM   6782  N  NZ  . LYS C 1 192 ? 24.250  27.478  -12.385 1.00 107.44 ? 214 LYS C NZ  1 
ATOM   6783  N  N   . VAL C 1 193 ? 21.705  22.424  -11.150 1.00 68.20  ? 215 VAL C N   1 
ATOM   6784  C  CA  . VAL C 1 193 ? 22.382  21.229  -11.622 1.00 65.83  ? 215 VAL C CA  1 
ATOM   6785  C  C   . VAL C 1 193 ? 23.694  21.699  -12.252 1.00 71.63  ? 215 VAL C C   1 
ATOM   6786  O  O   . VAL C 1 193 ? 23.699  22.602  -13.091 1.00 70.64  ? 215 VAL C O   1 
ATOM   6787  C  CB  . VAL C 1 193 ? 21.556  20.325  -12.565 1.00 68.11  ? 215 VAL C CB  1 
ATOM   6788  C  CG1 . VAL C 1 193 ? 22.329  19.051  -12.894 1.00 65.87  ? 215 VAL C CG1 1 
ATOM   6789  C  CG2 . VAL C 1 193 ? 20.208  19.978  -11.951 1.00 68.59  ? 215 VAL C CG2 1 
ATOM   6790  N  N   . LEU C 1 194 ? 24.814  21.135  -11.790 1.00 69.74  ? 216 LEU C N   1 
ATOM   6791  C  CA  . LEU C 1 194 ? 26.132  21.499  -12.304 1.00 69.71  ? 216 LEU C CA  1 
ATOM   6792  C  C   . LEU C 1 194 ? 26.808  20.269  -12.855 1.00 72.12  ? 216 LEU C C   1 
ATOM   6793  O  O   . LEU C 1 194 ? 26.869  19.238  -12.187 1.00 71.84  ? 216 LEU C O   1 
ATOM   6794  C  CB  . LEU C 1 194 ? 27.002  22.186  -11.234 1.00 70.41  ? 216 LEU C CB  1 
ATOM   6795  C  CG  . LEU C 1 194 ? 26.377  23.340  -10.464 1.00 76.74  ? 216 LEU C CG  1 
ATOM   6796  C  CD1 . LEU C 1 194 ? 27.274  23.761  -9.324  1.00 77.51  ? 216 LEU C CD1 1 
ATOM   6797  C  CD2 . LEU C 1 194 ? 26.074  24.512  -11.373 1.00 78.72  ? 216 LEU C CD2 1 
ATOM   6798  N  N   . GLN C 1 195 ? 27.262  20.356  -14.094 1.00 67.94  ? 217 GLN C N   1 
ATOM   6799  C  CA  . GLN C 1 195 ? 27.921  19.246  -14.759 1.00 66.82  ? 217 GLN C CA  1 
ATOM   6800  C  C   . GLN C 1 195 ? 29.352  19.641  -14.905 1.00 69.61  ? 217 GLN C C   1 
ATOM   6801  O  O   . GLN C 1 195 ? 29.628  20.830  -15.067 1.00 71.40  ? 217 GLN C O   1 
ATOM   6802  C  CB  . GLN C 1 195 ? 27.307  18.975  -16.155 1.00 69.06  ? 217 GLN C CB  1 
ATOM   6803  C  CG  . GLN C 1 195 ? 25.786  19.194  -16.269 1.00 92.70  ? 217 GLN C CG  1 
ATOM   6804  C  CD  . GLN C 1 195 ? 25.239  18.656  -17.558 1.00 117.30 ? 217 GLN C CD  1 
ATOM   6805  O  OE1 . GLN C 1 195 ? 25.688  19.020  -18.651 1.00 119.36 ? 217 GLN C OE1 1 
ATOM   6806  N  NE2 . GLN C 1 195 ? 24.250  17.776  -17.459 1.00 105.83 ? 217 GLN C NE2 1 
ATOM   6807  N  N   . PHE C 1 196 ? 30.269  18.678  -14.841 1.00 63.91  ? 218 PHE C N   1 
ATOM   6808  C  CA  . PHE C 1 196 ? 31.694  18.966  -15.012 1.00 63.93  ? 218 PHE C CA  1 
ATOM   6809  C  C   . PHE C 1 196 ? 32.319  17.951  -15.964 1.00 67.74  ? 218 PHE C C   1 
ATOM   6810  O  O   . PHE C 1 196 ? 31.757  16.877  -16.158 1.00 66.79  ? 218 PHE C O   1 
ATOM   6811  C  CB  . PHE C 1 196 ? 32.413  18.996  -13.661 1.00 65.99  ? 218 PHE C CB  1 
ATOM   6812  C  CG  . PHE C 1 196 ? 32.395  17.682  -12.921 1.00 66.67  ? 218 PHE C CG  1 
ATOM   6813  C  CD1 . PHE C 1 196 ? 33.311  16.682  -13.226 1.00 69.15  ? 218 PHE C CD1 1 
ATOM   6814  C  CD2 . PHE C 1 196 ? 31.458  17.442  -11.923 1.00 69.18  ? 218 PHE C CD2 1 
ATOM   6815  C  CE1 . PHE C 1 196 ? 33.251  15.447  -12.593 1.00 69.59  ? 218 PHE C CE1 1 
ATOM   6816  C  CE2 . PHE C 1 196 ? 31.417  16.215  -11.268 1.00 71.64  ? 218 PHE C CE2 1 
ATOM   6817  C  CZ  . PHE C 1 196 ? 32.313  15.224  -11.612 1.00 69.22  ? 218 PHE C CZ  1 
ATOM   6818  N  N   . GLU C 1 197 ? 33.459  18.277  -16.564 1.00 66.42  ? 219 GLU C N   1 
ATOM   6819  C  CA  . GLU C 1 197 ? 34.093  17.340  -17.476 1.00 67.38  ? 219 GLU C CA  1 
ATOM   6820  C  C   . GLU C 1 197 ? 34.781  16.211  -16.694 1.00 72.96  ? 219 GLU C C   1 
ATOM   6821  O  O   . GLU C 1 197 ? 35.648  16.489  -15.858 1.00 72.20  ? 219 GLU C O   1 
ATOM   6822  C  CB  . GLU C 1 197 ? 35.128  18.035  -18.384 1.00 70.25  ? 219 GLU C CB  1 
ATOM   6823  C  CG  . GLU C 1 197 ? 34.861  17.878  -19.877 1.00 88.58  ? 219 GLU C CG  1 
ATOM   6824  C  CD  . GLU C 1 197 ? 34.971  16.487  -20.478 1.00 113.49 ? 219 GLU C CD  1 
ATOM   6825  O  OE1 . GLU C 1 197 ? 36.030  15.836  -20.309 1.00 120.05 ? 219 GLU C OE1 1 
ATOM   6826  O  OE2 . GLU C 1 197 ? 33.991  16.049  -21.122 1.00 99.79  ? 219 GLU C OE2 1 
ATOM   6827  N  N   . PRO C 1 198 ? 34.444  14.927  -16.966 1.00 70.16  ? 220 PRO C N   1 
ATOM   6828  C  CA  . PRO C 1 198 ? 35.162  13.840  -16.296 1.00 70.27  ? 220 PRO C CA  1 
ATOM   6829  C  C   . PRO C 1 198 ? 36.670  13.941  -16.580 1.00 76.44  ? 220 PRO C C   1 
ATOM   6830  O  O   . PRO C 1 198 ? 37.074  14.163  -17.734 1.00 77.49  ? 220 PRO C O   1 
ATOM   6831  C  CB  . PRO C 1 198 ? 34.536  12.584  -16.914 1.00 71.05  ? 220 PRO C CB  1 
ATOM   6832  C  CG  . PRO C 1 198 ? 33.216  13.022  -17.415 1.00 73.96  ? 220 PRO C CG  1 
ATOM   6833  C  CD  . PRO C 1 198 ? 33.457  14.394  -17.923 1.00 70.61  ? 220 PRO C CD  1 
ATOM   6834  N  N   . GLY C 1 199 ? 37.469  13.881  -15.513 1.00 72.60  ? 221 GLY C N   1 
ATOM   6835  C  CA  . GLY C 1 199 ? 38.920  13.973  -15.598 1.00 72.59  ? 221 GLY C CA  1 
ATOM   6836  C  C   . GLY C 1 199 ? 39.473  15.313  -15.167 1.00 78.62  ? 221 GLY C C   1 
ATOM   6837  O  O   . GLY C 1 199 ? 40.693  15.457  -15.044 1.00 80.14  ? 221 GLY C O   1 
ATOM   6838  N  N   . THR C 1 200 ? 38.591  16.316  -14.961 1.00 75.47  ? 222 THR C N   1 
ATOM   6839  C  CA  . THR C 1 200 ? 38.969  17.650  -14.479 1.00 76.42  ? 222 THR C CA  1 
ATOM   6840  C  C   . THR C 1 200 ? 39.452  17.501  -13.025 1.00 81.73  ? 222 THR C C   1 
ATOM   6841  O  O   . THR C 1 200 ? 38.709  16.979  -12.180 1.00 79.90  ? 222 THR C O   1 
ATOM   6842  C  CB  . THR C 1 200 ? 37.768  18.602  -14.562 1.00 80.99  ? 222 THR C CB  1 
ATOM   6843  O  OG1 . THR C 1 200 ? 37.302  18.634  -15.900 1.00 79.25  ? 222 THR C OG1 1 
ATOM   6844  C  CG2 . THR C 1 200 ? 38.108  20.001  -14.120 1.00 83.64  ? 222 THR C CG2 1 
ATOM   6845  N  N   . LYS C 1 201 ? 40.703  17.906  -12.752 1.00 81.43  ? 223 LYS C N   1 
ATOM   6846  C  CA  . LYS C 1 201 ? 41.245  17.801  -11.392 1.00 82.67  ? 223 LYS C CA  1 
ATOM   6847  C  C   . LYS C 1 201 ? 40.996  19.084  -10.579 1.00 91.55  ? 223 LYS C C   1 
ATOM   6848  O  O   . LYS C 1 201 ? 40.791  18.997  -9.356  1.00 92.26  ? 223 LYS C O   1 
ATOM   6849  C  CB  . LYS C 1 201 ? 42.716  17.365  -11.381 1.00 84.18  ? 223 LYS C CB  1 
ATOM   6850  N  N   . ASN C 1 202 ? 40.966  20.261  -11.262 1.00 90.05  ? 224 ASN C N   1 
ATOM   6851  C  CA  . ASN C 1 202 ? 40.699  21.541  -10.606 1.00 91.93  ? 224 ASN C CA  1 
ATOM   6852  C  C   . ASN C 1 202 ? 39.268  21.998  -10.913 1.00 96.35  ? 224 ASN C C   1 
ATOM   6853  O  O   . ASN C 1 202 ? 38.975  22.551  -11.991 1.00 95.32  ? 224 ASN C O   1 
ATOM   6854  C  CB  . ASN C 1 202 ? 41.760  22.620  -10.929 1.00 96.52  ? 224 ASN C CB  1 
ATOM   6855  C  CG  . ASN C 1 202 ? 42.097  23.559  -9.774  1.00 120.56 ? 224 ASN C CG  1 
ATOM   6856  O  OD1 . ASN C 1 202 ? 41.651  23.382  -8.628  1.00 107.95 ? 224 ASN C OD1 1 
ATOM   6857  N  ND2 . ASN C 1 202 ? 42.928  24.572  -10.046 1.00 117.06 ? 224 ASN C ND2 1 
ATOM   6858  N  N   . LEU C 1 203 ? 38.371  21.676  -9.957  1.00 92.34  ? 225 LEU C N   1 
ATOM   6859  C  CA  . LEU C 1 203 ? 36.939  21.954  -10.002 1.00 91.54  ? 225 LEU C CA  1 
ATOM   6860  C  C   . LEU C 1 203 ? 36.546  23.133  -9.102  1.00 96.10  ? 225 LEU C C   1 
ATOM   6861  O  O   . LEU C 1 203 ? 35.422  23.169  -8.592  1.00 96.35  ? 225 LEU C O   1 
ATOM   6862  C  CB  . LEU C 1 203 ? 36.161  20.685  -9.589  1.00 89.76  ? 225 LEU C CB  1 
ATOM   6863  C  CG  . LEU C 1 203 ? 36.324  19.455  -10.463 1.00 91.91  ? 225 LEU C CG  1 
ATOM   6864  C  CD1 . LEU C 1 203 ? 35.991  18.262  -9.693  1.00 90.91  ? 225 LEU C CD1 1 
ATOM   6865  C  CD2 . LEU C 1 203 ? 35.421  19.506  -11.673 1.00 92.44  ? 225 LEU C CD2 1 
ATOM   6866  N  N   . THR C 1 204 ? 37.450  24.107  -8.925  1.00 92.76  ? 226 THR C N   1 
ATOM   6867  C  CA  . THR C 1 204 ? 37.176  25.260  -8.067  1.00 94.06  ? 226 THR C CA  1 
ATOM   6868  C  C   . THR C 1 204 ? 36.093  26.175  -8.695  1.00 97.03  ? 226 THR C C   1 
ATOM   6869  O  O   . THR C 1 204 ? 35.260  26.712  -7.959  1.00 97.35  ? 226 THR C O   1 
ATOM   6870  C  CB  . THR C 1 204 ? 38.489  25.968  -7.683  1.00 106.50 ? 226 THR C CB  1 
ATOM   6871  O  OG1 . THR C 1 204 ? 39.351  25.007  -7.060  1.00 110.25 ? 226 THR C OG1 1 
ATOM   6872  C  CG2 . THR C 1 204 ? 38.278  27.139  -6.716  1.00 105.10 ? 226 THR C CG2 1 
ATOM   6873  N  N   . ALA C 1 205 ? 36.065  26.294  -10.041 1.00 91.77  ? 227 ALA C N   1 
ATOM   6874  C  CA  . ALA C 1 205 ? 35.080  27.125  -10.734 1.00 91.86  ? 227 ALA C CA  1 
ATOM   6875  C  C   . ALA C 1 205 ? 33.665  26.577  -10.514 1.00 93.00  ? 227 ALA C C   1 
ATOM   6876  O  O   . ALA C 1 205 ? 32.732  27.347  -10.237 1.00 94.10  ? 227 ALA C O   1 
ATOM   6877  C  CB  . ALA C 1 205 ? 35.403  27.201  -12.217 1.00 92.49  ? 227 ALA C CB  1 
ATOM   6878  N  N   . LEU C 1 206 ? 33.538  25.234  -10.573 1.00 84.29  ? 228 LEU C N   1 
ATOM   6879  C  CA  . LEU C 1 206 ? 32.288  24.515  -10.391 1.00 80.90  ? 228 LEU C CA  1 
ATOM   6880  C  C   . LEU C 1 206 ? 31.760  24.694  -8.981  1.00 84.07  ? 228 LEU C C   1 
ATOM   6881  O  O   . LEU C 1 206 ? 30.587  25.031  -8.801  1.00 84.47  ? 228 LEU C O   1 
ATOM   6882  C  CB  . LEU C 1 206 ? 32.536  23.030  -10.668 1.00 78.11  ? 228 LEU C CB  1 
ATOM   6883  C  CG  . LEU C 1 206 ? 31.331  22.109  -10.601 1.00 80.68  ? 228 LEU C CG  1 
ATOM   6884  C  CD1 . LEU C 1 206 ? 30.691  21.927  -11.973 1.00 80.15  ? 228 LEU C CD1 1 
ATOM   6885  C  CD2 . LEU C 1 206 ? 31.752  20.790  -10.078 1.00 80.34  ? 228 LEU C CD2 1 
ATOM   6886  N  N   . LEU C 1 207 ? 32.624  24.486  -7.981  1.00 79.55  ? 229 LEU C N   1 
ATOM   6887  C  CA  . LEU C 1 207 ? 32.240  24.547  -6.576  1.00 79.27  ? 229 LEU C CA  1 
ATOM   6888  C  C   . LEU C 1 207 ? 32.078  25.964  -6.038  1.00 85.17  ? 229 LEU C C   1 
ATOM   6889  O  O   . LEU C 1 207 ? 31.267  26.158  -5.129  1.00 85.39  ? 229 LEU C O   1 
ATOM   6890  C  CB  . LEU C 1 207 ? 33.185  23.710  -5.721  1.00 78.02  ? 229 LEU C CB  1 
ATOM   6891  C  CG  . LEU C 1 207 ? 32.880  22.224  -5.804  1.00 79.67  ? 229 LEU C CG  1 
ATOM   6892  C  CD1 . LEU C 1 207 ? 34.106  21.418  -6.131  1.00 78.16  ? 229 LEU C CD1 1 
ATOM   6893  C  CD2 . LEU C 1 207 ? 32.166  21.747  -4.567  1.00 81.28  ? 229 LEU C CD2 1 
ATOM   6894  N  N   . LEU C 1 208 ? 32.777  26.961  -6.627  1.00 82.90  ? 230 LEU C N   1 
ATOM   6895  C  CA  . LEU C 1 208 ? 32.602  28.351  -6.217  1.00 84.98  ? 230 LEU C CA  1 
ATOM   6896  C  C   . LEU C 1 208 ? 31.180  28.763  -6.633  1.00 91.99  ? 230 LEU C C   1 
ATOM   6897  O  O   . LEU C 1 208 ? 30.487  29.392  -5.824  1.00 94.40  ? 230 LEU C O   1 
ATOM   6898  C  CB  . LEU C 1 208 ? 33.683  29.269  -6.809  1.00 85.66  ? 230 LEU C CB  1 
ATOM   6899  N  N   . GLU C 1 209 ? 30.703  28.273  -7.830  1.00 87.20  ? 231 GLU C N   1 
ATOM   6900  C  CA  . GLU C 1 209 ? 29.352  28.472  -8.383  1.00 87.86  ? 231 GLU C CA  1 
ATOM   6901  C  C   . GLU C 1 209 ? 28.287  27.893  -7.439  1.00 92.33  ? 231 GLU C C   1 
ATOM   6902  O  O   . GLU C 1 209 ? 27.281  28.555  -7.171  1.00 94.62  ? 231 GLU C O   1 
ATOM   6903  C  CB  . GLU C 1 209 ? 29.239  27.813  -9.772  1.00 87.88  ? 231 GLU C CB  1 
ATOM   6904  C  CG  . GLU C 1 209 ? 28.265  28.503  -10.714 1.00 102.30 ? 231 GLU C CG  1 
ATOM   6905  C  CD  . GLU C 1 209 ? 28.233  27.937  -12.121 1.00 128.11 ? 231 GLU C CD  1 
ATOM   6906  O  OE1 . GLU C 1 209 ? 27.155  27.466  -12.552 1.00 116.52 ? 231 GLU C OE1 1 
ATOM   6907  O  OE2 . GLU C 1 209 ? 29.280  27.983  -12.805 1.00 130.28 ? 231 GLU C OE2 1 
ATOM   6908  N  N   . ALA C 1 210 ? 28.544  26.671  -6.911  1.00 86.54  ? 232 ALA C N   1 
ATOM   6909  C  CA  . ALA C 1 210 ? 27.702  25.944  -5.955  1.00 85.46  ? 232 ALA C CA  1 
ATOM   6910  C  C   . ALA C 1 210 ? 27.678  26.608  -4.578  1.00 90.42  ? 232 ALA C C   1 
ATOM   6911  O  O   . ALA C 1 210 ? 26.635  26.616  -3.926  1.00 90.86  ? 232 ALA C O   1 
ATOM   6912  C  CB  . ALA C 1 210 ? 28.191  24.518  -5.823  1.00 83.88  ? 232 ALA C CB  1 
ATOM   6913  N  N   . LYS C 1 211 ? 28.828  27.148  -4.132  1.00 88.27  ? 233 LYS C N   1 
ATOM   6914  C  CA  . LYS C 1 211 ? 28.976  27.806  -2.829  1.00 90.75  ? 233 LYS C CA  1 
ATOM   6915  C  C   . LYS C 1 211 ? 28.100  29.062  -2.698  1.00 100.09 ? 233 LYS C C   1 
ATOM   6916  O  O   . LYS C 1 211 ? 27.574  29.350  -1.607  1.00 102.26 ? 233 LYS C O   1 
ATOM   6917  C  CB  . LYS C 1 211 ? 30.453  28.147  -2.562  1.00 91.63  ? 233 LYS C CB  1 
ATOM   6918  C  CG  . LYS C 1 211 ? 30.755  28.309  -1.094  1.00 91.75  ? 233 LYS C CG  1 
ATOM   6919  C  CD  . LYS C 1 211 ? 32.181  28.710  -0.843  1.00 100.43 ? 233 LYS C CD  1 
ATOM   6920  C  CE  . LYS C 1 211 ? 32.450  28.798  0.642   1.00 111.31 ? 233 LYS C CE  1 
ATOM   6921  N  NZ  . LYS C 1 211 ? 33.819  29.305  0.918   1.00 116.74 ? 233 LYS C NZ  1 
ATOM   6922  N  N   . GLU C 1 212 ? 27.965  29.801  -3.819  1.00 97.36  ? 234 GLU C N   1 
ATOM   6923  C  CA  . GLU C 1 212 ? 27.215  31.050  -3.914  1.00 100.06 ? 234 GLU C CA  1 
ATOM   6924  C  C   . GLU C 1 212 ? 25.708  30.892  -3.642  1.00 104.90 ? 234 GLU C C   1 
ATOM   6925  O  O   . GLU C 1 212 ? 25.085  31.835  -3.142  1.00 106.51 ? 234 GLU C O   1 
ATOM   6926  C  CB  . GLU C 1 212 ? 27.481  31.721  -5.273  1.00 101.48 ? 234 GLU C CB  1 
ATOM   6927  C  CG  . GLU C 1 212 ? 28.599  32.750  -5.213  1.00 111.18 ? 234 GLU C CG  1 
ATOM   6928  C  CD  . GLU C 1 212 ? 28.136  34.153  -4.866  1.00 124.86 ? 234 GLU C CD  1 
ATOM   6929  O  OE1 . GLU C 1 212 ? 27.367  34.736  -5.663  1.00 119.74 ? 234 GLU C OE1 1 
ATOM   6930  O  OE2 . GLU C 1 212 ? 28.555  34.678  -3.809  1.00 109.29 ? 234 GLU C OE2 1 
ATOM   6931  N  N   . LEU C 1 213 ? 25.143  29.700  -3.941  1.00 99.29  ? 235 LEU C N   1 
ATOM   6932  C  CA  . LEU C 1 213 ? 23.721  29.389  -3.769  1.00 99.39  ? 235 LEU C CA  1 
ATOM   6933  C  C   . LEU C 1 213 ? 23.289  29.233  -2.311  1.00 104.85 ? 235 LEU C C   1 
ATOM   6934  O  O   . LEU C 1 213 ? 24.108  28.902  -1.445  1.00 104.88 ? 235 LEU C O   1 
ATOM   6935  C  CB  . LEU C 1 213 ? 23.339  28.146  -4.576  1.00 96.91  ? 235 LEU C CB  1 
ATOM   6936  C  CG  . LEU C 1 213 ? 23.648  28.216  -6.060  1.00 100.62 ? 235 LEU C CG  1 
ATOM   6937  C  CD1 . LEU C 1 213 ? 24.039  26.868  -6.586  1.00 97.80  ? 235 LEU C CD1 1 
ATOM   6938  C  CD2 . LEU C 1 213 ? 22.473  28.764  -6.837  1.00 106.04 ? 235 LEU C CD2 1 
ATOM   6939  N  N   . GLU C 1 214 ? 21.986  29.473  -2.056  1.00 102.81 ? 236 GLU C N   1 
ATOM   6940  C  CA  . GLU C 1 214 ? 21.354  29.394  -0.737  1.00 104.25 ? 236 GLU C CA  1 
ATOM   6941  C  C   . GLU C 1 214 ? 21.313  27.949  -0.249  1.00 106.47 ? 236 GLU C C   1 
ATOM   6942  O  O   . GLU C 1 214 ? 21.511  27.712  0.947   1.00 107.01 ? 236 GLU C O   1 
ATOM   6943  C  CB  . GLU C 1 214 ? 19.940  30.000  -0.775  1.00 107.83 ? 236 GLU C CB  1 
ATOM   6944  C  CG  . GLU C 1 214 ? 19.515  30.654  0.527   1.00 119.99 ? 236 GLU C CG  1 
ATOM   6945  C  CD  . GLU C 1 214 ? 18.141  31.306  0.542   1.00 145.40 ? 236 GLU C CD  1 
ATOM   6946  O  OE1 . GLU C 1 214 ? 17.562  31.424  1.646   1.00 141.01 ? 236 GLU C OE1 1 
ATOM   6947  O  OE2 . GLU C 1 214 ? 17.647  31.715  -0.537  1.00 140.62 ? 236 GLU C OE2 1 
ATOM   6948  N  N   . ALA C 1 215 ? 21.083  26.985  -1.179  1.00 99.79  ? 237 ALA C N   1 
ATOM   6949  C  CA  . ALA C 1 215 ? 21.031  25.557  -0.864  1.00 96.80  ? 237 ALA C CA  1 
ATOM   6950  C  C   . ALA C 1 215 ? 22.383  25.055  -0.352  1.00 99.04  ? 237 ALA C C   1 
ATOM   6951  O  O   . ALA C 1 215 ? 23.441  25.421  -0.883  1.00 98.69  ? 237 ALA C O   1 
ATOM   6952  C  CB  . ALA C 1 215 ? 20.586  24.755  -2.077  1.00 95.03  ? 237 ALA C CB  1 
ATOM   6953  N  N   . ARG C 1 216 ? 22.338  24.264  0.722   1.00 93.46  ? 238 ARG C N   1 
ATOM   6954  C  CA  . ARG C 1 216 ? 23.522  23.675  1.324   1.00 91.13  ? 238 ARG C CA  1 
ATOM   6955  C  C   . ARG C 1 216 ? 23.482  22.129  1.253   1.00 91.12  ? 238 ARG C C   1 
ATOM   6956  O  O   . ARG C 1 216 ? 24.376  21.461  1.783   1.00 90.53  ? 238 ARG C O   1 
ATOM   6957  C  CB  . ARG C 1 216 ? 23.738  24.216  2.741   1.00 93.67  ? 238 ARG C CB  1 
ATOM   6958  N  N   . VAL C 1 217 ? 22.463  21.561  0.572   1.00 84.05  ? 239 VAL C N   1 
ATOM   6959  C  CA  . VAL C 1 217 ? 22.393  20.120  0.367   1.00 80.70  ? 239 VAL C CA  1 
ATOM   6960  C  C   . VAL C 1 217 ? 22.979  19.878  -1.023  1.00 81.41  ? 239 VAL C C   1 
ATOM   6961  O  O   . VAL C 1 217 ? 22.441  20.354  -2.027  1.00 80.88  ? 239 VAL C O   1 
ATOM   6962  C  CB  . VAL C 1 217 ? 20.992  19.485  0.541   1.00 84.23  ? 239 VAL C CB  1 
ATOM   6963  C  CG1 . VAL C 1 217 ? 21.053  17.969  0.328   1.00 81.54  ? 239 VAL C CG1 1 
ATOM   6964  C  CG2 . VAL C 1 217 ? 20.413  19.804  1.915   1.00 86.43  ? 239 VAL C CG2 1 
ATOM   6965  N  N   . ILE C 1 218 ? 24.117  19.183  -1.065  1.00 74.41  ? 240 ILE C N   1 
ATOM   6966  C  CA  . ILE C 1 218 ? 24.808  18.869  -2.303  1.00 70.24  ? 240 ILE C CA  1 
ATOM   6967  C  C   . ILE C 1 218 ? 24.681  17.371  -2.536  1.00 70.82  ? 240 ILE C C   1 
ATOM   6968  O  O   . ILE C 1 218 ? 24.988  16.583  -1.641  1.00 69.36  ? 240 ILE C O   1 
ATOM   6969  C  CB  . ILE C 1 218 ? 26.279  19.336  -2.231  1.00 72.29  ? 240 ILE C CB  1 
ATOM   6970  C  CG1 . ILE C 1 218 ? 26.377  20.850  -1.983  1.00 73.91  ? 240 ILE C CG1 1 
ATOM   6971  C  CG2 . ILE C 1 218 ? 27.058  18.926  -3.471  1.00 70.20  ? 240 ILE C CG2 1 
ATOM   6972  C  CD1 . ILE C 1 218 ? 27.605  21.270  -1.170  1.00 76.93  ? 240 ILE C CD1 1 
ATOM   6973  N  N   . ILE C 1 219 ? 24.168  16.998  -3.722  1.00 66.26  ? 241 ILE C N   1 
ATOM   6974  C  CA  . ILE C 1 219 ? 24.002  15.621  -4.194  1.00 64.29  ? 241 ILE C CA  1 
ATOM   6975  C  C   . ILE C 1 219 ? 25.056  15.450  -5.286  1.00 67.54  ? 241 ILE C C   1 
ATOM   6976  O  O   . ILE C 1 219 ? 25.175  16.313  -6.156  1.00 67.17  ? 241 ILE C O   1 
ATOM   6977  C  CB  . ILE C 1 219 ? 22.553  15.301  -4.699  1.00 66.81  ? 241 ILE C CB  1 
ATOM   6978  C  CG1 . ILE C 1 219 ? 21.492  15.576  -3.612  1.00 68.07  ? 241 ILE C CG1 1 
ATOM   6979  C  CG2 . ILE C 1 219 ? 22.461  13.858  -5.178  1.00 66.00  ? 241 ILE C CG2 1 
ATOM   6980  C  CD1 . ILE C 1 219 ? 20.062  15.443  -4.051  1.00 66.81  ? 241 ILE C CD1 1 
ATOM   6981  N  N   . LEU C 1 220 ? 25.815  14.350  -5.244  1.00 63.82  ? 242 LEU C N   1 
ATOM   6982  C  CA  . LEU C 1 220 ? 26.895  14.114  -6.200  1.00 62.21  ? 242 LEU C CA  1 
ATOM   6983  C  C   . LEU C 1 220 ? 26.802  12.798  -6.936  1.00 64.38  ? 242 LEU C C   1 
ATOM   6984  O  O   . LEU C 1 220 ? 26.648  11.743  -6.316  1.00 63.85  ? 242 LEU C O   1 
ATOM   6985  C  CB  . LEU C 1 220 ? 28.278  14.249  -5.493  1.00 61.90  ? 242 LEU C CB  1 
ATOM   6986  C  CG  . LEU C 1 220 ? 29.522  13.886  -6.295  1.00 64.30  ? 242 LEU C CG  1 
ATOM   6987  C  CD1 . LEU C 1 220 ? 29.905  14.997  -7.281  1.00 64.24  ? 242 LEU C CD1 1 
ATOM   6988  C  CD2 . LEU C 1 220 ? 30.658  13.569  -5.392  1.00 65.00  ? 242 LEU C CD2 1 
ATOM   6989  N  N   . SER C 1 221 ? 26.985  12.864  -8.259  1.00 60.15  ? 243 SER C N   1 
ATOM   6990  C  CA  . SER C 1 221 ? 27.036  11.695  -9.118  1.00 58.92  ? 243 SER C CA  1 
ATOM   6991  C  C   . SER C 1 221 ? 28.327  11.769  -9.936  1.00 63.58  ? 243 SER C C   1 
ATOM   6992  O  O   . SER C 1 221 ? 28.457  12.639  -10.787 1.00 65.48  ? 243 SER C O   1 
ATOM   6993  C  CB  . SER C 1 221 ? 25.804  11.621  -9.999  1.00 61.30  ? 243 SER C CB  1 
ATOM   6994  O  OG  . SER C 1 221 ? 25.954  10.550  -10.912 1.00 74.95  ? 243 SER C OG  1 
ATOM   6995  N  N   . ALA C 1 222 ? 29.306  10.919  -9.617  1.00 59.48  ? 244 ALA C N   1 
ATOM   6996  C  CA  . ALA C 1 222 ? 30.637  10.915  -10.233 1.00 59.67  ? 244 ALA C CA  1 
ATOM   6997  C  C   . ALA C 1 222 ? 31.381  9.621   -9.918  1.00 63.87  ? 244 ALA C C   1 
ATOM   6998  O  O   . ALA C 1 222 ? 31.136  9.019   -8.869  1.00 63.13  ? 244 ALA C O   1 
ATOM   6999  C  CB  . ALA C 1 222 ? 31.463  12.096  -9.695  1.00 61.23  ? 244 ALA C CB  1 
ATOM   7000  N  N   . SER C 1 223 ? 32.348  9.234   -10.785 1.00 59.64  ? 245 SER C N   1 
ATOM   7001  C  CA  . SER C 1 223 ? 33.217  8.078   -10.581 1.00 58.78  ? 245 SER C CA  1 
ATOM   7002  C  C   . SER C 1 223 ? 34.089  8.330   -9.353  1.00 64.78  ? 245 SER C C   1 
ATOM   7003  O  O   . SER C 1 223 ? 34.287  9.482   -8.969  1.00 64.04  ? 245 SER C O   1 
ATOM   7004  C  CB  . SER C 1 223 ? 34.127  7.893   -11.786 1.00 62.31  ? 245 SER C CB  1 
ATOM   7005  O  OG  . SER C 1 223 ? 35.061  8.958   -11.880 1.00 74.61  ? 245 SER C OG  1 
ATOM   7006  N  N   . GLU C 1 224 ? 34.635  7.253   -8.769  1.00 63.19  ? 246 GLU C N   1 
ATOM   7007  C  CA  . GLU C 1 224 ? 35.535  7.281   -7.622  1.00 64.09  ? 246 GLU C CA  1 
ATOM   7008  C  C   . GLU C 1 224 ? 36.659  8.335   -7.774  1.00 68.13  ? 246 GLU C C   1 
ATOM   7009  O  O   . GLU C 1 224 ? 36.812  9.182   -6.888  1.00 67.03  ? 246 GLU C O   1 
ATOM   7010  C  CB  . GLU C 1 224 ? 36.051  5.858   -7.379  1.00 65.89  ? 246 GLU C CB  1 
ATOM   7011  C  CG  . GLU C 1 224 ? 37.432  5.697   -6.768  1.00 83.80  ? 246 GLU C CG  1 
ATOM   7012  C  CD  . GLU C 1 224 ? 37.894  4.249   -6.708  1.00 111.14 ? 246 GLU C CD  1 
ATOM   7013  O  OE1 . GLU C 1 224 ? 39.130  4.026   -6.720  1.00 91.38  ? 246 GLU C OE1 1 
ATOM   7014  O  OE2 . GLU C 1 224 ? 37.024  3.343   -6.652  1.00 103.16 ? 246 GLU C OE2 1 
ATOM   7015  N  N   . ASP C 1 225 ? 37.360  8.347   -8.936  1.00 66.18  ? 247 ASP C N   1 
ATOM   7016  C  CA  . ASP C 1 225 ? 38.435  9.311   -9.199  1.00 67.22  ? 247 ASP C CA  1 
ATOM   7017  C  C   . ASP C 1 225 ? 37.936  10.734  -9.380  1.00 69.74  ? 247 ASP C C   1 
ATOM   7018  O  O   . ASP C 1 225 ? 38.642  11.655  -8.961  1.00 70.72  ? 247 ASP C O   1 
ATOM   7019  C  CB  . ASP C 1 225 ? 39.317  8.869   -10.367 1.00 70.30  ? 247 ASP C CB  1 
ATOM   7020  C  CG  . ASP C 1 225 ? 40.071  7.552   -10.141 1.00 95.46  ? 247 ASP C CG  1 
ATOM   7021  O  OD1 . ASP C 1 225 ? 40.557  7.311   -8.987  1.00 97.99  ? 247 ASP C OD1 1 
ATOM   7022  O  OD2 . ASP C 1 225 ? 40.208  6.776   -11.112 1.00 105.55 ? 247 ASP C OD2 1 
ATOM   7023  N  N   . ASP C 1 226 ? 36.717  10.918  -9.955  1.00 64.36  ? 248 ASP C N   1 
ATOM   7024  C  CA  . ASP C 1 226 ? 36.105  12.242  -10.114 1.00 64.64  ? 248 ASP C CA  1 
ATOM   7025  C  C   . ASP C 1 226 ? 35.501  12.762  -8.788  1.00 65.93  ? 248 ASP C C   1 
ATOM   7026  O  O   . ASP C 1 226 ? 35.529  13.960  -8.511  1.00 63.92  ? 248 ASP C O   1 
ATOM   7027  C  CB  . ASP C 1 226 ? 35.081  12.262  -11.261 1.00 66.87  ? 248 ASP C CB  1 
ATOM   7028  C  CG  . ASP C 1 226 ? 35.686  12.329  -12.665 1.00 83.40  ? 248 ASP C CG  1 
ATOM   7029  O  OD1 . ASP C 1 226 ? 36.725  13.027  -12.842 1.00 87.98  ? 248 ASP C OD1 1 
ATOM   7030  O  OD2 . ASP C 1 226 ? 35.102  11.718  -13.596 1.00 84.82  ? 248 ASP C OD2 1 
ATOM   7031  N  N   . ALA C 1 227 ? 35.014  11.848  -7.946  1.00 62.47  ? 249 ALA C N   1 
ATOM   7032  C  CA  . ALA C 1 227 ? 34.463  12.181  -6.639  1.00 62.78  ? 249 ALA C CA  1 
ATOM   7033  C  C   . ALA C 1 227 ? 35.575  12.741  -5.764  1.00 65.60  ? 249 ALA C C   1 
ATOM   7034  O  O   . ALA C 1 227 ? 35.353  13.742  -5.088  1.00 65.06  ? 249 ALA C O   1 
ATOM   7035  C  CB  . ALA C 1 227 ? 33.841  10.952  -5.998  1.00 63.37  ? 249 ALA C CB  1 
ATOM   7036  N  N   . THR C 1 228 ? 36.793  12.153  -5.856  1.00 62.94  ? 250 THR C N   1 
ATOM   7037  C  CA  . THR C 1 228 ? 37.987  12.619  -5.134  1.00 64.69  ? 250 THR C CA  1 
ATOM   7038  C  C   . THR C 1 228 ? 38.290  14.083  -5.503  1.00 71.60  ? 250 THR C C   1 
ATOM   7039  O  O   . THR C 1 228 ? 38.487  14.921  -4.608  1.00 72.23  ? 250 THR C O   1 
ATOM   7040  C  CB  . THR C 1 228 ? 39.208  11.733  -5.430  1.00 66.91  ? 250 THR C CB  1 
ATOM   7041  O  OG1 . THR C 1 228 ? 38.901  10.358  -5.229  1.00 61.59  ? 250 THR C OG1 1 
ATOM   7042  C  CG2 . THR C 1 228 ? 40.385  12.096  -4.573  1.00 64.91  ? 250 THR C CG2 1 
ATOM   7043  N  N   . ALA C 1 229 ? 38.271  14.381  -6.825  1.00 67.88  ? 251 ALA C N   1 
ATOM   7044  C  CA  . ALA C 1 229 ? 38.512  15.715  -7.372  1.00 68.11  ? 251 ALA C CA  1 
ATOM   7045  C  C   . ALA C 1 229 ? 37.591  16.749  -6.738  1.00 70.05  ? 251 ALA C C   1 
ATOM   7046  O  O   . ALA C 1 229 ? 38.089  17.781  -6.280  1.00 71.40  ? 251 ALA C O   1 
ATOM   7047  C  CB  . ALA C 1 229 ? 38.354  15.706  -8.887  1.00 68.28  ? 251 ALA C CB  1 
ATOM   7048  N  N   . VAL C 1 230 ? 36.272  16.436  -6.647  1.00 63.03  ? 252 VAL C N   1 
ATOM   7049  C  CA  . VAL C 1 230 ? 35.238  17.297  -6.050  1.00 63.12  ? 252 VAL C CA  1 
ATOM   7050  C  C   . VAL C 1 230 ? 35.538  17.491  -4.570  1.00 70.58  ? 252 VAL C C   1 
ATOM   7051  O  O   . VAL C 1 230 ? 35.585  18.633  -4.097  1.00 71.52  ? 252 VAL C O   1 
ATOM   7052  C  CB  . VAL C 1 230 ? 33.800  16.732  -6.243  1.00 64.80  ? 252 VAL C CB  1 
ATOM   7053  C  CG1 . VAL C 1 230 ? 32.750  17.601  -5.547  1.00 64.79  ? 252 VAL C CG1 1 
ATOM   7054  C  CG2 . VAL C 1 230 ? 33.466  16.533  -7.713  1.00 63.57  ? 252 VAL C CG2 1 
ATOM   7055  N  N   . TYR C 1 231 ? 35.752  16.363  -3.855  1.00 67.94  ? 253 TYR C N   1 
ATOM   7056  C  CA  . TYR C 1 231 ? 36.019  16.329  -2.421  1.00 69.08  ? 253 TYR C CA  1 
ATOM   7057  C  C   . TYR C 1 231 ? 37.164  17.240  -1.982  1.00 74.61  ? 253 TYR C C   1 
ATOM   7058  O  O   . TYR C 1 231 ? 36.987  18.008  -1.030  1.00 75.48  ? 253 TYR C O   1 
ATOM   7059  C  CB  . TYR C 1 231 ? 36.234  14.896  -1.931  1.00 69.30  ? 253 TYR C CB  1 
ATOM   7060  C  CG  . TYR C 1 231 ? 34.990  14.032  -1.956  1.00 68.33  ? 253 TYR C CG  1 
ATOM   7061  C  CD1 . TYR C 1 231 ? 33.722  14.596  -1.892  1.00 69.45  ? 253 TYR C CD1 1 
ATOM   7062  C  CD2 . TYR C 1 231 ? 35.083  12.648  -2.032  1.00 67.94  ? 253 TYR C CD2 1 
ATOM   7063  C  CE1 . TYR C 1 231 ? 32.578  13.804  -1.934  1.00 67.90  ? 253 TYR C CE1 1 
ATOM   7064  C  CE2 . TYR C 1 231 ? 33.948  11.848  -2.069  1.00 68.13  ? 253 TYR C CE2 1 
ATOM   7065  C  CZ  . TYR C 1 231 ? 32.695  12.428  -2.029  1.00 72.48  ? 253 TYR C CZ  1 
ATOM   7066  O  OH  . TYR C 1 231 ? 31.581  11.620  -2.062  1.00 70.03  ? 253 TYR C OH  1 
ATOM   7067  N  N   . LYS C 1 232 ? 38.311  17.175  -2.690  1.00 70.65  ? 254 LYS C N   1 
ATOM   7068  C  CA  . LYS C 1 232 ? 39.503  17.990  -2.436  1.00 71.35  ? 254 LYS C CA  1 
ATOM   7069  C  C   . LYS C 1 232 ? 39.204  19.473  -2.685  1.00 79.83  ? 254 LYS C C   1 
ATOM   7070  O  O   . LYS C 1 232 ? 39.502  20.299  -1.829  1.00 82.96  ? 254 LYS C O   1 
ATOM   7071  C  CB  . LYS C 1 232 ? 40.660  17.553  -3.341  1.00 71.11  ? 254 LYS C CB  1 
ATOM   7072  C  CG  . LYS C 1 232 ? 41.216  16.184  -3.043  1.00 66.98  ? 254 LYS C CG  1 
ATOM   7073  C  CD  . LYS C 1 232 ? 42.178  15.782  -4.125  1.00 70.05  ? 254 LYS C CD  1 
ATOM   7074  C  CE  . LYS C 1 232 ? 43.021  14.607  -3.723  1.00 79.89  ? 254 LYS C CE  1 
ATOM   7075  N  NZ  . LYS C 1 232 ? 43.476  13.841  -4.913  1.00 88.02  ? 254 LYS C NZ  1 
ATOM   7076  N  N   . SER C 1 233 ? 38.618  19.801  -3.856  1.00 75.69  ? 255 SER C N   1 
ATOM   7077  C  CA  . SER C 1 233 ? 38.282  21.169  -4.230  1.00 76.81  ? 255 SER C CA  1 
ATOM   7078  C  C   . SER C 1 233 ? 37.372  21.799  -3.187  1.00 82.13  ? 255 SER C C   1 
ATOM   7079  O  O   . SER C 1 233 ? 37.703  22.863  -2.663  1.00 82.38  ? 255 SER C O   1 
ATOM   7080  C  CB  . SER C 1 233 ? 37.658  21.208  -5.622  1.00 79.98  ? 255 SER C CB  1 
ATOM   7081  O  OG  . SER C 1 233 ? 38.615  20.954  -6.641  1.00 90.40  ? 255 SER C OG  1 
ATOM   7082  N  N   . ALA C 1 234 ? 36.278  21.085  -2.822  1.00 79.29  ? 256 ALA C N   1 
ATOM   7083  C  CA  . ALA C 1 234 ? 35.304  21.481  -1.797  1.00 80.03  ? 256 ALA C CA  1 
ATOM   7084  C  C   . ALA C 1 234 ? 36.014  21.686  -0.453  1.00 83.95  ? 256 ALA C C   1 
ATOM   7085  O  O   . ALA C 1 234 ? 35.770  22.691  0.213   1.00 85.30  ? 256 ALA C O   1 
ATOM   7086  C  CB  . ALA C 1 234 ? 34.224  20.417  -1.666  1.00 79.83  ? 256 ALA C CB  1 
ATOM   7087  N  N   . ALA C 1 235 ? 36.932  20.766  -0.089  1.00 78.86  ? 257 ALA C N   1 
ATOM   7088  C  CA  . ALA C 1 235 ? 37.747  20.861  1.124   1.00 79.98  ? 257 ALA C CA  1 
ATOM   7089  C  C   . ALA C 1 235 ? 38.550  22.174  1.155   1.00 87.28  ? 257 ALA C C   1 
ATOM   7090  O  O   . ALA C 1 235 ? 38.657  22.785  2.225   1.00 88.67  ? 257 ALA C O   1 
ATOM   7091  C  CB  . ALA C 1 235 ? 38.700  19.683  1.203   1.00 79.56  ? 257 ALA C CB  1 
ATOM   7092  N  N   . MET C 1 236 ? 39.102  22.607  -0.026  1.00 83.87  ? 258 MET C N   1 
ATOM   7093  C  CA  . MET C 1 236 ? 39.890  23.836  -0.209  1.00 84.80  ? 258 MET C CA  1 
ATOM   7094  C  C   . MET C 1 236 ? 39.003  25.070  -0.118  1.00 92.83  ? 258 MET C C   1 
ATOM   7095  O  O   . MET C 1 236 ? 39.460  26.117  0.337   1.00 94.73  ? 258 MET C O   1 
ATOM   7096  C  CB  . MET C 1 236 ? 40.691  23.809  -1.531  1.00 85.55  ? 258 MET C CB  1 
ATOM   7097  N  N   . LEU C 1 237 ? 37.725  24.934  -0.533  1.00 89.89  ? 259 LEU C N   1 
ATOM   7098  C  CA  . LEU C 1 237 ? 36.732  26.005  -0.506  1.00 90.88  ? 259 LEU C CA  1 
ATOM   7099  C  C   . LEU C 1 237 ? 35.914  26.005  0.789   1.00 94.43  ? 259 LEU C C   1 
ATOM   7100  O  O   . LEU C 1 237 ? 34.941  26.749  0.891   1.00 94.45  ? 259 LEU C O   1 
ATOM   7101  C  CB  . LEU C 1 237 ? 35.817  25.947  -1.747  1.00 89.82  ? 259 LEU C CB  1 
ATOM   7102  C  CG  . LEU C 1 237 ? 36.467  26.253  -3.100  1.00 93.74  ? 259 LEU C CG  1 
ATOM   7103  C  CD1 . LEU C 1 237 ? 35.634  25.706  -4.223  1.00 92.05  ? 259 LEU C CD1 1 
ATOM   7104  C  CD2 . LEU C 1 237 ? 36.696  27.754  -3.294  1.00 98.65  ? 259 LEU C CD2 1 
ATOM   7105  N  N   . ASP C 1 238 ? 36.321  25.190  1.781   1.00 91.30  ? 260 ASP C N   1 
ATOM   7106  C  CA  . ASP C 1 238 ? 35.675  25.088  3.098   1.00 93.45  ? 260 ASP C CA  1 
ATOM   7107  C  C   . ASP C 1 238 ? 34.137  24.802  3.009   1.00 97.55  ? 260 ASP C C   1 
ATOM   7108  O  O   . ASP C 1 238 ? 33.339  25.384  3.747   1.00 98.29  ? 260 ASP C O   1 
ATOM   7109  C  CB  . ASP C 1 238 ? 35.998  26.340  3.968   1.00 98.19  ? 260 ASP C CB  1 
ATOM   7110  C  CG  . ASP C 1 238 ? 37.478  26.631  4.216   1.00 114.28 ? 260 ASP C CG  1 
ATOM   7111  O  OD1 . ASP C 1 238 ? 38.336  25.946  3.613   1.00 115.46 ? 260 ASP C OD1 1 
ATOM   7112  O  OD2 . ASP C 1 238 ? 37.776  27.547  5.009   1.00 123.08 ? 260 ASP C OD2 1 
ATOM   7113  N  N   . MET C 1 239 ? 33.754  23.862  2.123   1.00 92.82  ? 261 MET C N   1 
ATOM   7114  C  CA  . MET C 1 239 ? 32.369  23.452  1.837   1.00 92.20  ? 261 MET C CA  1 
ATOM   7115  C  C   . MET C 1 239 ? 32.045  22.031  2.335   1.00 95.74  ? 261 MET C C   1 
ATOM   7116  O  O   . MET C 1 239 ? 31.008  21.449  1.987   1.00 94.44  ? 261 MET C O   1 
ATOM   7117  C  CB  . MET C 1 239 ? 32.119  23.531  0.330   1.00 92.97  ? 261 MET C CB  1 
ATOM   7118  C  CG  . MET C 1 239 ? 32.117  24.922  -0.209  1.00 97.82  ? 261 MET C CG  1 
ATOM   7119  S  SD  . MET C 1 239 ? 32.186  24.876  -2.003  1.00 100.53 ? 261 MET C SD  1 
ATOM   7120  C  CE  . MET C 1 239 ? 30.494  24.327  -2.369  1.00 96.80  ? 261 MET C CE  1 
ATOM   7121  N  N   . THR C 1 240 ? 32.932  21.485  3.158   1.00 93.00  ? 262 THR C N   1 
ATOM   7122  C  CA  . THR C 1 240 ? 32.802  20.148  3.727   1.00 91.50  ? 262 THR C CA  1 
ATOM   7123  C  C   . THR C 1 240 ? 32.502  20.216  5.230   1.00 95.63  ? 262 THR C C   1 
ATOM   7124  O  O   . THR C 1 240 ? 32.339  19.187  5.869   1.00 94.19  ? 262 THR C O   1 
ATOM   7125  C  CB  . THR C 1 240 ? 34.071  19.366  3.411   1.00 94.72  ? 262 THR C CB  1 
ATOM   7126  O  OG1 . THR C 1 240 ? 35.200  20.089  3.908   1.00 91.09  ? 262 THR C OG1 1 
ATOM   7127  C  CG2 . THR C 1 240 ? 34.227  19.088  1.919   1.00 89.70  ? 262 THR C CG2 1 
ATOM   7128  N  N   . GLY C 1 241 ? 32.394  21.428  5.765   1.00 94.74  ? 263 GLY C N   1 
ATOM   7129  C  CA  . GLY C 1 241 ? 32.122  21.652  7.181   1.00 97.34  ? 263 GLY C CA  1 
ATOM   7130  C  C   . GLY C 1 241 ? 30.668  21.884  7.550   1.00 102.26 ? 263 GLY C C   1 
ATOM   7131  O  O   . GLY C 1 241 ? 29.764  21.553  6.779   1.00 100.69 ? 263 GLY C O   1 
ATOM   7132  N  N   . ALA C 1 242 ? 30.441  22.464  8.748   1.00 101.13 ? 264 ALA C N   1 
ATOM   7133  C  CA  . ALA C 1 242 ? 29.109  22.755  9.272   1.00 102.64 ? 264 ALA C CA  1 
ATOM   7134  C  C   . ALA C 1 242 ? 28.333  23.645  8.323   1.00 106.97 ? 264 ALA C C   1 
ATOM   7135  O  O   . ALA C 1 242 ? 28.918  24.546  7.722   1.00 106.23 ? 264 ALA C O   1 
ATOM   7136  C  CB  . ALA C 1 242 ? 29.212  23.407  10.636  1.00 106.28 ? 264 ALA C CB  1 
ATOM   7137  N  N   . GLY C 1 243 ? 27.044  23.337  8.157   1.00 104.08 ? 265 GLY C N   1 
ATOM   7138  C  CA  . GLY C 1 243 ? 26.126  24.056  7.274   1.00 103.37 ? 265 GLY C CA  1 
ATOM   7139  C  C   . GLY C 1 243 ? 25.711  23.252  6.057   1.00 102.66 ? 265 GLY C C   1 
ATOM   7140  O  O   . GLY C 1 243 ? 24.537  23.262  5.670   1.00 103.22 ? 265 GLY C O   1 
ATOM   7141  N  N   . TYR C 1 244 ? 26.681  22.529  5.465   1.00 94.04  ? 266 TYR C N   1 
ATOM   7142  C  CA  . TYR C 1 244 ? 26.509  21.687  4.287   1.00 89.58  ? 266 TYR C CA  1 
ATOM   7143  C  C   . TYR C 1 244 ? 26.137  20.234  4.615   1.00 89.38  ? 266 TYR C C   1 
ATOM   7144  O  O   . TYR C 1 244 ? 26.525  19.702  5.663   1.00 89.05  ? 266 TYR C O   1 
ATOM   7145  C  CB  . TYR C 1 244 ? 27.791  21.710  3.436   1.00 88.40  ? 266 TYR C CB  1 
ATOM   7146  C  CG  . TYR C 1 244 ? 28.121  23.071  2.862   1.00 90.43  ? 266 TYR C CG  1 
ATOM   7147  C  CD1 . TYR C 1 244 ? 27.605  23.475  1.634   1.00 91.28  ? 266 TYR C CD1 1 
ATOM   7148  C  CD2 . TYR C 1 244 ? 28.962  23.951  3.539   1.00 92.76  ? 266 TYR C CD2 1 
ATOM   7149  C  CE1 . TYR C 1 244 ? 27.932  24.710  1.086   1.00 92.53  ? 266 TYR C CE1 1 
ATOM   7150  C  CE2 . TYR C 1 244 ? 29.278  25.200  3.011   1.00 94.66  ? 266 TYR C CE2 1 
ATOM   7151  C  CZ  . TYR C 1 244 ? 28.761  25.576  1.782   1.00 102.02 ? 266 TYR C CZ  1 
ATOM   7152  O  OH  . TYR C 1 244 ? 29.047  26.820  1.267   1.00 103.93 ? 266 TYR C OH  1 
ATOM   7153  N  N   . VAL C 1 245 ? 25.363  19.614  3.694   1.00 82.69  ? 267 VAL C N   1 
ATOM   7154  C  CA  . VAL C 1 245 ? 24.953  18.201  3.675   1.00 79.59  ? 267 VAL C CA  1 
ATOM   7155  C  C   . VAL C 1 245 ? 25.460  17.625  2.344   1.00 79.18  ? 267 VAL C C   1 
ATOM   7156  O  O   . VAL C 1 245 ? 25.239  18.226  1.285   1.00 79.23  ? 267 VAL C O   1 
ATOM   7157  C  CB  . VAL C 1 245 ? 23.422  17.960  3.874   1.00 83.37  ? 267 VAL C CB  1 
ATOM   7158  C  CG1 . VAL C 1 245 ? 23.027  16.507  3.588   1.00 80.68  ? 267 VAL C CG1 1 
ATOM   7159  C  CG2 . VAL C 1 245 ? 22.998  18.340  5.284   1.00 86.09  ? 267 VAL C CG2 1 
ATOM   7160  N  N   . TRP C 1 246 ? 26.164  16.484  2.411   1.00 71.69  ? 268 TRP C N   1 
ATOM   7161  C  CA  . TRP C 1 246 ? 26.669  15.775  1.243   1.00 68.45  ? 268 TRP C CA  1 
ATOM   7162  C  C   . TRP C 1 246 ? 25.941  14.450  1.107   1.00 68.48  ? 268 TRP C C   1 
ATOM   7163  O  O   . TRP C 1 246 ? 26.000  13.604  1.992   1.00 67.94  ? 268 TRP C O   1 
ATOM   7164  C  CB  . TRP C 1 246 ? 28.186  15.615  1.309   1.00 67.08  ? 268 TRP C CB  1 
ATOM   7165  C  CG  . TRP C 1 246 ? 28.921  16.901  1.014   1.00 68.86  ? 268 TRP C CG  1 
ATOM   7166  C  CD1 . TRP C 1 246 ? 29.132  17.944  1.872   1.00 73.60  ? 268 TRP C CD1 1 
ATOM   7167  C  CD2 . TRP C 1 246 ? 29.511  17.290  -0.240  1.00 67.31  ? 268 TRP C CD2 1 
ATOM   7168  N  NE1 . TRP C 1 246 ? 29.844  18.943  1.241   1.00 72.99  ? 268 TRP C NE1 1 
ATOM   7169  C  CE2 . TRP C 1 246 ? 30.091  18.568  -0.055  1.00 72.44  ? 268 TRP C CE2 1 
ATOM   7170  C  CE3 . TRP C 1 246 ? 29.648  16.662  -1.489  1.00 66.31  ? 268 TRP C CE3 1 
ATOM   7171  C  CZ2 . TRP C 1 246 ? 30.768  19.246  -1.083  1.00 70.81  ? 268 TRP C CZ2 1 
ATOM   7172  C  CZ3 . TRP C 1 246 ? 30.324  17.334  -2.506  1.00 67.28  ? 268 TRP C CZ3 1 
ATOM   7173  C  CH2 . TRP C 1 246 ? 30.866  18.614  -2.300  1.00 68.99  ? 268 TRP C CH2 1 
ATOM   7174  N  N   . LEU C 1 247 ? 25.150  14.330  0.046   1.00 64.22  ? 269 LEU C N   1 
ATOM   7175  C  CA  . LEU C 1 247 ? 24.362  13.139  -0.251  1.00 62.92  ? 269 LEU C CA  1 
ATOM   7176  C  C   . LEU C 1 247 ? 24.955  12.554  -1.530  1.00 67.37  ? 269 LEU C C   1 
ATOM   7177  O  O   . LEU C 1 247 ? 25.228  13.275  -2.493  1.00 66.48  ? 269 LEU C O   1 
ATOM   7178  C  CB  . LEU C 1 247 ? 22.881  13.505  -0.374  1.00 63.09  ? 269 LEU C CB  1 
ATOM   7179  C  CG  . LEU C 1 247 ? 21.880  12.378  -0.553  1.00 65.74  ? 269 LEU C CG  1 
ATOM   7180  C  CD1 . LEU C 1 247 ? 21.983  11.335  0.553   1.00 65.97  ? 269 LEU C CD1 1 
ATOM   7181  C  CD2 . LEU C 1 247 ? 20.493  12.926  -0.642  1.00 65.54  ? 269 LEU C CD2 1 
ATOM   7182  N  N   . VAL C 1 248 ? 25.237  11.260  -1.500  1.00 64.01  ? 270 VAL C N   1 
ATOM   7183  C  CA  . VAL C 1 248 ? 26.013  10.623  -2.541  1.00 62.76  ? 270 VAL C CA  1 
ATOM   7184  C  C   . VAL C 1 248 ? 25.649  9.112   -2.756  1.00 68.45  ? 270 VAL C C   1 
ATOM   7185  O  O   . VAL C 1 248 ? 24.841  8.539   -2.001  1.00 68.89  ? 270 VAL C O   1 
ATOM   7186  C  CB  . VAL C 1 248 ? 27.463  10.900  -2.042  1.00 66.49  ? 270 VAL C CB  1 
ATOM   7187  C  CG1 . VAL C 1 248 ? 28.239  9.663   -1.601  1.00 66.42  ? 270 VAL C CG1 1 
ATOM   7188  C  CG2 . VAL C 1 248 ? 28.230  11.767  -2.998  1.00 65.78  ? 270 VAL C CG2 1 
ATOM   7189  N  N   . GLY C 1 249 ? 26.248  8.492   -3.774  1.00 63.89  ? 271 GLY C N   1 
ATOM   7190  C  CA  . GLY C 1 249 ? 26.020  7.081   -4.070  1.00 62.97  ? 271 GLY C CA  1 
ATOM   7191  C  C   . GLY C 1 249 ? 27.071  6.123   -3.523  1.00 66.30  ? 271 GLY C C   1 
ATOM   7192  O  O   . GLY C 1 249 ? 27.737  6.405   -2.517  1.00 67.52  ? 271 GLY C O   1 
ATOM   7193  N  N   . GLU C 1 250 ? 27.227  4.972   -4.183  1.00 59.30  ? 272 GLU C N   1 
ATOM   7194  C  CA  . GLU C 1 250 ? 28.181  3.955   -3.755  1.00 57.02  ? 272 GLU C CA  1 
ATOM   7195  C  C   . GLU C 1 250 ? 29.557  4.311   -4.283  1.00 61.54  ? 272 GLU C C   1 
ATOM   7196  O  O   . GLU C 1 250 ? 30.479  4.421   -3.484  1.00 61.71  ? 272 GLU C O   1 
ATOM   7197  C  CB  . GLU C 1 250 ? 27.728  2.569   -4.232  1.00 56.96  ? 272 GLU C CB  1 
ATOM   7198  C  CG  . GLU C 1 250 ? 28.288  1.390   -3.474  1.00 61.55  ? 272 GLU C CG  1 
ATOM   7199  C  CD  . GLU C 1 250 ? 27.468  0.120   -3.645  1.00 87.35  ? 272 GLU C CD  1 
ATOM   7200  O  OE1 . GLU C 1 250 ? 26.282  0.228   -4.042  1.00 76.19  ? 272 GLU C OE1 1 
ATOM   7201  O  OE2 . GLU C 1 250 ? 27.997  -0.980  -3.353  1.00 84.54  ? 272 GLU C OE2 1 
ATOM   7202  N  N   . ARG C 1 251 ? 29.701  4.561   -5.612  1.00 57.46  ? 273 ARG C N   1 
ATOM   7203  C  CA  . ARG C 1 251 ? 31.004  4.907   -6.198  1.00 56.40  ? 273 ARG C CA  1 
ATOM   7204  C  C   . ARG C 1 251 ? 31.759  6.022   -5.462  1.00 61.32  ? 273 ARG C C   1 
ATOM   7205  O  O   . ARG C 1 251 ? 32.970  5.914   -5.279  1.00 62.08  ? 273 ARG C O   1 
ATOM   7206  C  CB  . ARG C 1 251 ? 30.850  5.307   -7.656  1.00 53.31  ? 273 ARG C CB  1 
ATOM   7207  C  CG  . ARG C 1 251 ? 31.004  4.185   -8.634  1.00 62.58  ? 273 ARG C CG  1 
ATOM   7208  C  CD  . ARG C 1 251 ? 29.974  4.341   -9.722  1.00 77.75  ? 273 ARG C CD  1 
ATOM   7209  N  NE  . ARG C 1 251 ? 30.386  5.155   -10.872 1.00 78.30  ? 273 ARG C NE  1 
ATOM   7210  C  CZ  . ARG C 1 251 ? 30.025  6.408   -11.089 1.00 90.09  ? 273 ARG C CZ  1 
ATOM   7211  N  NH1 . ARG C 1 251 ? 29.350  7.079   -10.164 1.00 82.14  ? 273 ARG C NH1 1 
ATOM   7212  N  NH2 . ARG C 1 251 ? 30.394  7.026   -12.202 1.00 73.69  ? 273 ARG C NH2 1 
ATOM   7213  N  N   . GLU C 1 252 ? 31.037  7.063   -5.014  1.00 57.63  ? 274 GLU C N   1 
ATOM   7214  C  CA  . GLU C 1 252 ? 31.572  8.262   -4.365  1.00 57.72  ? 274 GLU C CA  1 
ATOM   7215  C  C   . GLU C 1 252 ? 32.052  8.040   -2.919  1.00 64.97  ? 274 GLU C C   1 
ATOM   7216  O  O   . GLU C 1 252 ? 32.617  8.960   -2.330  1.00 65.38  ? 274 GLU C O   1 
ATOM   7217  C  CB  . GLU C 1 252 ? 30.565  9.416   -4.445  1.00 58.96  ? 274 GLU C CB  1 
ATOM   7218  C  CG  . GLU C 1 252 ? 30.032  9.716   -5.843  1.00 68.47  ? 274 GLU C CG  1 
ATOM   7219  C  CD  . GLU C 1 252 ? 28.869  8.883   -6.367  1.00 95.79  ? 274 GLU C CD  1 
ATOM   7220  O  OE1 . GLU C 1 252 ? 28.340  9.225   -7.448  1.00 83.13  ? 274 GLU C OE1 1 
ATOM   7221  O  OE2 . GLU C 1 252 ? 28.491  7.883   -5.715  1.00 98.71  ? 274 GLU C OE2 1 
ATOM   7222  N  N   . ILE C 1 253 ? 31.830  6.832   -2.351  1.00 62.14  ? 275 ILE C N   1 
ATOM   7223  C  CA  . ILE C 1 253 ? 32.305  6.452   -1.022  1.00 62.78  ? 275 ILE C CA  1 
ATOM   7224  C  C   . ILE C 1 253 ? 33.099  5.152   -1.113  1.00 69.38  ? 275 ILE C C   1 
ATOM   7225  O  O   . ILE C 1 253 ? 33.186  4.406   -0.142  1.00 72.17  ? 275 ILE C O   1 
ATOM   7226  C  CB  . ILE C 1 253 ? 31.202  6.435   0.073   1.00 66.93  ? 275 ILE C CB  1 
ATOM   7227  C  CG1 . ILE C 1 253 ? 29.977  5.582   -0.331  1.00 67.52  ? 275 ILE C CG1 1 
ATOM   7228  C  CG2 . ILE C 1 253 ? 30.811  7.836   0.464   1.00 67.67  ? 275 ILE C CG2 1 
ATOM   7229  C  CD1 . ILE C 1 253 ? 29.224  4.858   0.801   1.00 71.78  ? 275 ILE C CD1 1 
ATOM   7230  N  N   . SER C 1 254 ? 33.696  4.892   -2.284  1.00 66.10  ? 276 SER C N   1 
ATOM   7231  C  CA  . SER C 1 254 ? 34.460  3.682   -2.604  1.00 66.13  ? 276 SER C CA  1 
ATOM   7232  C  C   . SER C 1 254 ? 35.864  4.029   -3.037  1.00 71.28  ? 276 SER C C   1 
ATOM   7233  O  O   . SER C 1 254 ? 36.048  4.998   -3.754  1.00 71.48  ? 276 SER C O   1 
ATOM   7234  C  CB  . SER C 1 254 ? 33.767  2.919   -3.730  1.00 69.49  ? 276 SER C CB  1 
ATOM   7235  O  OG  . SER C 1 254 ? 32.418  2.593   -3.414  1.00 79.90  ? 276 SER C OG  1 
ATOM   7236  N  N   . GLY C 1 255 ? 36.840  3.254   -2.579  1.00 69.80  ? 277 GLY C N   1 
ATOM   7237  C  CA  . GLY C 1 255 ? 38.253  3.431   -2.897  1.00 70.38  ? 277 GLY C CA  1 
ATOM   7238  C  C   . GLY C 1 255 ? 38.838  4.778   -2.522  1.00 76.37  ? 277 GLY C C   1 
ATOM   7239  O  O   . GLY C 1 255 ? 38.680  5.235   -1.386  1.00 75.97  ? 277 GLY C O   1 
ATOM   7240  N  N   . SER C 1 256 ? 39.514  5.429   -3.491  1.00 74.44  ? 278 SER C N   1 
ATOM   7241  C  CA  . SER C 1 256 ? 40.147  6.746   -3.307  1.00 75.13  ? 278 SER C CA  1 
ATOM   7242  C  C   . SER C 1 256 ? 39.137  7.844   -2.941  1.00 77.36  ? 278 SER C C   1 
ATOM   7243  O  O   . SER C 1 256 ? 39.514  8.830   -2.296  1.00 76.48  ? 278 SER C O   1 
ATOM   7244  C  CB  . SER C 1 256 ? 40.951  7.149   -4.550  1.00 79.92  ? 278 SER C CB  1 
ATOM   7245  O  OG  . SER C 1 256 ? 40.185  7.445   -5.711  1.00 91.56  ? 278 SER C OG  1 
ATOM   7246  N  N   . ALA C 1 257 ? 37.854  7.672   -3.355  1.00 72.32  ? 279 ALA C N   1 
ATOM   7247  C  CA  . ALA C 1 257 ? 36.800  8.645   -3.081  1.00 71.44  ? 279 ALA C CA  1 
ATOM   7248  C  C   . ALA C 1 257 ? 36.570  8.715   -1.589  1.00 76.68  ? 279 ALA C C   1 
ATOM   7249  O  O   . ALA C 1 257 ? 36.312  9.790   -1.064  1.00 77.27  ? 279 ALA C O   1 
ATOM   7250  C  CB  . ALA C 1 257 ? 35.524  8.260   -3.798  1.00 70.87  ? 279 ALA C CB  1 
ATOM   7251  N  N   . LEU C 1 258 ? 36.743  7.577   -0.898  1.00 73.19  ? 280 LEU C N   1 
ATOM   7252  C  CA  . LEU C 1 258 ? 36.569  7.477   0.538   1.00 73.44  ? 280 LEU C CA  1 
ATOM   7253  C  C   . LEU C 1 258 ? 37.716  8.114   1.334   1.00 77.51  ? 280 LEU C C   1 
ATOM   7254  O  O   . LEU C 1 258 ? 37.463  8.624   2.422   1.00 78.88  ? 280 LEU C O   1 
ATOM   7255  C  CB  . LEU C 1 258 ? 36.336  6.015   0.924   1.00 73.46  ? 280 LEU C CB  1 
ATOM   7256  C  CG  . LEU C 1 258 ? 35.718  5.750   2.291   1.00 79.91  ? 280 LEU C CG  1 
ATOM   7257  C  CD1 . LEU C 1 258 ? 34.502  6.638   2.553   1.00 80.64  ? 280 LEU C CD1 1 
ATOM   7258  C  CD2 . LEU C 1 258 ? 35.380  4.303   2.438   1.00 82.45  ? 280 LEU C CD2 1 
ATOM   7259  N  N   . ARG C 1 259 ? 38.955  8.125   0.796   1.00 72.80  ? 281 ARG C N   1 
ATOM   7260  C  CA  . ARG C 1 259 ? 40.119  8.713   1.484   1.00 72.71  ? 281 ARG C CA  1 
ATOM   7261  C  C   . ARG C 1 259 ? 40.046  10.244  1.595   1.00 78.86  ? 281 ARG C C   1 
ATOM   7262  O  O   . ARG C 1 259 ? 40.624  10.797  2.534   1.00 78.92  ? 281 ARG C O   1 
ATOM   7263  C  CB  . ARG C 1 259 ? 41.434  8.263   0.817   1.00 68.76  ? 281 ARG C CB  1 
ATOM   7264  C  CG  . ARG C 1 259 ? 42.702  8.907   1.338   1.00 77.42  ? 281 ARG C CG  1 
ATOM   7265  C  CD  . ARG C 1 259 ? 43.900  8.113   0.881   1.00 94.90  ? 281 ARG C CD  1 
ATOM   7266  N  NE  . ARG C 1 259 ? 44.221  7.025   1.807   1.00 103.08 ? 281 ARG C NE  1 
ATOM   7267  C  CZ  . ARG C 1 259 ? 45.044  7.156   2.843   1.00 127.67 ? 281 ARG C CZ  1 
ATOM   7268  N  NH1 . ARG C 1 259 ? 45.621  8.326   3.099   1.00 114.93 ? 281 ARG C NH1 1 
ATOM   7269  N  NH2 . ARG C 1 259 ? 45.289  6.120   3.639   1.00 123.88 ? 281 ARG C NH2 1 
ATOM   7270  N  N   . TYR C 1 260 ? 39.351  10.933  0.638   1.00 75.98  ? 282 TYR C N   1 
ATOM   7271  C  CA  . TYR C 1 260 ? 39.266  12.403  0.636   1.00 76.29  ? 282 TYR C CA  1 
ATOM   7272  C  C   . TYR C 1 260 ? 37.854  12.949  0.925   1.00 79.22  ? 282 TYR C C   1 
ATOM   7273  O  O   . TYR C 1 260 ? 37.662  14.167  1.006   1.00 77.42  ? 282 TYR C O   1 
ATOM   7274  C  CB  . TYR C 1 260 ? 39.854  12.983  -0.662  1.00 76.46  ? 282 TYR C CB  1 
ATOM   7275  C  CG  . TYR C 1 260 ? 41.337  12.723  -0.814  1.00 78.14  ? 282 TYR C CG  1 
ATOM   7276  C  CD1 . TYR C 1 260 ? 42.277  13.560  -0.222  1.00 81.58  ? 282 TYR C CD1 1 
ATOM   7277  C  CD2 . TYR C 1 260 ? 41.802  11.617  -1.518  1.00 77.92  ? 282 TYR C CD2 1 
ATOM   7278  C  CE1 . TYR C 1 260 ? 43.644  13.301  -0.325  1.00 84.40  ? 282 TYR C CE1 1 
ATOM   7279  C  CE2 . TYR C 1 260 ? 43.167  11.368  -1.663  1.00 79.68  ? 282 TYR C CE2 1 
ATOM   7280  C  CZ  . TYR C 1 260 ? 44.086  12.213  -1.062  1.00 91.83  ? 282 TYR C CZ  1 
ATOM   7281  O  OH  . TYR C 1 260 ? 45.436  11.979  -1.195  1.00 96.64  ? 282 TYR C OH  1 
ATOM   7282  N  N   . ALA C 1 261 ? 36.896  12.036  1.151   1.00 77.06  ? 283 ALA C N   1 
ATOM   7283  C  CA  . ALA C 1 261 ? 35.491  12.308  1.463   1.00 76.77  ? 283 ALA C CA  1 
ATOM   7284  C  C   . ALA C 1 261 ? 35.362  13.042  2.768   1.00 81.58  ? 283 ALA C C   1 
ATOM   7285  O  O   . ALA C 1 261 ? 36.030  12.689  3.750   1.00 82.97  ? 283 ALA C O   1 
ATOM   7286  C  CB  . ALA C 1 261 ? 34.701  11.004  1.541   1.00 76.87  ? 283 ALA C CB  1 
ATOM   7287  N  N   . PRO C 1 262 ? 34.457  14.023  2.812   1.00 77.86  ? 284 PRO C N   1 
ATOM   7288  C  CA  . PRO C 1 262 ? 34.247  14.770  4.057   1.00 80.18  ? 284 PRO C CA  1 
ATOM   7289  C  C   . PRO C 1 262 ? 33.581  13.963  5.158   1.00 87.27  ? 284 PRO C C   1 
ATOM   7290  O  O   . PRO C 1 262 ? 32.636  13.210  4.887   1.00 87.16  ? 284 PRO C O   1 
ATOM   7291  C  CB  . PRO C 1 262 ? 33.325  15.902  3.619   1.00 81.95  ? 284 PRO C CB  1 
ATOM   7292  C  CG  . PRO C 1 262 ? 32.626  15.399  2.442   1.00 84.00  ? 284 PRO C CG  1 
ATOM   7293  C  CD  . PRO C 1 262 ? 33.604  14.544  1.727   1.00 78.28  ? 284 PRO C CD  1 
ATOM   7294  N  N   . ASP C 1 263 ? 34.048  14.138  6.407   1.00 85.75  ? 285 ASP C N   1 
ATOM   7295  C  CA  . ASP C 1 263 ? 33.421  13.457  7.541   1.00 87.49  ? 285 ASP C CA  1 
ATOM   7296  C  C   . ASP C 1 263 ? 31.988  13.973  7.616   1.00 89.99  ? 285 ASP C C   1 
ATOM   7297  O  O   . ASP C 1 263 ? 31.757  15.174  7.428   1.00 89.78  ? 285 ASP C O   1 
ATOM   7298  C  CB  . ASP C 1 263 ? 34.166  13.716  8.880   1.00 92.80  ? 285 ASP C CB  1 
ATOM   7299  C  CG  . ASP C 1 263 ? 34.984  12.530  9.400   1.00 113.41 ? 285 ASP C CG  1 
ATOM   7300  O  OD1 . ASP C 1 263 ? 35.945  12.125  8.705   1.00 114.27 ? 285 ASP C OD1 1 
ATOM   7301  O  OD2 . ASP C 1 263 ? 34.668  12.014  10.521  1.00 121.35 ? 285 ASP C OD2 1 
ATOM   7302  N  N   . GLY C 1 264 ? 31.043  13.050  7.783   1.00 84.70  ? 286 GLY C N   1 
ATOM   7303  C  CA  . GLY C 1 264 ? 29.624  13.371  7.870   1.00 84.47  ? 286 GLY C CA  1 
ATOM   7304  C  C   . GLY C 1 264 ? 28.851  13.120  6.597   1.00 85.36  ? 286 GLY C C   1 
ATOM   7305  O  O   . GLY C 1 264 ? 27.630  13.274  6.587   1.00 88.59  ? 286 GLY C O   1 
ATOM   7306  N  N   . ILE C 1 265 ? 29.538  12.722  5.509   1.00 75.20  ? 287 ILE C N   1 
ATOM   7307  C  CA  . ILE C 1 265 ? 28.901  12.410  4.226   1.00 71.57  ? 287 ILE C CA  1 
ATOM   7308  C  C   . ILE C 1 265 ? 27.839  11.322  4.375   1.00 73.97  ? 287 ILE C C   1 
ATOM   7309  O  O   . ILE C 1 265 ? 27.905  10.541  5.318   1.00 75.54  ? 287 ILE C O   1 
ATOM   7310  C  CB  . ILE C 1 265 ? 29.992  12.021  3.193   1.00 72.09  ? 287 ILE C CB  1 
ATOM   7311  C  CG1 . ILE C 1 265 ? 29.475  12.091  1.737   1.00 69.85  ? 287 ILE C CG1 1 
ATOM   7312  C  CG2 . ILE C 1 265 ? 30.654  10.673  3.500   1.00 71.80  ? 287 ILE C CG2 1 
ATOM   7313  C  CD1 . ILE C 1 265 ? 30.386  12.735  0.814   1.00 66.52  ? 287 ILE C CD1 1 
ATOM   7314  N  N   . ILE C 1 266 ? 26.859  11.286  3.468   1.00 68.24  ? 288 ILE C N   1 
ATOM   7315  C  CA  . ILE C 1 266 ? 25.845  10.234  3.415   1.00 67.87  ? 288 ILE C CA  1 
ATOM   7316  C  C   . ILE C 1 266 ? 25.996  9.536   2.076   1.00 69.73  ? 288 ILE C C   1 
ATOM   7317  O  O   . ILE C 1 266 ? 25.820  10.161  1.030   1.00 69.35  ? 288 ILE C O   1 
ATOM   7318  C  CB  . ILE C 1 266 ? 24.379  10.697  3.634   1.00 72.29  ? 288 ILE C CB  1 
ATOM   7319  C  CG1 . ILE C 1 266 ? 24.183  11.464  4.988   1.00 74.82  ? 288 ILE C CG1 1 
ATOM   7320  C  CG2 . ILE C 1 266 ? 23.414  9.495   3.485   1.00 71.92  ? 288 ILE C CG2 1 
ATOM   7321  C  CD1 . ILE C 1 266 ? 24.135  10.622  6.296   1.00 71.15  ? 288 ILE C CD1 1 
ATOM   7322  N  N   . GLY C 1 267 ? 26.330  8.260   2.122   1.00 64.85  ? 289 GLY C N   1 
ATOM   7323  C  CA  . GLY C 1 267 ? 26.497  7.443   0.932   1.00 62.47  ? 289 GLY C CA  1 
ATOM   7324  C  C   . GLY C 1 267 ? 25.543  6.270   0.934   1.00 66.46  ? 289 GLY C C   1 
ATOM   7325  O  O   . GLY C 1 267 ? 24.720  6.128   1.842   1.00 68.29  ? 289 GLY C O   1 
ATOM   7326  N  N   . LEU C 1 268 ? 25.629  5.430   -0.086  1.00 61.16  ? 290 LEU C N   1 
ATOM   7327  C  CA  . LEU C 1 268 ? 24.766  4.259   -0.210  1.00 60.11  ? 290 LEU C CA  1 
ATOM   7328  C  C   . LEU C 1 268 ? 25.579  3.015   -0.500  1.00 65.35  ? 290 LEU C C   1 
ATOM   7329  O  O   . LEU C 1 268 ? 26.719  3.118   -0.953  1.00 65.02  ? 290 LEU C O   1 
ATOM   7330  C  CB  . LEU C 1 268 ? 23.678  4.462   -1.303  1.00 58.25  ? 290 LEU C CB  1 
ATOM   7331  C  CG  . LEU C 1 268 ? 22.706  5.636   -1.096  1.00 62.13  ? 290 LEU C CG  1 
ATOM   7332  C  CD1 . LEU C 1 268 ? 21.909  5.920   -2.336  1.00 60.31  ? 290 LEU C CD1 1 
ATOM   7333  C  CD2 . LEU C 1 268 ? 21.806  5.422   0.122   1.00 66.66  ? 290 LEU C CD2 1 
ATOM   7334  N  N   . GLN C 1 269 ? 24.995  1.842   -0.219  1.00 62.07  ? 291 GLN C N   1 
ATOM   7335  C  CA  . GLN C 1 269 ? 25.581  0.563   -0.545  1.00 61.43  ? 291 GLN C CA  1 
ATOM   7336  C  C   . GLN C 1 269 ? 24.497  -0.397  -0.916  1.00 67.40  ? 291 GLN C C   1 
ATOM   7337  O  O   . GLN C 1 269 ? 23.652  -0.707  -0.090  1.00 70.58  ? 291 GLN C O   1 
ATOM   7338  C  CB  . GLN C 1 269 ? 26.421  0.027   0.586   1.00 64.39  ? 291 GLN C CB  1 
ATOM   7339  C  CG  . GLN C 1 269 ? 27.893  0.250   0.333   1.00 86.83  ? 291 GLN C CG  1 
ATOM   7340  C  CD  . GLN C 1 269 ? 28.698  0.118   1.585   1.00 110.43 ? 291 GLN C CD  1 
ATOM   7341  O  OE1 . GLN C 1 269 ? 28.510  -0.823  2.376   1.00 104.80 ? 291 GLN C OE1 1 
ATOM   7342  N  NE2 . GLN C 1 269 ? 29.623  1.064   1.775   1.00 105.70 ? 291 GLN C NE2 1 
ATOM   7343  N  N   . LEU C 1 270 ? 24.460  -0.825  -2.170  1.00 61.80  ? 292 LEU C N   1 
ATOM   7344  C  CA  . LEU C 1 270 ? 23.443  -1.776  -2.613  1.00 60.60  ? 292 LEU C CA  1 
ATOM   7345  C  C   . LEU C 1 270 ? 23.689  -3.080  -1.893  1.00 64.70  ? 292 LEU C C   1 
ATOM   7346  O  O   . LEU C 1 270 ? 24.769  -3.648  -2.058  1.00 64.43  ? 292 LEU C O   1 
ATOM   7347  C  CB  . LEU C 1 270 ? 23.540  -1.981  -4.127  1.00 58.55  ? 292 LEU C CB  1 
ATOM   7348  C  CG  . LEU C 1 270 ? 22.541  -2.945  -4.726  1.00 60.60  ? 292 LEU C CG  1 
ATOM   7349  C  CD1 . LEU C 1 270 ? 21.159  -2.380  -4.664  1.00 59.88  ? 292 LEU C CD1 1 
ATOM   7350  C  CD2 . LEU C 1 270 ? 22.942  -3.314  -6.120  1.00 58.69  ? 292 LEU C CD2 1 
ATOM   7351  N  N   . ILE C 1 271 ? 22.727  -3.503  -1.041  1.00 62.39  ? 293 ILE C N   1 
ATOM   7352  C  CA  . ILE C 1 271 ? 22.811  -4.729  -0.224  1.00 63.17  ? 293 ILE C CA  1 
ATOM   7353  C  C   . ILE C 1 271 ? 22.910  -5.918  -1.165  1.00 69.95  ? 293 ILE C C   1 
ATOM   7354  O  O   . ILE C 1 271 ? 22.119  -6.009  -2.109  1.00 68.66  ? 293 ILE C O   1 
ATOM   7355  C  CB  . ILE C 1 271 ? 21.646  -4.828  0.806   1.00 66.09  ? 293 ILE C CB  1 
ATOM   7356  C  CG1 . ILE C 1 271 ? 21.797  -3.790  1.918   1.00 66.05  ? 293 ILE C CG1 1 
ATOM   7357  C  CG2 . ILE C 1 271 ? 21.535  -6.205  1.399   1.00 66.63  ? 293 ILE C CG2 1 
ATOM   7358  C  CD1 . ILE C 1 271 ? 20.533  -3.334  2.455   1.00 64.15  ? 293 ILE C CD1 1 
ATOM   7359  N  N   . ASN C 1 272 ? 23.947  -6.769  -0.961  1.00 69.39  ? 294 ASN C N   1 
ATOM   7360  C  CA  . ASN C 1 272 ? 24.251  -7.965  -1.778  1.00 70.02  ? 294 ASN C CA  1 
ATOM   7361  C  C   . ASN C 1 272 ? 24.691  -7.681  -3.220  1.00 71.25  ? 294 ASN C C   1 
ATOM   7362  O  O   . ASN C 1 272 ? 24.929  -8.631  -3.975  1.00 69.85  ? 294 ASN C O   1 
ATOM   7363  C  CB  . ASN C 1 272 ? 23.104  -8.992  -1.797  1.00 73.05  ? 294 ASN C CB  1 
ATOM   7364  C  CG  . ASN C 1 272 ? 22.993  -9.821  -0.562  1.00 100.69 ? 294 ASN C CG  1 
ATOM   7365  O  OD1 . ASN C 1 272 ? 23.990  -10.341 -0.017  1.00 96.99  ? 294 ASN C OD1 1 
ATOM   7366  N  ND2 . ASN C 1 272 ? 21.759  -9.962  -0.112  1.00 92.33  ? 294 ASN C ND2 1 
ATOM   7367  N  N   . GLY C 1 273 ? 24.835  -6.398  -3.560  1.00 66.49  ? 295 GLY C N   1 
ATOM   7368  C  CA  . GLY C 1 273 ? 25.220  -5.919  -4.882  1.00 64.80  ? 295 GLY C CA  1 
ATOM   7369  C  C   . GLY C 1 273 ? 26.496  -6.499  -5.453  1.00 68.63  ? 295 GLY C C   1 
ATOM   7370  O  O   . GLY C 1 273 ? 26.699  -6.455  -6.672  1.00 69.43  ? 295 GLY C O   1 
ATOM   7371  N  N   . LYS C 1 274 ? 27.367  -7.032  -4.580  1.00 62.92  ? 296 LYS C N   1 
ATOM   7372  C  CA  . LYS C 1 274 ? 28.613  -7.627  -5.009  1.00 61.50  ? 296 LYS C CA  1 
ATOM   7373  C  C   . LYS C 1 274 ? 28.628  -9.143  -4.752  1.00 67.46  ? 296 LYS C C   1 
ATOM   7374  O  O   . LYS C 1 274 ? 29.616  -9.806  -5.080  1.00 68.19  ? 296 LYS C O   1 
ATOM   7375  C  CB  . LYS C 1 274 ? 29.806  -6.885  -4.388  1.00 63.37  ? 296 LYS C CB  1 
ATOM   7376  C  CG  . LYS C 1 274 ? 29.826  -5.376  -4.680  1.00 68.55  ? 296 LYS C CG  1 
ATOM   7377  C  CD  . LYS C 1 274 ? 31.220  -4.831  -5.014  1.00 76.36  ? 296 LYS C CD  1 
ATOM   7378  C  CE  . LYS C 1 274 ? 31.429  -3.401  -4.536  1.00 87.35  ? 296 LYS C CE  1 
ATOM   7379  N  NZ  . LYS C 1 274 ? 31.794  -3.325  -3.080  1.00 92.92  ? 296 LYS C NZ  1 
ATOM   7380  N  N   . ASN C 1 275 ? 27.529  -9.702  -4.174  1.00 65.12  ? 297 ASN C N   1 
ATOM   7381  C  CA  . ASN C 1 275 ? 27.392  -11.145 -3.922  1.00 67.08  ? 297 ASN C CA  1 
ATOM   7382  C  C   . ASN C 1 275 ? 27.003  -11.785 -5.241  1.00 74.06  ? 297 ASN C C   1 
ATOM   7383  O  O   . ASN C 1 275 ? 25.807  -11.805 -5.578  1.00 75.45  ? 297 ASN C O   1 
ATOM   7384  C  CB  . ASN C 1 275 ? 26.280  -11.438 -2.888  1.00 68.58  ? 297 ASN C CB  1 
ATOM   7385  C  CG  . ASN C 1 275 ? 26.509  -12.602 -1.949  1.00 82.99  ? 297 ASN C CG  1 
ATOM   7386  O  OD1 . ASN C 1 275 ? 27.197  -13.565 -2.296  1.00 79.48  ? 297 ASN C OD1 1 
ATOM   7387  N  ND2 . ASN C 1 275 ? 25.833  -12.449 -0.770  1.00 79.94  ? 297 ASN C ND2 1 
ATOM   7388  N  N   . GLU C 1 276 ? 28.003  -12.252 -6.027  1.00 69.74  ? 298 GLU C N   1 
ATOM   7389  C  CA  . GLU C 1 276 ? 27.773  -12.941 -7.304  1.00 68.56  ? 298 GLU C CA  1 
ATOM   7390  C  C   . GLU C 1 276 ? 27.002  -14.246 -7.028  1.00 76.93  ? 298 GLU C C   1 
ATOM   7391  O  O   . GLU C 1 276 ? 26.123  -14.608 -7.812  1.00 76.33  ? 298 GLU C O   1 
ATOM   7392  C  CB  . GLU C 1 276 ? 29.110  -13.237 -7.981  1.00 69.23  ? 298 GLU C CB  1 
ATOM   7393  C  CG  . GLU C 1 276 ? 29.010  -13.833 -9.375  1.00 77.65  ? 298 GLU C CG  1 
ATOM   7394  C  CD  . GLU C 1 276 ? 30.344  -13.991 -10.077 1.00 93.79  ? 298 GLU C CD  1 
ATOM   7395  O  OE1 . GLU C 1 276 ? 31.276  -13.220 -9.755  1.00 82.20  ? 298 GLU C OE1 1 
ATOM   7396  O  OE2 . GLU C 1 276 ? 30.438  -14.841 -10.992 1.00 87.55  ? 298 GLU C OE2 1 
ATOM   7397  N  N   . SER C 1 277 ? 27.313  -14.918 -5.889  1.00 77.18  ? 299 SER C N   1 
ATOM   7398  C  CA  . SER C 1 277 ? 26.654  -16.148 -5.482  1.00 79.60  ? 299 SER C CA  1 
ATOM   7399  C  C   . SER C 1 277 ? 25.158  -15.924 -5.256  1.00 83.86  ? 299 SER C C   1 
ATOM   7400  O  O   . SER C 1 277 ? 24.360  -16.704 -5.780  1.00 84.66  ? 299 SER C O   1 
ATOM   7401  C  CB  . SER C 1 277 ? 27.318  -16.743 -4.244  1.00 86.97  ? 299 SER C CB  1 
ATOM   7402  O  OG  . SER C 1 277 ? 26.622  -17.904 -3.816  1.00 101.32 ? 299 SER C OG  1 
ATOM   7403  N  N   . ALA C 1 278 ? 24.773  -14.850 -4.520  1.00 78.96  ? 300 ALA C N   1 
ATOM   7404  C  CA  . ALA C 1 278 ? 23.357  -14.530 -4.272  1.00 78.38  ? 300 ALA C CA  1 
ATOM   7405  C  C   . ALA C 1 278 ? 22.624  -14.223 -5.589  1.00 81.52  ? 300 ALA C C   1 
ATOM   7406  O  O   . ALA C 1 278 ? 21.499  -14.681 -5.798  1.00 82.68  ? 300 ALA C O   1 
ATOM   7407  C  CB  . ALA C 1 278 ? 23.239  -13.353 -3.315  1.00 78.65  ? 300 ALA C CB  1 
ATOM   7408  N  N   . HIS C 1 279 ? 23.284  -13.489 -6.492  1.00 74.60  ? 301 HIS C N   1 
ATOM   7409  C  CA  . HIS C 1 279 ? 22.699  -13.118 -7.761  1.00 71.89  ? 301 HIS C CA  1 
ATOM   7410  C  C   . HIS C 1 279 ? 22.620  -14.267 -8.741  1.00 73.47  ? 301 HIS C C   1 
ATOM   7411  O  O   . HIS C 1 279 ? 21.707  -14.255 -9.573  1.00 72.88  ? 301 HIS C O   1 
ATOM   7412  C  CB  . HIS C 1 279 ? 23.410  -11.904 -8.331  1.00 70.98  ? 301 HIS C CB  1 
ATOM   7413  C  CG  . HIS C 1 279 ? 22.981  -10.670 -7.618  1.00 73.77  ? 301 HIS C CG  1 
ATOM   7414  N  ND1 . HIS C 1 279 ? 21.822  -10.005 -7.970  1.00 74.80  ? 301 HIS C ND1 1 
ATOM   7415  C  CD2 . HIS C 1 279 ? 23.503  -10.088 -6.520  1.00 75.87  ? 301 HIS C CD2 1 
ATOM   7416  C  CE1 . HIS C 1 279 ? 21.699  -9.018  -7.107  1.00 74.58  ? 301 HIS C CE1 1 
ATOM   7417  N  NE2 . HIS C 1 279 ? 22.692  -9.021  -6.219  1.00 75.50  ? 301 HIS C NE2 1 
ATOM   7418  N  N   . ILE C 1 280 ? 23.520  -15.279 -8.621  1.00 68.23  ? 302 ILE C N   1 
ATOM   7419  C  CA  . ILE C 1 280 ? 23.463  -16.478 -9.459  1.00 67.38  ? 302 ILE C CA  1 
ATOM   7420  C  C   . ILE C 1 280 ? 22.174  -17.209 -9.078  1.00 72.52  ? 302 ILE C C   1 
ATOM   7421  O  O   . ILE C 1 280 ? 21.399  -17.562 -9.964  1.00 70.96  ? 302 ILE C O   1 
ATOM   7422  C  CB  . ILE C 1 280 ? 24.710  -17.386 -9.309  1.00 71.20  ? 302 ILE C CB  1 
ATOM   7423  C  CG1 . ILE C 1 280 ? 25.921  -16.809 -10.057 1.00 70.07  ? 302 ILE C CG1 1 
ATOM   7424  C  CG2 . ILE C 1 280 ? 24.416  -18.835 -9.753  1.00 73.43  ? 302 ILE C CG2 1 
ATOM   7425  C  CD1 . ILE C 1 280 ? 27.304  -17.423 -9.627  1.00 79.05  ? 302 ILE C CD1 1 
ATOM   7426  N  N   . SER C 1 281 ? 21.923  -17.379 -7.758  1.00 71.51  ? 303 SER C N   1 
ATOM   7427  C  CA  . SER C 1 281 ? 20.738  -18.057 -7.235  1.00 73.39  ? 303 SER C CA  1 
ATOM   7428  C  C   . SER C 1 281 ? 19.469  -17.452 -7.799  1.00 78.23  ? 303 SER C C   1 
ATOM   7429  O  O   . SER C 1 281 ? 18.698  -18.128 -8.492  1.00 78.53  ? 303 SER C O   1 
ATOM   7430  C  CB  . SER C 1 281 ? 20.710  -17.979 -5.713  1.00 78.98  ? 303 SER C CB  1 
ATOM   7431  O  OG  . SER C 1 281 ? 21.855  -18.611 -5.163  1.00 96.43  ? 303 SER C OG  1 
ATOM   7432  N  N   . ASP C 1 282 ? 19.316  -16.146 -7.568  1.00 73.75  ? 304 ASP C N   1 
ATOM   7433  C  CA  . ASP C 1 282 ? 18.170  -15.364 -7.967  1.00 72.42  ? 304 ASP C CA  1 
ATOM   7434  C  C   . ASP C 1 282 ? 17.965  -15.327 -9.481  1.00 74.12  ? 304 ASP C C   1 
ATOM   7435  O  O   . ASP C 1 282 ? 16.859  -15.649 -9.917  1.00 75.99  ? 304 ASP C O   1 
ATOM   7436  C  CB  . ASP C 1 282 ? 18.243  -13.976 -7.327  1.00 73.49  ? 304 ASP C CB  1 
ATOM   7437  C  CG  . ASP C 1 282 ? 17.968  -14.033 -5.823  1.00 84.86  ? 304 ASP C CG  1 
ATOM   7438  O  OD1 . ASP C 1 282 ? 17.789  -15.161 -5.288  1.00 88.26  ? 304 ASP C OD1 1 
ATOM   7439  O  OD2 . ASP C 1 282 ? 17.886  -12.956 -5.190  1.00 86.71  ? 304 ASP C OD2 1 
ATOM   7440  N  N   . ALA C 1 283 ? 19.011  -15.059 -10.284 1.00 65.65  ? 305 ALA C N   1 
ATOM   7441  C  CA  . ALA C 1 283 ? 18.869  -15.053 -11.740 1.00 63.15  ? 305 ALA C CA  1 
ATOM   7442  C  C   . ALA C 1 283 ? 18.407  -16.403 -12.282 1.00 68.17  ? 305 ALA C C   1 
ATOM   7443  O  O   . ALA C 1 283 ? 17.506  -16.446 -13.107 1.00 67.06  ? 305 ALA C O   1 
ATOM   7444  C  CB  . ALA C 1 283 ? 20.164  -14.652 -12.388 1.00 62.36  ? 305 ALA C CB  1 
ATOM   7445  N  N   . VAL C 1 284 ? 18.980  -17.505 -11.769 1.00 67.18  ? 306 VAL C N   1 
ATOM   7446  C  CA  . VAL C 1 284 ? 18.609  -18.867 -12.162 1.00 68.04  ? 306 VAL C CA  1 
ATOM   7447  C  C   . VAL C 1 284 ? 17.150  -19.113 -11.800 1.00 74.35  ? 306 VAL C C   1 
ATOM   7448  O  O   . VAL C 1 284 ? 16.417  -19.571 -12.663 1.00 75.52  ? 306 VAL C O   1 
ATOM   7449  C  CB  . VAL C 1 284 ? 19.565  -19.961 -11.593 1.00 71.78  ? 306 VAL C CB  1 
ATOM   7450  C  CG1 . VAL C 1 284 ? 19.020  -21.371 -11.838 1.00 73.23  ? 306 VAL C CG1 1 
ATOM   7451  C  CG2 . VAL C 1 284 ? 20.963  -19.827 -12.175 1.00 70.16  ? 306 VAL C CG2 1 
ATOM   7452  N  N   . ALA C 1 285 ? 16.715  -18.766 -10.561 1.00 70.41  ? 307 ALA C N   1 
ATOM   7453  C  CA  . ALA C 1 285 ? 15.331  -18.961 -10.109 1.00 70.80  ? 307 ALA C CA  1 
ATOM   7454  C  C   . ALA C 1 285 ? 14.331  -18.322 -11.090 1.00 74.12  ? 307 ALA C C   1 
ATOM   7455  O  O   . ALA C 1 285 ? 13.364  -18.967 -11.520 1.00 73.08  ? 307 ALA C O   1 
ATOM   7456  C  CB  . ALA C 1 285 ? 15.153  -18.375 -8.718  1.00 71.80  ? 307 ALA C CB  1 
ATOM   7457  N  N   . VAL C 1 286 ? 14.634  -17.066 -11.477 1.00 69.97  ? 308 VAL C N   1 
ATOM   7458  C  CA  . VAL C 1 286 ? 13.875  -16.227 -12.390 1.00 69.57  ? 308 VAL C CA  1 
ATOM   7459  C  C   . VAL C 1 286 ? 13.861  -16.840 -13.806 1.00 75.26  ? 308 VAL C C   1 
ATOM   7460  O  O   . VAL C 1 286 ? 12.781  -17.024 -14.383 1.00 76.27  ? 308 VAL C O   1 
ATOM   7461  C  CB  . VAL C 1 286 ? 14.444  -14.786 -12.337 1.00 71.31  ? 308 VAL C CB  1 
ATOM   7462  C  CG1 . VAL C 1 286 ? 13.932  -13.926 -13.490 1.00 70.20  ? 308 VAL C CG1 1 
ATOM   7463  C  CG2 . VAL C 1 286 ? 14.136  -14.132 -10.993 1.00 71.29  ? 308 VAL C CG2 1 
ATOM   7464  N  N   . VAL C 1 287 ? 15.048  -17.174 -14.341 1.00 71.37  ? 309 VAL C N   1 
ATOM   7465  C  CA  . VAL C 1 287 ? 15.171  -17.774 -15.672 1.00 70.93  ? 309 VAL C CA  1 
ATOM   7466  C  C   . VAL C 1 287 ? 14.451  -19.133 -15.731 1.00 78.14  ? 309 VAL C C   1 
ATOM   7467  O  O   . VAL C 1 287 ? 13.697  -19.369 -16.676 1.00 79.45  ? 309 VAL C O   1 
ATOM   7468  C  CB  . VAL C 1 287 ? 16.629  -17.844 -16.172 1.00 72.84  ? 309 VAL C CB  1 
ATOM   7469  C  CG1 . VAL C 1 287 ? 16.707  -18.526 -17.529 1.00 72.27  ? 309 VAL C CG1 1 
ATOM   7470  C  CG2 . VAL C 1 287 ? 17.236  -16.452 -16.250 1.00 70.88  ? 309 VAL C CG2 1 
ATOM   7471  N  N   . ALA C 1 288 ? 14.612  -19.972 -14.690 1.00 74.81  ? 310 ALA C N   1 
ATOM   7472  C  CA  . ALA C 1 288 ? 13.970  -21.283 -14.619 1.00 76.17  ? 310 ALA C CA  1 
ATOM   7473  C  C   . ALA C 1 288 ? 12.446  -21.186 -14.729 1.00 80.34  ? 310 ALA C C   1 
ATOM   7474  O  O   . ALA C 1 288 ? 11.827  -21.957 -15.469 1.00 80.63  ? 310 ALA C O   1 
ATOM   7475  C  CB  . ALA C 1 288 ? 14.350  -21.975 -13.333 1.00 78.19  ? 310 ALA C CB  1 
ATOM   7476  N  N   . GLN C 1 289 ? 11.860  -20.200 -14.014 1.00 75.95  ? 311 GLN C N   1 
ATOM   7477  C  CA  . GLN C 1 289 ? 10.427  -19.903 -13.965 1.00 75.76  ? 311 GLN C CA  1 
ATOM   7478  C  C   . GLN C 1 289 ? 9.955   -19.537 -15.339 1.00 77.67  ? 311 GLN C C   1 
ATOM   7479  O  O   . GLN C 1 289 ? 9.022   -20.154 -15.861 1.00 78.63  ? 311 GLN C O   1 
ATOM   7480  C  CB  . GLN C 1 289 ? 10.188  -18.735 -13.005 1.00 76.27  ? 311 GLN C CB  1 
ATOM   7481  C  CG  . GLN C 1 289 ? 8.830   -18.755 -12.347 1.00 76.04  ? 311 GLN C CG  1 
ATOM   7482  C  CD  . GLN C 1 289 ? 8.651   -17.549 -11.493 1.00 92.54  ? 311 GLN C CD  1 
ATOM   7483  O  OE1 . GLN C 1 289 ? 8.645   -17.621 -10.256 1.00 92.14  ? 311 GLN C OE1 1 
ATOM   7484  N  NE2 . GLN C 1 289 ? 8.468   -16.413 -12.146 1.00 79.93  ? 311 GLN C NE2 1 
ATOM   7485  N  N   . ALA C 1 290 ? 10.632  -18.543 -15.927 1.00 71.90  ? 312 ALA C N   1 
ATOM   7486  C  CA  . ALA C 1 290 ? 10.372  -18.012 -17.256 1.00 70.62  ? 312 ALA C CA  1 
ATOM   7487  C  C   . ALA C 1 290 ? 10.451  -19.108 -18.321 1.00 74.67  ? 312 ALA C C   1 
ATOM   7488  O  O   . ALA C 1 290 ? 9.575   -19.140 -19.186 1.00 72.87  ? 312 ALA C O   1 
ATOM   7489  C  CB  . ALA C 1 290 ? 11.362  -16.908 -17.563 1.00 69.21  ? 312 ALA C CB  1 
ATOM   7490  N  N   . ILE C 1 291 ? 11.443  -20.051 -18.225 1.00 72.13  ? 313 ILE C N   1 
ATOM   7491  C  CA  . ILE C 1 291 ? 11.559  -21.140 -19.210 1.00 72.72  ? 313 ILE C CA  1 
ATOM   7492  C  C   . ILE C 1 291 ? 10.299  -22.009 -19.174 1.00 79.31  ? 313 ILE C C   1 
ATOM   7493  O  O   . ILE C 1 291 ? 9.693   -22.282 -20.213 1.00 79.67  ? 313 ILE C O   1 
ATOM   7494  C  CB  . ILE C 1 291 ? 12.849  -21.985 -19.076 1.00 75.32  ? 313 ILE C CB  1 
ATOM   7495  C  CG1 . ILE C 1 291 ? 14.142  -21.112 -19.042 1.00 73.91  ? 313 ILE C CG1 1 
ATOM   7496  C  CG2 . ILE C 1 291 ? 12.911  -23.075 -20.157 1.00 76.63  ? 313 ILE C CG2 1 
ATOM   7497  C  CD1 . ILE C 1 291 ? 14.751  -20.722 -20.312 1.00 79.99  ? 313 ILE C CD1 1 
ATOM   7498  N  N   . HIS C 1 292 ? 9.883   -22.371 -17.973 1.00 77.04  ? 314 HIS C N   1 
ATOM   7499  C  CA  . HIS C 1 292 ? 8.713   -23.188 -17.759 1.00 79.99  ? 314 HIS C CA  1 
ATOM   7500  C  C   . HIS C 1 292 ? 7.433   -22.485 -18.153 1.00 85.54  ? 314 HIS C C   1 
ATOM   7501  O  O   . HIS C 1 292 ? 6.549   -23.116 -18.746 1.00 87.30  ? 314 HIS C O   1 
ATOM   7502  C  CB  . HIS C 1 292 ? 8.685   -23.694 -16.340 1.00 82.85  ? 314 HIS C CB  1 
ATOM   7503  C  CG  . HIS C 1 292 ? 9.660   -24.803 -16.112 1.00 87.41  ? 314 HIS C CG  1 
ATOM   7504  N  ND1 . HIS C 1 292 ? 10.773  -24.630 -15.314 1.00 88.63  ? 314 HIS C ND1 1 
ATOM   7505  C  CD2 . HIS C 1 292 ? 9.658   -26.068 -16.596 1.00 91.01  ? 314 HIS C CD2 1 
ATOM   7506  C  CE1 . HIS C 1 292 ? 11.402  -25.794 -15.327 1.00 89.29  ? 314 HIS C CE1 1 
ATOM   7507  N  NE2 . HIS C 1 292 ? 10.763  -26.692 -16.077 1.00 90.97  ? 314 HIS C NE2 1 
ATOM   7508  N  N   . GLU C 1 293 ? 7.361   -21.164 -17.903 1.00 80.70  ? 315 GLU C N   1 
ATOM   7509  C  CA  . GLU C 1 293 ? 6.240   -20.313 -18.319 1.00 79.66  ? 315 GLU C CA  1 
ATOM   7510  C  C   . GLU C 1 293 ? 6.203   -20.267 -19.866 1.00 81.42  ? 315 GLU C C   1 
ATOM   7511  O  O   . GLU C 1 293 ? 5.138   -20.455 -20.439 1.00 82.83  ? 315 GLU C O   1 
ATOM   7512  C  CB  . GLU C 1 293 ? 6.392   -18.900 -17.737 1.00 79.66  ? 315 GLU C CB  1 
ATOM   7513  C  CG  . GLU C 1 293 ? 5.125   -18.071 -17.812 1.00 93.93  ? 315 GLU C CG  1 
ATOM   7514  C  CD  . GLU C 1 293 ? 5.264   -16.601 -17.468 1.00 124.30 ? 315 GLU C CD  1 
ATOM   7515  O  OE1 . GLU C 1 293 ? 5.903   -16.276 -16.441 1.00 117.35 ? 315 GLU C OE1 1 
ATOM   7516  O  OE2 . GLU C 1 293 ? 4.690   -15.773 -18.210 1.00 128.45 ? 315 GLU C OE2 1 
ATOM   7517  N  N   . LEU C 1 294 ? 7.377   -20.070 -20.525 1.00 74.61  ? 316 LEU C N   1 
ATOM   7518  C  CA  . LEU C 1 294 ? 7.545   -20.031 -21.982 1.00 73.27  ? 316 LEU C CA  1 
ATOM   7519  C  C   . LEU C 1 294 ? 7.013   -21.282 -22.643 1.00 80.16  ? 316 LEU C C   1 
ATOM   7520  O  O   . LEU C 1 294 ? 6.262   -21.164 -23.608 1.00 79.81  ? 316 LEU C O   1 
ATOM   7521  C  CB  . LEU C 1 294 ? 9.029   -19.828 -22.381 1.00 70.98  ? 316 LEU C CB  1 
ATOM   7522  C  CG  . LEU C 1 294 ? 9.358   -19.752 -23.892 1.00 73.09  ? 316 LEU C CG  1 
ATOM   7523  C  CD1 . LEU C 1 294 ? 9.034   -18.376 -24.463 1.00 70.95  ? 316 LEU C CD1 1 
ATOM   7524  C  CD2 . LEU C 1 294 ? 10.818  -20.062 -24.148 1.00 73.24  ? 316 LEU C CD2 1 
ATOM   7525  N  N   . PHE C 1 295 ? 7.375   -22.476 -22.122 1.00 79.60  ? 317 PHE C N   1 
ATOM   7526  C  CA  . PHE C 1 295 ? 6.941   -23.756 -22.697 1.00 82.10  ? 317 PHE C CA  1 
ATOM   7527  C  C   . PHE C 1 295 ? 5.460   -24.065 -22.486 1.00 91.77  ? 317 PHE C C   1 
ATOM   7528  O  O   . PHE C 1 295 ? 4.992   -25.083 -23.010 1.00 93.57  ? 317 PHE C O   1 
ATOM   7529  C  CB  . PHE C 1 295 ? 7.827   -24.921 -22.251 1.00 84.25  ? 317 PHE C CB  1 
ATOM   7530  C  CG  . PHE C 1 295 ? 9.108   -24.944 -23.043 1.00 85.16  ? 317 PHE C CG  1 
ATOM   7531  C  CD1 . PHE C 1 295 ? 9.172   -25.589 -24.268 1.00 89.16  ? 317 PHE C CD1 1 
ATOM   7532  C  CD2 . PHE C 1 295 ? 10.236  -24.254 -22.598 1.00 85.66  ? 317 PHE C CD2 1 
ATOM   7533  C  CE1 . PHE C 1 295 ? 10.349  -25.568 -25.023 1.00 89.72  ? 317 PHE C CE1 1 
ATOM   7534  C  CE2 . PHE C 1 295 ? 11.412  -24.235 -23.353 1.00 87.48  ? 317 PHE C CE2 1 
ATOM   7535  C  CZ  . PHE C 1 295 ? 11.462  -24.890 -24.560 1.00 86.79  ? 317 PHE C CZ  1 
ATOM   7536  N  N   . GLU C 1 296 ? 4.706   -23.164 -21.787 1.00 90.16  ? 318 GLU C N   1 
ATOM   7537  C  CA  . GLU C 1 296 ? 3.248   -23.268 -21.640 1.00 91.56  ? 318 GLU C CA  1 
ATOM   7538  C  C   . GLU C 1 296 ? 2.636   -22.793 -22.967 1.00 95.82  ? 318 GLU C C   1 
ATOM   7539  O  O   . GLU C 1 296 ? 1.541   -23.232 -23.314 1.00 98.14  ? 318 GLU C O   1 
ATOM   7540  C  CB  . GLU C 1 296 ? 2.722   -22.422 -20.481 1.00 92.67  ? 318 GLU C CB  1 
ATOM   7541  N  N   . MET C 1 297 ? 3.356   -21.920 -23.714 1.00 89.60  ? 319 MET C N   1 
ATOM   7542  C  CA  . MET C 1 297 ? 2.955   -21.435 -25.035 1.00 89.52  ? 319 MET C CA  1 
ATOM   7543  C  C   . MET C 1 297 ? 3.286   -22.469 -26.107 1.00 95.72  ? 319 MET C C   1 
ATOM   7544  O  O   . MET C 1 297 ? 4.042   -23.419 -25.855 1.00 94.92  ? 319 MET C O   1 
ATOM   7545  C  CB  . MET C 1 297 ? 3.668   -20.132 -25.376 1.00 89.84  ? 319 MET C CB  1 
ATOM   7546  C  CG  . MET C 1 297 ? 2.911   -18.914 -24.977 1.00 93.12  ? 319 MET C CG  1 
ATOM   7547  S  SD  . MET C 1 297 ? 4.026   -17.743 -24.170 1.00 94.45  ? 319 MET C SD  1 
ATOM   7548  C  CE  . MET C 1 297 ? 3.755   -18.192 -22.458 1.00 92.20  ? 319 MET C CE  1 
ATOM   7549  N  N   . GLU C 1 298 ? 2.734   -22.273 -27.311 1.00 94.87  ? 320 GLU C N   1 
ATOM   7550  C  CA  . GLU C 1 298 ? 2.953   -23.188 -28.426 1.00 96.74  ? 320 GLU C CA  1 
ATOM   7551  C  C   . GLU C 1 298 ? 3.972   -22.661 -29.431 1.00 101.91 ? 320 GLU C C   1 
ATOM   7552  O  O   . GLU C 1 298 ? 4.253   -21.451 -29.477 1.00 99.72  ? 320 GLU C O   1 
ATOM   7553  C  CB  . GLU C 1 298 ? 1.624   -23.545 -29.115 1.00 100.13 ? 320 GLU C CB  1 
ATOM   7554  N  N   . ASN C 1 299 ? 4.541   -23.603 -30.221 1.00 100.72 ? 321 ASN C N   1 
ATOM   7555  C  CA  . ASN C 1 299 ? 5.510   -23.379 -31.298 1.00 100.11 ? 321 ASN C CA  1 
ATOM   7556  C  C   . ASN C 1 299 ? 6.803   -22.646 -30.820 1.00 100.15 ? 321 ASN C C   1 
ATOM   7557  O  O   . ASN C 1 299 ? 7.302   -21.720 -31.476 1.00 99.65  ? 321 ASN C O   1 
ATOM   7558  C  CB  . ASN C 1 299 ? 4.821   -22.679 -32.497 1.00 103.36 ? 321 ASN C CB  1 
ATOM   7559  C  CG  . ASN C 1 299 ? 3.620   -23.433 -33.047 1.00 130.81 ? 321 ASN C CG  1 
ATOM   7560  O  OD1 . ASN C 1 299 ? 3.650   -24.659 -33.253 1.00 125.12 ? 321 ASN C OD1 1 
ATOM   7561  N  ND2 . ASN C 1 299 ? 2.541   -22.709 -33.325 1.00 124.48 ? 321 ASN C ND2 1 
ATOM   7562  N  N   . ILE C 1 300 ? 7.348   -23.107 -29.681 1.00 93.76  ? 322 ILE C N   1 
ATOM   7563  C  CA  . ILE C 1 300 ? 8.577   -22.568 -29.089 1.00 90.66  ? 322 ILE C CA  1 
ATOM   7564  C  C   . ILE C 1 300 ? 9.783   -23.123 -29.868 1.00 95.04  ? 322 ILE C C   1 
ATOM   7565  O  O   . ILE C 1 300 ? 10.060  -24.331 -29.818 1.00 95.89  ? 322 ILE C O   1 
ATOM   7566  C  CB  . ILE C 1 300 ? 8.646   -22.839 -27.549 1.00 92.24  ? 322 ILE C CB  1 
ATOM   7567  C  CG1 . ILE C 1 300 ? 7.479   -22.159 -26.761 1.00 91.89  ? 322 ILE C CG1 1 
ATOM   7568  C  CG2 . ILE C 1 300 ? 10.000  -22.494 -26.959 1.00 90.49  ? 322 ILE C CG2 1 
ATOM   7569  C  CD1 . ILE C 1 300 ? 7.157   -20.634 -27.002 1.00 90.99  ? 322 ILE C CD1 1 
ATOM   7570  N  N   . THR C 1 301 ? 10.473  -22.235 -30.613 1.00 90.08  ? 323 THR C N   1 
ATOM   7571  C  CA  . THR C 1 301 ? 11.632  -22.610 -31.424 1.00 89.49  ? 323 THR C CA  1 
ATOM   7572  C  C   . THR C 1 301 ? 12.888  -22.620 -30.557 1.00 92.00  ? 323 THR C C   1 
ATOM   7573  O  O   . THR C 1 301 ? 12.966  -21.890 -29.561 1.00 89.21  ? 323 THR C O   1 
ATOM   7574  C  CB  . THR C 1 301 ? 11.776  -21.695 -32.659 1.00 95.09  ? 323 THR C CB  1 
ATOM   7575  O  OG1 . THR C 1 301 ? 12.355  -20.447 -32.280 1.00 91.12  ? 323 THR C OG1 1 
ATOM   7576  C  CG2 . THR C 1 301 ? 10.454  -21.442 -33.364 1.00 95.74  ? 323 THR C CG2 1 
ATOM   7577  N  N   . ASP C 1 302 ? 13.869  -23.450 -30.937 1.00 90.16  ? 324 ASP C N   1 
ATOM   7578  C  CA  . ASP C 1 302 ? 15.149  -23.547 -30.237 1.00 89.22  ? 324 ASP C CA  1 
ATOM   7579  C  C   . ASP C 1 302 ? 16.059  -22.416 -30.708 1.00 89.49  ? 324 ASP C C   1 
ATOM   7580  O  O   . ASP C 1 302 ? 15.930  -21.984 -31.865 1.00 89.35  ? 324 ASP C O   1 
ATOM   7581  C  CB  . ASP C 1 302 ? 15.849  -24.881 -30.558 1.00 93.66  ? 324 ASP C CB  1 
ATOM   7582  C  CG  . ASP C 1 302 ? 15.154  -26.098 -30.015 1.00 113.01 ? 324 ASP C CG  1 
ATOM   7583  O  OD1 . ASP C 1 302 ? 14.781  -26.081 -28.820 1.00 114.56 ? 324 ASP C OD1 1 
ATOM   7584  O  OD2 . ASP C 1 302 ? 14.994  -27.085 -30.785 1.00 122.63 ? 324 ASP C OD2 1 
ATOM   7585  N  N   . PRO C 1 303 ? 17.036  -21.964 -29.877 1.00 82.38  ? 325 PRO C N   1 
ATOM   7586  C  CA  . PRO C 1 303 ? 17.971  -20.947 -30.356 1.00 80.52  ? 325 PRO C CA  1 
ATOM   7587  C  C   . PRO C 1 303 ? 18.901  -21.577 -31.400 1.00 84.72  ? 325 PRO C C   1 
ATOM   7588  O  O   . PRO C 1 303 ? 18.929  -22.814 -31.508 1.00 86.03  ? 325 PRO C O   1 
ATOM   7589  C  CB  . PRO C 1 303 ? 18.742  -20.556 -29.081 1.00 80.63  ? 325 PRO C CB  1 
ATOM   7590  C  CG  . PRO C 1 303 ? 17.980  -21.146 -27.947 1.00 84.84  ? 325 PRO C CG  1 
ATOM   7591  C  CD  . PRO C 1 303 ? 17.381  -22.370 -28.503 1.00 82.59  ? 325 PRO C CD  1 
ATOM   7592  N  N   . PRO C 1 304 ? 19.661  -20.782 -32.189 1.00 79.06  ? 326 PRO C N   1 
ATOM   7593  C  CA  . PRO C 1 304 ? 20.595  -21.392 -33.150 1.00 79.72  ? 326 PRO C CA  1 
ATOM   7594  C  C   . PRO C 1 304 ? 21.695  -22.212 -32.471 1.00 82.65  ? 326 PRO C C   1 
ATOM   7595  O  O   . PRO C 1 304 ? 22.122  -21.872 -31.363 1.00 80.25  ? 326 PRO C O   1 
ATOM   7596  C  CB  . PRO C 1 304 ? 21.186  -20.182 -33.875 1.00 81.02  ? 326 PRO C CB  1 
ATOM   7597  C  CG  . PRO C 1 304 ? 21.048  -19.071 -32.902 1.00 83.85  ? 326 PRO C CG  1 
ATOM   7598  C  CD  . PRO C 1 304 ? 19.749  -19.308 -32.222 1.00 78.93  ? 326 PRO C CD  1 
ATOM   7599  N  N   . ARG C 1 305 ? 22.135  -23.304 -33.119 1.00 81.70  ? 327 ARG C N   1 
ATOM   7600  C  CA  . ARG C 1 305 ? 23.222  -24.133 -32.597 1.00 82.50  ? 327 ARG C CA  1 
ATOM   7601  C  C   . ARG C 1 305 ? 24.520  -23.553 -33.140 1.00 84.32  ? 327 ARG C C   1 
ATOM   7602  O  O   . ARG C 1 305 ? 24.833  -23.728 -34.319 1.00 85.32  ? 327 ARG C O   1 
ATOM   7603  C  CB  . ARG C 1 305 ? 23.032  -25.615 -32.982 1.00 86.50  ? 327 ARG C CB  1 
ATOM   7604  C  CG  . ARG C 1 305 ? 23.737  -26.609 -32.055 1.00 99.97  ? 327 ARG C CG  1 
ATOM   7605  C  CD  . ARG C 1 305 ? 23.982  -27.930 -32.765 1.00 115.32 ? 327 ARG C CD  1 
ATOM   7606  N  NE  . ARG C 1 305 ? 24.861  -27.732 -33.930 1.00 136.00 ? 327 ARG C NE  1 
ATOM   7607  C  CZ  . ARG C 1 305 ? 25.384  -28.700 -34.683 1.00 158.17 ? 327 ARG C CZ  1 
ATOM   7608  N  NH1 . ARG C 1 305 ? 25.122  -29.977 -34.418 1.00 149.82 ? 327 ARG C NH1 1 
ATOM   7609  N  NH2 . ARG C 1 305 ? 26.182  -28.399 -35.700 1.00 144.88 ? 327 ARG C NH2 1 
ATOM   7610  N  N   . GLY C 1 306 ? 25.188  -22.766 -32.304 1.00 78.41  ? 328 GLY C N   1 
ATOM   7611  C  CA  . GLY C 1 306 ? 26.434  -22.089 -32.650 1.00 78.55  ? 328 GLY C CA  1 
ATOM   7612  C  C   . GLY C 1 306 ? 26.294  -20.820 -33.472 1.00 82.97  ? 328 GLY C C   1 
ATOM   7613  O  O   . GLY C 1 306 ? 25.198  -20.485 -33.934 1.00 82.23  ? 328 GLY C O   1 
ATOM   7614  N  N   . CYS C 1 307 ? 27.416  -20.084 -33.644 1.00 79.87  ? 329 CYS C N   1 
ATOM   7615  C  CA  . CYS C 1 307 ? 27.435  -18.840 -34.408 1.00 79.14  ? 329 CYS C CA  1 
ATOM   7616  C  C   . CYS C 1 307 ? 27.671  -19.097 -35.875 1.00 81.19  ? 329 CYS C C   1 
ATOM   7617  O  O   . CYS C 1 307 ? 26.963  -18.534 -36.691 1.00 80.93  ? 329 CYS C O   1 
ATOM   7618  C  CB  . CYS C 1 307 ? 28.456  -17.843 -33.860 1.00 79.79  ? 329 CYS C CB  1 
ATOM   7619  S  SG  . CYS C 1 307 ? 28.029  -17.089 -32.264 1.00 81.98  ? 329 CYS C SG  1 
ATOM   7620  N  N   . VAL C 1 308 ? 28.687  -19.905 -36.216 1.00 77.74  ? 330 VAL C N   1 
ATOM   7621  C  CA  . VAL C 1 308 ? 29.120  -20.176 -37.593 1.00 78.91  ? 330 VAL C CA  1 
ATOM   7622  C  C   . VAL C 1 308 ? 27.965  -20.554 -38.528 1.00 80.87  ? 330 VAL C C   1 
ATOM   7623  O  O   . VAL C 1 308 ? 27.254  -21.522 -38.277 1.00 79.84  ? 330 VAL C O   1 
ATOM   7624  C  CB  . VAL C 1 308 ? 30.275  -21.198 -37.658 1.00 84.29  ? 330 VAL C CB  1 
ATOM   7625  C  CG1 . VAL C 1 308 ? 30.632  -21.551 -39.101 1.00 86.44  ? 330 VAL C CG1 1 
ATOM   7626  C  CG2 . VAL C 1 308 ? 31.492  -20.665 -36.924 1.00 83.55  ? 330 VAL C CG2 1 
ATOM   7627  N  N   . GLY C 1 309 ? 27.789  -19.747 -39.567 1.00 76.83  ? 331 GLY C N   1 
ATOM   7628  C  CA  . GLY C 1 309 ? 26.764  -19.952 -40.578 1.00 78.32  ? 331 GLY C CA  1 
ATOM   7629  C  C   . GLY C 1 309 ? 25.354  -19.579 -40.169 1.00 82.50  ? 331 GLY C C   1 
ATOM   7630  O  O   . GLY C 1 309 ? 24.404  -19.875 -40.906 1.00 84.15  ? 331 GLY C O   1 
ATOM   7631  N  N   . ASN C 1 310 ? 25.200  -18.913 -39.009 1.00 76.39  ? 332 ASN C N   1 
ATOM   7632  C  CA  . ASN C 1 310 ? 23.895  -18.481 -38.521 1.00 74.28  ? 332 ASN C CA  1 
ATOM   7633  C  C   . ASN C 1 310 ? 23.839  -16.976 -38.413 1.00 78.66  ? 332 ASN C C   1 
ATOM   7634  O  O   . ASN C 1 310 ? 24.538  -16.385 -37.588 1.00 75.88  ? 332 ASN C O   1 
ATOM   7635  C  CB  . ASN C 1 310 ? 23.561  -19.132 -37.192 1.00 69.62  ? 332 ASN C CB  1 
ATOM   7636  C  CG  . ASN C 1 310 ? 23.493  -20.633 -37.256 1.00 86.42  ? 332 ASN C CG  1 
ATOM   7637  O  OD1 . ASN C 1 310 ? 22.996  -21.228 -38.224 1.00 79.62  ? 332 ASN C OD1 1 
ATOM   7638  N  ND2 . ASN C 1 310 ? 23.974  -21.285 -36.215 1.00 79.46  ? 332 ASN C ND2 1 
ATOM   7639  N  N   . THR C 1 311 ? 23.014  -16.348 -39.268 1.00 78.11  ? 333 THR C N   1 
ATOM   7640  C  CA  . THR C 1 311 ? 22.846  -14.886 -39.277 1.00 77.29  ? 333 THR C CA  1 
ATOM   7641  C  C   . THR C 1 311 ? 21.390  -14.489 -39.005 1.00 80.71  ? 333 THR C C   1 
ATOM   7642  O  O   . THR C 1 311 ? 21.047  -13.300 -39.057 1.00 80.33  ? 333 THR C O   1 
ATOM   7643  C  CB  . THR C 1 311 ? 23.428  -14.263 -40.552 1.00 86.59  ? 333 THR C CB  1 
ATOM   7644  O  OG1 . THR C 1 311 ? 22.918  -14.943 -41.697 1.00 88.50  ? 333 THR C OG1 1 
ATOM   7645  C  CG2 . THR C 1 311 ? 24.942  -14.280 -40.572 1.00 86.53  ? 333 THR C CG2 1 
ATOM   7646  N  N   . ASN C 1 312 ? 20.543  -15.486 -38.686 1.00 75.89  ? 334 ASN C N   1 
ATOM   7647  C  CA  . ASN C 1 312 ? 19.145  -15.220 -38.384 1.00 74.08  ? 334 ASN C CA  1 
ATOM   7648  C  C   . ASN C 1 312 ? 18.929  -15.220 -36.923 1.00 74.92  ? 334 ASN C C   1 
ATOM   7649  O  O   . ASN C 1 312 ? 19.503  -16.049 -36.213 1.00 75.43  ? 334 ASN C O   1 
ATOM   7650  C  CB  . ASN C 1 312 ? 18.210  -16.204 -39.056 1.00 74.50  ? 334 ASN C CB  1 
ATOM   7651  C  CG  . ASN C 1 312 ? 17.904  -15.831 -40.469 1.00 103.18 ? 334 ASN C CG  1 
ATOM   7652  O  OD1 . ASN C 1 312 ? 17.770  -14.655 -40.816 1.00 99.52  ? 334 ASN C OD1 1 
ATOM   7653  N  ND2 . ASN C 1 312 ? 17.790  -16.829 -41.324 1.00 100.29 ? 334 ASN C ND2 1 
ATOM   7654  N  N   . ILE C 1 313 ? 18.086  -14.295 -36.463 1.00 68.58  ? 335 ILE C N   1 
ATOM   7655  C  CA  . ILE C 1 313 ? 17.751  -14.160 -35.047 1.00 65.62  ? 335 ILE C CA  1 
ATOM   7656  C  C   . ILE C 1 313 ? 16.959  -15.370 -34.586 1.00 67.93  ? 335 ILE C C   1 
ATOM   7657  O  O   . ILE C 1 313 ? 16.379  -16.077 -35.405 1.00 68.81  ? 335 ILE C O   1 
ATOM   7658  C  CB  . ILE C 1 313 ? 16.995  -12.830 -34.733 1.00 67.34  ? 335 ILE C CB  1 
ATOM   7659  C  CG1 . ILE C 1 313 ? 15.577  -12.791 -35.355 1.00 67.41  ? 335 ILE C CG1 1 
ATOM   7660  C  CG2 . ILE C 1 313 ? 17.810  -11.604 -35.111 1.00 68.67  ? 335 ILE C CG2 1 
ATOM   7661  C  CD1 . ILE C 1 313 ? 14.486  -12.612 -34.326 1.00 65.39  ? 335 ILE C CD1 1 
ATOM   7662  N  N   . TRP C 1 314 ? 16.940  -15.602 -33.281 1.00 62.78  ? 336 TRP C N   1 
ATOM   7663  C  CA  . TRP C 1 314 ? 16.134  -16.643 -32.672 1.00 63.24  ? 336 TRP C CA  1 
ATOM   7664  C  C   . TRP C 1 314 ? 14.677  -16.100 -32.669 1.00 69.32  ? 336 TRP C C   1 
ATOM   7665  O  O   . TRP C 1 314 ? 14.373  -15.104 -31.986 1.00 68.99  ? 336 TRP C O   1 
ATOM   7666  C  CB  . TRP C 1 314 ? 16.660  -16.941 -31.255 1.00 60.73  ? 336 TRP C CB  1 
ATOM   7667  C  CG  . TRP C 1 314 ? 15.828  -17.870 -30.430 1.00 62.44  ? 336 TRP C CG  1 
ATOM   7668  C  CD1 . TRP C 1 314 ? 15.121  -18.948 -30.872 1.00 66.97  ? 336 TRP C CD1 1 
ATOM   7669  C  CD2 . TRP C 1 314 ? 15.731  -17.884 -29.001 1.00 61.62  ? 336 TRP C CD2 1 
ATOM   7670  N  NE1 . TRP C 1 314 ? 14.560  -19.613 -29.809 1.00 66.80  ? 336 TRP C NE1 1 
ATOM   7671  C  CE2 . TRP C 1 314 ? 14.918  -18.982 -28.648 1.00 66.94  ? 336 TRP C CE2 1 
ATOM   7672  C  CE3 . TRP C 1 314 ? 16.252  -17.076 -27.981 1.00 61.76  ? 336 TRP C CE3 1 
ATOM   7673  C  CZ2 . TRP C 1 314 ? 14.568  -19.257 -27.324 1.00 66.35  ? 336 TRP C CZ2 1 
ATOM   7674  C  CZ3 . TRP C 1 314 ? 15.887  -17.334 -26.670 1.00 63.37  ? 336 TRP C CZ3 1 
ATOM   7675  C  CH2 . TRP C 1 314 ? 15.065  -18.418 -26.351 1.00 65.35  ? 336 TRP C CH2 1 
ATOM   7676  N  N   . LYS C 1 315 ? 13.804  -16.707 -33.486 1.00 67.22  ? 337 LYS C N   1 
ATOM   7677  C  CA  . LYS C 1 315 ? 12.407  -16.280 -33.593 1.00 68.23  ? 337 LYS C CA  1 
ATOM   7678  C  C   . LYS C 1 315 ? 11.670  -16.217 -32.219 1.00 74.24  ? 337 LYS C C   1 
ATOM   7679  O  O   . LYS C 1 315 ? 10.841  -15.314 -32.018 1.00 74.74  ? 337 LYS C O   1 
ATOM   7680  C  CB  . LYS C 1 315 ? 11.655  -17.149 -34.609 1.00 71.86  ? 337 LYS C CB  1 
ATOM   7681  N  N   . THR C 1 316 ? 12.017  -17.129 -31.262 1.00 69.66  ? 338 THR C N   1 
ATOM   7682  C  CA  . THR C 1 316 ? 11.376  -17.162 -29.945 1.00 69.06  ? 338 THR C CA  1 
ATOM   7683  C  C   . THR C 1 316 ? 11.988  -16.139 -28.984 1.00 72.49  ? 338 THR C C   1 
ATOM   7684  O  O   . THR C 1 316 ? 11.361  -15.818 -27.970 1.00 71.49  ? 338 THR C O   1 
ATOM   7685  C  CB  . THR C 1 316 ? 11.348  -18.594 -29.392 1.00 80.03  ? 338 THR C CB  1 
ATOM   7686  O  OG1 . THR C 1 316 ? 10.706  -19.436 -30.355 1.00 87.82  ? 338 THR C OG1 1 
ATOM   7687  C  CG2 . THR C 1 316 ? 10.596  -18.703 -28.071 1.00 75.41  ? 338 THR C CG2 1 
ATOM   7688  N  N   . GLY C 1 317 ? 13.183  -15.633 -29.320 1.00 69.05  ? 339 GLY C N   1 
ATOM   7689  C  CA  . GLY C 1 317 ? 13.915  -14.624 -28.559 1.00 67.04  ? 339 GLY C CA  1 
ATOM   7690  C  C   . GLY C 1 317 ? 13.031  -13.508 -28.038 1.00 71.70  ? 339 GLY C C   1 
ATOM   7691  O  O   . GLY C 1 317 ? 12.832  -13.430 -26.827 1.00 72.77  ? 339 GLY C O   1 
ATOM   7692  N  N   . PRO C 1 318 ? 12.380  -12.702 -28.919 1.00 67.65  ? 340 PRO C N   1 
ATOM   7693  C  CA  . PRO C 1 318 ? 11.493  -11.619 -28.437 1.00 66.72  ? 340 PRO C CA  1 
ATOM   7694  C  C   . PRO C 1 318 ? 10.340  -12.012 -27.479 1.00 68.45  ? 340 PRO C C   1 
ATOM   7695  O  O   . PRO C 1 318 ? 9.987   -11.217 -26.597 1.00 66.81  ? 340 PRO C O   1 
ATOM   7696  C  CB  . PRO C 1 318 ? 10.953  -11.028 -29.740 1.00 69.28  ? 340 PRO C CB  1 
ATOM   7697  C  CG  . PRO C 1 318 ? 12.046  -11.265 -30.703 1.00 74.00  ? 340 PRO C CG  1 
ATOM   7698  C  CD  . PRO C 1 318 ? 12.494  -12.651 -30.390 1.00 70.07  ? 340 PRO C CD  1 
ATOM   7699  N  N   . LEU C 1 319 ? 9.736   -13.211 -27.652 1.00 63.63  ? 341 LEU C N   1 
ATOM   7700  C  CA  . LEU C 1 319 ? 8.653   -13.642 -26.756 1.00 62.58  ? 341 LEU C CA  1 
ATOM   7701  C  C   . LEU C 1 319 ? 9.243   -13.977 -25.401 1.00 68.93  ? 341 LEU C C   1 
ATOM   7702  O  O   . LEU C 1 319 ? 8.721   -13.521 -24.375 1.00 69.18  ? 341 LEU C O   1 
ATOM   7703  C  CB  . LEU C 1 319 ? 7.868   -14.836 -27.338 1.00 62.69  ? 341 LEU C CB  1 
ATOM   7704  C  CG  . LEU C 1 319 ? 7.029   -15.648 -26.362 1.00 66.05  ? 341 LEU C CG  1 
ATOM   7705  C  CD1 . LEU C 1 319 ? 5.881   -14.849 -25.819 1.00 66.68  ? 341 LEU C CD1 1 
ATOM   7706  C  CD2 . LEU C 1 319 ? 6.555   -16.937 -26.978 1.00 67.50  ? 341 LEU C CD2 1 
ATOM   7707  N  N   . PHE C 1 320 ? 10.366  -14.744 -25.410 1.00 65.42  ? 342 PHE C N   1 
ATOM   7708  C  CA  . PHE C 1 320 ? 11.089  -15.117 -24.215 1.00 64.49  ? 342 PHE C CA  1 
ATOM   7709  C  C   . PHE C 1 320 ? 11.536  -13.870 -23.438 1.00 66.25  ? 342 PHE C C   1 
ATOM   7710  O  O   . PHE C 1 320 ? 11.452  -13.872 -22.201 1.00 65.25  ? 342 PHE C O   1 
ATOM   7711  C  CB  . PHE C 1 320 ? 12.236  -16.082 -24.535 1.00 66.65  ? 342 PHE C CB  1 
ATOM   7712  C  CG  . PHE C 1 320 ? 12.910  -16.592 -23.287 1.00 68.56  ? 342 PHE C CG  1 
ATOM   7713  C  CD1 . PHE C 1 320 ? 12.165  -16.914 -22.158 1.00 72.47  ? 342 PHE C CD1 1 
ATOM   7714  C  CD2 . PHE C 1 320 ? 14.290  -16.717 -23.226 1.00 71.19  ? 342 PHE C CD2 1 
ATOM   7715  C  CE1 . PHE C 1 320 ? 12.787  -17.318 -20.987 1.00 73.86  ? 342 PHE C CE1 1 
ATOM   7716  C  CE2 . PHE C 1 320 ? 14.912  -17.147 -22.053 1.00 74.69  ? 342 PHE C CE2 1 
ATOM   7717  C  CZ  . PHE C 1 320 ? 14.154  -17.433 -20.942 1.00 73.29  ? 342 PHE C CZ  1 
ATOM   7718  N  N   . LYS C 1 321 ? 11.922  -12.780 -24.165 1.00 62.30  ? 343 LYS C N   1 
ATOM   7719  C  CA  . LYS C 1 321 ? 12.252  -11.495 -23.538 1.00 61.04  ? 343 LYS C CA  1 
ATOM   7720  C  C   . LYS C 1 321 ? 10.997  -10.971 -22.807 1.00 66.73  ? 343 LYS C C   1 
ATOM   7721  O  O   . LYS C 1 321 ? 11.092  -10.743 -21.606 1.00 66.21  ? 343 LYS C O   1 
ATOM   7722  C  CB  . LYS C 1 321 ? 12.811  -10.447 -24.526 1.00 60.89  ? 343 LYS C CB  1 
ATOM   7723  C  CG  . LYS C 1 321 ? 13.136  -9.127  -23.806 1.00 55.35  ? 343 LYS C CG  1 
ATOM   7724  C  CD  . LYS C 1 321 ? 13.792  -8.068  -24.666 1.00 60.94  ? 343 LYS C CD  1 
ATOM   7725  C  CE  . LYS C 1 321 ? 13.635  -6.707  -24.036 1.00 68.31  ? 343 LYS C CE  1 
ATOM   7726  N  NZ  . LYS C 1 321 ? 14.530  -5.721  -24.656 1.00 68.84  ? 343 LYS C NZ  1 
ATOM   7727  N  N   . ARG C 1 322 ? 9.822   -10.870 -23.497 1.00 64.55  ? 344 ARG C N   1 
ATOM   7728  C  CA  . ARG C 1 322 ? 8.571   -10.429 -22.869 1.00 66.04  ? 344 ARG C CA  1 
ATOM   7729  C  C   . ARG C 1 322 ? 8.264   -11.211 -21.576 1.00 71.63  ? 344 ARG C C   1 
ATOM   7730  O  O   . ARG C 1 322 ? 8.007   -10.588 -20.540 1.00 72.72  ? 344 ARG C O   1 
ATOM   7731  C  CB  . ARG C 1 322 ? 7.382   -10.493 -23.841 1.00 69.17  ? 344 ARG C CB  1 
ATOM   7732  C  CG  . ARG C 1 322 ? 6.097   -9.940  -23.212 1.00 75.77  ? 344 ARG C CG  1 
ATOM   7733  C  CD  . ARG C 1 322 ? 4.896   -9.939  -24.135 1.00 89.00  ? 344 ARG C CD  1 
ATOM   7734  N  NE  . ARG C 1 322 ? 5.034   -9.033  -25.281 1.00 103.08 ? 344 ARG C NE  1 
ATOM   7735  C  CZ  . ARG C 1 322 ? 4.748   -7.732  -25.267 1.00 121.93 ? 344 ARG C CZ  1 
ATOM   7736  N  NH1 . ARG C 1 322 ? 4.352   -7.141  -24.144 1.00 108.48 ? 344 ARG C NH1 1 
ATOM   7737  N  NH2 . ARG C 1 322 ? 4.868   -7.009  -26.374 1.00 112.16 ? 344 ARG C NH2 1 
ATOM   7738  N  N   . VAL C 1 323 ? 8.331   -12.564 -21.641 1.00 67.69  ? 345 VAL C N   1 
ATOM   7739  C  CA  . VAL C 1 323 ? 8.114   -13.483 -20.517 1.00 68.07  ? 345 VAL C CA  1 
ATOM   7740  C  C   . VAL C 1 323 ? 9.036   -13.110 -19.333 1.00 72.31  ? 345 VAL C C   1 
ATOM   7741  O  O   . VAL C 1 323 ? 8.544   -12.935 -18.216 1.00 72.43  ? 345 VAL C O   1 
ATOM   7742  C  CB  . VAL C 1 323 ? 8.286   -14.969 -20.942 1.00 72.05  ? 345 VAL C CB  1 
ATOM   7743  C  CG1 . VAL C 1 323 ? 8.196   -15.894 -19.739 1.00 72.96  ? 345 VAL C CG1 1 
ATOM   7744  C  CG2 . VAL C 1 323 ? 7.263   -15.379 -21.999 1.00 72.62  ? 345 VAL C CG2 1 
ATOM   7745  N  N   . LEU C 1 324 ? 10.358  -12.949 -19.596 1.00 68.49  ? 346 LEU C N   1 
ATOM   7746  C  CA  . LEU C 1 324 ? 11.363  -12.579 -18.591 1.00 67.20  ? 346 LEU C CA  1 
ATOM   7747  C  C   . LEU C 1 324 ? 11.091  -11.227 -17.950 1.00 71.41  ? 346 LEU C C   1 
ATOM   7748  O  O   . LEU C 1 324 ? 11.046  -11.127 -16.737 1.00 72.75  ? 346 LEU C O   1 
ATOM   7749  C  CB  . LEU C 1 324 ? 12.762  -12.584 -19.206 1.00 66.23  ? 346 LEU C CB  1 
ATOM   7750  C  CG  . LEU C 1 324 ? 13.480  -13.921 -19.267 1.00 72.49  ? 346 LEU C CG  1 
ATOM   7751  C  CD1 . LEU C 1 324 ? 14.688  -13.816 -20.137 1.00 73.00  ? 346 LEU C CD1 1 
ATOM   7752  C  CD2 . LEU C 1 324 ? 13.940  -14.363 -17.908 1.00 74.67  ? 346 LEU C CD2 1 
ATOM   7753  N  N   . MET C 1 325 ? 10.892  -10.200 -18.770 1.00 67.81  ? 347 MET C N   1 
ATOM   7754  C  CA  . MET C 1 325 ? 10.619  -8.816  -18.407 1.00 68.08  ? 347 MET C CA  1 
ATOM   7755  C  C   . MET C 1 325 ? 9.468   -8.712  -17.416 1.00 75.66  ? 347 MET C C   1 
ATOM   7756  O  O   . MET C 1 325 ? 9.482   -7.856  -16.526 1.00 76.01  ? 347 MET C O   1 
ATOM   7757  C  CB  . MET C 1 325 ? 10.227  -8.042  -19.679 1.00 70.42  ? 347 MET C CB  1 
ATOM   7758  C  CG  . MET C 1 325 ? 11.378  -7.681  -20.559 1.00 73.59  ? 347 MET C CG  1 
ATOM   7759  S  SD  . MET C 1 325 ? 12.122  -6.214  -19.873 1.00 78.51  ? 347 MET C SD  1 
ATOM   7760  C  CE  . MET C 1 325 ? 11.460  -4.995  -20.952 1.00 76.47  ? 347 MET C CE  1 
ATOM   7761  N  N   . SER C 1 326 ? 8.460   -9.574  -17.598 1.00 74.26  ? 348 SER C N   1 
ATOM   7762  C  CA  . SER C 1 326 ? 7.239   -9.603  -16.812 1.00 76.45  ? 348 SER C CA  1 
ATOM   7763  C  C   . SER C 1 326 ? 7.262   -10.705 -15.732 1.00 81.27  ? 348 SER C C   1 
ATOM   7764  O  O   . SER C 1 326 ? 6.206   -11.080 -15.196 1.00 83.05  ? 348 SER C O   1 
ATOM   7765  C  CB  . SER C 1 326 ? 6.039   -9.742  -17.746 1.00 83.36  ? 348 SER C CB  1 
ATOM   7766  O  OG  . SER C 1 326 ? 6.098   -10.972 -18.453 1.00 100.68 ? 348 SER C OG  1 
ATOM   7767  N  N   . SER C 1 327 ? 8.474   -11.200 -15.392 1.00 75.68  ? 349 SER C N   1 
ATOM   7768  C  CA  . SER C 1 327 ? 8.639   -12.216 -14.354 1.00 74.90  ? 349 SER C CA  1 
ATOM   7769  C  C   . SER C 1 327 ? 8.836   -11.592 -12.988 1.00 77.02  ? 349 SER C C   1 
ATOM   7770  O  O   . SER C 1 327 ? 9.529   -10.579 -12.853 1.00 74.09  ? 349 SER C O   1 
ATOM   7771  C  CB  . SER C 1 327 ? 9.791   -13.150 -14.680 1.00 77.55  ? 349 SER C CB  1 
ATOM   7772  O  OG  . SER C 1 327 ? 9.309   -14.269 -15.401 1.00 87.69  ? 349 SER C OG  1 
ATOM   7773  N  N   . LYS C 1 328 ? 8.172   -12.186 -11.987 1.00 76.29  ? 350 LYS C N   1 
ATOM   7774  C  CA  . LYS C 1 328 ? 8.225   -11.811 -10.572 1.00 77.68  ? 350 LYS C CA  1 
ATOM   7775  C  C   . LYS C 1 328 ? 8.603   -13.055 -9.756  1.00 84.88  ? 350 LYS C C   1 
ATOM   7776  O  O   . LYS C 1 328 ? 7.989   -14.118 -9.919  1.00 85.27  ? 350 LYS C O   1 
ATOM   7777  C  CB  . LYS C 1 328 ? 6.865   -11.303 -10.064 1.00 81.80  ? 350 LYS C CB  1 
ATOM   7778  C  CG  . LYS C 1 328 ? 6.211   -10.197 -10.870 1.00 94.36  ? 350 LYS C CG  1 
ATOM   7779  C  CD  . LYS C 1 328 ? 4.909   -9.772  -10.216 1.00 106.51 ? 350 LYS C CD  1 
ATOM   7780  C  CE  . LYS C 1 328 ? 4.120   -8.841  -11.090 1.00 123.16 ? 350 LYS C CE  1 
ATOM   7781  N  NZ  . LYS C 1 328 ? 2.977   -8.248  -10.344 1.00 143.52 ? 350 LYS C NZ  1 
ATOM   7782  N  N   . TYR C 1 329 ? 9.609   -12.918 -8.884  1.00 82.83  ? 351 TYR C N   1 
ATOM   7783  C  CA  . TYR C 1 329 ? 10.081  -13.967 -7.979  1.00 84.06  ? 351 TYR C CA  1 
ATOM   7784  C  C   . TYR C 1 329 ? 10.284  -13.252 -6.648  1.00 89.95  ? 351 TYR C C   1 
ATOM   7785  O  O   . TYR C 1 329 ? 11.227  -12.460 -6.530  1.00 88.99  ? 351 TYR C O   1 
ATOM   7786  C  CB  . TYR C 1 329 ? 11.389  -14.577 -8.483  1.00 83.94  ? 351 TYR C CB  1 
ATOM   7787  C  CG  . TYR C 1 329 ? 11.798  -15.798 -7.712  1.00 88.08  ? 351 TYR C CG  1 
ATOM   7788  C  CD1 . TYR C 1 329 ? 11.198  -17.031 -7.953  1.00 92.07  ? 351 TYR C CD1 1 
ATOM   7789  C  CD2 . TYR C 1 329 ? 12.785  -15.729 -6.731  1.00 89.40  ? 351 TYR C CD2 1 
ATOM   7790  C  CE1 . TYR C 1 329 ? 11.556  -18.165 -7.227  1.00 94.45  ? 351 TYR C CE1 1 
ATOM   7791  C  CE2 . TYR C 1 329 ? 13.162  -16.861 -6.004  1.00 91.80  ? 351 TYR C CE2 1 
ATOM   7792  C  CZ  . TYR C 1 329 ? 12.549  -18.078 -6.262  1.00 98.95  ? 351 TYR C CZ  1 
ATOM   7793  O  OH  . TYR C 1 329 ? 12.921  -19.194 -5.558  1.00 98.61  ? 351 TYR C OH  1 
ATOM   7794  N  N   . PRO C 1 330 ? 9.373   -13.427 -5.665  1.00 88.38  ? 352 PRO C N   1 
ATOM   7795  C  CA  . PRO C 1 330 ? 9.471   -12.630 -4.432  1.00 89.60  ? 352 PRO C CA  1 
ATOM   7796  C  C   . PRO C 1 330 ? 10.379  -13.174 -3.330  1.00 97.66  ? 352 PRO C C   1 
ATOM   7797  O  O   . PRO C 1 330 ? 10.845  -12.405 -2.479  1.00 98.02  ? 352 PRO C O   1 
ATOM   7798  C  CB  . PRO C 1 330 ? 8.018   -12.535 -3.961  1.00 92.96  ? 352 PRO C CB  1 
ATOM   7799  C  CG  . PRO C 1 330 ? 7.223   -13.462 -4.854  1.00 96.97  ? 352 PRO C CG  1 
ATOM   7800  C  CD  . PRO C 1 330 ? 8.167   -14.271 -5.652  1.00 90.92  ? 352 PRO C CD  1 
ATOM   7801  N  N   . ASP C 1 331 ? 10.620  -14.494 -3.337  1.00 95.98  ? 353 ASP C N   1 
ATOM   7802  C  CA  . ASP C 1 331 ? 11.426  -15.206 -2.342  1.00 96.95  ? 353 ASP C CA  1 
ATOM   7803  C  C   . ASP C 1 331 ? 12.916  -15.322 -2.752  1.00 96.36  ? 353 ASP C C   1 
ATOM   7804  O  O   . ASP C 1 331 ? 13.580  -16.322 -2.471  1.00 96.03  ? 353 ASP C O   1 
ATOM   7805  C  CB  . ASP C 1 331 ? 10.793  -16.590 -1.991  1.00 101.83 ? 353 ASP C CB  1 
ATOM   7806  C  CG  . ASP C 1 331 ? 9.532   -17.005 -2.763  1.00 116.39 ? 353 ASP C CG  1 
ATOM   7807  O  OD1 . ASP C 1 331 ? 9.560   -16.974 -4.028  1.00 114.35 ? 353 ASP C OD1 1 
ATOM   7808  O  OD2 . ASP C 1 331 ? 8.543   -17.431 -2.106  1.00 126.12 ? 353 ASP C OD2 1 
ATOM   7809  N  N   . GLY C 1 332 ? 13.426  -14.286 -3.401  1.00 90.03  ? 354 GLY C N   1 
ATOM   7810  C  CA  . GLY C 1 332 ? 14.818  -14.265 -3.815  1.00 87.97  ? 354 GLY C CA  1 
ATOM   7811  C  C   . GLY C 1 332 ? 15.732  -13.959 -2.648  1.00 90.50  ? 354 GLY C C   1 
ATOM   7812  O  O   . GLY C 1 332 ? 15.320  -13.292 -1.696  1.00 91.26  ? 354 GLY C O   1 
ATOM   7813  N  N   . VAL C 1 333 ? 16.974  -14.450 -2.717  1.00 84.69  ? 355 VAL C N   1 
ATOM   7814  C  CA  . VAL C 1 333 ? 18.035  -14.245 -1.726  1.00 84.27  ? 355 VAL C CA  1 
ATOM   7815  C  C   . VAL C 1 333 ? 18.273  -12.729 -1.512  1.00 87.18  ? 355 VAL C C   1 
ATOM   7816  O  O   . VAL C 1 333 ? 18.460  -12.282 -0.373  1.00 88.37  ? 355 VAL C O   1 
ATOM   7817  C  CB  . VAL C 1 333 ? 19.345  -14.966 -2.169  1.00 86.91  ? 355 VAL C CB  1 
ATOM   7818  C  CG1 . VAL C 1 333 ? 20.501  -14.645 -1.233  1.00 86.99  ? 355 VAL C CG1 1 
ATOM   7819  C  CG2 . VAL C 1 333 ? 19.147  -16.471 -2.265  1.00 88.05  ? 355 VAL C CG2 1 
ATOM   7820  N  N   . THR C 1 334 ? 18.260  -11.955 -2.624  1.00 80.41  ? 356 THR C N   1 
ATOM   7821  C  CA  . THR C 1 334 ? 18.495  -10.512 -2.650  1.00 78.34  ? 356 THR C CA  1 
ATOM   7822  C  C   . THR C 1 334 ? 17.167  -9.715  -2.573  1.00 83.39  ? 356 THR C C   1 
ATOM   7823  O  O   . THR C 1 334 ? 17.169  -8.487  -2.748  1.00 82.81  ? 356 THR C O   1 
ATOM   7824  C  CB  . THR C 1 334 ? 19.390  -10.131 -3.857  1.00 79.22  ? 356 THR C CB  1 
ATOM   7825  O  OG1 . THR C 1 334 ? 18.722  -10.424 -5.067  1.00 79.47  ? 356 THR C OG1 1 
ATOM   7826  C  CG2 . THR C 1 334 ? 20.711  -10.862 -3.874  1.00 76.44  ? 356 THR C CG2 1 
ATOM   7827  N  N   . GLY C 1 335 ? 16.063  -10.413 -2.291  1.00 80.96  ? 357 GLY C N   1 
ATOM   7828  C  CA  . GLY C 1 335 ? 14.752  -9.793  -2.147  1.00 81.48  ? 357 GLY C CA  1 
ATOM   7829  C  C   . GLY C 1 335 ? 13.734  -10.123 -3.222  1.00 85.96  ? 357 GLY C C   1 
ATOM   7830  O  O   . GLY C 1 335 ? 13.745  -11.211 -3.809  1.00 85.79  ? 357 GLY C O   1 
ATOM   7831  N  N   . ARG C 1 336 ? 12.814  -9.166  -3.448  1.00 82.27  ? 358 ARG C N   1 
ATOM   7832  C  CA  . ARG C 1 336 ? 11.715  -9.230  -4.405  1.00 81.47  ? 358 ARG C CA  1 
ATOM   7833  C  C   . ARG C 1 336 ? 12.269  -8.908  -5.788  1.00 83.34  ? 358 ARG C C   1 
ATOM   7834  O  O   . ARG C 1 336 ? 12.630  -7.756  -6.056  1.00 83.49  ? 358 ARG C O   1 
ATOM   7835  C  CB  . ARG C 1 336 ? 10.647  -8.209  -3.971  1.00 83.17  ? 358 ARG C CB  1 
ATOM   7836  C  CG  . ARG C 1 336 ? 9.396   -8.090  -4.840  1.00 95.05  ? 358 ARG C CG  1 
ATOM   7837  C  CD  . ARG C 1 336 ? 8.358   -7.308  -4.068  1.00 106.74 ? 358 ARG C CD  1 
ATOM   7838  N  NE  . ARG C 1 336 ? 7.154   -7.033  -4.842  1.00 120.08 ? 358 ARG C NE  1 
ATOM   7839  C  CZ  . ARG C 1 336 ? 6.406   -5.946  -4.685  1.00 141.00 ? 358 ARG C CZ  1 
ATOM   7840  N  NH1 . ARG C 1 336 ? 6.757   -5.010  -3.809  1.00 130.86 ? 358 ARG C NH1 1 
ATOM   7841  N  NH2 . ARG C 1 336 ? 5.319   -5.769  -5.426  1.00 128.62 ? 358 ARG C NH2 1 
ATOM   7842  N  N   . ILE C 1 337 ? 12.357  -9.920  -6.662  1.00 77.80  ? 359 ILE C N   1 
ATOM   7843  C  CA  . ILE C 1 337 ? 12.855  -9.703  -8.015  1.00 75.42  ? 359 ILE C CA  1 
ATOM   7844  C  C   . ILE C 1 337 ? 11.726  -9.368  -8.981  1.00 77.86  ? 359 ILE C C   1 
ATOM   7845  O  O   . ILE C 1 337 ? 10.824  -10.179 -9.204  1.00 77.07  ? 359 ILE C O   1 
ATOM   7846  C  CB  . ILE C 1 337 ? 13.745  -10.854 -8.530  1.00 78.09  ? 359 ILE C CB  1 
ATOM   7847  C  CG1 . ILE C 1 337 ? 15.008  -10.959 -7.692  1.00 78.64  ? 359 ILE C CG1 1 
ATOM   7848  C  CG2 . ILE C 1 337 ? 14.107  -10.651 -10.002 1.00 77.31  ? 359 ILE C CG2 1 
ATOM   7849  C  CD1 . ILE C 1 337 ? 14.981  -12.036 -6.748  1.00 92.51  ? 359 ILE C CD1 1 
ATOM   7850  N  N   . GLU C 1 338 ? 11.795  -8.164  -9.546  1.00 73.85  ? 360 GLU C N   1 
ATOM   7851  C  CA  . GLU C 1 338 ? 10.882  -7.643  -10.556 1.00 73.55  ? 360 GLU C CA  1 
ATOM   7852  C  C   . GLU C 1 338 ? 11.711  -6.754  -11.459 1.00 77.10  ? 360 GLU C C   1 
ATOM   7853  O  O   . GLU C 1 338 ? 12.756  -6.252  -11.025 1.00 78.27  ? 360 GLU C O   1 
ATOM   7854  C  CB  . GLU C 1 338 ? 9.749   -6.844  -9.917  1.00 76.26  ? 360 GLU C CB  1 
ATOM   7855  C  CG  . GLU C 1 338 ? 8.570   -7.706  -9.507  1.00 90.06  ? 360 GLU C CG  1 
ATOM   7856  C  CD  . GLU C 1 338 ? 7.276   -6.963  -9.230  1.00 116.52 ? 360 GLU C CD  1 
ATOM   7857  O  OE1 . GLU C 1 338 ? 6.836   -6.170  -10.096 1.00 108.00 ? 360 GLU C OE1 1 
ATOM   7858  O  OE2 . GLU C 1 338 ? 6.678   -7.203  -8.157  1.00 115.71 ? 360 GLU C OE2 1 
ATOM   7859  N  N   . PHE C 1 339 ? 11.282  -6.571  -12.716 1.00 71.19  ? 361 PHE C N   1 
ATOM   7860  C  CA  . PHE C 1 339 ? 12.028  -5.732  -13.656 1.00 68.00  ? 361 PHE C CA  1 
ATOM   7861  C  C   . PHE C 1 339 ? 11.217  -4.572  -14.161 1.00 71.87  ? 361 PHE C C   1 
ATOM   7862  O  O   . PHE C 1 339 ? 10.041  -4.726  -14.486 1.00 74.41  ? 361 PHE C O   1 
ATOM   7863  C  CB  . PHE C 1 339 ? 12.570  -6.553  -14.828 1.00 68.32  ? 361 PHE C CB  1 
ATOM   7864  C  CG  . PHE C 1 339 ? 13.372  -7.746  -14.390 1.00 69.65  ? 361 PHE C CG  1 
ATOM   7865  C  CD1 . PHE C 1 339 ? 14.657  -7.589  -13.870 1.00 72.00  ? 361 PHE C CD1 1 
ATOM   7866  C  CD2 . PHE C 1 339 ? 12.835  -9.023  -14.458 1.00 72.84  ? 361 PHE C CD2 1 
ATOM   7867  C  CE1 . PHE C 1 339 ? 15.398  -8.694  -13.455 1.00 73.06  ? 361 PHE C CE1 1 
ATOM   7868  C  CE2 . PHE C 1 339 ? 13.570  -10.125 -14.030 1.00 75.99  ? 361 PHE C CE2 1 
ATOM   7869  C  CZ  . PHE C 1 339 ? 14.850  -9.955  -13.538 1.00 73.25  ? 361 PHE C CZ  1 
ATOM   7870  N  N   . ASN C 1 340 ? 11.829  -3.410  -14.246 1.00 65.92  ? 362 ASN C N   1 
ATOM   7871  C  CA  . ASN C 1 340 ? 11.101  -2.272  -14.757 1.00 65.72  ? 362 ASN C CA  1 
ATOM   7872  C  C   . ASN C 1 340 ? 11.065  -2.252  -16.311 1.00 70.52  ? 362 ASN C C   1 
ATOM   7873  O  O   . ASN C 1 340 ? 11.514  -3.195  -16.965 1.00 69.65  ? 362 ASN C O   1 
ATOM   7874  C  CB  . ASN C 1 340 ? 11.644  -0.985  -14.136 1.00 62.56  ? 362 ASN C CB  1 
ATOM   7875  C  CG  . ASN C 1 340 ? 12.947  -0.478  -14.674 1.00 69.79  ? 362 ASN C CG  1 
ATOM   7876  O  OD1 . ASN C 1 340 ? 13.581  -1.070  -15.557 1.00 51.31  ? 362 ASN C OD1 1 
ATOM   7877  N  ND2 . ASN C 1 340 ? 13.357  0.664   -14.151 1.00 69.53  ? 362 ASN C ND2 1 
ATOM   7878  N  N   . GLU C 1 341 ? 10.547  -1.154  -16.886 1.00 68.23  ? 363 GLU C N   1 
ATOM   7879  C  CA  . GLU C 1 341 ? 10.419  -0.879  -18.315 1.00 67.19  ? 363 GLU C CA  1 
ATOM   7880  C  C   . GLU C 1 341 ? 11.726  -1.100  -19.133 1.00 69.63  ? 363 GLU C C   1 
ATOM   7881  O  O   . GLU C 1 341 ? 11.638  -1.318  -20.343 1.00 69.48  ? 363 GLU C O   1 
ATOM   7882  C  CB  . GLU C 1 341 ? 9.865   0.545   -18.502 1.00 69.17  ? 363 GLU C CB  1 
ATOM   7883  N  N   . ASP C 1 342 ? 12.925  -1.075  -18.484 1.00 64.93  ? 364 ASP C N   1 
ATOM   7884  C  CA  . ASP C 1 342 ? 14.231  -1.291  -19.158 1.00 62.99  ? 364 ASP C CA  1 
ATOM   7885  C  C   . ASP C 1 342 ? 14.876  -2.642  -18.744 1.00 64.40  ? 364 ASP C C   1 
ATOM   7886  O  O   . ASP C 1 342 ? 16.023  -2.959  -19.104 1.00 60.55  ? 364 ASP C O   1 
ATOM   7887  C  CB  . ASP C 1 342 ? 15.203  -0.097  -18.986 1.00 63.91  ? 364 ASP C CB  1 
ATOM   7888  C  CG  . ASP C 1 342 ? 14.616  1.165   -18.372 1.00 79.74  ? 364 ASP C CG  1 
ATOM   7889  O  OD1 . ASP C 1 342 ? 13.807  1.843   -19.058 1.00 81.03  ? 364 ASP C OD1 1 
ATOM   7890  O  OD2 . ASP C 1 342 ? 14.984  1.491   -17.205 1.00 87.98  ? 364 ASP C OD2 1 
ATOM   7891  N  N   . GLY C 1 343 ? 14.088  -3.450  -18.043 1.00 62.39  ? 365 GLY C N   1 
ATOM   7892  C  CA  . GLY C 1 343 ? 14.532  -4.752  -17.575 1.00 62.55  ? 365 GLY C CA  1 
ATOM   7893  C  C   . GLY C 1 343 ? 15.524  -4.662  -16.433 1.00 67.97  ? 365 GLY C C   1 
ATOM   7894  O  O   . GLY C 1 343 ? 16.288  -5.613  -16.197 1.00 67.48  ? 365 GLY C O   1 
ATOM   7895  N  N   . ASP C 1 344 ? 15.513  -3.504  -15.713 1.00 64.52  ? 366 ASP C N   1 
ATOM   7896  C  CA  . ASP C 1 344 ? 16.369  -3.228  -14.556 1.00 63.62  ? 366 ASP C CA  1 
ATOM   7897  C  C   . ASP C 1 344 ? 15.652  -3.665  -13.291 1.00 67.54  ? 366 ASP C C   1 
ATOM   7898  O  O   . ASP C 1 344 ? 14.426  -3.551  -13.189 1.00 68.68  ? 366 ASP C O   1 
ATOM   7899  C  CB  . ASP C 1 344 ? 16.700  -1.730  -14.447 1.00 65.16  ? 366 ASP C CB  1 
ATOM   7900  C  CG  . ASP C 1 344 ? 17.562  -1.170  -15.553 1.00 74.74  ? 366 ASP C CG  1 
ATOM   7901  O  OD1 . ASP C 1 344 ? 18.655  -1.743  -15.807 1.00 74.38  ? 366 ASP C OD1 1 
ATOM   7902  O  OD2 . ASP C 1 344 ? 17.181  -0.120  -16.122 1.00 80.01  ? 366 ASP C OD2 1 
ATOM   7903  N  N   . ARG C 1 345 ? 16.414  -4.116  -12.315 1.00 62.73  ? 367 ARG C N   1 
ATOM   7904  C  CA  . ARG C 1 345 ? 15.861  -4.561  -11.052 1.00 64.06  ? 367 ARG C CA  1 
ATOM   7905  C  C   . ARG C 1 345 ? 15.086  -3.485  -10.289 1.00 72.97  ? 367 ARG C C   1 
ATOM   7906  O  O   . ARG C 1 345 ? 15.596  -2.375  -10.056 1.00 73.70  ? 367 ARG C O   1 
ATOM   7907  C  CB  . ARG C 1 345 ? 16.971  -5.124  -10.159 1.00 60.39  ? 367 ARG C CB  1 
ATOM   7908  C  CG  . ARG C 1 345 ? 16.540  -5.409  -8.743  1.00 50.63  ? 367 ARG C CG  1 
ATOM   7909  C  CD  . ARG C 1 345 ? 15.736  -6.670  -8.681  1.00 41.49  ? 367 ARG C CD  1 
ATOM   7910  N  NE  . ARG C 1 345 ? 16.384  -7.633  -7.799  1.00 61.96  ? 367 ARG C NE  1 
ATOM   7911  C  CZ  . ARG C 1 345 ? 16.152  -7.741  -6.495  1.00 82.72  ? 367 ARG C CZ  1 
ATOM   7912  N  NH1 . ARG C 1 345 ? 15.271  -6.949  -5.899  1.00 78.10  ? 367 ARG C NH1 1 
ATOM   7913  N  NH2 . ARG C 1 345 ? 16.785  -8.650  -5.782  1.00 72.00  ? 367 ARG C NH2 1 
ATOM   7914  N  N   . LYS C 1 346 ? 13.860  -3.857  -9.886  1.00 71.31  ? 368 LYS C N   1 
ATOM   7915  C  CA  . LYS C 1 346 ? 12.953  -3.092  -9.043  1.00 72.64  ? 368 LYS C CA  1 
ATOM   7916  C  C   . LYS C 1 346 ? 13.062  -3.673  -7.625  1.00 80.64  ? 368 LYS C C   1 
ATOM   7917  O  O   . LYS C 1 346 ? 13.344  -4.872  -7.468  1.00 81.08  ? 368 LYS C O   1 
ATOM   7918  C  CB  . LYS C 1 346 ? 11.514  -3.273  -9.523  1.00 75.32  ? 368 LYS C CB  1 
ATOM   7919  C  CG  . LYS C 1 346 ? 11.167  -2.461  -10.757 1.00 80.66  ? 368 LYS C CG  1 
ATOM   7920  C  CD  . LYS C 1 346 ? 9.788   -2.791  -11.257 1.00 84.92  ? 368 LYS C CD  1 
ATOM   7921  C  CE  . LYS C 1 346 ? 8.701   -2.327  -10.328 1.00 100.76 ? 368 LYS C CE  1 
ATOM   7922  N  NZ  . LYS C 1 346 ? 7.393   -2.918  -10.703 1.00 114.40 ? 368 LYS C NZ  1 
ATOM   7923  N  N   . PHE C 1 347 ? 12.796  -2.829  -6.599  1.00 78.35  ? 369 PHE C N   1 
ATOM   7924  C  CA  . PHE C 1 347 ? 12.783  -3.171  -5.164  1.00 79.46  ? 369 PHE C CA  1 
ATOM   7925  C  C   . PHE C 1 347 ? 14.140  -3.627  -4.629  1.00 80.66  ? 369 PHE C C   1 
ATOM   7926  O  O   . PHE C 1 347 ? 14.235  -4.579  -3.842  1.00 81.77  ? 369 PHE C O   1 
ATOM   7927  C  CB  . PHE C 1 347 ? 11.669  -4.189  -4.813  1.00 83.17  ? 369 PHE C CB  1 
ATOM   7928  C  CG  . PHE C 1 347 ? 10.348  -3.912  -5.493  1.00 85.59  ? 369 PHE C CG  1 
ATOM   7929  C  CD1 . PHE C 1 347 ? 9.708   -2.685  -5.333  1.00 89.50  ? 369 PHE C CD1 1 
ATOM   7930  C  CD2 . PHE C 1 347 ? 9.754   -4.871  -6.316  1.00 88.09  ? 369 PHE C CD2 1 
ATOM   7931  C  CE1 . PHE C 1 347 ? 8.509   -2.421  -5.997  1.00 91.42  ? 369 PHE C CE1 1 
ATOM   7932  C  CE2 . PHE C 1 347 ? 8.545   -4.614  -6.955  1.00 91.75  ? 369 PHE C CE2 1 
ATOM   7933  C  CZ  . PHE C 1 347 ? 7.929   -3.394  -6.789  1.00 90.90  ? 369 PHE C CZ  1 
ATOM   7934  N  N   . ALA C 1 348 ? 15.180  -2.898  -5.023  1.00 73.97  ? 370 ALA C N   1 
ATOM   7935  C  CA  . ALA C 1 348 ? 16.534  -3.116  -4.535  1.00 72.33  ? 370 ALA C CA  1 
ATOM   7936  C  C   . ALA C 1 348 ? 16.663  -2.450  -3.160  1.00 76.09  ? 370 ALA C C   1 
ATOM   7937  O  O   . ALA C 1 348 ? 16.001  -1.444  -2.866  1.00 74.65  ? 370 ALA C O   1 
ATOM   7938  C  CB  . ALA C 1 348 ? 17.551  -2.531  -5.497  1.00 70.86  ? 370 ALA C CB  1 
ATOM   7939  N  N   . GLN C 1 349 ? 17.509  -3.043  -2.316  1.00 73.82  ? 371 GLN C N   1 
ATOM   7940  C  CA  . GLN C 1 349 ? 17.751  -2.569  -0.960  1.00 74.57  ? 371 GLN C CA  1 
ATOM   7941  C  C   . GLN C 1 349 ? 19.164  -2.032  -0.800  1.00 77.05  ? 371 GLN C C   1 
ATOM   7942  O  O   . GLN C 1 349 ? 20.133  -2.604  -1.314  1.00 74.86  ? 371 GLN C O   1 
ATOM   7943  C  CB  . GLN C 1 349 ? 17.432  -3.652  0.068   1.00 77.44  ? 371 GLN C CB  1 
ATOM   7944  C  CG  . GLN C 1 349 ? 16.101  -4.337  -0.193  1.00 86.51  ? 371 GLN C CG  1 
ATOM   7945  C  CD  . GLN C 1 349 ? 15.805  -5.366  0.837   1.00 104.28 ? 371 GLN C CD  1 
ATOM   7946  O  OE1 . GLN C 1 349 ? 16.649  -6.209  1.153   1.00 99.01  ? 371 GLN C OE1 1 
ATOM   7947  N  NE2 . GLN C 1 349 ? 14.596  -5.319  1.376   1.00 99.97  ? 371 GLN C NE2 1 
ATOM   7948  N  N   . TYR C 1 350 ? 19.262  -0.900  -0.109  1.00 74.10  ? 372 TYR C N   1 
ATOM   7949  C  CA  . TYR C 1 350 ? 20.504  -0.161  0.102   1.00 72.35  ? 372 TYR C CA  1 
ATOM   7950  C  C   . TYR C 1 350 ? 20.750  0.109   1.585   1.00 76.71  ? 372 TYR C C   1 
ATOM   7951  O  O   . TYR C 1 350 ? 19.797  0.302   2.341   1.00 77.03  ? 372 TYR C O   1 
ATOM   7952  C  CB  . TYR C 1 350 ? 20.418  1.210   -0.595  1.00 71.74  ? 372 TYR C CB  1 
ATOM   7953  C  CG  . TYR C 1 350 ? 20.132  1.191   -2.078  1.00 71.03  ? 372 TYR C CG  1 
ATOM   7954  C  CD1 . TYR C 1 350 ? 18.821  1.127   -2.559  1.00 72.84  ? 372 TYR C CD1 1 
ATOM   7955  C  CD2 . TYR C 1 350 ? 21.158  1.350   -3.004  1.00 69.85  ? 372 TYR C CD2 1 
ATOM   7956  C  CE1 . TYR C 1 350 ? 18.547  1.181   -3.927  1.00 70.88  ? 372 TYR C CE1 1 
ATOM   7957  C  CE2 . TYR C 1 350 ? 20.896  1.399   -4.375  1.00 68.97  ? 372 TYR C CE2 1 
ATOM   7958  C  CZ  . TYR C 1 350 ? 19.588  1.323   -4.831  1.00 73.83  ? 372 TYR C CZ  1 
ATOM   7959  O  OH  . TYR C 1 350 ? 19.331  1.374   -6.179  1.00 71.95  ? 372 TYR C OH  1 
ATOM   7960  N  N   . SER C 1 351 ? 22.039  0.205   1.967   1.00 72.14  ? 373 SER C N   1 
ATOM   7961  C  CA  . SER C 1 351 ? 22.501  0.571   3.299   1.00 72.89  ? 373 SER C CA  1 
ATOM   7962  C  C   . SER C 1 351 ? 22.743  2.064   3.240   1.00 75.88  ? 373 SER C C   1 
ATOM   7963  O  O   . SER C 1 351 ? 23.454  2.532   2.345   1.00 73.76  ? 373 SER C O   1 
ATOM   7964  C  CB  . SER C 1 351 ? 23.826  -0.115  3.631   1.00 75.40  ? 373 SER C CB  1 
ATOM   7965  O  OG  . SER C 1 351 ? 23.668  -1.483  3.951   1.00 84.77  ? 373 SER C OG  1 
ATOM   7966  N  N   . ILE C 1 352 ? 22.145  2.815   4.163   1.00 73.79  ? 374 ILE C N   1 
ATOM   7967  C  CA  . ILE C 1 352 ? 22.385  4.249   4.246   1.00 73.27  ? 374 ILE C CA  1 
ATOM   7968  C  C   . ILE C 1 352 ? 23.624  4.436   5.146   1.00 75.19  ? 374 ILE C C   1 
ATOM   7969  O  O   . ILE C 1 352 ? 23.575  4.208   6.352   1.00 76.12  ? 374 ILE C O   1 
ATOM   7970  C  CB  . ILE C 1 352 ? 21.122  5.040   4.670   1.00 78.16  ? 374 ILE C CB  1 
ATOM   7971  C  CG1 . ILE C 1 352 ? 19.964  4.729   3.688   1.00 77.93  ? 374 ILE C CG1 1 
ATOM   7972  C  CG2 . ILE C 1 352 ? 21.420  6.552   4.713   1.00 78.63  ? 374 ILE C CG2 1 
ATOM   7973  C  CD1 . ILE C 1 352 ? 18.574  4.677   4.301   1.00 86.73  ? 374 ILE C CD1 1 
ATOM   7974  N  N   . MET C 1 353 ? 24.754  4.766   4.502   1.00 69.26  ? 375 MET C N   1 
ATOM   7975  C  CA  . MET C 1 353 ? 26.077  4.928   5.106   1.00 69.36  ? 375 MET C CA  1 
ATOM   7976  C  C   . MET C 1 353 ? 26.398  6.363   5.527   1.00 76.82  ? 375 MET C C   1 
ATOM   7977  O  O   . MET C 1 353 ? 26.022  7.314   4.843   1.00 76.42  ? 375 MET C O   1 
ATOM   7978  C  CB  . MET C 1 353 ? 27.167  4.421   4.151   1.00 69.21  ? 375 MET C CB  1 
ATOM   7979  C  CG  . MET C 1 353 ? 26.909  3.028   3.594   1.00 71.62  ? 375 MET C CG  1 
ATOM   7980  S  SD  . MET C 1 353 ? 26.760  1.726   4.848   1.00 77.00  ? 375 MET C SD  1 
ATOM   7981  C  CE  . MET C 1 353 ? 28.389  1.706   5.455   1.00 74.04  ? 375 MET C CE  1 
ATOM   7982  N  N   . ASN C 1 354 ? 27.140  6.508   6.638   1.00 75.36  ? 376 ASN C N   1 
ATOM   7983  C  CA  . ASN C 1 354 ? 27.538  7.805   7.174   1.00 75.79  ? 376 ASN C CA  1 
ATOM   7984  C  C   . ASN C 1 354 ? 28.980  7.783   7.700   1.00 79.06  ? 376 ASN C C   1 
ATOM   7985  O  O   . ASN C 1 354 ? 29.325  6.891   8.493   1.00 79.72  ? 376 ASN C O   1 
ATOM   7986  C  CB  . ASN C 1 354 ? 26.539  8.269   8.255   1.00 77.20  ? 376 ASN C CB  1 
ATOM   7987  C  CG  . ASN C 1 354 ? 26.815  9.634   8.856   1.00 92.37  ? 376 ASN C CG  1 
ATOM   7988  O  OD1 . ASN C 1 354 ? 26.921  10.677  8.175   1.00 81.76  ? 376 ASN C OD1 1 
ATOM   7989  N  ND2 . ASN C 1 354 ? 26.919  9.652   10.162  1.00 82.50  ? 376 ASN C ND2 1 
ATOM   7990  N  N   . LEU C 1 355 ? 29.820  8.765   7.245   1.00 72.77  ? 377 LEU C N   1 
ATOM   7991  C  CA  . LEU C 1 355 ? 31.206  8.895   7.688   1.00 72.07  ? 377 LEU C CA  1 
ATOM   7992  C  C   . LEU C 1 355 ? 31.235  9.454   9.098   1.00 80.48  ? 377 LEU C C   1 
ATOM   7993  O  O   . LEU C 1 355 ? 31.100  10.662  9.343   1.00 80.69  ? 377 LEU C O   1 
ATOM   7994  C  CB  . LEU C 1 355 ? 32.069  9.709   6.739   1.00 70.25  ? 377 LEU C CB  1 
ATOM   7995  C  CG  . LEU C 1 355 ? 33.413  9.098   6.376   1.00 73.48  ? 377 LEU C CG  1 
ATOM   7996  C  CD1 . LEU C 1 355 ? 34.037  9.839   5.196   1.00 72.60  ? 377 LEU C CD1 1 
ATOM   7997  C  CD2 . LEU C 1 355 ? 34.365  9.106   7.557   1.00 76.76  ? 377 LEU C CD2 1 
ATOM   7998  N  N   . GLN C 1 356 ? 31.428  8.511   10.019  1.00 79.94  ? 378 GLN C N   1 
ATOM   7999  C  CA  . GLN C 1 356 ? 31.401  8.616   11.462  1.00 82.39  ? 378 GLN C CA  1 
ATOM   8000  C  C   . GLN C 1 356 ? 32.688  8.030   12.040  1.00 87.97  ? 378 GLN C C   1 
ATOM   8001  O  O   . GLN C 1 356 ? 32.930  6.827   11.900  1.00 87.53  ? 378 GLN C O   1 
ATOM   8002  C  CB  . GLN C 1 356 ? 30.242  7.720   11.919  1.00 84.62  ? 378 GLN C CB  1 
ATOM   8003  C  CG  . GLN C 1 356 ? 29.371  8.220   13.030  1.00 97.16  ? 378 GLN C CG  1 
ATOM   8004  C  CD  . GLN C 1 356 ? 27.913  7.964   12.723  1.00 112.13 ? 378 GLN C CD  1 
ATOM   8005  O  OE1 . GLN C 1 356 ? 27.512  6.974   12.088  1.00 100.20 ? 378 GLN C OE1 1 
ATOM   8006  N  NE2 . GLN C 1 356 ? 27.087  8.897   13.120  1.00 110.64 ? 378 GLN C NE2 1 
ATOM   8007  N  N   . ASN C 1 357 ? 33.495  8.862   12.727  1.00 85.86  ? 379 ASN C N   1 
ATOM   8008  C  CA  . ASN C 1 357 ? 34.701  8.442   13.472  1.00 85.44  ? 379 ASN C CA  1 
ATOM   8009  C  C   . ASN C 1 357 ? 35.607  7.516   12.657  1.00 83.14  ? 379 ASN C C   1 
ATOM   8010  O  O   . ASN C 1 357 ? 35.900  6.391   13.079  1.00 82.19  ? 379 ASN C O   1 
ATOM   8011  C  CB  . ASN C 1 357 ? 34.292  7.804   14.810  1.00 86.23  ? 379 ASN C CB  1 
ATOM   8012  C  CG  . ASN C 1 357 ? 33.114  8.480   15.463  1.00 102.54 ? 379 ASN C CG  1 
ATOM   8013  O  OD1 . ASN C 1 357 ? 33.238  9.539   16.090  1.00 96.64  ? 379 ASN C OD1 1 
ATOM   8014  N  ND2 . ASN C 1 357 ? 31.931  7.915   15.261  1.00 91.33  ? 379 ASN C ND2 1 
ATOM   8015  N  N   . ARG C 1 358 ? 35.948  7.979   11.420  1.00 74.70  ? 380 ARG C N   1 
ATOM   8016  C  CA  . ARG C 1 358 ? 36.808  7.318   10.433  1.00 70.55  ? 380 ARG C CA  1 
ATOM   8017  C  C   . ARG C 1 358 ? 36.316  5.916   10.062  1.00 72.89  ? 380 ARG C C   1 
ATOM   8018  O  O   . ARG C 1 358 ? 37.107  5.040   9.723   1.00 71.73  ? 380 ARG C O   1 
ATOM   8019  C  CB  . ARG C 1 358 ? 38.276  7.326   10.878  1.00 66.61  ? 380 ARG C CB  1 
ATOM   8020  C  CG  . ARG C 1 358 ? 38.772  8.719   11.292  1.00 70.71  ? 380 ARG C CG  1 
ATOM   8021  C  CD  . ARG C 1 358 ? 39.503  9.435   10.187  1.00 68.89  ? 380 ARG C CD  1 
ATOM   8022  N  NE  . ARG C 1 358 ? 40.729  8.727   9.846   1.00 65.08  ? 380 ARG C NE  1 
ATOM   8023  C  CZ  . ARG C 1 358 ? 41.911  8.996   10.371  1.00 81.30  ? 380 ARG C CZ  1 
ATOM   8024  N  NH1 . ARG C 1 358 ? 42.053  10.003  11.219  1.00 74.97  ? 380 ARG C NH1 1 
ATOM   8025  N  NH2 . ARG C 1 358 ? 42.970  8.276   10.033  1.00 73.72  ? 380 ARG C NH2 1 
ATOM   8026  N  N   . LYS C 1 359 ? 34.990  5.725   10.107  1.00 69.74  ? 381 LYS C N   1 
ATOM   8027  C  CA  . LYS C 1 359 ? 34.321  4.479   9.749   1.00 69.23  ? 381 LYS C CA  1 
ATOM   8028  C  C   . LYS C 1 359 ? 33.053  4.774   8.949   1.00 73.89  ? 381 LYS C C   1 
ATOM   8029  O  O   . LYS C 1 359 ? 32.273  5.663   9.304   1.00 73.63  ? 381 LYS C O   1 
ATOM   8030  C  CB  . LYS C 1 359 ? 33.906  3.667   10.990  1.00 72.99  ? 381 LYS C CB  1 
ATOM   8031  C  CG  . LYS C 1 359 ? 35.013  3.149   11.889  1.00 85.54  ? 381 LYS C CG  1 
ATOM   8032  C  CD  . LYS C 1 359 ? 34.517  3.015   13.340  1.00 99.16  ? 381 LYS C CD  1 
ATOM   8033  C  CE  . LYS C 1 359 ? 33.726  1.753   13.627  1.00 109.05 ? 381 LYS C CE  1 
ATOM   8034  N  NZ  . LYS C 1 359 ? 33.177  1.745   15.012  1.00 121.11 ? 381 LYS C NZ  1 
ATOM   8035  N  N   . LEU C 1 360 ? 32.824  4.008   7.881   1.00 70.35  ? 382 LEU C N   1 
ATOM   8036  C  CA  . LEU C 1 360 ? 31.576  4.139   7.169   1.00 69.89  ? 382 LEU C CA  1 
ATOM   8037  C  C   . LEU C 1 360 ? 30.658  3.314   8.041   1.00 77.57  ? 382 LEU C C   1 
ATOM   8038  O  O   . LEU C 1 360 ? 30.927  2.132   8.250   1.00 77.72  ? 382 LEU C O   1 
ATOM   8039  C  CB  . LEU C 1 360 ? 31.662  3.591   5.739   1.00 67.73  ? 382 LEU C CB  1 
ATOM   8040  C  CG  . LEU C 1 360 ? 31.899  4.622   4.619   1.00 70.27  ? 382 LEU C CG  1 
ATOM   8041  C  CD1 . LEU C 1 360 ? 31.970  3.934   3.274   1.00 68.45  ? 382 LEU C CD1 1 
ATOM   8042  C  CD2 . LEU C 1 360 ? 30.792  5.646   4.566   1.00 72.67  ? 382 LEU C CD2 1 
ATOM   8043  N  N   . VAL C 1 361 ? 29.704  3.983   8.711   1.00 77.16  ? 383 VAL C N   1 
ATOM   8044  C  CA  . VAL C 1 361 ? 28.795  3.344   9.667   1.00 78.87  ? 383 VAL C CA  1 
ATOM   8045  C  C   . VAL C 1 361 ? 27.359  3.436   9.176   1.00 82.83  ? 383 VAL C C   1 
ATOM   8046  O  O   . VAL C 1 361 ? 26.858  4.534   8.921   1.00 82.38  ? 383 VAL C O   1 
ATOM   8047  C  CB  . VAL C 1 361 ? 28.949  3.910   11.102  1.00 85.19  ? 383 VAL C CB  1 
ATOM   8048  C  CG1 . VAL C 1 361 ? 28.134  3.093   12.100  1.00 87.86  ? 383 VAL C CG1 1 
ATOM   8049  C  CG2 . VAL C 1 361 ? 30.406  3.953   11.530  1.00 84.97  ? 383 VAL C CG2 1 
ATOM   8050  N  N   . GLN C 1 362 ? 26.704  2.271   9.059   1.00 79.68  ? 384 GLN C N   1 
ATOM   8051  C  CA  . GLN C 1 362 ? 25.323  2.145   8.600   1.00 78.99  ? 384 GLN C CA  1 
ATOM   8052  C  C   . GLN C 1 362 ? 24.374  2.807   9.592   1.00 86.13  ? 384 GLN C C   1 
ATOM   8053  O  O   . GLN C 1 362 ? 24.449  2.546   10.795  1.00 88.83  ? 384 GLN C O   1 
ATOM   8054  C  CB  . GLN C 1 362 ? 24.945  0.677   8.357   1.00 79.43  ? 384 GLN C CB  1 
ATOM   8055  C  CG  . GLN C 1 362 ? 23.507  0.514   7.870   1.00 83.27  ? 384 GLN C CG  1 
ATOM   8056  C  CD  . GLN C 1 362 ? 23.129  -0.897  7.506   1.00 96.09  ? 384 GLN C CD  1 
ATOM   8057  O  OE1 . GLN C 1 362 ? 22.051  -1.370  7.853   1.00 90.69  ? 384 GLN C OE1 1 
ATOM   8058  N  NE2 . GLN C 1 362 ? 23.981  -1.598  6.771   1.00 86.15  ? 384 GLN C NE2 1 
ATOM   8059  N  N   . VAL C 1 363 ? 23.505  3.683   9.077   1.00 82.04  ? 385 VAL C N   1 
ATOM   8060  C  CA  . VAL C 1 363 ? 22.558  4.457   9.868   1.00 84.07  ? 385 VAL C CA  1 
ATOM   8061  C  C   . VAL C 1 363 ? 21.113  4.094   9.539   1.00 88.38  ? 385 VAL C C   1 
ATOM   8062  O  O   . VAL C 1 363 ? 20.196  4.506   10.257  1.00 91.46  ? 385 VAL C O   1 
ATOM   8063  C  CB  . VAL C 1 363 ? 22.825  5.991   9.805   1.00 88.09  ? 385 VAL C CB  1 
ATOM   8064  C  CG1 . VAL C 1 363 ? 24.197  6.340   10.385  1.00 88.23  ? 385 VAL C CG1 1 
ATOM   8065  C  CG2 . VAL C 1 363 ? 22.662  6.552   8.393   1.00 85.51  ? 385 VAL C CG2 1 
ATOM   8066  N  N   . GLY C 1 364 ? 20.931  3.287   8.506   1.00 82.39  ? 386 GLY C N   1 
ATOM   8067  C  CA  . GLY C 1 364 ? 19.612  2.861   8.071   1.00 82.73  ? 386 GLY C CA  1 
ATOM   8068  C  C   . GLY C 1 364 ? 19.632  2.030   6.808   1.00 85.08  ? 386 GLY C C   1 
ATOM   8069  O  O   . GLY C 1 364 ? 20.700  1.673   6.303   1.00 83.19  ? 386 GLY C O   1 
ATOM   8070  N  N   . ILE C 1 365 ? 18.431  1.698   6.310   1.00 82.13  ? 387 ILE C N   1 
ATOM   8071  C  CA  . ILE C 1 365 ? 18.229  0.890   5.114   1.00 80.22  ? 387 ILE C CA  1 
ATOM   8072  C  C   . ILE C 1 365 ? 17.069  1.426   4.282   1.00 85.34  ? 387 ILE C C   1 
ATOM   8073  O  O   . ILE C 1 365 ? 16.062  1.881   4.832   1.00 86.22  ? 387 ILE C O   1 
ATOM   8074  C  CB  . ILE C 1 365 ? 18.046  -0.625  5.494   1.00 83.52  ? 387 ILE C CB  1 
ATOM   8075  C  CG1 . ILE C 1 365 ? 19.353  -1.406  5.333   1.00 82.79  ? 387 ILE C CG1 1 
ATOM   8076  C  CG2 . ILE C 1 365 ? 16.854  -1.350  4.810   1.00 82.36  ? 387 ILE C CG2 1 
ATOM   8077  C  CD1 . ILE C 1 365 ? 19.480  -2.689  6.328   1.00 91.17  ? 387 ILE C CD1 1 
ATOM   8078  N  N   . PHE C 1 366 ? 17.219  1.367   2.953   1.00 81.04  ? 388 PHE C N   1 
ATOM   8079  C  CA  . PHE C 1 366 ? 16.124  1.655   2.050   1.00 81.21  ? 388 PHE C CA  1 
ATOM   8080  C  C   . PHE C 1 366 ? 15.675  0.257   1.648   1.00 86.96  ? 388 PHE C C   1 
ATOM   8081  O  O   . PHE C 1 366 ? 16.401  -0.437  0.945   1.00 83.94  ? 388 PHE C O   1 
ATOM   8082  C  CB  . PHE C 1 366 ? 16.564  2.479   0.852   1.00 81.19  ? 388 PHE C CB  1 
ATOM   8083  C  CG  . PHE C 1 366 ? 15.400  2.754   -0.061  1.00 83.08  ? 388 PHE C CG  1 
ATOM   8084  C  CD1 . PHE C 1 366 ? 14.492  3.757   0.236   1.00 88.72  ? 388 PHE C CD1 1 
ATOM   8085  C  CD2 . PHE C 1 366 ? 15.202  1.996   -1.209  1.00 83.85  ? 388 PHE C CD2 1 
ATOM   8086  C  CE1 . PHE C 1 366 ? 13.402  4.000   -0.597  1.00 90.30  ? 388 PHE C CE1 1 
ATOM   8087  C  CE2 . PHE C 1 366 ? 14.113  2.234   -2.039  1.00 87.43  ? 388 PHE C CE2 1 
ATOM   8088  C  CZ  . PHE C 1 366 ? 13.218  3.237   -1.731  1.00 87.74  ? 388 PHE C CZ  1 
ATOM   8089  N  N   . ASN C 1 367 ? 14.542  -0.192  2.190   1.00 89.19  ? 389 ASN C N   1 
ATOM   8090  C  CA  . ASN C 1 367 ? 14.056  -1.567  2.071   1.00 91.23  ? 389 ASN C CA  1 
ATOM   8091  C  C   . ASN C 1 367 ? 13.478  -1.963  0.714   1.00 96.07  ? 389 ASN C C   1 
ATOM   8092  O  O   . ASN C 1 367 ? 13.030  -3.098  0.570   1.00 96.94  ? 389 ASN C O   1 
ATOM   8093  C  CB  . ASN C 1 367 ? 13.036  -1.862  3.189   1.00 99.77  ? 389 ASN C CB  1 
ATOM   8094  C  CG  . ASN C 1 367 ? 11.592  -1.497  2.898   1.00 138.32 ? 389 ASN C CG  1 
ATOM   8095  O  OD1 . ASN C 1 367 ? 11.295  -0.600  2.090   1.00 137.13 ? 389 ASN C OD1 1 
ATOM   8096  N  ND2 . ASN C 1 367 ? 10.660  -2.202  3.552   1.00 131.52 ? 389 ASN C ND2 1 
ATOM   8097  N  N   . GLY C 1 368 ? 13.471  -1.052  -0.248  1.00 92.24  ? 390 GLY C N   1 
ATOM   8098  C  CA  . GLY C 1 368 ? 12.928  -1.328  -1.574  1.00 90.98  ? 390 GLY C CA  1 
ATOM   8099  C  C   . GLY C 1 368 ? 11.824  -0.367  -1.924  1.00 94.64  ? 390 GLY C C   1 
ATOM   8100  O  O   . GLY C 1 368 ? 11.484  -0.221  -3.100  1.00 93.51  ? 390 GLY C O   1 
ATOM   8101  N  N   . SER C 1 369 ? 11.283  0.320   -0.890  1.00 92.59  ? 391 SER C N   1 
ATOM   8102  C  CA  . SER C 1 369 ? 10.200  1.301   -1.024  1.00 93.65  ? 391 SER C CA  1 
ATOM   8103  C  C   . SER C 1 369 ? 10.188  2.386   0.070   1.00 98.96  ? 391 SER C C   1 
ATOM   8104  O  O   . SER C 1 369 ? 9.751   3.504   -0.196  1.00 97.73  ? 391 SER C O   1 
ATOM   8105  C  CB  . SER C 1 369 ? 8.850   0.593   -1.073  1.00 98.20  ? 391 SER C CB  1 
ATOM   8106  N  N   . TYR C 1 370 ? 10.682  2.056   1.282   1.00 97.72  ? 392 TYR C N   1 
ATOM   8107  C  CA  . TYR C 1 370 ? 10.681  2.919   2.476   1.00 99.61  ? 392 TYR C CA  1 
ATOM   8108  C  C   . TYR C 1 370 ? 12.071  3.060   3.130   1.00 102.31 ? 392 TYR C C   1 
ATOM   8109  O  O   . TYR C 1 370 ? 12.895  2.150   3.005   1.00 100.68 ? 392 TYR C O   1 
ATOM   8110  C  CB  . TYR C 1 370 ? 9.704   2.313   3.501   1.00 103.33 ? 392 TYR C CB  1 
ATOM   8111  N  N   . ILE C 1 371 ? 12.312  4.181   3.856   1.00 98.90  ? 393 ILE C N   1 
ATOM   8112  C  CA  . ILE C 1 371 ? 13.556  4.397   4.608   1.00 98.21  ? 393 ILE C CA  1 
ATOM   8113  C  C   . ILE C 1 371 ? 13.340  3.976   6.062   1.00 103.58 ? 393 ILE C C   1 
ATOM   8114  O  O   . ILE C 1 371 ? 12.460  4.511   6.739   1.00 105.85 ? 393 ILE C O   1 
ATOM   8115  C  CB  . ILE C 1 371 ? 14.115  5.842   4.512   1.00 101.34 ? 393 ILE C CB  1 
ATOM   8116  C  CG1 . ILE C 1 371 ? 14.690  6.100   3.105   1.00 99.87  ? 393 ILE C CG1 1 
ATOM   8117  C  CG2 . ILE C 1 371 ? 15.181  6.110   5.616   1.00 102.15 ? 393 ILE C CG2 1 
ATOM   8118  C  CD1 . ILE C 1 371 ? 15.404  7.429   2.903   1.00 110.85 ? 393 ILE C CD1 1 
ATOM   8119  N  N   . ILE C 1 372 ? 14.155  3.037   6.540   1.00 98.27  ? 394 ILE C N   1 
ATOM   8120  C  CA  . ILE C 1 372 ? 14.076  2.553   7.910   1.00 99.91  ? 394 ILE C CA  1 
ATOM   8121  C  C   . ILE C 1 372 ? 15.341  2.956   8.628   1.00 102.20 ? 394 ILE C C   1 
ATOM   8122  O  O   . ILE C 1 372 ? 16.382  2.360   8.379   1.00 100.16 ? 394 ILE C O   1 
ATOM   8123  C  CB  . ILE C 1 372 ? 13.871  1.017   7.964   1.00 103.17 ? 394 ILE C CB  1 
ATOM   8124  C  CG1 . ILE C 1 372 ? 12.762  0.549   7.000   1.00 102.83 ? 394 ILE C CG1 1 
ATOM   8125  C  CG2 . ILE C 1 372 ? 13.616  0.562   9.402   1.00 107.40 ? 394 ILE C CG2 1 
ATOM   8126  C  CD1 . ILE C 1 372 ? 12.790  -0.940  6.688   1.00 111.43 ? 394 ILE C CD1 1 
ATOM   8127  N  N   . GLN C 1 373 ? 15.262  3.949   9.517   1.00 99.77  ? 395 GLN C N   1 
ATOM   8128  C  CA  . GLN C 1 373 ? 16.419  4.401   10.297  1.00 99.23  ? 395 GLN C CA  1 
ATOM   8129  C  C   . GLN C 1 373 ? 16.738  3.391   11.401  1.00 104.80 ? 395 GLN C C   1 
ATOM   8130  O  O   . GLN C 1 373 ? 15.817  2.807   11.977  1.00 106.06 ? 395 GLN C O   1 
ATOM   8131  C  CB  . GLN C 1 373 ? 16.156  5.778   10.918  1.00 101.90 ? 395 GLN C CB  1 
ATOM   8132  C  CG  . GLN C 1 373 ? 15.962  6.889   9.900   1.00 103.37 ? 395 GLN C CG  1 
ATOM   8133  C  CD  . GLN C 1 373 ? 16.347  8.226   10.475  1.00 118.55 ? 395 GLN C CD  1 
ATOM   8134  O  OE1 . GLN C 1 373 ? 17.481  8.435   10.938  1.00 111.79 ? 395 GLN C OE1 1 
ATOM   8135  N  NE2 . GLN C 1 373 ? 15.411  9.163   10.459  1.00 111.01 ? 395 GLN C NE2 1 
ATOM   8136  N  N   . ASN C 1 374 ? 18.027  3.169   11.689  1.00 101.35 ? 396 ASN C N   1 
ATOM   8137  C  CA  . ASN C 1 374 ? 18.425  2.255   12.766  1.00 103.59 ? 396 ASN C CA  1 
ATOM   8138  C  C   . ASN C 1 374 ? 18.755  3.064   14.022  1.00 112.76 ? 396 ASN C C   1 
ATOM   8139  O  O   . ASN C 1 374 ? 18.797  4.288   13.941  1.00 113.20 ? 396 ASN C O   1 
ATOM   8140  C  CB  . ASN C 1 374 ? 19.586  1.332   12.346  1.00 99.42  ? 396 ASN C CB  1 
ATOM   8141  C  CG  . ASN C 1 374 ? 20.925  1.986   12.129  1.00 115.59 ? 396 ASN C CG  1 
ATOM   8142  O  OD1 . ASN C 1 374 ? 21.243  3.080   12.630  1.00 103.62 ? 396 ASN C OD1 1 
ATOM   8143  N  ND2 . ASN C 1 374 ? 21.743  1.314   11.345  1.00 109.11 ? 396 ASN C ND2 1 
ATOM   8144  N  N   . ASP C 1 375 ? 19.059  2.396   15.148  1.00 112.59 ? 397 ASP C N   1 
ATOM   8145  C  CA  . ASP C 1 375 ? 19.377  3.037   16.429  1.00 116.19 ? 397 ASP C CA  1 
ATOM   8146  C  C   . ASP C 1 375 ? 20.646  3.929   16.454  1.00 117.68 ? 397 ASP C C   1 
ATOM   8147  O  O   . ASP C 1 375 ? 20.895  4.575   17.482  1.00 119.07 ? 397 ASP C O   1 
ATOM   8148  C  CB  . ASP C 1 375 ? 19.447  1.983   17.543  1.00 121.86 ? 397 ASP C CB  1 
ATOM   8149  C  CG  . ASP C 1 375 ? 18.097  1.385   17.891  1.00 140.35 ? 397 ASP C CG  1 
ATOM   8150  O  OD1 . ASP C 1 375 ? 17.252  1.230   16.965  1.00 141.21 ? 397 ASP C OD1 1 
ATOM   8151  O  OD2 . ASP C 1 375 ? 17.883  1.056   19.082  1.00 148.08 ? 397 ASP C OD2 1 
ATOM   8152  N  N   . ARG C 1 376 ? 21.416  3.987   15.339  1.00 109.95 ? 398 ARG C N   1 
ATOM   8153  C  CA  . ARG C 1 376 ? 22.610  4.836   15.227  1.00 107.52 ? 398 ARG C CA  1 
ATOM   8154  C  C   . ARG C 1 376 ? 22.261  6.238   14.700  1.00 107.50 ? 398 ARG C C   1 
ATOM   8155  O  O   . ARG C 1 376 ? 21.620  6.387   13.645  1.00 104.20 ? 398 ARG C O   1 
ATOM   8156  C  CB  . ARG C 1 376 ? 23.719  4.169   14.397  1.00 104.40 ? 398 ARG C CB  1 
ATOM   8157  C  CG  . ARG C 1 376 ? 24.435  3.055   15.129  1.00 114.70 ? 398 ARG C CG  1 
ATOM   8158  C  CD  . ARG C 1 376 ? 24.962  2.012   14.174  1.00 127.37 ? 398 ARG C CD  1 
ATOM   8159  N  NE  . ARG C 1 376 ? 24.945  0.687   14.796  1.00 148.21 ? 398 ARG C NE  1 
ATOM   8160  C  CZ  . ARG C 1 376 ? 24.167  -0.319  14.408  1.00 167.35 ? 398 ARG C CZ  1 
ATOM   8161  N  NH1 . ARG C 1 376 ? 23.354  -0.177  13.369  1.00 157.96 ? 398 ARG C NH1 1 
ATOM   8162  N  NH2 . ARG C 1 376 ? 24.222  -1.487  15.035  1.00 153.82 ? 398 ARG C NH2 1 
ATOM   8163  N  N   . LYS C 1 377 ? 22.656  7.254   15.484  1.00 104.31 ? 399 LYS C N   1 
ATOM   8164  C  CA  . LYS C 1 377 ? 22.425  8.665   15.194  1.00 103.97 ? 399 LYS C CA  1 
ATOM   8165  C  C   . LYS C 1 377 ? 23.365  9.166   14.110  1.00 105.44 ? 399 LYS C C   1 
ATOM   8166  O  O   . LYS C 1 377 ? 24.550  8.834   14.137  1.00 105.46 ? 399 LYS C O   1 
ATOM   8167  C  CB  . LYS C 1 377 ? 22.601  9.511   16.462  1.00 109.06 ? 399 LYS C CB  1 
ATOM   8168  N  N   . ILE C 1 378 ? 22.843  9.966   13.162  1.00 98.85  ? 400 ILE C N   1 
ATOM   8169  C  CA  . ILE C 1 378 ? 23.653  10.527  12.079  1.00 94.93  ? 400 ILE C CA  1 
ATOM   8170  C  C   . ILE C 1 378 ? 24.468  11.705  12.603  1.00 99.15  ? 400 ILE C C   1 
ATOM   8171  O  O   . ILE C 1 378 ? 23.927  12.584  13.272  1.00 101.37 ? 400 ILE C O   1 
ATOM   8172  C  CB  . ILE C 1 378 ? 22.785  10.948  10.846  1.00 95.86  ? 400 ILE C CB  1 
ATOM   8173  C  CG1 . ILE C 1 378 ? 22.150  9.727   10.167  1.00 94.67  ? 400 ILE C CG1 1 
ATOM   8174  C  CG2 . ILE C 1 378 ? 23.590  11.786  9.839   1.00 93.20  ? 400 ILE C CG2 1 
ATOM   8175  C  CD1 . ILE C 1 378 ? 20.879  10.017  9.290   1.00 100.87 ? 400 ILE C CD1 1 
ATOM   8176  N  N   . ILE C 1 379 ? 25.759  11.721  12.274  1.00 93.42  ? 401 ILE C N   1 
ATOM   8177  C  CA  . ILE C 1 379 ? 26.651  12.832  12.534  1.00 93.58  ? 401 ILE C CA  1 
ATOM   8178  C  C   . ILE C 1 379 ? 26.771  13.549  11.175  1.00 97.52  ? 401 ILE C C   1 
ATOM   8179  O  O   . ILE C 1 379 ? 27.198  12.944  10.179  1.00 95.86  ? 401 ILE C O   1 
ATOM   8180  C  CB  . ILE C 1 379 ? 27.998  12.360  13.125  1.00 96.16  ? 401 ILE C CB  1 
ATOM   8181  C  CG1 . ILE C 1 379 ? 27.812  12.007  14.608  1.00 98.21  ? 401 ILE C CG1 1 
ATOM   8182  C  CG2 . ILE C 1 379 ? 29.080  13.433  12.949  1.00 97.76  ? 401 ILE C CG2 1 
ATOM   8183  C  CD1 . ILE C 1 379 ? 28.772  11.107  15.168  1.00 98.21  ? 401 ILE C CD1 1 
ATOM   8184  N  N   . TRP C 1 380 ? 26.294  14.803  11.121  1.00 94.57  ? 402 TRP C N   1 
ATOM   8185  C  CA  . TRP C 1 380 ? 26.309  15.598  9.896   1.00 92.18  ? 402 TRP C CA  1 
ATOM   8186  C  C   . TRP C 1 380 ? 27.651  16.281  9.773   1.00 93.70  ? 402 TRP C C   1 
ATOM   8187  O  O   . TRP C 1 380 ? 28.330  16.391  10.798  1.00 93.57  ? 402 TRP C O   1 
ATOM   8188  C  CB  . TRP C 1 380 ? 25.169  16.626  9.896   1.00 92.75  ? 402 TRP C CB  1 
ATOM   8189  C  CG  . TRP C 1 380 ? 23.821  15.993  10.020  1.00 94.62  ? 402 TRP C CG  1 
ATOM   8190  C  CD1 . TRP C 1 380 ? 23.082  15.865  11.161  1.00 100.25 ? 402 TRP C CD1 1 
ATOM   8191  C  CD2 . TRP C 1 380 ? 23.103  15.292  8.994   1.00 92.68  ? 402 TRP C CD2 1 
ATOM   8192  N  NE1 . TRP C 1 380 ? 21.934  15.153  10.904  1.00 99.88  ? 402 TRP C NE1 1 
ATOM   8193  C  CE2 . TRP C 1 380 ? 21.916  14.796  9.579   1.00 98.41  ? 402 TRP C CE2 1 
ATOM   8194  C  CE3 . TRP C 1 380 ? 23.332  15.063  7.623   1.00 91.05  ? 402 TRP C CE3 1 
ATOM   8195  C  CZ2 . TRP C 1 380 ? 20.969  14.072  8.850   1.00 96.50  ? 402 TRP C CZ2 1 
ATOM   8196  C  CZ3 . TRP C 1 380 ? 22.394  14.337  6.903   1.00 91.45  ? 402 TRP C CZ3 1 
ATOM   8197  C  CH2 . TRP C 1 380 ? 21.231  13.848  7.515   1.00 93.81  ? 402 TRP C CH2 1 
ATOM   8198  N  N   . PRO C 1 381 ? 28.053  16.742  8.553   1.00 88.70  ? 403 PRO C N   1 
ATOM   8199  C  CA  . PRO C 1 381 ? 29.366  17.397  8.395   1.00 88.42  ? 403 PRO C CA  1 
ATOM   8200  C  C   . PRO C 1 381 ? 29.682  18.498  9.416   1.00 95.75  ? 403 PRO C C   1 
ATOM   8201  O  O   . PRO C 1 381 ? 28.884  19.403  9.659   1.00 96.02  ? 403 PRO C O   1 
ATOM   8202  C  CB  . PRO C 1 381 ? 29.320  17.917  6.962   1.00 88.13  ? 403 PRO C CB  1 
ATOM   8203  C  CG  . PRO C 1 381 ? 28.426  16.960  6.265   1.00 90.85  ? 403 PRO C CG  1 
ATOM   8204  C  CD  . PRO C 1 381 ? 27.354  16.649  7.251   1.00 88.23  ? 403 PRO C CD  1 
ATOM   8205  N  N   . GLY C 1 382 ? 30.837  18.354  10.045  1.00 94.65  ? 404 GLY C N   1 
ATOM   8206  C  CA  . GLY C 1 382 ? 31.288  19.257  11.092  1.00 98.19  ? 404 GLY C CA  1 
ATOM   8207  C  C   . GLY C 1 382 ? 31.181  18.649  12.479  1.00 106.77 ? 404 GLY C C   1 
ATOM   8208  O  O   . GLY C 1 382 ? 31.910  19.049  13.391  1.00 108.16 ? 404 GLY C O   1 
ATOM   8209  N  N   . GLY C 1 383 ? 30.278  17.682  12.633  1.00 104.81 ? 405 GLY C N   1 
ATOM   8210  C  CA  . GLY C 1 383 ? 30.062  16.987  13.897  1.00 106.99 ? 405 GLY C CA  1 
ATOM   8211  C  C   . GLY C 1 383 ? 28.832  17.472  14.628  1.00 113.49 ? 405 GLY C C   1 
ATOM   8212  O  O   . GLY C 1 383 ? 28.949  18.151  15.649  1.00 115.95 ? 405 GLY C O   1 
ATOM   8213  N  N   . GLU C 1 384 ? 27.643  17.132  14.101  1.00 109.56 ? 406 GLU C N   1 
ATOM   8214  C  CA  . GLU C 1 384 ? 26.358  17.528  14.684  1.00 111.75 ? 406 GLU C CA  1 
ATOM   8215  C  C   . GLU C 1 384 ? 25.283  16.436  14.531  1.00 115.75 ? 406 GLU C C   1 
ATOM   8216  O  O   . GLU C 1 384 ? 25.199  15.810  13.468  1.00 113.18 ? 406 GLU C O   1 
ATOM   8217  C  CB  . GLU C 1 384 ? 25.882  18.879  14.094  1.00 113.06 ? 406 GLU C CB  1 
ATOM   8218  C  CG  . GLU C 1 384 ? 24.972  19.669  15.028  1.00 123.95 ? 406 GLU C CG  1 
ATOM   8219  C  CD  . GLU C 1 384 ? 25.607  20.414  16.197  1.00 131.03 ? 406 GLU C CD  1 
ATOM   8220  O  OE1 . GLU C 1 384 ? 26.277  19.775  17.044  1.00 120.49 ? 406 GLU C OE1 1 
ATOM   8221  O  OE2 . GLU C 1 384 ? 25.361  21.637  16.304  1.00 108.85 ? 406 GLU C OE2 1 
ATOM   8222  N  N   . THR C 1 385 ? 24.465  16.212  15.592  1.00 114.22 ? 407 THR C N   1 
ATOM   8223  C  CA  . THR C 1 385 ? 23.378  15.232  15.564  1.00 134.22 ? 407 THR C CA  1 
ATOM   8224  C  C   . THR C 1 385 ? 22.044  15.862  15.984  1.00 161.39 ? 407 THR C C   1 
ATOM   8225  O  O   . THR C 1 385 ? 21.394  16.522  15.176  1.00 124.41 ? 407 THR C O   1 
ATOM   8226  C  CB  . THR C 1 385 ? 23.743  13.975  16.352  1.00 141.68 ? 407 THR C CB  1 
ATOM   8227  O  OG1 . THR C 1 385 ? 23.002  12.881  15.814  1.00 140.07 ? 407 THR C OG1 1 
ATOM   8228  C  CG2 . THR C 1 385 ? 23.501  14.111  17.859  1.00 144.09 ? 407 THR C CG2 1 
ATOM   8229  N  N   . PRO D 2 2   ? 58.336  3.027   -51.336 1.00 112.47 ? 32  PRO D N   1 
ATOM   8230  C  CA  . PRO D 2 2   ? 59.481  2.191   -50.949 1.00 112.76 ? 32  PRO D CA  1 
ATOM   8231  C  C   . PRO D 2 2   ? 59.089  1.099   -49.921 1.00 113.44 ? 32  PRO D C   1 
ATOM   8232  O  O   . PRO D 2 2   ? 58.950  -0.025  -50.414 1.00 113.72 ? 32  PRO D O   1 
ATOM   8233  C  CB  . PRO D 2 2   ? 60.538  3.213   -50.495 1.00 115.40 ? 32  PRO D CB  1 
ATOM   8234  C  CG  . PRO D 2 2   ? 60.222  4.460   -51.288 1.00 120.76 ? 32  PRO D CG  1 
ATOM   8235  C  CD  . PRO D 2 2   ? 58.768  4.371   -51.766 1.00 115.57 ? 32  PRO D CD  1 
ATOM   8236  N  N   . PRO D 2 3   ? 58.822  1.305   -48.580 1.00 106.12 ? 33  PRO D N   1 
ATOM   8237  C  CA  . PRO D 2 3   ? 58.382  0.155   -47.755 1.00 103.62 ? 33  PRO D CA  1 
ATOM   8238  C  C   . PRO D 2 3   ? 56.958  -0.294  -48.109 1.00 104.41 ? 33  PRO D C   1 
ATOM   8239  O  O   . PRO D 2 3   ? 56.225  0.444   -48.774 1.00 103.81 ? 33  PRO D O   1 
ATOM   8240  C  CB  . PRO D 2 3   ? 58.466  0.684   -46.322 1.00 104.03 ? 33  PRO D CB  1 
ATOM   8241  C  CG  . PRO D 2 3   ? 58.273  2.140   -46.449 1.00 108.89 ? 33  PRO D CG  1 
ATOM   8242  C  CD  . PRO D 2 3   ? 58.898  2.536   -47.762 1.00 106.58 ? 33  PRO D CD  1 
ATOM   8243  N  N   . SER D 2 4   ? 56.571  -1.504  -47.702 1.00 98.75  ? 34  SER D N   1 
ATOM   8244  C  CA  . SER D 2 4   ? 55.246  -2.007  -48.041 1.00 97.18  ? 34  SER D CA  1 
ATOM   8245  C  C   . SER D 2 4   ? 54.313  -2.102  -46.843 1.00 97.98  ? 34  SER D C   1 
ATOM   8246  O  O   . SER D 2 4   ? 54.770  -2.291  -45.710 1.00 97.43  ? 34  SER D O   1 
ATOM   8247  C  CB  . SER D 2 4   ? 55.349  -3.345  -48.768 1.00 101.38 ? 34  SER D CB  1 
ATOM   8248  O  OG  . SER D 2 4   ? 54.759  -4.408  -48.034 1.00 107.35 ? 34  SER D OG  1 
ATOM   8249  N  N   . ILE D 2 5   ? 52.995  -1.970  -47.105 1.00 91.60  ? 35  ILE D N   1 
ATOM   8250  C  CA  . ILE D 2 5   ? 51.937  -2.099  -46.103 1.00 87.47  ? 35  ILE D CA  1 
ATOM   8251  C  C   . ILE D 2 5   ? 50.967  -3.141  -46.551 1.00 88.56  ? 35  ILE D C   1 
ATOM   8252  O  O   . ILE D 2 5   ? 50.585  -3.171  -47.718 1.00 88.58  ? 35  ILE D O   1 
ATOM   8253  C  CB  . ILE D 2 5   ? 51.240  -0.784  -45.665 1.00 88.98  ? 35  ILE D CB  1 
ATOM   8254  C  CG1 . ILE D 2 5   ? 50.664  0.018   -46.844 1.00 89.50  ? 35  ILE D CG1 1 
ATOM   8255  C  CG2 . ILE D 2 5   ? 52.172  0.066   -44.814 1.00 90.14  ? 35  ILE D CG2 1 
ATOM   8256  C  CD1 . ILE D 2 5   ? 49.484  0.897   -46.440 1.00 92.30  ? 35  ILE D CD1 1 
ATOM   8257  N  N   . GLY D 2 6   ? 50.599  -4.006  -45.629 1.00 83.40  ? 36  GLY D N   1 
ATOM   8258  C  CA  . GLY D 2 6   ? 49.646  -5.065  -45.909 1.00 82.52  ? 36  GLY D CA  1 
ATOM   8259  C  C   . GLY D 2 6   ? 48.212  -4.595  -45.797 1.00 83.19  ? 36  GLY D C   1 
ATOM   8260  O  O   . GLY D 2 6   ? 47.790  -4.126  -44.739 1.00 80.44  ? 36  GLY D O   1 
ATOM   8261  N  N   . ILE D 2 7   ? 47.454  -4.732  -46.889 1.00 80.06  ? 37  ILE D N   1 
ATOM   8262  C  CA  . ILE D 2 7   ? 46.031  -4.384  -46.926 1.00 78.96  ? 37  ILE D CA  1 
ATOM   8263  C  C   . ILE D 2 7   ? 45.204  -5.626  -47.321 1.00 82.14  ? 37  ILE D C   1 
ATOM   8264  O  O   . ILE D 2 7   ? 45.464  -6.221  -48.362 1.00 82.46  ? 37  ILE D O   1 
ATOM   8265  C  CB  . ILE D 2 7   ? 45.737  -3.142  -47.818 1.00 82.39  ? 37  ILE D CB  1 
ATOM   8266  C  CG1 . ILE D 2 7   ? 46.544  -1.902  -47.349 1.00 82.66  ? 37  ILE D CG1 1 
ATOM   8267  C  CG2 . ILE D 2 7   ? 44.234  -2.839  -47.862 1.00 81.96  ? 37  ILE D CG2 1 
ATOM   8268  C  CD1 . ILE D 2 7   ? 46.492  -0.704  -48.289 1.00 88.85  ? 37  ILE D CD1 1 
ATOM   8269  N  N   . ALA D 2 8   ? 44.234  -6.028  -46.472 1.00 77.09  ? 38  ALA D N   1 
ATOM   8270  C  CA  . ALA D 2 8   ? 43.364  -7.174  -46.756 1.00 76.44  ? 38  ALA D CA  1 
ATOM   8271  C  C   . ALA D 2 8   ? 42.027  -6.679  -47.277 1.00 78.42  ? 38  ALA D C   1 
ATOM   8272  O  O   . ALA D 2 8   ? 41.406  -5.821  -46.645 1.00 77.80  ? 38  ALA D O   1 
ATOM   8273  C  CB  . ALA D 2 8   ? 43.161  -8.022  -45.508 1.00 76.12  ? 38  ALA D CB  1 
ATOM   8274  N  N   . VAL D 2 9   ? 41.597  -7.191  -48.440 1.00 74.23  ? 39  VAL D N   1 
ATOM   8275  C  CA  . VAL D 2 9   ? 40.309  -6.832  -49.043 1.00 73.74  ? 39  VAL D CA  1 
ATOM   8276  C  C   . VAL D 2 9   ? 39.359  -8.028  -48.891 1.00 74.39  ? 39  VAL D C   1 
ATOM   8277  O  O   . VAL D 2 9   ? 39.422  -8.984  -49.670 1.00 74.46  ? 39  VAL D O   1 
ATOM   8278  C  CB  . VAL D 2 9   ? 40.417  -6.331  -50.523 1.00 79.75  ? 39  VAL D CB  1 
ATOM   8279  C  CG1 . VAL D 2 9   ? 39.037  -6.027  -51.118 1.00 79.12  ? 39  VAL D CG1 1 
ATOM   8280  C  CG2 . VAL D 2 9   ? 41.338  -5.118  -50.644 1.00 79.87  ? 39  VAL D CG2 1 
ATOM   8281  N  N   . ILE D 2 10  ? 38.505  -7.975  -47.869 1.00 68.87  ? 40  ILE D N   1 
ATOM   8282  C  CA  . ILE D 2 10  ? 37.540  -9.031  -47.602 1.00 69.03  ? 40  ILE D CA  1 
ATOM   8283  C  C   . ILE D 2 10  ? 36.274  -8.790  -48.423 1.00 72.49  ? 40  ILE D C   1 
ATOM   8284  O  O   . ILE D 2 10  ? 35.664  -7.719  -48.344 1.00 69.15  ? 40  ILE D O   1 
ATOM   8285  C  CB  . ILE D 2 10  ? 37.276  -9.248  -46.082 1.00 70.94  ? 40  ILE D CB  1 
ATOM   8286  C  CG1 . ILE D 2 10  ? 38.588  -9.609  -45.353 1.00 70.63  ? 40  ILE D CG1 1 
ATOM   8287  C  CG2 . ILE D 2 10  ? 36.219  -10.355 -45.862 1.00 71.80  ? 40  ILE D CG2 1 
ATOM   8288  C  CD1 . ILE D 2 10  ? 38.586  -9.344  -43.920 1.00 75.85  ? 40  ILE D CD1 1 
ATOM   8289  N  N   . LEU D 2 11  ? 35.901  -9.799  -49.221 1.00 72.28  ? 41  LEU D N   1 
ATOM   8290  C  CA  . LEU D 2 11  ? 34.736  -9.743  -50.092 1.00 73.61  ? 41  LEU D CA  1 
ATOM   8291  C  C   . LEU D 2 11  ? 33.752  -10.867 -49.785 1.00 81.51  ? 41  LEU D C   1 
ATOM   8292  O  O   . LEU D 2 11  ? 33.936  -12.018 -50.217 1.00 83.86  ? 41  LEU D O   1 
ATOM   8293  C  CB  . LEU D 2 11  ? 35.131  -9.769  -51.583 1.00 75.03  ? 41  LEU D CB  1 
ATOM   8294  C  CG  . LEU D 2 11  ? 36.051  -8.672  -52.085 1.00 79.64  ? 41  LEU D CG  1 
ATOM   8295  C  CD1 . LEU D 2 11  ? 36.838  -9.145  -53.293 1.00 81.28  ? 41  LEU D CD1 1 
ATOM   8296  C  CD2 . LEU D 2 11  ? 35.293  -7.356  -52.320 1.00 80.20  ? 41  LEU D CD2 1 
ATOM   8297  N  N   . VAL D 2 12  ? 32.696  -10.518 -49.039 1.00 77.79  ? 42  VAL D N   1 
ATOM   8298  C  CA  . VAL D 2 12  ? 31.627  -11.443 -48.715 1.00 78.89  ? 42  VAL D CA  1 
ATOM   8299  C  C   . VAL D 2 12  ? 30.700  -11.478 -49.933 1.00 88.17  ? 42  VAL D C   1 
ATOM   8300  O  O   . VAL D 2 12  ? 30.263  -10.419 -50.409 1.00 87.73  ? 42  VAL D O   1 
ATOM   8301  C  CB  . VAL D 2 12  ? 30.865  -11.020 -47.440 1.00 80.78  ? 42  VAL D CB  1 
ATOM   8302  C  CG1 . VAL D 2 12  ? 29.554  -11.776 -47.313 1.00 81.33  ? 42  VAL D CG1 1 
ATOM   8303  C  CG2 . VAL D 2 12  ? 31.709  -11.203 -46.197 1.00 79.37  ? 42  VAL D CG2 1 
ATOM   8304  N  N   . GLY D 2 13  ? 30.417  -12.683 -50.412 1.00 88.95  ? 43  GLY D N   1 
ATOM   8305  C  CA  . GLY D 2 13  ? 29.512  -12.883 -51.531 1.00 92.24  ? 43  GLY D CA  1 
ATOM   8306  C  C   . GLY D 2 13  ? 30.177  -12.878 -52.887 1.00 103.41 ? 43  GLY D C   1 
ATOM   8307  O  O   . GLY D 2 13  ? 31.407  -12.822 -52.974 1.00 104.00 ? 43  GLY D O   1 
ATOM   8308  N  N   . THR D 2 14  ? 29.347  -12.935 -53.958 1.00 104.68 ? 44  THR D N   1 
ATOM   8309  C  CA  . THR D 2 14  ? 29.760  -12.964 -55.371 1.00 107.56 ? 44  THR D CA  1 
ATOM   8310  C  C   . THR D 2 14  ? 30.392  -11.637 -55.786 1.00 111.94 ? 44  THR D C   1 
ATOM   8311  O  O   . THR D 2 14  ? 29.782  -10.572 -55.615 1.00 110.78 ? 44  THR D O   1 
ATOM   8312  C  CB  . THR D 2 14  ? 28.579  -13.332 -56.310 1.00 124.78 ? 44  THR D CB  1 
ATOM   8313  O  OG1 . THR D 2 14  ? 27.794  -12.169 -56.611 1.00 126.86 ? 44  THR D OG1 1 
ATOM   8314  C  CG2 . THR D 2 14  ? 27.687  -14.450 -55.759 1.00 125.83 ? 44  THR D CG2 1 
ATOM   8315  N  N   . SER D 2 15  ? 31.607  -11.707 -56.343 1.00 109.19 ? 45  SER D N   1 
ATOM   8316  C  CA  . SER D 2 15  ? 32.347  -10.524 -56.783 1.00 108.36 ? 45  SER D CA  1 
ATOM   8317  C  C   . SER D 2 15  ? 33.282  -10.842 -57.943 1.00 113.68 ? 45  SER D C   1 
ATOM   8318  O  O   . SER D 2 15  ? 33.796  -11.962 -58.026 1.00 114.13 ? 45  SER D O   1 
ATOM   8319  C  CB  . SER D 2 15  ? 33.132  -9.926  -55.617 1.00 108.65 ? 45  SER D CB  1 
ATOM   8320  O  OG  . SER D 2 15  ? 33.864  -10.931 -54.935 1.00 112.94 ? 45  SER D OG  1 
ATOM   8321  N  N   . ASP D 2 16  ? 33.488  -9.867  -58.849 1.00 110.70 ? 46  ASP D N   1 
ATOM   8322  C  CA  . ASP D 2 16  ? 34.419  -10.057 -59.958 1.00 112.61 ? 46  ASP D CA  1 
ATOM   8323  C  C   . ASP D 2 16  ? 35.800  -9.621  -59.482 1.00 116.17 ? 46  ASP D C   1 
ATOM   8324  O  O   . ASP D 2 16  ? 36.138  -8.428  -59.495 1.00 115.15 ? 46  ASP D O   1 
ATOM   8325  C  CB  . ASP D 2 16  ? 33.986  -9.336  -61.248 1.00 115.45 ? 46  ASP D CB  1 
ATOM   8326  C  CG  . ASP D 2 16  ? 34.628  -9.962  -62.467 1.00 126.00 ? 46  ASP D CG  1 
ATOM   8327  O  OD1 . ASP D 2 16  ? 34.027  -10.892 -63.040 1.00 129.31 ? 46  ASP D OD1 1 
ATOM   8328  O  OD2 . ASP D 2 16  ? 35.762  -9.575  -62.804 1.00 129.08 ? 46  ASP D OD2 1 
ATOM   8329  N  N   . GLU D 2 17  ? 36.570  -10.597 -58.987 1.00 112.69 ? 47  GLU D N   1 
ATOM   8330  C  CA  . GLU D 2 17  ? 37.916  -10.377 -58.478 1.00 112.29 ? 47  GLU D CA  1 
ATOM   8331  C  C   . GLU D 2 17  ? 38.858  -9.815  -59.576 1.00 118.57 ? 47  GLU D C   1 
ATOM   8332  O  O   . GLU D 2 17  ? 39.756  -9.024  -59.260 1.00 118.10 ? 47  GLU D O   1 
ATOM   8333  C  CB  . GLU D 2 17  ? 38.460  -11.662 -57.833 1.00 113.86 ? 47  GLU D CB  1 
ATOM   8334  N  N   . VAL D 2 18  ? 38.607  -10.176 -60.870 1.00 116.65 ? 48  VAL D N   1 
ATOM   8335  C  CA  . VAL D 2 18  ? 39.380  -9.683  -62.018 1.00 117.95 ? 48  VAL D CA  1 
ATOM   8336  C  C   . VAL D 2 18  ? 39.096  -8.197  -62.269 1.00 121.92 ? 48  VAL D C   1 
ATOM   8337  O  O   . VAL D 2 18  ? 40.048  -7.436  -62.461 1.00 123.00 ? 48  VAL D O   1 
ATOM   8338  C  CB  . VAL D 2 18  ? 39.232  -10.543 -63.290 1.00 123.79 ? 48  VAL D CB  1 
ATOM   8339  N  N   . ALA D 2 19  ? 37.805  -7.777  -62.204 1.00 116.21 ? 49  ALA D N   1 
ATOM   8340  C  CA  . ALA D 2 19  ? 37.385  -6.377  -62.364 1.00 114.96 ? 49  ALA D CA  1 
ATOM   8341  C  C   . ALA D 2 19  ? 37.903  -5.505  -61.208 1.00 117.23 ? 49  ALA D C   1 
ATOM   8342  O  O   . ALA D 2 19  ? 38.315  -4.366  -61.437 1.00 116.16 ? 49  ALA D O   1 
ATOM   8343  C  CB  . ALA D 2 19  ? 35.871  -6.288  -62.437 1.00 114.99 ? 49  ALA D CB  1 
ATOM   8344  N  N   . ILE D 2 20  ? 37.915  -6.067  -59.977 1.00 113.45 ? 50  ILE D N   1 
ATOM   8345  C  CA  . ILE D 2 20  ? 38.350  -5.400  -58.748 1.00 111.87 ? 50  ILE D CA  1 
ATOM   8346  C  C   . ILE D 2 20  ? 39.844  -5.007  -58.781 1.00 117.97 ? 50  ILE D C   1 
ATOM   8347  O  O   . ILE D 2 20  ? 40.139  -3.838  -58.506 1.00 118.01 ? 50  ILE D O   1 
ATOM   8348  C  CB  . ILE D 2 20  ? 37.957  -6.225  -57.481 1.00 112.90 ? 50  ILE D CB  1 
ATOM   8349  C  CG1 . ILE D 2 20  ? 36.467  -5.979  -57.133 1.00 111.65 ? 50  ILE D CG1 1 
ATOM   8350  C  CG2 . ILE D 2 20  ? 38.861  -5.907  -56.267 1.00 111.33 ? 50  ILE D CG2 1 
ATOM   8351  C  CD1 . ILE D 2 20  ? 35.798  -7.091  -56.388 1.00 116.47 ? 50  ILE D CD1 1 
ATOM   8352  N  N   . LYS D 2 21  ? 40.764  -5.949  -59.143 1.00 115.55 ? 51  LYS D N   1 
ATOM   8353  C  CA  . LYS D 2 21  ? 42.231  -5.743  -59.166 1.00 115.90 ? 51  LYS D CA  1 
ATOM   8354  C  C   . LYS D 2 21  ? 42.730  -4.606  -60.078 1.00 119.86 ? 51  LYS D C   1 
ATOM   8355  O  O   . LYS D 2 21  ? 43.909  -4.247  -60.021 1.00 119.61 ? 51  LYS D O   1 
ATOM   8356  C  CB  . LYS D 2 21  ? 42.963  -7.044  -59.499 1.00 119.99 ? 51  LYS D CB  1 
ATOM   8357  C  CG  . LYS D 2 21  ? 43.108  -7.957  -58.289 1.00 132.73 ? 51  LYS D CG  1 
ATOM   8358  C  CD  . LYS D 2 21  ? 43.774  -9.283  -58.626 1.00 145.68 ? 51  LYS D CD  1 
ATOM   8359  C  CE  . LYS D 2 21  ? 42.796  -10.353 -59.066 1.00 156.68 ? 51  LYS D CE  1 
ATOM   8360  N  NZ  . LYS D 2 21  ? 42.393  -10.196 -60.487 1.00 165.38 ? 51  LYS D NZ  1 
ATOM   8361  N  N   . ASP D 2 22  ? 41.817  -4.015  -60.863 1.00 116.17 ? 52  ASP D N   1 
ATOM   8362  C  CA  . ASP D 2 22  ? 42.051  -2.906  -61.770 1.00 133.57 ? 52  ASP D CA  1 
ATOM   8363  C  C   . ASP D 2 22  ? 41.528  -1.614  -61.159 1.00 123.04 ? 52  ASP D C   1 
ATOM   8364  O  O   . ASP D 2 22  ? 42.261  -0.961  -60.416 1.00 76.54  ? 52  ASP D O   1 
ATOM   8365  C  CB  . ASP D 2 22  ? 41.393  -3.197  -63.125 1.00 137.27 ? 52  ASP D CB  1 
ATOM   8366  C  CG  . ASP D 2 22  ? 42.036  -4.369  -63.839 1.00 150.74 ? 52  ASP D CG  1 
ATOM   8367  O  OD1 . ASP D 2 22  ? 42.105  -5.468  -63.239 1.00 150.77 ? 52  ASP D OD1 1 
ATOM   8368  O  OD2 . ASP D 2 22  ? 42.505  -4.182  -64.983 1.00 159.59 ? 52  ASP D OD2 1 
ATOM   8369  N  N   . PHE D 2 29  ? 47.719  3.536   -59.213 1.00 105.55 ? 59  PHE D N   1 
ATOM   8370  C  CA  . PHE D 2 29  ? 49.177  3.514   -59.065 1.00 107.40 ? 59  PHE D CA  1 
ATOM   8371  C  C   . PHE D 2 29  ? 49.682  4.654   -58.174 1.00 110.67 ? 59  PHE D C   1 
ATOM   8372  O  O   . PHE D 2 29  ? 49.143  5.765   -58.236 1.00 109.35 ? 59  PHE D O   1 
ATOM   8373  C  CB  . PHE D 2 29  ? 49.893  3.514   -60.428 1.00 112.51 ? 59  PHE D CB  1 
ATOM   8374  C  CG  . PHE D 2 29  ? 51.102  2.607   -60.484 1.00 115.81 ? 59  PHE D CG  1 
ATOM   8375  C  CD1 . PHE D 2 29  ? 52.299  2.973   -59.874 1.00 120.10 ? 59  PHE D CD1 1 
ATOM   8376  C  CD2 . PHE D 2 29  ? 51.046  1.388   -61.151 1.00 119.52 ? 59  PHE D CD2 1 
ATOM   8377  C  CE1 . PHE D 2 29  ? 53.419  2.128   -59.919 1.00 122.51 ? 59  PHE D CE1 1 
ATOM   8378  C  CE2 . PHE D 2 29  ? 52.166  0.546   -61.205 1.00 124.05 ? 59  PHE D CE2 1 
ATOM   8379  C  CZ  . PHE D 2 29  ? 53.347  0.922   -60.590 1.00 122.66 ? 59  PHE D CZ  1 
ATOM   8380  N  N   . HIS D 2 30  ? 50.730  4.372   -57.353 1.00 107.67 ? 60  HIS D N   1 
ATOM   8381  C  CA  . HIS D 2 30  ? 51.271  5.296   -56.344 1.00 107.14 ? 60  HIS D CA  1 
ATOM   8382  C  C   . HIS D 2 30  ? 52.739  5.796   -56.620 1.00 116.32 ? 60  HIS D C   1 
ATOM   8383  O  O   . HIS D 2 30  ? 53.425  5.318   -57.535 1.00 118.57 ? 60  HIS D O   1 
ATOM   8384  C  CB  . HIS D 2 30  ? 51.123  4.679   -54.928 1.00 104.85 ? 60  HIS D CB  1 
ATOM   8385  C  CG  . HIS D 2 30  ? 49.751  4.101   -54.657 1.00 106.20 ? 60  HIS D CG  1 
ATOM   8386  N  ND1 . HIS D 2 30  ? 48.603  4.899   -54.641 1.00 107.05 ? 60  HIS D ND1 1 
ATOM   8387  C  CD2 . HIS D 2 30  ? 49.379  2.818   -54.429 1.00 106.32 ? 60  HIS D CD2 1 
ATOM   8388  C  CE1 . HIS D 2 30  ? 47.590  4.078   -54.403 1.00 104.46 ? 60  HIS D CE1 1 
ATOM   8389  N  NE2 . HIS D 2 30  ? 48.005  2.819   -54.262 1.00 104.48 ? 60  HIS D NE2 1 
ATOM   8390  N  N   . HIS D 2 31  ? 53.166  6.806   -55.822 1.00 112.81 ? 61  HIS D N   1 
ATOM   8391  C  CA  . HIS D 2 31  ? 54.422  7.588   -55.857 1.00 113.52 ? 61  HIS D CA  1 
ATOM   8392  C  C   . HIS D 2 31  ? 54.868  7.893   -54.406 1.00 114.74 ? 61  HIS D C   1 
ATOM   8393  O  O   . HIS D 2 31  ? 55.966  8.405   -54.183 1.00 114.10 ? 61  HIS D O   1 
ATOM   8394  C  CB  . HIS D 2 31  ? 54.084  8.944   -56.501 1.00 115.68 ? 61  HIS D CB  1 
ATOM   8395  C  CG  . HIS D 2 31  ? 52.927  9.630   -55.813 1.00 117.77 ? 61  HIS D CG  1 
ATOM   8396  N  ND1 . HIS D 2 31  ? 51.613  9.207   -56.004 1.00 118.33 ? 61  HIS D ND1 1 
ATOM   8397  C  CD2 . HIS D 2 31  ? 52.932  10.615  -54.885 1.00 119.25 ? 61  HIS D CD2 1 
ATOM   8398  C  CE1 . HIS D 2 31  ? 50.871  9.978   -55.226 1.00 116.71 ? 61  HIS D CE1 1 
ATOM   8399  N  NE2 . HIS D 2 31  ? 51.619  10.836  -54.530 1.00 117.58 ? 61  HIS D NE2 1 
ATOM   8400  N  N   . LEU D 2 32  ? 53.929  7.658   -53.448 1.00 108.65 ? 62  LEU D N   1 
ATOM   8401  C  CA  . LEU D 2 32  ? 53.913  7.877   -51.992 1.00 105.74 ? 62  LEU D CA  1 
ATOM   8402  C  C   . LEU D 2 32  ? 55.123  7.329   -51.190 1.00 109.30 ? 62  LEU D C   1 
ATOM   8403  O  O   . LEU D 2 32  ? 55.975  6.629   -51.743 1.00 110.38 ? 62  LEU D O   1 
ATOM   8404  C  CB  . LEU D 2 32  ? 52.604  7.277   -51.433 1.00 103.12 ? 62  LEU D CB  1 
ATOM   8405  C  CG  . LEU D 2 32  ? 51.279  7.944   -51.817 1.00 106.53 ? 62  LEU D CG  1 
ATOM   8406  C  CD1 . LEU D 2 32  ? 50.105  7.156   -51.259 1.00 104.78 ? 62  LEU D CD1 1 
ATOM   8407  C  CD2 . LEU D 2 32  ? 51.205  9.379   -51.314 1.00 107.67 ? 62  LEU D CD2 1 
ATOM   8408  N  N   . SER D 2 33  ? 55.174  7.649   -49.866 1.00 103.31 ? 63  SER D N   1 
ATOM   8409  C  CA  . SER D 2 33  ? 56.217  7.228   -48.908 1.00 101.65 ? 63  SER D CA  1 
ATOM   8410  C  C   . SER D 2 33  ? 56.193  5.712   -48.613 1.00 102.06 ? 63  SER D C   1 
ATOM   8411  O  O   . SER D 2 33  ? 57.202  5.164   -48.168 1.00 101.01 ? 63  SER D O   1 
ATOM   8412  C  CB  . SER D 2 33  ? 56.103  8.015   -47.598 1.00 103.42 ? 63  SER D CB  1 
ATOM   8413  O  OG  . SER D 2 33  ? 56.219  9.417   -47.780 1.00 111.16 ? 63  SER D OG  1 
ATOM   8414  N  N   . VAL D 2 34  ? 55.032  5.057   -48.840 1.00 96.86  ? 64  VAL D N   1 
ATOM   8415  C  CA  . VAL D 2 34  ? 54.780  3.627   -48.620 1.00 94.82  ? 64  VAL D CA  1 
ATOM   8416  C  C   . VAL D 2 34  ? 53.974  3.017   -49.795 1.00 97.15  ? 64  VAL D C   1 
ATOM   8417  O  O   . VAL D 2 34  ? 53.313  3.750   -50.537 1.00 96.34  ? 64  VAL D O   1 
ATOM   8418  C  CB  . VAL D 2 34  ? 54.123  3.402   -47.231 1.00 96.54  ? 64  VAL D CB  1 
ATOM   8419  C  CG1 . VAL D 2 34  ? 52.590  3.444   -47.292 1.00 95.34  ? 64  VAL D CG1 1 
ATOM   8420  C  CG2 . VAL D 2 34  ? 54.612  2.117   -46.596 1.00 95.70  ? 64  VAL D CG2 1 
ATOM   8421  N  N   . VAL D 2 35  ? 54.023  1.687   -49.952 1.00 92.95  ? 65  VAL D N   1 
ATOM   8422  C  CA  . VAL D 2 35  ? 53.341  1.017   -51.056 1.00 92.45  ? 65  VAL D CA  1 
ATOM   8423  C  C   . VAL D 2 35  ? 52.396  -0.127  -50.558 1.00 91.96  ? 65  VAL D C   1 
ATOM   8424  O  O   . VAL D 2 35  ? 52.741  -0.844  -49.621 1.00 89.80  ? 65  VAL D O   1 
ATOM   8425  C  CB  . VAL D 2 35  ? 54.398  0.581   -52.118 1.00 98.37  ? 65  VAL D CB  1 
ATOM   8426  C  CG1 . VAL D 2 35  ? 54.655  -0.924  -52.143 1.00 98.43  ? 65  VAL D CG1 1 
ATOM   8427  C  CG2 . VAL D 2 35  ? 54.053  1.111   -53.501 1.00 99.63  ? 65  VAL D CG2 1 
ATOM   8428  N  N   . PRO D 2 36  ? 51.189  -0.288  -51.136 1.00 87.38  ? 66  PRO D N   1 
ATOM   8429  C  CA  . PRO D 2 36  ? 50.313  -1.367  -50.667 1.00 86.06  ? 66  PRO D CA  1 
ATOM   8430  C  C   . PRO D 2 36  ? 50.672  -2.747  -51.230 1.00 90.80  ? 66  PRO D C   1 
ATOM   8431  O  O   . PRO D 2 36  ? 51.085  -2.872  -52.394 1.00 91.72  ? 66  PRO D O   1 
ATOM   8432  C  CB  . PRO D 2 36  ? 48.933  -0.934  -51.159 1.00 87.12  ? 66  PRO D CB  1 
ATOM   8433  C  CG  . PRO D 2 36  ? 49.197  -0.127  -52.372 1.00 92.68  ? 66  PRO D CG  1 
ATOM   8434  C  CD  . PRO D 2 36  ? 50.568  0.466   -52.246 1.00 89.25  ? 66  PRO D CD  1 
ATOM   8435  N  N   . ARG D 2 37  ? 50.481  -3.783  -50.393 1.00 84.74  ? 67  ARG D N   1 
ATOM   8436  C  CA  . ARG D 2 37  ? 50.623  -5.194  -50.737 1.00 83.51  ? 67  ARG D CA  1 
ATOM   8437  C  C   . ARG D 2 37  ? 49.257  -5.807  -50.415 1.00 84.97  ? 67  ARG D C   1 
ATOM   8438  O  O   . ARG D 2 37  ? 49.040  -6.347  -49.334 1.00 83.37  ? 67  ARG D O   1 
ATOM   8439  C  CB  . ARG D 2 37  ? 51.783  -5.872  -49.990 1.00 79.40  ? 67  ARG D CB  1 
ATOM   8440  N  N   . VAL D 2 38  ? 48.313  -5.615  -51.345 1.00 81.41  ? 68  VAL D N   1 
ATOM   8441  C  CA  . VAL D 2 38  ? 46.908  -6.047  -51.292 1.00 79.98  ? 68  VAL D CA  1 
ATOM   8442  C  C   . VAL D 2 38  ? 46.742  -7.578  -51.379 1.00 86.77  ? 68  VAL D C   1 
ATOM   8443  O  O   . VAL D 2 38  ? 47.538  -8.242  -52.035 1.00 88.34  ? 68  VAL D O   1 
ATOM   8444  C  CB  . VAL D 2 38  ? 46.088  -5.316  -52.389 1.00 82.72  ? 68  VAL D CB  1 
ATOM   8445  C  CG1 . VAL D 2 38  ? 44.604  -5.628  -52.280 1.00 81.29  ? 68  VAL D CG1 1 
ATOM   8446  C  CG2 . VAL D 2 38  ? 46.316  -3.811  -52.333 1.00 82.05  ? 68  VAL D CG2 1 
ATOM   8447  N  N   . GLU D 2 39  ? 45.720  -8.132  -50.700 1.00 83.94  ? 69  GLU D N   1 
ATOM   8448  C  CA  . GLU D 2 39  ? 45.391  -9.557  -50.740 1.00 85.47  ? 69  GLU D CA  1 
ATOM   8449  C  C   . GLU D 2 39  ? 43.879  -9.668  -50.744 1.00 89.45  ? 69  GLU D C   1 
ATOM   8450  O  O   . GLU D 2 39  ? 43.247  -9.308  -49.749 1.00 87.81  ? 69  GLU D O   1 
ATOM   8451  C  CB  . GLU D 2 39  ? 45.942  -10.349 -49.535 1.00 86.84  ? 69  GLU D CB  1 
ATOM   8452  C  CG  . GLU D 2 39  ? 47.421  -10.175 -49.213 1.00 107.12 ? 69  GLU D CG  1 
ATOM   8453  C  CD  . GLU D 2 39  ? 47.683  -9.563  -47.844 1.00 135.98 ? 69  GLU D CD  1 
ATOM   8454  O  OE1 . GLU D 2 39  ? 47.178  -10.108 -46.836 1.00 140.11 ? 69  GLU D OE1 1 
ATOM   8455  O  OE2 . GLU D 2 39  ? 48.411  -8.547  -47.777 1.00 121.27 ? 69  GLU D OE2 1 
ATOM   8456  N  N   . LEU D 2 40  ? 43.286  -10.149 -51.856 1.00 86.77  ? 70  LEU D N   1 
ATOM   8457  C  CA  . LEU D 2 40  ? 41.836  -10.332 -51.925 1.00 85.24  ? 70  LEU D CA  1 
ATOM   8458  C  C   . LEU D 2 40  ? 41.478  -11.605 -51.198 1.00 89.74  ? 70  LEU D C   1 
ATOM   8459  O  O   . LEU D 2 40  ? 42.097  -12.652 -51.417 1.00 90.63  ? 70  LEU D O   1 
ATOM   8460  C  CB  . LEU D 2 40  ? 41.326  -10.349 -53.362 1.00 86.30  ? 70  LEU D CB  1 
ATOM   8461  C  CG  . LEU D 2 40  ? 40.672  -9.070  -53.869 1.00 90.17  ? 70  LEU D CG  1 
ATOM   8462  C  CD1 . LEU D 2 40  ? 41.638  -7.888  -53.861 1.00 89.38  ? 70  LEU D CD1 1 
ATOM   8463  C  CD2 . LEU D 2 40  ? 40.138  -9.269  -55.277 1.00 94.94  ? 70  LEU D CD2 1 
ATOM   8464  N  N   . VAL D 2 41  ? 40.534  -11.487 -50.274 1.00 85.57  ? 71  VAL D N   1 
ATOM   8465  C  CA  . VAL D 2 41  ? 40.087  -12.568 -49.413 1.00 85.95  ? 71  VAL D CA  1 
ATOM   8466  C  C   . VAL D 2 41  ? 38.599  -12.777 -49.634 1.00 93.20  ? 71  VAL D C   1 
ATOM   8467  O  O   . VAL D 2 41  ? 37.824  -11.816 -49.580 1.00 92.19  ? 71  VAL D O   1 
ATOM   8468  C  CB  . VAL D 2 41  ? 40.428  -12.199 -47.937 1.00 88.48  ? 71  VAL D CB  1 
ATOM   8469  C  CG1 . VAL D 2 41  ? 39.646  -13.027 -46.932 1.00 87.86  ? 71  VAL D CG1 1 
ATOM   8470  C  CG2 . VAL D 2 41  ? 41.922  -12.309 -47.668 1.00 88.68  ? 71  VAL D CG2 1 
ATOM   8471  N  N   . ALA D 2 42  ? 38.194  -14.023 -49.889 1.00 93.32  ? 72  ALA D N   1 
ATOM   8472  C  CA  . ALA D 2 42  ? 36.769  -14.308 -50.042 1.00 94.38  ? 72  ALA D CA  1 
ATOM   8473  C  C   . ALA D 2 42  ? 36.235  -14.887 -48.733 1.00 99.14  ? 72  ALA D C   1 
ATOM   8474  O  O   . ALA D 2 42  ? 36.798  -15.847 -48.195 1.00 100.08 ? 72  ALA D O   1 
ATOM   8475  C  CB  . ALA D 2 42  ? 36.531  -15.272 -51.189 1.00 97.27  ? 72  ALA D CB  1 
ATOM   8476  N  N   . MET D 2 43  ? 35.192  -14.267 -48.193 1.00 94.37  ? 73  MET D N   1 
ATOM   8477  C  CA  . MET D 2 43  ? 34.595  -14.734 -46.960 1.00 93.37  ? 73  MET D CA  1 
ATOM   8478  C  C   . MET D 2 43  ? 33.223  -15.309 -47.225 1.00 96.01  ? 73  MET D C   1 
ATOM   8479  O  O   . MET D 2 43  ? 32.387  -14.655 -47.856 1.00 96.25  ? 73  MET D O   1 
ATOM   8480  C  CB  . MET D 2 43  ? 34.562  -13.627 -45.921 1.00 94.50  ? 73  MET D CB  1 
ATOM   8481  C  CG  . MET D 2 43  ? 33.762  -13.995 -44.716 1.00 98.30  ? 73  MET D CG  1 
ATOM   8482  S  SD  . MET D 2 43  ? 34.512  -13.458 -43.198 1.00 102.21 ? 73  MET D SD  1 
ATOM   8483  C  CE  . MET D 2 43  ? 34.049  -11.807 -43.194 1.00 97.69  ? 73  MET D CE  1 
ATOM   8484  N  N   . ASN D 2 44  ? 32.997  -16.535 -46.729 1.00 91.74  ? 74  ASN D N   1 
ATOM   8485  C  CA  . ASN D 2 44  ? 31.750  -17.272 -46.912 1.00 91.59  ? 74  ASN D CA  1 
ATOM   8486  C  C   . ASN D 2 44  ? 30.609  -16.840 -45.968 1.00 88.19  ? 74  ASN D C   1 
ATOM   8487  O  O   . ASN D 2 44  ? 29.488  -16.642 -46.434 1.00 87.71  ? 74  ASN D O   1 
ATOM   8488  C  CB  . ASN D 2 44  ? 31.987  -18.779 -46.770 1.00 100.16 ? 74  ASN D CB  1 
ATOM   8489  C  CG  . ASN D 2 44  ? 33.130  -19.412 -47.549 1.00 148.92 ? 74  ASN D CG  1 
ATOM   8490  O  OD1 . ASN D 2 44  ? 33.974  -18.740 -48.190 1.00 150.67 ? 74  ASN D OD1 1 
ATOM   8491  N  ND2 . ASN D 2 44  ? 33.092  -20.776 -47.401 1.00 145.62 ? 74  ASN D ND2 1 
ATOM   8492  N  N   . GLU D 2 45  ? 30.885  -16.726 -44.658 1.00 79.81  ? 75  GLU D N   1 
ATOM   8493  C  CA  . GLU D 2 45  ? 29.877  -16.446 -43.635 1.00 77.42  ? 75  GLU D CA  1 
ATOM   8494  C  C   . GLU D 2 45  ? 29.954  -15.039 -43.026 1.00 76.17  ? 75  GLU D C   1 
ATOM   8495  O  O   . GLU D 2 45  ? 31.012  -14.423 -43.045 1.00 75.76  ? 75  GLU D O   1 
ATOM   8496  C  CB  . GLU D 2 45  ? 29.933  -17.531 -42.543 1.00 79.44  ? 75  GLU D CB  1 
ATOM   8497  C  CG  . GLU D 2 45  ? 29.775  -18.959 -43.064 1.00 92.41  ? 75  GLU D CG  1 
ATOM   8498  C  CD  . GLU D 2 45  ? 28.486  -19.308 -43.800 1.00 116.03 ? 75  GLU D CD  1 
ATOM   8499  O  OE1 . GLU D 2 45  ? 27.496  -18.542 -43.712 1.00 107.23 ? 75  GLU D OE1 1 
ATOM   8500  O  OE2 . GLU D 2 45  ? 28.463  -20.375 -44.456 1.00 108.61 ? 75  GLU D OE2 1 
ATOM   8501  N  N   . THR D 2 46  ? 28.831  -14.527 -42.484 1.00 69.28  ? 76  THR D N   1 
ATOM   8502  C  CA  . THR D 2 46  ? 28.778  -13.177 -41.906 1.00 66.48  ? 76  THR D CA  1 
ATOM   8503  C  C   . THR D 2 46  ? 28.300  -13.108 -40.450 1.00 68.58  ? 76  THR D C   1 
ATOM   8504  O  O   . THR D 2 46  ? 27.912  -12.034 -39.989 1.00 67.48  ? 76  THR D O   1 
ATOM   8505  C  CB  . THR D 2 46  ? 27.959  -12.217 -42.777 1.00 72.31  ? 76  THR D CB  1 
ATOM   8506  O  OG1 . THR D 2 46  ? 26.682  -12.779 -43.101 1.00 75.35  ? 76  THR D OG1 1 
ATOM   8507  C  CG2 . THR D 2 46  ? 28.687  -11.806 -44.005 1.00 66.66  ? 76  THR D CG2 1 
ATOM   8508  N  N   . ASP D 2 47  ? 28.358  -14.222 -39.719 1.00 65.59  ? 77  ASP D N   1 
ATOM   8509  C  CA  . ASP D 2 47  ? 28.017  -14.276 -38.289 1.00 65.22  ? 77  ASP D CA  1 
ATOM   8510  C  C   . ASP D 2 47  ? 29.202  -13.689 -37.438 1.00 68.42  ? 77  ASP D C   1 
ATOM   8511  O  O   . ASP D 2 47  ? 30.312  -13.563 -37.992 1.00 67.07  ? 77  ASP D O   1 
ATOM   8512  C  CB  . ASP D 2 47  ? 27.753  -15.725 -37.894 1.00 68.20  ? 77  ASP D CB  1 
ATOM   8513  C  CG  . ASP D 2 47  ? 28.983  -16.597 -38.044 1.00 74.40  ? 77  ASP D CG  1 
ATOM   8514  O  OD1 . ASP D 2 47  ? 29.255  -17.037 -39.173 1.00 74.45  ? 77  ASP D OD1 1 
ATOM   8515  O  OD2 . ASP D 2 47  ? 29.687  -16.817 -37.025 1.00 76.42  ? 77  ASP D OD2 1 
ATOM   8516  N  N   . PRO D 2 48  ? 29.013  -13.329 -36.122 1.00 64.49  ? 78  PRO D N   1 
ATOM   8517  C  CA  . PRO D 2 48  ? 30.133  -12.750 -35.349 1.00 63.48  ? 78  PRO D CA  1 
ATOM   8518  C  C   . PRO D 2 48  ? 31.399  -13.602 -35.341 1.00 69.49  ? 78  PRO D C   1 
ATOM   8519  O  O   . PRO D 2 48  ? 32.469  -13.066 -35.667 1.00 68.22  ? 78  PRO D O   1 
ATOM   8520  C  CB  . PRO D 2 48  ? 29.554  -12.542 -33.947 1.00 64.00  ? 78  PRO D CB  1 
ATOM   8521  C  CG  . PRO D 2 48  ? 28.123  -12.430 -34.163 1.00 68.48  ? 78  PRO D CG  1 
ATOM   8522  C  CD  . PRO D 2 48  ? 27.794  -13.373 -35.297 1.00 65.32  ? 78  PRO D CD  1 
ATOM   8523  N  N   . LYS D 2 49  ? 31.276  -14.929 -35.057 1.00 67.47  ? 79  LYS D N   1 
ATOM   8524  C  CA  . LYS D 2 49  ? 32.435  -15.818 -34.997 1.00 67.98  ? 79  LYS D CA  1 
ATOM   8525  C  C   . LYS D 2 49  ? 33.222  -15.841 -36.293 1.00 72.71  ? 79  LYS D C   1 
ATOM   8526  O  O   . LYS D 2 49  ? 34.434  -15.656 -36.250 1.00 73.80  ? 79  LYS D O   1 
ATOM   8527  C  CB  . LYS D 2 49  ? 32.089  -17.243 -34.528 1.00 71.92  ? 79  LYS D CB  1 
ATOM   8528  C  CG  . LYS D 2 49  ? 33.350  -18.061 -34.195 1.00 84.71  ? 79  LYS D CG  1 
ATOM   8529  C  CD  . LYS D 2 49  ? 33.072  -19.464 -33.659 1.00 92.87  ? 79  LYS D CD  1 
ATOM   8530  C  CE  . LYS D 2 49  ? 33.996  -20.514 -34.229 1.00 102.97 ? 79  LYS D CE  1 
ATOM   8531  N  NZ  . LYS D 2 49  ? 35.432  -20.165 -34.060 1.00 124.72 ? 79  LYS D NZ  1 
ATOM   8532  N  N   . SER D 2 50  ? 32.546  -16.033 -37.436 1.00 67.77  ? 80  SER D N   1 
ATOM   8533  C  CA  . SER D 2 50  ? 33.203  -16.082 -38.743 1.00 66.64  ? 80  SER D CA  1 
ATOM   8534  C  C   . SER D 2 50  ? 33.994  -14.825 -39.071 1.00 69.06  ? 80  SER D C   1 
ATOM   8535  O  O   . SER D 2 50  ? 35.187  -14.925 -39.348 1.00 69.07  ? 80  SER D O   1 
ATOM   8536  C  CB  . SER D 2 50  ? 32.197  -16.408 -39.828 1.00 68.85  ? 80  SER D CB  1 
ATOM   8537  O  OG  . SER D 2 50  ? 31.708  -17.711 -39.567 1.00 77.83  ? 80  SER D OG  1 
ATOM   8538  N  N   . ILE D 2 51  ? 33.357  -13.647 -38.959 1.00 64.07  ? 81  ILE D N   1 
ATOM   8539  C  CA  . ILE D 2 51  ? 34.008  -12.367 -39.211 1.00 62.21  ? 81  ILE D CA  1 
ATOM   8540  C  C   . ILE D 2 51  ? 35.191  -12.144 -38.227 1.00 68.16  ? 81  ILE D C   1 
ATOM   8541  O  O   . ILE D 2 51  ? 36.291  -11.812 -38.676 1.00 68.66  ? 81  ILE D O   1 
ATOM   8542  C  CB  . ILE D 2 51  ? 32.974  -11.196 -39.239 1.00 62.36  ? 81  ILE D CB  1 
ATOM   8543  C  CG1 . ILE D 2 51  ? 31.835  -11.493 -40.248 1.00 61.92  ? 81  ILE D CG1 1 
ATOM   8544  C  CG2 . ILE D 2 51  ? 33.669  -9.849  -39.528 1.00 61.15  ? 81  ILE D CG2 1 
ATOM   8545  C  CD1 . ILE D 2 51  ? 30.805  -10.394 -40.465 1.00 63.98  ? 81  ILE D CD1 1 
ATOM   8546  N  N   . ILE D 2 52  ? 34.975  -12.347 -36.908 1.00 64.55  ? 82  ILE D N   1 
ATOM   8547  C  CA  . ILE D 2 52  ? 36.049  -12.134 -35.923 1.00 63.43  ? 82  ILE D CA  1 
ATOM   8548  C  C   . ILE D 2 52  ? 37.228  -13.040 -36.263 1.00 67.63  ? 82  ILE D C   1 
ATOM   8549  O  O   . ILE D 2 52  ? 38.333  -12.533 -36.436 1.00 66.75  ? 82  ILE D O   1 
ATOM   8550  C  CB  . ILE D 2 52  ? 35.589  -12.253 -34.432 1.00 65.73  ? 82  ILE D CB  1 
ATOM   8551  C  CG1 . ILE D 2 52  ? 34.626  -11.131 -34.037 1.00 64.53  ? 82  ILE D CG1 1 
ATOM   8552  C  CG2 . ILE D 2 52  ? 36.787  -12.261 -33.486 1.00 67.50  ? 82  ILE D CG2 1 
ATOM   8553  C  CD1 . ILE D 2 52  ? 33.796  -11.413 -32.762 1.00 71.83  ? 82  ILE D CD1 1 
ATOM   8554  N  N   . THR D 2 53  ? 36.961  -14.354 -36.437 1.00 65.71  ? 83  THR D N   1 
ATOM   8555  C  CA  . THR D 2 53  ? 37.934  -15.387 -36.773 1.00 67.32  ? 83  THR D CA  1 
ATOM   8556  C  C   . THR D 2 53  ? 38.684  -15.095 -38.072 1.00 74.08  ? 83  THR D C   1 
ATOM   8557  O  O   . THR D 2 53  ? 39.908  -15.162 -38.066 1.00 74.84  ? 83  THR D O   1 
ATOM   8558  C  CB  . THR D 2 53  ? 37.269  -16.749 -36.767 1.00 76.86  ? 83  THR D CB  1 
ATOM   8559  O  OG1 . THR D 2 53  ? 36.947  -17.044 -35.419 1.00 76.85  ? 83  THR D OG1 1 
ATOM   8560  C  CG2 . THR D 2 53  ? 38.163  -17.837 -37.288 1.00 81.50  ? 83  THR D CG2 1 
ATOM   8561  N  N   . ARG D 2 54  ? 37.975  -14.756 -39.162 1.00 71.40  ? 84  ARG D N   1 
ATOM   8562  C  CA  . ARG D 2 54  ? 38.615  -14.455 -40.433 1.00 71.97  ? 84  ARG D CA  1 
ATOM   8563  C  C   . ARG D 2 54  ? 39.615  -13.333 -40.316 1.00 78.82  ? 84  ARG D C   1 
ATOM   8564  O  O   . ARG D 2 54  ? 40.768  -13.548 -40.679 1.00 80.41  ? 84  ARG D O   1 
ATOM   8565  C  CB  . ARG D 2 54  ? 37.598  -14.157 -41.536 1.00 70.70  ? 84  ARG D CB  1 
ATOM   8566  C  CG  . ARG D 2 54  ? 38.146  -14.313 -42.963 1.00 81.42  ? 84  ARG D CG  1 
ATOM   8567  C  CD  . ARG D 2 54  ? 38.597  -15.737 -43.252 1.00 95.94  ? 84  ARG D CD  1 
ATOM   8568  N  NE  . ARG D 2 54  ? 38.609  -16.054 -44.680 1.00 106.33 ? 84  ARG D NE  1 
ATOM   8569  C  CZ  . ARG D 2 54  ? 39.709  -16.129 -45.422 1.00 117.87 ? 84  ARG D CZ  1 
ATOM   8570  N  NH1 . ARG D 2 54  ? 40.900  -15.877 -44.886 1.00 103.67 ? 84  ARG D NH1 1 
ATOM   8571  N  NH2 . ARG D 2 54  ? 39.628  -16.442 -46.712 1.00 96.89  ? 84  ARG D NH2 1 
ATOM   8572  N  N   . ILE D 2 55  ? 39.207  -12.165 -39.779 1.00 76.44  ? 85  ILE D N   1 
ATOM   8573  C  CA  . ILE D 2 55  ? 40.092  -11.002 -39.646 1.00 77.47  ? 85  ILE D CA  1 
ATOM   8574  C  C   . ILE D 2 55  ? 41.293  -11.327 -38.746 1.00 86.44  ? 85  ILE D C   1 
ATOM   8575  O  O   . ILE D 2 55  ? 42.424  -11.014 -39.116 1.00 86.89  ? 85  ILE D O   1 
ATOM   8576  C  CB  . ILE D 2 55  ? 39.337  -9.701  -39.241 1.00 79.16  ? 85  ILE D CB  1 
ATOM   8577  C  CG1 . ILE D 2 55  ? 38.343  -9.303  -40.338 1.00 80.27  ? 85  ILE D CG1 1 
ATOM   8578  C  CG2 . ILE D 2 55  ? 40.295  -8.542  -39.024 1.00 78.51  ? 85  ILE D CG2 1 
ATOM   8579  C  CD1 . ILE D 2 55  ? 37.238  -8.341  -39.921 1.00 92.54  ? 85  ILE D CD1 1 
ATOM   8580  N  N   . CYS D 2 56  ? 41.059  -12.041 -37.646 1.00 86.34  ? 86  CYS D N   1 
ATOM   8581  C  CA  . CYS D 2 56  ? 42.098  -12.410 -36.697 1.00 88.66  ? 86  CYS D CA  1 
ATOM   8582  C  C   . CYS D 2 56  ? 43.156  -13.354 -37.263 1.00 91.65  ? 86  CYS D C   1 
ATOM   8583  O  O   . CYS D 2 56  ? 44.326  -13.228 -36.893 1.00 91.62  ? 86  CYS D O   1 
ATOM   8584  C  CB  . CYS D 2 56  ? 41.474  -12.949 -35.416 1.00 91.03  ? 86  CYS D CB  1 
ATOM   8585  S  SG  . CYS D 2 56  ? 40.658  -11.665 -34.422 1.00 95.23  ? 86  CYS D SG  1 
ATOM   8586  N  N   . ASP D 2 57  ? 42.765  -14.250 -38.182 1.00 87.61  ? 87  ASP D N   1 
ATOM   8587  C  CA  . ASP D 2 57  ? 43.677  -15.186 -38.839 1.00 88.11  ? 87  ASP D CA  1 
ATOM   8588  C  C   . ASP D 2 57  ? 44.504  -14.460 -39.887 1.00 90.61  ? 87  ASP D C   1 
ATOM   8589  O  O   . ASP D 2 57  ? 45.696  -14.725 -40.012 1.00 90.30  ? 87  ASP D O   1 
ATOM   8590  C  CB  . ASP D 2 57  ? 42.920  -16.380 -39.445 1.00 91.22  ? 87  ASP D CB  1 
ATOM   8591  C  CG  . ASP D 2 57  ? 42.225  -17.277 -38.426 1.00 102.86 ? 87  ASP D CG  1 
ATOM   8592  O  OD1 . ASP D 2 57  ? 42.468  -17.099 -37.204 1.00 104.05 ? 87  ASP D OD1 1 
ATOM   8593  O  OD2 . ASP D 2 57  ? 41.405  -18.129 -38.846 1.00 106.95 ? 87  ASP D OD2 1 
ATOM   8594  N  N   . LEU D 2 58  ? 43.894  -13.492 -40.586 1.00 86.35  ? 88  LEU D N   1 
ATOM   8595  C  CA  . LEU D 2 58  ? 44.590  -12.674 -41.580 1.00 86.21  ? 88  LEU D CA  1 
ATOM   8596  C  C   . LEU D 2 58  ? 45.664  -11.832 -40.913 1.00 87.27  ? 88  LEU D C   1 
ATOM   8597  O  O   . LEU D 2 58  ? 46.667  -11.495 -41.529 1.00 85.72  ? 88  LEU D O   1 
ATOM   8598  C  CB  . LEU D 2 58  ? 43.603  -11.742 -42.310 1.00 86.12  ? 88  LEU D CB  1 
ATOM   8599  C  CG  . LEU D 2 58  ? 42.549  -12.368 -43.216 1.00 92.12  ? 88  LEU D CG  1 
ATOM   8600  C  CD1 . LEU D 2 58  ? 41.849  -11.301 -44.013 1.00 92.66  ? 88  LEU D CD1 1 
ATOM   8601  C  CD2 . LEU D 2 58  ? 43.151  -13.371 -44.172 1.00 96.14  ? 88  LEU D CD2 1 
ATOM   8602  N  N   . MET D 2 59  ? 45.421  -11.479 -39.653 1.00 84.34  ? 89  MET D N   1 
ATOM   8603  C  CA  . MET D 2 59  ? 46.293  -10.657 -38.827 1.00 84.23  ? 89  MET D CA  1 
ATOM   8604  C  C   . MET D 2 59  ? 47.455  -11.467 -38.307 1.00 90.67  ? 89  MET D C   1 
ATOM   8605  O  O   . MET D 2 59  ? 48.574  -10.951 -38.270 1.00 92.02  ? 89  MET D O   1 
ATOM   8606  C  CB  . MET D 2 59  ? 45.506  -10.029 -37.675 1.00 84.94  ? 89  MET D CB  1 
ATOM   8607  C  CG  . MET D 2 59  ? 44.669  -8.853  -38.088 1.00 87.41  ? 89  MET D CG  1 
ATOM   8608  S  SD  . MET D 2 59  ? 44.190  -7.987  -36.594 1.00 90.73  ? 89  MET D SD  1 
ATOM   8609  C  CE  . MET D 2 59  ? 42.479  -8.153  -36.645 1.00 86.74  ? 89  MET D CE  1 
ATOM   8610  N  N   . SER D 2 60  ? 47.199  -12.742 -37.934 1.00 87.17  ? 90  SER D N   1 
ATOM   8611  C  CA  . SER D 2 60  ? 48.224  -13.665 -37.454 1.00 87.91  ? 90  SER D CA  1 
ATOM   8612  C  C   . SER D 2 60  ? 49.132  -14.150 -38.601 1.00 95.22  ? 90  SER D C   1 
ATOM   8613  O  O   . SER D 2 60  ? 50.222  -14.674 -38.343 1.00 97.17  ? 90  SER D O   1 
ATOM   8614  C  CB  . SER D 2 60  ? 47.602  -14.825 -36.673 1.00 90.71  ? 90  SER D CB  1 
ATOM   8615  O  OG  . SER D 2 60  ? 47.537  -16.049 -37.391 1.00 99.81  ? 90  SER D OG  1 
ATOM   8616  N  N   . ASP D 2 61  ? 48.701  -13.944 -39.857 1.00 91.90  ? 91  ASP D N   1 
ATOM   8617  C  CA  . ASP D 2 61  ? 49.472  -14.341 -41.025 1.00 93.39  ? 91  ASP D CA  1 
ATOM   8618  C  C   . ASP D 2 61  ? 50.252  -13.202 -41.665 1.00 98.97  ? 91  ASP D C   1 
ATOM   8619  O  O   . ASP D 2 61  ? 51.448  -13.108 -41.416 1.00 100.27 ? 91  ASP D O   1 
ATOM   8620  C  CB  . ASP D 2 61  ? 48.598  -15.064 -42.050 1.00 96.13  ? 91  ASP D CB  1 
ATOM   8621  C  CG  . ASP D 2 61  ? 48.231  -16.466 -41.619 1.00 111.75 ? 91  ASP D CG  1 
ATOM   8622  O  OD1 . ASP D 2 61  ? 48.124  -16.710 -40.386 1.00 111.17 ? 91  ASP D OD1 1 
ATOM   8623  O  OD2 . ASP D 2 61  ? 48.045  -17.322 -42.504 1.00 122.84 ? 91  ASP D OD2 1 
ATOM   8624  N  N   . ARG D 2 62  ? 49.610  -12.352 -42.484 1.00 95.73  ? 92  ARG D N   1 
ATOM   8625  C  CA  . ARG D 2 62  ? 50.304  -11.304 -43.229 1.00 96.21  ? 92  ARG D CA  1 
ATOM   8626  C  C   . ARG D 2 62  ? 50.722  -10.059 -42.422 1.00 99.03  ? 92  ARG D C   1 
ATOM   8627  O  O   . ARG D 2 62  ? 51.626  -9.366  -42.899 1.00 101.27 ? 92  ARG D O   1 
ATOM   8628  C  CB  . ARG D 2 62  ? 49.498  -10.872 -44.486 1.00 98.48  ? 92  ARG D CB  1 
ATOM   8629  C  CG  . ARG D 2 62  ? 50.375  -10.459 -45.706 1.00 113.30 ? 92  ARG D CG  1 
ATOM   8630  C  CD  . ARG D 2 62  ? 50.739  -8.968  -45.746 1.00 115.56 ? 92  ARG D CD  1 
ATOM   8631  N  NE  . ARG D 2 62  ? 51.759  -8.630  -46.743 1.00 112.10 ? 92  ARG D NE  1 
ATOM   8632  C  CZ  . ARG D 2 62  ? 52.613  -7.616  -46.630 1.00 122.76 ? 92  ARG D CZ  1 
ATOM   8633  N  NH1 . ARG D 2 62  ? 52.612  -6.853  -45.543 1.00 105.19 ? 92  ARG D NH1 1 
ATOM   8634  N  NH2 . ARG D 2 62  ? 53.498  -7.377  -47.587 1.00 113.91 ? 92  ARG D NH2 1 
ATOM   8635  N  N   . LYS D 2 63  ? 50.144  -9.765  -41.231 1.00 91.91  ? 93  LYS D N   1 
ATOM   8636  C  CA  . LYS D 2 63  ? 50.477  -8.510  -40.501 1.00 90.19  ? 93  LYS D CA  1 
ATOM   8637  C  C   . LYS D 2 63  ? 49.869  -7.358  -41.340 1.00 92.05  ? 93  LYS D C   1 
ATOM   8638  O  O   . LYS D 2 63  ? 50.505  -6.804  -42.260 1.00 91.92  ? 93  LYS D O   1 
ATOM   8639  C  CB  . LYS D 2 63  ? 51.996  -8.316  -40.239 1.00 92.64  ? 93  LYS D CB  1 
ATOM   8640  N  N   . ILE D 2 64  ? 48.583  -7.073  -41.026 1.00 85.14  ? 94  ILE D N   1 
ATOM   8641  C  CA  . ILE D 2 64  ? 47.668  -6.156  -41.712 1.00 82.00  ? 94  ILE D CA  1 
ATOM   8642  C  C   . ILE D 2 64  ? 47.675  -4.731  -41.142 1.00 80.31  ? 94  ILE D C   1 
ATOM   8643  O  O   . ILE D 2 64  ? 47.375  -4.509  -39.961 1.00 77.95  ? 94  ILE D O   1 
ATOM   8644  C  CB  . ILE D 2 64  ? 46.243  -6.800  -41.723 1.00 83.52  ? 94  ILE D CB  1 
ATOM   8645  C  CG1 . ILE D 2 64  ? 46.242  -8.161  -42.444 1.00 84.51  ? 94  ILE D CG1 1 
ATOM   8646  C  CG2 . ILE D 2 64  ? 45.175  -5.879  -42.279 1.00 83.19  ? 94  ILE D CG2 1 
ATOM   8647  C  CD1 . ILE D 2 64  ? 46.923  -8.186  -43.847 1.00 95.50  ? 94  ILE D CD1 1 
ATOM   8648  N  N   . GLN D 2 65  ? 47.993  -3.769  -42.029 1.00 74.31  ? 95  GLN D N   1 
ATOM   8649  C  CA  . GLN D 2 65  ? 48.005  -2.348  -41.732 1.00 72.39  ? 95  GLN D CA  1 
ATOM   8650  C  C   . GLN D 2 65  ? 46.564  -1.761  -41.686 1.00 73.64  ? 95  GLN D C   1 
ATOM   8651  O  O   . GLN D 2 65  ? 46.309  -0.844  -40.905 1.00 73.02  ? 95  GLN D O   1 
ATOM   8652  C  CB  . GLN D 2 65  ? 48.898  -1.617  -42.740 1.00 74.58  ? 95  GLN D CB  1 
ATOM   8653  C  CG  . GLN D 2 65  ? 49.462  -0.264  -42.294 1.00 88.67  ? 95  GLN D CG  1 
ATOM   8654  C  CD  . GLN D 2 65  ? 50.191  -0.264  -40.970 1.00 99.67  ? 95  GLN D CD  1 
ATOM   8655  O  OE1 . GLN D 2 65  ? 49.687  0.265   -39.991 1.00 92.99  ? 95  GLN D OE1 1 
ATOM   8656  N  NE2 . GLN D 2 65  ? 51.417  -0.766  -40.918 1.00 90.15  ? 95  GLN D NE2 1 
ATOM   8657  N  N   . GLY D 2 66  ? 45.651  -2.332  -42.482 1.00 67.43  ? 96  GLY D N   1 
ATOM   8658  C  CA  . GLY D 2 66  ? 44.246  -1.942  -42.571 1.00 64.80  ? 96  GLY D CA  1 
ATOM   8659  C  C   . GLY D 2 66  ? 43.422  -2.907  -43.408 1.00 65.55  ? 96  GLY D C   1 
ATOM   8660  O  O   . GLY D 2 66  ? 43.968  -3.605  -44.276 1.00 64.73  ? 96  GLY D O   1 
ATOM   8661  N  N   . VAL D 2 67  ? 42.085  -2.937  -43.169 1.00 59.32  ? 97  VAL D N   1 
ATOM   8662  C  CA  . VAL D 2 67  ? 41.146  -3.826  -43.873 1.00 58.75  ? 97  VAL D CA  1 
ATOM   8663  C  C   . VAL D 2 67  ? 40.149  -3.035  -44.731 1.00 64.85  ? 97  VAL D C   1 
ATOM   8664  O  O   . VAL D 2 67  ? 39.609  -2.036  -44.278 1.00 64.21  ? 97  VAL D O   1 
ATOM   8665  C  CB  . VAL D 2 67  ? 40.408  -4.794  -42.878 1.00 60.70  ? 97  VAL D CB  1 
ATOM   8666  C  CG1 . VAL D 2 67  ? 39.411  -5.711  -43.588 1.00 60.12  ? 97  VAL D CG1 1 
ATOM   8667  C  CG2 . VAL D 2 67  ? 41.390  -5.626  -42.046 1.00 60.46  ? 97  VAL D CG2 1 
ATOM   8668  N  N   . VAL D 2 68  ? 39.885  -3.504  -45.950 1.00 64.78  ? 98  VAL D N   1 
ATOM   8669  C  CA  . VAL D 2 68  ? 38.843  -2.975  -46.836 1.00 66.34  ? 98  VAL D CA  1 
ATOM   8670  C  C   . VAL D 2 68  ? 37.728  -4.070  -46.879 1.00 72.71  ? 98  VAL D C   1 
ATOM   8671  O  O   . VAL D 2 68  ? 37.982  -5.181  -47.350 1.00 73.77  ? 98  VAL D O   1 
ATOM   8672  C  CB  . VAL D 2 68  ? 39.381  -2.606  -48.246 1.00 71.18  ? 98  VAL D CB  1 
ATOM   8673  C  CG1 . VAL D 2 68  ? 38.233  -2.284  -49.204 1.00 71.17  ? 98  VAL D CG1 1 
ATOM   8674  C  CG2 . VAL D 2 68  ? 40.357  -1.438  -48.166 1.00 71.06  ? 98  VAL D CG2 1 
ATOM   8675  N  N   . PHE D 2 69  ? 36.536  -3.778  -46.345 1.00 68.61  ? 99  PHE D N   1 
ATOM   8676  C  CA  . PHE D 2 69  ? 35.439  -4.751  -46.277 1.00 69.01  ? 99  PHE D CA  1 
ATOM   8677  C  C   . PHE D 2 69  ? 34.216  -4.417  -47.161 1.00 73.67  ? 99  PHE D C   1 
ATOM   8678  O  O   . PHE D 2 69  ? 33.681  -3.304  -47.097 1.00 73.42  ? 99  PHE D O   1 
ATOM   8679  C  CB  . PHE D 2 69  ? 34.980  -4.920  -44.815 1.00 70.07  ? 99  PHE D CB  1 
ATOM   8680  C  CG  . PHE D 2 69  ? 34.196  -6.181  -44.526 1.00 72.19  ? 99  PHE D CG  1 
ATOM   8681  C  CD1 . PHE D 2 69  ? 32.831  -6.250  -44.785 1.00 74.22  ? 99  PHE D CD1 1 
ATOM   8682  C  CD2 . PHE D 2 69  ? 34.817  -7.290  -43.958 1.00 75.18  ? 99  PHE D CD2 1 
ATOM   8683  C  CE1 . PHE D 2 69  ? 32.113  -7.415  -44.507 1.00 75.26  ? 99  PHE D CE1 1 
ATOM   8684  C  CE2 . PHE D 2 69  ? 34.088  -8.446  -43.666 1.00 77.36  ? 99  PHE D CE2 1 
ATOM   8685  C  CZ  . PHE D 2 69  ? 32.746  -8.500  -43.942 1.00 74.54  ? 99  PHE D CZ  1 
ATOM   8686  N  N   . ALA D 2 70  ? 33.722  -5.418  -47.909 1.00 70.59  ? 100 ALA D N   1 
ATOM   8687  C  CA  . ALA D 2 70  ? 32.536  -5.285  -48.761 1.00 71.00  ? 100 ALA D CA  1 
ATOM   8688  C  C   . ALA D 2 70  ? 31.681  -6.530  -48.698 1.00 76.81  ? 100 ALA D C   1 
ATOM   8689  O  O   . ALA D 2 70  ? 32.201  -7.650  -48.756 1.00 77.47  ? 100 ALA D O   1 
ATOM   8690  C  CB  . ALA D 2 70  ? 32.939  -5.039  -50.195 1.00 73.07  ? 100 ALA D CB  1 
ATOM   8691  N  N   . ASP D 2 71  ? 30.362  -6.339  -48.639 1.00 73.91  ? 101 ASP D N   1 
ATOM   8692  C  CA  . ASP D 2 71  ? 29.391  -7.426  -48.596 1.00 74.20  ? 101 ASP D CA  1 
ATOM   8693  C  C   . ASP D 2 71  ? 28.162  -7.102  -49.465 1.00 78.90  ? 101 ASP D C   1 
ATOM   8694  O  O   . ASP D 2 71  ? 27.851  -5.938  -49.716 1.00 78.88  ? 101 ASP D O   1 
ATOM   8695  C  CB  . ASP D 2 71  ? 28.998  -7.743  -47.145 1.00 75.06  ? 101 ASP D CB  1 
ATOM   8696  C  CG  . ASP D 2 71  ? 28.132  -6.681  -46.510 1.00 86.81  ? 101 ASP D CG  1 
ATOM   8697  O  OD1 . ASP D 2 71  ? 26.885  -6.824  -46.555 1.00 86.80  ? 101 ASP D OD1 1 
ATOM   8698  O  OD2 . ASP D 2 71  ? 28.693  -5.689  -46.000 1.00 93.56  ? 101 ASP D OD2 1 
ATOM   8699  N  N   . ASP D 2 72  ? 27.471  -8.142  -49.900 1.00 75.34  ? 102 ASP D N   1 
ATOM   8700  C  CA  . ASP D 2 72  ? 26.290  -8.094  -50.756 1.00 75.51  ? 102 ASP D CA  1 
ATOM   8701  C  C   . ASP D 2 72  ? 24.979  -8.195  -49.995 1.00 76.93  ? 102 ASP D C   1 
ATOM   8702  O  O   . ASP D 2 72  ? 23.928  -8.253  -50.613 1.00 77.60  ? 102 ASP D O   1 
ATOM   8703  C  CB  . ASP D 2 72  ? 26.375  -9.290  -51.715 1.00 80.46  ? 102 ASP D CB  1 
ATOM   8704  C  CG  . ASP D 2 72  ? 26.363  -10.665 -51.052 1.00 100.13 ? 102 ASP D CG  1 
ATOM   8705  O  OD1 . ASP D 2 72  ? 27.133  -10.869 -50.085 1.00 100.17 ? 102 ASP D OD1 1 
ATOM   8706  O  OD2 . ASP D 2 72  ? 25.601  -11.542 -51.516 1.00 112.46 ? 102 ASP D OD2 1 
ATOM   8707  N  N   . THR D 2 73  ? 25.044  -8.257  -48.662 1.00 72.58  ? 103 THR D N   1 
ATOM   8708  C  CA  . THR D 2 73  ? 23.914  -8.488  -47.745 1.00 71.12  ? 103 THR D CA  1 
ATOM   8709  C  C   . THR D 2 73  ? 23.126  -7.216  -47.282 1.00 72.79  ? 103 THR D C   1 
ATOM   8710  O  O   . THR D 2 73  ? 23.477  -6.079  -47.625 1.00 72.04  ? 103 THR D O   1 
ATOM   8711  C  CB  . THR D 2 73  ? 24.415  -9.285  -46.521 1.00 71.34  ? 103 THR D CB  1 
ATOM   8712  O  OG1 . THR D 2 73  ? 24.820  -8.359  -45.524 1.00 69.73  ? 103 THR D OG1 1 
ATOM   8713  C  CG2 . THR D 2 73  ? 25.584  -10.222 -46.855 1.00 68.21  ? 103 THR D CG2 1 
ATOM   8714  N  N   . ASP D 2 74  ? 22.034  -7.460  -46.519 1.00 66.98  ? 104 ASP D N   1 
ATOM   8715  C  CA  . ASP D 2 74  ? 21.167  -6.466  -45.888 1.00 65.18  ? 104 ASP D CA  1 
ATOM   8716  C  C   . ASP D 2 74  ? 21.367  -6.684  -44.391 1.00 67.77  ? 104 ASP D C   1 
ATOM   8717  O  O   . ASP D 2 74  ? 20.415  -6.620  -43.585 1.00 66.84  ? 104 ASP D O   1 
ATOM   8718  C  CB  . ASP D 2 74  ? 19.701  -6.745  -46.236 1.00 67.96  ? 104 ASP D CB  1 
ATOM   8719  C  CG  . ASP D 2 74  ? 19.316  -6.499  -47.671 1.00 84.67  ? 104 ASP D CG  1 
ATOM   8720  O  OD1 . ASP D 2 74  ? 19.274  -5.325  -48.071 1.00 86.68  ? 104 ASP D OD1 1 
ATOM   8721  O  OD2 . ASP D 2 74  ? 18.935  -7.480  -48.363 1.00 89.48  ? 104 ASP D OD2 1 
ATOM   8722  N  N   . GLN D 2 75  ? 22.619  -6.994  -44.024 1.00 63.54  ? 105 GLN D N   1 
ATOM   8723  C  CA  . GLN D 2 75  ? 22.979  -7.329  -42.658 1.00 61.75  ? 105 GLN D CA  1 
ATOM   8724  C  C   . GLN D 2 75  ? 23.829  -6.235  -42.042 1.00 61.84  ? 105 GLN D C   1 
ATOM   8725  O  O   . GLN D 2 75  ? 25.052  -6.346  -41.976 1.00 59.69  ? 105 GLN D O   1 
ATOM   8726  C  CB  . GLN D 2 75  ? 23.665  -8.682  -42.672 1.00 63.49  ? 105 GLN D CB  1 
ATOM   8727  C  CG  . GLN D 2 75  ? 23.470  -9.511  -41.435 1.00 72.76  ? 105 GLN D CG  1 
ATOM   8728  C  CD  . GLN D 2 75  ? 24.407  -10.685 -41.546 1.00 80.62  ? 105 GLN D CD  1 
ATOM   8729  O  OE1 . GLN D 2 75  ? 24.390  -11.405 -42.576 1.00 69.32  ? 105 GLN D OE1 1 
ATOM   8730  N  NE2 . GLN D 2 75  ? 25.295  -10.846 -40.526 1.00 56.65  ? 105 GLN D NE2 1 
ATOM   8731  N  N   . GLU D 2 76  ? 23.145  -5.154  -41.605 1.00 57.51  ? 106 GLU D N   1 
ATOM   8732  C  CA  . GLU D 2 76  ? 23.722  -3.950  -40.993 1.00 55.55  ? 106 GLU D CA  1 
ATOM   8733  C  C   . GLU D 2 76  ? 24.551  -4.227  -39.729 1.00 60.01  ? 106 GLU D C   1 
ATOM   8734  O  O   . GLU D 2 76  ? 25.311  -3.343  -39.327 1.00 60.21  ? 106 GLU D O   1 
ATOM   8735  C  CB  . GLU D 2 76  ? 22.646  -2.863  -40.734 1.00 55.85  ? 106 GLU D CB  1 
ATOM   8736  C  CG  . GLU D 2 76  ? 21.736  -3.051  -39.532 1.00 55.31  ? 106 GLU D CG  1 
ATOM   8737  C  CD  . GLU D 2 76  ? 20.850  -4.279  -39.536 1.00 72.42  ? 106 GLU D CD  1 
ATOM   8738  O  OE1 . GLU D 2 76  ? 20.428  -4.729  -40.628 1.00 85.70  ? 106 GLU D OE1 1 
ATOM   8739  O  OE2 . GLU D 2 76  ? 20.587  -4.800  -38.432 1.00 72.59  ? 106 GLU D OE2 1 
ATOM   8740  N  N   . ALA D 2 77  ? 24.413  -5.432  -39.113 1.00 56.62  ? 107 ALA D N   1 
ATOM   8741  C  CA  . ALA D 2 77  ? 25.192  -5.806  -37.922 1.00 56.76  ? 107 ALA D CA  1 
ATOM   8742  C  C   . ALA D 2 77  ? 26.647  -6.057  -38.299 1.00 57.80  ? 107 ALA D C   1 
ATOM   8743  O  O   . ALA D 2 77  ? 27.535  -5.938  -37.449 1.00 56.67  ? 107 ALA D O   1 
ATOM   8744  C  CB  . ALA D 2 77  ? 24.607  -7.032  -37.241 1.00 58.26  ? 107 ALA D CB  1 
ATOM   8745  N  N   . ILE D 2 78  ? 26.886  -6.392  -39.581 1.00 52.57  ? 108 ILE D N   1 
ATOM   8746  C  CA  . ILE D 2 78  ? 28.242  -6.548  -40.086 1.00 52.15  ? 108 ILE D CA  1 
ATOM   8747  C  C   . ILE D 2 78  ? 29.008  -5.250  -39.680 1.00 58.05  ? 108 ILE D C   1 
ATOM   8748  O  O   . ILE D 2 78  ? 30.137  -5.345  -39.170 1.00 58.55  ? 108 ILE D O   1 
ATOM   8749  C  CB  . ILE D 2 78  ? 28.264  -6.856  -41.624 1.00 54.04  ? 108 ILE D CB  1 
ATOM   8750  C  CG1 . ILE D 2 78  ? 27.947  -8.338  -41.911 1.00 53.48  ? 108 ILE D CG1 1 
ATOM   8751  C  CG2 . ILE D 2 78  ? 29.574  -6.444  -42.271 1.00 52.92  ? 108 ILE D CG2 1 
ATOM   8752  C  CD1 . ILE D 2 78  ? 27.320  -8.579  -43.222 1.00 48.21  ? 108 ILE D CD1 1 
ATOM   8753  N  N   . ALA D 2 79  ? 28.330  -4.068  -39.794 1.00 53.24  ? 109 ALA D N   1 
ATOM   8754  C  CA  . ALA D 2 79  ? 28.907  -2.781  -39.436 1.00 52.48  ? 109 ALA D CA  1 
ATOM   8755  C  C   . ALA D 2 79  ? 29.304  -2.778  -37.970 1.00 58.72  ? 109 ALA D C   1 
ATOM   8756  O  O   . ALA D 2 79  ? 30.445  -2.417  -37.660 1.00 60.88  ? 109 ALA D O   1 
ATOM   8757  C  CB  . ALA D 2 79  ? 27.943  -1.653  -39.742 1.00 52.82  ? 109 ALA D CB  1 
ATOM   8758  N  N   . GLN D 2 80  ? 28.425  -3.281  -37.080 1.00 54.05  ? 110 GLN D N   1 
ATOM   8759  C  CA  . GLN D 2 80  ? 28.731  -3.361  -35.650 1.00 53.21  ? 110 GLN D CA  1 
ATOM   8760  C  C   . GLN D 2 80  ? 29.951  -4.277  -35.399 1.00 57.57  ? 110 GLN D C   1 
ATOM   8761  O  O   . GLN D 2 80  ? 30.920  -3.826  -34.780 1.00 57.12  ? 110 GLN D O   1 
ATOM   8762  C  CB  . GLN D 2 80  ? 27.497  -3.800  -34.845 1.00 54.38  ? 110 GLN D CB  1 
ATOM   8763  C  CG  . GLN D 2 80  ? 27.631  -3.659  -33.322 1.00 73.26  ? 110 GLN D CG  1 
ATOM   8764  C  CD  . GLN D 2 80  ? 27.995  -2.284  -32.837 1.00 87.32  ? 110 GLN D CD  1 
ATOM   8765  O  OE1 . GLN D 2 80  ? 29.168  -1.927  -32.792 1.00 81.96  ? 110 GLN D OE1 1 
ATOM   8766  N  NE2 . GLN D 2 80  ? 27.002  -1.506  -32.414 1.00 80.41  ? 110 GLN D NE2 1 
ATOM   8767  N  N   . ILE D 2 81  ? 29.936  -5.524  -35.950 1.00 53.73  ? 111 ILE D N   1 
ATOM   8768  C  CA  . ILE D 2 81  ? 31.042  -6.493  -35.827 1.00 52.73  ? 111 ILE D CA  1 
ATOM   8769  C  C   . ILE D 2 81  ? 32.352  -5.867  -36.258 1.00 55.31  ? 111 ILE D C   1 
ATOM   8770  O  O   . ILE D 2 81  ? 33.359  -6.072  -35.576 1.00 55.56  ? 111 ILE D O   1 
ATOM   8771  C  CB  . ILE D 2 81  ? 30.794  -7.842  -36.558 1.00 56.08  ? 111 ILE D CB  1 
ATOM   8772  C  CG1 . ILE D 2 81  ? 29.355  -8.367  -36.312 1.00 56.70  ? 111 ILE D CG1 1 
ATOM   8773  C  CG2 . ILE D 2 81  ? 31.824  -8.888  -36.111 1.00 56.29  ? 111 ILE D CG2 1 
ATOM   8774  C  CD1 . ILE D 2 81  ? 28.934  -9.652  -37.089 1.00 60.27  ? 111 ILE D CD1 1 
ATOM   8775  N  N   . LEU D 2 82  ? 32.331  -5.052  -37.346 1.00 50.32  ? 112 LEU D N   1 
ATOM   8776  C  CA  . LEU D 2 82  ? 33.537  -4.384  -37.847 1.00 49.30  ? 112 LEU D CA  1 
ATOM   8777  C  C   . LEU D 2 82  ? 34.005  -3.278  -36.926 1.00 56.09  ? 112 LEU D C   1 
ATOM   8778  O  O   . LEU D 2 82  ? 35.219  -3.154  -36.714 1.00 57.24  ? 112 LEU D O   1 
ATOM   8779  C  CB  . LEU D 2 82  ? 33.423  -3.905  -39.294 1.00 48.59  ? 112 LEU D CB  1 
ATOM   8780  C  CG  . LEU D 2 82  ? 33.171  -5.023  -40.305 1.00 53.52  ? 112 LEU D CG  1 
ATOM   8781  C  CD1 . LEU D 2 82  ? 32.819  -4.478  -41.625 1.00 54.87  ? 112 LEU D CD1 1 
ATOM   8782  C  CD2 . LEU D 2 82  ? 34.325  -6.004  -40.393 1.00 53.96  ? 112 LEU D CD2 1 
ATOM   8783  N  N   . ASP D 2 83  ? 33.072  -2.548  -36.288 1.00 52.06  ? 113 ASP D N   1 
ATOM   8784  C  CA  . ASP D 2 83  ? 33.485  -1.499  -35.360 1.00 52.04  ? 113 ASP D CA  1 
ATOM   8785  C  C   . ASP D 2 83  ? 34.202  -2.128  -34.141 1.00 57.99  ? 113 ASP D C   1 
ATOM   8786  O  O   . ASP D 2 83  ? 35.302  -1.702  -33.768 1.00 58.18  ? 113 ASP D O   1 
ATOM   8787  C  CB  . ASP D 2 83  ? 32.294  -0.635  -34.941 1.00 53.03  ? 113 ASP D CB  1 
ATOM   8788  C  CG  . ASP D 2 83  ? 32.696  0.544   -34.078 1.00 63.29  ? 113 ASP D CG  1 
ATOM   8789  O  OD1 . ASP D 2 83  ? 33.305  1.489   -34.623 1.00 63.68  ? 113 ASP D OD1 1 
ATOM   8790  O  OD2 . ASP D 2 83  ? 32.390  0.522   -32.850 1.00 68.40  ? 113 ASP D OD2 1 
ATOM   8791  N  N   . PHE D 2 84  ? 33.596  -3.188  -33.583 1.00 55.48  ? 114 PHE D N   1 
ATOM   8792  C  CA  . PHE D 2 84  ? 34.132  -3.941  -32.463 1.00 55.96  ? 114 PHE D CA  1 
ATOM   8793  C  C   . PHE D 2 84  ? 35.538  -4.447  -32.823 1.00 60.57  ? 114 PHE D C   1 
ATOM   8794  O  O   . PHE D 2 84  ? 36.488  -4.114  -32.105 1.00 60.48  ? 114 PHE D O   1 
ATOM   8795  C  CB  . PHE D 2 84  ? 33.179  -5.103  -32.085 1.00 57.99  ? 114 PHE D CB  1 
ATOM   8796  C  CG  . PHE D 2 84  ? 33.705  -6.055  -31.029 1.00 58.96  ? 114 PHE D CG  1 
ATOM   8797  C  CD1 . PHE D 2 84  ? 33.558  -5.770  -29.677 1.00 60.26  ? 114 PHE D CD1 1 
ATOM   8798  C  CD2 . PHE D 2 84  ? 34.335  -7.240  -31.392 1.00 61.18  ? 114 PHE D CD2 1 
ATOM   8799  C  CE1 . PHE D 2 84  ? 34.036  -6.650  -28.711 1.00 62.05  ? 114 PHE D CE1 1 
ATOM   8800  C  CE2 . PHE D 2 84  ? 34.828  -8.112  -30.423 1.00 64.44  ? 114 PHE D CE2 1 
ATOM   8801  C  CZ  . PHE D 2 84  ? 34.670  -7.818  -29.089 1.00 62.35  ? 114 PHE D CZ  1 
ATOM   8802  N  N   . ILE D 2 85  ? 35.687  -5.185  -33.963 1.00 56.56  ? 115 ILE D N   1 
ATOM   8803  C  CA  . ILE D 2 85  ? 37.005  -5.698  -34.367 1.00 56.30  ? 115 ILE D CA  1 
ATOM   8804  C  C   . ILE D 2 85  ? 38.030  -4.557  -34.483 1.00 60.32  ? 115 ILE D C   1 
ATOM   8805  O  O   . ILE D 2 85  ? 39.128  -4.650  -33.911 1.00 57.06  ? 115 ILE D O   1 
ATOM   8806  C  CB  . ILE D 2 85  ? 36.943  -6.587  -35.618 1.00 59.31  ? 115 ILE D CB  1 
ATOM   8807  C  CG1 . ILE D 2 85  ? 36.126  -7.855  -35.327 1.00 60.04  ? 115 ILE D CG1 1 
ATOM   8808  C  CG2 . ILE D 2 85  ? 38.356  -6.953  -36.106 1.00 59.89  ? 115 ILE D CG2 1 
ATOM   8809  C  CD1 . ILE D 2 85  ? 35.532  -8.488  -36.539 1.00 72.81  ? 115 ILE D CD1 1 
ATOM   8810  N  N   . SER D 2 86  ? 37.613  -3.455  -35.159 1.00 58.49  ? 116 SER D N   1 
ATOM   8811  C  CA  . SER D 2 86  ? 38.410  -2.254  -35.383 1.00 58.49  ? 116 SER D CA  1 
ATOM   8812  C  C   . SER D 2 86  ? 38.952  -1.642  -34.100 1.00 64.96  ? 116 SER D C   1 
ATOM   8813  O  O   . SER D 2 86  ? 40.154  -1.414  -34.015 1.00 65.72  ? 116 SER D O   1 
ATOM   8814  C  CB  . SER D 2 86  ? 37.605  -1.210  -36.136 1.00 60.54  ? 116 SER D CB  1 
ATOM   8815  O  OG  . SER D 2 86  ? 38.433  -0.074  -36.286 1.00 68.44  ? 116 SER D OG  1 
ATOM   8816  N  N   . ALA D 2 87  ? 38.079  -1.370  -33.113 1.00 61.49  ? 117 ALA D N   1 
ATOM   8817  C  CA  . ALA D 2 87  ? 38.490  -0.767  -31.851 1.00 61.76  ? 117 ALA D CA  1 
ATOM   8818  C  C   . ALA D 2 87  ? 39.370  -1.681  -30.980 1.00 66.99  ? 117 ALA D C   1 
ATOM   8819  O  O   . ALA D 2 87  ? 40.384  -1.212  -30.452 1.00 69.01  ? 117 ALA D O   1 
ATOM   8820  C  CB  . ALA D 2 87  ? 37.279  -0.295  -31.081 1.00 62.36  ? 117 ALA D CB  1 
ATOM   8821  N  N   . GLN D 2 88  ? 39.011  -2.976  -30.859 1.00 61.16  ? 118 GLN D N   1 
ATOM   8822  C  CA  . GLN D 2 88  ? 39.756  -3.963  -30.070 1.00 59.62  ? 118 GLN D CA  1 
ATOM   8823  C  C   . GLN D 2 88  ? 41.192  -4.159  -30.567 1.00 65.00  ? 118 GLN D C   1 
ATOM   8824  O  O   . GLN D 2 88  ? 42.122  -4.165  -29.756 1.00 65.94  ? 118 GLN D O   1 
ATOM   8825  C  CB  . GLN D 2 88  ? 39.033  -5.310  -30.075 1.00 60.28  ? 118 GLN D CB  1 
ATOM   8826  C  CG  . GLN D 2 88  ? 37.730  -5.373  -29.287 1.00 67.47  ? 118 GLN D CG  1 
ATOM   8827  C  CD  . GLN D 2 88  ? 37.896  -4.885  -27.879 1.00 77.65  ? 118 GLN D CD  1 
ATOM   8828  O  OE1 . GLN D 2 88  ? 37.260  -3.909  -27.473 1.00 61.19  ? 118 GLN D OE1 1 
ATOM   8829  N  NE2 . GLN D 2 88  ? 38.826  -5.496  -27.133 1.00 81.20  ? 118 GLN D NE2 1 
ATOM   8830  N  N   . THR D 2 89  ? 41.372  -4.332  -31.895 1.00 60.89  ? 119 THR D N   1 
ATOM   8831  C  CA  . THR D 2 89  ? 42.680  -4.558  -32.512 1.00 59.85  ? 119 THR D CA  1 
ATOM   8832  C  C   . THR D 2 89  ? 43.375  -3.250  -32.885 1.00 65.53  ? 119 THR D C   1 
ATOM   8833  O  O   . THR D 2 89  ? 44.562  -3.264  -33.151 1.00 65.89  ? 119 THR D O   1 
ATOM   8834  C  CB  . THR D 2 89  ? 42.561  -5.478  -33.723 1.00 58.07  ? 119 THR D CB  1 
ATOM   8835  O  OG1 . THR D 2 89  ? 41.843  -4.810  -34.753 1.00 55.63  ? 119 THR D OG1 1 
ATOM   8836  C  CG2 . THR D 2 89  ? 41.900  -6.790  -33.398 1.00 57.42  ? 119 THR D CG2 1 
ATOM   8837  N  N   . LEU D 2 90  ? 42.635  -2.123  -32.916 1.00 62.83  ? 120 LEU D N   1 
ATOM   8838  C  CA  . LEU D 2 90  ? 43.155  -0.813  -33.326 1.00 62.38  ? 120 LEU D CA  1 
ATOM   8839  C  C   . LEU D 2 90  ? 43.748  -0.895  -34.735 1.00 67.82  ? 120 LEU D C   1 
ATOM   8840  O  O   . LEU D 2 90  ? 44.888  -0.502  -34.974 1.00 68.75  ? 120 LEU D O   1 
ATOM   8841  C  CB  . LEU D 2 90  ? 44.108  -0.187  -32.296 1.00 61.97  ? 120 LEU D CB  1 
ATOM   8842  C  CG  . LEU D 2 90  ? 43.440  0.342   -31.052 1.00 66.11  ? 120 LEU D CG  1 
ATOM   8843  C  CD1 . LEU D 2 90  ? 44.411  0.344   -29.897 1.00 66.46  ? 120 LEU D CD1 1 
ATOM   8844  C  CD2 . LEU D 2 90  ? 42.840  1.747   -31.282 1.00 67.52  ? 120 LEU D CD2 1 
ATOM   8845  N  N   . THR D 2 91  ? 42.957  -1.479  -35.645 1.00 65.04  ? 121 THR D N   1 
ATOM   8846  C  CA  . THR D 2 91  ? 43.240  -1.686  -37.062 1.00 66.52  ? 121 THR D CA  1 
ATOM   8847  C  C   . THR D 2 91  ? 42.175  -0.947  -37.889 1.00 71.84  ? 121 THR D C   1 
ATOM   8848  O  O   . THR D 2 91  ? 40.966  -1.168  -37.684 1.00 69.96  ? 121 THR D O   1 
ATOM   8849  C  CB  . THR D 2 91  ? 43.184  -3.185  -37.398 1.00 75.59  ? 121 THR D CB  1 
ATOM   8850  O  OG1 . THR D 2 91  ? 43.871  -3.908  -36.388 1.00 77.76  ? 121 THR D OG1 1 
ATOM   8851  C  CG2 . THR D 2 91  ? 43.750  -3.516  -38.777 1.00 72.17  ? 121 THR D CG2 1 
ATOM   8852  N  N   . PRO D 2 92  ? 42.600  -0.102  -38.854 1.00 70.21  ? 122 PRO D N   1 
ATOM   8853  C  CA  . PRO D 2 92  ? 41.612  0.602   -39.694 1.00 70.42  ? 122 PRO D CA  1 
ATOM   8854  C  C   . PRO D 2 92  ? 40.772  -0.371  -40.520 1.00 74.41  ? 122 PRO D C   1 
ATOM   8855  O  O   . PRO D 2 92  ? 41.318  -1.320  -41.089 1.00 75.20  ? 122 PRO D O   1 
ATOM   8856  C  CB  . PRO D 2 92  ? 42.474  1.497   -40.590 1.00 73.02  ? 122 PRO D CB  1 
ATOM   8857  C  CG  . PRO D 2 92  ? 43.810  1.581   -39.900 1.00 77.67  ? 122 PRO D CG  1 
ATOM   8858  C  CD  . PRO D 2 92  ? 43.980  0.267   -39.222 1.00 72.47  ? 122 PRO D CD  1 
ATOM   8859  N  N   . ILE D 2 93  ? 39.442  -0.191  -40.515 1.00 68.37  ? 123 ILE D N   1 
ATOM   8860  C  CA  . ILE D 2 93  ? 38.529  -1.032  -41.297 1.00 66.62  ? 123 ILE D CA  1 
ATOM   8861  C  C   . ILE D 2 93  ? 37.640  -0.115  -42.077 1.00 69.82  ? 123 ILE D C   1 
ATOM   8862  O  O   . ILE D 2 93  ? 37.089  0.820   -41.498 1.00 70.79  ? 123 ILE D O   1 
ATOM   8863  C  CB  . ILE D 2 93  ? 37.736  -2.081  -40.472 1.00 67.78  ? 123 ILE D CB  1 
ATOM   8864  C  CG1 . ILE D 2 93  ? 38.689  -3.091  -39.811 1.00 67.40  ? 123 ILE D CG1 1 
ATOM   8865  C  CG2 . ILE D 2 93  ? 36.720  -2.812  -41.357 1.00 68.61  ? 123 ILE D CG2 1 
ATOM   8866  C  CD1 . ILE D 2 93  ? 38.061  -4.036  -38.770 1.00 71.87  ? 123 ILE D CD1 1 
ATOM   8867  N  N   . LEU D 2 94  ? 37.528  -0.350  -43.388 1.00 64.78  ? 124 LEU D N   1 
ATOM   8868  C  CA  . LEU D 2 94  ? 36.668  0.459   -44.249 1.00 65.13  ? 124 LEU D CA  1 
ATOM   8869  C  C   . LEU D 2 94  ? 35.490  -0.369  -44.759 1.00 68.51  ? 124 LEU D C   1 
ATOM   8870  O  O   . LEU D 2 94  ? 35.698  -1.365  -45.449 1.00 68.57  ? 124 LEU D O   1 
ATOM   8871  C  CB  . LEU D 2 94  ? 37.445  1.092   -45.433 1.00 66.40  ? 124 LEU D CB  1 
ATOM   8872  C  CG  . LEU D 2 94  ? 38.719  1.864   -45.095 1.00 71.67  ? 124 LEU D CG  1 
ATOM   8873  C  CD1 . LEU D 2 94  ? 39.459  2.197   -46.321 1.00 73.35  ? 124 LEU D CD1 1 
ATOM   8874  C  CD2 . LEU D 2 94  ? 38.435  3.149   -44.344 1.00 73.65  ? 124 LEU D CD2 1 
ATOM   8875  N  N   . GLY D 2 95  ? 34.279  0.021   -44.371 1.00 64.15  ? 125 GLY D N   1 
ATOM   8876  C  CA  . GLY D 2 95  ? 33.041  -0.632  -44.800 1.00 63.65  ? 125 GLY D CA  1 
ATOM   8877  C  C   . GLY D 2 95  ? 32.626  0.052   -46.074 1.00 66.84  ? 125 GLY D C   1 
ATOM   8878  O  O   . GLY D 2 95  ? 32.053  1.144   -46.036 1.00 67.03  ? 125 GLY D O   1 
ATOM   8879  N  N   . ILE D 2 96  ? 33.028  -0.525  -47.198 1.00 62.93  ? 126 ILE D N   1 
ATOM   8880  C  CA  . ILE D 2 96  ? 32.887  0.134   -48.487 1.00 63.43  ? 126 ILE D CA  1 
ATOM   8881  C  C   . ILE D 2 96  ? 31.547  -0.124  -49.194 1.00 69.89  ? 126 ILE D C   1 
ATOM   8882  O  O   . ILE D 2 96  ? 31.188  0.674   -50.073 1.00 70.67  ? 126 ILE D O   1 
ATOM   8883  C  CB  . ILE D 2 96  ? 34.110  -0.177  -49.422 1.00 66.62  ? 126 ILE D CB  1 
ATOM   8884  C  CG1 . ILE D 2 96  ? 34.235  -1.673  -49.798 1.00 66.32  ? 126 ILE D CG1 1 
ATOM   8885  C  CG2 . ILE D 2 96  ? 35.414  0.346   -48.821 1.00 66.40  ? 126 ILE D CG2 1 
ATOM   8886  C  CD1 . ILE D 2 96  ? 34.646  -1.928  -51.196 1.00 65.33  ? 126 ILE D CD1 1 
ATOM   8887  N  N   . HIS D 2 97  ? 30.821  -1.206  -48.829 1.00 66.08  ? 127 HIS D N   1 
ATOM   8888  C  CA  . HIS D 2 97  ? 29.597  -1.600  -49.517 1.00 66.82  ? 127 HIS D CA  1 
ATOM   8889  C  C   . HIS D 2 97  ? 28.814  -2.641  -48.746 1.00 71.90  ? 127 HIS D C   1 
ATOM   8890  O  O   . HIS D 2 97  ? 29.420  -3.548  -48.180 1.00 73.48  ? 127 HIS D O   1 
ATOM   8891  C  CB  . HIS D 2 97  ? 29.954  -2.166  -50.916 1.00 69.19  ? 127 HIS D CB  1 
ATOM   8892  C  CG  . HIS D 2 97  ? 28.779  -2.646  -51.722 1.00 73.92  ? 127 HIS D CG  1 
ATOM   8893  N  ND1 . HIS D 2 97  ? 27.724  -1.794  -52.053 1.00 76.09  ? 127 HIS D ND1 1 
ATOM   8894  C  CD2 . HIS D 2 97  ? 28.516  -3.882  -52.219 1.00 76.45  ? 127 HIS D CD2 1 
ATOM   8895  C  CE1 . HIS D 2 97  ? 26.874  -2.532  -52.748 1.00 76.23  ? 127 HIS D CE1 1 
ATOM   8896  N  NE2 . HIS D 2 97  ? 27.311  -3.795  -52.880 1.00 76.90  ? 127 HIS D NE2 1 
ATOM   8897  N  N   . GLY D 2 98  ? 27.477  -2.552  -48.814 1.00 66.19  ? 128 GLY D N   1 
ATOM   8898  C  CA  . GLY D 2 98  ? 26.558  -3.491  -48.186 1.00 64.64  ? 128 GLY D CA  1 
ATOM   8899  C  C   . GLY D 2 98  ? 26.300  -3.175  -46.736 1.00 67.54  ? 128 GLY D C   1 
ATOM   8900  O  O   . GLY D 2 98  ? 26.273  -2.006  -46.354 1.00 65.44  ? 128 GLY D O   1 
ATOM   8901  N  N   . GLY D 2 99  ? 26.135  -4.228  -45.940 1.00 65.96  ? 129 GLY D N   1 
ATOM   8902  C  CA  . GLY D 2 99  ? 25.899  -4.173  -44.498 1.00 65.39  ? 129 GLY D CA  1 
ATOM   8903  C  C   . GLY D 2 99  ? 26.992  -3.454  -43.741 1.00 69.63  ? 129 GLY D C   1 
ATOM   8904  O  O   . GLY D 2 99  ? 26.719  -2.752  -42.764 1.00 68.81  ? 129 GLY D O   1 
ATOM   8905  N  N   . SER D 2 100 ? 28.228  -3.593  -44.222 1.00 67.45  ? 130 SER D N   1 
ATOM   8906  C  CA  . SER D 2 100 ? 29.395  -2.940  -43.651 1.00 68.03  ? 130 SER D CA  1 
ATOM   8907  C  C   . SER D 2 100 ? 29.321  -1.407  -43.745 1.00 72.51  ? 130 SER D C   1 
ATOM   8908  O  O   . SER D 2 100 ? 29.845  -0.731  -42.866 1.00 71.93  ? 130 SER D O   1 
ATOM   8909  C  CB  . SER D 2 100 ? 30.660  -3.448  -44.327 1.00 72.92  ? 130 SER D CB  1 
ATOM   8910  O  OG  . SER D 2 100 ? 30.488  -3.505  -45.731 1.00 83.45  ? 130 SER D OG  1 
ATOM   8911  N  N   . SER D 2 101 ? 28.666  -0.871  -44.790 1.00 69.01  ? 131 SER D N   1 
ATOM   8912  C  CA  . SER D 2 101 ? 28.543  0.565   -45.020 1.00 68.64  ? 131 SER D CA  1 
ATOM   8913  C  C   . SER D 2 101 ? 27.268  1.217   -44.412 1.00 71.07  ? 131 SER D C   1 
ATOM   8914  O  O   . SER D 2 101 ? 27.108  2.445   -44.510 1.00 70.38  ? 131 SER D O   1 
ATOM   8915  C  CB  . SER D 2 101 ? 28.653  0.858   -46.513 1.00 73.29  ? 131 SER D CB  1 
ATOM   8916  O  OG  . SER D 2 101 ? 27.523  0.355   -47.206 1.00 84.01  ? 131 SER D OG  1 
ATOM   8917  N  N   . MET D 2 102 ? 26.397  0.418   -43.748 1.00 66.85  ? 132 MET D N   1 
ATOM   8918  C  CA  . MET D 2 102 ? 25.147  0.907   -43.151 1.00 66.74  ? 132 MET D CA  1 
ATOM   8919  C  C   . MET D 2 102 ? 25.293  1.652   -41.824 1.00 70.97  ? 132 MET D C   1 
ATOM   8920  O  O   . MET D 2 102 ? 26.098  1.266   -40.979 1.00 69.55  ? 132 MET D O   1 
ATOM   8921  C  CB  . MET D 2 102 ? 24.151  -0.231  -42.993 1.00 69.50  ? 132 MET D CB  1 
ATOM   8922  C  CG  . MET D 2 102 ? 23.379  -0.533  -44.249 1.00 75.05  ? 132 MET D CG  1 
ATOM   8923  S  SD  . MET D 2 102 ? 22.775  -2.236  -44.186 1.00 81.22  ? 132 MET D SD  1 
ATOM   8924  C  CE  . MET D 2 102 ? 21.868  -2.318  -45.707 1.00 79.40  ? 132 MET D CE  1 
ATOM   8925  N  N   . ILE D 2 103 ? 24.459  2.707   -41.624 1.00 70.13  ? 133 ILE D N   1 
ATOM   8926  C  CA  . ILE D 2 103 ? 24.404  3.515   -40.388 1.00 69.71  ? 133 ILE D CA  1 
ATOM   8927  C  C   . ILE D 2 103 ? 24.333  2.613   -39.166 1.00 75.16  ? 133 ILE D C   1 
ATOM   8928  O  O   . ILE D 2 103 ? 23.688  1.554   -39.172 1.00 75.13  ? 133 ILE D O   1 
ATOM   8929  C  CB  . ILE D 2 103 ? 23.297  4.609   -40.375 1.00 72.60  ? 133 ILE D CB  1 
ATOM   8930  C  CG1 . ILE D 2 103 ? 21.922  4.030   -40.777 1.00 73.28  ? 133 ILE D CG1 1 
ATOM   8931  C  CG2 . ILE D 2 103 ? 23.692  5.778   -41.263 1.00 73.93  ? 133 ILE D CG2 1 
ATOM   8932  C  CD1 . ILE D 2 103 ? 20.738  4.781   -40.306 1.00 80.14  ? 133 ILE D CD1 1 
ATOM   8933  N  N   . MET D 2 104 ? 25.067  2.987   -38.143 1.00 73.04  ? 134 MET D N   1 
ATOM   8934  C  CA  . MET D 2 104 ? 25.115  2.163   -36.944 1.00 72.37  ? 134 MET D CA  1 
ATOM   8935  C  C   . MET D 2 104 ? 25.013  2.980   -35.641 1.00 76.21  ? 134 MET D C   1 
ATOM   8936  O  O   . MET D 2 104 ? 24.743  4.194   -35.651 1.00 75.40  ? 134 MET D O   1 
ATOM   8937  C  CB  . MET D 2 104 ? 26.380  1.262   -36.984 1.00 73.75  ? 134 MET D CB  1 
ATOM   8938  C  CG  . MET D 2 104 ? 27.704  2.016   -36.986 1.00 76.00  ? 134 MET D CG  1 
ATOM   8939  S  SD  . MET D 2 104 ? 28.980  0.926   -36.316 1.00 78.81  ? 134 MET D SD  1 
ATOM   8940  C  CE  . MET D 2 104 ? 28.895  1.306   -34.557 1.00 74.23  ? 134 MET D CE  1 
ATOM   8941  N  N   . ALA D 2 105 ? 25.265  2.293   -34.519 1.00 72.55  ? 135 ALA D N   1 
ATOM   8942  C  CA  . ALA D 2 105 ? 25.302  2.877   -33.184 1.00 71.94  ? 135 ALA D CA  1 
ATOM   8943  C  C   . ALA D 2 105 ? 26.495  3.879   -33.061 1.00 73.78  ? 135 ALA D C   1 
ATOM   8944  O  O   . ALA D 2 105 ? 27.202  4.141   -34.051 1.00 73.29  ? 135 ALA D O   1 
ATOM   8945  C  CB  . ALA D 2 105 ? 25.404  1.753   -32.153 1.00 72.30  ? 135 ALA D CB  1 
ATOM   8946  N  N   . ASP D 2 106 ? 26.675  4.484   -31.888 1.00 68.51  ? 136 ASP D N   1 
ATOM   8947  C  CA  . ASP D 2 106 ? 27.809  5.363   -31.752 1.00 68.73  ? 136 ASP D CA  1 
ATOM   8948  C  C   . ASP D 2 106 ? 29.066  4.461   -31.820 1.00 68.04  ? 136 ASP D C   1 
ATOM   8949  O  O   . ASP D 2 106 ? 29.126  3.445   -31.120 1.00 68.39  ? 136 ASP D O   1 
ATOM   8950  C  CB  . ASP D 2 106 ? 27.726  6.176   -30.431 1.00 72.61  ? 136 ASP D CB  1 
ATOM   8951  C  CG  . ASP D 2 106 ? 26.855  7.436   -30.463 1.00 89.26  ? 136 ASP D CG  1 
ATOM   8952  O  OD1 . ASP D 2 106 ? 26.053  7.590   -31.420 1.00 90.75  ? 136 ASP D OD1 1 
ATOM   8953  O  OD2 . ASP D 2 106 ? 26.947  8.249   -29.507 1.00 96.76  ? 136 ASP D OD2 1 
ATOM   8954  N  N   . LYS D 2 107 ? 30.009  4.783   -32.726 1.00 60.29  ? 137 LYS D N   1 
ATOM   8955  C  CA  . LYS D 2 107 ? 31.268  4.048   -32.887 1.00 58.59  ? 137 LYS D CA  1 
ATOM   8956  C  C   . LYS D 2 107 ? 32.088  4.167   -31.593 1.00 61.88  ? 137 LYS D C   1 
ATOM   8957  O  O   . LYS D 2 107 ? 31.922  5.160   -30.865 1.00 61.88  ? 137 LYS D O   1 
ATOM   8958  C  CB  . LYS D 2 107 ? 32.073  4.582   -34.086 1.00 59.90  ? 137 LYS D CB  1 
ATOM   8959  C  CG  . LYS D 2 107 ? 31.614  4.039   -35.417 1.00 54.55  ? 137 LYS D CG  1 
ATOM   8960  C  CD  . LYS D 2 107 ? 32.193  4.782   -36.590 1.00 57.49  ? 137 LYS D CD  1 
ATOM   8961  C  CE  . LYS D 2 107 ? 31.613  4.322   -37.916 1.00 66.74  ? 137 LYS D CE  1 
ATOM   8962  N  NZ  . LYS D 2 107 ? 30.141  4.525   -37.992 1.00 80.41  ? 137 LYS D NZ  1 
ATOM   8963  N  N   . ASP D 2 108 ? 32.942  3.157   -31.295 1.00 57.37  ? 138 ASP D N   1 
ATOM   8964  C  CA  . ASP D 2 108 ? 33.744  3.127   -30.067 1.00 57.85  ? 138 ASP D CA  1 
ATOM   8965  C  C   . ASP D 2 108 ? 34.624  4.358   -29.935 1.00 60.98  ? 138 ASP D C   1 
ATOM   8966  O  O   . ASP D 2 108 ? 34.890  5.014   -30.950 1.00 60.23  ? 138 ASP D O   1 
ATOM   8967  C  CB  . ASP D 2 108 ? 34.597  1.844   -29.998 1.00 60.15  ? 138 ASP D CB  1 
ATOM   8968  C  CG  . ASP D 2 108 ? 35.123  1.504   -28.617 1.00 74.77  ? 138 ASP D CG  1 
ATOM   8969  O  OD1 . ASP D 2 108 ? 34.346  0.978   -27.804 1.00 76.48  ? 138 ASP D OD1 1 
ATOM   8970  O  OD2 . ASP D 2 108 ? 36.314  1.769   -28.351 1.00 85.14  ? 138 ASP D OD2 1 
ATOM   8971  N  N   . GLU D 2 109 ? 35.041  4.699   -28.690 1.00 58.02  ? 139 GLU D N   1 
ATOM   8972  C  CA  . GLU D 2 109 ? 35.935  5.835   -28.481 1.00 59.70  ? 139 GLU D CA  1 
ATOM   8973  C  C   . GLU D 2 109 ? 37.243  5.518   -29.217 1.00 66.46  ? 139 GLU D C   1 
ATOM   8974  O  O   . GLU D 2 109 ? 37.831  6.386   -29.864 1.00 67.01  ? 139 GLU D O   1 
ATOM   8975  C  CB  . GLU D 2 109 ? 36.195  6.093   -26.978 1.00 61.52  ? 139 GLU D CB  1 
ATOM   8976  N  N   . SER D 2 110 ? 37.637  4.242   -29.186 1.00 64.59  ? 140 SER D N   1 
ATOM   8977  C  CA  . SER D 2 110 ? 38.863  3.766   -29.798 1.00 65.41  ? 140 SER D CA  1 
ATOM   8978  C  C   . SER D 2 110 ? 38.686  3.199   -31.195 1.00 70.11  ? 140 SER D C   1 
ATOM   8979  O  O   . SER D 2 110 ? 39.571  2.500   -31.676 1.00 70.31  ? 140 SER D O   1 
ATOM   8980  C  CB  . SER D 2 110 ? 39.543  2.762   -28.872 1.00 68.67  ? 140 SER D CB  1 
ATOM   8981  O  OG  . SER D 2 110 ? 40.324  3.483   -27.933 1.00 79.02  ? 140 SER D OG  1 
ATOM   8982  N  N   . SER D 2 111 ? 37.584  3.531   -31.867 1.00 67.94  ? 141 SER D N   1 
ATOM   8983  C  CA  . SER D 2 111 ? 37.309  3.003   -33.203 1.00 68.49  ? 141 SER D CA  1 
ATOM   8984  C  C   . SER D 2 111 ? 38.195  3.590   -34.292 1.00 72.87  ? 141 SER D C   1 
ATOM   8985  O  O   . SER D 2 111 ? 38.637  4.738   -34.194 1.00 73.55  ? 141 SER D O   1 
ATOM   8986  C  CB  . SER D 2 111 ? 35.838  3.179   -33.581 1.00 72.30  ? 141 SER D CB  1 
ATOM   8987  O  OG  . SER D 2 111 ? 35.610  2.733   -34.910 1.00 81.37  ? 141 SER D OG  1 
ATOM   8988  N  N   . MET D 2 112 ? 38.426  2.779   -35.342 1.00 67.55  ? 142 MET D N   1 
ATOM   8989  C  CA  . MET D 2 112 ? 39.175  3.109   -36.555 1.00 66.08  ? 142 MET D CA  1 
ATOM   8990  C  C   . MET D 2 112 ? 38.357  2.615   -37.757 1.00 68.53  ? 142 MET D C   1 
ATOM   8991  O  O   . MET D 2 112 ? 38.918  2.315   -38.813 1.00 68.34  ? 142 MET D O   1 
ATOM   8992  C  CB  . MET D 2 112 ? 40.562  2.466   -36.514 1.00 67.85  ? 142 MET D CB  1 
ATOM   8993  C  CG  . MET D 2 112 ? 41.387  2.930   -35.344 1.00 70.46  ? 142 MET D CG  1 
ATOM   8994  S  SD  . MET D 2 112 ? 43.121  2.540   -35.525 1.00 74.21  ? 142 MET D SD  1 
ATOM   8995  C  CE  . MET D 2 112 ? 43.571  3.704   -36.793 1.00 71.80  ? 142 MET D CE  1 
ATOM   8996  N  N   . PHE D 2 113 ? 37.012  2.522   -37.566 1.00 64.73  ? 143 PHE D N   1 
ATOM   8997  C  CA  . PHE D 2 113 ? 36.014  2.083   -38.559 1.00 64.12  ? 143 PHE D CA  1 
ATOM   8998  C  C   . PHE D 2 113 ? 35.428  3.270   -39.308 1.00 65.77  ? 143 PHE D C   1 
ATOM   8999  O  O   . PHE D 2 113 ? 34.934  4.210   -38.685 1.00 63.82  ? 143 PHE D O   1 
ATOM   9000  C  CB  . PHE D 2 113 ? 34.895  1.254   -37.892 1.00 64.96  ? 143 PHE D CB  1 
ATOM   9001  C  CG  . PHE D 2 113 ? 33.892  0.641   -38.842 1.00 65.62  ? 143 PHE D CG  1 
ATOM   9002  C  CD1 . PHE D 2 113 ? 34.311  -0.040  -39.979 1.00 68.50  ? 143 PHE D CD1 1 
ATOM   9003  C  CD2 . PHE D 2 113 ? 32.529  0.681   -38.562 1.00 66.10  ? 143 PHE D CD2 1 
ATOM   9004  C  CE1 . PHE D 2 113 ? 33.382  -0.612  -40.854 1.00 68.80  ? 143 PHE D CE1 1 
ATOM   9005  C  CE2 . PHE D 2 113 ? 31.605  0.098   -39.430 1.00 68.26  ? 143 PHE D CE2 1 
ATOM   9006  C  CZ  . PHE D 2 113 ? 32.039  -0.550  -40.565 1.00 66.88  ? 143 PHE D CZ  1 
ATOM   9007  N  N   . PHE D 2 114 ? 35.541  3.235   -40.636 1.00 63.60  ? 144 PHE D N   1 
ATOM   9008  C  CA  . PHE D 2 114 ? 35.071  4.271   -41.548 1.00 65.39  ? 144 PHE D CA  1 
ATOM   9009  C  C   . PHE D 2 114 ? 34.216  3.616   -42.620 1.00 69.48  ? 144 PHE D C   1 
ATOM   9010  O  O   . PHE D 2 114 ? 34.629  2.601   -43.194 1.00 70.91  ? 144 PHE D O   1 
ATOM   9011  C  CB  . PHE D 2 114 ? 36.264  4.989   -42.188 1.00 68.77  ? 144 PHE D CB  1 
ATOM   9012  C  CG  . PHE D 2 114 ? 37.166  5.722   -41.226 1.00 70.97  ? 144 PHE D CG  1 
ATOM   9013  C  CD1 . PHE D 2 114 ? 36.926  7.056   -40.902 1.00 74.81  ? 144 PHE D CD1 1 
ATOM   9014  C  CD2 . PHE D 2 114 ? 38.269  5.088   -40.664 1.00 73.42  ? 144 PHE D CD2 1 
ATOM   9015  C  CE1 . PHE D 2 114 ? 37.767  7.740   -40.019 1.00 76.61  ? 144 PHE D CE1 1 
ATOM   9016  C  CE2 . PHE D 2 114 ? 39.105  5.768   -39.777 1.00 77.13  ? 144 PHE D CE2 1 
ATOM   9017  C  CZ  . PHE D 2 114 ? 38.851  7.094   -39.462 1.00 75.97  ? 144 PHE D CZ  1 
ATOM   9018  N  N   . GLN D 2 115 ? 33.012  4.145   -42.860 1.00 62.91  ? 145 GLN D N   1 
ATOM   9019  C  CA  . GLN D 2 115 ? 32.112  3.541   -43.847 1.00 61.89  ? 145 GLN D CA  1 
ATOM   9020  C  C   . GLN D 2 115 ? 31.803  4.484   -45.008 1.00 66.31  ? 145 GLN D C   1 
ATOM   9021  O  O   . GLN D 2 115 ? 31.754  5.707   -44.834 1.00 65.94  ? 145 GLN D O   1 
ATOM   9022  C  CB  . GLN D 2 115 ? 30.828  2.985   -43.192 1.00 61.87  ? 145 GLN D CB  1 
ATOM   9023  C  CG  . GLN D 2 115 ? 30.744  3.236   -41.687 1.00 57.96  ? 145 GLN D CG  1 
ATOM   9024  C  CD  . GLN D 2 115 ? 29.528  2.661   -41.042 1.00 72.89  ? 145 GLN D CD  1 
ATOM   9025  O  OE1 . GLN D 2 115 ? 28.913  3.274   -40.184 1.00 75.13  ? 145 GLN D OE1 1 
ATOM   9026  N  NE2 . GLN D 2 115 ? 29.197  1.439   -41.361 1.00 62.82  ? 145 GLN D NE2 1 
ATOM   9027  N  N   . PHE D 2 116 ? 31.579  3.910   -46.181 1.00 63.73  ? 146 PHE D N   1 
ATOM   9028  C  CA  . PHE D 2 116 ? 31.305  4.650   -47.408 1.00 65.35  ? 146 PHE D CA  1 
ATOM   9029  C  C   . PHE D 2 116 ? 29.868  5.203   -47.525 1.00 72.36  ? 146 PHE D C   1 
ATOM   9030  O  O   . PHE D 2 116 ? 29.586  6.025   -48.404 1.00 74.18  ? 146 PHE D O   1 
ATOM   9031  C  CB  . PHE D 2 116 ? 31.674  3.787   -48.627 1.00 67.34  ? 146 PHE D CB  1 
ATOM   9032  C  CG  . PHE D 2 116 ? 33.144  3.811   -48.991 1.00 68.82  ? 146 PHE D CG  1 
ATOM   9033  C  CD1 . PHE D 2 116 ? 34.110  4.131   -48.047 1.00 70.47  ? 146 PHE D CD1 1 
ATOM   9034  C  CD2 . PHE D 2 116 ? 33.560  3.517   -50.281 1.00 72.22  ? 146 PHE D CD2 1 
ATOM   9035  C  CE1 . PHE D 2 116 ? 35.457  4.156   -48.385 1.00 72.12  ? 146 PHE D CE1 1 
ATOM   9036  C  CE2 . PHE D 2 116 ? 34.909  3.541   -50.620 1.00 75.26  ? 146 PHE D CE2 1 
ATOM   9037  C  CZ  . PHE D 2 116 ? 35.847  3.862   -49.669 1.00 73.03  ? 146 PHE D CZ  1 
ATOM   9038  N  N   . GLY D 2 117 ? 28.995  4.807   -46.616 1.00 68.07  ? 147 GLY D N   1 
ATOM   9039  C  CA  . GLY D 2 117 ? 27.620  5.284   -46.650 1.00 68.23  ? 147 GLY D CA  1 
ATOM   9040  C  C   . GLY D 2 117 ? 27.374  6.665   -46.068 1.00 73.04  ? 147 GLY D C   1 
ATOM   9041  O  O   . GLY D 2 117 ? 28.232  7.217   -45.370 1.00 70.97  ? 147 GLY D O   1 
ATOM   9042  N  N   . PRO D 2 118 ? 26.160  7.233   -46.311 1.00 71.70  ? 148 PRO D N   1 
ATOM   9043  C  CA  . PRO D 2 118 ? 25.818  8.531   -45.691 1.00 72.16  ? 148 PRO D CA  1 
ATOM   9044  C  C   . PRO D 2 118 ? 25.424  8.352   -44.215 1.00 77.13  ? 148 PRO D C   1 
ATOM   9045  O  O   . PRO D 2 118 ? 25.034  7.245   -43.812 1.00 76.78  ? 148 PRO D O   1 
ATOM   9046  C  CB  . PRO D 2 118 ? 24.630  9.011   -46.518 1.00 73.78  ? 148 PRO D CB  1 
ATOM   9047  C  CG  . PRO D 2 118 ? 23.997  7.771   -47.008 1.00 76.90  ? 148 PRO D CG  1 
ATOM   9048  C  CD  . PRO D 2 118 ? 25.036  6.703   -47.111 1.00 72.07  ? 148 PRO D CD  1 
ATOM   9049  N  N   . SER D 2 119 ? 25.514  9.440   -43.418 1.00 72.71  ? 149 SER D N   1 
ATOM   9050  C  CA  . SER D 2 119 ? 25.162  9.434   -41.990 1.00 70.60  ? 149 SER D CA  1 
ATOM   9051  C  C   . SER D 2 119 ? 23.644  9.485   -41.771 1.00 71.28  ? 149 SER D C   1 
ATOM   9052  O  O   . SER D 2 119 ? 22.876  9.636   -42.730 1.00 71.47  ? 149 SER D O   1 
ATOM   9053  C  CB  . SER D 2 119 ? 25.805  10.628  -41.301 1.00 74.96  ? 149 SER D CB  1 
ATOM   9054  O  OG  . SER D 2 119 ? 25.161  11.835  -41.684 1.00 84.44  ? 149 SER D OG  1 
ATOM   9055  N  N   . ILE D 2 120 ? 23.218  9.379   -40.504 1.00 64.75  ? 150 ILE D N   1 
ATOM   9056  C  CA  . ILE D 2 120 ? 21.801  9.472   -40.143 1.00 63.25  ? 150 ILE D CA  1 
ATOM   9057  C  C   . ILE D 2 120 ? 21.279  10.897  -40.472 1.00 68.12  ? 150 ILE D C   1 
ATOM   9058  O  O   . ILE D 2 120 ? 20.324  11.054  -41.233 1.00 67.65  ? 150 ILE D O   1 
ATOM   9059  C  CB  . ILE D 2 120 ? 21.609  9.092   -38.662 1.00 64.92  ? 150 ILE D CB  1 
ATOM   9060  C  CG1 . ILE D 2 120 ? 21.979  7.612   -38.424 1.00 65.05  ? 150 ILE D CG1 1 
ATOM   9061  C  CG2 . ILE D 2 120 ? 20.205  9.394   -38.202 1.00 64.64  ? 150 ILE D CG2 1 
ATOM   9062  C  CD1 . ILE D 2 120 ? 22.294  7.173   -36.944 1.00 72.99  ? 150 ILE D CD1 1 
ATOM   9063  N  N   . GLU D 2 121 ? 21.965  11.913  -39.942 1.00 65.96  ? 151 GLU D N   1 
ATOM   9064  C  CA  . GLU D 2 121 ? 21.657  13.331  -40.106 1.00 67.07  ? 151 GLU D CA  1 
ATOM   9065  C  C   . GLU D 2 121 ? 21.687  13.779  -41.590 1.00 71.10  ? 151 GLU D C   1 
ATOM   9066  O  O   . GLU D 2 121 ? 20.831  14.580  -41.982 1.00 71.50  ? 151 GLU D O   1 
ATOM   9067  C  CB  . GLU D 2 121 ? 22.545  14.215  -39.188 1.00 69.18  ? 151 GLU D CB  1 
ATOM   9068  C  CG  . GLU D 2 121 ? 23.827  13.570  -38.658 1.00 82.57  ? 151 GLU D CG  1 
ATOM   9069  C  CD  . GLU D 2 121 ? 23.703  12.665  -37.438 1.00 108.46 ? 151 GLU D CD  1 
ATOM   9070  O  OE1 . GLU D 2 121 ? 23.053  13.085  -36.450 1.00 114.37 ? 151 GLU D OE1 1 
ATOM   9071  O  OE2 . GLU D 2 121 ? 24.281  11.549  -37.459 1.00 87.03  ? 151 GLU D OE2 1 
ATOM   9072  N  N   . GLN D 2 122 ? 22.621  13.233  -42.416 1.00 66.94  ? 152 GLN D N   1 
ATOM   9073  C  CA  . GLN D 2 122 ? 22.721  13.543  -43.859 1.00 67.69  ? 152 GLN D CA  1 
ATOM   9074  C  C   . GLN D 2 122 ? 21.468  13.078  -44.562 1.00 72.31  ? 152 GLN D C   1 
ATOM   9075  O  O   . GLN D 2 122 ? 20.865  13.838  -45.319 1.00 73.75  ? 152 GLN D O   1 
ATOM   9076  C  CB  . GLN D 2 122 ? 23.884  12.782  -44.492 1.00 69.13  ? 152 GLN D CB  1 
ATOM   9077  C  CG  . GLN D 2 122 ? 24.866  13.622  -45.297 1.00 90.12  ? 152 GLN D CG  1 
ATOM   9078  C  CD  . GLN D 2 122 ? 26.282  13.059  -45.229 1.00 110.27 ? 152 GLN D CD  1 
ATOM   9079  O  OE1 . GLN D 2 122 ? 27.186  13.578  -45.876 1.00 112.19 ? 152 GLN D OE1 1 
ATOM   9080  N  NE2 . GLN D 2 122 ? 26.536  12.010  -44.426 1.00 88.88  ? 152 GLN D NE2 1 
ATOM   9081  N  N   . GLN D 2 123 ? 21.085  11.806  -44.310 1.00 67.36  ? 153 GLN D N   1 
ATOM   9082  C  CA  . GLN D 2 123 ? 19.910  11.164  -44.893 1.00 65.91  ? 153 GLN D CA  1 
ATOM   9083  C  C   . GLN D 2 123 ? 18.645  11.904  -44.504 1.00 71.62  ? 153 GLN D C   1 
ATOM   9084  O  O   . GLN D 2 123 ? 17.884  12.307  -45.377 1.00 72.34  ? 153 GLN D O   1 
ATOM   9085  C  CB  . GLN D 2 123 ? 19.868  9.686   -44.518 1.00 65.06  ? 153 GLN D CB  1 
ATOM   9086  C  CG  . GLN D 2 123 ? 20.864  8.894   -45.333 1.00 67.95  ? 153 GLN D CG  1 
ATOM   9087  C  CD  . GLN D 2 123 ? 20.801  7.433   -45.033 1.00 82.81  ? 153 GLN D CD  1 
ATOM   9088  O  OE1 . GLN D 2 123 ? 19.848  6.762   -45.382 1.00 75.70  ? 153 GLN D OE1 1 
ATOM   9089  N  NE2 . GLN D 2 123 ? 21.834  6.892   -44.426 1.00 77.04  ? 153 GLN D NE2 1 
ATOM   9090  N  N   . ALA D 2 124 ? 18.480  12.182  -43.204 1.00 68.74  ? 154 ALA D N   1 
ATOM   9091  C  CA  . ALA D 2 124 ? 17.361  12.939  -42.656 1.00 69.18  ? 154 ALA D CA  1 
ATOM   9092  C  C   . ALA D 2 124 ? 17.156  14.273  -43.404 1.00 76.37  ? 154 ALA D C   1 
ATOM   9093  O  O   . ALA D 2 124 ? 16.013  14.664  -43.636 1.00 76.54  ? 154 ALA D O   1 
ATOM   9094  C  CB  . ALA D 2 124 ? 17.598  13.202  -41.175 1.00 69.26  ? 154 ALA D CB  1 
ATOM   9095  N  N   . SER D 2 125 ? 18.251  14.959  -43.794 1.00 74.15  ? 155 SER D N   1 
ATOM   9096  C  CA  . SER D 2 125 ? 18.159  16.239  -44.491 1.00 75.70  ? 155 SER D CA  1 
ATOM   9097  C  C   . SER D 2 125 ? 17.692  16.021  -45.913 1.00 78.57  ? 155 SER D C   1 
ATOM   9098  O  O   . SER D 2 125 ? 16.801  16.733  -46.373 1.00 79.17  ? 155 SER D O   1 
ATOM   9099  C  CB  . SER D 2 125 ? 19.491  16.978  -44.452 1.00 81.92  ? 155 SER D CB  1 
ATOM   9100  O  OG  . SER D 2 125 ? 20.335  16.567  -45.516 1.00 97.56  ? 155 SER D OG  1 
ATOM   9101  N  N   . VAL D 2 126 ? 18.255  14.993  -46.586 1.00 73.71  ? 156 VAL D N   1 
ATOM   9102  C  CA  . VAL D 2 126 ? 17.900  14.576  -47.949 1.00 73.17  ? 156 VAL D CA  1 
ATOM   9103  C  C   . VAL D 2 126 ? 16.381  14.314  -48.016 1.00 75.38  ? 156 VAL D C   1 
ATOM   9104  O  O   . VAL D 2 126 ? 15.726  14.766  -48.947 1.00 76.32  ? 156 VAL D O   1 
ATOM   9105  C  CB  . VAL D 2 126 ? 18.742  13.340  -48.387 1.00 76.10  ? 156 VAL D CB  1 
ATOM   9106  C  CG1 . VAL D 2 126 ? 18.239  12.754  -49.707 1.00 76.51  ? 156 VAL D CG1 1 
ATOM   9107  C  CG2 . VAL D 2 126 ? 20.227  13.683  -48.479 1.00 75.64  ? 156 VAL D CG2 1 
ATOM   9108  N  N   . MET D 2 127 ? 15.826  13.652  -46.983 1.00 70.13  ? 157 MET D N   1 
ATOM   9109  C  CA  . MET D 2 127 ? 14.406  13.343  -46.856 1.00 69.18  ? 157 MET D CA  1 
ATOM   9110  C  C   . MET D 2 127 ? 13.553  14.600  -46.815 1.00 72.99  ? 157 MET D C   1 
ATOM   9111  O  O   . MET D 2 127 ? 12.528  14.644  -47.492 1.00 73.81  ? 157 MET D O   1 
ATOM   9112  C  CB  . MET D 2 127 ? 14.152  12.428  -45.652 1.00 70.62  ? 157 MET D CB  1 
ATOM   9113  C  CG  . MET D 2 127 ? 14.611  11.010  -45.898 1.00 74.35  ? 157 MET D CG  1 
ATOM   9114  S  SD  . MET D 2 127 ? 14.749  9.934   -44.447 1.00 78.89  ? 157 MET D SD  1 
ATOM   9115  C  CE  . MET D 2 127 ? 13.070  9.521   -44.160 1.00 75.86  ? 157 MET D CE  1 
ATOM   9116  N  N   . LEU D 2 128 ? 13.997  15.639  -46.079 1.00 69.05  ? 158 LEU D N   1 
ATOM   9117  C  CA  . LEU D 2 128 ? 13.301  16.932  -45.984 1.00 69.19  ? 158 LEU D CA  1 
ATOM   9118  C  C   . LEU D 2 128 ? 13.448  17.719  -47.270 1.00 73.32  ? 158 LEU D C   1 
ATOM   9119  O  O   . LEU D 2 128 ? 12.515  18.423  -47.660 1.00 74.67  ? 158 LEU D O   1 
ATOM   9120  C  CB  . LEU D 2 128 ? 13.758  17.750  -44.769 1.00 69.32  ? 158 LEU D CB  1 
ATOM   9121  C  CG  . LEU D 2 128 ? 13.311  17.227  -43.392 1.00 73.37  ? 158 LEU D CG  1 
ATOM   9122  C  CD1 . LEU D 2 128 ? 14.252  17.675  -42.306 1.00 73.88  ? 158 LEU D CD1 1 
ATOM   9123  C  CD2 . LEU D 2 128 ? 11.901  17.682  -43.047 1.00 75.70  ? 158 LEU D CD2 1 
ATOM   9124  N  N   . ASN D 2 129 ? 14.594  17.565  -47.962 1.00 69.41  ? 159 ASN D N   1 
ATOM   9125  C  CA  . ASN D 2 129 ? 14.823  18.222  -49.256 1.00 71.41  ? 159 ASN D CA  1 
ATOM   9126  C  C   . ASN D 2 129 ? 13.794  17.740  -50.293 1.00 75.97  ? 159 ASN D C   1 
ATOM   9127  O  O   . ASN D 2 129 ? 13.244  18.560  -51.034 1.00 76.58  ? 159 ASN D O   1 
ATOM   9128  C  CB  . ASN D 2 129 ? 16.246  18.004  -49.752 1.00 71.06  ? 159 ASN D CB  1 
ATOM   9129  C  CG  . ASN D 2 129 ? 17.219  18.977  -49.149 1.00 93.21  ? 159 ASN D CG  1 
ATOM   9130  O  OD1 . ASN D 2 129 ? 17.368  20.127  -49.599 1.00 78.36  ? 159 ASN D OD1 1 
ATOM   9131  N  ND2 . ASN D 2 129 ? 17.910  18.532  -48.117 1.00 90.69  ? 159 ASN D ND2 1 
ATOM   9132  N  N   . ILE D 2 130 ? 13.507  16.408  -50.297 1.00 70.81  ? 160 ILE D N   1 
ATOM   9133  C  CA  . ILE D 2 130 ? 12.486  15.758  -51.131 1.00 69.04  ? 160 ILE D CA  1 
ATOM   9134  C  C   . ILE D 2 130 ? 11.113  16.386  -50.789 1.00 72.97  ? 160 ILE D C   1 
ATOM   9135  O  O   . ILE D 2 130 ? 10.384  16.806  -51.688 1.00 72.93  ? 160 ILE D O   1 
ATOM   9136  C  CB  . ILE D 2 130 ? 12.495  14.214  -50.911 1.00 69.13  ? 160 ILE D CB  1 
ATOM   9137  C  CG1 . ILE D 2 130 ? 13.755  13.584  -51.482 1.00 68.28  ? 160 ILE D CG1 1 
ATOM   9138  C  CG2 . ILE D 2 130 ? 11.235  13.543  -51.475 1.00 68.98  ? 160 ILE D CG2 1 
ATOM   9139  C  CD1 . ILE D 2 130 ? 14.204  12.318  -50.724 1.00 75.95  ? 160 ILE D CD1 1 
ATOM   9140  N  N   . MET D 2 131 ? 10.804  16.484  -49.488 1.00 69.02  ? 161 MET D N   1 
ATOM   9141  C  CA  . MET D 2 131 ? 9.554   17.027  -49.002 1.00 70.50  ? 161 MET D CA  1 
ATOM   9142  C  C   . MET D 2 131 ? 9.355   18.500  -49.384 1.00 78.78  ? 161 MET D C   1 
ATOM   9143  O  O   . MET D 2 131 ? 8.268   18.866  -49.841 1.00 79.29  ? 161 MET D O   1 
ATOM   9144  C  CB  . MET D 2 131 ? 9.445   16.819  -47.496 1.00 72.28  ? 161 MET D CB  1 
ATOM   9145  C  CG  . MET D 2 131 ? 9.124   15.398  -47.086 1.00 74.50  ? 161 MET D CG  1 
ATOM   9146  S  SD  . MET D 2 131 ? 8.916   15.299  -45.281 1.00 77.94  ? 161 MET D SD  1 
ATOM   9147  C  CE  . MET D 2 131 ? 10.501  14.966  -44.844 1.00 73.74  ? 161 MET D CE  1 
ATOM   9148  N  N   . GLU D 2 132 ? 10.409  19.337  -49.246 1.00 77.81  ? 162 GLU D N   1 
ATOM   9149  C  CA  . GLU D 2 132 ? 10.330  20.760  -49.609 1.00 79.90  ? 162 GLU D CA  1 
ATOM   9150  C  C   . GLU D 2 132 ? 9.998   20.940  -51.087 1.00 84.39  ? 162 GLU D C   1 
ATOM   9151  O  O   . GLU D 2 132 ? 9.199   21.819  -51.412 1.00 87.46  ? 162 GLU D O   1 
ATOM   9152  C  CB  . GLU D 2 132 ? 11.627  21.503  -49.264 1.00 81.77  ? 162 GLU D CB  1 
ATOM   9153  N  N   . GLU D 2 133 ? 10.579  20.077  -51.962 1.00 77.57  ? 163 GLU D N   1 
ATOM   9154  C  CA  . GLU D 2 133 ? 10.414  20.059  -53.423 1.00 77.86  ? 163 GLU D CA  1 
ATOM   9155  C  C   . GLU D 2 133 ? 8.940   19.868  -53.887 1.00 80.80  ? 163 GLU D C   1 
ATOM   9156  O  O   . GLU D 2 133 ? 8.458   20.599  -54.765 1.00 81.13  ? 163 GLU D O   1 
ATOM   9157  C  CB  . GLU D 2 133 ? 11.333  18.992  -54.050 1.00 78.37  ? 163 GLU D CB  1 
ATOM   9158  C  CG  . GLU D 2 133 ? 11.347  18.964  -55.569 1.00 92.20  ? 163 GLU D CG  1 
ATOM   9159  C  CD  . GLU D 2 133 ? 12.183  20.035  -56.246 1.00 127.22 ? 163 GLU D CD  1 
ATOM   9160  O  OE1 . GLU D 2 133 ? 11.584  20.947  -56.863 1.00 135.30 ? 163 GLU D OE1 1 
ATOM   9161  O  OE2 . GLU D 2 133 ? 13.433  19.948  -56.188 1.00 119.25 ? 163 GLU D OE2 1 
ATOM   9162  N  N   . TYR D 2 134 ? 8.243   18.894  -53.298 1.00 74.68  ? 164 TYR D N   1 
ATOM   9163  C  CA  . TYR D 2 134 ? 6.864   18.585  -53.661 1.00 73.65  ? 164 TYR D CA  1 
ATOM   9164  C  C   . TYR D 2 134 ? 5.856   19.191  -52.698 1.00 79.91  ? 164 TYR D C   1 
ATOM   9165  O  O   . TYR D 2 134 ? 4.651   18.911  -52.799 1.00 80.44  ? 164 TYR D O   1 
ATOM   9166  C  CB  . TYR D 2 134 ? 6.674   17.068  -53.816 1.00 71.78  ? 164 TYR D CB  1 
ATOM   9167  C  CG  . TYR D 2 134 ? 7.628   16.464  -54.814 1.00 70.64  ? 164 TYR D CG  1 
ATOM   9168  C  CD1 . TYR D 2 134 ? 7.444   16.647  -56.179 1.00 72.95  ? 164 TYR D CD1 1 
ATOM   9169  C  CD2 . TYR D 2 134 ? 8.744   15.755  -54.393 1.00 70.08  ? 164 TYR D CD2 1 
ATOM   9170  C  CE1 . TYR D 2 134 ? 8.348   16.141  -57.102 1.00 72.82  ? 164 TYR D CE1 1 
ATOM   9171  C  CE2 . TYR D 2 134 ? 9.650   15.236  -55.306 1.00 71.41  ? 164 TYR D CE2 1 
ATOM   9172  C  CZ  . TYR D 2 134 ? 9.442   15.426  -56.661 1.00 79.55  ? 164 TYR D CZ  1 
ATOM   9173  O  OH  . TYR D 2 134 ? 10.304  14.893  -57.576 1.00 80.78  ? 164 TYR D OH  1 
ATOM   9174  N  N   . ASP D 2 135 ? 6.355   20.073  -51.797 1.00 76.66  ? 165 ASP D N   1 
ATOM   9175  C  CA  . ASP D 2 135 ? 5.585   20.791  -50.776 1.00 76.54  ? 165 ASP D CA  1 
ATOM   9176  C  C   . ASP D 2 135 ? 4.797   19.814  -49.910 1.00 78.98  ? 165 ASP D C   1 
ATOM   9177  O  O   . ASP D 2 135 ? 3.577   19.846  -49.844 1.00 78.99  ? 165 ASP D O   1 
ATOM   9178  C  CB  . ASP D 2 135 ? 4.718   21.921  -51.394 1.00 79.49  ? 165 ASP D CB  1 
ATOM   9179  C  CG  . ASP D 2 135 ? 5.489   22.929  -52.234 1.00 89.38  ? 165 ASP D CG  1 
ATOM   9180  O  OD1 . ASP D 2 135 ? 6.612   23.328  -51.819 1.00 89.68  ? 165 ASP D OD1 1 
ATOM   9181  O  OD2 . ASP D 2 135 ? 4.969   23.337  -53.292 1.00 97.53  ? 165 ASP D OD2 1 
ATOM   9182  N  N   . TRP D 2 136 ? 5.527   18.893  -49.318 1.00 75.77  ? 166 TRP D N   1 
ATOM   9183  C  CA  . TRP D 2 136 ? 5.044   17.843  -48.439 1.00 75.69  ? 166 TRP D CA  1 
ATOM   9184  C  C   . TRP D 2 136 ? 5.437   18.264  -47.036 1.00 78.64  ? 166 TRP D C   1 
ATOM   9185  O  O   . TRP D 2 136 ? 6.368   17.702  -46.457 1.00 76.44  ? 166 TRP D O   1 
ATOM   9186  C  CB  . TRP D 2 136 ? 5.706   16.501  -48.831 1.00 73.95  ? 166 TRP D CB  1 
ATOM   9187  C  CG  . TRP D 2 136 ? 5.246   15.954  -50.151 1.00 76.00  ? 166 TRP D CG  1 
ATOM   9188  C  CD1 . TRP D 2 136 ? 4.184   16.379  -50.890 1.00 80.45  ? 166 TRP D CD1 1 
ATOM   9189  C  CD2 . TRP D 2 136 ? 5.803   14.838  -50.855 1.00 75.46  ? 166 TRP D CD2 1 
ATOM   9190  N  NE1 . TRP D 2 136 ? 4.065   15.621  -52.032 1.00 80.66  ? 166 TRP D NE1 1 
ATOM   9191  C  CE2 . TRP D 2 136 ? 5.037   14.656  -52.028 1.00 80.83  ? 166 TRP D CE2 1 
ATOM   9192  C  CE3 . TRP D 2 136 ? 6.896   13.984  -50.626 1.00 75.88  ? 166 TRP D CE3 1 
ATOM   9193  C  CZ2 . TRP D 2 136 ? 5.328   13.657  -52.969 1.00 79.92  ? 166 TRP D CZ2 1 
ATOM   9194  C  CZ3 . TRP D 2 136 ? 7.180   12.989  -51.552 1.00 77.21  ? 166 TRP D CZ3 1 
ATOM   9195  C  CH2 . TRP D 2 136 ? 6.401   12.831  -52.707 1.00 78.82  ? 166 TRP D CH2 1 
ATOM   9196  N  N   . TYR D 2 137 ? 4.759   19.309  -46.520 1.00 76.07  ? 167 TYR D N   1 
ATOM   9197  C  CA  . TYR D 2 137 ? 5.068   19.921  -45.229 1.00 76.20  ? 167 TYR D CA  1 
ATOM   9198  C  C   . TYR D 2 137 ? 4.390   19.264  -44.030 1.00 79.52  ? 167 TYR D C   1 
ATOM   9199  O  O   . TYR D 2 137 ? 4.865   19.437  -42.910 1.00 79.31  ? 167 TYR D O   1 
ATOM   9200  C  CB  . TYR D 2 137 ? 4.781   21.427  -45.268 1.00 79.47  ? 167 TYR D CB  1 
ATOM   9201  C  CG  . TYR D 2 137 ? 5.528   22.142  -46.372 1.00 82.81  ? 167 TYR D CG  1 
ATOM   9202  C  CD1 . TYR D 2 137 ? 6.919   22.116  -46.432 1.00 84.97  ? 167 TYR D CD1 1 
ATOM   9203  C  CD2 . TYR D 2 137 ? 4.845   22.839  -47.364 1.00 84.72  ? 167 TYR D CD2 1 
ATOM   9204  C  CE1 . TYR D 2 137 ? 7.611   22.742  -47.468 1.00 87.91  ? 167 TYR D CE1 1 
ATOM   9205  C  CE2 . TYR D 2 137 ? 5.528   23.516  -48.375 1.00 86.63  ? 167 TYR D CE2 1 
ATOM   9206  C  CZ  . TYR D 2 137 ? 6.912   23.456  -48.431 1.00 97.17  ? 167 TYR D CZ  1 
ATOM   9207  O  OH  . TYR D 2 137 ? 7.592   24.107  -49.439 1.00 101.83 ? 167 TYR D OH  1 
ATOM   9208  N  N   . ILE D 2 138 ? 3.312   18.501  -44.251 1.00 75.39  ? 168 ILE D N   1 
ATOM   9209  C  CA  . ILE D 2 138 ? 2.620   17.816  -43.160 1.00 74.28  ? 168 ILE D CA  1 
ATOM   9210  C  C   . ILE D 2 138 ? 3.026   16.344  -43.158 1.00 78.21  ? 168 ILE D C   1 
ATOM   9211  O  O   . ILE D 2 138 ? 2.851   15.655  -44.169 1.00 77.11  ? 168 ILE D O   1 
ATOM   9212  C  CB  . ILE D 2 138 ? 1.107   18.066  -43.227 1.00 77.61  ? 168 ILE D CB  1 
ATOM   9213  C  CG1 . ILE D 2 138 ? 0.807   19.498  -42.753 1.00 78.91  ? 168 ILE D CG1 1 
ATOM   9214  C  CG2 . ILE D 2 138 ? 0.344   17.035  -42.402 1.00 77.67  ? 168 ILE D CG2 1 
ATOM   9215  C  CD1 . ILE D 2 138 ? -0.240  20.146  -43.416 1.00 86.18  ? 168 ILE D CD1 1 
ATOM   9216  N  N   . PHE D 2 139 ? 3.616   15.883  -42.028 1.00 75.07  ? 169 PHE D N   1 
ATOM   9217  C  CA  . PHE D 2 139 ? 4.165   14.535  -41.896 1.00 73.33  ? 169 PHE D CA  1 
ATOM   9218  C  C   . PHE D 2 139 ? 4.260   13.983  -40.461 1.00 76.50  ? 169 PHE D C   1 
ATOM   9219  O  O   . PHE D 2 139 ? 4.082   14.719  -39.493 1.00 76.71  ? 169 PHE D O   1 
ATOM   9220  C  CB  . PHE D 2 139 ? 5.560   14.513  -42.548 1.00 74.22  ? 169 PHE D CB  1 
ATOM   9221  C  CG  . PHE D 2 139 ? 6.627   15.269  -41.801 1.00 75.40  ? 169 PHE D CG  1 
ATOM   9222  C  CD1 . PHE D 2 139 ? 6.725   16.653  -41.905 1.00 79.33  ? 169 PHE D CD1 1 
ATOM   9223  C  CD2 . PHE D 2 139 ? 7.561   14.593  -41.022 1.00 76.27  ? 169 PHE D CD2 1 
ATOM   9224  C  CE1 . PHE D 2 139 ? 7.727   17.346  -41.231 1.00 80.34  ? 169 PHE D CE1 1 
ATOM   9225  C  CE2 . PHE D 2 139 ? 8.571   15.283  -40.362 1.00 78.90  ? 169 PHE D CE2 1 
ATOM   9226  C  CZ  . PHE D 2 139 ? 8.649   16.650  -40.477 1.00 78.47  ? 169 PHE D CZ  1 
ATOM   9227  N  N   . SER D 2 140 ? 4.603   12.682  -40.345 1.00 71.66  ? 170 SER D N   1 
ATOM   9228  C  CA  . SER D 2 140 ? 4.854   11.969  -39.084 1.00 70.23  ? 170 SER D CA  1 
ATOM   9229  C  C   . SER D 2 140 ? 6.165   11.143  -39.178 1.00 73.34  ? 170 SER D C   1 
ATOM   9230  O  O   . SER D 2 140 ? 6.640   10.849  -40.277 1.00 73.67  ? 170 SER D O   1 
ATOM   9231  C  CB  . SER D 2 140 ? 3.676   11.074  -38.708 1.00 71.62  ? 170 SER D CB  1 
ATOM   9232  O  OG  . SER D 2 140 ? 2.548   11.822  -38.296 1.00 82.81  ? 170 SER D OG  1 
ATOM   9233  N  N   . ILE D 2 141 ? 6.754   10.797  -38.035 1.00 68.19  ? 171 ILE D N   1 
ATOM   9234  C  CA  . ILE D 2 141 ? 7.971   9.995   -37.974 1.00 66.84  ? 171 ILE D CA  1 
ATOM   9235  C  C   . ILE D 2 141 ? 7.628   8.722   -37.221 1.00 70.74  ? 171 ILE D C   1 
ATOM   9236  O  O   . ILE D 2 141 ? 6.865   8.770   -36.258 1.00 71.07  ? 171 ILE D O   1 
ATOM   9237  C  CB  . ILE D 2 141 ? 9.150   10.777  -37.303 1.00 69.75  ? 171 ILE D CB  1 
ATOM   9238  C  CG1 . ILE D 2 141 ? 9.513   12.055  -38.097 1.00 70.85  ? 171 ILE D CG1 1 
ATOM   9239  C  CG2 . ILE D 2 141 ? 10.382  9.880   -37.133 1.00 68.58  ? 171 ILE D CG2 1 
ATOM   9240  C  CD1 . ILE D 2 141 ? 10.487  13.023  -37.426 1.00 75.11  ? 171 ILE D CD1 1 
ATOM   9241  N  N   . VAL D 2 142 ? 8.159   7.586   -37.672 1.00 66.49  ? 172 VAL D N   1 
ATOM   9242  C  CA  . VAL D 2 142 ? 7.955   6.298   -37.018 1.00 65.41  ? 172 VAL D CA  1 
ATOM   9243  C  C   . VAL D 2 142 ? 9.293   5.668   -36.966 1.00 70.12  ? 172 VAL D C   1 
ATOM   9244  O  O   . VAL D 2 142 ? 9.851   5.358   -38.018 1.00 70.57  ? 172 VAL D O   1 
ATOM   9245  C  CB  . VAL D 2 142 ? 6.975   5.368   -37.765 1.00 68.56  ? 172 VAL D CB  1 
ATOM   9246  C  CG1 . VAL D 2 142 ? 7.006   3.955   -37.172 1.00 67.30  ? 172 VAL D CG1 1 
ATOM   9247  C  CG2 . VAL D 2 142 ? 5.564   5.939   -37.764 1.00 69.10  ? 172 VAL D CG2 1 
ATOM   9248  N  N   . THR D 2 143 ? 9.828   5.474   -35.765 1.00 66.95  ? 173 THR D N   1 
ATOM   9249  C  CA  . THR D 2 143 ? 11.121  4.800   -35.604 1.00 64.98  ? 173 THR D CA  1 
ATOM   9250  C  C   . THR D 2 143 ? 10.990  3.599   -34.701 1.00 66.02  ? 173 THR D C   1 
ATOM   9251  O  O   . THR D 2 143 ? 10.032  3.483   -33.923 1.00 65.47  ? 173 THR D O   1 
ATOM   9252  C  CB  . THR D 2 143 ? 12.228  5.735   -35.059 1.00 75.13  ? 173 THR D CB  1 
ATOM   9253  O  OG1 . THR D 2 143 ? 11.996  6.055   -33.676 1.00 72.59  ? 173 THR D OG1 1 
ATOM   9254  C  CG2 . THR D 2 143 ? 12.404  6.999   -35.879 1.00 77.41  ? 173 THR D CG2 1 
ATOM   9255  N  N   . THR D 2 144 ? 11.979  2.717   -34.793 1.00 61.25  ? 174 THR D N   1 
ATOM   9256  C  CA  . THR D 2 144 ? 12.138  1.608   -33.869 1.00 60.53  ? 174 THR D CA  1 
ATOM   9257  C  C   . THR D 2 144 ? 13.232  2.096   -32.924 1.00 64.35  ? 174 THR D C   1 
ATOM   9258  O  O   . THR D 2 144 ? 13.528  3.304   -32.912 1.00 64.72  ? 174 THR D O   1 
ATOM   9259  C  CB  . THR D 2 144 ? 12.499  0.320   -34.584 1.00 63.93  ? 174 THR D CB  1 
ATOM   9260  O  OG1 . THR D 2 144 ? 13.679  0.534   -35.342 1.00 64.33  ? 174 THR D OG1 1 
ATOM   9261  C  CG2 . THR D 2 144 ? 11.385  -0.173  -35.449 1.00 61.24  ? 174 THR D CG2 1 
ATOM   9262  N  N   . TYR D 2 145 ? 13.849  1.185   -32.146 1.00 59.48  ? 175 TYR D N   1 
ATOM   9263  C  CA  . TYR D 2 145 ? 14.923  1.593   -31.243 1.00 57.97  ? 175 TYR D CA  1 
ATOM   9264  C  C   . TYR D 2 145 ? 16.274  1.489   -31.925 1.00 60.98  ? 175 TYR D C   1 
ATOM   9265  O  O   . TYR D 2 145 ? 17.279  1.681   -31.275 1.00 60.48  ? 175 TYR D O   1 
ATOM   9266  C  CB  . TYR D 2 145 ? 14.893  0.801   -29.928 1.00 58.82  ? 175 TYR D CB  1 
ATOM   9267  C  CG  . TYR D 2 145 ? 13.893  1.309   -28.918 1.00 60.74  ? 175 TYR D CG  1 
ATOM   9268  C  CD1 . TYR D 2 145 ? 12.551  0.943   -28.989 1.00 62.57  ? 175 TYR D CD1 1 
ATOM   9269  C  CD2 . TYR D 2 145 ? 14.293  2.119   -27.861 1.00 62.34  ? 175 TYR D CD2 1 
ATOM   9270  C  CE1 . TYR D 2 145 ? 11.632  1.371   -28.036 1.00 63.28  ? 175 TYR D CE1 1 
ATOM   9271  C  CE2 . TYR D 2 145 ? 13.379  2.566   -26.908 1.00 64.51  ? 175 TYR D CE2 1 
ATOM   9272  C  CZ  . TYR D 2 145 ? 12.049  2.182   -26.994 1.00 72.74  ? 175 TYR D CZ  1 
ATOM   9273  O  OH  . TYR D 2 145 ? 11.147  2.601   -26.040 1.00 76.80  ? 175 TYR D OH  1 
ATOM   9274  N  N   . PHE D 2 146 ? 16.306  1.203   -33.236 1.00 58.30  ? 176 PHE D N   1 
ATOM   9275  C  CA  . PHE D 2 146 ? 17.545  1.085   -34.002 1.00 58.00  ? 176 PHE D CA  1 
ATOM   9276  C  C   . PHE D 2 146 ? 18.495  2.250   -33.681 1.00 64.51  ? 176 PHE D C   1 
ATOM   9277  O  O   . PHE D 2 146 ? 18.067  3.416   -33.726 1.00 67.04  ? 176 PHE D O   1 
ATOM   9278  C  CB  . PHE D 2 146 ? 17.298  0.947   -35.521 1.00 59.06  ? 176 PHE D CB  1 
ATOM   9279  C  CG  . PHE D 2 146 ? 18.589  0.651   -36.241 1.00 59.89  ? 176 PHE D CG  1 
ATOM   9280  C  CD1 . PHE D 2 146 ? 19.189  -0.605  -36.143 1.00 61.89  ? 176 PHE D CD1 1 
ATOM   9281  C  CD2 . PHE D 2 146 ? 19.272  1.656   -36.916 1.00 61.84  ? 176 PHE D CD2 1 
ATOM   9282  C  CE1 . PHE D 2 146 ? 20.412  -0.867  -36.759 1.00 61.61  ? 176 PHE D CE1 1 
ATOM   9283  C  CE2 . PHE D 2 146 ? 20.502  1.392   -37.530 1.00 64.34  ? 176 PHE D CE2 1 
ATOM   9284  C  CZ  . PHE D 2 146 ? 21.052  0.127   -37.462 1.00 61.40  ? 176 PHE D CZ  1 
ATOM   9285  N  N   . PRO D 2 147 ? 19.759  1.957   -33.298 1.00 57.27  ? 177 PRO D N   1 
ATOM   9286  C  CA  . PRO D 2 147 ? 20.660  3.038   -32.906 1.00 56.23  ? 177 PRO D CA  1 
ATOM   9287  C  C   . PRO D 2 147 ? 20.668  4.278   -33.807 1.00 61.85  ? 177 PRO D C   1 
ATOM   9288  O  O   . PRO D 2 147 ? 20.877  4.180   -35.024 1.00 61.40  ? 177 PRO D O   1 
ATOM   9289  C  CB  . PRO D 2 147 ? 22.003  2.352   -32.865 1.00 57.22  ? 177 PRO D CB  1 
ATOM   9290  C  CG  . PRO D 2 147 ? 21.715  0.949   -32.591 1.00 61.42  ? 177 PRO D CG  1 
ATOM   9291  C  CD  . PRO D 2 147 ? 20.409  0.635   -33.173 1.00 57.30  ? 177 PRO D CD  1 
ATOM   9292  N  N   . GLY D 2 148 ? 20.422  5.426   -33.173 1.00 59.18  ? 178 GLY D N   1 
ATOM   9293  C  CA  . GLY D 2 148 ? 20.439  6.737   -33.804 1.00 60.04  ? 178 GLY D CA  1 
ATOM   9294  C  C   . GLY D 2 148 ? 19.068  7.298   -34.079 1.00 66.70  ? 178 GLY D C   1 
ATOM   9295  O  O   . GLY D 2 148 ? 18.941  8.396   -34.630 1.00 67.19  ? 178 GLY D O   1 
ATOM   9296  N  N   . TYR D 2 149 ? 18.030  6.549   -33.687 1.00 64.09  ? 179 TYR D N   1 
ATOM   9297  C  CA  . TYR D 2 149 ? 16.649  6.959   -33.881 1.00 64.70  ? 179 TYR D CA  1 
ATOM   9298  C  C   . TYR D 2 149 ? 16.396  8.327   -33.303 1.00 69.71  ? 179 TYR D C   1 
ATOM   9299  O  O   . TYR D 2 149 ? 15.725  9.119   -33.949 1.00 71.00  ? 179 TYR D O   1 
ATOM   9300  C  CB  . TYR D 2 149 ? 15.676  5.898   -33.359 1.00 66.29  ? 179 TYR D CB  1 
ATOM   9301  C  CG  . TYR D 2 149 ? 15.555  5.859   -31.852 1.00 69.67  ? 179 TYR D CG  1 
ATOM   9302  C  CD1 . TYR D 2 149 ? 14.598  6.623   -31.190 1.00 72.22  ? 179 TYR D CD1 1 
ATOM   9303  C  CD2 . TYR D 2 149 ? 16.379  5.039   -31.085 1.00 70.60  ? 179 TYR D CD2 1 
ATOM   9304  C  CE1 . TYR D 2 149 ? 14.472  6.589   -29.804 1.00 73.29  ? 179 TYR D CE1 1 
ATOM   9305  C  CE2 . TYR D 2 149 ? 16.260  4.993   -29.692 1.00 72.39  ? 179 TYR D CE2 1 
ATOM   9306  C  CZ  . TYR D 2 149 ? 15.288  5.759   -29.057 1.00 82.22  ? 179 TYR D CZ  1 
ATOM   9307  O  OH  . TYR D 2 149 ? 15.122  5.740   -27.689 1.00 84.14  ? 179 TYR D OH  1 
ATOM   9308  N  N   . GLN D 2 150 ? 16.987  8.633   -32.137 1.00 67.35  ? 180 GLN D N   1 
ATOM   9309  C  CA  . GLN D 2 150 ? 16.880  9.951   -31.493 1.00 69.10  ? 180 GLN D CA  1 
ATOM   9310  C  C   . GLN D 2 150 ? 17.630  10.999  -32.307 1.00 72.98  ? 180 GLN D C   1 
ATOM   9311  O  O   . GLN D 2 150 ? 17.084  12.071  -32.528 1.00 74.07  ? 180 GLN D O   1 
ATOM   9312  C  CB  . GLN D 2 150 ? 17.336  9.939   -30.030 1.00 71.57  ? 180 GLN D CB  1 
ATOM   9313  C  CG  . GLN D 2 150 ? 18.132  8.676   -29.607 1.00 106.43 ? 180 GLN D CG  1 
ATOM   9314  C  CD  . GLN D 2 150 ? 18.490  8.667   -28.139 1.00 138.38 ? 180 GLN D CD  1 
ATOM   9315  O  OE1 . GLN D 2 150 ? 19.479  9.287   -27.708 1.00 134.40 ? 180 GLN D OE1 1 
ATOM   9316  N  NE2 . GLN D 2 150 ? 17.704  7.952   -27.333 1.00 134.21 ? 180 GLN D NE2 1 
ATOM   9317  N  N   . ASP D 2 151 ? 18.822  10.657  -32.835 1.00 68.39  ? 181 ASP D N   1 
ATOM   9318  C  CA  . ASP D 2 151 ? 19.609  11.553  -33.688 1.00 68.90  ? 181 ASP D CA  1 
ATOM   9319  C  C   . ASP D 2 151 ? 18.843  11.888  -34.982 1.00 71.17  ? 181 ASP D C   1 
ATOM   9320  O  O   . ASP D 2 151 ? 18.857  13.042  -35.425 1.00 72.56  ? 181 ASP D O   1 
ATOM   9321  C  CB  . ASP D 2 151 ? 21.002  10.963  -33.990 1.00 71.07  ? 181 ASP D CB  1 
ATOM   9322  C  CG  . ASP D 2 151 ? 21.998  10.944  -32.832 1.00 93.39  ? 181 ASP D CG  1 
ATOM   9323  O  OD1 . ASP D 2 151 ? 21.676  11.501  -31.738 1.00 95.55  ? 181 ASP D OD1 1 
ATOM   9324  O  OD2 . ASP D 2 151 ? 23.113  10.419  -33.026 1.00 105.24 ? 181 ASP D OD2 1 
ATOM   9325  N  N   . PHE D 2 152 ? 18.110  10.901  -35.529 1.00 64.76  ? 182 PHE D N   1 
ATOM   9326  C  CA  . PHE D 2 152 ? 17.268  11.076  -36.703 1.00 64.15  ? 182 PHE D CA  1 
ATOM   9327  C  C   . PHE D 2 152 ? 16.145  12.070  -36.404 1.00 68.46  ? 182 PHE D C   1 
ATOM   9328  O  O   . PHE D 2 152 ? 16.063  13.087  -37.100 1.00 69.37  ? 182 PHE D O   1 
ATOM   9329  C  CB  . PHE D 2 152 ? 16.709  9.722   -37.178 1.00 65.21  ? 182 PHE D CB  1 
ATOM   9330  C  CG  . PHE D 2 152 ? 15.813  9.818   -38.391 1.00 66.85  ? 182 PHE D CG  1 
ATOM   9331  C  CD1 . PHE D 2 152 ? 16.352  9.918   -39.672 1.00 69.29  ? 182 PHE D CD1 1 
ATOM   9332  C  CD2 . PHE D 2 152 ? 14.431  9.807   -38.255 1.00 68.83  ? 182 PHE D CD2 1 
ATOM   9333  C  CE1 . PHE D 2 152 ? 15.522  10.017  -40.789 1.00 70.15  ? 182 PHE D CE1 1 
ATOM   9334  C  CE2 . PHE D 2 152 ? 13.606  9.907   -39.370 1.00 71.83  ? 182 PHE D CE2 1 
ATOM   9335  C  CZ  . PHE D 2 152 ? 14.157  9.991   -40.631 1.00 69.62  ? 182 PHE D CZ  1 
ATOM   9336  N  N   . VAL D 2 153 ? 15.320  11.806  -35.344 1.00 63.89  ? 183 VAL D N   1 
ATOM   9337  C  CA  . VAL D 2 153 ? 14.207  12.675  -34.924 1.00 64.85  ? 183 VAL D CA  1 
ATOM   9338  C  C   . VAL D 2 153 ? 14.716  14.090  -34.610 1.00 70.23  ? 183 VAL D C   1 
ATOM   9339  O  O   . VAL D 2 153 ? 14.162  15.073  -35.105 1.00 68.01  ? 183 VAL D O   1 
ATOM   9340  C  CB  . VAL D 2 153 ? 13.332  12.087  -33.771 1.00 68.69  ? 183 VAL D CB  1 
ATOM   9341  C  CG1 . VAL D 2 153 ? 12.134  12.994  -33.460 1.00 70.15  ? 183 VAL D CG1 1 
ATOM   9342  C  CG2 . VAL D 2 153 ? 12.827  10.693  -34.111 1.00 67.40  ? 183 VAL D CG2 1 
ATOM   9343  N  N   . ASN D 2 154 ? 15.805  14.175  -33.832 1.00 69.83  ? 184 ASN D N   1 
ATOM   9344  C  CA  . ASN D 2 154 ? 16.434  15.444  -33.461 1.00 71.59  ? 184 ASN D CA  1 
ATOM   9345  C  C   . ASN D 2 154 ? 16.898  16.257  -34.675 1.00 75.72  ? 184 ASN D C   1 
ATOM   9346  O  O   . ASN D 2 154 ? 16.709  17.486  -34.687 1.00 76.18  ? 184 ASN D O   1 
ATOM   9347  C  CB  . ASN D 2 154 ? 17.570  15.226  -32.462 1.00 71.09  ? 184 ASN D CB  1 
ATOM   9348  C  CG  . ASN D 2 154 ? 17.116  14.740  -31.097 1.00 84.25  ? 184 ASN D CG  1 
ATOM   9349  O  OD1 . ASN D 2 154 ? 15.958  14.930  -30.655 1.00 67.47  ? 184 ASN D OD1 1 
ATOM   9350  N  ND2 . ASN D 2 154 ? 18.037  14.077  -30.407 1.00 77.46  ? 184 ASN D ND2 1 
ATOM   9351  N  N   . LYS D 2 155 ? 17.458  15.578  -35.707 1.00 70.19  ? 185 LYS D N   1 
ATOM   9352  C  CA  . LYS D 2 155 ? 17.864  16.294  -36.910 1.00 70.18  ? 185 LYS D CA  1 
ATOM   9353  C  C   . LYS D 2 155 ? 16.657  16.931  -37.581 1.00 74.90  ? 185 LYS D C   1 
ATOM   9354  O  O   . LYS D 2 155 ? 16.693  18.131  -37.842 1.00 76.55  ? 185 LYS D O   1 
ATOM   9355  C  CB  . LYS D 2 155 ? 18.641  15.408  -37.891 1.00 71.26  ? 185 LYS D CB  1 
ATOM   9356  C  CG  . LYS D 2 155 ? 19.186  16.169  -39.119 1.00 81.87  ? 185 LYS D CG  1 
ATOM   9357  C  CD  . LYS D 2 155 ? 19.963  17.453  -38.788 1.00 88.52  ? 185 LYS D CD  1 
ATOM   9358  C  CE  . LYS D 2 155 ? 20.341  18.241  -40.013 1.00 92.94  ? 185 LYS D CE  1 
ATOM   9359  N  NZ  . LYS D 2 155 ? 21.718  17.920  -40.469 1.00 103.95 ? 185 LYS D NZ  1 
ATOM   9360  N  N   . ILE D 2 156 ? 15.579  16.145  -37.807 1.00 69.51  ? 186 ILE D N   1 
ATOM   9361  C  CA  . ILE D 2 156 ? 14.339  16.621  -38.422 1.00 69.52  ? 186 ILE D CA  1 
ATOM   9362  C  C   . ILE D 2 156 ? 13.834  17.809  -37.611 1.00 76.93  ? 186 ILE D C   1 
ATOM   9363  O  O   . ILE D 2 156 ? 13.721  18.902  -38.149 1.00 78.38  ? 186 ILE D O   1 
ATOM   9364  C  CB  . ILE D 2 156 ? 13.259  15.504  -38.514 1.00 70.95  ? 186 ILE D CB  1 
ATOM   9365  C  CG1 . ILE D 2 156 ? 13.776  14.183  -39.177 1.00 68.98  ? 186 ILE D CG1 1 
ATOM   9366  C  CG2 . ILE D 2 156 ? 11.997  16.013  -39.185 1.00 71.85  ? 186 ILE D CG2 1 
ATOM   9367  C  CD1 . ILE D 2 156 ? 14.174  14.203  -40.655 1.00 61.13  ? 186 ILE D CD1 1 
ATOM   9368  N  N   . ARG D 2 157 ? 13.625  17.607  -36.300 1.00 74.77  ? 187 ARG D N   1 
ATOM   9369  C  CA  . ARG D 2 157 ? 13.134  18.614  -35.364 1.00 75.93  ? 187 ARG D CA  1 
ATOM   9370  C  C   . ARG D 2 157 ? 13.923  19.900  -35.373 1.00 83.16  ? 187 ARG D C   1 
ATOM   9371  O  O   . ARG D 2 157 ? 13.314  20.970  -35.415 1.00 84.27  ? 187 ARG D O   1 
ATOM   9372  C  CB  . ARG D 2 157 ? 13.044  18.054  -33.940 1.00 74.08  ? 187 ARG D CB  1 
ATOM   9373  C  CG  . ARG D 2 157 ? 11.857  17.146  -33.729 1.00 81.25  ? 187 ARG D CG  1 
ATOM   9374  C  CD  . ARG D 2 157 ? 11.422  17.136  -32.296 1.00 89.13  ? 187 ARG D CD  1 
ATOM   9375  N  NE  . ARG D 2 157 ? 9.991   16.898  -32.220 1.00 104.39 ? 187 ARG D NE  1 
ATOM   9376  C  CZ  . ARG D 2 157 ? 9.450   15.864  -31.597 1.00 120.51 ? 187 ARG D CZ  1 
ATOM   9377  N  NH1 . ARG D 2 157 ? 10.220  14.986  -30.964 1.00 98.87  ? 187 ARG D NH1 1 
ATOM   9378  N  NH2 . ARG D 2 157 ? 8.132   15.705  -31.589 1.00 115.26 ? 187 ARG D NH2 1 
ATOM   9379  N  N   . SER D 2 158 ? 15.268  19.812  -35.339 1.00 81.34  ? 188 SER D N   1 
ATOM   9380  C  CA  . SER D 2 158 ? 16.093  21.017  -35.340 1.00 83.36  ? 188 SER D CA  1 
ATOM   9381  C  C   . SER D 2 158 ? 15.921  21.784  -36.654 1.00 87.81  ? 188 SER D C   1 
ATOM   9382  O  O   . SER D 2 158 ? 15.658  22.985  -36.612 1.00 89.30  ? 188 SER D O   1 
ATOM   9383  C  CB  . SER D 2 158 ? 17.555  20.690  -35.054 1.00 87.64  ? 188 SER D CB  1 
ATOM   9384  O  OG  . SER D 2 158 ? 18.277  20.451  -36.251 1.00 102.83 ? 188 SER D OG  1 
ATOM   9385  N  N   . THR D 2 159 ? 15.995  21.063  -37.799 1.00 83.22  ? 189 THR D N   1 
ATOM   9386  C  CA  . THR D 2 159 ? 15.821  21.577  -39.162 1.00 84.28  ? 189 THR D CA  1 
ATOM   9387  C  C   . THR D 2 159 ? 14.476  22.323  -39.324 1.00 91.29  ? 189 THR D C   1 
ATOM   9388  O  O   . THR D 2 159 ? 14.449  23.420  -39.883 1.00 92.17  ? 189 THR D O   1 
ATOM   9389  C  CB  . THR D 2 159 ? 15.986  20.441  -40.180 1.00 86.42  ? 189 THR D CB  1 
ATOM   9390  O  OG1 . THR D 2 159 ? 17.236  19.795  -39.959 1.00 83.93  ? 189 THR D OG1 1 
ATOM   9391  C  CG2 . THR D 2 159 ? 15.946  20.932  -41.603 1.00 86.87  ? 189 THR D CG2 1 
ATOM   9392  N  N   . ILE D 2 160 ? 13.400  21.758  -38.772 1.00 88.97  ? 190 ILE D N   1 
ATOM   9393  C  CA  . ILE D 2 160 ? 12.056  22.319  -38.798 1.00 91.38  ? 190 ILE D CA  1 
ATOM   9394  C  C   . ILE D 2 160 ? 11.935  23.592  -37.946 1.00 102.01 ? 190 ILE D C   1 
ATOM   9395  O  O   . ILE D 2 160 ? 11.279  24.538  -38.374 1.00 103.32 ? 190 ILE D O   1 
ATOM   9396  C  CB  . ILE D 2 160 ? 11.042  21.221  -38.410 1.00 93.23  ? 190 ILE D CB  1 
ATOM   9397  C  CG1 . ILE D 2 160 ? 10.842  20.278  -39.580 1.00 91.85  ? 190 ILE D CG1 1 
ATOM   9398  C  CG2 . ILE D 2 160 ? 9.691   21.781  -37.910 1.00 96.17  ? 190 ILE D CG2 1 
ATOM   9399  C  CD1 . ILE D 2 160 ? 10.138  19.201  -39.203 1.00 98.18  ? 190 ILE D CD1 1 
ATOM   9400  N  N   . GLU D 2 161 ? 12.530  23.602  -36.745 1.00 102.70 ? 191 GLU D N   1 
ATOM   9401  C  CA  . GLU D 2 161 ? 12.521  24.750  -35.832 1.00 106.36 ? 191 GLU D CA  1 
ATOM   9402  C  C   . GLU D 2 161 ? 13.317  25.905  -36.477 1.00 114.12 ? 191 GLU D C   1 
ATOM   9403  O  O   . GLU D 2 161 ? 12.812  27.029  -36.588 1.00 114.50 ? 191 GLU D O   1 
ATOM   9404  C  CB  . GLU D 2 161 ? 13.138  24.344  -34.469 1.00 107.83 ? 191 GLU D CB  1 
ATOM   9405  C  CG  . GLU D 2 161 ? 12.869  25.346  -33.349 1.00 126.36 ? 191 GLU D CG  1 
ATOM   9406  C  CD  . GLU D 2 161 ? 13.800  25.359  -32.147 1.00 150.27 ? 191 GLU D CD  1 
ATOM   9407  O  OE1 . GLU D 2 161 ? 14.571  24.386  -31.961 1.00 139.79 ? 191 GLU D OE1 1 
ATOM   9408  O  OE2 . GLU D 2 161 ? 13.741  26.347  -31.376 1.00 144.06 ? 191 GLU D OE2 1 
ATOM   9409  N  N   . ASN D 2 162 ? 14.548  25.581  -36.947 1.00 113.07 ? 192 ASN D N   1 
ATOM   9410  C  CA  . ASN D 2 162 ? 15.500  26.464  -37.626 1.00 115.52 ? 192 ASN D CA  1 
ATOM   9411  C  C   . ASN D 2 162 ? 15.070  26.677  -39.115 1.00 123.11 ? 192 ASN D C   1 
ATOM   9412  O  O   . ASN D 2 162 ? 15.881  26.453  -40.025 1.00 122.41 ? 192 ASN D O   1 
ATOM   9413  C  CB  . ASN D 2 162 ? 16.927  25.859  -37.516 1.00 114.80 ? 192 ASN D CB  1 
ATOM   9414  C  CG  . ASN D 2 162 ? 18.081  26.823  -37.716 1.00 139.27 ? 192 ASN D CG  1 
ATOM   9415  O  OD1 . ASN D 2 162 ? 18.388  27.661  -36.856 1.00 133.17 ? 192 ASN D OD1 1 
ATOM   9416  N  ND2 . ASN D 2 162 ? 18.799  26.674  -38.823 1.00 130.77 ? 192 ASN D ND2 1 
ATOM   9417  N  N   . SER D 2 163 ? 13.776  27.095  -39.340 1.00 122.53 ? 193 SER D N   1 
ATOM   9418  C  CA  . SER D 2 163 ? 13.102  27.378  -40.640 1.00 123.85 ? 193 SER D CA  1 
ATOM   9419  C  C   . SER D 2 163 ? 11.600  27.645  -40.474 1.00 127.60 ? 193 SER D C   1 
ATOM   9420  O  O   . SER D 2 163 ? 10.967  27.050  -39.599 1.00 126.60 ? 193 SER D O   1 
ATOM   9421  C  CB  . SER D 2 163 ? 13.289  26.239  -41.654 1.00 126.95 ? 193 SER D CB  1 
ATOM   9422  O  OG  . SER D 2 163 ? 12.175  25.364  -41.776 1.00 134.23 ? 193 SER D OG  1 
ATOM   9423  N  N   . PHE D 2 164 ? 11.018  28.482  -41.345 1.00 124.49 ? 194 PHE D N   1 
ATOM   9424  C  CA  . PHE D 2 164 ? 9.580   28.698  -41.272 1.00 124.61 ? 194 PHE D CA  1 
ATOM   9425  C  C   . PHE D 2 164 ? 8.974   28.542  -42.655 1.00 123.64 ? 194 PHE D C   1 
ATOM   9426  O  O   . PHE D 2 164 ? 8.618   29.508  -43.340 1.00 124.44 ? 194 PHE D O   1 
ATOM   9427  C  CB  . PHE D 2 164 ? 9.179   29.981  -40.519 1.00 129.47 ? 194 PHE D CB  1 
ATOM   9428  C  CG  . PHE D 2 164 ? 8.408   29.627  -39.259 1.00 131.41 ? 194 PHE D CG  1 
ATOM   9429  C  CD1 . PHE D 2 164 ? 9.052   29.043  -38.166 1.00 133.39 ? 194 PHE D CD1 1 
ATOM   9430  C  CD2 . PHE D 2 164 ? 7.029   29.814  -39.190 1.00 134.58 ? 194 PHE D CD2 1 
ATOM   9431  C  CE1 . PHE D 2 164 ? 8.333   28.661  -37.029 1.00 134.17 ? 194 PHE D CE1 1 
ATOM   9432  C  CE2 . PHE D 2 164 ? 6.313   29.453  -38.040 1.00 137.13 ? 194 PHE D CE2 1 
ATOM   9433  C  CZ  . PHE D 2 164 ? 6.971   28.878  -36.969 1.00 134.29 ? 194 PHE D CZ  1 
ATOM   9434  N  N   . VAL D 2 165 ? 8.902   27.252  -43.044 1.00 114.61 ? 195 VAL D N   1 
ATOM   9435  C  CA  . VAL D 2 165 ? 8.426   26.690  -44.310 1.00 112.15 ? 195 VAL D CA  1 
ATOM   9436  C  C   . VAL D 2 165 ? 7.052   25.990  -44.067 1.00 112.92 ? 195 VAL D C   1 
ATOM   9437  O  O   . VAL D 2 165 ? 6.576   25.217  -44.903 1.00 113.20 ? 195 VAL D O   1 
ATOM   9438  C  CB  . VAL D 2 165 ? 9.509   25.730  -44.928 1.00 113.79 ? 195 VAL D CB  1 
ATOM   9439  C  CG1 . VAL D 2 165 ? 9.344   25.588  -46.435 1.00 113.49 ? 195 VAL D CG1 1 
ATOM   9440  C  CG2 . VAL D 2 165 ? 10.933  26.198  -44.619 1.00 113.89 ? 195 VAL D CG2 1 
ATOM   9441  N  N   . GLY D 2 166 ? 6.414   26.325  -42.945 1.00 105.80 ? 196 GLY D N   1 
ATOM   9442  C  CA  . GLY D 2 166 ? 5.125   25.787  -42.510 1.00 102.68 ? 196 GLY D CA  1 
ATOM   9443  C  C   . GLY D 2 166 ? 5.071   24.289  -42.305 1.00 96.63  ? 196 GLY D C   1 
ATOM   9444  O  O   . GLY D 2 166 ? 4.051   23.670  -42.614 1.00 94.13  ? 196 GLY D O   1 
ATOM   9445  N  N   . TRP D 2 167 ? 6.178   23.699  -41.798 1.00 87.98  ? 197 TRP D N   1 
ATOM   9446  C  CA  . TRP D 2 167 ? 6.297   22.264  -41.516 1.00 83.95  ? 197 TRP D CA  1 
ATOM   9447  C  C   . TRP D 2 167 ? 5.412   21.924  -40.336 1.00 86.64  ? 197 TRP D C   1 
ATOM   9448  O  O   . TRP D 2 167 ? 5.299   22.718  -39.403 1.00 87.98  ? 197 TRP D O   1 
ATOM   9449  C  CB  . TRP D 2 167 ? 7.726   21.909  -41.126 1.00 80.74  ? 197 TRP D CB  1 
ATOM   9450  C  CG  . TRP D 2 167 ? 8.758   22.063  -42.199 1.00 81.00  ? 197 TRP D CG  1 
ATOM   9451  C  CD1 . TRP D 2 167 ? 9.735   23.016  -42.268 1.00 84.52  ? 197 TRP D CD1 1 
ATOM   9452  C  CD2 . TRP D 2 167 ? 9.028   21.135  -43.251 1.00 79.58  ? 197 TRP D CD2 1 
ATOM   9453  N  NE1 . TRP D 2 167 ? 10.570  22.763  -43.330 1.00 82.93  ? 197 TRP D NE1 1 
ATOM   9454  C  CE2 . TRP D 2 167 ? 10.159  21.613  -43.952 1.00 83.27  ? 197 TRP D CE2 1 
ATOM   9455  C  CE3 . TRP D 2 167 ? 8.409   19.949  -43.688 1.00 79.63  ? 197 TRP D CE3 1 
ATOM   9456  C  CZ2 . TRP D 2 167 ? 10.668  20.962  -45.080 1.00 81.91  ? 197 TRP D CZ2 1 
ATOM   9457  C  CZ3 . TRP D 2 167 ? 8.924   19.295  -44.796 1.00 80.29  ? 197 TRP D CZ3 1 
ATOM   9458  C  CH2 . TRP D 2 167 ? 10.033  19.806  -45.485 1.00 81.30  ? 197 TRP D CH2 1 
ATOM   9459  N  N   . GLU D 2 168 ? 4.800   20.745  -40.361 1.00 80.54  ? 198 GLU D N   1 
ATOM   9460  C  CA  . GLU D 2 168 ? 3.935   20.288  -39.280 1.00 78.87  ? 198 GLU D CA  1 
ATOM   9461  C  C   . GLU D 2 168 ? 4.170   18.799  -38.990 1.00 77.35  ? 198 GLU D C   1 
ATOM   9462  O  O   . GLU D 2 168 ? 3.672   17.929  -39.719 1.00 75.28  ? 198 GLU D O   1 
ATOM   9463  C  CB  . GLU D 2 168 ? 2.456   20.628  -39.561 1.00 80.97  ? 198 GLU D CB  1 
ATOM   9464  N  N   . LEU D 2 169 ? 4.985   18.527  -37.953 1.00 71.61  ? 199 LEU D N   1 
ATOM   9465  C  CA  . LEU D 2 169 ? 5.303   17.176  -37.500 1.00 70.32  ? 199 LEU D CA  1 
ATOM   9466  C  C   . LEU D 2 169 ? 4.187   16.705  -36.541 1.00 76.87  ? 199 LEU D C   1 
ATOM   9467  O  O   . LEU D 2 169 ? 4.228   16.965  -35.325 1.00 78.88  ? 199 LEU D O   1 
ATOM   9468  C  CB  . LEU D 2 169 ? 6.728   17.108  -36.882 1.00 69.04  ? 199 LEU D CB  1 
ATOM   9469  C  CG  . LEU D 2 169 ? 7.173   15.826  -36.130 1.00 70.78  ? 199 LEU D CG  1 
ATOM   9470  C  CD1 . LEU D 2 169 ? 7.000   14.566  -36.969 1.00 69.50  ? 199 LEU D CD1 1 
ATOM   9471  C  CD2 . LEU D 2 169 ? 8.589   15.951  -35.663 1.00 70.92  ? 199 LEU D CD2 1 
ATOM   9472  N  N   . GLU D 2 170 ? 3.184   16.023  -37.123 1.00 71.70  ? 200 GLU D N   1 
ATOM   9473  C  CA  . GLU D 2 170 ? 1.971   15.546  -36.461 1.00 71.93  ? 200 GLU D CA  1 
ATOM   9474  C  C   . GLU D 2 170 ? 2.189   14.511  -35.345 1.00 74.73  ? 200 GLU D C   1 
ATOM   9475  O  O   . GLU D 2 170 ? 1.620   14.666  -34.260 1.00 73.67  ? 200 GLU D O   1 
ATOM   9476  C  CB  . GLU D 2 170 ? 0.976   15.017  -37.495 1.00 73.49  ? 200 GLU D CB  1 
ATOM   9477  C  CG  . GLU D 2 170 ? 0.586   16.051  -38.541 1.00 84.58  ? 200 GLU D CG  1 
ATOM   9478  C  CD  . GLU D 2 170 ? -0.758  15.769  -39.168 1.00 99.78  ? 200 GLU D CD  1 
ATOM   9479  O  OE1 . GLU D 2 170 ? -0.798  15.047  -40.189 1.00 102.31 ? 200 GLU D OE1 1 
ATOM   9480  O  OE2 . GLU D 2 170 ? -1.778  16.217  -38.599 1.00 95.08  ? 200 GLU D OE2 1 
ATOM   9481  N  N   . GLU D 2 171 ? 2.979   13.455  -35.613 1.00 71.80  ? 201 GLU D N   1 
ATOM   9482  C  CA  . GLU D 2 171 ? 3.261   12.388  -34.640 1.00 71.45  ? 201 GLU D CA  1 
ATOM   9483  C  C   . GLU D 2 171 ? 4.669   11.830  -34.749 1.00 73.95  ? 201 GLU D C   1 
ATOM   9484  O  O   . GLU D 2 171 ? 5.290   11.939  -35.804 1.00 74.14  ? 201 GLU D O   1 
ATOM   9485  C  CB  . GLU D 2 171 ? 2.227   11.250  -34.733 1.00 72.86  ? 201 GLU D CB  1 
ATOM   9486  C  CG  . GLU D 2 171 ? 1.140   11.332  -33.667 1.00 91.37  ? 201 GLU D CG  1 
ATOM   9487  C  CD  . GLU D 2 171 ? 1.458   10.800  -32.276 1.00 127.87 ? 201 GLU D CD  1 
ATOM   9488  O  OE1 . GLU D 2 171 ? 2.626   10.899  -31.823 1.00 120.12 ? 201 GLU D OE1 1 
ATOM   9489  O  OE2 . GLU D 2 171 ? 0.504   10.326  -31.616 1.00 130.63 ? 201 GLU D OE2 1 
ATOM   9490  N  N   . VAL D 2 172 ? 5.190   11.272  -33.650 1.00 68.91  ? 202 VAL D N   1 
ATOM   9491  C  CA  . VAL D 2 172 ? 6.500   10.615  -33.613 1.00 67.34  ? 202 VAL D CA  1 
ATOM   9492  C  C   . VAL D 2 172 ? 6.266   9.328   -32.838 1.00 75.32  ? 202 VAL D C   1 
ATOM   9493  O  O   . VAL D 2 172 ? 6.020   9.385   -31.619 1.00 78.85  ? 202 VAL D O   1 
ATOM   9494  C  CB  . VAL D 2 172 ? 7.658   11.436  -32.984 1.00 70.04  ? 202 VAL D CB  1 
ATOM   9495  C  CG1 . VAL D 2 172 ? 8.966   10.667  -33.048 1.00 68.55  ? 202 VAL D CG1 1 
ATOM   9496  C  CG2 . VAL D 2 172 ? 7.827   12.782  -33.652 1.00 70.67  ? 202 VAL D CG2 1 
ATOM   9497  N  N   . LEU D 2 173 ? 6.296   8.176   -33.528 1.00 69.41  ? 203 LEU D N   1 
ATOM   9498  C  CA  . LEU D 2 173 ? 6.099   6.898   -32.846 1.00 67.56  ? 203 LEU D CA  1 
ATOM   9499  C  C   . LEU D 2 173 ? 7.408   6.171   -32.591 1.00 70.38  ? 203 LEU D C   1 
ATOM   9500  O  O   . LEU D 2 173 ? 8.336   6.235   -33.401 1.00 70.21  ? 203 LEU D O   1 
ATOM   9501  C  CB  . LEU D 2 173 ? 5.107   5.989   -33.576 1.00 67.32  ? 203 LEU D CB  1 
ATOM   9502  C  CG  . LEU D 2 173 ? 3.737   6.566   -33.973 1.00 73.04  ? 203 LEU D CG  1 
ATOM   9503  C  CD1 . LEU D 2 173 ? 2.927   5.530   -34.698 1.00 73.83  ? 203 LEU D CD1 1 
ATOM   9504  C  CD2 . LEU D 2 173 ? 2.955   7.046   -32.782 1.00 75.10  ? 203 LEU D CD2 1 
ATOM   9505  N  N   . LEU D 2 174 ? 7.494   5.492   -31.434 1.00 65.94  ? 204 LEU D N   1 
ATOM   9506  C  CA  . LEU D 2 174 ? 8.643   4.657   -31.036 1.00 63.57  ? 204 LEU D CA  1 
ATOM   9507  C  C   . LEU D 2 174 ? 8.124   3.219   -30.928 1.00 68.77  ? 204 LEU D C   1 
ATOM   9508  O  O   . LEU D 2 174 ? 7.259   2.910   -30.095 1.00 69.56  ? 204 LEU D O   1 
ATOM   9509  C  CB  . LEU D 2 174 ? 9.262   5.127   -29.701 1.00 62.81  ? 204 LEU D CB  1 
ATOM   9510  C  CG  . LEU D 2 174 ? 10.644  4.627   -29.340 1.00 66.08  ? 204 LEU D CG  1 
ATOM   9511  C  CD1 . LEU D 2 174 ? 11.578  4.535   -30.557 1.00 65.11  ? 204 LEU D CD1 1 
ATOM   9512  C  CD2 . LEU D 2 174 ? 11.256  5.497   -28.292 1.00 68.60  ? 204 LEU D CD2 1 
ATOM   9513  N  N   . LEU D 2 175 ? 8.573   2.368   -31.836 1.00 64.46  ? 205 LEU D N   1 
ATOM   9514  C  CA  . LEU D 2 175 ? 8.118   0.986   -31.856 1.00 63.70  ? 205 LEU D CA  1 
ATOM   9515  C  C   . LEU D 2 175 ? 9.175   0.098   -31.225 1.00 66.70  ? 205 LEU D C   1 
ATOM   9516  O  O   . LEU D 2 175 ? 10.332  0.152   -31.624 1.00 64.63  ? 205 LEU D O   1 
ATOM   9517  C  CB  . LEU D 2 175 ? 7.787   0.553   -33.293 1.00 63.05  ? 205 LEU D CB  1 
ATOM   9518  C  CG  . LEU D 2 175 ? 6.803   1.428   -34.071 1.00 67.10  ? 205 LEU D CG  1 
ATOM   9519  C  CD1 . LEU D 2 175 ? 6.651   0.903   -35.444 1.00 68.56  ? 205 LEU D CD1 1 
ATOM   9520  C  CD2 . LEU D 2 175 ? 5.421   1.409   -33.469 1.00 67.53  ? 205 LEU D CD2 1 
ATOM   9521  N  N   . ASP D 2 176 ? 8.798   -0.653  -30.181 1.00 65.08  ? 206 ASP D N   1 
ATOM   9522  C  CA  . ASP D 2 176 ? 9.717   -1.554  -29.476 1.00 64.73  ? 206 ASP D CA  1 
ATOM   9523  C  C   . ASP D 2 176 ? 9.620   -2.932  -30.139 1.00 71.28  ? 206 ASP D C   1 
ATOM   9524  O  O   . ASP D 2 176 ? 8.641   -3.667  -29.960 1.00 73.76  ? 206 ASP D O   1 
ATOM   9525  C  CB  . ASP D 2 176 ? 9.402   -1.594  -27.969 1.00 66.05  ? 206 ASP D CB  1 
ATOM   9526  C  CG  . ASP D 2 176 ? 10.330  -2.441  -27.124 1.00 68.19  ? 206 ASP D CG  1 
ATOM   9527  O  OD1 . ASP D 2 176 ? 11.324  -2.958  -27.665 1.00 65.07  ? 206 ASP D OD1 1 
ATOM   9528  O  OD2 . ASP D 2 176 ? 10.098  -2.531  -25.907 1.00 77.80  ? 206 ASP D OD2 1 
ATOM   9529  N  N   . MET D 2 177 ? 10.592  -3.217  -30.986 1.00 66.69  ? 207 MET D N   1 
ATOM   9530  C  CA  . MET D 2 177 ? 10.656  -4.438  -31.762 1.00 67.50  ? 207 MET D CA  1 
ATOM   9531  C  C   . MET D 2 177 ? 11.276  -5.608  -31.001 1.00 73.41  ? 207 MET D C   1 
ATOM   9532  O  O   . MET D 2 177 ? 11.126  -6.755  -31.428 1.00 73.42  ? 207 MET D O   1 
ATOM   9533  C  CB  . MET D 2 177 ? 11.396  -4.170  -33.076 1.00 69.37  ? 207 MET D CB  1 
ATOM   9534  C  CG  . MET D 2 177 ? 10.592  -3.320  -34.034 1.00 73.68  ? 207 MET D CG  1 
ATOM   9535  S  SD  . MET D 2 177 ? 9.193   -4.152  -34.812 1.00 79.67  ? 207 MET D SD  1 
ATOM   9536  C  CE  . MET D 2 177 ? 8.106   -2.863  -34.898 1.00 77.07  ? 207 MET D CE  1 
ATOM   9537  N  N   . SER D 2 178 ? 11.941  -5.317  -29.861 1.00 70.83  ? 208 SER D N   1 
ATOM   9538  C  CA  . SER D 2 178 ? 12.625  -6.269  -28.986 1.00 70.96  ? 208 SER D CA  1 
ATOM   9539  C  C   . SER D 2 178 ? 11.686  -7.297  -28.313 1.00 76.36  ? 208 SER D C   1 
ATOM   9540  O  O   . SER D 2 178 ? 12.176  -8.304  -27.783 1.00 76.03  ? 208 SER D O   1 
ATOM   9541  C  CB  . SER D 2 178 ? 13.465  -5.532  -27.944 1.00 74.35  ? 208 SER D CB  1 
ATOM   9542  O  OG  . SER D 2 178 ? 12.691  -5.120  -26.828 1.00 85.82  ? 208 SER D OG  1 
ATOM   9543  N  N   . LEU D 2 179 ? 10.355  -7.056  -28.363 1.00 73.71  ? 209 LEU D N   1 
ATOM   9544  C  CA  . LEU D 2 179 ? 9.340   -7.939  -27.783 1.00 74.74  ? 209 LEU D CA  1 
ATOM   9545  C  C   . LEU D 2 179 ? 8.473   -8.536  -28.858 1.00 83.31  ? 209 LEU D C   1 
ATOM   9546  O  O   . LEU D 2 179 ? 8.420   -7.993  -29.957 1.00 82.24  ? 209 LEU D O   1 
ATOM   9547  C  CB  . LEU D 2 179 ? 8.463   -7.164  -26.785 1.00 74.63  ? 209 LEU D CB  1 
ATOM   9548  C  CG  . LEU D 2 179 ? 9.188   -6.364  -25.704 1.00 77.67  ? 209 LEU D CG  1 
ATOM   9549  C  CD1 . LEU D 2 179 ? 8.244   -5.470  -25.021 1.00 78.66  ? 209 LEU D CD1 1 
ATOM   9550  C  CD2 . LEU D 2 179 ? 9.869   -7.246  -24.706 1.00 76.26  ? 209 LEU D CD2 1 
ATOM   9551  N  N   . ASP D 2 180 ? 7.780   -9.648  -28.552 1.00 86.01  ? 210 ASP D N   1 
ATOM   9552  C  CA  . ASP D 2 180 ? 6.857   -10.271 -29.504 1.00 89.24  ? 210 ASP D CA  1 
ATOM   9553  C  C   . ASP D 2 180 ? 5.620   -9.383  -29.625 1.00 99.90  ? 210 ASP D C   1 
ATOM   9554  O  O   . ASP D 2 180 ? 5.188   -8.804  -28.615 1.00 100.94 ? 210 ASP D O   1 
ATOM   9555  C  CB  . ASP D 2 180 ? 6.448   -11.695 -29.054 1.00 92.88  ? 210 ASP D CB  1 
ATOM   9556  C  CG  . ASP D 2 180 ? 5.377   -11.780 -27.959 1.00 106.41 ? 210 ASP D CG  1 
ATOM   9557  O  OD1 . ASP D 2 180 ? 5.742   -11.733 -26.768 1.00 108.44 ? 210 ASP D OD1 1 
ATOM   9558  O  OD2 . ASP D 2 180 ? 4.170   -11.878 -28.305 1.00 110.62 ? 210 ASP D OD2 1 
ATOM   9559  N  N   . ASP D 2 181 ? 5.042   -9.275  -30.836 1.00 99.63  ? 211 ASP D N   1 
ATOM   9560  C  CA  . ASP D 2 181 ? 3.828   -8.471  -31.007 1.00 100.59 ? 211 ASP D CA  1 
ATOM   9561  C  C   . ASP D 2 181 ? 2.612   -9.368  -31.147 1.00 105.94 ? 211 ASP D C   1 
ATOM   9562  O  O   . ASP D 2 181 ? 2.117   -9.580  -32.255 1.00 105.52 ? 211 ASP D O   1 
ATOM   9563  C  CB  . ASP D 2 181 ? 3.959   -7.441  -32.144 1.00 101.76 ? 211 ASP D CB  1 
ATOM   9564  C  CG  . ASP D 2 181 ? 2.895   -6.363  -32.129 1.00 115.56 ? 211 ASP D CG  1 
ATOM   9565  O  OD1 . ASP D 2 181 ? 2.930   -5.503  -31.218 1.00 116.04 ? 211 ASP D OD1 1 
ATOM   9566  O  OD2 . ASP D 2 181 ? 2.050   -6.352  -33.046 1.00 125.32 ? 211 ASP D OD2 1 
ATOM   9567  N  N   . GLY D 2 182 ? 2.190   -9.930  -30.013 1.00 104.57 ? 212 GLY D N   1 
ATOM   9568  C  CA  . GLY D 2 182 ? 1.012   -10.789 -29.914 1.00 107.12 ? 212 GLY D CA  1 
ATOM   9569  C  C   . GLY D 2 182 ? -0.210  -10.013 -29.452 1.00 113.20 ? 212 GLY D C   1 
ATOM   9570  O  O   . GLY D 2 182 ? -1.346  -10.294 -29.855 1.00 113.66 ? 212 GLY D O   1 
ATOM   9571  N  N   . ASP D 2 183 ? 0.055   -9.001  -28.611 1.00 109.98 ? 213 ASP D N   1 
ATOM   9572  C  CA  . ASP D 2 183 ? -0.864  -8.047  -27.984 1.00 110.42 ? 213 ASP D CA  1 
ATOM   9573  C  C   . ASP D 2 183 ? -1.400  -6.986  -28.967 1.00 111.14 ? 213 ASP D C   1 
ATOM   9574  O  O   . ASP D 2 183 ? -2.310  -6.225  -28.612 1.00 111.38 ? 213 ASP D O   1 
ATOM   9575  C  CB  . ASP D 2 183 ? -0.126  -7.332  -26.831 1.00 112.66 ? 213 ASP D CB  1 
ATOM   9576  C  CG  . ASP D 2 183 ? 1.286   -6.822  -27.140 1.00 129.69 ? 213 ASP D CG  1 
ATOM   9577  O  OD1 . ASP D 2 183 ? 1.655   -6.748  -28.346 1.00 130.92 ? 213 ASP D OD1 1 
ATOM   9578  O  OD2 . ASP D 2 183 ? 2.018   -6.487  -26.182 1.00 137.46 ? 213 ASP D OD2 1 
ATOM   9579  N  N   . SER D 2 184 ? -0.805  -6.924  -30.187 1.00 103.55 ? 214 SER D N   1 
ATOM   9580  C  CA  . SER D 2 184 ? -1.087  -5.975  -31.268 1.00 100.91 ? 214 SER D CA  1 
ATOM   9581  C  C   . SER D 2 184 ? -0.826  -4.527  -30.838 1.00 100.85 ? 214 SER D C   1 
ATOM   9582  O  O   . SER D 2 184 ? -1.628  -3.646  -31.137 1.00 101.67 ? 214 SER D O   1 
ATOM   9583  C  CB  . SER D 2 184 ? -2.485  -6.175  -31.851 1.00 105.25 ? 214 SER D CB  1 
ATOM   9584  O  OG  . SER D 2 184 ? -3.528  -5.855  -30.946 1.00 114.38 ? 214 SER D OG  1 
ATOM   9585  N  N   . LYS D 2 185 ? 0.301   -4.285  -30.120 1.00 93.63  ? 215 LYS D N   1 
ATOM   9586  C  CA  . LYS D 2 185 ? 0.694   -2.946  -29.670 1.00 91.34  ? 215 LYS D CA  1 
ATOM   9587  C  C   . LYS D 2 185 ? 1.117   -2.090  -30.856 1.00 91.88  ? 215 LYS D C   1 
ATOM   9588  O  O   . LYS D 2 185 ? 0.641   -0.957  -30.976 1.00 92.40  ? 215 LYS D O   1 
ATOM   9589  C  CB  . LYS D 2 185 ? 1.783   -2.986  -28.590 1.00 93.03  ? 215 LYS D CB  1 
ATOM   9590  C  CG  . LYS D 2 185 ? 2.282   -1.592  -28.196 1.00 105.96 ? 215 LYS D CG  1 
ATOM   9591  C  CD  . LYS D 2 185 ? 2.405   -1.376  -26.705 1.00 117.62 ? 215 LYS D CD  1 
ATOM   9592  C  CE  . LYS D 2 185 ? 2.952   -0.004  -26.405 1.00 125.35 ? 215 LYS D CE  1 
ATOM   9593  N  NZ  . LYS D 2 185 ? 3.507   0.088   -25.020 1.00 131.63 ? 215 LYS D NZ  1 
ATOM   9594  N  N   . ILE D 2 186 ? 1.980   -2.631  -31.745 1.00 85.00  ? 216 ILE D N   1 
ATOM   9595  C  CA  . ILE D 2 186 ? 2.426   -1.910  -32.946 1.00 82.99  ? 216 ILE D CA  1 
ATOM   9596  C  C   . ILE D 2 186 ? 1.217   -1.464  -33.786 1.00 81.86  ? 216 ILE D C   1 
ATOM   9597  O  O   . ILE D 2 186 ? 1.146   -0.292  -34.152 1.00 79.24  ? 216 ILE D O   1 
ATOM   9598  C  CB  . ILE D 2 186 ? 3.504   -2.697  -33.754 1.00 85.65  ? 216 ILE D CB  1 
ATOM   9599  C  CG1 . ILE D 2 186 ? 4.874   -2.545  -33.096 1.00 84.99  ? 216 ILE D CG1 1 
ATOM   9600  C  CG2 . ILE D 2 186 ? 3.590   -2.252  -35.226 1.00 86.08  ? 216 ILE D CG2 1 
ATOM   9601  C  CD1 . ILE D 2 186 ? 5.397   -3.775  -32.615 1.00 96.89  ? 216 ILE D CD1 1 
ATOM   9602  N  N   . GLN D 2 187 ? 0.243   -2.374  -34.008 1.00 78.08  ? 217 GLN D N   1 
ATOM   9603  C  CA  . GLN D 2 187 ? -0.983  -2.094  -34.771 1.00 78.29  ? 217 GLN D CA  1 
ATOM   9604  C  C   . GLN D 2 187 ? -1.745  -0.911  -34.198 1.00 82.86  ? 217 GLN D C   1 
ATOM   9605  O  O   . GLN D 2 187 ? -2.170  -0.030  -34.947 1.00 81.78  ? 217 GLN D O   1 
ATOM   9606  C  CB  . GLN D 2 187 ? -1.874  -3.342  -34.872 1.00 80.40  ? 217 GLN D CB  1 
ATOM   9607  C  CG  . GLN D 2 187 ? -3.179  -3.100  -35.624 1.00 91.43  ? 217 GLN D CG  1 
ATOM   9608  C  CD  . GLN D 2 187 ? -4.114  -4.286  -35.603 1.00 108.42 ? 217 GLN D CD  1 
ATOM   9609  O  OE1 . GLN D 2 187 ? -4.420  -4.888  -36.647 1.00 100.12 ? 217 GLN D OE1 1 
ATOM   9610  N  NE2 . GLN D 2 187 ? -4.617  -4.634  -34.425 1.00 104.72 ? 217 GLN D NE2 1 
ATOM   9611  N  N   . ASN D 2 188 ? -1.875  -0.873  -32.866 1.00 80.97  ? 218 ASN D N   1 
ATOM   9612  C  CA  . ASN D 2 188 ? -2.570  0.203   -32.169 1.00 81.48  ? 218 ASN D CA  1 
ATOM   9613  C  C   . ASN D 2 188 ? -1.804  1.519   -32.257 1.00 82.68  ? 218 ASN D C   1 
ATOM   9614  O  O   . ASN D 2 188 ? -2.417  2.574   -32.411 1.00 83.38  ? 218 ASN D O   1 
ATOM   9615  C  CB  . ASN D 2 188 ? -2.911  -0.207  -30.739 1.00 85.11  ? 218 ASN D CB  1 
ATOM   9616  C  CG  . ASN D 2 188 ? -3.932  -1.336  -30.685 1.00 122.44 ? 218 ASN D CG  1 
ATOM   9617  O  OD1 . ASN D 2 188 ? -4.919  -1.382  -31.441 1.00 121.12 ? 218 ASN D OD1 1 
ATOM   9618  N  ND2 . ASN D 2 188 ? -3.710  -2.287  -29.797 1.00 116.98 ? 218 ASN D ND2 1 
ATOM   9619  N  N   . GLN D 2 189 ? -0.470  1.448   -32.256 1.00 75.98  ? 219 GLN D N   1 
ATOM   9620  C  CA  . GLN D 2 189 ? 0.360   2.638   -32.411 1.00 73.84  ? 219 GLN D CA  1 
ATOM   9621  C  C   . GLN D 2 189 ? 0.213   3.171   -33.829 1.00 75.84  ? 219 GLN D C   1 
ATOM   9622  O  O   . GLN D 2 189 ? -0.061  4.352   -34.003 1.00 76.25  ? 219 GLN D O   1 
ATOM   9623  C  CB  . GLN D 2 189 ? 1.830   2.340   -32.101 1.00 72.97  ? 219 GLN D CB  1 
ATOM   9624  C  CG  . GLN D 2 189 ? 2.096   2.191   -30.630 1.00 73.44  ? 219 GLN D CG  1 
ATOM   9625  C  CD  . GLN D 2 189 ? 3.514   1.794   -30.396 1.00 97.46  ? 219 GLN D CD  1 
ATOM   9626  O  OE1 . GLN D 2 189 ? 4.379   2.629   -30.126 1.00 99.55  ? 219 GLN D OE1 1 
ATOM   9627  N  NE2 . GLN D 2 189 ? 3.791   0.507   -30.519 1.00 81.12  ? 219 GLN D NE2 1 
ATOM   9628  N  N   . LEU D 2 190 ? 0.328   2.291   -34.831 1.00 69.59  ? 220 LEU D N   1 
ATOM   9629  C  CA  . LEU D 2 190 ? 0.234   2.683   -36.228 1.00 68.44  ? 220 LEU D CA  1 
ATOM   9630  C  C   . LEU D 2 190 ? -1.118  3.291   -36.589 1.00 74.39  ? 220 LEU D C   1 
ATOM   9631  O  O   . LEU D 2 190 ? -1.176  4.132   -37.487 1.00 74.60  ? 220 LEU D O   1 
ATOM   9632  C  CB  . LEU D 2 190 ? 0.606   1.530   -37.175 1.00 67.47  ? 220 LEU D CB  1 
ATOM   9633  C  CG  . LEU D 2 190 ? 2.048   1.003   -37.139 1.00 70.05  ? 220 LEU D CG  1 
ATOM   9634  C  CD1 . LEU D 2 190 ? 2.282   0.045   -38.273 1.00 69.18  ? 220 LEU D CD1 1 
ATOM   9635  C  CD2 . LEU D 2 190 ? 3.085   2.133   -37.223 1.00 71.63  ? 220 LEU D CD2 1 
ATOM   9636  N  N   . LYS D 2 191 ? -2.189  2.913   -35.851 1.00 71.40  ? 221 LYS D N   1 
ATOM   9637  C  CA  . LYS D 2 191 ? -3.540  3.449   -36.052 1.00 71.68  ? 221 LYS D CA  1 
ATOM   9638  C  C   . LYS D 2 191 ? -3.600  4.938   -35.636 1.00 76.14  ? 221 LYS D C   1 
ATOM   9639  O  O   . LYS D 2 191 ? -4.475  5.674   -36.112 1.00 77.61  ? 221 LYS D O   1 
ATOM   9640  C  CB  . LYS D 2 191 ? -4.596  2.602   -35.320 1.00 74.02  ? 221 LYS D CB  1 
ATOM   9641  C  CG  . LYS D 2 191 ? -4.955  1.316   -36.042 1.00 81.33  ? 221 LYS D CG  1 
ATOM   9642  C  CD  . LYS D 2 191 ? -5.545  0.258   -35.124 1.00 101.39 ? 221 LYS D CD  1 
ATOM   9643  C  CE  . LYS D 2 191 ? -6.197  -0.869  -35.895 1.00 118.29 ? 221 LYS D CE  1 
ATOM   9644  N  NZ  . LYS D 2 191 ? -6.538  -2.023  -35.016 1.00 127.97 ? 221 LYS D NZ  1 
ATOM   9645  N  N   . LYS D 2 192 ? -2.629  5.389   -34.802 1.00 70.33  ? 222 LYS D N   1 
ATOM   9646  C  CA  . LYS D 2 192 ? -2.509  6.780   -34.372 1.00 69.93  ? 222 LYS D CA  1 
ATOM   9647  C  C   . LYS D 2 192 ? -2.144  7.716   -35.559 1.00 74.45  ? 222 LYS D C   1 
ATOM   9648  O  O   . LYS D 2 192 ? -2.604  8.865   -35.599 1.00 74.96  ? 222 LYS D O   1 
ATOM   9649  C  CB  . LYS D 2 192 ? -1.527  6.915   -33.183 1.00 71.54  ? 222 LYS D CB  1 
ATOM   9650  N  N   . LEU D 2 193 ? -1.374  7.197   -36.546 1.00 70.76  ? 223 LEU D N   1 
ATOM   9651  C  CA  . LEU D 2 193 ? -0.952  7.928   -37.760 1.00 70.22  ? 223 LEU D CA  1 
ATOM   9652  C  C   . LEU D 2 193 ? -2.110  8.426   -38.629 1.00 75.93  ? 223 LEU D C   1 
ATOM   9653  O  O   . LEU D 2 193 ? -3.025  7.651   -38.950 1.00 76.69  ? 223 LEU D O   1 
ATOM   9654  C  CB  . LEU D 2 193 ? -0.005  7.078   -38.619 1.00 68.74  ? 223 LEU D CB  1 
ATOM   9655  C  CG  . LEU D 2 193 ? 1.295   6.609   -37.983 1.00 71.05  ? 223 LEU D CG  1 
ATOM   9656  C  CD1 . LEU D 2 193 ? 2.019   5.664   -38.908 1.00 69.47  ? 223 LEU D CD1 1 
ATOM   9657  C  CD2 . LEU D 2 193 ? 2.186   7.782   -37.618 1.00 72.59  ? 223 LEU D CD2 1 
ATOM   9658  N  N   . GLN D 2 194 ? -2.051  9.725   -39.019 1.00 72.62  ? 224 GLN D N   1 
ATOM   9659  C  CA  . GLN D 2 194 ? -3.067  10.411  -39.847 1.00 72.73  ? 224 GLN D CA  1 
ATOM   9660  C  C   . GLN D 2 194 ? -2.432  11.199  -41.028 1.00 76.85  ? 224 GLN D C   1 
ATOM   9661  O  O   . GLN D 2 194 ? -3.153  11.582  -41.952 1.00 77.19  ? 224 GLN D O   1 
ATOM   9662  C  CB  . GLN D 2 194 ? -3.912  11.384  -38.987 1.00 74.86  ? 224 GLN D CB  1 
ATOM   9663  C  CG  . GLN D 2 194 ? -4.623  10.774  -37.771 1.00 101.68 ? 224 GLN D CG  1 
ATOM   9664  C  CD  . GLN D 2 194 ? -5.943  10.096  -38.073 1.00 126.55 ? 224 GLN D CD  1 
ATOM   9665  O  OE1 . GLN D 2 194 ? -6.791  10.614  -38.816 1.00 123.91 ? 224 GLN D OE1 1 
ATOM   9666  N  NE2 . GLN D 2 194 ? -6.182  8.956   -37.426 1.00 118.79 ? 224 GLN D NE2 1 
ATOM   9667  N  N   . SER D 2 195 ? -1.096  11.460  -40.978 1.00 72.40  ? 225 SER D N   1 
ATOM   9668  C  CA  . SER D 2 195 ? -0.342  12.234  -41.977 1.00 71.80  ? 225 SER D CA  1 
ATOM   9669  C  C   . SER D 2 195 ? -0.251  11.613  -43.368 1.00 76.91  ? 225 SER D C   1 
ATOM   9670  O  O   . SER D 2 195 ? -0.135  10.392  -43.457 1.00 77.50  ? 225 SER D O   1 
ATOM   9671  C  CB  . SER D 2 195 ? 1.081   12.490  -41.494 1.00 72.99  ? 225 SER D CB  1 
ATOM   9672  O  OG  . SER D 2 195 ? 1.106   13.120  -40.228 1.00 79.59  ? 225 SER D OG  1 
ATOM   9673  N  N   . PRO D 2 196 ? -0.196  12.429  -44.460 1.00 72.82  ? 226 PRO D N   1 
ATOM   9674  C  CA  . PRO D 2 196 ? -0.002  11.851  -45.797 1.00 72.18  ? 226 PRO D CA  1 
ATOM   9675  C  C   . PRO D 2 196 ? 1.429   11.364  -46.039 1.00 74.69  ? 226 PRO D C   1 
ATOM   9676  O  O   . PRO D 2 196 ? 1.623   10.513  -46.900 1.00 74.53  ? 226 PRO D O   1 
ATOM   9677  C  CB  . PRO D 2 196 ? -0.343  13.008  -46.729 1.00 75.08  ? 226 PRO D CB  1 
ATOM   9678  C  CG  . PRO D 2 196 ? 0.011   14.215  -45.961 1.00 79.85  ? 226 PRO D CG  1 
ATOM   9679  C  CD  . PRO D 2 196 ? -0.320  13.900  -44.535 1.00 75.12  ? 226 PRO D CD  1 
ATOM   9680  N  N   . ILE D 2 197 ? 2.427   11.898  -45.293 1.00 70.57  ? 227 ILE D N   1 
ATOM   9681  C  CA  . ILE D 2 197 ? 3.842   11.503  -45.420 1.00 68.80  ? 227 ILE D CA  1 
ATOM   9682  C  C   . ILE D 2 197 ? 4.366   10.903  -44.123 1.00 72.44  ? 227 ILE D C   1 
ATOM   9683  O  O   . ILE D 2 197 ? 4.183   11.485  -43.057 1.00 72.64  ? 227 ILE D O   1 
ATOM   9684  C  CB  . ILE D 2 197 ? 4.718   12.671  -45.955 1.00 71.23  ? 227 ILE D CB  1 
ATOM   9685  C  CG1 . ILE D 2 197 ? 4.519   12.847  -47.462 1.00 72.07  ? 227 ILE D CG1 1 
ATOM   9686  C  CG2 . ILE D 2 197 ? 6.195   12.470  -45.650 1.00 69.57  ? 227 ILE D CG2 1 
ATOM   9687  C  CD1 . ILE D 2 197 ? 3.510   13.813  -47.805 1.00 86.35  ? 227 ILE D CD1 1 
ATOM   9688  N  N   . ILE D 2 198 ? 4.994   9.733   -44.206 1.00 68.62  ? 228 ILE D N   1 
ATOM   9689  C  CA  . ILE D 2 198 ? 5.560   9.063   -43.025 1.00 67.73  ? 228 ILE D CA  1 
ATOM   9690  C  C   . ILE D 2 198 ? 7.041   8.767   -43.250 1.00 70.44  ? 228 ILE D C   1 
ATOM   9691  O  O   . ILE D 2 198 ? 7.397   8.104   -44.226 1.00 71.22  ? 228 ILE D O   1 
ATOM   9692  C  CB  . ILE D 2 198 ? 4.765   7.782   -42.655 1.00 70.66  ? 228 ILE D CB  1 
ATOM   9693  C  CG1 . ILE D 2 198 ? 3.260   8.083   -42.455 1.00 71.82  ? 228 ILE D CG1 1 
ATOM   9694  C  CG2 . ILE D 2 198 ? 5.351   7.113   -41.433 1.00 70.25  ? 228 ILE D CG2 1 
ATOM   9695  C  CD1 . ILE D 2 198 ? 2.373   7.233   -43.282 1.00 73.64  ? 228 ILE D CD1 1 
ATOM   9696  N  N   . LEU D 2 199 ? 7.905   9.266   -42.360 1.00 64.57  ? 229 LEU D N   1 
ATOM   9697  C  CA  . LEU D 2 199 ? 9.347   9.006   -42.417 1.00 62.24  ? 229 LEU D CA  1 
ATOM   9698  C  C   . LEU D 2 199 ? 9.601   7.829   -41.496 1.00 63.76  ? 229 LEU D C   1 
ATOM   9699  O  O   . LEU D 2 199 ? 9.271   7.891   -40.304 1.00 62.93  ? 229 LEU D O   1 
ATOM   9700  C  CB  . LEU D 2 199 ? 10.166  10.233  -41.990 1.00 62.02  ? 229 LEU D CB  1 
ATOM   9701  C  CG  . LEU D 2 199 ? 9.837   11.554  -42.692 1.00 67.09  ? 229 LEU D CG  1 
ATOM   9702  C  CD1 . LEU D 2 199 ? 10.760  12.617  -42.257 1.00 68.11  ? 229 LEU D CD1 1 
ATOM   9703  C  CD2 . LEU D 2 199 ? 9.899   11.429  -44.187 1.00 67.02  ? 229 LEU D CD2 1 
ATOM   9704  N  N   . LEU D 2 200 ? 10.077  6.720   -42.064 1.00 59.15  ? 230 LEU D N   1 
ATOM   9705  C  CA  . LEU D 2 200 ? 10.296  5.512   -41.271 1.00 58.35  ? 230 LEU D CA  1 
ATOM   9706  C  C   . LEU D 2 200 ? 11.781  5.221   -41.088 1.00 63.13  ? 230 LEU D C   1 
ATOM   9707  O  O   . LEU D 2 200 ? 12.481  5.058   -42.077 1.00 63.23  ? 230 LEU D O   1 
ATOM   9708  C  CB  . LEU D 2 200 ? 9.532   4.312   -41.877 1.00 57.79  ? 230 LEU D CB  1 
ATOM   9709  C  CG  . LEU D 2 200 ? 9.854   2.923   -41.343 1.00 60.31  ? 230 LEU D CG  1 
ATOM   9710  C  CD1 . LEU D 2 200 ? 9.093   2.628   -40.068 1.00 60.18  ? 230 LEU D CD1 1 
ATOM   9711  C  CD2 . LEU D 2 200 ? 9.535   1.883   -42.364 1.00 61.39  ? 230 LEU D CD2 1 
ATOM   9712  N  N   . TYR D 2 201 ? 12.251  5.185   -39.828 1.00 59.37  ? 231 TYR D N   1 
ATOM   9713  C  CA  . TYR D 2 201 ? 13.643  4.901   -39.447 1.00 58.83  ? 231 TYR D CA  1 
ATOM   9714  C  C   . TYR D 2 201 ? 13.689  3.592   -38.649 1.00 60.73  ? 231 TYR D C   1 
ATOM   9715  O  O   . TYR D 2 201 ? 13.187  3.513   -37.518 1.00 59.89  ? 231 TYR D O   1 
ATOM   9716  C  CB  . TYR D 2 201 ? 14.237  6.063   -38.633 1.00 60.21  ? 231 TYR D CB  1 
ATOM   9717  C  CG  . TYR D 2 201 ? 15.671  5.849   -38.229 1.00 60.68  ? 231 TYR D CG  1 
ATOM   9718  C  CD1 . TYR D 2 201 ? 15.993  5.136   -37.079 1.00 62.69  ? 231 TYR D CD1 1 
ATOM   9719  C  CD2 . TYR D 2 201 ? 16.711  6.390   -38.974 1.00 61.68  ? 231 TYR D CD2 1 
ATOM   9720  C  CE1 . TYR D 2 201 ? 17.320  4.924   -36.706 1.00 65.97  ? 231 TYR D CE1 1 
ATOM   9721  C  CE2 . TYR D 2 201 ? 18.040  6.214   -38.597 1.00 62.42  ? 231 TYR D CE2 1 
ATOM   9722  C  CZ  . TYR D 2 201 ? 18.342  5.476   -37.463 1.00 73.24  ? 231 TYR D CZ  1 
ATOM   9723  O  OH  . TYR D 2 201 ? 19.649  5.284   -37.090 1.00 75.85  ? 231 TYR D OH  1 
ATOM   9724  N  N   . CYS D 2 202 ? 14.278  2.568   -39.260 1.00 55.70  ? 232 CYS D N   1 
ATOM   9725  C  CA  . CYS D 2 202 ? 14.375  1.232   -38.705 1.00 55.18  ? 232 CYS D CA  1 
ATOM   9726  C  C   . CYS D 2 202 ? 15.260  0.413   -39.647 1.00 60.89  ? 232 CYS D C   1 
ATOM   9727  O  O   . CYS D 2 202 ? 15.904  1.009   -40.518 1.00 59.87  ? 232 CYS D O   1 
ATOM   9728  C  CB  . CYS D 2 202 ? 12.982  0.618   -38.556 1.00 55.74  ? 232 CYS D CB  1 
ATOM   9729  S  SG  . CYS D 2 202 ? 12.132  0.282   -40.122 1.00 59.87  ? 232 CYS D SG  1 
ATOM   9730  N  N   . THR D 2 203 ? 15.318  -0.941  -39.458 1.00 59.12  ? 233 THR D N   1 
ATOM   9731  C  CA  . THR D 2 203 ? 16.104  -1.852  -40.305 1.00 58.92  ? 233 THR D CA  1 
ATOM   9732  C  C   . THR D 2 203 ? 15.205  -2.433  -41.375 1.00 63.37  ? 233 THR D C   1 
ATOM   9733  O  O   . THR D 2 203 ? 13.987  -2.342  -41.247 1.00 64.61  ? 233 THR D O   1 
ATOM   9734  C  CB  . THR D 2 203 ? 16.780  -2.963  -39.486 1.00 67.92  ? 233 THR D CB  1 
ATOM   9735  O  OG1 . THR D 2 203 ? 15.807  -3.746  -38.818 1.00 72.80  ? 233 THR D OG1 1 
ATOM   9736  C  CG2 . THR D 2 203 ? 17.716  -2.437  -38.469 1.00 65.86  ? 233 THR D CG2 1 
ATOM   9737  N  N   . LYS D 2 204 ? 15.793  -3.030  -42.432 1.00 58.98  ? 234 LYS D N   1 
ATOM   9738  C  CA  . LYS D 2 204 ? 15.038  -3.678  -43.506 1.00 58.21  ? 234 LYS D CA  1 
ATOM   9739  C  C   . LYS D 2 204 ? 14.167  -4.795  -42.926 1.00 64.27  ? 234 LYS D C   1 
ATOM   9740  O  O   . LYS D 2 204 ? 13.022  -4.931  -43.341 1.00 65.92  ? 234 LYS D O   1 
ATOM   9741  C  CB  . LYS D 2 204 ? 15.980  -4.229  -44.572 1.00 58.64  ? 234 LYS D CB  1 
ATOM   9742  C  CG  . LYS D 2 204 ? 15.286  -4.763  -45.820 1.00 61.27  ? 234 LYS D CG  1 
ATOM   9743  C  CD  . LYS D 2 204 ? 16.296  -4.872  -46.916 1.00 61.79  ? 234 LYS D CD  1 
ATOM   9744  C  CE  . LYS D 2 204 ? 15.781  -5.428  -48.196 1.00 53.12  ? 234 LYS D CE  1 
ATOM   9745  N  NZ  . LYS D 2 204 ? 16.795  -5.252  -49.277 1.00 49.62  ? 234 LYS D NZ  1 
ATOM   9746  N  N   . GLU D 2 205 ? 14.690  -5.554  -41.943 1.00 60.84  ? 235 GLU D N   1 
ATOM   9747  C  CA  . GLU D 2 205 ? 13.963  -6.639  -41.294 1.00 61.23  ? 235 GLU D CA  1 
ATOM   9748  C  C   . GLU D 2 205 ? 12.754  -6.111  -40.495 1.00 66.63  ? 235 GLU D C   1 
ATOM   9749  O  O   . GLU D 2 205 ? 11.652  -6.642  -40.622 1.00 67.49  ? 235 GLU D O   1 
ATOM   9750  C  CB  . GLU D 2 205 ? 14.912  -7.509  -40.456 1.00 62.05  ? 235 GLU D CB  1 
ATOM   9751  N  N   . GLU D 2 206 ? 12.948  -5.017  -39.754 1.00 63.94  ? 236 GLU D N   1 
ATOM   9752  C  CA  . GLU D 2 206 ? 11.922  -4.337  -38.951 1.00 64.67  ? 236 GLU D CA  1 
ATOM   9753  C  C   . GLU D 2 206 ? 10.863  -3.703  -39.852 1.00 69.38  ? 236 GLU D C   1 
ATOM   9754  O  O   . GLU D 2 206 ? 9.668   -3.792  -39.567 1.00 71.36  ? 236 GLU D O   1 
ATOM   9755  C  CB  . GLU D 2 206 ? 12.572  -3.247  -38.089 1.00 65.35  ? 236 GLU D CB  1 
ATOM   9756  C  CG  . GLU D 2 206 ? 13.269  -3.789  -36.860 1.00 73.94  ? 236 GLU D CG  1 
ATOM   9757  C  CD  . GLU D 2 206 ? 13.979  -2.752  -36.023 1.00 89.63  ? 236 GLU D CD  1 
ATOM   9758  O  OE1 . GLU D 2 206 ? 14.431  -1.740  -36.603 1.00 77.85  ? 236 GLU D OE1 1 
ATOM   9759  O  OE2 . GLU D 2 206 ? 14.108  -2.966  -34.794 1.00 81.21  ? 236 GLU D OE2 1 
ATOM   9760  N  N   . ALA D 2 207 ? 11.313  -3.067  -40.936 1.00 64.38  ? 237 ALA D N   1 
ATOM   9761  C  CA  . ALA D 2 207 ? 10.451  -2.415  -41.899 1.00 64.68  ? 237 ALA D CA  1 
ATOM   9762  C  C   . ALA D 2 207 ? 9.475   -3.404  -42.539 1.00 71.55  ? 237 ALA D C   1 
ATOM   9763  O  O   . ALA D 2 207 ? 8.319   -3.022  -42.741 1.00 72.36  ? 237 ALA D O   1 
ATOM   9764  C  CB  . ALA D 2 207 ? 11.285  -1.730  -42.957 1.00 64.94  ? 237 ALA D CB  1 
ATOM   9765  N  N   . THR D 2 208 ? 9.906   -4.685  -42.809 1.00 67.87  ? 238 THR D N   1 
ATOM   9766  C  CA  . THR D 2 208 ? 9.009   -5.679  -43.421 1.00 68.38  ? 238 THR D CA  1 
ATOM   9767  C  C   . THR D 2 208 ? 7.835   -5.936  -42.487 1.00 74.08  ? 238 THR D C   1 
ATOM   9768  O  O   . THR D 2 208 ? 6.691   -5.920  -42.948 1.00 75.88  ? 238 THR D O   1 
ATOM   9769  C  CB  . THR D 2 208 ? 9.709   -6.960  -43.893 1.00 74.15  ? 238 THR D CB  1 
ATOM   9770  O  OG1 . THR D 2 208 ? 9.930   -7.799  -42.780 1.00 85.38  ? 238 THR D OG1 1 
ATOM   9771  C  CG2 . THR D 2 208 ? 11.014  -6.720  -44.590 1.00 67.56  ? 238 THR D CG2 1 
ATOM   9772  N  N   . TYR D 2 209 ? 8.108   -6.065  -41.157 1.00 69.48  ? 239 TYR D N   1 
ATOM   9773  C  CA  . TYR D 2 209 ? 7.046   -6.267  -40.163 1.00 69.29  ? 239 TYR D CA  1 
ATOM   9774  C  C   . TYR D 2 209 ? 6.115   -5.075  -40.116 1.00 71.54  ? 239 TYR D C   1 
ATOM   9775  O  O   . TYR D 2 209 ? 4.913   -5.245  -40.340 1.00 72.59  ? 239 TYR D O   1 
ATOM   9776  C  CB  . TYR D 2 209 ? 7.586   -6.582  -38.757 1.00 70.10  ? 239 TYR D CB  1 
ATOM   9777  C  CG  . TYR D 2 209 ? 6.469   -6.877  -37.782 1.00 73.65  ? 239 TYR D CG  1 
ATOM   9778  C  CD1 . TYR D 2 209 ? 5.662   -7.999  -37.939 1.00 77.07  ? 239 TYR D CD1 1 
ATOM   9779  C  CD2 . TYR D 2 209 ? 6.168   -5.997  -36.747 1.00 74.44  ? 239 TYR D CD2 1 
ATOM   9780  C  CE1 . TYR D 2 209 ? 4.608   -8.258  -37.072 1.00 79.32  ? 239 TYR D CE1 1 
ATOM   9781  C  CE2 . TYR D 2 209 ? 5.108   -6.244  -35.873 1.00 76.21  ? 239 TYR D CE2 1 
ATOM   9782  C  CZ  . TYR D 2 209 ? 4.338   -7.383  -36.035 1.00 86.57  ? 239 TYR D CZ  1 
ATOM   9783  O  OH  . TYR D 2 209 ? 3.290   -7.663  -35.190 1.00 91.02  ? 239 TYR D OH  1 
ATOM   9784  N  N   . ILE D 2 210 ? 6.683   -3.873  -39.849 1.00 65.21  ? 240 ILE D N   1 
ATOM   9785  C  CA  . ILE D 2 210 ? 5.994   -2.573  -39.785 1.00 64.62  ? 240 ILE D CA  1 
ATOM   9786  C  C   . ILE D 2 210 ? 5.059   -2.345  -40.977 1.00 69.80  ? 240 ILE D C   1 
ATOM   9787  O  O   . ILE D 2 210 ? 3.912   -1.958  -40.770 1.00 69.84  ? 240 ILE D O   1 
ATOM   9788  C  CB  . ILE D 2 210 ? 7.027   -1.435  -39.618 1.00 66.49  ? 240 ILE D CB  1 
ATOM   9789  C  CG1 . ILE D 2 210 ? 7.648   -1.484  -38.205 1.00 66.30  ? 240 ILE D CG1 1 
ATOM   9790  C  CG2 . ILE D 2 210 ? 6.417   -0.060  -39.931 1.00 66.44  ? 240 ILE D CG2 1 
ATOM   9791  C  CD1 . ILE D 2 210 ? 9.023   -0.854  -38.064 1.00 76.36  ? 240 ILE D CD1 1 
ATOM   9792  N  N   . PHE D 2 211 ? 5.544   -2.623  -42.209 1.00 66.65  ? 241 PHE D N   1 
ATOM   9793  C  CA  . PHE D 2 211 ? 4.771   -2.464  -43.435 1.00 66.95  ? 241 PHE D CA  1 
ATOM   9794  C  C   . PHE D 2 211 ? 3.589   -3.412  -43.506 1.00 75.44  ? 241 PHE D C   1 
ATOM   9795  O  O   . PHE D 2 211 ? 2.502   -2.981  -43.905 1.00 77.39  ? 241 PHE D O   1 
ATOM   9796  C  CB  . PHE D 2 211 ? 5.662   -2.582  -44.675 1.00 67.98  ? 241 PHE D CB  1 
ATOM   9797  C  CG  . PHE D 2 211 ? 6.441   -1.332  -44.995 1.00 68.36  ? 241 PHE D CG  1 
ATOM   9798  C  CD1 . PHE D 2 211 ? 5.831   -0.077  -44.945 1.00 70.22  ? 241 PHE D CD1 1 
ATOM   9799  C  CD2 . PHE D 2 211 ? 7.777   -1.404  -45.370 1.00 70.49  ? 241 PHE D CD2 1 
ATOM   9800  C  CE1 . PHE D 2 211 ? 6.553   1.081   -45.212 1.00 70.62  ? 241 PHE D CE1 1 
ATOM   9801  C  CE2 . PHE D 2 211 ? 8.498   -0.241  -45.657 1.00 73.00  ? 241 PHE D CE2 1 
ATOM   9802  C  CZ  . PHE D 2 211 ? 7.878   0.993   -45.569 1.00 70.84  ? 241 PHE D CZ  1 
ATOM   9803  N  N   . GLU D 2 212 ? 3.789   -4.690  -43.098 1.00 72.63  ? 242 GLU D N   1 
ATOM   9804  C  CA  . GLU D 2 212 ? 2.744   -5.712  -43.060 1.00 74.03  ? 242 GLU D CA  1 
ATOM   9805  C  C   . GLU D 2 212 ? 1.629   -5.219  -42.143 1.00 78.79  ? 242 GLU D C   1 
ATOM   9806  O  O   . GLU D 2 212 ? 0.461   -5.211  -42.553 1.00 79.60  ? 242 GLU D O   1 
ATOM   9807  C  CB  . GLU D 2 212 ? 3.324   -7.043  -42.579 1.00 75.91  ? 242 GLU D CB  1 
ATOM   9808  C  CG  . GLU D 2 212 ? 2.307   -8.152  -42.417 1.00 88.93  ? 242 GLU D CG  1 
ATOM   9809  C  CD  . GLU D 2 212 ? 2.913   -9.427  -41.871 1.00 113.19 ? 242 GLU D CD  1 
ATOM   9810  O  OE1 . GLU D 2 212 ? 3.415   -9.404  -40.722 1.00 113.35 ? 242 GLU D OE1 1 
ATOM   9811  O  OE2 . GLU D 2 212 ? 2.888   -10.450 -42.594 1.00 105.09 ? 242 GLU D OE2 1 
ATOM   9812  N  N   . VAL D 2 213 ? 2.012   -4.736  -40.935 1.00 74.00  ? 243 VAL D N   1 
ATOM   9813  C  CA  . VAL D 2 213 ? 1.083   -4.154  -39.964 1.00 73.71  ? 243 VAL D CA  1 
ATOM   9814  C  C   . VAL D 2 213 ? 0.393   -2.926  -40.587 1.00 79.42  ? 243 VAL D C   1 
ATOM   9815  O  O   . VAL D 2 213 ? -0.844  -2.892  -40.619 1.00 80.19  ? 243 VAL D O   1 
ATOM   9816  C  CB  . VAL D 2 213 ? 1.748   -3.820  -38.613 1.00 75.21  ? 243 VAL D CB  1 
ATOM   9817  C  CG1 . VAL D 2 213 ? 0.760   -3.157  -37.681 1.00 74.77  ? 243 VAL D CG1 1 
ATOM   9818  C  CG2 . VAL D 2 213 ? 2.318   -5.069  -37.966 1.00 75.00  ? 243 VAL D CG2 1 
ATOM   9819  N  N   . ALA D 2 214 ? 1.193   -1.959  -41.130 1.00 74.85  ? 244 ALA D N   1 
ATOM   9820  C  CA  . ALA D 2 214 ? 0.700   -0.730  -41.777 1.00 74.70  ? 244 ALA D CA  1 
ATOM   9821  C  C   . ALA D 2 214 ? -0.350  -0.998  -42.898 1.00 80.97  ? 244 ALA D C   1 
ATOM   9822  O  O   . ALA D 2 214 ? -1.331  -0.249  -43.028 1.00 80.18  ? 244 ALA D O   1 
ATOM   9823  C  CB  . ALA D 2 214 ? 1.863   0.089   -42.324 1.00 74.04  ? 244 ALA D CB  1 
ATOM   9824  N  N   . ASN D 2 215 ? -0.146  -2.081  -43.677 1.00 78.49  ? 245 ASN D N   1 
ATOM   9825  C  CA  . ASN D 2 215 ? -1.022  -2.449  -44.773 1.00 79.93  ? 245 ASN D CA  1 
ATOM   9826  C  C   . ASN D 2 215 ? -2.372  -2.872  -44.253 1.00 86.68  ? 245 ASN D C   1 
ATOM   9827  O  O   . ASN D 2 215 ? -3.366  -2.636  -44.938 1.00 87.01  ? 245 ASN D O   1 
ATOM   9828  C  CB  . ASN D 2 215 ? -0.372  -3.521  -45.645 1.00 84.53  ? 245 ASN D CB  1 
ATOM   9829  C  CG  . ASN D 2 215 ? -1.148  -4.809  -45.754 1.00 116.74 ? 245 ASN D CG  1 
ATOM   9830  O  OD1 . ASN D 2 215 ? -2.095  -4.926  -46.554 1.00 113.19 ? 245 ASN D OD1 1 
ATOM   9831  N  ND2 . ASN D 2 215 ? -0.785  -5.789  -44.927 1.00 107.34 ? 245 ASN D ND2 1 
ATOM   9832  N  N   . SER D 2 216 ? -2.407  -3.490  -43.039 1.00 85.47  ? 246 SER D N   1 
ATOM   9833  C  CA  . SER D 2 216 ? -3.637  -3.951  -42.370 1.00 86.65  ? 246 SER D CA  1 
ATOM   9834  C  C   . SER D 2 216 ? -4.454  -2.768  -41.943 1.00 91.04  ? 246 SER D C   1 
ATOM   9835  O  O   . SER D 2 216 ? -5.670  -2.843  -41.980 1.00 93.02  ? 246 SER D O   1 
ATOM   9836  C  CB  . SER D 2 216 ? -3.333  -4.787  -41.127 1.00 91.31  ? 246 SER D CB  1 
ATOM   9837  O  OG  . SER D 2 216 ? -2.156  -5.564  -41.250 1.00 102.18 ? 246 SER D OG  1 
ATOM   9838  N  N   . VAL D 2 217 ? -3.801  -1.676  -41.538 1.00 86.77  ? 247 VAL D N   1 
ATOM   9839  C  CA  . VAL D 2 217 ? -4.445  -0.432  -41.088 1.00 87.00  ? 247 VAL D CA  1 
ATOM   9840  C  C   . VAL D 2 217 ? -4.645  0.611   -42.273 1.00 88.10  ? 247 VAL D C   1 
ATOM   9841  O  O   . VAL D 2 217 ? -4.878  1.807   -42.046 1.00 86.27  ? 247 VAL D O   1 
ATOM   9842  C  CB  . VAL D 2 217 ? -3.633  0.127   -39.885 1.00 91.30  ? 247 VAL D CB  1 
ATOM   9843  C  CG1 . VAL D 2 217 ? -4.314  1.340   -39.269 1.00 91.97  ? 247 VAL D CG1 1 
ATOM   9844  C  CG2 . VAL D 2 217 ? -3.405  -0.953  -38.826 1.00 91.32  ? 247 VAL D CG2 1 
ATOM   9845  N  N   . GLY D 2 218 ? -4.577  0.110   -43.512 1.00 83.70  ? 248 GLY D N   1 
ATOM   9846  C  CA  . GLY D 2 218 ? -4.717  0.880   -44.739 1.00 82.72  ? 248 GLY D CA  1 
ATOM   9847  C  C   . GLY D 2 218 ? -3.852  2.120   -44.756 1.00 84.49  ? 248 GLY D C   1 
ATOM   9848  O  O   . GLY D 2 218 ? -4.358  3.232   -44.928 1.00 85.87  ? 248 GLY D O   1 
ATOM   9849  N  N   . LEU D 2 219 ? -2.559  1.948   -44.517 1.00 77.20  ? 249 LEU D N   1 
ATOM   9850  C  CA  . LEU D 2 219 ? -1.642  3.078   -44.529 1.00 75.25  ? 249 LEU D CA  1 
ATOM   9851  C  C   . LEU D 2 219 ? -0.607  3.000   -45.657 1.00 79.77  ? 249 LEU D C   1 
ATOM   9852  O  O   . LEU D 2 219 ? 0.193   3.919   -45.800 1.00 79.46  ? 249 LEU D O   1 
ATOM   9853  C  CB  . LEU D 2 219 ? -0.947  3.197   -43.167 1.00 73.81  ? 249 LEU D CB  1 
ATOM   9854  C  CG  . LEU D 2 219 ? -1.813  3.600   -41.985 1.00 77.92  ? 249 LEU D CG  1 
ATOM   9855  C  CD1 . LEU D 2 219 ? -1.195  3.118   -40.684 1.00 77.51  ? 249 LEU D CD1 1 
ATOM   9856  C  CD2 . LEU D 2 219 ? -2.010  5.099   -41.938 1.00 79.28  ? 249 LEU D CD2 1 
ATOM   9857  N  N   . THR D 2 220 ? -0.605  1.910   -46.442 1.00 76.35  ? 250 THR D N   1 
ATOM   9858  C  CA  . THR D 2 220 ? 0.393   1.703   -47.492 1.00 76.09  ? 250 THR D CA  1 
ATOM   9859  C  C   . THR D 2 220 ? -0.089  2.156   -48.883 1.00 82.26  ? 250 THR D C   1 
ATOM   9860  O  O   . THR D 2 220 ? 0.749   2.378   -49.768 1.00 82.51  ? 250 THR D O   1 
ATOM   9861  C  CB  . THR D 2 220 ? 0.905   0.234   -47.494 1.00 80.70  ? 250 THR D CB  1 
ATOM   9862  O  OG1 . THR D 2 220 ? -0.195  -0.674  -47.628 1.00 82.80  ? 250 THR D OG1 1 
ATOM   9863  C  CG2 . THR D 2 220 ? 1.764   -0.113  -46.268 1.00 71.56  ? 250 THR D CG2 1 
ATOM   9864  N  N   . GLY D 2 221 ? -1.407  2.326   -49.052 1.00 78.90  ? 251 GLY D N   1 
ATOM   9865  C  CA  . GLY D 2 221 ? -2.030  2.725   -50.325 1.00 78.46  ? 251 GLY D CA  1 
ATOM   9866  C  C   . GLY D 2 221 ? -1.790  4.142   -50.819 1.00 79.72  ? 251 GLY D C   1 
ATOM   9867  O  O   . GLY D 2 221 ? -0.804  4.775   -50.430 1.00 78.67  ? 251 GLY D O   1 
ATOM   9868  N  N   . TYR D 2 222 ? -2.679  4.648   -51.704 1.00 75.73  ? 252 TYR D N   1 
ATOM   9869  C  CA  . TYR D 2 222 ? -2.612  6.029   -52.202 1.00 74.37  ? 252 TYR D CA  1 
ATOM   9870  C  C   . TYR D 2 222 ? -2.919  6.992   -51.045 1.00 79.29  ? 252 TYR D C   1 
ATOM   9871  O  O   . TYR D 2 222 ? -3.707  6.662   -50.132 1.00 77.97  ? 252 TYR D O   1 
ATOM   9872  C  CB  . TYR D 2 222 ? -3.679  6.274   -53.281 1.00 74.58  ? 252 TYR D CB  1 
ATOM   9873  C  CG  . TYR D 2 222 ? -3.660  5.372   -54.488 1.00 73.87  ? 252 TYR D CG  1 
ATOM   9874  C  CD1 . TYR D 2 222 ? -2.484  5.156   -55.206 1.00 74.49  ? 252 TYR D CD1 1 
ATOM   9875  C  CD2 . TYR D 2 222 ? -4.842  4.878   -55.019 1.00 74.86  ? 252 TYR D CD2 1 
ATOM   9876  C  CE1 . TYR D 2 222 ? -2.480  4.404   -56.377 1.00 73.70  ? 252 TYR D CE1 1 
ATOM   9877  C  CE2 . TYR D 2 222 ? -4.853  4.137   -56.198 1.00 75.72  ? 252 TYR D CE2 1 
ATOM   9878  C  CZ  . TYR D 2 222 ? -3.672  3.902   -56.875 1.00 79.03  ? 252 TYR D CZ  1 
ATOM   9879  O  OH  . TYR D 2 222 ? -3.701  3.137   -58.017 1.00 79.16  ? 252 TYR D OH  1 
ATOM   9880  N  N   . GLY D 2 223 ? -2.313  8.173   -51.103 1.00 76.58  ? 253 GLY D N   1 
ATOM   9881  C  CA  . GLY D 2 223 ? -2.543  9.185   -50.084 1.00 76.64  ? 253 GLY D CA  1 
ATOM   9882  C  C   . GLY D 2 223 ? -1.632  9.052   -48.891 1.00 79.33  ? 253 GLY D C   1 
ATOM   9883  O  O   . GLY D 2 223 ? -1.694  9.895   -48.004 1.00 78.70  ? 253 GLY D O   1 
ATOM   9884  N  N   . TYR D 2 224 ? -0.790  8.002   -48.858 1.00 75.79  ? 254 TYR D N   1 
ATOM   9885  C  CA  . TYR D 2 224 ? 0.210   7.754   -47.830 1.00 75.00  ? 254 TYR D CA  1 
ATOM   9886  C  C   . TYR D 2 224 ? 1.514   7.398   -48.508 1.00 76.90  ? 254 TYR D C   1 
ATOM   9887  O  O   . TYR D 2 224 ? 1.615   6.377   -49.199 1.00 76.04  ? 254 TYR D O   1 
ATOM   9888  C  CB  . TYR D 2 224 ? -0.213  6.657   -46.851 1.00 77.38  ? 254 TYR D CB  1 
ATOM   9889  C  CG  . TYR D 2 224 ? -1.403  7.014   -45.990 1.00 82.68  ? 254 TYR D CG  1 
ATOM   9890  C  CD1 . TYR D 2 224 ? -1.288  7.938   -44.951 1.00 85.11  ? 254 TYR D CD1 1 
ATOM   9891  C  CD2 . TYR D 2 224 ? -2.643  6.412   -46.194 1.00 84.79  ? 254 TYR D CD2 1 
ATOM   9892  C  CE1 . TYR D 2 224 ? -2.387  8.277   -44.157 1.00 87.96  ? 254 TYR D CE1 1 
ATOM   9893  C  CE2 . TYR D 2 224 ? -3.748  6.744   -45.409 1.00 86.69  ? 254 TYR D CE2 1 
ATOM   9894  C  CZ  . TYR D 2 224 ? -3.620  7.685   -44.399 1.00 97.03  ? 254 TYR D CZ  1 
ATOM   9895  O  OH  . TYR D 2 224 ? -4.714  8.003   -43.624 1.00 100.44 ? 254 TYR D OH  1 
ATOM   9896  N  N   . THR D 2 225 ? 2.505   8.279   -48.336 1.00 72.79  ? 255 THR D N   1 
ATOM   9897  C  CA  . THR D 2 225 ? 3.857   8.156   -48.885 1.00 71.38  ? 255 THR D CA  1 
ATOM   9898  C  C   . THR D 2 225 ? 4.815   7.890   -47.753 1.00 71.53  ? 255 THR D C   1 
ATOM   9899  O  O   . THR D 2 225 ? 4.777   8.585   -46.729 1.00 70.46  ? 255 THR D O   1 
ATOM   9900  C  CB  . THR D 2 225 ? 4.269   9.412   -49.664 1.00 76.02  ? 255 THR D CB  1 
ATOM   9901  O  OG1 . THR D 2 225 ? 3.134   9.915   -50.379 1.00 86.44  ? 255 THR D OG1 1 
ATOM   9902  C  CG2 . THR D 2 225 ? 5.409   9.146   -50.613 1.00 64.52  ? 255 THR D CG2 1 
ATOM   9903  N  N   . TRP D 2 226 ? 5.672   6.875   -47.938 1.00 65.33  ? 256 TRP D N   1 
ATOM   9904  C  CA  . TRP D 2 226 ? 6.674   6.487   -46.949 1.00 62.32  ? 256 TRP D CA  1 
ATOM   9905  C  C   . TRP D 2 226 ? 8.074   6.790   -47.445 1.00 65.97  ? 256 TRP D C   1 
ATOM   9906  O  O   . TRP D 2 226 ? 8.493   6.262   -48.476 1.00 66.13  ? 256 TRP D O   1 
ATOM   9907  C  CB  . TRP D 2 226 ? 6.552   5.002   -46.596 1.00 59.29  ? 256 TRP D CB  1 
ATOM   9908  C  CG  . TRP D 2 226 ? 5.301   4.652   -45.859 1.00 59.77  ? 256 TRP D CG  1 
ATOM   9909  C  CD1 . TRP D 2 226 ? 4.038   4.592   -46.367 1.00 63.11  ? 256 TRP D CD1 1 
ATOM   9910  C  CD2 . TRP D 2 226 ? 5.199   4.275   -44.478 1.00 59.09  ? 256 TRP D CD2 1 
ATOM   9911  N  NE1 . TRP D 2 226 ? 3.150   4.207   -45.392 1.00 62.37  ? 256 TRP D NE1 1 
ATOM   9912  C  CE2 . TRP D 2 226 ? 3.834   4.013   -44.217 1.00 63.56  ? 256 TRP D CE2 1 
ATOM   9913  C  CE3 . TRP D 2 226 ? 6.133   4.115   -43.435 1.00 58.89  ? 256 TRP D CE3 1 
ATOM   9914  C  CZ2 . TRP D 2 226 ? 3.380   3.606   -42.953 1.00 62.65  ? 256 TRP D CZ2 1 
ATOM   9915  C  CZ3 . TRP D 2 226 ? 5.685   3.687   -42.195 1.00 59.75  ? 256 TRP D CZ3 1 
ATOM   9916  C  CH2 . TRP D 2 226 ? 4.325   3.457   -41.954 1.00 60.87  ? 256 TRP D CH2 1 
ATOM   9917  N  N   . ILE D 2 227 ? 8.777   7.669   -46.747 1.00 61.76  ? 257 ILE D N   1 
ATOM   9918  C  CA  . ILE D 2 227 ? 10.167  7.953   -47.065 1.00 61.74  ? 257 ILE D CA  1 
ATOM   9919  C  C   . ILE D 2 227 ? 10.985  7.154   -46.053 1.00 68.25  ? 257 ILE D C   1 
ATOM   9920  O  O   . ILE D 2 227 ? 10.648  7.085   -44.862 1.00 66.43  ? 257 ILE D O   1 
ATOM   9921  C  CB  . ILE D 2 227 ? 10.516  9.459   -47.196 1.00 64.66  ? 257 ILE D CB  1 
ATOM   9922  C  CG1 . ILE D 2 227 ? 9.465   10.179  -48.079 1.00 65.76  ? 257 ILE D CG1 1 
ATOM   9923  C  CG2 . ILE D 2 227 ? 11.919  9.631   -47.796 1.00 64.16  ? 257 ILE D CG2 1 
ATOM   9924  C  CD1 . ILE D 2 227 ? 9.344   11.702  -47.946 1.00 71.45  ? 257 ILE D CD1 1 
ATOM   9925  N  N   . VAL D 2 228 ? 12.009  6.479   -46.553 1.00 68.31  ? 258 VAL D N   1 
ATOM   9926  C  CA  . VAL D 2 228 ? 12.825  5.553   -45.766 1.00 68.66  ? 258 VAL D CA  1 
ATOM   9927  C  C   . VAL D 2 228 ? 14.360  5.774   -45.957 1.00 72.43  ? 258 VAL D C   1 
ATOM   9928  O  O   . VAL D 2 228 ? 14.762  6.264   -47.021 1.00 73.80  ? 258 VAL D O   1 
ATOM   9929  C  CB  . VAL D 2 228 ? 12.314  4.142   -46.204 1.00 73.08  ? 258 VAL D CB  1 
ATOM   9930  C  CG1 . VAL D 2 228 ? 13.381  3.289   -46.884 1.00 72.38  ? 258 VAL D CG1 1 
ATOM   9931  C  CG2 . VAL D 2 228 ? 11.586  3.410   -45.077 1.00 72.61  ? 258 VAL D CG2 1 
ATOM   9932  N  N   . PRO D 2 229 ? 15.243  5.424   -44.981 1.00 67.23  ? 259 PRO D N   1 
ATOM   9933  C  CA  . PRO D 2 229 ? 16.688  5.586   -45.218 1.00 65.91  ? 259 PRO D CA  1 
ATOM   9934  C  C   . PRO D 2 229 ? 17.317  4.374   -45.931 1.00 68.09  ? 259 PRO D C   1 
ATOM   9935  O  O   . PRO D 2 229 ? 16.740  3.289   -45.977 1.00 67.03  ? 259 PRO D O   1 
ATOM   9936  C  CB  . PRO D 2 229 ? 17.255  5.798   -43.807 1.00 66.53  ? 259 PRO D CB  1 
ATOM   9937  C  CG  . PRO D 2 229 ? 16.232  5.245   -42.862 1.00 71.18  ? 259 PRO D CG  1 
ATOM   9938  C  CD  . PRO D 2 229 ? 15.015  4.811   -43.661 1.00 68.11  ? 259 PRO D CD  1 
ATOM   9939  N  N   . SER D 2 230 ? 18.508  4.582   -46.489 1.00 64.62  ? 260 SER D N   1 
ATOM   9940  C  CA  . SER D 2 230 ? 19.368  3.635   -47.207 1.00 64.16  ? 260 SER D CA  1 
ATOM   9941  C  C   . SER D 2 230 ? 19.293  2.177   -46.767 1.00 65.80  ? 260 SER D C   1 
ATOM   9942  O  O   . SER D 2 230 ? 19.190  1.291   -47.610 1.00 63.85  ? 260 SER D O   1 
ATOM   9943  C  CB  . SER D 2 230 ? 20.819  4.103   -47.100 1.00 67.37  ? 260 SER D CB  1 
ATOM   9944  O  OG  . SER D 2 230 ? 21.572  3.729   -48.240 1.00 78.81  ? 260 SER D OG  1 
ATOM   9945  N  N   . LEU D 2 231 ? 19.386  1.938   -45.445 1.00 63.11  ? 261 LEU D N   1 
ATOM   9946  C  CA  . LEU D 2 231 ? 19.429  0.608   -44.860 1.00 63.33  ? 261 LEU D CA  1 
ATOM   9947  C  C   . LEU D 2 231 ? 18.122  -0.181  -45.059 1.00 66.83  ? 261 LEU D C   1 
ATOM   9948  O  O   . LEU D 2 231 ? 18.189  -1.407  -45.190 1.00 66.38  ? 261 LEU D O   1 
ATOM   9949  C  CB  . LEU D 2 231 ? 19.885  0.655   -43.376 1.00 63.02  ? 261 LEU D CB  1 
ATOM   9950  C  CG  . LEU D 2 231 ? 18.871  0.902   -42.251 1.00 67.66  ? 261 LEU D CG  1 
ATOM   9951  C  CD1 . LEU D 2 231 ? 19.421  0.417   -40.928 1.00 66.80  ? 261 LEU D CD1 1 
ATOM   9952  C  CD2 . LEU D 2 231 ? 18.499  2.358   -42.153 1.00 70.02  ? 261 LEU D CD2 1 
ATOM   9953  N  N   . VAL D 2 232 ? 16.960  0.506   -45.125 1.00 62.53  ? 262 VAL D N   1 
ATOM   9954  C  CA  . VAL D 2 232 ? 15.693  -0.176  -45.378 1.00 62.60  ? 262 VAL D CA  1 
ATOM   9955  C  C   . VAL D 2 232 ? 15.637  -0.697  -46.833 1.00 67.72  ? 262 VAL D C   1 
ATOM   9956  O  O   . VAL D 2 232 ? 15.142  -1.802  -47.074 1.00 67.40  ? 262 VAL D O   1 
ATOM   9957  C  CB  . VAL D 2 232 ? 14.445  0.644   -44.979 1.00 66.00  ? 262 VAL D CB  1 
ATOM   9958  C  CG1 . VAL D 2 232 ? 13.173  -0.051  -45.431 1.00 66.08  ? 262 VAL D CG1 1 
ATOM   9959  C  CG2 . VAL D 2 232 ? 14.398  0.882   -43.477 1.00 65.14  ? 262 VAL D CG2 1 
ATOM   9960  N  N   . ALA D 2 233 ? 16.167  0.078   -47.792 1.00 65.55  ? 263 ALA D N   1 
ATOM   9961  C  CA  . ALA D 2 233 ? 16.199  -0.368  -49.182 1.00 66.53  ? 263 ALA D CA  1 
ATOM   9962  C  C   . ALA D 2 233 ? 17.243  -1.486  -49.309 1.00 73.05  ? 263 ALA D C   1 
ATOM   9963  O  O   . ALA D 2 233 ? 16.915  -2.564  -49.816 1.00 73.53  ? 263 ALA D O   1 
ATOM   9964  C  CB  . ALA D 2 233 ? 16.521  0.785   -50.112 1.00 67.37  ? 263 ALA D CB  1 
ATOM   9965  N  N   . GLY D 2 234 ? 18.446  -1.233  -48.770 1.00 70.13  ? 264 GLY D N   1 
ATOM   9966  C  CA  . GLY D 2 234 ? 19.581  -2.150  -48.766 1.00 70.61  ? 264 GLY D CA  1 
ATOM   9967  C  C   . GLY D 2 234 ? 19.895  -2.676  -50.150 1.00 76.75  ? 264 GLY D C   1 
ATOM   9968  O  O   . GLY D 2 234 ? 19.997  -1.893  -51.108 1.00 76.75  ? 264 GLY D O   1 
ATOM   9969  N  N   . ASP D 2 235 ? 20.013  -4.018  -50.265 1.00 73.70  ? 265 ASP D N   1 
ATOM   9970  C  CA  . ASP D 2 235 ? 20.229  -4.700  -51.536 1.00 74.82  ? 265 ASP D CA  1 
ATOM   9971  C  C   . ASP D 2 235 ? 18.959  -4.456  -52.344 1.00 80.77  ? 265 ASP D C   1 
ATOM   9972  O  O   . ASP D 2 235 ? 17.896  -4.976  -51.977 1.00 82.85  ? 265 ASP D O   1 
ATOM   9973  C  CB  . ASP D 2 235 ? 20.464  -6.206  -51.307 1.00 76.94  ? 265 ASP D CB  1 
ATOM   9974  C  CG  . ASP D 2 235 ? 20.659  -7.032  -52.567 1.00 89.60  ? 265 ASP D CG  1 
ATOM   9975  O  OD1 . ASP D 2 235 ? 21.132  -6.471  -53.590 1.00 89.88  ? 265 ASP D OD1 1 
ATOM   9976  O  OD2 . ASP D 2 235 ? 20.382  -8.246  -52.522 1.00 99.82  ? 265 ASP D OD2 1 
ATOM   9977  N  N   . THR D 2 236 ? 19.038  -3.575  -53.372 1.00 75.52  ? 266 THR D N   1 
ATOM   9978  C  CA  . THR D 2 236 ? 17.871  -3.196  -54.199 1.00 74.94  ? 266 THR D CA  1 
ATOM   9979  C  C   . THR D 2 236 ? 17.310  -4.374  -54.993 1.00 78.60  ? 266 THR D C   1 
ATOM   9980  O  O   . THR D 2 236 ? 16.186  -4.291  -55.497 1.00 78.17  ? 266 THR D O   1 
ATOM   9981  C  CB  . THR D 2 236 ? 18.147  -1.978  -55.079 1.00 80.38  ? 266 THR D CB  1 
ATOM   9982  O  OG1 . THR D 2 236 ? 19.468  -2.054  -55.626 1.00 86.28  ? 266 THR D OG1 1 
ATOM   9983  C  CG2 . THR D 2 236 ? 17.971  -0.690  -54.323 1.00 73.85  ? 266 THR D CG2 1 
ATOM   9984  N  N   . ASP D 2 237 ? 18.075  -5.485  -55.047 1.00 75.63  ? 267 ASP D N   1 
ATOM   9985  C  CA  . ASP D 2 237 ? 17.717  -6.733  -55.721 1.00 76.25  ? 267 ASP D CA  1 
ATOM   9986  C  C   . ASP D 2 237 ? 16.922  -7.657  -54.809 1.00 78.42  ? 267 ASP D C   1 
ATOM   9987  O  O   . ASP D 2 237 ? 16.387  -8.661  -55.277 1.00 79.52  ? 267 ASP D O   1 
ATOM   9988  C  CB  . ASP D 2 237 ? 18.955  -7.425  -56.320 1.00 79.07  ? 267 ASP D CB  1 
ATOM   9989  C  CG  . ASP D 2 237 ? 19.626  -6.618  -57.422 1.00 92.98  ? 267 ASP D CG  1 
ATOM   9990  O  OD1 . ASP D 2 237 ? 18.910  -6.175  -58.363 1.00 93.30  ? 267 ASP D OD1 1 
ATOM   9991  O  OD2 . ASP D 2 237 ? 20.869  -6.434  -57.353 1.00 102.82 ? 267 ASP D OD2 1 
ATOM   9992  N  N   . THR D 2 238 ? 16.822  -7.313  -53.511 1.00 72.27  ? 268 THR D N   1 
ATOM   9993  C  CA  . THR D 2 238 ? 16.004  -8.055  -52.557 1.00 71.32  ? 268 THR D CA  1 
ATOM   9994  C  C   . THR D 2 238 ? 14.886  -7.133  -52.143 1.00 74.40  ? 268 THR D C   1 
ATOM   9995  O  O   . THR D 2 238 ? 15.106  -6.204  -51.363 1.00 72.78  ? 268 THR D O   1 
ATOM   9996  C  CB  . THR D 2 238 ? 16.819  -8.637  -51.411 1.00 76.49  ? 268 THR D CB  1 
ATOM   9997  O  OG1 . THR D 2 238 ? 17.810  -9.521  -51.950 1.00 77.70  ? 268 THR D OG1 1 
ATOM   9998  C  CG2 . THR D 2 238 ? 15.949  -9.400  -50.427 1.00 73.33  ? 268 THR D CG2 1 
ATOM   9999  N  N   . VAL D 2 239 ? 13.707  -7.322  -52.762 1.00 71.68  ? 269 VAL D N   1 
ATOM   10000 C  CA  . VAL D 2 239 ? 12.555  -6.474  -52.483 1.00 70.20  ? 269 VAL D CA  1 
ATOM   10001 C  C   . VAL D 2 239 ? 11.491  -7.248  -51.715 1.00 74.50  ? 269 VAL D C   1 
ATOM   10002 O  O   . VAL D 2 239 ? 10.751  -8.024  -52.337 1.00 76.59  ? 269 VAL D O   1 
ATOM   10003 C  CB  . VAL D 2 239 ? 11.993  -5.777  -53.745 1.00 73.56  ? 269 VAL D CB  1 
ATOM   10004 C  CG1 . VAL D 2 239 ? 10.758  -4.932  -53.406 1.00 72.51  ? 269 VAL D CG1 1 
ATOM   10005 C  CG2 . VAL D 2 239 ? 13.067  -4.936  -54.427 1.00 73.07  ? 269 VAL D CG2 1 
ATOM   10006 N  N   . PRO D 2 240 ? 11.387  -7.070  -50.372 1.00 68.07  ? 270 PRO D N   1 
ATOM   10007 C  CA  . PRO D 2 240 ? 10.343  -7.795  -49.619 1.00 68.29  ? 270 PRO D CA  1 
ATOM   10008 C  C   . PRO D 2 240 ? 8.938   -7.518  -50.177 1.00 73.65  ? 270 PRO D C   1 
ATOM   10009 O  O   . PRO D 2 240 ? 8.622   -6.390  -50.555 1.00 72.55  ? 270 PRO D O   1 
ATOM   10010 C  CB  . PRO D 2 240 ? 10.512  -7.273  -48.195 1.00 68.03  ? 270 PRO D CB  1 
ATOM   10011 C  CG  . PRO D 2 240 ? 11.942  -6.842  -48.148 1.00 71.30  ? 270 PRO D CG  1 
ATOM   10012 C  CD  . PRO D 2 240 ? 12.188  -6.220  -49.477 1.00 67.11  ? 270 PRO D CD  1 
ATOM   10013 N  N   . ALA D 2 241 ? 8.125   -8.560  -50.280 1.00 71.10  ? 271 ALA D N   1 
ATOM   10014 C  CA  . ALA D 2 241 ? 6.769   -8.443  -50.787 1.00 72.42  ? 271 ALA D CA  1 
ATOM   10015 C  C   . ALA D 2 241 ? 5.934   -7.418  -49.990 1.00 78.48  ? 271 ALA D C   1 
ATOM   10016 O  O   . ALA D 2 241 ? 5.055   -6.748  -50.557 1.00 80.23  ? 271 ALA D O   1 
ATOM   10017 C  CB  . ALA D 2 241 ? 6.102   -9.793  -50.713 1.00 74.31  ? 271 ALA D CB  1 
ATOM   10018 N  N   . GLU D 2 242 ? 6.218   -7.297  -48.674 1.00 72.04  ? 272 GLU D N   1 
ATOM   10019 C  CA  . GLU D 2 242 ? 5.487   -6.422  -47.766 1.00 69.43  ? 272 GLU D CA  1 
ATOM   10020 C  C   . GLU D 2 242 ? 5.841   -4.932  -47.962 1.00 70.77  ? 272 GLU D C   1 
ATOM   10021 O  O   . GLU D 2 242 ? 5.098   -4.075  -47.477 1.00 71.27  ? 272 GLU D O   1 
ATOM   10022 C  CB  . GLU D 2 242 ? 5.620   -6.885  -46.311 1.00 69.87  ? 272 GLU D CB  1 
ATOM   10023 C  CG  . GLU D 2 242 ? 6.884   -7.680  -46.029 1.00 85.41  ? 272 GLU D CG  1 
ATOM   10024 C  CD  . GLU D 2 242 ? 6.844   -9.181  -46.244 1.00 106.16 ? 272 GLU D CD  1 
ATOM   10025 O  OE1 . GLU D 2 242 ? 5.912   -9.828  -45.715 1.00 98.42  ? 272 GLU D OE1 1 
ATOM   10026 O  OE2 . GLU D 2 242 ? 7.790   -9.719  -46.866 1.00 99.10  ? 272 GLU D OE2 1 
ATOM   10027 N  N   . PHE D 2 243 ? 6.898   -4.616  -48.748 1.00 64.19  ? 273 PHE D N   1 
ATOM   10028 C  CA  . PHE D 2 243 ? 7.250   -3.222  -49.040 1.00 62.35  ? 273 PHE D CA  1 
ATOM   10029 C  C   . PHE D 2 243 ? 6.141   -2.584  -49.898 1.00 69.22  ? 273 PHE D C   1 
ATOM   10030 O  O   . PHE D 2 243 ? 5.646   -3.237  -50.827 1.00 70.30  ? 273 PHE D O   1 
ATOM   10031 C  CB  . PHE D 2 243 ? 8.617   -3.130  -49.733 1.00 62.67  ? 273 PHE D CB  1 
ATOM   10032 C  CG  . PHE D 2 243 ? 9.827   -3.163  -48.822 1.00 62.07  ? 273 PHE D CG  1 
ATOM   10033 C  CD1 . PHE D 2 243 ? 9.765   -3.767  -47.569 1.00 63.92  ? 273 PHE D CD1 1 
ATOM   10034 C  CD2 . PHE D 2 243 ? 11.026  -2.590  -49.214 1.00 62.15  ? 273 PHE D CD2 1 
ATOM   10035 C  CE1 . PHE D 2 243 ? 10.869  -3.766  -46.719 1.00 62.98  ? 273 PHE D CE1 1 
ATOM   10036 C  CE2 . PHE D 2 243 ? 12.131  -2.600  -48.365 1.00 63.03  ? 273 PHE D CE2 1 
ATOM   10037 C  CZ  . PHE D 2 243 ? 12.050  -3.202  -47.129 1.00 60.46  ? 273 PHE D CZ  1 
ATOM   10038 N  N   . PRO D 2 244 ? 5.666   -1.362  -49.573 1.00 65.59  ? 274 PRO D N   1 
ATOM   10039 C  CA  . PRO D 2 244 ? 4.600   -0.771  -50.393 1.00 66.35  ? 274 PRO D CA  1 
ATOM   10040 C  C   . PRO D 2 244 ? 5.100   -0.183  -51.703 1.00 74.14  ? 274 PRO D C   1 
ATOM   10041 O  O   . PRO D 2 244 ? 6.149   0.467   -51.731 1.00 73.11  ? 274 PRO D O   1 
ATOM   10042 C  CB  . PRO D 2 244 ? 4.022   0.324   -49.494 1.00 67.10  ? 274 PRO D CB  1 
ATOM   10043 C  CG  . PRO D 2 244 ? 5.103   0.681   -48.558 1.00 70.40  ? 274 PRO D CG  1 
ATOM   10044 C  CD  . PRO D 2 244 ? 6.108   -0.440  -48.506 1.00 65.69  ? 274 PRO D CD  1 
ATOM   10045 N  N   . THR D 2 245 ? 4.343   -0.396  -52.791 1.00 74.83  ? 275 THR D N   1 
ATOM   10046 C  CA  . THR D 2 245 ? 4.644   0.220   -54.090 1.00 76.75  ? 275 THR D CA  1 
ATOM   10047 C  C   . THR D 2 245 ? 4.478   1.750   -53.884 1.00 81.08  ? 275 THR D C   1 
ATOM   10048 O  O   . THR D 2 245 ? 3.498   2.190   -53.276 1.00 82.23  ? 275 THR D O   1 
ATOM   10049 C  CB  . THR D 2 245 ? 3.729   -0.378  -55.183 1.00 90.81  ? 275 THR D CB  1 
ATOM   10050 O  OG1 . THR D 2 245 ? 4.186   -1.705  -55.469 1.00 94.97  ? 275 THR D OG1 1 
ATOM   10051 C  CG2 . THR D 2 245 ? 3.706   0.454   -56.473 1.00 88.17  ? 275 THR D CG2 1 
ATOM   10052 N  N   . GLY D 2 246 ? 5.473   2.515   -54.303 1.00 75.55  ? 276 GLY D N   1 
ATOM   10053 C  CA  . GLY D 2 246 ? 5.486   3.957   -54.115 1.00 74.55  ? 276 GLY D CA  1 
ATOM   10054 C  C   . GLY D 2 246 ? 6.356   4.362   -52.954 1.00 76.90  ? 276 GLY D C   1 
ATOM   10055 O  O   . GLY D 2 246 ? 6.304   5.517   -52.532 1.00 76.55  ? 276 GLY D O   1 
ATOM   10056 N  N   . LEU D 2 247 ? 7.170   3.402   -52.432 1.00 71.51  ? 277 LEU D N   1 
ATOM   10057 C  CA  . LEU D 2 247 ? 8.094   3.621   -51.320 1.00 68.22  ? 277 LEU D CA  1 
ATOM   10058 C  C   . LEU D 2 247 ? 9.282   4.407   -51.839 1.00 71.13  ? 277 LEU D C   1 
ATOM   10059 O  O   . LEU D 2 247 ? 9.855   4.030   -52.866 1.00 71.29  ? 277 LEU D O   1 
ATOM   10060 C  CB  . LEU D 2 247 ? 8.536   2.277   -50.693 1.00 66.66  ? 277 LEU D CB  1 
ATOM   10061 C  CG  . LEU D 2 247 ? 9.570   2.310   -49.559 1.00 68.26  ? 277 LEU D CG  1 
ATOM   10062 C  CD1 . LEU D 2 247 ? 9.035   2.998   -48.359 1.00 67.73  ? 277 LEU D CD1 1 
ATOM   10063 C  CD2 . LEU D 2 247 ? 9.963   0.931   -49.147 1.00 67.83  ? 277 LEU D CD2 1 
ATOM   10064 N  N   . ILE D 2 248 ? 9.612   5.528   -51.168 1.00 66.46  ? 278 ILE D N   1 
ATOM   10065 C  CA  . ILE D 2 248 ? 10.750  6.378   -51.534 1.00 66.45  ? 278 ILE D CA  1 
ATOM   10066 C  C   . ILE D 2 248 ? 11.905  6.081   -50.600 1.00 72.26  ? 278 ILE D C   1 
ATOM   10067 O  O   . ILE D 2 248 ? 11.710  5.959   -49.387 1.00 70.90  ? 278 ILE D O   1 
ATOM   10068 C  CB  . ILE D 2 248 ? 10.401  7.895   -51.561 1.00 69.64  ? 278 ILE D CB  1 
ATOM   10069 C  CG1 . ILE D 2 248 ? 9.167   8.192   -52.450 1.00 71.24  ? 278 ILE D CG1 1 
ATOM   10070 C  CG2 . ILE D 2 248 ? 11.618  8.753   -51.976 1.00 69.43  ? 278 ILE D CG2 1 
ATOM   10071 C  CD1 . ILE D 2 248 ? 8.554   9.582   -52.278 1.00 78.59  ? 278 ILE D CD1 1 
ATOM   10072 N  N   . SER D 2 249 ? 13.105  5.962   -51.155 1.00 72.30  ? 279 SER D N   1 
ATOM   10073 C  CA  . SER D 2 249 ? 14.304  5.706   -50.355 1.00 72.71  ? 279 SER D CA  1 
ATOM   10074 C  C   . SER D 2 249 ? 15.493  6.465   -50.916 1.00 78.09  ? 279 SER D C   1 
ATOM   10075 O  O   . SER D 2 249 ? 15.460  6.953   -52.049 1.00 77.71  ? 279 SER D O   1 
ATOM   10076 C  CB  . SER D 2 249 ? 14.605  4.206   -50.294 1.00 75.87  ? 279 SER D CB  1 
ATOM   10077 O  OG  . SER D 2 249 ? 15.619  3.913   -49.347 1.00 82.10  ? 279 SER D OG  1 
ATOM   10078 N  N   . VAL D 2 250 ? 16.529  6.570   -50.094 1.00 77.18  ? 280 VAL D N   1 
ATOM   10079 C  CA  . VAL D 2 250 ? 17.822  7.144   -50.456 1.00 79.30  ? 280 VAL D CA  1 
ATOM   10080 C  C   . VAL D 2 250 ? 18.745  5.921   -50.606 1.00 88.86  ? 280 VAL D C   1 
ATOM   10081 O  O   . VAL D 2 250 ? 18.587  4.962   -49.843 1.00 87.82  ? 280 VAL D O   1 
ATOM   10082 C  CB  . VAL D 2 250 ? 18.395  8.144   -49.408 1.00 81.70  ? 280 VAL D CB  1 
ATOM   10083 C  CG1 . VAL D 2 250 ? 19.133  9.263   -50.111 1.00 82.27  ? 280 VAL D CG1 1 
ATOM   10084 C  CG2 . VAL D 2 250 ? 17.319  8.711   -48.486 1.00 80.80  ? 280 VAL D CG2 1 
ATOM   10085 N  N   . SER D 2 251 ? 19.654  5.915   -51.597 1.00 90.09  ? 281 SER D N   1 
ATOM   10086 C  CA  . SER D 2 251 ? 20.582  4.788   -51.794 1.00 92.05  ? 281 SER D CA  1 
ATOM   10087 C  C   . SER D 2 251 ? 21.952  5.292   -52.193 1.00 103.58 ? 281 SER D C   1 
ATOM   10088 O  O   . SER D 2 251 ? 22.038  6.284   -52.923 1.00 103.86 ? 281 SER D O   1 
ATOM   10089 C  CB  . SER D 2 251 ? 20.062  3.812   -52.846 1.00 95.02  ? 281 SER D CB  1 
ATOM   10090 N  N   . TYR D 2 252 ? 23.029  4.641   -51.695 1.00 105.47 ? 282 TYR D N   1 
ATOM   10091 C  CA  . TYR D 2 252 ? 24.391  5.033   -52.064 1.00 108.60 ? 282 TYR D CA  1 
ATOM   10092 C  C   . TYR D 2 252 ? 24.678  4.384   -53.410 1.00 118.47 ? 282 TYR D C   1 
ATOM   10093 O  O   . TYR D 2 252 ? 24.838  3.158   -53.465 1.00 118.55 ? 282 TYR D O   1 
ATOM   10094 C  CB  . TYR D 2 252 ? 25.430  4.642   -50.997 1.00 109.52 ? 282 TYR D CB  1 
ATOM   10095 C  CG  . TYR D 2 252 ? 26.738  5.385   -51.172 1.00 113.13 ? 282 TYR D CG  1 
ATOM   10096 C  CD1 . TYR D 2 252 ? 26.797  6.773   -51.066 1.00 115.52 ? 282 TYR D CD1 1 
ATOM   10097 C  CD2 . TYR D 2 252 ? 27.921  4.703   -51.437 1.00 114.66 ? 282 TYR D CD2 1 
ATOM   10098 C  CE1 . TYR D 2 252 ? 27.993  7.463   -51.248 1.00 116.86 ? 282 TYR D CE1 1 
ATOM   10099 C  CE2 . TYR D 2 252 ? 29.124  5.383   -51.623 1.00 116.26 ? 282 TYR D CE2 1 
ATOM   10100 C  CZ  . TYR D 2 252 ? 29.154  6.765   -51.522 1.00 125.76 ? 282 TYR D CZ  1 
ATOM   10101 O  OH  . TYR D 2 252 ? 30.331  7.450   -51.689 1.00 131.46 ? 282 TYR D OH  1 
ATOM   10102 N  N   . ASP D 2 253 ? 24.681  5.218   -54.494 1.00 118.58 ? 283 ASP D N   1 
ATOM   10103 C  CA  . ASP D 2 253 ? 24.768  4.863   -55.920 1.00 120.80 ? 283 ASP D CA  1 
ATOM   10104 C  C   . ASP D 2 253 ? 25.711  3.686   -56.255 1.00 125.88 ? 283 ASP D C   1 
ATOM   10105 O  O   . ASP D 2 253 ? 26.874  3.845   -56.636 1.00 126.28 ? 283 ASP D O   1 
ATOM   10106 C  CB  . ASP D 2 253 ? 25.046  6.074   -56.835 1.00 124.30 ? 283 ASP D CB  1 
ATOM   10107 C  CG  . ASP D 2 253 ? 26.453  6.621   -56.878 1.00 137.24 ? 283 ASP D CG  1 
ATOM   10108 O  OD1 . ASP D 2 253 ? 27.110  6.658   -55.813 1.00 136.84 ? 283 ASP D OD1 1 
ATOM   10109 O  OD2 . ASP D 2 253 ? 26.891  7.032   -57.971 1.00 145.59 ? 283 ASP D OD2 1 
ATOM   10110 N  N   . GLU D 2 254 ? 25.122  2.484   -56.165 1.00 122.12 ? 284 GLU D N   1 
ATOM   10111 C  CA  . GLU D 2 254 ? 25.694  1.185   -56.513 1.00 122.08 ? 284 GLU D CA  1 
ATOM   10112 C  C   . GLU D 2 254 ? 25.854  1.240   -58.037 1.00 127.93 ? 284 GLU D C   1 
ATOM   10113 O  O   . GLU D 2 254 ? 26.672  0.522   -58.613 1.00 128.19 ? 284 GLU D O   1 
ATOM   10114 C  CB  . GLU D 2 254 ? 24.704  0.058   -56.128 1.00 122.89 ? 284 GLU D CB  1 
ATOM   10115 C  CG  . GLU D 2 254 ? 24.387  -0.051  -54.636 1.00 132.39 ? 284 GLU D CG  1 
ATOM   10116 C  CD  . GLU D 2 254 ? 22.963  -0.436  -54.262 1.00 147.96 ? 284 GLU D CD  1 
ATOM   10117 O  OE1 . GLU D 2 254 ? 22.107  0.472   -54.140 1.00 148.31 ? 284 GLU D OE1 1 
ATOM   10118 O  OE2 . GLU D 2 254 ? 22.714  -1.644  -54.051 1.00 130.20 ? 284 GLU D OE2 1 
ATOM   10119 N  N   . TRP D 2 255 ? 25.075  2.157   -58.662 1.00 125.30 ? 285 TRP D N   1 
ATOM   10120 C  CA  . TRP D 2 255 ? 24.974  2.468   -60.085 1.00 126.67 ? 285 TRP D CA  1 
ATOM   10121 C  C   . TRP D 2 255 ? 26.296  3.010   -60.698 1.00 126.36 ? 285 TRP D C   1 
ATOM   10122 O  O   . TRP D 2 255 ? 26.844  2.366   -61.599 1.00 126.63 ? 285 TRP D O   1 
ATOM   10123 C  CB  . TRP D 2 255 ? 23.800  3.457   -60.331 1.00 126.54 ? 285 TRP D CB  1 
ATOM   10124 C  CG  . TRP D 2 255 ? 22.410  2.950   -60.004 1.00 127.59 ? 285 TRP D CG  1 
ATOM   10125 C  CD1 . TRP D 2 255 ? 21.449  2.561   -60.895 1.00 131.70 ? 285 TRP D CD1 1 
ATOM   10126 C  CD2 . TRP D 2 255 ? 21.794  2.883   -58.699 1.00 125.83 ? 285 TRP D CD2 1 
ATOM   10127 N  NE1 . TRP D 2 255 ? 20.280  2.234   -60.227 1.00 130.31 ? 285 TRP D NE1 1 
ATOM   10128 C  CE2 . TRP D 2 255 ? 20.472  2.405   -58.879 1.00 129.81 ? 285 TRP D CE2 1 
ATOM   10129 C  CE3 . TRP D 2 255 ? 22.236  3.167   -57.397 1.00 125.42 ? 285 TRP D CE3 1 
ATOM   10130 C  CZ2 . TRP D 2 255 ? 19.605  2.179   -57.803 1.00 127.46 ? 285 TRP D CZ2 1 
ATOM   10131 C  CZ3 . TRP D 2 255 ? 21.379  2.947   -56.334 1.00 125.53 ? 285 TRP D CZ3 1 
ATOM   10132 C  CH2 . TRP D 2 255 ? 20.085  2.448   -56.538 1.00 126.27 ? 285 TRP D CH2 1 
ATOM   10133 N  N   . ASP D 2 256 ? 26.798  4.180   -60.220 1.00 118.79 ? 286 ASP D N   1 
ATOM   10134 C  CA  . ASP D 2 256 ? 28.003  4.831   -60.772 1.00 118.08 ? 286 ASP D CA  1 
ATOM   10135 C  C   . ASP D 2 256 ? 29.294  4.638   -59.966 1.00 114.26 ? 286 ASP D C   1 
ATOM   10136 O  O   . ASP D 2 256 ? 30.389  4.746   -60.530 1.00 114.71 ? 286 ASP D O   1 
ATOM   10137 C  CB  . ASP D 2 256 ? 27.762  6.326   -61.007 1.00 121.37 ? 286 ASP D CB  1 
ATOM   10138 C  CG  . ASP D 2 256 ? 26.673  6.597   -62.016 1.00 139.59 ? 286 ASP D CG  1 
ATOM   10139 O  OD1 . ASP D 2 256 ? 26.978  6.596   -63.234 1.00 142.68 ? 286 ASP D OD1 1 
ATOM   10140 O  OD2 . ASP D 2 256 ? 25.507  6.794   -61.591 1.00 147.02 ? 286 ASP D OD2 1 
ATOM   10141 N  N   . TYR D 2 257 ? 29.173  4.380   -58.660 1.00 103.62 ? 287 TYR D N   1 
ATOM   10142 C  CA  . TYR D 2 257 ? 30.322  4.124   -57.793 1.00 99.71  ? 287 TYR D CA  1 
ATOM   10143 C  C   . TYR D 2 257 ? 30.371  2.614   -57.542 1.00 96.81  ? 287 TYR D C   1 
ATOM   10144 O  O   . TYR D 2 257 ? 29.860  2.110   -56.543 1.00 93.56  ? 287 TYR D O   1 
ATOM   10145 C  CB  . TYR D 2 257 ? 30.236  4.962   -56.506 1.00 99.16  ? 287 TYR D CB  1 
ATOM   10146 C  CG  . TYR D 2 257 ? 31.502  5.028   -55.681 1.00 100.43 ? 287 TYR D CG  1 
ATOM   10147 C  CD1 . TYR D 2 257 ? 32.753  4.842   -56.265 1.00 103.64 ? 287 TYR D CD1 1 
ATOM   10148 C  CD2 . TYR D 2 257 ? 31.455  5.337   -54.327 1.00 99.82  ? 287 TYR D CD2 1 
ATOM   10149 C  CE1 . TYR D 2 257 ? 33.920  4.918   -55.509 1.00 104.28 ? 287 TYR D CE1 1 
ATOM   10150 C  CE2 . TYR D 2 257 ? 32.615  5.418   -53.563 1.00 100.07 ? 287 TYR D CE2 1 
ATOM   10151 C  CZ  . TYR D 2 257 ? 33.845  5.215   -54.160 1.00 108.18 ? 287 TYR D CZ  1 
ATOM   10152 O  OH  . TYR D 2 257 ? 34.980  5.280   -53.404 1.00 109.67 ? 287 TYR D OH  1 
ATOM   10153 N  N   . GLY D 2 258 ? 30.984  1.921   -58.499 1.00 91.59  ? 288 GLY D N   1 
ATOM   10154 C  CA  . GLY D 2 258 ? 31.107  0.474   -58.522 1.00 90.24  ? 288 GLY D CA  1 
ATOM   10155 C  C   . GLY D 2 258 ? 32.003  -0.089  -57.452 1.00 91.24  ? 288 GLY D C   1 
ATOM   10156 O  O   . GLY D 2 258 ? 32.816  0.640   -56.869 1.00 91.31  ? 288 GLY D O   1 
ATOM   10157 N  N   . LEU D 2 259 ? 31.862  -1.404  -57.195 1.00 85.07  ? 289 LEU D N   1 
ATOM   10158 C  CA  . LEU D 2 259 ? 32.719  -2.084  -56.235 1.00 82.89  ? 289 LEU D CA  1 
ATOM   10159 C  C   . LEU D 2 259 ? 34.226  -1.909  -56.561 1.00 86.64  ? 289 LEU D C   1 
ATOM   10160 O  O   . LEU D 2 259 ? 34.949  -1.520  -55.635 1.00 84.35  ? 289 LEU D O   1 
ATOM   10161 C  CB  . LEU D 2 259 ? 32.344  -3.567  -56.109 1.00 82.54  ? 289 LEU D CB  1 
ATOM   10162 C  CG  . LEU D 2 259 ? 32.949  -4.333  -54.938 1.00 84.92  ? 289 LEU D CG  1 
ATOM   10163 C  CD1 . LEU D 2 259 ? 32.431  -3.812  -53.641 1.00 82.56  ? 289 LEU D CD1 1 
ATOM   10164 C  CD2 . LEU D 2 259 ? 32.623  -5.790  -55.030 1.00 87.39  ? 289 LEU D CD2 1 
ATOM   10165 N  N   . PRO D 2 260 ? 34.721  -2.100  -57.831 1.00 84.79  ? 290 PRO D N   1 
ATOM   10166 C  CA  . PRO D 2 260 ? 36.161  -1.911  -58.093 1.00 85.88  ? 290 PRO D CA  1 
ATOM   10167 C  C   . PRO D 2 260 ? 36.690  -0.510  -57.767 1.00 89.95  ? 290 PRO D C   1 
ATOM   10168 O  O   . PRO D 2 260 ? 37.797  -0.396  -57.217 1.00 88.36  ? 290 PRO D O   1 
ATOM   10169 C  CB  . PRO D 2 260 ? 36.305  -2.274  -59.575 1.00 89.31  ? 290 PRO D CB  1 
ATOM   10170 C  CG  . PRO D 2 260 ? 35.175  -3.189  -59.830 1.00 93.40  ? 290 PRO D CG  1 
ATOM   10171 C  CD  . PRO D 2 260 ? 34.050  -2.574  -59.057 1.00 87.18  ? 290 PRO D CD  1 
ATOM   10172 N  N   . ALA D 2 261 ? 35.880  0.542   -58.053 1.00 86.23  ? 291 ALA D N   1 
ATOM   10173 C  CA  . ALA D 2 261 ? 36.248  1.921   -57.742 1.00 85.67  ? 291 ALA D CA  1 
ATOM   10174 C  C   . ALA D 2 261 ? 36.372  2.079   -56.233 1.00 87.74  ? 291 ALA D C   1 
ATOM   10175 O  O   . ALA D 2 261 ? 37.372  2.635   -55.759 1.00 88.73  ? 291 ALA D O   1 
ATOM   10176 C  CB  . ALA D 2 261 ? 35.208  2.875   -58.282 1.00 86.59  ? 291 ALA D CB  1 
ATOM   10177 N  N   . ARG D 2 262 ? 35.391  1.526   -55.483 1.00 80.72  ? 292 ARG D N   1 
ATOM   10178 C  CA  . ARG D 2 262 ? 35.355  1.564   -54.017 1.00 78.02  ? 292 ARG D CA  1 
ATOM   10179 C  C   . ARG D 2 262 ? 36.551  0.865   -53.407 1.00 79.18  ? 292 ARG D C   1 
ATOM   10180 O  O   . ARG D 2 262 ? 37.160  1.425   -52.495 1.00 77.89  ? 292 ARG D O   1 
ATOM   10181 C  CB  . ARG D 2 262 ? 34.064  0.949   -53.474 1.00 77.70  ? 292 ARG D CB  1 
ATOM   10182 C  CG  . ARG D 2 262 ? 32.860  1.848   -53.597 1.00 82.47  ? 292 ARG D CG  1 
ATOM   10183 C  CD  . ARG D 2 262 ? 31.614  1.032   -53.459 1.00 89.91  ? 292 ARG D CD  1 
ATOM   10184 N  NE  . ARG D 2 262 ? 30.441  1.757   -53.922 1.00 99.88  ? 292 ARG D NE  1 
ATOM   10185 C  CZ  . ARG D 2 262 ? 29.382  2.026   -53.173 1.00 113.44 ? 292 ARG D CZ  1 
ATOM   10186 N  NH1 . ARG D 2 262 ? 29.349  1.644   -51.901 1.00 99.40  ? 292 ARG D NH1 1 
ATOM   10187 N  NH2 . ARG D 2 262 ? 28.345  2.671   -53.687 1.00 100.73 ? 292 ARG D NH2 1 
ATOM   10188 N  N   . VAL D 2 263 ? 36.906  -0.343  -53.915 1.00 74.34  ? 293 VAL D N   1 
ATOM   10189 C  CA  . VAL D 2 263 ? 38.068  -1.081  -53.404 1.00 72.84  ? 293 VAL D CA  1 
ATOM   10190 C  C   . VAL D 2 263 ? 39.343  -0.232  -53.615 1.00 79.06  ? 293 VAL D C   1 
ATOM   10191 O  O   . VAL D 2 263 ? 40.088  -0.019  -52.667 1.00 77.56  ? 293 VAL D O   1 
ATOM   10192 C  CB  . VAL D 2 263 ? 38.196  -2.525  -53.965 1.00 75.19  ? 293 VAL D CB  1 
ATOM   10193 C  CG1 . VAL D 2 263 ? 39.421  -3.217  -53.405 1.00 74.35  ? 293 VAL D CG1 1 
ATOM   10194 C  CG2 . VAL D 2 263 ? 36.962  -3.349  -53.655 1.00 73.93  ? 293 VAL D CG2 1 
ATOM   10195 N  N   . ARG D 2 264 ? 39.538  0.305   -54.840 1.00 78.77  ? 294 ARG D N   1 
ATOM   10196 C  CA  . ARG D 2 264 ? 40.669  1.158   -55.224 1.00 79.64  ? 294 ARG D CA  1 
ATOM   10197 C  C   . ARG D 2 264 ? 40.764  2.349   -54.253 1.00 83.90  ? 294 ARG D C   1 
ATOM   10198 O  O   . ARG D 2 264 ? 41.842  2.613   -53.698 1.00 82.75  ? 294 ARG D O   1 
ATOM   10199 C  CB  . ARG D 2 264 ? 40.485  1.628   -56.687 1.00 79.58  ? 294 ARG D CB  1 
ATOM   10200 C  CG  . ARG D 2 264 ? 41.488  2.639   -57.190 1.00 91.04  ? 294 ARG D CG  1 
ATOM   10201 C  CD  . ARG D 2 264 ? 40.950  3.385   -58.389 1.00 106.54 ? 294 ARG D CD  1 
ATOM   10202 N  NE  . ARG D 2 264 ? 41.765  4.560   -58.697 1.00 126.43 ? 294 ARG D NE  1 
ATOM   10203 C  CZ  . ARG D 2 264 ? 41.881  5.107   -59.904 1.00 144.67 ? 294 ARG D CZ  1 
ATOM   10204 N  NH1 . ARG D 2 264 ? 41.252  4.575   -60.947 1.00 127.71 ? 294 ARG D NH1 1 
ATOM   10205 N  NH2 . ARG D 2 264 ? 42.642  6.180   -60.082 1.00 135.29 ? 294 ARG D NH2 1 
ATOM   10206 N  N   . ASP D 2 265 ? 39.618  3.025   -54.016 1.00 80.20  ? 295 ASP D N   1 
ATOM   10207 C  CA  . ASP D 2 265 ? 39.546  4.166   -53.111 1.00 79.33  ? 295 ASP D CA  1 
ATOM   10208 C  C   . ASP D 2 265 ? 39.838  3.766   -51.656 1.00 81.01  ? 295 ASP D C   1 
ATOM   10209 O  O   . ASP D 2 265 ? 40.563  4.478   -50.949 1.00 80.34  ? 295 ASP D O   1 
ATOM   10210 C  CB  . ASP D 2 265 ? 38.222  4.907   -53.277 1.00 80.97  ? 295 ASP D CB  1 
ATOM   10211 C  CG  . ASP D 2 265 ? 38.108  5.648   -54.600 1.00 99.20  ? 295 ASP D CG  1 
ATOM   10212 O  OD1 . ASP D 2 265 ? 39.075  5.599   -55.404 1.00 101.71 ? 295 ASP D OD1 1 
ATOM   10213 O  OD2 . ASP D 2 265 ? 37.065  6.296   -54.827 1.00 109.06 ? 295 ASP D OD2 1 
ATOM   10214 N  N   . GLY D 2 266 ? 39.356  2.591   -51.265 1.00 74.94  ? 296 GLY D N   1 
ATOM   10215 C  CA  . GLY D 2 266 ? 39.652  2.020   -49.962 1.00 73.03  ? 296 GLY D CA  1 
ATOM   10216 C  C   . GLY D 2 266 ? 41.152  1.795   -49.792 1.00 75.92  ? 296 GLY D C   1 
ATOM   10217 O  O   . GLY D 2 266 ? 41.718  2.206   -48.777 1.00 74.99  ? 296 GLY D O   1 
ATOM   10218 N  N   . ILE D 2 267 ? 41.822  1.200   -50.817 1.00 71.92  ? 297 ILE D N   1 
ATOM   10219 C  CA  . ILE D 2 267 ? 43.266  0.940   -50.796 1.00 71.89  ? 297 ILE D CA  1 
ATOM   10220 C  C   . ILE D 2 267 ? 44.041  2.251   -50.769 1.00 76.51  ? 297 ILE D C   1 
ATOM   10221 O  O   . ILE D 2 267 ? 45.047  2.349   -50.060 1.00 75.38  ? 297 ILE D O   1 
ATOM   10222 C  CB  . ILE D 2 267 ? 43.734  0.010   -51.939 1.00 76.09  ? 297 ILE D CB  1 
ATOM   10223 C  CG1 . ILE D 2 267 ? 42.965  -1.333  -51.917 1.00 75.34  ? 297 ILE D CG1 1 
ATOM   10224 C  CG2 . ILE D 2 267 ? 45.267  -0.212  -51.874 1.00 77.00  ? 297 ILE D CG2 1 
ATOM   10225 C  CD1 . ILE D 2 267 ? 42.963  -2.084  -53.202 1.00 78.40  ? 297 ILE D CD1 1 
ATOM   10226 N  N   . ALA D 2 268 ? 43.542  3.266   -51.512 1.00 73.90  ? 298 ALA D N   1 
ATOM   10227 C  CA  . ALA D 2 268 ? 44.133  4.605   -51.581 1.00 74.10  ? 298 ALA D CA  1 
ATOM   10228 C  C   . ALA D 2 268 ? 44.115  5.293   -50.216 1.00 76.58  ? 298 ALA D C   1 
ATOM   10229 O  O   . ALA D 2 268 ? 45.118  5.902   -49.833 1.00 76.40  ? 298 ALA D O   1 
ATOM   10230 C  CB  . ALA D 2 268 ? 43.375  5.449   -52.580 1.00 75.70  ? 298 ALA D CB  1 
ATOM   10231 N  N   . ILE D 2 269 ? 42.973  5.177   -49.482 1.00 71.42  ? 299 ILE D N   1 
ATOM   10232 C  CA  . ILE D 2 269 ? 42.767  5.788   -48.168 1.00 69.81  ? 299 ILE D CA  1 
ATOM   10233 C  C   . ILE D 2 269 ? 43.783  5.279   -47.127 1.00 74.82  ? 299 ILE D C   1 
ATOM   10234 O  O   . ILE D 2 269 ? 44.454  6.099   -46.488 1.00 75.72  ? 299 ILE D O   1 
ATOM   10235 C  CB  . ILE D 2 269 ? 41.303  5.655   -47.722 1.00 71.32  ? 299 ILE D CB  1 
ATOM   10236 C  CG1 . ILE D 2 269 ? 40.426  6.656   -48.515 1.00 72.31  ? 299 ILE D CG1 1 
ATOM   10237 C  CG2 . ILE D 2 269 ? 41.145  5.881   -46.213 1.00 70.69  ? 299 ILE D CG2 1 
ATOM   10238 C  CD1 . ILE D 2 269 ? 38.922  6.303   -48.609 1.00 73.66  ? 299 ILE D CD1 1 
ATOM   10239 N  N   . ILE D 2 270 ? 43.941  3.946   -47.003 1.00 70.31  ? 300 ILE D N   1 
ATOM   10240 C  CA  . ILE D 2 270 ? 44.883  3.320   -46.066 1.00 68.69  ? 300 ILE D CA  1 
ATOM   10241 C  C   . ILE D 2 270 ? 46.332  3.668   -46.425 1.00 74.51  ? 300 ILE D C   1 
ATOM   10242 O  O   . ILE D 2 270 ? 47.080  4.088   -45.537 1.00 73.19  ? 300 ILE D O   1 
ATOM   10243 C  CB  . ILE D 2 270 ? 44.620  1.798   -45.933 1.00 70.47  ? 300 ILE D CB  1 
ATOM   10244 C  CG1 . ILE D 2 270 ? 43.182  1.559   -45.387 1.00 69.88  ? 300 ILE D CG1 1 
ATOM   10245 C  CG2 . ILE D 2 270 ? 45.678  1.126   -45.045 1.00 70.39  ? 300 ILE D CG2 1 
ATOM   10246 C  CD1 . ILE D 2 270 ? 42.633  0.143   -45.539 1.00 82.53  ? 300 ILE D CD1 1 
ATOM   10247 N  N   . THR D 2 271 ? 46.700  3.565   -47.731 1.00 73.02  ? 301 THR D N   1 
ATOM   10248 C  CA  . THR D 2 271 ? 48.045  3.847   -48.237 1.00 73.64  ? 301 THR D CA  1 
ATOM   10249 C  C   . THR D 2 271 ? 48.434  5.309   -48.009 1.00 78.84  ? 301 THR D C   1 
ATOM   10250 O  O   . THR D 2 271 ? 49.516  5.570   -47.445 1.00 78.32  ? 301 THR D O   1 
ATOM   10251 C  CB  . THR D 2 271 ? 48.187  3.383   -49.682 1.00 79.63  ? 301 THR D CB  1 
ATOM   10252 O  OG1 . THR D 2 271 ? 47.827  2.008   -49.729 1.00 77.65  ? 301 THR D OG1 1 
ATOM   10253 C  CG2 . THR D 2 271 ? 49.609  3.510   -50.211 1.00 83.04  ? 301 THR D CG2 1 
ATOM   10254 N  N   . THR D 2 272 ? 47.556  6.256   -48.423 1.00 75.70  ? 302 THR D N   1 
ATOM   10255 C  CA  . THR D 2 272 ? 47.868  7.672   -48.220 1.00 76.22  ? 302 THR D CA  1 
ATOM   10256 C  C   . THR D 2 272 ? 48.003  7.946   -46.751 1.00 79.40  ? 302 THR D C   1 
ATOM   10257 O  O   . THR D 2 272 ? 49.072  8.396   -46.360 1.00 79.90  ? 302 THR D O   1 
ATOM   10258 C  CB  . THR D 2 272 ? 46.930  8.622   -48.952 1.00 81.05  ? 302 THR D CB  1 
ATOM   10259 O  OG1 . THR D 2 272 ? 46.851  8.231   -50.326 1.00 82.26  ? 302 THR D OG1 1 
ATOM   10260 C  CG2 . THR D 2 272 ? 47.394  10.069  -48.857 1.00 76.82  ? 302 THR D CG2 1 
ATOM   10261 N  N   . ALA D 2 273 ? 46.994  7.573   -45.928 1.00 74.28  ? 303 ALA D N   1 
ATOM   10262 C  CA  . ALA D 2 273 ? 47.059  7.741   -44.470 1.00 73.37  ? 303 ALA D CA  1 
ATOM   10263 C  C   . ALA D 2 273 ? 48.414  7.301   -43.879 1.00 77.05  ? 303 ALA D C   1 
ATOM   10264 O  O   . ALA D 2 273 ? 49.073  8.113   -43.228 1.00 76.44  ? 303 ALA D O   1 
ATOM   10265 C  CB  . ALA D 2 273 ? 45.923  6.993   -43.801 1.00 72.62  ? 303 ALA D CB  1 
ATOM   10266 N  N   . ALA D 2 274 ? 48.858  6.050   -44.186 1.00 74.41  ? 304 ALA D N   1 
ATOM   10267 C  CA  . ALA D 2 274 ? 50.143  5.456   -43.762 1.00 74.19  ? 304 ALA D CA  1 
ATOM   10268 C  C   . ALA D 2 274 ? 51.342  6.277   -44.269 1.00 79.08  ? 304 ALA D C   1 
ATOM   10269 O  O   . ALA D 2 274 ? 52.212  6.615   -43.467 1.00 77.62  ? 304 ALA D O   1 
ATOM   10270 C  CB  . ALA D 2 274 ? 50.250  4.013   -44.239 1.00 74.52  ? 304 ALA D CB  1 
ATOM   10271 N  N   . SER D 2 275 ? 51.367  6.634   -45.582 1.00 77.57  ? 305 SER D N   1 
ATOM   10272 C  CA  . SER D 2 275 ? 52.435  7.467   -46.167 1.00 79.19  ? 305 SER D CA  1 
ATOM   10273 C  C   . SER D 2 275 ? 52.556  8.809   -45.417 1.00 83.34  ? 305 SER D C   1 
ATOM   10274 O  O   . SER D 2 275 ? 53.662  9.199   -45.059 1.00 84.25  ? 305 SER D O   1 
ATOM   10275 C  CB  . SER D 2 275 ? 52.190  7.704   -47.660 1.00 83.12  ? 305 SER D CB  1 
ATOM   10276 O  OG  . SER D 2 275 ? 52.706  8.943   -48.129 1.00 89.17  ? 305 SER D OG  1 
ATOM   10277 N  N   . ASP D 2 276 ? 51.412  9.490   -45.191 1.00 78.14  ? 306 ASP D N   1 
ATOM   10278 C  CA  . ASP D 2 276 ? 51.278  10.769  -44.512 1.00 77.20  ? 306 ASP D CA  1 
ATOM   10279 C  C   . ASP D 2 276 ? 51.788  10.675  -43.106 1.00 78.44  ? 306 ASP D C   1 
ATOM   10280 O  O   . ASP D 2 276 ? 52.483  11.593  -42.667 1.00 79.18  ? 306 ASP D O   1 
ATOM   10281 C  CB  . ASP D 2 276 ? 49.805  11.215  -44.476 1.00 78.51  ? 306 ASP D CB  1 
ATOM   10282 C  CG  . ASP D 2 276 ? 49.156  11.607  -45.795 1.00 87.21  ? 306 ASP D CG  1 
ATOM   10283 O  OD1 . ASP D 2 276 ? 49.896  11.906  -46.761 1.00 88.45  ? 306 ASP D OD1 1 
ATOM   10284 O  OD2 . ASP D 2 276 ? 47.907  11.672  -45.840 1.00 92.07  ? 306 ASP D OD2 1 
ATOM   10285 N  N   . MET D 2 277 ? 51.444  9.584   -42.385 1.00 72.86  ? 307 MET D N   1 
ATOM   10286 C  CA  . MET D 2 277 ? 51.888  9.408   -40.995 1.00 72.12  ? 307 MET D CA  1 
ATOM   10287 C  C   . MET D 2 277 ? 53.399  9.241   -40.923 1.00 76.75  ? 307 MET D C   1 
ATOM   10288 O  O   . MET D 2 277 ? 54.036  9.933   -40.141 1.00 77.52  ? 307 MET D O   1 
ATOM   10289 C  CB  . MET D 2 277 ? 51.158  8.251   -40.283 1.00 72.70  ? 307 MET D CB  1 
ATOM   10290 C  CG  . MET D 2 277 ? 51.376  8.259   -38.765 1.00 75.64  ? 307 MET D CG  1 
ATOM   10291 S  SD  . MET D 2 277 ? 50.549  6.919   -37.878 1.00 77.59  ? 307 MET D SD  1 
ATOM   10292 C  CE  . MET D 2 277 ? 51.747  6.555   -36.716 1.00 74.49  ? 307 MET D CE  1 
ATOM   10293 N  N   . LEU D 2 278 ? 53.957  8.362   -41.780 1.00 73.22  ? 308 LEU D N   1 
ATOM   10294 C  CA  . LEU D 2 278 ? 55.375  8.028   -41.951 1.00 73.89  ? 308 LEU D CA  1 
ATOM   10295 C  C   . LEU D 2 278 ? 56.192  9.268   -42.330 1.00 81.73  ? 308 LEU D C   1 
ATOM   10296 O  O   . LEU D 2 278 ? 57.194  9.566   -41.671 1.00 82.48  ? 308 LEU D O   1 
ATOM   10297 C  CB  . LEU D 2 278 ? 55.497  6.948   -43.051 1.00 73.52  ? 308 LEU D CB  1 
ATOM   10298 C  CG  . LEU D 2 278 ? 56.773  6.107   -43.207 1.00 78.07  ? 308 LEU D CG  1 
ATOM   10299 C  CD1 . LEU D 2 278 ? 57.310  5.589   -41.887 1.00 76.86  ? 308 LEU D CD1 1 
ATOM   10300 C  CD2 . LEU D 2 278 ? 56.516  4.942   -44.117 1.00 81.33  ? 308 LEU D CD2 1 
ATOM   10301 N  N   . SER D 2 279 ? 55.724  10.031  -43.346 1.00 79.37  ? 309 SER D N   1 
ATOM   10302 C  CA  . SER D 2 279 ? 56.405  11.237  -43.795 1.00 81.60  ? 309 SER D CA  1 
ATOM   10303 C  C   . SER D 2 279 ? 56.150  12.457  -42.863 1.00 87.31  ? 309 SER D C   1 
ATOM   10304 O  O   . SER D 2 279 ? 56.382  13.604  -43.265 1.00 90.19  ? 309 SER D O   1 
ATOM   10305 C  CB  . SER D 2 279 ? 56.097  11.532  -45.264 1.00 86.53  ? 309 SER D CB  1 
ATOM   10306 O  OG  . SER D 2 279 ? 54.843  12.152  -45.480 1.00 98.16  ? 309 SER D OG  1 
ATOM   10307 N  N   . GLU D 2 280 ? 55.739  12.200  -41.604 1.00 81.76  ? 310 GLU D N   1 
ATOM   10308 C  CA  . GLU D 2 280 ? 55.486  13.233  -40.602 1.00 81.32  ? 310 GLU D CA  1 
ATOM   10309 C  C   . GLU D 2 280 ? 55.995  12.851  -39.238 1.00 84.22  ? 310 GLU D C   1 
ATOM   10310 O  O   . GLU D 2 280 ? 56.518  13.705  -38.519 1.00 85.61  ? 310 GLU D O   1 
ATOM   10311 C  CB  . GLU D 2 280 ? 54.003  13.591  -40.517 1.00 81.85  ? 310 GLU D CB  1 
ATOM   10312 C  CG  . GLU D 2 280 ? 53.781  15.094  -40.448 1.00 98.15  ? 310 GLU D CG  1 
ATOM   10313 C  CD  . GLU D 2 280 ? 53.170  15.589  -39.151 1.00 124.36 ? 310 GLU D CD  1 
ATOM   10314 O  OE1 . GLU D 2 280 ? 51.930  15.483  -39.008 1.00 125.13 ? 310 GLU D OE1 1 
ATOM   10315 O  OE2 . GLU D 2 280 ? 53.922  16.099  -38.288 1.00 113.61 ? 310 GLU D OE2 1 
ATOM   10316 N  N   . HIS D 2 281 ? 55.853  11.573  -38.877 1.00 78.50  ? 311 HIS D N   1 
ATOM   10317 C  CA  . HIS D 2 281 ? 56.258  11.072  -37.571 1.00 77.48  ? 311 HIS D CA  1 
ATOM   10318 C  C   . HIS D 2 281 ? 57.425  10.102  -37.599 1.00 79.77  ? 311 HIS D C   1 
ATOM   10319 O  O   . HIS D 2 281 ? 57.873  9.650   -36.533 1.00 77.47  ? 311 HIS D O   1 
ATOM   10320 C  CB  . HIS D 2 281 ? 55.057  10.465  -36.855 1.00 76.87  ? 311 HIS D CB  1 
ATOM   10321 C  CG  . HIS D 2 281 ? 54.079  11.502  -36.413 1.00 80.46  ? 311 HIS D CG  1 
ATOM   10322 N  ND1 . HIS D 2 281 ? 52.823  11.604  -36.992 1.00 81.62  ? 311 HIS D ND1 1 
ATOM   10323 C  CD2 . HIS D 2 281 ? 54.223  12.487  -35.498 1.00 83.08  ? 311 HIS D CD2 1 
ATOM   10324 C  CE1 . HIS D 2 281 ? 52.240  12.628  -36.396 1.00 81.37  ? 311 HIS D CE1 1 
ATOM   10325 N  NE2 . HIS D 2 281 ? 53.047  13.198  -35.503 1.00 82.85  ? 311 HIS D NE2 1 
ATOM   10326 N  N   . SER D 2 282 ? 57.935  9.807   -38.815 1.00 77.06  ? 312 SER D N   1 
ATOM   10327 C  CA  . SER D 2 282 ? 59.057  8.900   -39.078 1.00 77.06  ? 312 SER D CA  1 
ATOM   10328 C  C   . SER D 2 282 ? 58.753  7.458   -38.589 1.00 78.47  ? 312 SER D C   1 
ATOM   10329 O  O   . SER D 2 282 ? 59.663  6.704   -38.221 1.00 78.96  ? 312 SER D O   1 
ATOM   10330 C  CB  . SER D 2 282 ? 60.364  9.468   -38.512 1.00 81.67  ? 312 SER D CB  1 
ATOM   10331 O  OG  . SER D 2 282 ? 60.599  10.787  -38.980 1.00 90.99  ? 312 SER D OG  1 
ATOM   10332 N  N   . PHE D 2 283 ? 57.454  7.101   -38.582 1.00 71.79  ? 313 PHE D N   1 
ATOM   10333 C  CA  . PHE D 2 283 ? 56.943  5.801   -38.167 1.00 69.98  ? 313 PHE D CA  1 
ATOM   10334 C  C   . PHE D 2 283 ? 55.473  5.627   -38.522 1.00 74.98  ? 313 PHE D C   1 
ATOM   10335 O  O   . PHE D 2 283 ? 54.767  6.612   -38.747 1.00 76.21  ? 313 PHE D O   1 
ATOM   10336 C  CB  . PHE D 2 283 ? 57.178  5.533   -36.661 1.00 70.72  ? 313 PHE D CB  1 
ATOM   10337 C  CG  . PHE D 2 283 ? 56.146  6.095   -35.713 1.00 71.51  ? 313 PHE D CG  1 
ATOM   10338 C  CD1 . PHE D 2 283 ? 56.257  7.389   -35.227 1.00 75.79  ? 313 PHE D CD1 1 
ATOM   10339 C  CD2 . PHE D 2 283 ? 55.073  5.322   -35.285 1.00 71.80  ? 313 PHE D CD2 1 
ATOM   10340 C  CE1 . PHE D 2 283 ? 55.304  7.906   -34.343 1.00 75.63  ? 313 PHE D CE1 1 
ATOM   10341 C  CE2 . PHE D 2 283 ? 54.124  5.841   -34.401 1.00 73.13  ? 313 PHE D CE2 1 
ATOM   10342 C  CZ  . PHE D 2 283 ? 54.239  7.132   -33.949 1.00 71.92  ? 313 PHE D CZ  1 
ATOM   10343 N  N   . ILE D 2 284 ? 55.018  4.366   -38.537 1.00 70.38  ? 314 ILE D N   1 
ATOM   10344 C  CA  . ILE D 2 284 ? 53.641  3.928   -38.760 1.00 69.20  ? 314 ILE D CA  1 
ATOM   10345 C  C   . ILE D 2 284 ? 53.272  2.958   -37.624 1.00 73.25  ? 314 ILE D C   1 
ATOM   10346 O  O   . ILE D 2 284 ? 54.175  2.448   -36.948 1.00 71.97  ? 314 ILE D O   1 
ATOM   10347 C  CB  . ILE D 2 284 ? 53.369  3.335   -40.181 1.00 72.15  ? 314 ILE D CB  1 
ATOM   10348 C  CG1 . ILE D 2 284 ? 54.350  2.182   -40.528 1.00 71.74  ? 314 ILE D CG1 1 
ATOM   10349 C  CG2 . ILE D 2 284 ? 53.338  4.433   -41.234 1.00 74.12  ? 314 ILE D CG2 1 
ATOM   10350 C  CD1 . ILE D 2 284 ? 53.915  1.254   -41.634 1.00 69.45  ? 314 ILE D CD1 1 
ATOM   10351 N  N   . PRO D 2 285 ? 51.972  2.703   -37.351 1.00 70.74  ? 315 PRO D N   1 
ATOM   10352 C  CA  . PRO D 2 285 ? 51.649  1.777   -36.269 1.00 69.89  ? 315 PRO D CA  1 
ATOM   10353 C  C   . PRO D 2 285 ? 51.924  0.353   -36.689 1.00 75.52  ? 315 PRO D C   1 
ATOM   10354 O  O   . PRO D 2 285 ? 51.708  -0.022  -37.833 1.00 74.39  ? 315 PRO D O   1 
ATOM   10355 C  CB  . PRO D 2 285 ? 50.174  2.048   -35.981 1.00 70.91  ? 315 PRO D CB  1 
ATOM   10356 C  CG  . PRO D 2 285 ? 49.769  3.175   -36.882 1.00 76.53  ? 315 PRO D CG  1 
ATOM   10357 C  CD  . PRO D 2 285 ? 50.742  3.184   -38.002 1.00 72.99  ? 315 PRO D CD  1 
ATOM   10358 N  N   . GLU D 2 286 ? 52.472  -0.419  -35.772 1.00 76.21  ? 316 GLU D N   1 
ATOM   10359 C  CA  . GLU D 2 286 ? 52.805  -1.792  -36.069 1.00 77.77  ? 316 GLU D CA  1 
ATOM   10360 C  C   . GLU D 2 286 ? 51.587  -2.701  -36.081 1.00 85.11  ? 316 GLU D C   1 
ATOM   10361 O  O   . GLU D 2 286 ? 50.905  -2.830  -35.058 1.00 83.41  ? 316 GLU D O   1 
ATOM   10362 C  CB  . GLU D 2 286 ? 53.884  -2.327  -35.131 1.00 79.10  ? 316 GLU D CB  1 
ATOM   10363 C  CG  . GLU D 2 286 ? 54.461  -3.644  -35.606 1.00 85.60  ? 316 GLU D CG  1 
ATOM   10364 C  CD  . GLU D 2 286 ? 55.301  -4.370  -34.578 1.00 95.69  ? 316 GLU D CD  1 
ATOM   10365 O  OE1 . GLU D 2 286 ? 55.148  -4.087  -33.368 1.00 72.12  ? 316 GLU D OE1 1 
ATOM   10366 O  OE2 . GLU D 2 286 ? 56.088  -5.253  -34.986 1.00 88.63  ? 316 GLU D OE2 1 
ATOM   10367 N  N   . PRO D 2 287 ? 51.352  -3.384  -37.226 1.00 85.55  ? 317 PRO D N   1 
ATOM   10368 C  CA  . PRO D 2 287 ? 50.268  -4.356  -37.283 1.00 85.70  ? 317 PRO D CA  1 
ATOM   10369 C  C   . PRO D 2 287 ? 50.540  -5.487  -36.294 1.00 93.43  ? 317 PRO D C   1 
ATOM   10370 O  O   . PRO D 2 287 ? 51.489  -6.263  -36.424 1.00 94.96  ? 317 PRO D O   1 
ATOM   10371 C  CB  . PRO D 2 287 ? 50.306  -4.847  -38.734 1.00 88.38  ? 317 PRO D CB  1 
ATOM   10372 C  CG  . PRO D 2 287 ? 51.094  -3.827  -39.488 1.00 93.59  ? 317 PRO D CG  1 
ATOM   10373 C  CD  . PRO D 2 287 ? 52.099  -3.359  -38.501 1.00 89.10  ? 317 PRO D CD  1 
ATOM   10374 N  N   . LYS D 2 288 ? 49.749  -5.476  -35.239 1.00 91.76  ? 318 LYS D N   1 
ATOM   10375 C  CA  . LYS D 2 288 ? 49.669  -6.438  -34.149 1.00 92.70  ? 318 LYS D CA  1 
ATOM   10376 C  C   . LYS D 2 288 ? 49.278  -7.784  -34.766 1.00 99.16  ? 318 LYS D C   1 
ATOM   10377 O  O   . LYS D 2 288 ? 48.352  -7.854  -35.594 1.00 98.96  ? 318 LYS D O   1 
ATOM   10378 C  CB  . LYS D 2 288 ? 48.627  -5.962  -33.104 1.00 94.73  ? 318 LYS D CB  1 
ATOM   10379 C  CG  . LYS D 2 288 ? 47.282  -5.414  -33.656 1.00 102.12 ? 318 LYS D CG  1 
ATOM   10380 C  CD  . LYS D 2 288 ? 47.344  -3.949  -34.192 1.00 107.67 ? 318 LYS D CD  1 
ATOM   10381 C  CE  . LYS D 2 288 ? 46.873  -3.872  -35.636 1.00 114.09 ? 318 LYS D CE  1 
ATOM   10382 N  NZ  . LYS D 2 288 ? 47.001  -2.503  -36.208 1.00 118.02 ? 318 LYS D NZ  1 
ATOM   10383 N  N   . SER D 2 289 ? 50.051  -8.828  -34.433 1.00 96.67  ? 319 SER D N   1 
ATOM   10384 C  CA  . SER D 2 289 ? 49.887  -10.159 -35.007 1.00 97.10  ? 319 SER D CA  1 
ATOM   10385 C  C   . SER D 2 289 ? 48.928  -11.063 -34.238 1.00 99.44  ? 319 SER D C   1 
ATOM   10386 O  O   . SER D 2 289 ? 48.870  -12.261 -34.518 1.00 100.09 ? 319 SER D O   1 
ATOM   10387 C  CB  . SER D 2 289 ? 51.248  -10.826 -35.178 1.00 102.62 ? 319 SER D CB  1 
ATOM   10388 O  OG  . SER D 2 289 ? 51.900  -10.962 -33.925 1.00 113.69 ? 319 SER D OG  1 
ATOM   10389 N  N   . SER D 2 290 ? 48.157  -10.503 -33.294 1.00 93.96  ? 320 SER D N   1 
ATOM   10390 C  CA  . SER D 2 290 ? 47.210  -11.290 -32.506 1.00 93.04  ? 320 SER D CA  1 
ATOM   10391 C  C   . SER D 2 290 ? 45.998  -10.489 -32.030 1.00 97.59  ? 320 SER D C   1 
ATOM   10392 O  O   . SER D 2 290 ? 46.074  -9.272  -31.807 1.00 97.30  ? 320 SER D O   1 
ATOM   10393 C  CB  . SER D 2 290 ? 47.909  -11.913 -31.300 1.00 94.52  ? 320 SER D CB  1 
ATOM   10394 O  OG  . SER D 2 290 ? 47.185  -13.030 -30.820 1.00 96.84  ? 320 SER D OG  1 
ATOM   10395 N  N   . CYS D 2 291 ? 44.885  -11.200 -31.855 1.00 93.98  ? 321 CYS D N   1 
ATOM   10396 C  CA  . CYS D 2 291 ? 43.637  -10.684 -31.314 1.00 92.98  ? 321 CYS D CA  1 
ATOM   10397 C  C   . CYS D 2 291 ? 43.568  -11.136 -29.860 1.00 100.81 ? 321 CYS D C   1 
ATOM   10398 O  O   . CYS D 2 291 ? 42.719  -10.676 -29.105 1.00 100.19 ? 321 CYS D O   1 
ATOM   10399 C  CB  . CYS D 2 291 ? 42.461  -11.254 -32.100 1.00 92.32  ? 321 CYS D CB  1 
ATOM   10400 S  SG  . CYS D 2 291 ? 42.245  -10.560 -33.757 1.00 95.31  ? 321 CYS D SG  1 
ATOM   10401 N  N   . TYR D 2 292 ? 44.449  -12.062 -29.486 1.00 101.09 ? 322 TYR D N   1 
ATOM   10402 C  CA  . TYR D 2 292 ? 44.467  -12.720 -28.190 1.00 102.64 ? 322 TYR D CA  1 
ATOM   10403 C  C   . TYR D 2 292 ? 45.501  -12.102 -27.216 1.00 108.69 ? 322 TYR D C   1 
ATOM   10404 O  O   . TYR D 2 292 ? 45.689  -12.608 -26.108 1.00 109.39 ? 322 TYR D O   1 
ATOM   10405 C  CB  . TYR D 2 292 ? 44.648  -14.241 -28.435 1.00 105.36 ? 322 TYR D CB  1 
ATOM   10406 C  CG  . TYR D 2 292 ? 43.838  -14.708 -29.638 1.00 108.48 ? 322 TYR D CG  1 
ATOM   10407 C  CD1 . TYR D 2 292 ? 42.449  -14.536 -29.682 1.00 110.64 ? 322 TYR D CD1 1 
ATOM   10408 C  CD2 . TYR D 2 292 ? 44.465  -15.220 -30.773 1.00 109.87 ? 322 TYR D CD2 1 
ATOM   10409 C  CE1 . TYR D 2 292 ? 41.705  -14.888 -30.813 1.00 111.79 ? 322 TYR D CE1 1 
ATOM   10410 C  CE2 . TYR D 2 292 ? 43.729  -15.584 -31.910 1.00 111.17 ? 322 TYR D CE2 1 
ATOM   10411 C  CZ  . TYR D 2 292 ? 42.346  -15.419 -31.924 1.00 118.00 ? 322 TYR D CZ  1 
ATOM   10412 O  OH  . TYR D 2 292 ? 41.593  -15.781 -33.027 1.00 115.88 ? 322 TYR D OH  1 
ATOM   10413 N  N   . ASN D 2 293 ? 46.096  -10.959 -27.607 1.00 105.59 ? 323 ASN D N   1 
ATOM   10414 C  CA  . ASN D 2 293 ? 47.101  -10.215 -26.841 1.00 106.10 ? 323 ASN D CA  1 
ATOM   10415 C  C   . ASN D 2 293 ? 46.683  -8.750  -26.628 1.00 109.79 ? 323 ASN D C   1 
ATOM   10416 O  O   . ASN D 2 293 ? 47.386  -8.017  -25.922 1.00 108.63 ? 323 ASN D O   1 
ATOM   10417 C  CB  . ASN D 2 293 ? 48.448  -10.226 -27.599 1.00 110.23 ? 323 ASN D CB  1 
ATOM   10418 C  CG  . ASN D 2 293 ? 49.423  -11.309 -27.229 1.00 147.22 ? 323 ASN D CG  1 
ATOM   10419 O  OD1 . ASN D 2 293 ? 49.966  -11.345 -26.117 1.00 144.26 ? 323 ASN D OD1 1 
ATOM   10420 N  ND2 . ASN D 2 293 ? 49.772  -12.135 -28.206 1.00 142.35 ? 323 ASN D ND2 1 
ATOM   10421 N  N   . THR D 2 294 ? 45.553  -8.319  -27.250 1.00 107.64 ? 324 THR D N   1 
ATOM   10422 C  CA  . THR D 2 294 ? 45.030  -6.931  -27.226 1.00 107.64 ? 324 THR D CA  1 
ATOM   10423 C  C   . THR D 2 294 ? 45.164  -6.231  -25.848 1.00 111.49 ? 324 THR D C   1 
ATOM   10424 O  O   . THR D 2 294 ? 45.621  -5.082  -25.787 1.00 111.10 ? 324 THR D O   1 
ATOM   10425 C  CB  . THR D 2 294 ? 43.578  -6.836  -27.773 1.00 115.50 ? 324 THR D CB  1 
ATOM   10426 O  OG1 . THR D 2 294 ? 42.686  -7.636  -26.995 1.00 114.17 ? 324 THR D OG1 1 
ATOM   10427 C  CG2 . THR D 2 294 ? 43.473  -7.221  -29.240 1.00 114.51 ? 324 THR D CG2 1 
ATOM   10428 N  N   . HIS D 2 295 ? 44.816  -6.955  -24.765 1.00 107.28 ? 325 HIS D N   1 
ATOM   10429 C  CA  . HIS D 2 295 ? 44.849  -6.506  -23.371 1.00 106.63 ? 325 HIS D CA  1 
ATOM   10430 C  C   . HIS D 2 295 ? 46.240  -6.049  -22.840 1.00 110.24 ? 325 HIS D C   1 
ATOM   10431 O  O   . HIS D 2 295 ? 46.297  -4.949  -22.296 1.00 110.63 ? 325 HIS D O   1 
ATOM   10432 C  CB  . HIS D 2 295 ? 44.246  -7.580  -22.451 1.00 107.29 ? 325 HIS D CB  1 
ATOM   10433 C  CG  . HIS D 2 295 ? 44.899  -8.921  -22.576 1.00 110.73 ? 325 HIS D CG  1 
ATOM   10434 N  ND1 . HIS D 2 295 ? 44.800  -9.668  -23.737 1.00 112.33 ? 325 HIS D ND1 1 
ATOM   10435 C  CD2 . HIS D 2 295 ? 45.629  -9.610  -21.674 1.00 112.60 ? 325 HIS D CD2 1 
ATOM   10436 C  CE1 . HIS D 2 295 ? 45.473  -10.780 -23.505 1.00 112.17 ? 325 HIS D CE1 1 
ATOM   10437 N  NE2 . HIS D 2 295 ? 45.997  -10.786 -22.281 1.00 112.81 ? 325 HIS D NE2 1 
ATOM   10438 N  N   . GLU D 2 296 ? 47.322  -6.866  -22.895 1.00 105.46 ? 326 GLU D N   1 
ATOM   10439 C  CA  . GLU D 2 296 ? 48.632  -6.411  -22.367 1.00 105.11 ? 326 GLU D CA  1 
ATOM   10440 C  C   . GLU D 2 296 ? 49.567  -5.972  -23.517 1.00 105.52 ? 326 GLU D C   1 
ATOM   10441 O  O   . GLU D 2 296 ? 50.665  -6.507  -23.721 1.00 105.99 ? 326 GLU D O   1 
ATOM   10442 C  CB  . GLU D 2 296 ? 49.302  -7.415  -21.378 1.00 107.38 ? 326 GLU D CB  1 
ATOM   10443 C  CG  . GLU D 2 296 ? 48.987  -8.903  -21.553 1.00 118.55 ? 326 GLU D CG  1 
ATOM   10444 C  CD  . GLU D 2 296 ? 49.390  -9.606  -22.839 1.00 131.74 ? 326 GLU D CD  1 
ATOM   10445 O  OE1 . GLU D 2 296 ? 50.546  -9.433  -23.290 1.00 129.07 ? 326 GLU D OE1 1 
ATOM   10446 O  OE2 . GLU D 2 296 ? 48.567  -10.398 -23.351 1.00 116.08 ? 326 GLU D OE2 1 
ATOM   10447 N  N   . LYS D 2 297 ? 49.106  -4.963  -24.254 1.00 98.21  ? 327 LYS D N   1 
ATOM   10448 C  CA  . LYS D 2 297 ? 49.749  -4.453  -25.457 1.00 96.44  ? 327 LYS D CA  1 
ATOM   10449 C  C   . LYS D 2 297 ? 49.151  -3.086  -25.792 1.00 94.73  ? 327 LYS D C   1 
ATOM   10450 O  O   . LYS D 2 297 ? 49.702  -2.383  -26.633 1.00 94.32  ? 327 LYS D O   1 
ATOM   10451 C  CB  . LYS D 2 297 ? 49.409  -5.457  -26.585 1.00 99.28  ? 327 LYS D CB  1 
ATOM   10452 C  CG  . LYS D 2 297 ? 50.003  -5.240  -27.965 1.00 114.60 ? 327 LYS D CG  1 
ATOM   10453 C  CD  . LYS D 2 297 ? 49.586  -6.379  -28.928 1.00 127.78 ? 327 LYS D CD  1 
ATOM   10454 C  CE  . LYS D 2 297 ? 48.142  -6.332  -29.405 1.00 139.32 ? 327 LYS D CE  1 
ATOM   10455 N  NZ  . LYS D 2 297 ? 47.771  -7.538  -30.198 1.00 145.71 ? 327 LYS D NZ  1 
ATOM   10456 N  N   . ARG D 2 298 ? 48.028  -2.714  -25.131 1.00 86.31  ? 328 ARG D N   1 
ATOM   10457 C  CA  . ARG D 2 298 ? 47.281  -1.489  -25.425 1.00 83.17  ? 328 ARG D CA  1 
ATOM   10458 C  C   . ARG D 2 298 ? 48.015  -0.184  -25.067 1.00 80.89  ? 328 ARG D C   1 
ATOM   10459 O  O   . ARG D 2 298 ? 47.798  0.807   -25.768 1.00 79.06  ? 328 ARG D O   1 
ATOM   10460 C  CB  . ARG D 2 298 ? 45.866  -1.512  -24.820 1.00 83.27  ? 328 ARG D CB  1 
ATOM   10461 N  N   . ILE D 2 299 ? 48.897  -0.171  -24.029 1.00 75.24  ? 329 ILE D N   1 
ATOM   10462 C  CA  . ILE D 2 299 ? 49.678  1.039   -23.664 1.00 74.70  ? 329 ILE D CA  1 
ATOM   10463 C  C   . ILE D 2 299 ? 50.628  1.455   -24.783 1.00 75.75  ? 329 ILE D C   1 
ATOM   10464 O  O   . ILE D 2 299 ? 51.174  2.546   -24.736 1.00 75.27  ? 329 ILE D O   1 
ATOM   10465 C  CB  . ILE D 2 299 ? 50.506  0.916   -22.361 1.00 78.78  ? 329 ILE D CB  1 
ATOM   10466 C  CG1 . ILE D 2 299 ? 50.680  -0.543  -21.918 1.00 79.79  ? 329 ILE D CG1 1 
ATOM   10467 C  CG2 . ILE D 2 299 ? 49.961  1.805   -21.250 1.00 78.98  ? 329 ILE D CG2 1 
ATOM   10468 C  CD1 . ILE D 2 299 ? 52.071  -0.810  -21.417 1.00 92.88  ? 329 ILE D CD1 1 
ATOM   10469 N  N   . TYR D 2 300 ? 50.860  0.571   -25.747 1.00 70.77  ? 330 TYR D N   1 
ATOM   10470 C  CA  . TYR D 2 300 ? 51.756  0.771   -26.866 1.00 70.87  ? 330 TYR D CA  1 
ATOM   10471 C  C   . TYR D 2 300 ? 51.039  1.162   -28.141 1.00 77.05  ? 330 TYR D C   1 
ATOM   10472 O  O   . TYR D 2 300 ? 51.695  1.608   -29.093 1.00 78.93  ? 330 TYR D O   1 
ATOM   10473 C  CB  . TYR D 2 300 ? 52.544  -0.514  -27.094 1.00 71.74  ? 330 TYR D CB  1 
ATOM   10474 C  CG  . TYR D 2 300 ? 53.265  -0.988  -25.854 1.00 74.13  ? 330 TYR D CG  1 
ATOM   10475 C  CD1 . TYR D 2 300 ? 54.136  -0.148  -25.167 1.00 77.00  ? 330 TYR D CD1 1 
ATOM   10476 C  CD2 . TYR D 2 300 ? 53.093  -2.283  -25.375 1.00 74.23  ? 330 TYR D CD2 1 
ATOM   10477 C  CE1 . TYR D 2 300 ? 54.825  -0.584  -24.045 1.00 78.58  ? 330 TYR D CE1 1 
ATOM   10478 C  CE2 . TYR D 2 300 ? 53.785  -2.735  -24.255 1.00 74.98  ? 330 TYR D CE2 1 
ATOM   10479 C  CZ  . TYR D 2 300 ? 54.655  -1.880  -23.594 1.00 83.82  ? 330 TYR D CZ  1 
ATOM   10480 O  OH  . TYR D 2 300 ? 55.331  -2.277  -22.460 1.00 84.02  ? 330 TYR D OH  1 
ATOM   10481 N  N   . GLN D 2 301 ? 49.696  0.994   -28.164 1.00 71.75  ? 331 GLN D N   1 
ATOM   10482 C  CA  . GLN D 2 301 ? 48.834  1.251   -29.317 1.00 70.29  ? 331 GLN D CA  1 
ATOM   10483 C  C   . GLN D 2 301 ? 47.915  2.438   -29.071 1.00 72.69  ? 331 GLN D C   1 
ATOM   10484 O  O   . GLN D 2 301 ? 47.698  2.807   -27.916 1.00 71.38  ? 331 GLN D O   1 
ATOM   10485 C  CB  . GLN D 2 301 ? 47.981  0.010   -29.659 1.00 70.87  ? 331 GLN D CB  1 
ATOM   10486 C  CG  . GLN D 2 301 ? 48.630  -1.356  -29.447 1.00 90.91  ? 331 GLN D CG  1 
ATOM   10487 C  CD  . GLN D 2 301 ? 47.780  -2.490  -29.986 1.00 125.89 ? 331 GLN D CD  1 
ATOM   10488 O  OE1 . GLN D 2 301 ? 46.680  -2.798  -29.502 1.00 124.57 ? 331 GLN D OE1 1 
ATOM   10489 N  NE2 . GLN D 2 301 ? 48.297  -3.164  -30.982 1.00 126.90 ? 331 GLN D NE2 1 
ATOM   10490 N  N   . SER D 2 302 ? 47.370  3.018   -30.172 1.00 68.98  ? 332 SER D N   1 
ATOM   10491 C  CA  . SER D 2 302 ? 46.422  4.137   -30.204 1.00 68.10  ? 332 SER D CA  1 
ATOM   10492 C  C   . SER D 2 302 ? 45.723  4.230   -31.581 1.00 73.52  ? 332 SER D C   1 
ATOM   10493 O  O   . SER D 2 302 ? 46.100  3.519   -32.522 1.00 74.25  ? 332 SER D O   1 
ATOM   10494 C  CB  . SER D 2 302 ? 47.113  5.454   -29.837 1.00 70.26  ? 332 SER D CB  1 
ATOM   10495 O  OG  . SER D 2 302 ? 47.860  6.031   -30.893 1.00 76.18  ? 332 SER D OG  1 
ATOM   10496 N  N   . ASN D 2 303 ? 44.709  5.103   -31.704 1.00 70.17  ? 333 ASN D N   1 
ATOM   10497 C  CA  . ASN D 2 303 ? 44.012  5.309   -32.984 1.00 69.48  ? 333 ASN D CA  1 
ATOM   10498 C  C   . ASN D 2 303 ? 44.588  6.540   -33.737 1.00 73.27  ? 333 ASN D C   1 
ATOM   10499 O  O   . ASN D 2 303 ? 43.854  7.234   -34.450 1.00 73.69  ? 333 ASN D O   1 
ATOM   10500 C  CB  . ASN D 2 303 ? 42.494  5.414   -32.771 1.00 66.49  ? 333 ASN D CB  1 
ATOM   10501 C  CG  . ASN D 2 303 ? 42.043  6.523   -31.847 1.00 86.13  ? 333 ASN D CG  1 
ATOM   10502 O  OD1 . ASN D 2 303 ? 42.830  7.141   -31.112 1.00 76.35  ? 333 ASN D OD1 1 
ATOM   10503 N  ND2 . ASN D 2 303 ? 40.746  6.790   -31.856 1.00 79.46  ? 333 ASN D ND2 1 
ATOM   10504 N  N   . MET D 2 304 ? 45.916  6.782   -33.590 1.00 67.84  ? 334 MET D N   1 
ATOM   10505 C  CA  . MET D 2 304 ? 46.648  7.904   -34.173 1.00 67.92  ? 334 MET D CA  1 
ATOM   10506 C  C   . MET D 2 304 ? 46.439  8.015   -35.686 1.00 73.38  ? 334 MET D C   1 
ATOM   10507 O  O   . MET D 2 304 ? 46.270  9.128   -36.181 1.00 76.31  ? 334 MET D O   1 
ATOM   10508 C  CB  . MET D 2 304 ? 48.139  7.845   -33.794 1.00 70.60  ? 334 MET D CB  1 
ATOM   10509 C  CG  . MET D 2 304 ? 48.979  8.920   -34.453 1.00 75.70  ? 334 MET D CG  1 
ATOM   10510 S  SD  . MET D 2 304 ? 50.726  9.042   -33.963 1.00 80.91  ? 334 MET D SD  1 
ATOM   10511 C  CE  . MET D 2 304 ? 50.564  9.849   -32.336 1.00 78.18  ? 334 MET D CE  1 
ATOM   10512 N  N   . LEU D 2 305 ? 46.399  6.877   -36.414 1.00 66.21  ? 335 LEU D N   1 
ATOM   10513 C  CA  . LEU D 2 305 ? 46.228  6.908   -37.859 1.00 65.39  ? 335 LEU D CA  1 
ATOM   10514 C  C   . LEU D 2 305 ? 44.946  7.594   -38.309 1.00 72.27  ? 335 LEU D C   1 
ATOM   10515 O  O   . LEU D 2 305 ? 44.860  8.005   -39.475 1.00 74.26  ? 335 LEU D O   1 
ATOM   10516 C  CB  . LEU D 2 305 ? 46.254  5.490   -38.423 1.00 64.16  ? 335 LEU D CB  1 
ATOM   10517 C  CG  . LEU D 2 305 ? 47.321  5.125   -39.466 1.00 67.67  ? 335 LEU D CG  1 
ATOM   10518 C  CD1 . LEU D 2 305 ? 46.888  3.901   -40.248 1.00 66.63  ? 335 LEU D CD1 1 
ATOM   10519 C  CD2 . LEU D 2 305 ? 47.645  6.278   -40.413 1.00 69.50  ? 335 LEU D CD2 1 
ATOM   10520 N  N   . ASN D 2 306 ? 43.938  7.690   -37.404 1.00 67.61  ? 336 ASN D N   1 
ATOM   10521 C  CA  . ASN D 2 306 ? 42.638  8.273   -37.744 1.00 66.94  ? 336 ASN D CA  1 
ATOM   10522 C  C   . ASN D 2 306 ? 42.739  9.688   -38.298 1.00 71.84  ? 336 ASN D C   1 
ATOM   10523 O  O   . ASN D 2 306 ? 42.050  9.995   -39.270 1.00 72.00  ? 336 ASN D O   1 
ATOM   10524 C  CB  . ASN D 2 306 ? 41.652  8.204   -36.578 1.00 64.08  ? 336 ASN D CB  1 
ATOM   10525 C  CG  . ASN D 2 306 ? 40.943  6.882   -36.405 1.00 78.07  ? 336 ASN D CG  1 
ATOM   10526 O  OD1 . ASN D 2 306 ? 41.104  5.933   -37.179 1.00 74.17  ? 336 ASN D OD1 1 
ATOM   10527 N  ND2 . ASN D 2 306 ? 40.111  6.806   -35.384 1.00 66.55  ? 336 ASN D ND2 1 
ATOM   10528 N  N   . ARG D 2 307 ? 43.648  10.522  -37.747 1.00 68.59  ? 337 ARG D N   1 
ATOM   10529 C  CA  . ARG D 2 307 ? 43.802  11.892  -38.238 1.00 69.75  ? 337 ARG D CA  1 
ATOM   10530 C  C   . ARG D 2 307 ? 44.218  11.945  -39.709 1.00 75.48  ? 337 ARG D C   1 
ATOM   10531 O  O   . ARG D 2 307 ? 43.901  12.908  -40.414 1.00 78.07  ? 337 ARG D O   1 
ATOM   10532 C  CB  . ARG D 2 307 ? 44.713  12.749  -37.352 1.00 70.06  ? 337 ARG D CB  1 
ATOM   10533 C  CG  . ARG D 2 307 ? 46.080  12.207  -37.082 1.00 81.15  ? 337 ARG D CG  1 
ATOM   10534 C  CD  . ARG D 2 307 ? 46.767  13.132  -36.117 1.00 98.50  ? 337 ARG D CD  1 
ATOM   10535 N  NE  . ARG D 2 307 ? 47.506  12.417  -35.084 1.00 107.89 ? 337 ARG D NE  1 
ATOM   10536 C  CZ  . ARG D 2 307 ? 47.165  12.371  -33.795 1.00 119.29 ? 337 ARG D CZ  1 
ATOM   10537 N  NH1 . ARG D 2 307 ? 46.062  12.977  -33.368 1.00 118.44 ? 337 ARG D NH1 1 
ATOM   10538 N  NH2 . ARG D 2 307 ? 47.928  11.727  -32.925 1.00 91.52  ? 337 ARG D NH2 1 
ATOM   10539 N  N   . TYR D 2 308 ? 44.855  10.882  -40.182 1.00 69.49  ? 338 TYR D N   1 
ATOM   10540 C  CA  . TYR D 2 308 ? 45.271  10.770  -41.565 1.00 68.95  ? 338 TYR D CA  1 
ATOM   10541 C  C   . TYR D 2 308 ? 44.205  10.067  -42.435 1.00 72.12  ? 338 TYR D C   1 
ATOM   10542 O  O   . TYR D 2 308 ? 44.028  10.467  -43.581 1.00 72.94  ? 338 TYR D O   1 
ATOM   10543 C  CB  . TYR D 2 308 ? 46.642  10.084  -41.640 1.00 69.05  ? 338 TYR D CB  1 
ATOM   10544 C  CG  . TYR D 2 308 ? 47.696  10.812  -40.833 1.00 69.73  ? 338 TYR D CG  1 
ATOM   10545 C  CD1 . TYR D 2 308 ? 48.317  11.952  -41.331 1.00 72.03  ? 338 TYR D CD1 1 
ATOM   10546 C  CD2 . TYR D 2 308 ? 48.039  10.389  -39.549 1.00 69.96  ? 338 TYR D CD2 1 
ATOM   10547 C  CE1 . TYR D 2 308 ? 49.252  12.655  -40.578 1.00 71.32  ? 338 TYR D CE1 1 
ATOM   10548 C  CE2 . TYR D 2 308 ? 48.977  11.088  -38.785 1.00 71.29  ? 338 TYR D CE2 1 
ATOM   10549 C  CZ  . TYR D 2 308 ? 49.586  12.215  -39.314 1.00 76.69  ? 338 TYR D CZ  1 
ATOM   10550 O  OH  . TYR D 2 308 ? 50.511  12.925  -38.607 1.00 79.56  ? 338 TYR D OH  1 
ATOM   10551 N  N   . LEU D 2 309 ? 43.501  9.040   -41.900 1.00 66.24  ? 339 LEU D N   1 
ATOM   10552 C  CA  . LEU D 2 309 ? 42.487  8.282   -42.634 1.00 65.78  ? 339 LEU D CA  1 
ATOM   10553 C  C   . LEU D 2 309 ? 41.261  9.125   -42.952 1.00 75.49  ? 339 LEU D C   1 
ATOM   10554 O  O   . LEU D 2 309 ? 40.580  8.881   -43.961 1.00 76.69  ? 339 LEU D O   1 
ATOM   10555 C  CB  . LEU D 2 309 ? 42.032  7.062   -41.824 1.00 63.60  ? 339 LEU D CB  1 
ATOM   10556 C  CG  . LEU D 2 309 ? 43.017  5.948   -41.593 1.00 65.43  ? 339 LEU D CG  1 
ATOM   10557 C  CD1 . LEU D 2 309 ? 42.767  5.304   -40.247 1.00 63.77  ? 339 LEU D CD1 1 
ATOM   10558 C  CD2 . LEU D 2 309 ? 42.974  4.949   -42.726 1.00 62.66  ? 339 LEU D CD2 1 
ATOM   10559 N  N   . ILE D 2 310 ? 40.972  10.100  -42.072 1.00 74.03  ? 340 ILE D N   1 
ATOM   10560 C  CA  . ILE D 2 310 ? 39.820  11.002  -42.133 1.00 74.81  ? 340 ILE D CA  1 
ATOM   10561 C  C   . ILE D 2 310 ? 39.919  12.138  -43.190 1.00 84.66  ? 340 ILE D C   1 
ATOM   10562 O  O   . ILE D 2 310 ? 38.910  12.706  -43.566 1.00 84.62  ? 340 ILE D O   1 
ATOM   10563 C  CB  . ILE D 2 310 ? 39.632  11.562  -40.694 1.00 76.70  ? 340 ILE D CB  1 
ATOM   10564 C  CG1 . ILE D 2 310 ? 38.180  11.868  -40.379 1.00 76.71  ? 340 ILE D CG1 1 
ATOM   10565 C  CG2 . ILE D 2 310 ? 40.528  12.752  -40.396 1.00 77.56  ? 340 ILE D CG2 1 
ATOM   10566 C  CD1 . ILE D 2 310 ? 37.721  11.273  -39.125 1.00 83.82  ? 340 ILE D CD1 1 
ATOM   10567 N  N   . ASN D 2 311 ? 41.118  12.446  -43.656 1.00 86.77  ? 341 ASN D N   1 
ATOM   10568 C  CA  . ASN D 2 311 ? 41.484  13.594  -44.482 1.00 90.40  ? 341 ASN D CA  1 
ATOM   10569 C  C   . ASN D 2 311 ? 42.003  13.261  -45.900 1.00 98.11  ? 341 ASN D C   1 
ATOM   10570 O  O   . ASN D 2 311 ? 42.441  14.183  -46.604 1.00 98.86  ? 341 ASN D O   1 
ATOM   10571 C  CB  . ASN D 2 311 ? 42.636  14.225  -43.718 1.00 97.67  ? 341 ASN D CB  1 
ATOM   10572 C  CG  . ASN D 2 311 ? 42.720  15.699  -43.520 1.00 147.28 ? 341 ASN D CG  1 
ATOM   10573 O  OD1 . ASN D 2 311 ? 41.727  16.445  -43.520 1.00 138.60 ? 341 ASN D OD1 1 
ATOM   10574 N  ND2 . ASN D 2 311 ? 43.991  16.056  -43.289 1.00 158.72 ? 341 ASN D ND2 1 
ATOM   10575 N  N   . VAL D 2 312 ? 41.988  11.970  -46.303 1.00 96.68  ? 342 VAL D N   1 
ATOM   10576 C  CA  . VAL D 2 312 ? 42.537  11.493  -47.585 1.00 99.27  ? 342 VAL D CA  1 
ATOM   10577 C  C   . VAL D 2 312 ? 41.938  12.197  -48.814 1.00 109.01 ? 342 VAL D C   1 
ATOM   10578 O  O   . VAL D 2 312 ? 40.711  12.265  -48.988 1.00 108.32 ? 342 VAL D O   1 
ATOM   10579 C  CB  . VAL D 2 312 ? 42.471  9.948   -47.739 1.00 102.53 ? 342 VAL D CB  1 
ATOM   10580 C  CG1 . VAL D 2 312 ? 43.312  9.464   -48.923 1.00 103.04 ? 342 VAL D CG1 1 
ATOM   10581 C  CG2 . VAL D 2 312 ? 42.906  9.246   -46.460 1.00 101.58 ? 342 VAL D CG2 1 
ATOM   10582 N  N   . THR D 2 313 ? 42.840  12.703  -49.671 1.00 110.41 ? 343 THR D N   1 
ATOM   10583 C  CA  . THR D 2 313 ? 42.510  13.368  -50.932 1.00 113.03 ? 343 THR D CA  1 
ATOM   10584 C  C   . THR D 2 313 ? 43.202  12.633  -52.076 1.00 118.69 ? 343 THR D C   1 
ATOM   10585 O  O   . THR D 2 313 ? 44.433  12.585  -52.125 1.00 117.44 ? 343 THR D O   1 
ATOM   10586 C  CB  . THR D 2 313 ? 42.772  14.886  -50.865 1.00 126.53 ? 343 THR D CB  1 
ATOM   10587 O  OG1 . THR D 2 313 ? 44.013  15.139  -50.191 1.00 127.14 ? 343 THR D OG1 1 
ATOM   10588 C  CG2 . THR D 2 313 ? 41.634  15.645  -50.172 1.00 125.98 ? 343 THR D CG2 1 
ATOM   10589 N  N   . PHE D 2 314 ? 42.400  11.994  -52.950 1.00 117.92 ? 344 PHE D N   1 
ATOM   10590 C  CA  . PHE D 2 314 ? 42.899  11.220  -54.092 1.00 119.72 ? 344 PHE D CA  1 
ATOM   10591 C  C   . PHE D 2 314 ? 42.899  12.074  -55.366 1.00 125.63 ? 344 PHE D C   1 
ATOM   10592 O  O   . PHE D 2 314 ? 43.968  12.326  -55.947 1.00 127.00 ? 344 PHE D O   1 
ATOM   10593 C  CB  . PHE D 2 314 ? 42.059  9.936   -54.274 1.00 120.78 ? 344 PHE D CB  1 
ATOM   10594 C  CG  . PHE D 2 314 ? 42.660  8.794   -55.070 1.00 123.50 ? 344 PHE D CG  1 
ATOM   10595 C  CD1 . PHE D 2 314 ? 44.035  8.548   -55.049 1.00 127.45 ? 344 PHE D CD1 1 
ATOM   10596 C  CD2 . PHE D 2 314 ? 41.844  7.922   -55.787 1.00 125.72 ? 344 PHE D CD2 1 
ATOM   10597 C  CE1 . PHE D 2 314 ? 44.583  7.485   -55.774 1.00 129.04 ? 344 PHE D CE1 1 
ATOM   10598 C  CE2 . PHE D 2 314 ? 42.392  6.862   -56.514 1.00 129.35 ? 344 PHE D CE2 1 
ATOM   10599 C  CZ  . PHE D 2 314 ? 43.756  6.649   -56.502 1.00 128.32 ? 344 PHE D CZ  1 
ATOM   10600 N  N   . GLU D 2 315 ? 41.696  12.532  -55.778 1.00 121.00 ? 345 GLU D N   1 
ATOM   10601 C  CA  . GLU D 2 315 ? 41.474  13.376  -56.949 1.00 126.87 ? 345 GLU D CA  1 
ATOM   10602 C  C   . GLU D 2 315 ? 40.300  14.320  -56.681 1.00 147.76 ? 345 GLU D C   1 
ATOM   10603 O  O   . GLU D 2 315 ? 39.426  14.015  -55.865 1.00 113.75 ? 345 GLU D O   1 
ATOM   10604 C  CB  . GLU D 2 315 ? 41.192  12.513  -58.188 1.00 128.79 ? 345 GLU D CB  1 
ATOM   10605 C  CG  . GLU D 2 315 ? 42.426  11.868  -58.810 1.00 139.61 ? 345 GLU D CG  1 
ATOM   10606 C  CD  . GLU D 2 315 ? 42.618  10.375  -58.592 1.00 154.50 ? 345 GLU D CD  1 
ATOM   10607 O  OE1 . GLU D 2 315 ? 41.607  9.636   -58.523 1.00 149.04 ? 345 GLU D OE1 1 
ATOM   10608 O  OE2 . GLU D 2 315 ? 43.791  9.936   -58.562 1.00 140.05 ? 345 GLU D OE2 1 
ATOM   10609 N  N   . ASP D 2 318 ? 38.538  14.121  -53.110 1.00 106.00 ? 348 ASP D N   1 
ATOM   10610 C  CA  . ASP D 2 318 ? 38.274  14.309  -51.677 1.00 104.96 ? 348 ASP D CA  1 
ATOM   10611 C  C   . ASP D 2 318 ? 37.456  13.150  -51.069 1.00 105.87 ? 348 ASP D C   1 
ATOM   10612 O  O   . ASP D 2 318 ? 36.219  13.217  -50.985 1.00 104.20 ? 348 ASP D O   1 
ATOM   10613 C  CB  . ASP D 2 318 ? 37.633  15.694  -51.371 1.00 107.57 ? 348 ASP D CB  1 
ATOM   10614 C  CG  . ASP D 2 318 ? 37.356  15.967  -49.893 1.00 114.77 ? 348 ASP D CG  1 
ATOM   10615 O  OD1 . ASP D 2 318 ? 38.326  16.241  -49.142 1.00 116.81 ? 348 ASP D OD1 1 
ATOM   10616 O  OD2 . ASP D 2 318 ? 36.170  15.933  -49.495 1.00 115.19 ? 348 ASP D OD2 1 
ATOM   10617 N  N   . LEU D 2 319 ? 38.172  12.094  -50.624 1.00 100.55 ? 349 LEU D N   1 
ATOM   10618 C  CA  . LEU D 2 319 ? 37.570  10.896  -50.032 1.00 97.99  ? 349 LEU D CA  1 
ATOM   10619 C  C   . LEU D 2 319 ? 37.423  11.022  -48.504 1.00 101.44 ? 349 LEU D C   1 
ATOM   10620 O  O   . LEU D 2 319 ? 37.305  10.004  -47.822 1.00 100.96 ? 349 LEU D O   1 
ATOM   10621 C  CB  . LEU D 2 319 ? 38.395  9.631   -50.380 1.00 97.30  ? 349 LEU D CB  1 
ATOM   10622 C  CG  . LEU D 2 319 ? 39.119  9.560   -51.722 1.00 102.05 ? 349 LEU D CG  1 
ATOM   10623 C  CD1 . LEU D 2 319 ? 40.410  8.815   -51.576 1.00 101.98 ? 349 LEU D CD1 1 
ATOM   10624 C  CD2 . LEU D 2 319 ? 38.266  8.896   -52.773 1.00 102.18 ? 349 LEU D CD2 1 
ATOM   10625 N  N   . SER D 2 320 ? 37.418  12.260  -47.969 1.00 97.68  ? 350 SER D N   1 
ATOM   10626 C  CA  . SER D 2 320 ? 37.344  12.504  -46.528 1.00 95.65  ? 350 SER D CA  1 
ATOM   10627 C  C   . SER D 2 320 ? 36.076  11.957  -45.872 1.00 93.86  ? 350 SER D C   1 
ATOM   10628 O  O   . SER D 2 320 ? 35.033  11.838  -46.521 1.00 93.69  ? 350 SER D O   1 
ATOM   10629 C  CB  . SER D 2 320 ? 37.547  13.985  -46.201 1.00 101.12 ? 350 SER D CB  1 
ATOM   10630 O  OG  . SER D 2 320 ? 36.638  14.836  -46.879 1.00 113.93 ? 350 SER D OG  1 
ATOM   10631 N  N   . PHE D 2 321 ? 36.227  11.543  -44.603 1.00 86.26  ? 351 PHE D N   1 
ATOM   10632 C  CA  . PHE D 2 321 ? 35.169  11.032  -43.744 1.00 83.86  ? 351 PHE D CA  1 
ATOM   10633 C  C   . PHE D 2 321 ? 34.751  12.088  -42.743 1.00 85.81  ? 351 PHE D C   1 
ATOM   10634 O  O   . PHE D 2 321 ? 35.484  13.039  -42.481 1.00 85.04  ? 351 PHE D O   1 
ATOM   10635 C  CB  . PHE D 2 321 ? 35.612  9.770   -42.991 1.00 84.55  ? 351 PHE D CB  1 
ATOM   10636 C  CG  . PHE D 2 321 ? 35.859  8.578   -43.884 1.00 86.06  ? 351 PHE D CG  1 
ATOM   10637 C  CD1 . PHE D 2 321 ? 34.802  7.793   -44.334 1.00 88.14  ? 351 PHE D CD1 1 
ATOM   10638 C  CD2 . PHE D 2 321 ? 37.151  8.230   -44.266 1.00 87.85  ? 351 PHE D CD2 1 
ATOM   10639 C  CE1 . PHE D 2 321 ? 35.034  6.697   -45.170 1.00 88.47  ? 351 PHE D CE1 1 
ATOM   10640 C  CE2 . PHE D 2 321 ? 37.378  7.122   -45.088 1.00 90.08  ? 351 PHE D CE2 1 
ATOM   10641 C  CZ  . PHE D 2 321 ? 36.319  6.366   -45.536 1.00 87.40  ? 351 PHE D CZ  1 
ATOM   10642 N  N   . SER D 2 322 ? 33.545  11.918  -42.206 1.00 81.42  ? 352 SER D N   1 
ATOM   10643 C  CA  . SER D 2 322 ? 32.926  12.744  -41.184 1.00 81.07  ? 352 SER D CA  1 
ATOM   10644 C  C   . SER D 2 322 ? 33.636  12.448  -39.846 1.00 85.50  ? 352 SER D C   1 
ATOM   10645 O  O   . SER D 2 322 ? 34.442  11.516  -39.768 1.00 83.08  ? 352 SER D O   1 
ATOM   10646 C  CB  . SER D 2 322 ? 31.428  12.419  -41.132 1.00 83.14  ? 352 SER D CB  1 
ATOM   10647 O  OG  . SER D 2 322 ? 30.811  12.429  -39.856 1.00 89.62  ? 352 SER D OG  1 
ATOM   10648 N  N   . GLU D 2 323 ? 33.359  13.243  -38.802 1.00 84.98  ? 353 GLU D N   1 
ATOM   10649 C  CA  . GLU D 2 323 ? 33.940  12.998  -37.481 1.00 85.53  ? 353 GLU D CA  1 
ATOM   10650 C  C   . GLU D 2 323 ? 33.413  11.671  -36.898 1.00 88.74  ? 353 GLU D C   1 
ATOM   10651 O  O   . GLU D 2 323 ? 34.074  11.060  -36.055 1.00 89.42  ? 353 GLU D O   1 
ATOM   10652 C  CB  . GLU D 2 323 ? 33.645  14.162  -36.520 1.00 88.24  ? 353 GLU D CB  1 
ATOM   10653 C  CG  . GLU D 2 323 ? 34.850  14.521  -35.654 1.00 103.08 ? 353 GLU D CG  1 
ATOM   10654 C  CD  . GLU D 2 323 ? 34.532  15.261  -34.369 1.00 126.90 ? 353 GLU D CD  1 
ATOM   10655 O  OE1 . GLU D 2 323 ? 34.727  14.672  -33.281 1.00 128.87 ? 353 GLU D OE1 1 
ATOM   10656 O  OE2 . GLU D 2 323 ? 34.117  16.440  -34.447 1.00 115.16 ? 353 GLU D OE2 1 
ATOM   10657 N  N   . ASP D 2 324 ? 32.236  11.214  -37.379 1.00 83.38  ? 354 ASP D N   1 
ATOM   10658 C  CA  . ASP D 2 324 ? 31.579  9.970   -36.960 1.00 81.10  ? 354 ASP D CA  1 
ATOM   10659 C  C   . ASP D 2 324 ? 31.874  8.799   -37.895 1.00 80.92  ? 354 ASP D C   1 
ATOM   10660 O  O   . ASP D 2 324 ? 31.314  7.713   -37.726 1.00 79.74  ? 354 ASP D O   1 
ATOM   10661 C  CB  . ASP D 2 324 ? 30.069  10.189  -36.769 1.00 82.96  ? 354 ASP D CB  1 
ATOM   10662 C  CG  . ASP D 2 324 ? 29.749  11.199  -35.692 1.00 97.46  ? 354 ASP D CG  1 
ATOM   10663 O  OD1 . ASP D 2 324 ? 30.467  11.215  -34.648 1.00 99.04  ? 354 ASP D OD1 1 
ATOM   10664 O  OD2 . ASP D 2 324 ? 28.800  11.982  -35.885 1.00 104.64 ? 354 ASP D OD2 1 
ATOM   10665 N  N   . GLY D 2 325 ? 32.771  9.046   -38.845 1.00 75.07  ? 355 GLY D N   1 
ATOM   10666 C  CA  . GLY D 2 325 ? 33.240  8.067   -39.813 1.00 73.47  ? 355 GLY D CA  1 
ATOM   10667 C  C   . GLY D 2 325 ? 32.225  7.580   -40.814 1.00 73.53  ? 355 GLY D C   1 
ATOM   10668 O  O   . GLY D 2 325 ? 31.936  6.385   -40.838 1.00 70.73  ? 355 GLY D O   1 
ATOM   10669 N  N   . TYR D 2 326 ? 31.694  8.513   -41.644 1.00 71.66  ? 356 TYR D N   1 
ATOM   10670 C  CA  . TYR D 2 326 ? 30.766  8.331   -42.791 1.00 71.92  ? 356 TYR D CA  1 
ATOM   10671 C  C   . TYR D 2 326 ? 31.272  9.203   -43.947 1.00 81.96  ? 356 TYR D C   1 
ATOM   10672 O  O   . TYR D 2 326 ? 31.855  10.250  -43.681 1.00 83.41  ? 356 TYR D O   1 
ATOM   10673 C  CB  . TYR D 2 326 ? 29.330  8.791   -42.457 1.00 70.97  ? 356 TYR D CB  1 
ATOM   10674 C  CG  . TYR D 2 326 ? 28.656  7.969   -41.389 1.00 68.36  ? 356 TYR D CG  1 
ATOM   10675 C  CD1 . TYR D 2 326 ? 27.997  6.785   -41.704 1.00 68.88  ? 356 TYR D CD1 1 
ATOM   10676 C  CD2 . TYR D 2 326 ? 28.654  8.386   -40.065 1.00 67.93  ? 356 TYR D CD2 1 
ATOM   10677 C  CE1 . TYR D 2 326 ? 27.394  6.011   -40.716 1.00 67.79  ? 356 TYR D CE1 1 
ATOM   10678 C  CE2 . TYR D 2 326 ? 28.062  7.619   -39.068 1.00 67.64  ? 356 TYR D CE2 1 
ATOM   10679 C  CZ  . TYR D 2 326 ? 27.453  6.420   -39.391 1.00 74.58  ? 356 TYR D CZ  1 
ATOM   10680 O  OH  . TYR D 2 326 ? 26.909  5.660   -38.377 1.00 76.73  ? 356 TYR D OH  1 
ATOM   10681 N  N   . GLN D 2 327 ? 31.014  8.826   -45.215 1.00 81.82  ? 357 GLN D N   1 
ATOM   10682 C  CA  . GLN D 2 327 ? 31.445  9.644   -46.356 1.00 84.23  ? 357 GLN D CA  1 
ATOM   10683 C  C   . GLN D 2 327 ? 30.919  11.092  -46.196 1.00 92.60  ? 357 GLN D C   1 
ATOM   10684 O  O   . GLN D 2 327 ? 29.717  11.278  -45.973 1.00 90.91  ? 357 GLN D O   1 
ATOM   10685 C  CB  . GLN D 2 327 ? 31.045  9.005   -47.710 1.00 86.01  ? 357 GLN D CB  1 
ATOM   10686 C  CG  . GLN D 2 327 ? 32.091  9.242   -48.830 1.00 110.39 ? 357 GLN D CG  1 
ATOM   10687 C  CD  . GLN D 2 327 ? 33.044  8.081   -49.149 1.00 122.16 ? 357 GLN D CD  1 
ATOM   10688 O  OE1 . GLN D 2 327 ? 32.603  6.978   -49.497 1.00 119.16 ? 357 GLN D OE1 1 
ATOM   10689 N  NE2 . GLN D 2 327 ? 34.377  8.333   -49.158 1.00 96.76  ? 357 GLN D NE2 1 
ATOM   10690 N  N   . MET D 2 328 ? 31.858  12.092  -46.166 1.00 93.44  ? 358 MET D N   1 
ATOM   10691 C  CA  . MET D 2 328 ? 31.585  13.532  -46.002 1.00 95.10  ? 358 MET D CA  1 
ATOM   10692 C  C   . MET D 2 328 ? 30.685  14.078  -47.110 1.00 101.66 ? 358 MET D C   1 
ATOM   10693 O  O   . MET D 2 328 ? 29.720  14.794  -46.827 1.00 101.37 ? 358 MET D O   1 
ATOM   10694 C  CB  . MET D 2 328 ? 32.890  14.342  -45.979 1.00 98.45  ? 358 MET D CB  1 
ATOM   10695 C  CG  . MET D 2 328 ? 33.358  14.693  -44.601 1.00 101.91 ? 358 MET D CG  1 
ATOM   10696 S  SD  . MET D 2 328 ? 32.300  15.870  -43.747 1.00 106.29 ? 358 MET D SD  1 
ATOM   10697 C  CE  . MET D 2 328 ? 33.311  16.185  -42.281 1.00 102.72 ? 358 MET D CE  1 
ATOM   10698 N  N   . HIS D 2 329 ? 31.021  13.779  -48.369 1.00 100.10 ? 359 HIS D N   1 
ATOM   10699 C  CA  . HIS D 2 329 ? 30.238  14.276  -49.493 1.00 101.98 ? 359 HIS D CA  1 
ATOM   10700 C  C   . HIS D 2 329 ? 29.830  13.116  -50.392 1.00 102.92 ? 359 HIS D C   1 
ATOM   10701 O  O   . HIS D 2 329 ? 30.531  12.774  -51.354 1.00 103.44 ? 359 HIS D O   1 
ATOM   10702 C  CB  . HIS D 2 329 ? 30.977  15.401  -50.243 1.00 105.70 ? 359 HIS D CB  1 
ATOM   10703 C  CG  . HIS D 2 329 ? 31.518  16.447  -49.321 1.00 110.55 ? 359 HIS D CG  1 
ATOM   10704 N  ND1 . HIS D 2 329 ? 30.672  17.312  -48.632 1.00 112.84 ? 359 HIS D ND1 1 
ATOM   10705 C  CD2 . HIS D 2 329 ? 32.798  16.682  -48.938 1.00 113.22 ? 359 HIS D CD2 1 
ATOM   10706 C  CE1 . HIS D 2 329 ? 31.465  18.065  -47.885 1.00 113.07 ? 359 HIS D CE1 1 
ATOM   10707 N  NE2 . HIS D 2 329 ? 32.754  17.721  -48.031 1.00 113.54 ? 359 HIS D NE2 1 
ATOM   10708 N  N   . PRO D 2 330 ? 28.718  12.446  -50.043 1.00 95.42  ? 360 PRO D N   1 
ATOM   10709 C  CA  . PRO D 2 330 ? 28.310  11.293  -50.837 1.00 93.65  ? 360 PRO D CA  1 
ATOM   10710 C  C   . PRO D 2 330 ? 27.423  11.694  -52.002 1.00 94.66  ? 360 PRO D C   1 
ATOM   10711 O  O   . PRO D 2 330 ? 26.810  12.766  -51.983 1.00 94.05  ? 360 PRO D O   1 
ATOM   10712 C  CB  . PRO D 2 330 ? 27.586  10.410  -49.814 1.00 94.00  ? 360 PRO D CB  1 
ATOM   10713 C  CG  . PRO D 2 330 ? 27.097  11.355  -48.740 1.00 98.60  ? 360 PRO D CG  1 
ATOM   10714 C  CD  . PRO D 2 330 ? 27.776  12.693  -48.931 1.00 95.60  ? 360 PRO D CD  1 
ATOM   10715 N  N   . LYS D 2 331 ? 27.403  10.846  -53.032 1.00 89.97  ? 361 LYS D N   1 
ATOM   10716 C  CA  . LYS D 2 331 ? 26.519  11.003  -54.180 1.00 90.14  ? 361 LYS D CA  1 
ATOM   10717 C  C   . LYS D 2 331 ? 25.320  10.058  -53.906 1.00 89.04  ? 361 LYS D C   1 
ATOM   10718 O  O   . LYS D 2 331 ? 25.390  8.839   -54.124 1.00 88.05  ? 361 LYS D O   1 
ATOM   10719 C  CB  . LYS D 2 331 ? 27.254  10.749  -55.529 1.00 94.43  ? 361 LYS D CB  1 
ATOM   10720 C  CG  . LYS D 2 331 ? 26.393  10.240  -56.709 1.00 114.73 ? 361 LYS D CG  1 
ATOM   10721 C  CD  . LYS D 2 331 ? 25.548  11.307  -57.428 1.00 129.23 ? 361 LYS D CD  1 
ATOM   10722 C  CE  . LYS D 2 331 ? 24.460  10.720  -58.313 1.00 136.35 ? 361 LYS D CE  1 
ATOM   10723 N  NZ  . LYS D 2 331 ? 24.994  9.900   -59.439 1.00 139.02 ? 361 LYS D NZ  1 
ATOM   10724 N  N   . LEU D 2 332 ? 24.264  10.617  -53.315 1.00 81.44  ? 362 LEU D N   1 
ATOM   10725 C  CA  . LEU D 2 332 ? 23.095  9.806   -53.033 1.00 78.57  ? 362 LEU D CA  1 
ATOM   10726 C  C   . LEU D 2 332 ? 22.139  9.782   -54.204 1.00 81.90  ? 362 LEU D C   1 
ATOM   10727 O  O   . LEU D 2 332 ? 22.166  10.671  -55.057 1.00 82.66  ? 362 LEU D O   1 
ATOM   10728 C  CB  . LEU D 2 332 ? 22.408  10.197  -51.729 1.00 76.95  ? 362 LEU D CB  1 
ATOM   10729 C  CG  . LEU D 2 332 ? 23.320  10.328  -50.530 1.00 79.19  ? 362 LEU D CG  1 
ATOM   10730 C  CD1 . LEU D 2 332 ? 22.558  10.737  -49.336 1.00 77.64  ? 362 LEU D CD1 1 
ATOM   10731 C  CD2 . LEU D 2 332 ? 24.054  9.055   -50.267 1.00 80.52  ? 362 LEU D CD2 1 
ATOM   10732 N  N   . VAL D 2 333 ? 21.373  8.698   -54.301 1.00 77.31  ? 363 VAL D N   1 
ATOM   10733 C  CA  . VAL D 2 333 ? 20.400  8.488   -55.363 1.00 77.78  ? 363 VAL D CA  1 
ATOM   10734 C  C   . VAL D 2 333 ? 19.042  8.278   -54.718 1.00 81.88  ? 363 VAL D C   1 
ATOM   10735 O  O   . VAL D 2 333 ? 18.910  7.478   -53.782 1.00 82.46  ? 363 VAL D O   1 
ATOM   10736 C  CB  . VAL D 2 333 ? 20.802  7.322   -56.302 1.00 81.98  ? 363 VAL D CB  1 
ATOM   10737 C  CG1 . VAL D 2 333 ? 19.677  6.966   -57.264 1.00 82.49  ? 363 VAL D CG1 1 
ATOM   10738 C  CG2 . VAL D 2 333 ? 22.059  7.670   -57.083 1.00 83.04  ? 363 VAL D CG2 1 
ATOM   10739 N  N   . ILE D 2 334 ? 18.042  9.022   -55.188 1.00 76.28  ? 364 ILE D N   1 
ATOM   10740 C  CA  . ILE D 2 334 ? 16.685  8.880   -54.679 1.00 73.95  ? 364 ILE D CA  1 
ATOM   10741 C  C   . ILE D 2 334 ? 16.005  7.831   -55.517 1.00 75.82  ? 364 ILE D C   1 
ATOM   10742 O  O   . ILE D 2 334 ? 16.048  7.885   -56.746 1.00 75.80  ? 364 ILE D O   1 
ATOM   10743 C  CB  . ILE D 2 334 ? 15.934  10.219  -54.605 1.00 76.95  ? 364 ILE D CB  1 
ATOM   10744 C  CG1 . ILE D 2 334 ? 16.615  11.154  -53.591 1.00 77.46  ? 364 ILE D CG1 1 
ATOM   10745 C  CG2 . ILE D 2 334 ? 14.490  9.993   -54.204 1.00 74.81  ? 364 ILE D CG2 1 
ATOM   10746 C  CD1 . ILE D 2 334 ? 17.753  11.964  -54.119 1.00 87.79  ? 364 ILE D CD1 1 
ATOM   10747 N  N   . ILE D 2 335 ? 15.462  6.824   -54.853 1.00 71.21  ? 365 ILE D N   1 
ATOM   10748 C  CA  . ILE D 2 335 ? 14.861  5.697   -55.554 1.00 71.21  ? 365 ILE D CA  1 
ATOM   10749 C  C   . ILE D 2 335 ? 13.407  5.474   -55.179 1.00 76.43  ? 365 ILE D C   1 
ATOM   10750 O  O   . ILE D 2 335 ? 13.007  5.717   -54.041 1.00 76.66  ? 365 ILE D O   1 
ATOM   10751 C  CB  . ILE D 2 335 ? 15.720  4.405   -55.401 1.00 72.96  ? 365 ILE D CB  1 
ATOM   10752 C  CG1 . ILE D 2 335 ? 15.987  4.043   -53.919 1.00 69.86  ? 365 ILE D CG1 1 
ATOM   10753 C  CG2 . ILE D 2 335 ? 17.039  4.567   -56.173 1.00 74.56  ? 365 ILE D CG2 1 
ATOM   10754 C  CD1 . ILE D 2 335 ? 16.555  2.686   -53.690 1.00 58.97  ? 365 ILE D CD1 1 
ATOM   10755 N  N   . LEU D 2 336 ? 12.621  5.015   -56.145 1.00 73.30  ? 366 LEU D N   1 
ATOM   10756 C  CA  . LEU D 2 336 ? 11.203  4.737   -55.983 1.00 72.59  ? 366 LEU D CA  1 
ATOM   10757 C  C   . LEU D 2 336 ? 10.910  3.288   -56.354 1.00 76.45  ? 366 LEU D C   1 
ATOM   10758 O  O   . LEU D 2 336 ? 11.371  2.802   -57.391 1.00 75.61  ? 366 LEU D O   1 
ATOM   10759 C  CB  . LEU D 2 336 ? 10.397  5.697   -56.860 1.00 73.77  ? 366 LEU D CB  1 
ATOM   10760 C  CG  . LEU D 2 336 ? 8.879   5.601   -56.808 1.00 78.75  ? 366 LEU D CG  1 
ATOM   10761 C  CD1 . LEU D 2 336 ? 8.351   6.114   -55.501 1.00 79.03  ? 366 LEU D CD1 1 
ATOM   10762 C  CD2 . LEU D 2 336 ? 8.266   6.415   -57.872 1.00 79.86  ? 366 LEU D CD2 1 
ATOM   10763 N  N   . LEU D 2 337 ? 10.160  2.594   -55.492 1.00 74.00  ? 367 LEU D N   1 
ATOM   10764 C  CA  . LEU D 2 337 ? 9.774   1.203   -55.712 1.00 75.00  ? 367 LEU D CA  1 
ATOM   10765 C  C   . LEU D 2 337 ? 8.532   1.198   -56.621 1.00 85.18  ? 367 LEU D C   1 
ATOM   10766 O  O   . LEU D 2 337 ? 7.433   1.485   -56.150 1.00 85.30  ? 367 LEU D O   1 
ATOM   10767 C  CB  . LEU D 2 337 ? 9.514   0.517   -54.356 1.00 73.30  ? 367 LEU D CB  1 
ATOM   10768 C  CG  . LEU D 2 337 ? 9.058   -0.940  -54.354 1.00 77.23  ? 367 LEU D CG  1 
ATOM   10769 C  CD1 . LEU D 2 337 ? 10.053  -1.854  -55.055 1.00 77.44  ? 367 LEU D CD1 1 
ATOM   10770 C  CD2 . LEU D 2 337 ? 8.820   -1.405  -52.946 1.00 77.29  ? 367 LEU D CD2 1 
ATOM   10771 N  N   . ASN D 2 338 ? 8.713   0.912   -57.928 1.00 86.23  ? 368 ASN D N   1 
ATOM   10772 C  CA  . ASN D 2 338 ? 7.625   0.966   -58.922 1.00 88.63  ? 368 ASN D CA  1 
ATOM   10773 C  C   . ASN D 2 338 ? 6.612   -0.218  -58.879 1.00 94.89  ? 368 ASN D C   1 
ATOM   10774 O  O   . ASN D 2 338 ? 6.724   -1.113  -58.029 1.00 94.21  ? 368 ASN D O   1 
ATOM   10775 C  CB  . ASN D 2 338 ? 8.182   1.151   -60.349 1.00 90.11  ? 368 ASN D CB  1 
ATOM   10776 C  CG  . ASN D 2 338 ? 9.068   0.044   -60.870 1.00 104.12 ? 368 ASN D CG  1 
ATOM   10777 O  OD1 . ASN D 2 338 ? 8.917   -1.149  -60.553 1.00 94.98  ? 368 ASN D OD1 1 
ATOM   10778 N  ND2 . ASN D 2 338 ? 9.998   0.429   -61.725 1.00 94.74  ? 368 ASN D ND2 1 
ATOM   10779 N  N   . LYS D 2 339 ? 5.606   -0.177  -59.797 1.00 92.51  ? 369 LYS D N   1 
ATOM   10780 C  CA  . LYS D 2 339 ? 4.557   -1.188  -59.940 1.00 93.26  ? 369 LYS D CA  1 
ATOM   10781 C  C   . LYS D 2 339 ? 5.120   -2.579  -60.261 1.00 98.12  ? 369 LYS D C   1 
ATOM   10782 O  O   . LYS D 2 339 ? 4.629   -3.577  -59.727 1.00 97.23  ? 369 LYS D O   1 
ATOM   10783 C  CB  . LYS D 2 339 ? 3.520   -0.746  -60.979 1.00 97.42  ? 369 LYS D CB  1 
ATOM   10784 C  CG  . LYS D 2 339 ? 2.218   -0.239  -60.352 1.00 110.06 ? 369 LYS D CG  1 
ATOM   10785 C  CD  . LYS D 2 339 ? 2.200   1.267   -60.040 1.00 117.16 ? 369 LYS D CD  1 
ATOM   10786 C  CE  . LYS D 2 339 ? 0.936   1.645   -59.294 1.00 122.87 ? 369 LYS D CE  1 
ATOM   10787 N  NZ  . LYS D 2 339 ? 0.431   2.997   -59.659 1.00 125.30 ? 369 LYS D NZ  1 
ATOM   10788 N  N   . GLU D 2 340 ? 6.193   -2.637  -61.079 1.00 95.89  ? 370 GLU D N   1 
ATOM   10789 C  CA  . GLU D 2 340 ? 6.882   -3.888  -61.430 1.00 96.50  ? 370 GLU D CA  1 
ATOM   10790 C  C   . GLU D 2 340 ? 7.810   -4.332  -60.275 1.00 95.95  ? 370 GLU D C   1 
ATOM   10791 O  O   . GLU D 2 340 ? 8.760   -5.096  -60.488 1.00 96.01  ? 370 GLU D O   1 
ATOM   10792 C  CB  . GLU D 2 340 ? 7.666   -3.753  -62.760 1.00 99.71  ? 370 GLU D CB  1 
ATOM   10793 C  CG  . GLU D 2 340 ? 6.804   -3.565  -64.002 1.00 116.13 ? 370 GLU D CG  1 
ATOM   10794 C  CD  . GLU D 2 340 ? 6.551   -2.117  -64.376 1.00 141.56 ? 370 GLU D CD  1 
ATOM   10795 O  OE1 . GLU D 2 340 ? 5.825   -1.422  -63.629 1.00 124.05 ? 370 GLU D OE1 1 
ATOM   10796 O  OE2 . GLU D 2 340 ? 7.086   -1.677  -65.421 1.00 144.05 ? 370 GLU D OE2 1 
ATOM   10797 N  N   . ARG D 2 341 ? 7.530   -3.827  -59.053 1.00 88.18  ? 371 ARG D N   1 
ATOM   10798 C  CA  . ARG D 2 341 ? 8.228   -4.109  -57.791 1.00 84.81  ? 371 ARG D CA  1 
ATOM   10799 C  C   . ARG D 2 341 ? 9.775   -4.079  -57.920 1.00 85.63  ? 371 ARG D C   1 
ATOM   10800 O  O   . ARG D 2 341 ? 10.490  -4.934  -57.371 1.00 84.55  ? 371 ARG D O   1 
ATOM   10801 C  CB  . ARG D 2 341 ? 7.705   -5.410  -57.180 1.00 81.47  ? 371 ARG D CB  1 
ATOM   10802 C  CG  . ARG D 2 341 ? 6.283   -5.236  -56.682 1.00 82.15  ? 371 ARG D CG  1 
ATOM   10803 C  CD  . ARG D 2 341 ? 5.953   -6.163  -55.532 1.00 93.31  ? 371 ARG D CD  1 
ATOM   10804 N  NE  . ARG D 2 341 ? 6.797   -5.952  -54.350 1.00 102.45 ? 371 ARG D NE  1 
ATOM   10805 C  CZ  . ARG D 2 341 ? 6.639   -4.956  -53.484 1.00 109.03 ? 371 ARG D CZ  1 
ATOM   10806 N  NH1 . ARG D 2 341 ? 5.690   -4.048  -53.670 1.00 96.82  ? 371 ARG D NH1 1 
ATOM   10807 N  NH2 . ARG D 2 341 ? 7.437   -4.853  -52.436 1.00 87.80  ? 371 ARG D NH2 1 
ATOM   10808 N  N   . LYS D 2 342 ? 10.263  -3.052  -58.650 1.00 80.17  ? 372 LYS D N   1 
ATOM   10809 C  CA  . LYS D 2 342 ? 11.671  -2.784  -58.930 1.00 78.95  ? 372 LYS D CA  1 
ATOM   10810 C  C   . LYS D 2 342 ? 12.026  -1.365  -58.512 1.00 78.88  ? 372 LYS D C   1 
ATOM   10811 O  O   . LYS D 2 342 ? 11.201  -0.456  -58.617 1.00 77.68  ? 372 LYS D O   1 
ATOM   10812 C  CB  . LYS D 2 342 ? 11.984  -3.000  -60.425 1.00 83.69  ? 372 LYS D CB  1 
ATOM   10813 C  CG  . LYS D 2 342 ? 12.192  -4.469  -60.806 1.00 105.36 ? 372 LYS D CG  1 
ATOM   10814 C  CD  . LYS D 2 342 ? 12.291  -4.657  -62.315 1.00 122.69 ? 372 LYS D CD  1 
ATOM   10815 C  CE  . LYS D 2 342 ? 11.061  -5.327  -62.897 1.00 139.81 ? 372 LYS D CE  1 
ATOM   10816 N  NZ  . LYS D 2 342 ? 10.782  -4.914  -64.305 1.00 145.81 ? 372 LYS D NZ  1 
ATOM   10817 N  N   . TRP D 2 343 ? 13.249  -1.179  -58.015 1.00 73.42  ? 373 TRP D N   1 
ATOM   10818 C  CA  . TRP D 2 343 ? 13.709  0.134   -57.590 1.00 71.05  ? 373 TRP D CA  1 
ATOM   10819 C  C   . TRP D 2 343 ? 14.141  0.959   -58.809 1.00 77.10  ? 373 TRP D C   1 
ATOM   10820 O  O   . TRP D 2 343 ? 14.932  0.491   -59.633 1.00 77.60  ? 373 TRP D O   1 
ATOM   10821 C  CB  . TRP D 2 343 ? 14.817  0.005   -56.560 1.00 67.00  ? 373 TRP D CB  1 
ATOM   10822 C  CG  . TRP D 2 343 ? 14.321  -0.429  -55.221 1.00 65.90  ? 373 TRP D CG  1 
ATOM   10823 C  CD1 . TRP D 2 343 ? 14.455  -1.665  -54.658 1.00 68.47  ? 373 TRP D CD1 1 
ATOM   10824 C  CD2 . TRP D 2 343 ? 13.646  0.384   -54.253 1.00 64.31  ? 373 TRP D CD2 1 
ATOM   10825 N  NE1 . TRP D 2 343 ? 13.942  -1.660  -53.377 1.00 66.19  ? 373 TRP D NE1 1 
ATOM   10826 C  CE2 . TRP D 2 343 ? 13.425  -0.418  -53.111 1.00 66.84  ? 373 TRP D CE2 1 
ATOM   10827 C  CE3 . TRP D 2 343 ? 13.206  1.719   -54.237 1.00 65.30  ? 373 TRP D CE3 1 
ATOM   10828 C  CZ2 . TRP D 2 343 ? 12.796  0.075   -51.965 1.00 65.36  ? 373 TRP D CZ2 1 
ATOM   10829 C  CZ3 . TRP D 2 343 ? 12.602  2.212   -53.091 1.00 65.87  ? 373 TRP D CZ3 1 
ATOM   10830 C  CH2 . TRP D 2 343 ? 12.394  1.394   -51.975 1.00 65.67  ? 373 TRP D CH2 1 
ATOM   10831 N  N   . GLU D 2 344 ? 13.579  2.167   -58.929 1.00 72.99  ? 374 GLU D N   1 
ATOM   10832 C  CA  . GLU D 2 344 ? 13.789  3.098   -60.025 1.00 73.54  ? 374 GLU D CA  1 
ATOM   10833 C  C   . GLU D 2 344 ? 14.498  4.349   -59.518 1.00 75.34  ? 374 GLU D C   1 
ATOM   10834 O  O   . GLU D 2 344 ? 14.184  4.804   -58.426 1.00 74.51  ? 374 GLU D O   1 
ATOM   10835 C  CB  . GLU D 2 344 ? 12.406  3.467   -60.581 1.00 75.98  ? 374 GLU D CB  1 
ATOM   10836 C  CG  . GLU D 2 344 ? 12.378  4.396   -61.787 1.00 92.07  ? 374 GLU D CG  1 
ATOM   10837 C  CD  . GLU D 2 344 ? 10.972  4.716   -62.267 1.00 115.60 ? 374 GLU D CD  1 
ATOM   10838 O  OE1 . GLU D 2 344 ? 10.099  3.829   -62.125 1.00 111.90 ? 374 GLU D OE1 1 
ATOM   10839 O  OE2 . GLU D 2 344 ? 10.734  5.851   -62.745 1.00 106.84 ? 374 GLU D OE2 1 
ATOM   10840 N  N   . ARG D 2 345 ? 15.427  4.926   -60.315 1.00 70.00  ? 375 ARG D N   1 
ATOM   10841 C  CA  . ARG D 2 345 ? 16.103  6.178   -59.961 1.00 67.69  ? 375 ARG D CA  1 
ATOM   10842 C  C   . ARG D 2 345 ? 15.123  7.311   -60.262 1.00 69.98  ? 375 ARG D C   1 
AT