data_5EXU
# 
_entry.id   5EXU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5EXU         
WWPDB D_1000215018 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5EJU unspecified 
PDB . 5EB6 unspecified 
PDB . 5EB7 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5EXU 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Close, D.W.'      1 
'Langan, P.S.'     2 
'Bradbury, A.R.M.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_id_ASTM           JMOBAK 
_citation.journal_id_CSD            0070 
_citation.journal_id_ISSN           1089-8638 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            428 
_citation.language                  ? 
_citation.page_first                1776 
_citation.page_last                 1789 
_citation.title                     
'Evolution and characterization of a new reversibly photoswitching chromogenic protein, Dathail.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2016.02.029 
_citation.pdbx_database_id_PubMed   27000644 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Langan, P.S.'   1  
primary 'Close, D.W.'    2  
primary 'Coates, L.'     3  
primary 'Rocha, R.C.'    4  
primary 'Ghosh, K.'      5  
primary 'Kiss, C.'       6  
primary 'Waldo, G.'      7  
primary 'Freyer, J.'     8  
primary 'Kovalevsky, A.' 9  
primary 'Bradbury, A.R.' 10 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5EXU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     76.250 
_cell.length_a_esd                 ? 
_cell.length_b                     81.180 
_cell.length_b_esd                 ? 
_cell.length_c                     39.470 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5EXU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Reversibly photoswitching protein Dathail' 25903.100 1   ? ? ? ? 
2 water   nat water                                       18.015    126 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GSAHASVIKPEMKIKLRMEGAVNGHKFVIEGEGIGKPYEGTQTLDLTVEEGAPLPFSYDILTPAF(CRQ)NRAFTKYPED
IPDYFKQAFPEGYSWERSMTYEDQGICIATSDITMEGDCFFYEIRFDGTNFPPNGPVMQKKTLKWKSPTGKMYVEDGVLK
GDVEMALLLEGGGHYRCDFKTTYKAKKDVRLPDAHEVDHRIEILSHDKDYNKVRLYEHAEARYSGGGSGGGAS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSAHASVIKPEMKIKLRMEGAVNGHKFVIEGEGIGKPYEGTQTLDLTVEEGAPLPFSYDILTPAFQYGNRAFTKYPEDIP
DYFKQAFPEGYSWERSMTYEDQGICIATSDITMEGDCFFYEIRFDGTNFPPNGPVMQKKTLKWKSPTGKMYVEDGVLKGD
VEMALLLEGGGHYRCDFKTTYKAKKDVRLPDAHEVDHRIEILSHDKDYNKVRLYEHAEARYSGGGSGGGAS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   HIS n 
1 5   ALA n 
1 6   SER n 
1 7   VAL n 
1 8   ILE n 
1 9   LYS n 
1 10  PRO n 
1 11  GLU n 
1 12  MET n 
1 13  LYS n 
1 14  ILE n 
1 15  LYS n 
1 16  LEU n 
1 17  ARG n 
1 18  MET n 
1 19  GLU n 
1 20  GLY n 
1 21  ALA n 
1 22  VAL n 
1 23  ASN n 
1 24  GLY n 
1 25  HIS n 
1 26  LYS n 
1 27  PHE n 
1 28  VAL n 
1 29  ILE n 
1 30  GLU n 
1 31  GLY n 
1 32  GLU n 
1 33  GLY n 
1 34  ILE n 
1 35  GLY n 
1 36  LYS n 
1 37  PRO n 
1 38  TYR n 
1 39  GLU n 
1 40  GLY n 
1 41  THR n 
1 42  GLN n 
1 43  THR n 
1 44  LEU n 
1 45  ASP n 
1 46  LEU n 
1 47  THR n 
1 48  VAL n 
1 49  GLU n 
1 50  GLU n 
1 51  GLY n 
1 52  ALA n 
1 53  PRO n 
1 54  LEU n 
1 55  PRO n 
1 56  PHE n 
1 57  SER n 
1 58  TYR n 
1 59  ASP n 
1 60  ILE n 
1 61  LEU n 
1 62  THR n 
1 63  PRO n 
1 64  ALA n 
1 65  PHE n 
1 66  CRQ n 
1 67  ASN n 
1 68  ARG n 
1 69  ALA n 
1 70  PHE n 
1 71  THR n 
1 72  LYS n 
1 73  TYR n 
1 74  PRO n 
1 75  GLU n 
1 76  ASP n 
1 77  ILE n 
1 78  PRO n 
1 79  ASP n 
1 80  TYR n 
1 81  PHE n 
1 82  LYS n 
1 83  GLN n 
1 84  ALA n 
1 85  PHE n 
1 86  PRO n 
1 87  GLU n 
1 88  GLY n 
1 89  TYR n 
1 90  SER n 
1 91  TRP n 
1 92  GLU n 
1 93  ARG n 
1 94  SER n 
1 95  MET n 
1 96  THR n 
1 97  TYR n 
1 98  GLU n 
1 99  ASP n 
1 100 GLN n 
1 101 GLY n 
1 102 ILE n 
1 103 CYS n 
1 104 ILE n 
1 105 ALA n 
1 106 THR n 
1 107 SER n 
1 108 ASP n 
1 109 ILE n 
1 110 THR n 
1 111 MET n 
1 112 GLU n 
1 113 GLY n 
1 114 ASP n 
1 115 CYS n 
1 116 PHE n 
1 117 PHE n 
1 118 TYR n 
1 119 GLU n 
1 120 ILE n 
1 121 ARG n 
1 122 PHE n 
1 123 ASP n 
1 124 GLY n 
1 125 THR n 
1 126 ASN n 
1 127 PHE n 
1 128 PRO n 
1 129 PRO n 
1 130 ASN n 
1 131 GLY n 
1 132 PRO n 
1 133 VAL n 
1 134 MET n 
1 135 GLN n 
1 136 LYS n 
1 137 LYS n 
1 138 THR n 
1 139 LEU n 
1 140 LYS n 
1 141 TRP n 
1 142 LYS n 
1 143 SER n 
1 144 PRO n 
1 145 THR n 
1 146 GLY n 
1 147 LYS n 
1 148 MET n 
1 149 TYR n 
1 150 VAL n 
1 151 GLU n 
1 152 ASP n 
1 153 GLY n 
1 154 VAL n 
1 155 LEU n 
1 156 LYS n 
1 157 GLY n 
1 158 ASP n 
1 159 VAL n 
1 160 GLU n 
1 161 MET n 
1 162 ALA n 
1 163 LEU n 
1 164 LEU n 
1 165 LEU n 
1 166 GLU n 
1 167 GLY n 
1 168 GLY n 
1 169 GLY n 
1 170 HIS n 
1 171 TYR n 
1 172 ARG n 
1 173 CYS n 
1 174 ASP n 
1 175 PHE n 
1 176 LYS n 
1 177 THR n 
1 178 THR n 
1 179 TYR n 
1 180 LYS n 
1 181 ALA n 
1 182 LYS n 
1 183 LYS n 
1 184 ASP n 
1 185 VAL n 
1 186 ARG n 
1 187 LEU n 
1 188 PRO n 
1 189 ASP n 
1 190 ALA n 
1 191 HIS n 
1 192 GLU n 
1 193 VAL n 
1 194 ASP n 
1 195 HIS n 
1 196 ARG n 
1 197 ILE n 
1 198 GLU n 
1 199 ILE n 
1 200 LEU n 
1 201 SER n 
1 202 HIS n 
1 203 ASP n 
1 204 LYS n 
1 205 ASP n 
1 206 TYR n 
1 207 ASN n 
1 208 LYS n 
1 209 VAL n 
1 210 ARG n 
1 211 LEU n 
1 212 TYR n 
1 213 GLU n 
1 214 HIS n 
1 215 ALA n 
1 216 GLU n 
1 217 ALA n 
1 218 ARG n 
1 219 TYR n 
1 220 SER n 
1 221 GLY n 
1 222 GLY n 
1 223 GLY n 
1 224 SER n 
1 225 GLY n 
1 226 GLY n 
1 227 GLY n 
1 228 ALA n 
1 229 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   229 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'synthetic construct' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     32630 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    5EXU 
_struct_ref.pdbx_db_accession          5EXU 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5EXU 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 229 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             5EXU 
_struct_ref_seq.db_align_beg                  -3 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  227 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       -3 
_struct_ref_seq.pdbx_auth_seq_align_end       227 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                                  
?                           'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                                 
?                           'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                               
?                           'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                          
?                           'C4 H7 N O4'     133.103 
CRQ 'L-peptide linking' n '[2-(3-CARBAMOYL-1-IMINO-PROPYL)-4-(4-HYDROXY-BENZYLIDENE)-5-OXO-4,5-DIHYDRO-IMIDAZOL-1-YL]-ACETIC ACID' 
'CHROMOPHORE (GLN-TYR-GLY)' 'C16 H16 N4 O5'  344.322 
CYS 'L-peptide linking' y CYSTEINE                                                                                                 
?                           'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                                
?                           'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                          
?                           'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                                  
?                           'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                                
?                           'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                                    
?                           'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                               
?                           'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                                  
?                           'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                                   
?                           'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                               
?                           'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                            
?                           'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                                  
?                           'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                                                   
?                           'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                                                
?                           'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                               
?                           'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                                 
?                           'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                                   
?                           'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5EXU 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.36 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.84 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2M Magnesium Chloride, 0.1M Bis-Tris:HCl pH 6.5, 25% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS IV++' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-10-17 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.542 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.542 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5EXU 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.65 
_reflns.d_resolution_low                 32.18 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       29829 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.1 
_reflns.pdbx_Rmerge_I_obs                0.063 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.91 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.65 
_reflns_shell.d_res_low                   1.7019 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.18 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        88.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.304 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5EXU 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.650 
_refine.ls_d_res_low                             32.18 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     29523 
_refine.ls_number_reflns_R_free                  2247 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.63 
_refine.ls_percent_reflns_R_free                 7.61 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1711 
_refine.ls_R_factor_R_free                       0.2099 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1678 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             0.90 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.60 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.73 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.17 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1745 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             126 
_refine_hist.number_atoms_total               1871 
_refine_hist.d_res_high                       1.650 
_refine_hist.d_res_low                        32.18 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.016 ? ? ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.705 ? ? ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 19.00 ? ? ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.074 ? ? ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.011 ? ? ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.6501 1.6860  . . 117 1455 85.00  . . . 0.2765 . 0.2550 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6860 1.7252  . . 135 1647 96.00  . . . 0.3162 . 0.2250 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7252 1.7683  . . 156 1696 100.00 . . . 0.2151 . 0.1997 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7683 1.8161  . . 143 1699 100.00 . . . 0.2718 . 0.1820 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8161 1.8696  . . 140 1722 99.00  . . . 0.2132 . 0.1708 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8696 1.9299  . . 130 1599 93.00  . . . 0.3842 . 0.3149 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9299 1.9989  . . 140 1662 96.00  . . . 0.2342 . 0.2099 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9989 2.0789  . . 139 1724 99.00  . . . 0.2127 . 0.1806 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0789 2.1735  . . 129 1730 100.00 . . . 0.2343 . 0.1694 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1735 2.2880  . . 149 1666 97.00  . . . 0.3156 . 0.2363 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2880 2.4313  . . 134 1724 98.00  . . . 0.1915 . 0.1523 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4313 2.6190  . . 150 1746 100.00 . . . 0.1949 . 0.1501 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6190 2.8824  . . 136 1752 100.00 . . . 0.1947 . 0.1549 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8824 3.2991  . . 149 1767 100.00 . . . 0.2216 . 0.1511 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2991 4.1551  . . 141 1790 100.00 . . . 0.1848 . 0.1526 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1551 32.1867 . . 159 1897 100.00 . . . 0.1668 . 0.1469 . . . . . . . . . . 
# 
_struct.entry_id                     5EXU 
_struct.pdbx_CASP_flag               ? 
_struct.pdbx_descriptor              ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_details           ? 
_struct.pdbx_model_type_details      ? 
_struct.title                        'Reversibly photoswitching protein Dathail, Ensemble refinement' 
# 
_struct_keywords.entry_id        5EXU 
_struct_keywords.text            'Ensemble refinement, GFP, Fluorescent protein, photoswitching' 
_struct_keywords.pdbx_keywords   'FLUORESCENT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 57 ? PHE A 65 ? SER A 53 PHE A 61 5 ? 9 
HELX_P HELX_P2 AA2 ASP A 79 ? ALA A 84 ? ASP A 77 ALA A 82 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A PHE 65 C ? ? ? 1_555 A CRQ 66 N ? ? A PHE 61 A CRQ 62 1_555 ? ? ? ? ? ? ? 1.368 ? 
covale2 covale both ? A CRQ 66 C ? ? ? 1_555 A ASN 67 N ? ? A CRQ 62 A ASN 65 1_555 ? ? ? ? ? ? ? 1.298 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1   ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 1  -1.57  
2   PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 1  7.23   
3   ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 2  -8.54  
4   PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 2  9.04   
5   ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 3  1.90   
6   PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 3  12.01  
7   ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 4  5.41   
8   PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 4  0.48   
9   ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 5  -3.59  
10  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 5  7.69   
11  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 6  1.60   
12  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 6  10.95  
13  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 7  -7.96  
14  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 7  2.03   
15  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 8  -4.05  
16  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 8  11.46  
17  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 9  -9.27  
18  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 9  8.28   
19  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 10 -7.25  
20  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 10 12.60  
21  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 11 -0.99  
22  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 11 11.29  
23  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 12 -5.59  
24  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 12 9.21   
25  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 13 -3.12  
26  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 13 8.31   
27  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 14 -6.36  
28  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 14 5.64   
29  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 15 -8.94  
30  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 15 11.95  
31  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 16 -0.37  
32  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 16 8.56   
33  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 17 -13.39 
34  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 17 9.92   
35  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 18 2.83   
36  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 18 8.93   
37  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 19 -2.34  
38  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 19 7.96   
39  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 20 -8.50  
40  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 20 2.27   
41  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 21 1.16   
42  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 21 9.01   
43  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 22 -5.23  
44  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 22 6.51   
45  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 23 -4.25  
46  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 23 8.41   
47  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 24 -15.32 
48  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 24 4.30   
49  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 25 -3.78  
50  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 25 3.55   
51  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 26 -7.39  
52  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 26 3.68   
53  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 27 -8.21  
54  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 27 10.83  
55  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 28 0.46   
56  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 28 9.74   
57  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 29 -4.94  
58  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 29 9.42   
59  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 30 -3.09  
60  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 30 4.06   
61  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 31 -0.49  
62  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 31 11.59  
63  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 32 -3.76  
64  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 32 11.15  
65  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 33 -9.64  
66  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 33 7.77   
67  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 34 -2.85  
68  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 34 5.07   
69  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 35 -5.17  
70  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 35 7.47   
71  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 36 -8.06  
72  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 36 7.21   
73  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 37 3.58   
74  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 37 3.36   
75  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 38 -3.04  
76  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 38 8.99   
77  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 39 -10.04 
78  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 39 10.08  
79  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 40 -1.11  
80  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 40 11.46  
81  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 41 -6.26  
82  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 41 11.98  
83  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 42 1.27   
84  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 42 -0.93  
85  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 43 -20.19 
86  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 43 13.18  
87  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 44 -3.64  
88  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 44 5.66   
89  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 45 -1.47  
90  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 45 11.02  
91  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 46 -5.39  
92  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 46 5.80   
93  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 47 -3.62  
94  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 47 4.32   
95  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 48 -9.44  
96  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 48 9.84   
97  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 49 -4.45  
98  PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 49 7.58   
99  ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 50 -2.84  
100 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 50 9.83   
101 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 51 -0.75  
102 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 51 -1.94  
103 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 52 -2.38  
104 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 52 12.52  
105 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 53 -10.53 
106 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 53 8.80   
107 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 54 2.69   
108 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 54 10.97  
109 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 55 -7.18  
110 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 55 8.34   
111 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 56 1.25   
112 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 56 9.49   
113 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 57 -12.93 
114 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 57 8.47   
115 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 58 -5.55  
116 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 58 11.78  
117 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 59 -5.63  
118 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 59 4.31   
119 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 60 -8.33  
120 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 60 15.20  
121 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 61 -3.81  
122 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 61 8.64   
123 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 62 -3.79  
124 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 62 6.53   
125 ALA 52 A . ? ALA 48 A PRO 53 A ? PRO 49 A 63 -5.45  
126 PHE 85 A . ? PHE 83 A PRO 86 A ? PRO 84 A 63 3.22   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 11 ? 
AA2 ? 5  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? anti-parallel 
AA1 4  5  ? anti-parallel 
AA1 5  6  ? anti-parallel 
AA1 6  7  ? parallel      
AA1 7  8  ? anti-parallel 
AA1 8  9  ? anti-parallel 
AA1 9  10 ? anti-parallel 
AA1 10 11 ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  THR A 138 ? TRP A 141 ? THR A 136 TRP A 139 
AA1 2  VAL A 154 ? LEU A 165 ? VAL A 152 LEU A 163 
AA1 3  HIS A 170 ? ALA A 181 ? HIS A 168 ALA A 179 
AA1 4  TYR A 89  ? TYR A 97  ? TYR A 87  TYR A 95  
AA1 5  ILE A 102 ? GLU A 112 ? ILE A 100 GLU A 110 
AA1 6  CYS A 115 ? THR A 125 ? CYS A 113 THR A 123 
AA1 7  MET A 12  ? VAL A 22  ? MET A 8   VAL A 18  
AA1 8  HIS A 25  ? LYS A 36  ? HIS A 21  LYS A 32  
AA1 9  THR A 41  ? GLU A 50  ? THR A 37  GLU A 46  
AA1 10 LYS A 208 ? HIS A 214 ? LYS A 206 HIS A 212 
AA1 11 ARG A 196 ? HIS A 202 ? ARG A 194 HIS A 200 
AA2 1  THR A 138 ? TRP A 141 ? THR A 136 TRP A 139 
AA2 2  VAL A 154 ? LEU A 165 ? VAL A 152 LEU A 163 
AA2 3  THR A 145 ? GLU A 151 ? THR A 143 GLU A 149 
AA2 4  HIS A 191 ? ASP A 194 ? HIS A 189 ASP A 192 
AA2 5  ALA A 217 ? ARG A 218 ? ALA A 215 ARG A 216 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N LEU A 139 ? N LEU A 137 O LEU A 164 ? O LEU A 162 
AA1 2  3  N LEU A 163 ? N LEU A 161 O TYR A 171 ? O TYR A 169 
AA1 3  4  O LYS A 176 ? O LYS A 174 N SER A 94  ? N SER A 92  
AA1 4  5  N ARG A 93  ? N ARG A 91  O ALA A 105 ? O ALA A 103 
AA1 5  6  N ILE A 104 ? N ILE A 102 O ASP A 123 ? O ASP A 121 
AA1 6  7  O PHE A 116 ? O PHE A 114 N LYS A 13  ? N LYS A 9   
AA1 7  8  N VAL A 22  ? N VAL A 18  O HIS A 25  ? O HIS A 21  
AA1 8  9  N GLU A 30  ? N GLU A 26  O THR A 47  ? O THR A 43  
AA1 9  10 N LEU A 46  ? N LEU A 42  O VAL A 209 ? O VAL A 207 
AA1 10 11 O ARG A 210 ? O ARG A 208 N SER A 201 ? N SER A 199 
AA2 1  2  N LEU A 139 ? N LEU A 137 O LEU A 164 ? O LEU A 162 
AA2 2  3  O LYS A 156 ? O LYS A 154 N TYR A 149 ? N TYR A 147 
AA2 3  4  N MET A 148 ? N MET A 146 O HIS A 191 ? O HIS A 189 
AA2 4  5  N GLU A 192 ? N GLU A 190 O ARG A 218 ? O ARG A 216 
# 
_atom_sites.entry_id                    5EXU 
_atom_sites.fract_transf_matrix[1][1]   0.013115 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012318 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.025336 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N N    . SER A 1 6   ? -3.594  -5.009  -12.236 0.016 36.79 ? 2   SER A N    1  
ATOM   2      C CA   . SER A 1 6   ? -3.769  -6.011  -13.273 0.016 37.67 ? 2   SER A CA   1  
ATOM   3      C C    . SER A 1 6   ? -5.225  -6.034  -13.681 0.016 36.62 ? 2   SER A C    1  
ATOM   4      O O    . SER A 1 6   ? -6.120  -6.311  -12.876 0.016 35.01 ? 2   SER A O    1  
ATOM   5      C CB   . SER A 1 6   ? -3.279  -7.374  -12.772 0.016 37.90 ? 2   SER A CB   1  
ATOM   6      O OG   . SER A 1 6   ? -3.272  -8.373  -13.794 0.016 39.17 ? 2   SER A OG   1  
ATOM   7      H HA   . SER A 1 6   ? -3.243  -5.768  -14.051 0.016 38.94 ? 2   SER A HA   1  
ATOM   8      H HB2  . SER A 1 6   ? -2.378  -7.260  -12.432 0.016 38.44 ? 2   SER A HB2  1  
ATOM   9      H HB3  . SER A 1 6   ? -3.860  -7.665  -12.053 0.016 36.73 ? 2   SER A HB3  1  
ATOM   10     H HG   . SER A 1 6   ? -4.050  -8.654  -13.938 0.016 38.62 ? 2   SER A HG   1  
ATOM   11     N N    . VAL A 1 7   ? -5.461  -5.668  -14.944 0.016 37.66 ? 3   VAL A N    1  
ATOM   12     C CA   . VAL A 1 7   ? -6.821  -5.457  -15.457 0.016 36.92 ? 3   VAL A CA   1  
ATOM   13     C C    . VAL A 1 7   ? -7.535  -4.268  -14.825 0.016 35.46 ? 3   VAL A C    1  
ATOM   14     O O    . VAL A 1 7   ? -8.260  -3.545  -15.531 0.016 35.59 ? 3   VAL A O    1  
ATOM   15     C CB   . VAL A 1 7   ? -7.736  -6.680  -15.269 0.016 36.17 ? 3   VAL A CB   1  
ATOM   16     C CG1  . VAL A 1 7   ? -9.066  -6.412  -15.911 0.016 35.77 ? 3   VAL A CG1  1  
ATOM   17     C CG2  . VAL A 1 7   ? -7.109  -7.945  -15.852 0.016 37.62 ? 3   VAL A CG2  1  
ATOM   18     H H    . VAL A 1 7   ? -4.845  -5.538  -15.522 0.016 38.88 ? 3   VAL A H    1  
ATOM   19     H HA   . VAL A 1 7   ? -6.756  -5.285  -16.411 0.016 38.01 ? 3   VAL A HA   1  
ATOM   20     H HB   . VAL A 1 7   ? -7.883  -6.818  -14.323 0.016 35.10 ? 3   VAL A HB   1  
ATOM   21     H HG11 . VAL A 1 7   ? -9.455  -7.236  -16.236 0.016 36.35 ? 3   VAL A HG11 1  
ATOM   22     H HG12 . VAL A 1 7   ? -9.657  -6.012  -15.254 0.016 34.49 ? 3   VAL A HG12 1  
ATOM   23     H HG13 . VAL A 1 7   ? -8.925  -5.805  -16.651 0.016 36.34 ? 3   VAL A HG13 1  
ATOM   24     H HG21 . VAL A 1 7   ? -7.748  -8.389  -16.429 0.016 37.62 ? 3   VAL A HG21 1  
ATOM   25     H HG22 . VAL A 1 7   ? -6.324  -7.696  -16.365 0.016 38.88 ? 3   VAL A HG22 1  
ATOM   26     H HG23 . VAL A 1 7   ? -6.854  -8.537  -15.127 0.016 37.37 ? 3   VAL A HG23 1  
ATOM   27     N N    . ILE A 1 8   ? -7.397  -4.057  -13.520 0.016 34.21 ? 4   ILE A N    1  
ATOM   28     C CA   . ILE A 1 8   ? -7.767  -2.786  -12.905 0.016 33.20 ? 4   ILE A CA   1  
ATOM   29     C C    . ILE A 1 8   ? -6.546  -1.877  -13.017 0.016 34.37 ? 4   ILE A C    1  
ATOM   30     O O    . ILE A 1 8   ? -5.499  -2.149  -12.424 0.016 34.94 ? 4   ILE A O    1  
ATOM   31     C CB   . ILE A 1 8   ? -8.222  -2.975  -11.449 0.016 31.61 ? 4   ILE A CB   1  
ATOM   32     C CG1  . ILE A 1 8   ? -9.602  -3.655  -11.366 0.016 30.55 ? 4   ILE A CG1  1  
ATOM   33     C CG2  . ILE A 1 8   ? -8.222  -1.666  -10.700 0.016 30.89 ? 4   ILE A CG2  1  
ATOM   34     C CD1  . ILE A 1 8   ? -10.556 -3.324  -12.473 0.016 30.60 ? 4   ILE A CD1  1  
ATOM   35     H H    . ILE A 1 8   ? -7.102  -4.633  -12.959 0.016 33.97 ? 4   ILE A H    1  
ATOM   36     H HA   . ILE A 1 8   ? -8.474  -2.367  -13.415 0.016 33.02 ? 4   ILE A HA   1  
ATOM   37     H HB   . ILE A 1 8   ? -7.583  -3.560  -11.013 0.016 31.89 ? 4   ILE A HB   1  
ATOM   38     H HG12 . ILE A 1 8   ? -9.475  -4.618  -11.373 0.016 30.93 ? 4   ILE A HG12 1  
ATOM   39     H HG13 . ILE A 1 8   ? -10.025 -3.400  -10.533 0.016 29.57 ? 4   ILE A HG13 1  
ATOM   40     H HG21 . ILE A 1 8   ? -7.304  -1.398  -10.536 0.016 31.21 ? 4   ILE A HG21 1  
ATOM   41     H HG22 . ILE A 1 8   ? -8.675  -0.989  -11.229 0.016 31.31 ? 4   ILE A HG22 1  
ATOM   42     H HG23 . ILE A 1 8   ? -8.680  -1.788  -9.853  0.016 29.83 ? 4   ILE A HG23 1  
ATOM   43     H HD11 . ILE A 1 8   ? -10.204 -3.648  -13.315 0.016 31.61 ? 4   ILE A HD11 1  
ATOM   44     H HD12 . ILE A 1 8   ? -11.405 -3.758  -12.293 0.016 29.85 ? 4   ILE A HD12 1  
ATOM   45     H HD13 . ILE A 1 8   ? -10.674 -2.361  -12.508 0.016 30.49 ? 4   ILE A HD13 1  
ATOM   46     N N    . LYS A 1 9   ? -6.667  -0.807  -13.805 0.016 34.88 ? 5   LYS A N    1  
ATOM   47     C CA   . LYS A 1 9   ? -5.536  0.076   -14.091 0.016 36.31 ? 5   LYS A CA   1  
ATOM   48     C C    . LYS A 1 9   ? -5.499  1.252   -13.119 0.016 35.56 ? 5   LYS A C    1  
ATOM   49     O O    . LYS A 1 9   ? -6.460  1.484   -12.390 0.016 33.95 ? 5   LYS A O    1  
ATOM   50     C CB   . LYS A 1 9   ? -5.622  0.608   -15.523 0.016 37.59 ? 5   LYS A CB   1  
ATOM   51     C CG   . LYS A 1 9   ? -5.835  -0.462  -16.589 0.016 38.50 ? 5   LYS A CG   1  
ATOM   52     C CD   . LYS A 1 9   ? -5.111  -1.777  -16.233 0.016 38.90 ? 5   LYS A CD   1  
ATOM   53     C CE   . LYS A 1 9   ? -5.028  -2.726  -17.436 0.016 40.49 ? 5   LYS A CE   1  
ATOM   54     N NZ   . LYS A 1 9   ? -4.285  -3.986  -17.139 0.016 40.83 ? 5   LYS A NZ   1  
ATOM   55     H H    . LYS A 1 9   ? -7.397  -0.582  -14.195 0.016 34.49 ? 5   LYS A H    1  
ATOM   56     H HA   . LYS A 1 9   ? -4.711  -0.422  -13.992 0.016 37.13 ? 5   LYS A HA   1  
ATOM   57     H HB2  . LYS A 1 9   ? -6.361  1.229   -15.581 0.016 36.88 ? 5   LYS A HB2  1  
ATOM   58     H HB3  . LYS A 1 9   ? -4.797  1.068   -15.731 0.016 38.73 ? 5   LYS A HB3  1  
ATOM   59     H HG2  . LYS A 1 9   ? -6.783  -0.647  -16.674 0.016 37.64 ? 5   LYS A HG2  1  
ATOM   60     H HG3  . LYS A 1 9   ? -5.483  -0.142  -17.434 0.016 39.83 ? 5   LYS A HG3  1  
ATOM   61     H HD2  . LYS A 1 9   ? -4.205  -1.579  -15.945 0.016 39.49 ? 5   LYS A HD2  1  
ATOM   62     H HD3  . LYS A 1 9   ? -5.594  -2.232  -15.528 0.016 37.67 ? 5   LYS A HD3  1  
ATOM   63     H HE2  . LYS A 1 9   ? -5.925  -2.968  -17.715 0.016 40.08 ? 5   LYS A HE2  1  
ATOM   64     H HE3  . LYS A 1 9   ? -4.568  -2.276  -18.160 0.016 41.87 ? 5   LYS A HE3  1  
ATOM   65     H HZ1  . LYS A 1 9   ? -4.220  -4.090  -16.260 0.016 39.92 ? 5   LYS A HZ1  1  
ATOM   66     H HZ2  . LYS A 1 9   ? -4.714  -4.685  -17.486 0.016 40.74 ? 5   LYS A HZ2  1  
ATOM   67     H HZ3  . LYS A 1 9   ? -3.465  -3.945  -17.481 0.016 42.14 ? 5   LYS A HZ3  1  
ATOM   68     N N    . PRO A 1 10  ? -4.381  1.988   -13.060 0.016 36.87 ? 6   PRO A N    1  
ATOM   69     C CA   . PRO A 1 10  ? -4.366  3.210   -12.235 0.016 36.41 ? 6   PRO A CA   1  
ATOM   70     C C    . PRO A 1 10  ? -5.483  4.174   -12.599 0.016 35.53 ? 6   PRO A C    1  
ATOM   71     O O    . PRO A 1 10  ? -5.855  5.035   -11.786 0.016 34.62 ? 6   PRO A O    1  
ATOM   72     C CB   . PRO A 1 10  ? -2.992  3.823   -12.522 0.016 38.45 ? 6   PRO A CB   1  
ATOM   73     C CG   . PRO A 1 10  ? -2.148  2.689   -12.984 0.016 39.62 ? 6   PRO A CG   1  
ATOM   74     C CD   . PRO A 1 10  ? -3.076  1.740   -13.700 0.016 38.91 ? 6   PRO A CD   1  
ATOM   75     H HA   . PRO A 1 10  ? -4.421  2.981   -11.294 0.016 35.65 ? 6   PRO A HA   1  
ATOM   76     H HB2  . PRO A 1 10  ? -3.077  4.493   -13.217 0.016 39.07 ? 6   PRO A HB2  1  
ATOM   77     H HB3  . PRO A 1 10  ? -2.634  4.213   -11.709 0.016 38.40 ? 6   PRO A HB3  1  
ATOM   78     H HG2  . PRO A 1 10  ? -1.477  3.028   -13.597 0.016 41.10 ? 6   PRO A HG2  1  
ATOM   79     H HG3  . PRO A 1 10  ? -1.732  2.257   -12.222 0.016 39.44 ? 6   PRO A HG3  1  
ATOM   80     H HD2  . PRO A 1 10  ? -3.105  1.950   -14.646 0.016 39.81 ? 6   PRO A HD2  1  
ATOM   81     H HD3  . PRO A 1 10  ? -2.797  0.823   -13.550 0.016 38.95 ? 6   PRO A HD3  1  
ATOM   82     N N    . GLU A 1 11  ? -6.011  4.058   -13.814 0.016 35.97 ? 7   GLU A N    1  
ATOM   83     C CA   . GLU A 1 11  ? -7.106  4.884   -14.282 0.016 35.22 ? 7   GLU A CA   1  
ATOM   84     C C    . GLU A 1 11  ? -8.189  3.980   -14.844 0.016 34.82 ? 7   GLU A C    1  
ATOM   85     O O    . GLU A 1 11  ? -7.899  3.051   -15.611 0.016 36.02 ? 7   GLU A O    1  
ATOM   86     C CB   . GLU A 1 11  ? -6.655  5.887   -15.341 0.016 36.69 ? 7   GLU A CB   1  
ATOM   87     C CG   . GLU A 1 11  ? -7.318  7.250   -15.145 0.016 35.83 ? 7   GLU A CG   1  
ATOM   88     C CD   . GLU A 1 11  ? -6.760  8.025   -13.945 0.016 36.25 ? 7   GLU A CD   1  
ATOM   89     O OE1  . GLU A 1 11  ? -5.699  8.637   -14.112 0.016 37.99 ? 7   GLU A OE1  1  
ATOM   90     O OE2  . GLU A 1 11  ? -7.365  8.054   -12.845 0.016 34.97 ? 7   GLU A OE2  1  
ATOM   91     H H    . GLU A 1 11  ? -5.752  3.482   -14.395 0.016 36.79 ? 7   GLU A H    1  
ATOM   92     H HA   . GLU A 1 11  ? -7.479  5.374   -13.535 0.016 34.11 ? 7   GLU A HA   1  
ATOM   93     H HB2  . GLU A 1 11  ? -5.694  6.003   -15.289 0.016 37.29 ? 7   GLU A HB2  1  
ATOM   94     H HB3  . GLU A 1 11  ? -6.906  5.548   -16.213 0.016 37.72 ? 7   GLU A HB3  1  
ATOM   95     H HG2  . GLU A 1 11  ? -7.166  7.786   -15.939 0.016 36.48 ? 7   GLU A HG2  1  
ATOM   96     H HG3  . GLU A 1 11  ? -8.269  7.119   -15.004 0.016 34.49 ? 7   GLU A HG3  1  
ATOM   97     N N    . MET A 1 12  ? -9.429  4.238   -14.443 0.016 33.26 ? 8   MET A N    1  
ATOM   98     C CA   . MET A 1 12  ? -10.575 3.513   -14.963 0.016 32.85 ? 8   MET A CA   1  
ATOM   99     C C    . MET A 1 12  ? -11.696 4.493   -15.266 0.016 32.41 ? 8   MET A C    1  
ATOM   100    O O    . MET A 1 12  ? -12.186 5.189   -14.373 0.016 31.39 ? 8   MET A O    1  
ATOM   101    C CB   . MET A 1 12  ? -11.039 2.443   -13.979 0.016 31.42 ? 8   MET A CB   1  
ATOM   102    C CG   . MET A 1 12  ? -10.135 1.202   -13.920 0.016 31.95 ? 8   MET A CG   1  
ATOM   103    S SD   . MET A 1 12  ? -10.006 0.316   -15.491 0.016 33.41 ? 8   MET A SD   1  
ATOM   104    C CE   . MET A 1 12  ? -11.627 -0.488  -15.566 0.016 32.09 ? 8   MET A CE   1  
ATOM   105    H H    . MET A 1 12  ? -9.629  4.832   -13.855 0.016 32.49 ? 8   MET A H    1  
ATOM   106    H HA   . MET A 1 12  ? -10.329 3.072   -15.789 0.016 33.91 ? 8   MET A HA   1  
ATOM   107    H HB2  . MET A 1 12  ? -11.060 2.827   -13.088 0.016 30.59 ? 8   MET A HB2  1  
ATOM   108    H HB3  . MET A 1 12  ? -11.928 2.154   -14.238 0.016 31.05 ? 8   MET A HB3  1  
ATOM   109    H HG2  . MET A 1 12  ? -9.242  1.478   -13.663 0.016 32.58 ? 8   MET A HG2  1  
ATOM   110    H HG3  . MET A 1 12  ? -10.487 0.583   -13.264 0.016 31.02 ? 8   MET A HG3  1  
ATOM   111    H HE1  . MET A 1 12  ? -11.610 -1.189  -16.238 0.016 32.85 ? 8   MET A HE1  1  
ATOM   112    H HE2  . MET A 1 12  ? -11.830 -0.869  -14.698 0.016 31.25 ? 8   MET A HE2  1  
ATOM   113    H HE3  . MET A 1 12  ? -12.297 0.176   -15.797 0.016 31.61 ? 8   MET A HE3  1  
ATOM   114    N N    . LYS A 1 13  ? -12.085 4.552   -16.531 0.016 33.30 ? 9   LYS A N    1  
ATOM   115    C CA   . LYS A 1 13  ? -13.248 5.325   -16.928 0.016 32.94 ? 9   LYS A CA   1  
ATOM   116    C C    . LYS A 1 13  ? -14.533 4.697   -16.390 0.016 31.41 ? 9   LYS A C    1  
ATOM   117    O O    . LYS A 1 13  ? -14.576 3.537   -15.968 0.016 30.85 ? 9   LYS A O    1  
ATOM   118    C CB   . LYS A 1 13  ? -13.329 5.415   -18.449 0.016 34.68 ? 9   LYS A CB   1  
ATOM   119    C CG   . LYS A 1 13  ? -12.190 6.142   -19.084 0.016 36.47 ? 9   LYS A CG   1  
ATOM   120    C CD   . LYS A 1 13  ? -12.398 6.173   -20.570 0.016 38.33 ? 9   LYS A CD   1  
ATOM   121    C CE   . LYS A 1 13  ? -11.140 6.524   -21.316 0.016 40.45 ? 9   LYS A CE   1  
ATOM   122    N NZ   . LYS A 1 13  ? -11.237 5.945   -22.668 0.016 42.24 ? 9   LYS A NZ   1  
ATOM   123    H H    . LYS A 1 13  ? -11.687 4.163   -17.185 0.016 34.22 ? 9   LYS A H    1  
ATOM   124    H HA   . LYS A 1 13  ? -13.169 6.221   -16.569 0.016 32.72 ? 9   LYS A HA   1  
ATOM   125    H HB2  . LYS A 1 13  ? -13.332 4.516   -18.811 0.016 35.00 ? 9   LYS A HB2  1  
ATOM   126    H HB3  . LYS A 1 13  ? -14.151 5.870   -18.691 0.016 34.48 ? 9   LYS A HB3  1  
ATOM   127    H HG2  . LYS A 1 13  ? -12.159 7.053   -18.753 0.016 36.32 ? 9   LYS A HG2  1  
ATOM   128    H HG3  . LYS A 1 13  ? -11.358 5.679   -18.894 0.016 36.76 ? 9   LYS A HG3  1  
ATOM   129    H HD2  . LYS A 1 13  ? -12.696 5.299   -20.861 0.016 38.37 ? 9   LYS A HD2  1  
ATOM   130    H HD3  . LYS A 1 13  ? -13.065 6.843   -20.785 0.016 38.28 ? 9   LYS A HD3  1  
ATOM   131    H HE2  . LYS A 1 13  ? -11.068 7.487   -21.396 0.016 40.93 ? 9   LYS A HE2  1  
ATOM   132    H HE3  . LYS A 1 13  ? -10.364 6.159   -20.865 0.016 40.32 ? 9   LYS A HE3  1  
ATOM   133    H HZ1  . LYS A 1 13  ? -11.259 6.594   -23.276 0.016 43.05 ? 9   LYS A HZ1  1  
ATOM   134    H HZ2  . LYS A 1 13  ? -10.532 5.423   -22.824 0.016 43.25 ? 9   LYS A HZ2  1  
ATOM   135    H HZ3  . LYS A 1 13  ? -11.977 5.457   -22.738 0.016 41.65 ? 9   LYS A HZ3  1  
ATOM   136    N N    . ILE A 1 14  ? -15.603 5.478   -16.464 0.016 30.90 ? 10  ILE A N    1  
ATOM   137    C CA   . ILE A 1 14  ? -16.917 5.105   -15.971 0.016 29.67 ? 10  ILE A CA   1  
ATOM   138    C C    . ILE A 1 14  ? -17.970 5.561   -16.966 0.016 30.35 ? 10  ILE A C    1  
ATOM   139    O O    . ILE A 1 14  ? -17.910 6.696   -17.462 0.016 31.01 ? 10  ILE A O    1  
ATOM   140    C CB   . ILE A 1 14  ? -17.209 5.752   -14.605 0.016 28.15 ? 10  ILE A CB   1  
ATOM   141    C CG1  . ILE A 1 14  ? -16.024 5.618   -13.655 0.016 27.68 ? 10  ILE A CG1  1  
ATOM   142    C CG2  . ILE A 1 14  ? -18.488 5.183   -14.037 0.016 27.08 ? 10  ILE A CG2  1  
ATOM   143    C CD1  . ILE A 1 14  ? -16.181 6.468   -12.388 0.016 26.78 ? 10  ILE A CD1  1  
ATOM   144    H H    . ILE A 1 14  ? -15.581 6.267   -16.804 0.016 31.34 ? 10  ILE A H    1  
ATOM   145    H HA   . ILE A 1 14  ? -16.969 4.143   -15.877 0.016 29.51 ? 10  ILE A HA   1  
ATOM   146    H HB   . ILE A 1 14  ? -17.354 6.698   -14.761 0.016 28.35 ? 10  ILE A HB   1  
ATOM   147    H HG12 . ILE A 1 14  ? -15.935 4.693   -13.379 0.016 27.21 ? 10  ILE A HG12 1  
ATOM   148    H HG13 . ILE A 1 14  ? -15.215 5.909   -14.097 0.016 28.55 ? 10  ILE A HG13 1  
ATOM   149    H HG21 . ILE A 1 14  ? -18.606 5.497   -13.129 0.016 26.19 ? 10  ILE A HG21 1  
ATOM   150    H HG22 . ILE A 1 14  ? -19.235 5.470   -14.583 0.016 27.36 ? 10  ILE A HG22 1  
ATOM   151    H HG23 . ILE A 1 14  ? -18.431 4.216   -14.048 0.016 27.13 ? 10  ILE A HG23 1  
ATOM   152    H HD11 . ILE A 1 14  ? -16.953 6.154   -11.893 0.016 25.98 ? 10  ILE A HD11 1  
ATOM   153    H HD12 . ILE A 1 14  ? -15.386 6.385   -11.838 0.016 26.62 ? 10  ILE A HD12 1  
ATOM   154    H HD13 . ILE A 1 14  ? -16.309 7.393   -12.648 0.016 27.28 ? 10  ILE A HD13 1  
ATOM   155    N N    . LYS A 1 15  ? -18.929 4.684   -17.250 0.016 30.32 ? 11  LYS A N    1  
ATOM   156    C CA   . LYS A 1 15  ? -20.214 5.023   -17.861 0.016 30.65 ? 11  LYS A CA   1  
ATOM   157    C C    . LYS A 1 15  ? -21.313 4.409   -17.018 0.016 29.33 ? 11  LYS A C    1  
ATOM   158    O O    . LYS A 1 15  ? -21.168 3.276   -16.536 0.016 28.79 ? 11  LYS A O    1  
ATOM   159    C CB   . LYS A 1 15  ? -20.366 4.492   -19.307 0.016 32.43 ? 11  LYS A CB   1  
ATOM   160    C CG   . LYS A 1 15  ? -21.870 4.199   -19.731 0.016 32.66 ? 11  LYS A CG   1  
ATOM   161    C CD   . LYS A 1 15  ? -22.332 2.725   -19.468 0.016 32.21 ? 11  LYS A CD   1  
ATOM   162    C CE   . LYS A 1 15  ? -23.870 2.472   -19.540 0.016 32.14 ? 11  LYS A CE   1  
ATOM   163    N NZ   . LYS A 1 15  ? -24.303 1.263   -18.679 0.016 31.11 ? 11  LYS A NZ   1  
ATOM   164    H H    . LYS A 1 15  ? -18.862 3.849   -17.075 0.016 30.17 ? 11  LYS A H    1  
ATOM   165    H HA   . LYS A 1 15  ? -20.334 5.983   -17.871 0.016 30.69 ? 11  LYS A HA   1  
ATOM   166    H HB2  . LYS A 1 15  ? -19.998 5.146   -19.920 0.016 33.40 ? 11  LYS A HB2  1  
ATOM   167    H HB3  . LYS A 1 15  ? -19.872 3.661   -19.386 0.016 32.64 ? 11  LYS A HB3  1  
ATOM   168    H HG2  . LYS A 1 15  ? -22.471 4.791   -19.255 0.016 31.96 ? 11  LYS A HG2  1  
ATOM   169    H HG3  . LYS A 1 15  ? -21.957 4.363   -20.683 0.016 33.99 ? 11  LYS A HG3  1  
ATOM   170    H HD2  . LYS A 1 15  ? -21.924 2.158   -20.142 0.016 33.22 ? 11  LYS A HD2  1  
ATOM   171    H HD3  . LYS A 1 15  ? -22.035 2.450   -18.587 0.016 31.11 ? 11  LYS A HD3  1  
ATOM   172    H HE2  . LYS A 1 15  ? -24.335 3.258   -19.216 0.016 31.62 ? 11  LYS A HE2  1  
ATOM   173    H HE3  . LYS A 1 15  ? -24.122 2.296   -20.458 0.016 33.41 ? 11  LYS A HE3  1  
ATOM   174    H HZ1  . LYS A 1 15  ? -23.952 1.326   -17.865 0.016 30.04 ? 11  LYS A HZ1  1  
ATOM   175    H HZ2  . LYS A 1 15  ? -25.188 1.231   -18.604 0.016 31.17 ? 11  LYS A HZ2  1  
ATOM   176    H HZ3  . LYS A 1 15  ? -24.019 0.509   -19.053 0.016 31.61 ? 11  LYS A HZ3  1  
ATOM   177    N N    . LEU A 1 16  ? -22.411 5.138   -16.839 0.016 28.94 ? 12  LEU A N    1  
ATOM   178    C CA   . LEU A 1 16  ? -23.567 4.579   -16.156 0.016 27.97 ? 12  LEU A CA   1  
ATOM   179    C C    . LEU A 1 16  ? -24.860 5.102   -16.761 0.016 28.50 ? 12  LEU A C    1  
ATOM   180    O O    . LEU A 1 16  ? -24.895 6.158   -17.405 0.016 29.25 ? 12  LEU A O    1  
ATOM   181    C CB   . LEU A 1 16  ? -23.552 4.885   -14.649 0.016 26.39 ? 12  LEU A CB   1  
ATOM   182    C CG   . LEU A 1 16  ? -23.611 6.341   -14.182 0.016 25.97 ? 12  LEU A CG   1  
ATOM   183    C CD1  . LEU A 1 16  ? -25.046 6.813   -14.051 0.016 25.64 ? 12  LEU A CD1  1  
ATOM   184    C CD2  . LEU A 1 16  ? -22.880 6.491   -12.847 0.016 24.95 ? 12  LEU A CD2  1  
ATOM   185    H H    . LEU A 1 16  ? -22.505 5.947   -17.105 0.016 29.30 ? 12  LEU A H    1  
ATOM   186    H HA   . LEU A 1 16  ? -23.564 3.615   -16.262 0.016 28.13 ? 12  LEU A HA   1  
ATOM   187    H HB2  . LEU A 1 16  ? -24.323 4.448   -14.257 0.016 25.92 ? 12  LEU A HB2  1  
ATOM   188    H HB3  . LEU A 1 16  ? -22.742 4.498   -14.279 0.016 26.15 ? 12  LEU A HB3  1  
ATOM   189    H HG   . LEU A 1 16  ? -23.165 6.896   -14.838 0.016 26.75 ? 12  LEU A HG   1  
ATOM   190    H HD11 . LEU A 1 16  ? -25.055 7.782   -14.062 0.016 25.69 ? 12  LEU A HD11 1  
ATOM   191    H HD12 . LEU A 1 16  ? -25.575 6.473   -14.783 0.016 26.30 ? 12  LEU A HD12 1  
ATOM   192    H HD13 . LEU A 1 16  ? -25.409 6.494   -13.211 0.016 24.83 ? 12  LEU A HD13 1  
ATOM   193    H HD21 . LEU A 1 16  ? -23.354 7.123   -12.290 0.016 24.42 ? 12  LEU A HD21 1  
ATOM   194    H HD22 . LEU A 1 16  ? -22.851 5.630   -12.405 0.016 24.53 ? 12  LEU A HD22 1  
ATOM   195    H HD23 . LEU A 1 16  ? -21.976 6.797   -13.016 0.016 25.37 ? 12  LEU A HD23 1  
ATOM   196    N N    . ARG A 1 17  ? -25.920 4.333   -16.516 0.016 28.19 ? 13  ARG A N    1  
ATOM   197    C CA   . ARG A 1 17  ? -27.305 4.709   -16.766 0.016 28.50 ? 13  ARG A CA   1  
ATOM   198    C C    . ARG A 1 17  ? -28.137 4.309   -15.558 0.016 27.31 ? 13  ARG A C    1  
ATOM   199    O O    . ARG A 1 17  ? -28.093 3.161   -15.109 0.016 26.95 ? 13  ARG A O    1  
ATOM   200    C CB   . ARG A 1 17  ? -27.877 4.058   -18.032 0.016 30.15 ? 13  ARG A CB   1  
ATOM   201    C CG   . ARG A 1 17  ? -29.325 4.514   -18.296 0.016 30.54 ? 13  ARG A CG   1  
ATOM   202    C CD   . ARG A 1 17  ? -29.883 4.133   -19.660 0.016 32.53 ? 13  ARG A CD   1  
ATOM   203    N NE   . ARG A 1 17  ? -31.320 3.846   -19.591 0.016 32.88 ? 13  ARG A NE   1  
ATOM   204    C CZ   . ARG A 1 17  ? -32.301 4.664   -19.946 0.016 33.77 ? 13  ARG A CZ   1  
ATOM   205    N NH1  . ARG A 1 17  ? -32.045 5.863   -20.477 0.016 34.51 ? 13  ARG A NH1  1  
ATOM   206    N NH2  . ARG A 1 17  ? -33.557 4.260   -19.809 0.016 34.11 ? 13  ARG A NH2  1  
ATOM   207    H H    . ARG A 1 17  ? -25.852 3.547   -16.176 0.016 27.86 ? 13  ARG A H    1  
ATOM   208    H HA   . ARG A 1 17  ? -27.359 5.670   -16.878 0.016 28.55 ? 13  ARG A HA   1  
ATOM   209    H HB2  . ARG A 1 17  ? -27.336 4.311   -18.796 0.016 31.04 ? 13  ARG A HB2  1  
ATOM   210    H HB3  . ARG A 1 17  ? -27.873 3.095   -17.925 0.016 30.25 ? 13  ARG A HB3  1  
ATOM   211    H HG2  . ARG A 1 17  ? -29.898 4.120   -17.622 0.016 29.96 ? 13  ARG A HG2  1  
ATOM   212    H HG3  . ARG A 1 17  ? -29.360 5.480   -18.224 0.016 30.20 ? 13  ARG A HG3  1  
ATOM   213    H HD2  . ARG A 1 17  ? -29.738 4.859   -20.283 0.016 33.15 ? 13  ARG A HD2  1  
ATOM   214    H HD3  . ARG A 1 17  ? -29.429 3.336   -19.971 0.016 33.08 ? 13  ARG A HD3  1  
ATOM   215    H HE   . ARG A 1 17  ? -31.555 3.105   -19.223 0.016 32.84 ? 13  ARG A HE   1  
ATOM   216    H HH11 . ARG A 1 17  ? -31.236 6.136   -20.572 0.016 34.40 ? 13  ARG A HH11 1  
ATOM   217    H HH12 . ARG A 1 17  ? -32.697 6.376   -20.714 0.016 35.16 ? 13  ARG A HH12 1  
ATOM   218    H HH21 . ARG A 1 17  ? -33.721 3.486   -19.476 0.016 33.73 ? 13  ARG A HH21 1  
ATOM   219    H HH22 . ARG A 1 17  ? -34.205 4.767   -20.049 0.016 34.78 ? 13  ARG A HH22 1  
ATOM   220    N N    . MET A 1 18  ? -28.877 5.264   -15.017 0.016 26.81 ? 14  MET A N    1  
ATOM   221    C CA   . MET A 1 18  ? -29.854 5.038   -13.975 0.016 26.02 ? 14  MET A CA   1  
ATOM   222    C C    . MET A 1 18  ? -31.243 5.309   -14.539 0.016 26.93 ? 14  MET A C    1  
ATOM   223    O O    . MET A 1 18  ? -31.512 6.417   -15.037 0.016 27.35 ? 14  MET A O    1  
ATOM   224    C CB   . MET A 1 18  ? -29.597 5.967   -12.782 0.016 24.80 ? 14  MET A CB   1  
ATOM   225    C CG   . MET A 1 18  ? -30.601 5.863   -11.661 0.016 24.18 ? 14  MET A CG   1  
ATOM   226    S SD   . MET A 1 18  ? -30.334 7.129   -10.375 0.016 23.13 ? 14  MET A SD   1  
ATOM   227    C CE   . MET A 1 18  ? -28.804 6.533   -9.709  0.016 22.38 ? 14  MET A CE   1  
ATOM   228    H H    . MET A 1 18  ? -28.823 6.090   -15.247 0.016 27.01 ? 14  MET A H    1  
ATOM   229    H HA   . MET A 1 18  ? -29.802 4.130   -13.655 0.016 25.81 ? 14  MET A HA   1  
ATOM   230    H HB2  . MET A 1 18  ? -28.725 5.771   -12.413 0.016 24.30 ? 14  MET A HB2  1  
ATOM   231    H HB3  . MET A 1 18  ? -29.618 6.879   -13.104 0.016 25.04 ? 14  MET A HB3  1  
ATOM   232    H HG2  . MET A 1 18  ? -31.495 5.982   -12.016 0.016 24.74 ? 14  MET A HG2  1  
ATOM   233    H HG3  . MET A 1 18  ? -30.527 4.995   -11.238 0.016 23.91 ? 14  MET A HG3  1  
ATOM   234    H HE1  . MET A 1 18  ? -28.494 7.138   -9.018  0.016 21.85 ? 14  MET A HE1  1  
ATOM   235    H HE2  . MET A 1 18  ? -28.959 5.650   -9.330  0.016 22.30 ? 14  MET A HE2  1  
ATOM   236    H HE3  . MET A 1 18  ? -28.154 6.469   -10.421 0.016 22.72 ? 14  MET A HE3  1  
ATOM   237    N N    . GLU A 1 19  ? -32.119 4.314   -14.453 0.016 27.39 ? 15  GLU A N    1  
ATOM   238    C CA   . GLU A 1 19  ? -33.543 4.530   -14.625 0.016 28.01 ? 15  GLU A CA   1  
ATOM   239    C C    . GLU A 1 19  ? -34.223 4.425   -13.276 0.016 26.96 ? 15  GLU A C    1  
ATOM   240    O O    . GLU A 1 19  ? -33.859 3.576   -12.443 0.016 26.14 ? 15  GLU A O    1  
ATOM   241    C CB   . GLU A 1 19  ? -34.157 3.556   -15.593 0.016 29.47 ? 15  GLU A CB   1  
ATOM   242    C CG   . GLU A 1 19  ? -35.631 3.825   -15.857 0.016 30.38 ? 15  GLU A CG   1  
ATOM   243    C CD   . GLU A 1 19  ? -36.036 3.266   -17.177 0.016 32.22 ? 15  GLU A CD   1  
ATOM   244    O OE1  . GLU A 1 19  ? -37.175 3.529   -17.636 0.016 33.48 ? 15  GLU A OE1  1  
ATOM   245    O OE2  . GLU A 1 19  ? -35.183 2.571   -17.767 0.016 32.50 ? 15  GLU A OE2  1  
ATOM   246    H H    . GLU A 1 19  ? -31.912 3.495   -14.301 0.016 27.43 ? 15  GLU A H    1  
ATOM   247    H HA   . GLU A 1 19  ? -33.694 5.425   -14.972 0.016 28.28 ? 15  GLU A HA   1  
ATOM   248    H HB2  . GLU A 1 19  ? -33.673 3.621   -16.433 0.016 30.19 ? 15  GLU A HB2  1  
ATOM   249    H HB3  . GLU A 1 19  ? -34.078 2.659   -15.228 0.016 29.25 ? 15  GLU A HB3  1  
ATOM   250    H HG2  . GLU A 1 19  ? -36.180 3.426   -15.166 0.016 29.96 ? 15  GLU A HG2  1  
ATOM   251    H HG3  . GLU A 1 19  ? -35.767 4.783   -15.881 0.016 30.34 ? 15  GLU A HG3  1  
ATOM   252    N N    . GLY A 1 20  ? -35.196 5.300   -13.039 0.016 27.11 ? 16  GLY A N    1  
ATOM   253    C CA   . GLY A 1 20  ? -35.811 5.266   -11.732 0.016 26.28 ? 16  GLY A CA   1  
ATOM   254    C C    . GLY A 1 20  ? -37.137 5.976   -11.653 0.016 26.88 ? 16  GLY A C    1  
ATOM   255    O O    . GLY A 1 20  ? -37.665 6.468   -12.648 0.016 27.98 ? 16  GLY A O    1  
ATOM   256    H H    . GLY A 1 20  ? -35.496 5.885   -13.590 0.016 27.73 ? 16  GLY A H    1  
ATOM   257    H HA2  . GLY A 1 20  ? -35.968 4.340   -11.489 0.016 26.30 ? 16  GLY A HA2  1  
ATOM   258    H HA3  . GLY A 1 20  ? -35.201 5.657   -11.088 0.016 25.42 ? 16  GLY A HA3  1  
ATOM   259    N N    . ALA A 1 21  ? -37.675 5.965   -10.437 0.016 26.28 ? 17  ALA A N    1  
ATOM   260    C CA   . ALA A 1 21  ? -38.838 6.751   -10.057 0.016 26.75 ? 17  ALA A CA   1  
ATOM   261    C C    . ALA A 1 21  ? -38.744 7.031   -8.563  0.016 25.75 ? 17  ALA A C    1  
ATOM   262    O O    . ALA A 1 21  ? -38.429 6.136   -7.771  0.016 25.23 ? 17  ALA A O    1  
ATOM   263    C CB   . ALA A 1 21  ? -40.151 6.010   -10.400 0.016 28.05 ? 17  ALA A CB   1  
ATOM   264    H H    . ALA A 1 21  ? -37.373 5.493   -9.791  0.016 25.68 ? 17  ALA A H    1  
ATOM   265    H HA   . ALA A 1 21  ? -38.817 7.591   -10.534 0.016 27.00 ? 17  ALA A HA   1  
ATOM   266    H HB1  . ALA A 1 21  ? -40.889 6.458   -9.961  0.016 28.31 ? 17  ALA A HB1  1  
ATOM   267    H HB2  . ALA A 1 21  ? -40.286 6.005   -11.360 0.016 28.86 ? 17  ALA A HB2  1  
ATOM   268    H HB3  . ALA A 1 21  ? -40.089 5.096   -10.074 0.016 27.92 ? 17  ALA A HB3  1  
ATOM   269    N N    . VAL A 1 22  ? -39.007 8.275   -8.166  0.016 25.63 ? 18  VAL A N    1  
ATOM   270    C CA   . VAL A 1 22  ? -39.155 8.599   -6.763  0.016 25.03 ? 18  VAL A CA   1  
ATOM   271    C C    . VAL A 1 22  ? -40.496 9.294   -6.636  0.016 25.95 ? 18  VAL A C    1  
ATOM   272    O O    . VAL A 1 22  ? -40.830 10.152  -7.468  0.016 26.53 ? 18  VAL A O    1  
ATOM   273    C CB   . VAL A 1 22  ? -37.993 9.450   -6.224  0.016 24.09 ? 18  VAL A CB   1  
ATOM   274    C CG1  . VAL A 1 22  ? -37.967 9.428   -4.665  0.016 23.61 ? 18  VAL A CG1  1  
ATOM   275    C CG2  . VAL A 1 22  ? -36.699 8.903   -6.770  0.016 23.47 ? 18  VAL A CG2  1  
ATOM   276    H H    . VAL A 1 22  ? -39.106 8.941   -8.694  0.016 25.97 ? 18  VAL A H    1  
ATOM   277    H HA   . VAL A 1 22  ? -39.183 7.787   -6.244  0.016 24.82 ? 18  VAL A HA   1  
ATOM   278    H HB   . VAL A 1 22  ? -38.086 10.368  -6.522  0.016 24.34 ? 18  VAL A HB   1  
ATOM   279    H HG11 . VAL A 1 22  ? -38.782 9.011   -4.346  0.016 24.00 ? 18  VAL A HG11 1  
ATOM   280    H HG12 . VAL A 1 22  ? -37.199 8.926   -4.358  0.016 23.01 ? 18  VAL A HG12 1  
ATOM   281    H HG13 . VAL A 1 22  ? -37.921 10.342  -4.340  0.016 23.68 ? 18  VAL A HG13 1  
ATOM   282    H HG21 . VAL A 1 22  ? -36.781 7.947   -6.896  0.016 23.47 ? 18  VAL A HG21 1  
ATOM   283    H HG22 . VAL A 1 22  ? -36.523 9.331   -7.615  0.016 23.80 ? 18  VAL A HG22 1  
ATOM   284    H HG23 . VAL A 1 22  ? -35.977 9.082   -6.149  0.016 22.87 ? 18  VAL A HG23 1  
ATOM   285    N N    . ASN A 1 23  ? -41.261 8.915   -5.615  0.016 26.22 ? 19  ASN A N    1  
ATOM   286    C CA   . ASN A 1 23  ? -42.679 9.272   -5.512  0.016 27.35 ? 19  ASN A CA   1  
ATOM   287    C C    . ASN A 1 23  ? -43.339 9.361   -6.888  0.016 28.53 ? 19  ASN A C    1  
ATOM   288    O O    . ASN A 1 23  ? -44.126 10.264  -7.160  0.016 29.35 ? 19  ASN A O    1  
ATOM   289    C CB   . ASN A 1 23  ? -42.857 10.583  -4.743  0.016 27.20 ? 19  ASN A CB   1  
ATOM   290    C CG   . ASN A 1 23  ? -42.622 10.444  -3.240  0.016 26.57 ? 19  ASN A CG   1  
ATOM   291    O OD1  . ASN A 1 23  ? -42.061 9.455   -2.763  0.016 26.00 ? 19  ASN A OD1  1  
ATOM   292    N ND2  . ASN A 1 23  ? -43.026 11.452  -2.487  0.016 26.82 ? 19  ASN A ND2  1  
ATOM   293    H H    . ASN A 1 23  ? -40.977 8.455   -4.948  0.016 25.83 ? 19  ASN A H    1  
ATOM   294    H HA   . ASN A 1 23  ? -43.135 8.573   -5.021  0.016 27.62 ? 19  ASN A HA   1  
ATOM   295    H HB2  . ASN A 1 23  ? -42.222 11.231  -5.086  0.016 26.79 ? 19  ASN A HB2  1  
ATOM   296    H HB3  . ASN A 1 23  ? -43.764 10.903  -4.876  0.016 28.05 ? 19  ASN A HB3  1  
ATOM   297    H HD21 . ASN A 1 23  ? -43.570 12.033  -2.807  0.016 27.47 ? 19  ASN A HD21 1  
ATOM   298    H HD22 . ASN A 1 23  ? -42.749 11.529  -1.678  0.016 26.41 ? 19  ASN A HD22 1  
ATOM   299    N N    . GLY A 1 24  ? -43.015 8.420   -7.780  0.016 28.75 ? 20  GLY A N    1  
ATOM   300    C CA   . GLY A 1 24  ? -43.675 8.333   -9.064  0.016 30.15 ? 20  GLY A CA   1  
ATOM   301    C C    . GLY A 1 24  ? -43.079 9.131   -10.217 0.016 30.41 ? 20  GLY A C    1  
ATOM   302    O O    . GLY A 1 24  ? -43.466 8.872   -11.368 0.016 31.73 ? 20  GLY A O    1  
ATOM   303    H H    . GLY A 1 24  ? -42.411 7.822   -7.659  0.016 28.18 ? 20  GLY A H    1  
ATOM   304    H HA2  . GLY A 1 24  ? -43.680 7.404   -9.336  0.016 30.37 ? 20  GLY A HA2  1  
ATOM   305    H HA3  . GLY A 1 24  ? -44.597 8.607   -8.957  0.016 30.96 ? 20  GLY A HA3  1  
ATOM   306    N N    . HIS A 1 25  ? -42.191 10.122  -9.981  0.016 29.40 ? 21  HIS A N    1  
ATOM   307    C CA   . HIS A 1 25  ? -41.617 10.866  -11.112 0.016 29.74 ? 21  HIS A CA   1  
ATOM   308    C C    . HIS A 1 25  ? -40.481 10.010  -11.648 0.016 29.11 ? 21  HIS A C    1  
ATOM   309    O O    . HIS A 1 25  ? -39.485 9.752   -10.948 0.016 27.81 ? 21  HIS A O    1  
ATOM   310    C CB   . HIS A 1 25  ? -41.146 12.293  -10.780 0.016 29.27 ? 21  HIS A CB   1  
ATOM   311    C CG   . HIS A 1 25  ? -41.825 13.396  -11.591 0.016 30.54 ? 21  HIS A CG   1  
ATOM   312    N ND1  . HIS A 1 25  ? -43.154 13.358  -11.983 0.016 32.06 ? 21  HIS A ND1  1  
ATOM   313    C CD2  . HIS A 1 25  ? -41.335 14.555  -12.081 0.016 30.63 ? 21  HIS A CD2  1  
ATOM   314    C CE1  . HIS A 1 25  ? -43.455 14.462  -12.651 0.016 33.00 ? 21  HIS A CE1  1  
ATOM   315    N NE2  . HIS A 1 25  ? -42.369 15.212  -12.718 0.016 32.15 ? 21  HIS A NE2  1  
ATOM   316    H H    . HIS A 1 25  ? -41.922 10.364  -9.204  0.016 28.63 ? 21  HIS A H    1  
ATOM   317    H HA   . HIS A 1 25  ? -42.283 10.936  -11.811 0.016 30.85 ? 21  HIS A HA   1  
ATOM   318    H HB2  . HIS A 1 25  ? -41.305 12.458  -9.840  0.016 29.01 ? 21  HIS A HB2  1  
ATOM   319    H HB3  . HIS A 1 25  ? -40.203 12.365  -10.955 0.016 28.49 ? 21  HIS A HB3  1  
ATOM   320    H HD1  . HIS A 1 25  ? -43.710 12.725  -11.802 0.016 32.42 ? 21  HIS A HD1  1  
ATOM   321    H HD2  . HIS A 1 25  ? -40.471 14.870  -11.972 0.016 29.88 ? 21  HIS A HD2  1  
ATOM   322    H HE1  . HIS A 1 25  ? -44.282 14.671  -13.020 0.016 34.16 ? 21  HIS A HE1  1  
ATOM   323    H HE2  . HIS A 1 25  ? -42.307 15.968  -13.118 0.016 32.57 ? 21  HIS A HE2  1  
ATOM   324    N N    . LYS A 1 26  ? -40.688 9.506   -12.853 0.016 30.19 ? 22  LYS A N    1  
ATOM   325    C CA   . LYS A 1 26  ? -39.704 8.747   -13.588 0.016 29.99 ? 22  LYS A CA   1  
ATOM   326    C C    . LYS A 1 26  ? -38.583 9.665   -14.040 0.016 29.61 ? 22  LYS A C    1  
ATOM   327    O O    . LYS A 1 26  ? -38.790 10.852  -14.328 0.016 30.00 ? 22  LYS A O    1  
ATOM   328    C CB   . LYS A 1 26  ? -40.328 8.082   -14.819 0.016 31.61 ? 22  LYS A CB   1  
ATOM   329    C CG   . LYS A 1 26  ? -41.538 7.190   -14.558 0.016 32.67 ? 22  LYS A CG   1  
ATOM   330    C CD   . LYS A 1 26  ? -41.847 6.309   -15.803 0.016 34.18 ? 22  LYS A CD   1  
ATOM   331    C CE   . LYS A 1 26  ? -43.304 5.756   -15.812 0.016 35.72 ? 22  LYS A CE   1  
ATOM   332    N NZ   . LYS A 1 26  ? -43.471 4.453   -16.593 0.016 36.99 ? 22  LYS A NZ   1  
ATOM   333    H H    . LYS A 1 26  ? -41.427 9.601   -13.280 0.016 31.19 ? 22  LYS A H    1  
ATOM   334    H HA   . LYS A 1 26  ? -39.332 8.058   -13.017 0.016 29.19 ? 22  LYS A HA   1  
ATOM   335    H HB2  . LYS A 1 26  ? -40.623 8.776   -15.428 0.016 32.38 ? 22  LYS A HB2  1  
ATOM   336    H HB3  . LYS A 1 26  ? -39.646 7.548   -15.254 0.016 31.40 ? 22  LYS A HB3  1  
ATOM   337    H HG2  . LYS A 1 26  ? -41.354 6.604   -13.807 0.016 31.95 ? 22  LYS A HG2  1  
ATOM   338    H HG3  . LYS A 1 26  ? -42.309 7.748   -14.369 0.016 33.28 ? 22  LYS A HG3  1  
ATOM   339    H HD2  . LYS A 1 26  ? -41.715 6.843   -16.600 0.016 34.87 ? 22  LYS A HD2  1  
ATOM   340    H HD3  . LYS A 1 26  ? -41.239 5.554   -15.813 0.016 33.61 ? 22  LYS A HD3  1  
ATOM   341    H HE2  . LYS A 1 26  ? -43.593 5.600   -14.900 0.016 35.13 ? 22  LYS A HE2  1  
ATOM   342    H HE3  . LYS A 1 26  ? -43.884 6.417   -16.220 0.016 36.65 ? 22  LYS A HE3  1  
ATOM   343    H HZ1  . LYS A 1 26  ? -43.360 4.598   -17.463 0.016 37.83 ? 22  LYS A HZ1  1  
ATOM   344    H HZ2  . LYS A 1 26  ? -42.869 3.857   -16.322 0.016 36.20 ? 22  LYS A HZ2  1  
ATOM   345    H HZ3  . LYS A 1 26  ? -44.285 4.120   -16.457 0.016 37.81 ? 22  LYS A HZ3  1  
ATOM   346    N N    . PHE A 1 27  ? -37.399 9.092   -14.147 0.016 29.06 ? 23  PHE A N    1  
ATOM   347    C CA   . PHE A 1 27  ? -36.243 9.849   -14.568 0.016 28.90 ? 23  PHE A CA   1  
ATOM   348    C C    . PHE A 1 27  ? -35.196 8.889   -15.075 0.016 28.93 ? 23  PHE A C    1  
ATOM   349    O O    . PHE A 1 27  ? -35.205 7.691   -14.751 0.016 28.66 ? 23  PHE A O    1  
ATOM   350    C CB   . PHE A 1 27  ? -35.676 10.704  -13.425 0.016 27.56 ? 23  PHE A CB   1  
ATOM   351    C CG   . PHE A 1 27  ? -35.245 9.910   -12.214 0.016 26.26 ? 23  PHE A CG   1  
ATOM   352    C CD1  . PHE A 1 27  ? -33.954 9.453   -12.073 0.016 25.55 ? 23  PHE A CD1  1  
ATOM   353    C CD2  . PHE A 1 27  ? -36.145 9.640   -11.215 0.016 25.93 ? 23  PHE A CD2  1  
ATOM   354    C CE1  . PHE A 1 27  ? -33.584 8.731   -10.947 0.016 24.51 ? 23  PHE A CE1  1  
ATOM   355    C CE2  . PHE A 1 27  ? -35.788 8.943   -10.102 0.016 24.94 ? 23  PHE A CE2  1  
ATOM   356    C CZ   . PHE A 1 27  ? -34.515 8.473   -9.965  0.016 24.22 ? 23  PHE A CZ   1  
ATOM   357    H H    . PHE A 1 27  ? -37.246 8.265   -13.981 0.016 28.85 ? 23  PHE A H    1  
ATOM   358    H HA   . PHE A 1 27  ? -36.490 10.438  -15.298 0.016 29.80 ? 23  PHE A HA   1  
ATOM   359    H HB2  . PHE A 1 27  ? -34.904 11.192  -13.748 0.016 27.56 ? 23  PHE A HB2  1  
ATOM   360    H HB3  . PHE A 1 27  ? -36.367 11.320  -13.141 0.016 27.68 ? 23  PHE A HB3  1  
ATOM   361    H HD1  . PHE A 1 27  ? -33.329 9.627   -12.741 0.016 25.86 ? 23  PHE A HD1  1  
ATOM   362    H HD2  . PHE A 1 27  ? -37.017 9.949   -11.299 0.016 26.48 ? 23  PHE A HD2  1  
ATOM   363    H HE1  . PHE A 1 27  ? -32.711 8.423   -10.856 0.016 24.10 ? 23  PHE A HE1  1  
ATOM   364    H HE2  . PHE A 1 27  ? -36.420 8.767   -9.448  0.016 24.86 ? 23  PHE A HE2  1  
ATOM   365    H HZ   . PHE A 1 27  ? -34.273 7.994   -9.207  0.016 23.64 ? 23  PHE A HZ   1  
ATOM   366    N N    . VAL A 1 28  ? -34.311 9.431   -15.894 0.016 29.40 ? 24  VAL A N    1  
ATOM   367    C CA   . VAL A 1 28  ? -33.106 8.749   -16.343 0.016 29.46 ? 24  VAL A CA   1  
ATOM   368    C C    . VAL A 1 28  ? -31.951 9.713   -16.156 0.016 28.98 ? 24  VAL A C    1  
ATOM   369    O O    . VAL A 1 28  ? -32.105 10.920  -16.385 0.016 29.57 ? 24  VAL A O    1  
ATOM   370    C CB   . VAL A 1 28  ? -33.199 8.294   -17.812 0.016 31.23 ? 24  VAL A CB   1  
ATOM   371    C CG1  . VAL A 1 28  ? -31.874 7.669   -18.270 0.016 31.41 ? 24  VAL A CG1  1  
ATOM   372    C CG2  . VAL A 1 28  ? -34.353 7.281   -18.002 0.016 31.86 ? 24  VAL A CG2  1  
ATOM   373    H H    . VAL A 1 28  ? -34.389 10.223  -16.218 0.016 29.79 ? 24  VAL A H    1  
ATOM   374    H HA   . VAL A 1 28  ? -32.960 7.974   -15.783 0.016 28.76 ? 24  VAL A HA   1  
ATOM   375    H HB   . VAL A 1 28  ? -33.378 9.065   -18.374 0.016 32.04 ? 24  VAL A HB   1  
ATOM   376    H HG11 . VAL A 1 28  ? -31.730 7.895   -19.201 0.016 32.61 ? 24  VAL A HG11 1  
ATOM   377    H HG12 . VAL A 1 28  ? -31.130 7.994   -17.748 0.016 30.57 ? 24  VAL A HG12 1  
ATOM   378    H HG13 . VAL A 1 28  ? -31.935 6.708   -18.165 0.016 31.30 ? 24  VAL A HG13 1  
ATOM   379    H HG21 . VAL A 1 28  ? -34.409 7.036   -18.939 0.016 33.12 ? 24  VAL A HG21 1  
ATOM   380    H HG22 . VAL A 1 28  ? -34.173 6.495   -17.464 0.016 31.16 ? 24  VAL A HG22 1  
ATOM   381    H HG23 . VAL A 1 28  ? -35.182 7.692   -17.716 0.016 31.81 ? 24  VAL A HG23 1  
ATOM   382    N N    . ILE A 1 29  ? -30.800 9.189   -15.753 0.016 28.06 ? 25  ILE A N    1  
ATOM   383    C CA   . ILE A 1 29  ? -29.582 9.972   -15.603 0.016 27.71 ? 25  ILE A CA   1  
ATOM   384    C C    . ILE A 1 29  ? -28.431 9.195   -16.232 0.016 28.13 ? 25  ILE A C    1  
ATOM   385    O O    . ILE A 1 29  ? -28.353 7.965   -16.096 0.016 27.85 ? 25  ILE A O    1  
ATOM   386    C CB   . ILE A 1 29  ? -29.297 10.282  -14.127 0.016 26.22 ? 25  ILE A CB   1  
ATOM   387    C CG1  . ILE A 1 29  ? -30.387 11.223  -13.592 0.016 26.05 ? 25  ILE A CG1  1  
ATOM   388    C CG2  . ILE A 1 29  ? -27.950 10.969  -13.970 0.016 26.04 ? 25  ILE A CG2  1  
ATOM   389    C CD1  . ILE A 1 29  ? -30.362 11.417  -12.100 0.016 24.79 ? 25  ILE A CD1  1  
ATOM   390    H H    . ILE A 1 29  ? -30.699 8.362   -15.553 0.016 27.68 ? 25  ILE A H    1  
ATOM   391    H HA   . ILE A 1 29  ? -29.688 10.806  -16.079 0.016 28.36 ? 25  ILE A HA   1  
ATOM   392    H HB   . ILE A 1 29  ? -29.299 9.459   -13.616 0.016 25.64 ? 25  ILE A HB   1  
ATOM   393    H HG12 . ILE A 1 29  ? -30.264 12.090  -14.003 0.016 26.55 ? 25  ILE A HG12 1  
ATOM   394    H HG13 . ILE A 1 29  ? -31.255 10.865  -13.828 0.016 26.42 ? 25  ILE A HG13 1  
ATOM   395    H HG21 . ILE A 1 29  ? -27.798 11.131  -13.025 0.016 25.20 ? 25  ILE A HG21 1  
ATOM   396    H HG22 . ILE A 1 29  ? -27.247 10.401  -14.319 0.016 26.24 ? 25  ILE A HG22 1  
ATOM   397    H HG23 . ILE A 1 29  ? -27.966 11.811  -14.448 0.016 26.66 ? 25  ILE A HG23 1  
ATOM   398    H HD11 . ILE A 1 29  ? -29.510 11.802  -11.842 0.016 24.49 ? 25  ILE A HD11 1  
ATOM   399    H HD12 . ILE A 1 29  ? -31.084 12.013  -11.848 0.016 24.84 ? 25  ILE A HD12 1  
ATOM   400    H HD13 . ILE A 1 29  ? -30.481 10.554  -11.674 0.016 24.36 ? 25  ILE A HD13 1  
ATOM   401    N N    . GLU A 1 30  ? -27.572 9.905   -16.951 0.016 28.97 ? 26  GLU A N    1  
ATOM   402    C CA   . GLU A 1 30  ? -26.419 9.296   -17.594 0.016 29.57 ? 26  GLU A CA   1  
ATOM   403    C C    . GLU A 1 30  ? -25.149 9.986   -17.133 0.016 29.11 ? 26  GLU A C    1  
ATOM   404    O O    . GLU A 1 30  ? -25.130 11.190  -16.862 0.016 28.89 ? 26  GLU A O    1  
ATOM   405    C CB   . GLU A 1 30  ? -26.529 9.362   -19.115 0.016 31.49 ? 26  GLU A CB   1  
ATOM   406    C CG   . GLU A 1 30  ? -27.687 8.545   -19.631 0.016 32.22 ? 26  GLU A CG   1  
ATOM   407    C CD   . GLU A 1 30  ? -27.752 8.511   -21.140 0.016 34.34 ? 26  GLU A CD   1  
ATOM   408    O OE1  . GLU A 1 30  ? -27.532 9.571   -21.771 0.016 35.43 ? 26  GLU A OE1  1  
ATOM   409    O OE2  . GLU A 1 30  ? -27.989 7.411   -21.685 0.016 35.03 ? 26  GLU A OE2  1  
ATOM   410    H H    . GLU A 1 30  ? -27.637 10.750  -17.082 0.016 29.30 ? 26  GLU A H    1  
ATOM   411    H HA   . GLU A 1 30  ? -26.368 8.364   -17.331 0.016 29.15 ? 26  GLU A HA   1  
ATOM   412    H HB2  . GLU A 1 30  ? -26.673 10.284  -19.378 0.016 31.97 ? 26  GLU A HB2  1  
ATOM   413    H HB3  . GLU A 1 30  ? -25.710 9.032   -19.512 0.016 31.95 ? 26  GLU A HB3  1  
ATOM   414    H HG2  . GLU A 1 30  ? -27.587 7.632   -19.316 0.016 31.68 ? 26  GLU A HG2  1  
ATOM   415    H HG3  . GLU A 1 30  ? -28.518 8.916   -19.300 0.016 32.01 ? 26  GLU A HG3  1  
ATOM   416    N N    . GLY A 1 31  ? -24.090 9.203   -17.024 0.016 29.05 ? 27  GLY A N    1  
ATOM   417    C CA   . GLY A 1 31  ? -22.868 9.677   -16.411 0.016 28.72 ? 27  GLY A CA   1  
ATOM   418    C C    . GLY A 1 31  ? -21.628 9.151   -17.097 0.016 29.68 ? 27  GLY A C    1  
ATOM   419    O O    . GLY A 1 31  ? -21.592 8.033   -17.618 0.016 30.14 ? 27  GLY A O    1  
ATOM   420    H H    . GLY A 1 31  ? -24.055 8.391   -17.301 0.016 29.28 ? 27  GLY A H    1  
ATOM   421    H HA2  . GLY A 1 31  ? -22.845 10.643  -16.430 0.016 29.02 ? 27  GLY A HA2  1  
ATOM   422    H HA3  . GLY A 1 31  ? -22.851 9.387   -15.486 0.016 27.67 ? 27  GLY A HA3  1  
ATOM   423    N N    . GLU A 1 32  ? -20.590 9.977   -17.064 0.016 30.11 ? 28  GLU A N    1  
ATOM   424    C CA   . GLU A 1 32  ? -19.292 9.605   -17.593 0.016 31.09 ? 28  GLU A CA   1  
ATOM   425    C C    . GLU A 1 32  ? -18.246 10.228  -16.692 0.016 30.71 ? 28  GLU A C    1  
ATOM   426    O O    . GLU A 1 32  ? -18.324 11.412  -16.368 0.016 30.56 ? 28  GLU A O    1  
ATOM   427    C CB   . GLU A 1 32  ? -19.137 10.053  -19.046 0.016 33.07 ? 28  GLU A CB   1  
ATOM   428    C CG   . GLU A 1 32  ? -20.200 9.417   -19.949 0.016 33.68 ? 28  GLU A CG   1  
ATOM   429    C CD   . GLU A 1 32  ? -19.873 9.473   -21.413 0.016 35.87 ? 28  GLU A CD   1  
ATOM   430    O OE1  . GLU A 1 32  ? -19.141 8.579   -21.898 0.016 36.68 ? 28  GLU A OE1  1  
ATOM   431    O OE2  . GLU A 1 32  ? -20.359 10.415  -22.088 0.016 36.92 ? 28  GLU A OE2  1  
ATOM   432    H H    . GLU A 1 32  ? -20.615 10.766  -16.729 0.016 29.93 ? 28  GLU A H    1  
ATOM   433    H HA   . GLU A 1 32  ? -19.193 8.642   -17.566 0.016 30.84 ? 28  GLU A HA   1  
ATOM   434    H HB2  . GLU A 1 32  ? -19.246 11.016  -19.082 0.016 33.39 ? 28  GLU A HB2  1  
ATOM   435    H HB3  . GLU A 1 32  ? -18.260 9.802   -19.374 0.016 33.80 ? 28  GLU A HB3  1  
ATOM   436    H HG2  . GLU A 1 32  ? -20.300 8.484   -19.701 0.016 33.10 ? 28  GLU A HG2  1  
ATOM   437    H HG3  . GLU A 1 32  ? -21.037 9.886   -19.816 0.016 33.34 ? 28  GLU A HG3  1  
ATOM   438    N N    . GLY A 1 33  ? -17.301 9.420   -16.241 0.016 30.60 ? 29  GLY A N    1  
ATOM   439    C CA   . GLY A 1 33  ? -16.268 9.949   -15.391 0.016 30.49 ? 29  GLY A CA   1  
ATOM   440    C C    . GLY A 1 33  ? -14.998 9.145   -15.487 0.016 31.04 ? 29  GLY A C    1  
ATOM   441    O O    . GLY A 1 33  ? -14.795 8.379   -16.428 0.016 31.95 ? 29  GLY A O    1  
ATOM   442    H H    . GLY A 1 33  ? -17.246 8.582   -16.411 0.016 30.67 ? 29  GLY A H    1  
ATOM   443    H HA2  . GLY A 1 33  ? -16.065 10.860  -15.659 0.016 31.27 ? 29  GLY A HA2  1  
ATOM   444    H HA3  . GLY A 1 33  ? -16.558 9.951   -14.467 0.016 29.44 ? 29  GLY A HA3  1  
ATOM   445    N N    . ILE A 1 34  ? -14.162 9.321   -14.469 0.016 30.59 ? 30  ILE A N    1  
ATOM   446    C CA   . ILE A 1 34  ? -12.851 8.688   -14.416 0.016 31.29 ? 30  ILE A CA   1  
ATOM   447    C C    . ILE A 1 34  ? -12.386 8.737   -12.970 0.016 30.38 ? 30  ILE A C    1  
ATOM   448    O O    . ILE A 1 34  ? -12.753 9.637   -12.212 0.016 29.75 ? 30  ILE A O    1  
ATOM   449    C CB   . ILE A 1 34  ? -11.859 9.389   -15.383 0.016 33.24 ? 30  ILE A CB   1  
ATOM   450    C CG1  . ILE A 1 34  ? -10.556 8.602   -15.499 0.016 34.23 ? 30  ILE A CG1  1  
ATOM   451    C CG2  . ILE A 1 34  ? -11.566 10.797  -14.910 0.016 33.52 ? 30  ILE A CG2  1  
ATOM   452    C CD1  . ILE A 1 34  ? -9.676  9.048   -16.668 0.016 36.40 ? 30  ILE A CD1  1  
ATOM   453    H H    . ILE A 1 34  ? -14.339 9.797   -13.780 0.016 29.94 ? 30  ILE A H    1  
ATOM   454    H HA   . ILE A 1 34  ? -12.934 7.757   -14.673 0.016 31.23 ? 30  ILE A HA   1  
ATOM   455    H HB   . ILE A 1 34  ? -12.268 9.440   -16.261 0.016 33.83 ? 30  ILE A HB   1  
ATOM   456    H HG12 . ILE A 1 34  ? -10.048 8.717   -14.681 0.016 33.89 ? 30  ILE A HG12 1  
ATOM   457    H HG13 . ILE A 1 34  ? -10.767 7.663   -15.624 0.016 33.95 ? 30  ILE A HG13 1  
ATOM   458    H HG21 . ILE A 1 34  ? -11.095 11.268  -15.616 0.016 34.77 ? 30  ILE A HG21 1  
ATOM   459    H HG22 . ILE A 1 34  ? -12.400 11.248  -14.708 0.016 32.67 ? 30  ILE A HG22 1  
ATOM   460    H HG23 . ILE A 1 34  ? -11.013 10.761  -14.117 0.016 33.43 ? 30  ILE A HG23 1  
ATOM   461    H HD11 . ILE A 1 34  ? -8.835  9.391   -16.326 0.016 36.91 ? 30  ILE A HD11 1  
ATOM   462    H HD12 . ILE A 1 34  ? -9.508  8.291   -17.252 0.016 37.03 ? 30  ILE A HD12 1  
ATOM   463    H HD13 . ILE A 1 34  ? -10.143 9.744   -17.157 0.016 36.72 ? 30  ILE A HD13 1  
ATOM   464    N N    . GLY A 1 35  ? -11.629 7.728   -12.566 0.016 30.39 ? 31  GLY A N    1  
ATOM   465    C CA   . GLY A 1 35  ? -11.128 7.681   -11.211 0.016 29.79 ? 31  GLY A CA   1  
ATOM   466    C C    . GLY A 1 35  ? -9.849  6.875   -11.142 0.016 30.63 ? 31  GLY A C    1  
ATOM   467    O O    . GLY A 1 35  ? -9.368  6.340   -12.145 0.016 31.69 ? 31  GLY A O    1  
ATOM   468    H H    . GLY A 1 35  ? -11.397 7.064   -13.056 0.016 30.82 ? 31  GLY A H    1  
ATOM   469    H HA2  . GLY A 1 35  ? -10.953 8.577   -10.892 0.016 30.01 ? 31  GLY A HA2  1  
ATOM   470    H HA3  . GLY A 1 35  ? -11.791 7.271   -10.633 0.016 28.72 ? 31  GLY A HA3  1  
ATOM   471    N N    . LYS A 1 36  ? -9.285  6.829   -9.933  0.016 30.30 ? 32  LYS A N    1  
ATOM   472    C CA   . LYS A 1 36  ? -8.055  6.100   -9.633  0.016 31.13 ? 32  LYS A CA   1  
ATOM   473    C C    . LYS A 1 36  ? -8.416  5.032   -8.605  0.016 29.95 ? 32  LYS A C    1  
ATOM   474    O O    . LYS A 1 36  ? -8.463  5.312   -7.401  0.016 29.39 ? 32  LYS A O    1  
ATOM   475    C CB   . LYS A 1 36  ? -6.948  7.026   -9.111  0.016 32.20 ? 32  LYS A CB   1  
ATOM   476    C CG   . LYS A 1 36  ? -6.585  8.180   -10.023 0.016 33.50 ? 32  LYS A CG   1  
ATOM   477    C CD   . LYS A 1 36  ? -7.709  9.145   -10.230 0.016 32.75 ? 32  LYS A CD   1  
ATOM   478    C CE   . LYS A 1 36  ? -8.402  9.529   -8.957  0.016 31.39 ? 32  LYS A CE   1  
ATOM   479    N NZ   . LYS A 1 36  ? -9.433  10.535  -9.243  0.016 30.91 ? 32  LYS A NZ   1  
ATOM   480    H H    . LYS A 1 36  ? -9.620  7.209   -9.245  0.016 29.66 ? 32  LYS A H    1  
ATOM   481    H HA   . LYS A 1 36  ? -7.726  5.671   -10.436 0.016 31.88 ? 32  LYS A HA   1  
ATOM   482    H HB2  . LYS A 1 36  ? -7.198  7.379   -8.244  0.016 31.57 ? 32  LYS A HB2  1  
ATOM   483    H HB3  . LYS A 1 36  ? -6.143  6.492   -9.013  0.016 32.87 ? 32  LYS A HB3  1  
ATOM   484    H HG2  . LYS A 1 36  ? -5.846  8.677   -9.635  0.016 34.24 ? 32  LYS A HG2  1  
ATOM   485    H HG3  . LYS A 1 36  ? -6.321  7.830   -10.885 0.016 34.27 ? 32  LYS A HG3  1  
ATOM   486    H HD2  . LYS A 1 36  ? -7.329  9.963   -10.597 0.016 33.69 ? 32  LYS A HD2  1  
ATOM   487    H HD3  . LYS A 1 36  ? -8.359  8.800   -10.851 0.016 32.42 ? 32  LYS A HD3  1  
ATOM   488    H HE2  . LYS A 1 36  ? -8.832  8.772   -8.546  0.016 30.46 ? 32  LYS A HE2  1  
ATOM   489    H HE3  . LYS A 1 36  ? -7.747  9.920   -8.360  0.016 31.90 ? 32  LYS A HE3  1  
ATOM   490    H HZ1  . LYS A 1 36  ? -10.201 10.298  -8.869  0.016 29.88 ? 32  LYS A HZ1  1  
ATOM   491    H HZ2  . LYS A 1 36  ? -9.187  11.325  -8.921  0.016 31.37 ? 32  LYS A HZ2  1  
ATOM   492    H HZ3  . LYS A 1 36  ? -9.549  10.593  -10.121 0.016 31.28 ? 32  LYS A HZ3  1  
ATOM   493    N N    . PRO A 1 37  ? -8.626  3.785   -9.029  0.016 29.74 ? 33  PRO A N    1  
ATOM   494    C CA   . PRO A 1 37  ? -9.147  2.778   -8.085  0.016 28.59 ? 33  PRO A CA   1  
ATOM   495    C C    . PRO A 1 37  ? -8.270  2.556   -6.868  0.016 28.79 ? 33  PRO A C    1  
ATOM   496    O O    . PRO A 1 37  ? -8.791  2.378   -5.758  0.016 27.87 ? 33  PRO A O    1  
ATOM   497    C CB   . PRO A 1 37  ? -9.249  1.531   -8.969  0.016 28.85 ? 33  PRO A CB   1  
ATOM   498    C CG   . PRO A 1 37  ? -9.596  2.080   -10.289 0.016 29.46 ? 33  PRO A CG   1  
ATOM   499    C CD   . PRO A 1 37  ? -8.726  3.306   -10.413 0.016 30.47 ? 33  PRO A CD   1  
ATOM   500    H HA   . PRO A 1 37  ? -10.038 3.026   -7.799  0.016 27.71 ? 33  PRO A HA   1  
ATOM   501    H HB2  . PRO A 1 37  ? -8.392  1.081   -9.005  0.016 29.59 ? 33  PRO A HB2  1  
ATOM   502    H HB3  . PRO A 1 37  ? -9.943  0.939   -8.635  0.016 28.04 ? 33  PRO A HB3  1  
ATOM   503    H HG2  . PRO A 1 37  ? -9.386  1.432   -10.976 0.016 30.06 ? 33  PRO A HG2  1  
ATOM   504    H HG3  . PRO A 1 37  ? -10.535 2.320   -10.315 0.016 28.74 ? 33  PRO A HG3  1  
ATOM   505    H HD2  . PRO A 1 37  ? -7.849  3.065   -10.745 0.016 31.47 ? 33  PRO A HD2  1  
ATOM   506    H HD3  . PRO A 1 37  ? -9.151  3.967   -10.978 0.016 30.63 ? 33  PRO A HD3  1  
ATOM   507    N N    . TYR A 1 38  ? -6.935  2.532   -7.041  0.016 30.15 ? 34  TYR A N    1  
ATOM   508    C CA   . TYR A 1 38  ? -6.068  2.284   -5.902  0.016 30.54 ? 34  TYR A CA   1  
ATOM   509    C C    . TYR A 1 38  ? -5.857  3.504   -5.015  0.016 30.53 ? 34  TYR A C    1  
ATOM   510    O O    . TYR A 1 38  ? -5.374  3.352   -3.891  0.016 30.37 ? 34  TYR A O    1  
ATOM   511    C CB   . TYR A 1 38  ? -4.708  1.744   -6.377  0.016 32.19 ? 34  TYR A CB   1  
ATOM   512    C CG   . TYR A 1 38  ? -4.795  0.586   -7.354  0.016 32.45 ? 34  TYR A CG   1  
ATOM   513    C CD1  . TYR A 1 38  ? -4.750  0.798   -8.719  0.016 33.20 ? 34  TYR A CD1  1  
ATOM   514    C CD2  . TYR A 1 38  ? -4.912  -0.724  -6.902  0.016 32.08 ? 34  TYR A CD2  1  
ATOM   515    C CE1  . TYR A 1 38  ? -4.809  -0.248  -9.613  0.016 33.64 ? 34  TYR A CE1  1  
ATOM   516    C CE2  . TYR A 1 38  ? -4.984  -1.769  -7.786  0.016 32.44 ? 34  TYR A CE2  1  
ATOM   517    C CZ   . TYR A 1 38  ? -4.939  -1.529  -9.139  0.016 33.22 ? 34  TYR A CZ   1  
ATOM   518    O OH   . TYR A 1 38  ? -5.003  -2.587  -10.031 0.016 33.78 ? 34  TYR A OH   1  
ATOM   519    H H    . TYR A 1 38  ? -6.528  2.653   -7.787  0.016 30.93 ? 34  TYR A H    1  
ATOM   520    H HA   . TYR A 1 38  ? -6.486  1.605   -5.352  0.016 29.89 ? 34  TYR A HA   1  
ATOM   521    H HB2  . TYR A 1 38  ? -4.232  2.462   -6.825  0.016 32.95 ? 34  TYR A HB2  1  
ATOM   522    H HB3  . TYR A 1 38  ? -4.199  1.451   -5.608  0.016 32.49 ? 34  TYR A HB3  1  
ATOM   523    H HD1  . TYR A 1 38  ? -4.663  1.666   -9.041  0.016 33.55 ? 34  TYR A HD1  1  
ATOM   524    H HD2  . TYR A 1 38  ? -4.945  -0.885  -5.990  0.016 31.67 ? 34  TYR A HD2  1  
ATOM   525    H HE1  . TYR A 1 38  ? -4.780  -0.090  -10.529 0.016 34.28 ? 34  TYR A HE1  1  
ATOM   526    H HE2  . TYR A 1 38  ? -5.066  -2.641  -7.472  0.016 32.25 ? 34  TYR A HE2  1  
ATOM   527    H HH   . TYR A 1 38  ? -4.930  -2.303  -10.818 0.016 34.32 ? 34  TYR A HH   1  
ATOM   528    N N    . GLU A 1 39  ? -6.211  4.707   -5.470  0.016 30.83 ? 35  GLU A N    1  
ATOM   529    C CA   . GLU A 1 39  ? -6.238  5.850   -4.569  0.016 30.86 ? 35  GLU A CA   1  
ATOM   530    C C    . GLU A 1 39  ? -7.592  6.055   -3.899  0.016 29.34 ? 35  GLU A C    1  
ATOM   531    O O    . GLU A 1 39  ? -7.678  6.820   -2.927  0.016 29.29 ? 35  GLU A O    1  
ATOM   532    C CB   . GLU A 1 39  ? -5.856  7.122   -5.326  0.016 32.00 ? 35  GLU A CB   1  
ATOM   533    C CG   . GLU A 1 39  ? -4.448  7.084   -5.876  0.016 33.75 ? 35  GLU A CG   1  
ATOM   534    C CD   . GLU A 1 39  ? -3.406  6.819   -4.798  0.016 34.42 ? 35  GLU A CD   1  
ATOM   535    O OE1  . GLU A 1 39  ? -3.333  7.631   -3.852  0.016 34.89 ? 35  GLU A OE1  1  
ATOM   536    O OE2  . GLU A 1 39  ? -2.670  5.787   -4.894  0.016 34.57 ? 35  GLU A OE2  1  
ATOM   537    H H    . GLU A 1 39  ? -6.420  4.881   -6.283  0.016 31.12 ? 35  GLU A H    1  
ATOM   538    H HA   . GLU A 1 39  ? -5.588  5.716   -3.866  0.016 31.30 ? 35  GLU A HA   1  
ATOM   539    H HB2  . GLU A 1 39  ? -6.469  7.234   -6.068  0.016 31.65 ? 35  GLU A HB2  1  
ATOM   540    H HB3  . GLU A 1 39  ? -5.927  7.875   -4.719  0.016 32.09 ? 35  GLU A HB3  1  
ATOM   541    H HG2  . GLU A 1 39  ? -4.384  6.378   -6.538  0.016 33.80 ? 35  GLU A HG2  1  
ATOM   542    H HG3  . GLU A 1 39  ? -4.235  7.940   -6.281  0.016 34.59 ? 35  GLU A HG3  1  
ATOM   543    N N    . GLY A 1 40  ? -8.634  5.386   -4.382  0.016 28.26 ? 36  GLY A N    1  
ATOM   544    C CA   . GLY A 1 40  ? -9.952  5.538   -3.820  0.016 26.93 ? 36  GLY A CA   1  
ATOM   545    C C    . GLY A 1 40  ? -10.682 6.804   -4.189  0.016 26.66 ? 36  GLY A C    1  
ATOM   546    O O    . GLY A 1 40  ? -11.582 7.200   -3.442  0.016 25.87 ? 36  GLY A O    1  
ATOM   547    H H    . GLY A 1 40  ? -8.601  4.827   -5.036  0.016 28.36 ? 36  GLY A H    1  
ATOM   548    H HA2  . GLY A 1 40  ? -10.501 4.795   -4.109  0.016 26.38 ? 36  GLY A HA2  1  
ATOM   549    H HA3  . GLY A 1 40  ? -9.888  5.501   -2.856  0.016 26.81 ? 36  GLY A HA3  1  
ATOM   550    N N    . THR A 1 41  ? -10.379 7.414   -5.332  0.016 27.35 ? 37  THR A N    1  
ATOM   551    C CA   . THR A 1 41  ? -10.992 8.684   -5.721  0.016 27.25 ? 37  THR A CA   1  
ATOM   552    C C    . THR A 1 41  ? -11.600 8.555   -7.114  0.016 27.22 ? 37  THR A C    1  
ATOM   553    O O    . THR A 1 41  ? -11.202 7.701   -7.913  0.016 27.67 ? 37  THR A O    1  
ATOM   554    C CB   . THR A 1 41  ? -9.978  9.856   -5.684  0.016 28.51 ? 37  THR A CB   1  
ATOM   555    O OG1  . THR A 1 41  ? -8.813  9.522   -6.431  0.016 29.81 ? 37  THR A OG1  1  
ATOM   556    C CG2  . THR A 1 41  ? -9.574  10.217  -4.252  0.016 28.67 ? 37  THR A CG2  1  
ATOM   557    H H    . THR A 1 41  ? -9.824  7.111   -5.907  0.016 27.96 ? 37  THR A H    1  
ATOM   558    H HA   . THR A 1 41  ? -11.702 8.894   -5.098  0.016 26.50 ? 37  THR A HA   1  
ATOM   559    H HB   . THR A 1 41  ? -10.399 10.639  -6.077  0.016 28.50 ? 37  THR A HB   1  
ATOM   560    H HG1  . THR A 1 41  ? -8.556  8.745   -6.243  0.016 29.77 ? 37  THR A HG1  1  
ATOM   561    H HG21 . THR A 1 41  ? -10.356 10.225  -3.676  0.016 27.80 ? 37  THR A HG21 1  
ATOM   562    H HG22 . THR A 1 41  ? -8.939  9.566   -3.914  0.016 29.09 ? 37  THR A HG22 1  
ATOM   563    H HG23 . THR A 1 41  ? -9.164  11.095  -4.235  0.016 29.34 ? 37  THR A HG23 1  
ATOM   564    N N    . GLN A 1 42  ? -12.604 9.393   -7.386  0.016 26.79 ? 38  GLN A N    1  
ATOM   565    C CA   . GLN A 1 42  ? -13.307 9.334   -8.658  0.016 26.88 ? 38  GLN A CA   1  
ATOM   566    C C    . GLN A 1 42  ? -14.171 10.585  -8.817  0.016 26.71 ? 38  GLN A C    1  
ATOM   567    O O    . GLN A 1 42  ? -14.632 11.171  -7.833  0.016 26.10 ? 38  GLN A O    1  
ATOM   568    C CB   . GLN A 1 42  ? -14.178 8.076   -8.711  0.016 25.98 ? 38  GLN A CB   1  
ATOM   569    C CG   . GLN A 1 42  ? -14.946 7.918   -7.411  0.016 24.75 ? 38  GLN A CG   1  
ATOM   570    C CD   . GLN A 1 42  ? -16.069 6.902   -7.484  0.016 23.91 ? 38  GLN A CD   1  
ATOM   571    O OE1  . GLN A 1 42  ? -16.309 6.116   -6.531  0.016 23.20 ? 38  GLN A OE1  1  
ATOM   572    N NE2  . GLN A 1 42  ? -16.770 6.901   -8.602  0.016 24.15 ? 38  GLN A NE2  1  
ATOM   573    H H    . GLN A 1 42  ? -12.898 9.990   -6.844  0.016 26.51 ? 38  GLN A H    1  
ATOM   574    H HA   . GLN A 1 42  ? -12.672 9.299   -9.388  0.016 27.78 ? 38  GLN A HA   1  
ATOM   575    H HB2  . GLN A 1 42  ? -14.800 8.142   -9.448  0.016 26.03 ? 38  GLN A HB2  1  
ATOM   576    H HB3  . GLN A 1 42  ? -13.609 7.299   -8.822  0.016 26.27 ? 38  GLN A HB3  1  
ATOM   577    H HG2  . GLN A 1 42  ? -14.328 7.630   -6.721  0.016 24.75 ? 38  GLN A HG2  1  
ATOM   578    H HG3  . GLN A 1 42  ? -15.334 8.776   -7.168  0.016 24.60 ? 38  GLN A HG3  1  
ATOM   579    H HE21 . GLN A 1 42  ? -17.144 6.180   -8.874  0.016 23.91 ? 38  GLN A HE21 1  
ATOM   580    H HE22 . GLN A 1 42  ? -16.843 7.623   -9.058  0.016 24.63 ? 38  GLN A HE22 1  
ATOM   581    N N    . THR A 1 43  ? -14.357 10.986  -10.069 0.016 27.42 ? 39  THR A N    1  
ATOM   582    C CA   . THR A 1 43  ? -15.196 12.110  -10.441 0.016 27.46 ? 39  THR A CA   1  
ATOM   583    C C    . THR A 1 43  ? -16.136 11.645  -11.539 0.016 27.54 ? 39  THR A C    1  
ATOM   584    O O    . THR A 1 43  ? -15.715 10.938  -12.465 0.016 28.33 ? 39  THR A O    1  
ATOM   585    C CB   . THR A 1 43  ? -14.352 13.288  -10.944 0.016 28.81 ? 39  THR A CB   1  
ATOM   586    O OG1  . THR A 1 43  ? -13.252 13.520  -10.069 0.016 29.04 ? 39  THR A OG1  1  
ATOM   587    C CG2  . THR A 1 43  ? -15.177 14.543  -11.017 0.016 28.82 ? 39  THR A CG2  1  
ATOM   588    H H    . THR A 1 43  ? -13.999 10.602  -10.746 0.016 27.98 ? 39  THR A H    1  
ATOM   589    H HA   . THR A 1 43  ? -15.716 12.394  -9.677  0.016 26.70 ? 39  THR A HA   1  
ATOM   590    H HB   . THR A 1 43  ? -14.014 13.091  -11.832 0.016 29.68 ? 39  THR A HB   1  
ATOM   591    H HG1  . THR A 1 43  ? -12.779 12.829  -10.005 0.016 29.21 ? 39  THR A HG1  1  
ATOM   592    H HG21 . THR A 1 43  ? -16.084 14.362  -10.721 0.016 27.94 ? 39  THR A HG21 1  
ATOM   593    H HG22 . THR A 1 43  ? -14.787 15.223  -10.447 0.016 28.98 ? 39  THR A HG22 1  
ATOM   594    H HG23 . THR A 1 43  ? -15.194 14.867  -11.932 0.016 29.67 ? 39  THR A HG23 1  
ATOM   595    N N    . LEU A 1 44  ? -17.394 12.030  -11.432 0.016 26.85 ? 40  LEU A N    1  
ATOM   596    C CA   . LEU A 1 44  ? -18.406 11.737  -12.424 0.016 27.01 ? 40  LEU A CA   1  
ATOM   597    C C    . LEU A 1 44  ? -19.108 13.018  -12.842 0.016 27.46 ? 40  LEU A C    1  
ATOM   598    O O    . LEU A 1 44  ? -19.346 13.897  -12.024 0.016 26.99 ? 40  LEU A O    1  
ATOM   599    C CB   . LEU A 1 44  ? -19.449 10.787  -11.893 0.016 25.82 ? 40  LEU A CB   1  
ATOM   600    C CG   . LEU A 1 44  ? -18.984 9.350   -11.846 0.016 25.67 ? 40  LEU A CG   1  
ATOM   601    C CD1  . LEU A 1 44  ? -19.849 8.583   -10.874 0.016 24.47 ? 40  LEU A CD1  1  
ATOM   602    C CD2  . LEU A 1 44  ? -19.075 8.761   -13.257 0.016 26.76 ? 40  LEU A CD2  1  
ATOM   603    H H    . LEU A 1 44  ? -17.703 12.473  -10.766 0.016 26.35 ? 40  LEU A H    1  
ATOM   604    H HA   . LEU A 1 44  ? -17.992 11.343  -13.206 0.016 27.76 ? 40  LEU A HA   1  
ATOM   605    H HB2  . LEU A 1 44  ? -19.682 11.061  -10.991 0.016 25.11 ? 40  LEU A HB2  1  
ATOM   606    H HB3  . LEU A 1 44  ? -20.229 10.822  -12.467 0.016 25.96 ? 40  LEU A HB3  1  
ATOM   607    H HG   . LEU A 1 44  ? -18.064 9.319   -11.542 0.016 25.80 ? 40  LEU A HG   1  
ATOM   608    H HD11 . LEU A 1 44  ? -19.359 7.814   -10.540 0.016 24.54 ? 40  LEU A HD11 1  
ATOM   609    H HD12 . LEU A 1 44  ? -20.085 9.168   -10.137 0.016 23.94 ? 40  LEU A HD12 1  
ATOM   610    H HD13 . LEU A 1 44  ? -20.653 8.289   -11.330 0.016 24.31 ? 40  LEU A HD13 1  
ATOM   611    H HD21 . LEU A 1 44  ? -18.482 9.247   -13.845 0.016 27.59 ? 40  LEU A HD21 1  
ATOM   612    H HD22 . LEU A 1 44  ? -18.808 7.828   -13.225 0.016 26.59 ? 40  LEU A HD22 1  
ATOM   613    H HD23 . LEU A 1 44  ? -19.990 8.830   -13.568 0.016 26.91 ? 40  LEU A HD23 1  
ATOM   614    N N    . ASP A 1 45  ? -19.474 13.072  -14.108 0.016 28.48 ? 41  ASP A N    1  
ATOM   615    C CA   . ASP A 1 45  ? -20.323 14.114  -14.650 0.016 29.00 ? 41  ASP A CA   1  
ATOM   616    C C    . ASP A 1 45  ? -21.656 13.470  -15.022 0.016 28.65 ? 41  ASP A C    1  
ATOM   617    O O    . ASP A 1 45  ? -21.690 12.549  -15.844 0.016 29.21 ? 41  ASP A O    1  
ATOM   618    C CB   . ASP A 1 45  ? -19.645 14.763  -15.857 0.016 30.78 ? 41  ASP A CB   1  
ATOM   619    C CG   . ASP A 1 45  ? -18.461 15.644  -15.461 0.016 31.31 ? 41  ASP A CG   1  
ATOM   620    O OD1  . ASP A 1 45  ? -17.453 15.623  -16.170 0.016 32.74 ? 41  ASP A OD1  1  
ATOM   621    O OD2  . ASP A 1 45  ? -18.544 16.379  -14.445 0.016 30.46 ? 41  ASP A OD2  1  
ATOM   622    H H    . ASP A 1 45  ? -19.234 12.500  -14.700 0.016 28.99 ? 41  ASP A H    1  
ATOM   623    H HA   . ASP A 1 45  ? -20.473 14.793  -13.976 0.016 28.54 ? 41  ASP A HA   1  
ATOM   624    H HB2  . ASP A 1 45  ? -19.315 14.070  -16.447 0.016 31.31 ? 41  ASP A HB2  1  
ATOM   625    H HB3  . ASP A 1 45  ? -20.293 15.312  -16.326 0.016 31.22 ? 41  ASP A HB3  1  
ATOM   626    N N    . LEU A 1 46  ? -22.742 13.988  -14.449 0.016 27.92 ? 42  LEU A N    1  
ATOM   627    C CA   . LEU A 1 46  ? -24.074 13.396  -14.496 0.016 27.52 ? 42  LEU A CA   1  
ATOM   628    C C    . LEU A 1 46  ? -25.055 14.313  -15.213 0.016 28.35 ? 42  LEU A C    1  
ATOM   629    O O    . LEU A 1 46  ? -25.099 15.514  -14.928 0.016 28.48 ? 42  LEU A O    1  
ATOM   630    C CB   . LEU A 1 46  ? -24.574 13.125  -13.070 0.016 26.04 ? 42  LEU A CB   1  
ATOM   631    C CG   . LEU A 1 46  ? -23.579 12.227  -12.302 0.016 25.37 ? 42  LEU A CG   1  
ATOM   632    C CD1  . LEU A 1 46  ? -23.902 12.055  -10.801 0.016 24.35 ? 42  LEU A CD1  1  
ATOM   633    C CD2  . LEU A 1 46  ? -23.514 10.867  -13.008 0.016 25.12 ? 42  LEU A CD2  1  
ATOM   634    H H    . LEU A 1 46  ? -22.727 14.725  -14.010 0.016 27.71 ? 42  LEU A H    1  
ATOM   635    H HA   . LEU A 1 46  ? -24.046 12.573  -15.001 0.016 27.82 ? 42  LEU A HA   1  
ATOM   636    H HB2  . LEU A 1 46  ? -24.654 13.966  -12.597 0.016 25.81 ? 42  LEU A HB2  1  
ATOM   637    H HB3  . LEU A 1 46  ? -25.429 12.670  -13.102 0.016 25.86 ? 42  LEU A HB3  1  
ATOM   638    H HG   . LEU A 1 46  ? -22.697 12.626  -12.352 0.016 25.94 ? 42  LEU A HG   1  
ATOM   639    H HD11 . LEU A 1 46  ? -24.827 11.776  -10.708 0.016 23.88 ? 42  LEU A HD11 1  
ATOM   640    H HD12 . LEU A 1 46  ? -23.305 11.390  -10.422 0.016 24.00 ? 42  LEU A HD12 1  
ATOM   641    H HD13 . LEU A 1 46  ? -23.769 12.900  -10.347 0.016 24.67 ? 42  LEU A HD13 1  
ATOM   642    H HD21 . LEU A 1 46  ? -23.481 10.967  -13.968 0.016 25.91 ? 42  LEU A HD21 1  
ATOM   643    H HD22 . LEU A 1 46  ? -22.720 10.397  -12.706 0.016 24.85 ? 42  LEU A HD22 1  
ATOM   644    H HD23 . LEU A 1 46  ? -24.304 10.361  -12.765 0.016 24.57 ? 42  LEU A HD23 1  
ATOM   645    N N    . THR A 1 47  ? -25.845 13.735  -16.123 0.016 29.02 ? 43  THR A N    1  
ATOM   646    C CA   . THR A 1 47  ? -26.864 14.478  -16.865 0.016 29.98 ? 43  THR A CA   1  
ATOM   647    C C    . THR A 1 47  ? -28.236 13.829  -16.704 0.016 29.60 ? 43  THR A C    1  
ATOM   648    O O    . THR A 1 47  ? -28.382 12.603  -16.822 0.016 29.41 ? 43  THR A O    1  
ATOM   649    C CB   . THR A 1 47  ? -26.507 14.586  -18.357 0.016 31.83 ? 43  THR A CB   1  
ATOM   650    O OG1  . THR A 1 47  ? -27.304 15.614  -18.959 0.016 32.88 ? 43  THR A OG1  1  
ATOM   651    C CG2  . THR A 1 47  ? -26.816 13.302  -19.066 0.016 32.35 ? 43  THR A CG2  1  
ATOM   652    H H    . THR A 1 47  ? -25.806 12.904  -16.331 0.016 29.01 ? 43  THR A H    1  
ATOM   653    H HA   . THR A 1 47  ? -26.921 15.375  -16.507 0.016 29.85 ? 43  THR A HA   1  
ATOM   654    H HB   . THR A 1 47  ? -25.564 14.797  -18.467 0.016 32.14 ? 43  THR A HB   1  
ATOM   655    H HG1  . THR A 1 47  ? -27.113 15.688  -19.776 0.016 34.00 ? 43  THR A HG1  1  
ATOM   656    H HG21 . THR A 1 47  ? -27.762 13.263  -19.276 0.016 32.63 ? 43  THR A HG21 1  
ATOM   657    H HG22 . THR A 1 47  ? -26.313 13.255  -19.894 0.016 33.45 ? 43  THR A HG22 1  
ATOM   658    H HG23 . THR A 1 47  ? -26.583 12.545  -18.506 0.016 31.43 ? 43  THR A HG23 1  
ATOM   659    N N    . VAL A 1 48  ? -29.247 14.656  -16.442 0.016 29.63 ? 44  VAL A N    1  
ATOM   660    C CA   . VAL A 1 48  ? -30.631 14.191  -16.417 0.016 29.65 ? 44  VAL A CA   1  
ATOM   661    C C    . VAL A 1 48  ? -31.172 14.170  -17.848 0.016 31.43 ? 44  VAL A C    1  
ATOM   662    O O    . VAL A 1 48  ? -31.509 15.214  -18.417 0.016 32.48 ? 44  VAL A O    1  
ATOM   663    C CB   . VAL A 1 48  ? -31.498 15.061  -15.508 0.016 29.05 ? 44  VAL A CB   1  
ATOM   664    C CG1  . VAL A 1 48  ? -32.936 14.539  -15.502 0.016 29.21 ? 44  VAL A CG1  1  
ATOM   665    C CG2  . VAL A 1 48  ? -30.929 15.089  -14.103 0.016 27.55 ? 44  VAL A CG2  1  
ATOM   666    H H    . VAL A 1 48  ? -29.155 15.489  -16.270 0.016 29.71 ? 44  VAL A H    1  
ATOM   667    H HA   . VAL A 1 48  ? -30.660 13.283  -16.075 0.016 29.05 ? 44  VAL A HA   1  
ATOM   668    H HB   . VAL A 1 48  ? -31.508 15.968  -15.854 0.016 29.71 ? 44  VAL A HB   1  
ATOM   669    H HG11 . VAL A 1 48  ? -32.921 13.572  -15.420 0.016 28.88 ? 44  VAL A HG11 1  
ATOM   670    H HG12 . VAL A 1 48  ? -33.407 14.926  -14.749 0.016 28.66 ? 44  VAL A HG12 1  
ATOM   671    H HG13 . VAL A 1 48  ? -33.372 14.795  -16.330 0.016 30.30 ? 44  VAL A HG13 1  
ATOM   672    H HG21 . VAL A 1 48  ? -30.423 14.280  -13.951 0.016 27.08 ? 44  VAL A HG21 1  
ATOM   673    H HG22 . VAL A 1 48  ? -30.346 15.857  -14.014 0.016 27.65 ? 44  VAL A HG22 1  
ATOM   674    H HG23 . VAL A 1 48  ? -31.654 15.148  -13.464 0.016 27.11 ? 44  VAL A HG23 1  
ATOM   675    N N    . GLU A 1 49  ? -31.253 12.974  -18.436 0.016 31.92 ? 45  GLU A N    1  
ATOM   676    C CA   . GLU A 1 49  ? -31.719 12.825  -19.806 0.016 33.79 ? 45  GLU A CA   1  
ATOM   677    C C    . GLU A 1 49  ? -33.233 12.757  -19.911 0.016 34.31 ? 45  GLU A C    1  
ATOM   678    O O    . GLU A 1 49  ? -33.792 13.273  -20.885 0.016 35.93 ? 45  GLU A O    1  
ATOM   679    C CB   . GLU A 1 49  ? -31.128 11.568  -20.461 0.016 34.30 ? 45  GLU A CB   1  
ATOM   680    C CG   . GLU A 1 49  ? -30.216 11.831  -21.654 0.016 36.06 ? 45  GLU A CG   1  
ATOM   681    C CD   . GLU A 1 49  ? -30.774 12.861  -22.613 0.016 37.63 ? 45  GLU A CD   1  
ATOM   682    O OE1  . GLU A 1 49  ? -30.834 14.060  -22.266 0.016 37.10 ? 45  GLU A OE1  1  
ATOM   683    O OE2  . GLU A 1 49  ? -31.189 12.461  -23.712 0.016 39.51 ? 45  GLU A OE2  1  
ATOM   684    H H    . GLU A 1 49  ? -31.037 12.235  -18.056 0.016 31.26 ? 45  GLU A H    1  
ATOM   685    H HA   . GLU A 1 49  ? -31.430 13.608  -20.285 0.016 34.60 ? 45  GLU A HA   1  
ATOM   686    H HB2  . GLU A 1 49  ? -30.614 11.080  -19.797 0.016 33.19 ? 45  GLU A HB2  1  
ATOM   687    H HB3  . GLU A 1 49  ? -31.863 11.019  -20.778 0.016 34.67 ? 45  GLU A HB3  1  
ATOM   688    H HG2  . GLU A 1 49  ? -29.357 12.148  -21.335 0.016 35.57 ? 45  GLU A HG2  1  
ATOM   689    H HG3  . GLU A 1 49  ? -30.104 11.006  -22.149 0.016 36.82 ? 45  GLU A HG3  1  
ATOM   690    N N    . GLU A 1 50  ? -33.909 12.153  -18.933 0.016 33.13 ? 46  GLU A N    1  
ATOM   691    C CA   . GLU A 1 50  ? -35.365 12.141  -18.896 0.016 33.68 ? 46  GLU A CA   1  
ATOM   692    C C    . GLU A 1 50  ? -35.849 12.566  -17.516 0.016 32.20 ? 46  GLU A C    1  
ATOM   693    O O    . GLU A 1 50  ? -35.192 12.318  -16.503 0.016 30.68 ? 46  GLU A O    1  
ATOM   694    C CB   . GLU A 1 50  ? -35.947 10.760  -19.233 0.016 34.35 ? 46  GLU A CB   1  
ATOM   695    C CG   . GLU A 1 50  ? -35.525 10.214  -20.589 0.016 36.02 ? 46  GLU A CG   1  
ATOM   696    C CD   . GLU A 1 50  ? -36.171 8.859   -20.900 0.016 36.78 ? 46  GLU A CD   1  
ATOM   697    O OE1  . GLU A 1 50  ? -36.151 8.462   -22.077 0.016 38.50 ? 46  GLU A OE1  1  
ATOM   698    O OE2  . GLU A 1 50  ? -36.689 8.197   -19.972 0.016 35.81 ? 46  GLU A OE2  1  
ATOM   699    H H    . GLU A 1 50  ? -33.540 11.750  -18.273 0.016 32.11 ? 46  GLU A H    1  
ATOM   700    H HA   . GLU A 1 50  ? -35.707 12.772  -19.546 0.016 34.75 ? 46  GLU A HA   1  
ATOM   701    H HB2  . GLU A 1 50  ? -35.657 10.126  -18.558 0.016 33.31 ? 46  GLU A HB2  1  
ATOM   702    H HB3  . GLU A 1 50  ? -36.914 10.821  -19.229 0.016 34.87 ? 46  GLU A HB3  1  
ATOM   703    H HG2  . GLU A 1 50  ? -35.799 10.840  -21.277 0.016 37.20 ? 46  GLU A HG2  1  
ATOM   704    H HG3  . GLU A 1 50  ? -34.561 10.109  -20.607 0.016 35.63 ? 46  GLU A HG3  1  
ATOM   705    N N    . GLY A 1 51  ? -37.019 13.202  -17.490 0.016 32.82 ? 47  GLY A N    1  
ATOM   706    C CA   . GLY A 1 51  ? -37.664 13.606  -16.258 0.016 31.78 ? 47  GLY A CA   1  
ATOM   707    C C    . GLY A 1 51  ? -37.189 14.907  -15.653 0.016 31.12 ? 47  GLY A C    1  
ATOM   708    O O    . GLY A 1 51  ? -37.546 15.199  -14.502 0.016 30.18 ? 47  GLY A O    1  
ATOM   709    H H    . GLY A 1 51  ? -37.468 13.397  -18.194 0.016 33.96 ? 47  GLY A H    1  
ATOM   710    H HA2  . GLY A 1 51  ? -38.615 13.695  -16.419 0.016 32.52 ? 47  GLY A HA2  1  
ATOM   711    H HA3  . GLY A 1 51  ? -37.543 12.910  -15.594 0.016 30.88 ? 47  GLY A HA3  1  
ATOM   712    N N    . ALA A 1 52  ? -36.424 15.713  -16.386 0.016 31.74 ? 48  ALA A N    1  
ATOM   713    C CA   . ALA A 1 52  ? -36.045 17.019  -15.878 0.016 31.39 ? 48  ALA A CA   1  
ATOM   714    C C    . ALA A 1 52  ? -37.267 17.927  -15.961 0.016 32.30 ? 48  ALA A C    1  
ATOM   715    O O    . ALA A 1 52  ? -38.074 17.797  -16.890 0.016 33.71 ? 48  ALA A O    1  
ATOM   716    C CB   . ALA A 1 52  ? -34.910 17.601  -16.661 0.016 32.06 ? 48  ALA A CB   1  
ATOM   717    H H    . ALA A 1 52  ? -36.117 15.531  -17.168 0.016 32.45 ? 48  ALA A H    1  
ATOM   718    H HA   . ALA A 1 52  ? -35.764 16.925  -14.955 0.016 30.28 ? 48  ALA A HA   1  
ATOM   719    H HB1  . ALA A 1 52  ? -34.687 18.468  -16.290 0.016 31.86 ? 48  ALA A HB1  1  
ATOM   720    H HB2  . ALA A 1 52  ? -34.142 17.014  -16.604 0.016 31.59 ? 48  ALA A HB2  1  
ATOM   721    H HB3  . ALA A 1 52  ? -35.190 17.697  -17.584 0.016 33.28 ? 48  ALA A HB3  1  
ATOM   722    N N    . PRO A 1 53  ? -37.400 18.874  -15.016 0.016 31.66 ? 49  PRO A N    1  
ATOM   723    C CA   . PRO A 1 53  ? -36.505 19.113  -13.882 0.016 30.24 ? 49  PRO A CA   1  
ATOM   724    C C    . PRO A 1 53  ? -36.802 18.133  -12.725 0.016 28.99 ? 49  PRO A C    1  
ATOM   725    O O    . PRO A 1 53  ? -37.973 17.858  -12.444 0.016 29.24 ? 49  PRO A O    1  
ATOM   726    C CB   . PRO A 1 53  ? -36.812 20.566  -13.485 0.016 30.58 ? 49  PRO A CB   1  
ATOM   727    C CG   . PRO A 1 53  ? -38.224 20.822  -13.957 0.016 31.71 ? 49  PRO A CG   1  
ATOM   728    C CD   . PRO A 1 53  ? -38.491 19.867  -15.094 0.016 32.63 ? 49  PRO A CD   1  
ATOM   729    H HA   . PRO A 1 53  ? -35.580 19.041  -14.158 0.016 30.10 ? 49  PRO A HA   1  
ATOM   730    H HB2  . PRO A 1 53  ? -36.747 20.668  -12.524 0.016 29.75 ? 49  PRO A HB2  1  
ATOM   731    H HB3  . PRO A 1 53  ? -36.189 21.155  -13.933 0.016 31.06 ? 49  PRO A HB3  1  
ATOM   732    H HG2  . PRO A 1 53  ? -38.851 20.669  -13.233 0.016 31.25 ? 49  PRO A HG2  1  
ATOM   733    H HG3  . PRO A 1 53  ? -38.293 21.737  -14.267 0.016 32.41 ? 49  PRO A HG3  1  
ATOM   734    H HD2  . PRO A 1 53  ? -39.349 19.433  -14.972 0.016 32.84 ? 49  PRO A HD2  1  
ATOM   735    H HD3  . PRO A 1 53  ? -38.450 20.343  -15.939 0.016 33.68 ? 49  PRO A HD3  1  
ATOM   736    N N    . LEU A 1 54  ? -35.784 17.628  -12.047 0.016 27.81 ? 50  LEU A N    1  
ATOM   737    C CA   . LEU A 1 54  ? -36.048 16.641  -11.007 0.016 26.83 ? 50  LEU A CA   1  
ATOM   738    C C    . LEU A 1 54  ? -36.806 17.280  -9.849  0.016 26.53 ? 50  LEU A C    1  
ATOM   739    O O    . LEU A 1 54  ? -36.377 18.315  -9.325  0.016 26.37 ? 50  LEU A O    1  
ATOM   740    C CB   . LEU A 1 54  ? -34.769 16.012  -10.474 0.016 25.77 ? 50  LEU A CB   1  
ATOM   741    C CG   . LEU A 1 54  ? -34.066 14.997  -11.357 0.016 26.00 ? 50  LEU A CG   1  
ATOM   742    C CD1  . LEU A 1 54  ? -32.762 14.599  -10.671 0.016 24.97 ? 50  LEU A CD1  1  
ATOM   743    C CD2  . LEU A 1 54  ? -34.936 13.770  -11.665 0.016 26.54 ? 50  LEU A CD2  1  
ATOM   744    H H    . LEU A 1 54  ? -34.958 17.833  -12.167 0.016 27.65 ? 50  LEU A H    1  
ATOM   745    H HA   . LEU A 1 54  ? -36.575 15.932  -11.394 0.016 27.18 ? 50  LEU A HA   1  
ATOM   746    H HB2  . LEU A 1 54  ? -34.138 16.726  -10.295 0.016 25.58 ? 50  LEU A HB2  1  
ATOM   747    H HB3  . LEU A 1 54  ? -34.983 15.556  -9.645  0.016 25.20 ? 50  LEU A HB3  1  
ATOM   748    H HG   . LEU A 1 54  ? -33.842 15.424  -12.198 0.016 26.64 ? 50  LEU A HG   1  
ATOM   749    H HD11 . LEU A 1 54  ? -32.029 15.082  -11.084 0.016 25.23 ? 50  LEU A HD11 1  
ATOM   750    H HD12 . LEU A 1 54  ? -32.822 14.829  -9.730  0.016 24.44 ? 50  LEU A HD12 1  
ATOM   751    H HD13 . LEU A 1 54  ? -32.622 13.644  -10.778 0.016 24.73 ? 50  LEU A HD13 1  
ATOM   752    H HD21 . LEU A 1 54  ? -34.382 13.083  -12.066 0.016 26.33 ? 50  LEU A HD21 1  
ATOM   753    H HD22 . LEU A 1 54  ? -35.325 13.444  -10.840 0.016 26.27 ? 50  LEU A HD22 1  
ATOM   754    H HD23 . LEU A 1 54  ? -35.637 14.024  -12.284 0.016 27.46 ? 50  LEU A HD23 1  
ATOM   755    N N    . PRO A 1 55  ? -37.921 16.699  -9.419  0.016 26.61 ? 51  PRO A N    1  
ATOM   756    C CA   . PRO A 1 55  ? -38.712 17.322  -8.350  0.016 26.61 ? 51  PRO A CA   1  
ATOM   757    C C    . PRO A 1 55  ? -38.389 16.822  -6.946  0.016 25.59 ? 51  PRO A C    1  
ATOM   758    O O    . PRO A 1 55  ? -39.277 16.788  -6.090  0.016 25.69 ? 51  PRO A O    1  
ATOM   759    C CB   . PRO A 1 55  ? -40.137 16.936  -8.740  0.016 27.46 ? 51  PRO A CB   1  
ATOM   760    C CG   . PRO A 1 55  ? -39.959 15.525  -9.268  0.016 27.34 ? 51  PRO A CG   1  
ATOM   761    C CD   . PRO A 1 55  ? -38.671 15.616  -10.089 0.016 27.09 ? 51  PRO A CD   1  
ATOM   762    H HA   . PRO A 1 55  ? -38.628 18.284  -8.386  0.016 26.96 ? 51  PRO A HA   1  
ATOM   763    H HB2  . PRO A 1 55  ? -40.715 16.952  -7.962  0.016 27.32 ? 51  PRO A HB2  1  
ATOM   764    H HB3  . PRO A 1 55  ? -40.459 17.532  -9.433  0.016 28.28 ? 51  PRO A HB3  1  
ATOM   765    H HG2  . PRO A 1 55  ? -39.852 14.910  -8.528  0.016 26.74 ? 51  PRO A HG2  1  
ATOM   766    H HG3  . PRO A 1 55  ? -40.719 15.278  -9.803  0.016 28.16 ? 51  PRO A HG3  1  
ATOM   767    H HD2  . PRO A 1 55  ? -38.181 14.780  -10.037 0.016 26.54 ? 51  PRO A HD2  1  
ATOM   768    H HD3  . PRO A 1 55  ? -38.862 15.860  -11.007 0.016 27.89 ? 51  PRO A HD3  1  
ATOM   769    N N    . PHE A 1 56  ? -37.137 16.420  -6.699  0.016 24.75 ? 52  PHE A N    1  
ATOM   770    C CA   . PHE A 1 56  ? -36.711 15.962  -5.388  0.016 23.93 ? 52  PHE A CA   1  
ATOM   771    C C    . PHE A 1 56  ? -35.198 16.139  -5.231  0.016 23.31 ? 52  PHE A C    1  
ATOM   772    O O    . PHE A 1 56  ? -34.465 16.345  -6.193  0.016 23.46 ? 52  PHE A O    1  
ATOM   773    C CB   . PHE A 1 56  ? -37.065 14.486  -5.194  0.016 23.68 ? 52  PHE A CB   1  
ATOM   774    C CG   . PHE A 1 56  ? -36.457 13.611  -6.247  0.016 23.61 ? 52  PHE A CG   1  
ATOM   775    C CD1  . PHE A 1 56  ? -35.158 13.185  -6.133  0.016 22.93 ? 52  PHE A CD1  1  
ATOM   776    C CD2  . PHE A 1 56  ? -37.172 13.254  -7.378  0.016 24.41 ? 52  PHE A CD2  1  
ATOM   777    C CE1  . PHE A 1 56  ? -34.585 12.409  -7.111  0.016 23.00 ? 52  PHE A CE1  1  
ATOM   778    C CE2  . PHE A 1 56  ? -36.603 12.458  -8.348  0.016 24.52 ? 52  PHE A CE2  1  
ATOM   779    C CZ   . PHE A 1 56  ? -35.296 12.034  -8.216  0.016 23.79 ? 52  PHE A CZ   1  
ATOM   780    H H    . PHE A 1 56  ? -36.511 16.407  -7.289  0.016 24.73 ? 52  PHE A H    1  
ATOM   781    H HA   . PHE A 1 56  ? -37.159 16.481  -4.704  0.016 24.07 ? 52  PHE A HA   1  
ATOM   782    H HB2  . PHE A 1 56  ? -36.737 14.196  -4.331  0.016 23.21 ? 52  PHE A HB2  1  
ATOM   783    H HB3  . PHE A 1 56  ? -38.028 14.376  -5.234  0.016 24.17 ? 52  PHE A HB3  1  
ATOM   784    H HD1  . PHE A 1 56  ? -34.661 13.429  -5.386  0.016 22.50 ? 52  PHE A HD1  1  
ATOM   785    H HD2  . PHE A 1 56  ? -38.056 13.541  -7.470  0.016 24.98 ? 52  PHE A HD2  1  
ATOM   786    H HE1  . PHE A 1 56  ? -33.704 12.120  -7.010  0.016 22.59 ? 52  PHE A HE1  1  
ATOM   787    H HE2  . PHE A 1 56  ? -37.091 12.217  -9.101  0.016 25.18 ? 52  PHE A HE2  1  
ATOM   788    H HZ   . PHE A 1 56  ? -34.904 11.504  -8.871  0.016 23.94 ? 52  PHE A HZ   1  
ATOM   789    N N    . SER A 1 57  ? -34.736 16.047  -4.000  0.016 22.76 ? 53  SER A N    1  
ATOM   790    C CA   . SER A 1 57  ? -33.316 16.236  -3.685  0.016 22.33 ? 53  SER A CA   1  
ATOM   791    C C    . SER A 1 57  ? -32.397 15.294  -4.458  0.016 21.96 ? 53  SER A C    1  
ATOM   792    O O    . SER A 1 57  ? -32.467 14.073  -4.321  0.016 21.56 ? 53  SER A O    1  
ATOM   793    C CB   . SER A 1 57  ? -33.088 16.029  -2.188  0.016 22.02 ? 53  SER A CB   1  
ATOM   794    O OG   . SER A 1 57  ? -31.718 15.714  -1.905  0.016 21.81 ? 53  SER A OG   1  
ATOM   795    H H    . SER A 1 57  ? -35.221 15.867  -3.317  0.016 22.71 ? 53  SER A H    1  
ATOM   796    H HA   . SER A 1 57  ? -33.058 17.143  -3.904  0.016 22.63 ? 53  SER A HA   1  
ATOM   797    H HB2  . SER A 1 57  ? -33.324 16.841  -1.714  0.016 22.35 ? 53  SER A HB2  1  
ATOM   798    H HB3  . SER A 1 57  ? -33.646 15.299  -1.879  0.016 21.77 ? 53  SER A HB3  1  
ATOM   799    H HG   . SER A 1 57  ? -31.668 14.962  -1.536  0.016 21.51 ? 53  SER A HG   1  
ATOM   800    N N    . TYR A 1 58  ? -31.434 15.869  -5.169  0.016 22.19 ? 54  TYR A N    1  
ATOM   801    C CA   . TYR A 1 58  ? -30.437 15.053  -5.857  0.016 22.01 ? 54  TYR A CA   1  
ATOM   802    C C    . TYR A 1 58  ? -29.610 14.232  -4.878  0.016 21.36 ? 54  TYR A C    1  
ATOM   803    O O    . TYR A 1 58  ? -29.093 13.176  -5.249  0.016 21.13 ? 54  TYR A O    1  
ATOM   804    C CB   . TYR A 1 58  ? -29.504 15.949  -6.688  0.016 22.53 ? 54  TYR A CB   1  
ATOM   805    C CG   . TYR A 1 58  ? -28.857 15.272  -7.870  0.016 22.81 ? 54  TYR A CG   1  
ATOM   806    C CD1  . TYR A 1 58  ? -29.451 15.321  -9.102  0.016 23.53 ? 54  TYR A CD1  1  
ATOM   807    C CD2  . TYR A 1 58  ? -27.656 14.578  -7.755  0.016 22.52 ? 54  TYR A CD2  1  
ATOM   808    C CE1  . TYR A 1 58  ? -28.890 14.736  -10.203 0.016 24.00 ? 54  TYR A CE1  1  
ATOM   809    C CE2  . TYR A 1 58  ? -27.099 13.965  -8.844  0.016 22.93 ? 54  TYR A CE2  1  
ATOM   810    C CZ   . TYR A 1 58  ? -27.724 14.037  -10.070 0.016 23.68 ? 54  TYR A CZ   1  
ATOM   811    O OH   . TYR A 1 58  ? -27.158 13.439  -11.173 0.016 24.30 ? 54  TYR A OH   1  
ATOM   812    H H    . TYR A 1 58  ? -31.338 16.715  -5.279  0.016 22.52 ? 54  TYR A H    1  
ATOM   813    H HA   . TYR A 1 58  ? -30.890 14.463  -6.473  0.016 22.13 ? 54  TYR A HA   1  
ATOM   814    H HB2  . TYR A 1 58  ? -30.019 16.695  -7.026  0.016 22.98 ? 54  TYR A HB2  1  
ATOM   815    H HB3  . TYR A 1 58  ? -28.798 16.276  -6.112  0.016 22.39 ? 54  TYR A HB3  1  
ATOM   816    H HD1  . TYR A 1 58  ? -30.250 15.783  -9.194  0.016 23.80 ? 54  TYR A HD1  1  
ATOM   817    H HD2  . TYR A 1 58  ? -27.226 14.518  -6.932  0.016 22.14 ? 54  TYR A HD2  1  
ATOM   818    H HE1  . TYR A 1 58  ? -29.322 14.783  -11.022 0.016 24.61 ? 54  TYR A HE1  1  
ATOM   819    H HE2  . TYR A 1 58  ? -26.294 13.509  -8.755  0.016 22.80 ? 54  TYR A HE2  1  
ATOM   820    H HH   . TYR A 1 58  ? -27.741 13.318  -11.763 0.016 24.63 ? 54  TYR A HH   1  
ATOM   821    N N    . ASP A 1 59  ? -29.491 14.665  -3.619  0.016 21.18 ? 55  ASP A N    1  
ATOM   822    C CA   . ASP A 1 59  ? -28.602 13.981  -2.695  0.016 20.78 ? 55  ASP A CA   1  
ATOM   823    C C    . ASP A 1 59  ? -29.051 12.532  -2.439  0.016 20.38 ? 55  ASP A C    1  
ATOM   824    O O    . ASP A 1 59  ? -28.214 11.681  -2.142  0.016 20.11 ? 55  ASP A O    1  
ATOM   825    C CB   . ASP A 1 59  ? -28.493 14.718  -1.360  0.016 20.91 ? 55  ASP A CB   1  
ATOM   826    C CG   . ASP A 1 59  ? -27.825 16.088  -1.482  0.016 21.41 ? 55  ASP A CG   1  
ATOM   827    O OD1  . ASP A 1 59  ? -26.817 16.202  -2.207  0.016 21.56 ? 55  ASP A OD1  1  
ATOM   828    O OD2  . ASP A 1 59  ? -28.316 17.029  -0.806  0.016 21.78 ? 55  ASP A OD2  1  
ATOM   829    H H    . ASP A 1 59  ? -29.898 15.341  -3.287  0.016 21.38 ? 55  ASP A H    1  
ATOM   830    H HA   . ASP A 1 59  ? -27.717 13.950  -3.088  0.016 20.82 ? 55  ASP A HA   1  
ATOM   831    H HB2  . ASP A 1 59  ? -29.379 14.843  -0.988  0.016 20.99 ? 55  ASP A HB2  1  
ATOM   832    H HB3  . ASP A 1 59  ? -27.951 14.194  -0.757  0.016 20.73 ? 55  ASP A HB3  1  
ATOM   833    N N    . ILE A 1 60  ? -30.343 12.234  -2.556  0.016 20.47 ? 56  ILE A N    1  
ATOM   834    C CA   . ILE A 1 60  ? -30.729 10.850  -2.299  0.016 20.25 ? 56  ILE A CA   1  
ATOM   835    C C    . ILE A 1 60  ? -30.147 9.907   -3.330  0.016 20.16 ? 56  ILE A C    1  
ATOM   836    O O    . ILE A 1 60  ? -30.093 8.693   -3.072  0.016 19.97 ? 56  ILE A O    1  
ATOM   837    C CB   . ILE A 1 60  ? -32.253 10.664  -2.229  0.016 20.56 ? 56  ILE A CB   1  
ATOM   838    C CG1  . ILE A 1 60  ? -32.877 10.814  -3.617  0.016 20.97 ? 56  ILE A CG1  1  
ATOM   839    C CG2  . ILE A 1 60  ? -32.813 11.573  -1.165  0.016 20.78 ? 56  ILE A CG2  1  
ATOM   840    C CD1  . ILE A 1 60  ? -34.341 10.526  -3.691  0.016 21.45 ? 56  ILE A CD1  1  
ATOM   841    H H    . ILE A 1 60  ? -30.979 12.772  -2.759  0.016 20.72 ? 56  ILE A H    1  
ATOM   842    H HA   . ILE A 1 60  ? -30.365 10.594  -1.440  0.016 20.08 ? 56  ILE A HA   1  
ATOM   843    H HB   . ILE A 1 60  ? -32.411 9.752   -1.938  0.016 20.47 ? 56  ILE A HB   1  
ATOM   844    H HG12 . ILE A 1 60  ? -32.720 11.713  -3.943  0.016 21.13 ? 56  ILE A HG12 1  
ATOM   845    H HG13 . ILE A 1 60  ? -32.465 10.181  -4.220  0.016 20.90 ? 56  ILE A HG13 1  
ATOM   846    H HG21 . ILE A 1 60  ? -33.752 11.364  -1.040  0.016 21.03 ? 56  ILE A HG21 1  
ATOM   847    H HG22 . ILE A 1 60  ? -32.339 11.435  -0.335  0.016 20.63 ? 56  ILE A HG22 1  
ATOM   848    H HG23 . ILE A 1 60  ? -32.723 12.491  -1.459  0.016 20.94 ? 56  ILE A HG23 1  
ATOM   849    H HD11 . ILE A 1 60  ? -34.827 11.166  -3.151  0.016 21.58 ? 56  ILE A HD11 1  
ATOM   850    H HD12 . ILE A 1 60  ? -34.616 10.589  -4.619  0.016 21.81 ? 56  ILE A HD12 1  
ATOM   851    H HD13 . ILE A 1 60  ? -34.507 9.629   -3.362  0.016 21.39 ? 56  ILE A HD13 1  
ATOM   852    N N    . LEU A 1 61  ? -29.721 10.408  -4.490  0.016 20.42 ? 57  LEU A N    1  
ATOM   853    C CA   . LEU A 1 61  ? -29.200 9.542   -5.551  0.016 20.56 ? 57  LEU A CA   1  
ATOM   854    C C    . LEU A 1 61  ? -27.711 9.252   -5.451  0.016 20.37 ? 57  LEU A C    1  
ATOM   855    O O    . LEU A 1 61  ? -27.258 8.253   -6.015  0.016 20.44 ? 57  LEU A O    1  
ATOM   856    C CB   . LEU A 1 61  ? -29.434 10.175  -6.924  0.016 21.21 ? 57  LEU A CB   1  
ATOM   857    C CG   . LEU A 1 61  ? -30.874 10.541  -7.229  0.016 21.64 ? 57  LEU A CG   1  
ATOM   858    C CD1  . LEU A 1 61  ? -30.927 11.298  -8.533  0.016 22.43 ? 57  LEU A CD1  1  
ATOM   859    C CD2  . LEU A 1 61  ? -31.791 9.293   -7.284  0.016 21.74 ? 57  LEU A CD2  1  
ATOM   860    H H    . LEU A 1 61  ? -29.733 11.237  -4.693  0.016 20.62 ? 57  LEU A H    1  
ATOM   861    H HA   . LEU A 1 61  ? -29.678 8.704   -5.540  0.016 20.54 ? 57  LEU A HA   1  
ATOM   862    H HB2  . LEU A 1 61  ? -28.912 10.989  -6.971  0.016 21.30 ? 57  LEU A HB2  1  
ATOM   863    H HB3  . LEU A 1 61  ? -29.138 9.571   -7.618  0.016 21.41 ? 57  LEU A HB3  1  
ATOM   864    H HG   . LEU A 1 61  ? -31.202 11.111  -6.518  0.016 21.49 ? 57  LEU A HG   1  
ATOM   865    H HD11 . LEU A 1 61  ? -31.822 11.658  -8.641  0.016 22.73 ? 57  LEU A HD11 1  
ATOM   866    H HD12 . LEU A 1 61  ? -30.272 12.011  -8.512  0.016 22.43 ? 57  LEU A HD12 1  
ATOM   867    H HD13 . LEU A 1 61  ? -30.724 10.688  -9.257  0.016 22.73 ? 57  LEU A HD13 1  
ATOM   868    H HD21 . LEU A 1 61  ? -31.323 8.579   -7.742  0.016 21.81 ? 57  LEU A HD21 1  
ATOM   869    H HD22 . LEU A 1 61  ? -32.014 9.019   -6.381  0.016 21.38 ? 57  LEU A HD22 1  
ATOM   870    H HD23 . LEU A 1 61  ? -32.602 9.521   -7.766  0.016 22.22 ? 57  LEU A HD23 1  
ATOM   871    N N    . THR A 1 62  ? -26.908 10.136  -4.859  0.016 20.29 ? 58  THR A N    1  
ATOM   872    C CA   . THR A 1 62  ? -25.506 10.118  -5.237  0.016 20.48 ? 58  THR A CA   1  
ATOM   873    C C    . THR A 1 62  ? -24.772 8.863   -4.768  0.016 20.21 ? 58  THR A C    1  
ATOM   874    O O    . THR A 1 62  ? -23.904 8.374   -5.499  0.016 20.48 ? 58  THR A O    1  
ATOM   875    C CB   . THR A 1 62  ? -24.804 11.396  -4.759  0.016 20.71 ? 58  THR A CB   1  
ATOM   876    O OG1  . THR A 1 62  ? -25.155 11.678  -3.412  0.016 20.42 ? 58  THR A OG1  1  
ATOM   877    C CG2  . THR A 1 62  ? -25.201 12.539  -5.671  0.016 21.22 ? 58  THR A CG2  1  
ATOM   878    H H    . THR A 1 62  ? -27.135 10.719  -4.272  0.016 20.23 ? 58  THR A H    1  
ATOM   879    H HA   . THR A 1 62  ? -25.461 10.129  -6.206  0.016 20.82 ? 58  THR A HA   1  
ATOM   880    H HB   . THR A 1 62  ? -23.848 11.267  -4.820  0.016 20.88 ? 58  THR A HB   1  
ATOM   881    H HG1  . THR A 1 62  ? -24.680 11.234  -2.886  0.016 20.29 ? 58  THR A HG1  1  
ATOM   882    H HG21 . THR A 1 62  ? -26.160 12.692  -5.620  0.016 21.11 ? 58  THR A HG21 1  
ATOM   883    H HG22 . THR A 1 62  ? -24.748 13.361  -5.414  0.016 21.47 ? 58  THR A HG22 1  
ATOM   884    H HG23 . THR A 1 62  ? -24.969 12.318  -6.586  0.016 21.52 ? 58  THR A HG23 1  
ATOM   885    N N    . PRO A 1 63  ? -25.088 8.293   -3.606  0.016 19.82 ? 59  PRO A N    1  
ATOM   886    C CA   . PRO A 1 63  ? -24.421 7.042   -3.244  0.016 19.69 ? 59  PRO A CA   1  
ATOM   887    C C    . PRO A 1 63  ? -24.726 5.918   -4.237  0.016 19.80 ? 59  PRO A C    1  
ATOM   888    O O    . PRO A 1 63  ? -23.935 4.949   -4.325  0.016 19.88 ? 59  PRO A O    1  
ATOM   889    C CB   . PRO A 1 63  ? -24.965 6.741   -1.837  0.016 19.44 ? 59  PRO A CB   1  
ATOM   890    C CG   . PRO A 1 63  ? -25.491 8.058   -1.314  0.016 19.51 ? 59  PRO A CG   1  
ATOM   891    C CD   . PRO A 1 63  ? -26.023 8.724   -2.554  0.016 19.64 ? 59  PRO A CD   1  
ATOM   892    H HA   . PRO A 1 63  ? -23.469 7.194   -3.191  0.016 19.84 ? 59  PRO A HA   1  
ATOM   893    H HB2  . PRO A 1 63  ? -25.684 6.095   -1.898  0.016 19.36 ? 59  PRO A HB2  1  
ATOM   894    H HB3  . PRO A 1 63  ? -24.248 6.427   -1.263  0.016 19.46 ? 59  PRO A HB3  1  
ATOM   895    H HG2  . PRO A 1 63  ? -26.196 7.894   -0.674  0.016 19.46 ? 59  PRO A HG2  1  
ATOM   896    H HG3  . PRO A 1 63  ? -24.763 8.561   -0.919  0.016 19.65 ? 59  PRO A HG3  1  
ATOM   897    H HD2  . PRO A 1 63  ? -26.914 8.402   -2.750  0.016 19.60 ? 59  PRO A HD2  1  
ATOM   898    H HD3  . PRO A 1 63  ? -26.010 9.686   -2.452  0.016 19.78 ? 59  PRO A HD3  1  
ATOM   899    N N    . ALA A 1 64  ? -25.813 6.020   -5.019  0.016 19.95 ? 60  ALA A N    1  
ATOM   900    C CA   . ALA A 1 64  ? -26.051 4.972   -6.015  0.016 20.28 ? 60  ALA A CA   1  
ATOM   901    C C    . ALA A 1 64  ? -25.155 5.141   -7.233  0.016 20.80 ? 60  ALA A C    1  
ATOM   902    O O    . ALA A 1 64  ? -24.907 4.164   -7.963  0.016 21.11 ? 60  ALA A O    1  
ATOM   903    C CB   . ALA A 1 64  ? -27.521 4.928   -6.440  0.016 20.55 ? 60  ALA A CB   1  
ATOM   904    H H    . ALA A 1 64  ? -26.389 6.648   -5.001  0.016 19.96 ? 60  ALA A H    1  
ATOM   905    H HA   . ALA A 1 64  ? -25.844 4.114   -5.609  0.016 20.15 ? 60  ALA A HA   1  
ATOM   906    H HB1  . ALA A 1 64  ? -27.613 4.285   -7.158  0.016 20.94 ? 60  ALA A HB1  1  
ATOM   907    H HB2  . ALA A 1 64  ? -28.064 4.653   -5.686  0.016 20.37 ? 60  ALA A HB2  1  
ATOM   908    H HB3  . ALA A 1 64  ? -27.798 5.805   -6.753  0.016 20.62 ? 60  ALA A HB3  1  
ATOM   909    N N    . PHE A 1 65  ? -24.651 6.352   -7.456  0.016 21.03 ? 61  PHE A N    1  
ATOM   910    C CA   . PHE A 1 65  ? -23.707 6.618   -8.525  0.016 21.69 ? 61  PHE A CA   1  
ATOM   911    C C    . PHE A 1 65  ? -22.295 6.184   -8.143  0.016 21.63 ? 61  PHE A C    1  
ATOM   912    O O    . PHE A 1 65  ? -21.502 5.814   -9.000  0.016 22.23 ? 61  PHE A O    1  
ATOM   913    C CB   . PHE A 1 65  ? -23.713 8.106   -8.859  0.016 22.08 ? 61  PHE A CB   1  
ATOM   914    C CG   . PHE A 1 65  ? -24.976 8.566   -9.517  0.016 22.34 ? 61  PHE A CG   1  
ATOM   915    C CD1  . PHE A 1 65  ? -25.676 9.687   -9.052  0.016 22.13 ? 61  PHE A CD1  1  
ATOM   916    C CD2  . PHE A 1 65  ? -25.447 7.915   -10.635 0.016 22.98 ? 61  PHE A CD2  1  
ATOM   917    C CE1  . PHE A 1 65  ? -26.842 10.085  -9.688  0.016 22.51 ? 61  PHE A CE1  1  
ATOM   918    C CE2  . PHE A 1 65  ? -26.568 8.317   -11.278 0.016 23.42 ? 61  PHE A CE2  1  
ATOM   919    C CZ   . PHE A 1 65  ? -27.286 9.405   -10.812 0.016 23.17 ? 61  PHE A CZ   1  
ATOM   920    H H    . PHE A 1 65  ? -24.845 7.039   -6.984  0.016 20.89 ? 61  PHE A H    1  
ATOM   921    H HA   . PHE A 1 65  ? -23.966 6.125   -9.316  0.016 22.09 ? 61  PHE A HA   1  
ATOM   922    H HB2  . PHE A 1 65  ? -23.598 8.611   -8.039  0.016 21.76 ? 61  PHE A HB2  1  
ATOM   923    H HB3  . PHE A 1 65  ? -22.976 8.280   -9.462  0.016 22.62 ? 61  PHE A HB3  1  
ATOM   924    H HD1  . PHE A 1 65  ? -25.385 10.140  -8.296  0.016 21.81 ? 61  PHE A HD1  1  
ATOM   925    H HD2  . PHE A 1 65  ? -24.977 7.184   -10.963 0.016 23.21 ? 61  PHE A HD2  1  
ATOM   926    H HE1  . PHE A 1 65  ? -27.313 10.820  -9.374  0.016 22.42 ? 61  PHE A HE1  1  
ATOM   927    H HE2  . PHE A 1 65  ? -26.865 7.852   -12.024 0.016 23.96 ? 61  PHE A HE2  1  
ATOM   928    H HZ   . PHE A 1 65  ? -28.061 9.674   -11.245 0.016 23.53 ? 61  PHE A HZ   1  
HETATM 929    N N    . CRQ A 1 66  ? -21.993 6.583   -6.870  0.016 21.15 ? 62  CRQ A N    1  
HETATM 930    C CA1  . CRQ A 1 66  ? -20.843 6.348   -6.234  0.016 21.20 ? 62  CRQ A CA1  1  
HETATM 931    C CB1  . CRQ A 1 66  ? -19.848 7.444   -5.950  0.016 21.56 ? 62  CRQ A CB1  1  
HETATM 932    C CG1  . CRQ A 1 66  ? -19.714 8.239   -7.202  0.016 22.23 ? 62  CRQ A CG1  1  
HETATM 933    C C1   . CRQ A 1 66  ? -21.015 5.418   -5.155  0.016 20.67 ? 62  CRQ A C1   1  
HETATM 934    N N2   . CRQ A 1 66  ? -20.835 5.670   -3.886  0.016 20.40 ? 62  CRQ A N2   1  
HETATM 935    N N3   . CRQ A 1 66  ? -21.401 4.007   -5.380  0.016 20.55 ? 62  CRQ A N3   1  
HETATM 936    C C2   . CRQ A 1 66  ? -21.488 3.415   -4.103  0.016 20.15 ? 62  CRQ A C2   1  
HETATM 937    O O2   . CRQ A 1 66  ? -21.774 2.269   -3.827  0.016 20.03 ? 62  CRQ A O2   1  
HETATM 938    C CA2  . CRQ A 1 66  ? -21.131 4.469   -3.193  0.016 20.09 ? 62  CRQ A CA2  1  
HETATM 939    C CA3  . CRQ A 1 66  ? -21.752 3.423   -6.615  0.016 20.93 ? 62  CRQ A CA3  1  
HETATM 940    C CB2  . CRQ A 1 66  ? -20.990 4.349   -1.839  0.016 19.95 ? 62  CRQ A CB2  1  
HETATM 941    C CG2  . CRQ A 1 66  ? -21.787 3.669   -0.787  0.016 19.74 ? 62  CRQ A CG2  1  
HETATM 942    C CD1  . CRQ A 1 66  ? -21.237 3.481   0.472   0.016 19.96 ? 62  CRQ A CD1  1  
HETATM 943    C CD2  . CRQ A 1 66  ? -23.105 3.316   -0.972  0.016 19.50 ? 62  CRQ A CD2  1  
HETATM 944    C CE1  . CRQ A 1 66  ? -21.967 2.864   1.495   0.016 19.94 ? 62  CRQ A CE1  1  
HETATM 945    C CE2  . CRQ A 1 66  ? -23.847 2.728   0.043   0.016 19.48 ? 62  CRQ A CE2  1  
HETATM 946    C CZ   . CRQ A 1 66  ? -23.255 2.486   1.274   0.016 19.71 ? 62  CRQ A CZ   1  
HETATM 947    O OH   . CRQ A 1 66  ? -24.025 1.926   2.251   0.016 19.85 ? 62  CRQ A OH   1  
HETATM 948    O OE1  . CRQ A 1 66  ? -19.288 10.219  -5.955  0.016 22.39 ? 62  CRQ A OE1  1  
HETATM 949    C C    . CRQ A 1 66  ? -21.019 2.142   -6.867  0.016 21.27 ? 62  CRQ A C    1  
HETATM 950    O O    . CRQ A 1 66  ? -21.553 1.279   -7.628  0.016 21.65 ? 62  CRQ A O    1  
HETATM 951    C CD3  . CRQ A 1 66  ? -19.043 9.576   -6.959  0.016 22.71 ? 62  CRQ A CD3  1  
HETATM 952    N NE1  . CRQ A 1 66  ? -18.144 10.043  -7.931  0.016 23.69 ? 62  CRQ A NE1  1  
ATOM   953    N N    . ASN A 1 67  ? -19.758 2.409   -6.714  0.016 21.53 ? 65  ASN A N    1  
ATOM   954    C CA   . ASN A 1 67  ? -18.758 1.411   -7.129  0.016 22.10 ? 65  ASN A CA   1  
ATOM   955    C C    . ASN A 1 67  ? -17.515 1.318   -6.207  0.016 22.21 ? 65  ASN A C    1  
ATOM   956    O O    . ASN A 1 67  ? -16.511 1.998   -6.404  0.016 22.69 ? 65  ASN A O    1  
ATOM   957    C CB   . ASN A 1 67  ? -18.312 1.709   -8.552  0.016 22.95 ? 65  ASN A CB   1  
ATOM   958    C CG   . ASN A 1 67  ? -17.279 0.709   -9.093  0.016 23.73 ? 65  ASN A CG   1  
ATOM   959    O OD1  . ASN A 1 67  ? -17.033 -0.364  -8.508  0.016 23.59 ? 65  ASN A OD1  1  
ATOM   960    N ND2  . ASN A 1 67  ? -16.704 1.036   -10.238 0.016 24.68 ? 65  ASN A ND2  1  
ATOM   961    H H    . ASN A 1 67  ? -19.659 2.666   -5.899  0.016 21.24 ? 65  ASN A H    1  
ATOM   962    H HA   . ASN A 1 67  ? -19.185 0.543   -7.127  0.016 22.03 ? 65  ASN A HA   1  
ATOM   963    H HB2  . ASN A 1 67  ? -19.093 1.689   -9.129  0.016 23.00 ? 65  ASN A HB2  1  
ATOM   964    H HB3  . ASN A 1 67  ? -17.913 2.595   -8.578  0.016 23.10 ? 65  ASN A HB3  1  
ATOM   965    H HD21 . ASN A 1 67  ? -16.534 0.422   -10.816 0.016 25.19 ? 65  ASN A HD21 1  
ATOM   966    H HD22 . ASN A 1 67  ? -16.503 1.851   -10.411 0.016 24.85 ? 65  ASN A HD22 1  
ATOM   967    N N    . ARG A 1 68  ? -17.565 0.401   -5.246  0.016 21.94 ? 66  ARG A N    1  
ATOM   968    C CA   . ARG A 1 68  ? -16.519 0.266   -4.239  0.016 22.14 ? 66  ARG A CA   1  
ATOM   969    C C    . ARG A 1 68  ? -15.200 -0.315  -4.795  0.016 22.98 ? 66  ARG A C    1  
ATOM   970    O O    . ARG A 1 68  ? -14.261 -0.446  -4.022  0.016 23.32 ? 66  ARG A O    1  
ATOM   971    C CB   . ARG A 1 68  ? -17.055 -0.546  -3.063  0.016 21.77 ? 66  ARG A CB   1  
ATOM   972    C CG   . ARG A 1 68  ? -17.212 0.221   -1.703  0.016 21.36 ? 66  ARG A CG   1  
ATOM   973    C CD   . ARG A 1 68  ? -17.011 -0.848  -0.658  0.016 21.28 ? 66  ARG A CD   1  
ATOM   974    N NE   . ARG A 1 68  ? -17.117 -0.582  0.777   0.016 21.31 ? 66  ARG A NE   1  
ATOM   975    C CZ   . ARG A 1 68  ? -17.978 0.206   1.407   0.016 21.04 ? 66  ARG A CZ   1  
ATOM   976    N NH1  . ARG A 1 68  ? -18.829 0.956   0.766   0.016 20.66 ? 66  ARG A NH1  1  
ATOM   977    N NH2  . ARG A 1 68  ? -17.983 0.256   2.721   0.016 21.31 ? 66  ARG A NH2  1  
ATOM   978    H H    . ARG A 1 68  ? -18.210 -0.153  -5.154  0.016 21.73 ? 66  ARG A H    1  
ATOM   979    H HA   . ARG A 1 68  ? -16.311 1.145   -3.885  0.016 22.09 ? 66  ARG A HA   1  
ATOM   980    H HB2  . ARG A 1 68  ? -17.941 -0.861  -3.299  0.016 21.59 ? 66  ARG A HB2  1  
ATOM   981    H HB3  . ARG A 1 68  ? -16.472 -1.304  -2.909  0.016 22.12 ? 66  ARG A HB3  1  
ATOM   982    H HG2  . ARG A 1 68  ? -16.540 0.917   -1.607  0.016 21.61 ? 66  ARG A HG2  1  
ATOM   983    H HG3  . ARG A 1 68  ? -18.102 0.585   -1.658  0.016 21.03 ? 66  ARG A HG3  1  
ATOM   984    H HD2  . ARG A 1 68  ? -17.643 -1.558  -0.849  0.016 21.00 ? 66  ARG A HD2  1  
ATOM   985    H HD3  . ARG A 1 68  ? -16.114 -1.194  -0.785  0.016 21.63 ? 66  ARG A HD3  1  
ATOM   986    H HE   . ARG A 1 68  ? -16.767 -1.194  1.267   0.016 21.52 ? 66  ARG A HE   1  
ATOM   987    H HH11 . ARG A 1 68  ? -18.875 0.937   -0.081  0.016 20.60 ? 66  ARG A HH11 1  
ATOM   988    H HH12 . ARG A 1 68  ? -19.371 1.452   1.205   0.016 20.53 ? 66  ARG A HH12 1  
ATOM   989    H HH21 . ARG A 1 68  ? -17.434 -0.217  3.177   0.016 21.64 ? 66  ARG A HH21 1  
ATOM   990    H HH22 . ARG A 1 68  ? -18.526 0.794   3.125   0.016 21.23 ? 66  ARG A HH22 1  
ATOM   991    N N    . ALA A 1 69  ? -15.080 -0.599  -6.097  0.016 23.48 ? 67  ALA A N    1  
ATOM   992    C CA   . ALA A 1 69  ? -13.760 -0.797  -6.707  0.016 24.48 ? 67  ALA A CA   1  
ATOM   993    C C    . ALA A 1 69  ? -12.888 0.448   -6.567  0.016 24.92 ? 67  ALA A C    1  
ATOM   994    O O    . ALA A 1 69  ? -11.658 0.363   -6.630  0.016 25.82 ? 67  ALA A O    1  
ATOM   995    C CB   . ALA A 1 69  ? -13.909 -1.152  -8.188  0.016 25.10 ? 67  ALA A CB   1  
ATOM   996    H H    . ALA A 1 69  ? -15.738 -0.686  -6.640  0.016 23.36 ? 67  ALA A H    1  
ATOM   997    H HA   . ALA A 1 69  ? -13.307 -1.534  -6.275  0.016 24.66 ? 67  ALA A HA   1  
ATOM   998    H HB1  . ALA A 1 69  ? -14.200 -0.375  -8.686  0.016 25.17 ? 67  ALA A HB1  1  
ATOM   999    H HB2  . ALA A 1 69  ? -13.049 -1.448  -8.523  0.016 25.82 ? 67  ALA A HB2  1  
ATOM   1000   H HB3  . ALA A 1 69  ? -14.563 -1.858  -8.280  0.016 24.81 ? 67  ALA A HB3  1  
ATOM   1001   N N    . PHE A 1 70  ? -13.526 1.600   -6.384  0.016 24.43 ? 68  PHE A N    1  
ATOM   1002   C CA   . PHE A 1 70  ? -12.852 2.890   -6.111  0.016 24.87 ? 68  PHE A CA   1  
ATOM   1003   C C    . PHE A 1 70  ? -12.711 3.107   -4.597  0.016 24.54 ? 68  PHE A C    1  
ATOM   1004   O O    . PHE A 1 70  ? -13.241 4.053   -3.999  0.016 24.09 ? 68  PHE A O    1  
ATOM   1005   C CB   . PHE A 1 70  ? -13.623 4.044   -6.760  0.016 24.71 ? 68  PHE A CB   1  
ATOM   1006   C CG   . PHE A 1 70  ? -13.577 4.076   -8.287  0.016 25.43 ? 68  PHE A CG   1  
ATOM   1007   C CD1  . PHE A 1 70  ? -14.691 3.748   -9.033  0.016 25.06 ? 68  PHE A CD1  1  
ATOM   1008   C CD2  . PHE A 1 70  ? -12.432 4.485   -8.973  0.016 26.66 ? 68  PHE A CD2  1  
ATOM   1009   C CE1  . PHE A 1 70  ? -14.669 3.772   -10.405 0.016 25.91 ? 68  PHE A CE1  1  
ATOM   1010   C CE2  . PHE A 1 70  ? -12.395 4.521   -10.362 0.016 27.53 ? 68  PHE A CE2  1  
ATOM   1011   C CZ   . PHE A 1 70  ? -13.487 4.178   -11.088 0.016 27.19 ? 68  PHE A CZ   1  
ATOM   1012   H H    . PHE A 1 70  ? -14.378 1.666   -6.424  0.016 23.91 ? 68  PHE A H    1  
ATOM   1013   H HA   . PHE A 1 70  ? -11.964 2.859   -6.495  0.016 25.65 ? 68  PHE A HA   1  
ATOM   1014   H HB2  . PHE A 1 70  ? -14.552 3.959   -6.500  0.016 23.99 ? 68  PHE A HB2  1  
ATOM   1015   H HB3  . PHE A 1 70  ? -13.269 4.882   -6.428  0.016 24.97 ? 68  PHE A HB3  1  
ATOM   1016   H HD1  . PHE A 1 70  ? -15.463 3.472   -8.600  0.016 24.35 ? 68  PHE A HD1  1  
ATOM   1017   H HD2  . PHE A 1 70  ? -11.672 4.717   -8.492  0.016 27.03 ? 68  PHE A HD2  1  
ATOM   1018   H HE1  . PHE A 1 70  ? -15.426 3.535   -10.886 0.016 25.77 ? 68  PHE A HE1  1  
ATOM   1019   H HE2  . PHE A 1 70  ? -11.616 4.784   -10.797 0.016 28.46 ? 68  PHE A HE2  1  
ATOM   1020   H HZ   . PHE A 1 70  ? -13.464 4.203   -12.015 0.016 27.89 ? 68  PHE A HZ   1  
ATOM   1021   N N    . THR A 1 71  ? -11.965 2.192   -3.969  0.016 24.95 ? 69  THR A N    1  
ATOM   1022   C CA   . THR A 1 71  ? -11.678 2.211   -2.540  0.016 24.99 ? 69  THR A CA   1  
ATOM   1023   C C    . THR A 1 71  ? -10.221 1.849   -2.352  0.016 26.14 ? 69  THR A C    1  
ATOM   1024   O O    . THR A 1 71  ? -9.763  0.858   -2.921  0.016 26.50 ? 69  THR A O    1  
ATOM   1025   C CB   . THR A 1 71  ? -12.520 1.188   -1.755  0.016 24.26 ? 69  THR A CB   1  
ATOM   1026   O OG1  . THR A 1 71  ? -13.901 1.367   -2.012  0.016 23.36 ? 69  THR A OG1  1  
ATOM   1027   C CG2  . THR A 1 71  ? -12.270 1.324   -0.248  0.016 24.33 ? 69  THR A CG2  1  
ATOM   1028   H H    . THR A 1 71  ? -11.594 1.534   -4.377  0.016 25.32 ? 69  THR A H    1  
ATOM   1029   H HA   . THR A 1 71  ? -11.839 3.096   -2.176  0.016 24.93 ? 69  THR A HA   1  
ATOM   1030   H HB   . THR A 1 71  ? -12.253 0.299   -2.027  0.016 24.52 ? 69  THR A HB   1  
ATOM   1031   H HG1  . THR A 1 71  ? -14.037 1.371   -2.838  0.016 23.42 ? 69  THR A HG1  1  
ATOM   1032   H HG21 . THR A 1 71  ? -12.081 0.458   0.140   0.016 24.37 ? 69  THR A HG21 1  
ATOM   1033   H HG22 . THR A 1 71  ? -11.518 1.914   -0.084  0.016 24.97 ? 69  THR A HG22 1  
ATOM   1034   H HG23 . THR A 1 71  ? -13.053 1.697   0.183   0.016 23.82 ? 69  THR A HG23 1  
ATOM   1035   N N    . LYS A 1 72  ? -9.503  2.646   -1.565  0.016 26.85 ? 70  LYS A N    1  
ATOM   1036   C CA   . LYS A 1 72  ? -8.113  2.354   -1.220  0.016 28.08 ? 70  LYS A CA   1  
ATOM   1037   C C    . LYS A 1 72  ? -8.117  1.251   -0.166  0.016 27.89 ? 70  LYS A C    1  
ATOM   1038   O O    . LYS A 1 72  ? -8.593  1.458   0.951   0.016 27.52 ? 70  LYS A O    1  
ATOM   1039   C CB   . LYS A 1 72  ? -7.423  3.628   -0.732  0.016 29.07 ? 70  LYS A CB   1  
ATOM   1040   C CG   . LYS A 1 72  ? -6.394  3.470   0.414   0.016 29.94 ? 70  LYS A CG   1  
ATOM   1041   C CD   . LYS A 1 72  ? -5.731  4.827   0.760   0.016 31.12 ? 70  LYS A CD   1  
ATOM   1042   C CE   . LYS A 1 72  ? -4.356  4.981   0.226   0.016 32.67 ? 70  LYS A CE   1  
ATOM   1043   N NZ   . LYS A 1 72  ? -4.036  6.463   0.258   0.016 33.44 ? 70  LYS A NZ   1  
ATOM   1044   H H    . LYS A 1 72  ? -9.810  3.360   -1.205  0.016 26.72 ? 70  LYS A H    1  
ATOM   1045   H HA   . LYS A 1 72  ? -7.635  2.031   -2.002  0.016 28.51 ? 70  LYS A HA   1  
ATOM   1046   H HB2  . LYS A 1 72  ? -6.957  4.036   -1.479  0.016 29.83 ? 70  LYS A HB2  1  
ATOM   1047   H HB3  . LYS A 1 72  ? -8.121  4.218   -0.445  0.016 28.61 ? 70  LYS A HB3  1  
ATOM   1048   H HG2  . LYS A 1 72  ? -6.837  3.154   1.216   0.016 29.34 ? 70  LYS A HG2  1  
ATOM   1049   H HG3  . LYS A 1 72  ? -5.705  2.846   0.138   0.016 30.50 ? 70  LYS A HG3  1  
ATOM   1050   H HD2  . LYS A 1 72  ? -6.258  5.546   0.382   0.016 30.70 ? 70  LYS A HD2  1  
ATOM   1051   H HD3  . LYS A 1 72  ? -5.683  4.923   1.725   0.016 31.43 ? 70  LYS A HD3  1  
ATOM   1052   H HE2  . LYS A 1 72  ? -3.724  4.501   0.783   0.016 33.45 ? 70  LYS A HE2  1  
ATOM   1053   H HE3  . LYS A 1 72  ? -4.323  4.659   -0.689  0.016 32.51 ? 70  LYS A HE3  1  
ATOM   1054   H HZ1  . LYS A 1 72  ? -3.157  6.587   0.198   0.016 34.56 ? 70  LYS A HZ1  1  
ATOM   1055   H HZ2  . LYS A 1 72  ? -4.432  6.876   -0.424  0.016 32.91 ? 70  LYS A HZ2  1  
ATOM   1056   H HZ3  . LYS A 1 72  ? -4.328  6.821   1.020   0.016 33.39 ? 70  LYS A HZ3  1  
ATOM   1057   N N    . TYR A 1 73  ? -7.631  0.039   -0.551  0.016 28.22 ? 71  TYR A N    1  
ATOM   1058   C CA   . TYR A 1 73  ? -7.573  -1.129  0.316   0.016 28.27 ? 71  TYR A CA   1  
ATOM   1059   C C    . TYR A 1 73  ? -6.137  -1.404  0.729   0.016 29.73 ? 71  TYR A C    1  
ATOM   1060   O O    . TYR A 1 73  ? -5.265  -1.484  -0.139  0.016 30.59 ? 71  TYR A O    1  
ATOM   1061   C CB   . TYR A 1 73  ? -8.140  -2.360  -0.393  0.016 27.72 ? 71  TYR A CB   1  
ATOM   1062   C CG   . TYR A 1 73  ? -9.575  -2.623  -0.031  0.016 26.52 ? 71  TYR A CG   1  
ATOM   1063   C CD1  . TYR A 1 73  ? -10.596 -2.021  -0.727  0.016 25.62 ? 71  TYR A CD1  1  
ATOM   1064   C CD2  . TYR A 1 73  ? -9.902  -3.416  1.061   0.016 26.46 ? 71  TYR A CD2  1  
ATOM   1065   C CE1  . TYR A 1 73  ? -11.930 -2.232  -0.379  0.016 24.66 ? 71  TYR A CE1  1  
ATOM   1066   C CE2  . TYR A 1 73  ? -11.221 -3.633  1.407   0.016 25.54 ? 71  TYR A CE2  1  
ATOM   1067   C CZ   . TYR A 1 73  ? -12.225 -3.025  0.694   0.016 24.65 ? 71  TYR A CZ   1  
ATOM   1068   O OH   . TYR A 1 73  ? -13.518 -3.237  1.049   0.016 23.90 ? 71  TYR A OH   1  
ATOM   1069   H H    . TYR A 1 73  ? -7.321  -0.117  -1.338  0.016 28.51 ? 71  TYR A H    1  
ATOM   1070   H HA   . TYR A 1 73  ? -8.108  -0.961  1.103   0.016 27.84 ? 71  TYR A HA   1  
ATOM   1071   H HB2  . TYR A 1 73  ? -8.090  -2.230  -1.352  0.016 27.74 ? 71  TYR A HB2  1  
ATOM   1072   H HB3  . TYR A 1 73  ? -7.617  -3.132  -0.133  0.016 28.27 ? 71  TYR A HB3  1  
ATOM   1073   H HD1  . TYR A 1 73  ? -10.390 -1.479  -1.455  0.016 25.74 ? 71  TYR A HD1  1  
ATOM   1074   H HD2  . TYR A 1 73  ? -9.225  -3.821  1.550   0.016 27.15 ? 71  TYR A HD2  1  
ATOM   1075   H HE1  . TYR A 1 73  ? -12.610 -1.831  -0.864  0.016 24.14 ? 71  TYR A HE1  1  
ATOM   1076   H HE2  . TYR A 1 73  ? -11.435 -4.169  2.136   0.016 25.62 ? 71  TYR A HE2  1  
ATOM   1077   H HH   . TYR A 1 73  ? -13.681 -4.061  1.059   0.016 23.94 ? 71  TYR A HH   1  
ATOM   1078   N N    . PRO A 1 74  ? -5.845  -1.526  2.018   0.016 30.24 ? 72  PRO A N    1  
ATOM   1079   C CA   . PRO A 1 74  ? -4.523  -2.014  2.419   0.016 31.76 ? 72  PRO A CA   1  
ATOM   1080   C C    . PRO A 1 74  ? -4.337  -3.437  1.922   0.016 31.89 ? 72  PRO A C    1  
ATOM   1081   O O    . PRO A 1 74  ? -5.314  -4.161  1.724   0.016 30.85 ? 72  PRO A O    1  
ATOM   1082   C CB   . PRO A 1 74  ? -4.568  -1.953  3.949   0.016 32.14 ? 72  PRO A CB   1  
ATOM   1083   C CG   . PRO A 1 74  ? -5.624  -0.926  4.278   0.016 31.13 ? 72  PRO A CG   1  
ATOM   1084   C CD   . PRO A 1 74  ? -6.669  -1.156  3.187   0.016 29.67 ? 72  PRO A CD   1  
ATOM   1085   H HA   . PRO A 1 74  ? -3.817  -1.443  2.079   0.016 32.50 ? 72  PRO A HA   1  
ATOM   1086   H HB2  . PRO A 1 74  ? -4.817  -2.824  4.295   0.016 31.99 ? 72  PRO A HB2  1  
ATOM   1087   H HB3  . PRO A 1 74  ? -3.701  -1.680  4.290   0.016 33.27 ? 72  PRO A HB3  1  
ATOM   1088   H HG2  . PRO A 1 74  ? -5.983  -1.080  5.165   0.016 31.10 ? 72  PRO A HG2  1  
ATOM   1089   H HG3  . PRO A 1 74  ? -5.249  -0.035  4.211   0.016 31.57 ? 72  PRO A HG3  1  
ATOM   1090   H HD2  . PRO A 1 74  ? -7.260  -1.883  3.430   0.016 29.16 ? 72  PRO A HD2  1  
ATOM   1091   H HD3  . PRO A 1 74  ? -7.163  -0.341  3.013   0.016 29.15 ? 72  PRO A HD3  1  
ATOM   1092   N N    . GLU A 1 75  ? -3.073  -3.824  1.699   0.016 33.29 ? 73  GLU A N    1  
ATOM   1093   C CA   . GLU A 1 75  ? -2.788  -5.175  1.226   0.016 33.64 ? 73  GLU A CA   1  
ATOM   1094   C C    . GLU A 1 75  ? -3.154  -6.232  2.253   0.016 33.54 ? 73  GLU A C    1  
ATOM   1095   O O    . GLU A 1 75  ? -3.369  -7.390  1.874   0.016 33.40 ? 73  GLU A O    1  
ATOM   1096   C CB   . GLU A 1 75  ? -1.307  -5.320  0.832   0.016 35.38 ? 73  GLU A CB   1  
ATOM   1097   C CG   . GLU A 1 75  ? -0.963  -4.590  -0.470  0.016 35.61 ? 73  GLU A CG   1  
ATOM   1098   C CD   . GLU A 1 75  ? 0.497   -4.745  -0.895  0.016 37.51 ? 73  GLU A CD   1  
ATOM   1099   O OE1  . GLU A 1 75  ? 1.111   -5.790  -0.625  0.016 38.48 ? 73  GLU A OE1  1  
ATOM   1100   O OE2  . GLU A 1 75  ? 1.028   -3.787  -1.502  0.016 38.13 ? 73  GLU A OE2  1  
ATOM   1101   H H    . GLU A 1 75  ? -2.381  -3.333  1.816   0.016 34.12 ? 73  GLU A H    1  
ATOM   1102   H HA   . GLU A 1 75  ? -3.318  -5.343  0.431   0.016 32.94 ? 73  GLU A HA   1  
ATOM   1103   H HB2  . GLU A 1 75  ? -0.751  -4.960  1.540   0.016 36.17 ? 73  GLU A HB2  1  
ATOM   1104   H HB3  . GLU A 1 75  ? -1.104  -6.260  0.705   0.016 35.73 ? 73  GLU A HB3  1  
ATOM   1105   H HG2  . GLU A 1 75  ? -1.524  -4.929  -1.184  0.016 34.89 ? 73  GLU A HG2  1  
ATOM   1106   H HG3  . GLU A 1 75  ? -1.133  -3.644  -0.347  0.016 35.37 ? 73  GLU A HG3  1  
ATOM   1107   N N    . ASP A 1 76  ? -3.238  -5.872  3.529   0.016 33.76 ? 74  ASP A N    1  
ATOM   1108   C CA   . ASP A 1 76  ? -3.646  -6.802  4.578   0.016 33.78 ? 74  ASP A CA   1  
ATOM   1109   C C    . ASP A 1 76  ? -5.138  -7.179  4.531   0.016 32.23 ? 74  ASP A C    1  
ATOM   1110   O O    . ASP A 1 76  ? -5.531  -8.135  5.209   0.016 32.30 ? 74  ASP A O    1  
ATOM   1111   C CB   . ASP A 1 76  ? -3.332  -6.212  5.953   0.016 34.66 ? 74  ASP A CB   1  
ATOM   1112   C CG   . ASP A 1 76  ? -2.034  -6.728  6.548   0.016 36.59 ? 74  ASP A CG   1  
ATOM   1113   O OD1  . ASP A 1 76  ? -1.157  -7.280  5.829   0.016 37.30 ? 74  ASP A OD1  1  
ATOM   1114   O OD2  . ASP A 1 76  ? -1.880  -6.559  7.774   0.016 37.57 ? 74  ASP A OD2  1  
ATOM   1115   H H    . ASP A 1 76  ? -3.043  -5.087  3.819   0.016 34.02 ? 74  ASP A H    1  
ATOM   1116   H HA   . ASP A 1 76  ? -3.136  -7.618  4.482   0.016 34.44 ? 74  ASP A HA   1  
ATOM   1117   H HB2  . ASP A 1 76  ? -3.273  -5.246  5.881   0.016 34.44 ? 74  ASP A HB2  1  
ATOM   1118   H HB3  . ASP A 1 76  ? -4.043  -6.457  6.564   0.016 34.34 ? 74  ASP A HB3  1  
ATOM   1119   N N    . ILE A 1 77  ? -5.968  -6.460  3.777   0.016 30.99 ? 75  ILE A N    1  
ATOM   1120   C CA   . ILE A 1 77  ? -7.400  -6.726  3.692   0.016 29.66 ? 75  ILE A CA   1  
ATOM   1121   C C    . ILE A 1 77  ? -7.725  -7.134  2.260   0.016 29.06 ? 75  ILE A C    1  
ATOM   1122   O O    . ILE A 1 77  ? -7.539  -6.336  1.334   0.016 28.82 ? 75  ILE A O    1  
ATOM   1123   C CB   . ILE A 1 77  ? -8.252  -5.502  4.086   0.016 28.81 ? 75  ILE A CB   1  
ATOM   1124   C CG1  . ILE A 1 77  ? -7.735  -4.908  5.402   0.016 29.66 ? 75  ILE A CG1  1  
ATOM   1125   C CG2  . ILE A 1 77  ? -9.727  -5.882  4.188   0.016 27.66 ? 75  ILE A CG2  1  
ATOM   1126   C CD1  . ILE A 1 77  ? -8.648  -3.883  6.064   0.016 29.04 ? 75  ILE A CD1  1  
ATOM   1127   H H    . ILE A 1 77  ? -5.719  -5.796  3.294   0.016 30.99 ? 75  ILE A H    1  
ATOM   1128   H HA   . ILE A 1 77  ? -7.624  -7.447  4.295   0.016 29.83 ? 75  ILE A HA   1  
ATOM   1129   H HB   . ILE A 1 77  ? -8.163  -4.834  3.391   0.016 28.61 ? 75  ILE A HB   1  
ATOM   1130   H HG12 . ILE A 1 77  ? -7.601  -5.633  6.033   0.016 30.00 ? 75  ILE A HG12 1  
ATOM   1131   H HG13 . ILE A 1 77  ? -6.886  -4.471  5.227   0.016 30.47 ? 75  ILE A HG13 1  
ATOM   1132   H HG21 . ILE A 1 77  ? -10.260 -5.073  4.192   0.016 27.13 ? 75  ILE A HG21 1  
ATOM   1133   H HG22 . ILE A 1 77  ? -9.975  -6.428  3.427   0.016 27.30 ? 75  ILE A HG22 1  
ATOM   1134   H HG23 . ILE A 1 77  ? -9.874  -6.370  5.010   0.016 27.93 ? 75  ILE A HG23 1  
ATOM   1135   H HD11 . ILE A 1 77  ? -9.492  -4.304  6.289   0.016 28.46 ? 75  ILE A HD11 1  
ATOM   1136   H HD12 . ILE A 1 77  ? -8.220  -3.555  6.867   0.016 29.81 ? 75  ILE A HD12 1  
ATOM   1137   H HD13 . ILE A 1 77  ? -8.794  -3.144  5.454   0.016 28.59 ? 75  ILE A HD13 1  
ATOM   1138   N N    . PRO A 1 78  ? -8.276  -8.329  2.019   0.016 28.87 ? 76  PRO A N    1  
ATOM   1139   C CA   . PRO A 1 78  ? -8.621  -8.702  0.646   0.016 28.49 ? 76  PRO A CA   1  
ATOM   1140   C C    . PRO A 1 78  ? -9.639  -7.745  0.054   0.016 27.37 ? 76  PRO A C    1  
ATOM   1141   O O    . PRO A 1 78  ? -10.634 -7.401  0.689   0.016 26.59 ? 76  PRO A O    1  
ATOM   1142   C CB   . PRO A 1 78  ? -9.188  -10.126 0.788   0.016 28.52 ? 76  PRO A CB   1  
ATOM   1143   C CG   . PRO A 1 78  ? -8.620  -10.628 2.067   0.016 29.35 ? 76  PRO A CG   1  
ATOM   1144   C CD   . PRO A 1 78  ? -8.430  -9.445  2.960   0.016 29.30 ? 76  PRO A CD   1  
ATOM   1145   H HA   . PRO A 1 78  ? -7.828  -8.707  0.093   0.016 29.10 ? 76  PRO A HA   1  
ATOM   1146   H HB2  . PRO A 1 78  ? -10.155 -10.085 0.828   0.016 27.80 ? 76  PRO A HB2  1  
ATOM   1147   H HB3  . PRO A 1 78  ? -8.899  -10.671 0.041   0.016 28.88 ? 76  PRO A HB3  1  
ATOM   1148   H HG2  . PRO A 1 78  ? -9.239  -11.250 2.478   0.016 29.21 ? 76  PRO A HG2  1  
ATOM   1149   H HG3  . PRO A 1 78  ? -7.773  -11.064 1.895   0.016 30.16 ? 76  PRO A HG3  1  
ATOM   1150   H HD2  . PRO A 1 78  ? -9.227  -9.311  3.497   0.016 28.78 ? 76  PRO A HD2  1  
ATOM   1151   H HD3  . PRO A 1 78  ? -7.637  -9.540  3.508   0.016 30.15 ? 76  PRO A HD3  1  
ATOM   1152   N N    . ASP A 1 79  ? -9.405  -7.395  -1.200  0.016 27.44 ? 77  ASP A N    1  
ATOM   1153   C CA   . ASP A 1 79  ? -10.191 -6.396  -1.915  0.016 26.62 ? 77  ASP A CA   1  
ATOM   1154   C C    . ASP A 1 79  ? -11.230 -7.093  -2.778  0.016 26.14 ? 77  ASP A C    1  
ATOM   1155   O O    . ASP A 1 79  ? -10.994 -7.376  -3.945  0.016 26.58 ? 77  ASP A O    1  
ATOM   1156   C CB   . ASP A 1 79  ? -9.268  -5.535  -2.758  0.016 27.23 ? 77  ASP A CB   1  
ATOM   1157   C CG   . ASP A 1 79  ? -9.986  -4.392  -3.424  0.016 26.55 ? 77  ASP A CG   1  
ATOM   1158   O OD1  . ASP A 1 79  ? -11.221 -4.488  -3.567  0.016 25.67 ? 77  ASP A OD1  1  
ATOM   1159   O OD2  . ASP A 1 79  ? -9.304  -3.393  -3.781  0.016 27.01 ? 77  ASP A OD2  1  
ATOM   1160   H H    . ASP A 1 79  ? -8.776  -7.728  -1.678  0.016 28.05 ? 77  ASP A H    1  
ATOM   1161   H HA   . ASP A 1 79  ? -10.642 -5.825  -1.274  0.016 26.13 ? 77  ASP A HA   1  
ATOM   1162   H HB2  . ASP A 1 79  ? -8.565  -5.176  -2.193  0.016 27.71 ? 77  ASP A HB2  1  
ATOM   1163   H HB3  . ASP A 1 79  ? -8.880  -6.085  -3.456  0.016 27.73 ? 77  ASP A HB3  1  
ATOM   1164   N N    . TYR A 1 80  ? -12.408 -7.331  -2.197  0.016 25.40 ? 78  TYR A N    1  
ATOM   1165   C CA   . TYR A 1 80  ? -13.479 -8.056  -2.875  0.016 25.08 ? 78  TYR A CA   1  
ATOM   1166   C C    . TYR A 1 80  ? -13.777 -7.453  -4.234  0.016 24.99 ? 78  TYR A C    1  
ATOM   1167   O O    . TYR A 1 80  ? -14.024 -8.156  -5.211  0.016 25.33 ? 78  TYR A O    1  
ATOM   1168   C CB   . TYR A 1 80  ? -14.741 -8.009  -2.011  0.016 24.32 ? 78  TYR A CB   1  
ATOM   1169   C CG   . TYR A 1 80  ? -15.904 -8.833  -2.491  0.016 24.18 ? 78  TYR A CG   1  
ATOM   1170   C CD1  . TYR A 1 80  ? -16.165 -10.046 -1.895  0.016 24.50 ? 78  TYR A CD1  1  
ATOM   1171   C CD2  . TYR A 1 80  ? -16.736 -8.405  -3.514  0.016 23.92 ? 78  TYR A CD2  1  
ATOM   1172   C CE1  . TYR A 1 80  ? -17.206 -10.829 -2.292  0.016 24.57 ? 78  TYR A CE1  1  
ATOM   1173   C CE2  . TYR A 1 80  ? -17.801 -9.179  -3.928  0.016 24.01 ? 78  TYR A CE2  1  
ATOM   1174   C CZ   . TYR A 1 80  ? -18.013 -10.420 -3.317  0.016 24.35 ? 78  TYR A CZ   1  
ATOM   1175   O OH   . TYR A 1 80  ? -19.077 -11.265 -3.655  0.016 24.62 ? 78  TYR A OH   1  
ATOM   1176   H H    . TYR A 1 80  ? -12.620 -7.068  -1.407  0.016 25.15 ? 78  TYR A H    1  
ATOM   1177   H HA   . TYR A 1 80  ? -13.212 -8.983  -2.989  0.016 25.56 ? 78  TYR A HA   1  
ATOM   1178   H HB2  . TYR A 1 80  ? -14.512 -8.327  -1.124  0.016 24.48 ? 78  TYR A HB2  1  
ATOM   1179   H HB3  . TYR A 1 80  ? -15.037 -7.089  -1.954  0.016 23.87 ? 78  TYR A HB3  1  
ATOM   1180   H HD1  . TYR A 1 80  ? -15.608 -10.337 -1.209  0.016 24.77 ? 78  TYR A HD1  1  
ATOM   1181   H HD2  . TYR A 1 80  ? -16.575 -7.585  -3.925  0.016 23.78 ? 78  TYR A HD2  1  
ATOM   1182   H HE1  . TYR A 1 80  ? -17.359 -11.645 -1.878  0.016 24.87 ? 78  TYR A HE1  1  
ATOM   1183   H HE2  . TYR A 1 80  ? -18.349 -8.887  -4.621  0.016 23.95 ? 78  TYR A HE2  1  
ATOM   1184   H HH   . TYR A 1 80  ? -18.790 -11.911 -4.112  0.016 25.12 ? 78  TYR A HH   1  
ATOM   1185   N N    . PHE A 1 81  ? -13.846 -6.140  -4.287  0.016 24.62 ? 79  PHE A N    1  
ATOM   1186   C CA   . PHE A 1 81  ? -14.349 -5.461  -5.463  0.016 24.50 ? 79  PHE A CA   1  
ATOM   1187   C C    . PHE A 1 81  ? -13.354 -5.496  -6.621  0.016 25.47 ? 79  PHE A C    1  
ATOM   1188   O O    . PHE A 1 81  ? -13.740 -5.778  -7.759  0.016 25.84 ? 79  PHE A O    1  
ATOM   1189   C CB   . PHE A 1 81  ? -14.719 -4.045  -5.036  0.016 23.85 ? 79  PHE A CB   1  
ATOM   1190   C CG   . PHE A 1 81  ? -15.642 -4.030  -3.856  0.016 23.07 ? 79  PHE A CG   1  
ATOM   1191   C CD1  . PHE A 1 81  ? -15.178 -3.721  -2.594  0.016 22.99 ? 79  PHE A CD1  1  
ATOM   1192   C CD2  . PHE A 1 81  ? -16.959 -4.408  -4.001  0.016 22.64 ? 79  PHE A CD2  1  
ATOM   1193   C CE1  . PHE A 1 81  ? -16.001 -3.774  -1.515  0.016 22.50 ? 79  PHE A CE1  1  
ATOM   1194   C CE2  . PHE A 1 81  ? -17.788 -4.454  -2.923  0.016 22.13 ? 79  PHE A CE2  1  
ATOM   1195   C CZ   . PHE A 1 81  ? -17.316 -4.118  -1.679  0.016 22.05 ? 79  PHE A CZ   1  
ATOM   1196   H H    . PHE A 1 81  ? -13.623 -5.624  -3.640  0.016 24.51 ? 79  PHE A H    1  
ATOM   1197   H HA   . PHE A 1 81  ? -15.165 -5.896  -5.754  0.016 24.30 ? 79  PHE A HA   1  
ATOM   1198   H HB2  . PHE A 1 81  ? -13.906 -3.599  -4.766  0.016 24.12 ? 79  PHE A HB2  1  
ATOM   1199   H HB3  . PHE A 1 81  ? -15.138 -3.584  -5.778  0.016 23.79 ? 79  PHE A HB3  1  
ATOM   1200   H HD1  . PHE A 1 81  ? -14.289 -3.489  -2.478  0.016 23.40 ? 79  PHE A HD1  1  
ATOM   1201   H HD2  . PHE A 1 81  ? -17.282 -4.633  -4.842  0.016 22.81 ? 79  PHE A HD2  1  
ATOM   1202   H HE1  . PHE A 1 81  ? -15.682 -3.546  -0.672  0.016 22.57 ? 79  PHE A HE1  1  
ATOM   1203   H HE2  . PHE A 1 81  ? -18.681 -4.686  -3.028  0.016 21.93 ? 79  PHE A HE2  1  
ATOM   1204   H HZ   . PHE A 1 81  ? -17.888 -4.139  -0.947  0.016 21.81 ? 79  PHE A HZ   1  
ATOM   1205   N N    . LYS A 1 82  ? -12.054 -5.267  -6.361  0.016 26.11 ? 80  LYS A N    1  
ATOM   1206   C CA   . LYS A 1 82  ? -11.101 -5.384  -7.459  0.016 27.25 ? 80  LYS A CA   1  
ATOM   1207   C C    . LYS A 1 82  ? -10.922 -6.839  -7.887  0.016 27.92 ? 80  LYS A C    1  
ATOM   1208   O O    . LYS A 1 82  ? -10.669 -7.106  -9.058  0.016 28.82 ? 80  LYS A O    1  
ATOM   1209   C CB   . LYS A 1 82  ? -9.767  -4.743  -7.075  0.016 27.94 ? 80  LYS A CB   1  
ATOM   1210   C CG   . LYS A 1 82  ? -9.867  -3.240  -6.979  0.016 27.59 ? 80  LYS A CG   1  
ATOM   1211   C CD   . LYS A 1 82  ? -8.519  -2.571  -6.763  0.016 28.54 ? 80  LYS A CD   1  
ATOM   1212   C CE   . LYS A 1 82  ? -8.707  -1.045  -6.513  0.016 28.19 ? 80  LYS A CE   1  
ATOM   1213   N NZ   . LYS A 1 82  ? -9.187  -0.737  -5.147  0.016 27.28 ? 80  LYS A NZ   1  
ATOM   1214   H H    . LYS A 1 82  ? -11.718 -5.060  -5.598  0.016 26.01 ? 80  LYS A H    1  
ATOM   1215   H HA   . LYS A 1 82  ? -11.445 -4.911  -8.230  0.016 27.29 ? 80  LYS A HA   1  
ATOM   1216   H HB2  . LYS A 1 82  ? -9.483  -5.066  -6.209  0.016 27.87 ? 80  LYS A HB2  1  
ATOM   1217   H HB3  . LYS A 1 82  ? -9.110  -4.951  -7.756  0.016 28.81 ? 80  LYS A HB3  1  
ATOM   1218   H HG2  . LYS A 1 82  ? -10.241 -2.909  -7.809  0.016 27.66 ? 80  LYS A HG2  1  
ATOM   1219   H HG3  . LYS A 1 82  ? -10.444 -3.010  -6.235  0.016 26.81 ? 80  LYS A HG3  1  
ATOM   1220   H HD2  . LYS A 1 82  ? -8.083  -2.953  -5.988  0.016 28.65 ? 80  LYS A HD2  1  
ATOM   1221   H HD3  . LYS A 1 82  ? -7.978  -2.687  -7.557  0.016 29.39 ? 80  LYS A HD3  1  
ATOM   1222   H HE2  . LYS A 1 82  ? -7.858  -0.594  -6.633  0.016 28.99 ? 80  LYS A HE2  1  
ATOM   1223   H HE3  . LYS A 1 82  ? -9.353  -0.707  -7.147  0.016 27.89 ? 80  LYS A HE3  1  
ATOM   1224   H HZ1  . LYS A 1 82  ? -9.382  0.130   -5.086  0.016 27.14 ? 80  LYS A HZ1  1  
ATOM   1225   H HZ2  . LYS A 1 82  ? -9.922  -1.204  -4.969  0.016 26.60 ? 80  LYS A HZ2  1  
ATOM   1226   H HZ3  . LYS A 1 82  ? -8.567  -0.936  -4.546  0.016 27.62 ? 80  LYS A HZ3  1  
ATOM   1227   N N    . GLN A 1 83  ? -11.118 -7.788  -6.982  0.016 27.60 ? 81  GLN A N    1  
ATOM   1228   C CA   . GLN A 1 83  ? -10.967 -9.187  -7.377  0.016 28.35 ? 81  GLN A CA   1  
ATOM   1229   C C    . GLN A 1 83  ? -12.082 -9.646  -8.308  0.016 28.27 ? 81  GLN A C    1  
ATOM   1230   O O    . GLN A 1 83  ? -11.900 -10.608 -9.088  0.016 29.20 ? 81  GLN A O    1  
ATOM   1231   C CB   . GLN A 1 83  ? -10.915 -10.082 -6.126  0.016 28.23 ? 81  GLN A CB   1  
ATOM   1232   C CG   . GLN A 1 83  ? -9.649  -9.902  -5.313  0.016 28.85 ? 81  GLN A CG   1  
ATOM   1233   C CD   . GLN A 1 83  ? -8.491  -9.476  -6.189  0.016 29.97 ? 81  GLN A CD   1  
ATOM   1234   O OE1  . GLN A 1 83  ? -8.250  -8.257  -6.410  0.016 30.04 ? 81  GLN A OE1  1  
ATOM   1235   N NE2  . GLN A 1 83  ? -7.815  -10.469 -6.777  0.016 30.96 ? 81  GLN A NE2  1  
ATOM   1236   H H    . GLN A 1 83  ? -11.328 -7.657  -6.160  0.016 27.07 ? 81  GLN A H    1  
ATOM   1237   H HA   . GLN A 1 83  ? -10.153 -9.275  -7.892  0.016 29.18 ? 81  GLN A HA   1  
ATOM   1238   H HB2  . GLN A 1 83  ? -11.664 -9.857  -5.555  0.016 27.46 ? 81  GLN A HB2  1  
ATOM   1239   H HB3  . GLN A 1 83  ? -10.979 -11.008 -6.396  0.016 28.63 ? 81  GLN A HB3  1  
ATOM   1240   H HG2  . GLN A 1 83  ? -9.777  -9.230  -4.631  0.016 28.37 ? 81  GLN A HG2  1  
ATOM   1241   H HG3  . GLN A 1 83  ? -9.418  -10.751 -4.906  0.016 29.17 ? 81  GLN A HG3  1  
ATOM   1242   H HE21 . GLN A 1 83  ? -7.690  -10.458 -7.627  0.016 31.60 ? 81  GLN A HE21 1  
ATOM   1243   H HE22 . GLN A 1 83  ? -7.522  -11.131 -6.308  0.016 31.01 ? 81  GLN A HE22 1  
ATOM   1244   N N    . ALA A 1 84  ? -13.228 -8.959  -8.268  0.016 27.34 ? 82  ALA A N    1  
ATOM   1245   C CA   . ALA A 1 84  ? -14.377 -9.426  -9.016  0.016 27.39 ? 82  ALA A CA   1  
ATOM   1246   C C    . ALA A 1 84  ? -14.254 -9.162  -10.503 0.016 28.31 ? 82  ALA A C    1  
ATOM   1247   O O    . ALA A 1 84  ? -15.085 -9.655  -11.256 0.016 28.70 ? 82  ALA A O    1  
ATOM   1248   C CB   . ALA A 1 84  ? -15.657 -8.771  -8.470  0.016 26.27 ? 82  ALA A CB   1  
ATOM   1249   H H    . ALA A 1 84  ? -13.355 -8.241  -7.815  0.016 26.77 ? 82  ALA A H    1  
ATOM   1250   H HA   . ALA A 1 84  ? -14.460 -10.387 -8.895  0.016 27.70 ? 82  ALA A HA   1  
ATOM   1251   H HB1  . ALA A 1 84  ? -16.430 -9.239  -8.820  0.016 26.38 ? 82  ALA A HB1  1  
ATOM   1252   H HB2  . ALA A 1 84  ? -15.657 -8.823  -7.504  0.016 25.78 ? 82  ALA A HB2  1  
ATOM   1253   H HB3  . ALA A 1 84  ? -15.666 -7.843  -8.749  0.016 26.08 ? 82  ALA A HB3  1  
ATOM   1254   N N    . PHE A 1 85  ? -13.242 -8.417  -10.940 0.016 28.84 ? 83  PHE A N    1  
ATOM   1255   C CA   . PHE A 1 85  ? -13.088 -8.058  -12.345 0.016 29.89 ? 83  PHE A CA   1  
ATOM   1256   C C    . PHE A 1 85  ? -12.118 -8.996  -13.091 0.016 31.43 ? 83  PHE A C    1  
ATOM   1257   O O    . PHE A 1 85  ? -11.299 -9.655  -12.458 0.016 31.64 ? 83  PHE A O    1  
ATOM   1258   C CB   . PHE A 1 85  ? -12.673 -6.583  -12.395 0.016 29.70 ? 83  PHE A CB   1  
ATOM   1259   C CG   . PHE A 1 85  ? -13.798 -5.700  -11.989 0.016 28.51 ? 83  PHE A CG   1  
ATOM   1260   C CD1  . PHE A 1 85  ? -13.911 -5.236  -10.696 0.016 27.34 ? 83  PHE A CD1  1  
ATOM   1261   C CD2  . PHE A 1 85  ? -14.805 -5.472  -12.866 0.016 28.69 ? 83  PHE A CD2  1  
ATOM   1262   C CE1  . PHE A 1 85  ? -15.014 -4.502  -10.307 0.016 26.34 ? 83  PHE A CE1  1  
ATOM   1263   C CE2  . PHE A 1 85  ? -15.898 -4.739  -12.509 0.016 27.71 ? 83  PHE A CE2  1  
ATOM   1264   C CZ   . PHE A 1 85  ? -16.011 -4.248  -11.221 0.016 26.50 ? 83  PHE A CZ   1  
ATOM   1265   H H    . PHE A 1 85  ? -12.627 -8.097  -10.434 0.016 28.70 ? 83  PHE A H    1  
ATOM   1266   H HA   . PHE A 1 85  ? -13.951 -8.134  -12.777 0.016 29.84 ? 83  PHE A HA   1  
ATOM   1267   H HB2  . PHE A 1 85  ? -11.944 -6.441  -11.775 0.016 29.59 ? 83  PHE A HB2  1  
ATOM   1268   H HB3  . PHE A 1 85  ? -12.396 -6.344  -13.291 0.016 30.57 ? 83  PHE A HB3  1  
ATOM   1269   H HD1  . PHE A 1 85  ? -13.241 -5.417  -10.081 0.016 27.32 ? 83  PHE A HD1  1  
ATOM   1270   H HD2  . PHE A 1 85  ? -14.738 -5.811  -13.729 0.016 29.60 ? 83  PHE A HD2  1  
ATOM   1271   H HE1  . PHE A 1 85  ? -15.074 -4.169  -9.441  0.016 25.67 ? 83  PHE A HE1  1  
ATOM   1272   H HE2  . PHE A 1 85  ? -16.568 -4.573  -13.132 0.016 27.94 ? 83  PHE A HE2  1  
ATOM   1273   H HZ   . PHE A 1 85  ? -16.752 -3.739  -10.981 0.016 25.90 ? 83  PHE A HZ   1  
ATOM   1274   N N    . PRO A 1 86  ? -12.232 -9.074  -14.429 0.016 32.64 ? 84  PRO A N    1  
ATOM   1275   C CA   . PRO A 1 86  ? -13.091 -8.247  -15.288 0.016 32.77 ? 84  PRO A CA   1  
ATOM   1276   C C    . PRO A 1 86  ? -14.497 -8.779  -15.483 0.016 32.63 ? 84  PRO A C    1  
ATOM   1277   O O    . PRO A 1 86  ? -15.179 -8.412  -16.436 0.016 33.58 ? 84  PRO A O    1  
ATOM   1278   C CB   . PRO A 1 86  ? -12.349 -8.265  -16.621 0.016 34.60 ? 84  PRO A CB   1  
ATOM   1279   C CG   . PRO A 1 86  ? -11.781 -9.689  -16.666 0.016 35.56 ? 84  PRO A CG   1  
ATOM   1280   C CD   . PRO A 1 86  ? -11.386 -9.999  -15.231 0.016 34.30 ? 84  PRO A CD   1  
ATOM   1281   H HA   . PRO A 1 86  ? -13.136 -7.333  -14.970 0.016 32.04 ? 84  PRO A HA   1  
ATOM   1282   H HB2  . PRO A 1 86  ? -12.967 -8.107  -17.350 0.016 35.11 ? 84  PRO A HB2  1  
ATOM   1283   H HB3  . PRO A 1 86  ? -11.644 -7.599  -16.614 0.016 34.70 ? 84  PRO A HB3  1  
ATOM   1284   H HG2  . PRO A 1 86  ? -12.467 -10.302 -16.972 0.016 35.91 ? 84  PRO A HG2  1  
ATOM   1285   H HG3  . PRO A 1 86  ? -11.007 -9.718  -17.249 0.016 36.65 ? 84  PRO A HG3  1  
ATOM   1286   H HD2  . PRO A 1 86  ? -11.596 -10.921 -15.018 0.016 34.37 ? 84  PRO A HD2  1  
ATOM   1287   H HD3  . PRO A 1 86  ? -10.445 -9.808  -15.089 0.016 34.61 ? 84  PRO A HD3  1  
ATOM   1288   N N    . GLU A 1 87  ? -14.938 -9.656  -14.600 0.016 31.64 ? 85  GLU A N    1  
ATOM   1289   C CA   . GLU A 1 87  ? -16.252 -10.250 -14.792 0.016 31.66 ? 85  GLU A CA   1  
ATOM   1290   C C    . GLU A 1 87  ? -17.336 -9.440  -14.093 0.016 30.23 ? 85  GLU A C    1  
ATOM   1291   O O    . GLU A 1 87  ? -18.471 -9.361  -14.584 0.016 30.33 ? 85  GLU A O    1  
ATOM   1292   C CB   . GLU A 1 87  ? -16.193 -11.699 -14.322 0.016 32.05 ? 85  GLU A CB   1  
ATOM   1293   C CG   . GLU A 1 87  ? -15.092 -12.472 -15.068 0.016 33.51 ? 85  GLU A CG   1  
ATOM   1294   C CD   . GLU A 1 87  ? -13.903 -12.864 -14.196 0.016 33.26 ? 85  GLU A CD   1  
ATOM   1295   O OE1  . GLU A 1 87  ? -13.330 -13.967 -14.408 0.016 34.25 ? 85  GLU A OE1  1  
ATOM   1296   O OE2  . GLU A 1 87  ? -13.528 -12.073 -13.324 0.016 32.23 ? 85  GLU A OE2  1  
ATOM   1297   H H    . GLU A 1 87  ? -14.508 -9.928  -13.908 0.016 31.06 ? 85  GLU A H    1  
ATOM   1298   H HA   . GLU A 1 87  ? -16.462 -10.256 -15.738 0.016 32.56 ? 85  GLU A HA   1  
ATOM   1299   H HB2  . GLU A 1 87  ? -15.995 -11.717 -13.376 0.016 31.21 ? 85  GLU A HB2  1  
ATOM   1300   H HB3  . GLU A 1 87  ? -17.044 -12.128 -14.500 0.016 32.32 ? 85  GLU A HB3  1  
ATOM   1301   H HG2  . GLU A 1 87  ? -15.470 -13.284 -15.443 0.016 34.36 ? 85  GLU A HG2  1  
ATOM   1302   H HG3  . GLU A 1 87  ? -14.752 -11.908 -15.781 0.016 33.96 ? 85  GLU A HG3  1  
ATOM   1303   N N    . GLY A 1 88  ? -16.991 -8.790  -12.988 0.016 29.06 ? 86  GLY A N    1  
ATOM   1304   C CA   . GLY A 1 88  ? -17.848 -7.801  -12.351 0.016 27.87 ? 86  GLY A CA   1  
ATOM   1305   C C    . GLY A 1 88  ? -18.555 -8.287  -11.103 0.016 26.86 ? 86  GLY A C    1  
ATOM   1306   O O    . GLY A 1 88  ? -18.350 -9.405  -10.614 0.016 27.04 ? 86  GLY A O    1  
ATOM   1307   H H    . GLY A 1 88  ? -16.242 -8.904  -12.584 0.016 29.02 ? 86  GLY A H    1  
ATOM   1308   H HA2  . GLY A 1 88  ? -17.313 -7.031  -12.105 0.016 27.55 ? 86  GLY A HA2  1  
ATOM   1309   H HA3  . GLY A 1 88  ? -18.525 -7.517  -12.981 0.016 28.13 ? 86  GLY A HA3  1  
ATOM   1310   N N    . TYR A 1 89  ? -19.430 -7.409  -10.598 0.016 25.92 ? 87  TYR A N    1  
ATOM   1311   C CA   . TYR A 1 89  ? -20.236 -7.691  -9.425  0.016 25.11 ? 87  TYR A CA   1  
ATOM   1312   C C    . TYR A 1 89  ? -21.508 -6.834  -9.484  0.016 24.66 ? 87  TYR A C    1  
ATOM   1313   O O    . TYR A 1 89  ? -21.615 -5.901  -10.280 0.016 24.82 ? 87  TYR A O    1  
ATOM   1314   C CB   . TYR A 1 89  ? -19.443 -7.429  -8.140  0.016 24.39 ? 87  TYR A CB   1  
ATOM   1315   C CG   . TYR A 1 89  ? -19.259 -5.962  -7.845  0.016 23.73 ? 87  TYR A CG   1  
ATOM   1316   C CD1  . TYR A 1 89  ? -19.960 -5.372  -6.822  0.016 22.90 ? 87  TYR A CD1  1  
ATOM   1317   C CD2  . TYR A 1 89  ? -18.385 -5.194  -8.570  0.016 24.09 ? 87  TYR A CD2  1  
ATOM   1318   C CE1  . TYR A 1 89  ? -19.811 -4.055  -6.547  0.016 22.42 ? 87  TYR A CE1  1  
ATOM   1319   C CE2  . TYR A 1 89  ? -18.249 -3.864  -8.287  0.016 23.61 ? 87  TYR A CE2  1  
ATOM   1320   C CZ   . TYR A 1 89  ? -18.951 -3.319  -7.272  0.016 22.76 ? 87  TYR A CZ   1  
ATOM   1321   O OH   . TYR A 1 89  ? -18.782 -1.963  -7.006  0.016 22.39 ? 87  TYR A OH   1  
ATOM   1322   H H    . TYR A 1 89  ? -19.571 -6.634  -10.934 0.016 25.80 ? 87  TYR A H    1  
ATOM   1323   H HA   . TYR A 1 89  ? -20.512 -8.617  -9.437  0.016 25.49 ? 87  TYR A HA   1  
ATOM   1324   H HB2  . TYR A 1 89  ? -19.915 -7.803  -7.385  0.016 24.08 ? 87  TYR A HB2  1  
ATOM   1325   H HB3  . TYR A 1 89  ? -18.567 -7.831  -8.207  0.016 24.78 ? 87  TYR A HB3  1  
ATOM   1326   H HD1  . TYR A 1 89  ? -20.555 -5.875  -6.317  0.016 22.76 ? 87  TYR A HD1  1  
ATOM   1327   H HD2  . TYR A 1 89  ? -17.900 -5.565  -9.269  0.016 24.76 ? 87  TYR A HD2  1  
ATOM   1328   H HE1  . TYR A 1 89  ? -20.292 -3.670  -5.852  0.016 21.94 ? 87  TYR A HE1  1  
ATOM   1329   H HE2  . TYR A 1 89  ? -17.659 -3.335  -8.775  0.016 23.94 ? 87  TYR A HE2  1  
ATOM   1330   H HH   . TYR A 1 89  ? -18.768 -1.835  -6.176  0.016 22.02 ? 87  TYR A HH   1  
ATOM   1331   N N    . SER A 1 90  ? -22.481 -7.197  -8.654  0.016 24.24 ? 88  SER A N    1  
ATOM   1332   C CA   . SER A 1 90  ? -23.721 -6.434  -8.556  0.016 23.82 ? 88  SER A CA   1  
ATOM   1333   C C    . SER A 1 90  ? -23.965 -6.080  -7.102  0.016 22.94 ? 88  SER A C    1  
ATOM   1334   O O    . SER A 1 90  ? -23.332 -6.609  -6.189  0.016 22.76 ? 88  SER A O    1  
ATOM   1335   C CB   . SER A 1 90  ? -24.932 -7.187  -9.123  0.016 24.58 ? 88  SER A CB   1  
ATOM   1336   O OG   . SER A 1 90  ? -25.044 -8.509  -8.580  0.016 25.01 ? 88  SER A OG   1  
ATOM   1337   H H    . SER A 1 90  ? -22.448 -7.871  -8.127  0.016 24.26 ? 88  SER A H    1  
ATOM   1338   H HA   . SER A 1 90  ? -23.628 -5.608  -9.054  0.016 23.74 ? 88  SER A HA   1  
ATOM   1339   H HB2  . SER A 1 90  ? -25.739 -6.698  -8.899  0.016 24.32 ? 88  SER A HB2  1  
ATOM   1340   H HB3  . SER A 1 90  ? -24.841 -7.244  -10.088 0.016 25.19 ? 88  SER A HB3  1  
ATOM   1341   H HG   . SER A 1 90  ? -25.516 -8.987  -9.085  0.016 25.54 ? 88  SER A HG   1  
ATOM   1342   N N    . TRP A 1 91  ? -24.901 -5.163  -6.879  0.016 22.51 ? 89  TRP A N    1  
ATOM   1343   C CA   . TRP A 1 91  ? -25.300 -4.839  -5.520  0.016 21.87 ? 89  TRP A CA   1  
ATOM   1344   C C    . TRP A 1 91  ? -26.781 -4.463  -5.472  0.016 21.88 ? 89  TRP A C    1  
ATOM   1345   O O    . TRP A 1 91  ? -27.379 -4.014  -6.458  0.016 22.19 ? 89  TRP A O    1  
ATOM   1346   C CB   . TRP A 1 91  ? -24.419 -3.735  -4.865  0.016 21.25 ? 89  TRP A CB   1  
ATOM   1347   C CG   . TRP A 1 91  ? -24.141 -2.370  -5.571  0.016 21.06 ? 89  TRP A CG   1  
ATOM   1348   C CD1  . TRP A 1 91  ? -22.991 -1.994  -6.218  0.016 21.24 ? 89  TRP A CD1  1  
ATOM   1349   C CD2  . TRP A 1 91  ? -25.003 -1.232  -5.603  0.016 20.80 ? 89  TRP A CD2  1  
ATOM   1350   N NE1  . TRP A 1 91  ? -23.092 -0.692  -6.664  0.016 21.11 ? 89  TRP A NE1  1  
ATOM   1351   C CE2  . TRP A 1 91  ? -24.329 -0.207  -6.321  0.016 20.83 ? 89  TRP A CE2  1  
ATOM   1352   C CE3  . TRP A 1 91  ? -26.285 -0.995  -5.134  0.016 20.69 ? 89  TRP A CE3  1  
ATOM   1353   C CZ2  . TRP A 1 91  ? -24.907 1.052   -6.566  0.016 20.70 ? 89  TRP A CZ2  1  
ATOM   1354   C CZ3  . TRP A 1 91  ? -26.872 0.255   -5.393  0.016 20.56 ? 89  TRP A CZ3  1  
ATOM   1355   C CH2  . TRP A 1 91  ? -26.168 1.257   -6.094  0.016 20.54 ? 89  TRP A CH2  1  
ATOM   1356   H H    . TRP A 1 91  ? -25.314 -4.733  -7.495  0.016 22.66 ? 89  TRP A H    1  
ATOM   1357   H HA   . TRP A 1 91  ? -25.191 -5.635  -4.980  0.016 21.99 ? 89  TRP A HA   1  
ATOM   1358   H HB2  . TRP A 1 91  ? -24.822 -3.529  -4.007  0.016 20.97 ? 89  TRP A HB2  1  
ATOM   1359   H HB3  . TRP A 1 91  ? -23.555 -4.133  -4.717  0.016 21.36 ? 89  TRP A HB3  1  
ATOM   1360   H HD1  . TRP A 1 91  ? -22.240 -2.533  -6.318  0.016 21.47 ? 89  TRP A HD1  1  
ATOM   1361   H HE1  . TRP A 1 91  ? -22.493 -0.268  -7.107  0.016 21.27 ? 89  TRP A HE1  1  
ATOM   1362   H HE3  . TRP A 1 91  ? -26.745 -1.659  -4.679  0.016 20.78 ? 89  TRP A HE3  1  
ATOM   1363   H HZ2  . TRP A 1 91  ? -24.449 1.711   -7.035  0.016 20.80 ? 89  TRP A HZ2  1  
ATOM   1364   H HZ3  . TRP A 1 91  ? -27.729 0.429   -5.078  0.016 20.55 ? 89  TRP A HZ3  1  
ATOM   1365   H HH2  . TRP A 1 91  ? -26.579 2.078   -6.237  0.016 20.51 ? 89  TRP A HH2  1  
ATOM   1366   N N    . GLU A 1 92  ? -27.359 -4.730  -4.309  0.016 21.71 ? 90  GLU A N    1  
ATOM   1367   C CA   . GLU A 1 92  ? -28.732 -4.400  -3.945  0.016 21.82 ? 90  GLU A CA   1  
ATOM   1368   C C    . GLU A 1 92  ? -28.644 -3.601  -2.654  0.016 21.27 ? 90  GLU A C    1  
ATOM   1369   O O    . GLU A 1 92  ? -27.949 -4.010  -1.717  0.016 21.16 ? 90  GLU A O    1  
ATOM   1370   C CB   . GLU A 1 92  ? -29.619 -5.644  -3.689  0.016 22.58 ? 90  GLU A CB   1  
ATOM   1371   C CG   . GLU A 1 92  ? -29.616 -6.765  -4.701  0.016 23.25 ? 90  GLU A CG   1  
ATOM   1372   C CD   . GLU A 1 92  ? -30.613 -7.874  -4.333  0.016 24.21 ? 90  GLU A CD   1  
ATOM   1373   O OE1  . GLU A 1 92  ? -31.161 -7.871  -3.197  0.016 24.34 ? 90  GLU A OE1  1  
ATOM   1374   O OE2  . GLU A 1 92  ? -30.795 -8.779  -5.166  0.016 24.96 ? 90  GLU A OE2  1  
ATOM   1375   H H    . GLU A 1 92  ? -26.941 -5.111  -3.663  0.016 21.62 ? 90  GLU A H    1  
ATOM   1376   H HA   . GLU A 1 92  ? -29.141 -3.847  -4.627  0.016 21.87 ? 90  GLU A HA   1  
ATOM   1377   H HB2  . GLU A 1 92  ? -29.349 -6.031  -2.841  0.016 22.53 ? 90  GLU A HB2  1  
ATOM   1378   H HB3  . GLU A 1 92  ? -30.534 -5.339  -3.618  0.016 22.84 ? 90  GLU A HB3  1  
ATOM   1379   H HG2  . GLU A 1 92  ? -29.845 -6.415  -5.576  0.016 23.37 ? 90  GLU A HG2  1  
ATOM   1380   H HG3  . GLU A 1 92  ? -28.731 -7.152  -4.725  0.016 23.07 ? 90  GLU A HG3  1  
ATOM   1381   N N    . ARG A 1 93  ? -29.376 -2.484  -2.581  0.016 21.06 ? 91  ARG A N    1  
ATOM   1382   C CA   . ARG A 1 93  ? -29.287 -1.586  -1.444  0.016 20.65 ? 91  ARG A CA   1  
ATOM   1383   C C    . ARG A 1 93  ? -30.668 -1.102  -1.021  0.016 20.88 ? 91  ARG A C    1  
ATOM   1384   O O    . ARG A 1 93  ? -31.470 -0.668  -1.853  0.016 21.07 ? 91  ARG A O    1  
ATOM   1385   C CB   . ARG A 1 93  ? -28.423 -0.358  -1.770  0.016 20.16 ? 91  ARG A CB   1  
ATOM   1386   C CG   . ARG A 1 93  ? -28.136 0.478   -0.545  0.016 19.88 ? 91  ARG A CG   1  
ATOM   1387   C CD   . ARG A 1 93  ? -27.164 1.580   -0.882  0.016 19.58 ? 91  ARG A CD   1  
ATOM   1388   N NE   . ARG A 1 93  ? -25.859 1.053   -1.257  0.016 19.58 ? 91  ARG A NE   1  
ATOM   1389   C CZ   . ARG A 1 93  ? -25.090 1.627   -2.171  0.016 19.57 ? 91  ARG A CZ   1  
ATOM   1390   N NH1  . ARG A 1 93  ? -25.478 2.758   -2.761  0.016 19.54 ? 91  ARG A NH1  1  
ATOM   1391   N NH2  . ARG A 1 93  ? -23.909 1.144   -2.444  0.016 19.71 ? 91  ARG A NH2  1  
ATOM   1392   H H    . ARG A 1 93  ? -29.941 -2.241  -3.177  0.016 21.24 ? 91  ARG A H    1  
ATOM   1393   H HA   . ARG A 1 93  ? -28.890 -2.043  -0.693  0.016 20.67 ? 91  ARG A HA   1  
ATOM   1394   H HB2  . ARG A 1 93  ? -27.579 -0.645  -2.148  0.016 20.13 ? 91  ARG A HB2  1  
ATOM   1395   H HB3  . ARG A 1 93  ? -28.896 0.192   -2.410  0.016 20.20 ? 91  ARG A HB3  1  
ATOM   1396   H HG2  . ARG A 1 93  ? -28.972 0.859   -0.230  0.016 19.97 ? 91  ARG A HG2  1  
ATOM   1397   H HG3  . ARG A 1 93  ? -27.739 -0.069  0.146   0.016 19.95 ? 91  ARG A HG3  1  
ATOM   1398   H HD2  . ARG A 1 93  ? -27.530 2.081   -1.619  0.016 19.59 ? 91  ARG A HD2  1  
ATOM   1399   H HD3  . ARG A 1 93  ? -27.038 2.144   -0.110  0.016 19.50 ? 91  ARG A HD3  1  
ATOM   1400   H HE   . ARG A 1 93  ? -25.451 0.613   -0.650  0.016 19.63 ? 91  ARG A HE   1  
ATOM   1401   H HH11 . ARG A 1 93  ? -26.240 3.106   -2.591  0.016 19.51 ? 91  ARG A HH11 1  
ATOM   1402   H HH12 . ARG A 1 93  ? -24.965 3.119   -3.349  0.016 19.63 ? 91  ARG A HH12 1  
ATOM   1403   H HH21 . ARG A 1 93  ? -23.643 0.424   -2.058  0.016 19.77 ? 91  ARG A HH21 1  
ATOM   1404   H HH22 . ARG A 1 93  ? -23.419 1.522   -3.035  0.016 19.80 ? 91  ARG A HH22 1  
ATOM   1405   N N    . SER A 1 94  ? -30.902 -1.136  0.277   0.016 20.98 ? 92  SER A N    1  
ATOM   1406   C CA   . SER A 1 94  ? -32.045 -0.487  0.894   0.016 21.27 ? 92  SER A CA   1  
ATOM   1407   C C    . SER A 1 94  ? -31.604 0.740   1.690   0.016 20.94 ? 92  SER A C    1  
ATOM   1408   O O    . SER A 1 94  ? -30.502 0.789   2.262   0.016 20.79 ? 92  SER A O    1  
ATOM   1409   C CB   . SER A 1 94  ? -32.809 -1.445  1.810   0.016 22.00 ? 92  SER A CB   1  
ATOM   1410   O OG   . SER A 1 94  ? -32.029 -1.770  2.945   0.016 22.00 ? 92  SER A OG   1  
ATOM   1411   H H    . SER A 1 94  ? -30.396 -1.535  0.841   0.016 20.97 ? 92  SER A H    1  
ATOM   1412   H HA   . SER A 1 94  ? -32.649 -0.201  0.193   0.016 21.38 ? 92  SER A HA   1  
ATOM   1413   H HB2  . SER A 1 94  ? -33.637 -1.031  2.091   0.016 22.31 ? 92  SER A HB2  1  
ATOM   1414   H HB3  . SER A 1 94  ? -32.993 -2.259  1.318   0.016 22.26 ? 92  SER A HB3  1  
ATOM   1415   H HG   . SER A 1 94  ? -32.500 -1.718  3.639   0.016 22.44 ? 92  SER A HG   1  
ATOM   1416   N N    . MET A 1 95  ? -32.456 1.757   1.661   0.016 20.96 ? 93  MET A N    1  
ATOM   1417   C CA   . MET A 1 95  ? -32.159 3.042   2.270   0.016 20.79 ? 93  MET A CA   1  
ATOM   1418   C C    . MET A 1 95  ? -33.413 3.529   3.006   0.016 21.41 ? 93  MET A C    1  
ATOM   1419   O O    . MET A 1 95  ? -34.351 4.032   2.374   0.016 21.76 ? 93  MET A O    1  
ATOM   1420   C CB   . MET A 1 95  ? -31.713 4.029   1.186   0.016 20.33 ? 93  MET A CB   1  
ATOM   1421   C CG   . MET A 1 95  ? -30.452 3.624   0.430   0.016 19.95 ? 93  MET A CG   1  
ATOM   1422   S SD   . MET A 1 95  ? -30.083 4.446   -1.142  0.016 19.73 ? 93  MET A SD   1  
ATOM   1423   C CE   . MET A 1 95  ? -31.104 3.460   -2.285  0.016 20.19 ? 93  MET A CE   1  
ATOM   1424   H H    . MET A 1 95  ? -33.224 1.725   1.285   0.016 21.13 ? 93  MET A H    1  
ATOM   1425   H HA   . MET A 1 95  ? -31.434 2.930   2.902   0.016 20.72 ? 93  MET A HA   1  
ATOM   1426   H HB2  . MET A 1 95  ? -32.431 4.128   0.545   0.016 20.47 ? 93  MET A HB2  1  
ATOM   1427   H HB3  . MET A 1 95  ? -31.532 4.882   1.612   0.016 20.27 ? 93  MET A HB3  1  
ATOM   1428   H HG2  . MET A 1 95  ? -29.691 3.787   1.012   0.016 19.84 ? 93  MET A HG2  1  
ATOM   1429   H HG3  . MET A 1 95  ? -30.494 2.673   0.238   0.016 20.08 ? 93  MET A HG3  1  
ATOM   1430   H HE1  . MET A 1 95  ? -30.623 3.386   -3.123  0.016 20.26 ? 93  MET A HE1  1  
ATOM   1431   H HE2  . MET A 1 95  ? -31.260 2.583   -1.901  0.016 20.26 ? 93  MET A HE2  1  
ATOM   1432   H HE3  . MET A 1 95  ? -31.948 3.913   -2.431  0.016 20.43 ? 93  MET A HE3  1  
ATOM   1433   N N    . THR A 1 96  ? -33.429 3.408   4.337   0.016 21.76 ? 94  THR A N    1  
ATOM   1434   C CA   . THR A 1 96  ? -34.624 3.690   5.131   0.016 22.56 ? 94  THR A CA   1  
ATOM   1435   C C    . THR A 1 96  ? -34.417 5.003   5.889   0.016 22.69 ? 94  THR A C    1  
ATOM   1436   O O    . THR A 1 96  ? -33.670 5.063   6.863   0.016 22.89 ? 94  THR A O    1  
ATOM   1437   C CB   . THR A 1 96  ? -34.960 2.540   6.091   0.016 23.31 ? 94  THR A CB   1  
ATOM   1438   O OG1  . THR A 1 96  ? -35.477 1.443   5.333   0.016 23.29 ? 94  THR A OG1  1  
ATOM   1439   C CG2  . THR A 1 96  ? -36.059 2.944   7.078   0.016 24.33 ? 94  THR A CG2  1  
ATOM   1440   H H    . THR A 1 96  ? -32.753 3.177   4.808   0.016 21.64 ? 94  THR A H    1  
ATOM   1441   H HA   . THR A 1 96  ? -35.381 3.805   4.534   0.016 22.70 ? 94  THR A HA   1  
ATOM   1442   H HB   . THR A 1 96  ? -34.170 2.284   6.591   0.016 23.31 ? 94  THR A HB   1  
ATOM   1443   H HG1  . THR A 1 96  ? -34.952 1.256   4.702   0.016 22.77 ? 94  THR A HG1  1  
ATOM   1444   H HG21 . THR A 1 96  ? -36.780 2.298   7.053   0.016 24.84 ? 94  THR A HG21 1  
ATOM   1445   H HG22 . THR A 1 96  ? -35.700 2.980   7.979   0.016 24.67 ? 94  THR A HG22 1  
ATOM   1446   H HG23 . THR A 1 96  ? -36.426 3.811   6.850   0.016 24.27 ? 94  THR A HG23 1  
ATOM   1447   N N    . TYR A 1 97  ? -35.117 6.031   5.463   0.016 22.73 ? 95  TYR A N    1  
ATOM   1448   C CA   . TYR A 1 97  ? -35.007 7.355   6.070   0.016 22.92 ? 95  TYR A CA   1  
ATOM   1449   C C    . TYR A 1 97  ? -35.883 7.469   7.331   0.016 24.01 ? 95  TYR A C    1  
ATOM   1450   O O    . TYR A 1 97  ? -36.917 6.805   7.478   0.016 24.65 ? 95  TYR A O    1  
ATOM   1451   C CB   . TYR A 1 97  ? -35.369 8.406   5.026   0.016 22.61 ? 95  TYR A CB   1  
ATOM   1452   C CG   . TYR A 1 97  ? -34.349 8.549   3.914   0.016 21.76 ? 95  TYR A CG   1  
ATOM   1453   C CD1  . TYR A 1 97  ? -34.465 7.847   2.727   0.016 21.46 ? 95  TYR A CD1  1  
ATOM   1454   C CD2  . TYR A 1 97  ? -33.268 9.407   4.056   0.016 21.46 ? 95  TYR A CD2  1  
ATOM   1455   C CE1  . TYR A 1 97  ? -33.520 7.974   1.729   0.016 20.89 ? 95  TYR A CE1  1  
ATOM   1456   C CE2  . TYR A 1 97  ? -32.337 9.554   3.073   0.016 20.89 ? 95  TYR A CE2  1  
ATOM   1457   C CZ   . TYR A 1 97  ? -32.466 8.863   1.900   0.016 20.61 ? 95  TYR A CZ   1  
ATOM   1458   O OH   . TYR A 1 97  ? -31.509 8.997   0.946   0.016 20.22 ? 95  TYR A OH   1  
ATOM   1459   H H    . TYR A 1 97  ? -35.680 5.989   4.815   0.016 22.72 ? 95  TYR A H    1  
ATOM   1460   H HA   . TYR A 1 97  ? -34.089 7.500   6.339   0.016 22.68 ? 95  TYR A HA   1  
ATOM   1461   H HB2  . TYR A 1 97  ? -36.219 8.178   4.625   0.016 22.87 ? 95  TYR A HB2  1  
ATOM   1462   H HB3  . TYR A 1 97  ? -35.435 9.269   5.464   0.016 22.86 ? 95  TYR A HB3  1  
ATOM   1463   H HD1  . TYR A 1 97  ? -35.178 7.258   2.610   0.016 21.76 ? 95  TYR A HD1  1  
ATOM   1464   H HD2  . TYR A 1 97  ? -33.172 9.890   4.844   0.016 21.76 ? 95  TYR A HD2  1  
ATOM   1465   H HE1  . TYR A 1 97  ? -33.608 7.498   0.936   0.016 20.81 ? 95  TYR A HE1  1  
ATOM   1466   H HE2  . TYR A 1 97  ? -31.620 10.134  3.197   0.016 20.80 ? 95  TYR A HE2  1  
ATOM   1467   H HH   . TYR A 1 97  ? -31.319 8.247   0.621   0.016 20.07 ? 95  TYR A HH   1  
ATOM   1468   N N    . GLU A 1 98  ? -35.432 8.315   8.263   0.016 24.39 ? 96  GLU A N    1  
ATOM   1469   C CA   . GLU A 1 98  ? -36.076 8.476   9.564   0.016 25.60 ? 96  GLU A CA   1  
ATOM   1470   C C    . GLU A 1 98  ? -37.534 8.938   9.490   0.016 26.37 ? 96  GLU A C    1  
ATOM   1471   O O    . GLU A 1 98  ? -38.285 8.704   10.437  0.016 27.54 ? 96  GLU A O    1  
ATOM   1472   C CB   . GLU A 1 98  ? -35.270 9.460   10.424  0.016 25.95 ? 96  GLU A CB   1  
ATOM   1473   C CG   . GLU A 1 98  ? -35.271 10.914  9.925   0.016 25.49 ? 96  GLU A CG   1  
ATOM   1474   C CD   . GLU A 1 98  ? -34.206 11.828  10.578  0.016 25.99 ? 96  GLU A CD   1  
ATOM   1475   O OE1  . GLU A 1 98  ? -33.589 11.489  11.598  0.016 26.45 ? 96  GLU A OE1  1  
ATOM   1476   O OE2  . GLU A 1 98  ? -34.000 12.930  10.047  0.016 26.04 ? 96  GLU A OE2  1  
ATOM   1477   H H    . GLU A 1 98  ? -34.736 8.807   8.162   0.016 24.05 ? 96  GLU A H    1  
ATOM   1478   H HA   . GLU A 1 98  ? -36.059 7.616   10.014  0.016 25.90 ? 96  GLU A HA   1  
ATOM   1479   H HB2  . GLU A 1 98  ? -35.639 9.456   11.320  0.016 26.86 ? 96  GLU A HB2  1  
ATOM   1480   H HB3  . GLU A 1 98  ? -34.350 9.159   10.452  0.016 25.71 ? 96  GLU A HB3  1  
ATOM   1481   H HG2  . GLU A 1 98  ? -35.108 10.920  8.967   0.016 24.68 ? 96  GLU A HG2  1  
ATOM   1482   H HG3  . GLU A 1 98  ? -36.144 11.300  10.103  0.016 25.79 ? 96  GLU A HG3  1  
ATOM   1483   N N    . ASP A 1 99  ? -37.945 9.614   8.421   0.016 25.93 ? 97  ASP A N    1  
ATOM   1484   C CA   . ASP A 1 99  ? -39.240 10.285  8.369   0.016 26.76 ? 97  ASP A CA   1  
ATOM   1485   C C    . ASP A 1 99  ? -40.228 9.418   7.605   0.016 26.85 ? 97  ASP A C    1  
ATOM   1486   O O    . ASP A 1 99  ? -41.223 9.895   7.048   0.016 27.26 ? 97  ASP A O    1  
ATOM   1487   C CB   . ASP A 1 99  ? -39.093 11.691  7.767   0.016 26.52 ? 97  ASP A CB   1  
ATOM   1488   C CG   . ASP A 1 99  ? -38.873 11.686  6.271   0.016 25.40 ? 97  ASP A CG   1  
ATOM   1489   O OD1  . ASP A 1 99  ? -38.496 10.636  5.727   0.016 24.75 ? 97  ASP A OD1  1  
ATOM   1490   O OD2  . ASP A 1 99  ? -39.063 12.754  5.630   0.016 25.30 ? 97  ASP A OD2  1  
ATOM   1491   H H    . ASP A 1 99  ? -37.489 9.692   7.697   0.016 25.22 ? 97  ASP A H    1  
ATOM   1492   H HA   . ASP A 1 99  ? -39.573 10.389  9.273   0.016 27.62 ? 97  ASP A HA   1  
ATOM   1493   H HB2  . ASP A 1 99  ? -39.896 12.202  7.950   0.016 27.16 ? 97  ASP A HB2  1  
ATOM   1494   H HB3  . ASP A 1 99  ? -38.326 12.121  8.175   0.016 26.58 ? 97  ASP A HB3  1  
ATOM   1495   N N    . GLN A 1 100 ? -39.959 8.116   7.646   0.016 26.57 ? 98  GLN A N    1  
ATOM   1496   C CA   . GLN A 1 100 ? -40.575 7.006   6.911   0.016 26.62 ? 98  GLN A CA   1  
ATOM   1497   C C    . GLN A 1 100 ? -40.625 7.218   5.384   0.016 25.97 ? 98  GLN A C    1  
ATOM   1498   O O    . GLN A 1 100 ? -41.670 6.974   4.794   0.016 26.61 ? 98  GLN A O    1  
ATOM   1499   C CB   . GLN A 1 100 ? -41.984 6.676   7.438   0.016 28.04 ? 98  GLN A CB   1  
ATOM   1500   C CG   . GLN A 1 100 ? -41.995 6.048   8.855   0.016 29.01 ? 98  GLN A CG   1  
ATOM   1501   C CD   . GLN A 1 100 ? -43.010 4.899   9.021   0.016 30.36 ? 98  GLN A CD   1  
ATOM   1502   O OE1  . GLN A 1 100 ? -44.197 5.048   8.732   0.016 31.24 ? 98  GLN A OE1  1  
ATOM   1503   N NE2  . GLN A 1 100 ? -42.538 3.756   9.505   0.016 30.65 ? 98  GLN A NE2  1  
ATOM   1504   H H    . GLN A 1 100 ? -39.351 7.815   8.170   0.016 26.42 ? 98  GLN A H    1  
ATOM   1505   H HA   . GLN A 1 100 ? -40.040 6.218   7.086   0.016 26.33 ? 98  GLN A HA   1  
ATOM   1506   H HB2  . GLN A 1 100 ? -42.513 7.488   7.460   0.016 28.44 ? 98  GLN A HB2  1  
ATOM   1507   H HB3  . GLN A 1 100 ? -42.389 6.040   6.831   0.016 28.09 ? 98  GLN A HB3  1  
ATOM   1508   H HG2  . GLN A 1 100 ? -41.115 5.688   9.037   0.016 28.53 ? 98  GLN A HG2  1  
ATOM   1509   H HG3  . GLN A 1 100 ? -42.205 6.740   9.500   0.016 29.38 ? 98  GLN A HG3  1  
ATOM   1510   H HE21 . GLN A 1 100 ? -41.890 3.762   10.070  0.016 30.76 ? 98  GLN A HE21 1  
ATOM   1511   H HE22 . GLN A 1 100 ? -42.887 3.011   9.260   0.016 30.80 ? 98  GLN A HE22 1  
ATOM   1512   N N    . GLY A 1 101 ? -39.546 7.665   4.739   0.016 24.93 ? 99  GLY A N    1  
ATOM   1513   C CA   . GLY A 1 101 ? -39.401 7.455   3.299   0.016 24.36 ? 99  GLY A CA   1  
ATOM   1514   C C    . GLY A 1 101 ? -38.354 6.375   3.018   0.016 23.67 ? 99  GLY A C    1  
ATOM   1515   O O    . GLY A 1 101 ? -37.478 6.129   3.837   0.016 23.40 ? 99  GLY A O    1  
ATOM   1516   H H    . GLY A 1 101 ? -38.894 8.081   5.114   0.016 24.65 ? 99  GLY A H    1  
ATOM   1517   H HA2  . GLY A 1 101 ? -40.244 7.210   2.899   0.016 24.87 ? 99  GLY A HA2  1  
ATOM   1518   H HA3  . GLY A 1 101 ? -39.093 8.269   2.884   0.016 23.99 ? 99  GLY A HA3  1  
ATOM   1519   N N    . ILE A 1 102 ? -38.451 5.726   1.854   0.016 23.55 ? 100 ILE A N    1  
ATOM   1520   C CA   . ILE A 1 102 ? -37.662 4.512   1.580   0.016 23.16 ? 100 ILE A CA   1  
ATOM   1521   C C    . ILE A 1 102 ? -37.257 4.466   0.100   0.016 22.76 ? 100 ILE A C    1  
ATOM   1522   O O    . ILE A 1 102 ? -38.089 4.679   -0.790  0.016 23.23 ? 100 ILE A O    1  
ATOM   1523   C CB   . ILE A 1 102 ? -38.423 3.227   2.010   0.016 23.98 ? 100 ILE A CB   1  
ATOM   1524   C CG1  . ILE A 1 102 ? -37.701 1.992   1.450   0.016 23.70 ? 100 ILE A CG1  1  
ATOM   1525   C CG2  . ILE A 1 102 ? -39.849 3.275   1.619   0.016 24.95 ? 100 ILE A CG2  1  
ATOM   1526   C CD1  . ILE A 1 102 ? -37.965 1.685   -0.030  0.016 23.80 ? 100 ILE A CD1  1  
ATOM   1527   H H    . ILE A 1 102 ? -38.963 5.958   1.207   0.016 23.76 ? 100 ILE A H    1  
ATOM   1528   H HA   . ILE A 1 102 ? -36.850 4.539   2.107   0.016 22.75 ? 100 ILE A HA   1  
ATOM   1529   H HB   . ILE A 1 102 ? -38.408 3.162   2.979   0.016 24.18 ? 100 ILE A HB   1  
ATOM   1530   H HG12 . ILE A 1 102 ? -36.751 2.114   1.573   0.016 23.10 ? 100 ILE A HG12 1  
ATOM   1531   H HG13 . ILE A 1 102 ? -37.997 1.219   1.951   0.016 24.22 ? 100 ILE A HG13 1  
ATOM   1532   H HG21 . ILE A 1 102 ? -40.200 2.371   1.608   0.016 25.44 ? 100 ILE A HG21 1  
ATOM   1533   H HG22 . ILE A 1 102 ? -40.327 3.808   2.271   0.016 25.33 ? 100 ILE A HG22 1  
ATOM   1534   H HG23 . ILE A 1 102 ? -39.921 3.668   0.738   0.016 24.82 ? 100 ILE A HG23 1  
ATOM   1535   H HD11 . ILE A 1 102 ? -38.432 2.417   -0.457  0.016 23.96 ? 100 ILE A HD11 1  
ATOM   1536   H HD12 . ILE A 1 102 ? -37.123 1.521   -0.484  0.016 23.26 ? 100 ILE A HD12 1  
ATOM   1537   H HD13 . ILE A 1 102 ? -38.532 0.910   -0.074  0.016 24.40 ? 100 ILE A HD13 1  
ATOM   1538   N N    . CYS A 1 103 ? -35.995 4.114   -0.160  0.016 22.07 ? 101 CYS A N    1  
ATOM   1539   C CA   . CYS A 1 103 ? -35.472 3.885   -1.501  0.016 21.86 ? 101 CYS A CA   1  
ATOM   1540   C C    . CYS A 1 103 ? -34.844 2.503   -1.594  0.016 21.76 ? 101 CYS A C    1  
ATOM   1541   O O    . CYS A 1 103 ? -34.215 2.053   -0.638  0.016 21.52 ? 101 CYS A O    1  
ATOM   1542   C CB   . CYS A 1 103 ? -34.400 4.877   -1.861  0.016 21.24 ? 101 CYS A CB   1  
ATOM   1543   S SG   . CYS A 1 103 ? -35.009 6.565   -1.853  0.016 21.38 ? 101 CYS A SG   1  
ATOM   1544   H H    . CYS A 1 103 ? -35.407 3.999   0.450   0.016 21.81 ? 101 CYS A H    1  
ATOM   1545   H HA   . CYS A 1 103 ? -36.188 3.958   -2.149  0.016 22.30 ? 101 CYS A HA   1  
ATOM   1546   H HB2  . CYS A 1 103 ? -33.687 4.813   -1.209  0.016 20.88 ? 101 CYS A HB2  1  
ATOM   1547   H HB3  . CYS A 1 103 ? -34.059 4.677   -2.744  0.016 21.23 ? 101 CYS A HB3  1  
ATOM   1548   H HG   . CYS A 1 103 ? -35.605 6.731   -2.877  0.016 21.79 ? 101 CYS A HG   1  
ATOM   1549   N N    . ILE A 1 104 ? -34.936 1.894   -2.769  0.016 22.04 ? 102 ILE A N    1  
ATOM   1550   C CA   . ILE A 1 104 ? -34.262 0.633   -3.066  0.016 22.01 ? 102 ILE A CA   1  
ATOM   1551   C C    . ILE A 1 104 ? -33.554 0.781   -4.404  0.016 21.95 ? 102 ILE A C    1  
ATOM   1552   O O    . ILE A 1 104 ? -34.113 1.338   -5.355  0.016 22.40 ? 102 ILE A O    1  
ATOM   1553   C CB   . ILE A 1 104 ? -35.237 -0.566  -3.057  0.016 22.84 ? 102 ILE A CB   1  
ATOM   1554   C CG1  . ILE A 1 104 ? -36.536 -0.306  -3.730  0.016 23.70 ? 102 ILE A CG1  1  
ATOM   1555   C CG2  . ILE A 1 104 ? -35.617 -0.882  -1.642  0.016 22.98 ? 102 ILE A CG2  1  
ATOM   1556   C CD1  . ILE A 1 104 ? -37.396 -1.655  -3.860  0.016 24.73 ? 102 ILE A CD1  1  
ATOM   1557   H H    . ILE A 1 104 ? -35.394 2.191   -3.428  0.016 22.34 ? 102 ILE A H    1  
ATOM   1558   H HA   . ILE A 1 104 ? -33.597 0.459   -2.383  0.016 21.61 ? 102 ILE A HA   1  
ATOM   1559   H HB   . ILE A 1 104 ? -34.815 -1.345  -3.465  0.016 22.90 ? 102 ILE A HB   1  
ATOM   1560   H HG12 . ILE A 1 104 ? -37.016 0.303   -3.161  0.016 23.71 ? 102 ILE A HG12 1  
ATOM   1561   H HG13 . ILE A 1 104 ? -36.388 0.075   -4.611  0.016 23.76 ? 102 ILE A HG13 1  
ATOM   1562   H HG21 . ILE A 1 104 ? -36.066 -0.121  -1.254  0.016 23.19 ? 102 ILE A HG21 1  
ATOM   1563   H HG22 . ILE A 1 104 ? -36.193 -1.655  -1.626  0.016 23.47 ? 102 ILE A HG22 1  
ATOM   1564   H HG23 . ILE A 1 104 ? -34.812 -1.075  -1.137  0.016 22.48 ? 102 ILE A HG23 1  
ATOM   1565   H HD11 . ILE A 1 104 ? -38.099 -1.530  -4.516  0.016 25.39 ? 102 ILE A HD11 1  
ATOM   1566   H HD12 . ILE A 1 104 ? -36.804 -2.364  -4.148  0.016 24.75 ? 102 ILE A HD12 1  
ATOM   1567   H HD13 . ILE A 1 104 ? -37.779 -1.887  -2.999  0.016 24.81 ? 102 ILE A HD13 1  
ATOM   1568   N N    . ALA A 1 105 ? -32.308 0.300   -4.475  0.016 21.50 ? 103 ALA A N    1  
ATOM   1569   C CA   . ALA A 1 105 ? -31.444 0.546   -5.620  0.016 21.50 ? 103 ALA A CA   1  
ATOM   1570   C C    . ALA A 1 105 ? -30.702 -0.725  -5.993  0.016 21.79 ? 103 ALA A C    1  
ATOM   1571   O O    . ALA A 1 105 ? -30.394 -1.532  -5.125  0.016 21.76 ? 103 ALA A O    1  
ATOM   1572   C CB   . ALA A 1 105 ? -30.439 1.646   -5.329  0.016 20.84 ? 103 ALA A CB   1  
ATOM   1573   H H    . ALA A 1 105 ? -31.949 -0.172  -3.857  0.016 21.27 ? 103 ALA A H    1  
ATOM   1574   H HA   . ALA A 1 105 ? -31.976 0.815   -6.380  0.016 21.88 ? 103 ALA A HA   1  
ATOM   1575   H HB1  . ALA A 1 105 ? -29.977 1.889   -6.148  0.016 20.97 ? 103 ALA A HB1  1  
ATOM   1576   H HB2  . ALA A 1 105 ? -30.932 2.405   -4.985  0.016 20.72 ? 103 ALA A HB2  1  
ATOM   1577   H HB3  . ALA A 1 105 ? -29.808 1.343   -4.656  0.016 20.55 ? 103 ALA A HB3  1  
ATOM   1578   N N    . THR A 1 106 ? -30.436 -0.896  -7.294  0.016 22.25 ? 104 THR A N    1  
ATOM   1579   C CA   . THR A 1 106 ? -29.672 -2.037  -7.800  0.016 22.65 ? 104 THR A CA   1  
ATOM   1580   C C    . THR A 1 106 ? -28.660 -1.530  -8.807  0.016 22.87 ? 104 THR A C    1  
ATOM   1581   O O    . THR A 1 106 ? -28.949 -0.628  -9.589  0.016 23.22 ? 104 THR A O    1  
ATOM   1582   C CB   . THR A 1 106 ? -30.514 -3.104  -8.548  0.016 23.67 ? 104 THR A CB   1  
ATOM   1583   O OG1  . THR A 1 106 ? -31.133 -2.509  -9.690  0.016 24.40 ? 104 THR A OG1  1  
ATOM   1584   C CG2  . THR A 1 106 ? -31.561 -3.740  -7.655  0.016 23.76 ? 104 THR A CG2  1  
ATOM   1585   H H    . THR A 1 106 ? -30.675 -0.350  -7.908  0.016 22.43 ? 104 THR A H    1  
ATOM   1586   H HA   . THR A 1 106 ? -29.192 -2.457  -7.073  0.016 22.29 ? 104 THR A HA   1  
ATOM   1587   H HB   . THR A 1 106 ? -29.913 -3.800  -8.851  0.016 23.92 ? 104 THR A HB   1  
ATOM   1588   H HG1  . THR A 1 106 ? -30.562 -2.337  -10.280 0.016 24.45 ? 104 THR A HG1  1  
ATOM   1589   H HG21 . THR A 1 106 ? -32.029 -4.437  -8.139  0.016 24.48 ? 104 THR A HG21 1  
ATOM   1590   H HG22 . THR A 1 106 ? -31.144 -4.130  -6.873  0.016 23.33 ? 104 THR A HG22 1  
ATOM   1591   H HG23 . THR A 1 106 ? -32.201 -3.066  -7.366  0.016 23.66 ? 104 THR A HG23 1  
ATOM   1592   N N    . SER A 1 107 ? -27.489 -2.167  -8.833  0.016 22.85 ? 105 SER A N    1  
ATOM   1593   C CA   . SER A 1 107 ? -26.477 -1.800  -9.800  0.016 23.18 ? 105 SER A CA   1  
ATOM   1594   C C    . SER A 1 107 ? -25.786 -3.059  -10.275 0.016 23.76 ? 105 SER A C    1  
ATOM   1595   O O    . SER A 1 107 ? -25.385 -3.895  -9.469  0.016 23.38 ? 105 SER A O    1  
ATOM   1596   C CB   . SER A 1 107 ? -25.433 -0.830  -9.234  0.016 22.48 ? 105 SER A CB   1  
ATOM   1597   O OG   . SER A 1 107 ? -24.632 -0.299  -10.283 0.016 22.99 ? 105 SER A OG   1  
ATOM   1598   H H    . SER A 1 107 ? -27.270 -2.802  -8.301  0.016 22.72 ? 105 SER A H    1  
ATOM   1599   H HA   . SER A 1 107 ? -26.900 -1.388  -10.566 0.016 23.67 ? 105 SER A HA   1  
ATOM   1600   H HB2  . SER A 1 107 ? -25.880 -0.110  -8.762  0.016 22.06 ? 105 SER A HB2  1  
ATOM   1601   H HB3  . SER A 1 107 ? -24.853 -1.318  -8.636  0.016 22.23 ? 105 SER A HB3  1  
ATOM   1602   H HG   . SER A 1 107 ? -25.120 0.006   -10.894 0.016 23.40 ? 105 SER A HG   1  
ATOM   1603   N N    . ASP A 1 108 ? -25.680 -3.188  -11.574 0.016 24.81 ? 106 ASP A N    1  
ATOM   1604   C CA   . ASP A 1 108 ? -24.924 -4.266  -12.177 0.016 25.60 ? 106 ASP A CA   1  
ATOM   1605   C C    . ASP A 1 108 ? -23.687 -3.641  -12.811 0.016 25.86 ? 106 ASP A C    1  
ATOM   1606   O O    . ASP A 1 108 ? -23.805 -2.799  -13.710 0.016 26.41 ? 106 ASP A O    1  
ATOM   1607   C CB   . ASP A 1 108 ? -25.797 -4.988  -13.195 0.016 26.86 ? 106 ASP A CB   1  
ATOM   1608   C CG   . ASP A 1 108 ? -25.165 -6.212  -13.702 0.016 27.67 ? 106 ASP A CG   1  
ATOM   1609   O OD1  . ASP A 1 108 ? -25.061 -6.311  -14.912 0.016 28.91 ? 106 ASP A OD1  1  
ATOM   1610   O OD2  . ASP A 1 108 ? -24.766 -7.049  -12.893 0.016 27.18 ? 106 ASP A OD2  1  
ATOM   1611   H H    . ASP A 1 108 ? -26.035 -2.657  -12.145 0.016 25.18 ? 106 ASP A H    1  
ATOM   1612   H HA   . ASP A 1 108 ? -24.653 -4.900  -11.499 0.016 25.28 ? 106 ASP A HA   1  
ATOM   1613   H HB2  . ASP A 1 108 ? -26.627 -5.252  -12.771 0.016 26.74 ? 106 ASP A HB2  1  
ATOM   1614   H HB3  . ASP A 1 108 ? -25.973 -4.396  -13.944 0.016 27.40 ? 106 ASP A HB3  1  
ATOM   1615   N N    . ILE A 1 109 ? -22.505 -4.045  -12.342 0.016 25.65 ? 107 ILE A N    1  
ATOM   1616   C CA   . ILE A 1 109 ? -21.254 -3.391  -12.702 0.016 25.91 ? 107 ILE A CA   1  
ATOM   1617   C C    . ILE A 1 109 ? -20.414 -4.357  -13.520 0.016 27.06 ? 107 ILE A C    1  
ATOM   1618   O O    . ILE A 1 109 ? -19.998 -5.420  -13.030 0.016 27.04 ? 107 ILE A O    1  
ATOM   1619   C CB   . ILE A 1 109 ? -20.499 -2.892  -11.464 0.016 24.91 ? 107 ILE A CB   1  
ATOM   1620   C CG1  . ILE A 1 109 ? -21.311 -1.796  -10.760 0.016 23.98 ? 107 ILE A CG1  1  
ATOM   1621   C CG2  . ILE A 1 109 ? -19.109 -2.348  -11.844 0.016 25.41 ? 107 ILE A CG2  1  
ATOM   1622   C CD1  . ILE A 1 109 ? -20.832 -1.552  -9.384  0.016 23.14 ? 107 ILE A CD1  1  
ATOM   1623   H H    . ILE A 1 109 ? -22.406 -4.714  -11.816 0.016 25.45 ? 107 ILE A H    1  
ATOM   1624   H HA   . ILE A 1 109 ? -21.442 -2.622  -13.263 0.016 26.17 ? 107 ILE A HA   1  
ATOM   1625   H HB   . ILE A 1 109 ? -20.388 -3.626  -10.842 0.016 24.66 ? 107 ILE A HB   1  
ATOM   1626   H HG12 . ILE A 1 109 ? -21.214 -0.972  -11.256 0.016 24.23 ? 107 ILE A HG12 1  
ATOM   1627   H HG13 . ILE A 1 109 ? -22.244 -2.055  -10.717 0.016 23.83 ? 107 ILE A HG13 1  
ATOM   1628   H HG21 . ILE A 1 109 ? -19.211 -1.625  -12.480 0.016 25.67 ? 107 ILE A HG21 1  
ATOM   1629   H HG22 . ILE A 1 109 ? -18.658 -2.023  -11.051 0.016 24.89 ? 107 ILE A HG22 1  
ATOM   1630   H HG23 . ILE A 1 109 ? -18.584 -3.060  -12.240 0.016 26.10 ? 107 ILE A HG23 1  
ATOM   1631   H HD11 . ILE A 1 109 ? -20.990 -0.622  -9.152  0.016 23.00 ? 107 ILE A HD11 1  
ATOM   1632   H HD12 . ILE A 1 109 ? -21.318 -2.134  -8.778  0.016 22.65 ? 107 ILE A HD12 1  
ATOM   1633   H HD13 . ILE A 1 109 ? -19.884 -1.745  -9.332  0.016 23.33 ? 107 ILE A HD13 1  
ATOM   1634   N N    . THR A 1 110 ? -20.189 -3.992  -14.764 0.016 28.20 ? 108 THR A N    1  
ATOM   1635   C CA   . THR A 1 110 ? -19.380 -4.771  -15.676 0.016 29.57 ? 108 THR A CA   1  
ATOM   1636   C C    . THR A 1 110 ? -18.154 -3.959  -16.048 0.016 30.06 ? 108 THR A C    1  
ATOM   1637   O O    . THR A 1 110 ? -17.992 -2.801  -15.657 0.016 29.28 ? 108 THR A O    1  
ATOM   1638   C CB   . THR A 1 110 ? -20.172 -5.161  -16.923 0.016 30.93 ? 108 THR A CB   1  
ATOM   1639   O OG1  . THR A 1 110 ? -20.767 -3.976  -17.506 0.016 31.16 ? 108 THR A OG1  1  
ATOM   1640   C CG2  . THR A 1 110 ? -21.256 -6.166  -16.591 0.016 30.74 ? 108 THR A CG2  1  
ATOM   1641   H H    . THR A 1 110 ? -20.514 -3.283  -15.122 0.016 28.30 ? 108 THR A H    1  
ATOM   1642   H HA   . THR A 1 110 ? -19.078 -5.581  -15.239 0.016 29.44 ? 108 THR A HA   1  
ATOM   1643   H HB   . THR A 1 110 ? -19.572 -5.570  -17.566 0.016 31.95 ? 108 THR A HB   1  
ATOM   1644   H HG1  . THR A 1 110 ? -21.291 -4.189  -18.127 0.016 31.95 ? 108 THR A HG1  1  
ATOM   1645   H HG21 . THR A 1 110 ? -21.676 -6.469  -17.411 0.016 31.70 ? 108 THR A HG21 1  
ATOM   1646   H HG22 . THR A 1 110 ? -20.872 -6.930  -16.134 0.016 30.77 ? 108 THR A HG22 1  
ATOM   1647   H HG23 . THR A 1 110 ? -21.932 -5.767  -16.024 0.016 29.78 ? 108 THR A HG23 1  
ATOM   1648   N N    . MET A 1 111 ? -17.280 -4.589  -16.820 0.016 31.53 ? 109 MET A N    1  
ATOM   1649   C CA   . MET A 1 111 ? -15.998 -3.993  -17.133 0.016 32.19 ? 109 MET A CA   1  
ATOM   1650   C C    . MET A 1 111 ? -15.620 -4.367  -18.550 0.016 34.19 ? 109 MET A C    1  
ATOM   1651   O O    . MET A 1 111 ? -15.754 -5.526  -18.943 0.016 34.89 ? 109 MET A O    1  
ATOM   1652   C CB   . MET A 1 111 ? -14.919 -4.491  -16.182 0.016 31.51 ? 109 MET A CB   1  
ATOM   1653   C CG   . MET A 1 111 ? -13.822 -3.509  -15.973 0.016 31.88 ? 109 MET A CG   1  
ATOM   1654   S SD   . MET A 1 111 ? -12.240 -4.281  -15.545 0.016 32.27 ? 109 MET A SD   1  
ATOM   1655   C CE   . MET A 1 111 ? -11.382 -4.169  -17.118 0.016 34.55 ? 109 MET A CE   1  
ATOM   1656   H H    . MET A 1 111 ? -17.413 -5.361  -17.172 0.016 32.24 ? 109 MET A H    1  
ATOM   1657   H HA   . MET A 1 111 ? -16.054 -3.030  -17.061 0.016 31.94 ? 109 MET A HA   1  
ATOM   1658   H HB2  . MET A 1 111 ? -15.331 -4.662  -15.324 0.016 30.36 ? 109 MET A HB2  1  
ATOM   1659   H HB3  . MET A 1 111 ? -14.533 -5.306  -16.539 0.016 32.06 ? 109 MET A HB3  1  
ATOM   1660   H HG2  . MET A 1 111 ? -13.700 -3.006  -16.793 0.016 32.94 ? 109 MET A HG2  1  
ATOM   1661   H HG3  . MET A 1 111 ? -14.075 -2.908  -15.253 0.016 31.01 ? 109 MET A HG3  1  
ATOM   1662   H HE1  . MET A 1 111 ? -10.448 -4.385  -16.987 0.016 35.00 ? 109 MET A HE1  1  
ATOM   1663   H HE2  . MET A 1 111 ? -11.780 -4.789  -17.750 0.016 35.21 ? 109 MET A HE2  1  
ATOM   1664   H HE3  . MET A 1 111 ? -11.463 -3.262  -17.454 0.016 34.77 ? 109 MET A HE3  1  
ATOM   1665   N N    . GLU A 1 112 ? -15.125 -3.392  -19.303 0.016 35.24 ? 110 GLU A N    1  
ATOM   1666   C CA   . GLU A 1 112 ? -14.710 -3.623  -20.685 0.016 37.41 ? 110 GLU A CA   1  
ATOM   1667   C C    . GLU A 1 112 ? -13.540 -2.686  -20.955 0.016 38.18 ? 110 GLU A C    1  
ATOM   1668   O O    . GLU A 1 112 ? -13.751 -1.521  -21.299 0.016 38.35 ? 110 GLU A O    1  
ATOM   1669   C CB   . GLU A 1 112 ? -15.867 -3.367  -21.658 0.016 38.41 ? 110 GLU A CB   1  
ATOM   1670   C CG   . GLU A 1 112 ? -15.829 -4.152  -22.926 0.016 40.73 ? 110 GLU A CG   1  
ATOM   1671   C CD   . GLU A 1 112 ? -14.524 -3.992  -23.654 0.016 42.34 ? 110 GLU A CD   1  
ATOM   1672   O OE1  . GLU A 1 112 ? -13.944 -5.020  -24.073 0.016 43.81 ? 110 GLU A OE1  1  
ATOM   1673   O OE2  . GLU A 1 112 ? -14.070 -2.836  -23.776 0.016 42.26 ? 110 GLU A OE2  1  
ATOM   1674   H H    . GLU A 1 112 ? -15.011 -2.584  -19.035 0.016 34.82 ? 110 GLU A H    1  
ATOM   1675   H HA   . GLU A 1 112 ? -14.407 -4.537  -20.791 0.016 37.85 ? 110 GLU A HA   1  
ATOM   1676   H HB2  . GLU A 1 112 ? -16.705 -3.569  -21.215 0.016 37.59 ? 110 GLU A HB2  1  
ATOM   1677   H HB3  . GLU A 1 112 ? -15.851 -2.435  -21.916 0.016 38.48 ? 110 GLU A HB3  1  
ATOM   1678   H HG2  . GLU A 1 112 ? -15.951 -5.092  -22.721 0.016 40.72 ? 110 GLU A HG2  1  
ATOM   1679   H HG3  . GLU A 1 112 ? -16.538 -3.842  -23.511 0.016 41.40 ? 110 GLU A HG3  1  
ATOM   1680   N N    . GLY A 1 113 ? -12.327 -3.156  -20.702 0.016 38.64 ? 111 GLY A N    1  
ATOM   1681   C CA   . GLY A 1 113 ? -11.158 -2.431  -21.170 0.016 39.93 ? 111 GLY A CA   1  
ATOM   1682   C C    . GLY A 1 113 ? -10.674 -1.426  -20.148 0.016 38.65 ? 111 GLY A C    1  
ATOM   1683   O O    . GLY A 1 113 ? -10.210 -1.776  -19.062 0.016 37.53 ? 111 GLY A O    1  
ATOM   1684   H H    . GLY A 1 113 ? -12.159 -3.869  -20.256 0.016 38.28 ? 111 GLY A H    1  
ATOM   1685   H HA2  . GLY A 1 113 ? -10.438 -3.052  -21.352 0.016 40.74 ? 111 GLY A HA2  1  
ATOM   1686   H HA3  . GLY A 1 113 ? -11.376 -1.963  -21.991 0.016 40.99 ? 111 GLY A HA3  1  
ATOM   1687   N N    . ASP A 1 114 ? -10.753 -0.154  -20.503 0.016 39.01 ? 112 ASP A N    1  
ATOM   1688   C CA   . ASP A 1 114 ? -10.347 0.921   -19.611 0.016 38.07 ? 112 ASP A CA   1  
ATOM   1689   C C    . ASP A 1 114 ? -11.529 1.505   -18.837 0.016 36.18 ? 112 ASP A C    1  
ATOM   1690   O O    . ASP A 1 114 ? -11.363 2.514   -18.138 0.016 35.44 ? 112 ASP A O    1  
ATOM   1691   C CB   . ASP A 1 114 ? -9.640  2.014   -20.420 0.016 39.80 ? 112 ASP A CB   1  
ATOM   1692   C CG   . ASP A 1 114 ? -10.590 2.768   -21.329 0.016 40.35 ? 112 ASP A CG   1  
ATOM   1693   O OD1  . ASP A 1 114 ? -11.645 2.192   -21.669 0.016 40.04 ? 112 ASP A OD1  1  
ATOM   1694   O OD2  . ASP A 1 114 ? -10.296 3.934   -21.701 0.016 41.22 ? 112 ASP A OD2  1  
ATOM   1695   H H    . ASP A 1 114 ? -11.045 0.117   -21.264 0.016 39.87 ? 112 ASP A H    1  
ATOM   1696   H HA   . ASP A 1 114 ? -9.714  0.569   -18.967 0.016 37.72 ? 112 ASP A HA   1  
ATOM   1697   H HB2  . ASP A 1 114 ? -9.237  2.654   -19.814 0.016 39.37 ? 112 ASP A HB2  1  
ATOM   1698   H HB3  . ASP A 1 114 ? -8.956  1.607   -20.970 0.016 41.14 ? 112 ASP A HB3  1  
ATOM   1699   N N    . CYS A 1 115 ? -12.706 0.867   -18.908 0.016 35.48 ? 113 CYS A N    1  
ATOM   1700   C CA   . CYS A 1 115 ? -13.953 1.510   -18.494 0.016 34.11 ? 113 CYS A CA   1  
ATOM   1701   C C    . CYS A 1 115 ? -14.858 0.570   -17.704 0.016 32.66 ? 113 CYS A C    1  
ATOM   1702   O O    . CYS A 1 115 ? -15.174 -0.526  -18.169 0.016 33.15 ? 113 CYS A O    1  
ATOM   1703   C CB   . CYS A 1 115 ? -14.712 2.018   -19.725 0.016 35.21 ? 113 CYS A CB   1  
ATOM   1704   S SG   . CYS A 1 115 ? -16.080 3.158   -19.363 0.016 33.94 ? 113 CYS A SG   1  
ATOM   1705   H H    . CYS A 1 115 ? -12.808 0.064   -19.193 0.016 35.85 ? 113 CYS A H    1  
ATOM   1706   H HA   . CYS A 1 115 ? -13.746 2.274   -17.933 0.016 33.54 ? 113 CYS A HA   1  
ATOM   1707   H HB2  . CYS A 1 115 ? -14.087 2.480   -20.305 0.016 36.35 ? 113 CYS A HB2  1  
ATOM   1708   H HB3  . CYS A 1 115 ? -15.085 1.257   -20.194 0.016 35.69 ? 113 CYS A HB3  1  
ATOM   1709   H HG   . CYS A 1 115 ? -16.981 2.537   -18.876 0.016 33.08 ? 113 CYS A HG   1  
ATOM   1710   N N    . PHE A 1 116 ? -15.326 1.029   -16.538 0.016 31.04 ? 114 PHE A N    1  
ATOM   1711   C CA   . PHE A 1 116 ? -16.436 0.383   -15.858 0.016 29.80 ? 114 PHE A CA   1  
ATOM   1712   C C    . PHE A 1 116 ? -17.769 0.869   -16.421 0.016 29.83 ? 114 PHE A C    1  
ATOM   1713   O O    . PHE A 1 116 ? -17.927 2.053   -16.781 0.016 30.15 ? 114 PHE A O    1  
ATOM   1714   C CB   . PHE A 1 116 ? -16.456 0.688   -14.356 0.016 28.23 ? 114 PHE A CB   1  
ATOM   1715   C CG   . PHE A 1 116 ? -15.288 0.177   -13.568 0.016 28.12 ? 114 PHE A CG   1  
ATOM   1716   C CD1  . PHE A 1 116 ? -15.123 -1.169  -13.333 0.016 28.24 ? 114 PHE A CD1  1  
ATOM   1717   C CD2  . PHE A 1 116 ? -14.436 1.058   -12.932 0.016 27.88 ? 114 PHE A CD2  1  
ATOM   1718   C CE1  . PHE A 1 116 ? -14.083 -1.614  -12.548 0.016 28.19 ? 114 PHE A CE1  1  
ATOM   1719   C CE2  . PHE A 1 116 ? -13.412 0.616   -12.139 0.016 27.87 ? 114 PHE A CE2  1  
ATOM   1720   C CZ   . PHE A 1 116 ? -13.235 -0.724  -11.954 0.016 28.03 ? 114 PHE A CZ   1  
ATOM   1721   H H    . PHE A 1 116 ? -15.009 1.708   -16.124 0.016 30.72 ? 114 PHE A H    1  
ATOM   1722   H HA   . PHE A 1 116 ? -16.383 -0.574  -15.981 0.016 30.07 ? 114 PHE A HA   1  
ATOM   1723   H HB2  . PHE A 1 116 ? -16.498 1.649   -14.230 0.016 28.02 ? 114 PHE A HB2  1  
ATOM   1724   H HB3  . PHE A 1 116 ? -17.251 0.283   -13.984 0.016 27.57 ? 114 PHE A HB3  1  
ATOM   1725   H HD1  . PHE A 1 116 ? -15.698 -1.782  -13.734 0.016 28.47 ? 114 PHE A HD1  1  
ATOM   1726   H HD2  . PHE A 1 116 ? -14.553 1.973   -13.055 0.016 27.83 ? 114 PHE A HD2  1  
ATOM   1727   H HE1  . PHE A 1 116 ? -13.963 -2.524  -12.416 0.016 28.35 ? 114 PHE A HE1  1  
ATOM   1728   H HE2  . PHE A 1 116 ? -12.830 1.222   -11.744 0.016 27.87 ? 114 PHE A HE2  1  
ATOM   1729   H HZ   . PHE A 1 116 ? -12.533 -1.031  -11.430 0.016 28.11 ? 114 PHE A HZ   1  
ATOM   1730   N N    . PHE A 1 117 ? -18.756 -0.024  -16.393 0.016 29.48 ? 115 PHE A N    1  
ATOM   1731   C CA   . PHE A 1 117 ? -20.117 0.260   -16.826 0.016 29.58 ? 115 PHE A CA   1  
ATOM   1732   C C    . PHE A 1 117 ? -21.117 -0.139  -15.745 0.016 28.23 ? 115 PHE A C    1  
ATOM   1733   O O    . PHE A 1 117 ? -21.072 -1.262  -15.236 0.016 27.89 ? 115 PHE A O    1  
ATOM   1734   C CB   . PHE A 1 117 ? -20.429 -0.470  -18.128 0.016 31.20 ? 115 PHE A CB   1  
ATOM   1735   C CG   . PHE A 1 117 ? -19.363 -0.296  -19.187 0.016 32.78 ? 115 PHE A CG   1  
ATOM   1736   C CD1  . PHE A 1 117 ? -18.268 -1.135  -19.245 0.016 33.31 ? 115 PHE A CD1  1  
ATOM   1737   C CD2  . PHE A 1 117 ? -19.444 0.751   -20.091 0.016 33.86 ? 115 PHE A CD2  1  
ATOM   1738   C CE1  . PHE A 1 117 ? -17.287 -0.958  -20.209 0.016 34.95 ? 115 PHE A CE1  1  
ATOM   1739   C CE2  . PHE A 1 117 ? -18.466 0.936   -21.057 0.016 35.50 ? 115 PHE A CE2  1  
ATOM   1740   C CZ   . PHE A 1 117 ? -17.386 0.088   -21.114 0.016 36.06 ? 115 PHE A CZ   1  
ATOM   1741   H H    . PHE A 1 117 ? -18.661 -0.826  -16.103 0.016 29.24 ? 115 PHE A H    1  
ATOM   1742   H HA   . PHE A 1 117 ? -20.205 1.211   -16.986 0.016 29.63 ? 115 PHE A HA   1  
ATOM   1743   H HB2  . PHE A 1 117 ? -20.520 -1.419  -17.950 0.016 31.13 ? 115 PHE A HB2  1  
ATOM   1744   H HB3  . PHE A 1 117 ? -21.264 -0.122  -18.478 0.016 31.43 ? 115 PHE A HB3  1  
ATOM   1745   H HD1  . PHE A 1 117 ? -18.198 -1.836  -18.639 0.016 32.66 ? 115 PHE A HD1  1  
ATOM   1746   H HD2  . PHE A 1 117 ? -20.172 1.325   -20.055 0.016 33.57 ? 115 PHE A HD2  1  
ATOM   1747   H HE1  . PHE A 1 117 ? -16.558 -1.530  -20.241 0.016 35.38 ? 115 PHE A HE1  1  
ATOM   1748   H HE2  . PHE A 1 117 ? -18.541 1.639   -21.661 0.016 36.31 ? 115 PHE A HE2  1  
ATOM   1749   H HZ   . PHE A 1 117 ? -16.731 0.212   -21.760 0.016 37.26 ? 115 PHE A HZ   1  
ATOM   1750   N N    . TYR A 1 118 ? -22.019 0.783   -15.381 0.016 27.56 ? 116 TYR A N    1  
ATOM   1751   C CA   . TYR A 1 118 ? -23.063 0.497   -14.400 0.016 26.51 ? 116 TYR A CA   1  
ATOM   1752   C C    . TYR A 1 118 ? -24.450 0.595   -15.022 0.016 27.05 ? 116 TYR A C    1  
ATOM   1753   O O    . TYR A 1 118 ? -24.762 1.570   -15.723 0.016 27.59 ? 116 TYR A O    1  
ATOM   1754   C CB   . TYR A 1 118 ? -23.045 1.439   -13.186 0.016 25.21 ? 116 TYR A CB   1  
ATOM   1755   C CG   . TYR A 1 118 ? -21.719 1.898   -12.621 0.016 24.88 ? 116 TYR A CG   1  
ATOM   1756   C CD1  . TYR A 1 118 ? -21.634 3.083   -11.911 0.016 24.24 ? 116 TYR A CD1  1  
ATOM   1757   C CD2  . TYR A 1 118 ? -20.545 1.180   -12.791 0.016 25.35 ? 116 TYR A CD2  1  
ATOM   1758   C CE1  . TYR A 1 118 ? -20.433 3.540   -11.402 0.016 24.14 ? 116 TYR A CE1  1  
ATOM   1759   C CE2  . TYR A 1 118 ? -19.342 1.633   -12.280 0.016 25.23 ? 116 TYR A CE2  1  
ATOM   1760   C CZ   . TYR A 1 118 ? -19.284 2.818   -11.593 0.016 24.65 ? 116 TYR A CZ   1  
ATOM   1761   O OH   . TYR A 1 118 ? -18.080 3.250   -11.092 0.016 24.72 ? 116 TYR A OH   1  
ATOM   1762   H H    . TYR A 1 118 ? -22.040 1.581   -15.693 0.016 27.78 ? 116 TYR A H    1  
ATOM   1763   H HA   . TYR A 1 118 ? -22.951 -0.410  -14.071 0.016 26.38 ? 116 TYR A HA   1  
ATOM   1764   H HB2  . TYR A 1 118 ? -23.513 2.245   -13.451 0.016 25.27 ? 116 TYR A HB2  1  
ATOM   1765   H HB3  . TYR A 1 118 ? -23.541 1.017   -12.469 0.016 24.61 ? 116 TYR A HB3  1  
ATOM   1766   H HD1  . TYR A 1 118 ? -22.406 3.585   -11.783 0.016 23.98 ? 116 TYR A HD1  1  
ATOM   1767   H HD2  . TYR A 1 118 ? -20.564 0.381   -13.266 0.016 25.85 ? 116 TYR A HD2  1  
ATOM   1768   H HE1  . TYR A 1 118 ? -20.399 4.341   -10.932 0.016 23.80 ? 116 TYR A HE1  1  
ATOM   1769   H HE2  . TYR A 1 118 ? -18.567 1.140   -12.413 0.016 25.63 ? 116 TYR A HE2  1  
ATOM   1770   H HH   . TYR A 1 118 ? -17.455 2.906   -11.532 0.016 25.20 ? 116 TYR A HH   1  
ATOM   1771   N N    . GLU A 1 119 ? -25.303 -0.374  -14.700 0.016 26.99 ? 117 GLU A N    1  
ATOM   1772   C CA   . GLU A 1 119 ? -26.728 -0.315  -15.023 0.016 27.33 ? 117 GLU A CA   1  
ATOM   1773   C C    . GLU A 1 119 ? -27.482 -0.293  -13.693 0.016 26.08 ? 117 GLU A C    1  
ATOM   1774   O O    . GLU A 1 119 ? -27.441 -1.255  -12.913 0.016 25.61 ? 117 GLU A O    1  
ATOM   1775   C CB   . GLU A 1 119 ? -27.150 -1.470  -15.941 0.016 28.69 ? 117 GLU A CB   1  
ATOM   1776   C CG   . GLU A 1 119 ? -28.474 -1.204  -16.739 0.016 29.42 ? 117 GLU A CG   1  
ATOM   1777   C CD   . GLU A 1 119 ? -28.708 0.267   -17.261 0.016 29.97 ? 117 GLU A CD   1  
ATOM   1778   O OE1  . GLU A 1 119 ? -29.720 0.941   -16.826 0.016 29.42 ? 117 GLU A OE1  1  
ATOM   1779   O OE2  . GLU A 1 119 ? -27.930 0.712   -18.123 0.016 31.18 ? 117 GLU A OE2  1  
ATOM   1780   H H    . GLU A 1 119 ? -25.079 -1.077  -14.264 0.016 26.81 ? 117 GLU A H    1  
ATOM   1781   H HA   . GLU A 1 119 ? -26.905 0.519   -15.484 0.016 27.61 ? 117 GLU A HA   1  
ATOM   1782   H HB2  . GLU A 1 119 ? -26.440 -1.625  -16.580 0.016 29.52 ? 117 GLU A HB2  1  
ATOM   1783   H HB3  . GLU A 1 119 ? -27.281 -2.257  -15.400 0.016 28.43 ? 117 GLU A HB3  1  
ATOM   1784   H HG2  . GLU A 1 119 ? -28.493 -1.777  -17.532 0.016 30.40 ? 117 GLU A HG2  1  
ATOM   1785   H HG3  . GLU A 1 119 ? -29.207 -1.439  -16.162 0.016 28.71 ? 117 GLU A HG3  1  
ATOM   1786   N N    . ILE A 1 120 ? -28.088 0.858   -13.397 0.016 25.62 ? 118 ILE A N    1  
ATOM   1787   C CA   . ILE A 1 120 ? -28.588 1.202   -12.070 0.016 24.50 ? 118 ILE A CA   1  
ATOM   1788   C C    . ILE A 1 120 ? -30.102 1.358   -12.130 0.016 24.90 ? 118 ILE A C    1  
ATOM   1789   O O    . ILE A 1 120 ? -30.621 2.044   -13.021 0.016 25.71 ? 118 ILE A O    1  
ATOM   1790   C CB   . ILE A 1 120 ? -27.966 2.513   -11.545 0.016 23.73 ? 118 ILE A CB   1  
ATOM   1791   C CG1  . ILE A 1 120 ? -26.442 2.469   -11.627 0.016 23.60 ? 118 ILE A CG1  1  
ATOM   1792   C CG2  . ILE A 1 120 ? -28.455 2.796   -10.117 0.016 22.76 ? 118 ILE A CG2  1  
ATOM   1793   C CD1  . ILE A 1 120 ? -25.779 3.837   -11.504 0.016 23.48 ? 118 ILE A CD1  1  
ATOM   1794   H H    . ILE A 1 120 ? -28.216 1.474   -13.977 0.016 26.05 ? 118 ILE A H    1  
ATOM   1795   H HA   . ILE A 1 120 ? -28.362 0.488   -11.459 0.016 24.14 ? 118 ILE A HA   1  
ATOM   1796   H HB   . ILE A 1 120 ? -28.271 3.235   -12.113 0.016 24.13 ? 118 ILE A HB   1  
ATOM   1797   H HG12 . ILE A 1 120 ? -26.105 1.912   -10.908 0.016 23.04 ? 118 ILE A HG12 1  
ATOM   1798   H HG13 . ILE A 1 120 ? -26.182 2.096   -12.483 0.016 24.27 ? 118 ILE A HG13 1  
ATOM   1799   H HG21 . ILE A 1 120 ? -29.252 3.340   -10.166 0.016 22.89 ? 118 ILE A HG21 1  
ATOM   1800   H HG22 . ILE A 1 120 ? -28.667 1.954   -9.686  0.016 22.64 ? 118 ILE A HG22 1  
ATOM   1801   H HG23 . ILE A 1 120 ? -27.761 3.262   -9.629  0.016 22.28 ? 118 ILE A HG23 1  
ATOM   1802   H HD11 . ILE A 1 120 ? -24.818 3.718   -11.521 0.016 23.46 ? 118 ILE A HD11 1  
ATOM   1803   H HD12 . ILE A 1 120 ? -26.053 4.380   -12.255 0.016 24.14 ? 118 ILE A HD12 1  
ATOM   1804   H HD13 . ILE A 1 120 ? -26.044 4.244   -10.666 0.016 22.90 ? 118 ILE A HD13 1  
ATOM   1805   N N    . ARG A 1 121 ? -30.803 0.712   -11.197 0.016 24.50 ? 119 ARG A N    1  
ATOM   1806   C CA   . ARG A 1 121 ? -32.236 0.906   -10.983 0.016 24.80 ? 119 ARG A CA   1  
ATOM   1807   C C    . ARG A 1 121 ? -32.450 1.522   -9.605  0.016 23.76 ? 119 ARG A C    1  
ATOM   1808   O O    . ARG A 1 121 ? -31.891 1.045   -8.606  0.016 23.03 ? 119 ARG A O    1  
ATOM   1809   C CB   . ARG A 1 121 ? -33.017 -0.413  -11.094 0.016 25.56 ? 119 ARG A CB   1  
ATOM   1810   C CG   . ARG A 1 121 ? -34.552 -0.307  -10.822 0.016 26.14 ? 119 ARG A CG   1  
ATOM   1811   C CD   . ARG A 1 121 ? -35.332 0.269   -11.991 0.016 27.39 ? 119 ARG A CD   1  
ATOM   1812   N NE   . ARG A 1 121 ? -36.565 0.957   -11.574 0.016 27.79 ? 119 ARG A NE   1  
ATOM   1813   C CZ   . ARG A 1 121 ? -37.432 1.520   -12.422 0.016 28.88 ? 119 ARG A CZ   1  
ATOM   1814   N NH1  . ARG A 1 121 ? -37.210 1.471   -13.730 0.016 29.70 ? 119 ARG A NH1  1  
ATOM   1815   N NH2  . ARG A 1 121 ? -38.510 2.156   -11.961 0.016 29.23 ? 119 ARG A NH2  1  
ATOM   1816   H H    . ARG A 1 121 ? -30.458 0.146   -10.653 0.016 24.12 ? 119 ARG A H    1  
ATOM   1817   H HA   . ARG A 1 121 ? -32.582 1.506   -11.657 0.016 25.32 ? 119 ARG A HA   1  
ATOM   1818   H HB2  . ARG A 1 121 ? -32.896 -0.772  -11.987 0.016 26.30 ? 119 ARG A HB2  1  
ATOM   1819   H HB3  . ARG A 1 121 ? -32.661 -1.028  -10.445 0.016 25.09 ? 119 ARG A HB3  1  
ATOM   1820   H HG2  . ARG A 1 121 ? -34.904 -1.196  -10.653 0.016 26.46 ? 119 ARG A HG2  1  
ATOM   1821   H HG3  . ARG A 1 121 ? -34.704 0.254   -10.047 0.016 25.52 ? 119 ARG A HG3  1  
ATOM   1822   H HD2  . ARG A 1 121 ? -34.778 0.908   -12.464 0.016 27.26 ? 119 ARG A HD2  1  
ATOM   1823   H HD3  . ARG A 1 121 ? -35.587 -0.458  -12.583 0.016 28.21 ? 119 ARG A HD3  1  
ATOM   1824   H HE   . ARG A 1 121 ? -36.854 0.793   -10.779 0.016 27.35 ? 119 ARG A HE   1  
ATOM   1825   H HH11 . ARG A 1 121 ? -36.511 1.079   -14.035 0.016 29.53 ? 119 ARG A HH11 1  
ATOM   1826   H HH12 . ARG A 1 121 ? -37.765 1.836   -14.273 0.016 30.47 ? 119 ARG A HH12 1  
ATOM   1827   H HH21 . ARG A 1 121 ? -38.660 2.186   -11.116 0.016 28.80 ? 119 ARG A HH21 1  
ATOM   1828   H HH22 . ARG A 1 121 ? -39.070 2.511   -12.508 0.016 29.99 ? 119 ARG A HH22 1  
ATOM   1829   N N    . PHE A 1 122 ? -33.239 2.599   -9.559  0.016 23.84 ? 120 PHE A N    1  
ATOM   1830   C CA   . PHE A 1 122 ? -33.422 3.376   -8.342  0.016 23.05 ? 120 PHE A CA   1  
ATOM   1831   C C    . PHE A 1 122 ? -34.897 3.687   -8.178  0.016 23.60 ? 120 PHE A C    1  
ATOM   1832   O O    . PHE A 1 122 ? -35.517 4.280   -9.069  0.016 24.34 ? 120 PHE A O    1  
ATOM   1833   C CB   . PHE A 1 122 ? -32.635 4.680   -8.381  0.016 22.58 ? 120 PHE A CB   1  
ATOM   1834   C CG   . PHE A 1 122 ? -32.614 5.391   -7.067  0.016 21.85 ? 120 PHE A CG   1  
ATOM   1835   C CD1  . PHE A 1 122 ? -33.723 6.069   -6.606  0.016 22.04 ? 120 PHE A CD1  1  
ATOM   1836   C CD2  . PHE A 1 122 ? -31.493 5.374   -6.287  0.016 21.14 ? 120 PHE A CD2  1  
ATOM   1837   C CE1  . PHE A 1 122 ? -33.696 6.691   -5.393  0.016 21.54 ? 120 PHE A CE1  1  
ATOM   1838   C CE2  . PHE A 1 122 ? -31.473 5.999   -5.082  0.016 20.68 ? 120 PHE A CE2  1  
ATOM   1839   C CZ   . PHE A 1 122 ? -32.579 6.655   -4.632  0.016 20.89 ? 120 PHE A CZ   1  
ATOM   1840   H H    . PHE A 1 122 ? -33.680 2.895   -10.231 0.016 24.43 ? 120 PHE A H    1  
ATOM   1841   H HA   . PHE A 1 122 ? -33.124 2.867   -7.574  0.016 22.61 ? 120 PHE A HA   1  
ATOM   1842   H HB2  . PHE A 1 122 ? -31.720 4.494   -8.641  0.016 22.41 ? 120 PHE A HB2  1  
ATOM   1843   H HB3  . PHE A 1 122 ? -33.050 5.260   -9.036  0.016 23.06 ? 120 PHE A HB3  1  
ATOM   1844   H HD1  . PHE A 1 122 ? -34.493 6.084   -7.119  0.016 22.60 ? 120 PHE A HD1  1  
ATOM   1845   H HD2  . PHE A 1 122 ? -30.739 4.921   -6.584  0.016 21.07 ? 120 PHE A HD2  1  
ATOM   1846   H HE1  . PHE A 1 122 ? -34.450 7.142   -5.088  0.016 21.75 ? 120 PHE A HE1  1  
ATOM   1847   H HE2  . PHE A 1 122 ? -30.703 5.979   -4.561  0.016 20.33 ? 120 PHE A HE2  1  
ATOM   1848   H HZ   . PHE A 1 122 ? -32.552 7.085   -3.810  0.016 20.68 ? 120 PHE A HZ   1  
ATOM   1849   N N    . ASP A 1 123 ? -35.445 3.312   -7.036  0.016 23.39 ? 121 ASP A N    1  
ATOM   1850   C CA   . ASP A 1 123 ? -36.848 3.501   -6.764  0.016 24.05 ? 121 ASP A CA   1  
ATOM   1851   C C    . ASP A 1 123 ? -37.022 3.990   -5.344  0.016 23.50 ? 121 ASP A C    1  
ATOM   1852   O O    . ASP A 1 123 ? -36.398 3.492   -4.408  0.016 22.92 ? 121 ASP A O    1  
ATOM   1853   C CB   . ASP A 1 123 ? -37.651 2.214   -7.017  0.016 24.96 ? 121 ASP A CB   1  
ATOM   1854   C CG   . ASP A 1 123 ? -37.706 1.887   -8.472  0.016 25.86 ? 121 ASP A CG   1  
ATOM   1855   O OD1  . ASP A 1 123 ? -38.516 2.510   -9.207  0.016 26.75 ? 121 ASP A OD1  1  
ATOM   1856   O OD2  . ASP A 1 123 ? -36.915 1.036   -8.891  0.016 25.81 ? 121 ASP A OD2  1  
ATOM   1857   H H    . ASP A 1 123 ? -35.013 2.955   -6.389  0.016 22.95 ? 121 ASP A H    1  
ATOM   1858   H HA   . ASP A 1 123 ? -37.188 4.182   -7.360  0.016 24.42 ? 121 ASP A HA   1  
ATOM   1859   H HB2  . ASP A 1 123 ? -37.220 1.480   -6.556  0.016 24.64 ? 121 ASP A HB2  1  
ATOM   1860   H HB3  . ASP A 1 123 ? -38.555 2.329   -6.691  0.016 25.40 ? 121 ASP A HB3  1  
ATOM   1861   N N    . GLY A 1 124 ? -37.832 5.019   -5.204  0.016 23.78 ? 122 GLY A N    1  
ATOM   1862   C CA   . GLY A 1 124 ? -38.119 5.570   -3.901  0.016 23.54 ? 122 GLY A CA   1  
ATOM   1863   C C    . GLY A 1 124 ? -39.580 5.932   -3.813  0.016 24.50 ? 122 GLY A C    1  
ATOM   1864   O O    . GLY A 1 124 ? -40.217 6.311   -4.794  0.016 25.17 ? 122 GLY A O    1  
ATOM   1865   H H    . GLY A 1 124 ? -38.237 5.405   -5.852  0.016 24.20 ? 122 GLY A H    1  
ATOM   1866   H HA2  . GLY A 1 124 ? -37.917 4.932   -3.207  0.016 23.35 ? 122 GLY A HA2  1  
ATOM   1867   H HA3  . GLY A 1 124 ? -37.590 6.369   -3.753  0.016 23.08 ? 122 GLY A HA3  1  
ATOM   1868   N N    . THR A 1 125 ? -40.103 5.812   -2.618  0.016 24.70 ? 123 THR A N    1  
ATOM   1869   C CA   . THR A 1 125 ? -41.504 6.085   -2.458  0.016 25.76 ? 123 THR A CA   1  
ATOM   1870   C C    . THR A 1 125 ? -41.789 6.509   -1.052  0.016 25.78 ? 123 THR A C    1  
ATOM   1871   O O    . THR A 1 125 ? -40.957 6.391   -0.148  0.016 25.08 ? 123 THR A O    1  
ATOM   1872   C CB   . THR A 1 125 ? -42.406 4.910   -2.728  0.016 26.79 ? 123 THR A CB   1  
ATOM   1873   O OG1  . THR A 1 125 ? -43.691 5.332   -2.331  0.016 27.85 ? 123 THR A OG1  1  
ATOM   1874   C CG2  . THR A 1 125 ? -42.050 3.769   -1.853  0.016 26.59 ? 123 THR A CG2  1  
ATOM   1875   H H    . THR A 1 125 ? -39.681 5.607   -1.901  0.016 24.34 ? 123 THR A H    1  
ATOM   1876   H HA   . THR A 1 125 ? -41.762 6.811   -3.049  0.016 25.98 ? 123 THR A HA   1  
ATOM   1877   H HB   . THR A 1 125 ? -42.385 4.628   -3.657  0.016 27.01 ? 123 THR A HB   1  
ATOM   1878   H HG1  . THR A 1 125 ? -43.943 5.978   -2.814  0.016 28.03 ? 123 THR A HG1  1  
ATOM   1879   H HG21 . THR A 1 125 ? -41.161 3.473   -2.086  0.016 25.87 ? 123 THR A HG21 1  
ATOM   1880   H HG22 . THR A 1 125 ? -42.060 4.024   -0.921  0.016 26.53 ? 123 THR A HG22 1  
ATOM   1881   H HG23 . THR A 1 125 ? -42.677 3.043   -1.978  0.016 27.33 ? 123 THR A HG23 1  
ATOM   1882   N N    . ASN A 1 126 ? -43.010 7.037   -0.904  0.016 26.77 ? 124 ASN A N    1  
ATOM   1883   C CA   . ASN A 1 126 ? -43.568 7.405   0.362   0.016 27.24 ? 124 ASN A CA   1  
ATOM   1884   C C    . ASN A 1 126 ? -42.665 8.427   1.088   0.016 26.41 ? 124 ASN A C    1  
ATOM   1885   O O    . ASN A 1 126 ? -42.453 8.344   2.295   0.016 26.48 ? 124 ASN A O    1  
ATOM   1886   C CB   . ASN A 1 126 ? -43.881 6.113   1.132   0.016 27.81 ? 124 ASN A CB   1  
ATOM   1887   C CG   . ASN A 1 126 ? -44.724 5.072   0.252   0.016 28.85 ? 124 ASN A CG   1  
ATOM   1888   O OD1  . ASN A 1 126 ? -44.220 4.042   -0.175  0.016 28.54 ? 124 ASN A OD1  1  
ATOM   1889   N ND2  . ASN A 1 126 ? -45.987 5.388   -0.017  0.016 30.22 ? 124 ASN A ND2  1  
ATOM   1890   H H    . ASN A 1 126 ? -43.545 7.181   -1.560  0.016 27.29 ? 124 ASN A H    1  
ATOM   1891   H HA   . ASN A 1 126 ? -44.421 7.842   0.199   0.016 27.99 ? 124 ASN A HA   1  
ATOM   1892   H HB2  . ASN A 1 126 ? -43.057 5.692   1.406   0.016 27.14 ? 124 ASN A HB2  1  
ATOM   1893   H HB3  . ASN A 1 126 ? -44.408 6.339   1.914   0.016 28.34 ? 124 ASN A HB3  1  
ATOM   1894   H HD21 . ASN A 1 126 ? -46.332 6.083   0.350   0.016 30.68 ? 124 ASN A HD21 1  
ATOM   1895   H HD22 . ASN A 1 126 ? -46.448 4.910   -0.559  0.016 30.72 ? 124 ASN A HD22 1  
ATOM   1896   N N    . PHE A 1 127 ? -42.138 9.427   0.358   0.016 25.81 ? 125 PHE A N    1  
ATOM   1897   C CA   . PHE A 1 127 ? -41.453 10.559  1.008   0.016 25.36 ? 125 PHE A CA   1  
ATOM   1898   C C    . PHE A 1 127 ? -42.476 11.623  1.408   0.016 26.27 ? 125 PHE A C    1  
ATOM   1899   O O    . PHE A 1 127 ? -43.306 12.013  0.581   0.016 26.77 ? 125 PHE A O    1  
ATOM   1900   C CB   . PHE A 1 127 ? -40.412 11.201  0.093   0.016 24.50 ? 125 PHE A CB   1  
ATOM   1901   C CG   . PHE A 1 127 ? -39.131 10.432  0.037   0.016 23.63 ? 125 PHE A CG   1  
ATOM   1902   C CD1  . PHE A 1 127 ? -38.207 10.544  1.067   0.016 23.13 ? 125 PHE A CD1  1  
ATOM   1903   C CD2  . PHE A 1 127 ? -38.856 9.615   -1.030  0.016 23.49 ? 125 PHE A CD2  1  
ATOM   1904   C CE1  . PHE A 1 127 ? -37.033 9.849   1.035   0.016 22.45 ? 125 PHE A CE1  1  
ATOM   1905   C CE2  . PHE A 1 127 ? -37.680 8.904   -1.071  0.016 22.79 ? 125 PHE A CE2  1  
ATOM   1906   C CZ   . PHE A 1 127 ? -36.774 9.011   -0.049  0.016 22.25 ? 125 PHE A CZ   1  
ATOM   1907   H H    . PHE A 1 127 ? -42.158 9.472   -0.500  0.016 25.77 ? 125 PHE A H    1  
ATOM   1908   H HA   . PHE A 1 127 ? -40.995 10.245  1.795   0.016 25.17 ? 125 PHE A HA   1  
ATOM   1909   H HB2  . PHE A 1 127 ? -40.758 11.277  -0.808  0.016 24.71 ? 125 PHE A HB2  1  
ATOM   1910   H HB3  . PHE A 1 127 ? -40.210 12.078  0.441   0.016 24.43 ? 125 PHE A HB3  1  
ATOM   1911   H HD1  . PHE A 1 127 ? -38.387 11.096  1.791   0.016 23.34 ? 125 PHE A HD1  1  
ATOM   1912   H HD2  . PHE A 1 127 ? -39.470 9.530   -1.722  0.016 23.95 ? 125 PHE A HD2  1  
ATOM   1913   H HE1  . PHE A 1 127 ? -36.424 9.926   1.734   0.016 22.22 ? 125 PHE A HE1  1  
ATOM   1914   H HE2  . PHE A 1 127 ? -37.500 8.349   -1.795  0.016 22.76 ? 125 PHE A HE2  1  
ATOM   1915   H HZ   . PHE A 1 127 ? -35.977 8.532   -0.083  0.016 21.85 ? 125 PHE A HZ   1  
ATOM   1916   N N    . PRO A 1 128 ? -42.459 12.097  2.649   0.016 26.66 ? 126 PRO A N    1  
ATOM   1917   C CA   . PRO A 1 128 ? -43.388 13.193  3.080   0.016 27.66 ? 126 PRO A CA   1  
ATOM   1918   C C    . PRO A 1 128 ? -43.419 14.365  2.104   0.016 27.49 ? 126 PRO A C    1  
ATOM   1919   O O    . PRO A 1 128 ? -42.379 14.877  1.682   0.016 26.59 ? 126 PRO A O    1  
ATOM   1920   C CB   . PRO A 1 128 ? -42.811 13.600  4.445   0.016 27.91 ? 126 PRO A CB   1  
ATOM   1921   C CG   . PRO A 1 128 ? -42.239 12.260  4.995   0.016 26.91 ? 126 PRO A CG   1  
ATOM   1922   C CD   . PRO A 1 128 ? -41.894 11.380  3.809   0.016 26.49 ? 126 PRO A CD   1  
ATOM   1923   H HA   . PRO A 1 128 ? -44.251 12.782  3.222   0.016 28.41 ? 126 PRO A HA   1  
ATOM   1924   H HB2  . PRO A 1 128 ? -42.114 14.263  4.324   0.016 28.06 ? 126 PRO A HB2  1  
ATOM   1925   H HB3  . PRO A 1 128 ? -43.520 13.935  5.012   0.016 28.67 ? 126 PRO A HB3  1  
ATOM   1926   H HG2  . PRO A 1 128 ? -41.431 12.439  5.505   0.016 26.36 ? 126 PRO A HG2  1  
ATOM   1927   H HG3  . PRO A 1 128 ? -42.897 11.818  5.556   0.016 27.23 ? 126 PRO A HG3  1  
ATOM   1928   H HD2  . PRO A 1 128 ? -40.935 11.268  3.725   0.016 25.74 ? 126 PRO A HD2  1  
ATOM   1929   H HD3  . PRO A 1 128 ? -42.344 10.524  3.895   0.016 27.05 ? 126 PRO A HD3  1  
ATOM   1930   N N    . PRO A 1 129 ? -44.614 14.883  1.798   0.016 28.48 ? 127 PRO A N    1  
ATOM   1931   C CA   . PRO A 1 129 ? -44.727 16.054  0.923   0.016 28.54 ? 127 PRO A CA   1  
ATOM   1932   C C    . PRO A 1 129 ? -44.019 17.307  1.459   0.016 28.32 ? 127 PRO A C    1  
ATOM   1933   O O    . PRO A 1 129 ? -43.337 17.949  0.680   0.016 27.97 ? 127 PRO A O    1  
ATOM   1934   C CB   . PRO A 1 129 ? -46.269 16.235  0.781   0.016 29.92 ? 127 PRO A CB   1  
ATOM   1935   C CG   . PRO A 1 129 ? -46.859 15.459  1.831   0.016 30.64 ? 127 PRO A CG   1  
ATOM   1936   C CD   . PRO A 1 129 ? -45.940 14.281  1.994   0.016 29.77 ? 127 PRO A CD   1  
ATOM   1937   H HA   . PRO A 1 129 ? -44.388 15.788  0.053   0.016 28.03 ? 127 PRO A HA   1  
ATOM   1938   H HB2  . PRO A 1 129 ? -46.436 17.194  0.851   0.016 30.26 ? 127 PRO A HB2  1  
ATOM   1939   H HB3  . PRO A 1 129 ? -46.542 15.931  -0.108  0.016 30.05 ? 127 PRO A HB3  1  
ATOM   1940   H HG2  . PRO A 1 129 ? -46.975 15.966  2.648   0.016 30.92 ? 127 PRO A HG2  1  
ATOM   1941   H HG3  . PRO A 1 129 ? -47.698 15.142  1.468   0.016 31.47 ? 127 PRO A HG3  1  
ATOM   1942   H HD2  . PRO A 1 129 ? -46.019 13.834  2.822   0.016 29.90 ? 127 PRO A HD2  1  
ATOM   1943   H HD3  . PRO A 1 129 ? -46.132 13.711  1.295   0.016 30.05 ? 127 PRO A HD3  1  
ATOM   1944   N N    . ASN A 1 130 ? -44.199 17.696  2.734   0.016 28.69 ? 128 ASN A N    1  
ATOM   1945   C CA   . ASN A 1 130 ? -43.588 18.896  3.324   0.016 28.61 ? 128 ASN A CA   1  
ATOM   1946   C C    . ASN A 1 130 ? -42.092 18.752  3.479   0.016 27.52 ? 128 ASN A C    1  
ATOM   1947   O O    . ASN A 1 130 ? -41.429 19.725  3.828   0.016 27.50 ? 128 ASN A O    1  
ATOM   1948   C CB   . ASN A 1 130 ? -44.150 19.194  4.727   0.016 29.70 ? 128 ASN A CB   1  
ATOM   1949   C CG   . ASN A 1 130 ? -45.376 20.146  4.751   0.016 30.95 ? 128 ASN A CG   1  
ATOM   1950   O OD1  . ASN A 1 130 ? -46.391 19.808  5.374   0.016 32.10 ? 128 ASN A OD1  1  
ATOM   1951   N ND2  . ASN A 1 130 ? -45.252 21.354  4.183   0.016 30.88 ? 128 ASN A ND2  1  
ATOM   1952   H H    . ASN A 1 130 ? -44.692 17.270  3.297   0.016 29.14 ? 128 ASN A H    1  
ATOM   1953   H HA   . ASN A 1 130 ? -43.761 19.673  2.757   0.016 28.70 ? 128 ASN A HA   1  
ATOM   1954   H HB2  . ASN A 1 130 ? -44.413 18.351  5.125   0.016 29.88 ? 128 ASN A HB2  1  
ATOM   1955   H HB3  . ASN A 1 130 ? -43.450 19.591  5.271   0.016 29.55 ? 128 ASN A HB3  1  
ATOM   1956   H HD21 . ASN A 1 130 ? -44.684 21.479  3.547   0.016 30.72 ? 128 ASN A HD21 1  
ATOM   1957   H HD22 . ASN A 1 130 ? -45.747 22.003  4.456   0.016 31.06 ? 128 ASN A HD22 1  
ATOM   1958   N N    . GLY A 1 131 ? -41.557 17.556  3.213   0.016 26.77 ? 129 GLY A N    1  
ATOM   1959   C CA   . GLY A 1 131 ? -40.356 17.075  3.866   0.016 25.97 ? 129 GLY A CA   1  
ATOM   1960   C C    . GLY A 1 131 ? -39.113 17.467  3.113   0.016 25.29 ? 129 GLY A C    1  
ATOM   1961   O O    . GLY A 1 131 ? -39.161 17.982  2.007   0.016 25.33 ? 129 GLY A O    1  
ATOM   1962   H H    . GLY A 1 131 ? -41.860 17.009  2.624   0.016 26.77 ? 129 GLY A H    1  
ATOM   1963   H HA2  . GLY A 1 131 ? -40.306 17.434  4.764   0.016 26.33 ? 129 GLY A HA2  1  
ATOM   1964   H HA3  . GLY A 1 131 ? -40.387 16.111  3.926   0.016 25.63 ? 129 GLY A HA3  1  
ATOM   1965   N N    . PRO A 1 132 ? -37.960 17.179  3.723   0.016 24.80 ? 130 PRO A N    1  
ATOM   1966   C CA   . PRO A 1 132 ? -36.679 17.725  3.211   0.016 24.28 ? 130 PRO A CA   1  
ATOM   1967   C C    . PRO A 1 132 ? -36.279 17.209  1.850   0.016 23.60 ? 130 PRO A C    1  
ATOM   1968   O O    . PRO A 1 132 ? -35.576 17.909  1.119   0.016 23.47 ? 130 PRO A O    1  
ATOM   1969   C CB   . PRO A 1 132 ? -35.682 17.298  4.283   0.016 24.11 ? 130 PRO A CB   1  
ATOM   1970   C CG   . PRO A 1 132 ? -36.315 15.995  4.836   0.016 24.10 ? 130 PRO A CG   1  
ATOM   1971   C CD   . PRO A 1 132 ? -37.770 16.370  4.933   0.016 24.88 ? 130 PRO A CD   1  
ATOM   1972   H HA   . PRO A 1 132 ? -36.716 18.695  3.187   0.016 24.66 ? 130 PRO A HA   1  
ATOM   1973   H HB2  . PRO A 1 132 ? -34.807 17.150  3.893   0.016 23.63 ? 130 PRO A HB2  1  
ATOM   1974   H HB3  . PRO A 1 132 ? -35.642 17.975  4.977   0.016 24.63 ? 130 PRO A HB3  1  
ATOM   1975   H HG2  . PRO A 1 132 ? -36.192 15.268  4.206   0.016 23.58 ? 130 PRO A HG2  1  
ATOM   1976   H HG3  . PRO A 1 132 ? -35.943 15.780  5.707   0.016 24.28 ? 130 PRO A HG3  1  
ATOM   1977   H HD2  . PRO A 1 132 ? -38.333 15.581  4.914   0.016 24.89 ? 130 PRO A HD2  1  
ATOM   1978   H HD3  . PRO A 1 132 ? -37.935 16.898  5.728   0.016 25.48 ? 130 PRO A HD3  1  
ATOM   1979   N N    . VAL A 1 133 ? -36.677 15.992  1.493   0.016 23.32 ? 131 VAL A N    1  
ATOM   1980   C CA   . VAL A 1 133 ? -36.358 15.453  0.181   0.016 22.89 ? 131 VAL A CA   1  
ATOM   1981   C C    . VAL A 1 133 ? -37.217 16.100  -0.903  0.016 23.44 ? 131 VAL A C    1  
ATOM   1982   O O    . VAL A 1 133 ? -36.701 16.619  -1.897  0.016 23.40 ? 131 VAL A O    1  
ATOM   1983   C CB   . VAL A 1 133 ? -36.497 13.912  0.204   0.016 22.58 ? 131 VAL A CB   1  
ATOM   1984   C CG1  . VAL A 1 133 ? -36.369 13.361  -1.181  0.016 22.42 ? 131 VAL A CG1  1  
ATOM   1985   C CG2  . VAL A 1 133 ? -35.476 13.341  1.142   0.016 22.09 ? 131 VAL A CG2  1  
ATOM   1986   H H    . VAL A 1 133 ? -37.139 15.474  1.993   0.016 23.47 ? 131 VAL A H    1  
ATOM   1987   H HA   . VAL A 1 133 ? -35.432 15.643  -0.022  0.016 22.56 ? 131 VAL A HA   1  
ATOM   1988   H HB   . VAL A 1 133 ? -37.371 13.667  0.538   0.016 22.98 ? 131 VAL A HB   1  
ATOM   1989   H HG11 . VAL A 1 133 ? -36.355 12.390  -1.135  0.016 22.24 ? 131 VAL A HG11 1  
ATOM   1990   H HG12 . VAL A 1 133 ? -37.119 13.656  -1.718  0.016 22.87 ? 131 VAL A HG12 1  
ATOM   1991   H HG13 . VAL A 1 133 ? -35.538 13.684  -1.564  0.016 22.15 ? 131 VAL A HG13 1  
ATOM   1992   H HG21 . VAL A 1 133 ? -35.361 12.394  0.975   0.016 21.85 ? 131 VAL A HG21 1  
ATOM   1993   H HG22 . VAL A 1 133 ? -34.633 13.799  1.014   0.016 21.86 ? 131 VAL A HG22 1  
ATOM   1994   H HG23 . VAL A 1 133 ? -35.791 13.475  2.049   0.016 22.38 ? 131 VAL A HG23 1  
ATOM   1995   N N    . MET A 1 134 ? -38.542 16.076  -0.756  0.016 24.13 ? 132 MET A N    1  
ATOM   1996   C CA   . MET A 1 134 ? -39.335 16.677  -1.826  0.016 24.79 ? 132 MET A CA   1  
ATOM   1997   C C    . MET A 1 134 ? -39.423 18.200  -1.680  0.016 25.19 ? 132 MET A C    1  
ATOM   1998   O O    . MET A 1 134 ? -40.064 18.830  -2.504  0.016 25.61 ? 132 MET A O    1  
ATOM   1999   C CB   . MET A 1 134 ? -40.738 16.055  -1.901  0.016 25.59 ? 132 MET A CB   1  
ATOM   2000   C CG   . MET A 1 134 ? -40.769 14.485  -2.038  0.016 25.44 ? 132 MET A CG   1  
ATOM   2001   S SD   . MET A 1 134 ? -40.096 13.609  -3.515  0.016 25.10 ? 132 MET A SD   1  
ATOM   2002   C CE   . MET A 1 134 ? -40.757 14.697  -4.804  0.016 26.27 ? 132 MET A CE   1  
ATOM   2003   H H    . MET A 1 134 ? -38.970 15.746  -0.095  0.016 24.31 ? 132 MET A H    1  
ATOM   2004   H HA   . MET A 1 134 ? -38.912 16.477  -2.675  0.016 24.62 ? 132 MET A HA   1  
ATOM   2005   H HB2  . MET A 1 134 ? -41.216 16.292  -1.093  0.016 25.81 ? 132 MET A HB2  1  
ATOM   2006   H HB3  . MET A 1 134 ? -41.199 16.424  -2.664  0.016 26.14 ? 132 MET A HB3  1  
ATOM   2007   H HG2  . MET A 1 134 ? -40.281 14.126  -1.283  0.016 25.01 ? 132 MET A HG2  1  
ATOM   2008   H HG3  . MET A 1 134 ? -41.695 14.215  -1.959  0.016 26.10 ? 132 MET A HG3  1  
ATOM   2009   H HE1  . MET A 1 134 ? -41.682 14.461  -4.967  0.016 26.86 ? 132 MET A HE1  1  
ATOM   2010   H HE2  . MET A 1 134 ? -40.701 15.618  -4.522  0.016 26.39 ? 132 MET A HE2  1  
ATOM   2011   H HE3  . MET A 1 134 ? -40.244 14.583  -5.619  0.016 26.30 ? 132 MET A HE3  1  
ATOM   2012   N N    . GLN A 1 135 ? -38.819 18.794  -0.658  0.016 25.24 ? 133 GLN A N    1  
ATOM   2013   C CA   . GLN A 1 135 ? -38.694 20.253  -0.595  0.016 25.69 ? 133 GLN A CA   1  
ATOM   2014   C C    . GLN A 1 135 ? -37.271 20.720  -0.858  0.016 25.18 ? 133 GLN A C    1  
ATOM   2015   O O    . GLN A 1 135 ? -37.014 21.933  -0.839  0.016 25.62 ? 133 GLN A O    1  
ATOM   2016   C CB   . GLN A 1 135 ? -39.159 20.781  0.763   0.016 26.26 ? 133 GLN A CB   1  
ATOM   2017   C CG   . GLN A 1 135 ? -40.679 20.703  1.029   0.016 27.16 ? 133 GLN A CG   1  
ATOM   2018   C CD   . GLN A 1 135 ? -41.424 21.961  0.598   0.016 28.04 ? 133 GLN A CD   1  
ATOM   2019   O OE1  . GLN A 1 135 ? -41.020 22.645  -0.332  0.016 27.97 ? 133 GLN A OE1  1  
ATOM   2020   N NE2  . GLN A 1 135 ? -42.515 22.271  1.297   0.016 29.02 ? 133 GLN A NE2  1  
ATOM   2021   H H    . GLN A 1 135 ? -38.464 18.386  0.006   0.016 25.10 ? 133 GLN A H    1  
ATOM   2022   H HA   . GLN A 1 135 ? -39.258 20.655  -1.268  0.016 26.14 ? 133 GLN A HA   1  
ATOM   2023   H HB2  . GLN A 1 135 ? -38.712 20.285  1.466   0.016 25.93 ? 133 GLN A HB2  1  
ATOM   2024   H HB3  . GLN A 1 135 ? -38.911 21.717  0.817   0.016 26.52 ? 133 GLN A HB3  1  
ATOM   2025   H HG2  . GLN A 1 135 ? -41.051 19.939  0.570   0.016 27.05 ? 133 GLN A HG2  1  
ATOM   2026   H HG3  . GLN A 1 135 ? -40.805 20.616  1.978   0.016 27.43 ? 133 GLN A HG3  1  
ATOM   2027   H HE21 . GLN A 1 135 ? -43.132 22.764  0.948   0.016 29.62 ? 133 GLN A HE21 1  
ATOM   2028   H HE22 . GLN A 1 135 ? -42.604 21.980  2.101   0.016 29.12 ? 133 GLN A HE22 1  
ATOM   2029   N N    . LYS A 1 136 ? -36.343 19.802  -1.127  0.016 24.39 ? 134 LYS A N    1  
ATOM   2030   C CA   . LYS A 1 136 ? -34.983 20.174  -1.560  0.016 24.04 ? 134 LYS A CA   1  
ATOM   2031   C C    . LYS A 1 136 ? -34.250 21.001  -0.503  0.016 24.25 ? 134 LYS A C    1  
ATOM   2032   O O    . LYS A 1 136 ? -33.650 22.038  -0.792  0.016 24.66 ? 134 LYS A O    1  
ATOM   2033   C CB   . LYS A 1 136 ? -35.027 20.910  -2.907  0.016 24.42 ? 134 LYS A CB   1  
ATOM   2034   C CG   . LYS A 1 136 ? -34.946 20.005  -4.126  0.016 24.24 ? 134 LYS A CG   1  
ATOM   2035   C CD   . LYS A 1 136 ? -36.131 20.114  -5.075  0.016 25.04 ? 134 LYS A CD   1  
ATOM   2036   C CE   . LYS A 1 136 ? -35.720 20.120  -6.525  0.016 25.37 ? 134 LYS A CE   1  
ATOM   2037   N NZ   . LYS A 1 136 ? -36.665 19.418  -7.445  0.016 25.70 ? 134 LYS A NZ   1  
ATOM   2038   H H    . LYS A 1 136 ? -36.471 18.959  -1.073  0.016 24.13 ? 134 LYS A H    1  
ATOM   2039   H HA   . LYS A 1 136 ? -34.476 19.354  -1.683  0.016 23.53 ? 134 LYS A HA   1  
ATOM   2040   H HB2  . LYS A 1 136 ? -35.849 21.419  -2.960  0.016 24.98 ? 134 LYS A HB2  1  
ATOM   2041   H HB3  . LYS A 1 136 ? -34.281 21.527  -2.964  0.016 24.36 ? 134 LYS A HB3  1  
ATOM   2042   H HG2  . LYS A 1 136 ? -34.147 20.242  -4.618  0.016 23.98 ? 134 LYS A HG2  1  
ATOM   2043   H HG3  . LYS A 1 136 ? -34.887 19.082  -3.836  0.016 23.96 ? 134 LYS A HG3  1  
ATOM   2044   H HD2  . LYS A 1 136 ? -36.706 19.343  -4.942  0.016 25.02 ? 134 LYS A HD2  1  
ATOM   2045   H HD3  . LYS A 1 136 ? -36.621 20.932  -4.902  0.016 25.49 ? 134 LYS A HD3  1  
ATOM   2046   H HE2  . LYS A 1 136 ? -35.680 21.043  -6.820  0.016 25.94 ? 134 LYS A HE2  1  
ATOM   2047   H HE3  . LYS A 1 136 ? -34.853 19.699  -6.617  0.016 24.98 ? 134 LYS A HE3  1  
ATOM   2048   H HZ1  . LYS A 1 136 ? -37.455 19.825  -7.445  0.016 26.20 ? 134 LYS A HZ1  1  
ATOM   2049   H HZ2  . LYS A 1 136 ? -36.342 19.413  -8.271  0.016 25.96 ? 134 LYS A HZ2  1  
ATOM   2050   H HZ3  . LYS A 1 136 ? -36.770 18.583  -7.175  0.016 25.25 ? 134 LYS A HZ3  1  
ATOM   2051   N N    . LYS A 1 137 ? -34.305 20.532  0.741   0.016 24.13 ? 135 LYS A N    1  
ATOM   2052   C CA   . LYS A 1 137 ? -33.634 21.223  1.832   0.016 24.51 ? 135 LYS A CA   1  
ATOM   2053   C C    . LYS A 1 137 ? -32.417 20.467  2.360   0.016 24.04 ? 135 LYS A C    1  
ATOM   2054   O O    . LYS A 1 137 ? -31.959 20.741  3.472   0.016 24.44 ? 135 LYS A O    1  
ATOM   2055   C CB   . LYS A 1 137 ? -34.644 21.538  2.946   0.016 25.20 ? 135 LYS A CB   1  
ATOM   2056   C CG   . LYS A 1 137 ? -35.048 23.137  3.045   0.016 26.17 ? 135 LYS A CG   1  
ATOM   2057   C CD   . LYS A 1 137 ? -36.281 23.664  2.196   0.016 26.45 ? 135 LYS A CD   1  
ATOM   2058   C CE   . LYS A 1 137 ? -35.929 24.011  0.711   0.016 26.48 ? 135 LYS A CE   1  
ATOM   2059   N NZ   . LYS A 1 137 ? -37.038 24.803  -0.045  0.016 26.99 ? 135 LYS A NZ   1  
ATOM   2060   H H    . LYS A 1 137 ? -34.734 19.830  0.978   0.016 23.93 ? 135 LYS A H    1  
ATOM   2061   H HA   . LYS A 1 137 ? -33.311 22.082  1.501   0.016 24.83 ? 135 LYS A HA   1  
ATOM   2062   H HB2  . LYS A 1 137 ? -35.457 21.041  2.784   0.016 25.10 ? 135 LYS A HB2  1  
ATOM   2063   H HB3  . LYS A 1 137 ? -34.257 21.275  3.794   0.016 25.29 ? 135 LYS A HB3  1  
ATOM   2064   H HG2  . LYS A 1 137 ? -35.235 23.332  3.975   0.016 26.66 ? 135 LYS A HG2  1  
ATOM   2065   H HG3  . LYS A 1 137 ? -34.279 23.655  2.768   0.016 26.26 ? 135 LYS A HG3  1  
ATOM   2066   H HD2  . LYS A 1 137 ? -36.973 22.984  2.191   0.016 26.11 ? 135 LYS A HD2  1  
ATOM   2067   H HD3  . LYS A 1 137 ? -36.629 24.472  2.605   0.016 27.11 ? 135 LYS A HD3  1  
ATOM   2068   H HE2  . LYS A 1 137 ? -35.138 24.579  0.715   0.016 26.88 ? 135 LYS A HE2  1  
ATOM   2069   H HE3  . LYS A 1 137 ? -35.719 23.197  0.240   0.016 25.91 ? 135 LYS A HE3  1  
ATOM   2070   H HZ1  . LYS A 1 137 ? -36.883 25.674  0.026   0.016 27.59 ? 135 LYS A HZ1  1  
ATOM   2071   H HZ2  . LYS A 1 137 ? -37.039 24.577  -0.909  0.016 26.80 ? 135 LYS A HZ2  1  
ATOM   2072   H HZ3  . LYS A 1 137 ? -37.837 24.620  0.299   0.016 27.00 ? 135 LYS A HZ3  1  
ATOM   2073   N N    . THR A 1 138 ? -31.868 19.515  1.593   0.016 23.33 ? 136 THR A N    1  
ATOM   2074   C CA   . THR A 1 138 ? -30.662 18.822  2.031   0.016 22.98 ? 136 THR A CA   1  
ATOM   2075   C C    . THR A 1 138 ? -29.431 19.544  1.502   0.016 23.14 ? 136 THR A C    1  
ATOM   2076   O O    . THR A 1 138 ? -29.451 20.090  0.401   0.016 23.24 ? 136 THR A O    1  
ATOM   2077   C CB   . THR A 1 138 ? -30.638 17.367  1.554   0.016 22.26 ? 136 THR A CB   1  
ATOM   2078   O OG1  . THR A 1 138 ? -30.457 17.338  0.135   0.016 21.99 ? 136 THR A OG1  1  
ATOM   2079   C CG2  . THR A 1 138 ? -31.944 16.697  1.876   0.016 22.26 ? 136 THR A CG2  1  
ATOM   2080   H H    . THR A 1 138 ? -32.159 19.269  0.824   0.016 23.13 ? 136 THR A H    1  
ATOM   2081   H HA   . THR A 1 138 ? -30.628 18.814  3.001   0.016 23.25 ? 136 THR A HA   1  
ATOM   2082   H HB   . THR A 1 138 ? -29.923 16.890  1.991   0.016 22.12 ? 136 THR A HB   1  
ATOM   2083   H HG1  . THR A 1 138 ? -29.649 17.455  -0.053  0.016 21.95 ? 136 THR A HG1  1  
ATOM   2084   H HG21 . THR A 1 138 ? -31.947 15.790  1.534   0.016 21.89 ? 136 THR A HG21 1  
ATOM   2085   H HG22 . THR A 1 138 ? -32.082 16.681  2.834   0.016 22.57 ? 136 THR A HG22 1  
ATOM   2086   H HG23 . THR A 1 138 ? -32.675 17.182  1.463   0.016 22.46 ? 136 THR A HG23 1  
ATOM   2087   N N    . LEU A 1 139 ? -28.346 19.494  2.265   0.016 23.30 ? 137 LEU A N    1  
ATOM   2088   C CA   . LEU A 1 139 ? -27.099 20.161  1.878   0.016 23.69 ? 137 LEU A CA   1  
ATOM   2089   C C    . LEU A 1 139 ? -26.028 19.196  1.375   0.016 23.25 ? 137 LEU A C    1  
ATOM   2090   O O    . LEU A 1 139 ? -25.361 19.479  0.377   0.016 23.42 ? 137 LEU A O    1  
ATOM   2091   C CB   . LEU A 1 139 ? -26.536 20.945  3.067   0.016 24.53 ? 137 LEU A CB   1  
ATOM   2092   C CG   . LEU A 1 139 ? -27.447 21.938  3.779   0.016 25.19 ? 137 LEU A CG   1  
ATOM   2093   C CD1  . LEU A 1 139 ? -26.709 22.521  4.949   0.016 26.18 ? 137 LEU A CD1  1  
ATOM   2094   C CD2  . LEU A 1 139 ? -27.870 23.048  2.808   0.016 25.45 ? 137 LEU A CD2  1  
ATOM   2095   H H    . LEU A 1 139 ? -28.301 19.082  3.016   0.016 23.29 ? 137 LEU A H    1  
ATOM   2096   H HA   . LEU A 1 139 ? -27.289 20.785  1.162   0.016 23.88 ? 137 LEU A HA   1  
ATOM   2097   H HB2  . LEU A 1 139 ? -26.257 20.294  3.727   0.016 24.43 ? 137 LEU A HB2  1  
ATOM   2098   H HB3  . LEU A 1 139 ? -25.761 21.438  2.760   0.016 24.90 ? 137 LEU A HB3  1  
ATOM   2099   H HG   . LEU A 1 139 ? -28.238 21.490  4.108   0.016 24.94 ? 137 LEU A HG   1  
ATOM   2100   H HD11 . LEU A 1 139 ? -25.861 22.873  4.641   0.016 26.46 ? 137 LEU A HD11 1  
ATOM   2101   H HD12 . LEU A 1 139 ? -27.235 23.239  5.333   0.016 26.70 ? 137 LEU A HD12 1  
ATOM   2102   H HD13 . LEU A 1 139 ? -26.557 21.831  5.609   0.016 26.12 ? 137 LEU A HD13 1  
ATOM   2103   H HD21 . LEU A 1 139 ? -27.112 23.640  2.687   0.016 25.45 ? 137 LEU A HD21 1  
ATOM   2104   H HD22 . LEU A 1 139 ? -28.124 22.668  1.956   0.016 25.04 ? 137 LEU A HD22 1  
ATOM   2105   H HD23 . LEU A 1 139 ? -28.611 23.543  3.188   0.016 26.11 ? 137 LEU A HD23 1  
ATOM   2106   N N    . LYS A 1 140 ? -25.806 18.095  2.083   0.016 22.85 ? 138 LYS A N    1  
ATOM   2107   C CA   . LYS A 1 140 ? -24.718 17.176  1.778   0.016 22.62 ? 138 LYS A CA   1  
ATOM   2108   C C    . LYS A 1 140 ? -24.889 15.999  2.711   0.016 22.24 ? 138 LYS A C    1  
ATOM   2109   O O    . LYS A 1 140 ? -25.575 16.090  3.730   0.016 22.43 ? 138 LYS A O    1  
ATOM   2110   C CB   . LYS A 1 140 ? -23.324 17.813  2.011   0.016 23.40 ? 138 LYS A CB   1  
ATOM   2111   C CG   . LYS A 1 140 ? -22.118 16.946  1.645   0.016 23.32 ? 138 LYS A CG   1  
ATOM   2112   C CD   . LYS A 1 140 ? -20.895 16.978  2.624   0.016 24.03 ? 138 LYS A CD   1  
ATOM   2113   C CE   . LYS A 1 140 ? -19.936 15.789  2.299   0.016 23.75 ? 138 LYS A CE   1  
ATOM   2114   N NZ   . LYS A 1 140 ? -18.438 16.179  2.165   0.016 24.39 ? 138 LYS A NZ   1  
ATOM   2115   H H    . LYS A 1 140 ? -26.272 17.861  2.764   0.016 22.78 ? 138 LYS A H    1  
ATOM   2116   H HA   . LYS A 1 140 ? -24.796 16.865  0.864   0.016 22.33 ? 138 LYS A HA   1  
ATOM   2117   H HB2  . LYS A 1 140 ? -23.267 18.604  1.463   0.016 23.74 ? 138 LYS A HB2  1  
ATOM   2118   H HB3  . LYS A 1 140 ? -23.241 18.060  2.947   0.016 23.78 ? 138 LYS A HB3  1  
ATOM   2119   H HG2  . LYS A 1 140 ? -22.408 16.028  1.625   0.016 22.74 ? 138 LYS A HG2  1  
ATOM   2120   H HG3  . LYS A 1 140 ? -21.814 17.194  0.757   0.016 23.49 ? 138 LYS A HG3  1  
ATOM   2121   H HD2  . LYS A 1 140 ? -20.377 17.779  2.462   0.016 24.68 ? 138 LYS A HD2  1  
ATOM   2122   H HD3  . LYS A 1 140 ? -21.255 16.954  3.518   0.016 24.13 ? 138 LYS A HD3  1  
ATOM   2123   H HE2  . LYS A 1 140 ? -19.999 15.127  2.999   0.016 23.94 ? 138 LYS A HE2  1  
ATOM   2124   H HE3  . LYS A 1 140 ? -20.203 15.407  1.459   0.016 23.09 ? 138 LYS A HE3  1  
ATOM   2125   H HZ1  . LYS A 1 140 ? -18.217 16.779  2.783   0.016 25.07 ? 138 LYS A HZ1  1  
ATOM   2126   H HZ2  . LYS A 1 140 ? -17.933 15.456  2.275   0.016 24.26 ? 138 LYS A HZ2  1  
ATOM   2127   H HZ3  . LYS A 1 140 ? -18.281 16.509  1.357   0.016 24.31 ? 138 LYS A HZ3  1  
ATOM   2128   N N    . TRP A 1 141 ? -24.253 14.888  2.359   0.016 21.87 ? 139 TRP A N    1  
ATOM   2129   C CA   . TRP A 1 141 ? -24.119 13.822  3.320   0.016 21.75 ? 139 TRP A CA   1  
ATOM   2130   C C    . TRP A 1 141 ? -23.008 14.072  4.313   0.016 22.47 ? 139 TRP A C    1  
ATOM   2131   O O    . TRP A 1 141 ? -21.932 14.538  3.958   0.016 22.87 ? 139 TRP A O    1  
ATOM   2132   C CB   . TRP A 1 141 ? -23.801 12.512  2.618   0.016 21.16 ? 139 TRP A CB   1  
ATOM   2133   C CG   . TRP A 1 141 ? -24.877 12.014  1.724   0.016 20.59 ? 139 TRP A CG   1  
ATOM   2134   C CD1  . TRP A 1 141 ? -24.947 12.169  0.369   0.016 20.41 ? 139 TRP A CD1  1  
ATOM   2135   C CD2  . TRP A 1 141 ? -26.040 11.249  2.096   0.016 20.34 ? 139 TRP A CD2  1  
ATOM   2136   N NE1  . TRP A 1 141 ? -26.077 11.571  -0.118  0.016 20.09 ? 139 TRP A NE1  1  
ATOM   2137   C CE2  . TRP A 1 141 ? -26.760 10.996  0.916   0.016 20.03 ? 139 TRP A CE2  1  
ATOM   2138   C CE3  . TRP A 1 141 ? -26.541 10.772  3.301   0.016 20.53 ? 139 TRP A CE3  1  
ATOM   2139   C CZ2  . TRP A 1 141 ? -27.958 10.283  0.899   0.016 19.89 ? 139 TRP A CZ2  1  
ATOM   2140   C CZ3  . TRP A 1 141 ? -27.742 10.029  3.273   0.016 20.37 ? 139 TRP A CZ3  1  
ATOM   2141   C CH2  . TRP A 1 141 ? -28.423 9.808   2.071   0.016 20.05 ? 139 TRP A CH2  1  
ATOM   2142   H H    . TRP A 1 141 ? -23.914 14.728  1.590   0.016 21.75 ? 139 TRP A H    1  
ATOM   2143   H HA   . TRP A 1 141 ? -24.951 13.746  3.813   0.016 21.71 ? 139 TRP A HA   1  
ATOM   2144   H HB2  . TRP A 1 141 ? -23.002 12.632  2.088   0.016 21.26 ? 139 TRP A HB2  1  
ATOM   2145   H HB3  . TRP A 1 141 ? -23.631 11.852  3.305   0.016 21.19 ? 139 TRP A HB3  1  
ATOM   2146   H HD1  . TRP A 1 141 ? -24.324 12.624  -0.146  0.016 20.60 ? 139 TRP A HD1  1  
ATOM   2147   H HE1  . TRP A 1 141 ? -26.315 11.552  -0.940  0.016 20.04 ? 139 TRP A HE1  1  
ATOM   2148   H HE3  . TRP A 1 141 ? -26.081 10.918  4.094   0.016 20.86 ? 139 TRP A HE3  1  
ATOM   2149   H HZ2  . TRP A 1 141 ? -28.412 10.125  0.103   0.016 19.81 ? 139 TRP A HZ2  1  
ATOM   2150   H HZ3  . TRP A 1 141 ? -28.101 9.696   4.065   0.016 20.60 ? 139 TRP A HZ3  1  
ATOM   2151   H HH2  . TRP A 1 141 ? -29.221 9.332   2.076   0.016 20.06 ? 139 TRP A HH2  1  
ATOM   2152   N N    . LYS A 1 142 ? -23.234 13.662  5.544   0.016 22.78 ? 140 LYS A N    1  
ATOM   2153   C CA   . LYS A 1 142 ? -22.104 13.508  6.428   0.016 23.53 ? 140 LYS A CA   1  
ATOM   2154   C C    . LYS A 1 142 ? -21.197 12.396  5.887   0.016 23.18 ? 140 LYS A C    1  
ATOM   2155   O O    . LYS A 1 142 ? -21.525 11.716  4.900   0.016 22.38 ? 140 LYS A O    1  
ATOM   2156   C CB   . LYS A 1 142 ? -22.583 13.249  7.849   0.016 24.11 ? 140 LYS A CB   1  
ATOM   2157   C CG   . LYS A 1 142 ? -23.235 14.504  8.462   0.016 24.80 ? 140 LYS A CG   1  
ATOM   2158   C CD   . LYS A 1 142 ? -23.958 14.183  9.753   0.016 25.44 ? 140 LYS A CD   1  
ATOM   2159   C CE   . LYS A 1 142 ? -23.051 13.904  10.928  0.016 26.48 ? 140 LYS A CE   1  
ATOM   2160   N NZ   . LYS A 1 142 ? -23.896 13.809  12.153  0.016 27.36 ? 140 LYS A NZ   1  
ATOM   2161   H H    . LYS A 1 142 ? -23.999 13.486  5.886   0.016 22.69 ? 140 LYS A H    1  
ATOM   2162   H HA   . LYS A 1 142 ? -21.587 14.330  6.439   0.016 24.05 ? 140 LYS A HA   1  
ATOM   2163   H HB2  . LYS A 1 142 ? -23.241 12.540  7.842   0.016 23.66 ? 140 LYS A HB2  1  
ATOM   2164   H HB3  . LYS A 1 142 ? -21.830 13.002  8.406   0.016 24.63 ? 140 LYS A HB3  1  
ATOM   2165   H HG2  . LYS A 1 142 ? -22.541 15.153  8.657   0.016 25.41 ? 140 LYS A HG2  1  
ATOM   2166   H HG3  . LYS A 1 142 ? -23.873 14.876  7.836   0.016 24.36 ? 140 LYS A HG3  1  
ATOM   2167   H HD2  . LYS A 1 142 ? -24.526 14.934  9.994   0.016 25.85 ? 140 LYS A HD2  1  
ATOM   2168   H HD3  . LYS A 1 142 ? -24.497 13.388  9.611   0.016 24.92 ? 140 LYS A HD3  1  
ATOM   2169   H HE2  . LYS A 1 142 ? -22.581 13.066  10.796  0.016 26.14 ? 140 LYS A HE2  1  
ATOM   2170   H HE3  . LYS A 1 142 ? -22.423 14.633  11.045  0.016 27.08 ? 140 LYS A HE3  1  
ATOM   2171   H HZ1  . LYS A 1 142 ? -24.321 14.579  12.295  0.016 27.67 ? 140 LYS A HZ1  1  
ATOM   2172   H HZ2  . LYS A 1 142 ? -24.500 13.163  12.051  0.016 26.91 ? 140 LYS A HZ2  1  
ATOM   2173   H HZ3  . LYS A 1 142 ? -23.385 13.624  12.859  0.016 28.12 ? 140 LYS A HZ3  1  
ATOM   2174   N N    . SER A 1 143 ? -20.020 12.267  6.526   0.016 23.93 ? 141 SER A N    1  
ATOM   2175   C CA   . SER A 1 143 ? -18.872 11.432  6.152   0.016 23.90 ? 141 SER A CA   1  
ATOM   2176   C C    . SER A 1 143 ? -18.714 10.241  7.108   0.016 24.09 ? 141 SER A C    1  
ATOM   2177   O O    . SER A 1 143 ? -17.717 10.081  7.835   0.016 24.87 ? 141 SER A O    1  
ATOM   2178   C CB   . SER A 1 143 ? -17.632 12.336  6.075   0.016 24.79 ? 141 SER A CB   1  
ATOM   2179   O OG   . SER A 1 143 ? -17.934 13.530  5.327   0.016 24.53 ? 141 SER A OG   1  
ATOM   2180   H H    . SER A 1 143 ? -19.851 12.718  7.234   0.016 24.56 ? 141 SER A H    1  
ATOM   2181   H HA   . SER A 1 143 ? -19.007 11.080  5.261   0.016 23.27 ? 141 SER A HA   1  
ATOM   2182   H HB2  . SER A 1 143 ? -17.354 12.586  6.971   0.016 25.53 ? 141 SER A HB2  1  
ATOM   2183   H HB3  . SER A 1 143 ? -16.923 11.850  5.626   0.016 24.90 ? 141 SER A HB3  1  
ATOM   2184   H HG   . SER A 1 143 ? -18.677 13.849  5.550   0.016 24.29 ? 141 SER A HG   1  
ATOM   2185   N N    . PRO A 1 144 ? -19.621 9.294   7.031   0.016 23.41 ? 142 PRO A N    1  
ATOM   2186   C CA   . PRO A 1 144 ? -19.550 8.148   7.918   0.016 23.64 ? 142 PRO A CA   1  
ATOM   2187   C C    . PRO A 1 144 ? -18.325 7.308   7.598   0.016 23.67 ? 142 PRO A C    1  
ATOM   2188   O O    . PRO A 1 144 ? -17.579 7.548   6.643   0.016 23.09 ? 142 PRO A O    1  
ATOM   2189   C CB   . PRO A 1 144 ? -20.817 7.385   7.570   0.016 22.80 ? 142 PRO A CB   1  
ATOM   2190   C CG   . PRO A 1 144 ? -20.846 7.519   6.063   0.016 22.00 ? 142 PRO A CG   1  
ATOM   2191   C CD   . PRO A 1 144 ? -20.187 8.890   5.739   0.016 22.42 ? 142 PRO A CD   1  
ATOM   2192   H HA   . PRO A 1 144 ? -19.545 8.420   8.848   0.016 24.33 ? 142 PRO A HA   1  
ATOM   2193   H HB2  . PRO A 1 144 ? -20.714 6.455   7.836   0.016 22.84 ? 142 PRO A HB2  1  
ATOM   2194   H HB3  . PRO A 1 144 ? -21.585 7.782   7.992   0.016 22.90 ? 142 PRO A HB3  1  
ATOM   2195   H HG2  . PRO A 1 144 ? -20.343 6.794   5.667   0.016 21.86 ? 142 PRO A HG2  1  
ATOM   2196   H HG3  . PRO A 1 144 ? -21.765 7.510   5.756   0.016 21.57 ? 142 PRO A HG3  1  
ATOM   2197   H HD2  . PRO A 1 144 ? -19.476 8.782   5.091   0.016 22.40 ? 142 PRO A HD2  1  
ATOM   2198   H HD3  . PRO A 1 144 ? -20.845 9.538   5.445   0.016 22.21 ? 142 PRO A HD3  1  
ATOM   2199   N N    . THR A 1 145 ? -18.098 6.360   8.479   0.016 24.49 ? 143 THR A N    1  
ATOM   2200   C CA   . THR A 1 145 ? -17.254 5.205   8.207   0.016 24.56 ? 143 THR A CA   1  
ATOM   2201   C C    . THR A 1 145 ? -18.140 4.005   8.520   0.016 24.14 ? 143 THR A C    1  
ATOM   2202   O O    . THR A 1 145 ? -18.568 3.835   9.657   0.016 24.69 ? 143 THR A O    1  
ATOM   2203   C CB   . THR A 1 145 ? -15.961 5.229   9.049   0.016 25.87 ? 143 THR A CB   1  
ATOM   2204   O OG1  . THR A 1 145 ? -14.907 5.916   8.337   0.016 26.18 ? 143 THR A OG1  1  
ATOM   2205   C CG2  . THR A 1 145 ? -15.488 3.799   9.437   0.016 26.25 ? 143 THR A CG2  1  
ATOM   2206   H H    . THR A 1 145 ? -18.437 6.358   9.270   0.016 25.09 ? 143 THR A H    1  
ATOM   2207   H HA   . THR A 1 145 ? -17.015 5.183   7.268   0.016 24.13 ? 143 THR A HA   1  
ATOM   2208   H HB   . THR A 1 145 ? -16.132 5.712   9.874   0.016 26.44 ? 143 THR A HB   1  
ATOM   2209   H HG1  . THR A 1 145 ? -14.704 6.629   8.730   0.016 25.88 ? 143 THR A HG1  1  
ATOM   2210   H HG21 . THR A 1 145 ? -14.556 3.824   9.707   0.016 27.11 ? 143 THR A HG21 1  
ATOM   2211   H HG22 . THR A 1 145 ? -16.016 3.492   10.187  0.016 26.38 ? 143 THR A HG22 1  
ATOM   2212   H HG23 . THR A 1 145 ? -15.590 3.183   8.695   0.016 25.65 ? 143 THR A HG23 1  
ATOM   2213   N N    . GLY A 1 146 ? -18.476 3.219   7.501   0.016 23.29 ? 144 GLY A N    1  
ATOM   2214   C CA   . GLY A 1 146 ? -19.359 2.088   7.669   0.016 22.97 ? 144 GLY A CA   1  
ATOM   2215   C C    . GLY A 1 146 ? -18.655 0.741   7.751   0.016 23.47 ? 144 GLY A C    1  
ATOM   2216   O O    . GLY A 1 146 ? -17.445 0.626   7.598   0.016 23.99 ? 144 GLY A O    1  
ATOM   2217   H H    . GLY A 1 146 ? -18.205 3.324   6.694   0.016 22.97 ? 144 GLY A H    1  
ATOM   2218   H HA2  . GLY A 1 146 ? -19.863 2.197   8.487   0.016 23.16 ? 144 GLY A HA2  1  
ATOM   2219   H HA3  . GLY A 1 146 ? -19.983 2.058   6.932   0.016 22.34 ? 144 GLY A HA3  1  
ATOM   2220   N N    . LYS A 1 147 ? -19.473 -0.276  8.003   0.016 23.41 ? 145 LYS A N    1  
ATOM   2221   C CA   . LYS A 1 147 ? -19.017 -1.622  8.345   0.016 24.05 ? 145 LYS A CA   1  
ATOM   2222   C C    . LYS A 1 147 ? -19.236 -2.568  7.172   0.016 23.47 ? 145 LYS A C    1  
ATOM   2223   O O    . LYS A 1 147 ? -20.346 -2.666  6.636   0.016 22.88 ? 145 LYS A O    1  
ATOM   2224   C CB   . LYS A 1 147 ? -19.787 -2.133  9.567   0.016 24.66 ? 145 LYS A CB   1  
ATOM   2225   C CG   . LYS A 1 147 ? -19.088 -3.145  10.516  0.016 25.86 ? 145 LYS A CG   1  
ATOM   2226   C CD   . LYS A 1 147 ? -19.345 -2.686  11.991  0.016 26.93 ? 145 LYS A CD   1  
ATOM   2227   C CE   . LYS A 1 147 ? -18.757 -1.301  12.263  0.016 26.80 ? 145 LYS A CE   1  
ATOM   2228   N NZ   . LYS A 1 147 ? -17.688 -0.997  11.277  0.016 26.47 ? 145 LYS A NZ   1  
ATOM   2229   H H    . LYS A 1 147 ? -20.326 -0.208  7.976   0.016 23.06 ? 145 LYS A H    1  
ATOM   2230   H HA   . LYS A 1 147 ? -18.073 -1.604  8.548   0.016 24.56 ? 145 LYS A HA   1  
ATOM   2231   H HB2  . LYS A 1 147 ? -20.049 -1.364  10.094  0.016 24.74 ? 145 LYS A HB2  1  
ATOM   2232   H HB3  . LYS A 1 147 ? -20.587 -2.575  9.239   0.016 24.27 ? 145 LYS A HB3  1  
ATOM   2233   H HG2  . LYS A 1 147 ? -19.485 -4.021  10.397  0.016 25.93 ? 145 LYS A HG2  1  
ATOM   2234   H HG3  . LYS A 1 147 ? -18.137 -3.186  10.340  0.016 26.02 ? 145 LYS A HG3  1  
ATOM   2235   H HD2  . LYS A 1 147 ? -20.301 -2.623  12.138  0.016 26.96 ? 145 LYS A HD2  1  
ATOM   2236   H HD3  . LYS A 1 147 ? -18.950 -3.317  12.611  0.016 27.79 ? 145 LYS A HD3  1  
ATOM   2237   H HE2  . LYS A 1 147 ? -19.449 -0.624  12.173  0.016 26.17 ? 145 LYS A HE2  1  
ATOM   2238   H HE3  . LYS A 1 147 ? -18.376 -1.276  13.154  0.016 27.70 ? 145 LYS A HE3  1  
ATOM   2239   H HZ1  . LYS A 1 147 ? -18.037 -0.805  10.483  0.016 25.81 ? 145 LYS A HZ1  1  
ATOM   2240   H HZ2  . LYS A 1 147 ? -17.237 -0.288  11.571  0.016 27.18 ? 145 LYS A HZ2  1  
ATOM   2241   H HZ3  . LYS A 1 147 ? -17.127 -1.685  11.201  0.016 26.34 ? 145 LYS A HZ3  1  
ATOM   2242   N N    . MET A 1 148 ? -18.180 -3.291  6.802   0.016 23.79 ? 146 MET A N    1  
ATOM   2243   C CA   . MET A 1 148 ? -18.242 -4.367  5.833   0.016 23.43 ? 146 MET A CA   1  
ATOM   2244   C C    . MET A 1 148 ? -18.084 -5.663  6.586   0.016 24.19 ? 146 MET A C    1  
ATOM   2245   O O    . MET A 1 148 ? -17.250 -5.753  7.484   0.016 25.04 ? 146 MET A O    1  
ATOM   2246   C CB   . MET A 1 148 ? -17.121 -4.267  4.810   0.016 23.30 ? 146 MET A CB   1  
ATOM   2247   C CG   . MET A 1 148 ? -17.483 -3.325  3.749   0.016 22.72 ? 146 MET A CG   1  
ATOM   2248   S SD   . MET A 1 148 ? -18.329 -4.152  2.427   0.016 21.85 ? 146 MET A SD   1  
ATOM   2249   C CE   . MET A 1 148 ? -16.770 -4.467  1.558   0.016 22.23 ? 146 MET A CE   1  
ATOM   2250   H H    . MET A 1 148 ? -17.390 -3.170  7.107   0.016 24.32 ? 146 MET A H    1  
ATOM   2251   H HA   . MET A 1 148 ? -19.088 -4.344  5.364   0.016 22.95 ? 146 MET A HA   1  
ATOM   2252   H HB2  . MET A 1 148 ? -16.312 -3.953  5.241   0.016 23.86 ? 146 MET A HB2  1  
ATOM   2253   H HB3  . MET A 1 148 ? -16.974 -5.131  4.408   0.016 23.15 ? 146 MET A HB3  1  
ATOM   2254   H HG2  . MET A 1 148 ? -18.078 -2.650  4.110   0.016 22.71 ? 146 MET A HG2  1  
ATOM   2255   H HG3  . MET A 1 148 ? -16.677 -2.922  3.400   0.016 22.95 ? 146 MET A HG3  1  
ATOM   2256   H HE1  . MET A 1 148 ? -16.209 -5.040  2.105   0.016 22.68 ? 146 MET A HE1  1  
ATOM   2257   H HE2  . MET A 1 148 ? -16.958 -4.914  0.727   0.016 22.03 ? 146 MET A HE2  1  
ATOM   2258   H HE3  . MET A 1 148 ? -16.320 -3.623  1.396   0.016 22.30 ? 146 MET A HE3  1  
ATOM   2259   N N    . TYR A 1 149 ? -18.840 -6.677  6.187   0.016 24.03 ? 147 TYR A N    1  
ATOM   2260   C CA   . TYR A 1 149 ? -18.702 -7.941  6.882   0.016 24.87 ? 147 TYR A CA   1  
ATOM   2261   C C    . TYR A 1 149 ? -19.285 -9.028  6.001   0.016 24.69 ? 147 TYR A C    1  
ATOM   2262   O O    . TYR A 1 149 ? -20.036 -8.759  5.080   0.016 24.02 ? 147 TYR A O    1  
ATOM   2263   C CB   . TYR A 1 149 ? -19.358 -7.894  8.260   0.016 25.54 ? 147 TYR A CB   1  
ATOM   2264   C CG   . TYR A 1 149 ? -20.839 -7.709  8.230   0.016 25.19 ? 147 TYR A CG   1  
ATOM   2265   C CD1  . TYR A 1 149 ? -21.698 -8.797  8.110   0.016 25.35 ? 147 TYR A CD1  1  
ATOM   2266   C CD2  . TYR A 1 149 ? -21.390 -6.438  8.326   0.016 24.86 ? 147 TYR A CD2  1  
ATOM   2267   C CE1  . TYR A 1 149 ? -23.056 -8.629  8.074   0.016 25.21 ? 147 TYR A CE1  1  
ATOM   2268   C CE2  . TYR A 1 149 ? -22.734 -6.259  8.281   0.016 24.66 ? 147 TYR A CE2  1  
ATOM   2269   C CZ   . TYR A 1 149 ? -23.569 -7.363  8.167   0.016 24.86 ? 147 TYR A CZ   1  
ATOM   2270   O OH   . TYR A 1 149 ? -24.923 -7.190  8.126   0.016 24.84 ? 147 TYR A OH   1  
ATOM   2271   H H    . TYR A 1 149 ? -19.404 -6.671  5.541   0.016 23.56 ? 147 TYR A H    1  
ATOM   2272   H HA   . TYR A 1 149 ? -17.757 -8.126  7.006   0.016 25.27 ? 147 TYR A HA   1  
ATOM   2273   H HB2  . TYR A 1 149 ? -19.170 -8.724  8.728   0.016 26.20 ? 147 TYR A HB2  1  
ATOM   2274   H HB3  . TYR A 1 149 ? -18.977 -7.150  8.746   0.016 25.72 ? 147 TYR A HB3  1  
ATOM   2275   H HD1  . TYR A 1 149 ? -21.345 -9.661  8.047   0.016 25.64 ? 147 TYR A HD1  1  
ATOM   2276   H HD2  . TYR A 1 149 ? -20.827 -5.704  8.402   0.016 24.83 ? 147 TYR A HD2  1  
ATOM   2277   H HE1  . TYR A 1 149 ? -23.623 -9.363  7.991   0.016 25.43 ? 147 TYR A HE1  1  
ATOM   2278   H HE2  . TYR A 1 149 ? -23.093 -5.406  8.343   0.016 24.49 ? 147 TYR A HE2  1  
ATOM   2279   H HH   . TYR A 1 149 ? -25.139 -6.781  7.425   0.016 24.46 ? 147 TYR A HH   1  
ATOM   2280   N N    . VAL A 1 150 ? -18.885 -10.273 6.257   0.016 25.46 ? 148 VAL A N    1  
ATOM   2281   C CA   . VAL A 1 150 ? -19.314 -11.382 5.426   0.016 25.53 ? 148 VAL A CA   1  
ATOM   2282   C C    . VAL A 1 150 ? -20.235 -12.254 6.252   0.016 26.22 ? 148 VAL A C    1  
ATOM   2283   O O    . VAL A 1 150 ? -19.939 -12.539 7.417   0.016 26.97 ? 148 VAL A O    1  
ATOM   2284   C CB   . VAL A 1 150 ? -18.120 -12.217 4.925   0.016 26.04 ? 148 VAL A CB   1  
ATOM   2285   C CG1  . VAL A 1 150 ? -18.602 -13.432 4.119   0.016 26.40 ? 148 VAL A CG1  1  
ATOM   2286   C CG2  . VAL A 1 150 ? -17.197 -11.369 4.087   0.016 25.52 ? 148 VAL A CG2  1  
ATOM   2287   H H    . VAL A 1 150 ? -18.378 -10.491 6.910   0.016 26.02 ? 148 VAL A H    1  
ATOM   2288   H HA   . VAL A 1 150 ? -19.800 -11.056 4.654   0.016 24.96 ? 148 VAL A HA   1  
ATOM   2289   H HB   . VAL A 1 150 ? -17.630 -12.537 5.696   0.016 26.64 ? 148 VAL A HB   1  
ATOM   2290   H HG11 . VAL A 1 150 ? -19.291 -13.912 4.605   0.016 26.98 ? 148 VAL A HG11 1  
ATOM   2291   H HG12 . VAL A 1 150 ? -18.953 -13.137 3.263   0.016 25.95 ? 148 VAL A HG12 1  
ATOM   2292   H HG13 . VAL A 1 150 ? -17.842 -14.020 3.980   0.016 26.61 ? 148 VAL A HG13 1  
ATOM   2293   H HG21 . VAL A 1 150 ? -17.386 -10.433 4.239   0.016 25.25 ? 148 VAL A HG21 1  
ATOM   2294   H HG22 . VAL A 1 150 ? -16.285 -11.563 4.350   0.016 25.98 ? 148 VAL A HG22 1  
ATOM   2295   H HG23 . VAL A 1 150 ? -17.324 -11.594 3.152   0.016 25.12 ? 148 VAL A HG23 1  
ATOM   2296   N N    . GLU A 1 151 ? -21.319 -12.711 5.648   0.016 26.14 ? 149 GLU A N    1  
ATOM   2297   C CA   . GLU A 1 151 ? -22.074 -13.812 6.238   0.016 27.08 ? 149 GLU A CA   1  
ATOM   2298   C C    . GLU A 1 151 ? -22.393 -14.858 5.180   0.016 27.32 ? 149 GLU A C    1  
ATOM   2299   O O    . GLU A 1 151 ? -22.941 -14.527 4.126   0.016 26.73 ? 149 GLU A O    1  
ATOM   2300   C CB   . GLU A 1 151 ? -23.344 -13.301 6.904   0.016 27.09 ? 149 GLU A CB   1  
ATOM   2301   C CG   . GLU A 1 151 ? -24.119 -14.402 7.657   0.016 28.20 ? 149 GLU A CG   1  
ATOM   2302   C CD   . GLU A 1 151 ? -23.291 -15.633 8.046   0.016 29.32 ? 149 GLU A CD   1  
ATOM   2303   O OE1  . GLU A 1 151 ? -22.919 -15.789 9.234   0.016 30.35 ? 149 GLU A OE1  1  
ATOM   2304   O OE2  . GLU A 1 151 ? -23.035 -16.431 7.136   0.016 29.29 ? 149 GLU A OE2  1  
ATOM   2305   H H    . GLU A 1 151 ? -21.636 -12.408 4.908   0.016 25.66 ? 149 GLU A H    1  
ATOM   2306   H HA   . GLU A 1 151 ? -21.514 -14.227 6.911   0.016 27.70 ? 149 GLU A HA   1  
ATOM   2307   H HB2  . GLU A 1 151 ? -23.124 -12.597 7.538   0.016 27.12 ? 149 GLU A HB2  1  
ATOM   2308   H HB3  . GLU A 1 151 ? -23.922 -12.941 6.212   0.016 26.46 ? 149 GLU A HB3  1  
ATOM   2309   H HG2  . GLU A 1 151 ? -24.484 -14.021 8.470   0.016 28.47 ? 149 GLU A HG2  1  
ATOM   2310   H HG3  . GLU A 1 151 ? -24.835 -14.709 7.080   0.016 28.07 ? 149 GLU A HG3  1  
ATOM   2311   N N    . ASP A 1 152 ? -22.051 -16.114 5.490   0.016 28.32 ? 150 ASP A N    1  
ATOM   2312   C CA   . ASP A 1 152 ? -22.373 -17.300 4.689   0.016 28.91 ? 150 ASP A CA   1  
ATOM   2313   C C    . ASP A 1 152 ? -21.986 -17.153 3.220   0.016 28.34 ? 150 ASP A C    1  
ATOM   2314   O O    . ASP A 1 152 ? -22.715 -17.575 2.321   0.016 28.65 ? 150 ASP A O    1  
ATOM   2315   C CB   . ASP A 1 152 ? -23.854 -17.658 4.812   0.016 29.28 ? 150 ASP A CB   1  
ATOM   2316   C CG   . ASP A 1 152 ? -24.760 -16.650 4.171   0.016 28.33 ? 150 ASP A CG   1  
ATOM   2317   O OD1  . ASP A 1 152 ? -25.949 -16.662 4.577   0.016 28.64 ? 150 ASP A OD1  1  
ATOM   2318   O OD2  . ASP A 1 152 ? -24.322 -15.908 3.261   0.016 27.48 ? 150 ASP A OD2  1  
ATOM   2319   H H    . ASP A 1 152 ? -21.620 -16.311 6.207   0.016 28.77 ? 150 ASP A H    1  
ATOM   2320   H HA   . ASP A 1 152 ? -21.861 -18.047 5.034   0.016 29.64 ? 150 ASP A HA   1  
ATOM   2321   H HB2  . ASP A 1 152 ? -24.007 -18.514 4.376   0.016 29.82 ? 150 ASP A HB2  1  
ATOM   2322   H HB3  . ASP A 1 152 ? -24.110 -17.730 5.736   0.016 29.77 ? 150 ASP A HB3  1  
ATOM   2323   N N    . GLY A 1 153 ? -20.825 -16.535 2.977   0.016 27.63 ? 151 GLY A N    1  
ATOM   2324   C CA   . GLY A 1 153 ? -20.308 -16.357 1.617   0.016 27.30 ? 151 GLY A CA   1  
ATOM   2325   C C    . GLY A 1 153 ? -20.683 -15.105 0.821   0.016 26.32 ? 151 GLY A C    1  
ATOM   2326   O O    . GLY A 1 153 ? -20.245 -14.989 -0.332  0.016 26.26 ? 151 GLY A O    1  
ATOM   2327   H H    . GLY A 1 153 ? -20.306 -16.237 3.593   0.016 27.44 ? 151 GLY A H    1  
ATOM   2328   H HA2  . GLY A 1 153 ? -19.341 -16.379 1.673   0.016 27.40 ? 151 GLY A HA2  1  
ATOM   2329   H HA3  . GLY A 1 153 ? -20.582 -17.120 1.088   0.016 27.80 ? 151 GLY A HA3  1  
ATOM   2330   N N    . VAL A 1 154 ? -21.479 -14.181 1.379   0.016 25.70 ? 152 VAL A N    1  
ATOM   2331   C CA   . VAL A 1 154 ? -21.895 -12.946 0.713   0.016 24.86 ? 152 VAL A CA   1  
ATOM   2332   C C    . VAL A 1 154 ? -21.242 -11.788 1.459   0.016 24.27 ? 152 VAL A C    1  
ATOM   2333   O O    . VAL A 1 154 ? -21.257 -11.766 2.697   0.016 24.48 ? 152 VAL A O    1  
ATOM   2334   C CB   . VAL A 1 154 ? -23.433 -12.753 0.728   0.016 24.79 ? 152 VAL A CB   1  
ATOM   2335   C CG1  . VAL A 1 154 ? -23.948 -12.163 -0.533  0.016 24.55 ? 152 VAL A CG1  1  
ATOM   2336   C CG2  . VAL A 1 154 ? -24.156 -14.086 1.000   0.016 25.75 ? 152 VAL A CG2  1  
ATOM   2337   H H    . VAL A 1 154 ? -21.797 -14.252 2.175   0.016 25.82 ? 152 VAL A H    1  
ATOM   2338   H HA   . VAL A 1 154 ? -21.587 -12.940 -0.207  0.016 24.85 ? 152 VAL A HA   1  
ATOM   2339   H HB   . VAL A 1 154 ? -23.667 -12.137 1.441   0.016 24.45 ? 152 VAL A HB   1  
ATOM   2340   H HG11 . VAL A 1 154 ? -23.413 -11.386 -0.753  0.016 23.98 ? 152 VAL A HG11 1  
ATOM   2341   H HG12 . VAL A 1 154 ? -23.893 -12.818 -1.247  0.016 24.88 ? 152 VAL A HG12 1  
ATOM   2342   H HG13 . VAL A 1 154 ? -24.870 -11.910 -0.391  0.016 24.77 ? 152 VAL A HG13 1  
ATOM   2343   H HG21 . VAL A 1 154 ? -23.592 -14.837 0.762   0.016 26.18 ? 152 VAL A HG21 1  
ATOM   2344   H HG22 . VAL A 1 154 ? -24.377 -14.106 1.941   0.016 25.89 ? 152 VAL A HG22 1  
ATOM   2345   H HG23 . VAL A 1 154 ? -24.965 -14.128 0.468   0.016 25.87 ? 152 VAL A HG23 1  
ATOM   2346   N N    . LEU A 1 155 ? -20.731 -10.807 0.724   0.016 23.70 ? 153 LEU A N    1  
ATOM   2347   C CA   . LEU A 1 155 ? -20.283 -9.567  1.356   0.016 23.24 ? 153 LEU A CA   1  
ATOM   2348   C C    . LEU A 1 155 ? -21.451 -8.631  1.604   0.016 22.71 ? 153 LEU A C    1  
ATOM   2349   O O    . LEU A 1 155 ? -22.286 -8.416  0.715   0.016 22.37 ? 153 LEU A O    1  
ATOM   2350   C CB   . LEU A 1 155 ? -19.238 -8.855  0.502   0.016 23.01 ? 153 LEU A CB   1  
ATOM   2351   C CG   . LEU A 1 155 ? -18.439 -7.692  1.096   0.016 22.82 ? 153 LEU A CG   1  
ATOM   2352   C CD1  . LEU A 1 155 ? -17.871 -8.056  2.446   0.016 23.43 ? 153 LEU A CD1  1  
ATOM   2353   C CD2  . LEU A 1 155 ? -17.335 -7.402  0.115   0.016 22.84 ? 153 LEU A CD2  1  
ATOM   2354   H H    . LEU A 1 155 ? -20.633 -10.830 -0.131  0.016 23.66 ? 153 LEU A H    1  
ATOM   2355   H HA   . LEU A 1 155 ? -19.892 -9.787  2.215   0.016 23.56 ? 153 LEU A HA   1  
ATOM   2356   H HB2  . LEU A 1 155 ? -18.590 -9.529  0.253   0.016 23.42 ? 153 LEU A HB2  1  
ATOM   2357   H HB3  . LEU A 1 155 ? -19.677 -8.529  -0.299  0.016 22.73 ? 153 LEU A HB3  1  
ATOM   2358   H HG   . LEU A 1 155 ? -19.002 -6.906  1.186   0.016 22.44 ? 153 LEU A HG   1  
ATOM   2359   H HD11 . LEU A 1 155 ? -16.956 -7.747  2.503   0.016 23.64 ? 153 LEU A HD11 1  
ATOM   2360   H HD12 . LEU A 1 155 ? -18.408 -7.647  3.139   0.016 23.35 ? 153 LEU A HD12 1  
ATOM   2361   H HD13 . LEU A 1 155 ? -17.887 -9.021  2.540   0.016 23.81 ? 153 LEU A HD13 1  
ATOM   2362   H HD21 . LEU A 1 155 ? -16.593 -6.973  0.567   0.016 22.74 ? 153 LEU A HD21 1  
ATOM   2363   H HD22 . LEU A 1 155 ? -17.039 -8.240  -0.252  0.016 23.30 ? 153 LEU A HD22 1  
ATOM   2364   H HD23 . LEU A 1 155 ? -17.680 -6.828  -0.590  0.016 22.59 ? 153 LEU A HD23 1  
ATOM   2365   N N    . LYS A 1 156 ? -21.487 -8.064  2.812   0.016 22.79 ? 154 LYS A N    1  
ATOM   2366   C CA   . LYS A 1 156 ? -22.502 -7.099  3.232   0.016 22.42 ? 154 LYS A CA   1  
ATOM   2367   C C    . LYS A 1 156 ? -21.828 -5.809  3.648   0.016 22.13 ? 154 LYS A C    1  
ATOM   2368   O O    . LYS A 1 156 ? -20.771 -5.811  4.249   0.016 22.46 ? 154 LYS A O    1  
ATOM   2369   C CB   . LYS A 1 156 ? -23.316 -7.543  4.453   0.016 22.97 ? 154 LYS A CB   1  
ATOM   2370   C CG   . LYS A 1 156 ? -24.177 -8.715  4.319   0.016 23.50 ? 154 LYS A CG   1  
ATOM   2371   C CD   . LYS A 1 156 ? -24.615 -9.065  2.902   0.016 23.23 ? 154 LYS A CD   1  
ATOM   2372   C CE   . LYS A 1 156 ? -25.527 -10.282 2.998   0.016 24.03 ? 154 LYS A CE   1  
ATOM   2373   N NZ   . LYS A 1 156 ? -26.613 -10.011 4.003   0.016 24.58 ? 154 LYS A NZ   1  
ATOM   2374   H H    . LYS A 1 156 ? -20.905 -8.227  3.423   0.016 23.14 ? 154 LYS A H    1  
ATOM   2375   H HA   . LYS A 1 156 ? -23.104 -6.911  2.499   0.016 22.13 ? 154 LYS A HA   1  
ATOM   2376   H HB2  . LYS A 1 156 ? -22.702 -7.731  5.181   0.016 23.34 ? 154 LYS A HB2  1  
ATOM   2377   H HB3  . LYS A 1 156 ? -23.887 -6.800  4.706   0.016 22.73 ? 154 LYS A HB3  1  
ATOM   2378   H HG2  . LYS A 1 156 ? -23.725 -9.489  4.689   0.016 23.91 ? 154 LYS A HG2  1  
ATOM   2379   H HG3  . LYS A 1 156 ? -24.947 -8.510  4.854   0.016 23.80 ? 154 LYS A HG3  1  
ATOM   2380   H HD2  . LYS A 1 156 ? -25.112 -8.328  2.513   0.016 22.99 ? 154 LYS A HD2  1  
ATOM   2381   H HD3  . LYS A 1 156 ? -23.845 -9.296  2.360   0.016 22.96 ? 154 LYS A HD3  1  
ATOM   2382   H HE2  . LYS A 1 156 ? -25.943 -10.456 2.139   0.016 24.01 ? 154 LYS A HE2  1  
ATOM   2383   H HE3  . LYS A 1 156 ? -25.017 -11.051 3.291   0.016 24.36 ? 154 LYS A HE3  1  
ATOM   2384   H HZ1  . LYS A 1 156 ? -26.323 -9.589  4.720   0.016 24.91 ? 154 LYS A HZ1  1  
ATOM   2385   H HZ2  . LYS A 1 156 ? -27.256 -9.528  3.624   0.016 24.26 ? 154 LYS A HZ2  1  
ATOM   2386   H HZ3  . LYS A 1 156 ? -26.952 -10.789 4.274   0.016 25.01 ? 154 LYS A HZ3  1  
ATOM   2387   N N    . GLY A 1 157 ? -22.443 -4.684  3.382   0.016 21.66 ? 155 GLY A N    1  
ATOM   2388   C CA   . GLY A 1 157 ? -21.856 -3.424  3.777   0.016 21.52 ? 155 GLY A CA   1  
ATOM   2389   C C    . GLY A 1 157 ? -22.968 -2.503  4.193   0.016 21.30 ? 155 GLY A C    1  
ATOM   2390   O O    . GLY A 1 157 ? -23.951 -2.351  3.465   0.016 20.98 ? 155 GLY A O    1  
ATOM   2391   H H    . GLY A 1 157 ? -23.191 -4.617  2.969   0.016 21.47 ? 155 GLY A H    1  
ATOM   2392   H HA2  . GLY A 1 157 ? -21.248 -3.556  4.521   0.016 21.94 ? 155 GLY A HA2  1  
ATOM   2393   H HA3  . GLY A 1 157 ? -21.370 -3.032  3.035   0.016 21.28 ? 155 GLY A HA3  1  
ATOM   2394   N N    . ASP A 1 158 ? -22.850 -1.953  5.408   0.016 21.64 ? 156 ASP A N    1  
ATOM   2395   C CA   . ASP A 1 158 ? -23.868 -0.987  5.780   0.016 21.49 ? 156 ASP A CA   1  
ATOM   2396   C C    . ASP A 1 158 ? -23.460 0.061   6.817   0.016 21.81 ? 156 ASP A C    1  
ATOM   2397   O O    . ASP A 1 158 ? -22.446 -0.046  7.509   0.016 22.31 ? 156 ASP A O    1  
ATOM   2398   C CB   . ASP A 1 158 ? -25.147 -1.712  6.184   0.016 21.88 ? 156 ASP A CB   1  
ATOM   2399   C CG   . ASP A 1 158 ? -25.037 -2.550  7.428   0.016 22.68 ? 156 ASP A CG   1  
ATOM   2400   O OD1  . ASP A 1 158 ? -25.451 -3.755  7.356   0.016 22.93 ? 156 ASP A OD1  1  
ATOM   2401   O OD2  . ASP A 1 158 ? -24.665 -1.996  8.468   0.016 23.17 ? 156 ASP A OD2  1  
ATOM   2402   H H    . ASP A 1 158 ? -22.233 -2.091  5.985   0.016 22.00 ? 156 ASP A H    1  
ATOM   2403   H HA   . ASP A 1 158 ? -24.085 -0.489  4.986   0.016 21.03 ? 156 ASP A HA   1  
ATOM   2404   H HB2  . ASP A 1 158 ? -25.827 -1.075  6.374   0.016 21.97 ? 156 ASP A HB2  1  
ATOM   2405   H HB3  . ASP A 1 158 ? -25.397 -2.302  5.457   0.016 21.67 ? 156 ASP A HB3  1  
ATOM   2406   N N    . VAL A 1 159 ? -24.262 1.119   6.862   0.016 21.65 ? 157 VAL A N    1  
ATOM   2407   C CA   . VAL A 1 159 ? -23.813 2.364   7.465   0.016 22.01 ? 157 VAL A CA   1  
ATOM   2408   C C    . VAL A 1 159 ? -25.032 3.195   7.824   0.016 22.04 ? 157 VAL A C    1  
ATOM   2409   O O    . VAL A 1 159 ? -26.036 3.224   7.105   0.016 21.56 ? 157 VAL A O    1  
ATOM   2410   C CB   . VAL A 1 159 ? -22.851 3.148   6.537   0.016 21.71 ? 157 VAL A CB   1  
ATOM   2411   C CG1  . VAL A 1 159 ? -23.390 3.271   5.174   0.016 20.94 ? 157 VAL A CG1  1  
ATOM   2412   C CG2  . VAL A 1 159 ? -22.558 4.506   7.098   0.016 22.19 ? 157 VAL A CG2  1  
ATOM   2413   H H    . VAL A 1 159 ? -25.064 1.136   6.554   0.016 21.43 ? 157 VAL A H    1  
ATOM   2414   H HA   . VAL A 1 159 ? -23.332 2.161   8.282   0.016 22.61 ? 157 VAL A HA   1  
ATOM   2415   H HB   . VAL A 1 159 ? -22.014 2.657   6.476   0.016 21.88 ? 157 VAL A HB   1  
ATOM   2416   H HG11 . VAL A 1 159 ? -23.020 4.066   4.765   0.016 20.91 ? 157 VAL A HG11 1  
ATOM   2417   H HG12 . VAL A 1 159 ? -23.124 2.486   4.667   0.016 20.77 ? 157 VAL A HG12 1  
ATOM   2418   H HG13 . VAL A 1 159 ? -24.353 3.333   5.217   0.016 20.77 ? 157 VAL A HG13 1  
ATOM   2419   H HG21 . VAL A 1 159 ? -22.001 4.980   6.460   0.016 22.10 ? 157 VAL A HG21 1  
ATOM   2420   H HG22 . VAL A 1 159 ? -23.379 5.003   7.232   0.016 22.06 ? 157 VAL A HG22 1  
ATOM   2421   H HG23 . VAL A 1 159 ? -22.084 4.410   7.935   0.016 22.83 ? 157 VAL A HG23 1  
ATOM   2422   N N    . GLU A 1 160 ? -24.938 3.847   8.967   0.016 22.78 ? 158 GLU A N    1  
ATOM   2423   C CA   . GLU A 1 160 ? -25.913 4.839   9.364   0.016 23.04 ? 158 GLU A CA   1  
ATOM   2424   C C    . GLU A 1 160 ? -25.444 6.146   8.766   0.016 22.69 ? 158 GLU A C    1  
ATOM   2425   O O    . GLU A 1 160 ? -24.450 6.685   9.210   0.016 23.16 ? 158 GLU A O    1  
ATOM   2426   C CB   . GLU A 1 160 ? -25.963 4.954   10.882  0.016 24.24 ? 158 GLU A CB   1  
ATOM   2427   C CG   . GLU A 1 160 ? -26.780 3.914   11.630  0.016 24.82 ? 158 GLU A CG   1  
ATOM   2428   C CD   . GLU A 1 160 ? -27.125 4.350   13.056  0.016 26.26 ? 158 GLU A CD   1  
ATOM   2429   O OE1  . GLU A 1 160 ? -26.477 5.303   13.554  0.016 26.84 ? 158 GLU A OE1  1  
ATOM   2430   O OE2  . GLU A 1 160 ? -28.054 3.754   13.673  0.016 26.96 ? 158 GLU A OE2  1  
ATOM   2431   H H    . GLU A 1 160 ? -24.303 3.743   9.536   0.016 23.23 ? 158 GLU A H    1  
ATOM   2432   H HA   . GLU A 1 160 ? -26.793 4.620   9.029   0.016 22.80 ? 158 GLU A HA   1  
ATOM   2433   H HB2  . GLU A 1 160 ? -25.054 4.893   11.207  0.016 24.56 ? 158 GLU A HB2  1  
ATOM   2434   H HB3  . GLU A 1 160 ? -26.326 5.822   11.111  0.016 24.50 ? 158 GLU A HB3  1  
ATOM   2435   H HG2  . GLU A 1 160 ? -27.611 3.764   11.155  0.016 24.57 ? 158 GLU A HG2  1  
ATOM   2436   H HG3  . GLU A 1 160 ? -26.273 3.086   11.683  0.016 24.67 ? 158 GLU A HG3  1  
ATOM   2437   N N    . MET A 1 161 ? -26.148 6.723   7.826   0.016 22.08 ? 159 MET A N    1  
ATOM   2438   C CA   . MET A 1 161 ? -25.751 8.115   7.776   0.016 22.27 ? 159 MET A CA   1  
ATOM   2439   C C    . MET A 1 161 ? -26.887 9.032   7.443   0.016 22.17 ? 159 MET A C    1  
ATOM   2440   O O    . MET A 1 161 ? -28.010 8.787   7.848   0.016 22.45 ? 159 MET A O    1  
ATOM   2441   C CB   . MET A 1 161 ? -24.500 8.309   6.941   0.016 21.97 ? 159 MET A CB   1  
ATOM   2442   C CG   . MET A 1 161 ? -23.558 9.400   7.664   0.016 22.75 ? 159 MET A CG   1  
ATOM   2443   S SD   . MET A 1 161 ? -23.443 9.005   9.456   0.016 23.99 ? 159 MET A SD   1  
ATOM   2444   C CE   . MET A 1 161 ? -21.825 9.551   10.014  0.016 24.85 ? 159 MET A CE   1  
ATOM   2445   H H    . MET A 1 161 ? -26.752 6.415   7.304   0.016 21.71 ? 159 MET A H    1  
ATOM   2446   H HA   . MET A 1 161 ? -25.575 8.393   8.675   0.016 22.92 ? 159 MET A HA   1  
ATOM   2447   H HB2  . MET A 1 161 ? -24.004 7.477   6.899   0.016 21.94 ? 159 MET A HB2  1  
ATOM   2448   H HB3  . MET A 1 161 ? -24.766 8.585   6.055   0.016 21.47 ? 159 MET A HB3  1  
ATOM   2449   H HG2  . MET A 1 161 ? -22.674 9.427   7.266   0.016 22.82 ? 159 MET A HG2  1  
ATOM   2450   H HG3  . MET A 1 161 ? -23.978 10.272  7.595   0.016 22.70 ? 159 MET A HG3  1  
ATOM   2451   H HE1  . MET A 1 161 ? -21.469 8.896   10.635  0.016 25.01 ? 159 MET A HE1  1  
ATOM   2452   H HE2  . MET A 1 161 ? -21.247 9.628   9.244   0.016 24.50 ? 159 MET A HE2  1  
ATOM   2453   H HE3  . MET A 1 161 ? -21.897 10.415  10.454  0.016 25.63 ? 159 MET A HE3  1  
ATOM   2454   N N    . ALA A 1 162 ? -26.522 10.212  6.962   0.016 22.09 ? 160 ALA A N    1  
ATOM   2455   C CA   . ALA A 1 162 ? -27.309 11.366  7.352   0.016 22.50 ? 160 ALA A CA   1  
ATOM   2456   C C    . ALA A 1 162 ? -27.065 12.507  6.399   0.016 22.23 ? 160 ALA A C    1  
ATOM   2457   O O    . ALA A 1 162 ? -25.935 12.751  5.982   0.016 22.18 ? 160 ALA A O    1  
ATOM   2458   C CB   . ALA A 1 162 ? -26.944 11.839  8.760   0.016 23.56 ? 160 ALA A CB   1  
ATOM   2459   H H    . ALA A 1 162 ? -25.864 10.364  6.433   0.016 21.88 ? 160 ALA A H    1  
ATOM   2460   H HA   . ALA A 1 162 ? -28.249 11.140  7.332   0.016 22.43 ? 160 ALA A HA   1  
ATOM   2461   H HB1  . ALA A 1 162 ? -26.570 12.730  8.709   0.016 23.79 ? 160 ALA A HB1  1  
ATOM   2462   H HB2  . ALA A 1 162 ? -27.751 11.840  9.291   0.016 23.91 ? 160 ALA A HB2  1  
ATOM   2463   H HB3  . ALA A 1 162 ? -26.296 11.237  9.147   0.016 23.76 ? 160 ALA A HB3  1  
ATOM   2464   N N    . LEU A 1 163 ? -28.138 13.210  6.100   0.016 22.20 ? 161 LEU A N    1  
ATOM   2465   C CA   . LEU A 1 163 ? -28.087 14.401  5.279   0.016 22.20 ? 161 LEU A CA   1  
ATOM   2466   C C    . LEU A 1 163 ? -28.122 15.595  6.206   0.016 23.08 ? 161 LEU A C    1  
ATOM   2467   O O    . LEU A 1 163 ? -28.880 15.617  7.175   0.016 23.59 ? 161 LEU A O    1  
ATOM   2468   C CB   . LEU A 1 163 ? -29.263 14.441  4.309   0.016 21.83 ? 161 LEU A CB   1  
ATOM   2469   C CG   . LEU A 1 163 ? -28.934 13.519  3.151   0.016 21.14 ? 161 LEU A CG   1  
ATOM   2470   C CD1  . LEU A 1 163 ? -30.180 13.005  2.532   0.016 20.97 ? 161 LEU A CD1  1  
ATOM   2471   C CD2  . LEU A 1 163 ? -28.057 14.174  2.085   0.016 21.04 ? 161 LEU A CD2  1  
ATOM   2472   H H    . LEU A 1 163 ? -28.926 13.029  6.379   0.016 22.27 ? 161 LEU A H    1  
ATOM   2473   H HA   . LEU A 1 163 ? -27.258 14.425  4.779   0.016 22.04 ? 161 LEU A HA   1  
ATOM   2474   H HB2  . LEU A 1 163 ? -30.062 14.126  4.755   0.016 21.98 ? 161 LEU A HB2  1  
ATOM   2475   H HB3  . LEU A 1 163 ? -29.400 15.333  3.958   0.016 22.00 ? 161 LEU A HB3  1  
ATOM   2476   H HG   . LEU A 1 163 ? -28.441 12.763  3.505   0.016 21.01 ? 161 LEU A HG   1  
ATOM   2477   H HD11 . LEU A 1 163 ? -30.108 13.111  1.571   0.016 20.73 ? 161 LEU A HD11 1  
ATOM   2478   H HD12 . LEU A 1 163 ? -30.263 12.065  2.759   0.016 20.91 ? 161 LEU A HD12 1  
ATOM   2479   H HD13 . LEU A 1 163 ? -30.943 13.501  2.868   0.016 21.28 ? 161 LEU A HD13 1  
ATOM   2480   H HD21 . LEU A 1 163 ? -27.939 13.542  1.362   0.016 20.72 ? 161 LEU A HD21 1  
ATOM   2481   H HD22 . LEU A 1 163 ? -28.484 14.972  1.745   0.016 21.14 ? 161 LEU A HD22 1  
ATOM   2482   H HD23 . LEU A 1 163 ? -27.196 14.382  2.476   0.016 21.31 ? 161 LEU A HD23 1  
ATOM   2483   N N    . LEU A 1 164 ? -27.242 16.548  5.951   0.016 23.42 ? 162 LEU A N    1  
ATOM   2484   C CA   . LEU A 1 164 ? -27.386 17.818  6.641   0.016 24.36 ? 162 LEU A CA   1  
ATOM   2485   C C    . LEU A 1 164 ? -28.464 18.636  5.965   0.016 24.32 ? 162 LEU A C    1  
ATOM   2486   O O    . LEU A 1 164 ? -28.601 18.630  4.745   0.016 23.72 ? 162 LEU A O    1  
ATOM   2487   C CB   . LEU A 1 164 ? -26.064 18.562  6.635   0.016 24.88 ? 162 LEU A CB   1  
ATOM   2488   C CG   . LEU A 1 164 ? -25.106 18.130  7.727   0.016 25.47 ? 162 LEU A CG   1  
ATOM   2489   C CD1  . LEU A 1 164 ? -23.744 18.549  7.299   0.016 25.92 ? 162 LEU A CD1  1  
ATOM   2490   C CD2  . LEU A 1 164 ? -25.422 18.746  9.136   0.016 26.59 ? 162 LEU A CD2  1  
ATOM   2491   H H    . LEU A 1 164 ? -26.589 16.498  5.399   0.016 23.22 ? 162 LEU A H    1  
ATOM   2492   H HA   . LEU A 1 164 ? -27.652 17.662  7.559   0.016 24.81 ? 162 LEU A HA   1  
ATOM   2493   H HB2  . LEU A 1 164 ? -25.644 18.445  5.771   0.016 24.42 ? 162 LEU A HB2  1  
ATOM   2494   H HB3  . LEU A 1 164 ? -26.256 19.503  6.785   0.016 25.44 ? 162 LEU A HB3  1  
ATOM   2495   H HG   . LEU A 1 164 ? -25.118 17.165  7.806   0.016 25.00 ? 162 LEU A HG   1  
ATOM   2496   H HD11 . LEU A 1 164 ? -23.096 18.040  7.803   0.016 26.06 ? 162 LEU A HD11 1  
ATOM   2497   H HD12 . LEU A 1 164 ? -23.632 18.383  6.352   0.016 25.41 ? 162 LEU A HD12 1  
ATOM   2498   H HD13 . LEU A 1 164 ? -23.636 19.498  7.481   0.016 26.68 ? 162 LEU A HD13 1  
ATOM   2499   H HD21 . LEU A 1 164 ? -26.304 19.149  9.125   0.016 26.75 ? 162 LEU A HD21 1  
ATOM   2500   H HD22 . LEU A 1 164 ? -25.398 18.031  9.790   0.016 26.50 ? 162 LEU A HD22 1  
ATOM   2501   H HD23 . LEU A 1 164 ? -24.754 19.413  9.354   0.016 27.32 ? 162 LEU A HD23 1  
ATOM   2502   N N    . LEU A 1 165 ? -29.229 19.364  6.773   0.016 25.13 ? 163 LEU A N    1  
ATOM   2503   C CA   . LEU A 1 165 ? -30.384 20.105  6.291   0.016 25.23 ? 163 LEU A CA   1  
ATOM   2504   C C    . LEU A 1 165 ? -30.149 21.604  6.347   0.016 26.03 ? 163 LEU A C    1  
ATOM   2505   O O    . LEU A 1 165 ? -29.432 22.114  7.196   0.016 26.81 ? 163 LEU A O    1  
ATOM   2506   C CB   . LEU A 1 165 ? -31.611 19.825  7.120   0.016 25.68 ? 163 LEU A CB   1  
ATOM   2507   C CG   . LEU A 1 165 ? -32.022 18.358  7.090   0.016 25.04 ? 163 LEU A CG   1  
ATOM   2508   C CD1  . LEU A 1 165 ? -33.276 18.232  7.893   0.016 25.72 ? 163 LEU A CD1  1  
ATOM   2509   C CD2  . LEU A 1 165 ? -32.193 17.888  5.642   0.016 24.09 ? 163 LEU A CD2  1  
ATOM   2510   H H    . LEU A 1 165 ? -29.100 19.423  7.618   0.016 25.70 ? 163 LEU A H    1  
ATOM   2511   H HA   . LEU A 1 165 ? -30.575 19.881  5.371   0.016 24.64 ? 163 LEU A HA   1  
ATOM   2512   H HB2  . LEU A 1 165 ? -31.427 20.058  8.041   0.016 26.28 ? 163 LEU A HB2  1  
ATOM   2513   H HB3  . LEU A 1 165 ? -32.343 20.353  6.770   0.016 25.99 ? 163 LEU A HB3  1  
ATOM   2514   H HG   . LEU A 1 165 ? -31.328 17.825  7.508   0.016 24.95 ? 163 LEU A HG   1  
ATOM   2515   H HD11 . LEU A 1 165 ? -33.701 17.378  7.714   0.016 25.40 ? 163 LEU A HD11 1  
ATOM   2516   H HD12 . LEU A 1 165 ? -33.046 18.292  8.833   0.016 26.38 ? 163 LEU A HD12 1  
ATOM   2517   H HD13 . LEU A 1 165 ? -33.878 18.951  7.652   0.016 25.94 ? 163 LEU A HD13 1  
ATOM   2518   H HD21 . LEU A 1 165 ? -32.678 17.050  5.633   0.016 23.87 ? 163 LEU A HD21 1  
ATOM   2519   H HD22 . LEU A 1 165 ? -32.687 18.560  5.148   0.016 24.24 ? 163 LEU A HD22 1  
ATOM   2520   H HD23 . LEU A 1 165 ? -31.317 17.766  5.245   0.016 23.70 ? 163 LEU A HD23 1  
ATOM   2521   N N    . GLU A 1 166 ? -30.810 22.307  5.472   0.016 26.02 ? 164 GLU A N    1  
ATOM   2522   C CA   . GLU A 1 166 ? -30.790 23.738  5.678   0.016 26.99 ? 164 GLU A CA   1  
ATOM   2523   C C    . GLU A 1 166 ? -31.400 24.105  7.016   0.016 28.00 ? 164 GLU A C    1  
ATOM   2524   O O    . GLU A 1 166 ? -32.441 23.572  7.421   0.016 28.01 ? 164 GLU A O    1  
ATOM   2525   C CB   . GLU A 1 166 ? -31.508 24.450  4.599   0.016 26.94 ? 164 GLU A CB   1  
ATOM   2526   C CG   . GLU A 1 166 ? -31.184 25.999  4.816   0.016 27.75 ? 164 GLU A CG   1  
ATOM   2527   C CD   . GLU A 1 166 ? -29.613 26.566  4.771   0.016 28.38 ? 164 GLU A CD   1  
ATOM   2528   O OE1  . GLU A 1 166 ? -28.985 26.938  5.792   0.016 29.13 ? 164 GLU A OE1  1  
ATOM   2529   O OE2  . GLU A 1 166 ? -29.036 26.733  3.692   0.016 28.42 ? 164 GLU A OE2  1  
ATOM   2530   H H    . GLU A 1 166 ? -31.237 22.026  4.786   0.016 25.59 ? 164 GLU A H    1  
ATOM   2531   H HA   . GLU A 1 166 ? -29.871 24.039  5.676   0.016 27.17 ? 164 GLU A HA   1  
ATOM   2532   H HB2  . GLU A 1 166 ? -31.230 24.165  3.718   0.016 26.29 ? 164 GLU A HB2  1  
ATOM   2533   H HB3  . GLU A 1 166 ? -32.452 24.316  4.721   0.016 27.26 ? 164 GLU A HB3  1  
ATOM   2534   H HG2  . GLU A 1 166 ? -31.696 26.369  4.099   0.016 27.51 ? 164 GLU A HG2  1  
ATOM   2535   H HG3  . GLU A 1 166 ? -31.576 26.265  5.656   0.016 28.36 ? 164 GLU A HG3  1  
ATOM   2536   N N    . GLY A 1 167 ? -30.769 25.067  7.683   0.016 29.03 ? 165 GLY A N    1  
ATOM   2537   C CA   . GLY A 1 167 ? -31.137 25.418  9.035   0.016 30.23 ? 165 GLY A CA   1  
ATOM   2538   C C    . GLY A 1 167 ? -30.310 24.780  10.130  0.016 30.57 ? 165 GLY A C    1  
ATOM   2539   O O    . GLY A 1 167 ? -30.428 25.193  11.278  0.016 31.85 ? 165 GLY A O    1  
ATOM   2540   H H    . GLY A 1 167 ? -30.121 25.529  7.364   0.016 29.14 ? 165 GLY A H    1  
ATOM   2541   H HA2  . GLY A 1 167 ? -31.061 26.379  9.133   0.016 30.99 ? 165 GLY A HA2  1  
ATOM   2542   H HA3  . GLY A 1 167 ? -32.066 25.174  9.187   0.016 30.28 ? 165 GLY A HA3  1  
ATOM   2543   N N    . GLY A 1 168 ? -29.523 23.752  9.846   0.016 29.61 ? 166 GLY A N    1  
ATOM   2544   C CA   . GLY A 1 168 ? -28.653 23.184  10.859  0.016 30.09 ? 166 GLY A CA   1  
ATOM   2545   C C    . GLY A 1 168 ? -28.998 21.784  11.298  0.016 29.66 ? 166 GLY A C    1  
ATOM   2546   O O    . GLY A 1 168 ? -28.139 21.127  11.898  0.016 30.00 ? 166 GLY A O    1  
ATOM   2547   H H    . GLY A 1 168 ? -29.483 23.349  9.083   0.016 28.76 ? 166 GLY A H    1  
ATOM   2548   H HA2  . GLY A 1 168 ? -27.741 23.182  10.530  0.016 29.81 ? 166 GLY A HA2  1  
ATOM   2549   H HA3  . GLY A 1 168 ? -28.673 23.739  11.652  0.016 31.17 ? 166 GLY A HA3  1  
ATOM   2550   N N    . GLY A 1 169 ? -30.216 21.309  11.046  0.016 29.11 ? 167 GLY A N    1  
ATOM   2551   C CA   . GLY A 1 169 ? -30.601 19.964  11.429  0.016 28.77 ? 167 GLY A CA   1  
ATOM   2552   C C    . GLY A 1 169 ? -29.929 18.867  10.600  0.016 27.46 ? 167 GLY A C    1  
ATOM   2553   O O    . GLY A 1 169 ? -29.136 19.111  9.686   0.016 26.84 ? 167 GLY A O    1  
ATOM   2554   H H    . GLY A 1 169 ? -30.839 21.750  10.653  0.016 29.01 ? 167 GLY A H    1  
ATOM   2555   H HA2  . GLY A 1 169 ? -30.378 19.824  12.363  0.016 29.56 ? 167 GLY A HA2  1  
ATOM   2556   H HA3  . GLY A 1 169 ? -31.561 19.866  11.333  0.016 28.75 ? 167 GLY A HA3  1  
ATOM   2557   N N    . HIS A 1 170 ? -30.282 17.632  10.944  0.016 27.18 ? 168 HIS A N    1  
ATOM   2558   C CA   . HIS A 1 170 ? -29.791 16.450  10.257  0.016 26.07 ? 168 HIS A CA   1  
ATOM   2559   C C    . HIS A 1 170 ? -30.948 15.493  9.984   0.016 25.63 ? 168 HIS A C    1  
ATOM   2560   O O    . HIS A 1 170 ? -31.974 15.508  10.663  0.016 26.33 ? 168 HIS A O    1  
ATOM   2561   C CB   . HIS A 1 170 ? -28.717 15.725  11.073  0.016 26.38 ? 168 HIS A CB   1  
ATOM   2562   C CG   . HIS A 1 170 ? -29.029 15.640  12.533  0.016 27.72 ? 168 HIS A CG   1  
ATOM   2563   N ND1  . HIS A 1 170 ? -29.426 14.469  13.140  0.016 27.97 ? 168 HIS A ND1  1  
ATOM   2564   C CD2  . HIS A 1 170 ? -29.022 16.585  13.503  0.016 29.04 ? 168 HIS A CD2  1  
ATOM   2565   C CE1  . HIS A 1 170 ? -29.632 14.691  14.425  0.016 29.43 ? 168 HIS A CE1  1  
ATOM   2566   N NE2  . HIS A 1 170 ? -29.402 15.972  14.671  0.016 30.11 ? 168 HIS A NE2  1  
ATOM   2567   H H    . HIS A 1 170 ? -30.815 17.451  11.590  0.016 27.72 ? 168 HIS A H    1  
ATOM   2568   H HA   . HIS A 1 170 ? -29.409 16.707  9.406   0.016 25.50 ? 168 HIS A HA   1  
ATOM   2569   H HB2  . HIS A 1 170 ? -28.644 14.816  10.743  0.016 25.78 ? 168 HIS A HB2  1  
ATOM   2570   H HB3  . HIS A 1 170 ? -27.872 16.182  10.959  0.016 26.43 ? 168 HIS A HB3  1  
ATOM   2571   H HD1  . HIS A 1 170 ? -29.515 13.710  12.746  0.016 27.37 ? 168 HIS A HD1  1  
ATOM   2572   H HD2  . HIS A 1 170 ? -28.801 17.479  13.395  0.016 29.27 ? 168 HIS A HD2  1  
ATOM   2573   H HE1  . HIS A 1 170 ? -29.904 14.060  15.042  0.016 29.98 ? 168 HIS A HE1  1  
ATOM   2574   H HE2  . HIS A 1 170 ? -29.471 16.353  15.439  0.016 31.14 ? 168 HIS A HE2  1  
ATOM   2575   N N    . TYR A 1 171 ? -30.756 14.655  8.967   0.016 24.60 ? 169 TYR A N    1  
ATOM   2576   C CA   . TYR A 1 171 ? -31.825 13.805  8.444   0.016 24.16 ? 169 TYR A CA   1  
ATOM   2577   C C    . TYR A 1 171 ? -31.229 12.436  8.173   0.016 23.53 ? 169 TYR A C    1  
ATOM   2578   O O    . TYR A 1 171 ? -30.413 12.291  7.272   0.016 22.82 ? 169 TYR A O    1  
ATOM   2579   C CB   . TYR A 1 171 ? -32.415 14.390  7.166   0.016 23.63 ? 169 TYR A CB   1  
ATOM   2580   C CG   . TYR A 1 171 ? -33.511 13.584  6.463   0.016 23.28 ? 169 TYR A CG   1  
ATOM   2581   C CD1  . TYR A 1 171 ? -34.689 13.252  7.083   0.016 23.90 ? 169 TYR A CD1  1  
ATOM   2582   C CD2  . TYR A 1 171 ? -33.363 13.246  5.143   0.016 22.53 ? 169 TYR A CD2  1  
ATOM   2583   C CE1  . TYR A 1 171 ? -35.664 12.551  6.395   0.016 23.75 ? 169 TYR A CE1  1  
ATOM   2584   C CE2  . TYR A 1 171 ? -34.327 12.546  4.461   0.016 22.40 ? 169 TYR A CE2  1  
ATOM   2585   C CZ   . TYR A 1 171 ? -35.454 12.205  5.082   0.016 23.00 ? 169 TYR A CZ   1  
ATOM   2586   O OH   . TYR A 1 171 ? -36.377 11.537  4.331   0.016 23.01 ? 169 TYR A OH   1  
ATOM   2587   H H    . TYR A 1 171 ? -30.006 14.551  8.564   0.016 24.23 ? 169 TYR A H    1  
ATOM   2588   H HA   . TYR A 1 171 ? -32.500 13.758  9.106   0.016 24.74 ? 169 TYR A HA   1  
ATOM   2589   H HB2  . TYR A 1 171 ? -32.788 15.261  7.379   0.016 24.10 ? 169 TYR A HB2  1  
ATOM   2590   H HB3  . TYR A 1 171 ? -31.698 14.491  6.526   0.016 23.17 ? 169 TYR A HB3  1  
ATOM   2591   H HD1  . TYR A 1 171 ? -34.822 13.482  7.973   0.016 24.53 ? 169 TYR A HD1  1  
ATOM   2592   H HD2  . TYR A 1 171 ? -32.577 13.473  4.705   0.016 22.21 ? 169 TYR A HD2  1  
ATOM   2593   H HE1  . TYR A 1 171 ? -36.455 12.315  6.819   0.016 24.28 ? 169 TYR A HE1  1  
ATOM   2594   H HE2  . TYR A 1 171 ? -34.196 12.318  3.570   0.016 22.01 ? 169 TYR A HE2  1  
ATOM   2595   H HH   . TYR A 1 171 ? -36.123 11.509  3.533   0.016 22.63 ? 169 TYR A HH   1  
ATOM   2596   N N    . ARG A 1 172 ? -31.703 11.423  8.897   0.016 23.91 ? 170 ARG A N    1  
ATOM   2597   C CA   . ARG A 1 172 ? -30.993 10.165  9.057   0.016 23.65 ? 170 ARG A CA   1  
ATOM   2598   C C    . ARG A 1 172 ? -31.528 9.063   8.148   0.016 23.00 ? 170 ARG A C    1  
ATOM   2599   O O    . ARG A 1 172 ? -32.697 9.056   7.764   0.016 23.06 ? 170 ARG A O    1  
ATOM   2600   C CB   . ARG A 1 172 ? -31.102 9.736   10.516  0.016 24.73 ? 170 ARG A CB   1  
ATOM   2601   C CG   . ARG A 1 172 ? -30.151 10.513  11.402  0.016 25.37 ? 170 ARG A CG   1  
ATOM   2602   C CD   . ARG A 1 172 ? -28.830 9.905   11.197  0.016 24.82 ? 170 ARG A CD   1  
ATOM   2603   N NE   . ARG A 1 172 ? -27.629 10.634  11.583  0.016 24.89 ? 170 ARG A NE   1  
ATOM   2604   C CZ   . ARG A 1 172 ? -26.708 10.152  12.415  0.016 25.66 ? 170 ARG A CZ   1  
ATOM   2605   N NH1  . ARG A 1 172 ? -26.887 8.971   13.021  0.016 26.40 ? 170 ARG A NH1  1  
ATOM   2606   N NH2  . ARG A 1 172 ? -25.616 10.898  12.655  0.016 25.84 ? 170 ARG A NH2  1  
ATOM   2607   H H    . ARG A 1 172 ? -32.454 11.431  9.288   0.016 24.38 ? 170 ARG A H    1  
ATOM   2608   H HA   . ARG A 1 172 ? -30.067 10.313  8.827   0.016 23.36 ? 170 ARG A HA   1  
ATOM   2609   H HB2  . ARG A 1 172 ? -32.005 9.898   10.827  0.016 25.25 ? 170 ARG A HB2  1  
ATOM   2610   H HB3  . ARG A 1 172 ? -30.883 8.795   10.591  0.016 24.63 ? 170 ARG A HB3  1  
ATOM   2611   H HG2  . ARG A 1 172 ? -30.121 11.443  11.140  0.016 25.29 ? 170 ARG A HG2  1  
ATOM   2612   H HG3  . ARG A 1 172 ? -30.395 10.405  12.335  0.016 26.25 ? 170 ARG A HG3  1  
ATOM   2613   H HD2  . ARG A 1 172 ? -28.877 9.121   11.752  0.016 25.22 ? 170 ARG A HD2  1  
ATOM   2614   H HD3  . ARG A 1 172 ? -28.726 9.640   10.270  0.016 24.03 ? 170 ARG A HD3  1  
ATOM   2615   H HE   . ARG A 1 172 ? -27.426 11.356  11.152  0.016 24.26 ? 170 ARG A HE   1  
ATOM   2616   H HH11 . ARG A 1 172 ? -27.578 8.493   12.861  0.016 26.39 ? 170 ARG A HH11 1  
ATOM   2617   H HH12 . ARG A 1 172 ? -26.290 8.675   13.568  0.016 26.98 ? 170 ARG A HH12 1  
ATOM   2618   H HH21 . ARG A 1 172 ? -25.528 11.660  12.271  0.016 25.44 ? 170 ARG A HH21 1  
ATOM   2619   H HH22 . ARG A 1 172 ? -25.019 10.628  13.209  0.016 26.42 ? 170 ARG A HH22 1  
ATOM   2620   N N    . CYS A 1 173 ? -30.630 8.158   7.778   0.016 22.47 ? 171 CYS A N    1  
ATOM   2621   C CA   . CYS A 1 173 ? -30.965 7.097   6.840   0.016 21.95 ? 171 CYS A CA   1  
ATOM   2622   C C    . CYS A 1 173 ? -30.137 5.872   7.180   0.016 21.95 ? 171 CYS A C    1  
ATOM   2623   O O    . CYS A 1 173 ? -28.923 5.984   7.343   0.016 21.82 ? 171 CYS A O    1  
ATOM   2624   C CB   . CYS A 1 173 ? -30.694 7.564   5.402   0.016 21.20 ? 171 CYS A CB   1  
ATOM   2625   S SG   . CYS A 1 173 ? -31.139 6.340   4.086   0.016 20.87 ? 171 CYS A SG   1  
ATOM   2626   H H    . CYS A 1 173 ? -29.817 8.138   8.058   0.016 22.47 ? 171 CYS A H    1  
ATOM   2627   H HA   . CYS A 1 173 ? -31.907 6.866   6.929   0.016 22.25 ? 171 CYS A HA   1  
ATOM   2628   H HB2  . CYS A 1 173 ? -31.189 8.372   5.238   0.016 21.28 ? 171 CYS A HB2  1  
ATOM   2629   H HB3  . CYS A 1 173 ? -29.744 7.753   5.321   0.016 20.97 ? 171 CYS A HB3  1  
ATOM   2630   H HG   . CYS A 1 173 ? -30.624 5.317   4.436   0.016 20.86 ? 171 CYS A HG   1  
ATOM   2631   N N    . ASP A 1 174 ? -30.786 4.702   7.249   0.016 22.18 ? 172 ASP A N    1  
ATOM   2632   C CA   . ASP A 1 174 ? -30.067 3.436   7.425   0.016 22.23 ? 172 ASP A CA   1  
ATOM   2633   C C    . ASP A 1 174 ? -29.845 2.805   6.051   0.016 21.52 ? 172 ASP A C    1  
ATOM   2634   O O    . ASP A 1 174 ? -30.811 2.536   5.336   0.016 21.47 ? 172 ASP A O    1  
ATOM   2635   C CB   . ASP A 1 174 ? -30.861 2.462   8.312   0.016 23.10 ? 172 ASP A CB   1  
ATOM   2636   C CG   . ASP A 1 174 ? -30.855 2.845   9.778   0.016 24.10 ? 172 ASP A CG   1  
ATOM   2637   O OD1  . ASP A 1 174 ? -29.775 3.147   10.332  0.016 24.24 ? 172 ASP A OD1  1  
ATOM   2638   O OD2  . ASP A 1 174 ? -31.941 2.846   10.388  0.016 24.94 ? 172 ASP A OD2  1  
ATOM   2639   H H    . ASP A 1 174 ? -31.636 4.618   7.192   0.016 22.38 ? 172 ASP A H    1  
ATOM   2640   H HA   . ASP A 1 174 ? -29.207 3.607   7.834   0.016 22.30 ? 172 ASP A HA   1  
ATOM   2641   H HB2  . ASP A 1 174 ? -31.777 2.436   8.002   0.016 23.14 ? 172 ASP A HB2  1  
ATOM   2642   H HB3  . ASP A 1 174 ? -30.455 1.580   8.248   0.016 23.14 ? 172 ASP A HB3  1  
ATOM   2643   N N    . PHE A 1 175 ? -28.584 2.535   5.696   0.016 21.14 ? 173 PHE A N    1  
ATOM   2644   C CA   . PHE A 1 175 ? -28.229 1.923   4.422   0.016 20.64 ? 173 PHE A CA   1  
ATOM   2645   C C    . PHE A 1 175 ? -27.867 0.471   4.686   0.016 20.91 ? 173 PHE A C    1  
ATOM   2646   O O    . PHE A 1 175 ? -27.145 0.191   5.640   0.016 21.28 ? 173 PHE A O    1  
ATOM   2647   C CB   . PHE A 1 175 ? -27.009 2.591   3.787   0.016 20.19 ? 173 PHE A CB   1  
ATOM   2648   C CG   . PHE A 1 175 ? -27.299 3.817   2.925   0.016 19.86 ? 173 PHE A CG   1  
ATOM   2649   C CD1  . PHE A 1 175 ? -28.229 4.763   3.271   0.016 20.00 ? 173 PHE A CD1  1  
ATOM   2650   C CD2  . PHE A 1 175 ? -26.566 4.029   1.766   0.016 19.56 ? 173 PHE A CD2  1  
ATOM   2651   C CE1  . PHE A 1 175 ? -28.460 5.880   2.445   0.016 19.81 ? 173 PHE A CE1  1  
ATOM   2652   C CE2  . PHE A 1 175 ? -26.813 5.124   0.952   0.016 19.42 ? 173 PHE A CE2  1  
ATOM   2653   C CZ   . PHE A 1 175 ? -27.755 6.042   1.307   0.016 19.53 ? 173 PHE A CZ   1  
ATOM   2654   H H    . PHE A 1 175 ? -27.904 2.697   6.193   0.016 21.27 ? 173 PHE A H    1  
ATOM   2655   H HA   . PHE A 1 175 ? -28.975 1.958   3.802   0.016 20.56 ? 173 PHE A HA   1  
ATOM   2656   H HB2  . PHE A 1 175 ? -26.401 2.849   4.494   0.016 20.37 ? 173 PHE A HB2  1  
ATOM   2657   H HB3  . PHE A 1 175 ? -26.577 1.937   3.220   0.016 20.05 ? 173 PHE A HB3  1  
ATOM   2658   H HD1  . PHE A 1 175 ? -28.725 4.648   4.049   0.016 20.31 ? 173 PHE A HD1  1  
ATOM   2659   H HD2  . PHE A 1 175 ? -25.931 3.399   1.511   0.016 19.55 ? 173 PHE A HD2  1  
ATOM   2660   H HE1  . PHE A 1 175 ? -29.093 6.508   2.679   0.016 19.96 ? 173 PHE A HE1  1  
ATOM   2661   H HE2  . PHE A 1 175 ? -26.325 5.247   0.174   0.016 19.34 ? 173 PHE A HE2  1  
ATOM   2662   H HZ   . PHE A 1 175 ? -27.901 6.785   0.769   0.016 19.50 ? 173 PHE A HZ   1  
ATOM   2663   N N    . LYS A 1 176 ? -28.391 -0.442  3.877   0.016 20.88 ? 174 LYS A N    1  
ATOM   2664   C CA   . LYS A 1 176 ? -27.964 -1.830  3.940   0.016 21.15 ? 174 LYS A CA   1  
ATOM   2665   C C    . LYS A 1 176 ? -27.756 -2.323  2.523   0.016 20.85 ? 174 LYS A C    1  
ATOM   2666   O O    . LYS A 1 176 ? -28.683 -2.275  1.708   0.016 20.82 ? 174 LYS A O    1  
ATOM   2667   C CB   . LYS A 1 176 ? -28.976 -2.716  4.684   0.016 21.89 ? 174 LYS A CB   1  
ATOM   2668   C CG   . LYS A 1 176 ? -28.791 -2.681  6.189   0.016 22.53 ? 174 LYS A CG   1  
ATOM   2669   C CD   . LYS A 1 176 ? -30.094 -2.564  6.921   0.016 23.16 ? 174 LYS A CD   1  
ATOM   2670   C CE   . LYS A 1 176 ? -29.879 -2.080  8.374   0.016 23.87 ? 174 LYS A CE   1  
ATOM   2671   N NZ   . LYS A 1 176 ? -29.870 -3.244  9.267   0.016 24.79 ? 174 LYS A NZ   1  
ATOM   2672   H H    . LYS A 1 176 ? -28.994 -0.293  3.287   0.016 20.78 ? 174 LYS A H    1  
ATOM   2673   H HA   . LYS A 1 176 ? -27.125 -1.869  4.408   0.016 21.18 ? 174 LYS A HA   1  
ATOM   2674   H HB2  . LYS A 1 176 ? -29.875 -2.422  4.476   0.016 21.95 ? 174 LYS A HB2  1  
ATOM   2675   H HB3  . LYS A 1 176 ? -28.860 -3.633  4.396   0.016 22.05 ? 174 LYS A HB3  1  
ATOM   2676   H HG2  . LYS A 1 176 ? -28.360 -3.499  6.479   0.016 22.88 ? 174 LYS A HG2  1  
ATOM   2677   H HG3  . LYS A 1 176 ? -28.233 -1.921  6.417   0.016 22.32 ? 174 LYS A HG3  1  
ATOM   2678   H HD2  . LYS A 1 176 ? -30.657 -1.927  6.462   0.016 22.84 ? 174 LYS A HD2  1  
ATOM   2679   H HD3  . LYS A 1 176 ? -30.519 -3.434  6.946   0.016 23.58 ? 174 LYS A HD3  1  
ATOM   2680   H HE2  . LYS A 1 176 ? -29.032 -1.620  8.458   0.016 23.56 ? 174 LYS A HE2  1  
ATOM   2681   H HE3  . LYS A 1 176 ? -30.607 -1.502  8.650   0.016 24.17 ? 174 LYS A HE3  1  
ATOM   2682   H HZ1  . LYS A 1 176 ? -29.235 -3.816  9.016   0.016 24.61 ? 174 LYS A HZ1  1  
ATOM   2683   H HZ2  . LYS A 1 176 ? -29.715 -2.980  10.104  0.016 25.08 ? 174 LYS A HZ2  1  
ATOM   2684   H HZ3  . LYS A 1 176 ? -30.659 -3.653  9.232   0.016 25.36 ? 174 LYS A HZ3  1  
ATOM   2685   N N    . THR A 1 177 ? -26.553 -2.834  2.246   0.016 20.81 ? 175 THR A N    1  
ATOM   2686   C CA   . THR A 1 177 ? -26.210 -3.304  0.918   0.016 20.73 ? 175 THR A CA   1  
ATOM   2687   C C    . THR A 1 177 ? -25.693 -4.729  0.991   0.016 21.18 ? 175 THR A C    1  
ATOM   2688   O O    . THR A 1 177 ? -24.957 -5.087  1.915   0.016 21.40 ? 175 THR A O    1  
ATOM   2689   C CB   . THR A 1 177 ? -25.165 -2.380  0.272   0.016 20.37 ? 175 THR A CB   1  
ATOM   2690   O OG1  . THR A 1 177 ? -25.688 -1.026  0.263   0.016 20.04 ? 175 THR A OG1  1  
ATOM   2691   C CG2  . THR A 1 177 ? -24.871 -2.830  -1.162  0.016 20.43 ? 175 THR A CG2  1  
ATOM   2692   H H    . THR A 1 177 ? -25.921 -2.923  2.822   0.016 20.92 ? 175 THR A H    1  
ATOM   2693   H HA   . THR A 1 177 ? -27.003 -3.302  0.363   0.016 20.75 ? 175 THR A HA   1  
ATOM   2694   H HB   . THR A 1 177 ? -24.347 -2.423  0.789   0.016 20.48 ? 175 THR A HB   1  
ATOM   2695   H HG1  . THR A 1 177 ? -25.194 -0.533  0.730   0.016 20.03 ? 175 THR A HG1  1  
ATOM   2696   H HG21 . THR A 1 177 ? -25.403 -3.607  -1.390  0.016 20.69 ? 175 THR A HG21 1  
ATOM   2697   H HG22 . THR A 1 177 ? -25.097 -2.112  -1.770  0.016 20.25 ? 175 THR A HG22 1  
ATOM   2698   H HG23 . THR A 1 177 ? -23.934 -3.049  -1.267  0.016 20.51 ? 175 THR A HG23 1  
ATOM   2699   N N    . THR A 1 178 ? -26.104 -5.540  0.024   0.016 21.45 ? 176 THR A N    1  
ATOM   2700   C CA   . THR A 1 178 ? -25.521 -6.851  -0.189  0.016 21.87 ? 176 THR A CA   1  
ATOM   2701   C C    . THR A 1 178 ? -24.898 -6.853  -1.589  0.016 21.82 ? 176 THR A C    1  
ATOM   2702   O O    . THR A 1 178 ? -25.503 -6.366  -2.551  0.016 21.75 ? 176 THR A O    1  
ATOM   2703   C CB   . THR A 1 178 ? -26.609 -7.934  0.039   0.016 22.58 ? 176 THR A CB   1  
ATOM   2704   O OG1  . THR A 1 178 ? -26.176 -9.229  -0.461  0.016 23.02 ? 176 THR A OG1  1  
ATOM   2705   C CG2  . THR A 1 178 ? -27.842 -7.579  -0.594  0.016 22.69 ? 176 THR A CG2  1  
ATOM   2706   H H    . THR A 1 178 ? -26.737 -5.361  -0.525  0.016 21.48 ? 176 THR A H    1  
ATOM   2707   H HA   . THR A 1 178 ? -24.816 -7.001  0.458   0.016 21.88 ? 176 THR A HA   1  
ATOM   2708   H HB   . THR A 1 178 ? -26.800 -7.994  0.988   0.016 22.82 ? 176 THR A HB   1  
ATOM   2709   H HG1  . THR A 1 178 ? -26.219 -9.239  -1.298  0.016 23.02 ? 176 THR A HG1  1  
ATOM   2710   H HG21 . THR A 1 178 ? -28.399 -8.371  -0.713  0.016 23.24 ? 176 THR A HG21 1  
ATOM   2711   H HG22 . THR A 1 178 ? -28.304 -6.924  -0.049  0.016 22.49 ? 176 THR A HG22 1  
ATOM   2712   H HG23 . THR A 1 178 ? -27.668 -7.186  -1.465  0.016 22.54 ? 176 THR A HG23 1  
ATOM   2713   N N    . TYR A 1 179 ? -23.646 -7.325  -1.675  0.016 22.00 ? 177 TYR A N    1  
ATOM   2714   C CA   . TYR A 1 179 ? -22.876 -7.360  -2.914  0.016 22.15 ? 177 TYR A CA   1  
ATOM   2715   C C    . TYR A 1 179 ? -22.726 -8.800  -3.391  0.016 22.88 ? 177 TYR A C    1  
ATOM   2716   O O    . TYR A 1 179 ? -22.973 -9.750  -2.623  0.016 23.21 ? 177 TYR A O    1  
ATOM   2717   C CB   . TYR A 1 179 ? -21.480 -6.704  -2.725  0.016 21.96 ? 177 TYR A CB   1  
ATOM   2718   C CG   . TYR A 1 179 ? -21.469 -5.241  -2.269  0.016 21.38 ? 177 TYR A CG   1  
ATOM   2719   C CD1  . TYR A 1 179 ? -21.510 -4.183  -3.181  0.016 21.20 ? 177 TYR A CD1  1  
ATOM   2720   C CD2  . TYR A 1 179 ? -21.300 -4.930  -0.937  0.016 21.19 ? 177 TYR A CD2  1  
ATOM   2721   C CE1  . TYR A 1 179 ? -21.478 -2.893  -2.775  0.016 20.79 ? 177 TYR A CE1  1  
ATOM   2722   C CE2  . TYR A 1 179 ? -21.243 -3.627  -0.532  0.016 20.81 ? 177 TYR A CE2  1  
ATOM   2723   C CZ   . TYR A 1 179 ? -21.329 -2.620  -1.457  0.016 20.58 ? 177 TYR A CZ   1  
ATOM   2724   O OH   . TYR A 1 179 ? -21.278 -1.346  -1.022  0.016 20.29 ? 177 TYR A OH   1  
ATOM   2725   H H    . TYR A 1 179 ? -23.210 -7.631  -1.003  0.016 22.12 ? 177 TYR A H    1  
ATOM   2726   H HA   . TYR A 1 179 ? -23.347 -6.869  -3.606  0.016 22.06 ? 177 TYR A HA   1  
ATOM   2727   H HB2  . TYR A 1 179 ? -20.991 -7.204  -2.059  0.016 22.13 ? 177 TYR A HB2  1  
ATOM   2728   H HB3  . TYR A 1 179 ? -21.010 -6.738  -3.574  0.016 22.17 ? 177 TYR A HB3  1  
ATOM   2729   H HD1  . TYR A 1 179 ? -21.616 -4.359  -4.088  0.016 21.45 ? 177 TYR A HD1  1  
ATOM   2730   H HD2  . TYR A 1 179 ? -21.243 -5.610  -0.307  0.016 21.41 ? 177 TYR A HD2  1  
ATOM   2731   H HE1  . TYR A 1 179 ? -21.529 -2.201  -3.392  0.016 20.74 ? 177 TYR A HE1  1  
ATOM   2732   H HE2  . TYR A 1 179 ? -21.150 -3.429  0.372   0.016 20.79 ? 177 TYR A HE2  1  
ATOM   2733   H HH   . TYR A 1 179 ? -20.540 -1.001  -1.232  0.016 20.22 ? 177 TYR A HH   1  
ATOM   2734   N N    . LYS A 1 180 ? -22.387 -8.959  -4.683  0.016 23.28 ? 178 LYS A N    1  
ATOM   2735   C CA   . LYS A 1 180 ? -22.135 -10.268 -5.310  0.016 24.15 ? 178 LYS A CA   1  
ATOM   2736   C C    . LYS A 1 180 ? -21.122 -10.128 -6.435  0.016 24.61 ? 178 LYS A C    1  
ATOM   2737   O O    . LYS A 1 180 ? -21.402 -9.469  -7.438  0.016 24.75 ? 178 LYS A O    1  
ATOM   2738   C CB   . LYS A 1 180 ? -23.392 -10.892 -5.905  0.016 24.57 ? 178 LYS A CB   1  
ATOM   2739   C CG   . LYS A 1 180 ? -23.124 -11.639 -7.341  0.016 25.57 ? 178 LYS A CG   1  
ATOM   2740   C CD   . LYS A 1 180 ? -23.538 -10.662 -8.493  0.016 25.64 ? 178 LYS A CD   1  
ATOM   2741   C CE   . LYS A 1 180 ? -22.680 -10.609 -9.752  0.016 26.41 ? 178 LYS A CE   1  
ATOM   2742   N NZ   . LYS A 1 180 ? -22.983 -9.424  -10.661 0.016 27.03 ? 178 LYS A NZ   1  
ATOM   2743   H H    . LYS A 1 180 ? -22.304 -8.308  -5.232  0.016 23.15 ? 178 LYS A H    1  
ATOM   2744   H HA   . LYS A 1 180 ? -21.778 -10.878 -4.647  0.016 24.31 ? 178 LYS A HA   1  
ATOM   2745   H HB2  . LYS A 1 180 ? -23.750 -11.530 -5.274  0.016 24.70 ? 178 LYS A HB2  1  
ATOM   2746   H HB3  . LYS A 1 180 ? -24.041 -10.192 -6.053  0.016 24.20 ? 178 LYS A HB3  1  
ATOM   2747   H HG2  . LYS A 1 180 ? -22.211 -11.928 -7.465  0.016 25.89 ? 178 LYS A HG2  1  
ATOM   2748   H HG3  . LYS A 1 180 ? -23.700 -12.421 -7.393  0.016 26.02 ? 178 LYS A HG3  1  
ATOM   2749   H HD2  . LYS A 1 180 ? -24.450 -10.846 -8.760  0.016 25.97 ? 178 LYS A HD2  1  
ATOM   2750   H HD3  . LYS A 1 180 ? -23.477 -9.783  -8.106  0.016 24.96 ? 178 LYS A HD3  1  
ATOM   2751   H HE2  . LYS A 1 180 ? -21.750 -10.552 -9.494  0.016 26.04 ? 178 LYS A HE2  1  
ATOM   2752   H HE3  . LYS A 1 180 ? -22.820 -11.407 -10.274 0.016 26.99 ? 178 LYS A HE3  1  
ATOM   2753   H HZ1  . LYS A 1 180 ? -22.591 -9.531  -11.453 0.016 27.18 ? 178 LYS A HZ1  1  
ATOM   2754   H HZ2  . LYS A 1 180 ? -23.858 -9.347  -10.791 0.016 27.77 ? 178 LYS A HZ2  1  
ATOM   2755   H HZ3  . LYS A 1 180 ? -22.687 -8.676  -10.300 0.016 26.63 ? 178 LYS A HZ3  1  
ATOM   2756   N N    . ALA A 1 181 ? -19.992 -10.819 -6.322  0.016 24.95 ? 179 ALA A N    1  
ATOM   2757   C CA   . ALA A 1 181 ? -19.122 -11.028 -7.476  0.016 25.74 ? 179 ALA A CA   1  
ATOM   2758   C C    . ALA A 1 181 ? -19.705 -12.081 -8.427  0.016 26.70 ? 179 ALA A C    1  
ATOM   2759   O O    . ALA A 1 181 ? -20.347 -13.053 -8.012  0.016 26.98 ? 179 ALA A O    1  
ATOM   2760   C CB   . ALA A 1 181 ? -17.737 -11.457 -7.011  0.016 26.05 ? 179 ALA A CB   1  
ATOM   2761   H H    . ALA A 1 181 ? -19.704 -11.159 -5.591  0.016 24.82 ? 179 ALA A H    1  
ATOM   2762   H HA   . ALA A 1 181 ? -19.031 -10.198 -7.968  0.016 25.61 ? 179 ALA A HA   1  
ATOM   2763   H HB1  . ALA A 1 181 ? -17.117 -11.404 -7.756  0.016 26.59 ? 179 ALA A HB1  1  
ATOM   2764   H HB2  . ALA A 1 181 ? -17.451 -10.869 -6.295  0.016 25.54 ? 179 ALA A HB2  1  
ATOM   2765   H HB3  . ALA A 1 181 ? -17.790 -12.368 -6.685  0.016 26.35 ? 179 ALA A HB3  1  
ATOM   2766   N N    . LYS A 1 182 ? -19.437 -11.910 -9.716  0.016 27.39 ? 180 LYS A N    1  
ATOM   2767   C CA   . LYS A 1 182 ? -19.865 -12.904 -10.697 0.016 28.57 ? 180 LYS A CA   1  
ATOM   2768   C C    . LYS A 1 182 ? -19.154 -14.255 -10.479 0.016 29.37 ? 180 LYS A C    1  
ATOM   2769   O O    . LYS A 1 182 ? -19.757 -15.305 -10.717 0.016 30.14 ? 180 LYS A O    1  
ATOM   2770   C CB   . LYS A 1 182 ? -19.641 -12.356 -12.115 0.016 29.31 ? 180 LYS A CB   1  
ATOM   2771   C CG   . LYS A 1 182 ? -19.675 -13.420 -13.285 0.016 30.93 ? 180 LYS A CG   1  
ATOM   2772   C CD   . LYS A 1 182 ? -20.876 -13.259 -14.253 0.016 31.55 ? 180 LYS A CD   1  
ATOM   2773   C CE   . LYS A 1 182 ? -22.189 -12.896 -13.518 0.016 30.57 ? 180 LYS A CE   1  
ATOM   2774   N NZ   . LYS A 1 182 ? -22.603 -11.428 -13.593 0.016 29.54 ? 180 LYS A NZ   1  
ATOM   2775   H H    . LYS A 1 182 ? -19.009 -11.244 -10.044 0.016 27.31 ? 180 LYS A H    1  
ATOM   2776   H HA   . LYS A 1 182 ? -20.818 -13.045 -10.591 0.016 28.48 ? 180 LYS A HA   1  
ATOM   2777   H HB2  . LYS A 1 182 ? -20.307 -11.672 -12.288 0.016 28.96 ? 180 LYS A HB2  1  
ATOM   2778   H HB3  . LYS A 1 182 ? -18.767 -11.937 -12.133 0.016 29.22 ? 180 LYS A HB3  1  
ATOM   2779   H HG2  . LYS A 1 182 ? -18.871 -13.312 -13.814 0.016 31.43 ? 180 LYS A HG2  1  
ATOM   2780   H HG3  . LYS A 1 182 ? -19.707 -14.320 -12.928 0.016 31.24 ? 180 LYS A HG3  1  
ATOM   2781   H HD2  . LYS A 1 182 ? -20.680 -12.558 -14.888 0.016 31.68 ? 180 LYS A HD2  1  
ATOM   2782   H HD3  . LYS A 1 182 ? -21.009 -14.110 -14.728 0.016 32.56 ? 180 LYS A HD3  1  
ATOM   2783   H HE2  . LYS A 1 182 ? -22.900 -13.429 -13.904 0.016 31.29 ? 180 LYS A HE2  1  
ATOM   2784   H HE3  . LYS A 1 182 ? -22.090 -13.118 -12.577 0.016 30.07 ? 180 LYS A HE3  1  
ATOM   2785   H HZ1  . LYS A 1 182 ? -22.109 -10.943 -13.032 0.016 28.69 ? 180 LYS A HZ1  1  
ATOM   2786   H HZ2  . LYS A 1 182 ? -22.492 -11.115 -14.419 0.016 29.79 ? 180 LYS A HZ2  1  
ATOM   2787   H HZ3  . LYS A 1 182 ? -23.462 -11.347 -13.368 0.016 29.59 ? 180 LYS A HZ3  1  
ATOM   2788   N N    . LYS A 1 183 ? -17.896 -14.245 -10.023 0.016 29.33 ? 181 LYS A N    1  
ATOM   2789   C CA   . LYS A 1 183 ? -17.078 -15.439 -9.757  0.016 30.11 ? 181 LYS A CA   1  
ATOM   2790   C C    . LYS A 1 183 ? -16.705 -15.439 -8.269  0.016 29.32 ? 181 LYS A C    1  
ATOM   2791   O O    . LYS A 1 183 ? -16.868 -14.435 -7.568  0.016 28.27 ? 181 LYS A O    1  
ATOM   2792   C CB   . LYS A 1 183 ? -15.799 -15.463 -10.692 0.016 31.14 ? 181 LYS A CB   1  
ATOM   2793   C CG   . LYS A 1 183 ? -14.856 -16.744 -10.599 0.016 32.29 ? 181 LYS A CG   1  
ATOM   2794   C CD   . LYS A 1 183 ? -13.567 -16.843 -11.582 0.016 33.53 ? 181 LYS A CD   1  
ATOM   2795   C CE   . LYS A 1 183 ? -12.788 -15.489 -11.949 0.016 33.20 ? 181 LYS A CE   1  
ATOM   2796   N NZ   . LYS A 1 183 ? -11.906 -14.812 -10.892 0.016 32.27 ? 181 LYS A NZ   1  
ATOM   2797   H H    . LYS A 1 183 ? -17.473 -13.518 -9.846  0.016 28.89 ? 181 LYS A H    1  
ATOM   2798   H HA   . LYS A 1 183 ? -17.602 -16.235 -9.939  0.016 30.66 ? 181 LYS A HA   1  
ATOM   2799   H HB2  . LYS A 1 183 ? -16.098 -15.404 -11.613 0.016 31.67 ? 181 LYS A HB2  1  
ATOM   2800   H HB3  . LYS A 1 183 ? -15.256 -14.684 -10.485 0.016 30.69 ? 181 LYS A HB3  1  
ATOM   2801   H HG2  . LYS A 1 183 ? -14.541 -16.815 -9.688  0.016 31.87 ? 181 LYS A HG2  1  
ATOM   2802   H HG3  . LYS A 1 183 ? -15.410 -17.511 -10.810 0.016 32.82 ? 181 LYS A HG3  1  
ATOM   2803   H HD2  . LYS A 1 183 ? -12.921 -17.435 -11.165 0.016 33.92 ? 181 LYS A HD2  1  
ATOM   2804   H HD3  . LYS A 1 183 ? -13.852 -17.247 -12.418 0.016 34.37 ? 181 LYS A HD3  1  
ATOM   2805   H HE2  . LYS A 1 183 ? -12.219 -15.665 -12.714 0.016 34.20 ? 181 LYS A HE2  1  
ATOM   2806   H HE3  . LYS A 1 183 ? -13.457 -14.832 -12.202 0.016 32.78 ? 181 LYS A HE3  1  
ATOM   2807   H HZ1  . LYS A 1 183 ? -12.382 -14.216 -10.438 0.016 31.40 ? 181 LYS A HZ1  1  
ATOM   2808   H HZ2  . LYS A 1 183 ? -11.593 -15.419 -10.322 0.016 32.30 ? 181 LYS A HZ2  1  
ATOM   2809   H HZ3  . LYS A 1 183 ? -11.219 -14.401 -11.277 0.016 32.67 ? 181 LYS A HZ3  1  
ATOM   2810   N N    . ASP A 1 184 ? -16.196 -16.568 -7.776  0.016 29.98 ? 182 ASP A N    1  
ATOM   2811   C CA   . ASP A 1 184 ? -15.728 -16.647 -6.394  0.016 29.53 ? 182 ASP A CA   1  
ATOM   2812   C C    . ASP A 1 184 ? -14.368 -15.967 -6.251  0.016 29.47 ? 182 ASP A C    1  
ATOM   2813   O O    . ASP A 1 184 ? -13.497 -16.119 -7.113  0.016 30.30 ? 182 ASP A O    1  
ATOM   2814   C CB   . ASP A 1 184 ? -15.638 -18.102 -5.932  0.016 30.42 ? 182 ASP A CB   1  
ATOM   2815   C CG   . ASP A 1 184 ? -16.985 -18.772 -5.884  0.016 30.63 ? 182 ASP A CG   1  
ATOM   2816   O OD1  . ASP A 1 184 ? -17.387 -19.346 -6.911  0.016 31.50 ? 182 ASP A OD1  1  
ATOM   2817   O OD2  . ASP A 1 184 ? -17.639 -18.729 -4.831  0.016 30.08 ? 182 ASP A OD2  1  
ATOM   2818   H H    . ASP A 1 184 ? -16.106 -17.294 -8.225  0.016 30.76 ? 182 ASP A H    1  
ATOM   2819   H HA   . ASP A 1 184 ? -16.363 -16.198 -5.817  0.016 28.81 ? 182 ASP A HA   1  
ATOM   2820   H HB2  . ASP A 1 184 ? -15.076 -18.592 -6.549  0.016 31.20 ? 182 ASP A HB2  1  
ATOM   2821   H HB3  . ASP A 1 184 ? -15.261 -18.135 -5.040  0.016 30.22 ? 182 ASP A HB3  1  
ATOM   2822   N N    . VAL A 1 185 ? -14.216 -15.191 -5.170  0.016 28.64 ? 183 VAL A N    1  
ATOM   2823   C CA   . VAL A 1 185 ? -13.008 -14.439 -4.846  0.016 28.63 ? 183 VAL A CA   1  
ATOM   2824   C C    . VAL A 1 185 ? -12.741 -14.601 -3.353  0.016 28.50 ? 183 VAL A C    1  
ATOM   2825   O O    . VAL A 1 185 ? -13.596 -15.061 -2.602  0.016 28.32 ? 183 VAL A O    1  
ATOM   2826   C CB   . VAL A 1 185 ? -13.120 -12.945 -5.197  0.016 27.86 ? 183 VAL A CB   1  
ATOM   2827   C CG1  . VAL A 1 185 ? -13.350 -12.770 -6.685  0.016 28.21 ? 183 VAL A CG1  1  
ATOM   2828   C CG2  . VAL A 1 185 ? -14.216 -12.314 -4.364  0.016 26.78 ? 183 VAL A CG2  1  
ATOM   2829   H H    . VAL A 1 185 ? -14.822 -15.105 -4.570  0.016 28.16 ? 183 VAL A H    1  
ATOM   2830   H HA   . VAL A 1 185 ? -12.256 -14.809 -5.334  0.016 29.37 ? 183 VAL A HA   1  
ATOM   2831   H HB   . VAL A 1 185 ? -12.289 -12.505 -4.967  0.016 28.01 ? 183 VAL A HB   1  
ATOM   2832   H HG11 . VAL A 1 185 ? -13.287 -11.827 -6.906  0.016 27.84 ? 183 VAL A HG11 1  
ATOM   2833   H HG12 . VAL A 1 185 ? -12.672 -13.274 -7.164  0.016 29.02 ? 183 VAL A HG12 1  
ATOM   2834   H HG13 . VAL A 1 185 ? -14.231 -13.108 -6.913  0.016 28.12 ? 183 VAL A HG13 1  
ATOM   2835   H HG21 . VAL A 1 185 ? -14.366 -11.409 -4.678  0.016 26.36 ? 183 VAL A HG21 1  
ATOM   2836   H HG22 . VAL A 1 185 ? -15.026 -12.840 -4.470  0.016 26.75 ? 183 VAL A HG22 1  
ATOM   2837   H HG23 . VAL A 1 185 ? -13.954 -12.305 -3.429  0.016 26.69 ? 183 VAL A HG23 1  
ATOM   2838   N N    . ARG A 1 186 ? -11.545 -14.213 -2.920  0.016 28.79 ? 184 ARG A N    1  
ATOM   2839   C CA   . ARG A 1 186 ? -11.222 -14.284 -1.501  0.016 28.91 ? 184 ARG A CA   1  
ATOM   2840   C C    . ARG A 1 186 ? -12.111 -13.330 -0.728  0.016 27.91 ? 184 ARG A C    1  
ATOM   2841   O O    . ARG A 1 186 ? -12.228 -12.167 -1.108  0.016 27.29 ? 184 ARG A O    1  
ATOM   2842   C CB   . ARG A 1 186 ? -9.766  -13.920 -1.251  0.016 29.64 ? 184 ARG A CB   1  
ATOM   2843   C CG   . ARG A 1 186 ? -9.366  -13.781 0.195   0.016 29.91 ? 184 ARG A CG   1  
ATOM   2844   C CD   . ARG A 1 186 ? -9.428  -15.094 0.910   0.016 30.59 ? 184 ARG A CD   1  
ATOM   2845   N NE   . ARG A 1 186 ? -8.376  -15.988 0.458   0.016 31.80 ? 184 ARG A NE   1  
ATOM   2846   C CZ   . ARG A 1 186 ? -8.451  -17.315 0.526   0.016 32.52 ? 184 ARG A CZ   1  
ATOM   2847   N NH1  . ARG A 1 186 ? -9.549  -17.904 0.987   0.016 32.17 ? 184 ARG A NH1  1  
ATOM   2848   N NH2  . ARG A 1 186 ? -7.426  -18.047 0.113   0.016 33.70 ? 184 ARG A NH2  1  
ATOM   2849   H H    . ARG A 1 186 ? -10.918 -13.905 -3.416  0.016 29.00 ? 184 ARG A H    1  
ATOM   2850   H HA   . ARG A 1 186 ? -11.373 -15.184 -1.175  0.016 29.33 ? 184 ARG A HA   1  
ATOM   2851   H HB2  . ARG A 1 186 ? -9.206  -14.616 -1.624  0.016 30.39 ? 184 ARG A HB2  1  
ATOM   2852   H HB3  . ARG A 1 186 ? -9.585  -13.069 -1.674  0.016 29.34 ? 184 ARG A HB3  1  
ATOM   2853   H HG2  . ARG A 1 186 ? -8.452  -13.459 0.240   0.016 30.45 ? 184 ARG A HG2  1  
ATOM   2854   H HG3  . ARG A 1 186 ? -9.965  -13.163 0.641   0.016 29.25 ? 184 ARG A HG3  1  
ATOM   2855   H HD2  . ARG A 1 186 ? -9.299  -14.949 1.858   0.016 30.74 ? 184 ARG A HD2  1  
ATOM   2856   H HD3  . ARG A 1 186 ? -10.291 -15.501 0.746   0.016 30.23 ? 184 ARG A HD3  1  
ATOM   2857   H HE   . ARG A 1 186 ? -7.729  -15.648 0.009   0.016 32.10 ? 184 ARG A HE   1  
ATOM   2858   H HH11 . ARG A 1 186 ? -10.214 -17.439 1.261   0.016 31.48 ? 184 ARG A HH11 1  
ATOM   2859   H HH12 . ARG A 1 186 ? -9.590  -18.760 1.020   0.016 32.71 ? 184 ARG A HH12 1  
ATOM   2860   H HH21 . ARG A 1 186 ? -6.723  -17.662 -0.191  0.016 34.02 ? 184 ARG A HH21 1  
ATOM   2861   H HH22 . ARG A 1 186 ? -7.471  -18.903 0.139   0.016 34.22 ? 184 ARG A HH22 1  
ATOM   2862   N N    . LEU A 1 187 ? -12.692 -13.810 0.397   0.016 27.90 ? 185 LEU A N    1  
ATOM   2863   C CA   . LEU A 1 187 ? -13.531 -12.937 1.230   0.016 27.09 ? 185 LEU A CA   1  
ATOM   2864   C C    . LEU A 1 187 ? -12.659 -12.221 2.256   0.016 27.35 ? 185 LEU A C    1  
ATOM   2865   O O    . LEU A 1 187 ? -11.644 -12.774 2.697   0.016 28.29 ? 185 LEU A O    1  
ATOM   2866   C CB   . LEU A 1 187 ? -14.630 -13.708 1.972   0.016 27.08 ? 185 LEU A CB   1  
ATOM   2867   C CG   . LEU A 1 187 ? -15.793 -14.510 1.352   0.016 27.14 ? 185 LEU A CG   1  
ATOM   2868   C CD1  . LEU A 1 187 ? -15.830 -14.468 -0.162  0.016 26.69 ? 185 LEU A CD1  1  
ATOM   2869   C CD2  . LEU A 1 187 ? -15.854 -15.941 1.813   0.016 28.17 ? 185 LEU A CD2  1  
ATOM   2870   H H    . LEU A 1 187 ? -12.613 -14.612 0.689   0.016 28.39 ? 185 LEU A H    1  
ATOM   2871   H HA   . LEU A 1 187 ? -13.956 -12.276 0.663   0.016 26.50 ? 185 LEU A HA   1  
ATOM   2872   H HB2  . LEU A 1 187 ? -14.174 -14.323 2.564   0.016 27.69 ? 185 LEU A HB2  1  
ATOM   2873   H HB3  . LEU A 1 187 ? -15.070 -13.047 2.525   0.016 26.57 ? 185 LEU A HB3  1  
ATOM   2874   H HG   . LEU A 1 187 ? -16.614 -14.097 1.665   0.016 26.91 ? 185 LEU A HG   1  
ATOM   2875   H HD11 . LEU A 1 187 ? -16.302 -15.252 -0.485  0.016 27.00 ? 185 LEU A HD11 1  
ATOM   2876   H HD12 . LEU A 1 187 ? -16.301 -13.662 -0.432  0.016 26.05 ? 185 LEU A HD12 1  
ATOM   2877   H HD13 . LEU A 1 187 ? -14.927 -14.457 -0.509  0.016 26.84 ? 185 LEU A HD13 1  
ATOM   2878   H HD21 . LEU A 1 187 ? -16.748 -16.272 1.645   0.016 28.28 ? 185 LEU A HD21 1  
ATOM   2879   H HD22 . LEU A 1 187 ? -15.206 -16.467 1.318   0.016 28.44 ? 185 LEU A HD22 1  
ATOM   2880   H HD23 . LEU A 1 187 ? -15.657 -15.986 2.763   0.016 28.58 ? 185 LEU A HD23 1  
ATOM   2881   N N    . PRO A 1 188 ? -12.996 -11.002 2.670   0.016 26.70 ? 186 PRO A N    1  
ATOM   2882   C CA   . PRO A 1 188 ? -12.197 -10.309 3.693   0.016 27.14 ? 186 PRO A CA   1  
ATOM   2883   C C    . PRO A 1 188 ? -12.662 -10.578 5.121   0.016 27.48 ? 186 PRO A C    1  
ATOM   2884   O O    . PRO A 1 188 ? -13.754 -11.091 5.361   0.016 27.19 ? 186 PRO A O    1  
ATOM   2885   C CB   . PRO A 1 188 ? -12.407 -8.829  3.342   0.016 26.37 ? 186 PRO A CB   1  
ATOM   2886   C CG   . PRO A 1 188 ? -13.821 -8.800  2.730   0.016 25.41 ? 186 PRO A CG   1  
ATOM   2887   C CD   . PRO A 1 188 ? -14.223 -10.253 2.399   0.016 25.67 ? 186 PRO A CD   1  
ATOM   2888   H HA   . PRO A 1 188 ? -11.258 -10.532 3.587   0.016 27.78 ? 186 PRO A HA   1  
ATOM   2889   H HB2  . PRO A 1 188 ? -12.369 -8.310  4.157   0.016 26.47 ? 186 PRO A HB2  1  
ATOM   2890   H HB3  . PRO A 1 188 ? -11.739 -8.521  2.710   0.016 26.52 ? 186 PRO A HB3  1  
ATOM   2891   H HG2  . PRO A 1 188 ? -14.435 -8.416  3.374   0.016 25.17 ? 186 PRO A HG2  1  
ATOM   2892   H HG3  . PRO A 1 188 ? -13.808 -8.271  1.920   0.016 25.02 ? 186 PRO A HG3  1  
ATOM   2893   H HD2  . PRO A 1 188 ? -14.931 -10.549 2.987   0.016 25.48 ? 186 PRO A HD2  1  
ATOM   2894   H HD3  . PRO A 1 188 ? -14.477 -10.337 1.468   0.016 25.52 ? 186 PRO A HD3  1  
ATOM   2895   N N    . ASP A 1 189 ? -11.800 -10.214 6.056   0.016 28.34 ? 187 ASP A N    1  
ATOM   2896   C CA   . ASP A 1 189 ? -12.157 -9.940  7.428   0.016 28.85 ? 187 ASP A CA   1  
ATOM   2897   C C    . ASP A 1 189 ? -13.306 -8.949  7.438   0.016 27.95 ? 187 ASP A C    1  
ATOM   2898   O O    . ASP A 1 189 ? -13.493 -8.238  6.459   0.016 27.11 ? 187 ASP A O    1  
ATOM   2899   C CB   . ASP A 1 189 ? -10.959 -9.289  8.164   0.016 30.11 ? 187 ASP A CB   1  
ATOM   2900   C CG   . ASP A 1 189 ? -11.040 -9.478  9.663   0.016 30.98 ? 187 ASP A CG   1  
ATOM   2901   O OD1  . ASP A 1 189 ? -10.766 -10.594 10.192  0.016 31.81 ? 187 ASP A OD1  1  
ATOM   2902   O OD2  . ASP A 1 189 ? -11.364 -8.441  10.334  0.016 31.06 ? 187 ASP A OD2  1  
ATOM   2903   H H    . ASP A 1 189 ? -10.961 -10.085 5.902   0.016 28.76 ? 187 ASP A H    1  
ATOM   2904   H HA   . ASP A 1 189 ? -12.379 -10.757 7.907   0.016 29.10 ? 187 ASP A HA   1  
ATOM   2905   H HB2  . ASP A 1 189 ? -10.206 -9.582  7.900   0.016 30.70 ? 187 ASP A HB2  1  
ATOM   2906   H HB3  . ASP A 1 189 ? -11.048 -8.347  8.034   0.016 29.94 ? 187 ASP A HB3  1  
ATOM   2907   N N    . ALA A 1 190 ? -14.059 -8.921  8.547   0.016 28.26 ? 188 ALA A N    1  
ATOM   2908   C CA   . ALA A 1 190 ? -14.815 -7.717  8.852   0.016 27.61 ? 188 ALA A CA   1  
ATOM   2909   C C    . ALA A 1 190 ? -13.878 -6.517  8.776   0.016 27.67 ? 188 ALA A C    1  
ATOM   2910   O O    . ALA A 1 190 ? -12.735 -6.589  9.208   0.016 28.66 ? 188 ALA A O    1  
ATOM   2911   C CB   . ALA A 1 190 ? -15.417 -7.783  10.272  0.016 28.32 ? 188 ALA A CB   1  
ATOM   2912   H H    . ALA A 1 190 ? -14.129 -9.567  9.112   0.016 28.90 ? 188 ALA A H    1  
ATOM   2913   H HA   . ALA A 1 190 ? -15.545 -7.578  8.227   0.016 26.79 ? 188 ALA A HA   1  
ATOM   2914   H HB1  . ALA A 1 190 ? -15.962 -8.582  10.327  0.016 28.39 ? 188 ALA A HB1  1  
ATOM   2915   H HB2  . ALA A 1 190 ? -14.687 -7.812  10.914  0.016 29.23 ? 188 ALA A HB2  1  
ATOM   2916   H HB3  . ALA A 1 190 ? -15.959 -6.991  10.414  0.016 27.92 ? 188 ALA A HB3  1  
ATOM   2917   N N    . HIS A 1 191 ? -14.360 -5.392  8.238   0.016 26.76 ? 189 HIS A N    1  
ATOM   2918   C CA   . HIS A 1 191 ? -13.493 -4.210  8.171   0.016 26.94 ? 189 HIS A CA   1  
ATOM   2919   C C    . HIS A 1 191 ? -14.354 -2.980  7.944   0.016 26.08 ? 189 HIS A C    1  
ATOM   2920   O O    . HIS A 1 191 ? -15.572 -3.061  7.996   0.016 25.46 ? 189 HIS A O    1  
ATOM   2921   C CB   . HIS A 1 191 ? -12.421 -4.358  7.095   0.016 26.97 ? 189 HIS A CB   1  
ATOM   2922   C CG   . HIS A 1 191 ? -12.939 -4.450  5.703   0.016 25.90 ? 189 HIS A CG   1  
ATOM   2923   N ND1  . HIS A 1 191 ? -13.349 -5.639  5.145   0.016 25.63 ? 189 HIS A ND1  1  
ATOM   2924   C CD2  . HIS A 1 191 ? -13.061 -3.515  4.731   0.016 25.23 ? 189 HIS A CD2  1  
ATOM   2925   C CE1  . HIS A 1 191 ? -13.720 -5.427  3.896   0.016 24.87 ? 189 HIS A CE1  1  
ATOM   2926   N NE2  . HIS A 1 191 ? -13.562 -4.145  3.619   0.016 24.60 ? 189 HIS A NE2  1  
ATOM   2927   H H    . HIS A 1 191 ? -15.153 -5.298  7.923   0.016 26.14 ? 189 HIS A H    1  
ATOM   2928   H HA   . HIS A 1 191 ? -13.043 -4.110  9.023   0.016 27.79 ? 189 HIS A HA   1  
ATOM   2929   H HB2  . HIS A 1 191 ? -11.834 -3.584  7.134   0.016 27.27 ? 189 HIS A HB2  1  
ATOM   2930   H HB3  . HIS A 1 191 ? -11.913 -5.166  7.268   0.016 27.55 ? 189 HIS A HB3  1  
ATOM   2931   H HD1  . HIS A 1 191 ? -13.358 -6.395  5.551   0.016 25.99 ? 189 HIS A HD1  1  
ATOM   2932   H HD2  . HIS A 1 191 ? -12.853 -2.614  4.812   0.016 25.28 ? 189 HIS A HD2  1  
ATOM   2933   H HE1  . HIS A 1 191 ? -14.045 -6.075  3.312   0.016 24.65 ? 189 HIS A HE1  1  
ATOM   2934   H HE2  . HIS A 1 191 ? -13.738 -3.773  2.869   0.016 24.20 ? 189 HIS A HE2  1  
ATOM   2935   N N    . GLU A 1 192 ? -13.703 -1.828  7.689   0.016 26.18 ? 190 GLU A N    1  
ATOM   2936   C CA   . GLU A 1 192 ? -14.358 -0.517  7.550   0.016 25.59 ? 190 GLU A CA   1  
ATOM   2937   C C    . GLU A 1 192 ? -14.128 0.113   6.197   0.016 24.88 ? 190 GLU A C    1  
ATOM   2938   O O    . GLU A 1 192 ? -13.207 -0.249  5.475   0.016 25.09 ? 190 GLU A O    1  
ATOM   2939   C CB   . GLU A 1 192 ? -13.807 0.486   8.549   0.016 26.54 ? 190 GLU A CB   1  
ATOM   2940   C CG   . GLU A 1 192 ? -14.132 0.113   9.885   0.016 27.40 ? 190 GLU A CG   1  
ATOM   2941   C CD   . GLU A 1 192 ? -15.579 0.210   10.052  0.016 26.73 ? 190 GLU A CD   1  
ATOM   2942   O OE1  . GLU A 1 192 ? -16.034 1.304   10.444  0.016 26.77 ? 190 GLU A OE1  1  
ATOM   2943   O OE2  . GLU A 1 192 ? -16.306 -0.769  9.750   0.016 26.19 ? 190 GLU A OE2  1  
ATOM   2944   H H    . GLU A 1 192 ? -12.852 -1.777  7.602   0.016 26.69 ? 190 GLU A H    1  
ATOM   2945   H HA   . GLU A 1 192 ? -15.312 -0.627  7.660   0.016 25.15 ? 190 GLU A HA   1  
ATOM   2946   H HB2  . GLU A 1 192 ? -12.842 0.521   8.468   0.016 27.08 ? 190 GLU A HB2  1  
ATOM   2947   H HB3  . GLU A 1 192 ? -14.184 1.357   8.375   0.016 26.15 ? 190 GLU A HB3  1  
ATOM   2948   H HG2  . GLU A 1 192 ? -13.852 -0.798  10.061  0.016 27.80 ? 190 GLU A HG2  1  
ATOM   2949   H HG3  . GLU A 1 192 ? -13.706 0.732   10.503  0.016 28.12 ? 190 GLU A HG3  1  
ATOM   2950   N N    . VAL A 1 193 ? -14.941 1.131   5.910   0.016 24.22 ? 191 VAL A N    1  
ATOM   2951   C CA   . VAL A 1 193 ? -14.805 1.956   4.712   0.016 23.80 ? 191 VAL A CA   1  
ATOM   2952   C C    . VAL A 1 193 ? -15.327 3.349   5.022   0.016 23.75 ? 191 VAL A C    1  
ATOM   2953   O O    . VAL A 1 193 ? -16.508 3.527   5.332   0.016 23.32 ? 191 VAL A O    1  
ATOM   2954   C CB   . VAL A 1 193 ? -15.546 1.377   3.501   0.016 22.91 ? 191 VAL A CB   1  
ATOM   2955   C CG1  . VAL A 1 193 ? -15.430 2.277   2.273   0.016 22.71 ? 191 VAL A CG1  1  
ATOM   2956   C CG2  . VAL A 1 193 ? -15.006 -0.048  3.191   0.016 23.11 ? 191 VAL A CG2  1  
ATOM   2957   H H    . VAL A 1 193 ? -15.602 1.359   6.406   0.016 24.07 ? 191 VAL A H    1  
ATOM   2958   H HA   . VAL A 1 193 ? -13.865 2.017   4.482   0.016 24.31 ? 191 VAL A HA   1  
ATOM   2959   H HB   . VAL A 1 193 ? -16.464 1.356   3.773   0.016 22.49 ? 191 VAL A HB   1  
ATOM   2960   H HG11 . VAL A 1 193 ? -15.608 3.198   2.501   0.016 22.76 ? 191 VAL A HG11 1  
ATOM   2961   H HG12 . VAL A 1 193 ? -14.534 2.195   1.912   0.016 23.17 ? 191 VAL A HG12 1  
ATOM   2962   H HG13 . VAL A 1 193 ? -16.080 1.981   1.616   0.016 22.20 ? 191 VAL A HG13 1  
ATOM   2963   H HG21 . VAL A 1 193 ? -15.476 -0.410  2.437   0.016 22.69 ? 191 VAL A HG21 1  
ATOM   2964   H HG22 . VAL A 1 193 ? -14.058 -0.001  2.987   0.016 23.65 ? 191 VAL A HG22 1  
ATOM   2965   H HG23 . VAL A 1 193 ? -15.152 -0.617  3.961   0.016 23.23 ? 191 VAL A HG23 1  
ATOM   2966   N N    . ASP A 1 194 ? -14.425 4.317   4.949   0.016 24.35 ? 192 ASP A N    1  
ATOM   2967   C CA   . ASP A 1 194 ? -14.759 5.738   4.984   0.016 24.36 ? 192 ASP A CA   1  
ATOM   2968   C C    . ASP A 1 194 ? -15.746 6.102   3.887   0.016 23.47 ? 192 ASP A C    1  
ATOM   2969   O O    . ASP A 1 194 ? -16.120 5.258   3.083   0.016 23.02 ? 192 ASP A O    1  
ATOM   2970   C CB   . ASP A 1 194 ? -13.532 6.568   4.759   0.016 25.44 ? 192 ASP A CB   1  
ATOM   2971   C CG   . ASP A 1 194 ? -13.072 6.483   3.352   0.016 25.47 ? 192 ASP A CG   1  
ATOM   2972   O OD1  . ASP A 1 194 ? -12.647 5.349   2.997   0.016 25.57 ? 192 ASP A OD1  1  
ATOM   2973   O OD2  . ASP A 1 194 ? -13.073 7.508   2.623   0.016 25.54 ? 192 ASP A OD2  1  
ATOM   2974   H H    . ASP A 1 194 ? -13.590 4.142   4.846   0.016 24.84 ? 192 ASP A H    1  
ATOM   2975   H HA   . ASP A 1 194 ? -15.147 5.907   5.855   0.016 24.40 ? 192 ASP A HA   1  
ATOM   2976   H HB2  . ASP A 1 194 ? -13.746 7.486   4.998   0.016 25.65 ? 192 ASP A HB2  1  
ATOM   2977   H HB3  . ASP A 1 194 ? -12.853 6.199   5.307   0.016 26.08 ? 192 ASP A HB3  1  
ATOM   2978   N N    . HIS A 1 195 ? -16.058 7.370   3.759   0.016 23.40 ? 193 HIS A N    1  
ATOM   2979   C CA   . HIS A 1 195 ? -16.956 7.769   2.681   0.016 22.69 ? 193 HIS A CA   1  
ATOM   2980   C C    . HIS A 1 195 ? -17.138 9.281   2.689   0.016 22.93 ? 193 HIS A C    1  
ATOM   2981   O O    . HIS A 1 195 ? -17.966 9.829   3.423   0.016 22.66 ? 193 HIS A O    1  
ATOM   2982   C CB   . HIS A 1 195 ? -18.332 7.024   2.762   0.016 21.86 ? 193 HIS A CB   1  
ATOM   2983   C CG   . HIS A 1 195 ? -18.328 5.645   2.154   0.016 21.52 ? 193 HIS A CG   1  
ATOM   2984   N ND1  . HIS A 1 195 ? -18.634 4.511   2.886   0.016 21.47 ? 193 HIS A ND1  1  
ATOM   2985   C CD2  . HIS A 1 195 ? -17.945 5.206   0.931   0.016 21.39 ? 193 HIS A CD2  1  
ATOM   2986   C CE1  . HIS A 1 195 ? -18.511 3.446   2.118   0.016 21.26 ? 193 HIS A CE1  1  
ATOM   2987   N NE2  . HIS A 1 195 ? -18.083 3.833   0.931   0.016 21.22 ? 193 HIS A NE2  1  
ATOM   2988   H H    . HIS A 1 195 ? -15.778 8.004   4.267   0.016 23.84 ? 193 HIS A H    1  
ATOM   2989   H HA   . HIS A 1 195 ? -16.542 7.528   1.840   0.016 22.69 ? 193 HIS A HA   1  
ATOM   2990   H HB2  . HIS A 1 195 ? -18.568 6.931   3.699   0.016 21.96 ? 193 HIS A HB2  1  
ATOM   2991   H HB3  . HIS A 1 195 ? -18.999 7.556   2.299   0.016 21.55 ? 193 HIS A HB3  1  
ATOM   2992   H HD1  . HIS A 1 195 ? -18.904 4.502   3.702   0.016 21.63 ? 193 HIS A HD1  1  
ATOM   2993   H HD2  . HIS A 1 195 ? -17.669 5.734   0.218   0.016 21.49 ? 193 HIS A HD2  1  
ATOM   2994   H HE1  . HIS A 1 195 ? -18.677 2.575   2.383   0.016 21.26 ? 193 HIS A HE1  1  
ATOM   2995   H HE2  . HIS A 1 195 ? -17.924 3.315   0.263   0.016 21.17 ? 193 HIS A HE2  1  
ATOM   2996   N N    . ARG A 1 196 ? -16.355 9.931   1.836   0.016 23.49 ? 194 ARG A N    1  
ATOM   2997   C CA   . ARG A 1 196 ? -16.442 11.367  1.580   0.016 23.70 ? 194 ARG A CA   1  
ATOM   2998   C C    . ARG A 1 196 ? -17.123 11.562  0.233   0.016 23.01 ? 194 ARG A C    1  
ATOM   2999   O O    . ARG A 1 196 ? -16.507 11.313  -0.806  0.016 22.98 ? 194 ARG A O    1  
ATOM   3000   C CB   . ARG A 1 196 ? -15.028 11.987  1.551   0.016 24.82 ? 194 ARG A CB   1  
ATOM   3001   C CG   . ARG A 1 196 ? -14.883 13.449  1.975   0.016 25.65 ? 194 ARG A CG   1  
ATOM   3002   C CD   . ARG A 1 196 ? -13.429 13.784  2.442   0.016 27.06 ? 194 ARG A CD   1  
ATOM   3003   N NE   . ARG A 1 196 ? -12.380 13.419  1.459   0.016 27.55 ? 194 ARG A NE   1  
ATOM   3004   C CZ   . ARG A 1 196 ? -11.226 14.075  1.319   0.016 28.92 ? 194 ARG A CZ   1  
ATOM   3005   N NH1  . ARG A 1 196 ? -10.946 15.112  2.117   0.016 29.91 ? 194 ARG A NH1  1  
ATOM   3006   N NH2  . ARG A 1 196 ? -10.349 13.710  0.386   0.016 29.47 ? 194 ARG A NH2  1  
ATOM   3007   H H    . ARG A 1 196 ? -15.740 9.545   1.375   0.016 23.83 ? 194 ARG A H    1  
ATOM   3008   H HA   . ARG A 1 196 ? -16.965 11.799  2.273   0.016 23.70 ? 194 ARG A HA   1  
ATOM   3009   H HB2  . ARG A 1 196 ? -14.454 11.457  2.123   0.016 25.19 ? 194 ARG A HB2  1  
ATOM   3010   H HB3  . ARG A 1 196 ? -14.706 11.928  0.640   0.016 24.81 ? 194 ARG A HB3  1  
ATOM   3011   H HG2  . ARG A 1 196 ? -15.100 14.024  1.226   0.016 25.59 ? 194 ARG A HG2  1  
ATOM   3012   H HG3  . ARG A 1 196 ? -15.488 13.634  2.710   0.016 25.49 ? 194 ARG A HG3  1  
ATOM   3013   H HD2  . ARG A 1 196 ? -13.381 14.741  2.592   0.016 27.61 ? 194 ARG A HD2  1  
ATOM   3014   H HD3  . ARG A 1 196 ? -13.246 13.321  3.274   0.016 27.27 ? 194 ARG A HD3  1  
ATOM   3015   H HE   . ARG A 1 196 ? -12.409 12.619  1.139   0.016 27.11 ? 194 ARG A HE   1  
ATOM   3016   H HH11 . ARG A 1 196 ? -11.506 15.363  2.718   0.016 29.67 ? 194 ARG A HH11 1  
ATOM   3017   H HH12 . ARG A 1 196 ? -10.197 15.532  2.029   0.016 30.89 ? 194 ARG A HH12 1  
ATOM   3018   H HH21 . ARG A 1 196 ? -10.516 13.039  -0.128  0.016 28.93 ? 194 ARG A HH21 1  
ATOM   3019   H HH22 . ARG A 1 196 ? -9.603  14.131  0.311   0.016 30.44 ? 194 ARG A HH22 1  
ATOM   3020   N N    . ILE A 1 197 ? -18.378 12.013  0.226   0.016 22.60 ? 195 ILE A N    1  
ATOM   3021   C CA   . ILE A 1 197 ? -19.082 12.235  -1.035  0.016 22.23 ? 195 ILE A CA   1  
ATOM   3022   C C    . ILE A 1 197 ? -19.600 13.670  -1.080  0.016 22.54 ? 195 ILE A C    1  
ATOM   3023   O O    . ILE A 1 197 ? -20.387 14.072  -0.223  0.016 22.45 ? 195 ILE A O    1  
ATOM   3024   C CB   . ILE A 1 197 ? -20.250 11.245  -1.200  0.016 21.40 ? 195 ILE A CB   1  
ATOM   3025   C CG1  . ILE A 1 197 ? -20.751 11.200  -2.633  0.016 21.28 ? 195 ILE A CG1  1  
ATOM   3026   C CG2  . ILE A 1 197 ? -21.391 11.614  -0.280  0.016 21.14 ? 195 ILE A CG2  1  
ATOM   3027   C CD1  . ILE A 1 197 ? -21.692 10.023  -2.832  0.016 20.67 ? 195 ILE A CD1  1  
ATOM   3028   H H    . ILE A 1 197 ? -18.837 12.189  0.928   0.016 22.61 ? 195 ILE A H    1  
ATOM   3029   H HA   . ILE A 1 197 ? -18.470 12.111  -1.775  0.016 22.48 ? 195 ILE A HA   1  
ATOM   3030   H HB   . ILE A 1 197 ? -19.937 10.353  -0.969  0.016 21.25 ? 195 ILE A HB   1  
ATOM   3031   H HG12 . ILE A 1 197 ? -21.227 12.021  -2.831  0.016 21.42 ? 195 ILE A HG12 1  
ATOM   3032   H HG13 . ILE A 1 197 ? -20.001 11.095  -3.238  0.016 21.61 ? 195 ILE A HG13 1  
ATOM   3033   H HG21 . ILE A 1 197 ? -21.037 11.884  0.584   0.016 21.42 ? 195 ILE A HG21 1  
ATOM   3034   H HG22 . ILE A 1 197 ? -21.900 12.345  -0.668  0.016 21.22 ? 195 ILE A HG22 1  
ATOM   3035   H HG23 . ILE A 1 197 ? -21.964 10.841  -0.174  0.016 20.73 ? 195 ILE A HG23 1  
ATOM   3036   H HD11 . ILE A 1 197 ? -22.514 10.200  -2.350  0.016 20.42 ? 195 ILE A HD11 1  
ATOM   3037   H HD12 . ILE A 1 197 ? -21.870 9.903   -3.777  0.016 20.73 ? 195 ILE A HD12 1  
ATOM   3038   H HD13 . ILE A 1 197 ? -21.273 9.223   -2.475  0.016 20.61 ? 195 ILE A HD13 1  
ATOM   3039   N N    . GLU A 1 198 ? -19.190 14.431  -2.090  0.016 22.99 ? 196 GLU A N    1  
ATOM   3040   C CA   . GLU A 1 198 ? -19.653 15.824  -2.195  0.016 23.43 ? 196 GLU A CA   1  
ATOM   3041   C C    . GLU A 1 198 ? -19.943 16.126  -3.661  0.016 23.59 ? 196 GLU A C    1  
ATOM   3042   O O    . GLU A 1 198 ? -19.290 15.606  -4.564  0.016 23.80 ? 196 GLU A O    1  
ATOM   3043   C CB   . GLU A 1 198 ? -18.654 16.829  -1.552  0.016 24.47 ? 196 GLU A CB   1  
ATOM   3044   C CG   . GLU A 1 198 ? -18.930 18.488  -1.660  0.016 24.99 ? 196 GLU A CG   1  
ATOM   3045   C CD   . GLU A 1 198 ? -20.399 19.110  -1.297  0.016 24.60 ? 196 GLU A CD   1  
ATOM   3046   O OE1  . GLU A 1 198 ? -20.898 19.164  -0.130  0.016 24.74 ? 196 GLU A OE1  1  
ATOM   3047   O OE2  . GLU A 1 198 ? -21.061 19.594  -2.242  0.016 24.36 ? 196 GLU A OE2  1  
ATOM   3048   H H    . GLU A 1 198 ? -18.668 14.175  -2.719  0.016 23.13 ? 196 GLU A H    1  
ATOM   3049   H HA   . GLU A 1 198 ? -20.492 15.921  -1.714  0.016 23.13 ? 196 GLU A HA   1  
ATOM   3050   H HB2  . GLU A 1 198 ? -18.592 16.615  -0.607  0.016 24.58 ? 196 GLU A HB2  1  
ATOM   3051   H HB3  . GLU A 1 198 ? -17.793 16.638  -1.965  0.016 24.92 ? 196 GLU A HB3  1  
ATOM   3052   H HG2  . GLU A 1 198 ? -18.339 18.930  -1.029  0.016 25.07 ? 196 GLU A HG2  1  
ATOM   3053   H HG3  . GLU A 1 198 ? -18.708 18.766  -2.562  0.016 25.72 ? 196 GLU A HG3  1  
ATOM   3054   N N    . ILE A 1 199 ? -21.001 16.888  -3.888  0.016 23.63 ? 197 ILE A N    1  
ATOM   3055   C CA   . ILE A 1 199 ? -21.273 17.461  -5.202  0.016 24.16 ? 197 ILE A CA   1  
ATOM   3056   C C    . ILE A 1 199 ? -20.369 18.674  -5.370  0.016 25.26 ? 197 ILE A C    1  
ATOM   3057   O O    . ILE A 1 199 ? -20.488 19.654  -4.625  0.016 25.57 ? 197 ILE A O    1  
ATOM   3058   C CB   . ILE A 1 199 ? -22.750 17.841  -5.354  0.016 23.85 ? 197 ILE A CB   1  
ATOM   3059   C CG1  . ILE A 1 199 ? -23.604 16.590  -5.319  0.016 22.97 ? 197 ILE A CG1  1  
ATOM   3060   C CG2  . ILE A 1 199 ? -22.940 18.572  -6.656  0.016 24.61 ? 197 ILE A CG2  1  
ATOM   3061   C CD1  . ILE A 1 199 ? -25.102 16.802  -5.360  0.016 22.75 ? 197 ILE A CD1  1  
ATOM   3062   H H    . ILE A 1 199 ? -21.587 17.077  -3.294  0.016 23.44 ? 197 ILE A H    1  
ATOM   3063   H HA   . ILE A 1 199 ? -21.053 16.819  -5.896  0.016 24.16 ? 197 ILE A HA   1  
ATOM   3064   H HB   . ILE A 1 199 ? -23.003 18.421  -4.619  0.016 23.88 ? 197 ILE A HB   1  
ATOM   3065   H HG12 . ILE A 1 199 ? -23.365 16.032  -6.076  0.016 23.01 ? 197 ILE A HG12 1  
ATOM   3066   H HG13 . ILE A 1 199 ? -23.410 16.113  -4.496  0.016 22.59 ? 197 ILE A HG13 1  
ATOM   3067   H HG21 . ILE A 1 199 ? -23.886 18.668  -6.844  0.016 24.47 ? 197 ILE A HG21 1  
ATOM   3068   H HG22 . ILE A 1 199 ? -22.535 19.450  -6.582  0.016 25.24 ? 197 ILE A HG22 1  
ATOM   3069   H HG23 . ILE A 1 199 ? -22.510 18.065  -7.363  0.016 24.72 ? 197 ILE A HG23 1  
ATOM   3070   H HD11 . ILE A 1 199 ? -25.539 15.941  -5.292  0.016 22.28 ? 197 ILE A HD11 1  
ATOM   3071   H HD12 . ILE A 1 199 ? -25.364 17.356  -4.611  0.016 22.76 ? 197 ILE A HD12 1  
ATOM   3072   H HD13 . ILE A 1 199 ? -25.341 17.227  -6.195  0.016 23.18 ? 197 ILE A HD13 1  
ATOM   3073   N N    . LEU A 1 200 ? -19.481 18.619  -6.357  0.016 26.00 ? 198 LEU A N    1  
ATOM   3074   C CA   . LEU A 1 200 ? -18.503 19.693  -6.550  0.016 27.27 ? 198 LEU A CA   1  
ATOM   3075   C C    . LEU A 1 200 ? -19.121 20.885  -7.271  0.016 27.95 ? 198 LEU A C    1  
ATOM   3076   O O    . LEU A 1 200 ? -18.666 22.022  -7.090  0.016 28.89 ? 198 LEU A O    1  
ATOM   3077   C CB   . LEU A 1 200 ? -17.313 19.179  -7.349  0.016 28.03 ? 198 LEU A CB   1  
ATOM   3078   C CG   . LEU A 1 200 ? -16.352 18.240  -6.601  0.016 27.76 ? 198 LEU A CG   1  
ATOM   3079   C CD1  . LEU A 1 200 ? -15.210 17.797  -7.521  0.016 28.71 ? 198 LEU A CD1  1  
ATOM   3080   C CD2  . LEU A 1 200 ? -15.834 18.973  -5.369  0.016 28.07 ? 198 LEU A CD2  1  
ATOM   3081   H H    . LEU A 1 200 ? -19.422 17.980  -6.928  0.016 25.89 ? 198 LEU A H    1  
ATOM   3082   H HA   . LEU A 1 200 ? -18.191 19.997  -5.686  0.016 27.36 ? 198 LEU A HA   1  
ATOM   3083   H HB2  . LEU A 1 200 ? -17.651 18.706  -8.124  0.016 27.89 ? 198 LEU A HB2  1  
ATOM   3084   H HB3  . LEU A 1 200 ? -16.787 19.937  -7.650  0.016 29.00 ? 198 LEU A HB3  1  
ATOM   3085   H HG   . LEU A 1 200 ? -16.849 17.465  -6.305  0.016 26.86 ? 198 LEU A HG   1  
ATOM   3086   H HD11 . LEU A 1 200 ? -14.765 18.586  -7.873  0.016 29.70 ? 198 LEU A HD11 1  
ATOM   3087   H HD12 . LEU A 1 200 ? -14.573 17.260  -7.022  0.016 28.65 ? 198 LEU A HD12 1  
ATOM   3088   H HD13 . LEU A 1 200 ? -15.580 17.278  -8.254  0.016 28.50 ? 198 LEU A HD13 1  
ATOM   3089   H HD21 . LEU A 1 200 ? -16.410 18.778  -4.612  0.016 27.29 ? 198 LEU A HD21 1  
ATOM   3090   H HD22 . LEU A 1 200 ? -14.924 18.682  -5.187  0.016 28.55 ? 198 LEU A HD22 1  
ATOM   3091   H HD23 . LEU A 1 200 ? -15.840 19.925  -5.555  0.016 28.69 ? 198 LEU A HD23 1  
ATOM   3092   N N    . SER A 1 201 ? -20.121 20.626  -8.114  0.016 27.64 ? 199 SER A N    1  
ATOM   3093   C CA   . SER A 1 201 ? -20.767 21.620  -8.960  0.016 28.41 ? 199 SER A CA   1  
ATOM   3094   C C    . SER A 1 201 ? -22.094 21.072  -9.477  0.016 27.76 ? 199 SER A C    1  
ATOM   3095   O O    . SER A 1 201 ? -22.336 19.853  -9.484  0.016 26.97 ? 199 SER A O    1  
ATOM   3096   C CB   . SER A 1 201 ? -19.883 22.004  -10.139 0.016 29.82 ? 199 SER A CB   1  
ATOM   3097   O OG   . SER A 1 201 ? -19.638 20.872  -10.963 0.016 29.71 ? 199 SER A OG   1  
ATOM   3098   H H    . SER A 1 201 ? -20.461 19.845  -8.213  0.016 27.04 ? 199 SER A H    1  
ATOM   3099   H HA   . SER A 1 201 ? -20.938 22.415  -8.436  0.016 28.59 ? 199 SER A HA   1  
ATOM   3100   H HB2  . SER A 1 201 ? -20.331 22.688  -10.663 0.016 30.42 ? 199 SER A HB2  1  
ATOM   3101   H HB3  . SER A 1 201 ? -19.038 22.340  -9.802  0.016 30.32 ? 199 SER A HB3  1  
ATOM   3102   H HG   . SER A 1 201 ? -18.927 20.498  -10.718 0.016 29.73 ? 199 SER A HG   1  
ATOM   3103   N N    . HIS A 1 202 ? -22.951 21.990  -9.919  0.016 28.26 ? 200 HIS A N    1  
ATOM   3104   C CA   . HIS A 1 202 ? -24.262 21.648  -10.454 0.016 27.93 ? 200 HIS A CA   1  
ATOM   3105   C C    . HIS A 1 202 ? -24.825 22.856  -11.194 0.016 29.04 ? 200 HIS A C    1  
ATOM   3106   O O    . HIS A 1 202 ? -24.482 24.002  -10.881 0.016 29.68 ? 200 HIS A O    1  
ATOM   3107   C CB   . HIS A 1 202 ? -25.234 21.185  -9.343  0.016 26.69 ? 200 HIS A CB   1  
ATOM   3108   C CG   . HIS A 1 202 ? -25.532 22.213  -8.300  0.016 26.69 ? 200 HIS A CG   1  
ATOM   3109   N ND1  . HIS A 1 202 ? -26.614 23.065  -8.389  0.016 27.09 ? 200 HIS A ND1  1  
ATOM   3110   C CD2  . HIS A 1 202 ? -24.914 22.509  -7.133  0.016 26.49 ? 200 HIS A CD2  1  
ATOM   3111   C CE1  . HIS A 1 202 ? -26.648 23.837  -7.316  0.016 27.10 ? 200 HIS A CE1  1  
ATOM   3112   N NE2  . HIS A 1 202 ? -25.637 23.512  -6.534  0.016 26.75 ? 200 HIS A NE2  1  
ATOM   3113   H H    . HIS A 1 202 ? -22.789 22.831  -9.920  0.016 28.87 ? 200 HIS A H    1  
ATOM   3114   H HA   . HIS A 1 202 ? -24.168 20.927  -11.093 0.016 27.96 ? 200 HIS A HA   1  
ATOM   3115   H HB2  . HIS A 1 202 ? -26.079 20.943  -9.748  0.016 26.59 ? 200 HIS A HB2  1  
ATOM   3116   H HB3  . HIS A 1 202 ? -24.857 20.419  -8.890  0.016 26.09 ? 200 HIS A HB3  1  
ATOM   3117   H HD1  . HIS A 1 202 ? -27.180 23.084  -9.035  0.016 27.37 ? 200 HIS A HD1  1  
ATOM   3118   H HD2  . HIS A 1 202 ? -24.158 22.097  -6.787  0.016 26.28 ? 200 HIS A HD2  1  
ATOM   3119   H HE1  . HIS A 1 202 ? -27.275 24.500  -7.142  0.016 27.38 ? 200 HIS A HE1  1  
ATOM   3120   H HE2  . HIS A 1 202 ? -25.445 23.886  -5.786  0.016 26.80 ? 200 HIS A HE2  1  
ATOM   3121   N N    . ASP A 1 203 ? -25.668 22.593  -12.195 0.016 29.43 ? 201 ASP A N    1  
ATOM   3122   C CA   . ASP A 1 203 ? -26.438 23.682  -12.798 0.016 30.49 ? 201 ASP A CA   1  
ATOM   3123   C C    . ASP A 1 203 ? -27.743 23.893  -12.025 0.016 29.82 ? 201 ASP A C    1  
ATOM   3124   O O    . ASP A 1 203 ? -27.944 23.359  -10.933 0.016 28.63 ? 201 ASP A O    1  
ATOM   3125   C CB   . ASP A 1 203 ? -26.665 23.437  -14.288 0.016 31.67 ? 201 ASP A CB   1  
ATOM   3126   C CG   . ASP A 1 203 ? -27.673 22.347  -14.574 0.016 31.20 ? 201 ASP A CG   1  
ATOM   3127   O OD1  . ASP A 1 203 ? -28.047 21.600  -13.646 0.016 29.87 ? 201 ASP A OD1  1  
ATOM   3128   O OD2  . ASP A 1 203 ? -28.071 22.233  -15.758 0.016 32.36 ? 201 ASP A OD2  1  
ATOM   3129   H H    . ASP A 1 203 ? -25.802 21.821  -12.541 0.016 29.20 ? 201 ASP A H    1  
ATOM   3130   H HA   . ASP A 1 203 ? -25.925 24.501  -12.719 0.016 31.05 ? 201 ASP A HA   1  
ATOM   3131   H HB2  . ASP A 1 203 ? -26.993 24.253  -14.693 0.016 32.54 ? 201 ASP A HB2  1  
ATOM   3132   H HB3  . ASP A 1 203 ? -25.824 23.184  -14.697 0.016 32.04 ? 201 ASP A HB3  1  
ATOM   3133   N N    . LYS A 1 204 ? -28.624 24.750  -12.551 0.016 30.75 ? 202 LYS A N    1  
ATOM   3134   C CA   . LYS A 1 204 ? -29.633 25.349  -11.689 0.016 30.42 ? 202 LYS A CA   1  
ATOM   3135   C C    . LYS A 1 204 ? -30.565 24.310  -11.072 0.016 29.26 ? 202 LYS A C    1  
ATOM   3136   O O    . LYS A 1 204 ? -30.749 24.293  -9.846  0.016 28.36 ? 202 LYS A O    1  
ATOM   3137   C CB   . LYS A 1 204 ? -30.397 26.446  -12.466 0.016 31.80 ? 202 LYS A CB   1  
ATOM   3138   C CG   . LYS A 1 204 ? -29.586 27.756  -12.651 0.016 32.92 ? 202 LYS A CG   1  
ATOM   3139   C CD   . LYS A 1 204 ? -30.305 28.946  -11.930 0.016 32.81 ? 202 LYS A CD   1  
ATOM   3140   C CE   . LYS A 1 204 ? -29.573 30.290  -12.023 0.016 34.08 ? 202 LYS A CE   1  
ATOM   3141   N NZ   . LYS A 1 204 ? -29.861 31.143  -10.845 0.016 33.58 ? 202 LYS A NZ   1  
ATOM   3142   H H    . LYS A 1 204 ? -28.659 24.990  -13.376 0.016 31.64 ? 202 LYS A H    1  
ATOM   3143   H HA   . LYS A 1 204 ? -29.173 25.777  -10.951 0.016 30.21 ? 202 LYS A HA   1  
ATOM   3144   H HB2  . LYS A 1 204 ? -30.623 26.117  -13.349 0.016 32.36 ? 202 LYS A HB2  1  
ATOM   3145   H HB3  . LYS A 1 204 ? -31.206 26.669  -11.981 0.016 31.58 ? 202 LYS A HB3  1  
ATOM   3146   H HG2  . LYS A 1 204 ? -28.703 27.638  -12.264 0.016 32.77 ? 202 LYS A HG2  1  
ATOM   3147   H HG3  . LYS A 1 204 ? -29.511 27.967  -13.596 0.016 33.98 ? 202 LYS A HG3  1  
ATOM   3148   H HD2  . LYS A 1 204 ? -31.180 29.066  -12.330 0.016 32.89 ? 202 LYS A HD2  1  
ATOM   3149   H HD3  . LYS A 1 204 ? -30.408 28.732  -10.991 0.016 31.91 ? 202 LYS A HD3  1  
ATOM   3150   H HE2  . LYS A 1 204 ? -28.618 30.149  -12.075 0.016 34.36 ? 202 LYS A HE2  1  
ATOM   3151   H HE3  . LYS A 1 204 ? -29.885 30.753  -12.814 0.016 34.98 ? 202 LYS A HE3  1  
ATOM   3152   H HZ1  . LYS A 1 204 ? -30.120 30.638  -10.159 0.016 32.83 ? 202 LYS A HZ1  1  
ATOM   3153   H HZ2  . LYS A 1 204 ? -29.144 31.606  -10.610 0.016 34.34 ? 202 LYS A HZ2  1  
ATOM   3154   H HZ3  . LYS A 1 204 ? -30.517 31.707  -11.045 0.016 33.36 ? 202 LYS A HZ3  1  
ATOM   3155   N N    . ASP A 1 205 ? -31.078 23.368  -11.872 0.016 29.35 ? 203 ASP A N    1  
ATOM   3156   C CA   . ASP A 1 205 ? -31.985 22.344  -11.346 0.016 28.47 ? 203 ASP A CA   1  
ATOM   3157   C C    . ASP A 1 205 ? -31.319 20.970  -11.204 0.016 27.49 ? 203 ASP A C    1  
ATOM   3158   O O    . ASP A 1 205 ? -32.014 19.964  -11.123 0.016 26.99 ? 203 ASP A O    1  
ATOM   3159   C CB   . ASP A 1 205 ? -33.232 22.276  -12.231 0.016 29.35 ? 203 ASP A CB   1  
ATOM   3160   C CG   . ASP A 1 205 ? -34.064 23.572  -12.181 0.016 30.03 ? 203 ASP A CG   1  
ATOM   3161   O OD1  . ASP A 1 205 ? -34.240 24.130  -11.066 0.016 29.36 ? 203 ASP A OD1  1  
ATOM   3162   O OD2  . ASP A 1 205 ? -34.547 24.022  -13.263 0.016 31.37 ? 203 ASP A OD2  1  
ATOM   3163   H H    . ASP A 1 205 ? -30.914 23.297  -12.713 0.016 30.01 ? 203 ASP A H    1  
ATOM   3164   H HA   . ASP A 1 205 ? -32.277 22.608  -10.464 0.016 28.06 ? 203 ASP A HA   1  
ATOM   3165   H HB2  . ASP A 1 205 ? -32.952 22.148  -13.152 0.016 30.09 ? 203 ASP A HB2  1  
ATOM   3166   H HB3  . ASP A 1 205 ? -33.790 21.538  -11.942 0.016 28.87 ? 203 ASP A HB3  1  
ATOM   3167   N N    . TYR A 1 206 ? -29.998 20.945  -11.063 0.016 27.28 ? 204 TYR A N    1  
ATOM   3168   C CA   . TYR A 1 206 ? -29.201 19.723  -10.952 0.016 26.55 ? 204 TYR A CA   1  
ATOM   3169   C C    . TYR A 1 206 ? -29.403 18.832  -12.165 0.016 27.06 ? 204 TYR A C    1  
ATOM   3170   O O    . TYR A 1 206 ? -29.203 17.629  -12.103 0.016 26.47 ? 204 TYR A O    1  
ATOM   3171   C CB   . TYR A 1 206 ? -29.496 18.969  -9.643  0.016 25.32 ? 204 TYR A CB   1  
ATOM   3172   C CG   . TYR A 1 206 ? -29.010 19.665  -8.389  0.016 24.91 ? 204 TYR A CG   1  
ATOM   3173   C CD1  . TYR A 1 206 ? -29.597 20.854  -7.950  0.016 25.29 ? 204 TYR A CD1  1  
ATOM   3174   C CD2  . TYR A 1 206 ? -27.951 19.179  -7.658  0.016 24.33 ? 204 TYR A CD2  1  
ATOM   3175   C CE1  . TYR A 1 206 ? -29.137 21.510  -6.814  0.016 25.12 ? 204 TYR A CE1  1  
ATOM   3176   C CE2  . TYR A 1 206 ? -27.481 19.842  -6.513  0.016 24.19 ? 204 TYR A CE2  1  
ATOM   3177   C CZ   . TYR A 1 206 ? -28.084 20.978  -6.082  0.016 24.58 ? 204 TYR A CZ   1  
ATOM   3178   O OH   . TYR A 1 206 ? -27.569 21.607  -4.946  0.016 24.62 ? 204 TYR A OH   1  
ATOM   3179   H H    . TYR A 1 206 ? -29.516 21.655  -11.031 0.016 27.64 ? 204 TYR A H    1  
ATOM   3180   H HA   . TYR A 1 206 ? -28.263 19.971  -10.947 0.016 26.69 ? 204 TYR A HA   1  
ATOM   3181   H HB2  . TYR A 1 206 ? -30.451 18.828  -9.561  0.016 25.27 ? 204 TYR A HB2  1  
ATOM   3182   H HB3  . TYR A 1 206 ? -29.038 18.114  -9.690  0.016 24.96 ? 204 TYR A HB3  1  
ATOM   3183   H HD1  . TYR A 1 206 ? -30.311 21.200  -8.428  0.016 25.75 ? 204 TYR A HD1  1  
ATOM   3184   H HD2  . TYR A 1 206 ? -27.534 18.396  -7.936  0.016 24.12 ? 204 TYR A HD2  1  
ATOM   3185   H HE1  . TYR A 1 206 ? -29.552 22.289  -6.532  0.016 25.45 ? 204 TYR A HE1  1  
ATOM   3186   H HE2  . TYR A 1 206 ? -26.771 19.492  -6.028  0.016 23.90 ? 204 TYR A HE2  1  
ATOM   3187   H HH   . TYR A 1 206 ? -27.020 21.106  -4.557  0.016 24.32 ? 204 TYR A HH   1  
ATOM   3188   N N    . ASN A 1 207 ? -29.751 19.436  -13.291 0.016 28.30 ? 205 ASN A N    1  
ATOM   3189   C CA   . ASN A 1 207 ? -29.727 18.749  -14.570 0.016 29.17 ? 205 ASN A CA   1  
ATOM   3190   C C    . ASN A 1 207 ? -28.327 18.277  -14.921 0.016 29.28 ? 205 ASN A C    1  
ATOM   3191   O O    . ASN A 1 207 ? -28.167 17.211  -15.530 0.016 29.44 ? 205 ASN A O    1  
ATOM   3192   C CB   . ASN A 1 207 ? -30.229 19.677  -15.665 0.016 30.74 ? 205 ASN A CB   1  
ATOM   3193   C CG   . ASN A 1 207 ? -31.746 19.669  -15.809 0.016 31.05 ? 205 ASN A CG   1  
ATOM   3194   O OD1  . ASN A 1 207 ? -32.471 19.012  -15.068 0.016 30.10 ? 205 ASN A OD1  1  
ATOM   3195   N ND2  . ASN A 1 207 ? -32.220 20.399  -16.798 0.016 32.57 ? 205 ASN A ND2  1  
ATOM   3196   H H    . ASN A 1 207 ? -30.003 20.259  -13.344 0.016 28.76 ? 205 ASN A H    1  
ATOM   3197   H HA   . ASN A 1 207 ? -30.310 17.975  -14.532 0.016 28.83 ? 205 ASN A HA   1  
ATOM   3198   H HB2  . ASN A 1 207 ? -29.957 20.582  -15.453 0.016 30.96 ? 205 ASN A HB2  1  
ATOM   3199   H HB3  . ASN A 1 207 ? -29.837 19.410  -16.510 0.016 31.51 ? 205 ASN A HB3  1  
ATOM   3200   H HD21 . ASN A 1 207 ? -31.684 20.708  -17.393 0.016 33.36 ? 205 ASN A HD21 1  
ATOM   3201   H HD22 . ASN A 1 207 ? -33.064 20.555  -16.852 0.016 32.83 ? 205 ASN A HD22 1  
ATOM   3202   N N    . LYS A 1 208 ? -27.315 19.066  -14.575 0.016 29.36 ? 206 LYS A N    1  
ATOM   3203   C CA   . LYS A 1 208 ? -25.922 18.696  -14.723 0.016 29.49 ? 206 LYS A CA   1  
ATOM   3204   C C    . LYS A 1 208 ? -25.292 18.755  -13.341 0.016 28.33 ? 206 LYS A C    1  
ATOM   3205   O O    . LYS A 1 208 ? -25.530 19.706  -12.590 0.016 28.14 ? 206 LYS A O    1  
ATOM   3206   C CB   . LYS A 1 208 ? -25.203 19.621  -15.708 0.016 31.10 ? 206 LYS A CB   1  
ATOM   3207   C CG   . LYS A 1 208 ? -25.927 19.751  -17.037 0.016 32.48 ? 206 LYS A CG   1  
ATOM   3208   C CD   . LYS A 1 208 ? -25.161 20.643  -18.032 0.016 34.29 ? 206 LYS A CD   1  
ATOM   3209   C CE   . LYS A 1 208 ? -24.835 22.042  -17.504 0.016 34.54 ? 206 LYS A CE   1  
ATOM   3210   N NZ   . LYS A 1 208 ? -23.543 22.507  -18.078 0.016 35.80 ? 206 LYS A NZ   1  
ATOM   3211   H H    . LYS A 1 208 ? -27.418 19.841  -14.229 0.016 29.42 ? 206 LYS A H    1  
ATOM   3212   H HA   . LYS A 1 208 ? -25.860 17.789  -15.057 0.016 29.41 ? 206 LYS A HA   1  
ATOM   3213   H HB2  . LYS A 1 208 ? -25.137 20.497  -15.302 0.016 31.16 ? 206 LYS A HB2  1  
ATOM   3214   H HB3  . LYS A 1 208 ? -24.317 19.269  -15.883 0.016 31.31 ? 206 LYS A HB3  1  
ATOM   3215   H HG2  . LYS A 1 208 ? -26.007 18.869  -17.435 0.016 32.50 ? 206 LYS A HG2  1  
ATOM   3216   H HG3  . LYS A 1 208 ? -26.808 20.131  -16.892 0.016 32.36 ? 206 LYS A HG3  1  
ATOM   3217   H HD2  . LYS A 1 208 ? -24.319 20.212  -18.243 0.016 34.52 ? 206 LYS A HD2  1  
ATOM   3218   H HD3  . LYS A 1 208 ? -25.689 20.744  -18.839 0.016 35.23 ? 206 LYS A HD3  1  
ATOM   3219   H HE2  . LYS A 1 208 ? -25.525 22.661  -17.797 0.016 35.18 ? 206 LYS A HE2  1  
ATOM   3220   H HE3  . LYS A 1 208 ? -24.762 22.062  -16.540 0.016 33.46 ? 206 LYS A HE3  1  
ATOM   3221   H HZ1  . LYS A 1 208 ? -22.900 21.915  -17.914 0.016 35.23 ? 206 LYS A HZ1  1  
ATOM   3222   H HZ2  . LYS A 1 208 ? -23.625 22.610  -18.959 0.016 36.80 ? 206 LYS A HZ2  1  
ATOM   3223   H HZ3  . LYS A 1 208 ? -23.317 23.290  -17.717 0.016 36.23 ? 206 LYS A HZ3  1  
ATOM   3224   N N    . VAL A 1 209 ? -24.534 17.718  -12.992 0.016 27.67 ? 207 VAL A N    1  
ATOM   3225   C CA   . VAL A 1 209 ? -23.948 17.583  -11.667 0.016 26.64 ? 207 VAL A CA   1  
ATOM   3226   C C    . VAL A 1 209 ? -22.567 16.970  -11.818 0.016 26.85 ? 207 VAL A C    1  
ATOM   3227   O O    . VAL A 1 209 ? -22.398 15.990  -12.553 0.016 27.12 ? 207 VAL A O    1  
ATOM   3228   C CB   . VAL A 1 209 ? -24.810 16.696  -10.744 0.016 25.39 ? 207 VAL A CB   1  
ATOM   3229   C CG1  . VAL A 1 209 ? -24.079 16.343  -9.477  0.016 24.56 ? 207 VAL A CG1  1  
ATOM   3230   C CG2  . VAL A 1 209 ? -26.128 17.356  -10.440 0.016 25.21 ? 207 VAL A CG2  1  
ATOM   3231   H H    . VAL A 1 209 ? -24.334 17.080  -13.525 0.016 27.91 ? 207 VAL A H    1  
ATOM   3232   H HA   . VAL A 1 209 ? -23.853 18.452  -11.256 0.016 26.76 ? 207 VAL A HA   1  
ATOM   3233   H HB   . VAL A 1 209 ? -25.000 15.861  -11.203 0.016 25.40 ? 207 VAL A HB   1  
ATOM   3234   H HG11 . VAL A 1 209 ? -24.707 15.913  -8.874  0.016 23.89 ? 207 VAL A HG11 1  
ATOM   3235   H HG12 . VAL A 1 209 ? -23.355 15.731  -9.677  0.016 24.61 ? 207 VAL A HG12 1  
ATOM   3236   H HG13 . VAL A 1 209 ? -23.736 17.150  -9.066  0.016 24.74 ? 207 VAL A HG13 1  
ATOM   3237   H HG21 . VAL A 1 209 ? -26.512 16.955  -9.644  0.016 24.47 ? 207 VAL A HG21 1  
ATOM   3238   H HG22 . VAL A 1 209 ? -25.976 18.303  -10.298 0.016 25.52 ? 207 VAL A HG22 1  
ATOM   3239   H HG23 . VAL A 1 209 ? -26.720 17.230  -11.197 0.016 25.65 ? 207 VAL A HG23 1  
ATOM   3240   N N    . ARG A 1 210 ? -21.605 17.517  -11.095 0.016 26.82 ? 208 ARG A N    1  
ATOM   3241   C CA   . ARG A 1 210 ? -20.267 16.957  -10.990 0.016 27.07 ? 208 ARG A CA   1  
ATOM   3242   C C    . ARG A 1 210 ? -20.103 16.419  -9.584  0.016 25.98 ? 208 ARG A C    1  
ATOM   3243   O O    . ARG A 1 210 ? -20.306 17.140  -8.604  0.016 25.78 ? 208 ARG A O    1  
ATOM   3244   C CB   . ARG A 1 210 ? -19.210 18.012  -11.287 0.016 28.34 ? 208 ARG A CB   1  
ATOM   3245   C CG   . ARG A 1 210 ? -17.874 17.444  -11.534 0.016 28.99 ? 208 ARG A CG   1  
ATOM   3246   C CD   . ARG A 1 210 ? -17.244 18.328  -12.586 0.016 30.67 ? 208 ARG A CD   1  
ATOM   3247   N NE   . ARG A 1 210 ? -15.900 17.951  -12.899 0.016 31.57 ? 208 ARG A NE   1  
ATOM   3248   C CZ   . ARG A 1 210 ? -15.163 18.555  -13.824 0.016 33.26 ? 208 ARG A CZ   1  
ATOM   3249   N NH1  . ARG A 1 210 ? -15.643 19.592  -14.534 0.016 34.22 ? 208 ARG A NH1  1  
ATOM   3250   N NH2  . ARG A 1 210 ? -13.932 18.126  -14.038 0.016 34.13 ? 208 ARG A NH2  1  
ATOM   3251   H H    . ARG A 1 210 ? -21.707 18.236  -10.637 0.016 26.73 ? 208 ARG A H    1  
ATOM   3252   H HA   . ARG A 1 210 ? -20.163 16.227  -11.621 0.016 27.23 ? 208 ARG A HA   1  
ATOM   3253   H HB2  . ARG A 1 210 ? -19.473 18.520  -12.069 0.016 29.06 ? 208 ARG A HB2  1  
ATOM   3254   H HB3  . ARG A 1 210 ? -19.129 18.587  -10.514 0.016 28.15 ? 208 ARG A HB3  1  
ATOM   3255   H HG2  . ARG A 1 210 ? -17.341 17.465  -10.726 0.016 28.81 ? 208 ARG A HG2  1  
ATOM   3256   H HG3  . ARG A 1 210 ? -17.952 16.537  -11.870 0.016 28.70 ? 208 ARG A HG3  1  
ATOM   3257   H HD2  . ARG A 1 210 ? -17.761 18.295  -13.405 0.016 31.00 ? 208 ARG A HD2  1  
ATOM   3258   H HD3  . ARG A 1 210 ? -17.226 19.236  -12.249 0.016 30.96 ? 208 ARG A HD3  1  
ATOM   3259   H HE   . ARG A 1 210 ? -15.516 17.375  -12.386 0.016 31.13 ? 208 ARG A HE   1  
ATOM   3260   H HH11 . ARG A 1 210 ? -16.443 19.876  -14.404 0.016 33.73 ? 208 ARG A HH11 1  
ATOM   3261   H HH12 . ARG A 1 210 ? -15.149 19.968  -15.128 0.016 35.41 ? 208 ARG A HH12 1  
ATOM   3262   H HH21 . ARG A 1 210 ? -13.624 17.464  -13.580 0.016 33.57 ? 208 ARG A HH21 1  
ATOM   3263   H HH22 . ARG A 1 210 ? -13.439 18.510  -14.632 0.016 35.32 ? 208 ARG A HH22 1  
ATOM   3264   N N    . LEU A 1 211 ? -19.756 15.139  -9.487  0.016 25.43 ? 209 LEU A N    1  
ATOM   3265   C CA   . LEU A 1 211 ? -19.868 14.402  -8.249  0.016 24.43 ? 209 LEU A CA   1  
ATOM   3266   C C    . LEU A 1 211 ? -18.552 13.709  -7.969  0.016 24.70 ? 209 LEU A C    1  
ATOM   3267   O O    . LEU A 1 211 ? -17.957 13.139  -8.879  0.016 25.27 ? 209 LEU A O    1  
ATOM   3268   C CB   . LEU A 1 211 ? -20.990 13.380  -8.368  0.016 23.59 ? 209 LEU A CB   1  
ATOM   3269   C CG   . LEU A 1 211 ? -21.215 12.509  -7.153  0.016 22.67 ? 209 LEU A CG   1  
ATOM   3270   C CD1  . LEU A 1 211 ? -21.762 13.352  -6.011  0.016 22.32 ? 209 LEU A CD1  1  
ATOM   3271   C CD2  . LEU A 1 211 ? -22.174 11.370  -7.503  0.016 22.14 ? 209 LEU A CD2  1  
ATOM   3272   H H    . LEU A 1 211 ? -19.449 14.678  -10.142 0.016 25.72 ? 209 LEU A H    1  
ATOM   3273   H HA   . LEU A 1 211 ? -20.059 15.006  -7.517  0.016 24.26 ? 209 LEU A HA   1  
ATOM   3274   H HB2  . LEU A 1 211 ? -21.820 13.846  -8.543  0.016 23.52 ? 209 LEU A HB2  1  
ATOM   3275   H HB3  . LEU A 1 211 ? -20.785 12.804  -9.118  0.016 23.85 ? 209 LEU A HB3  1  
ATOM   3276   H HG   . LEU A 1 211 ? -20.370 12.123  -6.874  0.016 22.80 ? 209 LEU A HG   1  
ATOM   3277   H HD11 . LEU A 1 211 ? -22.620 13.710  -6.288  0.016 22.11 ? 209 LEU A HD11 1  
ATOM   3278   H HD12 . LEU A 1 211 ? -21.872 12.800  -5.221  0.016 21.96 ? 209 LEU A HD12 1  
ATOM   3279   H HD13 . LEU A 1 211 ? -21.148 14.079  -5.827  0.016 22.79 ? 209 LEU A HD13 1  
ATOM   3280   H HD21 . LEU A 1 211 ? -22.504 10.990  -6.678  0.016 21.61 ? 209 LEU A HD21 1  
ATOM   3281   H HD22 . LEU A 1 211 ? -22.905 11.710  -8.038  0.016 22.32 ? 209 LEU A HD22 1  
ATOM   3282   H HD23 . LEU A 1 211 ? -21.686 10.701  -8.004  0.016 22.29 ? 209 LEU A HD23 1  
ATOM   3283   N N    . TYR A 1 212 ? -18.137 13.720  -6.713  0.016 24.43 ? 210 TYR A N    1  
ATOM   3284   C CA   . TYR A 1 212 ? -16.792 13.324  -6.352  0.016 24.90 ? 210 TYR A CA   1  
ATOM   3285   C C    . TYR A 1 212 ? -16.795 12.494  -5.068  0.016 24.14 ? 210 TYR A C    1  
ATOM   3286   O O    . TYR A 1 212 ? -17.585 12.732  -4.145  0.016 23.49 ? 210 TYR A O    1  
ATOM   3287   C CB   . TYR A 1 212 ? -15.968 14.597  -6.283  0.016 26.01 ? 210 TYR A CB   1  
ATOM   3288   C CG   . TYR A 1 212 ? -15.066 14.798  -5.149  0.016 26.36 ? 210 TYR A CG   1  
ATOM   3289   C CD1  . TYR A 1 212 ? -15.155 15.988  -4.385  0.016 26.84 ? 210 TYR A CD1  1  
ATOM   3290   C CD2  . TYR A 1 212 ? -14.037 13.929  -4.900  0.016 26.51 ? 210 TYR A CD2  1  
ATOM   3291   C CE1  . TYR A 1 212 ? -14.311 16.234  -3.336  0.016 27.41 ? 210 TYR A CE1  1  
ATOM   3292   C CE2  . TYR A 1 212 ? -13.159 14.135  -3.827  0.016 27.07 ? 210 TYR A CE2  1  
ATOM   3293   C CZ   . TYR A 1 212 ? -13.284 15.349  -3.070  0.016 27.61 ? 210 TYR A CZ   1  
ATOM   3294   O OH   . TYR A 1 212 ? -12.471 15.694  -2.006  0.016 28.41 ? 210 TYR A OH   1  
ATOM   3295   H H    . TYR A 1 212 ? -18.622 13.950  -6.042  0.016 24.06 ? 210 TYR A H    1  
ATOM   3296   H HA   . TYR A 1 212 ? -16.426 12.773  -7.060  0.016 25.14 ? 210 TYR A HA   1  
ATOM   3297   H HB2  . TYR A 1 212 ? -15.430 14.643  -7.085  0.016 26.69 ? 210 TYR A HB2  1  
ATOM   3298   H HB3  . TYR A 1 212 ? -16.578 15.347  -6.283  0.016 26.05 ? 210 TYR A HB3  1  
ATOM   3299   H HD1  . TYR A 1 212 ? -15.837 16.597  -4.562  0.016 26.80 ? 210 TYR A HD1  1  
ATOM   3300   H HD2  . TYR A 1 212 ? -13.968 13.168  -5.418  0.016 26.27 ? 210 TYR A HD2  1  
ATOM   3301   H HE1  . TYR A 1 212 ? -14.402 17.019  -2.838  0.016 27.80 ? 210 TYR A HE1  1  
ATOM   3302   H HE2  . TYR A 1 212 ? -12.467 13.536  -3.664  0.016 27.24 ? 210 TYR A HE2  1  
ATOM   3303   H HH   . TYR A 1 212 ? -12.488 16.527  -1.882  0.016 28.93 ? 210 TYR A HH   1  
ATOM   3304   N N    . GLU A 1 213 ? -15.959 11.449  -5.053  0.016 24.32 ? 211 GLU A N    1  
ATOM   3305   C CA   . GLU A 1 213 ? -15.902 10.544  -3.919  0.016 23.71 ? 211 GLU A CA   1  
ATOM   3306   C C    . GLU A 1 213 ? -14.468 10.142  -3.601  0.016 24.45 ? 211 GLU A C    1  
ATOM   3307   O O    . GLU A 1 213 ? -13.675 9.907   -4.505  0.016 25.15 ? 211 GLU A O    1  
ATOM   3308   C CB   . GLU A 1 213 ? -16.714 9.292   -4.204  0.016 22.98 ? 211 GLU A CB   1  
ATOM   3309   C CG   . GLU A 1 213 ? -17.217 8.615   -2.973  0.016 22.20 ? 211 GLU A CG   1  
ATOM   3310   C CD   . GLU A 1 213 ? -16.391 7.439   -2.628  0.016 22.41 ? 211 GLU A CD   1  
ATOM   3311   O OE1  . GLU A 1 213 ? -15.159 7.655   -2.554  0.016 23.15 ? 211 GLU A OE1  1  
ATOM   3312   O OE2  . GLU A 1 213 ? -16.966 6.328   -2.454  0.016 21.97 ? 211 GLU A OE2  1  
ATOM   3313   H H    . GLU A 1 213 ? -15.422 11.247  -5.692  0.016 24.87 ? 211 GLU A H    1  
ATOM   3314   H HA   . GLU A 1 213 ? -16.283 10.982  -3.146  0.016 23.42 ? 211 GLU A HA   1  
ATOM   3315   H HB2  . GLU A 1 213 ? -17.482 9.522   -4.742  0.016 22.86 ? 211 GLU A HB2  1  
ATOM   3316   H HB3  . GLU A 1 213 ? -16.152 8.666   -4.687  0.016 23.29 ? 211 GLU A HB3  1  
ATOM   3317   H HG2  . GLU A 1 213 ? -17.173 9.228   -2.226  0.016 22.07 ? 211 GLU A HG2  1  
ATOM   3318   H HG3  . GLU A 1 213 ? -18.129 8.314   -3.122  0.016 21.81 ? 211 GLU A HG3  1  
ATOM   3319   N N    . HIS A 1 214 ? -14.166 10.064  -2.305  0.016 24.40 ? 212 HIS A N    1  
ATOM   3320   C CA   . HIS A 1 214 ? -12.925 9.504   -1.778  0.016 25.10 ? 212 HIS A CA   1  
ATOM   3321   C C    . HIS A 1 214 ? -13.282 8.393   -0.806  0.016 24.48 ? 212 HIS A C    1  
ATOM   3322   O O    . HIS A 1 214 ? -14.095 8.615   0.092   0.016 23.95 ? 212 HIS A O    1  
ATOM   3323   C CB   . HIS A 1 214 ? -12.089 10.552  -1.028  0.016 26.10 ? 212 HIS A CB   1  
ATOM   3324   C CG   . HIS A 1 214 ? -11.083 9.944   -0.101  0.016 26.80 ? 212 HIS A CG   1  
ATOM   3325   N ND1  . HIS A 1 214 ? -11.447 9.213   1.012   0.016 26.37 ? 212 HIS A ND1  1  
ATOM   3326   C CD2  . HIS A 1 214 ? -9.730  9.892   -0.161  0.016 28.01 ? 212 HIS A CD2  1  
ATOM   3327   C CE1  . HIS A 1 214 ? -10.359 8.768   1.616   0.016 27.31 ? 212 HIS A CE1  1  
ATOM   3328   N NE2  . HIS A 1 214 ? -9.303  9.168   0.925   0.016 28.31 ? 212 HIS A NE2  1  
ATOM   3329   H H    . HIS A 1 214 ? -14.687 10.345  -1.686  0.016 24.05 ? 212 HIS A H    1  
ATOM   3330   H HA   . HIS A 1 214 ? -12.395 9.146   -2.501  0.016 25.48 ? 212 HIS A HA   1  
ATOM   3331   H HB2  . HIS A 1 214 ? -11.617 11.102  -1.671  0.016 26.70 ? 212 HIS A HB2  1  
ATOM   3332   H HB3  . HIS A 1 214 ? -12.681 11.101  -0.492  0.016 25.82 ? 212 HIS A HB3  1  
ATOM   3333   H HD1  . HIS A 1 214 ? -12.253 9.077   1.282   0.016 25.72 ? 212 HIS A HD1  1  
ATOM   3334   H HD2  . HIS A 1 214 ? -9.185  10.288  -0.804  0.016 28.65 ? 212 HIS A HD2  1  
ATOM   3335   H HE1  . HIS A 1 214 ? -10.343 8.262   2.397   0.016 27.35 ? 212 HIS A HE1  1  
ATOM   3336   H HE2  . HIS A 1 214 ? -8.483  9.004   1.123   0.016 29.10 ? 212 HIS A HE2  1  
ATOM   3337   N N    . ALA A 1 215 ? -12.689 7.203   -0.985  0.016 24.67 ? 213 ALA A N    1  
ATOM   3338   C CA   . ALA A 1 215 ? -12.969 6.061   -0.114  0.016 24.24 ? 213 ALA A CA   1  
ATOM   3339   C C    . ALA A 1 215 ? -11.705 5.244   0.177   0.016 25.11 ? 213 ALA A C    1  
ATOM   3340   O O    . ALA A 1 215 ? -10.829 5.090   -0.682  0.016 25.73 ? 213 ALA A O    1  
ATOM   3341   C CB   . ALA A 1 215 ? -14.046 5.153   -0.716  0.016 23.34 ? 213 ALA A CB   1  
ATOM   3342   H H    . ALA A 1 215 ? -12.119 7.039   -1.606  0.016 25.12 ? 213 ALA A H    1  
ATOM   3343   H HA   . ALA A 1 215 ? -13.309 6.392   0.725   0.016 24.11 ? 213 ALA A HA   1  
ATOM   3344   H HB1  . ALA A 1 215 ? -14.881 5.645   -0.743  0.016 22.85 ? 213 ALA A HB1  1  
ATOM   3345   H HB2  . ALA A 1 215 ? -13.787 4.893   -1.613  0.016 23.52 ? 213 ALA A HB2  1  
ATOM   3346   H HB3  . ALA A 1 215 ? -14.147 4.373   -0.153  0.016 23.21 ? 213 ALA A HB3  1  
ATOM   3347   N N    . GLU A 1 216 ? -11.644 4.726   1.396   0.016 25.31 ? 214 GLU A N    1  
ATOM   3348   C CA   . GLU A 1 216 ? -10.470 4.038   1.945   0.016 26.22 ? 214 GLU A CA   1  
ATOM   3349   C C    . GLU A 1 216 ? -10.910 3.019   3.009   0.016 25.97 ? 214 GLU A C    1  
ATOM   3350   O O    . GLU A 1 216 ? -11.719 3.334   3.883   0.016 25.56 ? 214 GLU A O    1  
ATOM   3351   C CB   . GLU A 1 216 ? -9.492  5.024   2.607   0.016 27.52 ? 214 GLU A CB   1  
ATOM   3352   C CG   . GLU A 1 216 ? -8.646  5.911   1.690   0.016 28.24 ? 214 GLU A CG   1  
ATOM   3353   C CD   . GLU A 1 216 ? -7.567  6.675   2.457   0.016 29.63 ? 214 GLU A CD   1  
ATOM   3354   O OE1  . GLU A 1 216 ? -6.905  7.564   1.851   0.016 30.46 ? 214 GLU A OE1  1  
ATOM   3355   O OE2  . GLU A 1 216 ? -7.398  6.375   3.666   0.016 30.00 ? 214 GLU A OE2  1  
ATOM   3356   H H    . GLU A 1 216 ? -12.310 4.704   1.916   0.016 24.99 ? 214 GLU A H    1  
ATOM   3357   H HA   . GLU A 1 216 ? -10.008 3.579   1.228   0.016 26.32 ? 214 GLU A HA   1  
ATOM   3358   H HB2  . GLU A 1 216 ? -10.005 5.608   3.187   0.016 27.48 ? 214 GLU A HB2  1  
ATOM   3359   H HB3  . GLU A 1 216 ? -8.873  4.501   3.143   0.016 28.13 ? 214 GLU A HB3  1  
ATOM   3360   H HG2  . GLU A 1 216 ? -8.199  5.341   1.075   0.016 28.52 ? 214 GLU A HG2  1  
ATOM   3361   H HG3  . GLU A 1 216 ? -9.201  6.536   1.209   0.016 27.69 ? 214 GLU A HG3  1  
ATOM   3362   N N    . ALA A 1 217 ? -10.343 1.808   2.979   0.016 26.40 ? 215 ALA A N    1  
ATOM   3363   C CA   . ALA A 1 217 ? -10.693 0.785   3.959   0.016 26.38 ? 215 ALA A CA   1  
ATOM   3364   C C    . ALA A 1 217 ? -9.613  0.592   5.027   0.016 27.71 ? 215 ALA A C    1  
ATOM   3365   O O    . ALA A 1 217 ? -8.427  0.863   4.788   0.016 28.70 ? 215 ALA A O    1  
ATOM   3366   C CB   . ALA A 1 217 ? -10.936 -0.555  3.254   0.016 26.01 ? 215 ALA A CB   1  
ATOM   3367   H H    . ALA A 1 217 ? -9.766  1.560   2.395   0.016 26.76 ? 215 ALA A H    1  
ATOM   3368   H HA   . ALA A 1 217 ? -11.512 1.042   4.403   0.016 25.88 ? 215 ALA A HA   1  
ATOM   3369   H HB1  . ALA A 1 217 ? -11.114 -1.234  3.923   0.016 26.11 ? 215 ALA A HB1  1  
ATOM   3370   H HB2  . ALA A 1 217 ? -11.696 -0.463  2.660   0.016 25.26 ? 215 ALA A HB2  1  
ATOM   3371   H HB3  . ALA A 1 217 ? -10.149 -0.791  2.742   0.016 26.53 ? 215 ALA A HB3  1  
ATOM   3372   N N    . ARG A 1 218 ? -10.051 0.169   6.231   0.016 27.89 ? 216 ARG A N    1  
ATOM   3373   C CA   . ARG A 1 218 ? -9.166  -0.245  7.324   0.016 29.26 ? 216 ARG A CA   1  
ATOM   3374   C C    . ARG A 1 218 ? -9.952  -1.107  8.321   0.016 29.23 ? 216 ARG A C    1  
ATOM   3375   O O    . ARG A 1 218 ? -11.147 -1.338  8.163   0.016 28.19 ? 216 ARG A O    1  
ATOM   3376   C CB   . ARG A 1 218 ? -8.529  0.968   8.042   0.016 30.38 ? 216 ARG A CB   1  
ATOM   3377   C CG   . ARG A 1 218 ? -7.526  0.583   9.169   0.016 32.14 ? 216 ARG A CG   1  
ATOM   3378   C CD   . ARG A 1 218 ? -6.456  1.663   9.524   0.016 33.56 ? 216 ARG A CD   1  
ATOM   3379   N NE   . ARG A 1 218 ? -6.842  2.552   10.626  0.016 34.00 ? 216 ARG A NE   1  
ATOM   3380   C CZ   . ARG A 1 218 ? -7.708  3.559   10.530  0.016 33.06 ? 216 ARG A CZ   1  
ATOM   3381   N NH1  . ARG A 1 218 ? -8.330  3.828   9.380   0.016 31.59 ? 216 ARG A NH1  1  
ATOM   3382   N NH2  . ARG A 1 218 ? -7.972  4.295   11.594  0.016 33.72 ? 216 ARG A NH2  1  
ATOM   3383   H H    . ARG A 1 218 ? -10.881 0.113   6.438   0.016 27.31 ? 216 ARG A H    1  
ATOM   3384   H HA   . ARG A 1 218 ? -8.454  -0.785  6.952   0.016 29.66 ? 216 ARG A HA   1  
ATOM   3385   H HB2  . ARG A 1 218 ? -8.058  1.504   7.389   0.016 30.38 ? 216 ARG A HB2  1  
ATOM   3386   H HB3  . ARG A 1 218 ? -9.238  1.487   8.451   0.016 30.10 ? 216 ARG A HB3  1  
ATOM   3387   H HG2  . ARG A 1 218 ? -8.024  0.399   9.981   0.016 32.31 ? 216 ARG A HG2  1  
ATOM   3388   H HG3  . ARG A 1 218 ? -7.049  -0.217  8.892   0.016 32.39 ? 216 ARG A HG3  1  
ATOM   3389   H HD2  . ARG A 1 218 ? -5.644  1.209   9.795   0.016 34.66 ? 216 ARG A HD2  1  
ATOM   3390   H HD3  . ARG A 1 218 ? -6.270  2.214   8.747   0.016 33.25 ? 216 ARG A HD3  1  
ATOM   3391   H HE   . ARG A 1 218 ? -6.485  2.409   11.396  0.016 34.91 ? 216 ARG A HE   1  
ATOM   3392   H HH11 . ARG A 1 218 ? -8.172  3.361   8.676   0.016 31.25 ? 216 ARG A HH11 1  
ATOM   3393   H HH12 . ARG A 1 218 ? -8.888  4.481   9.343   0.016 31.07 ? 216 ARG A HH12 1  
ATOM   3394   H HH21 . ARG A 1 218 ? -7.577  4.125   12.340  0.016 34.77 ? 216 ARG A HH21 1  
ATOM   3395   H HH22 . ARG A 1 218 ? -8.534  4.945   11.541  0.016 33.17 ? 216 ARG A HH22 1  
ATOM   3396   N N    . TYR A 1 219 ? -9.249  -1.605  9.345   0.016 30.56 ? 217 TYR A N    1  
ATOM   3397   C CA   . TYR A 1 219 ? -9.872  -2.202  10.513  0.016 31.01 ? 217 TYR A CA   1  
ATOM   3398   C C    . TYR A 1 219 ? -10.383 -1.068  11.384  0.016 31.17 ? 217 TYR A C    1  
ATOM   3399   O O    . TYR A 1 219 ? -11.211 -1.283  12.255  0.016 31.68 ? 217 TYR A O    1  
ATOM   3400   C CB   . TYR A 1 219 ? -8.900  -3.065  11.346  0.016 32.67 ? 217 TYR A CB   1  
ATOM   3401   C CG   . TYR A 1 219 ? -8.151  -4.181  10.653  0.016 32.74 ? 217 TYR A CG   1  
ATOM   3402   C CD1  . TYR A 1 219 ? -7.582  -4.007  9.413   0.016 32.04 ? 217 TYR A CD1  1  
ATOM   3403   C CD2  . TYR A 1 219 ? -7.937  -5.403  11.295  0.016 33.67 ? 217 TYR A CD2  1  
ATOM   3404   C CE1  . TYR A 1 219 ? -6.879  -5.002  8.813   0.016 32.25 ? 217 TYR A CE1  1  
ATOM   3405   C CE2  . TYR A 1 219 ? -7.221  -6.413  10.685  0.016 33.81 ? 217 TYR A CE2  1  
ATOM   3406   C CZ   . TYR A 1 219 ? -6.714  -6.190  9.426   0.016 33.08 ? 217 TYR A CZ   1  
ATOM   3407   O OH   . TYR A 1 219 ? -5.977  -7.113  8.739   0.016 33.30 ? 217 TYR A OH   1  
ATOM   3408   H H    . TYR A 1 219 ? -8.395  -1.614  9.381   0.016 31.34 ? 217 TYR A H    1  
ATOM   3409   H HA   . TYR A 1 219 ? -10.618 -2.755  10.245  0.016 30.28 ? 217 TYR A HA   1  
ATOM   3410   H HB2  . TYR A 1 219 ? -8.236  -2.477  11.734  0.016 33.46 ? 217 TYR A HB2  1  
ATOM   3411   H HB3  . TYR A 1 219 ? -9.412  -3.476  12.060  0.016 33.12 ? 217 TYR A HB3  1  
ATOM   3412   H HD1  . TYR A 1 219 ? -7.695  -3.204  8.964   0.016 31.51 ? 217 TYR A HD1  1  
ATOM   3413   H HD2  . TYR A 1 219 ? -8.298  -5.544  12.142  0.016 34.27 ? 217 TYR A HD2  1  
ATOM   3414   H HE1  . TYR A 1 219 ? -6.520  -4.871  7.966   0.016 31.89 ? 217 TYR A HE1  1  
ATOM   3415   H HE2  . TYR A 1 219 ? -7.098  -7.227  11.113  0.016 34.49 ? 217 TYR A HE2  1  
ATOM   3416   H HH   . TYR A 1 219 ? -5.895  -6.876  7.937   0.016 32.68 ? 217 TYR A HH   1  
HETATM 3417   O O    . HOH B 2 .   ? -13.310 5.729   7.845   0.016 26.85 ? 301 HOH A O    1  
HETATM 3418   O O    . HOH B 2 .   ? -12.764 -1.032  13.533  0.016 32.02 ? 302 HOH A O    1  
HETATM 3419   O O    . HOH B 2 .   ? -32.540 15.158  -22.482 0.016 38.38 ? 303 HOH A O    1  
HETATM 3420   O O    . HOH B 2 .   ? -24.078 -0.007  2.913   0.016 20.24 ? 304 HOH A O    1  
HETATM 3421   O O    . HOH B 2 .   ? -23.271 -18.401 7.767   0.016 31.28 ? 305 HOH A O    1  
HETATM 3422   O O    . HOH B 2 .   ? -26.812 12.681  12.502  0.016 26.79 ? 306 HOH A O    1  
HETATM 3423   O O    . HOH B 2 .   ? -33.314 18.178  -13.228 0.016 28.08 ? 307 HOH A O    1  
HETATM 3424   O O    . HOH B 2 .   ? -6.613  -7.559  -5.126  0.016 30.45 ? 308 HOH A O    1  
HETATM 3425   O O    . HOH B 2 .   ? -17.299 -17.232 -3.117  0.016 28.57 ? 309 HOH A O    1  
HETATM 3426   O O    . HOH B 2 .   ? -38.675 5.309   5.714   0.016 25.13 ? 310 HOH A O    1  
HETATM 3427   O O    . HOH B 2 .   ? -20.250 21.693  -3.001  0.016 26.90 ? 311 HOH A O    1  
HETATM 3428   O O    . HOH B 2 .   ? -9.498  -9.598  5.780   0.016 29.68 ? 312 HOH A O    1  
HETATM 3429   O O    . HOH B 2 .   ? -32.464 12.885  13.249  0.016 27.94 ? 313 HOH A O    1  
HETATM 3430   O O    . HOH B 2 .   ? -19.060 -9.401  -16.978 0.016 32.59 ? 314 HOH A O    1  
HETATM 3431   O O    . HOH B 2 .   ? -7.887  -7.928  7.404   0.016 31.47 ? 315 HOH A O    1  
HETATM 3432   O O    . HOH B 2 .   ? -37.807 8.526   -17.789 0.016 33.37 ? 316 HOH A O    1  
HETATM 3433   O O    . HOH B 2 .   ? -40.212 17.743  -13.517 0.016 31.45 ? 317 HOH A O    1  
HETATM 3434   O O    . HOH B 2 .   ? -4.983  -9.235  1.422   0.016 31.97 ? 318 HOH A O    1  
HETATM 3435   O O    . HOH B 2 .   ? -34.268 19.656  -9.507  0.016 26.05 ? 319 HOH A O    1  
HETATM 3436   O O    . HOH B 2 .   ? -22.756 14.965  -0.351  0.016 21.86 ? 320 HOH A O    1  
HETATM 3437   O O    . HOH B 2 .   ? -17.316 -7.308  -17.239 0.016 32.34 ? 321 HOH A O    1  
HETATM 3438   O O    . HOH B 2 .   ? -14.326 9.178   -18.791 0.016 35.21 ? 322 HOH A O    1  
HETATM 3439   O O    . HOH B 2 .   ? -6.753  -3.502  -3.732  0.016 29.45 ? 323 HOH A O    1  
HETATM 3440   O O    . HOH B 2 .   ? -22.622 13.055  -18.187 0.016 32.09 ? 324 HOH A O    1  
HETATM 3441   O O    . HOH B 2 .   ? -13.115 -18.160 -8.653  0.016 32.62 ? 325 HOH A O    1  
HETATM 3442   O O    . HOH B 2 .   ? -20.592 -0.017  -4.095  0.016 20.69 ? 326 HOH A O    1  
HETATM 3443   O O    . HOH B 2 .   ? -22.516 17.497  -1.751  0.016 23.04 ? 327 HOH A O    1  
HETATM 3444   O O    . HOH B 2 .   ? -29.694 -2.693  -11.854 0.016 25.87 ? 328 HOH A O    1  
HETATM 3445   O O    . HOH B 2 .   ? -30.588 18.359  -5.348  0.016 23.67 ? 329 HOH A O    1  
HETATM 3446   O O    . HOH B 2 .   ? -12.683 -3.416  11.669  0.016 29.99 ? 330 HOH A O    1  
HETATM 3447   O O    . HOH B 2 .   ? -35.419 -0.427  -6.883  0.016 24.37 ? 331 HOH A O    1  
HETATM 3448   O O    . HOH B 2 .   ? -9.747  -12.205 -9.156  0.016 31.68 ? 332 HOH A O    1  
HETATM 3449   O O    . HOH B 2 .   ? -38.469 4.916   -14.683 0.016 30.52 ? 333 HOH A O    1  
HETATM 3450   O O    . HOH B 2 .   ? -15.177 -10.543 -18.088 0.016 36.14 ? 334 HOH A O    1  
HETATM 3451   O O    . HOH B 2 .   ? -3.545  0.401   -1.025  0.016 32.56 ? 335 HOH A O    1  
HETATM 3452   O O    . HOH B 2 .   ? -23.515 2.073   -9.311  0.016 22.16 ? 336 HOH A O    1  
HETATM 3453   O O    . HOH B 2 .   ? -6.302  10.531  -6.270  0.016 32.95 ? 337 HOH A O    1  
HETATM 3454   O O    . HOH B 2 .   ? -16.273 -11.900 -10.307 0.016 28.59 ? 338 HOH A O    1  
HETATM 3455   O O    . HOH B 2 .   ? -40.942 3.133   -8.167  0.016 27.88 ? 339 HOH A O    1  
HETATM 3456   O O    . HOH B 2 .   ? -39.679 14.603  1.521   0.016 24.73 ? 340 HOH A O    1  
HETATM 3457   O O    . HOH B 2 .   ? -13.558 -12.392 -10.616 0.016 30.07 ? 341 HOH A O    1  
HETATM 3458   O O    . HOH B 2 .   ? -39.129 20.557  -7.140  0.016 27.68 ? 342 HOH A O    1  
HETATM 3459   O O    . HOH B 2 .   ? -33.479 -3.860  -10.088 0.016 26.41 ? 343 HOH A O    1  
HETATM 3460   O O    . HOH B 2 .   ? -35.587 15.188  -18.941 0.016 34.95 ? 344 HOH A O    1  
HETATM 3461   O O    . HOH B 2 .   ? -32.321 0.100   4.935   0.016 22.25 ? 345 HOH A O    1  
HETATM 3462   O O    . HOH B 2 .   ? -31.623 7.247   -1.169  0.016 20.08 ? 346 HOH A O    1  
HETATM 3463   O O    . HOH B 2 .   ? -16.014 -19.080 -9.291  0.016 32.77 ? 347 HOH A O    1  
HETATM 3464   O O    . HOH B 2 .   ? -5.827  -6.360  -0.843  0.016 29.79 ? 348 HOH A O    1  
HETATM 3465   O O    . HOH B 2 .   ? -40.910 11.994  -15.700 0.016 33.11 ? 349 HOH A O    1  
HETATM 3466   O O    . HOH B 2 .   ? -23.235 -3.289  -16.442 0.016 29.45 ? 350 HOH A O    1  
HETATM 3467   O O    . HOH B 2 .   ? -27.264 21.175  8.650   0.016 27.46 ? 351 HOH A O    1  
HETATM 3468   O O    . HOH B 2 .   ? -22.384 3.679   10.038  0.016 24.14 ? 352 HOH A O    1  
HETATM 3469   O O    . HOH B 2 .   ? -27.643 15.382  -13.096 0.016 26.44 ? 353 HOH A O    1  
HETATM 3470   O O    . HOH B 2 .   ? -24.660 14.267  -2.523  0.016 21.18 ? 354 HOH A O    1  
HETATM 3471   O O    . HOH B 2 .   ? -24.326 22.027  -0.055  0.016 24.99 ? 355 HOH A O    1  
HETATM 3472   O O    . HOH B 2 .   ? -13.193 -6.277  0.272   0.016 24.60 ? 356 HOH A O    1  
HETATM 3473   O O    . HOH B 2 .   ? -9.138  -8.765  -10.715 0.016 31.44 ? 357 HOH A O    1  
HETATM 3474   O O    . HOH B 2 .   ? -26.242 -5.299  5.154   0.016 22.25 ? 358 HOH A O    1  
HETATM 3475   O O    . HOH B 2 .   ? -11.791 -1.778  -4.097  0.016 24.99 ? 359 HOH A O    1  
HETATM 3476   O O    . HOH B 2 .   ? -5.199  -6.156  -18.681 0.016 42.24 ? 360 HOH A O    1  
HETATM 3477   O O    . HOH B 2 .   ? -23.953 10.360  5.379   0.016 21.55 ? 361 HOH A O    1  
HETATM 3478   O O    . HOH B 2 .   ? -25.257 20.400  -3.860  0.016 24.21 ? 362 HOH A O    1  
HETATM 3479   O O    . HOH B 2 .   ? -10.644 -10.701 -2.941  0.016 27.73 ? 363 HOH A O    1  
HETATM 3480   O O    . HOH B 2 .   ? -18.846 -14.703 8.890   0.016 29.47 ? 364 HOH A O    1  
HETATM 3481   O O    . HOH B 2 .   ? -14.663 -17.680 -2.341  0.016 29.45 ? 365 HOH A O    1  
HETATM 3482   O O    . HOH B 2 .   ? -9.988  -12.106 7.892   0.016 31.32 ? 366 HOH A O    1  
HETATM 3483   O O    . HOH B 2 .   ? -32.032 19.193  -1.379  0.016 22.96 ? 367 HOH A O    1  
HETATM 3484   O O    . HOH B 2 .   ? -32.442 17.837  -7.591  0.016 24.04 ? 368 HOH A O    1  
HETATM 3485   O O    . HOH B 2 .   ? -39.352 1.835   -15.616 0.016 33.18 ? 369 HOH A O    1  
HETATM 3486   O O    . HOH B 2 .   ? -5.428  3.988   -9.016  0.016 32.92 ? 370 HOH A O    1  
HETATM 3487   O O    . HOH B 2 .   ? -28.688 24.172  -4.231  0.016 25.99 ? 371 HOH A O    1  
HETATM 3488   O O    . HOH B 2 .   ? -32.310 17.546  13.002  0.016 29.50 ? 372 HOH A O    1  
HETATM 3489   O O    . HOH B 2 .   ? -9.598  -6.404  9.223   0.016 30.70 ? 373 HOH A O    1  
HETATM 3490   O O    . HOH B 2 .   ? -35.247 0.378   -15.590 0.016 30.65 ? 374 HOH A O    1  
HETATM 3491   O O    . HOH B 2 .   ? -30.301 5.957   10.923  0.016 24.63 ? 375 HOH A O    1  
HETATM 3492   O O    . HOH B 2 .   ? -45.247 16.060  4.915   0.016 30.16 ? 376 HOH A O    1  
HETATM 3493   O O    . HOH B 2 .   ? -27.979 7.530   10.704  0.016 23.88 ? 377 HOH A O    1  
HETATM 3494   O O    . HOH B 2 .   ? -32.867 18.097  -18.511 0.016 33.93 ? 378 HOH A O    1  
HETATM 3495   O O    . HOH B 2 .   ? -31.622 28.117  3.396   0.016 29.32 ? 379 HOH A O    1  
HETATM 3496   O O    . HOH B 2 .   ? -12.468 -16.657 1.146   0.016 29.75 ? 380 HOH A O    1  
HETATM 3497   O O    . HOH B 2 .   ? -43.095 10.703  -14.125 0.016 33.12 ? 381 HOH A O    1  
HETATM 3498   O O    . HOH B 2 .   ? -5.113  -3.995  -1.740  0.016 30.69 ? 382 HOH A O    1  
HETATM 3499   O O    . HOH B 2 .   ? -14.931 -11.489 9.800   0.016 29.47 ? 383 HOH A O    1  
HETATM 3500   O O    . HOH B 2 .   ? -16.094 -3.482  11.762  0.016 28.05 ? 384 HOH A O    1  
HETATM 3501   O O    . HOH B 2 .   ? -18.202 4.285   -4.969  0.016 21.62 ? 385 HOH A O    1  
HETATM 3502   O O    . HOH B 2 .   ? -6.879  -8.193  -2.604  0.016 29.82 ? 386 HOH A O    1  
HETATM 3503   O O    . HOH B 2 .   ? -21.434 19.554  2.798   0.016 25.11 ? 387 HOH A O    1  
HETATM 3504   O O    . HOH B 2 .   ? -33.520 -3.730  4.674   0.016 23.91 ? 388 HOH A O    1  
HETATM 3505   O O    . HOH B 2 .   ? -4.120  0.758   -3.011  0.016 31.32 ? 389 HOH A O    1  
HETATM 3506   O O    . HOH B 2 .   ? -6.645  -0.657  -3.505  0.016 29.27 ? 390 HOH A O    1  
HETATM 3507   O O    . HOH B 2 .   ? -28.144 19.908  -2.347  0.016 23.14 ? 391 HOH A O    1  
HETATM 3508   O O    . HOH B 2 .   ? -22.795 17.114  -16.158 0.016 30.96 ? 392 HOH A O    1  
HETATM 3509   O O    . HOH B 2 .   ? -38.912 13.486  -12.357 0.016 28.52 ? 393 HOH A O    1  
HETATM 3510   O O    . HOH B 2 .   ? -16.972 -14.677 -3.856  0.016 27.10 ? 394 HOH A O    1  
HETATM 3511   O O    . HOH B 2 .   ? -40.949 3.173   -13.583 0.016 31.56 ? 395 HOH A O    1  
HETATM 3512   O O    . HOH B 2 .   ? -22.038 20.727  -12.935 0.016 29.98 ? 396 HOH A O    1  
HETATM 3513   O O    . HOH B 2 .   ? -32.075 23.537  -7.032  0.016 26.48 ? 397 HOH A O    1  
HETATM 3514   O O    . HOH B 2 .   ? -35.046 21.854  -16.247 0.016 33.37 ? 398 HOH A O    1  
HETATM 3515   O O    . HOH B 2 .   ? -43.802 17.389  -2.487  0.016 28.37 ? 399 HOH A O    1  
HETATM 3516   O O    . HOH B 2 .   ? -30.373 20.542  -3.388  0.016 23.40 ? 400 HOH A O    1  
HETATM 3517   O O    . HOH B 2 .   ? -44.630 2.628   -13.936 0.016 35.81 ? 401 HOH A O    1  
HETATM 3518   O O    . HOH B 2 .   ? -44.955 5.975   4.679   0.016 29.35 ? 402 HOH A O    1  
HETATM 3519   O O    . HOH B 2 .   ? -11.882 -13.139 12.214  0.016 33.67 ? 403 HOH A O    1  
HETATM 3520   O O    . HOH B 2 .   ? -39.149 20.664  -9.542  0.016 28.98 ? 404 HOH A O    1  
HETATM 3521   O O    . HOH B 2 .   ? -28.590 -7.111  -7.684  0.016 24.15 ? 405 HOH A O    1  
HETATM 3522   O O    . HOH B 2 .   ? -29.294 -8.923  1.230   0.016 23.98 ? 406 HOH A O    1  
HETATM 3523   O O    . HOH B 2 .   ? -33.140 15.299  -24.952 0.016 43.37 ? 407 HOH A O    1  
HETATM 3524   O O    . HOH B 2 .   ? -37.914 11.087  13.271  0.016 29.88 ? 408 HOH A O    1  
HETATM 3525   O O    . HOH B 2 .   ? -34.608 17.947  11.821  0.016 29.05 ? 409 HOH A O    1  
HETATM 3526   O O    . HOH B 2 .   ? -39.963 10.337  -17.886 0.016 34.98 ? 410 HOH A O    1  
HETATM 3527   O O    . HOH B 2 .   ? -19.692 11.588  10.791  0.016 26.47 ? 411 HOH A O    1  
HETATM 3528   O O    . HOH B 2 .   ? -33.757 21.987  -7.721  0.016 26.40 ? 412 HOH A O    1  
HETATM 3529   O O    . HOH B 2 .   ? -24.446 -12.964 -9.897  0.016 28.14 ? 413 HOH A O    1  
HETATM 3530   O O    . HOH B 2 .   ? -42.602 3.846   -12.759 0.016 32.78 ? 414 HOH A O    1  
HETATM 3531   O O    . HOH B 2 .   ? -30.720 -10.272 -0.035  0.016 24.95 ? 415 HOH A O    1  
HETATM 3532   O O    . HOH B 2 .   ? -41.750 10.742  11.508  0.016 30.68 ? 416 HOH A O    1  
HETATM 3533   O O    . HOH B 2 .   ? -39.538 8.065   -24.471 0.016 44.56 ? 417 HOH A O    1  
HETATM 3534   O O    . HOH B 2 .   ? -3.262  1.769   2.035   0.016 32.84 ? 418 HOH A O    1  
HETATM 3535   O O    . HOH B 2 .   ? -25.955 -12.451 7.342   0.016 27.11 ? 419 HOH A O    1  
HETATM 3536   O O    . HOH B 2 .   ? -40.320 2.924   6.039   0.016 26.88 ? 420 HOH A O    1  
HETATM 3537   O O    . HOH B 2 .   ? -23.801 7.151   4.369   0.016 20.58 ? 421 HOH A O    1  
HETATM 3538   O O    . HOH B 2 .   ? -14.259 -14.141 8.361   0.016 30.19 ? 422 HOH A O    1  
HETATM 3539   O O    . HOH B 2 .   ? -30.334 -3.578  -15.974 0.016 30.09 ? 423 HOH A O    1  
HETATM 3540   O O    . HOH B 2 .   ? -16.330 18.311  -1.426  0.016 26.82 ? 424 HOH A O    1  
HETATM 3541   O O    . HOH B 2 .   ? -16.408 -15.744 5.141   0.016 28.54 ? 425 HOH A O    1  
HETATM 3542   O O    . HOH B 2 .   ? -18.781 -8.721  12.242  0.016 29.02 ? 426 HOH A O    1  
ATOM   3543   N N    . SER A 1 6   ? -3.307  -4.655  -13.013 0.016 37.90 ? 2   SER A N    2  
ATOM   3544   C CA   . SER A 1 6   ? -3.241  -5.894  -13.781 0.016 38.80 ? 2   SER A CA   2  
ATOM   3545   C C    . SER A 1 6   ? -4.671  -6.364  -13.881 0.016 37.45 ? 2   SER A C    2  
ATOM   3546   O O    . SER A 1 6   ? -5.106  -7.183  -13.072 0.016 36.45 ? 2   SER A O    2  
ATOM   3547   C CB   . SER A 1 6   ? -2.335  -6.924  -13.098 0.016 39.38 ? 2   SER A CB   2  
ATOM   3548   O OG   . SER A 1 6   ? -1.882  -7.978  -13.975 0.016 40.84 ? 2   SER A OG   2  
ATOM   3549   H HA   . SER A 1 6   ? -2.902  -5.719  -14.674 0.016 40.00 ? 2   SER A HA   2  
ATOM   3550   H HB2  . SER A 1 6   ? -1.558  -6.458  -12.755 0.016 39.98 ? 2   SER A HB2  2  
ATOM   3551   H HB3  . SER A 1 6   ? -2.822  -7.319  -12.359 0.016 38.28 ? 2   SER A HB3  2  
ATOM   3552   H HG   . SER A 1 6   ? -2.536  -8.331  -14.367 0.016 40.48 ? 2   SER A HG   2  
ATOM   3553   N N    . VAL A 1 7   ? -5.352  -5.813  -14.899 0.016 37.65 ? 3   VAL A N    2  
ATOM   3554   C CA   . VAL A 1 7   ? -6.807  -5.886  -15.135 0.016 36.52 ? 3   VAL A CA   2  
ATOM   3555   C C    . VAL A 1 7   ? -7.483  -4.562  -14.810 0.016 35.34 ? 3   VAL A C    2  
ATOM   3556   O O    . VAL A 1 7   ? -8.047  -3.936  -15.725 0.016 35.68 ? 3   VAL A O    2  
ATOM   3557   C CB   . VAL A 1 7   ? -7.522  -7.034  -14.401 0.016 35.42 ? 3   VAL A CB   2  
ATOM   3558   C CG1  . VAL A 1 7   ? -9.083  -6.794  -14.349 0.016 34.03 ? 3   VAL A CG1  2  
ATOM   3559   C CG2  . VAL A 1 7   ? -7.217  -8.360  -15.109 0.016 36.75 ? 3   VAL A CG2  2  
ATOM   3560   H H    . VAL A 1 7   ? -4.959  -5.349  -15.505 0.016 38.60 ? 3   VAL A H    2  
ATOM   3561   H HA   . VAL A 1 7   ? -6.950  -6.036  -16.082 0.016 37.42 ? 3   VAL A HA   2  
ATOM   3562   H HB   . VAL A 1 7   ? -7.214  -7.090  -13.489 0.016 34.84 ? 3   VAL A HB   2  
ATOM   3563   H HG11 . VAL A 1 7   ? -9.530  -7.606  -14.067 0.016 33.64 ? 3   VAL A HG11 2  
ATOM   3564   H HG12 . VAL A 1 7   ? -9.274  -6.091  -13.712 0.016 33.11 ? 3   VAL A HG12 2  
ATOM   3565   H HG13 . VAL A 1 7   ? -9.396  -6.542  -15.231 0.016 34.61 ? 3   VAL A HG13 2  
ATOM   3566   H HG21 . VAL A 1 7   ? -8.024  -8.681  -15.538 0.016 36.64 ? 3   VAL A HG21 2  
ATOM   3567   H HG22 . VAL A 1 7   ? -6.532  -8.210  -15.778 0.016 38.01 ? 3   VAL A HG22 2  
ATOM   3568   H HG23 . VAL A 1 7   ? -6.902  -9.008  -14.459 0.016 36.56 ? 3   VAL A HG23 2  
ATOM   3569   N N    . ILE A 1 8   ? -7.427  -4.089  -13.566 0.016 34.13 ? 4   ILE A N    2  
ATOM   3570   C CA   . ILE A 1 8   ? -7.782  -2.698  -13.275 0.016 33.39 ? 4   ILE A CA   2  
ATOM   3571   C C    . ILE A 1 8   ? -6.518  -1.864  -13.442 0.016 34.68 ? 4   ILE A C    2  
ATOM   3572   O O    . ILE A 1 8   ? -5.490  -2.150  -12.824 0.016 35.20 ? 4   ILE A O    2  
ATOM   3573   C CB   . ILE A 1 8   ? -8.376  -2.513  -11.870 0.016 31.69 ? 4   ILE A CB   2  
ATOM   3574   C CG1  . ILE A 1 8   ? -9.618  -3.382  -11.657 0.016 30.58 ? 4   ILE A CG1  2  
ATOM   3575   C CG2  . ILE A 1 8   ? -8.698  -1.006  -11.611 0.016 31.12 ? 4   ILE A CG2  2  
ATOM   3576   C CD1  . ILE A 1 8   ? -10.600 -3.347  -12.757 0.016 30.70 ? 4   ILE A CD1  2  
ATOM   3577   H H    . ILE A 1 8   ? -7.189  -4.543  -12.877 0.016 33.81 ? 4   ILE A H    2  
ATOM   3578   H HA   . ILE A 1 8   ? -8.426  -2.389  -13.929 0.016 33.37 ? 4   ILE A HA   2  
ATOM   3579   H HB   . ILE A 1 8   ? -7.713  -2.789  -11.220 0.016 31.83 ? 4   ILE A HB   2  
ATOM   3580   H HG12 . ILE A 1 8   ? -9.335  -4.303  -11.544 0.016 30.85 ? 4   ILE A HG12 2  
ATOM   3581   H HG13 . ILE A 1 8   ? -10.072 -3.088  -10.853 0.016 29.59 ? 4   ILE A HG13 2  
ATOM   3582   H HG21 . ILE A 1 8   ? -7.992  -0.616  -11.073 0.016 31.32 ? 4   ILE A HG21 2  
ATOM   3583   H HG22 . ILE A 1 8   ? -8.758  -0.542  -12.459 0.016 31.74 ? 4   ILE A HG22 2  
ATOM   3584   H HG23 . ILE A 1 8   ? -9.543  -0.939  -11.136 0.016 30.05 ? 4   ILE A HG23 2  
ATOM   3585   H HD11 . ILE A 1 8   ? -10.200 -3.705  -13.564 0.016 31.76 ? 4   ILE A HD11 2  
ATOM   3586   H HD12 . ILE A 1 8   ? -11.368 -3.885  -12.505 0.016 30.02 ? 4   ILE A HD12 2  
ATOM   3587   H HD13 . ILE A 1 8   ? -10.873 -2.427  -12.900 0.016 30.52 ? 4   ILE A HD13 2  
ATOM   3588   N N    . LYS A 1 9   ? -6.591  -0.830  -14.269 0.016 35.34 ? 5   LYS A N    2  
ATOM   3589   C CA   . LYS A 1 9   ? -5.466  0.086   -14.418 0.016 36.65 ? 5   LYS A CA   2  
ATOM   3590   C C    . LYS A 1 9   ? -5.578  1.200   -13.384 0.016 35.66 ? 5   LYS A C    2  
ATOM   3591   O O    . LYS A 1 9   ? -6.647  1.409   -12.819 0.016 34.08 ? 5   LYS A O    2  
ATOM   3592   C CB   . LYS A 1 9   ? -5.426  0.655   -15.835 0.016 38.15 ? 5   LYS A CB   2  
ATOM   3593   C CG   . LYS A 1 9   ? -5.065  -0.374  -16.934 0.016 39.68 ? 5   LYS A CG   2  
ATOM   3594   C CD   . LYS A 1 9   ? -4.212  -1.548  -16.422 0.016 40.07 ? 5   LYS A CD   2  
ATOM   3595   C CE   . LYS A 1 9   ? -3.899  -2.559  -17.520 0.016 41.65 ? 5   LYS A CE   2  
ATOM   3596   N NZ   . LYS A 1 9   ? -3.454  -3.871  -16.945 0.016 41.60 ? 5   LYS A NZ   2  
ATOM   3597   H H    . LYS A 1 9   ? -7.274  -0.644  -14.755 0.016 35.14 ? 5   LYS A H    2  
ATOM   3598   H HA   . LYS A 1 9   ? -4.642  -0.389  -14.238 0.016 37.35 ? 5   LYS A HA   2  
ATOM   3599   H HB2  . LYS A 1 9   ? -6.300  1.011   -16.049 0.016 37.49 ? 5   LYS A HB2  2  
ATOM   3600   H HB3  . LYS A 1 9   ? -4.770  1.366   -15.865 0.016 38.96 ? 5   LYS A HB3  2  
ATOM   3601   H HG2  . LYS A 1 9   ? -5.888  -0.737  -17.301 0.016 39.21 ? 5   LYS A HG2  2  
ATOM   3602   H HG3  . LYS A 1 9   ? -4.562  0.072   -17.634 0.016 41.05 ? 5   LYS A HG3  2  
ATOM   3603   H HD2  . LYS A 1 9   ? -3.375  -1.211  -16.068 0.016 40.69 ? 5   LYS A HD2  2  
ATOM   3604   H HD3  . LYS A 1 9   ? -4.702  -2.020  -15.730 0.016 38.81 ? 5   LYS A HD3  2  
ATOM   3605   H HE2  . LYS A 1 9   ? -4.697  -2.714  -18.050 0.016 41.36 ? 5   LYS A HE2  2  
ATOM   3606   H HE3  . LYS A 1 9   ? -3.184  -2.215  -18.079 0.016 43.13 ? 5   LYS A HE3  2  
ATOM   3607   H HZ1  . LYS A 1 9   ? -3.965  -4.079  -16.250 0.016 40.28 ? 5   LYS A HZ1  2  
ATOM   3608   H HZ2  . LYS A 1 9   ? -3.521  -4.514  -17.554 0.016 42.26 ? 5   LYS A HZ2  2  
ATOM   3609   H HZ3  . LYS A 1 9   ? -2.609  -3.813  -16.671 0.016 42.30 ? 5   LYS A HZ3  2  
ATOM   3610   N N    . PRO A 1 10  ? -4.473  1.876   -13.055 0.016 36.66 ? 6   PRO A N    2  
ATOM   3611   C CA   . PRO A 1 10  ? -4.552  2.871   -11.969 0.016 35.83 ? 6   PRO A CA   2  
ATOM   3612   C C    . PRO A 1 10  ? -5.449  4.045   -12.316 0.016 35.31 ? 6   PRO A C    2  
ATOM   3613   O O    . PRO A 1 10  ? -5.739  4.878   -11.447 0.016 34.50 ? 6   PRO A O    2  
ATOM   3614   C CB   . PRO A 1 10  ? -3.101  3.316   -11.765 0.016 37.48 ? 6   PRO A CB   2  
ATOM   3615   C CG   . PRO A 1 10  ? -2.240  2.327   -12.557 0.016 38.99 ? 6   PRO A CG   2  
ATOM   3616   C CD   . PRO A 1 10  ? -3.120  1.770   -13.632 0.016 38.74 ? 6   PRO A CD   2  
ATOM   3617   H HA   . PRO A 1 10  ? -4.874  2.450   -11.156 0.016 34.79 ? 6   PRO A HA   2  
ATOM   3618   H HB2  . PRO A 1 10  ? -2.990  4.216   -12.107 0.016 38.07 ? 6   PRO A HB2  2  
ATOM   3619   H HB3  . PRO A 1 10  ? -2.891  3.284   -10.818 0.016 37.04 ? 6   PRO A HB3  2  
ATOM   3620   H HG2  . PRO A 1 10  ? -1.492  2.804   -12.945 0.016 40.37 ? 6   PRO A HG2  2  
ATOM   3621   H HG3  . PRO A 1 10  ? -1.929  1.618   -11.972 0.016 38.81 ? 6   PRO A HG3  2  
ATOM   3622   H HD2  . PRO A 1 10  ? -3.046  2.297   -14.442 0.016 39.65 ? 6   PRO A HD2  2  
ATOM   3623   H HD3  . PRO A 1 10  ? -2.894  0.841   -13.794 0.016 39.06 ? 6   PRO A HD3  2  
ATOM   3624   N N    . GLU A 1 11  ? -5.876  4.139   -13.569 0.016 35.93 ? 7   GLU A N    2  
ATOM   3625   C CA   . GLU A 1 11  ? -6.889  5.085   -14.000 0.016 35.46 ? 7   GLU A CA   2  
ATOM   3626   C C    . GLU A 1 11  ? -7.938  4.275   -14.752 0.016 34.98 ? 7   GLU A C    2  
ATOM   3627   O O    . GLU A 1 11  ? -7.607  3.578   -15.716 0.016 36.19 ? 7   GLU A O    2  
ATOM   3628   C CB   . GLU A 1 11  ? -6.268  6.198   -14.871 0.016 37.23 ? 7   GLU A CB   2  
ATOM   3629   C CG   . GLU A 1 11  ? -7.101  7.478   -15.039 0.016 36.89 ? 7   GLU A CG   2  
ATOM   3630   C CD   . GLU A 1 11  ? -6.899  8.504   -13.920 0.016 36.29 ? 7   GLU A CD   2  
ATOM   3631   O OE1  . GLU A 1 11  ? -6.082  9.439   -14.075 0.016 37.63 ? 7   GLU A OE1  2  
ATOM   3632   O OE2  . GLU A 1 11  ? -7.601  8.392   -12.894 0.016 34.58 ? 7   GLU A OE2  2  
ATOM   3633   H H    . GLU A 1 11  ? -5.587  3.647   -14.208 0.016 36.74 ? 7   GLU A H    2  
ATOM   3634   H HA   . GLU A 1 11  ? -7.306  5.486   -13.222 0.016 34.42 ? 7   GLU A HA   2  
ATOM   3635   H HB2  . GLU A 1 11  ? -5.424  6.462   -14.474 0.016 37.83 ? 7   GLU A HB2  2  
ATOM   3636   H HB3  . GLU A 1 11  ? -6.111  5.837   -15.756 0.016 38.22 ? 7   GLU A HB3  2  
ATOM   3637   H HG2  . GLU A 1 11  ? -6.840  7.908   -15.872 0.016 38.18 ? 7   GLU A HG2  2  
ATOM   3638   H HG3  . GLU A 1 11  ? -8.042  7.241   -15.066 0.016 35.92 ? 7   GLU A HG3  2  
ATOM   3639   N N    . MET A 1 12  ? -9.182  4.308   -14.272 0.016 33.34 ? 8   MET A N    2  
ATOM   3640   C CA   . MET A 1 12  ? -10.304 3.673   -14.947 0.016 32.93 ? 8   MET A CA   2  
ATOM   3641   C C    . MET A 1 12  ? -11.360 4.714   -15.268 0.016 32.52 ? 8   MET A C    2  
ATOM   3642   O O    . MET A 1 12  ? -11.621 5.605   -14.461 0.016 31.65 ? 8   MET A O    2  
ATOM   3643   C CB   . MET A 1 12  ? -10.938 2.577   -14.092 0.016 31.50 ? 8   MET A CB   2  
ATOM   3644   C CG   . MET A 1 12  ? -10.139 1.279   -13.984 0.016 31.98 ? 8   MET A CG   2  
ATOM   3645   S SD   . MET A 1 12  ? -10.034 0.390   -15.547 0.016 33.58 ? 8   MET A SD   2  
ATOM   3646   C CE   . MET A 1 12  ? -11.704 -0.289  -15.679 0.016 32.43 ? 8   MET A CE   2  
ATOM   3647   H H    . MET A 1 12  ? -9.402  4.696   -13.537 0.016 32.52 ? 8   MET A H    2  
ATOM   3648   H HA   . MET A 1 12  ? -10.003 3.279   -15.778 0.016 34.00 ? 8   MET A HA   2  
ATOM   3649   H HB2  . MET A 1 12  ? -11.053 2.919   -13.192 0.016 30.61 ? 8   MET A HB2  2  
ATOM   3650   H HB3  . MET A 1 12  ? -11.801 2.361   -14.479 0.016 31.20 ? 8   MET A HB3  2  
ATOM   3651   H HG2  . MET A 1 12  ? -9.235  1.485   -13.699 0.016 32.52 ? 8   MET A HG2  2  
ATOM   3652   H HG3  . MET A 1 12  ? -10.562 0.695   -13.340 0.016 31.04 ? 8   MET A HG3  2  
ATOM   3653   H HE1  . MET A 1 12  ? -11.691 -1.057  -16.277 0.016 33.13 ? 8   MET A HE1  2  
ATOM   3654   H HE2  . MET A 1 12  ? -12.002 -0.569  -14.798 0.016 31.34 ? 8   MET A HE2  2  
ATOM   3655   H HE3  . MET A 1 12  ? -12.300 0.393   -16.023 0.016 32.33 ? 8   MET A HE3  2  
ATOM   3656   N N    . LYS A 1 13  ? -11.955 4.593   -16.447 0.016 33.28 ? 9   LYS A N    2  
ATOM   3657   C CA   . LYS A 1 13  ? -13.112 5.391   -16.821 0.016 32.96 ? 9   LYS A CA   2  
ATOM   3658   C C    . LYS A 1 13  ? -14.402 4.745   -16.309 0.016 31.45 ? 9   LYS A C    2  
ATOM   3659   O O    . LYS A 1 13  ? -14.446 3.568   -15.938 0.016 30.92 ? 9   LYS A O    2  
ATOM   3660   C CB   . LYS A 1 13  ? -13.172 5.537   -18.342 0.016 34.75 ? 9   LYS A CB   2  
ATOM   3661   C CG   . LYS A 1 13  ? -11.971 6.226   -18.938 0.016 36.50 ? 9   LYS A CG   2  
ATOM   3662   C CD   . LYS A 1 13  ? -12.057 6.247   -20.448 0.016 38.45 ? 9   LYS A CD   2  
ATOM   3663   C CE   . LYS A 1 13  ? -10.712 6.535   -21.073 0.016 40.47 ? 9   LYS A CE   2  
ATOM   3664   N NZ   . LYS A 1 13  ? -10.813 6.406   -22.542 0.016 42.54 ? 9   LYS A NZ   2  
ATOM   3665   H H    . LYS A 1 13  ? -11.701 4.052   -17.064 0.016 34.09 ? 9   LYS A H    2  
ATOM   3666   H HA   . LYS A 1 13  ? -13.028 6.273   -16.430 0.016 32.72 ? 9   LYS A HA   2  
ATOM   3667   H HB2  . LYS A 1 13  ? -13.226 4.655   -18.741 0.016 35.09 ? 9   LYS A HB2  2  
ATOM   3668   H HB3  . LYS A 1 13  ? -13.963 6.051   -18.574 0.016 34.58 ? 9   LYS A HB3  2  
ATOM   3669   H HG2  . LYS A 1 13  ? -11.940 7.141   -18.619 0.016 36.30 ? 9   LYS A HG2  2  
ATOM   3670   H HG3  . LYS A 1 13  ? -11.164 5.751   -18.683 0.016 36.72 ? 9   LYS A HG3  2  
ATOM   3671   H HD2  . LYS A 1 13  ? -12.367 5.386   -20.765 0.016 38.51 ? 9   LYS A HD2  2  
ATOM   3672   H HD3  . LYS A 1 13  ? -12.669 6.947   -20.725 0.016 38.53 ? 9   LYS A HD3  2  
ATOM   3673   H HE2  . LYS A 1 13  ? -10.436 7.438   -20.857 0.016 40.63 ? 9   LYS A HE2  2  
ATOM   3674   H HE3  . LYS A 1 13  ? -10.057 5.895   -20.752 0.016 40.42 ? 9   LYS A HE3  2  
ATOM   3675   H HZ1  . LYS A 1 13  ? -10.857 7.212   -22.919 0.016 43.26 ? 9   LYS A HZ1  2  
ATOM   3676   H HZ2  . LYS A 1 13  ? -10.099 5.975   -22.856 0.016 43.54 ? 9   LYS A HZ2  2  
ATOM   3677   H HZ3  . LYS A 1 13  ? -11.544 5.944   -22.754 0.016 42.18 ? 9   LYS A HZ3  2  
ATOM   3678   N N    . ILE A 1 14  ? -15.472 5.532   -16.311 0.016 30.92 ? 10  ILE A N    2  
ATOM   3679   C CA   . ILE A 1 14  ? -16.788 5.093   -15.869 0.016 29.69 ? 10  ILE A CA   2  
ATOM   3680   C C    . ILE A 1 14  ? -17.840 5.599   -16.839 0.016 30.31 ? 10  ILE A C    2  
ATOM   3681   O O    . ILE A 1 14  ? -17.829 6.779   -17.211 0.016 30.89 ? 10  ILE A O    2  
ATOM   3682   C CB   . ILE A 1 14  ? -17.116 5.616   -14.458 0.016 28.14 ? 10  ILE A CB   2  
ATOM   3683   C CG1  . ILE A 1 14  ? -16.131 5.086   -13.430 0.016 27.64 ? 10  ILE A CG1  2  
ATOM   3684   C CG2  . ILE A 1 14  ? -18.543 5.251   -14.084 0.016 27.11 ? 10  ILE A CG2  2  
ATOM   3685   C CD1  . ILE A 1 14  ? -16.309 5.729   -12.125 0.016 26.48 ? 10  ILE A CD1  2  
ATOM   3686   H H    . ILE A 1 14  ? -15.453 6.355   -16.563 0.016 31.33 ? 10  ILE A H    2  
ATOM   3687   H HA   . ILE A 1 14  ? -16.819 4.125   -15.856 0.016 29.59 ? 10  ILE A HA   2  
ATOM   3688   H HB   . ILE A 1 14  ? -17.044 6.579   -14.478 0.016 28.31 ? 10  ILE A HB   2  
ATOM   3689   H HG12 . ILE A 1 14  ? -16.271 4.134   -13.316 0.016 27.42 ? 10  ILE A HG12 2  
ATOM   3690   H HG13 . ILE A 1 14  ? -15.226 5.262   -13.730 0.016 28.43 ? 10  ILE A HG13 2  
ATOM   3691   H HG21 . ILE A 1 14  ? -18.685 5.432   -13.144 0.016 26.21 ? 10  ILE A HG21 2  
ATOM   3692   H HG22 . ILE A 1 14  ? -19.163 5.774   -14.614 0.016 27.42 ? 10  ILE A HG22 2  
ATOM   3693   H HG23 . ILE A 1 14  ? -18.681 4.309   -14.262 0.016 27.17 ? 10  ILE A HG23 2  
ATOM   3694   H HD11 . ILE A 1 14  ? -16.747 5.099   -11.535 0.016 25.75 ? 10  ILE A HD11 2  
ATOM   3695   H HD12 . ILE A 1 14  ? -15.447 5.989   -11.764 0.016 26.71 ? 10  ILE A HD12 2  
ATOM   3696   H HD13 . ILE A 1 14  ? -16.858 6.520   -12.244 0.016 26.37 ? 10  ILE A HD13 2  
ATOM   3697   N N    . LYS A 1 15  ? -18.747 4.715   -17.239 0.016 30.33 ? 11  LYS A N    2  
ATOM   3698   C CA   . LYS A 1 15  ? -19.996 5.081   -17.898 0.016 30.71 ? 11  LYS A CA   2  
ATOM   3699   C C    . LYS A 1 15  ? -21.135 4.422   -17.145 0.016 29.48 ? 11  LYS A C    2  
ATOM   3700   O O    . LYS A 1 15  ? -21.026 3.257   -16.736 0.016 29.04 ? 11  LYS A O    2  
ATOM   3701   C CB   . LYS A 1 15  ? -20.063 4.645   -19.383 0.016 32.57 ? 11  LYS A CB   2  
ATOM   3702   C CG   . LYS A 1 15  ? -21.548 4.545   -19.933 0.016 32.94 ? 11  LYS A CG   2  
ATOM   3703   C CD   . LYS A 1 15  ? -22.139 3.103   -19.823 0.016 32.70 ? 11  LYS A CD   2  
ATOM   3704   C CE   . LYS A 1 15  ? -23.681 2.974   -19.742 0.016 32.41 ? 11  LYS A CE   2  
ATOM   3705   N NZ   . LYS A 1 15  ? -24.151 1.905   -18.752 0.016 31.16 ? 11  LYS A NZ   2  
ATOM   3706   H H    . LYS A 1 15  ? -18.666 3.872   -17.124 0.016 30.19 ? 11  LYS A H    2  
ATOM   3707   H HA   . LYS A 1 15  ? -20.120 6.040   -17.855 0.016 30.68 ? 11  LYS A HA   2  
ATOM   3708   H HB2  . LYS A 1 15  ? -19.574 5.282   -19.926 0.016 33.49 ? 11  LYS A HB2  2  
ATOM   3709   H HB3  . LYS A 1 15  ? -19.657 3.769   -19.468 0.016 32.80 ? 11  LYS A HB3  2  
ATOM   3710   H HG2  . LYS A 1 15  ? -22.122 5.145   -19.433 0.016 32.15 ? 11  LYS A HG2  2  
ATOM   3711   H HG3  . LYS A 1 15  ? -21.552 4.796   -20.870 0.016 34.26 ? 11  LYS A HG3  2  
ATOM   3712   H HD2  . LYS A 1 15  ? -21.891 2.654   -20.640 0.016 33.92 ? 11  LYS A HD2  2  
ATOM   3713   H HD3  . LYS A 1 15  ? -21.760 2.656   -19.051 0.016 31.76 ? 11  LYS A HD3  2  
ATOM   3714   H HE2  . LYS A 1 15  ? -24.053 3.828   -19.465 0.016 31.96 ? 11  LYS A HE2  2  
ATOM   3715   H HE3  . LYS A 1 15  ? -24.023 2.733   -20.616 0.016 33.63 ? 11  LYS A HE3  2  
ATOM   3716   H HZ1  . LYS A 1 15  ? -24.051 2.199   -17.917 0.016 30.07 ? 11  LYS A HZ1  2  
ATOM   3717   H HZ2  . LYS A 1 15  ? -25.009 1.715   -18.889 0.016 31.34 ? 11  LYS A HZ2  2  
ATOM   3718   H HZ3  . LYS A 1 15  ? -23.678 1.158   -18.852 0.016 31.41 ? 11  LYS A HZ3  2  
ATOM   3719   N N    . LEU A 1 16  ? -22.225 5.156   -16.952 0.016 29.03 ? 12  LEU A N    2  
ATOM   3720   C CA   . LEU A 1 16  ? -23.363 4.604   -16.236 0.016 28.03 ? 12  LEU A CA   2  
ATOM   3721   C C    . LEU A 1 16  ? -24.663 5.150   -16.786 0.016 28.53 ? 12  LEU A C    2  
ATOM   3722   O O    . LEU A 1 16  ? -24.709 6.208   -17.429 0.016 29.30 ? 12  LEU A O    2  
ATOM   3723   C CB   . LEU A 1 16  ? -23.303 4.890   -14.732 0.016 26.46 ? 12  LEU A CB   2  
ATOM   3724   C CG   . LEU A 1 16  ? -23.430 6.364   -14.318 0.016 26.08 ? 12  LEU A CG   2  
ATOM   3725   C CD1  . LEU A 1 16  ? -24.866 6.784   -14.022 0.016 25.66 ? 12  LEU A CD1  2  
ATOM   3726   C CD2  . LEU A 1 16  ? -22.539 6.633   -13.109 0.016 25.14 ? 12  LEU A CD2  2  
ATOM   3727   H H    . LEU A 1 16  ? -22.326 5.960   -17.232 0.016 29.38 ? 12  LEU A H    2  
ATOM   3728   H HA   . LEU A 1 16  ? -23.380 3.640   -16.350 0.016 28.18 ? 12  LEU A HA   2  
ATOM   3729   H HB2  . LEU A 1 16  ? -24.033 4.414   -14.307 0.016 25.95 ? 12  LEU A HB2  2  
ATOM   3730   H HB3  . LEU A 1 16  ? -22.457 4.557   -14.393 0.016 26.25 ? 12  LEU A HB3  2  
ATOM   3731   H HG   . LEU A 1 16  ? -23.114 6.910   -15.052 0.016 26.90 ? 12  LEU A HG   2  
ATOM   3732   H HD11 . LEU A 1 16  ? -24.903 7.752   -13.994 0.016 25.70 ? 12  LEU A HD11 2  
ATOM   3733   H HD12 . LEU A 1 16  ? -25.455 6.455   -14.716 0.016 26.29 ? 12  LEU A HD12 2  
ATOM   3734   H HD13 . LEU A 1 16  ? -25.133 6.427   -13.162 0.016 24.84 ? 12  LEU A HD13 2  
ATOM   3735   H HD21 . LEU A 1 16  ? -22.463 7.594   -12.997 0.016 25.16 ? 12  LEU A HD21 2  
ATOM   3736   H HD22 . LEU A 1 16  ? -22.941 6.246   -12.316 0.016 24.36 ? 12  LEU A HD22 2  
ATOM   3737   H HD23 . LEU A 1 16  ? -21.660 6.255   -13.264 0.016 25.44 ? 12  LEU A HD23 2  
ATOM   3738   N N    . ARG A 1 17  ? -25.717 4.412   -16.461 0.016 28.16 ? 13  ARG A N    2  
ATOM   3739   C CA   . ARG A 1 17  ? -27.099 4.750   -16.748 0.016 28.53 ? 13  ARG A CA   2  
ATOM   3740   C C    . ARG A 1 17  ? -27.967 4.360   -15.566 0.016 27.32 ? 13  ARG A C    2  
ATOM   3741   O O    . ARG A 1 17  ? -28.009 3.192   -15.169 0.016 27.02 ? 13  ARG A O    2  
ATOM   3742   C CB   . ARG A 1 17  ? -27.581 4.039   -18.002 0.016 30.12 ? 13  ARG A CB   2  
ATOM   3743   C CG   . ARG A 1 17  ? -27.917 4.987   -19.077 0.016 31.46 ? 13  ARG A CG   2  
ATOM   3744   C CD   . ARG A 1 17  ? -28.871 4.354   -20.028 0.016 32.96 ? 13  ARG A CD   2  
ATOM   3745   N NE   . ARG A 1 17  ? -30.163 4.168   -19.395 0.016 32.42 ? 13  ARG A NE   2  
ATOM   3746   C CZ   . ARG A 1 17  ? -31.245 3.754   -20.039 0.016 33.70 ? 13  ARG A CZ   2  
ATOM   3747   N NH1  . ARG A 1 17  ? -31.167 3.489   -21.327 0.016 35.59 ? 13  ARG A NH1  2  
ATOM   3748   N NH2  . ARG A 1 17  ? -32.383 3.577   -19.395 0.016 33.26 ? 13  ARG A NH2  2  
ATOM   3749   H H    . ARG A 1 17  ? -25.646 3.665   -16.044 0.016 27.74 ? 13  ARG A H    2  
ATOM   3750   H HA   . ARG A 1 17  ? -27.171 5.705   -16.889 0.016 28.66 ? 13  ARG A HA   2  
ATOM   3751   H HB2  . ARG A 1 17  ? -26.880 3.451   -18.325 0.016 30.54 ? 13  ARG A HB2  2  
ATOM   3752   H HB3  . ARG A 1 17  ? -28.373 3.526   -17.782 0.016 30.01 ? 13  ARG A HB3  2  
ATOM   3753   H HG2  . ARG A 1 17  ? -28.351 5.766   -18.698 0.016 30.98 ? 13  ARG A HG2  2  
ATOM   3754   H HG3  . ARG A 1 17  ? -27.112 5.239   -19.558 0.016 32.01 ? 13  ARG A HG3  2  
ATOM   3755   H HD2  . ARG A 1 17  ? -28.983 4.923   -20.807 0.016 34.04 ? 13  ARG A HD2  2  
ATOM   3756   H HD3  . ARG A 1 17  ? -28.533 3.488   -20.294 0.016 33.36 ? 13  ARG A HD3  2  
ATOM   3757   H HE   . ARG A 1 17  ? -30.191 4.192   -18.537 0.016 31.30 ? 13  ARG A HE   2  
ATOM   3758   H HH11 . ARG A 1 17  ? -30.426 3.597   -21.750 0.016 35.97 ? 13  ARG A HH11 2  
ATOM   3759   H HH12 . ARG A 1 17  ? -31.865 3.221   -21.750 0.016 36.53 ? 13  ARG A HH12 2  
ATOM   3760   H HH21 . ARG A 1 17  ? -32.435 3.743   -18.554 0.016 32.14 ? 13  ARG A HH21 2  
ATOM   3761   H HH22 . ARG A 1 17  ? -33.078 3.311   -19.823 0.016 34.20 ? 13  ARG A HH22 2  
ATOM   3762   N N    . MET A 1 18  ? -28.650 5.336   -14.992 0.016 26.76 ? 14  MET A N    2  
ATOM   3763   C CA   . MET A 1 18  ? -29.669 5.119   -13.995 0.016 25.97 ? 14  MET A CA   2  
ATOM   3764   C C    . MET A 1 18  ? -31.030 5.425   -14.608 0.016 26.89 ? 14  MET A C    2  
ATOM   3765   O O    . MET A 1 18  ? -31.247 6.532   -15.140 0.016 27.44 ? 14  MET A O    2  
ATOM   3766   C CB   . MET A 1 18  ? -29.436 6.018   -12.776 0.016 24.78 ? 14  MET A CB   2  
ATOM   3767   C CG   . MET A 1 18  ? -30.464 5.892   -11.704 0.016 24.11 ? 14  MET A CG   2  
ATOM   3768   S SD   . MET A 1 18  ? -30.307 7.186   -10.420 0.016 23.11 ? 14  MET A SD   2  
ATOM   3769   C CE   . MET A 1 18  ? -28.938 6.537   -9.480  0.016 22.23 ? 14  MET A CE   2  
ATOM   3770   H H    . MET A 1 18  ? -28.531 6.168   -15.172 0.016 26.91 ? 14  MET A H    2  
ATOM   3771   H HA   . MET A 1 18  ? -29.649 4.204   -13.688 0.016 25.74 ? 14  MET A HA   2  
ATOM   3772   H HB2  . MET A 1 18  ? -28.578 5.805   -12.383 0.016 24.31 ? 14  MET A HB2  2  
ATOM   3773   H HB3  . MET A 1 18  ? -29.435 6.939   -13.075 0.016 25.05 ? 14  MET A HB3  2  
ATOM   3774   H HG2  . MET A 1 18  ? -31.348 5.964   -12.093 0.016 24.66 ? 14  MET A HG2  2  
ATOM   3775   H HG3  . MET A 1 18  ? -30.368 5.034   -11.267 0.016 23.80 ? 14  MET A HG3  2  
ATOM   3776   H HE1  . MET A 1 18  ? -28.763 7.116   -8.721  0.016 21.76 ? 14  MET A HE1  2  
ATOM   3777   H HE2  . MET A 1 18  ? -29.162 5.642   -9.170  0.016 22.08 ? 14  MET A HE2  2  
ATOM   3778   H HE3  . MET A 1 18  ? -28.159 6.492   -10.054 0.016 22.51 ? 14  MET A HE3  2  
ATOM   3779   N N    . GLU A 1 19  ? -31.935 4.446   -14.539 0.016 27.18 ? 15  GLU A N    2  
ATOM   3780   C CA   . GLU A 1 19  ? -33.366 4.663   -14.698 0.016 27.86 ? 15  GLU A CA   2  
ATOM   3781   C C    . GLU A 1 19  ? -34.033 4.560   -13.337 0.016 26.87 ? 15  GLU A C    2  
ATOM   3782   O O    . GLU A 1 19  ? -33.666 3.700   -12.521 0.016 26.13 ? 15  GLU A O    2  
ATOM   3783   C CB   . GLU A 1 19  ? -33.969 3.674   -15.673 0.016 29.30 ? 15  GLU A CB   2  
ATOM   3784   C CG   . GLU A 1 19  ? -35.346 4.050   -16.208 0.016 30.54 ? 15  GLU A CG   2  
ATOM   3785   C CD   . GLU A 1 19  ? -35.538 3.524   -17.613 0.016 32.39 ? 15  GLU A CD   2  
ATOM   3786   O OE1  . GLU A 1 19  ? -36.502 3.921   -18.320 0.016 33.78 ? 15  GLU A OE1  2  
ATOM   3787   O OE2  . GLU A 1 19  ? -34.682 2.712   -18.020 0.016 32.59 ? 15  GLU A OE2  2  
ATOM   3788   H H    . GLU A 1 19  ? -31.735 3.622   -14.410 0.016 27.08 ? 15  GLU A H    2  
ATOM   3789   H HA   . GLU A 1 19  ? -33.519 5.559   -15.044 0.016 28.19 ? 15  GLU A HA   2  
ATOM   3790   H HB2  . GLU A 1 19  ? -33.364 3.597   -16.427 0.016 29.88 ? 15  GLU A HB2  2  
ATOM   3791   H HB3  . GLU A 1 19  ? -34.055 2.815   -15.227 0.016 29.02 ? 15  GLU A HB3  2  
ATOM   3792   H HG2  . GLU A 1 19  ? -36.032 3.665   -15.641 0.016 30.36 ? 15  GLU A HG2  2  
ATOM   3793   H HG3  . GLU A 1 19  ? -35.424 5.015   -16.225 0.016 30.47 ? 15  GLU A HG3  2  
ATOM   3794   N N    . GLY A 1 20  ? -34.995 5.447   -13.075 0.016 26.96 ? 16  GLY A N    2  
ATOM   3795   C CA   . GLY A 1 20  ? -35.505 5.568   -11.723 0.016 26.17 ? 16  GLY A CA   2  
ATOM   3796   C C    . GLY A 1 20  ? -36.924 6.097   -11.680 0.016 26.84 ? 16  GLY A C    2  
ATOM   3797   O O    . GLY A 1 20  ? -37.471 6.518   -12.699 0.016 27.95 ? 16  GLY A O    2  
ATOM   3798   H H    . GLY A 1 20  ? -35.365 5.957   -13.655 0.016 27.53 ? 16  GLY A H    2  
ATOM   3799   H HA2  . GLY A 1 20  ? -35.495 4.697   -11.301 0.016 26.13 ? 16  GLY A HA2  2  
ATOM   3800   H HA3  . GLY A 1 20  ? -34.926 6.156   -11.218 0.016 25.32 ? 16  GLY A HA3  2  
ATOM   3801   N N    . ALA A 1 21  ? -37.532 5.996   -10.488 0.016 26.31 ? 17  ALA A N    2  
ATOM   3802   C CA   . ALA A 1 21  ? -38.758 6.704   -10.115 0.016 26.76 ? 17  ALA A CA   2  
ATOM   3803   C C    . ALA A 1 21  ? -38.686 7.042   -8.625  0.016 25.72 ? 17  ALA A C    2  
ATOM   3804   O O    . ALA A 1 21  ? -38.297 6.202   -7.809  0.016 25.08 ? 17  ALA A O    2  
ATOM   3805   C CB   . ALA A 1 21  ? -40.034 5.870   -10.416 0.016 28.00 ? 17  ALA A CB   2  
ATOM   3806   H H    . ALA A 1 21  ? -37.242 5.502   -9.854  0.016 25.73 ? 17  ALA A H    2  
ATOM   3807   H HA   . ALA A 1 21  ? -38.803 7.528   -10.616 0.016 27.07 ? 17  ALA A HA   2  
ATOM   3808   H HB1  . ALA A 1 21  ? -40.790 6.271   -9.961  0.016 28.21 ? 17  ALA A HB1  2  
ATOM   3809   H HB2  . ALA A 1 21  ? -40.199 5.845   -11.370 0.016 28.85 ? 17  ALA A HB2  2  
ATOM   3810   H HB3  . ALA A 1 21  ? -39.906 4.967   -10.080 0.016 27.81 ? 17  ALA A HB3  2  
ATOM   3811   N N    . VAL A 1 22  ? -39.040 8.278   -8.270  0.016 25.67 ? 18  VAL A N    2  
ATOM   3812   C CA   . VAL A 1 22  ? -39.129 8.711   -6.888  0.016 25.02 ? 18  VAL A CA   2  
ATOM   3813   C C    . VAL A 1 22  ? -40.493 9.361   -6.751  0.016 25.92 ? 18  VAL A C    2  
ATOM   3814   O O    . VAL A 1 22  ? -40.830 10.253  -7.541  0.016 26.53 ? 18  VAL A O    2  
ATOM   3815   C CB   . VAL A 1 22  ? -37.995 9.688   -6.522  0.016 24.14 ? 18  VAL A CB   2  
ATOM   3816   C CG1  . VAL A 1 22  ? -38.154 10.255  -5.104  0.016 23.73 ? 18  VAL A CG1  2  
ATOM   3817   C CG2  . VAL A 1 22  ? -36.666 8.959   -6.684  0.016 23.42 ? 18  VAL A CG2  2  
ATOM   3818   H H    . VAL A 1 22  ? -39.239 8.894   -8.829  0.016 26.11 ? 18  VAL A H    2  
ATOM   3819   H HA   . VAL A 1 22  ? -39.078 7.957   -6.291  0.016 24.75 ? 18  VAL A HA   2  
ATOM   3820   H HB   . VAL A 1 22  ? -38.006 10.434  -7.141  0.016 24.45 ? 18  VAL A HB   2  
ATOM   3821   H HG11 . VAL A 1 22  ? -38.792 10.986  -5.116  0.016 24.14 ? 18  VAL A HG11 2  
ATOM   3822   H HG12 . VAL A 1 22  ? -38.471 9.556   -4.512  0.016 23.77 ? 18  VAL A HG12 2  
ATOM   3823   H HG13 . VAL A 1 22  ? -37.291 10.575  -4.795  0.016 23.13 ? 18  VAL A HG13 2  
ATOM   3824   H HG21 . VAL A 1 22  ? -36.648 8.216   -6.064  0.016 23.16 ? 18  VAL A HG21 2  
ATOM   3825   H HG22 . VAL A 1 22  ? -36.592 8.643   -7.592  0.016 23.80 ? 18  VAL A HG22 2  
ATOM   3826   H HG23 . VAL A 1 22  ? -35.932 9.560   -6.484  0.016 22.98 ? 18  VAL A HG23 2  
ATOM   3827   N N    . ASN A 1 23  ? -41.275 8.917   -5.771  0.016 26.16 ? 19  ASN A N    2  
ATOM   3828   C CA   . ASN A 1 23  ? -42.686 9.303   -5.679  0.016 27.27 ? 19  ASN A CA   2  
ATOM   3829   C C    . ASN A 1 23  ? -43.309 9.405   -7.072  0.016 28.41 ? 19  ASN A C    2  
ATOM   3830   O O    . ASN A 1 23  ? -43.702 10.481  -7.528  0.016 28.95 ? 19  ASN A O    2  
ATOM   3831   C CB   . ASN A 1 23  ? -42.836 10.610  -4.907  0.016 27.07 ? 19  ASN A CB   2  
ATOM   3832   C CG   . ASN A 1 23  ? -42.583 10.448  -3.409  0.016 26.49 ? 19  ASN A CG   2  
ATOM   3833   O OD1  . ASN A 1 23  ? -42.004 9.458   -2.962  0.016 25.95 ? 19  ASN A OD1  2  
ATOM   3834   N ND2  . ASN A 1 23  ? -43.006 11.422  -2.628  0.016 26.72 ? 19  ASN A ND2  2  
ATOM   3835   H H    . ASN A 1 23  ? -41.012 8.402   -5.135  0.016 25.77 ? 19  ASN A H    2  
ATOM   3836   H HA   . ASN A 1 23  ? -43.168 8.613   -5.201  0.016 27.57 ? 19  ASN A HA   2  
ATOM   3837   H HB2  . ASN A 1 23  ? -42.185 11.244  -5.248  0.016 26.63 ? 19  ASN A HB2  2  
ATOM   3838   H HB3  . ASN A 1 23  ? -43.735 10.953  -5.035  0.016 27.90 ? 19  ASN A HB3  2  
ATOM   3839   H HD21 . ASN A 1 23  ? -43.567 11.998  -2.929  0.016 27.28 ? 19  ASN A HD21 2  
ATOM   3840   H HD22 . ASN A 1 23  ? -42.726 11.484  -1.819  0.016 26.39 ? 19  ASN A HD22 2  
ATOM   3841   N N    . GLY A 1 24  ? -43.366 8.265   -7.767  0.016 28.89 ? 20  GLY A N    2  
ATOM   3842   C CA   . GLY A 1 24  ? -43.967 8.177   -9.077  0.016 30.21 ? 20  GLY A CA   2  
ATOM   3843   C C    . GLY A 1 24  ? -43.236 8.895   -10.188 0.016 30.18 ? 20  GLY A C    2  
ATOM   3844   O O    . GLY A 1 24  ? -43.560 8.659   -11.362 0.016 31.33 ? 20  GLY A O    2  
ATOM   3845   H H    . GLY A 1 24  ? -43.061 7.516   -7.483  0.016 28.53 ? 20  GLY A H    2  
ATOM   3846   H HA2  . GLY A 1 24  ? -44.029 7.241   -9.327  0.016 30.57 ? 20  GLY A HA2  2  
ATOM   3847   H HA3  . GLY A 1 24  ? -44.868 8.531   -9.036  0.016 31.02 ? 20  GLY A HA3  2  
ATOM   3848   N N    . HIS A 1 25  ? -42.254 9.756   -9.868  0.016 29.08 ? 21  HIS A N    2  
ATOM   3849   C CA   . HIS A 1 25  ? -41.678 10.649  -10.866 0.016 29.29 ? 21  HIS A CA   2  
ATOM   3850   C C    . HIS A 1 25  ? -40.486 9.941   -11.486 0.016 28.83 ? 21  HIS A C    2  
ATOM   3851   O O    . HIS A 1 25  ? -39.479 9.678   -10.811 0.016 27.59 ? 21  HIS A O    2  
ATOM   3852   C CB   . HIS A 1 25  ? -41.306 12.000  -10.257 0.016 28.60 ? 21  HIS A CB   2  
ATOM   3853   C CG   . HIS A 1 25  ? -42.225 13.128  -10.662 0.016 29.69 ? 21  HIS A CG   2  
ATOM   3854   N ND1  . HIS A 1 25  ? -43.567 13.160  -10.325 0.016 30.58 ? 21  HIS A ND1  2  
ATOM   3855   C CD2  . HIS A 1 25  ? -41.996 14.250  -11.392 0.016 30.18 ? 21  HIS A CD2  2  
ATOM   3856   C CE1  . HIS A 1 25  ? -44.119 14.259  -10.811 0.016 31.51 ? 21  HIS A CE1  2  
ATOM   3857   N NE2  . HIS A 1 25  ? -43.192 14.943  -11.458 0.016 31.29 ? 21  HIS A NE2  2  
ATOM   3858   H H    . HIS A 1 25  ? -41.907 9.834   -9.087  0.016 28.30 ? 21  HIS A H    2  
ATOM   3859   H HA   . HIS A 1 25  ? -42.328 10.800  -11.568 0.016 30.36 ? 21  HIS A HA   2  
ATOM   3860   H HB2  . HIS A 1 25  ? -41.352 11.912  -9.294  0.016 28.00 ? 21  HIS A HB2  2  
ATOM   3861   H HB3  . HIS A 1 25  ? -40.412 12.239  -10.510 0.016 28.12 ? 21  HIS A HB3  2  
ATOM   3862   H HD1  . HIS A 1 25  ? -43.980 12.565  -9.859  0.016 30.59 ? 21  HIS A HD1  2  
ATOM   3863   H HD2  . HIS A 1 25  ? -41.185 14.512  -11.761 0.016 29.89 ? 21  HIS A HD2  2  
ATOM   3864   H HE1  . HIS A 1 25  ? -45.008 14.504  -10.712 0.016 32.28 ? 21  HIS A HE1  2  
ATOM   3865   H HE2  . HIS A 1 25  ? -43.317 15.690  -11.867 0.016 31.83 ? 21  HIS A HE2  2  
ATOM   3866   N N    . LYS A 1 26  ? -40.637 9.588   -12.752 0.016 30.00 ? 22  LYS A N    2  
ATOM   3867   C CA   . LYS A 1 26  ? -39.664 8.808   -13.481 0.016 29.95 ? 22  LYS A CA   2  
ATOM   3868   C C    . LYS A 1 26  ? -38.546 9.696   -13.999 0.016 29.66 ? 22  LYS A C    2  
ATOM   3869   O O    . LYS A 1 26  ? -38.732 10.893  -14.249 0.016 30.05 ? 22  LYS A O    2  
ATOM   3870   C CB   . LYS A 1 26  ? -40.326 8.098   -14.660 0.016 31.63 ? 22  LYS A CB   2  
ATOM   3871   C CG   . LYS A 1 26  ? -41.621 7.400   -14.304 0.016 32.39 ? 22  LYS A CG   2  
ATOM   3872   C CD   . LYS A 1 26  ? -42.319 6.881   -15.567 0.016 34.37 ? 22  LYS A CD   2  
ATOM   3873   C CE   . LYS A 1 26  ? -43.478 5.922   -15.243 0.016 35.28 ? 22  LYS A CE   2  
ATOM   3874   N NZ   . LYS A 1 26  ? -42.912 4.588   -14.813 0.016 34.54 ? 22  LYS A NZ   2  
ATOM   3875   H H    . LYS A 1 26  ? -41.322 9.801   -13.223 0.016 30.95 ? 22  LYS A H    2  
ATOM   3876   H HA   . LYS A 1 26  ? -39.280 8.138   -12.894 0.016 29.18 ? 22  LYS A HA   2  
ATOM   3877   H HB2  . LYS A 1 26  ? -40.528 8.745   -15.352 0.016 32.47 ? 22  LYS A HB2  2  
ATOM   3878   H HB3  . LYS A 1 26  ? -39.706 7.439   -15.006 0.016 31.58 ? 22  LYS A HB3  2  
ATOM   3879   H HG2  . LYS A 1 26  ? -41.430 6.639   -13.731 0.016 31.77 ? 22  LYS A HG2  2  
ATOM   3880   H HG3  . LYS A 1 26  ? -42.216 8.019   -13.855 0.016 32.39 ? 22  LYS A HG3  2  
ATOM   3881   H HD2  . LYS A 1 26  ? -42.686 7.637   -16.051 0.016 35.13 ? 22  LYS A HD2  2  
ATOM   3882   H HD3  . LYS A 1 26  ? -41.675 6.407   -16.118 0.016 34.49 ? 22  LYS A HD3  2  
ATOM   3883   H HE2  . LYS A 1 26  ? -44.006 6.279   -14.511 0.016 35.01 ? 22  LYS A HE2  2  
ATOM   3884   H HE3  . LYS A 1 26  ? -44.032 5.797   -16.028 0.016 36.70 ? 22  LYS A HE3  2  
ATOM   3885   H HZ1  . LYS A 1 26  ? -42.657 4.119   -15.526 0.016 35.20 ? 22  LYS A HZ1  2  
ATOM   3886   H HZ2  . LYS A 1 26  ? -42.204 4.710   -14.286 0.016 33.33 ? 22  LYS A HZ2  2  
ATOM   3887   H HZ3  . LYS A 1 26  ? -43.531 4.126   -14.370 0.016 34.73 ? 22  LYS A HZ3  2  
ATOM   3888   N N    . PHE A 1 27  ? -37.391 9.084   -14.213 0.016 29.17 ? 23  PHE A N    2  
ATOM   3889   C CA   . PHE A 1 27  ? -36.234 9.824   -14.667 0.016 28.98 ? 23  PHE A CA   2  
ATOM   3890   C C    . PHE A 1 27  ? -35.182 8.867   -15.188 0.016 28.97 ? 23  PHE A C    2  
ATOM   3891   O O    . PHE A 1 27  ? -35.227 7.653   -14.931 0.016 28.74 ? 23  PHE A O    2  
ATOM   3892   C CB   . PHE A 1 27  ? -35.672 10.698  -13.538 0.016 27.66 ? 23  PHE A CB   2  
ATOM   3893   C CG   . PHE A 1 27  ? -35.215 9.924   -12.325 0.016 26.33 ? 23  PHE A CG   2  
ATOM   3894   C CD1  . PHE A 1 27  ? -33.919 9.484   -12.222 0.016 25.67 ? 23  PHE A CD1  2  
ATOM   3895   C CD2  . PHE A 1 27  ? -36.084 9.654   -11.291 0.016 25.90 ? 23  PHE A CD2  2  
ATOM   3896   C CE1  . PHE A 1 27  ? -33.497 8.789   -11.110 0.016 24.60 ? 23  PHE A CE1  2  
ATOM   3897   C CE2  . PHE A 1 27  ? -35.670 8.964   -10.179 0.016 24.86 ? 23  PHE A CE2  2  
ATOM   3898   C CZ   . PHE A 1 27  ? -34.374 8.525   -10.095 0.016 24.21 ? 23  PHE A CZ   2  
ATOM   3899   H H    . PHE A 1 27  ? -37.259 8.244   -14.104 0.016 29.01 ? 23  PHE A H    2  
ATOM   3900   H HA   . PHE A 1 27  ? -36.494 10.404  -15.399 0.016 29.90 ? 23  PHE A HA   2  
ATOM   3901   H HB2  . PHE A 1 27  ? -34.910 11.191  -13.874 0.016 27.68 ? 23  PHE A HB2  2  
ATOM   3902   H HB3  . PHE A 1 27  ? -36.368 11.310  -13.254 0.016 27.79 ? 23  PHE A HB3  2  
ATOM   3903   H HD1  . PHE A 1 27  ? -33.320 9.663   -12.912 0.016 26.05 ? 23  PHE A HD1  2  
ATOM   3904   H HD2  . PHE A 1 27  ? -36.963 9.948   -11.346 0.016 26.41 ? 23  PHE A HD2  2  
ATOM   3905   H HE1  . PHE A 1 27  ? -32.615 8.495   -11.054 0.016 24.24 ? 23  PHE A HE1  2  
ATOM   3906   H HE2  . PHE A 1 27  ? -36.267 8.785   -9.494  0.016 24.71 ? 23  PHE A HE2  2  
ATOM   3907   H HZ   . PHE A 1 27  ? -34.088 8.055   -9.347  0.016 23.60 ? 23  PHE A HZ   2  
ATOM   3908   N N    . VAL A 1 28  ? -34.249 9.433   -15.944 0.016 29.39 ? 24  VAL A N    2  
ATOM   3909   C CA   . VAL A 1 28  ? -33.106 8.715   -16.497 0.016 29.53 ? 24  VAL A CA   2  
ATOM   3910   C C    . VAL A 1 28  ? -31.910 9.646   -16.470 0.016 29.17 ? 24  VAL A C    2  
ATOM   3911   O O    . VAL A 1 28  ? -31.960 10.734  -17.060 0.016 29.97 ? 24  VAL A O    2  
ATOM   3912   C CB   . VAL A 1 28  ? -33.345 8.231   -17.937 0.016 31.33 ? 24  VAL A CB   2  
ATOM   3913   C CG1  . VAL A 1 28  ? -32.064 7.574   -18.478 0.016 31.56 ? 24  VAL A CG1  2  
ATOM   3914   C CG2  . VAL A 1 28  ? -34.508 7.239   -17.998 0.016 31.91 ? 24  VAL A CG2  2  
ATOM   3915   H H    . VAL A 1 28  ? -34.256 10.264  -16.159 0.016 29.68 ? 24  VAL A H    2  
ATOM   3916   H HA   . VAL A 1 28  ? -32.913 7.948   -15.938 0.016 28.82 ? 24  VAL A HA   2  
ATOM   3917   H HB   . VAL A 1 28  ? -33.557 8.993   -18.499 0.016 32.13 ? 24  VAL A HB   2  
ATOM   3918   H HG11 . VAL A 1 28  ? -32.297 6.956   -19.188 0.016 32.56 ? 24  VAL A HG11 2  
ATOM   3919   H HG12 . VAL A 1 28  ? -31.476 8.265   -18.822 0.016 31.85 ? 24  VAL A HG12 2  
ATOM   3920   H HG13 . VAL A 1 28  ? -31.623 7.097   -17.758 0.016 30.51 ? 24  VAL A HG13 2  
ATOM   3921   H HG21 . VAL A 1 28  ? -34.645 6.970   -18.920 0.016 33.17 ? 24  VAL A HG21 2  
ATOM   3922   H HG22 . VAL A 1 28  ? -34.287 6.468   -17.455 0.016 31.18 ? 24  VAL A HG22 2  
ATOM   3923   H HG23 . VAL A 1 28  ? -35.306 7.667   -17.654 0.016 31.87 ? 24  VAL A HG23 2  
ATOM   3924   N N    . ILE A 1 29  ? -30.845 9.220   -15.800 0.016 28.12 ? 25  ILE A N    2  
ATOM   3925   C CA   . ILE A 1 29  ? -29.619 9.993   -15.650 0.016 27.80 ? 25  ILE A CA   2  
ATOM   3926   C C    . ILE A 1 29  ? -28.464 9.187   -16.227 0.016 28.19 ? 25  ILE A C    2  
ATOM   3927   O O    . ILE A 1 29  ? -28.390 7.969   -16.021 0.016 27.86 ? 25  ILE A O    2  
ATOM   3928   C CB   . ILE A 1 29  ? -29.347 10.326  -14.175 0.016 26.31 ? 25  ILE A CB   2  
ATOM   3929   C CG1  . ILE A 1 29  ? -30.341 11.384  -13.690 0.016 26.16 ? 25  ILE A CG1  2  
ATOM   3930   C CG2  . ILE A 1 29  ? -27.952 10.884  -13.990 0.016 26.09 ? 25  ILE A CG2  2  
ATOM   3931   C CD1  . ILE A 1 29  ? -30.498 11.438  -12.187 0.016 24.88 ? 25  ILE A CD1  2  
ATOM   3932   H H    . ILE A 1 29  ? -30.810 8.462   -15.403 0.016 27.64 ? 25  ILE A H    2  
ATOM   3933   H HA   . ILE A 1 29  ? -29.700 10.817  -16.149 0.016 28.47 ? 25  ILE A HA   2  
ATOM   3934   H HB   . ILE A 1 29  ? -29.441 9.523   -13.640 0.016 25.71 ? 25  ILE A HB   2  
ATOM   3935   H HG12 . ILE A 1 29  ? -30.008 12.245  -13.976 0.016 26.53 ? 25  ILE A HG12 2  
ATOM   3936   H HG13 . ILE A 1 29  ? -31.209 11.213  -14.085 0.016 26.67 ? 25  ILE A HG13 2  
ATOM   3937   H HG21 . ILE A 1 29  ? -27.865 11.171  -13.067 0.016 25.30 ? 25  ILE A HG21 2  
ATOM   3938   H HG22 . ILE A 1 29  ? -27.293 10.202  -14.181 0.016 26.14 ? 25  ILE A HG22 2  
ATOM   3939   H HG23 . ILE A 1 29  ? -27.833 11.645  -14.579 0.016 26.80 ? 25  ILE A HG23 2  
ATOM   3940   H HD11 . ILE A 1 29  ? -29.629 11.584  -11.784 0.016 24.45 ? 25  ILE A HD11 2  
ATOM   3941   H HD12 . ILE A 1 29  ? -31.095 12.167  -11.959 0.016 24.94 ? 25  ILE A HD12 2  
ATOM   3942   H HD13 . ILE A 1 29  ? -30.873 10.598  -11.883 0.016 24.58 ? 25  ILE A HD13 2  
ATOM   3943   N N    . GLU A 1 30  ? -27.585 9.862   -16.956 0.016 29.04 ? 26  GLU A N    2  
ATOM   3944   C CA   . GLU A 1 30  ? -26.386 9.245   -17.500 0.016 29.58 ? 26  GLU A CA   2  
ATOM   3945   C C    . GLU A 1 30  ? -25.160 9.932   -16.931 0.016 29.07 ? 26  GLU A C    2  
ATOM   3946   O O    . GLU A 1 30  ? -25.227 11.064  -16.440 0.016 28.71 ? 26  GLU A O    2  
ATOM   3947   C CB   . GLU A 1 30  ? -26.355 9.323   -19.027 0.016 31.50 ? 26  GLU A CB   2  
ATOM   3948   C CG   . GLU A 1 30  ? -27.480 8.546   -19.648 0.016 32.28 ? 26  GLU A CG   2  
ATOM   3949   C CD   . GLU A 1 30  ? -27.498 8.624   -21.160 0.016 34.42 ? 26  GLU A CD   2  
ATOM   3950   O OE1  . GLU A 1 30  ? -26.955 9.601   -21.735 0.016 35.36 ? 26  GLU A OE1  2  
ATOM   3951   O OE2  . GLU A 1 30  ? -28.060 7.699   -21.768 0.016 35.31 ? 26  GLU A OE2  2  
ATOM   3952   H H    . GLU A 1 30  ? -27.661 10.694  -17.150 0.016 29.39 ? 26  GLU A H    2  
ATOM   3953   H HA   . GLU A 1 30  ? -26.363 8.313   -17.236 0.016 29.16 ? 26  GLU A HA   2  
ATOM   3954   H HB2  . GLU A 1 30  ? -26.448 10.249  -19.298 0.016 31.99 ? 26  GLU A HB2  2  
ATOM   3955   H HB3  . GLU A 1 30  ? -25.512 8.973   -19.350 0.016 31.91 ? 26  GLU A HB3  2  
ATOM   3956   H HG2  . GLU A 1 30  ? -27.379 7.615   -19.401 0.016 31.87 ? 26  GLU A HG2  2  
ATOM   3957   H HG3  . GLU A 1 30  ? -28.325 8.881   -19.315 0.016 31.94 ? 26  GLU A HG3  2  
ATOM   3958   N N    . GLY A 1 31  ? -24.041 9.230   -17.003 0.016 29.17 ? 27  GLY A N    2  
ATOM   3959   C CA   . GLY A 1 31  ? -22.816 9.704   -16.396 0.016 28.77 ? 27  GLY A CA   2  
ATOM   3960   C C    . GLY A 1 31  ? -21.573 9.173   -17.078 0.016 29.75 ? 27  GLY A C    2  
ATOM   3961   O O    . GLY A 1 31  ? -21.542 8.063   -17.619 0.016 30.21 ? 27  GLY A O    2  
ATOM   3962   H H    . GLY A 1 31  ? -23.967 8.474   -17.403 0.016 29.56 ? 27  GLY A H    2  
ATOM   3963   H HA2  . GLY A 1 31  ? -22.799 10.668  -16.438 0.016 29.02 ? 27  GLY A HA2  2  
ATOM   3964   H HA3  . GLY A 1 31  ? -22.799 9.436   -15.464 0.016 27.72 ? 27  GLY A HA3  2  
ATOM   3965   N N    . GLU A 1 32  ? -20.523 9.982   -16.989 0.016 30.13 ? 28  GLU A N    2  
ATOM   3966   C CA   . GLU A 1 32  ? -19.226 9.730   -17.589 0.016 31.28 ? 28  GLU A CA   2  
ATOM   3967   C C    . GLU A 1 32  ? -18.204 10.227  -16.585 0.016 30.72 ? 28  GLU A C    2  
ATOM   3968   O O    . GLU A 1 32  ? -18.171 11.419  -16.282 0.016 30.77 ? 28  GLU A O    2  
ATOM   3969   C CB   . GLU A 1 32  ? -19.073 10.476  -18.912 0.016 33.16 ? 28  GLU A CB   2  
ATOM   3970   C CG   . GLU A 1 32  ? -19.060 9.626   -20.181 0.016 34.67 ? 28  GLU A CG   2  
ATOM   3971   C CD   . GLU A 1 32  ? -18.929 10.493  -21.421 0.016 36.68 ? 28  GLU A CD   2  
ATOM   3972   O OE1  . GLU A 1 32  ? -17.789 10.673  -21.893 0.016 37.98 ? 28  GLU A OE1  2  
ATOM   3973   O OE2  . GLU A 1 32  ? -19.963 11.021  -21.888 0.016 37.04 ? 28  GLU A OE2  2  
ATOM   3974   H H    . GLU A 1 32  ? -20.542 10.718  -16.549 0.016 29.79 ? 28  GLU A H    2  
ATOM   3975   H HA   . GLU A 1 32  ? -19.095 8.784   -17.750 0.016 31.33 ? 28  GLU A HA   2  
ATOM   3976   H HB2  . GLU A 1 32  ? -19.813 11.100  -18.986 0.016 33.10 ? 28  GLU A HB2  2  
ATOM   3977   H HB3  . GLU A 1 32  ? -18.237 10.967  -18.889 0.016 33.64 ? 28  GLU A HB3  2  
ATOM   3978   H HG2  . GLU A 1 32  ? -18.305 9.020   -20.155 0.016 34.84 ? 28  GLU A HG2  2  
ATOM   3979   H HG3  . GLU A 1 32  ? -19.889 9.127   -20.247 0.016 34.35 ? 28  GLU A HG3  2  
ATOM   3980   N N    . GLY A 1 33  ? -17.404 9.324   -16.037 0.016 30.26 ? 29  GLY A N    2  
ATOM   3981   C CA   . GLY A 1 33  ? -16.464 9.728   -15.017 0.016 29.81 ? 29  GLY A CA   2  
ATOM   3982   C C    . GLY A 1 33  ? -15.078 9.184   -15.263 0.016 30.75 ? 29  GLY A C    2  
ATOM   3983   O O    . GLY A 1 33  ? -14.812 8.559   -16.281 0.016 31.84 ? 29  GLY A O    2  
ATOM   3984   H H    . GLY A 1 33  ? -17.397 8.489   -16.233 0.016 30.28 ? 29  GLY A H    2  
ATOM   3985   H HA2  . GLY A 1 33  ? -16.404 10.694  -14.977 0.016 30.08 ? 29  GLY A HA2  2  
ATOM   3986   H HA3  . GLY A 1 33  ? -16.754 9.406   -14.151 0.016 28.72 ? 29  GLY A HA3  2  
ATOM   3987   N N    . ILE A 1 34  ? -14.223 9.408   -14.270 0.016 30.41 ? 30  ILE A N    2  
ATOM   3988   C CA   . ILE A 1 34  ? -12.819 9.019   -14.293 0.016 31.34 ? 30  ILE A CA   2  
ATOM   3989   C C    . ILE A 1 34  ? -12.395 8.875   -12.839 0.016 30.32 ? 30  ILE A C    2  
ATOM   3990   O O    . ILE A 1 34  ? -12.816 9.644   -11.978 0.016 29.51 ? 30  ILE A O    2  
ATOM   3991   C CB   . ILE A 1 34  ? -11.965 10.067  -15.062 0.016 33.08 ? 30  ILE A CB   2  
ATOM   3992   C CG1  . ILE A 1 34  ? -10.545 9.571   -15.255 0.016 34.33 ? 30  ILE A CG1  2  
ATOM   3993   C CG2  . ILE A 1 34  ? -11.955 11.399  -14.328 0.016 32.85 ? 30  ILE A CG2  2  
ATOM   3994   C CD1  . ILE A 1 34  ? -10.302 9.044   -16.630 0.016 35.85 ? 30  ILE A CD1  2  
ATOM   3995   H H    . ILE A 1 34  ? -14.452 9.785   -13.534 0.016 29.69 ? 30  ILE A H    2  
ATOM   3996   H HA   . ILE A 1 34  ? -12.727 8.158   -14.726 0.016 31.59 ? 30  ILE A HA   2  
ATOM   3997   H HB   . ILE A 1 34  ? -12.361 10.204  -15.936 0.016 33.71 ? 30  ILE A HB   2  
ATOM   3998   H HG12 . ILE A 1 34  ? -9.931  10.305  -15.101 0.016 34.99 ? 30  ILE A HG12 2  
ATOM   3999   H HG13 . ILE A 1 34  ? -10.370 8.852   -14.629 0.016 33.64 ? 30  ILE A HG13 2  
ATOM   4000   H HG21 . ILE A 1 34  ? -11.640 12.089  -14.930 0.016 33.98 ? 30  ILE A HG21 2  
ATOM   4001   H HG22 . ILE A 1 34  ? -12.858 11.606  -14.037 0.016 31.94 ? 30  ILE A HG22 2  
ATOM   4002   H HG23 . ILE A 1 34  ? -11.369 11.338  -13.559 0.016 32.60 ? 30  ILE A HG23 2  
ATOM   4003   H HD11 . ILE A 1 34  ? -9.345  9.004   -16.795 0.016 36.88 ? 30  ILE A HD11 2  
ATOM   4004   H HD12 . ILE A 1 34  ? -10.687 8.157   -16.698 0.016 35.32 ? 30  ILE A HD12 2  
ATOM   4005   H HD13 . ILE A 1 34  ? -10.723 9.639   -17.271 0.016 36.42 ? 30  ILE A HD13 2  
ATOM   4006   N N    . GLY A 1 35  ? -11.624 7.840   -12.544 0.016 30.42 ? 31  GLY A N    2  
ATOM   4007   C CA   . GLY A 1 35  ? -11.148 7.674   -11.188 0.016 29.72 ? 31  GLY A CA   2  
ATOM   4008   C C    . GLY A 1 35  ? -9.854  6.889   -11.134 0.016 30.61 ? 31  GLY A C    2  
ATOM   4009   O O    . GLY A 1 35  ? -9.379  6.357   -12.141 0.016 31.67 ? 31  GLY A O    2  
ATOM   4010   H H    . GLY A 1 35  ? -11.375 7.233   -13.097 0.016 30.94 ? 31  GLY A H    2  
ATOM   4011   H HA2  . GLY A 1 35  ? -11.004 8.539   -10.782 0.016 29.80 ? 31  GLY A HA2  2  
ATOM   4012   H HA3  . GLY A 1 35  ? -11.819 7.202   -10.670 0.016 28.68 ? 31  GLY A HA3  2  
ATOM   4013   N N    . LYS A 1 36  ? -9.279  6.843   -9.927  0.016 30.32 ? 32  LYS A N    2  
ATOM   4014   C CA   . LYS A 1 36  ? -8.066  6.085   -9.648  0.016 31.15 ? 32  LYS A CA   2  
ATOM   4015   C C    . LYS A 1 36  ? -8.407  5.017   -8.623  0.016 29.98 ? 32  LYS A C    2  
ATOM   4016   O O    . LYS A 1 36  ? -8.404  5.281   -7.414  0.016 29.44 ? 32  LYS A O    2  
ATOM   4017   C CB   . LYS A 1 36  ? -6.989  6.965   -9.135  0.016 32.25 ? 32  LYS A CB   2  
ATOM   4018   C CG   . LYS A 1 36  ? -6.657  7.900   -9.944  0.016 33.66 ? 32  LYS A CG   2  
ATOM   4019   C CD   . LYS A 1 36  ? -7.576  9.093   -10.308 0.016 33.01 ? 32  LYS A CD   2  
ATOM   4020   C CE   . LYS A 1 36  ? -8.277  9.590   -9.094  0.016 31.68 ? 32  LYS A CE   2  
ATOM   4021   N NZ   . LYS A 1 36  ? -9.351  10.553  -9.366  0.016 31.12 ? 32  LYS A NZ   2  
ATOM   4022   H H    . LYS A 1 36  ? -9.598  7.229   -9.233  0.016 29.71 ? 32  LYS A H    2  
ATOM   4023   H HA   . LYS A 1 36  ? -7.730  5.675   -10.455 0.016 31.89 ? 32  LYS A HA   2  
ATOM   4024   H HB2  . LYS A 1 36  ? -7.250  7.363   -8.298  0.016 31.63 ? 32  LYS A HB2  2  
ATOM   4025   H HB3  . LYS A 1 36  ? -6.181  6.446   -9.007  0.016 32.85 ? 32  LYS A HB3  2  
ATOM   4026   H HG2  . LYS A 1 36  ? -6.150  8.370   -9.412  0.016 34.42 ? 32  LYS A HG2  2  
ATOM   4027   H HG3  . LYS A 1 36  ? -5.983  7.669   -10.588 0.016 34.41 ? 32  LYS A HG3  2  
ATOM   4028   H HD2  . LYS A 1 36  ? -7.076  9.813   -10.738 0.016 34.02 ? 32  LYS A HD2  2  
ATOM   4029   H HD3  . LYS A 1 36  ? -8.275  8.791   -10.893 0.016 32.56 ? 32  LYS A HD3  2  
ATOM   4030   H HE2  . LYS A 1 36  ? -8.698  8.841   -8.658  0.016 30.75 ? 32  LYS A HE2  2  
ATOM   4031   H HE3  . LYS A 1 36  ? -7.626  10.012  -8.511  0.016 32.20 ? 32  LYS A HE3  2  
ATOM   4032   H HZ1  . LYS A 1 36  ? -10.099 10.126  -9.579  0.016 30.38 ? 32  LYS A HZ1  2  
ATOM   4033   H HZ2  . LYS A 1 36  ? -9.494  11.046  -8.644  0.016 30.77 ? 32  LYS A HZ2  2  
ATOM   4034   H HZ3  . LYS A 1 36  ? -9.116  11.081  -10.039 0.016 31.98 ? 32  LYS A HZ3  2  
ATOM   4035   N N    . PRO A 1 37  ? -8.664  3.786   -9.065  0.016 29.76 ? 33  PRO A N    2  
ATOM   4036   C CA   . PRO A 1 37  ? -9.184  2.771   -8.131  0.016 28.64 ? 33  PRO A CA   2  
ATOM   4037   C C    . PRO A 1 37  ? -8.301  2.531   -6.925  0.016 28.87 ? 33  PRO A C    2  
ATOM   4038   O O    . PRO A 1 37  ? -8.817  2.307   -5.820  0.016 27.95 ? 33  PRO A O    2  
ATOM   4039   C CB   . PRO A 1 37  ? -9.291  1.529   -9.023  0.016 28.92 ? 33  PRO A CB   2  
ATOM   4040   C CG   . PRO A 1 37  ? -9.612  2.091   -10.347 0.016 29.50 ? 33  PRO A CG   2  
ATOM   4041   C CD   . PRO A 1 37  ? -8.714  3.297   -10.447 0.016 30.49 ? 33  PRO A CD   2  
ATOM   4042   H HA   . PRO A 1 37  ? -10.072 3.024   -7.838  0.016 27.75 ? 33  PRO A HA   2  
ATOM   4043   H HB2  . PRO A 1 37  ? -8.439  1.070   -9.050  0.016 29.67 ? 33  PRO A HB2  2  
ATOM   4044   H HB3  . PRO A 1 37  ? -9.995  0.943   -8.702  0.016 28.11 ? 33  PRO A HB3  2  
ATOM   4045   H HG2  . PRO A 1 37  ? -9.409  1.449   -11.039 0.016 30.11 ? 33  PRO A HG2  2  
ATOM   4046   H HG3  . PRO A 1 37  ? -10.545 2.352   -10.380 0.016 28.76 ? 33  PRO A HG3  2  
ATOM   4047   H HD2  . PRO A 1 37  ? -7.827  3.035   -10.735 0.016 31.50 ? 33  PRO A HD2  2  
ATOM   4048   H HD3  . PRO A 1 37  ? -9.099  3.959   -11.039 0.016 30.64 ? 33  PRO A HD3  2  
ATOM   4049   N N    . TYR A 1 38  ? -6.965  2.552   -7.107  0.016 30.26 ? 34  TYR A N    2  
ATOM   4050   C CA   . TYR A 1 38  ? -6.071  2.292   -5.990  0.016 30.73 ? 34  TYR A CA   2  
ATOM   4051   C C    . TYR A 1 38  ? -5.864  3.495   -5.074  0.016 30.86 ? 34  TYR A C    2  
ATOM   4052   O O    . TYR A 1 38  ? -5.538  3.305   -3.899  0.016 30.92 ? 34  TYR A O    2  
ATOM   4053   C CB   . TYR A 1 38  ? -4.721  1.764   -6.515  0.016 32.34 ? 34  TYR A CB   2  
ATOM   4054   C CG   . TYR A 1 38  ? -4.859  0.563   -7.436  0.016 32.44 ? 34  TYR A CG   2  
ATOM   4055   C CD1  . TYR A 1 38  ? -4.950  0.720   -8.808  0.016 33.04 ? 34  TYR A CD1  2  
ATOM   4056   C CD2  . TYR A 1 38  ? -4.925  -0.726  -6.923  0.016 32.07 ? 34  TYR A CD2  2  
ATOM   4057   C CE1  . TYR A 1 38  ? -5.072  -0.364  -9.650  0.016 33.32 ? 34  TYR A CE1  2  
ATOM   4058   C CE2  . TYR A 1 38  ? -5.062  -1.807  -7.752  0.016 32.28 ? 34  TYR A CE2  2  
ATOM   4059   C CZ   . TYR A 1 38  ? -5.147  -1.626  -9.113  0.016 32.90 ? 34  TYR A CZ   2  
ATOM   4060   O OH   . TYR A 1 38  ? -5.275  -2.729  -9.942  0.016 33.30 ? 34  TYR A OH   2  
ATOM   4061   H H    . TYR A 1 38  ? -6.570  2.707   -7.853  0.016 31.03 ? 34  TYR A H    2  
ATOM   4062   H HA   . TYR A 1 38  ? -6.476  1.598   -5.449  0.016 30.05 ? 34  TYR A HA   2  
ATOM   4063   H HB2  . TYR A 1 38  ? -4.280  2.469   -7.016  0.016 33.15 ? 34  TYR A HB2  2  
ATOM   4064   H HB3  . TYR A 1 38  ? -4.169  1.503   -5.764  0.016 32.67 ? 34  TYR A HB3  2  
ATOM   4065   H HD1  . TYR A 1 38  ? -4.904  1.574   -9.172  0.016 33.37 ? 34  TYR A HD1  2  
ATOM   4066   H HD2  . TYR A 1 38  ? -4.875  -0.851  -6.005  0.016 31.78 ? 34  TYR A HD2  2  
ATOM   4067   H HE1  . TYR A 1 38  ? -5.131  -0.243  -10.570 0.016 33.85 ? 34  TYR A HE1  2  
ATOM   4068   H HE2  . TYR A 1 38  ? -5.103  -2.666  -7.398  0.016 32.10 ? 34  TYR A HE2  2  
ATOM   4069   H HH   . TYR A 1 38  ? -5.088  -2.515  -10.733 0.016 34.01 ? 34  TYR A HH   2  
ATOM   4070   N N    . GLU A 1 39  ? -6.074  4.727   -5.543  0.016 31.01 ? 35  GLU A N    2  
ATOM   4071   C CA   . GLU A 1 39  ? -6.013  5.863   -4.632  0.016 31.11 ? 35  GLU A CA   2  
ATOM   4072   C C    . GLU A 1 39  ? -7.346  6.146   -3.957  0.016 29.60 ? 35  GLU A C    2  
ATOM   4073   O O    . GLU A 1 39  ? -7.386  6.889   -2.963  0.016 29.60 ? 35  GLU A O    2  
ATOM   4074   C CB   . GLU A 1 39  ? -5.542  7.111   -5.377  0.016 32.22 ? 35  GLU A CB   2  
ATOM   4075   C CG   . GLU A 1 39  ? -4.075  7.086   -5.692  0.016 34.06 ? 35  GLU A CG   2  
ATOM   4076   C CD   . GLU A 1 39  ? -3.687  8.211   -6.610  0.016 35.26 ? 35  GLU A CD   2  
ATOM   4077   O OE1  . GLU A 1 39  ? -4.123  9.334   -6.337  0.016 35.01 ? 35  GLU A OE1  2  
ATOM   4078   O OE2  . GLU A 1 39  ? -3.009  7.959   -7.609  0.016 36.51 ? 35  GLU A OE2  2  
ATOM   4079   H H    . GLU A 1 39  ? -6.239  4.921   -6.363  0.016 31.15 ? 35  GLU A H    2  
ATOM   4080   H HA   . GLU A 1 39  ? -5.362  5.680   -3.939  0.016 31.64 ? 35  GLU A HA   2  
ATOM   4081   H HB2  . GLU A 1 39  ? -6.023  7.178   -6.215  0.016 31.97 ? 35  GLU A HB2  2  
ATOM   4082   H HB3  . GLU A 1 39  ? -5.717  7.888   -4.825  0.016 32.13 ? 35  GLU A HB3  2  
ATOM   4083   H HG2  . GLU A 1 39  ? -3.571  7.177   -4.868  0.016 34.48 ? 35  GLU A HG2  2  
ATOM   4084   H HG3  . GLU A 1 39  ? -3.859  6.249   -6.131  0.016 34.21 ? 35  GLU A HG3  2  
ATOM   4085   N N    . GLY A 1 40  ? -8.420  5.590   -4.500  0.016 28.49 ? 36  GLY A N    2  
ATOM   4086   C CA   . GLY A 1 40  ? -9.737  5.635   -3.901  0.016 27.13 ? 36  GLY A CA   2  
ATOM   4087   C C    . GLY A 1 40  ? -10.590 6.810   -4.306  0.016 26.72 ? 36  GLY A C    2  
ATOM   4088   O O    . GLY A 1 40  ? -11.573 7.087   -3.614  0.016 25.82 ? 36  GLY A O    2  
ATOM   4089   H H    . GLY A 1 40  ? -8.410  5.158   -5.244  0.016 28.59 ? 36  GLY A H    2  
ATOM   4090   H HA2  . GLY A 1 40  ? -10.211 4.834   -4.159  0.016 26.59 ? 36  GLY A HA2  2  
ATOM   4091   H HA3  . GLY A 1 40  ? -9.659  5.632   -2.936  0.016 27.04 ? 36  GLY A HA3  2  
ATOM   4092   N N    . THR A 1 41  ? -10.306 7.444   -5.439  0.016 27.43 ? 37  THR A N    2  
ATOM   4093   C CA   . THR A 1 41  ? -10.931 8.708   -5.836  0.016 27.37 ? 37  THR A CA   2  
ATOM   4094   C C    . THR A 1 41  ? -11.595 8.546   -7.194  0.016 27.28 ? 37  THR A C    2  
ATOM   4095   O O    . THR A 1 41  ? -11.199 7.697   -7.998  0.016 27.74 ? 37  THR A O    2  
ATOM   4096   C CB   . THR A 1 41  ? -9.911  9.877   -5.928  0.016 28.73 ? 37  THR A CB   2  
ATOM   4097   O OG1  . THR A 1 41  ? -8.737  9.455   -6.614  0.016 29.97 ? 37  THR A OG1  2  
ATOM   4098   C CG2  . THR A 1 41  ? -9.516  10.425  -4.585  0.016 28.94 ? 37  THR A CG2  2  
ATOM   4099   H H    . THR A 1 41  ? -9.746  7.153   -6.016  0.016 28.05 ? 37  THR A H    2  
ATOM   4100   H HA   . THR A 1 41  ? -11.609 8.953   -5.186  0.016 26.67 ? 37  THR A HA   2  
ATOM   4101   H HB   . THR A 1 41  ? -10.327 10.604  -6.423  0.016 28.79 ? 37  THR A HB   2  
ATOM   4102   H HG1  . THR A 1 41  ? -8.433  8.752   -6.272  0.016 29.90 ? 37  THR A HG1  2  
ATOM   4103   H HG21 . THR A 1 41  ? -10.265 10.389  -3.974  0.016 28.08 ? 37  THR A HG21 2  
ATOM   4104   H HG22 . THR A 1 41  ? -8.771  9.915   -4.234  0.016 29.40 ? 37  THR A HG22 2  
ATOM   4105   H HG23 . THR A 1 41  ? -9.235  11.348  -4.686  0.016 29.63 ? 37  THR A HG23 2  
ATOM   4106   N N    . GLN A 1 42  ? -12.622 9.361   -7.441  0.016 26.80 ? 38  GLN A N    2  
ATOM   4107   C CA   . GLN A 1 42  ? -13.258 9.355   -8.748  0.016 26.96 ? 38  GLN A CA   2  
ATOM   4108   C C    . GLN A 1 42  ? -14.142 10.591  -8.895  0.016 26.78 ? 38  GLN A C    2  
ATOM   4109   O O    . GLN A 1 42  ? -14.621 11.152  -7.907  0.016 26.11 ? 38  GLN A O    2  
ATOM   4110   C CB   . GLN A 1 42  ? -14.085 8.081   -8.941  0.016 26.12 ? 38  GLN A CB   2  
ATOM   4111   C CG   . GLN A 1 42  ? -15.019 7.787   -7.800  0.016 24.83 ? 38  GLN A CG   2  
ATOM   4112   C CD   . GLN A 1 42  ? -15.969 6.656   -8.137  0.016 24.22 ? 38  GLN A CD   2  
ATOM   4113   O OE1  . GLN A 1 42  ? -15.706 5.478   -7.814  0.016 24.04 ? 38  GLN A OE1  2  
ATOM   4114   N NE2  . GLN A 1 42  ? -17.019 6.968   -8.839  0.016 24.07 ? 38  GLN A NE2  2  
ATOM   4115   H H    . GLN A 1 42  ? -12.961 9.912   -6.876  0.016 26.48 ? 38  GLN A H    2  
ATOM   4116   H HA   . GLN A 1 42  ? -12.581 9.381   -9.438  0.016 27.88 ? 38  GLN A HA   2  
ATOM   4117   H HB2  . GLN A 1 42  ? -14.612 8.156   -9.748  0.016 26.27 ? 38  GLN A HB2  2  
ATOM   4118   H HB3  . GLN A 1 42  ? -13.474 7.331   -9.015  0.016 26.42 ? 38  GLN A HB3  2  
ATOM   4119   H HG2  . GLN A 1 42  ? -14.497 7.526   -7.028  0.016 24.75 ? 38  GLN A HG2  2  
ATOM   4120   H HG3  . GLN A 1 42  ? -15.535 8.586   -7.597  0.016 24.60 ? 38  GLN A HG3  2  
ATOM   4121   H HE21 . GLN A 1 42  ? -17.564 6.357   -9.092  0.016 23.88 ? 38  GLN A HE21 2  
ATOM   4122   H HE22 . GLN A 1 42  ? -17.156 7.787   -9.057  0.016 24.24 ? 38  GLN A HE22 2  
ATOM   4123   N N    . THR A 1 43  ? -14.327 11.001  -10.146 0.016 27.56 ? 39  THR A N    2  
ATOM   4124   C CA   . THR A 1 43  ? -15.147 12.136  -10.534 0.016 27.65 ? 39  THR A CA   2  
ATOM   4125   C C    . THR A 1 43  ? -16.127 11.659  -11.595 0.016 27.61 ? 39  THR A C    2  
ATOM   4126   O O    . THR A 1 43  ? -15.750 10.914  -12.510 0.016 28.32 ? 39  THR A O    2  
ATOM   4127   C CB   . THR A 1 43  ? -14.280 13.283  -11.092 0.016 29.11 ? 39  THR A CB   2  
ATOM   4128   O OG1  . THR A 1 43  ? -13.133 13.453  -10.277 0.016 29.51 ? 39  THR A OG1  2  
ATOM   4129   C CG2  . THR A 1 43  ? -15.028 14.594  -11.096 0.016 29.14 ? 39  THR A CG2  2  
ATOM   4130   H H    . THR A 1 43  ? -13.975 10.607  -10.821 0.016 28.15 ? 39  THR A H    2  
ATOM   4131   H HA   . THR A 1 43  ? -15.640 12.458  -9.767  0.016 26.94 ? 39  THR A HA   2  
ATOM   4132   H HB   . THR A 1 43  ? -14.003 13.085  -12.001 0.016 29.91 ? 39  THR A HB   2  
ATOM   4133   H HG1  . THR A 1 43  ? -12.741 12.719  -10.161 0.016 29.42 ? 39  THR A HG1  2  
ATOM   4134   H HG21 . THR A 1 43  ? -15.962 14.445  -10.881 0.016 28.28 ? 39  THR A HG21 2  
ATOM   4135   H HG22 . THR A 1 43  ? -14.643 15.188  -10.433 0.016 29.24 ? 39  THR A HG22 2  
ATOM   4136   H HG23 . THR A 1 43  ? -14.960 15.009  -11.971 0.016 30.04 ? 39  THR A HG23 2  
ATOM   4137   N N    . LEU A 1 44  ? -17.376 12.070  -11.461 0.016 26.92 ? 40  LEU A N    2  
ATOM   4138   C CA   . LEU A 1 44  ? -18.422 11.753  -12.410 0.016 27.02 ? 40  LEU A CA   2  
ATOM   4139   C C    . LEU A 1 44  ? -19.133 13.025  -12.844 0.016 27.48 ? 40  LEU A C    2  
ATOM   4140   O O    . LEU A 1 44  ? -19.410 13.890  -12.023 0.016 27.00 ? 40  LEU A O    2  
ATOM   4141   C CB   . LEU A 1 44  ? -19.445 10.810  -11.814 0.016 25.80 ? 40  LEU A CB   2  
ATOM   4142   C CG   . LEU A 1 44  ? -18.986 9.370   -11.932 0.016 25.70 ? 40  LEU A CG   2  
ATOM   4143   C CD1  . LEU A 1 44  ? -19.744 8.486   -10.957 0.016 24.47 ? 40  LEU A CD1  2  
ATOM   4144   C CD2  . LEU A 1 44  ? -19.190 8.885   -13.371 0.016 26.71 ? 40  LEU A CD2  2  
ATOM   4145   H H    . LEU A 1 44  ? -17.654 12.545  -10.803 0.016 26.45 ? 40  LEU A H    2  
ATOM   4146   H HA   . LEU A 1 44  ? -18.029 11.342  -13.193 0.016 27.74 ? 40  LEU A HA   2  
ATOM   4147   H HB2  . LEU A 1 44  ? -19.562 11.017  -10.873 0.016 25.11 ? 40  LEU A HB2  2  
ATOM   4148   H HB3  . LEU A 1 44  ? -20.285 10.900  -12.291 0.016 25.88 ? 40  LEU A HB3  2  
ATOM   4149   H HG   . LEU A 1 44  ? -18.042 9.326   -11.717 0.016 25.95 ? 40  LEU A HG   2  
ATOM   4150   H HD11 . LEU A 1 44  ? -19.314 7.617   -10.916 0.016 24.44 ? 40  LEU A HD11 2  
ATOM   4151   H HD12 . LEU A 1 44  ? -19.721 8.910   -10.084 0.016 23.97 ? 40  LEU A HD12 2  
ATOM   4152   H HD13 . LEU A 1 44  ? -20.664 8.393   -11.252 0.016 24.35 ? 40  LEU A HD13 2  
ATOM   4153   H HD21 . LEU A 1 44  ? -20.126 8.659   -13.489 0.016 26.41 ? 40  LEU A HD21 2  
ATOM   4154   H HD22 . LEU A 1 44  ? -18.948 9.585   -13.990 0.016 27.53 ? 40  LEU A HD22 2  
ATOM   4155   H HD23 . LEU A 1 44  ? -18.637 8.104   -13.527 0.016 26.94 ? 40  LEU A HD23 2  
ATOM   4156   N N    . ASP A 1 45  ? -19.444 13.087  -14.134 0.016 28.52 ? 41  ASP A N    2  
ATOM   4157   C CA   . ASP A 1 45  ? -20.311 14.093  -14.730 0.016 29.09 ? 41  ASP A CA   2  
ATOM   4158   C C    . ASP A 1 45  ? -21.656 13.428  -15.015 0.016 28.63 ? 41  ASP A C    2  
ATOM   4159   O O    . ASP A 1 45  ? -21.718 12.520  -15.849 0.016 29.16 ? 41  ASP A O    2  
ATOM   4160   C CB   . ASP A 1 45  ? -19.702 14.615  -16.037 0.016 30.90 ? 41  ASP A CB   2  
ATOM   4161   C CG   . ASP A 1 45  ? -18.190 14.747  -15.977 0.016 31.64 ? 41  ASP A CG   2  
ATOM   4162   O OD1  . ASP A 1 45  ? -17.445 13.857  -16.500 0.016 32.24 ? 41  ASP A OD1  2  
ATOM   4163   O OD2  . ASP A 1 45  ? -17.735 15.749  -15.405 0.016 31.77 ? 41  ASP A OD2  2  
ATOM   4164   H H    . ASP A 1 45  ? -19.143 12.536  -14.718 0.016 29.02 ? 41  ASP A H    2  
ATOM   4165   H HA   . ASP A 1 45  ? -20.432 14.827  -14.112 0.016 28.74 ? 41  ASP A HA   2  
ATOM   4166   H HB2  . ASP A 1 45  ? -19.914 13.993  -16.751 0.016 31.35 ? 41  ASP A HB2  2  
ATOM   4167   H HB3  . ASP A 1 45  ? -20.074 15.486  -16.236 0.016 31.32 ? 41  ASP A HB3  2  
ATOM   4168   N N    . LEU A 1 46  ? -22.725 13.902  -14.371 0.016 27.85 ? 42  LEU A N    2  
ATOM   4169   C CA   . LEU A 1 46  ? -24.059 13.312  -14.478 0.016 27.43 ? 42  LEU A CA   2  
ATOM   4170   C C    . LEU A 1 46  ? -25.012 14.259  -15.202 0.016 28.29 ? 42  LEU A C    2  
ATOM   4171   O O    . LEU A 1 46  ? -25.021 15.463  -14.923 0.016 28.43 ? 42  LEU A O    2  
ATOM   4172   C CB   . LEU A 1 46  ? -24.620 12.971  -13.079 0.016 25.94 ? 42  LEU A CB   2  
ATOM   4173   C CG   . LEU A 1 46  ? -23.635 12.039  -12.340 0.016 25.23 ? 42  LEU A CG   2  
ATOM   4174   C CD1  . LEU A 1 46  ? -23.667 12.189  -10.818 0.016 24.11 ? 42  LEU A CD1  2  
ATOM   4175   C CD2  . LEU A 1 46  ? -23.897 10.598  -12.738 0.016 25.15 ? 42  LEU A CD2  2  
ATOM   4176   H H    . LEU A 1 46  ? -22.697 14.578  -13.845 0.016 27.61 ? 42  LEU A H    2  
ATOM   4177   H HA   . LEU A 1 46  ? -24.003 12.491  -14.989 0.016 27.71 ? 42  LEU A HA   2  
ATOM   4178   H HB2  . LEU A 1 46  ? -24.723 13.784  -12.566 0.016 25.74 ? 42  LEU A HB2  2  
ATOM   4179   H HB3  . LEU A 1 46  ? -25.467 12.508  -13.163 0.016 25.77 ? 42  LEU A HB3  2  
ATOM   4180   H HG   . LEU A 1 46  ? -22.733 12.244  -12.625 0.016 25.74 ? 42  LEU A HG   2  
ATOM   4181   H HD11 . LEU A 1 46  ? -24.571 12.021  -10.507 0.016 23.67 ? 42  LEU A HD11 2  
ATOM   4182   H HD12 . LEU A 1 46  ? -23.050 11.560  -10.414 0.016 23.80 ? 42  LEU A HD12 2  
ATOM   4183   H HD13 . LEU A 1 46  ? -23.399 13.091  -10.592 0.016 24.28 ? 42  LEU A HD13 2  
ATOM   4184   H HD21 . LEU A 1 46  ? -23.896 10.546  -13.708 0.016 26.00 ? 42  LEU A HD21 2  
ATOM   4185   H HD22 . LEU A 1 46  ? -23.189 10.045  -12.369 0.016 24.87 ? 42  LEU A HD22 2  
ATOM   4186   H HD23 . LEU A 1 46  ? -24.755 10.309  -12.388 0.016 24.66 ? 42  LEU A HD23 2  
ATOM   4187   N N    . THR A 1 47  ? -25.808 13.698  -16.120 0.016 28.98 ? 43  THR A N    2  
ATOM   4188   C CA   . THR A 1 47  ? -26.792 14.445  -16.906 0.016 30.01 ? 43  THR A CA   2  
ATOM   4189   C C    . THR A 1 47  ? -28.177 13.814  -16.761 0.016 29.64 ? 43  THR A C    2  
ATOM   4190   O O    . THR A 1 47  ? -28.341 12.593  -16.915 0.016 29.52 ? 43  THR A O    2  
ATOM   4191   C CB   . THR A 1 47  ? -26.382 14.494  -18.390 0.016 31.84 ? 43  THR A CB   2  
ATOM   4192   O OG1  . THR A 1 47  ? -27.202 15.425  -19.103 0.016 33.01 ? 43  THR A OG1  2  
ATOM   4193   C CG2  . THR A 1 47  ? -26.581 13.136  -19.008 0.016 32.22 ? 43  THR A CG2  2  
ATOM   4194   H H    . THR A 1 47  ? -25.791 12.863  -16.310 0.016 28.95 ? 43  THR A H    2  
ATOM   4195   H HA   . THR A 1 47  ? -26.843 15.354  -16.575 0.016 29.94 ? 43  THR A HA   2  
ATOM   4196   H HB   . THR A 1 47  ? -25.451 14.759  -18.476 0.016 32.13 ? 43  THR A HB   2  
ATOM   4197   H HG1  . THR A 1 47  ? -26.955 15.471  -19.907 0.016 34.11 ? 43  THR A HG1  2  
ATOM   4198   H HG21 . THR A 1 47  ? -27.510 13.028  -19.261 0.016 32.51 ? 43  THR A HG21 2  
ATOM   4199   H HG22 . THR A 1 47  ? -26.029 13.049  -19.801 0.016 33.28 ? 43  THR A HG22 2  
ATOM   4200   H HG23 . THR A 1 47  ? -26.342 12.443  -18.375 0.016 31.24 ? 43  THR A HG23 2  
ATOM   4201   N N    . VAL A 1 48  ? -29.177 14.648  -16.473 0.016 29.61 ? 44  VAL A N    2  
ATOM   4202   C CA   . VAL A 1 48  ? -30.571 14.212  -16.506 0.016 29.69 ? 44  VAL A CA   2  
ATOM   4203   C C    . VAL A 1 48  ? -31.041 14.186  -17.962 0.016 31.48 ? 44  VAL A C    2  
ATOM   4204   O O    . VAL A 1 48  ? -31.258 15.232  -18.582 0.016 32.58 ? 44  VAL A O    2  
ATOM   4205   C CB   . VAL A 1 48  ? -31.464 15.113  -15.652 0.016 29.16 ? 44  VAL A CB   2  
ATOM   4206   C CG1  . VAL A 1 48  ? -32.926 14.665  -15.767 0.016 29.51 ? 44  VAL A CG1  2  
ATOM   4207   C CG2  . VAL A 1 48  ? -31.020 15.086  -14.203 0.016 27.60 ? 44  VAL A CG2  2  
ATOM   4208   H H    . VAL A 1 48  ? -29.071 15.468  -16.252 0.016 29.61 ? 44  VAL A H    2  
ATOM   4209   H HA   . VAL A 1 48  ? -30.636 13.310  -16.153 0.016 29.08 ? 44  VAL A HA   2  
ATOM   4210   H HB   . VAL A 1 48  ? -31.401 16.026  -15.978 0.016 29.78 ? 44  VAL A HB   2  
ATOM   4211   H HG11 . VAL A 1 48  ? -32.978 13.709  -15.612 0.016 29.13 ? 44  VAL A HG11 2  
ATOM   4212   H HG12 . VAL A 1 48  ? -33.448 15.134  -15.098 0.016 29.08 ? 44  VAL A HG12 2  
ATOM   4213   H HG13 . VAL A 1 48  ? -33.261 14.879  -16.652 0.016 30.64 ? 44  VAL A HG13 2  
ATOM   4214   H HG21 . VAL A 1 48  ? -30.542 14.265  -14.038 0.016 27.14 ? 44  VAL A HG21 2  
ATOM   4215   H HG22 . VAL A 1 48  ? -30.434 15.836  -14.034 0.016 27.59 ? 44  VAL A HG22 2  
ATOM   4216   H HG23 . VAL A 1 48  ? -31.796 15.133  -13.627 0.016 27.22 ? 44  VAL A HG23 2  
ATOM   4217   N N    . GLU A 1 49  ? -31.192 12.986  -18.517 0.016 31.93 ? 45  GLU A N    2  
ATOM   4218   C CA   . GLU A 1 49  ? -31.593 12.854  -19.908 0.016 33.83 ? 45  GLU A CA   2  
ATOM   4219   C C    . GLU A 1 49  ? -33.094 12.642  -20.059 0.016 34.42 ? 45  GLU A C    2  
ATOM   4220   O O    . GLU A 1 49  ? -33.636 12.931  -21.132 0.016 36.18 ? 45  GLU A O    2  
ATOM   4221   C CB   . GLU A 1 49  ? -30.822 11.712  -20.588 0.016 34.41 ? 45  GLU A CB   2  
ATOM   4222   C CG   . GLU A 1 49  ? -30.124 12.137  -21.878 0.016 36.23 ? 45  GLU A CG   2  
ATOM   4223   C CD   . GLU A 1 49  ? -31.086 12.730  -22.882 0.016 38.09 ? 45  GLU A CD   2  
ATOM   4224   O OE1  . GLU A 1 49  ? -31.422 13.937  -22.755 0.016 38.19 ? 45  GLU A OE1  2  
ATOM   4225   O OE2  . GLU A 1 49  ? -31.542 11.969  -23.774 0.016 39.54 ? 45  GLU A OE2  2  
ATOM   4226   H H    . GLU A 1 49  ? -31.065 12.241  -18.111 0.016 31.24 ? 45  GLU A H    2  
ATOM   4227   H HA   . GLU A 1 49  ? -31.365 13.672  -20.378 0.016 34.61 ? 45  GLU A HA   2  
ATOM   4228   H HB2  . GLU A 1 49  ? -30.146 11.377  -19.977 0.016 33.36 ? 45  GLU A HB2  2  
ATOM   4229   H HB3  . GLU A 1 49  ? -31.448 11.006  -20.811 0.016 34.78 ? 45  GLU A HB3  2  
ATOM   4230   H HG2  . GLU A 1 49  ? -29.450 12.806  -21.681 0.016 35.96 ? 45  GLU A HG2  2  
ATOM   4231   H HG3  . GLU A 1 49  ? -29.716 11.358  -22.284 0.016 36.66 ? 45  GLU A HG3  2  
ATOM   4232   N N    . GLU A 1 50  ? -33.786 12.191  -19.006 0.016 33.17 ? 46  GLU A N    2  
ATOM   4233   C CA   . GLU A 1 50  ? -35.244 12.152  -19.016 0.016 33.76 ? 46  GLU A CA   2  
ATOM   4234   C C    . GLU A 1 50  ? -35.790 12.545  -17.643 0.016 32.32 ? 46  GLU A C    2  
ATOM   4235   O O    . GLU A 1 50  ? -35.163 12.300  -16.612 0.016 30.79 ? 46  GLU A O    2  
ATOM   4236   C CB   . GLU A 1 50  ? -35.768 10.766  -19.441 0.016 34.44 ? 46  GLU A CB   2  
ATOM   4237   C CG   . GLU A 1 50  ? -35.226 10.283  -20.823 0.016 36.08 ? 46  GLU A CG   2  
ATOM   4238   C CD   . GLU A 1 50  ? -35.730 8.879   -21.218 0.016 36.86 ? 46  GLU A CD   2  
ATOM   4239   O OE1  . GLU A 1 50  ? -35.068 8.198   -22.043 0.016 37.81 ? 46  GLU A OE1  2  
ATOM   4240   O OE2  . GLU A 1 50  ? -36.791 8.465   -20.707 0.016 36.68 ? 46  GLU A OE2  2  
ATOM   4241   H H    . GLU A 1 50  ? -33.430 11.911  -18.277 0.016 32.06 ? 46  GLU A H    2  
ATOM   4242   H HA   . GLU A 1 50  ? -35.569 12.796  -19.663 0.016 34.86 ? 46  GLU A HA   2  
ATOM   4243   H HB2  . GLU A 1 50  ? -35.507 10.112  -18.775 0.016 33.39 ? 46  GLU A HB2  2  
ATOM   4244   H HB3  . GLU A 1 50  ? -36.735 10.808  -19.497 0.016 35.02 ? 46  GLU A HB3  2  
ATOM   4245   H HG2  . GLU A 1 50  ? -35.518 10.904  -21.507 0.016 37.26 ? 46  GLU A HG2  2  
ATOM   4246   H HG3  . GLU A 1 50  ? -34.257 10.262  -20.796 0.016 35.60 ? 46  GLU A HG3  2  
ATOM   4247   N N    . GLY A 1 51  ? -36.970 13.177  -17.647 0.016 33.00 ? 47  GLY A N    2  
ATOM   4248   C CA   . GLY A 1 51  ? -37.649 13.605  -16.433 0.016 32.00 ? 47  GLY A CA   2  
ATOM   4249   C C    . GLY A 1 51  ? -37.174 14.905  -15.813 0.016 31.30 ? 47  GLY A C    2  
ATOM   4250   O O    . GLY A 1 51  ? -37.447 15.143  -14.627 0.016 30.26 ? 47  GLY A O    2  
ATOM   4251   H H    . GLY A 1 51  ? -37.407 13.353  -18.364 0.016 34.16 ? 47  GLY A H    2  
ATOM   4252   H HA2  . GLY A 1 51  ? -38.592 13.709  -16.629 0.016 32.79 ? 47  GLY A HA2  2  
ATOM   4253   H HA3  . GLY A 1 51  ? -37.567 12.910  -15.763 0.016 31.11 ? 47  GLY A HA3  2  
ATOM   4254   N N    . ALA A 1 52  ? -36.508 15.767  -16.574 0.016 32.01 ? 48  ALA A N    2  
ATOM   4255   C CA   . ALA A 1 52  ? -36.044 17.047  -16.054 0.016 31.58 ? 48  ALA A CA   2  
ATOM   4256   C C    . ALA A 1 52  ? -37.181 18.066  -15.899 0.016 32.24 ? 48  ALA A C    2  
ATOM   4257   O O    . ALA A 1 52  ? -38.128 18.085  -16.708 0.016 33.63 ? 48  ALA A O    2  
ATOM   4258   C CB   . ALA A 1 52  ? -34.995 17.617  -16.962 0.016 32.38 ? 48  ALA A CB   2  
ATOM   4259   H H    . ALA A 1 52  ? -36.310 15.633  -17.399 0.016 32.85 ? 48  ALA A H    2  
ATOM   4260   H HA   . ALA A 1 52  ? -35.640 16.887  -15.189 0.016 30.44 ? 48  ALA A HA   2  
ATOM   4261   H HB1  . ALA A 1 52  ? -34.758 18.502  -16.644 0.016 32.24 ? 48  ALA A HB1  2  
ATOM   4262   H HB2  . ALA A 1 52  ? -34.214 17.045  -16.958 0.016 31.93 ? 48  ALA A HB2  2  
ATOM   4263   H HB3  . ALA A 1 52  ? -35.364 17.678  -17.857 0.016 33.61 ? 48  ALA A HB3  2  
ATOM   4264   N N    . PRO A 1 53  ? -37.080 18.950  -14.883 0.016 31.43 ? 49  PRO A N    2  
ATOM   4265   C CA   . PRO A 1 53  ? -36.104 18.965  -13.791 0.016 29.95 ? 49  PRO A CA   2  
ATOM   4266   C C    . PRO A 1 53  ? -36.590 18.070  -12.626 0.016 28.80 ? 49  PRO A C    2  
ATOM   4267   O O    . PRO A 1 53  ? -37.801 17.975  -12.440 0.016 29.18 ? 49  PRO A O    2  
ATOM   4268   C CB   . PRO A 1 53  ? -36.059 20.442  -13.384 0.016 30.16 ? 49  PRO A CB   2  
ATOM   4269   C CG   . PRO A 1 53  ? -37.390 20.904  -13.614 0.016 31.11 ? 49  PRO A CG   2  
ATOM   4270   C CD   . PRO A 1 53  ? -37.898 20.177  -14.862 0.016 32.24 ? 49  PRO A CD   2  
ATOM   4271   H HA   . PRO A 1 53  ? -35.228 18.687  -14.095 0.016 29.80 ? 49  PRO A HA   2  
ATOM   4272   H HB2  . PRO A 1 53  ? -35.824 20.523  -12.446 0.016 29.30 ? 49  PRO A HB2  2  
ATOM   4273   H HB3  . PRO A 1 53  ? -35.430 20.926  -13.943 0.016 30.68 ? 49  PRO A HB3  2  
ATOM   4274   H HG2  . PRO A 1 53  ? -37.935 20.675  -12.847 0.016 30.57 ? 49  PRO A HG2  2  
ATOM   4275   H HG3  . PRO A 1 53  ? -37.384 21.863  -13.753 0.016 31.67 ? 49  PRO A HG3  2  
ATOM   4276   H HD2  . PRO A 1 53  ? -38.839 19.957  -14.768 0.016 32.52 ? 49  PRO A HD2  2  
ATOM   4277   H HD3  . PRO A 1 53  ? -37.734 20.709  -15.657 0.016 33.22 ? 49  PRO A HD3  2  
ATOM   4278   N N    . LEU A 1 54  ? -35.705 17.444  -11.849 0.016 27.59 ? 50  LEU A N    2  
ATOM   4279   C CA   . LEU A 1 54  ? -36.171 16.563  -10.782 0.016 26.70 ? 50  LEU A CA   2  
ATOM   4280   C C    . LEU A 1 54  ? -36.742 17.383  -9.632  0.016 26.42 ? 50  LEU A C    2  
ATOM   4281   O O    . LEU A 1 54  ? -36.138 18.381  -9.234  0.016 26.27 ? 50  LEU A O    2  
ATOM   4282   C CB   . LEU A 1 54  ? -35.048 15.681  -10.230 0.016 25.61 ? 50  LEU A CB   2  
ATOM   4283   C CG   . LEU A 1 54  ? -34.083 15.059  -11.220 0.016 25.82 ? 50  LEU A CG   2  
ATOM   4284   C CD1  . LEU A 1 54  ? -32.874 14.473  -10.466 0.016 24.77 ? 50  LEU A CD1  2  
ATOM   4285   C CD2  . LEU A 1 54  ? -34.769 13.986  -12.087 0.016 26.51 ? 50  LEU A CD2  2  
ATOM   4286   H H    . LEU A 1 54  ? -34.854 17.514  -11.920 0.016 27.35 ? 50  LEU A H    2  
ATOM   4287   H HA   . LEU A 1 54  ? -36.849 15.979  -11.142 0.016 27.11 ? 50  LEU A HA   2  
ATOM   4288   H HB2  . LEU A 1 54  ? -34.530 16.221  -9.615  0.016 25.18 ? 50  LEU A HB2  2  
ATOM   4289   H HB3  . LEU A 1 54  ? -35.447 14.950  -9.735  0.016 25.25 ? 50  LEU A HB3  2  
ATOM   4290   H HG   . LEU A 1 54  ? -33.756 15.754  -11.811 0.016 26.36 ? 50  LEU A HG   2  
ATOM   4291   H HD11 . LEU A 1 54  ? -32.068 14.654  -10.979 0.016 24.98 ? 50  LEU A HD11 2  
ATOM   4292   H HD12 . LEU A 1 54  ? -32.812 14.898  -9.596  0.016 24.27 ? 50  LEU A HD12 2  
ATOM   4293   H HD13 . LEU A 1 54  ? -32.987 13.516  -10.360 0.016 24.52 ? 50  LEU A HD13 2  
ATOM   4294   H HD21 . LEU A 1 54  ? -34.151 13.253  -12.231 0.016 26.27 ? 50  LEU A HD21 2  
ATOM   4295   H HD22 . LEU A 1 54  ? -35.558 13.662  -11.627 0.016 26.38 ? 50  LEU A HD22 2  
ATOM   4296   H HD23 . LEU A 1 54  ? -35.018 14.372  -12.942 0.016 27.41 ? 50  LEU A HD23 2  
ATOM   4297   N N    . PRO A 1 55  ? -37.844 16.971  -9.038  0.016 26.45 ? 51  PRO A N    2  
ATOM   4298   C CA   . PRO A 1 55  ? -38.445 17.789  -7.980  0.016 26.42 ? 51  PRO A CA   2  
ATOM   4299   C C    . PRO A 1 55  ? -38.143 17.259  -6.591  0.016 25.46 ? 51  PRO A C    2  
ATOM   4300   O O    . PRO A 1 55  ? -38.842 17.553  -5.614  0.016 25.55 ? 51  PRO A O    2  
ATOM   4301   C CB   . PRO A 1 55  ? -39.933 17.710  -8.312  0.016 27.44 ? 51  PRO A CB   2  
ATOM   4302   C CG   . PRO A 1 55  ? -40.087 16.256  -8.760  0.016 27.39 ? 51  PRO A CG   2  
ATOM   4303   C CD   . PRO A 1 55  ? -38.740 15.873  -9.438  0.016 26.89 ? 51  PRO A CD   2  
ATOM   4304   H HA   . PRO A 1 55  ? -38.146 18.710  -8.044  0.016 26.61 ? 51  PRO A HA   2  
ATOM   4305   H HB2  . PRO A 1 55  ? -40.465 17.908  -7.527  0.016 27.43 ? 51  PRO A HB2  2  
ATOM   4306   H HB3  . PRO A 1 55  ? -40.136 18.321  -9.036  0.016 28.16 ? 51  PRO A HB3  2  
ATOM   4307   H HG2  . PRO A 1 55  ? -40.256 15.690  -7.991  0.016 26.94 ? 51  PRO A HG2  2  
ATOM   4308   H HG3  . PRO A 1 55  ? -40.817 16.195  -9.397  0.016 28.24 ? 51  PRO A HG3  2  
ATOM   4309   H HD2  . PRO A 1 55  ? -38.417 15.023  -9.095  0.016 26.31 ? 51  PRO A HD2  2  
ATOM   4310   H HD3  . PRO A 1 55  ? -38.838 15.850  -10.403 0.016 27.58 ? 51  PRO A HD3  2  
ATOM   4311   N N    . PHE A 1 56  ? -37.069 16.489  -6.484  0.016 24.65 ? 52  PHE A N    2  
ATOM   4312   C CA   . PHE A 1 56  ? -36.660 15.946  -5.212  0.016 23.85 ? 52  PHE A CA   2  
ATOM   4313   C C    . PHE A 1 56  ? -35.160 16.129  -5.096  0.016 23.25 ? 52  PHE A C    2  
ATOM   4314   O O    . PHE A 1 56  ? -34.464 16.441  -6.062  0.016 23.43 ? 52  PHE A O    2  
ATOM   4315   C CB   . PHE A 1 56  ? -37.007 14.460  -5.061  0.016 23.61 ? 52  PHE A CB   2  
ATOM   4316   C CG   . PHE A 1 56  ? -36.425 13.623  -6.147  0.016 23.55 ? 52  PHE A CG   2  
ATOM   4317   C CD1  . PHE A 1 56  ? -35.130 13.176  -6.068  0.016 22.87 ? 52  PHE A CD1  2  
ATOM   4318   C CD2  . PHE A 1 56  ? -37.162 13.327  -7.277  0.016 24.35 ? 52  PHE A CD2  2  
ATOM   4319   C CE1  . PHE A 1 56  ? -34.586 12.429  -7.087  0.016 22.95 ? 52  PHE A CE1  2  
ATOM   4320   C CE2  . PHE A 1 56  ? -36.623 12.566  -8.288  0.016 24.48 ? 52  PHE A CE2  2  
ATOM   4321   C CZ   . PHE A 1 56  ? -35.323 12.113  -8.196  0.016 23.75 ? 52  PHE A CZ   2  
ATOM   4322   H H    . PHE A 1 56  ? -36.552 16.277  -7.140  0.016 24.63 ? 52  PHE A H    2  
ATOM   4323   H HA   . PHE A 1 56  ? -37.086 16.437  -4.493  0.016 23.97 ? 52  PHE A HA   2  
ATOM   4324   H HB2  . PHE A 1 56  ? -36.651 14.143  -4.219  0.016 23.14 ? 52  PHE A HB2  2  
ATOM   4325   H HB3  . PHE A 1 56  ? -37.969 14.344  -5.074  0.016 24.09 ? 52  PHE A HB3  2  
ATOM   4326   H HD1  . PHE A 1 56  ? -34.619 13.381  -5.318  0.016 22.44 ? 52  PHE A HD1  2  
ATOM   4327   H HD2  . PHE A 1 56  ? -38.042 13.630  -7.343  0.016 24.91 ? 52  PHE A HD2  2  
ATOM   4328   H HE1  . PHE A 1 56  ? -33.709 12.123  -7.015  0.016 22.54 ? 52  PHE A HE1  2  
ATOM   4329   H HE2  . PHE A 1 56  ? -37.131 12.365  -9.040  0.016 25.14 ? 52  PHE A HE2  2  
ATOM   4330   H HZ   . PHE A 1 56  ? -34.951 11.605  -8.880  0.016 23.91 ? 52  PHE A HZ   2  
ATOM   4331   N N    . SER A 1 57  ? -34.685 15.989  -3.895  0.016 22.73 ? 53  SER A N    2  
ATOM   4332   C CA   . SER A 1 57  ? -33.286 16.245  -3.601  0.016 22.32 ? 53  SER A CA   2  
ATOM   4333   C C    . SER A 1 57  ? -32.343 15.303  -4.356  0.016 21.97 ? 53  SER A C    2  
ATOM   4334   O O    . SER A 1 57  ? -32.422 14.075  -4.238  0.016 21.63 ? 53  SER A O    2  
ATOM   4335   C CB   . SER A 1 57  ? -33.084 16.104  -2.101  0.016 22.00 ? 53  SER A CB   2  
ATOM   4336   O OG   . SER A 1 57  ? -31.707 16.057  -1.797  0.016 21.67 ? 53  SER A OG   2  
ATOM   4337   H H    . SER A 1 57  ? -35.146 15.732  -3.218  0.016 22.69 ? 53  SER A H    2  
ATOM   4338   H HA   . SER A 1 57  ? -33.063 17.154  -3.856  0.016 22.62 ? 53  SER A HA   2  
ATOM   4339   H HB2  . SER A 1 57  ? -33.490 16.857  -1.646  0.016 22.32 ? 53  SER A HB2  2  
ATOM   4340   H HB3  . SER A 1 57  ? -33.498 15.281  -1.802  0.016 21.82 ? 53  SER A HB3  2  
ATOM   4341   H HG   . SER A 1 57  ? -31.515 15.329  -1.426  0.016 21.41 ? 53  SER A HG   2  
ATOM   4342   N N    . TYR A 1 58  ? -31.376 15.877  -5.058  0.016 22.15 ? 54  TYR A N    2  
ATOM   4343   C CA   . TYR A 1 58  ? -30.397 15.060  -5.775  0.016 21.98 ? 54  TYR A CA   2  
ATOM   4344   C C    . TYR A 1 58  ? -29.575 14.217  -4.813  0.016 21.34 ? 54  TYR A C    2  
ATOM   4345   O O    . TYR A 1 58  ? -29.120 13.123  -5.175  0.016 21.11 ? 54  TYR A O    2  
ATOM   4346   C CB   . TYR A 1 58  ? -29.458 15.956  -6.603  0.016 22.51 ? 54  TYR A CB   2  
ATOM   4347   C CG   . TYR A 1 58  ? -28.858 15.291  -7.824  0.016 22.80 ? 54  TYR A CG   2  
ATOM   4348   C CD1  . TYR A 1 58  ? -29.500 15.363  -9.026  0.016 23.51 ? 54  TYR A CD1  2  
ATOM   4349   C CD2  . TYR A 1 58  ? -27.657 14.584  -7.770  0.016 22.53 ? 54  TYR A CD2  2  
ATOM   4350   C CE1  . TYR A 1 58  ? -28.987 14.804  -10.162 0.016 24.01 ? 54  TYR A CE1  2  
ATOM   4351   C CE2  . TYR A 1 58  ? -27.145 13.994  -8.893  0.016 22.96 ? 54  TYR A CE2  2  
ATOM   4352   C CZ   . TYR A 1 58  ? -27.820 14.095  -10.091 0.016 23.71 ? 54  TYR A CZ   2  
ATOM   4353   O OH   . TYR A 1 58  ? -27.304 13.522  -11.233 0.016 24.35 ? 54  TYR A OH   2  
ATOM   4354   H H    . TYR A 1 58  ? -31.265 16.725  -5.149  0.016 22.45 ? 54  TYR A H    2  
ATOM   4355   H HA   . TYR A 1 58  ? -30.869 14.491  -6.396  0.016 22.11 ? 54  TYR A HA   2  
ATOM   4356   H HB2  . TYR A 1 58  ? -29.956 16.729  -6.901  0.016 22.96 ? 54  TYR A HB2  2  
ATOM   4357   H HB3  . TYR A 1 58  ? -28.728 16.241  -6.035  0.016 22.37 ? 54  TYR A HB3  2  
ATOM   4358   H HD1  . TYR A 1 58  ? -30.298 15.836  -9.076  0.016 23.78 ? 54  TYR A HD1  2  
ATOM   4359   H HD2  . TYR A 1 58  ? -27.193 14.507  -6.967  0.016 22.15 ? 54  TYR A HD2  2  
ATOM   4360   H HE1  . TYR A 1 58  ? -29.452 14.870  -10.962 0.016 24.62 ? 54  TYR A HE1  2  
ATOM   4361   H HE2  . TYR A 1 58  ? -26.341 13.532  -8.846  0.016 22.83 ? 54  TYR A HE2  2  
ATOM   4362   H HH   . TYR A 1 58  ? -27.901 13.468  -11.818 0.016 24.78 ? 54  TYR A HH   2  
ATOM   4363   N N    . ASP A 1 59  ? -29.414 14.659  -3.564  0.016 21.16 ? 55  ASP A N    2  
ATOM   4364   C CA   . ASP A 1 59  ? -28.505 13.969  -2.669  0.016 20.77 ? 55  ASP A CA   2  
ATOM   4365   C C    . ASP A 1 59  ? -28.966 12.520  -2.416  0.016 20.37 ? 55  ASP A C    2  
ATOM   4366   O O    . ASP A 1 59  ? -28.127 11.645  -2.201  0.016 20.11 ? 55  ASP A O    2  
ATOM   4367   C CB   . ASP A 1 59  ? -28.344 14.716  -1.342  0.016 20.90 ? 55  ASP A CB   2  
ATOM   4368   C CG   . ASP A 1 59  ? -27.653 16.078  -1.492  0.016 21.41 ? 55  ASP A CG   2  
ATOM   4369   O OD1  . ASP A 1 59  ? -26.603 16.150  -2.168  0.016 21.57 ? 55  ASP A OD1  2  
ATOM   4370   O OD2  . ASP A 1 59  ? -28.181 17.058  -0.889  0.016 21.78 ? 55  ASP A OD2  2  
ATOM   4371   H H    . ASP A 1 59  ? -29.809 15.338  -3.224  0.016 21.35 ? 55  ASP A H    2  
ATOM   4372   H HA   . ASP A 1 59  ? -27.632 13.932  -3.088  0.016 20.82 ? 55  ASP A HA   2  
ATOM   4373   H HB2  . ASP A 1 59  ? -29.215 14.855  -0.940  0.016 20.96 ? 55  ASP A HB2  2  
ATOM   4374   H HB3  . ASP A 1 59  ? -27.789 14.184  -0.758  0.016 20.73 ? 55  ASP A HB3  2  
ATOM   4375   N N    . ILE A 1 60  ? -30.272 12.245  -2.479  0.016 20.45 ? 56  ILE A N    2  
ATOM   4376   C CA   . ILE A 1 60  ? -30.686 10.859  -2.245  0.016 20.23 ? 56  ILE A CA   2  
ATOM   4377   C C    . ILE A 1 60  ? -30.133 9.920   -3.298  0.016 20.15 ? 56  ILE A C    2  
ATOM   4378   O O    . ILE A 1 60  ? -30.063 8.700   -3.045  0.016 19.97 ? 56  ILE A O    2  
ATOM   4379   C CB   . ILE A 1 60  ? -32.217 10.681  -2.168  0.016 20.54 ? 56  ILE A CB   2  
ATOM   4380   C CG1  . ILE A 1 60  ? -32.852 10.768  -3.555  0.016 20.95 ? 56  ILE A CG1  2  
ATOM   4381   C CG2  . ILE A 1 60  ? -32.793 11.623  -1.134  0.016 20.78 ? 56  ILE A CG2  2  
ATOM   4382   C CD1  . ILE A 1 60  ? -34.311 10.499  -3.594  0.016 21.43 ? 56  ILE A CD1  2  
ATOM   4383   H H    . ILE A 1 60  ? -30.905 12.802  -2.639  0.016 20.69 ? 56  ILE A H    2  
ATOM   4384   H HA   . ILE A 1 60  ? -30.317 10.578  -1.395  0.016 20.07 ? 56  ILE A HA   2  
ATOM   4385   H HB   . ILE A 1 60  ? -32.374 9.780   -1.840  0.016 20.45 ? 56  ILE A HB   2  
ATOM   4386   H HG12 . ILE A 1 60  ? -32.694 11.651  -3.924  0.016 21.11 ? 56  ILE A HG12 2  
ATOM   4387   H HG13 . ILE A 1 60  ? -32.460 10.103  -4.135  0.016 20.88 ? 56  ILE A HG13 2  
ATOM   4388   H HG21 . ILE A 1 60  ? -33.734 11.423  -1.015  0.016 21.04 ? 56  ILE A HG21 2  
ATOM   4389   H HG22 . ILE A 1 60  ? -32.328 11.501  -0.296  0.016 20.64 ? 56  ILE A HG22 2  
ATOM   4390   H HG23 . ILE A 1 60  ? -32.698 12.533  -1.448  0.016 20.93 ? 56  ILE A HG23 2  
ATOM   4391   H HD11 . ILE A 1 60  ? -34.783 11.176  -3.085  0.016 21.60 ? 56  ILE A HD11 2  
ATOM   4392   H HD12 . ILE A 1 60  ? -34.599 10.515  -4.519  0.016 21.77 ? 56  ILE A HD12 2  
ATOM   4393   H HD13 . ILE A 1 60  ? -34.480 9.624   -3.211  0.016 21.35 ? 56  ILE A HD13 2  
ATOM   4394   N N    . LEU A 1 61  ? -29.734 10.431  -4.466  0.016 20.42 ? 57  LEU A N    2  
ATOM   4395   C CA   . LEU A 1 61  ? -29.244 9.570   -5.548  0.016 20.56 ? 57  LEU A CA   2  
ATOM   4396   C C    . LEU A 1 61  ? -27.755 9.286   -5.495  0.016 20.39 ? 57  LEU A C    2  
ATOM   4397   O O    . LEU A 1 61  ? -27.306 8.339   -6.148  0.016 20.50 ? 57  LEU A O    2  
ATOM   4398   C CB   . LEU A 1 61  ? -29.505 10.217  -6.910  0.016 21.21 ? 57  LEU A CB   2  
ATOM   4399   C CG   . LEU A 1 61  ? -30.946 10.561  -7.198  0.016 21.64 ? 57  LEU A CG   2  
ATOM   4400   C CD1  . LEU A 1 61  ? -31.021 11.293  -8.508  0.016 22.43 ? 57  LEU A CD1  2  
ATOM   4401   C CD2  . LEU A 1 61  ? -31.819 9.294   -7.241  0.016 21.73 ? 57  LEU A CD2  2  
ATOM   4402   H H    . LEU A 1 61  ? -29.742 11.262  -4.659  0.016 20.61 ? 57  LEU A H    2  
ATOM   4403   H HA   . LEU A 1 61  ? -29.718 8.730   -5.534  0.016 20.54 ? 57  LEU A HA   2  
ATOM   4404   H HB2  . LEU A 1 61  ? -29.001 11.044  -6.945  0.016 21.30 ? 57  LEU A HB2  2  
ATOM   4405   H HB3  . LEU A 1 61  ? -29.199 9.634   -7.618  0.016 21.42 ? 57  LEU A HB3  2  
ATOM   4406   H HG   . LEU A 1 61  ? -31.280 11.130  -6.489  0.016 21.48 ? 57  LEU A HG   2  
ATOM   4407   H HD11 . LEU A 1 61  ? -31.954 11.353  -8.772  0.016 22.80 ? 57  LEU A HD11 2  
ATOM   4408   H HD12 . LEU A 1 61  ? -30.646 12.179  -8.395  0.016 22.46 ? 57  LEU A HD12 2  
ATOM   4409   H HD13 . LEU A 1 61  ? -30.517 10.805  -9.175  0.016 22.64 ? 57  LEU A HD13 2  
ATOM   4410   H HD21 . LEU A 1 61  ? -31.340 8.603   -7.721  0.016 21.80 ? 57  LEU A HD21 2  
ATOM   4411   H HD22 . LEU A 1 61  ? -32.001 9.008   -6.333  0.016 21.36 ? 57  LEU A HD22 2  
ATOM   4412   H HD23 . LEU A 1 61  ? -32.652 9.496   -7.693  0.016 22.21 ? 57  LEU A HD23 2  
ATOM   4413   N N    . THR A 1 62  ? -26.951 10.144  -4.867  0.016 20.31 ? 58  THR A N    2  
ATOM   4414   C CA   . THR A 1 62  ? -25.547 10.128  -5.227  0.016 20.49 ? 58  THR A CA   2  
ATOM   4415   C C    . THR A 1 62  ? -24.821 8.885   -4.723  0.016 20.21 ? 58  THR A C    2  
ATOM   4416   O O    . THR A 1 62  ? -23.902 8.419   -5.404  0.016 20.47 ? 58  THR A O    2  
ATOM   4417   C CB   . THR A 1 62  ? -24.842 11.401  -4.749  0.016 20.70 ? 58  THR A CB   2  
ATOM   4418   O OG1  . THR A 1 62  ? -25.183 11.682  -3.399  0.016 20.42 ? 58  THR A OG1  2  
ATOM   4419   C CG2  . THR A 1 62  ? -25.248 12.540  -5.640  0.016 21.22 ? 58  THR A CG2  2  
ATOM   4420   H H    . THR A 1 62  ? -27.179 10.710  -4.265  0.016 20.24 ? 58  THR A H    2  
ATOM   4421   H HA   . THR A 1 62  ? -25.489 10.124  -6.195  0.016 20.83 ? 58  THR A HA   2  
ATOM   4422   H HB   . THR A 1 62  ? -23.887 11.276  -4.820  0.016 20.85 ? 58  THR A HB   2  
ATOM   4423   H HG1  . THR A 1 62  ? -24.679 11.263  -2.879  0.016 20.32 ? 58  THR A HG1  2  
ATOM   4424   H HG21 . THR A 1 62  ? -26.189 12.744  -5.507  0.016 21.14 ? 58  THR A HG21 2  
ATOM   4425   H HG22 . THR A 1 62  ? -24.729 13.337  -5.436  0.016 21.48 ? 58  THR A HG22 2  
ATOM   4426   H HG23 . THR A 1 62  ? -25.107 12.294  -6.567  0.016 21.51 ? 58  THR A HG23 2  
ATOM   4427   N N    . PRO A 1 63  ? -25.193 8.297   -3.587  0.016 19.82 ? 59  PRO A N    2  
ATOM   4428   C CA   . PRO A 1 63  ? -24.493 7.068   -3.187  0.016 19.68 ? 59  PRO A CA   2  
ATOM   4429   C C    . PRO A 1 63  ? -24.750 5.907   -4.170  0.016 19.77 ? 59  PRO A C    2  
ATOM   4430   O O    . PRO A 1 63  ? -23.910 4.982   -4.263  0.016 19.84 ? 59  PRO A O    2  
ATOM   4431   C CB   . PRO A 1 63  ? -25.041 6.787   -1.772  0.016 19.44 ? 59  PRO A CB   2  
ATOM   4432   C CG   . PRO A 1 63  ? -25.643 8.100   -1.303  0.016 19.50 ? 59  PRO A CG   2  
ATOM   4433   C CD   . PRO A 1 63  ? -26.144 8.745   -2.559  0.016 19.65 ? 59  PRO A CD   2  
ATOM   4434   H HA   . PRO A 1 63  ? -23.547 7.256   -3.130  0.016 19.83 ? 59  PRO A HA   2  
ATOM   4435   H HB2  . PRO A 1 63  ? -25.723 6.103   -1.811  0.016 19.36 ? 59  PRO A HB2  2  
ATOM   4436   H HB3  . PRO A 1 63  ? -24.313 6.534   -1.181  0.016 19.47 ? 59  PRO A HB3  2  
ATOM   4437   H HG2  . PRO A 1 63  ? -26.375 7.917   -0.696  0.016 19.43 ? 59  PRO A HG2  2  
ATOM   4438   H HG3  . PRO A 1 63  ? -24.959 8.637   -0.879  0.016 19.62 ? 59  PRO A HG3  2  
ATOM   4439   H HD2  . PRO A 1 63  ? -27.037 8.430   -2.766  0.016 19.62 ? 59  PRO A HD2  2  
ATOM   4440   H HD3  . PRO A 1 63  ? -26.125 9.709   -2.473  0.016 19.79 ? 59  PRO A HD3  2  
ATOM   4441   N N    . ALA A 1 64  ? -25.862 5.948   -4.934  0.016 19.92 ? 60  ALA A N    2  
ATOM   4442   C CA   . ALA A 1 64  ? -26.101 4.921   -5.956  0.016 20.25 ? 60  ALA A CA   2  
ATOM   4443   C C    . ALA A 1 64  ? -25.221 5.120   -7.185  0.016 20.77 ? 60  ALA A C    2  
ATOM   4444   O O    . ALA A 1 64  ? -24.955 4.154   -7.924  0.016 21.15 ? 60  ALA A O    2  
ATOM   4445   C CB   . ALA A 1 64  ? -27.580 4.885   -6.372  0.016 20.49 ? 60  ALA A CB   2  
ATOM   4446   H H    . ALA A 1 64  ? -26.477 6.534   -4.873  0.016 19.92 ? 60  ALA A H    2  
ATOM   4447   H HA   . ALA A 1 64  ? -25.887 4.056   -5.572  0.016 20.14 ? 60  ALA A HA   2  
ATOM   4448   H HB1  . ALA A 1 64  ? -27.722 4.138   -6.972  0.016 20.81 ? 60  ALA A HB1  2  
ATOM   4449   H HB2  . ALA A 1 64  ? -28.128 4.770   -5.583  0.016 20.26 ? 60  ALA A HB2  2  
ATOM   4450   H HB3  . ALA A 1 64  ? -27.814 5.716   -6.818  0.016 20.67 ? 60  ALA A HB3  2  
ATOM   4451   N N    . PHE A 1 65  ? -24.740 6.341   -7.392  0.016 20.94 ? 61  PHE A N    2  
ATOM   4452   C CA   . PHE A 1 65  ? -23.802 6.666   -8.443  0.016 21.60 ? 61  PHE A CA   2  
ATOM   4453   C C    . PHE A 1 65  ? -22.367 6.265   -8.081  0.016 21.63 ? 61  PHE A C    2  
ATOM   4454   O O    . PHE A 1 65  ? -21.576 5.837   -8.931  0.016 22.25 ? 61  PHE A O    2  
ATOM   4455   C CB   . PHE A 1 65  ? -23.861 8.168   -8.708  0.016 21.88 ? 61  PHE A CB   2  
ATOM   4456   C CG   . PHE A 1 65  ? -25.094 8.607   -9.427  0.016 22.22 ? 61  PHE A CG   2  
ATOM   4457   C CD1  . PHE A 1 65  ? -25.766 9.777   -9.067  0.016 22.13 ? 61  PHE A CD1  2  
ATOM   4458   C CD2  . PHE A 1 65  ? -25.561 7.892   -10.503 0.016 22.80 ? 61  PHE A CD2  2  
ATOM   4459   C CE1  . PHE A 1 65  ? -26.894 10.161  -9.756  0.016 22.58 ? 61  PHE A CE1  2  
ATOM   4460   C CE2  . PHE A 1 65  ? -26.650 8.283   -11.198 0.016 23.32 ? 61  PHE A CE2  2  
ATOM   4461   C CZ   . PHE A 1 65  ? -27.334 9.420   -10.831 0.016 23.20 ? 61  PHE A CZ   2  
ATOM   4462   H H    . PHE A 1 65  ? -24.954 7.016   -6.908  0.016 20.75 ? 61  PHE A H    2  
ATOM   4463   H HA   . PHE A 1 65  ? -24.043 6.191   -9.251  0.016 22.00 ? 61  PHE A HA   2  
ATOM   4464   H HB2  . PHE A 1 65  ? -23.833 8.632   -7.856  0.016 21.49 ? 61  PHE A HB2  2  
ATOM   4465   H HB3  . PHE A 1 65  ? -23.092 8.412   -9.244  0.016 22.35 ? 61  PHE A HB3  2  
ATOM   4466   H HD1  . PHE A 1 65  ? -25.475 10.278  -8.341  0.016 21.84 ? 61  PHE A HD1  2  
ATOM   4467   H HD2  . PHE A 1 65  ? -25.110 7.124   -10.768 0.016 22.95 ? 61  PHE A HD2  2  
ATOM   4468   H HE1  . PHE A 1 65  ? -27.348 10.932  -9.510  0.016 22.57 ? 61  PHE A HE1  2  
ATOM   4469   H HE2  . PHE A 1 65  ? -26.949 7.776   -11.915 0.016 23.83 ? 61  PHE A HE2  2  
ATOM   4470   H HZ   . PHE A 1 65  ? -28.091 9.682   -11.299 0.016 23.62 ? 61  PHE A HZ   2  
HETATM 4471   N N    . CRQ A 1 66  ? -21.725 6.540   -6.932  0.016 21.25 ? 62  CRQ A N    2  
HETATM 4472   C CA1  . CRQ A 1 66  ? -20.616 6.394   -6.195  0.016 21.25 ? 62  CRQ A CA1  2  
HETATM 4473   C CB1  . CRQ A 1 66  ? -19.719 7.584   -5.942  0.016 21.62 ? 62  CRQ A CB1  2  
HETATM 4474   C CG1  . CRQ A 1 66  ? -19.588 8.286   -7.259  0.016 22.31 ? 62  CRQ A CG1  2  
HETATM 4475   C C1   . CRQ A 1 66  ? -20.903 5.508   -5.080  0.016 20.70 ? 62  CRQ A C1   2  
HETATM 4476   N N2   . CRQ A 1 66  ? -20.946 5.824   -3.816  0.016 20.40 ? 62  CRQ A N2   2  
HETATM 4477   N N3   . CRQ A 1 66  ? -21.210 4.073   -5.264  0.016 20.60 ? 62  CRQ A N3   2  
HETATM 4478   C C2   . CRQ A 1 66  ? -21.485 3.549   -3.979  0.016 20.19 ? 62  CRQ A C2   2  
HETATM 4479   O O2   . CRQ A 1 66  ? -21.768 2.382   -3.717  0.016 20.10 ? 62  CRQ A O2   2  
HETATM 4480   C CA2  . CRQ A 1 66  ? -21.311 4.681   -3.088  0.016 20.09 ? 62  CRQ A CA2  2  
HETATM 4481   C CA3  . CRQ A 1 66  ? -21.305 3.457   -6.522  0.016 21.01 ? 62  CRQ A CA3  2  
HETATM 4482   C CB2  . CRQ A 1 66  ? -21.439 4.732   -1.723  0.016 19.92 ? 62  CRQ A CB2  2  
HETATM 4483   C CG2  . CRQ A 1 66  ? -21.629 3.530   -0.866  0.016 19.82 ? 62  CRQ A CG2  2  
HETATM 4484   C CD1  . CRQ A 1 66  ? -22.563 3.539   0.191   0.016 19.66 ? 62  CRQ A CD1  2  
HETATM 4485   C CD2  . CRQ A 1 66  ? -20.857 2.414   -1.100  0.016 20.04 ? 62  CRQ A CD2  2  
HETATM 4486   C CE1  . CRQ A 1 66  ? -22.735 2.440   1.023   0.016 19.74 ? 62  CRQ A CE1  2  
HETATM 4487   C CE2  . CRQ A 1 66  ? -21.053 1.311   -0.285  0.016 20.05 ? 62  CRQ A CE2  2  
HETATM 4488   C CZ   . CRQ A 1 66  ? -21.978 1.300   0.766   0.016 19.93 ? 62  CRQ A CZ   2  
HETATM 4489   O OH   . CRQ A 1 66  ? -22.155 0.194   1.573   0.016 20.13 ? 62  CRQ A OH   2  
HETATM 4490   O OE1  . CRQ A 1 66  ? -18.711 10.269  -6.292  0.016 22.75 ? 62  CRQ A OE1  2  
HETATM 4491   C C    . CRQ A 1 66  ? -21.029 2.004   -6.607  0.016 21.18 ? 62  CRQ A C    2  
HETATM 4492   O O    . CRQ A 1 66  ? -21.525 1.365   -7.593  0.016 21.56 ? 62  CRQ A O    2  
HETATM 4493   C CD3  . CRQ A 1 66  ? -18.723 9.549   -7.251  0.016 22.94 ? 62  CRQ A CD3  2  
HETATM 4494   N NE1  . CRQ A 1 66  ? -17.901 9.855   -8.356  0.016 23.95 ? 62  CRQ A NE1  2  
ATOM   4495   N N    . ASN A 1 67  ? -19.751 2.380   -6.601  0.016 21.54 ? 65  ASN A N    2  
ATOM   4496   C CA   . ASN A 1 67  ? -18.771 1.399   -7.085  0.016 22.11 ? 65  ASN A CA   2  
ATOM   4497   C C    . ASN A 1 67  ? -17.511 1.302   -6.207  0.016 22.25 ? 65  ASN A C    2  
ATOM   4498   O O    . ASN A 1 67  ? -16.530 2.012   -6.383  0.016 22.74 ? 65  ASN A O    2  
ATOM   4499   C CB   . ASN A 1 67  ? -18.344 1.707   -8.506  0.016 22.96 ? 65  ASN A CB   2  
ATOM   4500   C CG   . ASN A 1 67  ? -17.284 0.725   -9.030  0.016 23.74 ? 65  ASN A CG   2  
ATOM   4501   O OD1  . ASN A 1 67  ? -17.037 -0.335  -8.426  0.016 23.59 ? 65  ASN A OD1  2  
ATOM   4502   N ND2  . ASN A 1 67  ? -16.690 1.043   -10.164 0.016 24.69 ? 65  ASN A ND2  2  
ATOM   4503   H H    . ASN A 1 67  ? -19.535 2.707   -5.835  0.016 21.30 ? 65  ASN A H    2  
ATOM   4504   H HA   . ASN A 1 67  ? -19.192 0.528   -7.085  0.016 22.04 ? 65  ASN A HA   2  
ATOM   4505   H HB2  . ASN A 1 67  ? -19.124 1.666   -9.083  0.016 23.02 ? 65  ASN A HB2  2  
ATOM   4506   H HB3  . ASN A 1 67  ? -17.968 2.604   -8.536  0.016 23.11 ? 65  ASN A HB3  2  
ATOM   4507   H HD21 . ASN A 1 67  ? -15.857 0.868   -10.270 0.016 25.16 ? 65  ASN A HD21 2  
ATOM   4508   H HD22 . ASN A 1 67  ? -17.132 1.421   -10.794 0.016 24.92 ? 65  ASN A HD22 2  
ATOM   4509   N N    . ARG A 1 68  ? -17.522 0.306   -5.345  0.016 22.00 ? 66  ARG A N    2  
ATOM   4510   C CA   . ARG A 1 68  ? -16.528 0.121   -4.305  0.016 22.15 ? 66  ARG A CA   2  
ATOM   4511   C C    . ARG A 1 68  ? -15.179 -0.344  -4.828  0.016 23.00 ? 66  ARG A C    2  
ATOM   4512   O O    . ARG A 1 68  ? -14.245 -0.410  -4.037  0.016 23.33 ? 66  ARG A O    2  
ATOM   4513   C CB   . ARG A 1 68  ? -17.097 -0.848  -3.310  0.016 21.78 ? 66  ARG A CB   2  
ATOM   4514   C CG   . ARG A 1 68  ? -18.552 -0.555  -3.132  0.016 21.15 ? 66  ARG A CG   2  
ATOM   4515   C CD   . ARG A 1 68  ? -18.827 -0.594  -1.730  0.016 20.91 ? 66  ARG A CD   2  
ATOM   4516   N NE   . ARG A 1 68  ? -17.975 0.327   -0.965  0.016 21.11 ? 66  ARG A NE   2  
ATOM   4517   C CZ   . ARG A 1 68  ? -17.681 0.113   0.307   0.016 21.30 ? 66  ARG A CZ   2  
ATOM   4518   N NH1  . ARG A 1 68  ? -18.122 -1.029  0.908   0.016 21.29 ? 66  ARG A NH1  2  
ATOM   4519   N NH2  . ARG A 1 68  ? -16.919 0.979   0.952   0.016 21.67 ? 66  ARG A NH2  2  
ATOM   4520   H H    . ARG A 1 68  ? -18.113 -0.309  -5.368  0.016 21.83 ? 66  ARG A H    2  
ATOM   4521   H HA   . ARG A 1 68  ? -16.392 0.956   -3.832  0.016 22.06 ? 66  ARG A HA   2  
ATOM   4522   H HB2  . ARG A 1 68  ? -17.022 -1.748  -3.663  0.016 21.99 ? 66  ARG A HB2  2  
ATOM   4523   H HB3  . ARG A 1 68  ? -16.621 -0.783  -2.470  0.016 21.88 ? 66  ARG A HB3  2  
ATOM   4524   H HG2  . ARG A 1 68  ? -18.767 0.343   -3.427  0.016 21.04 ? 66  ARG A HG2  2  
ATOM   4525   H HG3  . ARG A 1 68  ? -19.097 -1.215  -3.592  0.016 21.13 ? 66  ARG A HG3  2  
ATOM   4526   H HD2  . ARG A 1 68  ? -19.739 -0.318  -1.616  0.016 20.58 ? 66  ARG A HD2  2  
ATOM   4527   H HD3  . ARG A 1 68  ? -18.690 -1.506  -1.428  0.016 21.06 ? 66  ARG A HD3  2  
ATOM   4528   H HE   . ARG A 1 68  ? -17.411 0.798   -1.408  0.016 21.33 ? 66  ARG A HE   2  
ATOM   4529   H HH11 . ARG A 1 68  ? -18.613 -1.584  0.486   0.016 21.14 ? 66  ARG A HH11 2  
ATOM   4530   H HH12 . ARG A 1 68  ? -17.931 -1.183  1.730   0.016 21.51 ? 66  ARG A HH12 2  
ATOM   4531   H HH21 . ARG A 1 68  ? -16.632 1.688   0.565   0.016 21.75 ? 66  ARG A HH21 2  
ATOM   4532   H HH22 . ARG A 1 68  ? -16.723 0.824   1.768   0.016 21.90 ? 66  ARG A HH22 2  
ATOM   4533   N N    . ALA A 1 69  ? -15.060 -0.627  -6.125  0.016 23.51 ? 67  ALA A N    2  
ATOM   4534   C CA   . ALA A 1 69  ? -13.753 -0.791  -6.754  0.016 24.52 ? 67  ALA A CA   2  
ATOM   4535   C C    . ALA A 1 69  ? -12.897 0.467   -6.624  0.016 24.95 ? 67  ALA A C    2  
ATOM   4536   O O    . ALA A 1 69  ? -11.670 0.384   -6.596  0.016 25.80 ? 67  ALA A O    2  
ATOM   4537   C CB   . ALA A 1 69  ? -13.936 -1.146  -8.228  0.016 25.14 ? 67  ALA A CB   2  
ATOM   4538   H H    . ALA A 1 69  ? -15.723 -0.728  -6.660  0.016 23.39 ? 67  ALA A H    2  
ATOM   4539   H HA   . ALA A 1 69  ? -13.276 -1.523  -6.338  0.016 24.70 ? 67  ALA A HA   2  
ATOM   4540   H HB1  . ALA A 1 69  ? -13.951 -0.338  -8.762  0.016 25.37 ? 67  ALA A HB1  2  
ATOM   4541   H HB2  . ALA A 1 69  ? -13.191 -1.698  -8.506  0.016 25.78 ? 67  ALA A HB2  2  
ATOM   4542   H HB3  . ALA A 1 69  ? -14.771 -1.627  -8.335  0.016 24.77 ? 67  ALA A HB3  2  
ATOM   4543   N N    . PHE A 1 70  ? -13.523 1.629   -6.530  0.016 24.49 ? 68  PHE A N    2  
ATOM   4544   C CA   . PHE A 1 70  ? -12.793 2.889   -6.275  0.016 24.93 ? 68  PHE A CA   2  
ATOM   4545   C C    . PHE A 1 70  ? -12.686 3.151   -4.766  0.016 24.55 ? 68  PHE A C    2  
ATOM   4546   O O    . PHE A 1 70  ? -13.121 4.180   -4.234  0.016 24.21 ? 68  PHE A O    2  
ATOM   4547   C CB   . PHE A 1 70  ? -13.473 4.071   -6.970  0.016 24.84 ? 68  PHE A CB   2  
ATOM   4548   C CG   . PHE A 1 70  ? -13.479 4.030   -8.497  0.016 25.58 ? 68  PHE A CG   2  
ATOM   4549   C CD1  . PHE A 1 70  ? -14.618 3.666   -9.191  0.016 25.22 ? 68  PHE A CD1  2  
ATOM   4550   C CD2  . PHE A 1 70  ? -12.371 4.435   -9.235  0.016 26.82 ? 68  PHE A CD2  2  
ATOM   4551   C CE1  . PHE A 1 70  ? -14.660 3.651   -10.547 0.016 26.07 ? 68  PHE A CE1  2  
ATOM   4552   C CE2  . PHE A 1 70  ? -12.395 4.421   -10.620 0.016 27.69 ? 68  PHE A CE2  2  
ATOM   4553   C CZ   . PHE A 1 70  ? -13.525 4.037   -11.287 0.016 27.34 ? 68  PHE A CZ   2  
ATOM   4554   H H    . PHE A 1 70  ? -14.369 1.720   -6.622  0.016 23.99 ? 68  PHE A H    2  
ATOM   4555   H HA   . PHE A 1 70  ? -11.896 2.796   -6.628  0.016 25.72 ? 68  PHE A HA   2  
ATOM   4556   H HB2  . PHE A 1 70  ? -14.388 4.086   -6.663  0.016 24.12 ? 68  PHE A HB2  2  
ATOM   4557   H HB3  . PHE A 1 70  ? -13.022 4.885   -6.705  0.016 25.13 ? 68  PHE A HB3  2  
ATOM   4558   H HD1  . PHE A 1 70  ? -15.371 3.403   -8.716  0.016 24.49 ? 68  PHE A HD1  2  
ATOM   4559   H HD2  . PHE A 1 70  ? -11.596 4.693   -8.794  0.016 27.18 ? 68  PHE A HD2  2  
ATOM   4560   H HE1  . PHE A 1 70  ? -15.434 3.385   -10.984 0.016 25.92 ? 68  PHE A HE1  2  
ATOM   4561   H HE2  . PHE A 1 70  ? -11.639 4.677   -11.097 0.016 28.63 ? 68  PHE A HE2  2  
ATOM   4562   H HZ   . PHE A 1 70  ? -13.548 4.027   -12.214 0.016 28.05 ? 68  PHE A HZ   2  
ATOM   4563   N N    . THR A 1 71  ? -12.116 2.163   -4.064  0.016 24.73 ? 69  THR A N    2  
ATOM   4564   C CA   . THR A 1 71  ? -11.807 2.236   -2.642  0.016 24.73 ? 69  THR A CA   2  
ATOM   4565   C C    . THR A 1 71  ? -10.348 1.876   -2.458  0.016 25.85 ? 69  THR A C    2  
ATOM   4566   O O    . THR A 1 71  ? -9.859  0.945   -3.102  0.016 26.28 ? 69  THR A O    2  
ATOM   4567   C CB   . THR A 1 71  ? -12.644 1.247   -1.807  0.016 24.01 ? 69  THR A CB   2  
ATOM   4568   O OG1  . THR A 1 71  ? -14.024 1.407   -2.079  0.016 23.12 ? 69  THR A OG1  2  
ATOM   4569   C CG2  . THR A 1 71  ? -12.414 1.479   -0.307  0.016 24.18 ? 69  THR A CG2  2  
ATOM   4570   H H    . THR A 1 71  ? -11.900 1.408   -4.414  0.016 24.94 ? 69  THR A H    2  
ATOM   4571   H HA   . THR A 1 71  ? -11.961 3.134   -2.310  0.016 24.66 ? 69  THR A HA   2  
ATOM   4572   H HB   . THR A 1 71  ? -12.372 0.346   -2.026  0.016 24.21 ? 69  THR A HB   2  
ATOM   4573   H HG1  . THR A 1 71  ? -14.163 1.344   -2.903  0.016 23.12 ? 69  THR A HG1  2  
ATOM   4574   H HG21 . THR A 1 71  ? -12.665 0.697   0.204   0.016 24.02 ? 69  THR A HG21 2  
ATOM   4575   H HG22 . THR A 1 71  ? -11.483 1.678   -0.130  0.016 24.89 ? 69  THR A HG22 2  
ATOM   4576   H HG23 . THR A 1 71  ? -12.948 2.236   -0.017  0.016 23.85 ? 69  THR A HG23 2  
ATOM   4577   N N    . LYS A 1 72  ? -9.662  2.585   -1.570  0.016 26.45 ? 70  LYS A N    2  
ATOM   4578   C CA   . LYS A 1 72  ? -8.273  2.253   -1.278  0.016 27.68 ? 70  LYS A CA   2  
ATOM   4579   C C    . LYS A 1 72  ? -8.230  1.170   -0.208  0.016 27.65 ? 70  LYS A C    2  
ATOM   4580   O O    . LYS A 1 72  ? -8.664  1.395   0.925   0.016 27.38 ? 70  LYS A O    2  
ATOM   4581   C CB   . LYS A 1 72  ? -7.484  3.469   -0.820  0.016 28.62 ? 70  LYS A CB   2  
ATOM   4582   C CG   . LYS A 1 72  ? -6.057  3.046   -0.630  0.016 30.06 ? 70  LYS A CG   2  
ATOM   4583   C CD   . LYS A 1 72  ? -5.123  4.222   -0.658  0.016 31.34 ? 70  LYS A CD   2  
ATOM   4584   C CE   . LYS A 1 72  ? -4.316  4.338   0.626   0.016 32.41 ? 70  LYS A CE   2  
ATOM   4585   N NZ   . LYS A 1 72  ? -4.540  5.659   1.264   0.016 32.53 ? 70  LYS A NZ   2  
ATOM   4586   H H    . LYS A 1 72  ? -9.980  3.242   -1.120  0.016 26.24 ? 70  LYS A H    2  
ATOM   4587   H HA   . LYS A 1 72  ? -7.843  1.905   -2.077  0.016 28.09 ? 70  LYS A HA   2  
ATOM   4588   H HB2  . LYS A 1 72  ? -7.526  4.170   -1.490  0.016 28.71 ? 70  LYS A HB2  2  
ATOM   4589   H HB3  . LYS A 1 72  ? -7.830  3.782   0.029   0.016 28.37 ? 70  LYS A HB3  2  
ATOM   4590   H HG2  . LYS A 1 72  ? -5.981  2.583   0.215   0.016 30.13 ? 70  LYS A HG2  2  
ATOM   4591   H HG3  . LYS A 1 72  ? -5.814  2.449   -1.353  0.016 30.22 ? 70  LYS A HG3  2  
ATOM   4592   H HD2  . LYS A 1 72  ? -4.502  4.109   -1.394  0.016 32.03 ? 70  LYS A HD2  2  
ATOM   4593   H HD3  . LYS A 1 72  ? -5.630  5.038   -0.775  0.016 30.95 ? 70  LYS A HD3  2  
ATOM   4594   H HE2  . LYS A 1 72  ? -4.580  3.653   1.259   0.016 32.06 ? 70  LYS A HE2  2  
ATOM   4595   H HE3  . LYS A 1 72  ? -3.380  4.253   0.423   0.016 33.52 ? 70  LYS A HE3  2  
ATOM   4596   H HZ1  . LYS A 1 72  ? -3.824  6.177   1.158   0.016 33.53 ? 70  LYS A HZ1  2  
ATOM   4597   H HZ2  . LYS A 1 72  ? -5.234  6.062   0.886   0.016 31.75 ? 70  LYS A HZ2  2  
ATOM   4598   H HZ3  . LYS A 1 72  ? -4.696  5.555   2.134   0.016 32.50 ? 70  LYS A HZ3  2  
ATOM   4599   N N    . TYR A 1 73  ? -7.708  -0.034  -0.586  0.016 28.06 ? 71  TYR A N    2  
ATOM   4600   C CA   . TYR A 1 73  ? -7.567  -1.182  0.296   0.016 28.23 ? 71  TYR A CA   2  
ATOM   4601   C C    . TYR A 1 73  ? -6.104  -1.426  0.632   0.016 29.72 ? 71  TYR A C    2  
ATOM   4602   O O    . TYR A 1 73  ? -5.274  -1.506  -0.280  0.016 30.52 ? 71  TYR A O    2  
ATOM   4603   C CB   . TYR A 1 73  ? -8.149  -2.434  -0.360  0.016 27.69 ? 71  TYR A CB   2  
ATOM   4604   C CG   . TYR A 1 73  ? -9.587  -2.670  0.007   0.016 26.48 ? 71  TYR A CG   2  
ATOM   4605   C CD1  . TYR A 1 73  ? -10.597 -2.029  -0.675  0.016 25.59 ? 71  TYR A CD1  2  
ATOM   4606   C CD2  . TYR A 1 73  ? -9.934  -3.483  1.084   0.016 26.41 ? 71  TYR A CD2  2  
ATOM   4607   C CE1  . TYR A 1 73  ? -11.931 -2.218  -0.334  0.016 24.64 ? 71  TYR A CE1  2  
ATOM   4608   C CE2  . TYR A 1 73  ? -11.268 -3.672  1.427   0.016 25.48 ? 71  TYR A CE2  2  
ATOM   4609   C CZ   . TYR A 1 73  ? -12.253 -3.022  0.723   0.016 24.60 ? 71  TYR A CZ   2  
ATOM   4610   O OH   . TYR A 1 73  ? -13.560 -3.186  1.065   0.016 23.83 ? 71  TYR A OH   2  
ATOM   4611   H H    . TYR A 1 73  ? -7.424  -0.191  -1.381  0.016 28.32 ? 71  TYR A H    2  
ATOM   4612   H HA   . TYR A 1 73  ? -8.061  -1.005  1.108   0.016 27.87 ? 71  TYR A HA   2  
ATOM   4613   H HB2  . TYR A 1 73  ? -8.101  -2.343  -1.323  0.016 27.71 ? 71  TYR A HB2  2  
ATOM   4614   H HB3  . TYR A 1 73  ? -7.633  -3.201  -0.070  0.016 28.23 ? 71  TYR A HB3  2  
ATOM   4615   H HD1  . TYR A 1 73  ? -10.380 -1.479  -1.393  0.016 25.73 ? 71  TYR A HD1  2  
ATOM   4616   H HD2  . TYR A 1 73  ? -9.269  -3.915  1.565   0.016 27.08 ? 71  TYR A HD2  2  
ATOM   4617   H HE1  . TYR A 1 73  ? -12.598 -1.785  -0.807  0.016 24.13 ? 71  TYR A HE1  2  
ATOM   4618   H HE2  . TYR A 1 73  ? -11.498 -4.215  2.146   0.016 25.54 ? 71  TYR A HE2  2  
ATOM   4619   H HH   . TYR A 1 73  ? -13.741 -4.004  1.108   0.016 23.87 ? 71  TYR A HH   2  
ATOM   4620   N N    . PRO A 1 74  ? -5.733  -1.559  1.896   0.016 30.32 ? 72  PRO A N    2  
ATOM   4621   C CA   . PRO A 1 74  ? -4.360  -1.975  2.202   0.016 31.88 ? 72  PRO A CA   2  
ATOM   4622   C C    . PRO A 1 74  ? -4.168  -3.437  1.824   0.016 32.04 ? 72  PRO A C    2  
ATOM   4623   O O    . PRO A 1 74  ? -5.141  -4.191  1.761   0.016 31.02 ? 72  PRO A O    2  
ATOM   4624   C CB   . PRO A 1 74  ? -4.237  -1.763  3.714   0.016 32.45 ? 72  PRO A CB   2  
ATOM   4625   C CG   . PRO A 1 74  ? -5.593  -1.446  4.243   0.016 31.17 ? 72  PRO A CG   2  
ATOM   4626   C CD   . PRO A 1 74  ? -6.587  -1.473  3.094   0.016 29.75 ? 72  PRO A CD   2  
ATOM   4627   H HA   . PRO A 1 74  ? -3.716  -1.423  1.733   0.016 32.53 ? 72  PRO A HA   2  
ATOM   4628   H HB2  . PRO A 1 74  ? -3.900  -2.581  4.120   0.016 32.93 ? 72  PRO A HB2  2  
ATOM   4629   H HB3  . PRO A 1 74  ? -3.632  -1.025  3.885   0.016 33.28 ? 72  PRO A HB3  2  
ATOM   4630   H HG2  . PRO A 1 74  ? -5.831  -2.119  4.898   0.016 31.19 ? 72  PRO A HG2  2  
ATOM   4631   H HG3  . PRO A 1 74  ? -5.582  -0.569  4.659   0.016 31.39 ? 72  PRO A HG3  2  
ATOM   4632   H HD2  . PRO A 1 74  ? -7.152  -2.257  3.158   0.016 29.24 ? 72  PRO A HD2  2  
ATOM   4633   H HD3  . PRO A 1 74  ? -7.113  -0.660  3.082   0.016 29.22 ? 72  PRO A HD3  2  
ATOM   4634   N N    . GLU A 1 75  ? -2.905  -3.824  1.542   0.016 33.45 ? 73  GLU A N    2  
ATOM   4635   C CA   . GLU A 1 75  ? -2.593  -5.218  1.215   0.016 33.86 ? 73  GLU A CA   2  
ATOM   4636   C C    . GLU A 1 75  ? -3.146  -6.165  2.256   0.016 33.55 ? 73  GLU A C    2  
ATOM   4637   O O    . GLU A 1 75  ? -3.486  -7.309  1.933   0.016 33.27 ? 73  GLU A O    2  
ATOM   4638   C CB   . GLU A 1 75  ? -1.074  -5.464  1.114   0.016 35.73 ? 73  GLU A CB   2  
ATOM   4639   C CG   . GLU A 1 75  ? -0.414  -4.725  -0.017  0.016 36.40 ? 73  GLU A CG   2  
ATOM   4640   C CD   . GLU A 1 75  ? 1.051   -5.055  -0.189  0.016 38.36 ? 73  GLU A CD   2  
ATOM   4641   O OE1  . GLU A 1 75  ? 1.577   -5.965  0.502   0.016 39.18 ? 73  GLU A OE1  2  
ATOM   4642   O OE2  . GLU A 1 75  ? 1.678   -4.369  -1.028  0.016 39.22 ? 73  GLU A OE2  2  
ATOM   4643   H H    . GLU A 1 75  ? -2.225  -3.304  1.539   0.016 34.25 ? 73  GLU A H    2  
ATOM   4644   H HA   . GLU A 1 75  ? -2.993  -5.435  0.359   0.016 33.30 ? 73  GLU A HA   2  
ATOM   4645   H HB2  . GLU A 1 75  ? -0.651  -5.189  1.943   0.016 36.41 ? 73  GLU A HB2  2  
ATOM   4646   H HB3  . GLU A 1 75  ? -0.922  -6.410  0.971   0.016 35.99 ? 73  GLU A HB3  2  
ATOM   4647   H HG2  . GLU A 1 75  ? -0.865  -4.946  -0.847  0.016 35.77 ? 73  GLU A HG2  2  
ATOM   4648   H HG3  . GLU A 1 75  ? -0.480  -3.771  0.154   0.016 36.33 ? 73  GLU A HG3  2  
ATOM   4649   N N    . ASP A 1 76  ? -3.225  -5.690  3.484   0.016 33.74 ? 74  ASP A N    2  
ATOM   4650   C CA   . ASP A 1 76  ? -3.689  -6.392  4.665   0.016 33.75 ? 74  ASP A CA   2  
ATOM   4651   C C    . ASP A 1 76  ? -5.170  -6.846  4.624   0.016 32.23 ? 74  ASP A C    2  
ATOM   4652   O O    . ASP A 1 76  ? -5.578  -7.629  5.484   0.016 32.36 ? 74  ASP A O    2  
ATOM   4653   C CB   . ASP A 1 76  ? -3.466  -5.459  5.865   0.016 34.41 ? 74  ASP A CB   2  
ATOM   4654   C CG   . ASP A 1 76  ? -3.491  -6.195  7.150   0.016 35.27 ? 74  ASP A CG   2  
ATOM   4655   O OD1  . ASP A 1 76  ? -3.874  -7.372  7.076   0.016 35.08 ? 74  ASP A OD1  2  
ATOM   4656   O OD2  . ASP A 1 76  ? -3.169  -5.619  8.210   0.016 36.21 ? 74  ASP A OD2  2  
ATOM   4657   H H    . ASP A 1 76  ? -2.966  -4.894  3.678   0.016 34.03 ? 74  ASP A H    2  
ATOM   4658   H HA   . ASP A 1 76  ? -3.141  -7.178  4.795   0.016 34.56 ? 74  ASP A HA   2  
ATOM   4659   H HB2  . ASP A 1 76  ? -2.608  -5.020  5.775   0.016 35.26 ? 74  ASP A HB2  2  
ATOM   4660   H HB3  . ASP A 1 76  ? -4.170  -4.791  5.887   0.016 33.53 ? 74  ASP A HB3  2  
ATOM   4661   N N    . ILE A 1 77  ? -5.989  -6.353  3.699   0.016 30.97 ? 75  ILE A N    2  
ATOM   4662   C CA   . ILE A 1 77  ? -7.415  -6.666  3.655   0.016 29.67 ? 75  ILE A CA   2  
ATOM   4663   C C    . ILE A 1 77  ? -7.756  -7.106  2.238   0.016 29.07 ? 75  ILE A C    2  
ATOM   4664   O O    . ILE A 1 77  ? -7.588  -6.326  1.297   0.016 28.88 ? 75  ILE A O    2  
ATOM   4665   C CB   . ILE A 1 77  ? -8.293  -5.461  4.052   0.016 28.81 ? 75  ILE A CB   2  
ATOM   4666   C CG1  . ILE A 1 77  ? -7.845  -4.915  5.416   0.016 29.68 ? 75  ILE A CG1  2  
ATOM   4667   C CG2  . ILE A 1 77  ? -9.778  -5.843  4.064   0.016 27.66 ? 75  ILE A CG2  2  
ATOM   4668   C CD1  . ILE A 1 77  ? -8.678  -3.756  6.009   0.016 29.09 ? 75  ILE A CD1  2  
ATOM   4669   H H    . ILE A 1 77  ? -5.738  -5.823  3.073   0.016 30.93 ? 75  ILE A H    2  
ATOM   4670   H HA   . ILE A 1 77  ? -7.603  -7.391  4.268   0.016 29.88 ? 75  ILE A HA   2  
ATOM   4671   H HB   . ILE A 1 77  ? -8.168  -4.766  3.390   0.016 28.59 ? 75  ILE A HB   2  
ATOM   4672   H HG12 . ILE A 1 77  ? -7.870  -5.647  6.045   0.016 30.06 ? 75  ILE A HG12 2  
ATOM   4673   H HG13 . ILE A 1 77  ? -6.931  -4.596  5.329   0.016 30.46 ? 75  ILE A HG13 2  
ATOM   4674   H HG21 . ILE A 1 77  ? -10.311 -5.033  4.081   0.016 27.10 ? 75  ILE A HG21 2  
ATOM   4675   H HG22 . ILE A 1 77  ? -9.993  -6.352  3.269   0.016 27.34 ? 75  ILE A HG22 2  
ATOM   4676   H HG23 . ILE A 1 77  ? -9.965  -6.366  4.855   0.016 27.93 ? 75  ILE A HG23 2  
ATOM   4677   H HD11 . ILE A 1 77  ? -9.623  -3.956  5.925   0.016 28.27 ? 75  ILE A HD11 2  
ATOM   4678   H HD12 . ILE A 1 77  ? -8.447  -3.658  6.945   0.016 29.78 ? 75  ILE A HD12 2  
ATOM   4679   H HD13 . ILE A 1 77  ? -8.468  -2.936  5.535   0.016 28.97 ? 75  ILE A HD13 2  
ATOM   4680   N N    . PRO A 1 78  ? -8.286  -8.314  2.013   0.016 28.86 ? 76  PRO A N    2  
ATOM   4681   C CA   . PRO A 1 78  ? -8.630  -8.685  0.642   0.016 28.46 ? 76  PRO A CA   2  
ATOM   4682   C C    . PRO A 1 78  ? -9.670  -7.728  0.082   0.016 27.32 ? 76  PRO A C    2  
ATOM   4683   O O    . PRO A 1 78  ? -10.634 -7.374  0.757   0.016 26.59 ? 76  PRO A O    2  
ATOM   4684   C CB   . PRO A 1 78  ? -9.167  -10.123 0.774   0.016 28.54 ? 76  PRO A CB   2  
ATOM   4685   C CG   . PRO A 1 78  ? -8.616  -10.613 2.082   0.016 29.34 ? 76  PRO A CG   2  
ATOM   4686   C CD   . PRO A 1 78  ? -8.532  -9.411  2.964   0.016 29.21 ? 76  PRO A CD   2  
ATOM   4687   H HA   . PRO A 1 78  ? -7.841  -8.668  0.082   0.016 29.06 ? 76  PRO A HA   2  
ATOM   4688   H HB2  . PRO A 1 78  ? -10.134 -10.110 0.785   0.016 27.83 ? 76  PRO A HB2  2  
ATOM   4689   H HB3  . PRO A 1 78  ? -8.841  -10.663 0.039   0.016 28.93 ? 76  PRO A HB3  2  
ATOM   4690   H HG2  . PRO A 1 78  ? -9.214  -11.269 2.470   0.016 29.21 ? 76  PRO A HG2  2  
ATOM   4691   H HG3  . PRO A 1 78  ? -7.741  -10.998 1.942   0.016 30.16 ? 76  PRO A HG3  2  
ATOM   4692   H HD2  . PRO A 1 78  ? -9.379  -9.278  3.424   0.016 28.64 ? 76  PRO A HD2  2  
ATOM   4693   H HD3  . PRO A 1 78  ? -7.793  -9.494  3.587   0.016 30.04 ? 76  PRO A HD3  2  
ATOM   4694   N N    . ASP A 1 79  ? -9.472  -7.368  -1.178  0.016 27.34 ? 77  ASP A N    2  
ATOM   4695   C CA   . ASP A 1 79  ? -10.259 -6.359  -1.880  0.016 26.53 ? 77  ASP A CA   2  
ATOM   4696   C C    . ASP A 1 79  ? -11.313 -7.046  -2.744  0.016 26.06 ? 77  ASP A C    2  
ATOM   4697   O O    . ASP A 1 79  ? -11.140 -7.214  -3.939  0.016 26.43 ? 77  ASP A O    2  
ATOM   4698   C CB   . ASP A 1 79  ? -9.319  -5.502  -2.715  0.016 27.16 ? 77  ASP A CB   2  
ATOM   4699   C CG   . ASP A 1 79  ? -10.005 -4.328  -3.376  0.016 26.51 ? 77  ASP A CG   2  
ATOM   4700   O OD1  . ASP A 1 79  ? -11.243 -4.369  -3.509  0.016 25.63 ? 77  ASP A OD1  2  
ATOM   4701   O OD2  . ASP A 1 79  ? -9.296  -3.352  -3.754  0.016 27.02 ? 77  ASP A OD2  2  
ATOM   4702   H H    . ASP A 1 79  ? -8.856  -7.702  -1.671  0.016 27.92 ? 77  ASP A H    2  
ATOM   4703   H HA   . ASP A 1 79  ? -10.699 -5.789  -1.232  0.016 26.05 ? 77  ASP A HA   2  
ATOM   4704   H HB2  . ASP A 1 79  ? -8.613  -5.161  -2.142  0.016 27.61 ? 77  ASP A HB2  2  
ATOM   4705   H HB3  . ASP A 1 79  ? -8.935  -6.055  -3.414  0.016 27.69 ? 77  ASP A HB3  2  
ATOM   4706   N N    . TYR A 1 80  ? -12.452 -7.370  -2.138  0.016 25.36 ? 78  TYR A N    2  
ATOM   4707   C CA   . TYR A 1 80  ? -13.513 -8.121  -2.806  0.016 25.07 ? 78  TYR A CA   2  
ATOM   4708   C C    . TYR A 1 80  ? -13.856 -7.530  -4.163  0.016 24.95 ? 78  TYR A C    2  
ATOM   4709   O O    . TYR A 1 80  ? -14.248 -8.246  -5.084  0.016 25.27 ? 78  TYR A O    2  
ATOM   4710   C CB   . TYR A 1 80  ? -14.744 -8.103  -1.913  0.016 24.34 ? 78  TYR A CB   2  
ATOM   4711   C CG   . TYR A 1 80  ? -15.934 -8.935  -2.324  0.016 24.19 ? 78  TYR A CG   2  
ATOM   4712   C CD1  . TYR A 1 80  ? -15.958 -10.290 -2.062  0.016 24.72 ? 78  TYR A CD1  2  
ATOM   4713   C CD2  . TYR A 1 80  ? -17.041 -8.354  -2.918  0.016 23.64 ? 78  TYR A CD2  2  
ATOM   4714   C CE1  . TYR A 1 80  ? -17.058 -11.061 -2.390  0.016 24.75 ? 78  TYR A CE1  2  
ATOM   4715   C CE2  . TYR A 1 80  ? -18.170 -9.110  -3.248  0.016 23.67 ? 78  TYR A CE2  2  
ATOM   4716   C CZ   . TYR A 1 80  ? -18.158 -10.479 -2.995  0.016 24.25 ? 78  TYR A CZ   2  
ATOM   4717   O OH   . TYR A 1 80  ? -19.257 -11.288 -3.315  0.016 24.48 ? 78  TYR A OH   2  
ATOM   4718   H H    . TYR A 1 80  ? -12.647 -7.149  -1.331  0.016 25.13 ? 78  TYR A H    2  
ATOM   4719   H HA   . TYR A 1 80  ? -13.225 -9.041  -2.922  0.016 25.57 ? 78  TYR A HA   2  
ATOM   4720   H HB2  . TYR A 1 80  ? -14.479 -8.395  -1.027  0.016 24.54 ? 78  TYR A HB2  2  
ATOM   4721   H HB3  . TYR A 1 80  ? -15.053 -7.188  -1.860  0.016 23.89 ? 78  TYR A HB3  2  
ATOM   4722   H HD1  . TYR A 1 80  ? -15.222 -10.684 -1.656  0.016 25.15 ? 78  TYR A HD1  2  
ATOM   4723   H HD2  . TYR A 1 80  ? -17.035 -7.438  -3.081  0.016 23.33 ? 78  TYR A HD2  2  
ATOM   4724   H HE1  . TYR A 1 80  ? -17.056 -11.971 -2.215  0.016 25.19 ? 78  TYR A HE1  2  
ATOM   4725   H HE2  . TYR A 1 80  ? -18.903 -8.714  -3.658  0.016 23.40 ? 78  TYR A HE2  2  
ATOM   4726   H HH   . TYR A 1 80  ? -19.848 -10.841 -3.708  0.016 24.31 ? 78  TYR A HH   2  
ATOM   4727   N N    . PHE A 1 81  ? -13.815 -6.207  -4.271  0.016 24.59 ? 79  PHE A N    2  
ATOM   4728   C CA   . PHE A 1 81  ? -14.325 -5.535  -5.449  0.016 24.49 ? 79  PHE A CA   2  
ATOM   4729   C C    . PHE A 1 81  ? -13.333 -5.566  -6.612  0.016 25.47 ? 79  PHE A C    2  
ATOM   4730   O O    . PHE A 1 81  ? -13.713 -5.886  -7.743  0.016 25.86 ? 79  PHE A O    2  
ATOM   4731   C CB   . PHE A 1 81  ? -14.699 -4.105  -5.040  0.016 23.84 ? 79  PHE A CB   2  
ATOM   4732   C CG   . PHE A 1 81  ? -15.559 -4.070  -3.822  0.016 23.09 ? 79  PHE A CG   2  
ATOM   4733   C CD1  . PHE A 1 81  ? -15.016 -3.754  -2.594  0.016 23.09 ? 79  PHE A CD1  2  
ATOM   4734   C CD2  . PHE A 1 81  ? -16.893 -4.444  -3.887  0.016 22.61 ? 79  PHE A CD2  2  
ATOM   4735   C CE1  . PHE A 1 81  ? -15.754 -3.788  -1.466  0.016 22.64 ? 79  PHE A CE1  2  
ATOM   4736   C CE2  . PHE A 1 81  ? -17.649 -4.477  -2.743  0.016 22.13 ? 79  PHE A CE2  2  
ATOM   4737   C CZ   . PHE A 1 81  ? -17.083 -4.129  -1.531  0.016 22.15 ? 79  PHE A CZ   2  
ATOM   4738   H H    . PHE A 1 81  ? -13.513 -5.685  -3.662  0.016 24.48 ? 79  PHE A H    2  
ATOM   4739   H HA   . PHE A 1 81  ? -15.140 -5.976  -5.734  0.016 24.31 ? 79  PHE A HA   2  
ATOM   4740   H HB2  . PHE A 1 81  ? -13.882 -3.642  -4.818  0.016 24.12 ? 79  PHE A HB2  2  
ATOM   4741   H HB3  . PHE A 1 81  ? -15.159 -3.670  -5.772  0.016 23.75 ? 79  PHE A HB3  2  
ATOM   4742   H HD1  . PHE A 1 81  ? -14.117 -3.528  -2.539  0.016 23.52 ? 79  PHE A HD1  2  
ATOM   4743   H HD2  . PHE A 1 81  ? -17.272 -4.676  -4.702  0.016 22.73 ? 79  PHE A HD2  2  
ATOM   4744   H HE1  . PHE A 1 81  ? -15.373 -3.553  -0.651  0.016 22.77 ? 79  PHE A HE1  2  
ATOM   4745   H HE2  . PHE A 1 81  ? -18.549 -4.704  -2.783  0.016 21.90 ? 79  PHE A HE2  2  
ATOM   4746   H HZ   . PHE A 1 81  ? -17.598 -4.134  -0.760  0.016 21.94 ? 79  PHE A HZ   2  
ATOM   4747   N N    . LYS A 1 82  ? -12.045 -5.268  -6.365  0.016 26.09 ? 80  LYS A N    2  
ATOM   4748   C CA   . LYS A 1 82  ? -11.087 -5.363  -7.462  0.016 27.23 ? 80  LYS A CA   2  
ATOM   4749   C C    . LYS A 1 82  ? -10.905 -6.806  -7.916  0.016 27.92 ? 80  LYS A C    2  
ATOM   4750   O O    . LYS A 1 82  ? -10.735 -7.064  -9.106  0.016 28.76 ? 80  LYS A O    2  
ATOM   4751   C CB   . LYS A 1 82  ? -9.753  -4.739  -7.060  0.016 27.91 ? 80  LYS A CB   2  
ATOM   4752   C CG   . LYS A 1 82  ? -9.819  -3.241  -6.937  0.016 27.59 ? 80  LYS A CG   2  
ATOM   4753   C CD   . LYS A 1 82  ? -8.461  -2.608  -6.647  0.016 28.53 ? 80  LYS A CD   2  
ATOM   4754   C CE   . LYS A 1 82  ? -8.611  -1.068  -6.385  0.016 28.21 ? 80  LYS A CE   2  
ATOM   4755   N NZ   . LYS A 1 82  ? -9.301  -0.736  -5.115  0.016 27.18 ? 80  LYS A NZ   2  
ATOM   4756   H H    . LYS A 1 82  ? -11.719 -5.025  -5.609  0.016 25.98 ? 80  LYS A H    2  
ATOM   4757   H HA   . LYS A 1 82  ? -11.427 -4.871  -8.223  0.016 27.27 ? 80  LYS A HA   2  
ATOM   4758   H HB2  . LYS A 1 82  ? -9.482  -5.083  -6.198  0.016 27.83 ? 80  LYS A HB2  2  
ATOM   4759   H HB3  . LYS A 1 82  ? -9.093  -4.951  -7.738  0.016 28.78 ? 80  LYS A HB3  2  
ATOM   4760   H HG2  . LYS A 1 82  ? -10.150 -2.883  -7.773  0.016 27.68 ? 80  LYS A HG2  2  
ATOM   4761   H HG3  . LYS A 1 82  ? -10.422 -3.016  -6.213  0.016 26.80 ? 80  LYS A HG3  2  
ATOM   4762   H HD2  . LYS A 1 82  ? -8.066  -3.010  -5.860  0.016 28.61 ? 80  LYS A HD2  2  
ATOM   4763   H HD3  . LYS A 1 82  ? -7.889  -2.732  -7.417  0.016 29.38 ? 80  LYS A HD3  2  
ATOM   4764   H HE2  . LYS A 1 82  ? -7.727  -0.675  -6.344  0.016 29.00 ? 80  LYS A HE2  2  
ATOM   4765   H HE3  . LYS A 1 82  ? -9.112  -0.674  -7.113  0.016 28.05 ? 80  LYS A HE3  2  
ATOM   4766   H HZ1  . LYS A 1 82  ? -9.557  0.117   -5.128  0.016 26.96 ? 80  LYS A HZ1  2  
ATOM   4767   H HZ2  . LYS A 1 82  ? -10.026 -1.241  -5.020  0.016 26.56 ? 80  LYS A HZ2  2  
ATOM   4768   H HZ3  . LYS A 1 82  ? -8.763  -0.865  -4.422  0.016 27.46 ? 80  LYS A HZ3  2  
ATOM   4769   N N    . GLN A 1 83  ? -10.979 -7.762  -7.003  0.016 27.70 ? 81  GLN A N    2  
ATOM   4770   C CA   . GLN A 1 83  ? -10.783 -9.143  -7.421  0.016 28.48 ? 81  GLN A CA   2  
ATOM   4771   C C    . GLN A 1 83  ? -11.956 -9.633  -8.273  0.016 28.35 ? 81  GLN A C    2  
ATOM   4772   O O    . GLN A 1 83  ? -11.817 -10.601 -9.053  0.016 29.27 ? 81  GLN A O    2  
ATOM   4773   C CB   . GLN A 1 83  ? -10.569 -10.023 -6.178  0.016 28.41 ? 81  GLN A CB   2  
ATOM   4774   C CG   . GLN A 1 83  ? -9.102  -10.120 -5.743  0.016 29.33 ? 81  GLN A CG   2  
ATOM   4775   C CD   . GLN A 1 83  ? -8.680  -9.178  -4.603  0.016 28.98 ? 81  GLN A CD   2  
ATOM   4776   O OE1  . GLN A 1 83  ? -9.441  -8.340  -4.176  0.016 28.01 ? 81  GLN A OE1  2  
ATOM   4777   N NE2  . GLN A 1 83  ? -7.439  -9.319  -4.125  0.016 29.94 ? 81  GLN A NE2  2  
ATOM   4778   H H    . GLN A 1 83  ? -11.141 -7.648  -6.167  0.016 27.21 ? 81  GLN A H    2  
ATOM   4779   H HA   . GLN A 1 83  ? -9.986  -9.184  -7.970  0.016 29.31 ? 81  GLN A HA   2  
ATOM   4780   H HB2  . GLN A 1 83  ? -11.076 -9.655  -5.439  0.016 27.67 ? 81  GLN A HB2  2  
ATOM   4781   H HB3  . GLN A 1 83  ? -10.889 -10.915 -6.372  0.016 28.63 ? 81  GLN A HB3  2  
ATOM   4782   H HG2  . GLN A 1 83  ? -8.922  -11.034 -5.459  0.016 29.74 ? 81  GLN A HG2  2  
ATOM   4783   H HG3  . GLN A 1 83  ? -8.544  -9.914  -6.509  0.016 29.96 ? 81  GLN A HG3  2  
ATOM   4784   H HE21 . GLN A 1 83  ? -6.766  -9.276  -4.658  0.016 30.63 ? 81  GLN A HE21 2  
ATOM   4785   H HE22 . GLN A 1 83  ? -7.313  -9.430  -3.282  0.016 29.93 ? 81  GLN A HE22 2  
ATOM   4786   N N    . ALA A 1 84  ? -13.095 -8.933  -8.188  0.016 27.39 ? 82  ALA A N    2  
ATOM   4787   C CA   . ALA A 1 84  ? -14.294 -9.324  -8.904  0.016 27.34 ? 82  ALA A CA   2  
ATOM   4788   C C    . ALA A 1 84  ? -14.184 -9.111  -10.401 0.016 28.26 ? 82  ALA A C    2  
ATOM   4789   O O    . ALA A 1 84  ? -15.007 -9.648  -11.138 0.016 28.65 ? 82  ALA A O    2  
ATOM   4790   C CB   . ALA A 1 84  ? -15.498 -8.535  -8.370  0.016 26.20 ? 82  ALA A CB   2  
ATOM   4791   H H    . ALA A 1 84  ? -13.192 -8.226  -7.709  0.016 26.84 ? 82  ALA A H    2  
ATOM   4792   H HA   . ALA A 1 84  ? -14.463 -10.268 -8.751  0.016 27.57 ? 82  ALA A HA   2  
ATOM   4793   H HB1  . ALA A 1 84  ? -16.301 -9.074  -8.447  0.016 26.17 ? 82  ALA A HB1  2  
ATOM   4794   H HB2  . ALA A 1 84  ? -15.336 -8.307  -7.440  0.016 25.70 ? 82  ALA A HB2  2  
ATOM   4795   H HB3  . ALA A 1 84  ? -15.577 -7.721  -8.892  0.016 26.13 ? 82  ALA A HB3  2  
ATOM   4796   N N    . PHE A 1 85  ? -13.201 -8.348  -10.864 0.016 28.81 ? 83  PHE A N    2  
ATOM   4797   C CA   . PHE A 1 85  ? -13.060 -8.049  -12.282 0.016 29.87 ? 83  PHE A CA   2  
ATOM   4798   C C    . PHE A 1 85  ? -12.091 -9.029  -12.967 0.016 31.36 ? 83  PHE A C    2  
ATOM   4799   O O    . PHE A 1 85  ? -11.290 -9.670  -12.295 0.016 31.51 ? 83  PHE A O    2  
ATOM   4800   C CB   . PHE A 1 85  ? -12.656 -6.579  -12.402 0.016 29.74 ? 83  PHE A CB   2  
ATOM   4801   C CG   . PHE A 1 85  ? -13.778 -5.695  -12.000 0.016 28.54 ? 83  PHE A CG   2  
ATOM   4802   C CD1  . PHE A 1 85  ? -13.894 -5.235  -10.706 0.016 27.38 ? 83  PHE A CD1  2  
ATOM   4803   C CD2  . PHE A 1 85  ? -14.788 -5.473  -12.877 0.016 28.70 ? 83  PHE A CD2  2  
ATOM   4804   C CE1  . PHE A 1 85  ? -15.001 -4.503  -10.315 0.016 26.36 ? 83  PHE A CE1  2  
ATOM   4805   C CE2  . PHE A 1 85  ? -15.880 -4.743  -12.523 0.016 27.71 ? 83  PHE A CE2  2  
ATOM   4806   C CZ   . PHE A 1 85  ? -16.002 -4.251  -11.233 0.016 26.51 ? 83  PHE A CZ   2  
ATOM   4807   H H    . PHE A 1 85  ? -12.601 -7.983  -10.370 0.016 28.67 ? 83  PHE A H    2  
ATOM   4808   H HA   . PHE A 1 85  ? -13.924 -8.150  -12.706 0.016 29.82 ? 83  PHE A HA   2  
ATOM   4809   H HB2  . PHE A 1 85  ? -11.911 -6.405  -11.810 0.016 29.66 ? 83  PHE A HB2  2  
ATOM   4810   H HB3  . PHE A 1 85  ? -12.411 -6.373  -13.315 0.016 30.62 ? 83  PHE A HB3  2  
ATOM   4811   H HD1  . PHE A 1 85  ? -13.222 -5.417  -10.093 0.016 27.37 ? 83  PHE A HD1  2  
ATOM   4812   H HD2  . PHE A 1 85  ? -14.719 -5.809  -13.741 0.016 29.60 ? 83  PHE A HD2  2  
ATOM   4813   H HE1  . PHE A 1 85  ? -15.062 -4.171  -9.448  0.016 25.70 ? 83  PHE A HE1  2  
ATOM   4814   H HE2  . PHE A 1 85  ? -16.549 -4.580  -13.147 0.016 27.93 ? 83  PHE A HE2  2  
ATOM   4815   H HZ   . PHE A 1 85  ? -16.745 -3.745  -10.997 0.016 25.90 ? 83  PHE A HZ   2  
ATOM   4816   N N    . PRO A 1 86  ? -12.195 -9.173  -14.296 0.016 32.58 ? 84  PRO A N    2  
ATOM   4817   C CA   . PRO A 1 86  ? -12.999 -8.384  -15.235 0.016 32.77 ? 84  PRO A CA   2  
ATOM   4818   C C    . PRO A 1 86  ? -14.487 -8.687  -15.271 0.016 32.19 ? 84  PRO A C    2  
ATOM   4819   O O    . PRO A 1 86  ? -15.223 -7.870  -15.829 0.016 32.15 ? 84  PRO A O    2  
ATOM   4820   C CB   . PRO A 1 86  ? -12.376 -8.735  -16.589 0.016 34.72 ? 84  PRO A CB   2  
ATOM   4821   C CG   . PRO A 1 86  ? -11.933 -10.152 -16.409 0.016 35.33 ? 84  PRO A CG   2  
ATOM   4822   C CD   . PRO A 1 86  ? -11.395 -10.206 -15.002 0.016 34.16 ? 84  PRO A CD   2  
ATOM   4823   H HA   . PRO A 1 86  ? -12.880 -7.435  -15.073 0.016 32.34 ? 84  PRO A HA   2  
ATOM   4824   H HB2  . PRO A 1 86  ? -13.043 -8.668  -17.290 0.016 35.14 ? 84  PRO A HB2  2  
ATOM   4825   H HB3  . PRO A 1 86  ? -11.623 -8.151  -16.768 0.016 35.16 ? 84  PRO A HB3  2  
ATOM   4826   H HG2  . PRO A 1 86  ? -12.696 -10.741 -16.508 0.016 35.28 ? 84  PRO A HG2  2  
ATOM   4827   H HG3  . PRO A 1 86  ? -11.242 -10.364 -17.053 0.016 36.57 ? 84  PRO A HG3  2  
ATOM   4828   H HD2  . PRO A 1 86  ? -11.554 -11.082 -14.616 0.016 34.06 ? 84  PRO A HD2  2  
ATOM   4829   H HD3  . PRO A 1 86  ? -10.454 -9.973  -14.987 0.016 34.65 ? 84  PRO A HD3  2  
ATOM   4830   N N    . GLU A 1 87  ? -14.918 -9.776  -14.637 0.016 31.80 ? 85  GLU A N    2  
ATOM   4831   C CA   . GLU A 1 87  ? -16.278 -10.278 -14.815 0.016 31.69 ? 85  GLU A CA   2  
ATOM   4832   C C    . GLU A 1 87  ? -17.314 -9.360  -14.181 0.016 30.32 ? 85  GLU A C    2  
ATOM   4833   O O    . GLU A 1 87  ? -18.392 -9.146  -14.755 0.016 30.50 ? 85  GLU A O    2  
ATOM   4834   C CB   . GLU A 1 87  ? -16.374 -11.695 -14.238 0.016 31.79 ? 85  GLU A CB   2  
ATOM   4835   C CG   . GLU A 1 87  ? -15.482 -12.737 -14.947 0.016 33.36 ? 85  GLU A CG   2  
ATOM   4836   C CD   . GLU A 1 87  ? -14.091 -12.916 -14.292 0.016 33.36 ? 85  GLU A CD   2  
ATOM   4837   O OE1  . GLU A 1 87  ? -13.409 -13.932 -14.569 0.016 34.50 ? 85  GLU A OE1  2  
ATOM   4838   O OE2  . GLU A 1 87  ? -13.670 -12.040 -13.519 0.016 32.36 ? 85  GLU A OE2  2  
ATOM   4839   H H    . GLU A 1 87  ? -14.441 -10.241 -14.095 0.016 31.68 ? 85  GLU A H    2  
ATOM   4840   H HA   . GLU A 1 87  ? -16.476 -10.325 -15.763 0.016 32.65 ? 85  GLU A HA   2  
ATOM   4841   H HB2  . GLU A 1 87  ? -16.106 -11.661 -13.309 0.016 30.99 ? 85  GLU A HB2  2  
ATOM   4842   H HB3  . GLU A 1 87  ? -17.295 -11.993 -14.299 0.016 31.73 ? 85  GLU A HB3  2  
ATOM   4843   H HG2  . GLU A 1 87  ? -15.931 -13.597 -14.938 0.016 33.68 ? 85  GLU A HG2  2  
ATOM   4844   H HG3  . GLU A 1 87  ? -15.344 -12.454 -15.864 0.016 34.23 ? 85  GLU A HG3  2  
ATOM   4845   N N    . GLY A 1 88  ? -17.003 -8.806  -13.013 0.016 29.09 ? 86  GLY A N    2  
ATOM   4846   C CA   . GLY A 1 88  ? -17.835 -7.797  -12.365 0.016 27.87 ? 86  GLY A CA   2  
ATOM   4847   C C    . GLY A 1 88  ? -18.538 -8.276  -11.112 0.016 26.88 ? 86  GLY A C    2  
ATOM   4848   O O    . GLY A 1 88  ? -18.343 -9.401  -10.624 0.016 27.05 ? 86  GLY A O    2  
ATOM   4849   H H    . GLY A 1 88  ? -16.292 -8.996  -12.573 0.016 29.02 ? 86  GLY A H    2  
ATOM   4850   H HA2  . GLY A 1 88  ? -17.279 -7.043  -12.119 0.016 27.55 ? 86  GLY A HA2  2  
ATOM   4851   H HA3  . GLY A 1 88  ? -18.511 -7.494  -12.987 0.016 28.10 ? 86  GLY A HA3  2  
ATOM   4852   N N    . TYR A 1 89  ? -19.394 -7.383  -10.596 0.016 25.94 ? 87  TYR A N    2  
ATOM   4853   C CA   . TYR A 1 89  ? -20.240 -7.680  -9.458  0.016 25.14 ? 87  TYR A CA   2  
ATOM   4854   C C    . TYR A 1 89  ? -21.514 -6.838  -9.557  0.016 24.70 ? 87  TYR A C    2  
ATOM   4855   O O    . TYR A 1 89  ? -21.606 -5.897  -10.344 0.016 24.85 ? 87  TYR A O    2  
ATOM   4856   C CB   . TYR A 1 89  ? -19.510 -7.432  -8.131  0.016 24.40 ? 87  TYR A CB   2  
ATOM   4857   C CG   . TYR A 1 89  ? -19.271 -5.969  -7.789  0.016 23.74 ? 87  TYR A CG   2  
ATOM   4858   C CD1  . TYR A 1 89  ? -19.950 -5.382  -6.742  0.016 22.90 ? 87  TYR A CD1  2  
ATOM   4859   C CD2  . TYR A 1 89  ? -18.353 -5.213  -8.473  0.016 24.10 ? 87  TYR A CD2  2  
ATOM   4860   C CE1  . TYR A 1 89  ? -19.757 -4.066  -6.418  0.016 22.42 ? 87  TYR A CE1  2  
ATOM   4861   C CE2  . TYR A 1 89  ? -18.160 -3.895  -8.139  0.016 23.62 ? 87  TYR A CE2  2  
ATOM   4862   C CZ   . TYR A 1 89  ? -18.853 -3.340  -7.100  0.016 22.77 ? 87  TYR A CZ   2  
ATOM   4863   O OH   . TYR A 1 89  ? -18.628 -2.002  -6.779  0.016 22.42 ? 87  TYR A OH   2  
ATOM   4864   H H    . TYR A 1 89  ? -19.498 -6.588  -10.904 0.016 25.84 ? 87  TYR A H    2  
ATOM   4865   H HA   . TYR A 1 89  ? -20.507 -8.611  -9.486  0.016 25.52 ? 87  TYR A HA   2  
ATOM   4866   H HB2  . TYR A 1 89  ? -20.045 -7.809  -7.417  0.016 24.08 ? 87  TYR A HB2  2  
ATOM   4867   H HB3  . TYR A 1 89  ? -18.648 -7.871  -8.150  0.016 24.78 ? 87  TYR A HB3  2  
ATOM   4868   H HD1  . TYR A 1 89  ? -20.575 -5.876  -6.266  0.016 22.75 ? 87  TYR A HD1  2  
ATOM   4869   H HD2  . TYR A 1 89  ? -17.875 -5.578  -9.181  0.016 24.77 ? 87  TYR A HD2  2  
ATOM   4870   H HE1  . TYR A 1 89  ? -20.226 -3.691  -5.709  0.016 21.94 ? 87  TYR A HE1  2  
ATOM   4871   H HE2  . TYR A 1 89  ? -17.541 -3.379  -8.603  0.016 23.97 ? 87  TYR A HE2  2  
ATOM   4872   H HH   . TYR A 1 89  ? -18.967 -1.825  -6.032  0.016 21.97 ? 87  TYR A HH   2  
ATOM   4873   N N    . SER A 1 90  ? -22.498 -7.214  -8.754  0.016 24.29 ? 88  SER A N    2  
ATOM   4874   C CA   . SER A 1 90  ? -23.717 -6.426  -8.641  0.016 23.88 ? 88  SER A CA   2  
ATOM   4875   C C    . SER A 1 90  ? -23.956 -6.105  -7.175  0.016 22.98 ? 88  SER A C    2  
ATOM   4876   O O    . SER A 1 90  ? -23.353 -6.680  -6.272  0.016 22.81 ? 88  SER A O    2  
ATOM   4877   C CB   . SER A 1 90  ? -24.923 -7.145  -9.251  0.016 24.62 ? 88  SER A CB   2  
ATOM   4878   O OG   . SER A 1 90  ? -24.886 -8.553  -8.991  0.016 25.10 ? 88  SER A OG   2  
ATOM   4879   H H    . SER A 1 90  ? -22.487 -7.908  -8.254  0.016 24.31 ? 88  SER A H    2  
ATOM   4880   H HA   . SER A 1 90  ? -23.600 -5.591  -9.116  0.016 23.84 ? 88  SER A HA   2  
ATOM   4881   H HB2  . SER A 1 90  ? -25.739 -6.776  -8.880  0.016 24.32 ? 88  SER A HB2  2  
ATOM   4882   H HB3  . SER A 1 90  ? -24.904 -7.010  -10.212 0.016 25.20 ? 88  SER A HB3  2  
ATOM   4883   H HG   . SER A 1 90  ? -25.520 -8.934  -9.388  0.016 25.62 ? 88  SER A HG   2  
ATOM   4884   N N    . TRP A 1 91  ? -24.848 -5.158  -6.922  0.016 22.54 ? 89  TRP A N    2  
ATOM   4885   C CA   . TRP A 1 91  ? -25.199 -4.844  -5.551  0.016 21.89 ? 89  TRP A CA   2  
ATOM   4886   C C    . TRP A 1 91  ? -26.672 -4.459  -5.502  0.016 21.89 ? 89  TRP A C    2  
ATOM   4887   O O    . TRP A 1 91  ? -27.272 -4.085  -6.515  0.016 22.24 ? 89  TRP A O    2  
ATOM   4888   C CB   . TRP A 1 91  ? -24.279 -3.752  -4.920  0.016 21.28 ? 89  TRP A CB   2  
ATOM   4889   C CG   . TRP A 1 91  ? -24.129 -2.340  -5.584  0.016 21.10 ? 89  TRP A CG   2  
ATOM   4890   C CD1  . TRP A 1 91  ? -23.047 -1.869  -6.282  0.016 21.31 ? 89  TRP A CD1  2  
ATOM   4891   C CD2  . TRP A 1 91  ? -25.067 -1.265  -5.533  0.016 20.83 ? 89  TRP A CD2  2  
ATOM   4892   N NE1  . TRP A 1 91  ? -23.256 -0.567  -6.669  0.016 21.18 ? 89  TRP A NE1  2  
ATOM   4893   C CE2  . TRP A 1 91  ? -24.503 -0.180  -6.251  0.016 20.87 ? 89  TRP A CE2  2  
ATOM   4894   C CE3  . TRP A 1 91  ? -26.335 -1.131  -4.991  0.016 20.68 ? 89  TRP A CE3  2  
ATOM   4895   C CZ2  . TRP A 1 91  ? -25.169 1.049   -6.416  0.016 20.73 ? 89  TRP A CZ2  2  
ATOM   4896   C CZ3  . TRP A 1 91  ? -27.020 0.098   -5.181  0.016 20.54 ? 89  TRP A CZ3  2  
ATOM   4897   C CH2  . TRP A 1 91  ? -26.416 1.159   -5.878  0.016 20.55 ? 89  TRP A CH2  2  
ATOM   4898   H H    . TRP A 1 91  ? -25.258 -4.700  -7.521  0.016 22.69 ? 89  TRP A H    2  
ATOM   4899   H HA   . TRP A 1 91  ? -25.094 -5.644  -5.017  0.016 22.00 ? 89  TRP A HA   2  
ATOM   4900   H HB2  . TRP A 1 91  ? -24.605 -3.599  -4.021  0.016 20.99 ? 89  TRP A HB2  2  
ATOM   4901   H HB3  . TRP A 1 91  ? -23.386 -4.120  -4.870  0.016 21.40 ? 89  TRP A HB3  2  
ATOM   4902   H HD1  . TRP A 1 91  ? -22.269 -2.351  -6.441  0.016 21.56 ? 89  TRP A HD1  2  
ATOM   4903   H HE1  . TRP A 1 91  ? -22.710 -0.093  -7.129  0.016 21.36 ? 89  TRP A HE1  2  
ATOM   4904   H HE3  . TRP A 1 91  ? -26.729 -1.836  -4.537  0.016 20.77 ? 89  TRP A HE3  2  
ATOM   4905   H HZ2  . TRP A 1 91  ? -24.778 1.747   -6.889  0.016 20.85 ? 89  TRP A HZ2  2  
ATOM   4906   H HZ3  . TRP A 1 91  ? -27.866 0.213   -4.817  0.016 20.52 ? 89  TRP A HZ3  2  
ATOM   4907   H HH2  . TRP A 1 91  ? -26.882 1.958   -5.974  0.016 20.50 ? 89  TRP A HH2  2  
ATOM   4908   N N    . GLU A 1 92  ? -27.260 -4.658  -4.330  0.016 21.70 ? 90  GLU A N    2  
ATOM   4909   C CA   . GLU A 1 92  ? -28.637 -4.291  -4.024  0.016 21.77 ? 90  GLU A CA   2  
ATOM   4910   C C    . GLU A 1 92  ? -28.634 -3.616  -2.661  0.016 21.25 ? 90  GLU A C    2  
ATOM   4911   O O    . GLU A 1 92  ? -28.010 -4.113  -1.717  0.016 21.18 ? 90  GLU A O    2  
ATOM   4912   C CB   . GLU A 1 92  ? -29.588 -5.506  -3.977  0.016 22.53 ? 90  GLU A CB   2  
ATOM   4913   C CG   . GLU A 1 92  ? -29.411 -6.565  -5.033  0.016 23.25 ? 90  GLU A CG   2  
ATOM   4914   C CD   . GLU A 1 92  ? -30.605 -7.562  -5.057  0.016 24.18 ? 90  GLU A CD   2  
ATOM   4915   O OE1  . GLU A 1 92  ? -31.230 -7.857  -4.010  0.016 24.28 ? 90  GLU A OE1  2  
ATOM   4916   O OE2  . GLU A 1 92  ? -30.948 -8.002  -6.155  0.016 24.96 ? 90  GLU A OE2  2  
ATOM   4917   H H    . GLU A 1 92  ? -26.861 -5.014  -3.658  0.016 21.61 ? 90  GLU A H    2  
ATOM   4918   H HA   . GLU A 1 92  ? -28.964 -3.659  -4.682  0.016 21.78 ? 90  GLU A HA   2  
ATOM   4919   H HB2  . GLU A 1 92  ? -29.481 -5.936  -3.117  0.016 22.50 ? 90  GLU A HB2  2  
ATOM   4920   H HB3  . GLU A 1 92  ? -30.495 -5.183  -4.055  0.016 22.72 ? 90  GLU A HB3  2  
ATOM   4921   H HG2  . GLU A 1 92  ? -29.329 -6.150  -5.905  0.016 23.35 ? 90  GLU A HG2  2  
ATOM   4922   H HG3  . GLU A 1 92  ? -28.608 -7.060  -4.831  0.016 23.17 ? 90  GLU A HG3  2  
ATOM   4923   N N    . ARG A 1 93  ? -29.379 -2.510  -2.544  0.016 21.06 ? 91  ARG A N    2  
ATOM   4924   C CA   . ARG A 1 93  ? -29.280 -1.631  -1.394  0.016 20.65 ? 91  ARG A CA   2  
ATOM   4925   C C    . ARG A 1 93  ? -30.654 -1.123  -0.982  0.016 20.89 ? 91  ARG A C    2  
ATOM   4926   O O    . ARG A 1 93  ? -31.462 -0.734  -1.830  0.016 21.10 ? 91  ARG A O    2  
ATOM   4927   C CB   . ARG A 1 93  ? -28.392 -0.432  -1.722  0.016 20.17 ? 91  ARG A CB   2  
ATOM   4928   C CG   . ARG A 1 93  ? -28.277 0.544   -0.599  0.016 19.90 ? 91  ARG A CG   2  
ATOM   4929   C CD   . ARG A 1 93  ? -27.297 1.624   -1.027  0.016 19.59 ? 91  ARG A CD   2  
ATOM   4930   N NE   . ARG A 1 93  ? -25.923 1.139   -1.044  0.016 19.57 ? 91  ARG A NE   2  
ATOM   4931   C CZ   . ARG A 1 93  ? -24.979 1.670   -1.818  0.016 19.53 ? 91  ARG A CZ   2  
ATOM   4932   N NH1  . ARG A 1 93  ? -25.269 2.711   -2.610  0.016 19.51 ? 91  ARG A NH1  2  
ATOM   4933   N NH2  . ARG A 1 93  ? -23.749 1.195   -1.780  0.016 19.65 ? 91  ARG A NH2  2  
ATOM   4934   H H    . ARG A 1 93  ? -29.962 -2.263  -3.120  0.016 21.24 ? 91  ARG A H    2  
ATOM   4935   H HA   . ARG A 1 93  ? -28.897 -2.108  -0.647  0.016 20.68 ? 91  ARG A HA   2  
ATOM   4936   H HB2  . ARG A 1 93  ? -27.501 -0.739  -1.947  0.016 20.11 ? 91  ARG A HB2  2  
ATOM   4937   H HB3  . ARG A 1 93  ? -28.774 0.031   -2.481  0.016 20.22 ? 91  ARG A HB3  2  
ATOM   4938   H HG2  . ARG A 1 93  ? -29.149 0.926   -0.410  0.016 20.00 ? 91  ARG A HG2  2  
ATOM   4939   H HG3  . ARG A 1 93  ? -27.912 0.107   0.185   0.016 19.96 ? 91  ARG A HG3  2  
ATOM   4940   H HD2  . ARG A 1 93  ? -27.518 1.888   -1.927  0.016 19.63 ? 91  ARG A HD2  2  
ATOM   4941   H HD3  . ARG A 1 93  ? -27.367 2.375   -0.436  0.016 19.50 ? 91  ARG A HD3  2  
ATOM   4942   H HE   . ARG A 1 93  ? -25.643 0.861   -0.283  0.016 19.61 ? 91  ARG A HE   2  
ATOM   4943   H HH11 . ARG A 1 93  ? -26.064 3.030   -2.639  0.016 19.49 ? 91  ARG A HH11 2  
ATOM   4944   H HH12 . ARG A 1 93  ? -24.656 3.052   -3.108  0.016 19.58 ? 91  ARG A HH12 2  
ATOM   4945   H HH21 . ARG A 1 93  ? -23.557 0.534   -1.267  0.016 19.73 ? 91  ARG A HH21 2  
ATOM   4946   H HH22 . ARG A 1 93  ? -23.145 1.541   -2.278  0.016 19.72 ? 91  ARG A HH22 2  
ATOM   4947   N N    . SER A 1 94  ? -30.878 -1.076  0.317   0.016 20.98 ? 92  SER A N    2  
ATOM   4948   C CA   . SER A 1 94  ? -32.054 -0.438  0.881   0.016 21.27 ? 92  SER A CA   2  
ATOM   4949   C C    . SER A 1 94  ? -31.637 0.781   1.697   0.016 20.93 ? 92  SER A C    2  
ATOM   4950   O O    . SER A 1 94  ? -30.616 0.775   2.400   0.016 20.74 ? 92  SER A O    2  
ATOM   4951   C CB   . SER A 1 94  ? -32.860 -1.399  1.756   0.016 22.01 ? 92  SER A CB   2  
ATOM   4952   O OG   . SER A 1 94  ? -32.088 -1.804  2.867   0.016 22.03 ? 92  SER A OG   2  
ATOM   4953   H H    . SER A 1 94  ? -30.347 -1.396  0.908   0.016 20.95 ? 92  SER A H    2  
ATOM   4954   H HA   . SER A 1 94  ? -32.623 -0.146  0.154   0.016 21.36 ? 92  SER A HA   2  
ATOM   4955   H HB2  . SER A 1 94  ? -33.667 -0.961  2.062   0.016 22.30 ? 92  SER A HB2  2  
ATOM   4956   H HB3  . SER A 1 94  ? -33.086 -2.177  1.227   0.016 22.28 ? 92  SER A HB3  2  
ATOM   4957   H HG   . SER A 1 94  ? -32.547 -1.745  3.568   0.016 22.40 ? 92  SER A HG   2  
ATOM   4958   N N    . MET A 1 95  ? -32.405 1.847   1.532   0.016 20.97 ? 93  MET A N    2  
ATOM   4959   C CA   . MET A 1 95  ? -32.077 3.140   2.093   0.016 20.73 ? 93  MET A CA   2  
ATOM   4960   C C    . MET A 1 95  ? -33.329 3.625   2.827   0.016 21.28 ? 93  MET A C    2  
ATOM   4961   O O    . MET A 1 95  ? -34.272 4.105   2.197   0.016 21.47 ? 93  MET A O    2  
ATOM   4962   C CB   . MET A 1 95  ? -31.651 4.075   0.969   0.016 20.29 ? 93  MET A CB   2  
ATOM   4963   C CG   . MET A 1 95  ? -31.085 3.364   -0.259  0.016 20.13 ? 93  MET A CG   2  
ATOM   4964   S SD   . MET A 1 95  ? -29.959 4.400   -1.189  0.016 19.74 ? 93  MET A SD   2  
ATOM   4965   C CE   . MET A 1 95  ? -29.631 3.485   -2.718  0.016 19.88 ? 93  MET A CE   2  
ATOM   4966   H H    . MET A 1 95  ? -33.127 1.851   1.073   0.016 21.20 ? 93  MET A H    2  
ATOM   4967   H HA   . MET A 1 95  ? -31.340 3.050   2.715   0.016 20.64 ? 93  MET A HA   2  
ATOM   4968   H HB2  . MET A 1 95  ? -32.435 4.566   0.677   0.016 20.46 ? 93  MET A HB2  2  
ATOM   4969   H HB3  . MET A 1 95  ? -30.984 4.693   1.303   0.016 20.08 ? 93  MET A HB3  2  
ATOM   4970   H HG2  . MET A 1 95  ? -30.562 2.598   0.032   0.016 20.11 ? 93  MET A HG2  2  
ATOM   4971   H HG3  . MET A 1 95  ? -31.801 3.064   -0.844  0.016 20.40 ? 93  MET A HG3  2  
ATOM   4972   H HE1  . MET A 1 95  ? -28.675 3.390   -2.827  0.016 19.73 ? 93  MET A HE1  2  
ATOM   4973   H HE2  . MET A 1 95  ? -30.049 2.615   -2.660  0.016 20.09 ? 93  MET A HE2  2  
ATOM   4974   H HE3  . MET A 1 95  ? -29.996 3.972   -3.468  0.016 20.03 ? 93  MET A HE3  2  
ATOM   4975   N N    . THR A 1 96  ? -33.347 3.514   4.146   0.016 21.70 ? 94  THR A N    2  
ATOM   4976   C CA   . THR A 1 96  ? -34.560 3.727   4.923   0.016 22.49 ? 94  THR A CA   2  
ATOM   4977   C C    . THR A 1 96  ? -34.439 5.015   5.748   0.016 22.63 ? 94  THR A C    2  
ATOM   4978   O O    . THR A 1 96  ? -33.759 5.052   6.771   0.016 22.81 ? 94  THR A O    2  
ATOM   4979   C CB   . THR A 1 96  ? -34.825 2.501   5.789   0.016 23.19 ? 94  THR A CB   2  
ATOM   4980   O OG1  . THR A 1 96  ? -34.992 1.391   4.899   0.016 23.13 ? 94  THR A OG1  2  
ATOM   4981   C CG2  . THR A 1 96  ? -36.099 2.683   6.624   0.016 24.24 ? 94  THR A CG2  2  
ATOM   4982   H H    . THR A 1 96  ? -32.666 3.317   4.624   0.016 21.64 ? 94  THR A H    2  
ATOM   4983   H HA   . THR A 1 96  ? -35.312 3.822   4.317   0.016 22.61 ? 94  THR A HA   2  
ATOM   4984   H HB   . THR A 1 96  ? -34.078 2.356   6.391   0.016 23.15 ? 94  THR A HB   2  
ATOM   4985   H HG1  . THR A 1 96  ? -34.519 1.483   4.212   0.016 22.62 ? 94  THR A HG1  2  
ATOM   4986   H HG21 . THR A 1 96  ? -35.921 2.489   7.556   0.016 24.67 ? 94  THR A HG21 2  
ATOM   4987   H HG22 . THR A 1 96  ? -36.418 3.590   6.555   0.016 24.21 ? 94  THR A HG22 2  
ATOM   4988   H HG23 . THR A 1 96  ? -36.792 2.090   6.301   0.016 24.62 ? 94  THR A HG23 2  
ATOM   4989   N N    . TYR A 1 97  ? -35.127 6.051   5.317   0.016 22.70 ? 95  TYR A N    2  
ATOM   4990   C CA   . TYR A 1 97  ? -35.046 7.351   5.975   0.016 22.90 ? 95  TYR A CA   2  
ATOM   4991   C C    . TYR A 1 97  ? -35.955 7.398   7.211   0.016 23.98 ? 95  TYR A C    2  
ATOM   4992   O O    . TYR A 1 97  ? -36.975 6.703   7.304   0.016 24.60 ? 95  TYR A O    2  
ATOM   4993   C CB   . TYR A 1 97  ? -35.400 8.444   4.974   0.016 22.62 ? 95  TYR A CB   2  
ATOM   4994   C CG   . TYR A 1 97  ? -34.396 8.578   3.863   0.016 21.79 ? 95  TYR A CG   2  
ATOM   4995   C CD1  . TYR A 1 97  ? -34.495 7.849   2.685   0.016 21.47 ? 95  TYR A CD1  2  
ATOM   4996   C CD2  . TYR A 1 97  ? -33.332 9.445   4.000   0.016 21.49 ? 95  TYR A CD2  2  
ATOM   4997   C CE1  . TYR A 1 97  ? -33.555 7.986   1.691   0.016 20.90 ? 95  TYR A CE1  2  
ATOM   4998   C CE2  . TYR A 1 97  ? -32.411 9.594   3.030   0.016 20.92 ? 95  TYR A CE2  2  
ATOM   4999   C CZ   . TYR A 1 97  ? -32.518 8.893   1.866   0.016 20.63 ? 95  TYR A CZ   2  
ATOM   5000   O OH   . TYR A 1 97  ? -31.545 9.054   0.932   0.016 20.23 ? 95  TYR A OH   2  
ATOM   5001   H H    . TYR A 1 97  ? -35.662 6.032   4.645   0.016 22.72 ? 95  TYR A H    2  
ATOM   5002   H HA   . TYR A 1 97  ? -34.138 7.498   6.275   0.016 22.66 ? 95  TYR A HA   2  
ATOM   5003   H HB2  . TYR A 1 97  ? -36.265 8.260   4.580   0.016 22.89 ? 95  TYR A HB2  2  
ATOM   5004   H HB3  . TYR A 1 97  ? -35.427 9.294   5.439   0.016 22.87 ? 95  TYR A HB3  2  
ATOM   5005   H HD1  . TYR A 1 97  ? -35.200 7.250   2.569   0.016 21.76 ? 95  TYR A HD1  2  
ATOM   5006   H HD2  . TYR A 1 97  ? -33.251 9.940   4.782   0.016 21.80 ? 95  TYR A HD2  2  
ATOM   5007   H HE1  . TYR A 1 97  ? -33.627 7.498   0.904   0.016 20.81 ? 95  TYR A HE1  2  
ATOM   5008   H HE2  . TYR A 1 97  ? -31.704 10.189  3.151   0.016 20.84 ? 95  TYR A HE2  2  
ATOM   5009   H HH   . TYR A 1 97  ? -31.329 8.307   0.616   0.016 20.08 ? 95  TYR A HH   2  
ATOM   5010   N N    . GLU A 1 98  ? -35.565 8.223   8.187   0.016 24.37 ? 96  GLU A N    2  
ATOM   5011   C CA   . GLU A 1 98  ? -36.249 8.174   9.473   0.016 25.58 ? 96  GLU A CA   2  
ATOM   5012   C C    . GLU A 1 98  ? -37.641 8.819   9.465   0.016 26.32 ? 96  GLU A C    2  
ATOM   5013   O O    . GLU A 1 98  ? -38.355 8.692   10.465  0.016 27.50 ? 96  GLU A O    2  
ATOM   5014   C CB   . GLU A 1 98  ? -35.381 8.791   10.571  0.016 26.03 ? 96  GLU A CB   2  
ATOM   5015   C CG   . GLU A 1 98  ? -34.945 10.163  10.336  0.016 25.76 ? 96  GLU A CG   2  
ATOM   5016   C CD   . GLU A 1 98  ? -34.058 10.681  11.465  0.016 26.42 ? 96  GLU A CD   2  
ATOM   5017   O OE1  . GLU A 1 98  ? -33.871 9.914   12.481  0.016 27.20 ? 96  GLU A OE1  2  
ATOM   5018   O OE2  . GLU A 1 98  ? -33.563 11.838  11.320  0.016 26.30 ? 96  GLU A OE2  2  
ATOM   5019   H H    . GLU A 1 98  ? -34.923 8.787   8.131   0.016 24.06 ? 96  GLU A H    2  
ATOM   5020   H HA   . GLU A 1 98  ? -36.364 7.238   9.703   0.016 25.82 ? 96  GLU A HA   2  
ATOM   5021   H HB2  . GLU A 1 98  ? -35.873 8.787   11.405  0.016 26.95 ? 96  GLU A HB2  2  
ATOM   5022   H HB3  . GLU A 1 98  ? -34.584 8.249   10.669  0.016 25.75 ? 96  GLU A HB3  2  
ATOM   5023   H HG2  . GLU A 1 98  ? -34.425 10.187  9.517   0.016 24.93 ? 96  GLU A HG2  2  
ATOM   5024   H HG3  . GLU A 1 98  ? -35.723 10.738  10.258  0.016 26.09 ? 96  GLU A HG3  2  
ATOM   5025   N N    . ASP A 1 99  ? -38.059 9.472   8.376   0.016 25.82 ? 97  ASP A N    2  
ATOM   5026   C CA   . ASP A 1 99  ? -39.440 9.921   8.210   0.016 26.58 ? 97  ASP A CA   2  
ATOM   5027   C C    . ASP A 1 99  ? -40.208 8.967   7.296   0.016 26.56 ? 97  ASP A C    2  
ATOM   5028   O O    . ASP A 1 99  ? -41.368 9.213   6.951   0.016 27.23 ? 97  ASP A O    2  
ATOM   5029   C CB   . ASP A 1 99  ? -39.505 11.369  7.703   0.016 26.38 ? 97  ASP A CB   2  
ATOM   5030   C CG   . ASP A 1 99  ? -38.977 11.528  6.292   0.016 25.31 ? 97  ASP A CG   2  
ATOM   5031   O OD1  . ASP A 1 99  ? -38.394 10.540  5.799   0.016 24.65 ? 97  ASP A OD1  2  
ATOM   5032   O OD2  . ASP A 1 99  ? -39.151 12.625  5.688   0.016 25.27 ? 97  ASP A OD2  2  
ATOM   5033   H H    . ASP A 1 99  ? -37.555 9.660   7.706   0.016 25.12 ? 97  ASP A H    2  
ATOM   5034   H HA   . ASP A 1 99  ? -39.876 9.902   9.077   0.016 27.45 ? 97  ASP A HA   2  
ATOM   5035   H HB2  . ASP A 1 99  ? -40.433 11.656  7.716   0.016 27.05 ? 97  ASP A HB2  2  
ATOM   5036   H HB3  . ASP A 1 99  ? -38.968 11.932  8.282   0.016 26.43 ? 97  ASP A HB3  2  
ATOM   5037   N N    . GLN A 1 100 ? -39.550 7.884   6.885   0.016 25.91 ? 98  GLN A N    2  
ATOM   5038   C CA   . GLN A 1 100 ? -40.127 6.636   6.345   0.016 26.15 ? 98  GLN A CA   2  
ATOM   5039   C C    . GLN A 1 100 ? -40.227 6.687   4.825   0.016 25.53 ? 98  GLN A C    2  
ATOM   5040   O O    . GLN A 1 100 ? -40.844 5.796   4.206   0.016 25.88 ? 98  GLN A O    2  
ATOM   5041   C CB   . GLN A 1 100 ? -41.507 6.313   6.940   0.016 27.56 ? 98  GLN A CB   2  
ATOM   5042   C CG   . GLN A 1 100 ? -41.559 6.574   8.419   0.016 28.47 ? 98  GLN A CG   2  
ATOM   5043   C CD   . GLN A 1 100 ? -42.518 5.719   9.117   0.016 29.82 ? 98  GLN A CD   2  
ATOM   5044   O OE1  . GLN A 1 100 ? -43.734 5.902   9.002   0.016 30.87 ? 98  GLN A OE1  2  
ATOM   5045   N NE2  . GLN A 1 100 ? -41.995 4.755   9.858   0.016 29.95 ? 98  GLN A NE2  2  
ATOM   5046   H H    . GLN A 1 100 ? -38.693 7.846   6.891   0.016 25.34 ? 98  GLN A H    2  
ATOM   5047   H HA   . GLN A 1 100 ? -39.543 5.904   6.586   0.016 25.95 ? 98  GLN A HA   2  
ATOM   5048   H HB2  . GLN A 1 100 ? -42.181 6.866   6.510   0.016 27.80 ? 98  GLN A HB2  2  
ATOM   5049   H HB3  . GLN A 1 100 ? -41.702 5.378   6.787   0.016 27.79 ? 98  GLN A HB3  2  
ATOM   5050   H HG2  . GLN A 1 100 ? -40.683 6.405   8.802   0.016 28.05 ? 98  GLN A HG2  2  
ATOM   5051   H HG3  . GLN A 1 100 ? -41.835 7.486   8.591   0.016 28.75 ? 98  GLN A HG3  2  
ATOM   5052   H HE21 . GLN A 1 100 ? -42.135 3.928   9.655   0.016 29.88 ? 98  GLN A HE21 2  
ATOM   5053   H HE22 . GLN A 1 100 ? -41.513 4.959   10.541  0.016 30.17 ? 98  GLN A HE22 2  
ATOM   5054   N N    . GLY A 1 101 ? -39.726 7.744   4.196   0.016 24.85 ? 99  GLY A N    2  
ATOM   5055   C CA   . GLY A 1 101 ? -39.281 7.596   2.834   0.016 24.14 ? 99  GLY A CA   2  
ATOM   5056   C C    . GLY A 1 101 ? -38.350 6.399   2.746   0.016 23.60 ? 99  GLY A C    2  
ATOM   5057   O O    . GLY A 1 101 ? -37.552 6.144   3.643   0.016 23.36 ? 99  GLY A O    2  
ATOM   5058   H H    . GLY A 1 101 ? -39.648 8.528   4.533   0.016 24.88 ? 99  GLY A H    2  
ATOM   5059   H HA2  . GLY A 1 101 ? -40.032 7.466   2.240   0.016 24.55 ? 99  GLY A HA2  2  
ATOM   5060   H HA3  . GLY A 1 101 ? -38.782 8.380   2.557   0.016 23.71 ? 99  GLY A HA3  2  
ATOM   5061   N N    . ILE A 1 102 ? -38.510 5.638   1.690   0.016 23.58 ? 100 ILE A N    2  
ATOM   5062   C CA   . ILE A 1 102 ? -37.726 4.432   1.500   0.016 23.21 ? 100 ILE A CA   2  
ATOM   5063   C C    . ILE A 1 102 ? -37.241 4.450   0.062   0.016 22.76 ? 100 ILE A C    2  
ATOM   5064   O O    . ILE A 1 102 ? -38.015 4.749   -0.852  0.016 23.20 ? 100 ILE A O    2  
ATOM   5065   C CB   . ILE A 1 102 ? -38.552 3.165   1.810   0.016 24.05 ? 100 ILE A CB   2  
ATOM   5066   C CG1  . ILE A 1 102 ? -37.746 1.929   1.402   0.016 23.72 ? 100 ILE A CG1  2  
ATOM   5067   C CG2  . ILE A 1 102 ? -39.849 3.254   1.150   0.016 24.88 ? 100 ILE A CG2  2  
ATOM   5068   C CD1  . ILE A 1 102 ? -37.683 1.568   -0.124  0.016 23.64 ? 100 ILE A CD1  2  
ATOM   5069   H H    . ILE A 1 102 ? -39.074 5.789   1.061   0.016 23.86 ? 100 ILE A H    2  
ATOM   5070   H HA   . ILE A 1 102 ? -36.959 4.436   2.091   0.016 22.83 ? 100 ILE A HA   2  
ATOM   5071   H HB   . ILE A 1 102 ? -38.716 3.116   2.768   0.016 24.37 ? 100 ILE A HB   2  
ATOM   5072   H HG12 . ILE A 1 102 ? -36.838 2.042   1.724   0.016 23.15 ? 100 ILE A HG12 2  
ATOM   5073   H HG13 . ILE A 1 102 ? -38.155 1.164   1.842   0.016 24.27 ? 100 ILE A HG13 2  
ATOM   5074   H HG21 . ILE A 1 102 ? -40.288 2.389   1.202   0.016 25.45 ? 100 ILE A HG21 2  
ATOM   5075   H HG22 . ILE A 1 102 ? -40.385 3.922   1.604   0.016 25.22 ? 100 ILE A HG22 2  
ATOM   5076   H HG23 . ILE A 1 102 ? -39.715 3.498   0.224   0.016 24.65 ? 100 ILE A HG23 2  
ATOM   5077   H HD11 . ILE A 1 102 ? -37.096 2.135   -0.615  0.016 23.11 ? 100 ILE A HD11 2  
ATOM   5078   H HD12 . ILE A 1 102 ? -37.343 0.670   -0.194  0.016 23.66 ? 100 ILE A HD12 2  
ATOM   5079   H HD13 . ILE A 1 102 ? -38.571 1.606   -0.498  0.016 24.25 ? 100 ILE A HD13 2  
ATOM   5080   N N    . CYS A 1 103 ? -35.991 4.085   -0.139  0.016 22.08 ? 101 CYS A N    2  
ATOM   5081   C CA   . CYS A 1 103 ? -35.445 3.869   -1.462  0.016 21.84 ? 101 CYS A CA   2  
ATOM   5082   C C    . CYS A 1 103 ? -34.793 2.505   -1.489  0.016 21.75 ? 101 CYS A C    2  
ATOM   5083   O O    . CYS A 1 103 ? -34.140 2.119   -0.520  0.016 21.48 ? 101 CYS A O    2  
ATOM   5084   C CB   . CYS A 1 103 ? -34.403 4.890   -1.814  0.016 21.22 ? 101 CYS A CB   2  
ATOM   5085   S SG   . CYS A 1 103 ? -35.080 6.573   -1.832  0.016 21.41 ? 101 CYS A SG   2  
ATOM   5086   H H    . CYS A 1 103 ? -35.433 3.938   0.493   0.016 21.83 ? 101 CYS A H    2  
ATOM   5087   H HA   . CYS A 1 103 ? -36.151 3.902   -2.123  0.016 22.28 ? 101 CYS A HA   2  
ATOM   5088   H HB2  . CYS A 1 103 ? -33.699 4.857   -1.150  0.016 20.88 ? 101 CYS A HB2  2  
ATOM   5089   H HB3  . CYS A 1 103 ? -34.042 4.692   -2.689  0.016 21.18 ? 101 CYS A HB3  2  
ATOM   5090   H HG   . CYS A 1 103 ? -35.644 6.721   -2.876  0.016 21.81 ? 101 CYS A HG   2  
ATOM   5091   N N    . ILE A 1 104 ? -34.950 1.811   -2.600  0.016 22.09 ? 102 ILE A N    2  
ATOM   5092   C CA   . ILE A 1 104 ? -34.225 0.574   -2.846  0.016 22.06 ? 102 ILE A CA   2  
ATOM   5093   C C    . ILE A 1 104 ? -33.601 0.715   -4.225  0.016 22.03 ? 102 ILE A C    2  
ATOM   5094   O O    . ILE A 1 104 ? -34.180 1.334   -5.123  0.016 22.42 ? 102 ILE A O    2  
ATOM   5095   C CB   . ILE A 1 104 ? -35.113 -0.682  -2.705  0.016 22.88 ? 102 ILE A CB   2  
ATOM   5096   C CG1  . ILE A 1 104 ? -36.475 -0.493  -3.252  0.016 23.73 ? 102 ILE A CG1  2  
ATOM   5097   C CG2  . ILE A 1 104 ? -35.246 -1.015  -1.226  0.016 22.91 ? 102 ILE A CG2  2  
ATOM   5098   C CD1  . ILE A 1 104 ? -37.275 -1.846  -3.271  0.016 24.77 ? 102 ILE A CD1  2  
ATOM   5099   H H    . ILE A 1 104 ? -35.476 2.030   -3.239  0.016 22.44 ? 102 ILE A H    2  
ATOM   5100   H HA   . ILE A 1 104 ? -33.517 0.482   -2.191  0.016 21.65 ? 102 ILE A HA   2  
ATOM   5101   H HB   . ILE A 1 104 ? -34.692 -1.435  -3.163  0.016 22.96 ? 102 ILE A HB   2  
ATOM   5102   H HG12 . ILE A 1 104 ? -36.952 0.130   -2.687  0.016 23.74 ? 102 ILE A HG12 2  
ATOM   5103   H HG13 . ILE A 1 104 ? -36.406 -0.146  -4.155  0.016 23.78 ? 102 ILE A HG13 2  
ATOM   5104   H HG21 . ILE A 1 104 ? -35.702 -0.294  -0.779  0.016 22.92 ? 102 ILE A HG21 2  
ATOM   5105   H HG22 . ILE A 1 104 ? -35.720 -1.844  -1.101  0.016 23.48 ? 102 ILE A HG22 2  
ATOM   5106   H HG23 . ILE A 1 104 ? -34.355 -1.110  -0.854  0.016 22.44 ? 102 ILE A HG23 2  
ATOM   5107   H HD11 . ILE A 1 104 ? -38.211 -1.676  -3.453  0.016 25.40 ? 102 ILE A HD11 2  
ATOM   5108   H HD12 . ILE A 1 104 ? -36.910 -2.391  -3.983  0.016 24.94 ? 102 ILE A HD12 2  
ATOM   5109   H HD13 . ILE A 1 104 ? -37.187 -2.311  -2.428  0.016 24.72 ? 102 ILE A HD13 2  
ATOM   5110   N N    . ALA A 1 105 ? -32.373 0.234   -4.364  0.016 21.67 ? 103 ALA A N    2  
ATOM   5111   C CA   . ALA A 1 105 ? -31.643 0.365   -5.608  0.016 21.75 ? 103 ALA A CA   2  
ATOM   5112   C C    . ALA A 1 105 ? -30.901 -0.924  -5.893  0.016 21.93 ? 103 ALA A C    2  
ATOM   5113   O O    . ALA A 1 105 ? -30.662 -1.713  -4.985  0.016 21.74 ? 103 ALA A O    2  
ATOM   5114   C CB   . ALA A 1 105 ? -30.659 1.514   -5.561  0.016 21.16 ? 103 ALA A CB   2  
ATOM   5115   H H    . ALA A 1 105 ? -31.947 -0.169  -3.740  0.016 21.46 ? 103 ALA A H    2  
ATOM   5116   H HA   . ALA A 1 105 ? -32.253 0.519   -6.345  0.016 22.24 ? 103 ALA A HA   2  
ATOM   5117   H HB1  . ALA A 1 105 ? -30.210 1.604   -6.415  0.016 21.35 ? 103 ALA A HB1  2  
ATOM   5118   H HB2  . ALA A 1 105 ? -31.166 2.318   -5.366  0.016 21.12 ? 103 ALA A HB2  2  
ATOM   5119   H HB3  . ALA A 1 105 ? -30.013 1.359   -4.855  0.016 20.77 ? 103 ALA A HB3  2  
ATOM   5120   N N    . THR A 1 106 ? -30.538 -1.104  -7.164  0.016 22.42 ? 104 THR A N    2  
ATOM   5121   C CA   . THR A 1 106 ? -29.699 -2.205  -7.615  0.016 22.71 ? 104 THR A CA   2  
ATOM   5122   C C    . THR A 1 106 ? -28.694 -1.658  -8.612  0.016 22.81 ? 104 THR A C    2  
ATOM   5123   O O    . THR A 1 106 ? -28.990 -0.724  -9.368  0.016 23.08 ? 104 THR A O    2  
ATOM   5124   C CB   . THR A 1 106 ? -30.501 -3.309  -8.321  0.016 23.72 ? 104 THR A CB   2  
ATOM   5125   O OG1  . THR A 1 106 ? -31.122 -2.769  -9.483  0.016 24.45 ? 104 THR A OG1  2  
ATOM   5126   C CG2  . THR A 1 106 ? -31.555 -3.890  -7.414  0.016 23.87 ? 104 THR A CG2  2  
ATOM   5127   H H    . THR A 1 106 ? -30.751 -0.573  -7.801  0.016 22.68 ? 104 THR A H    2  
ATOM   5128   H HA   . THR A 1 106 ? -29.219 -2.581  -6.865  0.016 22.33 ? 104 THR A HA   2  
ATOM   5129   H HB   . THR A 1 106 ? -29.891 -4.015  -8.584  0.016 23.93 ? 104 THR A HB   2  
ATOM   5130   H HG1  . THR A 1 106 ? -30.554 -2.432  -9.997  0.016 24.49 ? 104 THR A HG1  2  
ATOM   5131   H HG21 . THR A 1 106 ? -32.069 -4.558  -7.890  0.016 24.62 ? 104 THR A HG21 2  
ATOM   5132   H HG22 . THR A 1 106 ? -31.141 -4.303  -6.640  0.016 23.50 ? 104 THR A HG22 2  
ATOM   5133   H HG23 . THR A 1 106 ? -32.152 -3.184  -7.113  0.016 23.72 ? 104 THR A HG23 2  
ATOM   5134   N N    . SER A 1 107 ? -27.514 -2.276  -8.651  0.016 22.78 ? 105 SER A N    2  
ATOM   5135   C CA   . SER A 1 107 ? -26.556 -1.960  -9.692  0.016 23.19 ? 105 SER A CA   2  
ATOM   5136   C C    . SER A 1 107 ? -25.856 -3.230  -10.138 0.016 23.79 ? 105 SER A C    2  
ATOM   5137   O O    . SER A 1 107 ? -25.474 -4.061  -9.314  0.016 23.49 ? 105 SER A O    2  
ATOM   5138   C CB   . SER A 1 107 ? -25.485 -0.962  -9.249  0.016 22.56 ? 105 SER A CB   2  
ATOM   5139   O OG   . SER A 1 107 ? -24.597 -0.702  -10.326 0.016 23.19 ? 105 SER A OG   2  
ATOM   5140   H H    . SER A 1 107 ? -27.257 -2.868  -8.085  0.016 22.61 ? 105 SER A H    2  
ATOM   5141   H HA   . SER A 1 107 ? -27.023 -1.595  -10.455 0.016 23.67 ? 105 SER A HA   2  
ATOM   5142   H HB2  . SER A 1 107 ? -25.894 -0.136  -8.945  0.016 22.21 ? 105 SER A HB2  2  
ATOM   5143   H HB3  . SER A 1 107 ? -24.973 -1.363  -8.536  0.016 22.23 ? 105 SER A HB3  2  
ATOM   5144   H HG   . SER A 1 107 ? -24.984 -0.258  -10.924 0.016 23.52 ? 105 SER A HG   2  
ATOM   5145   N N    . ASP A 1 108 ? -25.702 -3.357  -11.439 0.016 24.77 ? 106 ASP A N    2  
ATOM   5146   C CA   . ASP A 1 108 ? -24.905 -4.416  -12.036 0.016 25.55 ? 106 ASP A CA   2  
ATOM   5147   C C    . ASP A 1 108 ? -23.701 -3.750  -12.699 0.016 25.86 ? 106 ASP A C    2  
ATOM   5148   O O    . ASP A 1 108 ? -23.863 -2.912  -13.593 0.016 26.41 ? 106 ASP A O    2  
ATOM   5149   C CB   . ASP A 1 108 ? -25.751 -5.207  -13.036 0.016 26.78 ? 106 ASP A CB   2  
ATOM   5150   C CG   . ASP A 1 108 ? -24.959 -6.238  -13.769 0.016 27.83 ? 106 ASP A CG   2  
ATOM   5151   O OD1  . ASP A 1 108 ? -25.222 -6.456  -14.956 0.016 29.11 ? 106 ASP A OD1  2  
ATOM   5152   O OD2  . ASP A 1 108 ? -24.057 -6.837  -13.166 0.016 27.51 ? 106 ASP A OD2  2  
ATOM   5153   H H    . ASP A 1 108 ? -26.053 -2.829  -12.015 0.016 25.09 ? 106 ASP A H    2  
ATOM   5154   H HA   . ASP A 1 108 ? -24.596 -5.021  -11.348 0.016 25.21 ? 106 ASP A HA   2  
ATOM   5155   H HB2  . ASP A 1 108 ? -26.467 -5.655  -12.559 0.016 26.65 ? 106 ASP A HB2  2  
ATOM   5156   H HB3  . ASP A 1 108 ? -26.118 -4.597  -13.695 0.016 27.17 ? 106 ASP A HB3  2  
ATOM   5157   N N    . ILE A 1 109 ? -22.496 -4.131  -12.278 0.016 25.66 ? 107 ILE A N    2  
ATOM   5158   C CA   . ILE A 1 109 ? -21.273 -3.448  -12.677 0.016 25.94 ? 107 ILE A CA   2  
ATOM   5159   C C    . ILE A 1 109 ? -20.444 -4.399  -13.517 0.016 27.10 ? 107 ILE A C    2  
ATOM   5160   O O    . ILE A 1 109 ? -20.041 -5.477  -13.055 0.016 27.09 ? 107 ILE A O    2  
ATOM   5161   C CB   . ILE A 1 109 ? -20.501 -2.927  -11.457 0.016 24.94 ? 107 ILE A CB   2  
ATOM   5162   C CG1  . ILE A 1 109 ? -21.394 -1.948  -10.685 0.016 23.98 ? 107 ILE A CG1  2  
ATOM   5163   C CG2  . ILE A 1 109 ? -19.152 -2.277  -11.851 0.016 25.43 ? 107 ILE A CG2  2  
ATOM   5164   C CD1  . ILE A 1 109 ? -20.632 -1.164  -9.721  0.016 23.32 ? 107 ILE A CD1  2  
ATOM   5165   H H    . ILE A 1 109 ? -22.363 -4.802  -11.763 0.016 25.46 ? 107 ILE A H    2  
ATOM   5166   H HA   . ILE A 1 109 ? -21.496 -2.685  -13.234 0.016 26.20 ? 107 ILE A HA   2  
ATOM   5167   H HB   . ILE A 1 109 ? -20.314 -3.674  -10.868 0.016 24.73 ? 107 ILE A HB   2  
ATOM   5168   H HG12 . ILE A 1 109 ? -21.823 -1.349  -11.311 0.016 24.25 ? 107 ILE A HG12 2  
ATOM   5169   H HG13 . ILE A 1 109 ? -22.061 -2.453  -10.194 0.016 23.65 ? 107 ILE A HG13 2  
ATOM   5170   H HG21 . ILE A 1 109 ? -19.314 -1.386  -12.200 0.016 25.50 ? 107 ILE A HG21 2  
ATOM   5171   H HG22 . ILE A 1 109 ? -18.584 -2.218  -11.068 0.016 24.98 ? 107 ILE A HG22 2  
ATOM   5172   H HG23 . ILE A 1 109 ? -18.707 -2.815  -12.523 0.016 26.22 ? 107 ILE A HG23 2  
ATOM   5173   H HD11 . ILE A 1 109 ? -20.259 -0.393  -10.175 0.016 23.60 ? 107 ILE A HD11 2  
ATOM   5174   H HD12 . ILE A 1 109 ? -21.222 -0.874  -9.008  0.016 22.71 ? 107 ILE A HD12 2  
ATOM   5175   H HD13 . ILE A 1 109 ? -19.921 -1.715  -9.356  0.016 23.34 ? 107 ILE A HD13 2  
ATOM   5176   N N    . THR A 1 110 ? -20.228 -4.015  -14.756 0.016 28.22 ? 108 THR A N    2  
ATOM   5177   C CA   . THR A 1 110 ? -19.465 -4.807  -15.686 0.016 29.59 ? 108 THR A CA   2  
ATOM   5178   C C    . THR A 1 110 ? -18.250 -4.017  -16.120 0.016 30.17 ? 108 THR A C    2  
ATOM   5179   O O    . THR A 1 110 ? -18.017 -2.875  -15.698 0.016 29.51 ? 108 THR A O    2  
ATOM   5180   C CB   . THR A 1 110 ? -20.300 -5.204  -16.905 0.016 30.91 ? 108 THR A CB   2  
ATOM   5181   O OG1  . THR A 1 110 ? -20.869 -4.013  -17.505 0.016 31.15 ? 108 THR A OG1  2  
ATOM   5182   C CG2  . THR A 1 110 ? -21.399 -6.188  -16.530 0.016 30.67 ? 108 THR A CG2  2  
ATOM   5183   H H    . THR A 1 110 ? -20.531 -3.287  -15.095 0.016 28.31 ? 108 THR A H    2  
ATOM   5184   H HA   . THR A 1 110 ? -19.151 -5.614  -15.255 0.016 29.46 ? 108 THR A HA   2  
ATOM   5185   H HB   . THR A 1 110 ? -19.729 -5.646  -17.552 0.016 31.94 ? 108 THR A HB   2  
ATOM   5186   H HG1  . THR A 1 110 ? -21.358 -4.220  -18.156 0.016 31.95 ? 108 THR A HG1  2  
ATOM   5187   H HG21 . THR A 1 110 ? -21.739 -6.608  -17.335 0.016 31.74 ? 108 THR A HG21 2  
ATOM   5188   H HG22 . THR A 1 110 ? -21.047 -6.873  -15.942 0.016 30.32 ? 108 THR A HG22 2  
ATOM   5189   H HG23 . THR A 1 110 ? -22.129 -5.735  -16.082 0.016 29.92 ? 108 THR A HG23 2  
ATOM   5190   N N    . MET A 1 111 ? -17.478 -4.673  -16.977 0.016 31.57 ? 109 MET A N    2  
ATOM   5191   C CA   . MET A 1 111 ? -16.208 -4.170  -17.453 0.016 32.49 ? 109 MET A CA   2  
ATOM   5192   C C    . MET A 1 111 ? -16.046 -4.496  -18.931 0.016 34.49 ? 109 MET A C    2  
ATOM   5193   O O    . MET A 1 111 ? -16.673 -5.423  -19.452 0.016 35.20 ? 109 MET A O    2  
ATOM   5194   C CB   . MET A 1 111 ? -15.058 -4.809  -16.680 0.016 32.27 ? 109 MET A CB   2  
ATOM   5195   C CG   . MET A 1 111 ? -14.133 -3.785  -16.102 0.016 31.85 ? 109 MET A CG   2  
ATOM   5196   S SD   . MET A 1 111 ? -12.422 -4.378  -16.054 0.016 32.87 ? 109 MET A SD   2  
ATOM   5197   C CE   . MET A 1 111 ? -12.121 -4.703  -17.802 0.016 35.16 ? 109 MET A CE   2  
ATOM   5198   H H    . MET A 1 111 ? -17.683 -5.441  -17.301 0.016 32.11 ? 109 MET A H    2  
ATOM   5199   H HA   . MET A 1 111 ? -16.176 -3.211  -17.329 0.016 32.13 ? 109 MET A HA   2  
ATOM   5200   H HB2  . MET A 1 111 ? -15.420 -5.344  -15.958 0.016 31.44 ? 109 MET A HB2  2  
ATOM   5201   H HB3  . MET A 1 111 ? -14.554 -5.379  -17.278 0.016 33.36 ? 109 MET A HB3  2  
ATOM   5202   H HG2  . MET A 1 111 ? -14.161 -2.987  -16.651 0.016 32.32 ? 109 MET A HG2  2  
ATOM   5203   H HG3  . MET A 1 111 ? -14.417 -3.580  -15.198 0.016 30.69 ? 109 MET A HG3  2  
ATOM   5204   H HE1  . MET A 1 111 ? -11.199 -4.485  -18.012 0.016 35.97 ? 109 MET A HE1  2  
ATOM   5205   H HE2  . MET A 1 111 ? -12.284 -5.643  -17.979 0.016 35.48 ? 109 MET A HE2  2  
ATOM   5206   H HE3  . MET A 1 111 ? -12.721 -4.158  -18.335 0.016 35.37 ? 109 MET A HE3  2  
ATOM   5207   N N    . GLU A 1 112 ? -15.197 -3.719  -19.596 0.016 35.56 ? 110 GLU A N    2  
ATOM   5208   C CA   . GLU A 1 112 ? -14.716 -4.010  -20.951 0.016 37.76 ? 110 GLU A CA   2  
ATOM   5209   C C    . GLU A 1 112 ? -13.728 -2.898  -21.268 0.016 38.50 ? 110 GLU A C    2  
ATOM   5210   O O    . GLU A 1 112 ? -14.010 -1.725  -21.003 0.016 37.77 ? 110 GLU A O    2  
ATOM   5211   C CB   . GLU A 1 112 ? -15.843 -4.070  -21.988 0.016 38.80 ? 110 GLU A CB   2  
ATOM   5212   C CG   . GLU A 1 112 ? -16.224 -5.507  -22.447 0.016 39.75 ? 110 GLU A CG   2  
ATOM   5213   C CD   . GLU A 1 112 ? -15.354 -6.063  -23.590 0.016 42.09 ? 110 GLU A CD   2  
ATOM   5214   O OE1  . GLU A 1 112 ? -15.676 -7.159  -24.095 0.016 43.12 ? 110 GLU A OE1  2  
ATOM   5215   O OE2  . GLU A 1 112 ? -14.361 -5.414  -23.987 0.016 43.04 ? 110 GLU A OE2  2  
ATOM   5216   H H    . GLU A 1 112 ? -14.873 -2.991  -19.271 0.016 35.13 ? 110 GLU A H    2  
ATOM   5217   H HA   . GLU A 1 112 ? -14.242 -4.855  -20.959 0.016 38.21 ? 110 GLU A HA   2  
ATOM   5218   H HB2  . GLU A 1 112 ? -16.638 -3.656  -21.620 0.016 37.82 ? 110 GLU A HB2  2  
ATOM   5219   H HB3  . GLU A 1 112 ? -15.557 -3.577  -22.772 0.016 40.03 ? 110 GLU A HB3  2  
ATOM   5220   H HG2  . GLU A 1 112 ? -16.132 -6.115  -21.697 0.016 38.81 ? 110 GLU A HG2  2  
ATOM   5221   H HG3  . GLU A 1 112 ? -17.147 -5.500  -22.751 0.016 39.93 ? 110 GLU A HG3  2  
ATOM   5222   N N    . GLY A 1 113 ? -12.568 -3.259  -21.779 0.016 39.99 ? 111 GLY A N    2  
ATOM   5223   C CA   . GLY A 1 113 ? -11.485 -2.299  -21.836 0.016 40.63 ? 111 GLY A CA   2  
ATOM   5224   C C    . GLY A 1 113 ? -11.210 -1.814  -20.430 0.016 38.72 ? 111 GLY A C    2  
ATOM   5225   O O    . GLY A 1 113 ? -11.346 -2.572  -19.464 0.016 37.38 ? 111 GLY A O    2  
ATOM   5226   H H    . GLY A 1 113 ? -12.383 -4.038  -22.092 0.016 40.71 ? 111 GLY A H    2  
ATOM   5227   H HA2  . GLY A 1 113 ? -10.686 -2.719  -22.189 0.016 41.78 ? 111 GLY A HA2  2  
ATOM   5228   H HA3  . GLY A 1 113 ? -11.726 -1.548  -22.401 0.016 41.25 ? 111 GLY A HA3  2  
ATOM   5229   N N    . ASP A 1 114 ? -10.834 -0.539  -20.306 0.016 38.74 ? 112 ASP A N    2  
ATOM   5230   C CA   . ASP A 1 114 ? -10.583 0.113   -19.025 0.016 37.19 ? 112 ASP A CA   2  
ATOM   5231   C C    . ASP A 1 114 ? -11.761 0.968   -18.559 0.016 35.72 ? 112 ASP A C    2  
ATOM   5232   O O    . ASP A 1 114 ? -11.563 1.990   -17.874 0.016 35.07 ? 112 ASP A O    2  
ATOM   5233   C CB   . ASP A 1 114 ? -9.327  0.973   -19.114 0.016 38.35 ? 112 ASP A CB   2  
ATOM   5234   C CG   . ASP A 1 114 ? -9.467  2.109   -20.119 0.016 39.66 ? 112 ASP A CG   2  
ATOM   5235   O OD1  . ASP A 1 114 ? -10.264 1.962   -21.061 0.016 40.18 ? 112 ASP A OD1  2  
ATOM   5236   O OD2  . ASP A 1 114 ? -8.810  3.159   -19.941 0.016 40.25 ? 112 ASP A OD2  2  
ATOM   5237   H H    . ASP A 1 114 ? -10.716 -0.016  -20.976 0.016 39.76 ? 112 ASP A H    2  
ATOM   5238   H HA   . ASP A 1 114 ? -10.431 -0.566  -18.350 0.016 36.47 ? 112 ASP A HA   2  
ATOM   5239   H HB2  . ASP A 1 114 ? -9.155  1.365   -18.245 0.016 37.42 ? 112 ASP A HB2  2  
ATOM   5240   H HB3  . ASP A 1 114 ? -8.582  0.412   -19.381 0.016 39.32 ? 112 ASP A HB3  2  
ATOM   5241   N N    . CYS A 1 115 ? -12.982 0.571   -18.904 0.016 35.30 ? 113 CYS A N    2  
ATOM   5242   C CA   . CYS A 1 115 ? -14.163 1.337   -18.528 0.016 34.07 ? 113 CYS A CA   2  
ATOM   5243   C C    . CYS A 1 115 ? -15.135 0.465   -17.749 0.016 32.60 ? 113 CYS A C    2  
ATOM   5244   O O    . CYS A 1 115 ? -15.646 -0.524  -18.276 0.016 33.08 ? 113 CYS A O    2  
ATOM   5245   C CB   . CYS A 1 115 ? -14.858 1.905   -19.765 0.016 35.29 ? 113 CYS A CB   2  
ATOM   5246   S SG   . CYS A 1 115 ? -16.140 3.123   -19.363 0.016 34.10 ? 113 CYS A SG   2  
ATOM   5247   H H    . CYS A 1 115 ? -13.156 -0.139  -19.355 0.016 35.79 ? 113 CYS A H    2  
ATOM   5248   H HA   . CYS A 1 115 ? -13.903 2.082   -17.963 0.016 33.52 ? 113 CYS A HA   2  
ATOM   5249   H HB2  . CYS A 1 115 ? -14.196 2.338   -20.325 0.016 36.45 ? 113 CYS A HB2  2  
ATOM   5250   H HB3  . CYS A 1 115 ? -15.275 1.179   -20.254 0.016 35.73 ? 113 CYS A HB3  2  
ATOM   5251   H HG   . CYS A 1 115 ? -17.062 2.567   -18.841 0.016 32.96 ? 113 CYS A HG   2  
ATOM   5252   N N    . PHE A 1 116 ? -15.426 0.860   -16.513 0.016 30.99 ? 114 PHE A N    2  
ATOM   5253   C CA   . PHE A 1 116 ? -16.552 0.288   -15.809 0.016 29.71 ? 114 PHE A CA   2  
ATOM   5254   C C    . PHE A 1 116 ? -17.862 0.799   -16.403 0.016 29.78 ? 114 PHE A C    2  
ATOM   5255   O O    . PHE A 1 116 ? -17.995 1.986   -16.770 0.016 30.08 ? 114 PHE A O    2  
ATOM   5256   C CB   . PHE A 1 116 ? -16.528 0.639   -14.319 0.016 28.17 ? 114 PHE A CB   2  
ATOM   5257   C CG   . PHE A 1 116 ? -15.335 0.130   -13.556 0.016 28.07 ? 114 PHE A CG   2  
ATOM   5258   C CD1  . PHE A 1 116 ? -15.149 -1.217  -13.326 0.016 28.08 ? 114 PHE A CD1  2  
ATOM   5259   C CD2  . PHE A 1 116 ? -14.462 1.016   -12.964 0.016 27.99 ? 114 PHE A CD2  2  
ATOM   5260   C CE1  . PHE A 1 116 ? -14.073 -1.654  -12.578 0.016 28.07 ? 114 PHE A CE1  2  
ATOM   5261   C CE2  . PHE A 1 116 ? -13.411 0.591   -12.205 0.016 28.00 ? 114 PHE A CE2  2  
ATOM   5262   C CZ   . PHE A 1 116 ? -13.210 -0.758  -12.022 0.016 28.04 ? 114 PHE A CZ   2  
ATOM   5263   H H    . PHE A 1 116 ? -14.984 1.443   -16.067 0.016 30.70 ? 114 PHE A H    2  
ATOM   5264   H HA   . PHE A 1 116 ? -16.533 -0.675  -15.896 0.016 29.92 ? 114 PHE A HA   2  
ATOM   5265   H HB2  . PHE A 1 116 ? -16.552 1.602   -14.222 0.016 28.02 ? 114 PHE A HB2  2  
ATOM   5266   H HB3  . PHE A 1 116 ? -17.317 0.257   -13.909 0.016 27.47 ? 114 PHE A HB3  2  
ATOM   5267   H HD1  . PHE A 1 116 ? -15.733 -1.835  -13.703 0.016 28.22 ? 114 PHE A HD1  2  
ATOM   5268   H HD2  . PHE A 1 116 ? -14.591 1.929   -13.087 0.016 28.01 ? 114 PHE A HD2  2  
ATOM   5269   H HE1  . PHE A 1 116 ? -13.945 -2.562  -12.445 0.016 28.15 ? 114 PHE A HE1  2  
ATOM   5270   H HE2  . PHE A 1 116 ? -12.819 1.205   -11.839 0.016 28.09 ? 114 PHE A HE2  2  
ATOM   5271   H HZ   . PHE A 1 116 ? -12.488 -1.054  -11.519 0.016 28.14 ? 114 PHE A HZ   2  
ATOM   5272   N N    . PHE A 1 117 ? -18.845 -0.095  -16.433 0.016 29.55 ? 115 PHE A N    2  
ATOM   5273   C CA   . PHE A 1 117 ? -20.210 0.195   -16.844 0.016 29.60 ? 115 PHE A CA   2  
ATOM   5274   C C    . PHE A 1 117 ? -21.172 -0.180  -15.723 0.016 28.20 ? 115 PHE A C    2  
ATOM   5275   O O    . PHE A 1 117 ? -21.101 -1.289  -15.187 0.016 27.84 ? 115 PHE A O    2  
ATOM   5276   C CB   . PHE A 1 117 ? -20.578 -0.564  -18.113 0.016 31.16 ? 115 PHE A CB   2  
ATOM   5277   C CG   . PHE A 1 117 ? -19.855 -0.086  -19.342 0.016 32.84 ? 115 PHE A CG   2  
ATOM   5278   C CD1  . PHE A 1 117 ? -18.500 -0.302  -19.515 0.016 33.49 ? 115 PHE A CD1  2  
ATOM   5279   C CD2  . PHE A 1 117 ? -20.546 0.593   -20.327 0.016 33.93 ? 115 PHE A CD2  2  
ATOM   5280   C CE1  . PHE A 1 117 ? -17.847 0.173   -20.659 0.016 35.24 ? 115 PHE A CE1  2  
ATOM   5281   C CE2  . PHE A 1 117 ? -19.899 1.048   -21.474 0.016 35.70 ? 115 PHE A CE2  2  
ATOM   5282   C CZ   . PHE A 1 117 ? -18.553 0.841   -21.625 0.016 36.34 ? 115 PHE A CZ   2  
ATOM   5283   H H    . PHE A 1 117 ? -18.743 -0.911  -16.192 0.016 29.42 ? 115 PHE A H    2  
ATOM   5284   H HA   . PHE A 1 117 ? -20.291 1.141   -17.024 0.016 29.68 ? 115 PHE A HA   2  
ATOM   5285   H HB2  . PHE A 1 117 ? -20.376 -1.505  -17.994 0.016 31.22 ? 115 PHE A HB2  2  
ATOM   5286   H HB3  . PHE A 1 117 ? -21.528 -0.449  -18.270 0.016 31.16 ? 115 PHE A HB3  2  
ATOM   5287   H HD1  . PHE A 1 117 ? -18.016 -0.748  -18.858 0.016 32.85 ? 115 PHE A HD1  2  
ATOM   5288   H HD2  . PHE A 1 117 ? -21.459 0.740   -20.223 0.016 33.59 ? 115 PHE A HD2  2  
ATOM   5289   H HE1  . PHE A 1 117 ? -16.936 0.026   -20.774 0.016 35.78 ? 115 PHE A HE1  2  
ATOM   5290   H HE2  . PHE A 1 117 ? -20.376 1.505   -22.126 0.016 36.52 ? 115 PHE A HE2  2  
ATOM   5291   H HZ   . PHE A 1 117 ? -18.120 1.144   -22.389 0.016 37.63 ? 115 PHE A HZ   2  
ATOM   5292   N N    . TYR A 1 118 ? -22.069 0.739   -15.354 0.016 27.52 ? 116 TYR A N    2  
ATOM   5293   C CA   . TYR A 1 118 ? -23.114 0.443   -14.382 0.016 26.45 ? 116 TYR A CA   2  
ATOM   5294   C C    . TYR A 1 118 ? -24.491 0.543   -15.024 0.016 27.01 ? 116 TYR A C    2  
ATOM   5295   O O    . TYR A 1 118 ? -24.793 1.522   -15.715 0.016 27.59 ? 116 TYR A O    2  
ATOM   5296   C CB   . TYR A 1 118 ? -23.107 1.375   -13.162 0.016 25.18 ? 116 TYR A CB   2  
ATOM   5297   C CG   . TYR A 1 118 ? -21.786 1.868   -12.618 0.016 24.85 ? 116 TYR A CG   2  
ATOM   5298   C CD1  . TYR A 1 118 ? -21.715 3.087   -11.974 0.016 24.25 ? 116 TYR A CD1  2  
ATOM   5299   C CD2  . TYR A 1 118 ? -20.601 1.157   -12.753 0.016 25.28 ? 116 TYR A CD2  2  
ATOM   5300   C CE1  . TYR A 1 118 ? -20.532 3.586   -11.491 0.016 24.14 ? 116 TYR A CE1  2  
ATOM   5301   C CE2  . TYR A 1 118 ? -19.405 1.655   -12.258 0.016 25.16 ? 116 TYR A CE2  2  
ATOM   5302   C CZ   . TYR A 1 118 ? -19.379 2.886   -11.633 0.016 24.61 ? 116 TYR A CZ   2  
ATOM   5303   O OH   . TYR A 1 118 ? -18.213 3.393   -11.146 0.016 24.67 ? 116 TYR A OH   2  
ATOM   5304   H H    . TYR A 1 118 ? -22.085 1.541   -15.654 0.016 27.74 ? 116 TYR A H    2  
ATOM   5305   H HA   . TYR A 1 118 ? -23.000 -0.466  -14.060 0.016 26.30 ? 116 TYR A HA   2  
ATOM   5306   H HB2  . TYR A 1 118 ? -23.594 2.169   -13.424 0.016 25.29 ? 116 TYR A HB2  2  
ATOM   5307   H HB3  . TYR A 1 118 ? -23.587 0.947   -12.440 0.016 24.57 ? 116 TYR A HB3  2  
ATOM   5308   H HD1  . TYR A 1 118 ? -22.493 3.587   -11.875 0.016 24.01 ? 116 TYR A HD1  2  
ATOM   5309   H HD2  . TYR A 1 118 ? -20.608 0.332   -13.184 0.016 25.76 ? 116 TYR A HD2  2  
ATOM   5310   H HE1  . TYR A 1 118 ? -20.516 4.411   -11.065 0.016 23.83 ? 116 TYR A HE1  2  
ATOM   5311   H HE2  . TYR A 1 118 ? -18.620 1.174   -12.360 0.016 25.54 ? 116 TYR A HE2  2  
ATOM   5312   H HH   . TYR A 1 118 ? -17.563 3.017   -11.517 0.016 25.22 ? 116 TYR A HH   2  
ATOM   5313   N N    . GLU A 1 119 ? -25.343 -0.430  -14.743 0.016 26.92 ? 117 GLU A N    2  
ATOM   5314   C CA   . GLU A 1 119 ? -26.773 -0.330  -15.031 0.016 27.31 ? 117 GLU A CA   2  
ATOM   5315   C C    . GLU A 1 119 ? -27.484 -0.294  -13.676 0.016 26.06 ? 117 GLU A C    2  
ATOM   5316   O O    . GLU A 1 119 ? -27.423 -1.253  -12.890 0.016 25.58 ? 117 GLU A O    2  
ATOM   5317   C CB   . GLU A 1 119 ? -27.253 -1.468  -15.943 0.016 28.64 ? 117 GLU A CB   2  
ATOM   5318   C CG   . GLU A 1 119 ? -28.543 -1.131  -16.778 0.016 29.76 ? 117 GLU A CG   2  
ATOM   5319   C CD   . GLU A 1 119 ? -28.495 0.156   -17.705 0.016 30.50 ? 117 GLU A CD   2  
ATOM   5320   O OE1  . GLU A 1 119 ? -29.544 0.869   -17.847 0.016 30.79 ? 117 GLU A OE1  2  
ATOM   5321   O OE2  . GLU A 1 119 ? -27.452 0.436   -18.333 0.016 30.97 ? 117 GLU A OE2  2  
ATOM   5322   H H    . GLU A 1 119 ? -25.117 -1.166  -14.366 0.016 26.69 ? 117 GLU A H    2  
ATOM   5323   H HA   . GLU A 1 119 ? -26.948 0.507   -15.488 0.016 27.63 ? 117 GLU A HA   2  
ATOM   5324   H HB2  . GLU A 1 119 ? -26.544 -1.686  -16.565 0.016 29.29 ? 117 GLU A HB2  2  
ATOM   5325   H HB3  . GLU A 1 119 ? -27.449 -2.235  -15.390 0.016 28.29 ? 117 GLU A HB3  2  
ATOM   5326   H HG2  . GLU A 1 119 ? -28.739 -1.887  -17.352 0.016 30.72 ? 117 GLU A HG2  2  
ATOM   5327   H HG3  . GLU A 1 119 ? -29.270 -1.009  -16.148 0.016 29.20 ? 117 GLU A HG3  2  
ATOM   5328   N N    . ILE A 1 120 ? -28.044 0.874   -13.357 0.016 25.60 ? 118 ILE A N    2  
ATOM   5329   C CA   . ILE A 1 120 ? -28.585 1.191   -12.041 0.016 24.50 ? 118 ILE A CA   2  
ATOM   5330   C C    . ILE A 1 120 ? -30.095 1.342   -12.136 0.016 24.92 ? 118 ILE A C    2  
ATOM   5331   O O    . ILE A 1 120 ? -30.601 2.055   -13.015 0.016 25.68 ? 118 ILE A O    2  
ATOM   5332   C CB   . ILE A 1 120 ? -28.000 2.499   -11.470 0.016 23.74 ? 118 ILE A CB   2  
ATOM   5333   C CG1  . ILE A 1 120 ? -26.476 2.491   -11.496 0.016 23.59 ? 118 ILE A CG1  2  
ATOM   5334   C CG2  . ILE A 1 120 ? -28.541 2.724   -10.058 0.016 22.77 ? 118 ILE A CG2  2  
ATOM   5335   C CD1  . ILE A 1 120 ? -25.863 3.858   -11.169 0.016 23.19 ? 118 ILE A CD1  2  
ATOM   5336   H H    . ILE A 1 120 ? -28.111 1.519   -13.915 0.016 26.02 ? 118 ILE A H    2  
ATOM   5337   H HA   . ILE A 1 120 ? -28.379 0.468   -11.430 0.016 24.12 ? 118 ILE A HA   2  
ATOM   5338   H HB   . ILE A 1 120 ? -28.304 3.229   -12.028 0.016 24.14 ? 118 ILE A HB   2  
ATOM   5339   H HG12 . ILE A 1 120 ? -26.149 1.849   -10.846 0.016 23.16 ? 118 ILE A HG12 2  
ATOM   5340   H HG13 . ILE A 1 120 ? -26.181 2.238   -12.386 0.016 24.32 ? 118 ILE A HG13 2  
ATOM   5341   H HG21 . ILE A 1 120 ? -29.379 3.203   -10.112 0.016 22.91 ? 118 ILE A HG21 2  
ATOM   5342   H HG22 . ILE A 1 120 ? -28.694 1.857   -9.648  0.016 22.65 ? 118 ILE A HG22 2  
ATOM   5343   H HG23 . ILE A 1 120 ? -27.899 3.232   -9.543  0.016 22.28 ? 118 ILE A HG23 2  
ATOM   5344   H HD11 . ILE A 1 120 ? -24.952 3.887   -11.498 0.016 23.46 ? 118 ILE A HD11 2  
ATOM   5345   H HD12 . ILE A 1 120 ? -26.392 4.537   -11.610 0.016 23.49 ? 118 ILE A HD12 2  
ATOM   5346   H HD13 . ILE A 1 120 ? -25.880 4.001   -10.210 0.016 22.50 ? 118 ILE A HD13 2  
ATOM   5347   N N    . ARG A 1 121 ? -30.807 0.692   -11.219 0.016 24.54 ? 119 ARG A N    2  
ATOM   5348   C CA   . ARG A 1 121 ? -32.234 0.902   -11.000 0.016 24.84 ? 119 ARG A CA   2  
ATOM   5349   C C    . ARG A 1 121 ? -32.425 1.549   -9.630  0.016 23.80 ? 119 ARG A C    2  
ATOM   5350   O O    . ARG A 1 121 ? -31.825 1.108   -8.637  0.016 23.04 ? 119 ARG A O    2  
ATOM   5351   C CB   . ARG A 1 121 ? -33.008 -0.424  -11.085 0.016 25.59 ? 119 ARG A CB   2  
ATOM   5352   C CG   . ARG A 1 121 ? -34.541 -0.301  -10.895 0.016 26.16 ? 119 ARG A CG   2  
ATOM   5353   C CD   . ARG A 1 121 ? -35.232 0.349   -12.076 0.016 27.30 ? 119 ARG A CD   2  
ATOM   5354   N NE   . ARG A 1 121 ? -36.344 1.197   -11.646 0.016 27.38 ? 119 ARG A NE   2  
ATOM   5355   C CZ   . ARG A 1 121 ? -37.318 1.638   -12.447 0.016 28.56 ? 119 ARG A CZ   2  
ATOM   5356   N NH1  . ARG A 1 121 ? -37.364 1.268   -13.713 0.016 29.84 ? 119 ARG A NH1  2  
ATOM   5357   N NH2  . ARG A 1 121 ? -38.270 2.426   -11.968 0.016 28.61 ? 119 ARG A NH2  2  
ATOM   5358   H H    . ARG A 1 121 ? -30.469 0.114   -10.683 0.016 24.18 ? 119 ARG A H    2  
ATOM   5359   H HA   . ARG A 1 121 ? -32.582 1.488   -11.685 0.016 25.38 ? 119 ARG A HA   2  
ATOM   5360   H HB2  . ARG A 1 121 ? -32.847 -0.823  -11.953 0.016 26.33 ? 119 ARG A HB2  2  
ATOM   5361   H HB3  . ARG A 1 121 ? -32.676 -1.011  -10.392 0.016 25.10 ? 119 ARG A HB3  2  
ATOM   5362   H HG2  . ARG A 1 121 ? -34.920 -1.188  -10.787 0.016 26.57 ? 119 ARG A HG2  2  
ATOM   5363   H HG3  . ARG A 1 121 ? -34.723 0.230   -10.105 0.016 25.53 ? 119 ARG A HG3  2  
ATOM   5364   H HD2  . ARG A 1 121 ? -34.601 0.904   -12.558 0.016 27.22 ? 119 ARG A HD2  2  
ATOM   5365   H HD3  . ARG A 1 121 ? -35.586 -0.346  -12.655 0.016 28.22 ? 119 ARG A HD3  2  
ATOM   5366   H HE   . ARG A 1 121 ? -36.542 1.153   -10.810 0.016 26.87 ? 119 ARG A HE   2  
ATOM   5367   H HH11 . ARG A 1 121 ? -36.752 0.760   -14.034 0.016 29.89 ? 119 ARG A HH11 2  
ATOM   5368   H HH12 . ARG A 1 121 ? -38.000 1.544   -14.219 0.016 30.70 ? 119 ARG A HH12 2  
ATOM   5369   H HH21 . ARG A 1 121 ? -38.253 2.663   -11.142 0.016 27.88 ? 119 ARG A HH21 2  
ATOM   5370   H HH22 . ARG A 1 121 ? -38.907 2.693   -12.480 0.016 29.44 ? 119 ARG A HH22 2  
ATOM   5371   N N    . PHE A 1 122 ? -33.209 2.634   -9.588  0.016 23.89 ? 120 PHE A N    2  
ATOM   5372   C CA   . PHE A 1 122 ? -33.408 3.393   -8.360  0.016 23.10 ? 120 PHE A CA   2  
ATOM   5373   C C    . PHE A 1 122 ? -34.888 3.678   -8.187  0.016 23.64 ? 120 PHE A C    2  
ATOM   5374   O O    . PHE A 1 122 ? -35.511 4.296   -9.057  0.016 24.37 ? 120 PHE A O    2  
ATOM   5375   C CB   . PHE A 1 122 ? -32.638 4.705   -8.381  0.016 22.63 ? 120 PHE A CB   2  
ATOM   5376   C CG   . PHE A 1 122 ? -32.625 5.398   -7.061  0.016 21.89 ? 120 PHE A CG   2  
ATOM   5377   C CD1  . PHE A 1 122 ? -33.723 6.101   -6.619  0.016 22.07 ? 120 PHE A CD1  2  
ATOM   5378   C CD2  . PHE A 1 122 ? -31.523 5.337   -6.255  0.016 21.18 ? 120 PHE A CD2  2  
ATOM   5379   C CE1  . PHE A 1 122 ? -33.706 6.713   -5.400  0.016 21.56 ? 120 PHE A CE1  2  
ATOM   5380   C CE2  . PHE A 1 122 ? -31.513 5.952   -5.042  0.016 20.71 ? 120 PHE A CE2  2  
ATOM   5381   C CZ   . PHE A 1 122 ? -32.606 6.637   -4.613  0.016 20.91 ? 120 PHE A CZ   2  
ATOM   5382   H H    . PHE A 1 122 ? -33.633 2.944   -10.265 0.016 24.48 ? 120 PHE A H    2  
ATOM   5383   H HA   . PHE A 1 122 ? -33.100 2.879   -7.598  0.016 22.64 ? 120 PHE A HA   2  
ATOM   5384   H HB2  . PHE A 1 122 ? -31.722 4.537   -8.647  0.016 22.48 ? 120 PHE A HB2  2  
ATOM   5385   H HB3  . PHE A 1 122 ? -33.071 5.285   -9.025  0.016 23.11 ? 120 PHE A HB3  2  
ATOM   5386   H HD1  . PHE A 1 122 ? -34.479 6.145   -7.150  0.016 22.63 ? 120 PHE A HD1  2  
ATOM   5387   H HD2  . PHE A 1 122 ? -30.775 4.865   -6.539  0.016 21.12 ? 120 PHE A HD2  2  
ATOM   5388   H HE1  . PHE A 1 122 ? -34.453 7.184   -5.106  0.016 21.76 ? 120 PHE A HE1  2  
ATOM   5389   H HE2  . PHE A 1 122 ? -30.757 5.903   -4.504  0.016 20.35 ? 120 PHE A HE2  2  
ATOM   5390   H HZ   . PHE A 1 122 ? -32.587 7.057   -3.787  0.016 20.69 ? 120 PHE A HZ   2  
ATOM   5391   N N    . ASP A 1 123 ? -35.437 3.268   -7.054  0.016 23.43 ? 121 ASP A N    2  
ATOM   5392   C CA   . ASP A 1 123 ? -36.830 3.495   -6.757  0.016 24.06 ? 121 ASP A CA   2  
ATOM   5393   C C    . ASP A 1 123 ? -36.985 4.000   -5.339  0.016 23.50 ? 121 ASP A C    2  
ATOM   5394   O O    . ASP A 1 123 ? -36.356 3.505   -4.404  0.016 22.92 ? 121 ASP A O    2  
ATOM   5395   C CB   . ASP A 1 123 ? -37.664 2.219   -6.984  0.016 24.99 ? 121 ASP A CB   2  
ATOM   5396   C CG   . ASP A 1 123 ? -37.692 1.832   -8.433  0.016 25.86 ? 121 ASP A CG   2  
ATOM   5397   O OD1  . ASP A 1 123 ? -38.529 2.383   -9.196  0.016 26.77 ? 121 ASP A OD1  2  
ATOM   5398   O OD2  . ASP A 1 123 ? -36.860 0.998   -8.820  0.016 25.76 ? 121 ASP A OD2  2  
ATOM   5399   H H    . ASP A 1 123 ? -35.016 2.861   -6.431  0.016 23.01 ? 121 ASP A H    2  
ATOM   5400   H HA   . ASP A 1 123 ? -37.167 4.176   -7.356  0.016 24.42 ? 121 ASP A HA   2  
ATOM   5401   H HB2  . ASP A 1 123 ? -37.273 1.494   -6.477  0.016 24.69 ? 121 ASP A HB2  2  
ATOM   5402   H HB3  . ASP A 1 123 ? -38.574 2.379   -6.694  0.016 25.45 ? 121 ASP A HB3  2  
ATOM   5403   N N    . GLY A 1 124 ? -37.799 5.031   -5.205  0.016 23.80 ? 122 GLY A N    2  
ATOM   5404   C CA   . GLY A 1 124 ? -38.136 5.563   -3.904  0.016 23.56 ? 122 GLY A CA   2  
ATOM   5405   C C    . GLY A 1 124 ? -39.603 5.933   -3.851  0.016 24.52 ? 122 GLY A C    2  
ATOM   5406   O O    . GLY A 1 124 ? -40.191 6.400   -4.826  0.016 25.17 ? 122 GLY A O    2  
ATOM   5407   H H    . GLY A 1 124 ? -38.177 5.427   -5.862  0.016 24.22 ? 122 GLY A H    2  
ATOM   5408   H HA2  . GLY A 1 124 ? -37.957 4.912   -3.215  0.016 23.38 ? 122 GLY A HA2  2  
ATOM   5409   H HA3  . GLY A 1 124 ? -37.608 6.355   -3.725  0.016 23.10 ? 122 GLY A HA3  2  
ATOM   5410   N N    . THR A 1 125 ? -40.180 5.711   -2.689  0.016 24.76 ? 123 THR A N    2  
ATOM   5411   C CA   . THR A 1 125 ? -41.567 6.053   -2.460  0.016 25.79 ? 123 THR A CA   2  
ATOM   5412   C C    . THR A 1 125 ? -41.745 6.455   -1.015  0.016 25.75 ? 123 THR A C    2  
ATOM   5413   O O    . THR A 1 125 ? -40.818 6.387   -0.210  0.016 24.99 ? 123 THR A O    2  
ATOM   5414   C CB   . THR A 1 125 ? -42.511 4.912   -2.767  0.016 26.86 ? 123 THR A CB   2  
ATOM   5415   O OG1  . THR A 1 125 ? -43.839 5.410   -2.627  0.016 27.99 ? 123 THR A OG1  2  
ATOM   5416   C CG2  . THR A 1 125 ? -42.286 3.800   -1.768  0.016 26.78 ? 123 THR A CG2  2  
ATOM   5417   H H    . THR A 1 125 ? -39.785 5.369   -2.009  0.016 24.42 ? 123 THR A H    2  
ATOM   5418   H HA   . THR A 1 125 ? -41.807 6.809   -3.019  0.016 25.99 ? 123 THR A HA   2  
ATOM   5419   H HB   . THR A 1 125 ? -42.362 4.558   -3.660  0.016 26.96 ? 123 THR A HB   2  
ATOM   5420   H HG1  . THR A 1 125 ? -43.914 6.171   -2.991  0.016 27.98 ? 123 THR A HG1  2  
ATOM   5421   H HG21 . THR A 1 125 ? -41.337 3.660   -1.689  0.016 25.97 ? 123 THR A HG21 2  
ATOM   5422   H HG22 . THR A 1 125 ? -42.626 4.042   -0.898  0.016 26.99 ? 123 THR A HG22 2  
ATOM   5423   H HG23 . THR A 1 125 ? -42.720 2.984   -2.056  0.016 27.42 ? 123 THR A HG23 2  
ATOM   5424   N N    . ASN A 1 126 ? -42.960 6.960   -0.716  0.016 26.74 ? 124 ASN A N    2  
ATOM   5425   C CA   . ASN A 1 126 ? -43.381 7.358   0.616   0.016 27.11 ? 124 ASN A CA   2  
ATOM   5426   C C    . ASN A 1 126 ? -42.655 8.614   1.119   0.016 26.40 ? 124 ASN A C    2  
ATOM   5427   O O    . ASN A 1 126 ? -42.688 8.914   2.314   0.016 26.61 ? 124 ASN A O    2  
ATOM   5428   C CB   . ASN A 1 126 ? -43.215 6.207   1.622   0.016 27.24 ? 124 ASN A CB   2  
ATOM   5429   C CG   . ASN A 1 126 ? -44.212 5.092   1.416   0.016 28.42 ? 124 ASN A CG   2  
ATOM   5430   O OD1  . ASN A 1 126 ? -44.430 4.598   0.296   0.016 28.70 ? 124 ASN A OD1  2  
ATOM   5431   N ND2  . ASN A 1 126 ? -44.821 4.663   2.512   0.016 29.30 ? 124 ASN A ND2  2  
ATOM   5432   H H    . ASN A 1 126 ? -43.575 7.072   -1.305  0.016 27.31 ? 124 ASN A H    2  
ATOM   5433   H HA   . ASN A 1 126 ? -44.329 7.558   0.583   0.016 27.98 ? 124 ASN A HA   2  
ATOM   5434   H HB2  . ASN A 1 126 ? -42.331 5.824   1.532   0.016 26.51 ? 124 ASN A HB2  2  
ATOM   5435   H HB3  . ASN A 1 126 ? -43.328 6.551   2.517   0.016 27.39 ? 124 ASN A HB3  2  
ATOM   5436   H HD21 . ASN A 1 126 ? -44.622 5.012   3.274   0.016 29.18 ? 124 ASN A HD21 2  
ATOM   5437   H HD22 . ASN A 1 126 ? -45.415 4.040   2.463   0.016 30.07 ? 124 ASN A HD22 2  
ATOM   5438   N N    . PHE A 1 127 ? -42.020 9.406   0.265   0.016 25.76 ? 125 PHE A N    2  
ATOM   5439   C CA   . PHE A 1 127 ? -41.413 10.628  0.790   0.016 25.31 ? 125 PHE A CA   2  
ATOM   5440   C C    . PHE A 1 127 ? -42.525 11.635  1.040   0.016 26.26 ? 125 PHE A C    2  
ATOM   5441   O O    . PHE A 1 127 ? -43.399 11.798  0.185   0.016 26.94 ? 125 PHE A O    2  
ATOM   5442   C CB   . PHE A 1 127 ? -40.361 11.210  -0.142  0.016 24.50 ? 125 PHE A CB   2  
ATOM   5443   C CG   . PHE A 1 127 ? -39.092 10.441  -0.092  0.016 23.60 ? 125 PHE A CG   2  
ATOM   5444   C CD1  . PHE A 1 127 ? -38.209 10.624  0.967   0.016 23.15 ? 125 PHE A CD1  2  
ATOM   5445   C CD2  . PHE A 1 127 ? -38.824 9.486   -1.038  0.016 23.38 ? 125 PHE A CD2  2  
ATOM   5446   C CE1  . PHE A 1 127 ? -37.051 9.912   1.048   0.016 22.46 ? 125 PHE A CE1  2  
ATOM   5447   C CE2  . PHE A 1 127 ? -37.666 8.748   -0.956  0.016 22.66 ? 125 PHE A CE2  2  
ATOM   5448   C CZ   . PHE A 1 127 ? -36.782 8.952   0.074   0.016 22.19 ? 125 PHE A CZ   2  
ATOM   5449   H H    . PHE A 1 127 ? -41.944 9.290   -0.583  0.016 25.67 ? 125 PHE A H    2  
ATOM   5450   H HA   . PHE A 1 127 ? -40.969 10.425  1.622   0.016 25.08 ? 125 PHE A HA   2  
ATOM   5451   H HB2  . PHE A 1 127 ? -40.681 11.218  -1.055  0.016 24.73 ? 125 PHE A HB2  2  
ATOM   5452   H HB3  . PHE A 1 127 ? -40.170 12.109  0.148   0.016 24.46 ? 125 PHE A HB3  2  
ATOM   5453   H HD1  . PHE A 1 127 ? -38.393 11.262  1.616   0.016 23.41 ? 125 PHE A HD1  2  
ATOM   5454   H HD2  . PHE A 1 127 ? -39.419 9.343   -1.738  0.016 23.81 ? 125 PHE A HD2  2  
ATOM   5455   H HE1  . PHE A 1 127 ? -36.463 10.049  1.756   0.016 22.28 ? 125 PHE A HE1  2  
ATOM   5456   H HE2  . PHE A 1 127 ? -37.476 8.113   -1.608  0.016 22.58 ? 125 PHE A HE2  2  
ATOM   5457   H HZ   . PHE A 1 127 ? -35.998 8.451   0.115   0.016 21.77 ? 125 PHE A HZ   2  
ATOM   5458   N N    . PRO A 1 128 ? -42.581 12.244  2.218   0.016 26.53 ? 126 PRO A N    2  
ATOM   5459   C CA   . PRO A 1 128 ? -43.632 13.230  2.489   0.016 27.55 ? 126 PRO A CA   2  
ATOM   5460   C C    . PRO A 1 128 ? -43.476 14.438  1.587   0.016 27.39 ? 126 PRO A C    2  
ATOM   5461   O O    . PRO A 1 128 ? -42.416 15.081  1.578   0.016 26.62 ? 126 PRO A O    2  
ATOM   5462   C CB   . PRO A 1 128 ? -43.421 13.589  3.966   0.016 27.78 ? 126 PRO A CB   2  
ATOM   5463   C CG   . PRO A 1 128 ? -42.665 12.460  4.538   0.016 27.24 ? 126 PRO A CG   2  
ATOM   5464   C CD   . PRO A 1 128 ? -41.819 11.910  3.433   0.016 26.18 ? 126 PRO A CD   2  
ATOM   5465   H HA   . PRO A 1 128 ? -44.499 12.817  2.391   0.016 28.27 ? 126 PRO A HA   2  
ATOM   5466   H HB2  . PRO A 1 128 ? -42.911 14.407  4.040   0.016 27.49 ? 126 PRO A HB2  2  
ATOM   5467   H HB3  . PRO A 1 128 ? -44.277 13.679  4.407   0.016 28.68 ? 126 PRO A HB3  2  
ATOM   5468   H HG2  . PRO A 1 128 ? -42.100 12.791  5.254   0.016 27.09 ? 126 PRO A HG2  2  
ATOM   5469   H HG3  . PRO A 1 128 ? -43.275 11.782  4.868   0.016 27.83 ? 126 PRO A HG3  2  
ATOM   5470   H HD2  . PRO A 1 128 ? -40.954 12.353  3.419   0.016 25.56 ? 126 PRO A HD2  2  
ATOM   5471   H HD3  . PRO A 1 128 ? -41.724 10.953  3.538   0.016 26.10 ? 126 PRO A HD3  2  
ATOM   5472   N N    . PRO A 1 129 ? -44.509 14.770  0.811   0.016 28.24 ? 127 PRO A N    2  
ATOM   5473   C CA   . PRO A 1 129 ? -44.435 15.942  -0.071  0.016 28.32 ? 127 PRO A CA   2  
ATOM   5474   C C    . PRO A 1 129 ? -43.886 17.173  0.620   0.016 28.14 ? 127 PRO A C    2  
ATOM   5475   O O    . PRO A 1 129 ? -43.343 18.046  -0.053  0.016 27.88 ? 127 PRO A O    2  
ATOM   5476   C CB   . PRO A 1 129 ? -45.900 16.138  -0.508  0.016 29.69 ? 127 PRO A CB   2  
ATOM   5477   C CG   . PRO A 1 129 ? -46.687 15.465  0.503   0.016 30.39 ? 127 PRO A CG   2  
ATOM   5478   C CD   . PRO A 1 129 ? -45.880 14.250  0.865   0.016 29.48 ? 127 PRO A CD   2  
ATOM   5479   H HA   . PRO A 1 129 ? -43.901 15.736  -0.851  0.016 27.83 ? 127 PRO A HA   2  
ATOM   5480   H HB2  . PRO A 1 129 ? -46.118 17.087  -0.526  0.016 30.08 ? 127 PRO A HB2  2  
ATOM   5481   H HB3  . PRO A 1 129 ? -46.050 15.734  -1.376  0.016 29.81 ? 127 PRO A HB3  2  
ATOM   5482   H HG2  . PRO A 1 129 ? -46.798 16.044  1.273   0.016 30.64 ? 127 PRO A HG2  2  
ATOM   5483   H HG3  . PRO A 1 129 ? -47.545 15.210  0.130   0.016 31.23 ? 127 PRO A HG3  2  
ATOM   5484   H HD2  . PRO A 1 129 ? -46.110 13.952  1.757   0.016 29.78 ? 127 PRO A HD2  2  
ATOM   5485   H HD3  . PRO A 1 129 ? -45.996 13.553  0.202   0.016 29.50 ? 127 PRO A HD3  2  
ATOM   5486   N N    . ASN A 1 130 ? -43.989 17.256  1.942   0.016 28.41 ? 128 ASN A N    2  
ATOM   5487   C CA   . ASN A 1 130 ? -43.590 18.419  2.704   0.016 28.56 ? 128 ASN A CA   2  
ATOM   5488   C C    . ASN A 1 130 ? -42.274 18.202  3.444   0.016 27.71 ? 128 ASN A C    2  
ATOM   5489   O O    . ASN A 1 130 ? -41.932 19.013  4.303   0.016 28.00 ? 128 ASN A O    2  
ATOM   5490   C CB   . ASN A 1 130 ? -44.699 18.830  3.686   0.016 29.87 ? 128 ASN A CB   2  
ATOM   5491   C CG   . ASN A 1 130 ? -45.601 17.646  4.146   0.016 30.52 ? 128 ASN A CG   2  
ATOM   5492   O OD1  . ASN A 1 130 ? -45.133 16.533  4.402   0.016 29.94 ? 128 ASN A OD1  2  
ATOM   5493   N ND2  . ASN A 1 130 ? -46.897 17.920  4.303   0.016 31.87 ? 128 ASN A ND2  2  
ATOM   5494   H H    . ASN A 1 130 ? -44.288 16.619  2.428   0.016 28.60 ? 128 ASN A H    2  
ATOM   5495   H HA   . ASN A 1 130 ? -43.452 19.159  2.090   0.016 28.54 ? 128 ASN A HA   2  
ATOM   5496   H HB2  . ASN A 1 130 ? -44.285 19.212  4.475   0.016 29.91 ? 128 ASN A HB2  2  
ATOM   5497   H HB3  . ASN A 1 130 ? -45.265 19.496  3.261   0.016 30.42 ? 128 ASN A HB3  2  
ATOM   5498   H HD21 . ASN A 1 130 ? -47.296 18.435  3.743   0.016 32.20 ? 128 ASN A HD21 2  
ATOM   5499   H HD22 . ASN A 1 130 ? -47.332 17.588  4.965   0.016 32.47 ? 128 ASN A HD22 2  
ATOM   5500   N N    . GLY A 1 131 ? -41.541 17.111  3.134   0.016 26.81 ? 129 GLY A N    2  
ATOM   5501   C CA   . GLY A 1 131 ? -40.313 16.784  3.829   0.016 26.12 ? 129 GLY A CA   2  
ATOM   5502   C C    . GLY A 1 131 ? -39.103 17.348  3.121   0.016 25.33 ? 129 GLY A C    2  
ATOM   5503   O O    . GLY A 1 131 ? -39.196 17.976  2.069   0.016 25.32 ? 129 GLY A O    2  
ATOM   5504   H H    . GLY A 1 131 ? -41.745 16.546  2.518   0.016 26.66 ? 129 GLY A H    2  
ATOM   5505   H HA2  . GLY A 1 131 ? -40.340 17.127  4.734   0.016 26.56 ? 129 GLY A HA2  2  
ATOM   5506   H HA3  . GLY A 1 131 ? -40.215 15.822  3.873   0.016 25.84 ? 129 GLY A HA3  2  
ATOM   5507   N N    . PRO A 1 132 ? -37.928 17.135  3.723   0.016 24.83 ? 130 PRO A N    2  
ATOM   5508   C CA   . PRO A 1 132 ? -36.695 17.760  3.187   0.016 24.31 ? 130 PRO A CA   2  
ATOM   5509   C C    . PRO A 1 132 ? -36.256 17.221  1.849   0.016 23.62 ? 130 PRO A C    2  
ATOM   5510   O O    . PRO A 1 132 ? -35.556 17.923  1.118   0.016 23.47 ? 130 PRO A O    2  
ATOM   5511   C CB   . PRO A 1 132 ? -35.660 17.481  4.277   0.016 24.16 ? 130 PRO A CB   2  
ATOM   5512   C CG   . PRO A 1 132 ? -36.208 16.282  5.023   0.016 24.27 ? 130 PRO A CG   2  
ATOM   5513   C CD   . PRO A 1 132 ? -37.698 16.495  5.023   0.016 25.00 ? 130 PRO A CD   2  
ATOM   5514   H HA   . PRO A 1 132 ? -36.819 18.720  3.115   0.016 24.69 ? 130 PRO A HA   2  
ATOM   5515   H HB2  . PRO A 1 132 ? -34.793 17.306  3.881   0.016 23.66 ? 130 PRO A HB2  2  
ATOM   5516   H HB3  . PRO A 1 132 ? -35.616 18.243  4.875   0.016 24.66 ? 130 PRO A HB3  2  
ATOM   5517   H HG2  . PRO A 1 132 ? -35.985 15.464  4.549   0.016 23.74 ? 130 PRO A HG2  2  
ATOM   5518   H HG3  . PRO A 1 132 ? -35.859 16.269  5.930   0.016 24.53 ? 130 PRO A HG3  2  
ATOM   5519   H HD2  . PRO A 1 132 ? -38.167 15.648  5.079   0.016 25.02 ? 130 PRO A HD2  2  
ATOM   5520   H HD3  . PRO A 1 132 ? -37.958 17.088  5.743   0.016 25.63 ? 130 PRO A HD3  2  
ATOM   5521   N N    . VAL A 1 133 ? -36.652 16.004  1.494   0.016 23.35 ? 131 VAL A N    2  
ATOM   5522   C CA   . VAL A 1 133 ? -36.318 15.454  0.191   0.016 22.90 ? 131 VAL A CA   2  
ATOM   5523   C C    . VAL A 1 133 ? -37.142 16.113  -0.911  0.016 23.42 ? 131 VAL A C    2  
ATOM   5524   O O    . VAL A 1 133 ? -36.596 16.658  -1.875  0.016 23.37 ? 131 VAL A O    2  
ATOM   5525   C CB   . VAL A 1 133 ? -36.503 13.920  0.212   0.016 22.62 ? 131 VAL A CB   2  
ATOM   5526   C CG1  . VAL A 1 133 ? -36.373 13.361  -1.179  0.016 22.43 ? 131 VAL A CG1  2  
ATOM   5527   C CG2  . VAL A 1 133 ? -35.515 13.299  1.172   0.016 22.17 ? 131 VAL A CG2  2  
ATOM   5528   H H    . VAL A 1 133 ? -37.124 15.490  1.990   0.016 23.51 ? 131 VAL A H    2  
ATOM   5529   H HA   . VAL A 1 133 ? -35.383 15.619  0.004   0.016 22.55 ? 131 VAL A HA   2  
ATOM   5530   H HB   . VAL A 1 133 ? -37.394 13.714  0.529   0.016 23.04 ? 131 VAL A HB   2  
ATOM   5531   H HG11 . VAL A 1 133 ? -36.400 12.391  -1.130  0.016 22.28 ? 131 VAL A HG11 2  
ATOM   5532   H HG12 . VAL A 1 133 ? -37.103 13.682  -1.731  0.016 22.87 ? 131 VAL A HG12 2  
ATOM   5533   H HG13 . VAL A 1 133 ? -35.523 13.648  -1.550  0.016 22.13 ? 131 VAL A HG13 2  
ATOM   5534   H HG21 . VAL A 1 133 ? -35.454 12.344  1.020   0.016 21.95 ? 131 VAL A HG21 2  
ATOM   5535   H HG22 . VAL A 1 133 ? -34.646 13.705  1.042   0.016 21.89 ? 131 VAL A HG22 2  
ATOM   5536   H HG23 . VAL A 1 133 ? -35.826 13.466  2.076   0.016 22.48 ? 131 VAL A HG23 2  
ATOM   5537   N N    . MET A 1 134 ? -38.468 16.077  -0.804  0.016 24.09 ? 132 MET A N    2  
ATOM   5538   C CA   . MET A 1 134 ? -39.256 16.606  -1.914  0.016 24.72 ? 132 MET A CA   2  
ATOM   5539   C C    . MET A 1 134 ? -39.194 18.128  -1.983  0.016 25.13 ? 132 MET A C    2  
ATOM   5540   O O    . MET A 1 134 ? -39.491 18.686  -3.030  0.016 25.59 ? 132 MET A O    2  
ATOM   5541   C CB   . MET A 1 134 ? -40.697 16.102  -1.814  0.016 25.50 ? 132 MET A CB   2  
ATOM   5542   C CG   . MET A 1 134 ? -40.765 14.530  -1.776  0.016 25.24 ? 132 MET A CG   2  
ATOM   5543   S SD   . MET A 1 134 ? -39.918 13.569  -3.073  0.016 24.70 ? 132 MET A SD   2  
ATOM   5544   C CE   . MET A 1 134 ? -40.749 14.348  -4.459  0.016 25.69 ? 132 MET A CE   2  
ATOM   5545   H H    . MET A 1 134 ? -38.907 15.777  -0.135  0.016 24.27 ? 132 MET A H    2  
ATOM   5546   H HA   . MET A 1 134 ? -38.897 16.260  -2.745  0.016 24.52 ? 132 MET A HA   2  
ATOM   5547   H HB2  . MET A 1 134 ? -41.085 16.441  -0.994  0.016 25.79 ? 132 MET A HB2  2  
ATOM   5548   H HB3  . MET A 1 134 ? -41.201 16.420  -2.572  0.016 26.01 ? 132 MET A HB3  2  
ATOM   5549   H HG2  . MET A 1 134 ? -40.393 14.240  -0.932  0.016 24.90 ? 132 MET A HG2  2  
ATOM   5550   H HG3  . MET A 1 134 ? -41.697 14.273  -1.810  0.016 25.89 ? 132 MET A HG3  2  
ATOM   5551   H HE1  . MET A 1 134 ? -41.054 15.226  -4.218  0.016 25.95 ? 132 MET A HE1  2  
ATOM   5552   H HE2  . MET A 1 134 ? -40.136 14.421  -5.206  0.016 25.52 ? 132 MET A HE2  2  
ATOM   5553   H HE3  . MET A 1 134 ? -41.508 13.798  -4.708  0.016 26.27 ? 132 MET A HE3  2  
ATOM   5554   N N    . GLN A 1 135 ? -38.795 18.790  -0.911  0.016 25.10 ? 133 GLN A N    2  
ATOM   5555   C CA   . GLN A 1 135 ? -38.646 20.242  -0.897  0.016 25.58 ? 133 GLN A CA   2  
ATOM   5556   C C    . GLN A 1 135 ? -37.198 20.696  -0.972  0.016 25.11 ? 133 GLN A C    2  
ATOM   5557   O O    . GLN A 1 135 ? -36.921 21.904  -0.824  0.016 25.57 ? 133 GLN A O    2  
ATOM   5558   C CB   . GLN A 1 135 ? -39.299 20.790  0.352   0.016 26.20 ? 133 GLN A CB   2  
ATOM   5559   C CG   . GLN A 1 135 ? -40.790 20.982  0.182   0.016 27.11 ? 133 GLN A CG   2  
ATOM   5560   C CD   . GLN A 1 135 ? -41.051 22.360  -0.260  0.016 27.87 ? 133 GLN A CD   2  
ATOM   5561   O OE1  . GLN A 1 135 ? -41.152 22.634  -1.460  0.016 28.04 ? 133 GLN A OE1  2  
ATOM   5562   N NE2  . GLN A 1 135 ? -41.091 23.269  0.701   0.016 28.44 ? 133 GLN A NE2  2  
ATOM   5563   H H    . GLN A 1 135 ? -38.596 18.420  -0.164  0.016 24.90 ? 133 GLN A H    2  
ATOM   5564   H HA   . GLN A 1 135 ? -39.105 20.618  -1.660  0.016 26.00 ? 133 GLN A HA   2  
ATOM   5565   H HB2  . GLN A 1 135 ? -39.142 20.180  1.089   0.016 25.94 ? 133 GLN A HB2  2  
ATOM   5566   H HB3  . GLN A 1 135 ? -38.914 21.657  0.550   0.016 26.42 ? 133 GLN A HB3  2  
ATOM   5567   H HG2  . GLN A 1 135 ? -41.124 20.386  -0.505  0.016 27.04 ? 133 GLN A HG2  2  
ATOM   5568   H HG3  . GLN A 1 135 ? -41.243 20.835  1.026   0.016 27.41 ? 133 GLN A HG3  2  
ATOM   5569   H HE21 . GLN A 1 135 ? -41.841 23.457  1.076   0.016 29.04 ? 133 GLN A HE21 2  
ATOM   5570   H HE22 . GLN A 1 135 ? -40.374 23.668  0.960   0.016 28.29 ? 133 GLN A HE22 2  
ATOM   5571   N N    . LYS A 1 136 ? -36.273 19.770  -1.221  0.016 24.34 ? 134 LYS A N    2  
ATOM   5572   C CA   . LYS A 1 136 ? -34.879 20.110  -1.566  0.016 24.03 ? 134 LYS A CA   2  
ATOM   5573   C C    . LYS A 1 136 ? -34.212 20.975  -0.488  0.016 24.24 ? 134 LYS A C    2  
ATOM   5574   O O    . LYS A 1 136 ? -33.592 22.005  -0.770  0.016 24.63 ? 134 LYS A O    2  
ATOM   5575   C CB   . LYS A 1 136 ? -34.809 20.771  -2.953  0.016 24.45 ? 134 LYS A CB   2  
ATOM   5576   C CG   . LYS A 1 136 ? -35.410 19.945  -4.086  0.016 24.45 ? 134 LYS A CG   2  
ATOM   5577   C CD   . LYS A 1 136 ? -35.399 20.673  -5.432  0.016 25.17 ? 134 LYS A CD   2  
ATOM   5578   C CE   . LYS A 1 136 ? -35.039 19.825  -6.658  0.016 25.11 ? 134 LYS A CE   2  
ATOM   5579   N NZ   . LYS A 1 136 ? -34.501 18.469  -6.432  0.016 24.31 ? 134 LYS A NZ   2  
ATOM   5580   H H    . LYS A 1 136 ? -36.425 18.928  -1.204  0.016 24.06 ? 134 LYS A H    2  
ATOM   5581   H HA   . LYS A 1 136 ? -34.382 19.276  -1.613  0.016 23.52 ? 134 LYS A HA   2  
ATOM   5582   H HB2  . LYS A 1 136 ? -35.268 21.625  -2.921  0.016 25.00 ? 134 LYS A HB2  2  
ATOM   5583   H HB3  . LYS A 1 136 ? -33.879 20.913  -3.180  0.016 24.31 ? 134 LYS A HB3  2  
ATOM   5584   H HG2  . LYS A 1 136 ? -34.911 19.123  -4.149  0.016 23.96 ? 134 LYS A HG2  2  
ATOM   5585   H HG3  . LYS A 1 136 ? -36.334 19.753  -3.869  0.016 24.63 ? 134 LYS A HG3  2  
ATOM   5586   H HD2  . LYS A 1 136 ? -36.284 21.035  -5.593  0.016 25.68 ? 134 LYS A HD2  2  
ATOM   5587   H HD3  . LYS A 1 136 ? -34.760 21.401  -5.392  0.016 25.34 ? 134 LYS A HD3  2  
ATOM   5588   H HE2  . LYS A 1 136 ? -35.833 19.741  -7.209  0.016 25.61 ? 134 LYS A HE2  2  
ATOM   5589   H HE3  . LYS A 1 136 ? -34.353 20.296  -7.155  0.016 25.30 ? 134 LYS A HE3  2  
ATOM   5590   H HZ1  . LYS A 1 136 ? -34.135 18.394  -5.628  0.016 23.86 ? 134 LYS A HZ1  2  
ATOM   5591   H HZ2  . LYS A 1 136 ? -35.166 17.893  -6.515  0.016 24.35 ? 134 LYS A HZ2  2  
ATOM   5592   H HZ3  . LYS A 1 136 ? -33.884 18.277  -7.047  0.016 24.32 ? 134 LYS A HZ3  2  
ATOM   5593   N N    . LYS A 1 137 ? -34.331 20.521  0.760   0.016 24.14 ? 135 LYS A N    2  
ATOM   5594   C CA   . LYS A 1 137 ? -33.695 21.156  1.910   0.016 24.49 ? 135 LYS A CA   2  
ATOM   5595   C C    . LYS A 1 137 ? -32.401 20.470  2.333   0.016 24.00 ? 135 LYS A C    2  
ATOM   5596   O O    . LYS A 1 137 ? -31.915 20.724  3.439   0.016 24.36 ? 135 LYS A O    2  
ATOM   5597   C CB   . LYS A 1 137 ? -34.646 21.191  3.109   0.016 25.04 ? 135 LYS A CB   2  
ATOM   5598   C CG   . LYS A 1 137 ? -35.996 21.916  2.913   0.016 25.74 ? 135 LYS A CG   2  
ATOM   5599   C CD   . LYS A 1 137 ? -35.747 23.316  2.390   0.016 26.26 ? 135 LYS A CD   2  
ATOM   5600   C CE   . LYS A 1 137 ? -36.842 24.314  2.825   0.016 27.35 ? 135 LYS A CE   2  
ATOM   5601   N NZ   . LYS A 1 137 ? -36.425 25.613  2.170   0.016 27.84 ? 135 LYS A NZ   2  
ATOM   5602   H H    . LYS A 1 137 ? -34.796 19.832  0.967   0.016 23.97 ? 135 LYS A H    2  
ATOM   5603   H HA   . LYS A 1 137 ? -33.473 22.076  1.674   0.016 24.88 ? 135 LYS A HA   2  
ATOM   5604   H HB2  . LYS A 1 137 ? -34.859 20.272  3.345   0.016 24.72 ? 135 LYS A HB2  2  
ATOM   5605   H HB3  . LYS A 1 137 ? -34.184 21.611  3.849   0.016 25.38 ? 135 LYS A HB3  2  
ATOM   5606   H HG2  . LYS A 1 137 ? -36.532 21.443  2.271   0.016 25.51 ? 135 LYS A HG2  2  
ATOM   5607   H HG3  . LYS A 1 137 ? -36.452 21.982  3.766   0.016 26.20 ? 135 LYS A HG3  2  
ATOM   5608   H HD2  . LYS A 1 137 ? -34.885 23.630  2.707   0.016 26.17 ? 135 LYS A HD2  2  
ATOM   5609   H HD3  . LYS A 1 137 ? -35.748 23.275  1.417   0.016 26.14 ? 135 LYS A HD3  2  
ATOM   5610   H HE2  . LYS A 1 137 ? -37.717 24.051  2.504   0.016 27.57 ? 135 LYS A HE2  2  
ATOM   5611   H HE3  . LYS A 1 137 ? -36.840 24.422  3.792   0.016 27.62 ? 135 LYS A HE3  2  
ATOM   5612   H HZ1  . LYS A 1 137 ? -36.043 26.144  2.771   0.016 28.25 ? 135 LYS A HZ1  2  
ATOM   5613   H HZ2  . LYS A 1 137 ? -35.837 25.445  1.526   0.016 27.43 ? 135 LYS A HZ2  2  
ATOM   5614   H HZ3  . LYS A 1 137 ? -37.126 26.022  1.815   0.016 28.24 ? 135 LYS A HZ3  2  
ATOM   5615   N N    . THR A 1 138 ? -31.877 19.538  1.527   0.016 23.30 ? 136 THR A N    2  
ATOM   5616   C CA   . THR A 1 138 ? -30.667 18.819  1.891   0.016 22.91 ? 136 THR A CA   2  
ATOM   5617   C C    . THR A 1 138 ? -29.454 19.559  1.368   0.016 23.12 ? 136 THR A C    2  
ATOM   5618   O O    . THR A 1 138 ? -29.478 20.087  0.260   0.016 23.24 ? 136 THR A O    2  
ATOM   5619   C CB   . THR A 1 138 ? -30.675 17.394  1.328   0.016 22.19 ? 136 THR A CB   2  
ATOM   5620   O OG1  . THR A 1 138 ? -30.534 17.438  -0.105  0.016 22.03 ? 136 THR A OG1  2  
ATOM   5621   C CG2  . THR A 1 138 ? -31.990 16.724  1.670   0.016 22.17 ? 136 THR A CG2  2  
ATOM   5622   H H    . THR A 1 138 ? -32.196 19.312  0.764   0.016 23.13 ? 136 THR A H    2  
ATOM   5623   H HA   . THR A 1 138 ? -30.601 18.765  2.858   0.016 23.12 ? 136 THR A HA   2  
ATOM   5624   H HB   . THR A 1 138 ? -29.954 16.886  1.719   0.016 22.00 ? 136 THR A HB   2  
ATOM   5625   H HG1  . THR A 1 138 ? -29.727 17.526  -0.313  0.016 22.00 ? 136 THR A HG1  2  
ATOM   5626   H HG21 . THR A 1 138 ? -32.032 15.839  1.278   0.016 21.80 ? 136 THR A HG21 2  
ATOM   5627   H HG22 . THR A 1 138 ? -32.087 16.656  2.631   0.016 22.37 ? 136 THR A HG22 2  
ATOM   5628   H HG23 . THR A 1 138 ? -32.726 17.247  1.320   0.016 22.44 ? 136 THR A HG23 2  
ATOM   5629   N N    . LEU A 1 139 ? -28.380 19.532  2.145   0.016 23.29 ? 137 LEU A N    2  
ATOM   5630   C CA   . LEU A 1 139 ? -27.120 20.202  1.808   0.016 23.69 ? 137 LEU A CA   2  
ATOM   5631   C C    . LEU A 1 139 ? -26.047 19.259  1.280   0.016 23.25 ? 137 LEU A C    2  
ATOM   5632   O O    . LEU A 1 139 ? -25.387 19.565  0.282   0.016 23.42 ? 137 LEU A O    2  
ATOM   5633   C CB   . LEU A 1 139 ? -26.565 20.900  3.048   0.016 24.49 ? 137 LEU A CB   2  
ATOM   5634   C CG   . LEU A 1 139 ? -27.451 21.918  3.731   0.016 25.19 ? 137 LEU A CG   2  
ATOM   5635   C CD1  . LEU A 1 139 ? -26.695 22.523  4.885   0.016 26.15 ? 137 LEU A CD1  2  
ATOM   5636   C CD2  . LEU A 1 139 ? -27.843 22.964  2.675   0.016 25.46 ? 137 LEU A CD2  2  
ATOM   5637   H H    . LEU A 1 139 ? -28.353 19.123  2.899   0.016 23.28 ? 137 LEU A H    2  
ATOM   5638   H HA   . LEU A 1 139 ? -27.292 20.864  1.122   0.016 23.92 ? 137 LEU A HA   2  
ATOM   5639   H HB2  . LEU A 1 139 ? -26.361 20.214  3.700   0.016 24.34 ? 137 LEU A HB2  2  
ATOM   5640   H HB3  . LEU A 1 139 ? -25.748 21.355  2.795   0.016 24.85 ? 137 LEU A HB3  2  
ATOM   5641   H HG   . LEU A 1 139 ? -28.251 21.494  4.073   0.016 24.97 ? 137 LEU A HG   2  
ATOM   5642   H HD11 . LEU A 1 139 ? -25.775 22.672  4.626   0.016 26.35 ? 137 LEU A HD11 2  
ATOM   5643   H HD12 . LEU A 1 139 ? -27.108 23.369  5.120   0.016 26.74 ? 137 LEU A HD12 2  
ATOM   5644   H HD13 . LEU A 1 139 ? -26.730 21.921  5.640   0.016 26.12 ? 137 LEU A HD13 2  
ATOM   5645   H HD21 . LEU A 1 139 ? -27.042 23.221  2.196   0.016 25.63 ? 137 LEU A HD21 2  
ATOM   5646   H HD22 . LEU A 1 139 ? -28.481 22.584  2.053   0.016 24.99 ? 137 LEU A HD22 2  
ATOM   5647   H HD23 . LEU A 1 139 ? -28.236 23.734  3.115   0.016 26.04 ? 137 LEU A HD23 2  
ATOM   5648   N N    . LYS A 1 140 ? -25.800 18.165  1.992   0.016 22.86 ? 138 LYS A N    2  
ATOM   5649   C CA   . LYS A 1 140 ? -24.730 17.226  1.690   0.016 22.58 ? 138 LYS A CA   2  
ATOM   5650   C C    . LYS A 1 140 ? -24.872 16.043  2.634   0.016 22.24 ? 138 LYS A C    2  
ATOM   5651   O O    . LYS A 1 140 ? -25.576 16.118  3.644   0.016 22.43 ? 138 LYS A O    2  
ATOM   5652   C CB   . LYS A 1 140 ? -23.361 17.856  1.926   0.016 23.30 ? 138 LYS A CB   2  
ATOM   5653   C CG   . LYS A 1 140 ? -23.253 18.375  3.352   0.016 24.06 ? 138 LYS A CG   2  
ATOM   5654   C CD   . LYS A 1 140 ? -21.872 18.795  3.706   0.016 24.90 ? 138 LYS A CD   2  
ATOM   5655   C CE   . LYS A 1 140 ? -20.980 17.619  3.948   0.016 24.63 ? 138 LYS A CE   2  
ATOM   5656   N NZ   . LYS A 1 140 ? -19.597 18.132  3.678   0.016 25.37 ? 138 LYS A NZ   2  
ATOM   5657   H H    . LYS A 1 140 ? -26.245 17.948  2.693   0.016 22.84 ? 138 LYS A H    2  
ATOM   5658   H HA   . LYS A 1 140 ? -24.811 16.917  0.775   0.016 22.26 ? 138 LYS A HA   2  
ATOM   5659   H HB2  . LYS A 1 140 ? -22.678 17.193  1.786   0.016 23.15 ? 138 LYS A HB2  2  
ATOM   5660   H HB3  . LYS A 1 140 ? -23.231 18.598  1.318   0.016 23.60 ? 138 LYS A HB3  2  
ATOM   5661   H HG2  . LYS A 1 140 ? -23.827 19.143  3.461   0.016 24.37 ? 138 LYS A HG2  2  
ATOM   5662   H HG3  . LYS A 1 140 ? -23.510 17.697  3.985   0.016 23.85 ? 138 LYS A HG3  2  
ATOM   5663   H HD2  . LYS A 1 140 ? -21.500 19.334  2.992   0.016 25.07 ? 138 LYS A HD2  2  
ATOM   5664   H HD3  . LYS A 1 140 ? -21.911 19.297  4.529   0.016 25.54 ? 138 LYS A HD3  2  
ATOM   5665   H HE2  . LYS A 1 140 ? -21.046 17.336  4.874   0.016 24.84 ? 138 LYS A HE2  2  
ATOM   5666   H HE3  . LYS A 1 140 ? -21.189 16.883  3.351   0.016 23.93 ? 138 LYS A HE3  2  
ATOM   5667   H HZ1  . LYS A 1 140 ? -19.086 17.999  4.392   0.016 25.81 ? 138 LYS A HZ1  2  
ATOM   5668   H HZ2  . LYS A 1 140 ? -19.249 17.706  2.980   0.016 25.02 ? 138 LYS A HZ2  2  
ATOM   5669   H HZ3  . LYS A 1 140 ? -19.619 19.000  3.495   0.016 25.83 ? 138 LYS A HZ3  2  
ATOM   5670   N N    . TRP A 1 141 ? -24.151 14.963  2.321   0.016 21.88 ? 139 TRP A N    2  
ATOM   5671   C CA   . TRP A 1 141 ? -24.021 13.856  3.252   0.016 21.74 ? 139 TRP A CA   2  
ATOM   5672   C C    . TRP A 1 141 ? -22.863 14.048  4.215   0.016 22.44 ? 139 TRP A C    2  
ATOM   5673   O O    . TRP A 1 141 ? -21.796 14.512  3.831   0.016 22.83 ? 139 TRP A O    2  
ATOM   5674   C CB   . TRP A 1 141 ? -23.773 12.541  2.504   0.016 21.15 ? 139 TRP A CB   2  
ATOM   5675   C CG   . TRP A 1 141 ? -24.902 12.024  1.630   0.016 20.59 ? 139 TRP A CG   2  
ATOM   5676   C CD1  . TRP A 1 141 ? -25.008 12.135  0.261   0.016 20.41 ? 139 TRP A CD1  2  
ATOM   5677   C CD2  . TRP A 1 141 ? -26.057 11.262  2.047   0.016 20.33 ? 139 TRP A CD2  2  
ATOM   5678   N NE1  . TRP A 1 141 ? -26.156 11.529  -0.174  0.016 20.09 ? 139 TRP A NE1  2  
ATOM   5679   C CE2  . TRP A 1 141 ? -26.817 10.995  0.896   0.016 20.03 ? 139 TRP A CE2  2  
ATOM   5680   C CE3  . TRP A 1 141 ? -26.532 10.830  3.276   0.016 20.52 ? 139 TRP A CE3  2  
ATOM   5681   C CZ2  . TRP A 1 141 ? -28.022 10.287  0.933   0.016 19.89 ? 139 TRP A CZ2  2  
ATOM   5682   C CZ3  . TRP A 1 141 ? -27.743 10.109  3.305   0.016 20.37 ? 139 TRP A CZ3  2  
ATOM   5683   C CH2  . TRP A 1 141 ? -28.462 9.863   2.134   0.016 20.05 ? 139 TRP A CH2  2  
ATOM   5684   H H    . TRP A 1 141 ? -23.730 14.852  1.583   0.016 21.78 ? 139 TRP A H    2  
ATOM   5685   H HA   . TRP A 1 141 ? -24.835 13.794  3.774   0.016 21.72 ? 139 TRP A HA   2  
ATOM   5686   H HB2  . TRP A 1 141 ? -22.998 12.653  1.938   0.016 21.24 ? 139 TRP A HB2  2  
ATOM   5687   H HB3  . TRP A 1 141 ? -23.576 11.870  3.171   0.016 21.18 ? 139 TRP A HB3  2  
ATOM   5688   H HD1  . TRP A 1 141 ? -24.396 12.564  -0.288  0.016 20.60 ? 139 TRP A HD1  2  
ATOM   5689   H HE1  . TRP A 1 141 ? -26.418 11.488  -0.988  0.016 20.03 ? 139 TRP A HE1  2  
ATOM   5690   H HE3  . TRP A 1 141 ? -26.054 11.000  4.054   0.016 20.86 ? 139 TRP A HE3  2  
ATOM   5691   H HZ2  . TRP A 1 141 ? -28.504 10.114  0.156   0.016 19.81 ? 139 TRP A HZ2  2  
ATOM   5692   H HZ3  . TRP A 1 141 ? -28.082 9.804   4.115   0.016 20.60 ? 139 TRP A HZ3  2  
ATOM   5693   H HH2  . TRP A 1 141 ? -29.261 9.391   2.178   0.016 20.07 ? 139 TRP A HH2  2  
ATOM   5694   N N    . LYS A 1 142 ? -23.036 13.574  5.442   0.016 22.74 ? 140 LYS A N    2  
ATOM   5695   C CA   . LYS A 1 142 ? -21.938 13.582  6.399   0.016 23.55 ? 140 LYS A CA   2  
ATOM   5696   C C    . LYS A 1 142 ? -20.784 12.674  5.914   0.016 23.38 ? 140 LYS A C    2  
ATOM   5697   O O    . LYS A 1 142 ? -20.496 12.580  4.724   0.016 22.86 ? 140 LYS A O    2  
ATOM   5698   C CB   . LYS A 1 142 ? -22.449 13.181  7.785   0.016 24.06 ? 140 LYS A CB   2  
ATOM   5699   C CG   . LYS A 1 142 ? -23.286 14.262  8.514   0.016 24.71 ? 140 LYS A CG   2  
ATOM   5700   C CD   . LYS A 1 142 ? -23.604 13.847  9.977   0.016 25.55 ? 140 LYS A CD   2  
ATOM   5701   C CE   . LYS A 1 142 ? -22.386 13.327  10.774  0.016 26.37 ? 140 LYS A CE   2  
ATOM   5702   N NZ   . LYS A 1 142 ? -22.723 12.548  12.034  0.016 27.13 ? 140 LYS A NZ   2  
ATOM   5703   H H    . LYS A 1 142 ? -23.768 13.254  5.742   0.016 22.59 ? 140 LYS A H    2  
ATOM   5704   H HA   . LYS A 1 142 ? -21.581 14.483  6.472   0.016 24.08 ? 140 LYS A HA   2  
ATOM   5705   H HB2  . LYS A 1 142 ? -22.983 12.375  7.715   0.016 23.57 ? 140 LYS A HB2  2  
ATOM   5706   H HB3  . LYS A 1 142 ? -21.679 13.024  8.332   0.016 24.61 ? 140 LYS A HB3  2  
ATOM   5707   H HG2  . LYS A 1 142 ? -22.783 15.092  8.534   0.016 25.21 ? 140 LYS A HG2  2  
ATOM   5708   H HG3  . LYS A 1 142 ? -24.123 14.391  8.042   0.016 24.23 ? 140 LYS A HG3  2  
ATOM   5709   H HD2  . LYS A 1 142 ? -23.962 14.614  10.452  0.016 26.15 ? 140 LYS A HD2  2  
ATOM   5710   H HD3  . LYS A 1 142 ? -24.261 13.133  9.960   0.016 25.13 ? 140 LYS A HD3  2  
ATOM   5711   H HE2  . LYS A 1 142 ? -21.853 12.749  10.225  0.016 25.88 ? 140 LYS A HE2  2  
ATOM   5712   H HE3  . LYS A 1 142 ? -21.852 14.090  11.048  0.016 27.08 ? 140 LYS A HE3  2  
ATOM   5713   H HZ1  . LYS A 1 142 ? -22.905 13.112  12.699  0.016 27.91 ? 140 LYS A HZ1  2  
ATOM   5714   H HZ2  . LYS A 1 142 ? -23.427 12.019  11.895  0.016 26.64 ? 140 LYS A HZ2  2  
ATOM   5715   H HZ3  . LYS A 1 142 ? -22.027 12.048  12.274  0.016 27.43 ? 140 LYS A HZ3  2  
ATOM   5716   N N    . SER A 1 143 ? -20.085 12.048  6.858   0.016 23.99 ? 141 SER A N    2  
ATOM   5717   C CA   . SER A 1 143 ? -18.961 11.155  6.555   0.016 24.01 ? 141 SER A CA   2  
ATOM   5718   C C    . SER A 1 143 ? -19.331 9.732   6.984   0.016 23.67 ? 141 SER A C    2  
ATOM   5719   O O    . SER A 1 143 ? -19.459 9.431   8.178   0.016 24.28 ? 141 SER A O    2  
ATOM   5720   C CB   . SER A 1 143 ? -17.658 11.662  7.215   0.016 25.22 ? 141 SER A CB   2  
ATOM   5721   O OG   . SER A 1 143 ? -17.476 13.040  6.968   0.016 25.75 ? 141 SER A OG   2  
ATOM   5722   H H    . SER A 1 143 ? -20.225 12.118  7.698   0.016 24.50 ? 141 SER A H    2  
ATOM   5723   H HA   . SER A 1 143 ? -18.790 11.171  5.606   0.016 23.60 ? 141 SER A HA   2  
ATOM   5724   H HB2  . SER A 1 143 ? -17.691 11.529  8.177   0.016 25.77 ? 141 SER A HB2  2  
ATOM   5725   H HB3  . SER A 1 143 ? -16.902 11.181  6.834   0.016 25.22 ? 141 SER A HB3  2  
ATOM   5726   H HG   . SER A 1 143 ? -16.661 13.236  7.039   0.016 26.23 ? 141 SER A HG   2  
ATOM   5727   N N    . PRO A 1 144 ? -19.577 8.830   6.050   0.016 22.84 ? 142 PRO A N    2  
ATOM   5728   C CA   . PRO A 1 144 ? -19.718 7.430   6.444   0.016 22.71 ? 142 PRO A CA   2  
ATOM   5729   C C    . PRO A 1 144 ? -18.509 7.068   7.289   0.016 23.65 ? 142 PRO A C    2  
ATOM   5730   O O    . PRO A 1 144 ? -17.422 7.610   7.095   0.016 24.16 ? 142 PRO A O    2  
ATOM   5731   C CB   . PRO A 1 144 ? -19.727 6.679   5.114   0.016 21.95 ? 142 PRO A CB   2  
ATOM   5732   C CG   . PRO A 1 144 ? -20.155 7.808   4.045   0.016 21.54 ? 142 PRO A CG   2  
ATOM   5733   C CD   . PRO A 1 144 ? -19.405 8.966   4.599   0.016 22.30 ? 142 PRO A CD   2  
ATOM   5734   H HA   . PRO A 1 144 ? -20.548 7.278   6.923   0.016 22.63 ? 142 PRO A HA   2  
ATOM   5735   H HB2  . PRO A 1 144 ? -18.850 6.310   4.967   0.016 22.19 ? 142 PRO A HB2  2  
ATOM   5736   H HB3  . PRO A 1 144 ? -20.387 5.970   5.146   0.016 21.62 ? 142 PRO A HB3  2  
ATOM   5737   H HG2  . PRO A 1 144 ? -19.900 7.578   3.147   0.016 21.31 ? 142 PRO A HG2  2  
ATOM   5738   H HG3  . PRO A 1 144 ? -21.111 7.968   4.083   0.016 21.25 ? 142 PRO A HG3  2  
ATOM   5739   H HD2  . PRO A 1 144 ? -18.487 8.852   4.379   0.016 22.61 ? 142 PRO A HD2  2  
ATOM   5740   H HD3  . PRO A 1 144 ? -19.761 9.809   4.295   0.016 22.23 ? 142 PRO A HD3  2  
ATOM   5741   N N    . THR A 1 145 ? -18.741 6.250   8.301   0.016 24.07 ? 143 THR A N    2  
ATOM   5742   C CA   . THR A 1 145 ? -17.868 5.098   8.592   0.016 24.52 ? 143 THR A CA   2  
ATOM   5743   C C    . THR A 1 145 ? -18.739 3.869   8.418   0.016 23.90 ? 143 THR A C    2  
ATOM   5744   O O    . THR A 1 145 ? -19.629 3.621   9.226   0.016 24.10 ? 143 THR A O    2  
ATOM   5745   C CB   . THR A 1 145 ? -17.269 5.076   10.005  0.016 25.86 ? 143 THR A CB   2  
ATOM   5746   O OG1  . THR A 1 145 ? -15.992 5.750   10.043  0.016 26.70 ? 143 THR A OG1  2  
ATOM   5747   C CG2  . THR A 1 145 ? -17.060 3.622   10.466  0.016 26.19 ? 143 THR A CG2  2  
ATOM   5748   H H    . THR A 1 145 ? -19.408 6.325   8.836   0.016 24.18 ? 143 THR A H    2  
ATOM   5749   H HA   . THR A 1 145 ? -17.142 5.059   7.949   0.016 24.44 ? 143 THR A HA   2  
ATOM   5750   H HB   . THR A 1 145 ? -17.887 5.509   10.615  0.016 26.11 ? 143 THR A HB   2  
ATOM   5751   H HG1  . THR A 1 145 ? -15.534 5.541   9.372   0.016 26.41 ? 143 THR A HG1  2  
ATOM   5752   H HG21 . THR A 1 145 ? -16.430 3.600   11.205  0.016 27.14 ? 143 THR A HG21 2  
ATOM   5753   H HG22 . THR A 1 145 ? -17.896 3.230   10.768  0.016 26.01 ? 143 THR A HG22 2  
ATOM   5754   H HG23 . THR A 1 145 ? -16.694 3.087   9.742   0.016 25.76 ? 143 THR A HG23 2  
ATOM   5755   N N    . GLY A 1 146 ? -18.540 3.147   7.343   0.016 23.27 ? 144 GLY A N    2  
ATOM   5756   C CA   . GLY A 1 146 ? -19.332 1.976   7.080   0.016 22.80 ? 144 GLY A CA   2  
ATOM   5757   C C    . GLY A 1 146 ? -18.643 0.717   7.568   0.016 23.39 ? 144 GLY A C    2  
ATOM   5758   O O    . GLY A 1 146 ? -17.423 0.637   7.639   0.016 23.94 ? 144 GLY A O    2  
ATOM   5759   H H    . GLY A 1 146 ? -17.951 3.316   6.743   0.016 23.19 ? 144 GLY A H    2  
ATOM   5760   H HA2  . GLY A 1 146 ? -20.189 2.048   7.529   0.016 22.78 ? 144 GLY A HA2  2  
ATOM   5761   H HA3  . GLY A 1 146 ? -19.483 1.893   6.126   0.016 22.24 ? 144 GLY A HA3  2  
ATOM   5762   N N    . LYS A 1 147 ? -19.467 -0.248  7.945   0.016 23.42 ? 145 LYS A N    2  
ATOM   5763   C CA   . LYS A 1 147 ? -19.005 -1.587  8.288   0.016 23.96 ? 145 LYS A CA   2  
ATOM   5764   C C    . LYS A 1 147 ? -19.260 -2.489  7.088   0.016 23.29 ? 145 LYS A C    2  
ATOM   5765   O O    . LYS A 1 147 ? -20.269 -2.350  6.395   0.016 22.63 ? 145 LYS A O    2  
ATOM   5766   C CB   . LYS A 1 147 ? -19.735 -2.104  9.536   0.016 24.70 ? 145 LYS A CB   2  
ATOM   5767   C CG   . LYS A 1 147 ? -19.544 -3.610  9.888   0.016 25.38 ? 145 LYS A CG   2  
ATOM   5768   C CD   . LYS A 1 147 ? -20.520 -4.111  10.998  0.016 26.14 ? 145 LYS A CD   2  
ATOM   5769   C CE   . LYS A 1 147 ? -19.818 -4.226  12.358  0.016 27.57 ? 145 LYS A CE   2  
ATOM   5770   N NZ   . LYS A 1 147 ? -19.061 -5.484  12.501  0.016 28.27 ? 145 LYS A NZ   2  
ATOM   5771   H H    . LYS A 1 147 ? -20.317 -0.154  7.999   0.016 23.19 ? 145 LYS A H    2  
ATOM   5772   H HA   . LYS A 1 147 ? -18.053 -1.570  8.459   0.016 24.41 ? 145 LYS A HA   2  
ATOM   5773   H HB2  . LYS A 1 147 ? -19.452 -1.574  10.298  0.016 25.26 ? 145 LYS A HB2  2  
ATOM   5774   H HB3  . LYS A 1 147 ? -20.684 -1.973  9.392   0.016 24.32 ? 145 LYS A HB3  2  
ATOM   5775   H HG2  . LYS A 1 147 ? -19.704 -4.141  9.093   0.016 24.89 ? 145 LYS A HG2  2  
ATOM   5776   H HG3  . LYS A 1 147 ? -18.639 -3.755  10.213  0.016 25.95 ? 145 LYS A HG3  2  
ATOM   5777   H HD2  . LYS A 1 147 ? -21.262 -3.490  11.085  0.016 25.89 ? 145 LYS A HD2  2  
ATOM   5778   H HD3  . LYS A 1 147 ? -20.848 -4.993  10.762  0.016 26.11 ? 145 LYS A HD3  2  
ATOM   5779   H HE2  . LYS A 1 147 ? -19.191 -3.492  12.452  0.016 27.68 ? 145 LYS A HE2  2  
ATOM   5780   H HE3  . LYS A 1 147 ? -20.482 -4.192  13.068  0.016 28.07 ? 145 LYS A HE3  2  
ATOM   5781   H HZ1  . LYS A 1 147 ? -18.365 -5.353  13.041  0.016 28.99 ? 145 LYS A HZ1  2  
ATOM   5782   H HZ2  . LYS A 1 147 ? -19.586 -6.108  12.855  0.016 28.65 ? 145 LYS A HZ2  2  
ATOM   5783   H HZ3  . LYS A 1 147 ? -18.765 -5.764  11.709  0.016 27.71 ? 145 LYS A HZ3  2  
ATOM   5784   N N    . MET A 1 148 ? -18.331 -3.398  6.823   0.016 23.60 ? 146 MET A N    2  
ATOM   5785   C CA   . MET A 1 148 ? -18.503 -4.393  5.784   0.016 23.24 ? 146 MET A CA   2  
ATOM   5786   C C    . MET A 1 148 ? -18.173 -5.735  6.414   0.016 24.02 ? 146 MET A C    2  
ATOM   5787   O O    . MET A 1 148 ? -17.258 -5.827  7.234   0.016 24.81 ? 146 MET A O    2  
ATOM   5788   C CB   . MET A 1 148 ? -17.592 -4.119  4.576   0.016 22.96 ? 146 MET A CB   2  
ATOM   5789   C CG   . MET A 1 148 ? -17.042 -2.641  4.440   0.016 22.85 ? 146 MET A CG   2  
ATOM   5790   S SD   . MET A 1 148 ? -18.094 -1.204  3.955   0.016 22.02 ? 146 MET A SD   2  
ATOM   5791   C CE   . MET A 1 148 ? -19.573 -2.135  3.450   0.016 21.53 ? 146 MET A CE   2  
ATOM   5792   H H    . MET A 1 148 ? -17.587 -3.463  7.239   0.016 24.11 ? 146 MET A H    2  
ATOM   5793   H HA   . MET A 1 148 ? -19.421 -4.403  5.488   0.016 22.84 ? 146 MET A HA   2  
ATOM   5794   H HB2  . MET A 1 148 ? -16.822 -4.698  4.639   0.016 23.42 ? 146 MET A HB2  2  
ATOM   5795   H HB3  . MET A 1 148 ? -18.088 -4.317  3.767   0.016 22.54 ? 146 MET A HB3  2  
ATOM   5796   H HG2  . MET A 1 148 ? -16.647 -2.395  5.290   0.016 23.31 ? 146 MET A HG2  2  
ATOM   5797   H HG3  . MET A 1 148 ? -16.340 -2.690  3.776   0.016 22.96 ? 146 MET A HG3  2  
ATOM   5798   H HE1  . MET A 1 148 ? -19.450 -2.497  2.558   0.016 21.41 ? 146 MET A HE1  2  
ATOM   5799   H HE2  . MET A 1 148 ? -19.739 -2.857  4.068   0.016 21.83 ? 146 MET A HE2  2  
ATOM   5800   H HE3  . MET A 1 148 ? -20.330 -1.526  3.463   0.016 21.22 ? 146 MET A HE3  2  
ATOM   5801   N N    . TYR A 1 149 ? -18.899 -6.776  6.009   0.016 23.93 ? 147 TYR A N    2  
ATOM   5802   C CA   . TYR A 1 149 ? -18.784 -8.062  6.672   0.016 24.77 ? 147 TYR A CA   2  
ATOM   5803   C C    . TYR A 1 149 ? -19.355 -9.121  5.749   0.016 24.62 ? 147 TYR A C    2  
ATOM   5804   O O    . TYR A 1 149 ? -20.032 -8.819  4.781   0.016 23.94 ? 147 TYR A O    2  
ATOM   5805   C CB   . TYR A 1 149 ? -19.483 -8.068  8.036   0.016 25.39 ? 147 TYR A CB   2  
ATOM   5806   C CG   . TYR A 1 149 ? -20.951 -7.792  7.972   0.016 24.97 ? 147 TYR A CG   2  
ATOM   5807   C CD1  . TYR A 1 149 ? -21.894 -8.819  8.006   0.016 25.32 ? 147 TYR A CD1  2  
ATOM   5808   C CD2  . TYR A 1 149 ? -21.408 -6.485  7.868   0.016 24.34 ? 147 TYR A CD2  2  
ATOM   5809   C CE1  . TYR A 1 149 ? -23.254 -8.549  7.934   0.016 25.09 ? 147 TYR A CE1  2  
ATOM   5810   C CE2  . TYR A 1 149 ? -22.733 -6.204  7.796   0.016 24.06 ? 147 TYR A CE2  2  
ATOM   5811   C CZ   . TYR A 1 149 ? -23.667 -7.238  7.838   0.016 24.46 ? 147 TYR A CZ   2  
ATOM   5812   O OH   . TYR A 1 149 ? -25.004 -6.900  7.739   0.016 24.30 ? 147 TYR A OH   2  
ATOM   5813   H H    . TYR A 1 149 ? -19.449 -6.767  5.351   0.016 23.49 ? 147 TYR A H    2  
ATOM   5814   H HA   . TYR A 1 149 ? -17.843 -8.259  6.816   0.016 25.19 ? 147 TYR A HA   2  
ATOM   5815   H HB2  . TYR A 1 149 ? -19.357 -8.938  8.449   0.016 26.05 ? 147 TYR A HB2  2  
ATOM   5816   H HB3  . TYR A 1 149 ? -19.079 -7.380  8.584   0.016 25.58 ? 147 TYR A HB3  2  
ATOM   5817   H HD1  . TYR A 1 149 ? -21.604 -9.705  8.073   0.016 25.81 ? 147 TYR A HD1  2  
ATOM   5818   H HD2  . TYR A 1 149 ? -20.786 -5.795  7.844   0.016 24.18 ? 147 TYR A HD2  2  
ATOM   5819   H HE1  . TYR A 1 149 ? -23.875 -9.241  7.953   0.016 25.44 ? 147 TYR A HE1  2  
ATOM   5820   H HE2  . TYR A 1 149 ? -23.019 -5.324  7.725   0.016 23.69 ? 147 TYR A HE2  2  
ATOM   5821   H HH   . TYR A 1 149 ? -25.363 -7.324  7.107   0.016 24.13 ? 147 TYR A HH   2  
ATOM   5822   N N    . VAL A 1 150 ? -19.020 -10.384 6.028   0.016 25.40 ? 148 VAL A N    2  
ATOM   5823   C CA   . VAL A 1 150 ? -19.494 -11.491 5.215   0.016 25.50 ? 148 VAL A CA   2  
ATOM   5824   C C    . VAL A 1 150 ? -20.588 -12.211 5.982   0.016 26.08 ? 148 VAL A C    2  
ATOM   5825   O O    . VAL A 1 150 ? -20.470 -12.424 7.190   0.016 26.85 ? 148 VAL A O    2  
ATOM   5826   C CB   . VAL A 1 150 ? -18.354 -12.468 4.860   0.016 26.11 ? 148 VAL A CB   2  
ATOM   5827   C CG1  . VAL A 1 150 ? -18.928 -13.793 4.283   0.016 26.52 ? 148 VAL A CG1  2  
ATOM   5828   C CG2  . VAL A 1 150 ? -17.410 -11.820 3.862   0.016 25.65 ? 148 VAL A CG2  2  
ATOM   5829   H H    . VAL A 1 150 ? -18.529 -10.615 6.690   0.016 25.96 ? 148 VAL A H    2  
ATOM   5830   H HA   . VAL A 1 150 ? -19.856 -11.146 4.390   0.016 24.93 ? 148 VAL A HA   2  
ATOM   5831   H HB   . VAL A 1 150 ? -17.858 -12.667 5.669   0.016 26.69 ? 148 VAL A HB   2  
ATOM   5832   H HG11 . VAL A 1 150 ? -19.523 -14.211 4.925   0.016 26.90 ? 148 VAL A HG11 2  
ATOM   5833   H HG12 . VAL A 1 150 ? -19.409 -13.602 3.462   0.016 26.06 ? 148 VAL A HG12 2  
ATOM   5834   H HG13 . VAL A 1 150 ? -18.191 -14.396 4.100   0.016 26.99 ? 148 VAL A HG13 2  
ATOM   5835   H HG21 . VAL A 1 150 ? -17.182 -10.930 4.172   0.016 25.37 ? 148 VAL A HG21 2  
ATOM   5836   H HG22 . VAL A 1 150 ? -16.609 -12.360 3.787   0.016 26.16 ? 148 VAL A HG22 2  
ATOM   5837   H HG23 . VAL A 1 150 ? -17.848 -11.775 3.000   0.016 25.27 ? 148 VAL A HG23 2  
ATOM   5838   N N    . GLU A 1 151 ? -21.648 -12.578 5.289   0.016 25.90 ? 149 GLU A N    2  
ATOM   5839   C CA   . GLU A 1 151 ? -22.630 -13.496 5.861   0.016 26.71 ? 149 GLU A CA   2  
ATOM   5840   C C    . GLU A 1 151 ? -22.530 -14.821 5.110   0.016 27.24 ? 149 GLU A C    2  
ATOM   5841   O O    . GLU A 1 151 ? -23.042 -14.958 3.997   0.016 26.92 ? 149 GLU A O    2  
ATOM   5842   C CB   . GLU A 1 151 ? -24.032 -12.882 5.821   0.016 26.40 ? 149 GLU A CB   2  
ATOM   5843   C CG   . GLU A 1 151 ? -24.809 -12.877 7.142   0.016 27.15 ? 149 GLU A CG   2  
ATOM   5844   C CD   . GLU A 1 151 ? -23.905 -12.984 8.307   0.016 27.89 ? 149 GLU A CD   2  
ATOM   5845   O OE1  . GLU A 1 151 ? -23.087 -12.078 8.506   0.016 27.47 ? 149 GLU A OE1  2  
ATOM   5846   O OE2  . GLU A 1 151 ? -23.968 -14.023 8.955   0.016 28.99 ? 149 GLU A OE2  2  
ATOM   5847   H H    . GLU A 1 151 ? -21.817 -12.322 4.490   0.016 25.42 ? 149 GLU A H    2  
ATOM   5848   H HA   . GLU A 1 151 ? -22.358 -13.708 6.760   0.016 27.29 ? 149 GLU A HA   2  
ATOM   5849   H HB2  . GLU A 1 151 ? -23.952 -11.960 5.538   0.016 25.70 ? 149 GLU A HB2  2  
ATOM   5850   H HB3  . GLU A 1 151 ? -24.565 -13.379 5.184   0.016 26.50 ? 149 GLU A HB3  2  
ATOM   5851   H HG2  . GLU A 1 151 ? -25.261 -12.044 7.289   0.016 26.76 ? 149 GLU A HG2  2  
ATOM   5852   H HG3  . GLU A 1 151 ? -25.443 -13.608 7.158   0.016 27.70 ? 149 GLU A HG3  2  
ATOM   5853   N N    . ASP A 1 152 ? -21.854 -15.790 5.714   0.016 28.17 ? 150 ASP A N    2  
ATOM   5854   C CA   . ASP A 1 152 ? -21.733 -17.139 5.165   0.016 28.92 ? 150 ASP A CA   2  
ATOM   5855   C C    . ASP A 1 152 ? -21.623 -17.137 3.638   0.016 28.37 ? 150 ASP A C    2  
ATOM   5856   O O    . ASP A 1 152 ? -22.399 -17.783 2.932   0.016 28.70 ? 150 ASP A O    2  
ATOM   5857   C CB   . ASP A 1 152 ? -22.901 -18.009 5.645   0.016 29.84 ? 150 ASP A CB   2  
ATOM   5858   C CG   . ASP A 1 152 ? -24.213 -17.694 4.966   0.016 29.46 ? 150 ASP A CG   2  
ATOM   5859   O OD1  . ASP A 1 152 ? -24.948 -18.671 4.655   0.016 30.30 ? 150 ASP A OD1  2  
ATOM   5860   O OD2  . ASP A 1 152 ? -24.498 -16.492 4.770   0.016 28.46 ? 150 ASP A OD2  2  
ATOM   5861   H H    . ASP A 1 152 ? -21.442 -15.693 6.465   0.016 28.48 ? 150 ASP A H    2  
ATOM   5862   H HA   . ASP A 1 152 ? -20.918 -17.532 5.511   0.016 29.39 ? 150 ASP A HA   2  
ATOM   5863   H HB2  . ASP A 1 152 ? -22.693 -18.944 5.523   0.016 30.56 ? 150 ASP A HB2  2  
ATOM   5864   H HB3  . ASP A 1 152 ? -23.018 -17.789 6.569   0.016 30.08 ? 150 ASP A HB3  2  
ATOM   5865   N N    . GLY A 1 153 ? -20.619 -16.423 3.126   0.016 27.74 ? 151 GLY A N    2  
ATOM   5866   C CA   . GLY A 1 153 ? -20.333 -16.399 1.687   0.016 27.43 ? 151 GLY A CA   2  
ATOM   5867   C C    . GLY A 1 153 ? -20.687 -15.129 0.930   0.016 26.42 ? 151 GLY A C    2  
ATOM   5868   O O    . GLY A 1 153 ? -20.308 -14.986 -0.242  0.016 26.28 ? 151 GLY A O    2  
ATOM   5869   H H    . GLY A 1 153 ? -20.088 -15.940 3.597   0.016 27.59 ? 151 GLY A H    2  
ATOM   5870   H HA2  . GLY A 1 153 ? -19.389 -16.581 1.562   0.016 27.60 ? 151 GLY A HA2  2  
ATOM   5871   H HA3  . GLY A 1 153 ? -20.819 -17.119 1.260   0.016 27.89 ? 151 GLY A HA3  2  
ATOM   5872   N N    . VAL A 1 154 ? -21.420 -14.212 1.546   0.016 25.85 ? 152 VAL A N    2  
ATOM   5873   C CA   . VAL A 1 154 ? -21.921 -13.027 0.880   0.016 25.01 ? 152 VAL A CA   2  
ATOM   5874   C C    . VAL A 1 154 ? -21.303 -11.807 1.557   0.016 24.39 ? 152 VAL A C    2  
ATOM   5875   O O    . VAL A 1 154 ? -21.322 -11.712 2.788   0.016 24.58 ? 152 VAL A O    2  
ATOM   5876   C CB   . VAL A 1 154 ? -23.455 -12.967 0.968   0.016 25.01 ? 152 VAL A CB   2  
ATOM   5877   C CG1  . VAL A 1 154 ? -23.995 -11.968 0.050   0.016 24.36 ? 152 VAL A CG1  2  
ATOM   5878   C CG2  . VAL A 1 154 ? -24.064 -14.295 0.635   0.016 25.91 ? 152 VAL A CG2  2  
ATOM   5879   H H    . VAL A 1 154 ? -21.652 -14.261 2.374   0.016 26.03 ? 152 VAL A H    2  
ATOM   5880   H HA   . VAL A 1 154 ? -21.663 -13.032 -0.054  0.016 24.95 ? 152 VAL A HA   2  
ATOM   5881   H HB   . VAL A 1 154 ? -23.710 -12.728 1.874   0.016 25.02 ? 152 VAL A HB   2  
ATOM   5882   H HG11 . VAL A 1 154 ? -23.371 -11.232 -0.009  0.016 23.87 ? 152 VAL A HG11 2  
ATOM   5883   H HG12 . VAL A 1 154 ? -24.117 -12.372 -0.822  0.016 24.59 ? 152 VAL A HG12 2  
ATOM   5884   H HG13 . VAL A 1 154 ? -24.844 -11.664 0.398   0.016 24.31 ? 152 VAL A HG13 2  
ATOM   5885   H HG21 . VAL A 1 154 ? -23.873 -14.923 1.350   0.016 26.41 ? 152 VAL A HG21 2  
ATOM   5886   H HG22 . VAL A 1 154 ? -25.021 -14.203 0.517   0.016 25.97 ? 152 VAL A HG22 2  
ATOM   5887   H HG23 . VAL A 1 154 ? -23.667 -14.610 -0.190  0.016 26.03 ? 152 VAL A HG23 2  
ATOM   5888   N N    . LEU A 1 155 ? -20.809 -10.860 0.768   0.016 23.82 ? 153 LEU A N    2  
ATOM   5889   C CA   . LEU A 1 155 ? -20.347 -9.592  1.344   0.016 23.32 ? 153 LEU A CA   2  
ATOM   5890   C C    . LEU A 1 155 ? -21.494 -8.629  1.595   0.016 22.77 ? 153 LEU A C    2  
ATOM   5891   O O    . LEU A 1 155 ? -22.258 -8.312  0.676   0.016 22.46 ? 153 LEU A O    2  
ATOM   5892   C CB   . LEU A 1 155 ? -19.332 -8.887  0.449   0.016 23.09 ? 153 LEU A CB   2  
ATOM   5893   C CG   . LEU A 1 155 ? -18.805 -7.581  1.042   0.016 22.74 ? 153 LEU A CG   2  
ATOM   5894   C CD1  . LEU A 1 155 ? -17.999 -7.878  2.308   0.016 23.28 ? 153 LEU A CD1  2  
ATOM   5895   C CD2  . LEU A 1 155 ? -17.983 -6.875  -0.002  0.016 22.66 ? 153 LEU A CD2  2  
ATOM   5896   H H    . LEU A 1 155 ? -20.731 -10.919 -0.086  0.016 23.81 ? 153 LEU A H    2  
ATOM   5897   H HA   . LEU A 1 155 ? -19.928 -9.778  2.197   0.016 23.62 ? 153 LEU A HA   2  
ATOM   5898   H HB2  . LEU A 1 155 ? -18.572 -9.474  0.323   0.016 23.51 ? 153 LEU A HB2  2  
ATOM   5899   H HB3  . LEU A 1 155 ? -19.747 -8.684  -0.406  0.016 22.87 ? 153 LEU A HB3  2  
ATOM   5900   H HG   . LEU A 1 155 ? -19.543 -6.995  1.272   0.016 22.36 ? 153 LEU A HG   2  
ATOM   5901   H HD11 . LEU A 1 155 ? -17.563 -7.063  2.593   0.016 23.19 ? 153 LEU A HD11 2  
ATOM   5902   H HD12 . LEU A 1 155 ? -18.596 -8.186  3.004   0.016 23.39 ? 153 LEU A HD12 2  
ATOM   5903   H HD13 . LEU A 1 155 ? -17.335 -8.553  2.107   0.016 23.72 ? 153 LEU A HD13 2  
ATOM   5904   H HD21 . LEU A 1 155 ? -17.610 -6.064  0.382   0.016 22.58 ? 153 LEU A HD21 2  
ATOM   5905   H HD22 . LEU A 1 155 ? -17.270 -7.472  -0.283  0.016 23.10 ? 153 LEU A HD22 2  
ATOM   5906   H HD23 . LEU A 1 155 ? -18.547 -6.649  -0.758  0.016 22.39 ? 153 LEU A HD23 2  
ATOM   5907   N N    . LYS A 1 156 ? -21.563 -8.114  2.826   0.016 22.79 ? 154 LYS A N    2  
ATOM   5908   C CA   . LYS A 1 156 ? -22.622 -7.195  3.256   0.016 22.44 ? 154 LYS A CA   2  
ATOM   5909   C C    . LYS A 1 156 ? -22.024 -5.880  3.707   0.016 22.13 ? 154 LYS A C    2  
ATOM   5910   O O    . LYS A 1 156 ? -20.871 -5.801  4.099   0.016 22.39 ? 154 LYS A O    2  
ATOM   5911   C CB   . LYS A 1 156 ? -23.458 -7.685  4.473   0.016 23.02 ? 154 LYS A CB   2  
ATOM   5912   C CG   . LYS A 1 156 ? -24.230 -8.941  4.332   0.016 23.58 ? 154 LYS A CG   2  
ATOM   5913   C CD   . LYS A 1 156 ? -25.195 -8.950  3.166   0.016 23.31 ? 154 LYS A CD   2  
ATOM   5914   C CE   . LYS A 1 156 ? -25.472 -10.411 2.843   0.016 24.02 ? 154 LYS A CE   2  
ATOM   5915   N NZ   . LYS A 1 156 ? -25.989 -11.064 4.051   0.016 24.82 ? 154 LYS A NZ   2  
ATOM   5916   H H    . LYS A 1 156 ? -20.984 -8.280  3.437   0.016 23.10 ? 154 LYS A H    2  
ATOM   5917   H HA   . LYS A 1 156 ? -23.219 -7.015  2.518   0.016 22.16 ? 154 LYS A HA   2  
ATOM   5918   H HB2  . LYS A 1 156 ? -22.858 -7.796  5.227   0.016 23.37 ? 154 LYS A HB2  2  
ATOM   5919   H HB3  . LYS A 1 156 ? -24.098 -6.987  4.680   0.016 22.80 ? 154 LYS A HB3  2  
ATOM   5920   H HG2  . LYS A 1 156 ? -23.600 -9.668  4.200   0.016 23.87 ? 154 LYS A HG2  2  
ATOM   5921   H HG3  . LYS A 1 156 ? -24.733 -9.085  5.147   0.016 23.99 ? 154 LYS A HG3  2  
ATOM   5922   H HD2  . LYS A 1 156 ? -26.035 -8.532  3.417   0.016 23.30 ? 154 LYS A HD2  2  
ATOM   5923   H HD3  . LYS A 1 156 ? -24.802 -8.512  2.396   0.016 22.86 ? 154 LYS A HD3  2  
ATOM   5924   H HE2  . LYS A 1 156 ? -26.142 -10.483 2.145   0.016 24.02 ? 154 LYS A HE2  2  
ATOM   5925   H HE3  . LYS A 1 156 ? -24.649 -10.841 2.576   0.016 24.08 ? 154 LYS A HE3  2  
ATOM   5926   H HZ1  . LYS A 1 156 ? -25.455 -11.736 4.272   0.016 25.16 ? 154 LYS A HZ1  2  
ATOM   5927   H HZ2  . LYS A 1 156 ? -26.038 -10.491 4.724   0.016 24.73 ? 154 LYS A HZ2  2  
ATOM   5928   H HZ3  . LYS A 1 156 ? -26.802 -11.389 3.894   0.016 25.17 ? 154 LYS A HZ3  2  
ATOM   5929   N N    . GLY A 1 157 ? -22.821 -4.828  3.661   0.016 21.70 ? 155 GLY A N    2  
ATOM   5930   C CA   . GLY A 1 157 ? -22.409 -3.559  4.216   0.016 21.54 ? 155 GLY A CA   2  
ATOM   5931   C C    . GLY A 1 157 ? -23.550 -2.927  4.982   0.016 21.57 ? 155 GLY A C    2  
ATOM   5932   O O    . GLY A 1 157 ? -24.719 -3.178  4.698   0.016 21.50 ? 155 GLY A O    2  
ATOM   5933   H H    . GLY A 1 157 ? -23.605 -4.821  3.313   0.016 21.56 ? 155 GLY A H    2  
ATOM   5934   H HA2  . GLY A 1 157 ? -21.655 -3.688  4.810   0.016 21.90 ? 155 GLY A HA2  2  
ATOM   5935   H HA3  . GLY A 1 157 ? -22.143 -2.968  3.496   0.016 21.19 ? 155 GLY A HA3  2  
ATOM   5936   N N    . ASP A 1 158 ? -23.199 -2.114  5.961   0.016 21.84 ? 156 ASP A N    2  
ATOM   5937   C CA   . ASP A 1 158 ? -24.186 -1.369  6.720   0.016 22.01 ? 156 ASP A CA   2  
ATOM   5938   C C    . ASP A 1 158 ? -23.558 -0.017  7.058   0.016 22.00 ? 156 ASP A C    2  
ATOM   5939   O O    . ASP A 1 158 ? -22.385 0.053   7.431   0.016 22.37 ? 156 ASP A O    2  
ATOM   5940   C CB   . ASP A 1 158 ? -24.628 -2.125  7.995   0.016 22.90 ? 156 ASP A CB   2  
ATOM   5941   C CG   . ASP A 1 158 ? -25.619 -3.278  7.708   0.016 23.06 ? 156 ASP A CG   2  
ATOM   5942   O OD1  . ASP A 1 158 ? -26.140 -3.316  6.591   0.016 22.51 ? 156 ASP A OD1  2  
ATOM   5943   O OD2  . ASP A 1 158 ? -25.851 -4.152  8.599   0.016 23.91 ? 156 ASP A OD2  2  
ATOM   5944   H H    . ASP A 1 158 ? -22.389 -1.958  6.198   0.016 22.01 ? 156 ASP A H    2  
ATOM   5945   H HA   . ASP A 1 158 ? -24.963 -1.225  6.162   0.016 21.67 ? 156 ASP A HA   2  
ATOM   5946   H HB2  . ASP A 1 158 ? -23.845 -2.502  8.423   0.016 23.29 ? 156 ASP A HB2  2  
ATOM   5947   H HB3  . ASP A 1 158 ? -25.067 -1.506  8.597   0.016 23.15 ? 156 ASP A HB3  2  
ATOM   5948   N N    . VAL A 1 159 ? -24.303 1.066   6.867   0.016 21.68 ? 157 VAL A N    2  
ATOM   5949   C CA   . VAL A 1 159 ? -23.765 2.373   7.228   0.016 21.82 ? 157 VAL A CA   2  
ATOM   5950   C C    . VAL A 1 159 ? -24.916 3.228   7.737   0.016 21.97 ? 157 VAL A C    2  
ATOM   5951   O O    . VAL A 1 159 ? -26.036 3.186   7.215   0.016 21.63 ? 157 VAL A O    2  
ATOM   5952   C CB   . VAL A 1 159 ? -22.999 3.045   6.055   0.016 21.27 ? 157 VAL A CB   2  
ATOM   5953   C CG1  . VAL A 1 159 ? -23.837 3.162   4.854   0.016 20.61 ? 157 VAL A CG1  2  
ATOM   5954   C CG2  . VAL A 1 159 ? -22.477 4.383   6.483   0.016 21.60 ? 157 VAL A CG2  2  
ATOM   5955   H H    . VAL A 1 159 ? -25.097 1.076   6.537   0.016 21.46 ? 157 VAL A H    2  
ATOM   5956   H HA   . VAL A 1 159 ? -23.135 2.262   7.957   0.016 22.35 ? 157 VAL A HA   2  
ATOM   5957   H HB   . VAL A 1 159 ? -22.236 2.489   5.821   0.016 21.31 ? 157 VAL A HB   2  
ATOM   5958   H HG11 . VAL A 1 159 ? -23.282 3.473   4.121   0.016 20.39 ? 157 VAL A HG11 2  
ATOM   5959   H HG12 . VAL A 1 159 ? -24.205 2.290   4.633   0.016 20.53 ? 157 VAL A HG12 2  
ATOM   5960   H HG13 . VAL A 1 159 ? -24.550 3.795   5.026   0.016 20.59 ? 157 VAL A HG13 2  
ATOM   5961   H HG21 . VAL A 1 159 ? -21.576 4.490   6.147   0.016 21.66 ? 157 VAL A HG21 2  
ATOM   5962   H HG22 . VAL A 1 159 ? -23.042 5.078   6.119   0.016 21.32 ? 157 VAL A HG22 2  
ATOM   5963   H HG23 . VAL A 1 159 ? -22.478 4.430   7.452   0.016 22.14 ? 157 VAL A HG23 2  
ATOM   5964   N N    . GLU A 1 160 ? -24.655 3.938   8.819   0.016 22.68 ? 158 GLU A N    2  
ATOM   5965   C CA   . GLU A 1 160 ? -25.626 4.853   9.380   0.016 23.03 ? 158 GLU A CA   2  
ATOM   5966   C C    . GLU A 1 160 ? -25.343 6.222   8.764   0.016 22.67 ? 158 GLU A C    2  
ATOM   5967   O O    . GLU A 1 160 ? -24.343 6.848   9.079   0.016 23.03 ? 158 GLU A O    2  
ATOM   5968   C CB   . GLU A 1 160 ? -25.517 4.819   10.897  0.016 24.22 ? 158 GLU A CB   2  
ATOM   5969   C CG   . GLU A 1 160 ? -25.480 3.354   11.485  0.016 24.74 ? 158 GLU A CG   2  
ATOM   5970   C CD   . GLU A 1 160 ? -26.770 2.972   12.086  0.016 25.30 ? 158 GLU A CD   2  
ATOM   5971   O OE1  . GLU A 1 160 ? -26.934 3.231   13.297  0.016 26.47 ? 158 GLU A OE1  2  
ATOM   5972   O OE2  . GLU A 1 160 ? -27.630 2.456   11.347  0.016 24.72 ? 158 GLU A OE2  2  
ATOM   5973   H H    . GLU A 1 160 ? -23.918 3.902   9.260   0.016 23.07 ? 158 GLU A H    2  
ATOM   5974   H HA   . GLU A 1 160 ? -26.523 4.583   9.137   0.016 22.83 ? 158 GLU A HA   2  
ATOM   5975   H HB2  . GLU A 1 160 ? -24.708 5.277   11.167  0.016 24.53 ? 158 GLU A HB2  2  
ATOM   5976   H HB3  . GLU A 1 160 ? -26.291 5.268   11.267  0.016 24.52 ? 158 GLU A HB3  2  
ATOM   5977   H HG2  . GLU A 1 160 ? -25.294 2.707   10.786  0.016 24.19 ? 158 GLU A HG2  2  
ATOM   5978   H HG3  . GLU A 1 160 ? -24.800 3.287   12.177  0.016 25.42 ? 158 GLU A HG3  2  
ATOM   5979   N N    . MET A 1 161 ? -26.195 6.647   7.836   0.016 22.06 ? 159 MET A N    2  
ATOM   5980   C CA   . MET A 1 161 ? -25.967 7.853   7.056   0.016 21.71 ? 159 MET A CA   2  
ATOM   5981   C C    . MET A 1 161 ? -26.791 9.008   7.619   0.016 22.13 ? 159 MET A C    2  
ATOM   5982   O O    . MET A 1 161 ? -27.749 8.813   8.368   0.016 22.62 ? 159 MET A O    2  
ATOM   5983   C CB   . MET A 1 161 ? -26.316 7.604   5.607   0.016 20.91 ? 159 MET A CB   2  
ATOM   5984   C CG   . MET A 1 161 ? -25.481 6.443   5.047   0.016 20.59 ? 159 MET A CG   2  
ATOM   5985   S SD   . MET A 1 161 ? -23.856 7.135   4.610   0.016 20.68 ? 159 MET A SD   2  
ATOM   5986   C CE   . MET A 1 161 ? -24.341 8.071   3.122   0.016 20.28 ? 159 MET A CE   2  
ATOM   5987   H H    . MET A 1 161 ? -26.931 6.251   7.642   0.016 21.94 ? 159 MET A H    2  
ATOM   5988   H HA   . MET A 1 161 ? -25.030 8.078   7.092   0.016 21.87 ? 159 MET A HA   2  
ATOM   5989   H HB2  . MET A 1 161 ? -27.254 7.394   5.515   0.016 20.86 ? 159 MET A HB2  2  
ATOM   5990   H HB3  . MET A 1 161 ? -26.103 8.391   5.096   0.016 20.79 ? 159 MET A HB3  2  
ATOM   5991   H HG2  . MET A 1 161 ? -25.390 5.724   5.690   0.016 20.85 ? 159 MET A HG2  2  
ATOM   5992   H HG3  . MET A 1 161 ? -25.883 6.124   4.233   0.016 20.23 ? 159 MET A HG3  2  
ATOM   5993   H HE1  . MET A 1 161 ? -23.950 7.703   2.319   0.016 20.06 ? 159 MET A HE1  2  
ATOM   5994   H HE2  . MET A 1 161 ? -25.308 8.087   3.055   0.016 20.15 ? 159 MET A HE2  2  
ATOM   5995   H HE3  . MET A 1 161 ? -24.026 8.981   3.239   0.016 20.54 ? 159 MET A HE3  2  
ATOM   5996   N N    . ALA A 1 162 ? -26.447 10.221  7.177   0.016 22.11 ? 160 ALA A N    2  
ATOM   5997   C CA   . ALA A 1 162 ? -27.235 11.388  7.547   0.016 22.55 ? 160 ALA A CA   2  
ATOM   5998   C C    . ALA A 1 162 ? -27.008 12.500  6.537   0.016 22.28 ? 160 ALA A C    2  
ATOM   5999   O O    . ALA A 1 162 ? -25.881 12.737  6.113   0.016 22.23 ? 160 ALA A O    2  
ATOM   6000   C CB   . ALA A 1 162 ? -26.859 11.890  8.942   0.016 23.62 ? 160 ALA A CB   2  
ATOM   6001   H H    . ALA A 1 162 ? -25.791 10.384  6.648   0.016 21.91 ? 160 ALA A H    2  
ATOM   6002   H HA   . ALA A 1 162 ? -28.175 11.163  7.536   0.016 22.50 ? 160 ALA A HA   2  
ATOM   6003   H HB1  . ALA A 1 162 ? -25.897 11.997  8.991   0.016 23.76 ? 160 ALA A HB1  2  
ATOM   6004   H HB2  . ALA A 1 162 ? -27.283 12.746  9.091   0.016 23.94 ? 160 ALA A HB2  2  
ATOM   6005   H HB3  . ALA A 1 162 ? -27.161 11.251  9.604   0.016 23.94 ? 160 ALA A HB3  2  
ATOM   6006   N N    . LEU A 1 163 ? -28.092 13.164  6.163   0.016 22.23 ? 161 LEU A N    2  
ATOM   6007   C CA   . LEU A 1 163 ? -28.036 14.363  5.340   0.016 22.21 ? 161 LEU A CA   2  
ATOM   6008   C C    . LEU A 1 163 ? -28.119 15.579  6.245   0.016 23.08 ? 161 LEU A C    2  
ATOM   6009   O O    . LEU A 1 163 ? -28.922 15.620  7.178   0.016 23.61 ? 161 LEU A O    2  
ATOM   6010   C CB   . LEU A 1 163 ? -29.182 14.380  4.322   0.016 21.81 ? 161 LEU A CB   2  
ATOM   6011   C CG   . LEU A 1 163 ? -28.827 13.580  3.074   0.016 21.13 ? 161 LEU A CG   2  
ATOM   6012   C CD1  . LEU A 1 163 ? -30.003 13.381  2.145   0.016 20.93 ? 161 LEU A CD1  2  
ATOM   6013   C CD2  . LEU A 1 163 ? -27.728 14.261  2.314   0.016 21.14 ? 161 LEU A CD2  2  
ATOM   6014   H H    . LEU A 1 163 ? -28.889 12.945  6.380   0.016 22.29 ? 161 LEU A H    2  
ATOM   6015   H HA   . LEU A 1 163 ? -27.190 14.397  4.874   0.016 22.05 ? 161 LEU A HA   2  
ATOM   6016   H HB2  . LEU A 1 163 ? -29.976 13.997  4.722   0.016 21.91 ? 161 LEU A HB2  2  
ATOM   6017   H HB3  . LEU A 1 163 ? -29.367 15.289  4.041   0.016 22.02 ? 161 LEU A HB3  2  
ATOM   6018   H HG   . LEU A 1 163 ? -28.505 12.711  3.352   0.016 20.97 ? 161 LEU A HG   2  
ATOM   6019   H HD11 . LEU A 1 163 ? -30.267 14.238  1.769   0.016 21.13 ? 161 LEU A HD11 2  
ATOM   6020   H HD12 . LEU A 1 163 ? -29.738 12.782  1.430   0.016 20.61 ? 161 LEU A HD12 2  
ATOM   6021   H HD13 . LEU A 1 163 ? -30.738 12.999  2.648   0.016 21.04 ? 161 LEU A HD13 2  
ATOM   6022   H HD21 . LEU A 1 163 ? -27.942 14.235  1.373   0.016 20.95 ? 161 LEU A HD21 2  
ATOM   6023   H HD22 . LEU A 1 163 ? -27.675 15.185  2.604   0.016 21.53 ? 161 LEU A HD22 2  
ATOM   6024   H HD23 . LEU A 1 163 ? -26.885 13.823  2.495   0.016 21.06 ? 161 LEU A HD23 2  
ATOM   6025   N N    . LEU A 1 164 ? -27.230 16.535  6.002   0.016 23.39 ? 162 LEU A N    2  
ATOM   6026   C CA   . LEU A 1 164 ? -27.358 17.822  6.662   0.016 24.30 ? 162 LEU A CA   2  
ATOM   6027   C C    . LEU A 1 164 ? -28.451 18.616  5.987   0.016 24.24 ? 162 LEU A C    2  
ATOM   6028   O O    . LEU A 1 164 ? -28.613 18.570  4.773   0.016 23.65 ? 162 LEU A O    2  
ATOM   6029   C CB   . LEU A 1 164 ? -26.029 18.564  6.589   0.016 24.81 ? 162 LEU A CB   2  
ATOM   6030   C CG   . LEU A 1 164 ? -24.922 18.048  7.489   0.016 25.29 ? 162 LEU A CG   2  
ATOM   6031   C CD1  . LEU A 1 164 ? -23.784 19.081  7.591   0.016 26.24 ? 162 LEU A CD1  2  
ATOM   6032   C CD2  . LEU A 1 164 ? -25.444 17.716  8.878   0.016 25.92 ? 162 LEU A CD2  2  
ATOM   6033   H H    . LEU A 1 164 ? -26.568 16.474  5.464   0.016 23.18 ? 162 LEU A H    2  
ATOM   6034   H HA   . LEU A 1 164 ? -27.622 17.697  7.584   0.016 24.77 ? 162 LEU A HA   2  
ATOM   6035   H HB2  . LEU A 1 164 ? -25.711 18.533  5.675   0.016 24.38 ? 162 LEU A HB2  2  
ATOM   6036   H HB3  . LEU A 1 164 ? -26.199 19.486  6.846   0.016 25.41 ? 162 LEU A HB3  2  
ATOM   6037   H HG   . LEU A 1 164 ? -24.556 17.241  7.101   0.016 24.75 ? 162 LEU A HG   2  
ATOM   6038   H HD11 . LEU A 1 164 ? -23.500 19.149  8.514   0.016 27.00 ? 162 LEU A HD11 2  
ATOM   6039   H HD12 . LEU A 1 164 ? -23.045 18.785  7.038   0.016 26.02 ? 162 LEU A HD12 2  
ATOM   6040   H HD13 . LEU A 1 164 ? -24.097 19.949  7.287   0.016 26.41 ? 162 LEU A HD13 2  
ATOM   6041   H HD21 . LEU A 1 164 ? -25.994 18.450  9.192   0.016 26.38 ? 162 LEU A HD21 2  
ATOM   6042   H HD22 . LEU A 1 164 ? -25.966 16.903  8.841   0.016 25.40 ? 162 LEU A HD22 2  
ATOM   6043   H HD23 . LEU A 1 164 ? -24.693 17.589  9.475   0.016 26.49 ? 162 LEU A HD23 2  
ATOM   6044   N N    . LEU A 1 165 ? -29.189 19.379  6.786   0.016 25.02 ? 163 LEU A N    2  
ATOM   6045   C CA   . LEU A 1 165 ? -30.340 20.123  6.305   0.016 25.15 ? 163 LEU A CA   2  
ATOM   6046   C C    . LEU A 1 165 ? -30.108 21.616  6.394   0.016 26.01 ? 163 LEU A C    2  
ATOM   6047   O O    . LEU A 1 165 ? -29.383 22.099  7.248   0.016 26.79 ? 163 LEU A O    2  
ATOM   6048   C CB   . LEU A 1 165 ? -31.581 19.842  7.120   0.016 25.55 ? 163 LEU A CB   2  
ATOM   6049   C CG   . LEU A 1 165 ? -32.087 18.399  7.046   0.016 24.90 ? 163 LEU A CG   2  
ATOM   6050   C CD1  . LEU A 1 165 ? -33.405 18.313  7.722   0.016 25.52 ? 163 LEU A CD1  2  
ATOM   6051   C CD2  . LEU A 1 165 ? -32.197 17.957  5.591   0.016 23.97 ? 163 LEU A CD2  2  
ATOM   6052   H H    . LEU A 1 165 ? -29.039 19.465  7.625   0.016 25.57 ? 163 LEU A H    2  
ATOM   6053   H HA   . LEU A 1 165 ? -30.520 19.917  5.379   0.016 24.59 ? 163 LEU A HA   2  
ATOM   6054   H HB2  . LEU A 1 165 ? -31.396 20.043  8.049   0.016 26.21 ? 163 LEU A HB2  2  
ATOM   6055   H HB3  . LEU A 1 165 ? -32.286 20.416  6.788   0.016 25.73 ? 163 LEU A HB3  2  
ATOM   6056   H HG   . LEU A 1 165 ? -31.459 17.819  7.503   0.016 24.84 ? 163 LEU A HG   2  
ATOM   6057   H HD11 . LEU A 1 165 ? -34.041 17.878  7.134   0.016 25.15 ? 163 LEU A HD11 2  
ATOM   6058   H HD12 . LEU A 1 165 ? -33.300 17.807  8.542   0.016 25.83 ? 163 LEU A HD12 2  
ATOM   6059   H HD13 . LEU A 1 165 ? -33.717 19.208  7.928   0.016 26.11 ? 163 LEU A HD13 2  
ATOM   6060   H HD21 . LEU A 1 165 ? -32.731 17.152  5.536   0.016 23.72 ? 163 LEU A HD21 2  
ATOM   6061   H HD22 . LEU A 1 165 ? -32.615 18.664  5.076   0.016 24.11 ? 163 LEU A HD22 2  
ATOM   6062   H HD23 . LEU A 1 165 ? -31.306 17.784  5.249   0.016 23.62 ? 163 LEU A HD23 2  
ATOM   6063   N N    . GLU A 1 166 ? -30.797 22.341  5.560   0.016 26.03 ? 164 GLU A N    2  
ATOM   6064   C CA   . GLU A 1 166 ? -30.750 23.766  5.777   0.016 27.01 ? 164 GLU A CA   2  
ATOM   6065   C C    . GLU A 1 166 ? -31.305 24.136  7.139   0.016 28.01 ? 164 GLU A C    2  
ATOM   6066   O O    . GLU A 1 166 ? -32.275 23.545  7.629   0.016 28.01 ? 164 GLU A O    2  
ATOM   6067   C CB   . GLU A 1 166 ? -31.483 24.485  4.717   0.016 27.03 ? 164 GLU A CB   2  
ATOM   6068   C CG   . GLU A 1 166 ? -30.964 26.018  4.713   0.016 28.09 ? 164 GLU A CG   2  
ATOM   6069   C CD   . GLU A 1 166 ? -29.439 26.526  5.282   0.016 28.77 ? 164 GLU A CD   2  
ATOM   6070   O OE1  . GLU A 1 166 ? -29.191 26.927  6.453   0.016 29.70 ? 164 GLU A OE1  2  
ATOM   6071   O OE2  . GLU A 1 166 ? -28.476 26.607  4.514   0.016 28.61 ? 164 GLU A OE2  2  
ATOM   6072   H H    . GLU A 1 166 ? -31.261 22.074  4.891   0.016 25.59 ? 164 GLU A H    2  
ATOM   6073   H HA   . GLU A 1 166 ? -29.824 24.041  5.741   0.016 27.18 ? 164 GLU A HA   2  
ATOM   6074   H HB2  . GLU A 1 166 ? -31.313 24.096  3.846   0.016 26.43 ? 164 GLU A HB2  2  
ATOM   6075   H HB3  . GLU A 1 166 ? -32.425 24.463  4.916   0.016 27.17 ? 164 GLU A HB3  2  
ATOM   6076   H HG2  . GLU A 1 166 ? -30.924 26.175  3.761   0.016 27.84 ? 164 GLU A HG2  2  
ATOM   6077   H HG3  . GLU A 1 166 ? -31.651 26.553  5.141   0.016 28.68 ? 164 GLU A HG3  2  
ATOM   6078   N N    . GLY A 1 167 ? -30.680 25.132  7.748   0.016 29.05 ? 165 GLY A N    2  
ATOM   6079   C CA   . GLY A 1 167 ? -30.973 25.475  9.117   0.016 30.24 ? 165 GLY A CA   2  
ATOM   6080   C C    . GLY A 1 167 ? -30.106 24.795  10.150  0.016 30.59 ? 165 GLY A C    2  
ATOM   6081   O O    . GLY A 1 167 ? -30.072 25.243  11.292  0.016 31.88 ? 165 GLY A O    2  
ATOM   6082   H H    . GLY A 1 167 ? -30.070 25.612  7.390   0.016 29.18 ? 165 GLY A H    2  
ATOM   6083   H HA2  . GLY A 1 167 ? -30.864 26.433  9.226   0.016 31.02 ? 165 GLY A HA2  2  
ATOM   6084   H HA3  . GLY A 1 167 ? -31.897 25.252  9.310   0.016 30.26 ? 165 GLY A HA3  2  
ATOM   6085   N N    . GLY A 1 168 ? -29.438 23.701  9.817   0.016 29.62 ? 166 GLY A N    2  
ATOM   6086   C CA   . GLY A 1 168 ? -28.461 23.134  10.722  0.016 30.08 ? 166 GLY A CA   2  
ATOM   6087   C C    . GLY A 1 168 ? -28.811 21.775  11.269  0.016 29.63 ? 166 GLY A C    2  
ATOM   6088   O O    . GLY A 1 168 ? -27.957 21.168  11.924  0.016 29.93 ? 166 GLY A O    2  
ATOM   6089   H H    . GLY A 1 168 ? -29.535 23.259  9.082   0.016 28.76 ? 166 GLY A H    2  
ATOM   6090   H HA2  . GLY A 1 168 ? -27.611 23.065  10.263  0.016 29.80 ? 166 GLY A HA2  2  
ATOM   6091   H HA3  . GLY A 1 168 ? -28.335 23.724  11.479  0.016 31.16 ? 166 GLY A HA3  2  
ATOM   6092   N N    . GLY A 1 169 ? -30.037 21.300  11.063  0.016 29.10 ? 167 GLY A N    2  
ATOM   6093   C CA   . GLY A 1 169 ? -30.423 19.969  11.484  0.016 28.76 ? 167 GLY A CA   2  
ATOM   6094   C C    . GLY A 1 169 ? -29.830 18.844  10.634  0.016 27.45 ? 167 GLY A C    2  
ATOM   6095   O O    . GLY A 1 169 ? -29.021 19.038  9.723   0.016 26.81 ? 167 GLY A O    2  
ATOM   6096   H H    . GLY A 1 169 ? -30.669 21.737  10.681  0.016 29.03 ? 167 GLY A H    2  
ATOM   6097   H HA2  . GLY A 1 169 ? -30.146 19.831  12.403  0.016 29.54 ? 167 GLY A HA2  2  
ATOM   6098   H HA3  . GLY A 1 169 ? -31.388 19.891  11.447  0.016 28.73 ? 167 GLY A HA3  2  
ATOM   6099   N N    . HIS A 1 170 ? -30.288 17.643  10.950  0.016 27.18 ? 168 HIS A N    2  
ATOM   6100   C CA   . HIS A 1 170 ? -29.829 16.434  10.295  0.016 26.11 ? 168 HIS A CA   2  
ATOM   6101   C C    . HIS A 1 170 ? -31.018 15.514  10.034  0.016 25.67 ? 168 HIS A C    2  
ATOM   6102   O O    . HIS A 1 170 ? -32.073 15.619  10.652  0.016 26.37 ? 168 HIS A O    2  
ATOM   6103   C CB   . HIS A 1 170 ? -28.767 15.701  11.130  0.016 26.51 ? 168 HIS A CB   2  
ATOM   6104   C CG   . HIS A 1 170 ? -29.091 15.624  12.591  0.016 27.83 ? 168 HIS A CG   2  
ATOM   6105   N ND1  . HIS A 1 170 ? -29.319 14.432  13.240  0.016 28.06 ? 168 HIS A ND1  2  
ATOM   6106   C CD2  . HIS A 1 170 ? -29.233 16.591  13.526  0.016 29.16 ? 168 HIS A CD2  2  
ATOM   6107   C CE1  . HIS A 1 170 ? -29.579 14.664  14.511  0.016 29.51 ? 168 HIS A CE1  2  
ATOM   6108   N NE2  . HIS A 1 170 ? -29.544 15.971  14.713  0.016 30.21 ? 168 HIS A NE2  2  
ATOM   6109   H H    . HIS A 1 170 ? -30.878 17.500  11.556  0.016 27.70 ? 168 HIS A H    2  
ATOM   6110   H HA   . HIS A 1 170 ? -29.437 16.664  9.440   0.016 25.52 ? 168 HIS A HA   2  
ATOM   6111   H HB2  . HIS A 1 170 ? -28.694 14.792  10.804  0.016 25.90 ? 168 HIS A HB2  2  
ATOM   6112   H HB3  . HIS A 1 170 ? -27.917 16.152  11.021  0.016 26.62 ? 168 HIS A HB3  2  
ATOM   6113   H HD1  . HIS A 1 170 ? -29.288 13.654  12.875  0.016 27.45 ? 168 HIS A HD1  2  
ATOM   6114   H HD2  . HIS A 1 170 ? -29.151 17.502  13.389  0.016 29.41 ? 168 HIS A HD2  2  
ATOM   6115   H HE1  . HIS A 1 170 ? -29.762 14.019  15.149  0.016 30.03 ? 168 HIS A HE1  2  
ATOM   6116   H HE2  . HIS A 1 170 ? -29.680 16.365  15.464  0.016 31.24 ? 168 HIS A HE2  2  
ATOM   6117   N N    . TYR A 1 171 ? -30.829 14.623  9.072   0.016 24.63 ? 169 TYR A N    2  
ATOM   6118   C CA   . TYR A 1 171 ? -31.909 13.784  8.557   0.016 24.20 ? 169 TYR A CA   2  
ATOM   6119   C C    . TYR A 1 171 ? -31.295 12.427  8.277   0.016 23.56 ? 169 TYR A C    2  
ATOM   6120   O O    . TYR A 1 171 ? -30.492 12.299  7.360   0.016 22.83 ? 169 TYR A O    2  
ATOM   6121   C CB   . TYR A 1 171 ? -32.487 14.388  7.280   0.016 23.68 ? 169 TYR A CB   2  
ATOM   6122   C CG   . TYR A 1 171 ? -33.537 13.581  6.508   0.016 23.31 ? 169 TYR A CG   2  
ATOM   6123   C CD1  . TYR A 1 171 ? -34.727 13.203  7.071   0.016 23.93 ? 169 TYR A CD1  2  
ATOM   6124   C CD2  . TYR A 1 171 ? -33.336 13.294  5.175   0.016 22.55 ? 169 TYR A CD2  2  
ATOM   6125   C CE1  . TYR A 1 171 ? -35.668 12.511  6.320   0.016 23.76 ? 169 TYR A CE1  2  
ATOM   6126   C CE2  . TYR A 1 171 ? -34.263 12.605  4.434   0.016 22.40 ? 169 TYR A CE2  2  
ATOM   6127   C CZ   . TYR A 1 171 ? -35.404 12.215  5.004   0.016 22.99 ? 169 TYR A CZ   2  
ATOM   6128   O OH   . TYR A 1 171 ? -36.297 11.560  4.196   0.016 22.98 ? 169 TYR A OH   2  
ATOM   6129   H H    . TYR A 1 171 ? -30.070 14.483  8.696   0.016 24.24 ? 169 TYR A H    2  
ATOM   6130   H HA   . TYR A 1 171 ? -32.610 13.698  9.218   0.016 24.79 ? 169 TYR A HA   2  
ATOM   6131   H HB2  . TYR A 1 171 ? -32.882 15.243  7.510   0.016 24.16 ? 169 TYR A HB2  2  
ATOM   6132   H HB3  . TYR A 1 171 ? -31.754 14.526  6.665   0.016 23.22 ? 169 TYR A HB3  2  
ATOM   6133   H HD1  . TYR A 1 171 ? -34.894 13.400  7.963   0.016 24.56 ? 169 TYR A HD1  2  
ATOM   6134   H HD2  . TYR A 1 171 ? -32.541 13.553  4.772   0.016 22.23 ? 169 TYR A HD2  2  
ATOM   6135   H HE1  . TYR A 1 171 ? -36.468 12.242  6.706   0.016 24.28 ? 169 TYR A HE1  2  
ATOM   6136   H HE2  . TYR A 1 171 ? -34.099 12.410  3.539   0.016 22.00 ? 169 TYR A HE2  2  
ATOM   6137   H HH   . TYR A 1 171 ? -36.030 11.581  3.402   0.016 22.60 ? 169 TYR A HH   2  
ATOM   6138   N N    . ARG A 1 172 ? -31.692 11.411  9.045   0.016 23.96 ? 170 ARG A N    2  
ATOM   6139   C CA   . ARG A 1 172 ? -30.956 10.151  9.074   0.016 23.62 ? 170 ARG A CA   2  
ATOM   6140   C C    . ARG A 1 172 ? -31.509 9.092   8.131   0.016 22.97 ? 170 ARG A C    2  
ATOM   6141   O O    . ARG A 1 172 ? -32.690 9.078   7.774   0.016 23.06 ? 170 ARG A O    2  
ATOM   6142   C CB   . ARG A 1 172 ? -30.956 9.575   10.480  0.016 24.62 ? 170 ARG A CB   2  
ATOM   6143   C CG   . ARG A 1 172 ? -30.178 10.409  11.451  0.016 25.44 ? 170 ARG A CG   2  
ATOM   6144   C CD   . ARG A 1 172 ? -29.910 9.641   12.685  0.016 26.43 ? 170 ARG A CD   2  
ATOM   6145   N NE   . ARG A 1 172 ? -29.234 10.433  13.693  0.016 27.50 ? 170 ARG A NE   2  
ATOM   6146   C CZ   . ARG A 1 172 ? -27.941 10.439  13.950  0.016 27.73 ? 170 ARG A CZ   2  
ATOM   6147   N NH1  . ARG A 1 172 ? -27.114 9.690   13.253  0.016 26.88 ? 170 ARG A NH1  2  
ATOM   6148   N NH2  . ARG A 1 172 ? -27.481 11.211  14.925  0.016 28.97 ? 170 ARG A NH2  2  
ATOM   6149   H H    . ARG A 1 172 ? -32.387 11.428  9.548   0.016 24.49 ? 170 ARG A H    2  
ATOM   6150   H HA   . ARG A 1 172 ? -30.040 10.326  8.818   0.016 23.32 ? 170 ARG A HA   2  
ATOM   6151   H HB2  . ARG A 1 172 ? -31.867 9.523   10.794  0.016 25.07 ? 170 ARG A HB2  2  
ATOM   6152   H HB3  . ARG A 1 172 ? -30.557 8.692   10.460  0.016 24.43 ? 170 ARG A HB3  2  
ATOM   6153   H HG2  . ARG A 1 172 ? -29.331 10.661  11.056  0.016 25.04 ? 170 ARG A HG2  2  
ATOM   6154   H HG3  . ARG A 1 172 ? -30.688 11.196  11.689  0.016 25.86 ? 170 ARG A HG3  2  
ATOM   6155   H HD2  . ARG A 1 172 ? -30.758 9.358   13.055  0.016 26.89 ? 170 ARG A HD2  2  
ATOM   6156   H HD3  . ARG A 1 172 ? -29.371 8.860   12.481  0.016 26.07 ? 170 ARG A HD3  2  
ATOM   6157   H HE   . ARG A 1 172 ? -29.736 10.841  14.259  0.016 28.22 ? 170 ARG A HE   2  
ATOM   6158   H HH11 . ARG A 1 172 ? -27.408 9.182   12.624  0.016 26.17 ? 170 ARG A HH11 2  
ATOM   6159   H HH12 . ARG A 1 172 ? -26.272 9.707   13.435  0.016 27.13 ? 170 ARG A HH12 2  
ATOM   6160   H HH21 . ARG A 1 172 ? -28.022 11.702  15.375  0.016 29.59 ? 170 ARG A HH21 2  
ATOM   6161   H HH22 . ARG A 1 172 ? -26.640 11.230  15.097  0.016 29.23 ? 170 ARG A HH22 2  
ATOM   6162   N N    . CYS A 1 173 ? -30.610 8.216   7.720   0.016 22.46 ? 171 CYS A N    2  
ATOM   6163   C CA   . CYS A 1 173 ? -30.957 7.141   6.817   0.016 21.95 ? 171 CYS A CA   2  
ATOM   6164   C C    . CYS A 1 173 ? -30.063 5.961   7.140   0.016 21.93 ? 171 CYS A C    2  
ATOM   6165   O O    . CYS A 1 173 ? -28.858 6.113   7.349   0.016 21.88 ? 171 CYS A O    2  
ATOM   6166   C CB   . CYS A 1 173 ? -30.801 7.597   5.367   0.016 21.22 ? 171 CYS A CB   2  
ATOM   6167   S SG   . CYS A 1 173 ? -31.287 6.311   4.176   0.016 20.83 ? 171 CYS A SG   2  
ATOM   6168   H H    . CYS A 1 173 ? -29.783 8.222   7.955   0.016 22.46 ? 171 CYS A H    2  
ATOM   6169   H HA   . CYS A 1 173 ? -31.881 6.871   6.965   0.016 22.26 ? 171 CYS A HA   2  
ATOM   6170   H HB2  . CYS A 1 173 ? -31.348 8.371   5.223   0.016 21.33 ? 171 CYS A HB2  2  
ATOM   6171   H HB3  . CYS A 1 173 ? -29.870 7.821   5.210   0.016 20.99 ? 171 CYS A HB3  2  
ATOM   6172   H HG   . CYS A 1 173 ? -30.658 5.332   4.464   0.016 20.80 ? 171 CYS A HG   2  
ATOM   6173   N N    . ASP A 1 174 ? -30.668 4.779   7.189   0.016 22.11 ? 172 ASP A N    2  
ATOM   6174   C CA   . ASP A 1 174 ? -29.913 3.564   7.451   0.016 22.18 ? 172 ASP A CA   2  
ATOM   6175   C C    . ASP A 1 174 ? -29.748 2.827   6.124   0.016 21.50 ? 172 ASP A C    2  
ATOM   6176   O O    . ASP A 1 174 ? -30.741 2.546   5.446   0.016 21.46 ? 172 ASP A O    2  
ATOM   6177   C CB   . ASP A 1 174 ? -30.673 2.756   8.499   0.016 23.09 ? 172 ASP A CB   2  
ATOM   6178   C CG   . ASP A 1 174 ? -31.331 3.648   9.544   0.016 23.92 ? 172 ASP A CG   2  
ATOM   6179   O OD1  . ASP A 1 174 ? -31.052 4.902   9.570   0.016 23.80 ? 172 ASP A OD1  2  
ATOM   6180   O OD2  . ASP A 1 174 ? -32.137 3.094   10.324  0.016 24.81 ? 172 ASP A OD2  2  
ATOM   6181   H H    . ASP A 1 174 ? -31.506 4.656   7.068   0.016 22.27 ? 172 ASP A H    2  
ATOM   6182   H HA   . ASP A 1 174 ? -29.038 3.777   7.800   0.016 22.21 ? 172 ASP A HA   2  
ATOM   6183   H HB2  . ASP A 1 174 ? -31.382 2.273   8.051   0.016 23.07 ? 172 ASP A HB2  2  
ATOM   6184   H HB3  . ASP A 1 174 ? -30.073 2.134   8.943   0.016 23.31 ? 172 ASP A HB3  2  
ATOM   6185   N N    . PHE A 1 175 ? -28.497 2.542   5.735   0.016 21.12 ? 173 PHE A N    2  
ATOM   6186   C CA   . PHE A 1 175 ? -28.190 1.881   4.472   0.016 20.63 ? 173 PHE A CA   2  
ATOM   6187   C C    . PHE A 1 175 ? -27.824 0.428   4.753   0.016 20.92 ? 173 PHE A C    2  
ATOM   6188   O O    . PHE A 1 175 ? -27.112 0.149   5.718   0.016 21.30 ? 173 PHE A O    2  
ATOM   6189   C CB   . PHE A 1 175 ? -27.006 2.539   3.754   0.016 20.18 ? 173 PHE A CB   2  
ATOM   6190   C CG   . PHE A 1 175 ? -27.363 3.749   2.873   0.016 19.85 ? 173 PHE A CG   2  
ATOM   6191   C CD1  . PHE A 1 175 ? -28.140 4.781   3.332   0.016 20.01 ? 173 PHE A CD1  2  
ATOM   6192   C CD2  . PHE A 1 175 ? -26.899 3.826   1.567   0.016 19.54 ? 173 PHE A CD2  2  
ATOM   6193   C CE1  . PHE A 1 175 ? -28.455 5.877   2.507   0.016 19.81 ? 173 PHE A CE1  2  
ATOM   6194   C CE2  . PHE A 1 175 ? -27.207 4.914   0.742   0.016 19.40 ? 173 PHE A CE2  2  
ATOM   6195   C CZ   . PHE A 1 175 ? -27.984 5.925   1.213   0.016 19.52 ? 173 PHE A CZ   2  
ATOM   6196   H H    . PHE A 1 175 ? -27.800 2.726   6.198   0.016 21.24 ? 173 PHE A H    2  
ATOM   6197   H HA   . PHE A 1 175 ? -28.964 1.900   3.887   0.016 20.54 ? 173 PHE A HA   2  
ATOM   6198   H HB2  . PHE A 1 175 ? -26.374 2.816   4.427   0.016 20.37 ? 173 PHE A HB2  2  
ATOM   6199   H HB3  . PHE A 1 175 ? -26.589 1.876   3.183   0.016 20.05 ? 173 PHE A HB3  2  
ATOM   6200   H HD1  . PHE A 1 175 ? -28.467 4.751   4.203   0.016 20.33 ? 173 PHE A HD1  2  
ATOM   6201   H HD2  . PHE A 1 175 ? -26.369 3.138   1.233   0.016 19.51 ? 173 PHE A HD2  2  
ATOM   6202   H HE1  . PHE A 1 175 ? -28.982 6.564   2.834   0.016 19.97 ? 173 PHE A HE1  2  
ATOM   6203   H HE2  . PHE A 1 175 ? -26.887 4.946   -0.129  0.016 19.32 ? 173 PHE A HE2  2  
ATOM   6204   H HZ   . PHE A 1 175 ? -28.187 6.649   0.669   0.016 19.49 ? 173 PHE A HZ   2  
ATOM   6205   N N    . LYS A 1 176 ? -28.341 -0.479  3.932   0.016 20.89 ? 174 LYS A N    2  
ATOM   6206   C CA   . LYS A 1 176 ? -28.014 -1.900  3.992   0.016 21.20 ? 174 LYS A CA   2  
ATOM   6207   C C    . LYS A 1 176 ? -27.720 -2.335  2.564   0.016 20.87 ? 174 LYS A C    2  
ATOM   6208   O O    . LYS A 1 176 ? -28.602 -2.216  1.714   0.016 20.83 ? 174 LYS A O    2  
ATOM   6209   C CB   . LYS A 1 176 ? -29.190 -2.749  4.533   0.016 21.89 ? 174 LYS A CB   2  
ATOM   6210   C CG   . LYS A 1 176 ? -29.804 -2.389  5.910   0.016 22.52 ? 174 LYS A CG   2  
ATOM   6211   C CD   . LYS A 1 176 ? -28.802 -2.664  6.975   0.016 22.88 ? 174 LYS A CD   2  
ATOM   6212   C CE   . LYS A 1 176 ? -29.408 -3.046  8.337   0.016 23.95 ? 174 LYS A CE   2  
ATOM   6213   N NZ   . LYS A 1 176 ? -29.882 -1.947  9.255   0.016 24.39 ? 174 LYS A NZ   2  
ATOM   6214   H H    . LYS A 1 176 ? -28.902 -0.298  3.312   0.016 20.77 ? 174 LYS A H    2  
ATOM   6215   H HA   . LYS A 1 176 ? -27.239 -2.036  4.555   0.016 21.32 ? 174 LYS A HA   2  
ATOM   6216   H HB2  . LYS A 1 176 ? -29.907 -2.694  3.882   0.016 21.85 ? 174 LYS A HB2  2  
ATOM   6217   H HB3  . LYS A 1 176 ? -28.893 -3.671  4.589   0.016 22.15 ? 174 LYS A HB3  2  
ATOM   6218   H HG2  . LYS A 1 176 ? -30.044 -1.449  5.933   0.016 22.32 ? 174 LYS A HG2  2  
ATOM   6219   H HG3  . LYS A 1 176 ? -30.583 -2.940  6.080   0.016 23.02 ? 174 LYS A HG3  2  
ATOM   6220   H HD2  . LYS A 1 176 ? -28.301 -3.435  6.688   0.016 22.85 ? 174 LYS A HD2  2  
ATOM   6221   H HD3  . LYS A 1 176 ? -28.216 -1.899  7.072   0.016 22.60 ? 174 LYS A HD3  2  
ATOM   6222   H HE2  . LYS A 1 176 ? -30.162 -3.619  8.173   0.016 24.26 ? 174 LYS A HE2  2  
ATOM   6223   H HE3  . LYS A 1 176 ? -28.730 -3.548  8.820   0.016 24.26 ? 174 LYS A HE3  2  
ATOM   6224   H HZ1  . LYS A 1 176 ? -29.777 -2.200  10.103  0.016 25.03 ? 174 LYS A HZ1  2  
ATOM   6225   H HZ2  . LYS A 1 176 ? -29.412 -1.205  9.113   0.016 23.94 ? 174 LYS A HZ2  2  
ATOM   6226   H HZ3  . LYS A 1 176 ? -30.744 -1.769  9.113   0.016 24.55 ? 174 LYS A HZ3  2  
ATOM   6227   N N    . THR A 1 177 ? -26.531 -2.898  2.291   0.016 20.81 ? 175 THR A N    2  
ATOM   6228   C CA   . THR A 1 177 ? -26.252 -3.391  0.942   0.016 20.70 ? 175 THR A CA   2  
ATOM   6229   C C    . THR A 1 177 ? -25.738 -4.820  0.959   0.016 21.13 ? 175 THR A C    2  
ATOM   6230   O O    . THR A 1 177 ? -25.061 -5.236  1.904   0.016 21.39 ? 175 THR A O    2  
ATOM   6231   C CB   . THR A 1 177 ? -25.232 -2.498  0.205   0.016 20.31 ? 175 THR A CB   2  
ATOM   6232   O OG1  . THR A 1 177 ? -25.845 -1.212  -0.068  0.016 20.00 ? 175 THR A OG1  2  
ATOM   6233   C CG2  . THR A 1 177 ? -24.763 -3.127  -1.140  0.016 20.43 ? 175 THR A CG2  2  
ATOM   6234   H H    . THR A 1 177 ? -25.891 -3.002  2.855   0.016 20.93 ? 175 THR A H    2  
ATOM   6235   H HA   . THR A 1 177 ? -27.072 -3.384  0.428   0.016 20.74 ? 175 THR A HA   2  
ATOM   6236   H HB   . THR A 1 177 ? -24.459 -2.385  0.776   0.016 20.33 ? 175 THR A HB   2  
ATOM   6237   H HG1  . THR A 1 177 ? -25.824 -0.737  0.626   0.016 19.91 ? 175 THR A HG1  2  
ATOM   6238   H HG21 . THR A 1 177 ? -24.584 -2.430  -1.788  0.016 20.29 ? 175 THR A HG21 2  
ATOM   6239   H HG22 . THR A 1 177 ? -23.944 -3.634  -1.009  0.016 20.51 ? 175 THR A HG22 2  
ATOM   6240   H HG23 . THR A 1 177 ? -25.448 -3.705  -1.505  0.016 20.69 ? 175 THR A HG23 2  
ATOM   6241   N N    . THR A 1 178 ? -26.103 -5.546  -0.100  0.016 21.35 ? 176 THR A N    2  
ATOM   6242   C CA   . THR A 1 178 ? -25.599 -6.870  -0.436  0.016 21.84 ? 176 THR A CA   2  
ATOM   6243   C C    . THR A 1 178 ? -24.786 -6.776  -1.725  0.016 21.78 ? 176 THR A C    2  
ATOM   6244   O O    . THR A 1 178 ? -25.284 -6.300  -2.748  0.016 21.75 ? 176 THR A O    2  
ATOM   6245   C CB   . THR A 1 178 ? -26.801 -7.826  -0.597  0.016 22.46 ? 176 THR A CB   2  
ATOM   6246   O OG1  . THR A 1 178 ? -26.371 -9.161  -0.965  0.016 23.07 ? 176 THR A OG1  2  
ATOM   6247   C CG2  . THR A 1 178 ? -27.785 -7.249  -1.673  0.016 22.44 ? 176 THR A CG2  2  
ATOM   6248   H H    . THR A 1 178 ? -26.683 -5.281  -0.668  0.016 21.31 ? 176 THR A H    2  
ATOM   6249   H HA   . THR A 1 178 ? -25.025 -7.184  0.278   0.016 21.95 ? 176 THR A HA   2  
ATOM   6250   H HB   . THR A 1 178 ? -27.275 -7.867  0.250   0.016 22.59 ? 176 THR A HB   2  
ATOM   6251   H HG1  . THR A 1 178 ? -26.201 -9.189  -1.786  0.016 23.10 ? 176 THR A HG1  2  
ATOM   6252   H HG21 . THR A 1 178 ? -28.149 -7.951  -2.223  0.016 22.91 ? 176 THR A HG21 2  
ATOM   6253   H HG22 . THR A 1 178 ? -28.533 -6.817  -1.209  0.016 22.48 ? 176 THR A HG22 2  
ATOM   6254   H HG23 . THR A 1 178 ? -27.372 -6.569  -2.230  0.016 22.06 ? 176 THR A HG23 2  
ATOM   6255   N N    . TYR A 1 179 ? -23.534 -7.240  -1.675  0.016 21.94 ? 177 TYR A N    2  
ATOM   6256   C CA   . TYR A 1 179 ? -22.668 -7.316  -2.845  0.016 22.12 ? 177 TYR A CA   2  
ATOM   6257   C C    . TYR A 1 179 ? -22.384 -8.749  -3.176  0.016 22.82 ? 177 TYR A C    2  
ATOM   6258   O O    . TYR A 1 179 ? -22.121 -9.546  -2.273  0.016 23.08 ? 177 TYR A O    2  
ATOM   6259   C CB   . TYR A 1 179 ? -21.308 -6.680  -2.626  0.016 21.94 ? 177 TYR A CB   2  
ATOM   6260   C CG   . TYR A 1 179 ? -21.324 -5.305  -2.145  0.016 21.39 ? 177 TYR A CG   2  
ATOM   6261   C CD1  . TYR A 1 179 ? -21.373 -4.235  -3.038  0.016 21.18 ? 177 TYR A CD1  2  
ATOM   6262   C CD2  . TYR A 1 179 ? -21.205 -5.041  -0.804  0.016 21.24 ? 177 TYR A CD2  2  
ATOM   6263   C CE1  . TYR A 1 179 ? -21.374 -3.005  -2.622  0.016 20.79 ? 177 TYR A CE1  2  
ATOM   6264   C CE2  . TYR A 1 179 ? -21.180 -3.759  -0.381  0.016 20.88 ? 177 TYR A CE2  2  
ATOM   6265   C CZ   . TYR A 1 179 ? -21.257 -2.762  -1.305  0.016 20.63 ? 177 TYR A CZ   2  
ATOM   6266   O OH   . TYR A 1 179 ? -21.264 -1.498  -0.889  0.016 20.36 ? 177 TYR A OH   2  
ATOM   6267   H H    . TYR A 1 179 ? -23.157 -7.522  -0.958  0.016 22.03 ? 177 TYR A H    2  
ATOM   6268   H HA   . TYR A 1 179 ? -23.093 -6.895  -3.610  0.016 22.08 ? 177 TYR A HA   2  
ATOM   6269   H HB2  . TYR A 1 179 ? -20.820 -7.211  -1.981  0.016 22.13 ? 177 TYR A HB2  2  
ATOM   6270   H HB3  . TYR A 1 179 ? -20.846 -6.676  -3.479  0.016 22.14 ? 177 TYR A HB3  2  
ATOM   6271   H HD1  . TYR A 1 179 ? -21.450 -4.393  -3.951  0.016 21.40 ? 177 TYR A HD1  2  
ATOM   6272   H HD2  . TYR A 1 179 ? -21.149 -5.736  -0.193  0.016 21.49 ? 177 TYR A HD2  2  
ATOM   6273   H HE1  . TYR A 1 179 ? -21.424 -2.302  -3.225  0.016 20.71 ? 177 TYR A HE1  2  
ATOM   6274   H HE2  . TYR A 1 179 ? -21.118 -3.565  0.526   0.016 20.89 ? 177 TYR A HE2  2  
ATOM   6275   H HH   . TYR A 1 179 ? -22.035 -1.176  -0.971  0.016 20.17 ? 177 TYR A HH   2  
ATOM   6276   N N    . LYS A 1 180 ? -22.281 -9.027  -4.470  0.016 23.26 ? 178 LYS A N    2  
ATOM   6277   C CA   . LYS A 1 180 ? -22.357 -10.396 -4.970  0.016 24.10 ? 178 LYS A CA   2  
ATOM   6278   C C    . LYS A 1 180 ? -21.617 -10.436 -6.306  0.016 24.62 ? 178 LYS A C    2  
ATOM   6279   O O    . LYS A 1 180 ? -22.093 -9.897  -7.308  0.016 24.77 ? 178 LYS A O    2  
ATOM   6280   C CB   . LYS A 1 180 ? -23.828 -10.815 -5.019  0.016 24.40 ? 178 LYS A CB   2  
ATOM   6281   C CG   . LYS A 1 180 ? -24.349 -11.706 -6.109  0.016 25.35 ? 178 LYS A CG   2  
ATOM   6282   C CD   . LYS A 1 180 ? -24.483 -10.965 -7.436  0.016 25.48 ? 178 LYS A CD   2  
ATOM   6283   C CE   . LYS A 1 180 ? -23.649 -11.683 -8.580  0.016 26.45 ? 178 LYS A CE   2  
ATOM   6284   N NZ   . LYS A 1 180 ? -23.110 -10.698 -9.568  0.016 26.49 ? 178 LYS A NZ   2  
ATOM   6285   H H    . LYS A 1 180 ? -22.170 -8.441  -5.084  0.016 23.17 ? 178 LYS A H    2  
ATOM   6286   H HA   . LYS A 1 180 ? -21.901 -10.987 -4.350  0.016 24.24 ? 178 LYS A HA   2  
ATOM   6287   H HB2  . LYS A 1 180 ? -24.023 -11.263 -4.181  0.016 24.46 ? 178 LYS A HB2  2  
ATOM   6288   H HB3  . LYS A 1 180 ? -24.358 -10.004 -5.054  0.016 24.00 ? 178 LYS A HB3  2  
ATOM   6289   H HG2  . LYS A 1 180 ? -23.752 -12.467 -6.219  0.016 25.81 ? 178 LYS A HG2  2  
ATOM   6290   H HG3  . LYS A 1 180 ? -25.238 -12.017 -5.864  0.016 25.58 ? 178 LYS A HG3  2  
ATOM   6291   H HD2  . LYS A 1 180 ? -25.420 -10.967 -7.693  0.016 25.71 ? 178 LYS A HD2  2  
ATOM   6292   H HD3  . LYS A 1 180 ? -24.190 -10.053 -7.327  0.016 24.87 ? 178 LYS A HD3  2  
ATOM   6293   H HE2  . LYS A 1 180 ? -22.888 -12.144 -8.188  0.016 26.46 ? 178 LYS A HE2  2  
ATOM   6294   H HE3  . LYS A 1 180 ? -24.216 -12.318 -9.050  0.016 27.17 ? 178 LYS A HE3  2  
ATOM   6295   H HZ1  . LYS A 1 180 ? -22.542 -11.097 -10.123 0.016 27.05 ? 178 LYS A HZ1  2  
ATOM   6296   H HZ2  . LYS A 1 180 ? -23.773 -10.342 -10.036 0.016 26.69 ? 178 LYS A HZ2  2  
ATOM   6297   H HZ3  . LYS A 1 180 ? -22.680 -10.050 -9.140  0.016 25.85 ? 178 LYS A HZ3  2  
ATOM   6298   N N    . ALA A 1 181 ? -20.390 -10.969 -6.270  0.016 24.99 ? 179 ALA A N    2  
ATOM   6299   C CA   . ALA A 1 181 ? -19.488 -11.017 -7.420  0.016 25.67 ? 179 ALA A CA   2  
ATOM   6300   C C    . ALA A 1 181 ? -19.917 -12.127 -8.371  0.016 26.70 ? 179 ALA A C    2  
ATOM   6301   O O    . ALA A 1 181 ? -20.529 -13.112 -7.960  0.016 26.99 ? 179 ALA A O    2  
ATOM   6302   C CB   . ALA A 1 181 ? -18.057 -11.251 -6.944  0.016 25.89 ? 179 ALA A CB   2  
ATOM   6303   H H    . ALA A 1 181 ? -20.051 -11.315 -5.563  0.016 24.93 ? 179 ALA A H    2  
ATOM   6304   H HA   . ALA A 1 181 ? -19.519 -10.171 -7.896  0.016 25.49 ? 179 ALA A HA   2  
ATOM   6305   H HB1  . ALA A 1 181 ? -17.438 -10.953 -7.628  0.016 26.25 ? 179 ALA A HB1  2  
ATOM   6306   H HB2  . ALA A 1 181 ? -17.913 -10.763 -6.119  0.016 25.33 ? 179 ALA A HB2  2  
ATOM   6307   H HB3  . ALA A 1 181 ? -17.936 -12.198 -6.776  0.016 26.33 ? 179 ALA A HB3  2  
ATOM   6308   N N    . LYS A 1 182 ? -19.616 -11.986 -9.659  0.016 27.45 ? 180 LYS A N    2  
ATOM   6309   C CA   . LYS A 1 182 ? -20.074 -13.058 -10.538 0.016 28.61 ? 180 LYS A CA   2  
ATOM   6310   C C    . LYS A 1 182 ? -19.350 -14.364 -10.222 0.016 29.31 ? 180 LYS A C    2  
ATOM   6311   O O    . LYS A 1 182 ? -19.874 -15.435 -10.525 0.016 30.17 ? 180 LYS A O    2  
ATOM   6312   C CB   . LYS A 1 182 ? -19.902 -12.766 -12.034 0.016 29.62 ? 180 LYS A CB   2  
ATOM   6313   C CG   . LYS A 1 182 ? -20.128 -14.094 -12.914 0.016 31.17 ? 180 LYS A CG   2  
ATOM   6314   C CD   . LYS A 1 182 ? -19.918 -14.018 -14.458 0.016 32.60 ? 180 LYS A CD   2  
ATOM   6315   C CE   . LYS A 1 182 ? -20.877 -13.115 -15.164 0.016 32.62 ? 180 LYS A CE   2  
ATOM   6316   N NZ   . LYS A 1 182 ? -20.326 -11.732 -15.147 0.016 31.89 ? 180 LYS A NZ   2  
ATOM   6317   H H    . LYS A 1 182 ? -19.174 -11.349 -10.022 0.016 27.42 ? 180 LYS A H    2  
ATOM   6318   H HA   . LYS A 1 182 ? -21.021 -13.191 -10.377 0.016 28.50 ? 180 LYS A HA   2  
ATOM   6319   H HB2  . LYS A 1 182 ? -20.548 -12.093 -12.306 0.016 29.38 ? 180 LYS A HB2  2  
ATOM   6320   H HB3  . LYS A 1 182 ? -19.001 -12.445 -12.189 0.016 29.69 ? 180 LYS A HB3  2  
ATOM   6321   H HG2  . LYS A 1 182 ? -19.488 -14.766 -12.637 0.016 31.44 ? 180 LYS A HG2  2  
ATOM   6322   H HG3  . LYS A 1 182 ? -21.027 -14.432 -12.753 0.016 31.19 ? 180 LYS A HG3  2  
ATOM   6323   H HD2  . LYS A 1 182 ? -19.017 -13.722 -14.658 0.016 32.76 ? 180 LYS A HD2  2  
ATOM   6324   H HD3  . LYS A 1 182 ? -20.053 -14.908 -14.819 0.016 33.54 ? 180 LYS A HD3  2  
ATOM   6325   H HE2  . LYS A 1 182 ? -20.988 -13.406 -16.079 0.016 33.78 ? 180 LYS A HE2  2  
ATOM   6326   H HE3  . LYS A 1 182 ? -21.729 -13.123 -14.700 0.016 32.05 ? 180 LYS A HE3  2  
ATOM   6327   H HZ1  . LYS A 1 182 ? -19.590 -11.702 -15.647 0.016 32.57 ? 180 LYS A HZ1  2  
ATOM   6328   H HZ2  . LYS A 1 182 ? -20.922 -11.154 -15.474 0.016 31.79 ? 180 LYS A HZ2  2  
ATOM   6329   H HZ3  . LYS A 1 182 ? -20.122 -11.491 -14.315 0.016 30.96 ? 180 LYS A HZ3  2  
ATOM   6330   N N    . LYS A 1 183 ? -18.165 -14.289 -9.616  0.016 29.08 ? 181 LYS A N    2  
ATOM   6331   C CA   . LYS A 1 183 ? -17.287 -15.443 -9.384  0.016 29.86 ? 181 LYS A CA   2  
ATOM   6332   C C    . LYS A 1 183 ? -16.847 -15.487 -7.920  0.016 29.15 ? 181 LYS A C    2  
ATOM   6333   O O    . LYS A 1 183 ? -16.929 -14.506 -7.187  0.016 28.13 ? 181 LYS A O    2  
ATOM   6334   C CB   . LYS A 1 183 ? -16.045 -15.389 -10.296 0.016 30.77 ? 181 LYS A CB   2  
ATOM   6335   C CG   . LYS A 1 183 ? -14.763 -16.015 -9.700  0.016 31.21 ? 181 LYS A CG   2  
ATOM   6336   C CD   . LYS A 1 183 ? -13.646 -16.152 -10.700 0.016 32.42 ? 181 LYS A CD   2  
ATOM   6337   C CE   . LYS A 1 183 ? -13.194 -14.829 -11.259 0.016 32.20 ? 181 LYS A CE   2  
ATOM   6338   N NZ   . LYS A 1 183 ? -12.134 -14.255 -10.391 0.016 31.76 ? 181 LYS A NZ   2  
ATOM   6339   H H    . LYS A 1 183 ? -17.835 -13.554 -9.315  0.016 28.52 ? 181 LYS A H    2  
ATOM   6340   H HA   . LYS A 1 183 ? -17.767 -16.264 -9.583  0.016 30.45 ? 181 LYS A HA   2  
ATOM   6341   H HB2  . LYS A 1 183 ? -16.244 -15.834 -11.135 0.016 31.61 ? 181 LYS A HB2  2  
ATOM   6342   H HB3  . LYS A 1 183 ? -15.842 -14.456 -10.470 0.016 30.36 ? 181 LYS A HB3  2  
ATOM   6343   H HG2  . LYS A 1 183 ? -14.442 -15.446 -8.982  0.016 30.51 ? 181 LYS A HG2  2  
ATOM   6344   H HG3  . LYS A 1 183 ? -14.954 -16.910 -9.380  0.016 31.55 ? 181 LYS A HG3  2  
ATOM   6345   H HD2  . LYS A 1 183 ? -12.881 -16.562 -10.259 0.016 32.70 ? 181 LYS A HD2  2  
ATOM   6346   H HD3  . LYS A 1 183 ? -13.940 -16.716 -11.435 0.016 33.23 ? 181 LYS A HD3  2  
ATOM   6347   H HE2  . LYS A 1 183 ? -12.807 -14.979 -12.137 0.016 33.17 ? 181 LYS A HE2  2  
ATOM   6348   H HE3  . LYS A 1 183 ? -13.947 -14.230 -11.332 0.016 31.57 ? 181 LYS A HE3  2  
ATOM   6349   H HZ1  . LYS A 1 183 ? -12.156 -14.643 -9.593  0.016 31.44 ? 181 LYS A HZ1  2  
ATOM   6350   H HZ2  . LYS A 1 183 ? -11.332 -14.385 -10.757 0.016 32.53 ? 181 LYS A HZ2  2  
ATOM   6351   H HZ3  . LYS A 1 183 ? -12.265 -13.382 -10.291 0.016 31.14 ? 181 LYS A HZ3  2  
ATOM   6352   N N    . ASP A 1 184 ? -16.332 -16.633 -7.501  0.016 29.84 ? 182 ASP A N    2  
ATOM   6353   C CA   . ASP A 1 184 ? -15.741 -16.747 -6.176  0.016 29.49 ? 182 ASP A CA   2  
ATOM   6354   C C    . ASP A 1 184 ? -14.409 -16.005 -6.133  0.016 29.43 ? 182 ASP A C    2  
ATOM   6355   O O    . ASP A 1 184 ? -13.562 -16.172 -7.014  0.016 30.26 ? 182 ASP A O    2  
ATOM   6356   C CB   . ASP A 1 184 ? -15.557 -18.215 -5.806  0.016 30.45 ? 182 ASP A CB   2  
ATOM   6357   C CG   . ASP A 1 184 ? -16.860 -18.979 -5.811  0.016 30.70 ? 182 ASP A CG   2  
ATOM   6358   O OD1  . ASP A 1 184 ? -16.890 -20.082 -6.397  0.016 31.82 ? 182 ASP A OD1  2  
ATOM   6359   O OD2  . ASP A 1 184 ? -17.853 -18.481 -5.248  0.016 29.92 ? 182 ASP A OD2  2  
ATOM   6360   H H    . ASP A 1 184 ? -16.316 -17.355 -7.963  0.016 30.60 ? 182 ASP A H    2  
ATOM   6361   H HA   . ASP A 1 184 ? -16.335 -16.357 -5.519  0.016 28.79 ? 182 ASP A HA   2  
ATOM   6362   H HB2  . ASP A 1 184 ? -14.961 -18.623 -6.450  0.016 31.20 ? 182 ASP A HB2  2  
ATOM   6363   H HB3  . ASP A 1 184 ? -15.180 -18.278 -4.918  0.016 30.30 ? 182 ASP A HB3  2  
ATOM   6364   N N    . VAL A 1 185 ? -14.261 -15.147 -5.124  0.016 28.59 ? 183 VAL A N    2  
ATOM   6365   C CA   . VAL A 1 185 ? -13.054 -14.378 -4.863  0.016 28.59 ? 183 VAL A CA   2  
ATOM   6366   C C    . VAL A 1 185 ? -12.700 -14.617 -3.401  0.016 28.54 ? 183 VAL A C    2  
ATOM   6367   O O    . VAL A 1 185 ? -13.458 -15.235 -2.655  0.016 28.41 ? 183 VAL A O    2  
ATOM   6368   C CB   . VAL A 1 185 ? -13.227 -12.871 -5.150  0.016 27.78 ? 183 VAL A CB   2  
ATOM   6369   C CG1  . VAL A 1 185 ? -13.485 -12.650 -6.632  0.016 28.09 ? 183 VAL A CG1  2  
ATOM   6370   C CG2  . VAL A 1 185 ? -14.343 -12.333 -4.303  0.016 26.74 ? 183 VAL A CG2  2  
ATOM   6371   H H    . VAL A 1 185 ? -14.870 -15.007 -4.537  0.016 28.09 ? 183 VAL A H    2  
ATOM   6372   H HA   . VAL A 1 185 ? -12.330 -14.708 -5.416  0.016 29.32 ? 183 VAL A HA   2  
ATOM   6373   H HB   . VAL A 1 185 ? -12.419 -12.396 -4.906  0.016 27.89 ? 183 VAL A HB   2  
ATOM   6374   H HG11 . VAL A 1 185 ? -13.267 -11.730 -6.856  0.016 27.84 ? 183 VAL A HG11 2  
ATOM   6375   H HG12 . VAL A 1 185 ? -12.928 -13.261 -7.140  0.016 28.91 ? 183 VAL A HG12 2  
ATOM   6376   H HG13 . VAL A 1 185 ? -14.421 -12.826 -6.822  0.016 27.85 ? 183 VAL A HG13 2  
ATOM   6377   H HG21 . VAL A 1 185 ? -14.515 -11.412 -4.562  0.016 26.28 ? 183 VAL A HG21 2  
ATOM   6378   H HG22 . VAL A 1 185 ? -15.136 -12.872 -4.454  0.016 26.73 ? 183 VAL A HG22 2  
ATOM   6379   H HG23 . VAL A 1 185 ? -14.087 -12.375 -3.367  0.016 26.67 ? 183 VAL A HG23 2  
ATOM   6380   N N    . ARG A 1 186 ? -11.524 -14.159 -2.995  0.016 28.85 ? 184 ARG A N    2  
ATOM   6381   C CA   . ARG A 1 186 ? -11.140 -14.268 -1.595  0.016 28.98 ? 184 ARG A CA   2  
ATOM   6382   C C    . ARG A 1 186 ? -11.999 -13.323 -0.769  0.016 27.96 ? 184 ARG A C    2  
ATOM   6383   O O    . ARG A 1 186 ? -12.098 -12.144 -1.102  0.016 27.33 ? 184 ARG A O    2  
ATOM   6384   C CB   . ARG A 1 186 ? -9.670  -13.916 -1.421  0.016 29.73 ? 184 ARG A CB   2  
ATOM   6385   C CG   . ARG A 1 186 ? -9.220  -13.749 0.021   0.016 29.97 ? 184 ARG A CG   2  
ATOM   6386   C CD   . ARG A 1 186 ? -9.374  -15.025 0.825   0.016 30.59 ? 184 ARG A CD   2  
ATOM   6387   N NE   . ARG A 1 186 ? -8.338  -15.982 0.466   0.016 31.81 ? 184 ARG A NE   2  
ATOM   6388   C CZ   . ARG A 1 186 ? -8.449  -17.302 0.592   0.016 32.52 ? 184 ARG A CZ   2  
ATOM   6389   N NH1  . ARG A 1 186 ? -9.570  -17.855 1.035   0.016 32.16 ? 184 ARG A NH1  2  
ATOM   6390   N NH2  . ARG A 1 186 ? -7.420  -18.067 0.253   0.016 33.72 ? 184 ARG A NH2  2  
ATOM   6391   H H    . ARG A 1 186 ? -10.946 -13.779 -3.499  0.016 29.09 ? 184 ARG A H    2  
ATOM   6392   H HA   . ARG A 1 186 ? -11.276 -15.174 -1.284  0.016 29.38 ? 184 ARG A HA   2  
ATOM   6393   H HB2  . ARG A 1 186 ? -9.133  -14.623 -1.812  0.016 30.48 ? 184 ARG A HB2  2  
ATOM   6394   H HB3  . ARG A 1 186 ? -9.496  -13.083 -1.883  0.016 29.46 ? 184 ARG A HB3  2  
ATOM   6395   H HG2  . ARG A 1 186 ? -8.284  -13.499 0.036   0.016 30.54 ? 184 ARG A HG2  2  
ATOM   6396   H HG3  . ARG A 1 186 ? -9.756  -13.060 0.444   0.016 29.29 ? 184 ARG A HG3  2  
ATOM   6397   H HD2  . ARG A 1 186 ? -9.272  -14.825 1.766   0.016 30.69 ? 184 ARG A HD2  2  
ATOM   6398   H HD3  . ARG A 1 186 ? -10.245 -15.415 0.657   0.016 30.21 ? 184 ARG A HD3  2  
ATOM   6399   H HE   . ARG A 1 186 ? -7.668  -15.685 0.022   0.016 32.13 ? 184 ARG A HE   2  
ATOM   6400   H HH11 . ARG A 1 186 ? -10.239 -17.369 1.261   0.016 31.45 ? 184 ARG A HH11 2  
ATOM   6401   H HH12 . ARG A 1 186 ? -9.623  -18.708 1.103   0.016 32.69 ? 184 ARG A HH12 2  
ATOM   6402   H HH21 . ARG A 1 186 ? -6.700  -17.705 -0.040  0.016 34.04 ? 184 ARG A HH21 2  
ATOM   6403   H HH22 . ARG A 1 186 ? -7.479  -18.921 0.315   0.016 34.23 ? 184 ARG A HH22 2  
ATOM   6404   N N    . LEU A 1 187 ? -12.581 -13.820 0.329   0.016 27.94 ? 185 LEU A N    2  
ATOM   6405   C CA   . LEU A 1 187 ? -13.502 -12.959 1.077   0.016 27.10 ? 185 LEU A CA   2  
ATOM   6406   C C    . LEU A 1 187 ? -12.789 -12.302 2.255   0.016 27.34 ? 185 LEU A C    2  
ATOM   6407   O O    . LEU A 1 187 ? -12.052 -12.979 2.983   0.016 28.26 ? 185 LEU A O    2  
ATOM   6408   C CB   . LEU A 1 187 ? -14.709 -13.738 1.575   0.016 27.04 ? 185 LEU A CB   2  
ATOM   6409   C CG   . LEU A 1 187 ? -15.751 -14.071 0.495   0.016 26.69 ? 185 LEU A CG   2  
ATOM   6410   C CD1  . LEU A 1 187 ? -15.278 -13.706 -0.939  0.016 26.63 ? 185 LEU A CD1  2  
ATOM   6411   C CD2  . LEU A 1 187 ? -16.170 -15.549 0.671   0.016 27.47 ? 185 LEU A CD2  2  
ATOM   6412   H H    . LEU A 1 187 ? -12.468 -14.606 0.651   0.016 28.46 ? 185 LEU A H    2  
ATOM   6413   H HA   . LEU A 1 187 ? -13.814 -12.252 0.494   0.016 26.53 ? 185 LEU A HA   2  
ATOM   6414   H HB2  . LEU A 1 187 ? -14.404 -14.578 1.949   0.016 27.70 ? 185 LEU A HB2  2  
ATOM   6415   H HB3  . LEU A 1 187 ? -15.145 -13.225 2.267   0.016 26.70 ? 185 LEU A HB3  2  
ATOM   6416   H HG   . LEU A 1 187 ? -16.537 -13.522 0.660   0.016 26.13 ? 185 LEU A HG   2  
ATOM   6417   H HD11 . LEU A 1 187 ? -15.943 -13.996 -1.581  0.016 26.58 ? 185 LEU A HD11 2  
ATOM   6418   H HD12 . LEU A 1 187 ? -15.176 -12.746 -1.006  0.016 26.16 ? 185 LEU A HD12 2  
ATOM   6419   H HD13 . LEU A 1 187 ? -14.442 -14.138 -1.114  0.016 27.22 ? 185 LEU A HD13 2  
ATOM   6420   H HD21 . LEU A 1 187 ? -16.914 -15.752 0.083   0.016 27.33 ? 185 LEU A HD21 2  
ATOM   6421   H HD22 . LEU A 1 187 ? -15.419 -16.120 0.453   0.016 28.06 ? 185 LEU A HD22 2  
ATOM   6422   H HD23 . LEU A 1 187 ? -16.434 -15.692 1.593   0.016 27.61 ? 185 LEU A HD23 2  
ATOM   6423   N N    . PRO A 1 188 ? -12.978 -10.997 2.467   0.016 26.70 ? 186 PRO A N    2  
ATOM   6424   C CA   . PRO A 1 188 ? -12.290 -10.317 3.567   0.016 27.11 ? 186 PRO A CA   2  
ATOM   6425   C C    . PRO A 1 188 ? -12.870 -10.653 4.935   0.016 27.41 ? 186 PRO A C    2  
ATOM   6426   O O    . PRO A 1 188 ? -14.014 -11.068 5.070   0.016 27.05 ? 186 PRO A O    2  
ATOM   6427   C CB   . PRO A 1 188 ? -12.500 -8.823  3.256   0.016 26.33 ? 186 PRO A CB   2  
ATOM   6428   C CG   . PRO A 1 188 ? -13.805 -8.807  2.540   0.016 25.41 ? 186 PRO A CG   2  
ATOM   6429   C CD   . PRO A 1 188 ? -13.878 -10.090 1.740   0.016 25.69 ? 186 PRO A CD   2  
ATOM   6430   H HA   . PRO A 1 188 ? -11.342 -10.522 3.555   0.016 27.76 ? 186 PRO A HA   2  
ATOM   6431   H HB2  . PRO A 1 188 ? -12.552 -8.325  4.084   0.016 26.41 ? 186 PRO A HB2  2  
ATOM   6432   H HB3  . PRO A 1 188 ? -11.786 -8.487  2.693   0.016 26.51 ? 186 PRO A HB3  2  
ATOM   6433   H HG2  . PRO A 1 188 ? -14.518 -8.770  3.192   0.016 25.21 ? 186 PRO A HG2  2  
ATOM   6434   H HG3  . PRO A 1 188 ? -13.852 -8.040  1.951   0.016 24.99 ? 186 PRO A HG3  2  
ATOM   6435   H HD2  . PRO A 1 188 ? -14.780 -10.449 1.747   0.016 25.42 ? 186 PRO A HD2  2  
ATOM   6436   H HD3  . PRO A 1 188 ? -13.558 -9.955  0.834   0.016 25.66 ? 186 PRO A HD3  2  
ATOM   6437   N N    . ASP A 1 189 ? -11.970 -10.623 5.912   0.016 28.35 ? 187 ASP A N    2  
ATOM   6438   C CA   . ASP A 1 189 ? -12.051 -10.087 7.263   0.016 28.82 ? 187 ASP A CA   2  
ATOM   6439   C C    . ASP A 1 189 ? -13.117 -8.993  7.327   0.016 27.83 ? 187 ASP A C    2  
ATOM   6440   O O    . ASP A 1 189 ? -13.169 -8.125  6.462   0.016 27.03 ? 187 ASP A O    2  
ATOM   6441   C CB   . ASP A 1 189 ? -10.647 -9.487  7.588   0.016 29.73 ? 187 ASP A CB   2  
ATOM   6442   C CG   . ASP A 1 189 ? -10.243 -9.462  9.105   0.016 30.99 ? 187 ASP A CG   2  
ATOM   6443   O OD1  . ASP A 1 189 ? -9.344  -10.257 9.490   0.016 32.23 ? 187 ASP A OD1  2  
ATOM   6444   O OD2  . ASP A 1 189 ? -10.696 -8.582  9.884   0.016 30.92 ? 187 ASP A OD2  2  
ATOM   6445   H H    . ASP A 1 189 ? -11.194 -10.971 5.785   0.016 28.91 ? 187 ASP A H    2  
ATOM   6446   H HA   . ASP A 1 189 ? -12.270 -10.783 7.898   0.016 29.33 ? 187 ASP A HA   2  
ATOM   6447   H HB2  . ASP A 1 189 ? -9.973  -9.997  7.112   0.016 30.13 ? 187 ASP A HB2  2  
ATOM   6448   H HB3  . ASP A 1 189 ? -10.633 -8.566  7.271   0.016 29.26 ? 187 ASP A HB3  2  
ATOM   6449   N N    . ALA A 1 190 ? -13.928 -8.990  8.386   0.016 28.06 ? 188 ALA A N    2  
ATOM   6450   C CA   . ALA A 1 190 ? -14.757 -7.810  8.637   0.016 27.40 ? 188 ALA A CA   2  
ATOM   6451   C C    . ALA A 1 190 ? -13.855 -6.590  8.732   0.016 27.57 ? 188 ALA A C    2  
ATOM   6452   O O    . ALA A 1 190 ? -12.754 -6.653  9.278   0.016 28.62 ? 188 ALA A O    2  
ATOM   6453   C CB   . ALA A 1 190 ? -15.561 -7.971  9.921   0.016 28.02 ? 188 ALA A CB   2  
ATOM   6454   H H    . ALA A 1 190 ? -14.017 -9.626  8.955   0.016 28.64 ? 188 ALA A H    2  
ATOM   6455   H HA   . ALA A 1 190 ? -15.370 -7.671  7.898   0.016 26.59 ? 188 ALA A HA   2  
ATOM   6456   H HB1  . ALA A 1 190 ? -15.833 -8.897  10.010  0.016 28.28 ? 188 ALA A HB1  2  
ATOM   6457   H HB2  . ALA A 1 190 ? -15.005 -7.713  10.672  0.016 28.81 ? 188 ALA A HB2  2  
ATOM   6458   H HB3  . ALA A 1 190 ? -16.340 -7.395  9.880   0.016 27.48 ? 188 ALA A HB3  2  
ATOM   6459   N N    . HIS A 1 191 ? -14.322 -5.472  8.202   0.016 26.67 ? 189 HIS A N    2  
ATOM   6460   C CA   . HIS A 1 191 ? -13.499 -4.268  8.226   0.016 26.91 ? 189 HIS A CA   2  
ATOM   6461   C C    . HIS A 1 191 ? -14.399 -3.066  8.042   0.016 26.07 ? 189 HIS A C    2  
ATOM   6462   O O    . HIS A 1 191 ? -15.614 -3.194  7.995   0.016 25.41 ? 189 HIS A O    2  
ATOM   6463   C CB   . HIS A 1 191 ? -12.418 -4.325  7.161   0.016 26.94 ? 189 HIS A CB   2  
ATOM   6464   C CG   . HIS A 1 191 ? -12.933 -4.419  5.769   0.016 25.89 ? 189 HIS A CG   2  
ATOM   6465   N ND1  . HIS A 1 191 ? -13.361 -5.606  5.215   0.016 25.62 ? 189 HIS A ND1  2  
ATOM   6466   C CD2  . HIS A 1 191 ? -13.058 -3.482  4.800   0.016 25.22 ? 189 HIS A CD2  2  
ATOM   6467   C CE1  . HIS A 1 191 ? -13.724 -5.392  3.964   0.016 24.87 ? 189 HIS A CE1  2  
ATOM   6468   N NE2  . HIS A 1 191 ? -13.559 -4.109  3.688   0.016 24.60 ? 189 HIS A NE2  2  
ATOM   6469   H H    . HIS A 1 191 ? -15.086 -5.382  7.825   0.016 26.01 ? 189 HIS A H    2  
ATOM   6470   H HA   . HIS A 1 191 ? -13.067 -4.189  9.089   0.016 27.76 ? 189 HIS A HA   2  
ATOM   6471   H HB2  . HIS A 1 191 ? -11.874 -3.521  7.218   0.016 27.21 ? 189 HIS A HB2  2  
ATOM   6472   H HB3  . HIS A 1 191 ? -11.872 -5.112  7.320   0.016 27.55 ? 189 HIS A HB3  2  
ATOM   6473   H HD1  . HIS A 1 191 ? -13.372 -6.363  5.619   0.016 25.99 ? 189 HIS A HD1  2  
ATOM   6474   H HD2  . HIS A 1 191 ? -12.840 -2.583  4.879   0.016 25.27 ? 189 HIS A HD2  2  
ATOM   6475   H HE1  . HIS A 1 191 ? -14.058 -6.035  3.383   0.016 24.65 ? 189 HIS A HE1  2  
ATOM   6476   H HE2  . HIS A 1 191 ? -13.735 -3.733  2.939   0.016 24.21 ? 189 HIS A HE2  2  
ATOM   6477   N N    . GLU A 1 192 ? -13.792 -1.891  7.931   0.016 26.21 ? 190 GLU A N    2  
ATOM   6478   C CA   . GLU A 1 192 ? -14.576 -0.666  7.822   0.016 25.57 ? 190 GLU A CA   2  
ATOM   6479   C C    . GLU A 1 192 ? -14.151 0.116   6.590   0.016 25.07 ? 190 GLU A C    2  
ATOM   6480   O O    . GLU A 1 192 ? -13.083 -0.102  6.018   0.016 25.47 ? 190 GLU A O    2  
ATOM   6481   C CB   . GLU A 1 192 ? -14.419 0.180   9.098   0.016 26.48 ? 190 GLU A CB   2  
ATOM   6482   C CG   . GLU A 1 192 ? -14.620 -0.636  10.370  0.016 27.39 ? 190 GLU A CG   2  
ATOM   6483   C CD   . GLU A 1 192 ? -15.962 -1.367  10.405  0.016 26.76 ? 190 GLU A CD   2  
ATOM   6484   O OE1  . GLU A 1 192 ? -17.008 -0.682  10.368  0.016 26.21 ? 190 GLU A OE1  2  
ATOM   6485   O OE2  . GLU A 1 192 ? -15.980 -2.605  10.480  0.016 26.95 ? 190 GLU A OE2  2  
ATOM   6486   H H    . GLU A 1 192 ? -12.944 -1.775  7.924   0.016 26.74 ? 190 GLU A H    2  
ATOM   6487   H HA   . GLU A 1 192 ? -15.513 -0.887  7.720   0.016 24.99 ? 190 GLU A HA   2  
ATOM   6488   H HB2  . GLU A 1 192 ? -13.529 0.561   9.118   0.016 27.04 ? 190 GLU A HB2  2  
ATOM   6489   H HB3  . GLU A 1 192 ? -15.080 0.886   9.088   0.016 26.06 ? 190 GLU A HB3  2  
ATOM   6490   H HG2  . GLU A 1 192 ? -13.910 -1.291  10.461  0.016 27.95 ? 190 GLU A HG2  2  
ATOM   6491   H HG3  . GLU A 1 192 ? -14.638 -0.064  11.143  0.016 27.98 ? 190 GLU A HG3  2  
ATOM   6492   N N    . VAL A 1 193 ? -15.019 1.016   6.152   0.016 24.31 ? 191 VAL A N    2  
ATOM   6493   C CA   . VAL A 1 193 ? -14.699 1.884   5.029   0.016 23.99 ? 191 VAL A CA   2  
ATOM   6494   C C    . VAL A 1 193 ? -15.065 3.304   5.415   0.016 24.01 ? 191 VAL A C    2  
ATOM   6495   O O    . VAL A 1 193 ? -16.201 3.572   5.811   0.016 23.55 ? 191 VAL A O    2  
ATOM   6496   C CB   . VAL A 1 193 ? -15.416 1.480   3.725   0.016 23.08 ? 191 VAL A CB   2  
ATOM   6497   C CG1  . VAL A 1 193 ? -15.047 2.408   2.629   0.016 22.99 ? 191 VAL A CG1  2  
ATOM   6498   C CG2  . VAL A 1 193 ? -14.990 0.047   3.306   0.016 23.23 ? 191 VAL A CG2  2  
ATOM   6499   H H    . VAL A 1 193 ? -15.804 1.134   6.478   0.016 24.04 ? 191 VAL A H    2  
ATOM   6500   H HA   . VAL A 1 193 ? -13.743 1.861   4.870   0.016 24.54 ? 191 VAL A HA   2  
ATOM   6501   H HB   . VAL A 1 193 ? -16.378 1.502   3.846   0.016 22.60 ? 191 VAL A HB   2  
ATOM   6502   H HG11 . VAL A 1 193 ? -14.367 3.023   2.946   0.016 23.44 ? 191 VAL A HG11 2  
ATOM   6503   H HG12 . VAL A 1 193 ? -14.682 1.894   1.892   0.016 23.17 ? 191 VAL A HG12 2  
ATOM   6504   H HG13 . VAL A 1 193 ? -15.832 2.895   2.338   0.016 22.45 ? 191 VAL A HG13 2  
ATOM   6505   H HG21 . VAL A 1 193 ? -15.200 -0.114  2.377   0.016 22.89 ? 191 VAL A HG21 2  
ATOM   6506   H HG22 . VAL A 1 193 ? -14.031 -0.034  3.437   0.016 23.85 ? 191 VAL A HG22 2  
ATOM   6507   H HG23 . VAL A 1 193 ? -15.445 -0.593  3.870   0.016 23.15 ? 191 VAL A HG23 2  
ATOM   6508   N N    . ASP A 1 194 ? -14.070 4.182   5.346   0.016 24.67 ? 192 ASP A N    2  
ATOM   6509   C CA   . ASP A 1 194 ? -14.282 5.625   5.346   0.016 24.74 ? 192 ASP A CA   2  
ATOM   6510   C C    . ASP A 1 194 ? -14.881 5.988   3.991   0.016 23.80 ? 192 ASP A C    2  
ATOM   6511   O O    . ASP A 1 194 ? -15.024 5.126   3.108   0.016 23.17 ? 192 ASP A O    2  
ATOM   6512   C CB   . ASP A 1 194 ? -12.971 6.361   5.634   0.016 25.95 ? 192 ASP A CB   2  
ATOM   6513   C CG   . ASP A 1 194 ? -12.866 7.726   4.920   0.016 26.02 ? 192 ASP A CG   2  
ATOM   6514   O OD1  . ASP A 1 194 ? -11.799 8.105   4.326   0.016 26.61 ? 192 ASP A OD1  2  
ATOM   6515   O OD2  . ASP A 1 194 ? -13.887 8.441   4.940   0.016 25.58 ? 192 ASP A OD2  2  
ATOM   6516   H H    . ASP A 1 194 ? -13.244 3.956   5.287   0.016 25.17 ? 192 ASP A H    2  
ATOM   6517   H HA   . ASP A 1 194 ? -14.909 5.856   6.048   0.016 24.71 ? 192 ASP A HA   2  
ATOM   6518   H HB2  . ASP A 1 194 ? -12.918 6.497   6.592   0.016 26.54 ? 192 ASP A HB2  2  
ATOM   6519   H HB3  . ASP A 1 194 ? -12.226 5.813   5.343   0.016 26.29 ? 192 ASP A HB3  2  
ATOM   6520   N N    . HIS A 1 195 ? -15.347 7.225   3.877   0.016 23.77 ? 193 HIS A N    2  
ATOM   6521   C CA   . HIS A 1 195 ? -16.076 7.717   2.731   0.016 23.07 ? 193 HIS A CA   2  
ATOM   6522   C C    . HIS A 1 195 ? -16.274 9.225   2.891   0.016 23.38 ? 193 HIS A C    2  
ATOM   6523   O O    . HIS A 1 195 ? -16.732 9.674   3.944   0.016 23.57 ? 193 HIS A O    2  
ATOM   6524   C CB   . HIS A 1 195 ? -17.475 7.096   2.696   0.016 22.14 ? 193 HIS A CB   2  
ATOM   6525   C CG   . HIS A 1 195 ? -17.650 5.904   1.807   0.016 21.69 ? 193 HIS A CG   2  
ATOM   6526   N ND1  . HIS A 1 195 ? -17.977 4.644   2.277   0.016 21.55 ? 193 HIS A ND1  2  
ATOM   6527   C CD2  . HIS A 1 195 ? -17.675 5.821   0.460   0.016 21.46 ? 193 HIS A CD2  2  
ATOM   6528   C CE1  . HIS A 1 195 ? -18.112 3.822   1.252   0.016 21.24 ? 193 HIS A CE1  2  
ATOM   6529   N NE2  . HIS A 1 195 ? -17.969 4.522   0.136   0.016 21.20 ? 193 HIS A NE2  2  
ATOM   6530   H H    . HIS A 1 195 ? -15.266 7.817   4.493   0.016 24.24 ? 193 HIS A H    2  
ATOM   6531   H HA   . HIS A 1 195 ? -15.596 7.531   1.911   0.016 23.14 ? 193 HIS A HA   2  
ATOM   6532   H HB2  . HIS A 1 195 ? -17.678 6.825   3.589   0.016 22.23 ? 193 HIS A HB2  2  
ATOM   6533   H HB3  . HIS A 1 195 ? -18.077 7.789   2.389   0.016 21.89 ? 193 HIS A HB3  2  
ATOM   6534   H HD1  . HIS A 1 195 ? -18.037 4.416   3.108   0.016 21.73 ? 193 HIS A HD1  2  
ATOM   6535   H HD2  . HIS A 1 195 ? -17.517 6.519   -0.128  0.016 21.56 ? 193 HIS A HD2  2  
ATOM   6536   H HE1  . HIS A 1 195 ? -18.319 2.917   1.303   0.016 21.16 ? 193 HIS A HE1  2  
ATOM   6537   H HE2  . HIS A 1 195 ? -18.008 4.210   -0.664  0.016 21.12 ? 193 HIS A HE2  2  
ATOM   6538   N N    . ARG A 1 196 ? -15.951 9.991   1.847   0.016 23.55 ? 194 ARG A N    2  
ATOM   6539   C CA   . ARG A 1 196 ? -16.392 11.391  1.709   0.016 23.70 ? 194 ARG A CA   2  
ATOM   6540   C C    . ARG A 1 196 ? -17.003 11.615  0.328   0.016 23.17 ? 194 ARG A C    2  
ATOM   6541   O O    . ARG A 1 196 ? -16.299 11.518  -0.687  0.016 23.39 ? 194 ARG A O    2  
ATOM   6542   C CB   . ARG A 1 196 ? -15.245 12.408  1.864   0.016 24.87 ? 194 ARG A CB   2  
ATOM   6543   C CG   . ARG A 1 196 ? -14.589 12.564  3.230   0.016 25.77 ? 194 ARG A CG   2  
ATOM   6544   C CD   . ARG A 1 196 ? -13.643 11.417  3.543   0.016 26.11 ? 194 ARG A CD   2  
ATOM   6545   N NE   . ARG A 1 196 ? -12.407 11.412  2.744   0.016 26.86 ? 194 ARG A NE   2  
ATOM   6546   C CZ   . ARG A 1 196 ? -11.324 12.116  3.048   0.016 28.20 ? 194 ARG A CZ   2  
ATOM   6547   N NH1  . ARG A 1 196 ? -11.338 12.912  4.109   0.016 28.91 ? 194 ARG A NH1  2  
ATOM   6548   N NH2  . ARG A 1 196 ? -10.229 12.006  2.308   0.016 28.99 ? 194 ARG A NH2  2  
ATOM   6549   H H    . ARG A 1 196 ? -15.465 9.718   1.193   0.016 23.67 ? 194 ARG A H    2  
ATOM   6550   H HA   . ARG A 1 196 ? -17.064 11.590  2.377   0.016 23.51 ? 194 ARG A HA   2  
ATOM   6551   H HB2  . ARG A 1 196 ? -14.546 12.178  1.236   0.016 25.15 ? 194 ARG A HB2  2  
ATOM   6552   H HB3  . ARG A 1 196 ? -15.606 13.281  1.630   0.016 24.94 ? 194 ARG A HB3  2  
ATOM   6553   H HG2  . ARG A 1 196 ? -14.088 13.395  3.252   0.016 26.53 ? 194 ARG A HG2  2  
ATOM   6554   H HG3  . ARG A 1 196 ? -15.275 12.585  3.913   0.016 25.51 ? 194 ARG A HG3  2  
ATOM   6555   H HD2  . ARG A 1 196 ? -13.402 11.445  4.483   0.016 26.65 ? 194 ARG A HD2  2  
ATOM   6556   H HD3  . ARG A 1 196 ? -14.102 10.585  3.363   0.016 25.39 ? 194 ARG A HD3  2  
ATOM   6557   H HE   . ARG A 1 196 ? -12.491 11.195  1.917   0.016 26.51 ? 194 ARG A HE   2  
ATOM   6558   H HH11 . ARG A 1 196 ? -12.038 12.974  4.602   0.016 28.50 ? 194 ARG A HH11 2  
ATOM   6559   H HH12 . ARG A 1 196 ? -10.638 13.372  4.304   0.016 29.88 ? 194 ARG A HH12 2  
ATOM   6560   H HH21 . ARG A 1 196 ? -10.226 11.495  1.617   0.016 28.61 ? 194 ARG A HH21 2  
ATOM   6561   H HH22 . ARG A 1 196 ? -9.533  12.476  2.495   0.016 29.95 ? 194 ARG A HH22 2  
ATOM   6562   N N    . ILE A 1 197 ? -18.277 12.002  0.277   0.016 22.65 ? 195 ILE A N    2  
ATOM   6563   C CA   . ILE A 1 197 ? -18.951 12.191  -1.005  0.016 22.30 ? 195 ILE A CA   2  
ATOM   6564   C C    . ILE A 1 197 ? -19.429 13.636  -1.139  0.016 22.62 ? 195 ILE A C    2  
ATOM   6565   O O    . ILE A 1 197 ? -19.995 14.196  -0.196  0.016 22.62 ? 195 ILE A O    2  
ATOM   6566   C CB   . ILE A 1 197 ? -20.126 11.220  -1.149  0.016 21.46 ? 195 ILE A CB   2  
ATOM   6567   C CG1  . ILE A 1 197 ? -20.682 11.253  -2.557  0.016 21.34 ? 195 ILE A CG1  2  
ATOM   6568   C CG2  . ILE A 1 197 ? -21.202 11.537  -0.160  0.016 21.16 ? 195 ILE A CG2  2  
ATOM   6569   C CD1  . ILE A 1 197 ? -21.659 10.130  -2.747  0.016 20.72 ? 195 ILE A CD1  2  
ATOM   6570   H H    . ILE A 1 197 ? -18.766 12.164  0.963   0.016 22.58 ? 195 ILE A H    2  
ATOM   6571   H HA   . ILE A 1 197 ? -18.332 12.019  -1.728  0.016 22.57 ? 195 ILE A HA   2  
ATOM   6572   H HB   . ILE A 1 197 ? -19.804 10.318  -0.977  0.016 21.33 ? 195 ILE A HB   2  
ATOM   6573   H HG12 . ILE A 1 197 ? -21.132 12.098  -2.712  0.016 21.47 ? 195 ILE A HG12 2  
ATOM   6574   H HG13 . ILE A 1 197 ? -19.959 11.135  -3.192  0.016 21.67 ? 195 ILE A HG13 2  
ATOM   6575   H HG21 . ILE A 1 197 ? -21.765 12.248  -0.510  0.016 21.16 ? 195 ILE A HG21 2  
ATOM   6576   H HG22 . ILE A 1 197 ? -21.725 10.735  -0.010  0.016 20.77 ? 195 ILE A HG22 2  
ATOM   6577   H HG23 . ILE A 1 197 ? -20.802 11.832  0.664   0.016 21.47 ? 195 ILE A HG23 2  
ATOM   6578   H HD11 . ILE A 1 197 ? -22.483 10.366  -2.295  0.016 20.50 ? 195 ILE A HD11 2  
ATOM   6579   H HD12 . ILE A 1 197 ? -21.815 9.996   -3.695  0.016 20.80 ? 195 ILE A HD12 2  
ATOM   6580   H HD13 . ILE A 1 197 ? -21.292 9.322   -2.355  0.016 20.60 ? 195 ILE A HD13 2  
ATOM   6581   N N    . GLU A 1 198 ? -19.264 14.206  -2.335  0.016 22.98 ? 196 GLU A N    2  
ATOM   6582   C CA   . GLU A 1 198 ? -19.410 15.652  -2.510  0.016 23.57 ? 196 GLU A CA   2  
ATOM   6583   C C    . GLU A 1 198 ? -19.908 15.998  -3.906  0.016 23.68 ? 196 GLU A C    2  
ATOM   6584   O O    . GLU A 1 198 ? -19.298 15.634  -4.910  0.016 24.04 ? 196 GLU A O    2  
ATOM   6585   C CB   . GLU A 1 198 ? -18.103 16.389  -2.277  0.016 24.64 ? 196 GLU A CB   2  
ATOM   6586   C CG   . GLU A 1 198 ? -18.250 17.654  -1.492  0.016 25.22 ? 196 GLU A CG   2  
ATOM   6587   C CD   . GLU A 1 198 ? -18.017 17.494  0.007   0.016 25.19 ? 196 GLU A CD   2  
ATOM   6588   O OE1  . GLU A 1 198 ? -18.027 16.300  0.393   0.016 24.60 ? 196 GLU A OE1  2  
ATOM   6589   O OE2  . GLU A 1 198 ? -17.917 18.491  0.798   0.016 25.87 ? 196 GLU A OE2  2  
ATOM   6590   H H    . GLU A 1 198 ? -19.098 13.780  -3.060  0.016 22.98 ? 196 GLU A H    2  
ATOM   6591   H HA   . GLU A 1 198 ? -20.055 15.988  -1.872  0.016 23.37 ? 196 GLU A HA   2  
ATOM   6592   H HB2  . GLU A 1 198 ? -17.474 15.827  -1.805  0.016 24.70 ? 196 GLU A HB2  2  
ATOM   6593   H HB3  . GLU A 1 198 ? -17.730 16.635  -3.138  0.016 25.05 ? 196 GLU A HB3  2  
ATOM   6594   H HG2  . GLU A 1 198 ? -17.507 18.074  -1.818  0.016 26.02 ? 196 GLU A HG2  2  
ATOM   6595   H HG3  . GLU A 1 198 ? -19.049 18.168  -1.702  0.016 24.96 ? 196 GLU A HG3  2  
ATOM   6596   N N    . ILE A 1 199 ? -20.974 16.781  -3.962  0.016 23.59 ? 197 ILE A N    2  
ATOM   6597   C CA   . ILE A 1 199 ? -21.310 17.496  -5.188  0.016 24.12 ? 197 ILE A CA   2  
ATOM   6598   C C    . ILE A 1 199 ? -20.377 18.701  -5.288  0.016 25.21 ? 197 ILE A C    2  
ATOM   6599   O O    . ILE A 1 199 ? -20.427 19.618  -4.455  0.016 25.50 ? 197 ILE A O    2  
ATOM   6600   C CB   . ILE A 1 199 ? -22.784 17.910  -5.205  0.016 23.79 ? 197 ILE A CB   2  
ATOM   6601   C CG1  . ILE A 1 199 ? -23.649 16.675  -5.336  0.016 22.97 ? 197 ILE A CG1  2  
ATOM   6602   C CG2  . ILE A 1 199 ? -23.062 18.838  -6.364  0.016 24.58 ? 197 ILE A CG2  2  
ATOM   6603   C CD1  . ILE A 1 199 ? -25.126 16.898  -5.341  0.016 22.72 ? 197 ILE A CD1  2  
ATOM   6604   H H    . ILE A 1 199 ? -21.516 16.904  -3.312  0.016 23.31 ? 197 ILE A H    2  
ATOM   6605   H HA   . ILE A 1 199 ? -21.150 16.926  -5.957  0.016 24.14 ? 197 ILE A HA   2  
ATOM   6606   H HB   . ILE A 1 199 ? -22.994 18.361  -4.374  0.016 23.73 ? 197 ILE A HB   2  
ATOM   6607   H HG12 . ILE A 1 199 ? -23.416 16.218  -6.159  0.016 23.10 ? 197 ILE A HG12 2  
ATOM   6608   H HG13 . ILE A 1 199 ? -23.457 16.094  -4.581  0.016 22.55 ? 197 ILE A HG13 2  
ATOM   6609   H HG21 . ILE A 1 199 ? -23.996 19.111  -6.329  0.016 24.42 ? 197 ILE A HG21 2  
ATOM   6610   H HG22 . ILE A 1 199 ? -22.496 19.622  -6.308  0.016 25.18 ? 197 ILE A HG22 2  
ATOM   6611   H HG23 . ILE A 1 199 ? -22.889 18.357  -7.189  0.016 24.75 ? 197 ILE A HG23 2  
ATOM   6612   H HD11 . ILE A 1 199 ? -25.569 16.037  -5.288  0.016 22.26 ? 197 ILE A HD11 2  
ATOM   6613   H HD12 . ILE A 1 199 ? -25.370 17.432  -4.572  0.016 22.70 ? 197 ILE A HD12 2  
ATOM   6614   H HD13 . ILE A 1 199 ? -25.373 17.348  -6.161  0.016 23.15 ? 197 ILE A HD13 2  
ATOM   6615   N N    . LEU A 1 200 ? -19.516 18.700  -6.303  0.016 25.98 ? 198 LEU A N    2  
ATOM   6616   C CA   . LEU A 1 200 ? -18.572 19.815  -6.438  0.016 27.22 ? 198 LEU A CA   2  
ATOM   6617   C C    . LEU A 1 200 ? -19.173 20.960  -7.247  0.016 27.94 ? 198 LEU A C    2  
ATOM   6618   O O    . LEU A 1 200 ? -18.853 22.127  -6.991  0.016 28.83 ? 198 LEU A O    2  
ATOM   6619   C CB   . LEU A 1 200 ? -17.267 19.339  -7.072  0.016 27.98 ? 198 LEU A CB   2  
ATOM   6620   C CG   . LEU A 1 200 ? -16.189 18.698  -6.164  0.016 27.96 ? 198 LEU A CG   2  
ATOM   6621   C CD1  . LEU A 1 200 ? -14.805 19.092  -6.696  0.016 29.44 ? 198 LEU A CD1  2  
ATOM   6622   C CD2  . LEU A 1 200 ? -16.315 19.117  -4.693  0.016 27.72 ? 198 LEU A CD2  2  
ATOM   6623   H H    . LEU A 1 200 ? -19.458 18.095  -6.909  0.016 25.90 ? 198 LEU A H    2  
ATOM   6624   H HA   . LEU A 1 200 ? -18.387 20.178  -5.562  0.016 27.26 ? 198 LEU A HA   2  
ATOM   6625   H HB2  . LEU A 1 200 ? -17.491 18.693  -7.758  0.016 27.76 ? 198 LEU A HB2  2  
ATOM   6626   H HB3  . LEU A 1 200 ? -16.837 20.095  -7.500  0.016 28.94 ? 198 LEU A HB3  2  
ATOM   6627   H HG   . LEU A 1 200 ? -16.268 17.736  -6.213  0.016 27.34 ? 198 LEU A HG   2  
ATOM   6628   H HD11 . LEU A 1 200 ? -14.790 19.017  -7.665  0.016 29.78 ? 198 LEU A HD11 2  
ATOM   6629   H HD12 . LEU A 1 200 ? -14.611 20.001  -6.436  0.016 30.11 ? 198 LEU A HD12 2  
ATOM   6630   H HD13 . LEU A 1 200 ? -14.149 18.491  -6.304  0.016 29.45 ? 198 LEU A HD13 2  
ATOM   6631   H HD21 . LEU A 1 200 ? -17.027 18.607  -4.279  0.016 26.83 ? 198 LEU A HD21 2  
ATOM   6632   H HD22 . LEU A 1 200 ? -15.475 18.939  -4.240  0.016 28.10 ? 198 LEU A HD22 2  
ATOM   6633   H HD23 . LEU A 1 200 ? -16.512 20.060  -4.637  0.016 28.21 ? 198 LEU A HD23 2  
ATOM   6634   N N    . SER A 1 201 ? -20.010 20.654  -8.239  0.016 27.75 ? 199 SER A N    2  
ATOM   6635   C CA   . SER A 1 201 ? -20.718 21.693  -8.975  0.016 28.46 ? 199 SER A CA   2  
ATOM   6636   C C    . SER A 1 201 ? -21.958 21.118  -9.659  0.016 27.91 ? 199 SER A C    2  
ATOM   6637   O O    . SER A 1 201 ? -22.069 19.902  -9.898  0.016 27.23 ? 199 SER A O    2  
ATOM   6638   C CB   . SER A 1 201 ? -19.788 22.388  -9.978  0.016 30.01 ? 199 SER A CB   2  
ATOM   6639   O OG   . SER A 1 201 ? -19.538 21.666  -11.175 0.016 30.44 ? 199 SER A OG   2  
ATOM   6640   H H    . SER A 1 201 ? -20.174 19.860  -8.517  0.016 27.32 ? 199 SER A H    2  
ATOM   6641   H HA   . SER A 1 201 ? -21.014 22.356  -8.338  0.016 28.43 ? 199 SER A HA   2  
ATOM   6642   H HB2  . SER A 1 201 ? -20.183 23.244  -10.216 0.016 30.56 ? 199 SER A HB2  2  
ATOM   6643   H HB3  . SER A 1 201 ? -18.935 22.535  -9.539  0.016 30.33 ? 199 SER A HB3  2  
ATOM   6644   H HG   . SER A 1 201 ? -19.406 20.856  -11.000 0.016 29.85 ? 199 SER A HG   2  
ATOM   6645   N N    . HIS A 1 202 ? -22.908 22.012  -9.939  0.016 28.31 ? 200 HIS A N    2  
ATOM   6646   C CA   . HIS A 1 202 ? -24.212 21.662  -10.491 0.016 28.01 ? 200 HIS A CA   2  
ATOM   6647   C C    . HIS A 1 202 ? -24.807 22.886  -11.181 0.016 29.11 ? 200 HIS A C    2  
ATOM   6648   O O    . HIS A 1 202 ? -24.471 24.027  -10.842 0.016 29.74 ? 200 HIS A O    2  
ATOM   6649   C CB   . HIS A 1 202 ? -25.177 21.138  -9.402  0.016 26.75 ? 200 HIS A CB   2  
ATOM   6650   C CG   . HIS A 1 202 ? -25.477 22.113  -8.307  0.016 26.67 ? 200 HIS A CG   2  
ATOM   6651   N ND1  . HIS A 1 202 ? -26.605 22.908  -8.316  0.016 26.94 ? 200 HIS A ND1  2  
ATOM   6652   C CD2  . HIS A 1 202 ? -24.817 22.409  -7.163  0.016 26.49 ? 200 HIS A CD2  2  
ATOM   6653   C CE1  . HIS A 1 202 ? -26.625 23.648  -7.220  0.016 26.90 ? 200 HIS A CE1  2  
ATOM   6654   N NE2  . HIS A 1 202 ? -25.556 23.360  -6.502  0.016 26.66 ? 200 HIS A NE2  2  
ATOM   6655   H H    . HIS A 1 202 ? -22.812 22.854  -9.812  0.016 28.85 ? 200 HIS A H    2  
ATOM   6656   H HA   . HIS A 1 202 ? -24.101 20.974  -11.161 0.016 28.09 ? 200 HIS A HA   2  
ATOM   6657   H HB2  . HIS A 1 202 ? -26.022 20.917  -9.818  0.016 26.69 ? 200 HIS A HB2  2  
ATOM   6658   H HB3  . HIS A 1 202 ? -24.798 20.349  -8.990  0.016 26.14 ? 200 HIS A HB3  2  
ATOM   6659   H HD1  . HIS A 1 202 ? -27.204 22.914  -8.933  0.016 27.17 ? 200 HIS A HD1  2  
ATOM   6660   H HD2  . HIS A 1 202 ? -24.021 22.033  -6.872  0.016 26.37 ? 200 HIS A HD2  2  
ATOM   6661   H HE1  . HIS A 1 202 ? -27.273 24.267  -6.990  0.016 27.11 ? 200 HIS A HE1  2  
ATOM   6662   H HE2  . HIS A 1 202 ? -25.349 23.723  -5.751  0.016 26.70 ? 200 HIS A HE2  2  
ATOM   6663   N N    . ASP A 1 203 ? -25.662 22.644  -12.175 0.016 29.51 ? 201 ASP A N    2  
ATOM   6664   C CA   . ASP A 1 203 ? -26.467 23.751  -12.683 0.016 30.49 ? 201 ASP A CA   2  
ATOM   6665   C C    . ASP A 1 203 ? -27.754 23.858  -11.867 0.016 29.72 ? 201 ASP A C    2  
ATOM   6666   O O    . ASP A 1 203 ? -27.926 23.234  -10.821 0.016 28.52 ? 201 ASP A O    2  
ATOM   6667   C CB   . ASP A 1 203 ? -26.723 23.633  -14.187 0.016 31.69 ? 201 ASP A CB   2  
ATOM   6668   C CG   . ASP A 1 203 ? -27.421 22.366  -14.588 0.016 31.16 ? 201 ASP A CG   2  
ATOM   6669   O OD1  . ASP A 1 203 ? -27.944 21.638  -13.711 0.016 29.86 ? 201 ASP A OD1  2  
ATOM   6670   O OD2  . ASP A 1 203 ? -27.452 22.116  -15.816 0.016 32.25 ? 201 ASP A OD2  2  
ATOM   6671   H H    . ASP A 1 203 ? -25.785 21.890  -12.562 0.016 29.33 ? 201 ASP A H    2  
ATOM   6672   H HA   . ASP A 1 203 ? -25.976 24.576  -12.548 0.016 31.06 ? 201 ASP A HA   2  
ATOM   6673   H HB2  . ASP A 1 203 ? -27.278 24.374  -14.471 0.016 32.37 ? 201 ASP A HB2  2  
ATOM   6674   H HB3  . ASP A 1 203 ? -25.873 23.664  -14.650 0.016 32.33 ? 201 ASP A HB3  2  
ATOM   6675   N N    . LYS A 1 204 ? -28.663 24.714  -12.318 0.016 30.57 ? 202 LYS A N    2  
ATOM   6676   C CA   . LYS A 1 204 ? -29.531 25.390  -11.373 0.016 30.26 ? 202 LYS A CA   2  
ATOM   6677   C C    . LYS A 1 204 ? -30.503 24.418  -10.705 0.016 29.10 ? 202 LYS A C    2  
ATOM   6678   O O    . LYS A 1 204 ? -30.707 24.460  -9.481  0.016 28.33 ? 202 LYS A O    2  
ATOM   6679   C CB   . LYS A 1 204 ? -30.181 26.576  -12.122 0.016 31.66 ? 202 LYS A CB   2  
ATOM   6680   C CG   . LYS A 1 204 ? -29.130 27.225  -13.130 0.016 33.04 ? 202 LYS A CG   2  
ATOM   6681   C CD   . LYS A 1 204 ? -29.125 28.770  -13.193 0.016 34.34 ? 202 LYS A CD   2  
ATOM   6682   C CE   . LYS A 1 204 ? -27.719 29.323  -13.481 0.016 35.24 ? 202 LYS A CE   2  
ATOM   6683   N NZ   . LYS A 1 204 ? -27.550 30.690  -12.887 0.016 35.92 ? 202 LYS A NZ   2  
ATOM   6684   H H    . LYS A 1 204 ? -28.803 24.897  -13.145 0.016 31.37 ? 202 LYS A H    2  
ATOM   6685   H HA   . LYS A 1 204 ? -28.977 25.754  -10.665 0.016 30.06 ? 202 LYS A HA   2  
ATOM   6686   H HB2  . LYS A 1 204 ? -30.941 26.269  -12.639 0.016 31.85 ? 202 LYS A HB2  2  
ATOM   6687   H HB3  . LYS A 1 204 ? -30.464 27.241  -11.478 0.016 31.66 ? 202 LYS A HB3  2  
ATOM   6688   H HG2  . LYS A 1 204 ? -28.234 26.967  -12.865 0.016 32.71 ? 202 LYS A HG2  2  
ATOM   6689   H HG3  . LYS A 1 204 ? -29.307 26.894  -14.025 0.016 33.57 ? 202 LYS A HG3  2  
ATOM   6690   H HD2  . LYS A 1 204 ? -29.711 29.061  -13.911 0.016 35.18 ? 202 LYS A HD2  2  
ATOM   6691   H HD3  . LYS A 1 204 ? -29.425 29.131  -12.345 0.016 33.91 ? 202 LYS A HD3  2  
ATOM   6692   H HE2  . LYS A 1 204 ? -27.059 28.751  -13.064 0.016 34.53 ? 202 LYS A HE2  2  
ATOM   6693   H HE3  . LYS A 1 204 ? -27.572 29.361  -14.438 0.016 36.21 ? 202 LYS A HE3  2  
ATOM   6694   H HZ1  . LYS A 1 204 ? -27.962 30.721  -12.097 0.016 35.22 ? 202 LYS A HZ1  2  
ATOM   6695   H HZ2  . LYS A 1 204 ? -26.685 30.868  -12.772 0.016 36.14 ? 202 LYS A HZ2  2  
ATOM   6696   H HZ3  . LYS A 1 204 ? -27.905 31.303  -13.427 0.016 36.90 ? 202 LYS A HZ3  2  
ATOM   6697   N N    . ASP A 1 205 ? -30.979 23.423  -11.444 0.016 29.03 ? 203 ASP A N    2  
ATOM   6698   C CA   . ASP A 1 205 ? -31.744 22.366  -10.805 0.016 28.00 ? 203 ASP A CA   2  
ATOM   6699   C C    . ASP A 1 205 ? -31.157 20.994  -11.058 0.016 27.39 ? 203 ASP A C    2  
ATOM   6700   O O    . ASP A 1 205 ? -31.889 20.020  -11.175 0.016 27.13 ? 203 ASP A O    2  
ATOM   6701   C CB   . ASP A 1 205 ? -33.190 22.455  -11.230 0.016 28.56 ? 203 ASP A CB   2  
ATOM   6702   C CG   . ASP A 1 205 ? -33.898 23.613  -10.538 0.016 28.87 ? 203 ASP A CG   2  
ATOM   6703   O OD1  . ASP A 1 205 ? -33.465 24.013  -9.431  0.016 28.29 ? 203 ASP A OD1  2  
ATOM   6704   O OD2  . ASP A 1 205 ? -34.865 24.143  -11.097 0.016 29.83 ? 203 ASP A OD2  2  
ATOM   6705   H H    . ASP A 1 205 ? -30.877 23.335  -12.295 0.016 29.64 ? 203 ASP A H    2  
ATOM   6706   H HA   . ASP A 1 205 ? -31.714 22.490  -9.847  0.016 27.42 ? 203 ASP A HA   2  
ATOM   6707   H HB2  . ASP A 1 205 ? -33.229 22.597  -12.189 0.016 29.39 ? 203 ASP A HB2  2  
ATOM   6708   H HB3  . ASP A 1 205 ? -33.639 21.627  -10.996 0.016 28.04 ? 203 ASP A HB3  2  
ATOM   6709   N N    . TYR A 1 206 ? -29.843 20.935  -11.074 0.016 27.26 ? 204 TYR A N    2  
ATOM   6710   C CA   . TYR A 1 206 ? -29.088 19.707  -10.987 0.016 26.56 ? 204 TYR A CA   2  
ATOM   6711   C C    . TYR A 1 206 ? -29.329 18.829  -12.200 0.016 27.07 ? 204 TYR A C    2  
ATOM   6712   O O    . TYR A 1 206 ? -29.179 17.621  -12.133 0.016 26.49 ? 204 TYR A O    2  
ATOM   6713   C CB   . TYR A 1 206 ? -29.413 18.954  -9.692  0.016 25.33 ? 204 TYR A CB   2  
ATOM   6714   C CG   . TYR A 1 206 ? -28.977 19.611  -8.401  0.016 24.90 ? 204 TYR A CG   2  
ATOM   6715   C CD1  . TYR A 1 206 ? -29.588 20.779  -7.930  0.016 25.27 ? 204 TYR A CD1  2  
ATOM   6716   C CD2  . TYR A 1 206 ? -27.961 19.086  -7.645  0.016 24.29 ? 204 TYR A CD2  2  
ATOM   6717   C CE1  . TYR A 1 206 ? -29.170 21.374  -6.750  0.016 25.06 ? 204 TYR A CE1  2  
ATOM   6718   C CE2  . TYR A 1 206 ? -27.542 19.678  -6.460  0.016 24.11 ? 204 TYR A CE2  2  
ATOM   6719   C CZ   . TYR A 1 206 ? -28.152 20.796  -6.003  0.016 24.50 ? 204 TYR A CZ   2  
ATOM   6720   O OH   . TYR A 1 206 ? -27.679 21.352  -4.824  0.016 24.49 ? 204 TYR A OH   2  
ATOM   6721   H H    . TYR A 1 206 ? -29.342 21.631  -11.141 0.016 27.66 ? 204 TYR A H    2  
ATOM   6722   H HA   . TYR A 1 206 ? -28.144 19.932  -10.982 0.016 26.69 ? 204 TYR A HA   2  
ATOM   6723   H HB2  . TYR A 1 206 ? -30.369 18.803  -9.642  0.016 25.28 ? 204 TYR A HB2  2  
ATOM   6724   H HB3  . TYR A 1 206 ? -28.949 18.102  -9.739  0.016 24.97 ? 204 TYR A HB3  2  
ATOM   6725   H HD1  . TYR A 1 206 ? -30.278 21.152  -8.420  0.016 25.74 ? 204 TYR A HD1  2  
ATOM   6726   H HD2  . TYR A 1 206 ? -27.537 18.311  -7.939  0.016 24.09 ? 204 TYR A HD2  2  
ATOM   6727   H HE1  . TYR A 1 206 ? -29.591 22.143  -6.444  0.016 25.38 ? 204 TYR A HE1  2  
ATOM   6728   H HE2  . TYR A 1 206 ? -26.852 19.299  -5.966  0.016 23.81 ? 204 TYR A HE2  2  
ATOM   6729   H HH   . TYR A 1 206 ? -26.886 21.121  -4.682  0.016 24.38 ? 204 TYR A HH   2  
ATOM   6730   N N    . ASN A 1 207 ? -29.665 19.427  -13.333 0.016 28.32 ? 205 ASN A N    2  
ATOM   6731   C CA   . ASN A 1 207 ? -29.637 18.681  -14.581 0.016 29.14 ? 205 ASN A CA   2  
ATOM   6732   C C    . ASN A 1 207 ? -28.215 18.288  -14.970 0.016 29.34 ? 205 ASN A C    2  
ATOM   6733   O O    . ASN A 1 207 ? -28.012 17.216  -15.554 0.016 29.50 ? 205 ASN A O    2  
ATOM   6734   C CB   . ASN A 1 207 ? -30.282 19.495  -15.694 0.016 30.69 ? 205 ASN A CB   2  
ATOM   6735   C CG   . ASN A 1 207 ? -31.786 19.668  -15.505 0.016 30.74 ? 205 ASN A CG   2  
ATOM   6736   O OD1  . ASN A 1 207 ? -32.476 18.827  -14.939 0.016 29.92 ? 205 ASN A OD1  2  
ATOM   6737   N ND2  . ASN A 1 207 ? -32.288 20.773  -15.986 0.016 31.87 ? 205 ASN A ND2  2  
ATOM   6738   H H    . ASN A 1 207 ? -29.906 20.250  -13.409 0.016 28.80 ? 205 ASN A H    2  
ATOM   6739   H HA   . ASN A 1 207 ? -30.154 17.869  -14.471 0.016 28.72 ? 205 ASN A HA   2  
ATOM   6740   H HB2  . ASN A 1 207 ? -29.876 20.374  -15.709 0.016 31.10 ? 205 ASN A HB2  2  
ATOM   6741   H HB3  . ASN A 1 207 ? -30.129 19.056  -16.544 0.016 31.40 ? 205 ASN A HB3  2  
ATOM   6742   H HD21 . ASN A 1 207 ? -31.818 21.260  -16.514 0.016 32.62 ? 205 ASN A HD21 2  
ATOM   6743   H HD22 . ASN A 1 207 ? -33.089 21.009  -15.777 0.016 31.92 ? 205 ASN A HD22 2  
ATOM   6744   N N    . LYS A 1 208 ? -27.229 19.125  -14.649 0.016 29.46 ? 206 LYS A N    2  
ATOM   6745   C CA   . LYS A 1 208 ? -25.809 18.833  -14.799 0.016 29.66 ? 206 LYS A CA   2  
ATOM   6746   C C    . LYS A 1 208 ? -25.219 18.796  -13.397 0.016 28.44 ? 206 LYS A C    2  
ATOM   6747   O O    . LYS A 1 208 ? -25.408 19.744  -12.628 0.016 28.25 ? 206 LYS A O    2  
ATOM   6748   C CB   . LYS A 1 208 ? -25.069 19.906  -15.644 0.016 31.22 ? 206 LYS A CB   2  
ATOM   6749   C CG   . LYS A 1 208 ? -25.027 19.717  -17.157 0.016 32.78 ? 206 LYS A CG   2  
ATOM   6750   C CD   . LYS A 1 208 ? -23.859 20.554  -17.728 0.016 34.21 ? 206 LYS A CD   2  
ATOM   6751   C CE   . LYS A 1 208 ? -24.051 20.866  -19.081 0.016 36.23 ? 206 LYS A CE   2  
ATOM   6752   N NZ   . LYS A 1 208 ? -22.882 21.580  -19.837 0.016 37.81 ? 206 LYS A NZ   2  
ATOM   6753   H H    . LYS A 1 208 ? -27.371 19.895  -14.307 0.016 29.49 ? 206 LYS A H    2  
ATOM   6754   H HA   . LYS A 1 208 ? -25.690 17.969  -15.220 0.016 29.68 ? 206 LYS A HA   2  
ATOM   6755   H HB2  . LYS A 1 208 ? -25.491 20.758  -15.472 0.016 31.46 ? 206 LYS A HB2  2  
ATOM   6756   H HB3  . LYS A 1 208 ? -24.147 19.952  -15.348 0.016 31.15 ? 206 LYS A HB3  2  
ATOM   6757   H HG2  . LYS A 1 208 ? -24.884 18.780  -17.372 0.016 32.54 ? 206 LYS A HG2  2  
ATOM   6758   H HG3  . LYS A 1 208 ? -25.860 20.027  -17.545 0.016 33.26 ? 206 LYS A HG3  2  
ATOM   6759   H HD2  . LYS A 1 208 ? -23.787 21.390  -17.244 0.016 34.13 ? 206 LYS A HD2  2  
ATOM   6760   H HD3  . LYS A 1 208 ? -23.034 20.048  -17.665 0.016 34.09 ? 206 LYS A HD3  2  
ATOM   6761   H HE2  . LYS A 1 208 ? -24.168 20.004  -19.489 0.016 36.43 ? 206 LYS A HE2  2  
ATOM   6762   H HE3  . LYS A 1 208 ? -24.870 21.370  -19.201 0.016 36.47 ? 206 LYS A HE3  2  
ATOM   6763   H HZ1  . LYS A 1 208 ? -22.108 21.230  -19.574 0.016 37.50 ? 206 LYS A HZ1  2  
ATOM   6764   H HZ2  . LYS A 1 208 ? -22.956 21.499  -20.721 0.016 39.00 ? 206 LYS A HZ2  2  
ATOM   6765   H HZ3  . LYS A 1 208 ? -22.876 22.445  -19.624 0.016 37.99 ? 206 LYS A HZ3  2  
ATOM   6766   N N    . VAL A 1 209 ? -24.527 17.707  -13.053 0.016 27.75 ? 207 VAL A N    2  
ATOM   6767   C CA   . VAL A 1 209 ? -23.929 17.539  -11.732 0.016 26.73 ? 207 VAL A CA   2  
ATOM   6768   C C    . VAL A 1 209 ? -22.546 16.922  -11.894 0.016 26.97 ? 207 VAL A C    2  
ATOM   6769   O O    . VAL A 1 209 ? -22.381 15.954  -12.645 0.016 27.19 ? 207 VAL A O    2  
ATOM   6770   C CB   . VAL A 1 209 ? -24.797 16.642  -10.822 0.016 25.46 ? 207 VAL A CB   2  
ATOM   6771   C CG1  . VAL A 1 209 ? -24.091 16.252  -9.545  0.016 24.61 ? 207 VAL A CG1  2  
ATOM   6772   C CG2  . VAL A 1 209 ? -26.115 17.308  -10.518 0.016 25.32 ? 207 VAL A CG2  2  
ATOM   6773   H H    . VAL A 1 209 ? -24.380 17.054  -13.586 0.016 27.94 ? 207 VAL A H    2  
ATOM   6774   H HA   . VAL A 1 209 ? -23.828 18.399  -11.304 0.016 26.86 ? 207 VAL A HA   2  
ATOM   6775   H HB   . VAL A 1 209 ? -24.986 15.814  -11.297 0.016 25.42 ? 207 VAL A HB   2  
ATOM   6776   H HG11 . VAL A 1 209 ? -24.709 15.722  -9.017  0.016 23.94 ? 207 VAL A HG11 2  
ATOM   6777   H HG12 . VAL A 1 209 ? -23.303 15.726  -9.740  0.016 24.70 ? 207 VAL A HG12 2  
ATOM   6778   H HG13 . VAL A 1 209 ? -23.854 17.050  -9.051  0.016 24.73 ? 207 VAL A HG13 2  
ATOM   6779   H HG21 . VAL A 1 209 ? -26.457 16.974  -9.674  0.016 24.58 ? 207 VAL A HG21 2  
ATOM   6780   H HG22 . VAL A 1 209 ? -25.971 18.264  -10.465 0.016 25.74 ? 207 VAL A HG22 2  
ATOM   6781   H HG23 . VAL A 1 209 ? -26.737 17.111  -11.235 0.016 25.67 ? 207 VAL A HG23 2  
ATOM   6782   N N    . ARG A 1 210 ? -21.571 17.464  -11.174 0.016 27.03 ? 208 ARG A N    2  
ATOM   6783   C CA   . ARG A 1 210 ? -20.249 16.862  -11.044 0.016 27.19 ? 208 ARG A CA   2  
ATOM   6784   C C    . ARG A 1 210 ? -20.108 16.351  -9.620  0.016 26.06 ? 208 ARG A C    2  
ATOM   6785   O O    . ARG A 1 210 ? -20.345 17.083  -8.658  0.016 25.76 ? 208 ARG A O    2  
ATOM   6786   C CB   . ARG A 1 210 ? -19.144 17.865  -11.383 0.016 28.50 ? 208 ARG A CB   2  
ATOM   6787   C CG   . ARG A 1 210 ? -17.743 17.295  -11.193 0.016 28.84 ? 208 ARG A CG   2  
ATOM   6788   C CD   . ARG A 1 210 ? -16.724 18.137  -11.986 0.016 30.55 ? 208 ARG A CD   2  
ATOM   6789   N NE   . ARG A 1 210 ? -16.959 18.039  -13.427 0.016 31.52 ? 208 ARG A NE   2  
ATOM   6790   C CZ   . ARG A 1 210 ? -16.431 18.837  -14.362 0.016 33.19 ? 208 ARG A CZ   2  
ATOM   6791   N NH1  . ARG A 1 210 ? -15.646 19.863  -14.033 0.016 34.10 ? 208 ARG A NH1  2  
ATOM   6792   N NH2  . ARG A 1 210 ? -16.699 18.618  -15.650 0.016 34.14 ? 208 ARG A NH2  2  
ATOM   6793   H H    . ARG A 1 210 ? -21.651 18.202  -10.744 0.016 27.08 ? 208 ARG A H    2  
ATOM   6794   H HA   . ARG A 1 210 ? -20.173 16.112  -11.653 0.016 27.31 ? 208 ARG A HA   2  
ATOM   6795   H HB2  . ARG A 1 210 ? -19.245 18.130  -12.309 0.016 29.30 ? 208 ARG A HB2  2  
ATOM   6796   H HB3  . ARG A 1 210 ? -19.226 18.635  -10.804 0.016 28.47 ? 208 ARG A HB3  2  
ATOM   6797   H HG2  . ARG A 1 210 ? -17.503 17.301  -10.256 0.016 28.36 ? 208 ARG A HG2  2  
ATOM   6798   H HG3  . ARG A 1 210 ? -17.725 16.387  -11.532 0.016 28.62 ? 208 ARG A HG3  2  
ATOM   6799   H HD2  . ARG A 1 210 ? -16.807 19.065  -11.722 0.016 30.86 ? 208 ARG A HD2  2  
ATOM   6800   H HD3  . ARG A 1 210 ? -15.831 17.814  -11.800 0.016 30.83 ? 208 ARG A HD3  2  
ATOM   6801   H HE   . ARG A 1 210 ? -17.528 17.452  -13.692 0.016 31.07 ? 208 ARG A HE   2  
ATOM   6802   H HH11 . ARG A 1 210 ? -15.457 20.015  -13.208 0.016 33.62 ? 208 ARG A HH11 2  
ATOM   6803   H HH12 . ARG A 1 210 ? -15.322 20.369  -14.649 0.016 35.26 ? 208 ARG A HH12 2  
ATOM   6804   H HH21 . ARG A 1 210 ? -17.210 17.966  -15.879 0.016 33.66 ? 208 ARG A HH21 2  
ATOM   6805   H HH22 . ARG A 1 210 ? -16.374 19.140  -16.251 0.016 35.31 ? 208 ARG A HH22 2  
ATOM   6806   N N    . LEU A 1 211 ? -19.754 15.075  -9.486  0.016 25.57 ? 209 LEU A N    2  
ATOM   6807   C CA   . LEU A 1 211 ? -19.812 14.387  -8.212  0.016 24.54 ? 209 LEU A CA   2  
ATOM   6808   C C    . LEU A 1 211 ? -18.473 13.723  -7.962  0.016 24.79 ? 209 LEU A C    2  
ATOM   6809   O O    . LEU A 1 211 ? -17.922 13.101  -8.870  0.016 25.31 ? 209 LEU A O    2  
ATOM   6810   C CB   . LEU A 1 211 ? -20.933 13.348  -8.237  0.016 23.69 ? 209 LEU A CB   2  
ATOM   6811   C CG   . LEU A 1 211 ? -21.085 12.412  -7.052  0.016 22.75 ? 209 LEU A CG   2  
ATOM   6812   C CD1  . LEU A 1 211 ? -21.460 13.165  -5.776  0.016 22.38 ? 209 LEU A CD1  2  
ATOM   6813   C CD2  . LEU A 1 211 ? -22.151 11.364  -7.392  0.016 22.25 ? 209 LEU A CD2  2  
ATOM   6814   H H    . LEU A 1 211 ? -19.472 14.589  -10.134 0.016 25.90 ? 209 LEU A H    2  
ATOM   6815   H HA   . LEU A 1 211 ? -19.978 15.016  -7.496  0.016 24.38 ? 209 LEU A HA   2  
ATOM   6816   H HB2  . LEU A 1 211 ? -21.777 13.812  -8.331  0.016 23.60 ? 209 LEU A HB2  2  
ATOM   6817   H HB3  . LEU A 1 211 ? -20.793 12.798  -9.021  0.016 23.98 ? 209 LEU A HB3  2  
ATOM   6818   H HG   . LEU A 1 211 ? -20.245 11.956  -6.896  0.016 22.86 ? 209 LEU A HG   2  
ATOM   6819   H HD11 . LEU A 1 211 ? -21.752 14.056  -6.012  0.016 22.69 ? 209 LEU A HD11 2  
ATOM   6820   H HD12 . LEU A 1 211 ? -22.170 12.689  -5.315  0.016 21.84 ? 209 LEU A HD12 2  
ATOM   6821   H HD13 . LEU A 1 211 ? -20.675 13.203  -5.209  0.016 22.49 ? 209 LEU A HD13 2  
ATOM   6822   H HD21 . LEU A 1 211 ? -22.136 10.680  -6.707  0.016 21.77 ? 209 LEU A HD21 2  
ATOM   6823   H HD22 . LEU A 1 211 ? -23.017 11.797  -7.411  0.016 22.15 ? 209 LEU A HD22 2  
ATOM   6824   H HD23 . LEU A 1 211 ? -21.962 10.988  -8.262  0.016 22.63 ? 209 LEU A HD23 2  
ATOM   6825   N N    . TYR A 1 212 ? -17.975 13.851  -6.733  0.016 24.56 ? 210 TYR A N    2  
ATOM   6826   C CA   . TYR A 1 212 ? -16.679 13.344  -6.319  0.016 24.95 ? 210 TYR A CA   2  
ATOM   6827   C C    . TYR A 1 212 ? -16.816 12.472  -5.077  0.016 24.12 ? 210 TYR A C    2  
ATOM   6828   O O    . TYR A 1 212 ? -17.634 12.736  -4.191  0.016 23.53 ? 210 TYR A O    2  
ATOM   6829   C CB   . TYR A 1 212 ? -15.738 14.490  -6.017  0.016 25.95 ? 210 TYR A CB   2  
ATOM   6830   C CG   . TYR A 1 212 ? -14.441 14.058  -5.417  0.016 26.49 ? 210 TYR A CG   2  
ATOM   6831   C CD1  . TYR A 1 212 ? -14.281 14.018  -4.045  0.016 26.27 ? 210 TYR A CD1  2  
ATOM   6832   C CD2  . TYR A 1 212 ? -13.389 13.695  -6.211  0.016 27.39 ? 210 TYR A CD2  2  
ATOM   6833   C CE1  . TYR A 1 212 ? -13.097 13.651  -3.487  0.016 26.95 ? 210 TYR A CE1  2  
ATOM   6834   C CE2  . TYR A 1 212 ? -12.200 13.320  -5.664  0.016 28.03 ? 210 TYR A CE2  2  
ATOM   6835   C CZ   . TYR A 1 212 ? -12.053 13.299  -4.306  0.016 27.81 ? 210 TYR A CZ   2  
ATOM   6836   O OH   . TYR A 1 212 ? -10.834 12.915  -3.792  0.016 28.64 ? 210 TYR A OH   2  
ATOM   6837   H H    . TYR A 1 212 ? -18.396 14.233  -6.091  0.016 24.25 ? 210 TYR A H    2  
ATOM   6838   H HA   . TYR A 1 212 ? -16.297 12.810  -7.031  0.016 25.27 ? 210 TYR A HA   2  
ATOM   6839   H HB2  . TYR A 1 212 ? -15.559 14.973  -6.834  0.016 26.60 ? 210 TYR A HB2  2  
ATOM   6840   H HB3  . TYR A 1 212 ? -16.168 15.070  -5.373  0.016 25.71 ? 210 TYR A HB3  2  
ATOM   6841   H HD1  . TYR A 1 212 ? -14.986 14.269  -3.496  0.016 25.78 ? 210 TYR A HD1  2  
ATOM   6842   H HD2  . TYR A 1 212 ? -13.487 13.717  -7.133  0.016 27.67 ? 210 TYR A HD2  2  
ATOM   6843   H HE1  . TYR A 1 212 ? -13.005 13.637  -2.565  0.016 26.92 ? 210 TYR A HE1  2  
ATOM   6844   H HE2  . TYR A 1 212 ? -11.490 13.079  -6.209  0.016 28.72 ? 210 TYR A HE2  2  
ATOM   6845   H HH   . TYR A 1 212 ? -10.797 13.092  -2.973  0.016 28.65 ? 210 TYR A HH   2  
ATOM   6846   N N    . GLU A 1 213 ? -15.982 11.439  -5.015  0.016 24.24 ? 211 GLU A N    2  
ATOM   6847   C CA   . GLU A 1 213 ? -15.978 10.489  -3.919  0.016 23.66 ? 211 GLU A CA   2  
ATOM   6848   C C    . GLU A 1 213 ? -14.552 10.059  -3.642  0.016 24.41 ? 211 GLU A C    2  
ATOM   6849   O O    . GLU A 1 213 ? -13.797 9.813   -4.576  0.016 25.09 ? 211 GLU A O    2  
ATOM   6850   C CB   . GLU A 1 213 ? -16.780 9.257   -4.288  0.016 22.89 ? 211 GLU A CB   2  
ATOM   6851   C CG   . GLU A 1 213 ? -17.833 8.843   -3.330  0.016 22.04 ? 211 GLU A CG   2  
ATOM   6852   C CD   . GLU A 1 213 ? -17.246 7.884   -2.350  0.016 21.98 ? 211 GLU A CD   2  
ATOM   6853   O OE1  . GLU A 1 213 ? -16.139 8.238   -1.875  0.016 22.64 ? 211 GLU A OE1  2  
ATOM   6854   O OE2  . GLU A 1 213 ? -17.827 6.773   -2.110  0.016 21.45 ? 211 GLU A OE2  2  
ATOM   6855   H H    . GLU A 1 213 ? -15.394 11.266  -5.617  0.016 24.74 ? 211 GLU A H    2  
ATOM   6856   H HA   . GLU A 1 213 ? -16.358 10.896  -3.126  0.016 23.43 ? 211 GLU A HA   2  
ATOM   6857   H HB2  . GLU A 1 213 ? -17.176 9.376   -5.154  0.016 22.92 ? 211 GLU A HB2  2  
ATOM   6858   H HB3  . GLU A 1 213 ? -16.152 8.519   -4.340  0.016 23.07 ? 211 GLU A HB3  2  
ATOM   6859   H HG2  . GLU A 1 213 ? -18.184 9.621   -2.861  0.016 22.02 ? 211 GLU A HG2  2  
ATOM   6860   H HG3  . GLU A 1 213 ? -18.543 8.384   -3.799  0.016 21.67 ? 211 GLU A HG3  2  
ATOM   6861   N N    . HIS A 1 214 ? -14.208 9.938   -2.367  0.016 24.43 ? 212 HIS A N    2  
ATOM   6862   C CA   . HIS A 1 214 ? -12.982 9.275   -1.962  0.016 25.11 ? 212 HIS A CA   2  
ATOM   6863   C C    . HIS A 1 214 ? -13.287 8.349   -0.799  0.016 24.58 ? 212 HIS A C    2  
ATOM   6864   O O    . HIS A 1 214 ? -14.117 8.672   0.053   0.016 24.12 ? 212 HIS A O    2  
ATOM   6865   C CB   . HIS A 1 214 ? -11.889 10.258  -1.579  0.016 26.31 ? 212 HIS A CB   2  
ATOM   6866   C CG   . HIS A 1 214 ? -10.635 9.582   -1.133  0.016 27.17 ? 212 HIS A CG   2  
ATOM   6867   N ND1  . HIS A 1 214 ? -10.346 9.377   0.198   0.016 27.46 ? 212 HIS A ND1  2  
ATOM   6868   C CD2  . HIS A 1 214 ? -9.626  9.007   -1.830  0.016 27.90 ? 212 HIS A CD2  2  
ATOM   6869   C CE1  . HIS A 1 214 ? -9.187  8.760   0.300   0.016 28.36 ? 212 HIS A CE1  2  
ATOM   6870   N NE2  . HIS A 1 214 ? -8.743  8.504   -0.915  0.016 28.60 ? 212 HIS A NE2  2  
ATOM   6871   H H    . HIS A 1 214 ? -14.670 10.238  -1.711  0.016 24.15 ? 212 HIS A H    2  
ATOM   6872   H HA   . HIS A 1 214 ? -12.661 8.745   -2.700  0.016 25.26 ? 212 HIS A HA   2  
ATOM   6873   H HB2  . HIS A 1 214 ? -11.686 10.820  -2.340  0.016 26.73 ? 212 HIS A HB2  2  
ATOM   6874   H HB3  . HIS A 1 214 ? -12.205 10.799  -0.839  0.016 26.24 ? 212 HIS A HB3  2  
ATOM   6875   H HD1  . HIS A 1 214 ? -10.824 9.659   0.857   0.016 27.23 ? 212 HIS A HD1  2  
ATOM   6876   H HD2  . HIS A 1 214 ? -9.539  8.958   -2.747  0.016 28.01 ? 212 HIS A HD2  2  
ATOM   6877   H HE1  . HIS A 1 214 ? -8.771  8.518   1.095   0.016 28.82 ? 212 HIS A HE1  2  
ATOM   6878   H HE2  . HIS A 1 214 ? -8.009  8.098   -1.104  0.016 29.20 ? 212 HIS A HE2  2  
ATOM   6879   N N    . ALA A 1 215 ? -12.654 7.175   -0.806  0.016 24.75 ? 213 ALA A N    2  
ATOM   6880   C CA   . ALA A 1 215 ? -12.997 6.111   0.124   0.016 24.31 ? 213 ALA A CA   2  
ATOM   6881   C C    . ALA A 1 215 ? -11.762 5.290   0.454   0.016 25.14 ? 213 ALA A C    2  
ATOM   6882   O O    . ALA A 1 215 ? -10.954 4.993   -0.431  0.016 25.68 ? 213 ALA A O    2  
ATOM   6883   C CB   . ALA A 1 215 ? -14.079 5.203   -0.464  0.016 23.35 ? 213 ALA A CB   2  
ATOM   6884   H H    . ALA A 1 215 ? -12.018 6.977   -1.348  0.016 25.20 ? 213 ALA A H    2  
ATOM   6885   H HA   . ALA A 1 215 ? -13.328 6.509   0.945   0.016 24.24 ? 213 ALA A HA   2  
ATOM   6886   H HB1  . ALA A 1 215 ? -14.905 5.709   -0.523  0.016 22.89 ? 213 ALA A HB1  2  
ATOM   6887   H HB2  . ALA A 1 215 ? -13.813 4.909   -1.347  0.016 23.48 ? 213 ALA A HB2  2  
ATOM   6888   H HB3  . ALA A 1 215 ? -14.202 4.444   0.123   0.016 23.20 ? 213 ALA A HB3  2  
ATOM   6889   N N    . GLU A 1 216 ? -11.623 4.941   1.721   0.016 25.39 ? 214 GLU A N    2  
ATOM   6890   C CA   . GLU A 1 216 ? -10.508 4.101   2.149   0.016 26.27 ? 214 GLU A CA   2  
ATOM   6891   C C    . GLU A 1 216 ? -11.002 3.042   3.129   0.016 25.98 ? 214 GLU A C    2  
ATOM   6892   O O    . GLU A 1 216 ? -11.846 3.316   3.985   0.016 25.63 ? 214 GLU A O    2  
ATOM   6893   C CB   . GLU A 1 216 ? -9.399  4.912   2.816   0.016 27.59 ? 214 GLU A CB   2  
ATOM   6894   C CG   . GLU A 1 216 ? -8.645  5.817   1.884   0.016 28.27 ? 214 GLU A CG   2  
ATOM   6895   C CD   . GLU A 1 216 ? -7.171  5.988   2.273   0.016 29.92 ? 214 GLU A CD   2  
ATOM   6896   O OE1  . GLU A 1 216 ? -6.501  6.792   1.616   0.016 30.72 ? 214 GLU A OE1  2  
ATOM   6897   O OE2  . GLU A 1 216 ? -6.683  5.317   3.213   0.016 30.55 ? 214 GLU A OE2  2  
ATOM   6898   H H    . GLU A 1 216 ? -12.157 5.167   2.353   0.016 25.16 ? 214 GLU A H    2  
ATOM   6899   H HA   . GLU A 1 216 ? -10.127 3.661   1.373   0.016 26.38 ? 214 GLU A HA   2  
ATOM   6900   H HB2  . GLU A 1 216 ? -9.801  5.459   3.510   0.016 27.55 ? 214 GLU A HB2  2  
ATOM   6901   H HB3  . GLU A 1 216 ? -8.763  4.291   3.210   0.016 28.19 ? 214 GLU A HB3  2  
ATOM   6902   H HG2  . GLU A 1 216 ? -8.691  5.456   0.987   0.016 27.98 ? 214 GLU A HG2  2  
ATOM   6903   H HG3  . GLU A 1 216 ? -9.058  6.692   1.911   0.016 28.08 ? 214 GLU A HG3  2  
ATOM   6904   N N    . ALA A 1 217 ? -10.456 1.829   3.014   0.016 26.27 ? 215 ALA A N    2  
ATOM   6905   C CA   . ALA A 1 217 ? -10.759 0.772   3.961   0.016 26.28 ? 215 ALA A CA   2  
ATOM   6906   C C    . ALA A 1 217 ? -9.665  0.619   5.013   0.016 27.61 ? 215 ALA A C    2  
ATOM   6907   O O    . ALA A 1 217 ? -8.492  0.949   4.773   0.016 28.57 ? 215 ALA A O    2  
ATOM   6908   C CB   . ALA A 1 217 ? -10.930 -0.569  3.230   0.016 25.89 ? 215 ALA A CB   2  
ATOM   6909   H H    . ALA A 1 217 ? -9.917  1.598   2.386   0.016 26.52 ? 215 ALA A H    2  
ATOM   6910   H HA   . ALA A 1 217 ? -11.593 0.979   4.408   0.016 25.80 ? 215 ALA A HA   2  
ATOM   6911   H HB1  . ALA A 1 217 ? -11.089 -1.264  3.886   0.016 26.01 ? 215 ALA A HB1  2  
ATOM   6912   H HB2  . ALA A 1 217 ? -11.682 -0.502  2.623   0.016 25.14 ? 215 ALA A HB2  2  
ATOM   6913   H HB3  . ALA A 1 217 ? -10.124 -0.764  2.731   0.016 26.39 ? 215 ALA A HB3  2  
ATOM   6914   N N    . ARG A 1 218 ? -10.068 0.153   6.205   0.016 27.83 ? 216 ARG A N    2  
ATOM   6915   C CA   . ARG A 1 218 ? -9.122  -0.388  7.179   0.016 29.18 ? 216 ARG A CA   2  
ATOM   6916   C C    . ARG A 1 218 ? -9.896  -1.162  8.250   0.016 29.20 ? 216 ARG A C    2  
ATOM   6917   O O    . ARG A 1 218 ? -11.111 -1.305  8.172   0.016 28.18 ? 216 ARG A O    2  
ATOM   6918   C CB   . ARG A 1 218 ? -8.241  0.715   7.791   0.016 30.42 ? 216 ARG A CB   2  
ATOM   6919   C CG   . ARG A 1 218 ? -6.781  0.187   8.042   0.016 31.98 ? 216 ARG A CG   2  
ATOM   6920   C CD   . ARG A 1 218 ? -5.773  1.259   8.519   0.016 33.47 ? 216 ARG A CD   2  
ATOM   6921   N NE   . ARG A 1 218 ? -6.219  1.990   9.721   0.016 34.03 ? 216 ARG A NE   2  
ATOM   6922   C CZ   . ARG A 1 218 ? -5.693  3.135   10.144  0.016 35.14 ? 216 ARG A CZ   2  
ATOM   6923   N NH1  . ARG A 1 218 ? -4.676  3.699   9.497   0.016 35.83 ? 216 ARG A NH1  2  
ATOM   6924   N NH2  . ARG A 1 218 ? -6.180  3.718   11.232  0.016 35.72 ? 216 ARG A NH2  2  
ATOM   6925   H H    . ARG A 1 218 ? -10.884 0.140   6.468   0.016 27.30 ? 216 ARG A H    2  
ATOM   6926   H HA   . ARG A 1 218 ? -8.540  -1.011  6.720   0.016 29.44 ? 216 ARG A HA   2  
ATOM   6927   H HB2  . ARG A 1 218 ? -8.195  1.460   7.174   0.016 30.13 ? 216 ARG A HB2  2  
ATOM   6928   H HB3  . ARG A 1 218 ? -8.625  1.004   8.633   0.016 30.64 ? 216 ARG A HB3  2  
ATOM   6929   H HG2  . ARG A 1 218 ? -6.802  -0.517  8.712   0.016 32.38 ? 216 ARG A HG2  2  
ATOM   6930   H HG3  . ARG A 1 218 ? -6.435  -0.175  7.210   0.016 31.80 ? 216 ARG A HG3  2  
ATOM   6931   H HD2  . ARG A 1 218 ? -4.942  0.820   8.755   0.016 34.49 ? 216 ARG A HD2  2  
ATOM   6932   H HD3  . ARG A 1 218 ? -5.616  1.878   7.787   0.016 33.19 ? 216 ARG A HD3  2  
ATOM   6933   H HE   . ARG A 1 218 ? -6.726  1.566   10.276  0.016 33.85 ? 216 ARG A HE   2  
ATOM   6934   H HH11 . ARG A 1 218 ? -4.353  3.336   8.787   0.016 35.56 ? 216 ARG A HH11 2  
ATOM   6935   H HH12 . ARG A 1 218 ? -4.345  4.439   9.784   0.016 36.63 ? 216 ARG A HH12 2  
ATOM   6936   H HH21 . ARG A 1 218 ? -6.830  3.356   11.663  0.016 35.39 ? 216 ARG A HH21 2  
ATOM   6937   H HH22 . ARG A 1 218 ? -5.835  4.453   11.516  0.016 36.52 ? 216 ARG A HH22 2  
ATOM   6938   N N    . TYR A 1 219 ? -9.181  -1.713  9.235   0.016 30.53 ? 217 TYR A N    2  
ATOM   6939   C CA   . TYR A 1 219 ? -9.900  -2.247  10.401  0.016 30.86 ? 217 TYR A CA   2  
ATOM   6940   C C    . TYR A 1 219 ? -10.088 -1.092  11.356  0.016 31.49 ? 217 TYR A C    2  
ATOM   6941   O O    . TYR A 1 219 ? -9.179  -0.290  11.516  0.016 32.44 ? 217 TYR A O    2  
ATOM   6942   C CB   . TYR A 1 219 ? -9.170  -3.394  11.108  0.016 32.16 ? 217 TYR A CB   2  
ATOM   6943   C CG   . TYR A 1 219 ? -8.472  -4.354  10.203  0.016 32.14 ? 217 TYR A CG   2  
ATOM   6944   C CD1  . TYR A 1 219 ? -7.091  -4.385  10.170  0.016 33.43 ? 217 TYR A CD1  2  
ATOM   6945   C CD2  . TYR A 1 219 ? -9.174  -5.260  9.408   0.016 31.03 ? 217 TYR A CD2  2  
ATOM   6946   C CE1  . TYR A 1 219 ? -6.435  -5.210  9.370   0.016 33.56 ? 217 TYR A CE1  2  
ATOM   6947   C CE2  . TYR A 1 219 ? -8.484  -6.141  8.586   0.016 31.20 ? 217 TYR A CE2  2  
ATOM   6948   C CZ   . TYR A 1 219 ? -7.115  -6.089  8.573   0.016 32.46 ? 217 TYR A CZ   2  
ATOM   6949   O OH   . TYR A 1 219 ? -6.409  -6.944  7.766   0.016 32.79 ? 217 TYR A OH   2  
ATOM   6950   H H    . TYR A 1 219 ? -8.326  -1.795  9.255   0.016 31.32 ? 217 TYR A H    2  
ATOM   6951   H HA   . TYR A 1 219 ? -10.776 -2.571  10.151  0.016 29.96 ? 217 TYR A HA   2  
ATOM   6952   H HB2  . TYR A 1 219 ? -8.503  -3.017  11.701  0.016 33.25 ? 217 TYR A HB2  2  
ATOM   6953   H HB3  . TYR A 1 219 ? -9.820  -3.894  11.624  0.016 32.11 ? 217 TYR A HB3  2  
ATOM   6954   H HD1  . TYR A 1 219 ? -6.613  -3.782  10.694  0.016 34.29 ? 217 TYR A HD1  2  
ATOM   6955   H HD2  . TYR A 1 219 ? -10.101 -5.269  9.420   0.016 30.27 ? 217 TYR A HD2  2  
ATOM   6956   H HE1  . TYR A 1 219 ? -5.505  -5.201  9.358   0.016 34.52 ? 217 TYR A HE1  2  
ATOM   6957   H HE2  . TYR A 1 219 ? -8.937  -6.740  8.039   0.016 30.57 ? 217 TYR A HE2  2  
ATOM   6958   H HH   . TYR A 1 219 ? -5.629  -7.045  8.065   0.016 33.78 ? 217 TYR A HH   2  
HETATM 6959   O O    . HOH B 2 .   ? -30.053 5.945   10.963  0.016 24.56 ? 301 HOH A O    2  
HETATM 6960   O O    . HOH B 2 .   ? -15.682 8.551   6.716   0.016 25.18 ? 302 HOH A O    2  
HETATM 6961   O O    . HOH B 2 .   ? -26.488 -11.069 6.071   0.016 25.75 ? 303 HOH A O    2  
HETATM 6962   O O    . HOH B 2 .   ? -20.571 -11.686 -1.726  0.016 24.28 ? 304 HOH A O    2  
HETATM 6963   O O    . HOH B 2 .   ? -29.452 9.016   15.298  0.016 29.09 ? 305 HOH A O    2  
HETATM 6964   O O    . HOH B 2 .   ? -24.264 20.931  -21.447 0.016 38.98 ? 306 HOH A O    2  
HETATM 6965   O O    . HOH B 2 .   ? -24.980 -5.283  -16.838 0.016 30.65 ? 307 HOH A O    2  
HETATM 6966   O O    . HOH B 2 .   ? -32.507 12.951  12.941  0.016 27.72 ? 308 HOH A O    2  
HETATM 6967   O O    . HOH B 2 .   ? -43.388 4.099   4.133   0.016 28.41 ? 309 HOH A O    2  
HETATM 6968   O O    . HOH B 2 .   ? -6.983  -8.146  -2.250  0.016 29.71 ? 310 HOH A O    2  
HETATM 6969   O O    . HOH B 2 .   ? -10.016 -12.087 8.250   0.016 31.60 ? 311 HOH A O    2  
HETATM 6970   O O    . HOH B 2 .   ? -34.313 4.927   9.028   0.016 24.46 ? 312 HOH A O    2  
HETATM 6971   O O    . HOH B 2 .   ? -13.489 -12.362 -10.407 0.016 30.05 ? 313 HOH A O    2  
HETATM 6972   O O    . HOH B 2 .   ? -38.131 4.657   5.436   0.016 24.62 ? 314 HOH A O    2  
HETATM 6973   O O    . HOH B 2 .   ? -34.603 22.301  -8.176  0.016 26.89 ? 315 HOH A O    2  
HETATM 6974   O O    . HOH B 2 .   ? -44.719 6.272   4.312   0.016 29.24 ? 316 HOH A O    2  
HETATM 6975   O O    . HOH B 2 .   ? -42.676 4.095   -12.437 0.016 32.23 ? 317 HOH A O    2  
HETATM 6976   O O    . HOH B 2 .   ? -28.698 19.681  -2.022  0.016 22.99 ? 318 HOH A O    2  
HETATM 6977   O O    . HOH B 2 .   ? -29.713 -2.825  -11.502 0.016 25.41 ? 319 HOH A O    2  
HETATM 6978   O O    . HOH B 2 .   ? -6.558  -5.951  -11.508 0.016 33.55 ? 320 HOH A O    2  
HETATM 6979   O O    . HOH B 2 .   ? -22.835 3.307   10.369  0.016 24.16 ? 321 HOH A O    2  
HETATM 6980   O O    . HOH B 2 .   ? -27.776 18.946  13.009  0.016 29.78 ? 322 HOH A O    2  
HETATM 6981   O O    . HOH B 2 .   ? -32.951 18.114  -12.362 0.016 27.40 ? 323 HOH A O    2  
HETATM 6982   O O    . HOH B 2 .   ? -4.489  -3.588  -1.400  0.016 31.38 ? 324 HOH A O    2  
HETATM 6983   O O    . HOH B 2 .   ? -32.399 17.853  -7.655  0.016 24.07 ? 325 HOH A O    2  
HETATM 6984   O O    . HOH B 2 .   ? -36.234 22.413  -9.854  0.016 28.45 ? 326 HOH A O    2  
HETATM 6985   O O    . HOH B 2 .   ? -21.425 10.669  10.905  0.016 25.96 ? 327 HOH A O    2  
HETATM 6986   O O    . HOH B 2 .   ? -31.186 7.326   -1.162  0.016 19.92 ? 328 HOH A O    2  
HETATM 6987   O O    . HOH B 2 .   ? -18.774 5.076   -9.101  0.016 23.20 ? 329 HOH A O    2  
HETATM 6988   O O    . HOH B 2 .   ? -17.407 -7.262  -17.156 0.016 32.63 ? 330 HOH A O    2  
HETATM 6989   O O    . HOH B 2 .   ? -27.982 0.211   8.168   0.016 22.72 ? 331 HOH A O    2  
HETATM 6990   O O    . HOH B 2 .   ? -14.405 9.421   -18.703 0.016 35.19 ? 332 HOH A O    2  
HETATM 6991   O O    . HOH B 2 .   ? -23.219 1.967   -9.505  0.016 22.37 ? 333 HOH A O    2  
HETATM 6992   O O    . HOH B 2 .   ? -31.956 19.201  -1.439  0.016 22.95 ? 334 HOH A O    2  
HETATM 6993   O O    . HOH B 2 .   ? -32.774 22.387  9.941   0.016 29.00 ? 335 HOH A O    2  
HETATM 6994   O O    . HOH B 2 .   ? -25.087 18.304  -2.084  0.016 22.78 ? 336 HOH A O    2  
HETATM 6995   O O    . HOH B 2 .   ? -17.189 21.508  -12.378 0.016 32.73 ? 337 HOH A O    2  
HETATM 6996   O O    . HOH B 2 .   ? -40.462 14.613  6.840   0.016 27.02 ? 338 HOH A O    2  
HETATM 6997   O O    . HOH B 2 .   ? -38.016 13.419  3.390   0.016 23.82 ? 339 HOH A O    2  
HETATM 6998   O O    . HOH B 2 .   ? -16.288 -11.829 -10.277 0.016 28.59 ? 340 HOH A O    2  
HETATM 6999   O O    . HOH B 2 .   ? -9.656  -12.170 -9.144  0.016 31.39 ? 341 HOH A O    2  
HETATM 7000   O O    . HOH B 2 .   ? -35.284 15.423  -18.930 0.016 34.28 ? 342 HOH A O    2  
HETATM 7001   O O    . HOH B 2 .   ? -23.252 -3.313  -16.485 0.016 29.51 ? 343 HOH A O    2  
HETATM 7002   O O    . HOH B 2 .   ? -35.217 -0.482  -7.296  0.016 24.37 ? 344 HOH A O    2  
HETATM 7003   O O    . HOH B 2 .   ? -40.896 3.094   -8.140  0.016 27.82 ? 345 HOH A O    2  
HETATM 7004   O O    . HOH B 2 .   ? -11.833 -1.823  -4.141  0.016 25.01 ? 346 HOH A O    2  
HETATM 7005   O O    . HOH B 2 .   ? -38.630 4.931   -14.537 0.016 30.66 ? 347 HOH A O    2  
HETATM 7006   O O    . HOH B 2 .   ? -45.580 10.290  -0.284  0.016 28.95 ? 348 HOH A O    2  
HETATM 7007   O O    . HOH B 2 .   ? -24.360 -0.015  3.111   0.016 20.26 ? 349 HOH A O    2  
HETATM 7008   O O    . HOH B 2 .   ? -20.182 11.042  2.527   0.016 21.82 ? 350 HOH A O    2  
HETATM 7009   O O    . HOH B 2 .   ? -33.486 -3.942  -10.069 0.016 26.38 ? 351 HOH A O    2  
HETATM 7010   O O    . HOH B 2 .   ? -28.123 7.367   10.624  0.016 24.14 ? 352 HOH A O    2  
HETATM 7011   O O    . HOH B 2 .   ? -32.103 23.647  -7.118  0.016 26.63 ? 353 HOH A O    2  
HETATM 7012   O O    . HOH B 2 .   ? -5.851  -6.550  -0.770  0.016 30.34 ? 354 HOH A O    2  
HETATM 7013   O O    . HOH B 2 .   ? -27.596 15.434  -13.142 0.016 26.50 ? 355 HOH A O    2  
HETATM 7014   O O    . HOH B 2 .   ? -14.916 -17.531 -2.757  0.016 29.35 ? 356 HOH A O    2  
HETATM 7015   O O    . HOH B 2 .   ? -39.754 14.559  1.303   0.016 24.61 ? 357 HOH A O    2  
HETATM 7016   O O    . HOH B 2 .   ? -10.372 -10.673 -3.114  0.016 28.00 ? 358 HOH A O    2  
HETATM 7017   O O    . HOH B 2 .   ? -13.195 -6.291  0.268   0.016 24.59 ? 359 HOH A O    2  
HETATM 7018   O O    . HOH B 2 .   ? -24.593 14.227  -2.560  0.016 21.18 ? 360 HOH A O    2  
HETATM 7019   O O    . HOH B 2 .   ? -11.090 -15.588 -8.206  0.016 31.75 ? 361 HOH A O    2  
HETATM 7020   O O    . HOH B 2 .   ? -25.202 20.460  -3.958  0.016 24.18 ? 362 HOH A O    2  
HETATM 7021   O O    . HOH B 2 .   ? -39.146 20.912  -4.645  0.016 26.64 ? 363 HOH A O    2  
HETATM 7022   O O    . HOH B 2 .   ? -33.343 24.048  -2.627  0.016 25.88 ? 364 HOH A O    2  
HETATM 7023   O O    . HOH B 2 .   ? -6.522  -3.453  -3.791  0.016 29.49 ? 365 HOH A O    2  
HETATM 7024   O O    . HOH B 2 .   ? -40.909 12.024  -15.560 0.016 32.99 ? 366 HOH A O    2  
HETATM 7025   O O    . HOH B 2 .   ? -32.027 17.843  13.119  0.016 29.49 ? 367 HOH A O    2  
HETATM 7026   O O    . HOH B 2 .   ? -22.408 17.402  -1.653  0.016 23.08 ? 368 HOH A O    2  
HETATM 7027   O O    . HOH B 2 .   ? -7.389  12.006  -10.786 0.016 34.67 ? 369 HOH A O    2  
HETATM 7028   O O    . HOH B 2 .   ? -9.041  -8.313  -10.992 0.016 31.61 ? 370 HOH A O    2  
HETATM 7029   O O    . HOH B 2 .   ? -32.398 0.137   4.901   0.016 22.25 ? 371 HOH A O    2  
HETATM 7030   O O    . HOH B 2 .   ? -19.274 14.467  8.628   0.016 26.42 ? 372 HOH A O    2  
HETATM 7031   O O    . HOH B 2 .   ? -44.492 2.411   -13.921 0.016 35.90 ? 373 HOH A O    2  
HETATM 7032   O O    . HOH B 2 .   ? -17.223 -17.418 -2.685  0.016 28.61 ? 374 HOH A O    2  
HETATM 7033   O O    . HOH B 2 .   ? -19.190 -17.487 -1.043  0.016 28.18 ? 375 HOH A O    2  
HETATM 7034   O O    . HOH B 2 .   ? -22.738 14.978  -0.379  0.016 21.87 ? 376 HOH A O    2  
HETATM 7035   O O    . HOH B 2 .   ? -14.454 -13.874 5.500   0.016 28.43 ? 377 HOH A O    2  
HETATM 7036   O O    . HOH B 2 .   ? -26.767 12.438  12.408  0.016 26.63 ? 378 HOH A O    2  
HETATM 7037   O O    . HOH B 2 .   ? -27.031 -8.847  -3.768  0.016 23.42 ? 379 HOH A O    2  
HETATM 7038   O O    . HOH B 2 .   ? -16.206 7.598   -19.474 0.016 34.66 ? 380 HOH A O    2  
HETATM 7039   O O    . HOH B 2 .   ? -28.950 25.534  -7.434  0.016 28.03 ? 381 HOH A O    2  
HETATM 7040   O O    . HOH B 2 .   ? -40.585 3.476   -13.467 0.016 31.45 ? 382 HOH A O    2  
HETATM 7041   O O    . HOH B 2 .   ? -27.124 21.232  8.885   0.016 27.57 ? 383 HOH A O    2  
HETATM 7042   O O    . HOH B 2 .   ? -41.477 5.855   -7.398  0.016 27.32 ? 384 HOH A O    2  
HETATM 7043   O O    . HOH B 2 .   ? -30.675 18.730  -4.956  0.016 23.14 ? 385 HOH A O    2  
HETATM 7044   O O    . HOH B 2 .   ? -12.384 -16.639 1.170   0.016 29.78 ? 386 HOH A O    2  
HETATM 7045   O O    . HOH B 2 .   ? -38.834 13.283  -19.929 0.016 37.01 ? 387 HOH A O    2  
HETATM 7046   O O    . HOH B 2 .   ? -34.764 22.695  6.294   0.016 27.19 ? 388 HOH A O    2  
HETATM 7047   O O    . HOH B 2 .   ? -3.899  0.892   -3.424  0.016 32.39 ? 389 HOH A O    2  
HETATM 7048   O O    . HOH B 2 .   ? -37.705 8.575   -17.876 0.016 33.43 ? 390 HOH A O    2  
HETATM 7049   O O    . HOH B 2 .   ? -33.662 0.687   9.423   0.016 25.15 ? 391 HOH A O    2  
HETATM 7050   O O    . HOH B 2 .   ? -32.200 0.248   -14.821 0.016 28.38 ? 392 HOH A O    2  
HETATM 7051   O O    . HOH B 2 .   ? -25.930 -15.236 2.402   0.016 27.12 ? 393 HOH A O    2  
HETATM 7052   O O    . HOH B 2 .   ? -5.691  -9.884  2.253   0.016 31.68 ? 394 HOH A O    2  
HETATM 7053   O O    . HOH B 2 .   ? -35.131 21.748  -16.523 0.016 33.66 ? 395 HOH A O    2  
HETATM 7054   O O    . HOH B 2 .   ? -21.953 20.480  -12.898 0.016 29.90 ? 396 HOH A O    2  
HETATM 7055   O O    . HOH B 2 .   ? -28.788 24.108  -4.051  0.016 25.92 ? 397 HOH A O    2  
HETATM 7056   O O    . HOH B 2 .   ? -22.715 17.055  -16.202 0.016 30.99 ? 398 HOH A O    2  
HETATM 7057   O O    . HOH B 2 .   ? -43.174 10.644  -14.156 0.016 33.38 ? 399 HOH A O    2  
HETATM 7058   O O    . HOH B 2 .   ? -5.466  -5.448  -18.678 0.016 41.71 ? 400 HOH A O    2  
HETATM 7059   O O    . HOH B 2 .   ? -22.091 24.777  -8.820  0.016 29.96 ? 401 HOH A O    2  
HETATM 7060   O O    . HOH B 2 .   ? -16.005 -19.046 -9.412  0.016 32.80 ? 402 HOH A O    2  
HETATM 7061   O O    . HOH B 2 .   ? -30.238 20.415  -3.345  0.016 23.61 ? 403 HOH A O    2  
HETATM 7062   O O    . HOH B 2 .   ? -6.604  -0.541  -3.554  0.016 29.32 ? 404 HOH A O    2  
HETATM 7063   O O    . HOH B 2 .   ? -17.090 -14.776 -3.854  0.016 27.06 ? 405 HOH A O    2  
HETATM 7064   O O    . HOH B 2 .   ? -34.991 0.504   -15.625 0.016 30.54 ? 406 HOH A O    2  
HETATM 7065   O O    . HOH B 2 .   ? -18.095 4.892   -4.815  0.016 21.62 ? 407 HOH A O    2  
HETATM 7066   O O    . HOH B 2 .   ? -15.035 -11.771 9.549   0.016 29.50 ? 408 HOH A O    2  
HETATM 7067   O O    . HOH B 2 .   ? -33.227 15.175  -25.119 0.016 42.95 ? 409 HOH A O    2  
HETATM 7068   O O    . HOH B 2 .   ? -9.956  0.431   14.564  0.016 34.82 ? 410 HOH A O    2  
HETATM 7069   O O    . HOH B 2 .   ? -16.849 19.965  -1.880  0.016 27.34 ? 411 HOH A O    2  
HETATM 7070   O O    . HOH B 2 .   ? -18.830 -14.651 8.904   0.016 29.47 ? 412 HOH A O    2  
HETATM 7071   O O    . HOH B 2 .   ? -39.373 13.325  -12.007 0.016 28.68 ? 413 HOH A O    2  
HETATM 7072   O O    . HOH B 2 .   ? -28.001 -6.266  3.229   0.016 22.52 ? 414 HOH A O    2  
HETATM 7073   O O    . HOH B 2 .   ? -17.494 -10.623 9.085   0.016 27.72 ? 415 HOH A O    2  
HETATM 7074   O O    . HOH B 2 .   ? -38.801 20.373  4.713   0.016 26.82 ? 416 HOH A O    2  
HETATM 7075   O O    . HOH B 2 .   ? -26.906 -8.314  -6.207  0.016 23.91 ? 417 HOH A O    2  
HETATM 7076   O O    . HOH B 2 .   ? -32.637 -0.665  7.624   0.016 23.90 ? 418 HOH A O    2  
HETATM 7077   O O    . HOH B 2 .   ? -24.137 -1.533  -18.371 0.016 31.25 ? 419 HOH A O    2  
HETATM 7078   O O    . HOH B 2 .   ? -4.801  9.578   -10.091 0.016 35.75 ? 420 HOH A O    2  
HETATM 7079   O O    . HOH B 2 .   ? -31.534 28.044  3.602   0.016 29.20 ? 421 HOH A O    2  
HETATM 7080   O O    . HOH B 2 .   ? -23.969 26.537  -8.421  0.016 30.35 ? 422 HOH A O    2  
HETATM 7081   O O    . HOH B 2 .   ? -15.226 -10.696 -18.077 0.016 35.98 ? 423 HOH A O    2  
HETATM 7082   O O    . HOH B 2 .   ? -29.288 -8.736  1.149   0.016 23.79 ? 424 HOH A O    2  
HETATM 7083   O O    . HOH B 2 .   ? -23.673 -18.836 8.112   0.016 31.90 ? 425 HOH A O    2  
HETATM 7084   O O    . HOH B 2 .   ? -15.819 21.226  -10.092 0.016 31.89 ? 426 HOH A O    2  
HETATM 7085   O O    . HOH B 2 .   ? -4.941  -11.110 3.740   0.016 33.23 ? 427 HOH A O    2  
HETATM 7086   O O    . HOH B 2 .   ? -35.588 25.259  6.013   0.016 28.82 ? 428 HOH A O    2  
HETATM 7087   O O    . HOH B 2 .   ? -12.509 -0.860  13.733  0.016 31.89 ? 429 HOH A O    2  
HETATM 7088   O O    . HOH B 2 .   ? -39.949 10.323  -18.135 0.016 35.23 ? 430 HOH A O    2  
HETATM 7089   O O    . HOH B 2 .   ? -13.340 1.502   11.307  0.016 29.01 ? 431 HOH A O    2  
HETATM 7090   O O    . HOH B 2 .   ? -5.692  -5.211  -5.648  0.016 31.04 ? 432 HOH A O    2  
HETATM 7091   O O    . HOH B 2 .   ? -33.774 -3.148  6.932   0.016 24.90 ? 433 HOH A O    2  
HETATM 7092   O O    . HOH B 2 .   ? -30.274 -3.661  -15.709 0.016 29.89 ? 434 HOH A O    2  
HETATM 7093   O O    . HOH B 2 .   ? -2.082  -0.146  -4.772  0.016 34.73 ? 435 HOH A O    2  
ATOM   7094   N N    . SER A 1 6   ? -2.389  -4.742  -14.555 0.016 38.78 ? 2   SER A N    3  
ATOM   7095   C CA   . SER A 1 6   ? -2.610  -6.072  -13.985 0.016 38.79 ? 2   SER A CA   3  
ATOM   7096   C C    . SER A 1 6   ? -4.067  -6.339  -13.610 0.016 37.13 ? 2   SER A C    3  
ATOM   7097   O O    . SER A 1 6   ? -4.296  -7.099  -12.682 0.016 36.08 ? 2   SER A O    3  
ATOM   7098   C CB   . SER A 1 6   ? -1.738  -6.252  -12.741 0.016 39.04 ? 2   SER A CB   3  
ATOM   7099   O OG   . SER A 1 6   ? -0.423  -6.642  -13.100 0.016 41.09 ? 2   SER A OG   3  
ATOM   7100   H HA   . SER A 1 6   ? -2.348  -6.740  -14.637 0.016 39.95 ? 2   SER A HA   3  
ATOM   7101   H HB2  . SER A 1 6   ? -1.689  -5.406  -12.268 0.016 38.52 ? 2   SER A HB2  3  
ATOM   7102   H HB3  . SER A 1 6   ? -2.125  -6.924  -12.161 0.016 38.48 ? 2   SER A HB3  3  
ATOM   7103   H HG   . SER A 1 6   ? -0.435  -7.428  -13.394 0.016 41.64 ? 2   SER A HG   3  
ATOM   7104   N N    . VAL A 1 7   ? -5.008  -5.697  -14.327 0.016 37.06 ? 3   VAL A N    3  
ATOM   7105   C CA   . VAL A 1 7   ? -6.470  -5.896  -14.197 0.016 35.98 ? 3   VAL A CA   3  
ATOM   7106   C C    . VAL A 1 7   ? -7.214  -4.599  -13.862 0.016 34.95 ? 3   VAL A C    3  
ATOM   7107   O O    . VAL A 1 7   ? -7.881  -4.019  -14.736 0.016 35.44 ? 3   VAL A O    3  
ATOM   7108   C CB   . VAL A 1 7   ? -6.917  -6.903  -13.117 0.016 34.75 ? 3   VAL A CB   3  
ATOM   7109   C CG1  . VAL A 1 7   ? -8.457  -6.778  -12.886 0.016 33.42 ? 3   VAL A CG1  3  
ATOM   7110   C CG2  . VAL A 1 7   ? -6.574  -8.389  -13.478 0.016 35.87 ? 3   VAL A CG2  3  
ATOM   7111   H H    . VAL A 1 7   ? -4.806  -5.108  -14.920 0.016 37.76 ? 3   VAL A H    3  
ATOM   7112   H HA   . VAL A 1 7   ? -6.822  -6.216  -15.042 0.016 36.87 ? 3   VAL A HA   3  
ATOM   7113   H HB   . VAL A 1 7   ? -6.484  -6.676  -12.280 0.016 34.18 ? 3   VAL A HB   3  
ATOM   7114   H HG11 . VAL A 1 7   ? -8.785  -7.618  -12.526 0.016 33.00 ? 3   VAL A HG11 3  
ATOM   7115   H HG12 . VAL A 1 7   ? -8.639  -6.071  -12.253 0.016 32.55 ? 3   VAL A HG12 3  
ATOM   7116   H HG13 . VAL A 1 7   ? -8.898  -6.603  -13.734 0.016 34.00 ? 3   VAL A HG13 3  
ATOM   7117   H HG21 . VAL A 1 7   ? -7.035  -8.965  -12.848 0.016 35.25 ? 3   VAL A HG21 3  
ATOM   7118   H HG22 . VAL A 1 7   ? -6.883  -8.579  -14.378 0.016 36.98 ? 3   VAL A HG22 3  
ATOM   7119   H HG23 . VAL A 1 7   ? -5.628  -8.564  -13.426 0.016 36.17 ? 3   VAL A HG23 3  
ATOM   7120   N N    . ILE A 1 8   ? -7.177  -4.160  -12.611 0.016 33.69 ? 4   ILE A N    3  
ATOM   7121   C CA   . ILE A 1 8   ? -7.675  -2.849  -12.233 0.016 32.99 ? 4   ILE A CA   3  
ATOM   7122   C C    . ILE A 1 8   ? -6.501  -1.907  -12.459 0.016 34.09 ? 4   ILE A C    3  
ATOM   7123   O O    . ILE A 1 8   ? -5.475  -2.011  -11.782 0.016 34.46 ? 4   ILE A O    3  
ATOM   7124   C CB   . ILE A 1 8   ? -8.174  -2.824  -10.780 0.016 31.22 ? 4   ILE A CB   3  
ATOM   7125   C CG1  . ILE A 1 8   ? -9.312  -3.829  -10.539 0.016 30.27 ? 4   ILE A CG1  3  
ATOM   7126   C CG2  . ILE A 1 8   ? -8.667  -1.449  -10.383 0.016 30.67 ? 4   ILE A CG2  3  
ATOM   7127   C CD1  . ILE A 1 8   ? -10.497 -3.682  -11.436 0.016 30.35 ? 4   ILE A CD1  3  
ATOM   7128   H H    . ILE A 1 8   ? -6.860  -4.610  -11.952 0.016 33.31 ? 4   ILE A H    3  
ATOM   7129   H HA   . ILE A 1 8   ? -8.393  -2.585  -12.822 0.016 33.16 ? 4   ILE A HA   3  
ATOM   7130   H HB   . ILE A 1 8   ? -7.431  -3.069  -10.208 0.016 31.16 ? 4   ILE A HB   3  
ATOM   7131   H HG12 . ILE A 1 8   ? -8.972  -4.729  -10.644 0.016 30.66 ? 4   ILE A HG12 3  
ATOM   7132   H HG13 . ILE A 1 8   ? -9.626  -3.709  -9.631  0.016 29.29 ? 4   ILE A HG13 3  
ATOM   7133   H HG21 . ILE A 1 8   ? -8.086  -0.767  -10.752 0.016 31.14 ? 4   ILE A HG21 3  
ATOM   7134   H HG22 . ILE A 1 8   ? -9.571  -1.320  -10.710 0.016 31.05 ? 4   ILE A HG22 3  
ATOM   7135   H HG23 . ILE A 1 8   ? -8.665  -1.397  -9.414  0.016 29.60 ? 4   ILE A HG23 3  
ATOM   7136   H HD11 . ILE A 1 8   ? -10.215 -3.456  -12.333 0.016 31.43 ? 4   ILE A HD11 3  
ATOM   7137   H HD12 . ILE A 1 8   ? -10.976 -4.525  -11.448 0.016 29.91 ? 4   ILE A HD12 3  
ATOM   7138   H HD13 . ILE A 1 8   ? -11.069 -2.983  -11.082 0.016 29.87 ? 4   ILE A HD13 3  
ATOM   7139   N N    . LYS A 1 9   ? -6.631  -1.028  -13.455 0.016 34.71 ? 5   LYS A N    3  
ATOM   7140   C CA   . LYS A 1 9   ? -5.521  -0.210  -13.909 0.016 36.21 ? 5   LYS A CA   3  
ATOM   7141   C C    . LYS A 1 9   ? -5.421  1.083   -13.108 0.016 35.62 ? 5   LYS A C    3  
ATOM   7142   O O    . LYS A 1 9   ? -6.304  1.400   -12.309 0.016 34.03 ? 5   LYS A O    3  
ATOM   7143   C CB   . LYS A 1 9   ? -5.676  0.119   -15.397 0.016 37.70 ? 5   LYS A CB   3  
ATOM   7144   C CG   . LYS A 1 9   ? -4.703  -0.626  -16.316 0.016 39.66 ? 5   LYS A CG   3  
ATOM   7145   C CD   . LYS A 1 9   ? -4.748  -2.150  -16.093 0.016 39.23 ? 5   LYS A CD   3  
ATOM   7146   C CE   . LYS A 1 9   ? -5.256  -2.933  -17.318 0.016 40.96 ? 5   LYS A CE   3  
ATOM   7147   N NZ   . LYS A 1 9   ? -5.413  -4.409  -17.034 0.016 40.96 ? 5   LYS A NZ   3  
ATOM   7148   H H    . LYS A 1 9   ? -7.361  -0.897  -13.889 0.016 34.39 ? 5   LYS A H    3  
ATOM   7149   H HA   . LYS A 1 9   ? -4.698  -0.708  -13.788 0.016 36.85 ? 5   LYS A HA   3  
ATOM   7150   H HB2  . LYS A 1 9   ? -6.576  -0.106  -15.678 0.016 37.22 ? 5   LYS A HB2  3  
ATOM   7151   H HB3  . LYS A 1 9   ? -5.529  1.069   -15.522 0.016 38.03 ? 5   LYS A HB3  3  
ATOM   7152   H HG2  . LYS A 1 9   ? -4.938  -0.448  -17.240 0.016 40.60 ? 5   LYS A HG2  3  
ATOM   7153   H HG3  . LYS A 1 9   ? -3.800  -0.319  -16.135 0.016 40.36 ? 5   LYS A HG3  3  
ATOM   7154   H HD2  . LYS A 1 9   ? -3.850  -2.459  -15.893 0.016 39.21 ? 5   LYS A HD2  3  
ATOM   7155   H HD3  . LYS A 1 9   ? -5.342  -2.348  -15.351 0.016 37.98 ? 5   LYS A HD3  3  
ATOM   7156   H HE2  . LYS A 1 9   ? -6.117  -2.584  -17.590 0.016 40.81 ? 5   LYS A HE2  3  
ATOM   7157   H HE3  . LYS A 1 9   ? -4.617  -2.834  -18.040 0.016 42.34 ? 5   LYS A HE3  3  
ATOM   7158   H HZ1  . LYS A 1 9   ? -5.910  -4.526  -16.306 0.016 39.72 ? 5   LYS A HZ1  3  
ATOM   7159   H HZ2  . LYS A 1 9   ? -5.807  -4.814  -17.721 0.016 41.92 ? 5   LYS A HZ2  3  
ATOM   7160   H HZ3  . LYS A 1 9   ? -4.616  -4.781  -16.900 0.016 41.35 ? 5   LYS A HZ3  3  
ATOM   7161   N N    . PRO A 1 10  ? -4.318  1.817   -13.275 0.016 37.04 ? 6   PRO A N    3  
ATOM   7162   C CA   . PRO A 1 10  ? -4.171  3.093   -12.565 0.016 36.76 ? 6   PRO A CA   3  
ATOM   7163   C C    . PRO A 1 10  ? -5.322  4.031   -12.849 0.016 35.73 ? 6   PRO A C    3  
ATOM   7164   O O    . PRO A 1 10  ? -5.791  4.719   -11.940 0.016 34.66 ? 6   PRO A O    3  
ATOM   7165   C CB   . PRO A 1 10  ? -2.833  3.631   -13.098 0.016 38.93 ? 6   PRO A CB   3  
ATOM   7166   C CG   . PRO A 1 10  ? -2.114  2.411   -13.561 0.016 39.99 ? 6   PRO A CG   3  
ATOM   7167   C CD   . PRO A 1 10  ? -3.160  1.541   -14.137 0.016 39.13 ? 6   PRO A CD   3  
ATOM   7168   H HA   . PRO A 1 10  ? -4.099  2.944   -11.609 0.016 36.14 ? 6   PRO A HA   3  
ATOM   7169   H HB2  . PRO A 1 10  ? -2.992  4.234   -13.840 0.016 39.51 ? 6   PRO A HB2  3  
ATOM   7170   H HB3  . PRO A 1 10  ? -2.337  4.071   -12.389 0.016 39.08 ? 6   PRO A HB3  3  
ATOM   7171   H HG2  . PRO A 1 10  ? -1.458  2.652   -14.234 0.016 41.51 ? 6   PRO A HG2  3  
ATOM   7172   H HG3  . PRO A 1 10  ? -1.692  1.977   -12.803 0.016 39.75 ? 6   PRO A HG3  3  
ATOM   7173   H HD2  . PRO A 1 10  ? -3.344  1.799   -15.055 0.016 39.91 ? 6   PRO A HD2  3  
ATOM   7174   H HD3  . PRO A 1 10  ? -2.901  0.609   -14.073 0.016 39.22 ? 6   PRO A HD3  3  
ATOM   7175   N N    . GLU A 1 11  ? -5.802  4.043   -14.084 0.016 36.18 ? 7   GLU A N    3  
ATOM   7176   C CA   . GLU A 1 11  ? -6.895  4.890   -14.512 0.016 35.28 ? 7   GLU A CA   3  
ATOM   7177   C C    . GLU A 1 11  ? -8.037  4.009   -14.978 0.016 34.78 ? 7   GLU A C    3  
ATOM   7178   O O    . GLU A 1 11  ? -7.820  3.029   -15.694 0.016 35.96 ? 7   GLU A O    3  
ATOM   7179   C CB   . GLU A 1 11  ? -6.466  5.819   -15.634 0.016 36.68 ? 7   GLU A CB   3  
ATOM   7180   C CG   . GLU A 1 11  ? -5.781  7.061   -15.162 0.016 37.45 ? 7   GLU A CG   3  
ATOM   7181   C CD   . GLU A 1 11  ? -6.140  8.244   -16.034 0.016 38.56 ? 7   GLU A CD   3  
ATOM   7182   O OE1  . GLU A 1 11  ? -6.304  8.028   -17.252 0.016 39.69 ? 7   GLU A OE1  3  
ATOM   7183   O OE2  . GLU A 1 11  ? -6.282  9.361   -15.507 0.016 38.37 ? 7   GLU A OE2  3  
ATOM   7184   H H    . GLU A 1 11  ? -5.499  3.544   -14.713 0.016 37.12 ? 7   GLU A H    3  
ATOM   7185   H HA   . GLU A 1 11  ? -7.205  5.423   -13.766 0.016 34.19 ? 7   GLU A HA   3  
ATOM   7186   H HB2  . GLU A 1 11  ? -5.854  5.345   -16.216 0.016 37.87 ? 7   GLU A HB2  3  
ATOM   7187   H HB3  . GLU A 1 11  ? -7.256  6.085   -16.128 0.016 36.10 ? 7   GLU A HB3  3  
ATOM   7188   H HG2  . GLU A 1 11  ? -6.058  7.252   -14.252 0.016 36.40 ? 7   GLU A HG2  3  
ATOM   7189   H HG3  . GLU A 1 11  ? -4.820  6.932   -15.200 0.016 38.45 ? 7   GLU A HG3  3  
ATOM   7190   N N    . MET A 1 12  ? -9.244  4.337   -14.548 0.016 33.24 ? 8   MET A N    3  
ATOM   7191   C CA   . MET A 1 12  ? -10.431 3.661   -15.032 0.016 32.99 ? 8   MET A CA   3  
ATOM   7192   C C    . MET A 1 12  ? -11.493 4.686   -15.366 0.016 32.55 ? 8   MET A C    3  
ATOM   7193   O O    . MET A 1 12  ? -11.833 5.526   -14.534 0.016 31.55 ? 8   MET A O    3  
ATOM   7194   C CB   . MET A 1 12  ? -10.956 2.679   -14.003 0.016 31.66 ? 8   MET A CB   3  
ATOM   7195   C CG   . MET A 1 12  ? -10.036 1.489   -13.763 0.016 32.07 ? 8   MET A CG   3  
ATOM   7196   S SD   . MET A 1 12  ? -9.875  0.365   -15.160 0.016 34.10 ? 8   MET A SD   3  
ATOM   7197   C CE   . MET A 1 12  ? -10.218 -1.175  -14.286 0.016 33.57 ? 8   MET A CE   3  
ATOM   7198   H H    . MET A 1 12  ? -9.403  4.947   -13.965 0.016 32.40 ? 8   MET A H    3  
ATOM   7199   H HA   . MET A 1 12  ? -10.206 3.167   -15.830 0.016 34.14 ? 8   MET A HA   3  
ATOM   7200   H HB2  . MET A 1 12  ? -11.059 3.140   -13.156 0.016 30.64 ? 8   MET A HB2  3  
ATOM   7201   H HB3  . MET A 1 12  ? -11.813 2.343   -14.309 0.016 31.60 ? 8   MET A HB3  3  
ATOM   7202   H HG2  . MET A 1 12  ? -9.148  1.817   -13.553 0.016 32.17 ? 8   MET A HG2  3  
ATOM   7203   H HG3  . MET A 1 12  ? -10.375 0.975   -13.017 0.016 31.21 ? 8   MET A HG3  3  
ATOM   7204   H HE1  . MET A 1 12  ? -9.910  -1.918  -14.828 0.016 34.71 ? 8   MET A HE1  3  
ATOM   7205   H HE2  . MET A 1 12  ? -9.749  -1.164  -13.440 0.016 32.92 ? 8   MET A HE2  3  
ATOM   7206   H HE3  . MET A 1 12  ? -11.171 -1.245  -14.127 0.016 32.96 ? 8   MET A HE3  3  
ATOM   7207   N N    . LYS A 1 13  ? -11.990 4.624   -16.594 0.016 33.43 ? 9   LYS A N    3  
ATOM   7208   C CA   . LYS A 1 13  ? -13.184 5.354   -16.973 0.016 33.16 ? 9   LYS A CA   3  
ATOM   7209   C C    . LYS A 1 13  ? -14.426 4.771   -16.284 0.016 31.61 ? 9   LYS A C    3  
ATOM   7210   O O    . LYS A 1 13  ? -14.409 3.679   -15.704 0.016 31.16 ? 9   LYS A O    3  
ATOM   7211   C CB   . LYS A 1 13  ? -13.351 5.312   -18.498 0.016 34.99 ? 9   LYS A CB   3  
ATOM   7212   C CG   . LYS A 1 13  ? -12.341 6.148   -19.249 0.016 36.71 ? 9   LYS A CG   3  
ATOM   7213   C CD   . LYS A 1 13  ? -12.718 6.355   -20.715 0.016 38.83 ? 9   LYS A CD   3  
ATOM   7214   C CE   . LYS A 1 13  ? -11.636 7.152   -21.412 0.016 40.60 ? 9   LYS A CE   3  
ATOM   7215   N NZ   . LYS A 1 13  ? -12.097 8.040   -22.526 0.016 42.92 ? 9   LYS A NZ   3  
ATOM   7216   H H    . LYS A 1 13  ? -11.645 4.170   -17.236 0.016 34.31 ? 9   LYS A H    3  
ATOM   7217   H HA   . LYS A 1 13  ? -13.086 6.277   -16.697 0.016 32.95 ? 9   LYS A HA   3  
ATOM   7218   H HB2  . LYS A 1 13  ? -13.245 4.397   -18.795 0.016 35.37 ? 9   LYS A HB2  3  
ATOM   7219   H HB3  . LYS A 1 13  ? -14.238 5.636   -18.724 0.016 34.85 ? 9   LYS A HB3  3  
ATOM   7220   H HG2  . LYS A 1 13  ? -12.289 7.021   -18.828 0.016 36.43 ? 9   LYS A HG2  3  
ATOM   7221   H HG3  . LYS A 1 13  ? -11.475 5.712   -19.219 0.016 36.88 ? 9   LYS A HG3  3  
ATOM   7222   H HD2  . LYS A 1 13  ? -12.805 5.497   -21.155 0.016 39.26 ? 9   LYS A HD2  3  
ATOM   7223   H HD3  . LYS A 1 13  ? -13.546 6.854   -20.774 0.016 38.81 ? 9   LYS A HD3  3  
ATOM   7224   H HE2  . LYS A 1 13  ? -11.205 7.715   -20.750 0.016 40.03 ? 9   LYS A HE2  3  
ATOM   7225   H HE3  . LYS A 1 13  ? -10.991 6.528   -21.784 0.016 40.91 ? 9   LYS A HE3  3  
ATOM   7226   H HZ1  . LYS A 1 13  ? -11.477 8.078   -23.163 0.016 43.94 ? 9   LYS A HZ1  3  
ATOM   7227   H HZ2  . LYS A 1 13  ? -12.852 7.723   -22.874 0.016 43.54 ? 9   LYS A HZ2  3  
ATOM   7228   H HZ3  . LYS A 1 13  ? -12.244 8.862   -22.218 0.016 42.78 ? 9   LYS A HZ3  3  
ATOM   7229   N N    . ILE A 1 14  ? -15.519 5.531   -16.352 0.016 30.93 ? 10  ILE A N    3  
ATOM   7230   C CA   . ILE A 1 14  ? -16.828 5.127   -15.855 0.016 29.66 ? 10  ILE A CA   3  
ATOM   7231   C C    . ILE A 1 14  ? -17.884 5.573   -16.852 0.016 30.30 ? 10  ILE A C    3  
ATOM   7232   O O    . ILE A 1 14  ? -17.900 6.742   -17.259 0.016 30.97 ? 10  ILE A O    3  
ATOM   7233   C CB   . ILE A 1 14  ? -17.160 5.768   -14.494 0.016 28.18 ? 10  ILE A CB   3  
ATOM   7234   C CG1  . ILE A 1 14  ? -16.031 5.625   -13.491 0.016 27.83 ? 10  ILE A CG1  3  
ATOM   7235   C CG2  . ILE A 1 14  ? -18.441 5.185   -13.938 0.016 27.00 ? 10  ILE A CG2  3  
ATOM   7236   C CD1  . ILE A 1 14  ? -16.248 6.505   -12.272 0.016 27.02 ? 10  ILE A CD1  3  
ATOM   7237   H H    . ILE A 1 14  ? -15.518 6.323   -16.688 0.016 31.28 ? 10  ILE A H    3  
ATOM   7238   H HA   . ILE A 1 14  ? -16.865 4.164   -15.766 0.016 29.46 ? 10  ILE A HA   3  
ATOM   7239   H HB   . ILE A 1 14  ? -17.301 6.712   -14.649 0.016 28.39 ? 10  ILE A HB   3  
ATOM   7240   H HG12 . ILE A 1 14  ? -15.989 4.704   -13.188 0.016 27.33 ? 10  ILE A HG12 3  
ATOM   7241   H HG13 . ILE A 1 14  ? -15.194 5.883   -13.903 0.016 28.74 ? 10  ILE A HG13 3  
ATOM   7242   H HG21 . ILE A 1 14  ? -18.669 5.644   -13.116 0.016 26.20 ? 10  ILE A HG21 3  
ATOM   7243   H HG22 . ILE A 1 14  ? -19.159 5.293   -14.579 0.016 27.31 ? 10  ILE A HG22 3  
ATOM   7244   H HG23 . ILE A 1 14  ? -18.299 4.244   -13.760 0.016 26.85 ? 10  ILE A HG23 3  
ATOM   7245   H HD11 . ILE A 1 14  ? -17.014 6.179   -11.778 0.016 26.59 ? 10  ILE A HD11 3  
ATOM   7246   H HD12 . ILE A 1 14  ? -15.460 6.481   -11.707 0.016 26.39 ? 10  ILE A HD12 3  
ATOM   7247   H HD13 . ILE A 1 14  ? -16.413 7.411   -12.572 0.016 27.69 ? 10  ILE A HD13 3  
ATOM   7248   N N    . LYS A 1 15  ? -18.767 4.659   -17.231 0.016 30.23 ? 11  LYS A N    3  
ATOM   7249   C CA   . LYS A 1 15  ? -20.046 4.983   -17.858 0.016 30.51 ? 11  LYS A CA   3  
ATOM   7250   C C    . LYS A 1 15  ? -21.139 4.434   -16.979 0.016 29.22 ? 11  LYS A C    3  
ATOM   7251   O O    . LYS A 1 15  ? -21.021 3.313   -16.467 0.016 28.79 ? 11  LYS A O    3  
ATOM   7252   C CB   . LYS A 1 15  ? -20.268 4.366   -19.262 0.016 32.28 ? 11  LYS A CB   3  
ATOM   7253   C CG   . LYS A 1 15  ? -21.833 4.091   -19.577 0.016 32.37 ? 11  LYS A CG   3  
ATOM   7254   C CD   . LYS A 1 15  ? -22.386 2.666   -19.092 0.016 31.98 ? 11  LYS A CD   3  
ATOM   7255   C CE   . LYS A 1 15  ? -23.920 2.526   -18.874 0.016 31.41 ? 11  LYS A CE   3  
ATOM   7256   N NZ   . LYS A 1 15  ? -24.384 1.150   -18.364 0.016 30.82 ? 11  LYS A NZ   3  
ATOM   7257   H H    . LYS A 1 15  ? -18.653 3.818   -17.121 0.016 30.08 ? 11  LYS A H    3  
ATOM   7258   H HA   . LYS A 1 15  ? -20.152 5.943   -17.921 0.016 30.50 ? 11  LYS A HA   3  
ATOM   7259   H HB2  . LYS A 1 15  ? -19.920 4.976   -19.932 0.016 33.22 ? 11  LYS A HB2  3  
ATOM   7260   H HB3  . LYS A 1 15  ? -19.798 3.520   -19.314 0.016 32.59 ? 11  LYS A HB3  3  
ATOM   7261   H HG2  . LYS A 1 15  ? -22.383 4.781   -19.177 0.016 31.61 ? 11  LYS A HG2  3  
ATOM   7262   H HG3  . LYS A 1 15  ? -21.953 4.127   -20.540 0.016 33.66 ? 11  LYS A HG3  3  
ATOM   7263   H HD2  . LYS A 1 15  ? -22.223 2.056   -19.817 0.016 33.16 ? 11  LYS A HD2  3  
ATOM   7264   H HD3  . LYS A 1 15  ? -21.930 2.365   -18.292 0.016 31.16 ? 11  LYS A HD3  3  
ATOM   7265   H HE2  . LYS A 1 15  ? -24.214 3.190   -18.237 0.016 30.52 ? 11  LYS A HE2  3  
ATOM   7266   H HE3  . LYS A 1 15  ? -24.357 2.675   -19.731 0.016 32.49 ? 11  LYS A HE3  3  
ATOM   7267   H HZ1  . LYS A 1 15  ? -24.083 1.008   -17.540 0.016 29.83 ? 11  LYS A HZ1  3  
ATOM   7268   H HZ2  . LYS A 1 15  ? -25.272 1.107   -18.355 0.016 30.75 ? 11  LYS A HZ2  3  
ATOM   7269   H HZ3  . LYS A 1 15  ? -24.076 0.511   -18.898 0.016 31.61 ? 11  LYS A HZ3  3  
ATOM   7270   N N    . LEU A 1 16  ? -22.229 5.177   -16.851 0.016 28.75 ? 12  LEU A N    3  
ATOM   7271   C CA   . LEU A 1 16  ? -23.366 4.622   -16.148 0.016 27.84 ? 12  LEU A CA   3  
ATOM   7272   C C    . LEU A 1 16  ? -24.662 5.176   -16.697 0.016 28.40 ? 12  LEU A C    3  
ATOM   7273   O O    . LEU A 1 16  ? -24.711 6.247   -17.323 0.016 29.18 ? 12  LEU A O    3  
ATOM   7274   C CB   . LEU A 1 16  ? -23.294 4.876   -14.641 0.016 26.27 ? 12  LEU A CB   3  
ATOM   7275   C CG   . LEU A 1 16  ? -23.413 6.342   -14.200 0.016 25.96 ? 12  LEU A CG   3  
ATOM   7276   C CD1  . LEU A 1 16  ? -24.857 6.761   -13.936 0.016 25.67 ? 12  LEU A CD1  3  
ATOM   7277   C CD2  . LEU A 1 16  ? -22.547 6.601   -12.950 0.016 24.97 ? 12  LEU A CD2  3  
ATOM   7278   H H    . LEU A 1 16  ? -22.329 5.971   -17.160 0.016 29.02 ? 12  LEU A H    3  
ATOM   7279   H HA   . LEU A 1 16  ? -23.382 3.660   -16.275 0.016 28.01 ? 12  LEU A HA   3  
ATOM   7280   H HB2  . LEU A 1 16  ? -24.018 4.388   -14.220 0.016 25.82 ? 12  LEU A HB2  3  
ATOM   7281   H HB3  . LEU A 1 16  ? -22.443 4.537   -14.319 0.016 26.01 ? 12  LEU A HB3  3  
ATOM   7282   H HG   . LEU A 1 16  ? -23.073 6.896   -14.917 0.016 26.78 ? 12  LEU A HG   3  
ATOM   7283   H HD11 . LEU A 1 16  ? -24.871 7.717   -13.774 0.016 25.82 ? 12  LEU A HD11 3  
ATOM   7284   H HD12 . LEU A 1 16  ? -25.411 6.554   -14.701 0.016 26.28 ? 12  LEU A HD12 3  
ATOM   7285   H HD13 . LEU A 1 16  ? -25.186 6.299   -13.151 0.016 24.83 ? 12  LEU A HD13 3  
ATOM   7286   H HD21 . LEU A 1 16  ? -22.386 7.555   -12.885 0.016 24.99 ? 12  LEU A HD21 3  
ATOM   7287   H HD22 . LEU A 1 16  ? -23.021 6.300   -12.159 0.016 24.21 ? 12  LEU A HD22 3  
ATOM   7288   H HD23 . LEU A 1 16  ? -21.703 6.135   -13.038 0.016 25.21 ? 12  LEU A HD23 3  
ATOM   7289   N N    . ARG A 1 17  ? -25.710 4.438   -16.361 0.016 28.04 ? 13  ARG A N    3  
ATOM   7290   C CA   . ARG A 1 17  ? -27.088 4.674   -16.747 0.016 28.40 ? 13  ARG A CA   3  
ATOM   7291   C C    . ARG A 1 17  ? -27.987 4.324   -15.571 0.016 27.21 ? 13  ARG A C    3  
ATOM   7292   O O    . ARG A 1 17  ? -28.002 3.172   -15.129 0.016 26.86 ? 13  ARG A O    3  
ATOM   7293   C CB   . ARG A 1 17  ? -27.416 3.814   -17.962 0.016 29.98 ? 13  ARG A CB   3  
ATOM   7294   C CG   . ARG A 1 17  ? -27.230 4.542   -19.269 0.016 31.50 ? 13  ARG A CG   3  
ATOM   7295   C CD   . ARG A 1 17  ? -28.325 4.172   -20.233 0.016 33.13 ? 13  ARG A CD   3  
ATOM   7296   N NE   . ARG A 1 17  ? -29.606 4.365   -19.563 0.016 32.67 ? 13  ARG A NE   3  
ATOM   7297   C CZ   . ARG A 1 17  ? -30.759 4.539   -20.189 0.016 34.00 ? 13  ARG A CZ   3  
ATOM   7298   N NH1  . ARG A 1 17  ? -30.811 4.537   -21.514 0.016 35.90 ? 13  ARG A NH1  3  
ATOM   7299   N NH2  . ARG A 1 17  ? -31.854 4.712   -19.479 0.016 33.58 ? 13  ARG A NH2  3  
ATOM   7300   H H    . ARG A 1 17  ? -25.635 3.738   -15.867 0.016 27.63 ? 13  ARG A H    3  
ATOM   7301   H HA   . ARG A 1 17  ? -27.212 5.606   -16.973 0.016 28.52 ? 13  ARG A HA   3  
ATOM   7302   H HB2  . ARG A 1 17  ? -26.796 3.069   -17.973 0.016 30.11 ? 13  ARG A HB2  3  
ATOM   7303   H HB3  . ARG A 1 17  ? -28.314 3.474   -17.872 0.016 29.97 ? 13  ARG A HB3  3  
ATOM   7304   H HG2  . ARG A 1 17  ? -27.272 5.497   -19.112 0.016 31.27 ? 13  ARG A HG2  3  
ATOM   7305   H HG3  . ARG A 1 17  ? -26.375 4.303   -19.664 0.016 31.82 ? 13  ARG A HG3  3  
ATOM   7306   H HD2  . ARG A 1 17  ? -28.280 4.749   -21.013 0.016 34.17 ? 13  ARG A HD2  3  
ATOM   7307   H HD3  . ARG A 1 17  ? -28.241 3.243   -20.492 0.016 33.57 ? 13  ARG A HD3  3  
ATOM   7308   H HE   . ARG A 1 17  ? -29.583 4.612   -18.741 0.016 31.66 ? 13  ARG A HE   3  
ATOM   7309   H HH11 . ARG A 1 17  ? -30.093 4.422   -21.976 0.016 36.25 ? 13  ARG A HH11 3  
ATOM   7310   H HH12 . ARG A 1 17  ? -31.566 4.650   -21.913 0.016 36.88 ? 13  ARG A HH12 3  
ATOM   7311   H HH21 . ARG A 1 17  ? -31.815 4.715   -18.623 0.016 32.45 ? 13  ARG A HH21 3  
ATOM   7312   H HH22 . ARG A 1 17  ? -32.611 4.822   -19.874 0.016 34.53 ? 13  ARG A HH22 3  
ATOM   7313   N N    . MET A 1 18  ? -28.714 5.307   -15.035 0.016 26.73 ? 14  MET A N    3  
ATOM   7314   C CA   . MET A 1 18  ? -29.666 5.094   -13.962 0.016 25.92 ? 14  MET A CA   3  
ATOM   7315   C C    . MET A 1 18  ? -31.081 5.372   -14.443 0.016 26.83 ? 14  MET A C    3  
ATOM   7316   O O    . MET A 1 18  ? -31.335 6.400   -15.106 0.016 27.40 ? 14  MET A O    3  
ATOM   7317   C CB   . MET A 1 18  ? -29.398 5.998   -12.753 0.016 24.73 ? 14  MET A CB   3  
ATOM   7318   C CG   . MET A 1 18  ? -30.471 5.896   -11.694 0.016 24.06 ? 14  MET A CG   3  
ATOM   7319   S SD   . MET A 1 18  ? -30.346 7.136   -10.367 0.016 23.04 ? 14  MET A SD   3  
ATOM   7320   C CE   . MET A 1 18  ? -28.910 6.513   -9.502  0.016 22.20 ? 14  MET A CE   3  
ATOM   7321   H H    . MET A 1 18  ? -28.665 6.128   -15.286 0.016 26.95 ? 14  MET A H    3  
ATOM   7322   H HA   . MET A 1 18  ? -29.612 4.181   -13.651 0.016 25.70 ? 14  MET A HA   3  
ATOM   7323   H HB2  . MET A 1 18  ? -28.558 5.751   -12.343 0.016 24.26 ? 14  MET A HB2  3  
ATOM   7324   H HB3  . MET A 1 18  ? -29.359 6.917   -13.054 0.016 24.98 ? 14  MET A HB3  3  
ATOM   7325   H HG2  . MET A 1 18  ? -31.344 6.012   -12.089 0.016 24.60 ? 14  MET A HG2  3  
ATOM   7326   H HG3  . MET A 1 18  ? -30.422 5.024   -11.275 0.016 23.75 ? 14  MET A HG3  3  
ATOM   7327   H HE1  . MET A 1 18  ? -28.729 7.072   -8.729  0.016 21.75 ? 14  MET A HE1  3  
ATOM   7328   H HE2  . MET A 1 18  ? -29.087 5.600   -9.215  0.016 22.02 ? 14  MET A HE2  3  
ATOM   7329   H HE3  . MET A 1 18  ? -28.155 6.519   -10.107 0.016 22.51 ? 14  MET A HE3  3  
ATOM   7330   N N    . GLU A 1 19  ? -32.009 4.532   -13.988 0.016 27.10 ? 15  GLU A N    3  
ATOM   7331   C CA   . GLU A 1 19  ? -33.429 4.717   -14.221 0.016 27.86 ? 15  GLU A CA   3  
ATOM   7332   C C    . GLU A 1 19  ? -34.242 4.345   -12.997 0.016 26.92 ? 15  GLU A C    3  
ATOM   7333   O O    . GLU A 1 19  ? -33.877 3.442   -12.232 0.016 26.17 ? 15  GLU A O    3  
ATOM   7334   C CB   . GLU A 1 19  ? -33.931 3.911   -15.416 0.016 29.40 ? 15  GLU A CB   3  
ATOM   7335   C CG   . GLU A 1 19  ? -35.419 4.160   -15.673 0.016 30.70 ? 15  GLU A CG   3  
ATOM   7336   C CD   . GLU A 1 19  ? -35.930 3.491   -16.919 0.016 32.65 ? 15  GLU A CD   3  
ATOM   7337   O OE1  . GLU A 1 19  ? -36.789 4.082   -17.614 0.016 33.96 ? 15  GLU A OE1  3  
ATOM   7338   O OE2  . GLU A 1 19  ? -35.467 2.386   -17.220 0.016 33.06 ? 15  GLU A OE2  3  
ATOM   7339   H H    . GLU A 1 19  ? -31.830 3.834   -13.522 0.016 26.93 ? 15  GLU A H    3  
ATOM   7340   H HA   . GLU A 1 19  ? -33.590 5.658   -14.403 0.016 28.14 ? 15  GLU A HA   3  
ATOM   7341   H HB2  . GLU A 1 19  ? -33.433 4.156   -16.210 0.016 29.93 ? 15  GLU A HB2  3  
ATOM   7342   H HB3  . GLU A 1 19  ? -33.817 2.966   -15.228 0.016 29.19 ? 15  GLU A HB3  3  
ATOM   7343   H HG2  . GLU A 1 19  ? -35.939 3.820   -14.929 0.016 30.70 ? 15  GLU A HG2  3  
ATOM   7344   H HG3  . GLU A 1 19  ? -35.556 5.117   -15.760 0.016 30.43 ? 15  GLU A HG3  3  
ATOM   7345   N N    . GLY A 1 20  ? -35.329 5.082   -12.792 0.016 27.02 ? 16  GLY A N    3  
ATOM   7346   C CA   . GLY A 1 20  ? -36.305 4.676   -11.804 0.016 26.26 ? 16  GLY A CA   3  
ATOM   7347   C C    . GLY A 1 20  ? -37.284 5.784   -11.529 0.016 26.83 ? 16  GLY A C    3  
ATOM   7348   O O    . GLY A 1 20  ? -37.681 6.511   -12.439 0.016 27.91 ? 16  GLY A O    3  
ATOM   7349   H H    . GLY A 1 20  ? -35.510 5.813   -13.203 0.016 27.58 ? 16  GLY A H    3  
ATOM   7350   H HA2  . GLY A 1 20  ? -36.809 3.935   -12.154 0.016 26.33 ? 16  GLY A HA2  3  
ATOM   7351   H HA3  . GLY A 1 20  ? -35.869 4.391   -10.999 0.016 25.39 ? 16  GLY A HA3  3  
ATOM   7352   N N    . ALA A 1 21  ? -37.694 5.877   -10.270 0.016 26.25 ? 17  ALA A N    3  
ATOM   7353   C CA   . ALA A 1 21  ? -38.788 6.758   -9.892  0.016 26.69 ? 17  ALA A CA   3  
ATOM   7354   C C    . ALA A 1 21  ? -38.724 7.057   -8.406  0.016 25.70 ? 17  ALA A C    3  
ATOM   7355   O O    . ALA A 1 21  ? -38.418 6.186   -7.588  0.016 25.14 ? 17  ALA A O    3  
ATOM   7356   C CB   . ALA A 1 21  ? -40.160 6.138   -10.233 0.016 28.00 ? 17  ALA A CB   3  
ATOM   7357   H H    . ALA A 1 21  ? -37.358 5.439   -9.615  0.016 25.66 ? 17  ALA A H    3  
ATOM   7358   H HA   . ALA A 1 21  ? -38.699 7.589   -10.374 0.016 26.93 ? 17  ALA A HA   3  
ATOM   7359   H HB1  . ALA A 1 21  ? -40.827 6.546   -9.661  0.016 28.30 ? 17  ALA A HB1  3  
ATOM   7360   H HB2  . ALA A 1 21  ? -40.373 6.300   -11.164 0.016 28.77 ? 17  ALA A HB2  3  
ATOM   7361   H HB3  . ALA A 1 21  ? -40.131 5.185   -10.055 0.016 27.85 ? 17  ALA A HB3  3  
ATOM   7362   N N    . VAL A 1 22  ? -39.067 8.295   -8.072  0.016 25.65 ? 18  VAL A N    3  
ATOM   7363   C CA   . VAL A 1 22  ? -39.205 8.758   -6.711  0.016 24.98 ? 18  VAL A CA   3  
ATOM   7364   C C    . VAL A 1 22  ? -40.575 9.420   -6.613  0.016 25.83 ? 18  VAL A C    3  
ATOM   7365   O O    . VAL A 1 22  ? -40.878 10.336  -7.395  0.016 26.46 ? 18  VAL A O    3  
ATOM   7366   C CB   . VAL A 1 22  ? -38.077 9.737   -6.341  0.016 24.10 ? 18  VAL A CB   3  
ATOM   7367   C CG1  . VAL A 1 22  ? -38.332 10.399  -4.970  0.016 23.67 ? 18  VAL A CG1  3  
ATOM   7368   C CG2  . VAL A 1 22  ? -36.754 8.983   -6.377  0.016 23.42 ? 18  VAL A CG2  3  
ATOM   7369   H H    . VAL A 1 22  ? -39.230 8.903   -8.650  0.016 26.09 ? 18  VAL A H    3  
ATOM   7370   H HA   . VAL A 1 22  ? -39.153 8.020   -6.100  0.016 24.72 ? 18  VAL A HA   3  
ATOM   7371   H HB   . VAL A 1 22  ? -38.034 10.440  -7.006  0.016 24.41 ? 18  VAL A HB   3  
ATOM   7372   H HG11 . VAL A 1 22  ? -39.072 11.020  -5.037  0.016 24.15 ? 18  VAL A HG11 3  
ATOM   7373   H HG12 . VAL A 1 22  ? -38.537 9.712   -4.318  0.016 23.56 ? 18  VAL A HG12 3  
ATOM   7374   H HG13 . VAL A 1 22  ? -37.527 10.869  -4.697  0.016 23.15 ? 18  VAL A HG13 3  
ATOM   7375   H HG21 . VAL A 1 22  ? -36.813 8.217   -5.788  0.016 23.29 ? 18  VAL A HG21 3  
ATOM   7376   H HG22 . VAL A 1 22  ? -36.579 8.700   -7.287  0.016 23.78 ? 18  VAL A HG22 3  
ATOM   7377   H HG23 . VAL A 1 22  ? -36.042 9.569   -6.073  0.016 22.89 ? 18  VAL A HG23 3  
ATOM   7378   N N    . ASN A 1 23  ? -41.399 8.963   -5.667  0.016 25.93 ? 19  ASN A N    3  
ATOM   7379   C CA   . ASN A 1 23  ? -42.663 9.648   -5.313  0.016 26.93 ? 19  ASN A CA   3  
ATOM   7380   C C    . ASN A 1 23  ? -43.452 10.099  -6.542  0.016 28.11 ? 19  ASN A C    3  
ATOM   7381   O O    . ASN A 1 23  ? -43.948 11.227  -6.597  0.016 28.74 ? 19  ASN A O    3  
ATOM   7382   C CB   . ASN A 1 23  ? -42.404 10.862  -4.417  0.016 26.67 ? 19  ASN A CB   3  
ATOM   7383   C CG   . ASN A 1 23  ? -42.538 10.555  -2.953  0.016 26.33 ? 19  ASN A CG   3  
ATOM   7384   O OD1  . ASN A 1 23  ? -42.104 9.497   -2.494  0.016 25.87 ? 19  ASN A OD1  3  
ATOM   7385   N ND2  . ASN A 1 23  ? -43.064 11.498  -2.195  0.016 26.66 ? 19  ASN A ND2  3  
ATOM   7386   H H    . ASN A 1 23  ? -41.249 8.260   -5.199  0.016 25.51 ? 19  ASN A H    3  
ATOM   7387   H HA   . ASN A 1 23  ? -43.208 9.019   -4.816  0.016 27.19 ? 19  ASN A HA   3  
ATOM   7388   H HB2  . ASN A 1 23  ? -41.494 11.170  -4.568  0.016 26.10 ? 19  ASN A HB2  3  
ATOM   7389   H HB3  . ASN A 1 23  ? -43.027 11.573  -4.621  0.016 27.42 ? 19  ASN A HB3  3  
ATOM   7390   H HD21 . ASN A 1 23  ? -43.356 12.225  -2.549  0.016 26.96 ? 19  ASN A HD21 3  
ATOM   7391   H HD22 . ASN A 1 23  ? -43.110 11.392  -1.343  0.016 26.63 ? 19  ASN A HD22 3  
ATOM   7392   N N    . GLY A 1 24  ? -43.525 9.244   -7.555  0.016 28.55 ? 20  GLY A N    3  
ATOM   7393   C CA   . GLY A 1 24  ? -44.138 9.594   -8.819  0.016 29.91 ? 20  GLY A CA   3  
ATOM   7394   C C    . GLY A 1 24  ? -43.206 9.660   -10.017 0.016 29.96 ? 20  GLY A C    3  
ATOM   7395   O O    . GLY A 1 24  ? -43.498 9.029   -11.053 0.016 31.17 ? 20  GLY A O    3  
ATOM   7396   H H    . GLY A 1 24  ? -43.217 8.439   -7.531  0.016 28.13 ? 20  GLY A H    3  
ATOM   7397   H HA2  . GLY A 1 24  ? -44.822 8.934   -9.017  0.016 30.33 ? 20  GLY A HA2  3  
ATOM   7398   H HA3  . GLY A 1 24  ? -44.565 10.457  -8.737  0.016 30.62 ? 20  GLY A HA3  3  
ATOM   7399   N N    . HIS A 1 25  ? -42.061 10.329  -9.886  0.016 28.87 ? 21  HIS A N    3  
ATOM   7400   C CA   . HIS A 1 25  ? -41.399 10.964  -11.024 0.016 29.17 ? 21  HIS A CA   3  
ATOM   7401   C C    . HIS A 1 25  ? -40.381 9.995   -11.623 0.016 28.70 ? 21  HIS A C    3  
ATOM   7402   O O    . HIS A 1 25  ? -39.363 9.679   -10.994 0.016 27.46 ? 21  HIS A O    3  
ATOM   7403   C CB   . HIS A 1 25  ? -40.741 12.287  -10.607 0.016 28.61 ? 21  HIS A CB   3  
ATOM   7404   C CG   . HIS A 1 25  ? -41.657 13.236  -9.891  0.016 29.79 ? 21  HIS A CG   3  
ATOM   7405   N ND1  . HIS A 1 25  ? -41.873 13.205  -8.530  0.016 30.60 ? 21  HIS A ND1  3  
ATOM   7406   C CD2  . HIS A 1 25  ? -42.421 14.248  -10.365 0.016 30.48 ? 21  HIS A CD2  3  
ATOM   7407   C CE1  . HIS A 1 25  ? -42.733 14.155  -8.194  0.016 31.68 ? 21  HIS A CE1  3  
ATOM   7408   N NE2  . HIS A 1 25  ? -43.074 14.810  -9.291  0.016 31.63 ? 21  HIS A NE2  3  
ATOM   7409   H H    . HIS A 1 25  ? -41.649 10.421  -9.139  0.016 28.03 ? 21  HIS A H    3  
ATOM   7410   H HA   . HIS A 1 25  ? -42.056 11.163  -11.705 0.016 30.25 ? 21  HIS A HA   3  
ATOM   7411   H HB2  . HIS A 1 25  ? -40.005 12.095  -10.008 0.016 27.96 ? 21  HIS A HB2  3  
ATOM   7412   H HB3  . HIS A 1 25  ? -40.414 12.737  -11.402 0.016 28.22 ? 21  HIS A HB3  3  
ATOM   7413   H HD1  . HIS A 1 25  ? -41.507 12.654  -7.979  0.016 30.49 ? 21  HIS A HD1  3  
ATOM   7414   H HD2  . HIS A 1 25  ? -42.476 14.507  -11.255 0.016 30.29 ? 21  HIS A HD2  3  
ATOM   7415   H HE1  . HIS A 1 25  ? -43.035 14.339  -7.333  0.016 32.44 ? 21  HIS A HE1  3  
ATOM   7416   H HE2  . HIS A 1 25  ? -43.623 15.469  -9.329  0.016 32.28 ? 21  HIS A HE2  3  
ATOM   7417   N N    . LYS A 1 26  ? -40.671 9.514   -12.829 0.016 29.86 ? 22  LYS A N    3  
ATOM   7418   C CA   . LYS A 1 26  ? -39.728 8.761   -13.638 0.016 29.82 ? 22  LYS A CA   3  
ATOM   7419   C C    . LYS A 1 26  ? -38.594 9.658   -14.120 0.016 29.45 ? 22  LYS A C    3  
ATOM   7420   O O    . LYS A 1 26  ? -38.800 10.823  -14.484 0.016 29.77 ? 22  LYS A O    3  
ATOM   7421   C CB   . LYS A 1 26  ? -40.394 8.170   -14.884 0.016 31.52 ? 22  LYS A CB   3  
ATOM   7422   C CG   . LYS A 1 26  ? -41.251 6.931   -14.757 0.016 32.34 ? 22  LYS A CG   3  
ATOM   7423   C CD   . LYS A 1 26  ? -41.463 6.445   -16.186 0.016 34.12 ? 22  LYS A CD   3  
ATOM   7424   C CE   . LYS A 1 26  ? -42.437 5.352   -16.291 0.016 35.10 ? 22  LYS A CE   3  
ATOM   7425   N NZ   . LYS A 1 26  ? -41.893 4.159   -15.618 0.016 34.05 ? 22  LYS A NZ   3  
ATOM   7426   H H    . LYS A 1 26  ? -41.435 9.618   -13.205 0.016 30.80 ? 22  LYS A H    3  
ATOM   7427   H HA   . LYS A 1 26  ? -39.350 8.040   -13.113 0.016 29.11 ? 22  LYS A HA   3  
ATOM   7428   H HB2  . LYS A 1 26  ? -40.957 8.854   -15.276 0.016 32.30 ? 22  LYS A HB2  3  
ATOM   7429   H HB3  . LYS A 1 26  ? -39.690 7.947   -15.513 0.016 31.52 ? 22  LYS A HB3  3  
ATOM   7430   H HG2  . LYS A 1 26  ? -40.795 6.241   -14.251 0.016 31.65 ? 22  LYS A HG2  3  
ATOM   7431   H HG3  . LYS A 1 26  ? -42.106 7.155   -14.359 0.016 32.62 ? 22  LYS A HG3  3  
ATOM   7432   H HD2  . LYS A 1 26  ? -41.780 7.187   -16.720 0.016 34.99 ? 22  LYS A HD2  3  
ATOM   7433   H HD3  . LYS A 1 26  ? -40.623 6.117   -16.540 0.016 33.94 ? 22  LYS A HD3  3  
ATOM   7434   H HE2  . LYS A 1 26  ? -43.268 5.616   -15.862 0.016 35.23 ? 22  LYS A HE2  3  
ATOM   7435   H HE3  . LYS A 1 26  ? -42.581 5.135   -17.225 0.016 36.41 ? 22  LYS A HE3  3  
ATOM   7436   H HZ1  . LYS A 1 26  ? -41.037 4.060   -15.838 0.016 33.78 ? 22  LYS A HZ1  3  
ATOM   7437   H HZ2  . LYS A 1 26  ? -41.951 4.259   -14.736 0.016 33.02 ? 22  LYS A HZ2  3  
ATOM   7438   H HZ3  . LYS A 1 26  ? -42.346 3.433   -15.863 0.016 34.80 ? 22  LYS A HZ3  3  
ATOM   7439   N N    . PHE A 1 27  ? -37.406 9.076   -14.210 0.016 29.08 ? 23  PHE A N    3  
ATOM   7440   C CA   . PHE A 1 27  ? -36.240 9.839   -14.606 0.016 28.93 ? 23  PHE A CA   3  
ATOM   7441   C C    . PHE A 1 27  ? -35.150 8.905   -15.089 0.016 28.93 ? 23  PHE A C    3  
ATOM   7442   O O    . PHE A 1 27  ? -35.099 7.725   -14.704 0.016 28.68 ? 23  PHE A O    3  
ATOM   7443   C CB   . PHE A 1 27  ? -35.747 10.699  -13.440 0.016 27.62 ? 23  PHE A CB   3  
ATOM   7444   C CG   . PHE A 1 27  ? -35.102 9.908   -12.329 0.016 26.30 ? 23  PHE A CG   3  
ATOM   7445   C CD1  . PHE A 1 27  ? -33.771 9.568   -12.400 0.016 25.67 ? 23  PHE A CD1  3  
ATOM   7446   C CD2  . PHE A 1 27  ? -35.825 9.513   -11.218 0.016 25.86 ? 23  PHE A CD2  3  
ATOM   7447   C CE1  . PHE A 1 27  ? -33.160 8.852   -11.385 0.016 24.60 ? 23  PHE A CE1  3  
ATOM   7448   C CE2  . PHE A 1 27  ? -35.216 8.789   -10.197 0.016 24.83 ? 23  PHE A CE2  3  
ATOM   7449   C CZ   . PHE A 1 27  ? -33.885 8.460   -10.292 0.016 24.20 ? 23  PHE A CZ   3  
ATOM   7450   H H    . PHE A 1 27  ? -37.256 8.248   -14.048 0.016 28.98 ? 23  PHE A H    3  
ATOM   7451   H HA   . PHE A 1 27  ? -36.475 10.429  -15.340 0.016 29.85 ? 23  PHE A HA   3  
ATOM   7452   H HB2  . PHE A 1 27  ? -35.093 11.330  -13.773 0.016 27.66 ? 23  PHE A HB2  3  
ATOM   7453   H HB3  . PHE A 1 27  ? -36.506 11.173  -13.067 0.016 27.72 ? 23  PHE A HB3  3  
ATOM   7454   H HD1  . PHE A 1 27  ? -33.273 9.831   -13.142 0.016 26.06 ? 23  PHE A HD1  3  
ATOM   7455   H HD2  . PHE A 1 27  ? -36.723 9.733   -11.153 0.016 26.36 ? 23  PHE A HD2  3  
ATOM   7456   H HE1  . PHE A 1 27  ? -32.259 8.629   -11.448 0.016 24.26 ? 23  PHE A HE1  3  
ATOM   7457   H HE2  . PHE A 1 27  ? -35.706 8.525   -9.452  0.016 24.66 ? 23  PHE A HE2  3  
ATOM   7458   H HZ   . PHE A 1 27  ? -33.471 7.977   -9.613  0.016 23.58 ? 23  PHE A HZ   3  
ATOM   7459   N N    . VAL A 1 28  ? -34.287 9.441   -15.947 0.016 29.38 ? 24  VAL A N    3  
ATOM   7460   C CA   . VAL A 1 28  ? -33.122 8.729   -16.467 0.016 29.46 ? 24  VAL A CA   3  
ATOM   7461   C C    . VAL A 1 28  ? -31.920 9.656   -16.417 0.016 29.02 ? 24  VAL A C    3  
ATOM   7462   O O    . VAL A 1 28  ? -31.962 10.759  -16.977 0.016 29.68 ? 24  VAL A O    3  
ATOM   7463   C CB   . VAL A 1 28  ? -33.329 8.233   -17.907 0.016 31.24 ? 24  VAL A CB   3  
ATOM   7464   C CG1  . VAL A 1 28  ? -32.081 7.464   -18.374 0.016 31.39 ? 24  VAL A CG1  3  
ATOM   7465   C CG2  . VAL A 1 28  ? -34.570 7.347   -17.999 0.016 31.90 ? 24  VAL A CG2  3  
ATOM   7466   H H    . VAL A 1 28  ? -34.359 10.238  -16.257 0.016 29.73 ? 24  VAL A H    3  
ATOM   7467   H HA   . VAL A 1 28  ? -32.939 7.963   -15.901 0.016 28.76 ? 24  VAL A HA   3  
ATOM   7468   H HB   . VAL A 1 28  ? -33.451 8.997   -18.493 0.016 32.03 ? 24  VAL A HB   3  
ATOM   7469   H HG11 . VAL A 1 28  ? -32.258 7.089   -19.248 0.016 32.45 ? 24  VAL A HG11 3  
ATOM   7470   H HG12 . VAL A 1 28  ? -31.332 8.078   -18.428 0.016 31.55 ? 24  VAL A HG12 3  
ATOM   7471   H HG13 . VAL A 1 28  ? -31.885 6.759   -17.739 0.016 30.38 ? 24  VAL A HG13 3  
ATOM   7472   H HG21 . VAL A 1 28  ? -34.681 7.055   -18.918 0.016 33.16 ? 24  VAL A HG21 3  
ATOM   7473   H HG22 . VAL A 1 28  ? -34.452 6.580   -17.418 0.016 31.20 ? 24  VAL A HG22 3  
ATOM   7474   H HG23 . VAL A 1 28  ? -35.341 7.861   -17.717 0.016 31.85 ? 24  VAL A HG23 3  
ATOM   7475   N N    . ILE A 1 29  ? -30.847 9.197   -15.777 0.016 28.08 ? 25  ILE A N    3  
ATOM   7476   C CA   . ILE A 1 29  ? -29.613 9.956   -15.616 0.016 27.73 ? 25  ILE A CA   3  
ATOM   7477   C C    . ILE A 1 29  ? -28.476 9.162   -16.247 0.016 28.11 ? 25  ILE A C    3  
ATOM   7478   O O    . ILE A 1 29  ? -28.367 7.950   -16.028 0.016 27.77 ? 25  ILE A O    3  
ATOM   7479   C CB   . ILE A 1 29  ? -29.313 10.226  -14.133 0.016 26.24 ? 25  ILE A CB   3  
ATOM   7480   C CG1  . ILE A 1 29  ? -30.464 11.014  -13.496 0.016 26.08 ? 25  ILE A CG1  3  
ATOM   7481   C CG2  . ILE A 1 29  ? -28.012 10.985  -13.975 0.016 26.03 ? 25  ILE A CG2  3  
ATOM   7482   C CD1  . ILE A 1 29  ? -30.195 11.428  -12.058 0.016 24.80 ? 25  ILE A CD1  3  
ATOM   7483   H H    . ILE A 1 29  ? -30.813 8.425   -15.408 0.016 27.69 ? 25  ILE A H    3  
ATOM   7484   H HA   . ILE A 1 29  ? -29.695 10.801  -16.079 0.016 28.39 ? 25  ILE A HA   3  
ATOM   7485   H HB   . ILE A 1 29  ? -29.230 9.374   -13.676 0.016 25.66 ? 25  ILE A HB   3  
ATOM   7486   H HG12 . ILE A 1 29  ? -30.623 11.814  -14.016 0.016 26.48 ? 25  ILE A HG12 3  
ATOM   7487   H HG13 . ILE A 1 29  ? -31.255 10.453  -13.492 0.016 26.54 ? 25  ILE A HG13 3  
ATOM   7488   H HG21 . ILE A 1 29  ? -27.808 11.046  -13.028 0.016 25.24 ? 25  ILE A HG21 3  
ATOM   7489   H HG22 . ILE A 1 29  ? -27.298 10.516  -14.430 0.016 26.08 ? 25  ILE A HG22 3  
ATOM   7490   H HG23 . ILE A 1 29  ? -28.116 11.873  -14.347 0.016 26.74 ? 25  ILE A HG23 3  
ATOM   7491   H HD11 . ILE A 1 29  ? -29.560 12.160  -12.048 0.016 24.42 ? 25  ILE A HD11 3  
ATOM   7492   H HD12 . ILE A 1 29  ? -31.029 11.701  -11.650 0.016 24.84 ? 25  ILE A HD12 3  
ATOM   7493   H HD13 . ILE A 1 29  ? -29.828 10.670  -11.577 0.016 24.45 ? 25  ILE A HD13 3  
ATOM   7494   N N    . GLU A 1 30  ? -27.659 9.842   -17.044 0.016 28.98 ? 26  GLU A N    3  
ATOM   7495   C CA   . GLU A 1 30  ? -26.460 9.262   -17.627 0.016 29.48 ? 26  GLU A CA   3  
ATOM   7496   C C    . GLU A 1 30  ? -25.238 9.949   -17.046 0.016 28.90 ? 26  GLU A C    3  
ATOM   7497   O O    . GLU A 1 30  ? -25.236 11.154  -16.802 0.016 28.51 ? 26  GLU A O    3  
ATOM   7498   C CB   . GLU A 1 30  ? -26.424 9.392   -19.155 0.016 31.40 ? 26  GLU A CB   3  
ATOM   7499   C CG   . GLU A 1 30  ? -27.448 8.546   -19.864 0.016 32.26 ? 26  GLU A CG   3  
ATOM   7500   C CD   . GLU A 1 30  ? -27.403 8.698   -21.379 0.016 34.34 ? 26  GLU A CD   3  
ATOM   7501   O OE1  . GLU A 1 30  ? -26.312 8.986   -21.942 0.016 35.15 ? 26  GLU A OE1  3  
ATOM   7502   O OE2  . GLU A 1 30  ? -28.469 8.530   -22.004 0.016 35.32 ? 26  GLU A OE2  3  
ATOM   7503   H H    . GLU A 1 30  ? -27.782 10.663  -17.261 0.016 29.38 ? 26  GLU A H    3  
ATOM   7504   H HA   . GLU A 1 30  ? -26.417 8.321   -17.395 0.016 29.08 ? 26  GLU A HA   3  
ATOM   7505   H HB2  . GLU A 1 30  ? -26.592 10.317  -19.395 0.016 31.87 ? 26  GLU A HB2  3  
ATOM   7506   H HB3  . GLU A 1 30  ? -25.546 9.131   -19.469 0.016 31.78 ? 26  GLU A HB3  3  
ATOM   7507   H HG2  . GLU A 1 30  ? -27.280 7.615   -19.651 0.016 31.67 ? 26  GLU A HG2  3  
ATOM   7508   H HG3  . GLU A 1 30  ? -28.334 8.796   -19.559 0.016 32.21 ? 26  GLU A HG3  3  
ATOM   7509   N N    . GLY A 1 31  ? -24.200 9.166   -16.817 0.016 28.94 ? 27  GLY A N    3  
ATOM   7510   C CA   . GLY A 1 31  ? -22.982 9.692   -16.242 0.016 28.65 ? 27  GLY A CA   3  
ATOM   7511   C C    . GLY A 1 31  ? -21.756 9.180   -16.962 0.016 29.68 ? 27  GLY A C    3  
ATOM   7512   O O    . GLY A 1 31  ? -21.749 8.089   -17.542 0.016 30.20 ? 27  GLY A O    3  
ATOM   7513   H H    . GLY A 1 31  ? -24.180 8.325   -16.984 0.016 29.22 ? 27  GLY A H    3  
ATOM   7514   H HA2  . GLY A 1 31  ? -22.984 10.658  -16.283 0.016 28.93 ? 27  GLY A HA2  3  
ATOM   7515   H HA3  . GLY A 1 31  ? -22.929 9.421   -15.313 0.016 27.62 ? 27  GLY A HA3  3  
ATOM   7516   N N    . GLU A 1 32  ? -20.698 9.983   -16.897 0.016 30.09 ? 28  GLU A N    3  
ATOM   7517   C CA   . GLU A 1 32  ? -19.412 9.611   -17.455 0.016 31.05 ? 28  GLU A CA   3  
ATOM   7518   C C    . GLU A 1 32  ? -18.333 10.218  -16.579 0.016 30.69 ? 28  GLU A C    3  
ATOM   7519   O O    . GLU A 1 32  ? -18.446 11.365  -16.153 0.016 30.64 ? 28  GLU A O    3  
ATOM   7520   C CB   . GLU A 1 32  ? -19.295 10.053  -18.917 0.016 33.04 ? 28  GLU A CB   3  
ATOM   7521   C CG   . GLU A 1 32  ? -19.893 8.990   -19.865 0.016 33.90 ? 28  GLU A CG   3  
ATOM   7522   C CD   . GLU A 1 32  ? -20.199 9.480   -21.276 0.016 36.09 ? 28  GLU A CD   3  
ATOM   7523   O OE1  . GLU A 1 32  ? -20.133 10.697  -21.543 0.016 37.29 ? 28  GLU A OE1  3  
ATOM   7524   O OE2  . GLU A 1 32  ? -20.506 8.629   -22.143 0.016 36.78 ? 28  GLU A OE2  3  
ATOM   7525   H H    . GLU A 1 32  ? -20.702 10.754  -16.521 0.016 29.89 ? 28  GLU A H    3  
ATOM   7526   H HA   . GLU A 1 32  ? -19.319 8.647   -17.428 0.016 30.78 ? 28  GLU A HA   3  
ATOM   7527   H HB2  . GLU A 1 32  ? -19.784 10.882  -19.035 0.016 33.27 ? 28  GLU A HB2  3  
ATOM   7528   H HB3  . GLU A 1 32  ? -18.359 10.177  -19.140 0.016 33.68 ? 28  GLU A HB3  3  
ATOM   7529   H HG2  . GLU A 1 32  ? -19.266 8.250   -19.933 0.016 33.80 ? 28  GLU A HG2  3  
ATOM   7530   H HG3  . GLU A 1 32  ? -20.725 8.669   -19.490 0.016 33.28 ? 28  GLU A HG3  3  
ATOM   7531   N N    . GLY A 1 33  ? -17.316 9.433   -16.260 0.016 30.51 ? 29  GLY A N    3  
ATOM   7532   C CA   . GLY A 1 33  ? -16.322 9.913   -15.335 0.016 30.34 ? 29  GLY A CA   3  
ATOM   7533   C C    . GLY A 1 33  ? -15.030 9.145   -15.429 0.016 31.00 ? 29  GLY A C    3  
ATOM   7534   O O    . GLY A 1 33  ? -14.790 8.413   -16.386 0.016 31.95 ? 29  GLY A O    3  
ATOM   7535   H H    . GLY A 1 33  ? -17.191 8.638   -16.559 0.016 30.56 ? 29  GLY A H    3  
ATOM   7536   H HA2  . GLY A 1 33  ? -16.132 10.847  -15.518 0.016 31.01 ? 29  GLY A HA2  3  
ATOM   7537   H HA3  . GLY A 1 33  ? -16.653 9.833   -14.430 0.016 29.25 ? 29  GLY A HA3  3  
ATOM   7538   N N    . ILE A 1 34  ? -14.217 9.316   -14.391 0.016 30.58 ? 30  ILE A N    3  
ATOM   7539   C CA   . ILE A 1 34  ? -12.885 8.733   -14.331 0.016 31.22 ? 30  ILE A CA   3  
ATOM   7540   C C    . ILE A 1 34  ? -12.434 8.763   -12.877 0.016 30.43 ? 30  ILE A C    3  
ATOM   7541   O O    . ILE A 1 34  ? -12.957 9.525   -12.060 0.016 30.01 ? 30  ILE A O    3  
ATOM   7542   C CB   . ILE A 1 34  ? -11.909 9.483   -15.278 0.016 33.22 ? 30  ILE A CB   3  
ATOM   7543   C CG1  . ILE A 1 34  ? -10.578 8.746   -15.378 0.016 34.07 ? 30  ILE A CG1  3  
ATOM   7544   C CG2  . ILE A 1 34  ? -11.684 10.897  -14.804 0.016 33.76 ? 30  ILE A CG2  3  
ATOM   7545   C CD1  . ILE A 1 34  ? -9.689  9.334   -16.442 0.016 36.28 ? 30  ILE A CD1  3  
ATOM   7546   H H    . ILE A 1 34  ? -14.428 9.764   -13.691 0.016 29.98 ? 30  ILE A H    3  
ATOM   7547   H HA   . ILE A 1 34  ? -12.930 7.804   -14.608 0.016 30.98 ? 30  ILE A HA   3  
ATOM   7548   H HB   . ILE A 1 34  ? -12.303 9.521   -16.164 0.016 33.74 ? 30  ILE A HB   3  
ATOM   7549   H HG12 . ILE A 1 34  ? -10.114 8.807   -14.529 0.016 33.55 ? 30  ILE A HG12 3  
ATOM   7550   H HG13 . ILE A 1 34  ? -10.744 7.815   -15.597 0.016 33.89 ? 30  ILE A HG13 3  
ATOM   7551   H HG21 . ILE A 1 34  ? -11.282 11.405  -15.524 0.016 35.10 ? 30  ILE A HG21 3  
ATOM   7552   H HG22 . ILE A 1 34  ? -12.536 11.290  -14.559 0.016 33.17 ? 30  ILE A HG22 3  
ATOM   7553   H HG23 . ILE A 1 34  ? -11.095 10.888  -14.037 0.016 33.45 ? 30  ILE A HG23 3  
ATOM   7554   H HD11 . ILE A 1 34  ? -9.232  10.109  -16.077 0.016 36.61 ? 30  ILE A HD11 3  
ATOM   7555   H HD12 . ILE A 1 34  ? -9.041  8.671   -16.732 0.016 36.90 ? 30  ILE A HD12 3  
ATOM   7556   H HD13 . ILE A 1 34  ? -10.243 9.599   -17.192 0.016 36.82 ? 30  ILE A HD13 3  
ATOM   7557   N N    . GLY A 1 35  ? -11.517 7.869   -12.534 0.016 30.27 ? 31  GLY A N    3  
ATOM   7558   C CA   . GLY A 1 35  ? -11.000 7.794   -11.182 0.016 29.73 ? 31  GLY A CA   3  
ATOM   7559   C C    . GLY A 1 35  ? -9.749  6.938   -11.140 0.016 30.59 ? 31  GLY A C    3  
ATOM   7560   O O    . GLY A 1 35  ? -9.335  6.369   -12.153 0.016 31.62 ? 31  GLY A O    3  
ATOM   7561   H H    . GLY A 1 35  ? -11.175 7.297   -13.074 0.016 30.54 ? 31  GLY A H    3  
ATOM   7562   H HA2  . GLY A 1 35  ? -10.801 8.679   -10.846 0.016 29.99 ? 31  GLY A HA2  3  
ATOM   7563   H HA3  . GLY A 1 35  ? -11.672 7.390   -10.612 0.016 28.67 ? 31  GLY A HA3  3  
ATOM   7564   N N    . LYS A 1 36  ? -9.125  6.870   -9.960  0.016 30.31 ? 32  LYS A N    3  
ATOM   7565   C CA   . LYS A 1 36  ? -7.977  5.992   -9.732  0.016 31.12 ? 32  LYS A CA   3  
ATOM   7566   C C    . LYS A 1 36  ? -8.391  4.980   -8.670  0.016 29.95 ? 32  LYS A C    3  
ATOM   7567   O O    . LYS A 1 36  ? -8.428  5.296   -7.475  0.016 29.42 ? 32  LYS A O    3  
ATOM   7568   C CB   . LYS A 1 36  ? -6.711  6.760   -9.326  0.016 32.27 ? 32  LYS A CB   3  
ATOM   7569   C CG   . LYS A 1 36  ? -6.153  7.746   -10.363 0.016 33.79 ? 32  LYS A CG   3  
ATOM   7570   C CD   . LYS A 1 36  ? -7.077  8.878   -10.639 0.016 33.29 ? 32  LYS A CD   3  
ATOM   7571   C CE   . LYS A 1 36  ? -7.704  9.504   -9.350  0.016 31.96 ? 32  LYS A CE   3  
ATOM   7572   N NZ   . LYS A 1 36  ? -8.871  10.477  -9.539  0.016 31.27 ? 32  LYS A NZ   3  
ATOM   7573   H H    . LYS A 1 36  ? -9.361  7.313   -9.264  0.016 29.72 ? 32  LYS A H    3  
ATOM   7574   H HA   . LYS A 1 36  ? -7.763  5.509   -10.544 0.016 31.84 ? 32  LYS A HA   3  
ATOM   7575   H HB2  . LYS A 1 36  ? -6.870  7.227   -8.498  0.016 31.68 ? 32  LYS A HB2  3  
ATOM   7576   H HB3  . LYS A 1 36  ? -6.013  6.098   -9.179  0.016 32.80 ? 32  LYS A HB3  3  
ATOM   7577   H HG2  . LYS A 1 36  ? -5.301  8.127   -10.049 0.016 34.54 ? 32  LYS A HG2  3  
ATOM   7578   H HG3  . LYS A 1 36  ? -6.010  7.221   -11.176 0.016 34.50 ? 32  LYS A HG3  3  
ATOM   7579   H HD2  . LYS A 1 36  ? -6.569  9.568   -11.087 0.016 34.36 ? 32  LYS A HD2  3  
ATOM   7580   H HD3  . LYS A 1 36  ? -7.787  8.586   -11.228 0.016 32.92 ? 32  LYS A HD3  3  
ATOM   7581   H HE2  . LYS A 1 36  ? -8.075  8.801   -8.804  0.016 31.05 ? 32  LYS A HE2  3  
ATOM   7582   H HE3  . LYS A 1 36  ? -7.002  9.972   -8.867  0.016 32.51 ? 32  LYS A HE3  3  
ATOM   7583   H HZ1  . LYS A 1 36  ? -9.552  10.069  -9.938  0.016 30.21 ? 32  LYS A HZ1  3  
ATOM   7584   H HZ2  . LYS A 1 36  ? -9.148  10.785  -8.752  0.016 31.58 ? 32  LYS A HZ2  3  
ATOM   7585   H HZ3  . LYS A 1 36  ? -8.611  11.162  -10.041 0.016 31.65 ? 32  LYS A HZ3  3  
ATOM   7586   N N    . PRO A 1 37  ? -8.661  3.738   -9.067  0.016 29.73 ? 33  PRO A N    3  
ATOM   7587   C CA   . PRO A 1 37  ? -9.212  2.759   -8.113  0.016 28.65 ? 33  PRO A CA   3  
ATOM   7588   C C    . PRO A 1 37  ? -8.375  2.541   -6.867  0.016 28.94 ? 33  PRO A C    3  
ATOM   7589   O O    . PRO A 1 37  ? -8.941  2.293   -5.793  0.016 28.04 ? 33  PRO A O    3  
ATOM   7590   C CB   . PRO A 1 37  ? -9.288  1.485   -8.962  0.016 28.93 ? 33  PRO A CB   3  
ATOM   7591   C CG   . PRO A 1 37  ? -9.564  1.967   -10.300 0.016 29.52 ? 33  PRO A CG   3  
ATOM   7592   C CD   . PRO A 1 37  ? -8.735  3.223   -10.438 0.016 30.47 ? 33  PRO A CD   3  
ATOM   7593   H HA   . PRO A 1 37  ? -10.111 3.016   -7.863  0.016 27.74 ? 33  PRO A HA   3  
ATOM   7594   H HB2  . PRO A 1 37  ? -8.435  1.027   -8.940  0.016 29.66 ? 33  PRO A HB2  3  
ATOM   7595   H HB3  . PRO A 1 37  ? -9.994  0.904   -8.635  0.016 28.12 ? 33  PRO A HB3  3  
ATOM   7596   H HG2  . PRO A 1 37  ? -9.291  1.304   -10.950 0.016 30.16 ? 33  PRO A HG2  3  
ATOM   7597   H HG3  . PRO A 1 37  ? -10.506 2.178   -10.399 0.016 28.78 ? 33  PRO A HG3  3  
ATOM   7598   H HD2  . PRO A 1 37  ? -7.851  2.996   -10.760 0.016 31.49 ? 33  PRO A HD2  3  
ATOM   7599   H HD3  . PRO A 1 37  ? -9.174  3.850   -11.029 0.016 30.60 ? 33  PRO A HD3  3  
ATOM   7600   N N    . TYR A 1 38  ? -7.031  2.590   -6.978  0.016 30.35 ? 34  TYR A N    3  
ATOM   7601   C CA   . TYR A 1 38  ? -6.178  2.305   -5.830  0.016 30.92 ? 34  TYR A CA   3  
ATOM   7602   C C    . TYR A 1 38  ? -5.999  3.485   -4.888  0.016 31.19 ? 34  TYR A C    3  
ATOM   7603   O O    . TYR A 1 38  ? -5.769  3.270   -3.694  0.016 31.99 ? 34  TYR A O    3  
ATOM   7604   C CB   . TYR A 1 38  ? -4.799  1.822   -6.297  0.016 32.51 ? 34  TYR A CB   3  
ATOM   7605   C CG   . TYR A 1 38  ? -4.861  0.607   -7.177  0.016 32.47 ? 34  TYR A CG   3  
ATOM   7606   C CD1  . TYR A 1 38  ? -4.881  0.725   -8.555  0.016 32.98 ? 34  TYR A CD1  3  
ATOM   7607   C CD2  . TYR A 1 38  ? -4.921  -0.659  -6.625  0.016 32.03 ? 34  TYR A CD2  3  
ATOM   7608   C CE1  . TYR A 1 38  ? -4.930  -0.379  -9.362  0.016 33.11 ? 34  TYR A CE1  3  
ATOM   7609   C CE2  . TYR A 1 38  ? -4.970  -1.766  -7.422  0.016 32.09 ? 34  TYR A CE2  3  
ATOM   7610   C CZ   . TYR A 1 38  ? -4.993  -1.628  -8.787  0.016 32.61 ? 34  TYR A CZ   3  
ATOM   7611   O OH   . TYR A 1 38  ? -5.043  -2.762  -9.579  0.016 32.81 ? 34  TYR A OH   3  
ATOM   7612   H H    . TYR A 1 38  ? -6.604  2.781   -7.699  0.016 31.09 ? 34  TYR A H    3  
ATOM   7613   H HA   . TYR A 1 38  ? -6.591  1.591   -5.321  0.016 30.24 ? 34  TYR A HA   3  
ATOM   7614   H HB2  . TYR A 1 38  ? -4.375  2.529   -6.808  0.016 33.32 ? 34  TYR A HB2  3  
ATOM   7615   H HB3  . TYR A 1 38  ? -4.256  1.608   -5.523  0.016 32.91 ? 34  TYR A HB3  3  
ATOM   7616   H HD1  . TYR A 1 38  ? -4.841  1.570   -8.939  0.016 33.37 ? 34  TYR A HD1  3  
ATOM   7617   H HD2  . TYR A 1 38  ? -4.911  -0.750  -5.701  0.016 31.78 ? 34  TYR A HD2  3  
ATOM   7618   H HE1  . TYR A 1 38  ? -4.940  -0.286  -10.287 0.016 33.58 ? 34  TYR A HE1  3  
ATOM   7619   H HE2  . TYR A 1 38  ? -5.009  -2.614  -7.043  0.016 31.85 ? 34  TYR A HE2  3  
ATOM   7620   H HH   . TYR A 1 38  ? -4.796  -2.580  -10.361 0.016 33.45 ? 34  TYR A HH   3  
ATOM   7621   N N    . GLU A 1 39  ? -6.087  4.720   -5.386  0.016 30.71 ? 35  GLU A N    3  
ATOM   7622   C CA   . GLU A 1 39  ? -6.006  5.884   -4.516  0.016 30.78 ? 35  GLU A CA   3  
ATOM   7623   C C    . GLU A 1 39  ? -7.353  6.193   -3.870  0.016 29.29 ? 35  GLU A C    3  
ATOM   7624   O O    . GLU A 1 39  ? -7.412  6.992   -2.921  0.016 29.30 ? 35  GLU A O    3  
ATOM   7625   C CB   . GLU A 1 39  ? -5.475  7.103   -5.306  0.016 31.89 ? 35  GLU A CB   3  
ATOM   7626   C CG   . GLU A 1 39  ? -3.983  7.005   -5.757  0.016 33.73 ? 35  GLU A CG   3  
ATOM   7627   C CD   . GLU A 1 39  ? -3.506  8.139   -6.701  0.016 34.97 ? 35  GLU A CD   3  
ATOM   7628   O OE1  . GLU A 1 39  ? -4.308  8.994   -7.105  0.016 34.77 ? 35  GLU A OE1  3  
ATOM   7629   O OE2  . GLU A 1 39  ? -2.311  8.174   -7.048  0.016 36.24 ? 35  GLU A OE2  3  
ATOM   7630   H H    . GLU A 1 39  ? -6.192  4.900   -6.219  0.016 30.40 ? 35  GLU A H    3  
ATOM   7631   H HA   . GLU A 1 39  ? -5.373  5.700   -3.805  0.016 31.27 ? 35  GLU A HA   3  
ATOM   7632   H HB2  . GLU A 1 39  ? -6.012  7.207   -6.105  0.016 31.54 ? 35  GLU A HB2  3  
ATOM   7633   H HB3  . GLU A 1 39  ? -5.558  7.891   -4.745  0.016 31.90 ? 35  GLU A HB3  3  
ATOM   7634   H HG2  . GLU A 1 39  ? -3.418  7.028   -4.967  0.016 34.19 ? 35  GLU A HG2  3  
ATOM   7635   H HG3  . GLU A 1 39  ? -3.859  6.164   -6.225  0.016 33.84 ? 35  GLU A HG3  3  
ATOM   7636   N N    . GLY A 1 40  ? -8.413  5.552   -4.358  0.016 28.16 ? 36  GLY A N    3  
ATOM   7637   C CA   . GLY A 1 40  ? -9.742  5.620   -3.783  0.016 26.87 ? 36  GLY A CA   3  
ATOM   7638   C C    . GLY A 1 40  ? -10.580 6.800   -4.210  0.016 26.62 ? 36  GLY A C    3  
ATOM   7639   O O    . GLY A 1 40  ? -11.517 7.151   -3.485  0.016 25.89 ? 36  GLY A O    3  
ATOM   7640   H H    . GLY A 1 40  ? -8.383  5.040   -5.049  0.016 28.21 ? 36  GLY A H    3  
ATOM   7641   H HA2  . GLY A 1 40  ? -10.222 4.822   -4.039  0.016 26.28 ? 36  GLY A HA2  3  
ATOM   7642   H HA3  . GLY A 1 40  ? -9.678  5.624   -2.818  0.016 26.79 ? 36  GLY A HA3  3  
ATOM   7643   N N    . THR A 1 41  ? -10.347 7.354   -5.395  0.016 27.25 ? 37  THR A N    3  
ATOM   7644   C CA   . THR A 1 41  ? -10.948 8.622   -5.802  0.016 27.28 ? 37  THR A CA   3  
ATOM   7645   C C    . THR A 1 41  ? -11.613 8.478   -7.162  0.016 27.23 ? 37  THR A C    3  
ATOM   7646   O O    . THR A 1 41  ? -11.224 7.640   -7.971  0.016 27.75 ? 37  THR A O    3  
ATOM   7647   C CB   . THR A 1 41  ? -9.895  9.751   -5.871  0.016 28.66 ? 37  THR A CB   3  
ATOM   7648   O OG1  . THR A 1 41  ? -8.941  9.476   -6.901  0.016 29.84 ? 37  THR A OG1  3  
ATOM   7649   C CG2  . THR A 1 41  ? -9.181  9.936   -4.543  0.016 29.13 ? 37  THR A CG2  3  
ATOM   7650   H H    . THR A 1 41  ? -9.846  7.007   -5.996  0.016 27.74 ? 37  THR A H    3  
ATOM   7651   H HA   . THR A 1 41  ? -11.625 8.882   -5.157  0.016 26.59 ? 37  THR A HA   3  
ATOM   7652   H HB   . THR A 1 41  ? -10.355 10.584  -6.078  0.016 28.60 ? 37  THR A HB   3  
ATOM   7653   H HG1  . THR A 1 41  ? -8.184  9.757   -6.674  0.016 30.20 ? 37  THR A HG1  3  
ATOM   7654   H HG21 . THR A 1 41  ? -9.806  10.269  -3.881  0.016 28.73 ? 37  THR A HG21 3  
ATOM   7655   H HG22 . THR A 1 41  ? -8.807  9.097   -4.232  0.016 28.88 ? 37  THR A HG22 3  
ATOM   7656   H HG23 . THR A 1 41  ? -8.469  10.587  -4.641  0.016 30.20 ? 37  THR A HG23 3  
ATOM   7657   N N    . GLN A 1 42  ? -12.631 9.302   -7.409  0.016 26.70 ? 38  GLN A N    3  
ATOM   7658   C CA   . GLN A 1 42  ? -13.329 9.249   -8.688  0.016 26.81 ? 38  GLN A CA   3  
ATOM   7659   C C    . GLN A 1 42  ? -14.178 10.503  -8.863  0.016 26.67 ? 38  GLN A C    3  
ATOM   7660   O O    . GLN A 1 42  ? -14.592 11.127  -7.884  0.016 26.03 ? 38  GLN A O    3  
ATOM   7661   C CB   . GLN A 1 42  ? -14.224 8.008   -8.766  0.016 25.91 ? 38  GLN A CB   3  
ATOM   7662   C CG   . GLN A 1 42  ? -15.068 7.848   -7.495  0.016 24.63 ? 38  GLN A CG   3  
ATOM   7663   C CD   . GLN A 1 42  ? -16.255 6.892   -7.648  0.016 23.83 ? 38  GLN A CD   3  
ATOM   7664   O OE1  . GLN A 1 42  ? -16.581 6.110   -6.733  0.016 23.06 ? 38  GLN A OE1  3  
ATOM   7665   N NE2  . GLN A 1 42  ? -16.891 6.940   -8.796  0.016 24.20 ? 38  GLN A NE2  3  
ATOM   7666   H H    . GLN A 1 42  ? -12.932 9.889   -6.859  0.016 26.37 ? 38  GLN A H    3  
ATOM   7667   H HA   . GLN A 1 42  ? -12.686 9.211   -9.410  0.016 27.70 ? 38  GLN A HA   3  
ATOM   7668   H HB2  . GLN A 1 42  ? -14.810 8.082   -9.531  0.016 26.02 ? 38  GLN A HB2  3  
ATOM   7669   H HB3  . GLN A 1 42  ? -13.663 7.223   -8.856  0.016 26.17 ? 38  GLN A HB3  3  
ATOM   7670   H HG2  . GLN A 1 42  ? -14.497 7.495   -6.795  0.016 24.58 ? 38  GLN A HG2  3  
ATOM   7671   H HG3  . GLN A 1 42  ? -15.408 8.720   -7.232  0.016 24.50 ? 38  GLN A HG3  3  
ATOM   7672   H HE21 . GLN A 1 42  ? -17.375 6.278   -9.047  0.016 23.96 ? 38  GLN A HE21 3  
ATOM   7673   H HE22 . GLN A 1 42  ? -16.822 7.634   -9.294  0.016 24.76 ? 38  GLN A HE22 3  
ATOM   7674   N N    . THR A 1 43  ? -14.450 10.823  -10.127 0.016 27.41 ? 39  THR A N    3  
ATOM   7675   C CA   . THR A 1 43  ? -15.178 12.002  -10.565 0.016 27.53 ? 39  THR A CA   3  
ATOM   7676   C C    . THR A 1 43  ? -16.141 11.592  -11.668 0.016 27.53 ? 39  THR A C    3  
ATOM   7677   O O    . THR A 1 43  ? -15.742 10.931  -12.633 0.016 28.30 ? 39  THR A O    3  
ATOM   7678   C CB   . THR A 1 43  ? -14.171 13.061  -11.048 0.016 28.98 ? 39  THR A CB   3  
ATOM   7679   O OG1  . THR A 1 43  ? -13.739 13.806  -9.917  0.016 29.02 ? 39  THR A OG1  3  
ATOM   7680   C CG2  . THR A 1 43  ? -14.702 13.988  -12.204 0.016 29.44 ? 39  THR A CG2  3  
ATOM   7681   H H    . THR A 1 43  ? -14.212 10.330  -10.788 0.016 27.95 ? 39  THR A H    3  
ATOM   7682   H HA   . THR A 1 43  ? -15.682 12.368  -9.824  0.016 26.83 ? 39  THR A HA   3  
ATOM   7683   H HB   . THR A 1 43  ? -13.401 12.597  -11.407 0.016 29.77 ? 39  THR A HB   3  
ATOM   7684   H HG1  . THR A 1 43  ? -13.441 13.288  -9.328  0.016 28.65 ? 39  THR A HG1  3  
ATOM   7685   H HG21 . THR A 1 43  ? -15.667 13.954  -12.279 0.016 28.62 ? 39  THR A HG21 3  
ATOM   7686   H HG22 . THR A 1 43  ? -14.442 14.906  -12.032 0.016 30.25 ? 39  THR A HG22 3  
ATOM   7687   H HG23 . THR A 1 43  ? -14.311 13.710  -13.048 0.016 29.87 ? 39  THR A HG23 3  
ATOM   7688   N N    . LEU A 1 44  ? -17.404 11.963  -11.510 0.016 26.78 ? 40  LEU A N    3  
ATOM   7689   C CA   . LEU A 1 44  ? -18.435 11.690  -12.492 0.016 26.85 ? 40  LEU A CA   3  
ATOM   7690   C C    . LEU A 1 44  ? -19.086 13.002  -12.895 0.016 27.31 ? 40  LEU A C    3  
ATOM   7691   O O    . LEU A 1 44  ? -19.308 13.866  -12.057 0.016 26.89 ? 40  LEU A O    3  
ATOM   7692   C CB   . LEU A 1 44  ? -19.516 10.751  -11.960 0.016 25.62 ? 40  LEU A CB   3  
ATOM   7693   C CG   . LEU A 1 44  ? -19.076 9.299   -11.905 0.016 25.38 ? 40  LEU A CG   3  
ATOM   7694   C CD1  . LEU A 1 44  ? -19.962 8.438   -10.980 0.016 24.20 ? 40  LEU A CD1  3  
ATOM   7695   C CD2  . LEU A 1 44  ? -19.089 8.747   -13.330 0.016 26.48 ? 40  LEU A CD2  3  
ATOM   7696   H H    . LEU A 1 44  ? -17.696 12.381  -10.822 0.016 26.29 ? 40  LEU A H    3  
ATOM   7697   H HA   . LEU A 1 44  ? -18.034 11.296  -13.280 0.016 27.56 ? 40  LEU A HA   3  
ATOM   7698   H HB2  . LEU A 1 44  ? -19.761 11.024  -11.061 0.016 24.96 ? 40  LEU A HB2  3  
ATOM   7699   H HB3  . LEU A 1 44  ? -20.287 10.801  -12.547 0.016 25.69 ? 40  LEU A HB3  3  
ATOM   7700   H HG   . LEU A 1 44  ? -18.166 9.268   -11.570 0.016 25.40 ? 40  LEU A HG   3  
ATOM   7701   H HD11 . LEU A 1 44  ? -19.435 7.709   -10.616 0.016 23.94 ? 40  LEU A HD11 3  
ATOM   7702   H HD12 . LEU A 1 44  ? -20.294 8.995   -10.258 0.016 23.72 ? 40  LEU A HD12 3  
ATOM   7703   H HD13 . LEU A 1 44  ? -20.709 8.086   -11.487 0.016 24.34 ? 40  LEU A HD13 3  
ATOM   7704   H HD21 . LEU A 1 44  ? -20.009 8.569   -13.580 0.016 26.52 ? 40  LEU A HD21 3  
ATOM   7705   H HD22 . LEU A 1 44  ? -18.707 9.393   -13.936 0.016 27.32 ? 40  LEU A HD22 3  
ATOM   7706   H HD23 . LEU A 1 44  ? -18.573 7.928   -13.356 0.016 26.39 ? 40  LEU A HD23 3  
ATOM   7707   N N    . ASP A 1 45  ? -19.385 13.120  -14.179 0.016 28.26 ? 41  ASP A N    3  
ATOM   7708   C CA   . ASP A 1 45  ? -20.267 14.153  -14.698 0.016 28.78 ? 41  ASP A CA   3  
ATOM   7709   C C    . ASP A 1 45  ? -21.592 13.479  -15.023 0.016 28.45 ? 41  ASP A C    3  
ATOM   7710   O O    . ASP A 1 45  ? -21.618 12.504  -15.784 0.016 29.10 ? 41  ASP A O    3  
ATOM   7711   C CB   . ASP A 1 45  ? -19.672 14.811  -15.944 0.016 30.53 ? 41  ASP A CB   3  
ATOM   7712   C CG   . ASP A 1 45  ? -18.336 15.461  -15.672 0.016 31.17 ? 41  ASP A CG   3  
ATOM   7713   O OD1  . ASP A 1 45  ? -17.649 15.018  -14.716 0.016 30.26 ? 41  ASP A OD1  3  
ATOM   7714   O OD2  . ASP A 1 45  ? -17.965 16.385  -16.422 0.016 32.75 ? 41  ASP A OD2  3  
ATOM   7715   H H    . ASP A 1 45  ? -19.075 12.609  -14.793 0.016 28.73 ? 41  ASP A H    3  
ATOM   7716   H HA   . ASP A 1 45  ? -20.409 14.826  -14.019 0.016 28.33 ? 41  ASP A HA   3  
ATOM   7717   H HB2  . ASP A 1 45  ? -19.541 14.134  -16.626 0.016 31.11 ? 41  ASP A HB2  3  
ATOM   7718   H HB3  . ASP A 1 45  ? -20.283 15.490  -16.267 0.016 30.83 ? 41  ASP A HB3  3  
ATOM   7719   N N    . LEU A 1 46  ? -22.681 14.037  -14.502 0.016 27.61 ? 42  LEU A N    3  
ATOM   7720   C CA   . LEU A 1 46  ? -24.003 13.427  -14.533 0.016 27.28 ? 42  LEU A CA   3  
ATOM   7721   C C    . LEU A 1 46  ? -24.990 14.320  -15.269 0.016 28.17 ? 42  LEU A C    3  
ATOM   7722   O O    . LEU A 1 46  ? -25.068 15.524  -14.990 0.016 28.50 ? 42  LEU A O    3  
ATOM   7723   C CB   . LEU A 1 46  ? -24.505 13.158  -13.108 0.016 25.80 ? 42  LEU A CB   3  
ATOM   7724   C CG   . LEU A 1 46  ? -23.515 12.213  -12.386 0.016 25.11 ? 42  LEU A CG   3  
ATOM   7725   C CD1  . LEU A 1 46  ? -23.723 12.142  -10.860 0.016 24.12 ? 42  LEU A CD1  3  
ATOM   7726   C CD2  . LEU A 1 46  ? -23.625 10.830  -13.005 0.016 24.81 ? 42  LEU A CD2  3  
ATOM   7727   H H    . LEU A 1 46  ? -22.676 14.807  -14.120 0.016 27.29 ? 42  LEU A H    3  
ATOM   7728   H HA   . LEU A 1 46  ? -23.955 12.597  -15.025 0.016 27.60 ? 42  LEU A HA   3  
ATOM   7729   H HB2  . LEU A 1 46  ? -24.549 13.995  -12.622 0.016 25.56 ? 42  LEU A HB2  3  
ATOM   7730   H HB3  . LEU A 1 46  ? -25.373 12.727  -13.134 0.016 25.68 ? 42  LEU A HB3  3  
ATOM   7731   H HG   . LEU A 1 46  ? -22.612 12.528  -12.537 0.016 25.67 ? 42  LEU A HG   3  
ATOM   7732   H HD11 . LEU A 1 46  ? -24.638 11.875  -10.679 0.016 23.69 ? 42  LEU A HD11 3  
ATOM   7733   H HD12 . LEU A 1 46  ? -23.103 11.500  -10.478 0.016 23.73 ? 42  LEU A HD12 3  
ATOM   7734   H HD13 . LEU A 1 46  ? -23.553 13.016  -10.480 0.016 24.44 ? 42  LEU A HD13 3  
ATOM   7735   H HD21 . LEU A 1 46  ? -23.864 10.893  -13.939 0.016 25.57 ? 42  LEU A HD21 3  
ATOM   7736   H HD22 . LEU A 1 46  ? -22.773 10.376  -12.911 0.016 24.52 ? 42  LEU A HD22 3  
ATOM   7737   H HD23 . LEU A 1 46  ? -24.311 10.335  -12.530 0.016 24.28 ? 42  LEU A HD23 3  
ATOM   7738   N N    . THR A 1 47  ? -25.745 13.698  -16.178 0.016 28.68 ? 43  THR A N    3  
ATOM   7739   C CA   . THR A 1 47  ? -26.758 14.352  -17.002 0.016 29.94 ? 43  THR A CA   3  
ATOM   7740   C C    . THR A 1 47  ? -28.142 13.768  -16.734 0.016 29.75 ? 43  THR A C    3  
ATOM   7741   O O    . THR A 1 47  ? -28.362 12.561  -16.914 0.016 29.67 ? 43  THR A O    3  
ATOM   7742   C CB   . THR A 1 47  ? -26.455 14.196  -18.503 0.016 31.59 ? 43  THR A CB   3  
ATOM   7743   O OG1  . THR A 1 47  ? -27.644 13.734  -19.156 0.016 33.09 ? 43  THR A OG1  3  
ATOM   7744   C CG2  . THR A 1 47  ? -25.353 13.157  -18.794 0.016 31.71 ? 43  THR A CG2  3  
ATOM   7745   H H    . THR A 1 47  ? -25.680 12.859  -16.342 0.016 28.38 ? 43  THR A H    3  
ATOM   7746   H HA   . THR A 1 47  ? -26.785 15.297  -16.790 0.016 29.96 ? 43  THR A HA   3  
ATOM   7747   H HB   . THR A 1 47  ? -26.164 15.046  -18.869 0.016 31.73 ? 43  THR A HB   3  
ATOM   7748   H HG1  . THR A 1 47  ? -27.463 13.471  -19.934 0.016 34.06 ? 43  THR A HG1  3  
ATOM   7749   H HG21 . THR A 1 47  ? -25.726 12.265  -18.738 0.016 31.43 ? 43  THR A HG21 3  
ATOM   7750   H HG22 . THR A 1 47  ? -25.014 13.289  -19.694 0.016 32.94 ? 43  THR A HG22 3  
ATOM   7751   H HG23 . THR A 1 47  ? -24.615 13.229  -18.174 0.016 30.98 ? 43  THR A HG23 3  
ATOM   7752   N N    . VAL A 1 48  ? -29.094 14.618  -16.355 0.016 29.72 ? 44  VAL A N    3  
ATOM   7753   C CA   . VAL A 1 48  ? -30.495 14.211  -16.401 0.016 29.82 ? 44  VAL A CA   3  
ATOM   7754   C C    . VAL A 1 48  ? -30.956 14.249  -17.862 0.016 31.62 ? 44  VAL A C    3  
ATOM   7755   O O    . VAL A 1 48  ? -31.004 15.316  -18.481 0.016 32.80 ? 44  VAL A O    3  
ATOM   7756   C CB   . VAL A 1 48  ? -31.375 15.089  -15.512 0.016 29.34 ? 44  VAL A CB   3  
ATOM   7757   C CG1  . VAL A 1 48  ? -32.811 14.581  -15.565 0.016 29.61 ? 44  VAL A CG1  3  
ATOM   7758   C CG2  . VAL A 1 48  ? -30.877 15.079  -14.087 0.016 27.79 ? 44  VAL A CG2  3  
ATOM   7759   H H    . VAL A 1 48  ? -28.955 15.411  -16.062 0.016 29.71 ? 44  VAL A H    3  
ATOM   7760   H HA   . VAL A 1 48  ? -30.570 13.297  -16.083 0.016 29.19 ? 44  VAL A HA   3  
ATOM   7761   H HB   . VAL A 1 48  ? -31.363 16.001  -15.843 0.016 30.01 ? 44  VAL A HB   3  
ATOM   7762   H HG11 . VAL A 1 48  ? -32.808 13.614  -15.493 0.016 29.22 ? 44  VAL A HG11 3  
ATOM   7763   H HG12 . VAL A 1 48  ? -33.308 14.963  -14.826 0.016 29.14 ? 44  VAL A HG12 3  
ATOM   7764   H HG13 . VAL A 1 48  ? -33.213 14.851  -16.407 0.016 30.74 ? 44  VAL A HG13 3  
ATOM   7765   H HG21 . VAL A 1 48  ? -30.494 14.211  -13.896 0.016 27.25 ? 44  VAL A HG21 3  
ATOM   7766   H HG22 . VAL A 1 48  ? -30.200 15.762  -13.981 0.016 27.81 ? 44  VAL A HG22 3  
ATOM   7767   H HG23 . VAL A 1 48  ? -31.619 15.248  -13.490 0.016 27.45 ? 44  VAL A HG23 3  
ATOM   7768   N N    . GLU A 1 49  ? -31.285 13.076  -18.420 0.016 31.97 ? 45  GLU A N    3  
ATOM   7769   C CA   . GLU A 1 49  ? -31.680 12.932  -19.820 0.016 33.82 ? 45  GLU A CA   3  
ATOM   7770   C C    . GLU A 1 49  ? -33.173 12.745  -19.972 0.016 34.39 ? 45  GLU A C    3  
ATOM   7771   O O    . GLU A 1 49  ? -33.718 13.040  -21.042 0.016 36.06 ? 45  GLU A O    3  
ATOM   7772   C CB   . GLU A 1 49  ? -30.984 11.731  -20.493 0.016 34.13 ? 45  GLU A CB   3  
ATOM   7773   C CG   . GLU A 1 49  ? -31.638 11.229  -21.845 0.016 36.00 ? 45  GLU A CG   3  
ATOM   7774   C CD   . GLU A 1 49  ? -31.379 12.101  -23.060 0.016 38.03 ? 45  GLU A CD   3  
ATOM   7775   O OE1  . GLU A 1 49  ? -30.573 13.052  -22.970 0.016 39.20 ? 45  GLU A OE1  3  
ATOM   7776   O OE2  . GLU A 1 49  ? -32.017 11.769  -24.109 0.016 38.64 ? 45  GLU A OE2  3  
ATOM   7777   H H    . GLU A 1 49  ? -31.289 12.336  -17.984 0.016 31.22 ? 45  GLU A H    3  
ATOM   7778   H HA   . GLU A 1 49  ? -31.417 13.733  -20.304 0.016 34.71 ? 45  GLU A HA   3  
ATOM   7779   H HB2  . GLU A 1 49  ? -30.055 11.944  -20.638 0.016 33.06 ? 45  GLU A HB2  3  
ATOM   7780   H HB3  . GLU A 1 49  ? -31.028 10.980  -19.883 0.016 34.27 ? 45  GLU A HB3  3  
ATOM   7781   H HG2  . GLU A 1 49  ? -31.263 10.382  -22.084 0.016 35.99 ? 45  GLU A HG2  3  
ATOM   7782   H HG3  . GLU A 1 49  ? -32.590 11.133  -21.760 0.016 36.06 ? 45  GLU A HG3  3  
ATOM   7783   N N    . GLU A 1 50  ? -33.834 12.211  -18.947 0.016 33.18 ? 46  GLU A N    3  
ATOM   7784   C CA   . GLU A 1 50  ? -35.285 12.136  -18.939 0.016 33.75 ? 46  GLU A CA   3  
ATOM   7785   C C    . GLU A 1 50  ? -35.794 12.539  -17.564 0.016 32.26 ? 46  GLU A C    3  
ATOM   7786   O O    . GLU A 1 50  ? -35.137 12.305  -16.547 0.016 30.74 ? 46  GLU A O    3  
ATOM   7787   C CB   . GLU A 1 50  ? -35.817 10.734  -19.292 0.016 34.44 ? 46  GLU A CB   3  
ATOM   7788   C CG   . GLU A 1 50  ? -35.434 10.218  -20.697 0.016 36.07 ? 46  GLU A CG   3  
ATOM   7789   C CD   . GLU A 1 50  ? -35.960 8.792   -20.964 0.016 36.80 ? 46  GLU A CD   3  
ATOM   7790   O OE1  . GLU A 1 50  ? -35.346 8.041   -21.769 0.016 37.68 ? 46  GLU A OE1  3  
ATOM   7791   O OE2  . GLU A 1 50  ? -36.988 8.419   -20.361 0.016 36.62 ? 46  GLU A OE2  3  
ATOM   7792   H H    . GLU A 1 50  ? -33.461 11.887  -18.246 0.016 32.10 ? 46  GLU A H    3  
ATOM   7793   H HA   . GLU A 1 50  ? -35.639 12.759  -19.592 0.016 34.83 ? 46  GLU A HA   3  
ATOM   7794   H HB2  . GLU A 1 50  ? -35.490 10.097  -18.637 0.016 33.40 ? 46  GLU A HB2  3  
ATOM   7795   H HB3  . GLU A 1 50  ? -36.785 10.766  -19.254 0.016 35.04 ? 46  GLU A HB3  3  
ATOM   7796   H HG2  . GLU A 1 50  ? -35.816 10.813  -21.362 0.016 37.28 ? 46  GLU A HG2  3  
ATOM   7797   H HG3  . GLU A 1 50  ? -34.468 10.209  -20.781 0.016 35.62 ? 46  GLU A HG3  3  
ATOM   7798   N N    . GLY A 1 51  ? -36.982 13.137  -17.551 0.016 32.88 ? 47  GLY A N    3  
ATOM   7799   C CA   . GLY A 1 51  ? -37.640 13.565  -16.334 0.016 31.85 ? 47  GLY A CA   3  
ATOM   7800   C C    . GLY A 1 51  ? -37.149 14.868  -15.752 0.016 31.11 ? 47  GLY A C    3  
ATOM   7801   O O    . GLY A 1 51  ? -37.444 15.157  -14.583 0.016 30.19 ? 47  GLY A O    3  
ATOM   7802   H H    . GLY A 1 51  ? -37.437 13.302  -18.260 0.016 34.02 ? 47  GLY A H    3  
ATOM   7803   H HA2  . GLY A 1 51  ? -38.586 13.673  -16.517 0.016 32.61 ? 47  GLY A HA2  3  
ATOM   7804   H HA3  . GLY A 1 51  ? -37.547 12.880  -15.656 0.016 30.98 ? 47  GLY A HA3  3  
ATOM   7805   N N    . ALA A 1 52  ? -36.430 15.674  -16.524 0.016 31.66 ? 48  ALA A N    3  
ATOM   7806   C CA   . ALA A 1 52  ? -36.045 16.992  -16.061 0.016 31.26 ? 48  ALA A CA   3  
ATOM   7807   C C    . ALA A 1 52  ? -37.277 17.902  -15.994 0.016 32.24 ? 48  ALA A C    3  
ATOM   7808   O O    . ALA A 1 52  ? -38.133 17.875  -16.896 0.016 33.66 ? 48  ALA A O    3  
ATOM   7809   C CB   . ALA A 1 52  ? -35.019 17.596  -16.971 0.016 31.78 ? 48  ALA A CB   3  
ATOM   7810   H H    . ALA A 1 52  ? -36.156 15.482  -17.316 0.016 32.34 ? 48  ALA A H    3  
ATOM   7811   H HA   . ALA A 1 52  ? -35.657 16.905  -15.178 0.016 30.16 ? 48  ALA A HA   3  
ATOM   7812   H HB1  . ALA A 1 52  ? -34.813 18.489  -16.654 0.016 31.66 ? 48  ALA A HB1  3  
ATOM   7813   H HB2  . ALA A 1 52  ? -34.218 17.050  -16.961 0.016 31.17 ? 48  ALA A HB2  3  
ATOM   7814   H HB3  . ALA A 1 52  ? -35.388 17.639  -17.867 0.016 32.97 ? 48  ALA A HB3  3  
ATOM   7815   N N    . PRO A 1 53  ? -37.356 18.752  -14.955 0.016 31.67 ? 49  PRO A N    3  
ATOM   7816   C CA   . PRO A 1 53  ? -36.404 18.974  -13.868 0.016 30.23 ? 49  PRO A CA   3  
ATOM   7817   C C    . PRO A 1 53  ? -36.691 18.007  -12.720 0.016 28.99 ? 49  PRO A C    3  
ATOM   7818   O O    . PRO A 1 53  ? -37.863 17.755  -12.486 0.016 29.23 ? 49  PRO A O    3  
ATOM   7819   C CB   . PRO A 1 53  ? -36.710 20.406  -13.445 0.016 30.59 ? 49  PRO A CB   3  
ATOM   7820   C CG   . PRO A 1 53  ? -38.190 20.473  -13.574 0.016 31.96 ? 49  PRO A CG   3  
ATOM   7821   C CD   . PRO A 1 53  ? -38.535 19.627  -14.800 0.016 32.87 ? 49  PRO A CD   3  
ATOM   7822   H HA   . PRO A 1 53  ? -35.489 18.895  -14.174 0.016 30.06 ? 49  PRO A HA   3  
ATOM   7823   H HB2  . PRO A 1 53  ? -36.441 20.543  -12.525 0.016 29.82 ? 49  PRO A HB2  3  
ATOM   7824   H HB3  . PRO A 1 53  ? -36.273 21.030  -14.045 0.016 30.84 ? 49  PRO A HB3  3  
ATOM   7825   H HG2  . PRO A 1 53  ? -38.597 20.095  -12.779 0.016 31.72 ? 49  PRO A HG2  3  
ATOM   7826   H HG3  . PRO A 1 53  ? -38.473 21.393  -13.699 0.016 32.62 ? 49  PRO A HG3  3  
ATOM   7827   H HD2  . PRO A 1 53  ? -39.333 19.102  -14.637 0.016 33.42 ? 49  PRO A HD2  3  
ATOM   7828   H HD3  . PRO A 1 53  ? -38.638 20.198  -15.578 0.016 33.69 ? 49  PRO A HD3  3  
ATOM   7829   N N    . LEU A 1 54  ? -35.716 17.493  -11.993 0.016 27.82 ? 50  LEU A N    3  
ATOM   7830   C CA   . LEU A 1 54  ? -36.074 16.536  -10.955 0.016 26.84 ? 50  LEU A CA   3  
ATOM   7831   C C    . LEU A 1 54  ? -36.669 17.285  -9.763  0.016 26.57 ? 50  LEU A C    3  
ATOM   7832   O O    . LEU A 1 54  ? -36.158 18.343  -9.379  0.016 26.31 ? 50  LEU A O    3  
ATOM   7833   C CB   . LEU A 1 54  ? -34.871 15.668  -10.530 0.016 25.75 ? 50  LEU A CB   3  
ATOM   7834   C CG   . LEU A 1 54  ? -34.204 14.842  -11.637 0.016 25.86 ? 50  LEU A CG   3  
ATOM   7835   C CD1  . LEU A 1 54  ? -33.071 13.954  -11.073 0.016 24.79 ? 50  LEU A CD1  3  
ATOM   7836   C CD2  . LEU A 1 54  ? -35.184 13.973  -12.438 0.016 26.29 ? 50  LEU A CD2  3  
ATOM   7837   H H    . LEU A 1 54  ? -34.880 17.669  -12.076 0.016 27.67 ? 50  LEU A H    3  
ATOM   7838   H HA   . LEU A 1 54  ? -36.741 15.946  -11.321 0.016 27.18 ? 50  LEU A HA   3  
ATOM   7839   H HB2  . LEU A 1 54  ? -34.191 16.250  -10.161 0.016 25.58 ? 50  LEU A HB2  3  
ATOM   7840   H HB3  . LEU A 1 54  ? -35.164 15.050  -9.845  0.016 25.18 ? 50  LEU A HB3  3  
ATOM   7841   H HG   . LEU A 1 54  ? -33.799 15.463  -12.262 0.016 26.50 ? 50  LEU A HG   3  
ATOM   7842   H HD11 . LEU A 1 54  ? -32.223 14.252  -11.441 0.016 24.89 ? 50  LEU A HD11 3  
ATOM   7843   H HD12 . LEU A 1 54  ? -33.054 14.035  -10.107 0.016 24.22 ? 50  LEU A HD12 3  
ATOM   7844   H HD13 . LEU A 1 54  ? -33.231 13.031  -11.329 0.016 24.73 ? 50  LEU A HD13 3  
ATOM   7845   H HD21 . LEU A 1 54  ? -34.717 13.570  -13.185 0.016 26.13 ? 50  LEU A HD21 3  
ATOM   7846   H HD22 . LEU A 1 54  ? -35.528 13.280  -11.855 0.016 25.94 ? 50  LEU A HD22 3  
ATOM   7847   H HD23 . LEU A 1 54  ? -35.909 14.523  -12.767 0.016 27.20 ? 50  LEU A HD23 3  
ATOM   7848   N N    . PRO A 1 55  ? -37.754 16.800  -9.176  0.016 26.69 ? 51  PRO A N    3  
ATOM   7849   C CA   . PRO A 1 55  ? -38.426 17.594  -8.146  0.016 26.73 ? 51  PRO A CA   3  
ATOM   7850   C C    . PRO A 1 55  ? -38.168 17.059  -6.753  0.016 25.69 ? 51  PRO A C    3  
ATOM   7851   O O    . PRO A 1 55  ? -38.994 17.211  -5.849  0.016 25.82 ? 51  PRO A O    3  
ATOM   7852   C CB   . PRO A 1 55  ? -39.893 17.455  -8.538  0.016 27.37 ? 51  PRO A CB   3  
ATOM   7853   C CG   . PRO A 1 55  ? -39.962 15.978  -8.988  0.016 27.31 ? 51  PRO A CG   3  
ATOM   7854   C CD   . PRO A 1 55  ? -38.572 15.629  -9.546  0.016 26.94 ? 51  PRO A CD   3  
ATOM   7855   H HA   . PRO A 1 55  ? -38.159 18.526  -8.193  0.016 27.24 ? 51  PRO A HA   3  
ATOM   7856   H HB2  . PRO A 1 55  ? -40.462 17.623  -7.773  0.016 27.06 ? 51  PRO A HB2  3  
ATOM   7857   H HB3  . PRO A 1 55  ? -40.098 18.057  -9.271  0.016 28.23 ? 51  PRO A HB3  3  
ATOM   7858   H HG2  . PRO A 1 55  ? -40.189 15.414  -8.234  0.016 26.80 ? 51  PRO A HG2  3  
ATOM   7859   H HG3  . PRO A 1 55  ? -40.623 15.900  -9.689  0.016 28.17 ? 51  PRO A HG3  3  
ATOM   7860   H HD2  . PRO A 1 55  ? -38.236 14.826  -9.120  0.016 26.27 ? 51  PRO A HD2  3  
ATOM   7861   H HD3  . PRO A 1 55  ? -38.618 15.527  -10.508 0.016 27.67 ? 51  PRO A HD3  3  
ATOM   7862   N N    . PHE A 1 56  ? -37.026 16.392  -6.587  0.016 24.83 ? 52  PHE A N    3  
ATOM   7863   C CA   . PHE A 1 56  ? -36.616 15.856  -5.308  0.016 23.98 ? 52  PHE A CA   3  
ATOM   7864   C C    . PHE A 1 56  ? -35.124 16.111  -5.158  0.016 23.35 ? 52  PHE A C    3  
ATOM   7865   O O    . PHE A 1 56  ? -34.418 16.384  -6.126  0.016 23.53 ? 52  PHE A O    3  
ATOM   7866   C CB   . PHE A 1 56  ? -36.919 14.347  -5.180  0.016 23.70 ? 52  PHE A CB   3  
ATOM   7867   C CG   . PHE A 1 56  ? -36.322 13.520  -6.295  0.016 23.61 ? 52  PHE A CG   3  
ATOM   7868   C CD1  . PHE A 1 56  ? -35.004 13.127  -6.251  0.016 22.92 ? 52  PHE A CD1  3  
ATOM   7869   C CD2  . PHE A 1 56  ? -37.076 13.159  -7.397  0.016 24.39 ? 52  PHE A CD2  3  
ATOM   7870   C CE1  . PHE A 1 56  ? -34.450 12.397  -7.276  0.016 22.98 ? 52  PHE A CE1  3  
ATOM   7871   C CE2  . PHE A 1 56  ? -36.531 12.407  -8.417  0.016 24.49 ? 52  PHE A CE2  3  
ATOM   7872   C CZ   . PHE A 1 56  ? -35.206 12.016  -8.357  0.016 23.76 ? 52  PHE A CZ   3  
ATOM   7873   H H    . PHE A 1 56  ? -36.461 16.241  -7.218  0.016 24.81 ? 52  PHE A H    3  
ATOM   7874   H HA   . PHE A 1 56  ? -37.080 16.326  -4.599  0.016 24.12 ? 52  PHE A HA   3  
ATOM   7875   H HB2  . PHE A 1 56  ? -36.544 14.027  -4.347  0.016 23.21 ? 52  PHE A HB2  3  
ATOM   7876   H HB3  . PHE A 1 56  ? -37.882 14.213  -5.183  0.016 24.18 ? 52  PHE A HB3  3  
ATOM   7877   H HD1  . PHE A 1 56  ? -34.480 13.373  -5.522  0.016 22.51 ? 52  PHE A HD1  3  
ATOM   7878   H HD2  . PHE A 1 56  ? -37.971 13.420  -7.441  0.016 24.95 ? 52  PHE A HD2  3  
ATOM   7879   H HE1  . PHE A 1 56  ? -33.557 12.135  -7.220  0.016 22.57 ? 52  PHE A HE1  3  
ATOM   7880   H HE2  . PHE A 1 56  ? -37.052 12.168  -9.150  0.016 25.14 ? 52  PHE A HE2  3  
ATOM   7881   H HZ   . PHE A 1 56  ? -34.830 11.519  -9.046  0.016 23.90 ? 52  PHE A HZ   3  
ATOM   7882   N N    . SER A 1 57  ? -34.673 16.106  -3.925  0.016 22.80 ? 53  SER A N    3  
ATOM   7883   C CA   . SER A 1 57  ? -33.257 16.298  -3.621  0.016 22.35 ? 53  SER A CA   3  
ATOM   7884   C C    . SER A 1 57  ? -32.351 15.343  -4.396  0.016 21.98 ? 53  SER A C    3  
ATOM   7885   O O    . SER A 1 57  ? -32.428 14.120  -4.247  0.016 21.59 ? 53  SER A O    3  
ATOM   7886   C CB   . SER A 1 57  ? -33.032 16.104  -2.126  0.016 22.04 ? 53  SER A CB   3  
ATOM   7887   O OG   . SER A 1 57  ? -31.648 15.918  -1.843  0.016 21.73 ? 53  SER A OG   3  
ATOM   7888   H H    . SER A 1 57  ? -35.164 16.000  -3.232  0.016 22.76 ? 53  SER A H    3  
ATOM   7889   H HA   . SER A 1 57  ? -33.001 17.204  -3.853  0.016 22.65 ? 53  SER A HA   3  
ATOM   7890   H HB2  . SER A 1 57  ? -33.351 16.883  -1.646  0.016 22.37 ? 53  SER A HB2  3  
ATOM   7891   H HB3  . SER A 1 57  ? -33.518 15.319  -1.833  0.016 21.85 ? 53  SER A HB3  3  
ATOM   7892   H HG   . SER A 1 57  ? -31.550 15.346  -1.237  0.016 21.43 ? 53  SER A HG   3  
ATOM   7893   N N    . TYR A 1 58  ? -31.404 15.905  -5.135  0.016 22.19 ? 54  TYR A N    3  
ATOM   7894   C CA   . TYR A 1 58  ? -30.432 15.078  -5.846  0.016 22.01 ? 54  TYR A CA   3  
ATOM   7895   C C    . TYR A 1 58  ? -29.592 14.250  -4.881  0.016 21.36 ? 54  TYR A C    3  
ATOM   7896   O O    . TYR A 1 58  ? -29.065 13.197  -5.263  0.016 21.12 ? 54  TYR A O    3  
ATOM   7897   C CB   . TYR A 1 58  ? -29.506 15.968  -6.697  0.016 22.54 ? 54  TYR A CB   3  
ATOM   7898   C CG   . TYR A 1 58  ? -28.886 15.286  -7.887  0.016 22.82 ? 54  TYR A CG   3  
ATOM   7899   C CD1  . TYR A 1 58  ? -29.488 15.356  -9.118  0.016 23.54 ? 54  TYR A CD1  3  
ATOM   7900   C CD2  . TYR A 1 58  ? -27.702 14.568  -7.783  0.016 22.52 ? 54  TYR A CD2  3  
ATOM   7901   C CE1  . TYR A 1 58  ? -28.942 14.759  -10.229 0.016 24.01 ? 54  TYR A CE1  3  
ATOM   7902   C CE2  . TYR A 1 58  ? -27.155 13.951  -8.884  0.016 22.92 ? 54  TYR A CE2  3  
ATOM   7903   C CZ   . TYR A 1 58  ? -27.786 14.040  -10.108 0.016 23.68 ? 54  TYR A CZ   3  
ATOM   7904   O OH   . TYR A 1 58  ? -27.227 13.435  -11.219 0.016 24.29 ? 54  TYR A OH   3  
ATOM   7905   H H    . TYR A 1 58  ? -31.303 16.751  -5.251  0.016 22.51 ? 54  TYR A H    3  
ATOM   7906   H HA   . TYR A 1 58  ? -30.910 14.497  -6.452  0.016 22.13 ? 54  TYR A HA   3  
ATOM   7907   H HB2  . TYR A 1 58  ? -30.016 16.722  -7.023  0.016 23.00 ? 54  TYR A HB2  3  
ATOM   7908   H HB3  . TYR A 1 58  ? -28.786 16.283  -6.132  0.016 22.41 ? 54  TYR A HB3  3  
ATOM   7909   H HD1  . TYR A 1 58  ? -30.279 15.835  -9.200  0.016 23.81 ? 54  TYR A HD1  3  
ATOM   7910   H HD2  . TYR A 1 58  ? -27.269 14.499  -6.963  0.016 22.14 ? 54  TYR A HD2  3  
ATOM   7911   H HE1  . TYR A 1 58  ? -29.375 14.820  -11.047 0.016 24.62 ? 54  TYR A HE1  3  
ATOM   7912   H HE2  . TYR A 1 58  ? -26.359 13.478  -8.801  0.016 22.79 ? 54  TYR A HE2  3  
ATOM   7913   H HH   . TYR A 1 58  ? -27.776 13.432  -11.851 0.016 24.79 ? 54  TYR A HH   3  
ATOM   7914   N N    . ASP A 1 59  ? -29.466 14.675  -3.620  0.016 21.19 ? 55  ASP A N    3  
ATOM   7915   C CA   . ASP A 1 59  ? -28.564 13.985  -2.711  0.016 20.78 ? 55  ASP A CA   3  
ATOM   7916   C C    . ASP A 1 59  ? -29.016 12.539  -2.452  0.016 20.38 ? 55  ASP A C    3  
ATOM   7917   O O    . ASP A 1 59  ? -28.169 11.689  -2.198  0.016 20.12 ? 55  ASP A O    3  
ATOM   7918   C CB   . ASP A 1 59  ? -28.415 14.728  -1.383  0.016 20.90 ? 55  ASP A CB   3  
ATOM   7919   C CG   . ASP A 1 59  ? -27.685 16.063  -1.525  0.016 21.40 ? 55  ASP A CG   3  
ATOM   7920   O OD1  . ASP A 1 59  ? -26.632 16.086  -2.182  0.016 21.54 ? 55  ASP A OD1  3  
ATOM   7921   O OD2  . ASP A 1 59  ? -28.176 17.078  -0.952  0.016 21.78 ? 55  ASP A OD2  3  
ATOM   7922   H H    . ASP A 1 59  ? -29.878 15.344  -3.279  0.016 21.38 ? 55  ASP A H    3  
ATOM   7923   H HA   . ASP A 1 59  ? -27.685 13.946  -3.118  0.016 20.83 ? 55  ASP A HA   3  
ATOM   7924   H HB2  . ASP A 1 59  ? -29.292 14.889  -1.002  0.016 20.98 ? 55  ASP A HB2  3  
ATOM   7925   H HB3  . ASP A 1 59  ? -27.886 14.187  -0.782  0.016 20.72 ? 55  ASP A HB3  3  
ATOM   7926   N N    . ILE A 1 60  ? -30.317 12.246  -2.527  0.016 20.46 ? 56  ILE A N    3  
ATOM   7927   C CA   . ILE A 1 60  ? -30.719 10.862  -2.275  0.016 20.24 ? 56  ILE A CA   3  
ATOM   7928   C C    . ILE A 1 60  ? -30.154 9.912   -3.313  0.016 20.16 ? 56  ILE A C    3  
ATOM   7929   O O    . ILE A 1 60  ? -30.092 8.693   -3.054  0.016 19.97 ? 56  ILE A O    3  
ATOM   7930   C CB   . ILE A 1 60  ? -32.247 10.689  -2.205  0.016 20.55 ? 56  ILE A CB   3  
ATOM   7931   C CG1  . ILE A 1 60  ? -32.867 10.811  -3.597  0.016 20.96 ? 56  ILE A CG1  3  
ATOM   7932   C CG2  . ILE A 1 60  ? -32.816 11.624  -1.164  0.016 20.77 ? 56  ILE A CG2  3  
ATOM   7933   C CD1  . ILE A 1 60  ? -34.327 10.555  -3.650  0.016 21.44 ? 56  ILE A CD1  3  
ATOM   7934   H H    . ILE A 1 60  ? -30.954 12.793  -2.704  0.016 20.70 ? 56  ILE A H    3  
ATOM   7935   H HA   . ILE A 1 60  ? -30.358 10.600  -1.415  0.016 20.07 ? 56  ILE A HA   3  
ATOM   7936   H HB   . ILE A 1 60  ? -32.414 9.784   -1.892  0.016 20.46 ? 56  ILE A HB   3  
ATOM   7937   H HG12 . ILE A 1 60  ? -32.701 11.701  -3.944  0.016 21.12 ? 56  ILE A HG12 3  
ATOM   7938   H HG13 . ILE A 1 60  ? -32.472 10.158  -4.188  0.016 20.90 ? 56  ILE A HG13 3  
ATOM   7939   H HG21 . ILE A 1 60  ? -33.751 11.411  -1.021  0.016 21.03 ? 56  ILE A HG21 3  
ATOM   7940   H HG22 . ILE A 1 60  ? -32.327 11.516  -0.338  0.016 20.62 ? 56  ILE A HG22 3  
ATOM   7941   H HG23 . ILE A 1 60  ? -32.739 12.535  -1.485  0.016 20.93 ? 56  ILE A HG23 3  
ATOM   7942   H HD11 . ILE A 1 60  ? -34.800 11.269  -3.199  0.016 21.62 ? 56  ILE A HD11 3  
ATOM   7943   H HD12 . ILE A 1 60  ? -34.593 10.510  -4.580  0.016 21.77 ? 56  ILE A HD12 3  
ATOM   7944   H HD13 . ILE A 1 60  ? -34.516 9.711   -3.213  0.016 21.35 ? 56  ILE A HD13 3  
ATOM   7945   N N    . LEU A 1 61  ? -29.753 10.408  -4.485  0.016 20.43 ? 57  LEU A N    3  
ATOM   7946   C CA   . LEU A 1 61  ? -29.246 9.532   -5.544  0.016 20.57 ? 57  LEU A CA   3  
ATOM   7947   C C    . LEU A 1 61  ? -27.764 9.245   -5.456  0.016 20.38 ? 57  LEU A C    3  
ATOM   7948   O O    . LEU A 1 61  ? -27.307 8.295   -6.097  0.016 20.50 ? 57  LEU A O    3  
ATOM   7949   C CB   . LEU A 1 61  ? -29.483 10.156  -6.927  0.016 21.22 ? 57  LEU A CB   3  
ATOM   7950   C CG   . LEU A 1 61  ? -30.921 10.510  -7.238  0.016 21.66 ? 57  LEU A CG   3  
ATOM   7951   C CD1  . LEU A 1 61  ? -31.002 11.276  -8.525  0.016 22.45 ? 57  LEU A CD1  3  
ATOM   7952   C CD2  . LEU A 1 61  ? -31.810 9.255   -7.321  0.016 21.76 ? 57  LEU A CD2  3  
ATOM   7953   H H    . LEU A 1 61  ? -29.766 11.235  -4.695  0.016 20.63 ? 57  LEU A H    3  
ATOM   7954   H HA   . LEU A 1 61  ? -29.722 8.691   -5.521  0.016 20.54 ? 57  LEU A HA   3  
ATOM   7955   H HB2  . LEU A 1 61  ? -28.966 10.974  -6.977  0.016 21.31 ? 57  LEU A HB2  3  
ATOM   7956   H HB3  . LEU A 1 61  ? -29.180 9.551   -7.618  0.016 21.43 ? 57  LEU A HB3  3  
ATOM   7957   H HG   . LEU A 1 61  ? -31.261 11.064  -6.520  0.016 21.50 ? 57  LEU A HG   3  
ATOM   7958   H HD11 . LEU A 1 61  ? -31.940 11.399  -8.742  0.016 22.82 ? 57  LEU A HD11 3  
ATOM   7959   H HD12 . LEU A 1 61  ? -30.568 12.135  -8.410  0.016 22.47 ? 57  LEU A HD12 3  
ATOM   7960   H HD13 . LEU A 1 61  ? -30.562 10.770  -9.224  0.016 22.66 ? 57  LEU A HD13 3  
ATOM   7961   H HD21 . LEU A 1 61  ? -31.445 8.651   -7.985  0.016 21.85 ? 57  LEU A HD21 3  
ATOM   7962   H HD22 . LEU A 1 61  ? -31.830 8.821   -6.454  0.016 21.38 ? 57  LEU A HD22 3  
ATOM   7963   H HD23 . LEU A 1 61  ? -32.707 9.520   -7.578  0.016 22.23 ? 57  LEU A HD23 3  
ATOM   7964   N N    . THR A 1 62  ? -26.971 10.097  -4.797  0.016 20.28 ? 58  THR A N    3  
ATOM   7965   C CA   . THR A 1 62  ? -25.564 10.127  -5.145  0.016 20.47 ? 58  THR A CA   3  
ATOM   7966   C C    . THR A 1 62  ? -24.822 8.891   -4.627  0.016 20.20 ? 58  THR A C    3  
ATOM   7967   O O    . THR A 1 62  ? -23.888 8.428   -5.288  0.016 20.47 ? 58  THR A O    3  
ATOM   7968   C CB   . THR A 1 62  ? -24.931 11.456  -4.681  0.016 20.69 ? 58  THR A CB   3  
ATOM   7969   O OG1  . THR A 1 62  ? -25.184 11.685  -3.306  0.016 20.41 ? 58  THR A OG1  3  
ATOM   7970   C CG2  . THR A 1 62  ? -25.496 12.597  -5.511  0.016 21.15 ? 58  THR A CG2  3  
ATOM   7971   H H    . THR A 1 62  ? -27.212 10.639  -4.178  0.016 20.19 ? 58  THR A H    3  
ATOM   7972   H HA   . THR A 1 62  ? -25.498 10.117  -6.113  0.016 20.81 ? 58  THR A HA   3  
ATOM   7973   H HB   . THR A 1 62  ? -23.979 11.429  -4.829  0.016 20.89 ? 58  THR A HB   3  
ATOM   7974   H HG1  . THR A 1 62  ? -24.615 11.291  -2.836  0.016 20.34 ? 58  THR A HG1  3  
ATOM   7975   H HG21 . THR A 1 62  ? -26.451 12.690  -5.356  0.016 21.04 ? 58  THR A HG21 3  
ATOM   7976   H HG22 . THR A 1 62  ? -25.064 13.436  -5.276  0.016 21.37 ? 58  THR A HG22 3  
ATOM   7977   H HG23 . THR A 1 62  ? -25.345 12.408  -6.452  0.016 21.48 ? 58  THR A HG23 3  
ATOM   7978   N N    . PRO A 1 63  ? -25.223 8.279   -3.514  0.016 19.82 ? 59  PRO A N    3  
ATOM   7979   C CA   . PRO A 1 63  ? -24.548 7.035   -3.124  0.016 19.70 ? 59  PRO A CA   3  
ATOM   7980   C C    . PRO A 1 63  ? -24.803 5.893   -4.110  0.016 19.78 ? 59  PRO A C    3  
ATOM   7981   O O    . PRO A 1 63  ? -24.032 4.916   -4.120  0.016 19.83 ? 59  PRO A O    3  
ATOM   7982   C CB   . PRO A 1 63  ? -25.128 6.743   -1.734  0.016 19.46 ? 59  PRO A CB   3  
ATOM   7983   C CG   . PRO A 1 63  ? -25.523 8.071   -1.204  0.016 19.57 ? 59  PRO A CG   3  
ATOM   7984   C CD   . PRO A 1 63  ? -26.054 8.798   -2.421  0.016 19.65 ? 59  PRO A CD   3  
ATOM   7985   H HA   . PRO A 1 63  ? -23.598 7.199   -3.042  0.016 19.86 ? 59  PRO A HA   3  
ATOM   7986   H HB2  . PRO A 1 63  ? -25.902 6.166   -1.817  0.016 19.37 ? 59  PRO A HB2  3  
ATOM   7987   H HB3  . PRO A 1 63  ? -24.443 6.355   -1.167  0.016 19.49 ? 59  PRO A HB3  3  
ATOM   7988   H HG2  . PRO A 1 63  ? -26.212 7.960   -0.534  0.016 19.53 ? 59  PRO A HG2  3  
ATOM   7989   H HG3  . PRO A 1 63  ? -24.745 8.520   -0.841  0.016 19.75 ? 59  PRO A HG3  3  
ATOM   7990   H HD2  . PRO A 1 63  ? -26.986 8.580   -2.565  0.016 19.57 ? 59  PRO A HD2  3  
ATOM   7991   H HD3  . PRO A 1 63  ? -25.933 9.752   -2.321  0.016 19.81 ? 59  PRO A HD3  3  
ATOM   7992   N N    . ALA A 1 64  ? -25.839 5.984   -4.954  0.016 19.93 ? 60  ALA A N    3  
ATOM   7993   C CA   . ALA A 1 64  ? -26.009 4.945   -5.972  0.016 20.26 ? 60  ALA A CA   3  
ATOM   7994   C C    . ALA A 1 64  ? -25.053 5.127   -7.140  0.016 20.77 ? 60  ALA A C    3  
ATOM   7995   O O    . ALA A 1 64  ? -24.626 4.134   -7.751  0.016 21.10 ? 60  ALA A O    3  
ATOM   7996   C CB   . ALA A 1 64  ? -27.445 4.908   -6.494  0.016 20.52 ? 60  ALA A CB   3  
ATOM   7997   H H    . ALA A 1 64  ? -26.432 6.597   -4.958  0.016 19.94 ? 60  ALA A H    3  
ATOM   7998   H HA   . ALA A 1 64  ? -25.827 4.086   -5.559  0.016 20.13 ? 60  ALA A HA   3  
ATOM   7999   H HB1  . ALA A 1 64  ? -27.457 4.377   -7.304  0.016 20.91 ? 60  ALA A HB1  3  
ATOM   8000   H HB2  . ALA A 1 64  ? -28.026 4.513   -5.826  0.016 20.34 ? 60  ALA A HB2  3  
ATOM   8001   H HB3  . ALA A 1 64  ? -27.736 5.812   -6.699  0.016 20.60 ? 60  ALA A HB3  3  
ATOM   8002   N N    . PHE A 1 65  ? -24.704 6.364   -7.459  0.016 21.00 ? 61  PHE A N    3  
ATOM   8003   C CA   . PHE A 1 65  ? -23.684 6.659   -8.444  0.016 21.66 ? 61  PHE A CA   3  
ATOM   8004   C C    . PHE A 1 65  ? -22.298 6.294   -7.904  0.016 21.61 ? 61  PHE A C    3  
ATOM   8005   O O    . PHE A 1 65  ? -21.425 5.844   -8.659  0.016 22.20 ? 61  PHE A O    3  
ATOM   8006   C CB   . PHE A 1 65  ? -23.722 8.144   -8.809  0.016 22.05 ? 61  PHE A CB   3  
ATOM   8007   C CG   . PHE A 1 65  ? -24.973 8.561   -9.505  0.016 22.26 ? 61  PHE A CG   3  
ATOM   8008   C CD1  . PHE A 1 65  ? -25.664 9.711   -9.122  0.016 22.06 ? 61  PHE A CD1  3  
ATOM   8009   C CD2  . PHE A 1 65  ? -25.435 7.849   -10.588 0.016 22.84 ? 61  PHE A CD2  3  
ATOM   8010   C CE1  . PHE A 1 65  ? -26.805 10.075  -9.779  0.016 22.38 ? 61  PHE A CE1  3  
ATOM   8011   C CE2  . PHE A 1 65  ? -26.545 8.221   -11.254 0.016 23.22 ? 61  PHE A CE2  3  
ATOM   8012   C CZ   . PHE A 1 65  ? -27.247 9.338   -10.853 0.016 22.97 ? 61  PHE A CZ   3  
ATOM   8013   H H    . PHE A 1 65  ? -25.054 7.060   -7.103  0.016 20.85 ? 61  PHE A H    3  
ATOM   8014   H HA   . PHE A 1 65  ? -23.843 6.143   -9.248  0.016 22.05 ? 61  PHE A HA   3  
ATOM   8015   H HB2  . PHE A 1 65  ? -23.642 8.667   -7.996  0.016 21.75 ? 61  PHE A HB2  3  
ATOM   8016   H HB3  . PHE A 1 65  ? -22.976 8.325   -9.398  0.016 22.61 ? 61  PHE A HB3  3  
ATOM   8017   H HD1  . PHE A 1 65  ? -25.374 10.206  -8.391  0.016 21.78 ? 61  PHE A HD1  3  
ATOM   8018   H HD2  . PHE A 1 65  ? -24.972 7.093   -10.869 0.016 23.07 ? 61  PHE A HD2  3  
ATOM   8019   H HE1  . PHE A 1 65  ? -27.271 10.831  -9.513  0.016 22.29 ? 61  PHE A HE1  3  
ATOM   8020   H HE2  . PHE A 1 65  ? -26.847 7.721   -11.974 0.016 23.73 ? 61  PHE A HE2  3  
ATOM   8021   H HZ   . PHE A 1 65  ? -28.017 9.590   -11.305 0.016 23.30 ? 61  PHE A HZ   3  
HETATM 8022   N N    . CRQ A 1 66  ? -21.822 6.360   -6.590  0.016 21.08 ? 62  CRQ A N    3  
HETATM 8023   C CA1  . CRQ A 1 66  ? -20.679 6.303   -5.877  0.016 21.15 ? 62  CRQ A CA1  3  
HETATM 8024   C CB1  . CRQ A 1 66  ? -19.783 7.542   -5.893  0.016 21.55 ? 62  CRQ A CB1  3  
HETATM 8025   C CG1  . CRQ A 1 66  ? -19.768 8.217   -7.244  0.016 22.19 ? 62  CRQ A CG1  3  
HETATM 8026   C C1   . CRQ A 1 66  ? -20.891 5.544   -4.605  0.016 20.62 ? 62  CRQ A C1   3  
HETATM 8027   N N2   . CRQ A 1 66  ? -20.928 5.885   -3.325  0.016 20.45 ? 62  CRQ A N2   3  
HETATM 8028   N N3   . CRQ A 1 66  ? -21.195 4.121   -4.648  0.016 20.37 ? 62  CRQ A N3   3  
HETATM 8029   C C2   . CRQ A 1 66  ? -21.407 3.620   -3.318  0.016 20.03 ? 62  CRQ A C2   3  
HETATM 8030   O O2   . CRQ A 1 66  ? -21.680 2.417   -3.084  0.016 19.87 ? 62  CRQ A O2   3  
HETATM 8031   C CA2  . CRQ A 1 66  ? -21.241 4.806   -2.442  0.016 20.12 ? 62  CRQ A CA2  3  
HETATM 8032   C CA3  . CRQ A 1 66  ? -21.275 3.523   -5.907  0.016 20.59 ? 62  CRQ A CA3  3  
HETATM 8033   C CB2  . CRQ A 1 66  ? -21.358 5.015   -1.015  0.016 20.05 ? 62  CRQ A CB2  3  
HETATM 8034   C CG2  . CRQ A 1 66  ? -20.945 4.193   0.221   0.016 20.10 ? 62  CRQ A CG2  3  
HETATM 8035   C CD1  . CRQ A 1 66  ? -20.245 4.758   1.310   0.016 20.20 ? 62  CRQ A CD1  3  
HETATM 8036   C CD2  . CRQ A 1 66  ? -21.218 2.837   0.331   0.016 20.23 ? 62  CRQ A CD2  3  
HETATM 8037   C CE1  . CRQ A 1 66  ? -19.814 4.034   2.427   0.016 20.41 ? 62  CRQ A CE1  3  
HETATM 8038   C CE2  . CRQ A 1 66  ? -20.759 2.097   1.437   0.016 20.37 ? 62  CRQ A CE2  3  
HETATM 8039   C CZ   . CRQ A 1 66  ? -20.077 2.656   2.510   0.016 20.46 ? 62  CRQ A CZ   3  
HETATM 8040   O OH   . CRQ A 1 66  ? -19.689 1.844   3.601   0.016 20.77 ? 62  CRQ A OH   3  
HETATM 8041   O OE1  . CRQ A 1 66  ? -18.758 10.245  -6.455  0.016 22.34 ? 62  CRQ A OE1  3  
HETATM 8042   C C    . CRQ A 1 66  ? -20.916 2.100   -6.105  0.016 21.16 ? 62  CRQ A C    3  
HETATM 8043   O O    . CRQ A 1 66  ? -21.376 1.545   -7.151  0.016 21.49 ? 62  CRQ A O    3  
HETATM 8044   C CD3  . CRQ A 1 66  ? -18.891 9.467   -7.374  0.016 22.65 ? 62  CRQ A CD3  3  
HETATM 8045   N NE1  . CRQ A 1 66  ? -18.206 9.694   -8.590  0.016 23.63 ? 62  CRQ A NE1  3  
ATOM   8046   N N    . ASN A 1 67  ? -19.759 2.419   -6.543  0.016 21.55 ? 65  ASN A N    3  
ATOM   8047   C CA   . ASN A 1 67  ? -18.827 1.389   -7.020  0.016 22.10 ? 65  ASN A CA   3  
ATOM   8048   C C    . ASN A 1 67  ? -17.537 1.294   -6.191  0.016 22.23 ? 65  ASN A C    3  
ATOM   8049   O O    . ASN A 1 67  ? -16.591 2.034   -6.390  0.016 22.73 ? 65  ASN A O    3  
ATOM   8050   C CB   . ASN A 1 67  ? -18.452 1.638   -8.467  0.016 22.96 ? 65  ASN A CB   3  
ATOM   8051   C CG   . ASN A 1 67  ? -17.328 0.718   -8.959  0.016 23.71 ? 65  ASN A CG   3  
ATOM   8052   O OD1  . ASN A 1 67  ? -17.048 -0.337  -8.360  0.016 23.53 ? 65  ASN A OD1  3  
ATOM   8053   N ND2  . ASN A 1 67  ? -16.714 1.080   -10.069 0.016 24.67 ? 65  ASN A ND2  3  
ATOM   8054   H H    . ASN A 1 67  ? -19.508 2.793   -5.809  0.016 21.18 ? 65  ASN A H    3  
ATOM   8055   H HA   . ASN A 1 67  ? -19.265 0.526   -6.969  0.016 22.00 ? 65  ASN A HA   3  
ATOM   8056   H HB2  . ASN A 1 67  ? -19.236 1.490   -9.018  0.016 23.01 ? 65  ASN A HB2  3  
ATOM   8057   H HB3  . ASN A 1 67  ? -18.153 2.558   -8.565  0.016 23.12 ? 65  ASN A HB3  3  
ATOM   8058   H HD21 . ASN A 1 67  ? -15.857 1.060   -10.107 0.016 25.18 ? 65  ASN A HD21 3  
ATOM   8059   H HD22 . ASN A 1 67  ? -17.169 1.335   -10.750 0.016 24.87 ? 65  ASN A HD22 3  
ATOM   8060   N N    . ARG A 1 68  ? -17.461 0.301   -5.331  0.016 21.97 ? 66  ARG A N    3  
ATOM   8061   C CA   . ARG A 1 68  ? -16.358 0.280   -4.393  0.016 22.15 ? 66  ARG A CA   3  
ATOM   8062   C C    . ARG A 1 68  ? -15.090 -0.338  -4.916  0.016 23.00 ? 66  ARG A C    3  
ATOM   8063   O O    . ARG A 1 68  ? -14.156 -0.449  -4.136  0.016 23.35 ? 66  ARG A O    3  
ATOM   8064   C CB   . ARG A 1 68  ? -16.845 -0.394  -3.170  0.016 21.80 ? 66  ARG A CB   3  
ATOM   8065   C CG   . ARG A 1 68  ? -17.925 0.460   -2.742  0.016 21.22 ? 66  ARG A CG   3  
ATOM   8066   C CD   . ARG A 1 68  ? -18.302 0.011   -1.539  0.016 20.98 ? 66  ARG A CD   3  
ATOM   8067   N NE   . ARG A 1 68  ? -17.460 0.525   -0.502  0.016 21.08 ? 66  ARG A NE   3  
ATOM   8068   C CZ   . ARG A 1 68  ? -17.332 -0.115  0.647   0.016 21.29 ? 66  ARG A CZ   3  
ATOM   8069   N NH1  . ARG A 1 68  ? -17.957 -1.281  0.858   0.016 21.42 ? 66  ARG A NH1  3  
ATOM   8070   N NH2  . ARG A 1 68  ? -16.578 0.416   1.573   0.016 21.54 ? 66  ARG A NH2  3  
ATOM   8071   H H    . ARG A 1 68  ? -18.015 -0.346  -5.259  0.016 21.79 ? 66  ARG A H    3  
ATOM   8072   H HA   . ARG A 1 68  ? -16.130 1.190   -4.145  0.016 22.08 ? 66  ARG A HA   3  
ATOM   8073   H HB2  . ARG A 1 68  ? -17.189 -1.274  -3.388  0.016 22.09 ? 66  ARG A HB2  3  
ATOM   8074   H HB3  . ARG A 1 68  ? -16.152 -0.437  -2.492  0.016 21.82 ? 66  ARG A HB3  3  
ATOM   8075   H HG2  . ARG A 1 68  ? -17.617 1.377   -2.666  0.016 21.01 ? 66  ARG A HG2  3  
ATOM   8076   H HG3  . ARG A 1 68  ? -18.688 0.391   -3.337  0.016 21.33 ? 66  ARG A HG3  3  
ATOM   8077   H HD2  . ARG A 1 68  ? -19.220 0.283   -1.370  0.016 20.66 ? 66  ARG A HD2  3  
ATOM   8078   H HD3  . ARG A 1 68  ? -18.225 -0.954  -1.551  0.016 21.16 ? 66  ARG A HD3  3  
ATOM   8079   H HE   . ARG A 1 68  ? -16.809 1.037   -0.739  0.016 21.16 ? 66  ARG A HE   3  
ATOM   8080   H HH11 . ARG A 1 68  ? -18.459 -1.627  0.256   0.016 21.34 ? 66  ARG A HH11 3  
ATOM   8081   H HH12 . ARG A 1 68  ? -17.859 -1.690  1.609   0.016 21.66 ? 66  ARG A HH12 3  
ATOM   8082   H HH21 . ARG A 1 68  ? -16.189 1.155   1.397   0.016 21.52 ? 66  ARG A HH21 3  
ATOM   8083   H HH22 . ARG A 1 68  ? -16.468 0.020   2.320   0.016 21.79 ? 66  ARG A HH22 3  
ATOM   8084   N N    . ALA A 1 69  ? -15.014 -0.657  -6.201  0.016 23.49 ? 67  ALA A N    3  
ATOM   8085   C CA   . ALA A 1 69  ? -13.712 -0.824  -6.829  0.016 24.50 ? 67  ALA A CA   3  
ATOM   8086   C C    . ALA A 1 69  ? -12.870 0.442   -6.699  0.016 24.89 ? 67  ALA A C    3  
ATOM   8087   O O    . ALA A 1 69  ? -11.642 0.368   -6.637  0.016 25.79 ? 67  ALA A O    3  
ATOM   8088   C CB   . ALA A 1 69  ? -13.887 -1.187  -8.300  0.016 25.11 ? 67  ALA A CB   3  
ATOM   8089   H H    . ALA A 1 69  ? -15.685 -0.776  -6.720  0.016 23.36 ? 67  ALA A H    3  
ATOM   8090   H HA   . ALA A 1 69  ? -13.231 -1.549  -6.404  0.016 24.70 ? 67  ALA A HA   3  
ATOM   8091   H HB1  . ALA A 1 69  ? -13.950 -0.379  -8.830  0.016 25.31 ? 67  ALA A HB1  3  
ATOM   8092   H HB2  . ALA A 1 69  ? -13.116 -1.698  -8.584  0.016 25.78 ? 67  ALA A HB2  3  
ATOM   8093   H HB3  . ALA A 1 69  ? -14.695 -1.710  -8.400  0.016 24.76 ? 67  ALA A HB3  3  
ATOM   8094   N N    . PHE A 1 70  ? -13.516 1.600   -6.660  0.016 24.33 ? 68  PHE A N    3  
ATOM   8095   C CA   . PHE A 1 70  ? -12.828 2.876   -6.366  0.016 24.71 ? 68  PHE A CA   3  
ATOM   8096   C C    . PHE A 1 70  ? -12.766 3.114   -4.848  0.016 24.37 ? 68  PHE A C    3  
ATOM   8097   O O    . PHE A 1 70  ? -13.266 4.114   -4.313  0.016 23.80 ? 68  PHE A O    3  
ATOM   8098   C CB   . PHE A 1 70  ? -13.525 4.055   -7.057  0.016 24.52 ? 68  PHE A CB   3  
ATOM   8099   C CG   . PHE A 1 70  ? -13.559 4.013   -8.588  0.016 25.28 ? 68  PHE A CG   3  
ATOM   8100   C CD1  . PHE A 1 70  ? -14.715 3.667   -9.254  0.016 25.00 ? 68  PHE A CD1  3  
ATOM   8101   C CD2  . PHE A 1 70  ? -12.465 4.416   -9.350  0.016 26.48 ? 68  PHE A CD2  3  
ATOM   8102   C CE1  . PHE A 1 70  ? -14.784 3.636   -10.613 0.016 25.88 ? 68  PHE A CE1  3  
ATOM   8103   C CE2  . PHE A 1 70  ? -12.521 4.400   -10.737 0.016 27.38 ? 68  PHE A CE2  3  
ATOM   8104   C CZ   . PHE A 1 70  ? -13.674 4.016   -11.378 0.016 27.11 ? 68  PHE A CZ   3  
ATOM   8105   H H    . PHE A 1 70  ? -14.353 1.678   -6.823  0.016 23.77 ? 68  PHE A H    3  
ATOM   8106   H HA   . PHE A 1 70  ? -11.922 2.811   -6.698  0.016 25.49 ? 68  PHE A HA   3  
ATOM   8107   H HB2  . PHE A 1 70  ? -14.439 4.083   -6.744  0.016 23.82 ? 68  PHE A HB2  3  
ATOM   8108   H HB3  . PHE A 1 70  ? -13.065 4.868   -6.802  0.016 24.67 ? 68  PHE A HB3  3  
ATOM   8109   H HD1  . PHE A 1 70  ? -15.456 3.401   -8.764  0.016 24.30 ? 68  PHE A HD1  3  
ATOM   8110   H HD2  . PHE A 1 70  ? -11.680 4.668   -8.926  0.016 26.80 ? 68  PHE A HD2  3  
ATOM   8111   H HE1  . PHE A 1 70  ? -15.570 3.377   -11.032 0.016 25.79 ? 68  PHE A HE1  3  
ATOM   8112   H HE2  . PHE A 1 70  ? -11.775 4.648   -11.233 0.016 28.29 ? 68  PHE A HE2  3  
ATOM   8113   H HZ   . PHE A 1 70  ? -13.722 4.002   -12.305 0.016 27.84 ? 68  PHE A HZ   3  
ATOM   8114   N N    . THR A 1 71  ? -12.122 2.166   -4.143  0.016 24.89 ? 69  THR A N    3  
ATOM   8115   C CA   . THR A 1 71  ? -11.872 2.248   -2.705  0.016 24.93 ? 69  THR A CA   3  
ATOM   8116   C C    . THR A 1 71  ? -10.415 1.922   -2.426  0.016 26.07 ? 69  THR A C    3  
ATOM   8117   O O    . THR A 1 71  ? -9.851  1.030   -3.071  0.016 26.40 ? 69  THR A O    3  
ATOM   8118   C CB   . THR A 1 71  ? -12.753 1.258   -1.913  0.016 24.19 ? 69  THR A CB   3  
ATOM   8119   O OG1  . THR A 1 71  ? -14.122 1.625   -1.996  0.016 23.29 ? 69  THR A OG1  3  
ATOM   8120   C CG2  . THR A 1 71  ? -12.346 1.250   -0.441  0.016 24.30 ? 69  THR A CG2  3  
ATOM   8121   H H    . THR A 1 71  ? -11.822 1.444   -4.495  0.016 25.34 ? 69  THR A H    3  
ATOM   8122   H HA   . THR A 1 71  ? -12.064 3.144   -2.385  0.016 24.89 ? 69  THR A HA   3  
ATOM   8123   H HB   . THR A 1 71  ? -12.634 0.372   -2.277  0.016 24.42 ? 69  THR A HB   3  
ATOM   8124   H HG1  . THR A 1 71  ? -14.377 1.608   -2.795  0.016 23.32 ? 69  THR A HG1  3  
ATOM   8125   H HG21 . THR A 1 71  ? -11.690 0.554   -0.286  0.016 24.31 ? 69  THR A HG21 3  
ATOM   8126   H HG22 . THR A 1 71  ? -11.965 2.107   -0.196  0.016 24.96 ? 69  THR A HG22 3  
ATOM   8127   H HG23 . THR A 1 71  ? -13.114 1.081   0.121   0.016 23.82 ? 69  THR A HG23 3  
ATOM   8128   N N    . LYS A 1 72  ? -9.808  2.605   -1.450  0.016 26.81 ? 70  LYS A N    3  
ATOM   8129   C CA   . LYS A 1 72  ? -8.392  2.376   -1.148  0.016 28.08 ? 70  LYS A CA   3  
ATOM   8130   C C    . LYS A 1 72  ? -8.248  1.278   -0.094  0.016 28.10 ? 70  LYS A C    3  
ATOM   8131   O O    . LYS A 1 72  ? -8.508  1.508   1.090   0.016 28.27 ? 70  LYS A O    3  
ATOM   8132   C CB   . LYS A 1 72  ? -7.696  3.649   -0.671  0.016 29.01 ? 70  LYS A CB   3  
ATOM   8133   C CG   . LYS A 1 72  ? -6.209  3.400   -0.385  0.016 30.52 ? 70  LYS A CG   3  
ATOM   8134   C CD   . LYS A 1 72  ? -5.404  4.714   -0.342  0.016 31.39 ? 70  LYS A CD   3  
ATOM   8135   C CE   . LYS A 1 72  ? -5.414  5.434   1.013   0.016 33.02 ? 70  LYS A CE   3  
ATOM   8136   N NZ   . LYS A 1 72  ? -4.718  6.759   0.841   0.016 33.75 ? 70  LYS A NZ   3  
ATOM   8137   H H    . LYS A 1 72  ? -10.197 3.180   -0.943  0.016 26.67 ? 70  LYS A H    3  
ATOM   8138   H HA   . LYS A 1 72  ? -7.935  2.080   -1.953  0.016 28.46 ? 70  LYS A HA   3  
ATOM   8139   H HB2  . LYS A 1 72  ? -7.762  4.329   -1.361  0.016 29.09 ? 70  LYS A HB2  3  
ATOM   8140   H HB3  . LYS A 1 72  ? -8.111  3.960   0.148   0.016 28.65 ? 70  LYS A HB3  3  
ATOM   8141   H HG2  . LYS A 1 72  ? -6.123  2.954   0.471   0.016 30.56 ? 70  LYS A HG2  3  
ATOM   8142   H HG3  . LYS A 1 72  ? -5.843  2.839   -1.087  0.016 31.01 ? 70  LYS A HG3  3  
ATOM   8143   H HD2  . LYS A 1 72  ? -4.481  4.514   -0.559  0.016 31.63 ? 70  LYS A HD2  3  
ATOM   8144   H HD3  . LYS A 1 72  ? -5.767  5.324   -1.001  0.016 30.81 ? 70  LYS A HD3  3  
ATOM   8145   H HE2  . LYS A 1 72  ? -6.327  5.594   1.302   0.016 32.91 ? 70  LYS A HE2  3  
ATOM   8146   H HE3  . LYS A 1 72  ? -4.929  4.910   1.672   0.016 33.78 ? 70  LYS A HE3  3  
ATOM   8147   H HZ1  . LYS A 1 72  ? -4.273  6.975   1.580   0.016 34.70 ? 70  LYS A HZ1  3  
ATOM   8148   H HZ2  . LYS A 1 72  ? -4.150  6.716   0.159   0.016 34.10 ? 70  LYS A HZ2  3  
ATOM   8149   H HZ3  . LYS A 1 72  ? -5.318  7.393   0.665   0.016 32.99 ? 70  LYS A HZ3  3  
ATOM   8150   N N    . TYR A 1 73  ? -7.766  0.055   -0.535  0.016 28.12 ? 71  TYR A N    3  
ATOM   8151   C CA   . TYR A 1 73  ? -7.601  -1.122  0.310   0.016 28.22 ? 71  TYR A CA   3  
ATOM   8152   C C    . TYR A 1 73  ? -6.145  -1.358  0.675   0.016 29.69 ? 71  TYR A C    3  
ATOM   8153   O O    . TYR A 1 73  ? -5.293  -1.464  -0.216  0.016 30.55 ? 71  TYR A O    3  
ATOM   8154   C CB   . TYR A 1 73  ? -8.140  -2.363  -0.394  0.016 27.69 ? 71  TYR A CB   3  
ATOM   8155   C CG   . TYR A 1 73  ? -9.560  -2.642  -0.017  0.016 26.48 ? 71  TYR A CG   3  
ATOM   8156   C CD1  . TYR A 1 73  ? -10.587 -2.039  -0.693  0.016 25.60 ? 71  TYR A CD1  3  
ATOM   8157   C CD2  . TYR A 1 73  ? -9.868  -3.455  1.071   0.016 26.41 ? 71  TYR A CD2  3  
ATOM   8158   C CE1  . TYR A 1 73  ? -11.902 -2.264  -0.338  0.016 24.64 ? 71  TYR A CE1  3  
ATOM   8159   C CE2  . TYR A 1 73  ? -11.176 -3.680  1.431   0.016 25.48 ? 71  TYR A CE2  3  
ATOM   8160   C CZ   . TYR A 1 73  ? -12.184 -3.069  0.729   0.016 24.60 ? 71  TYR A CZ   3  
ATOM   8161   O OH   . TYR A 1 73  ? -13.471 -3.274  1.084   0.016 23.85 ? 71  TYR A OH   3  
ATOM   8162   H H    . TYR A 1 73  ? -7.532  -0.087  -1.349  0.016 28.16 ? 71  TYR A H    3  
ATOM   8163   H HA   . TYR A 1 73  ? -8.116  -0.987  1.116   0.016 27.81 ? 71  TYR A HA   3  
ATOM   8164   H HB2  . TYR A 1 73  ? -8.115  -2.216  -1.349  0.016 27.72 ? 71  TYR A HB2  3  
ATOM   8165   H HB3  . TYR A 1 73  ? -7.598  -3.127  -0.150  0.016 28.24 ? 71  TYR A HB3  3  
ATOM   8166   H HD1  . TYR A 1 73  ? -10.392 -1.490  -1.418  0.016 25.73 ? 71  TYR A HD1  3  
ATOM   8167   H HD2  . TYR A 1 73  ? -9.183  -3.858  1.549   0.016 27.08 ? 71  TYR A HD2  3  
ATOM   8168   H HE1  . TYR A 1 73  ? -12.586 -1.859  -0.810  0.016 24.13 ? 71  TYR A HE1  3  
ATOM   8169   H HE2  . TYR A 1 73  ? -11.381 -4.223  2.156   0.016 25.54 ? 71  TYR A HE2  3  
ATOM   8170   H HH   . TYR A 1 73  ? -13.676 -4.078  0.960   0.016 23.87 ? 71  TYR A HH   3  
ATOM   8171   N N    . PRO A 1 74  ? -5.824  -1.506  1.948   0.016 30.19 ? 72  PRO A N    3  
ATOM   8172   C CA   . PRO A 1 74  ? -4.464  -1.914  2.307   0.016 31.73 ? 72  PRO A CA   3  
ATOM   8173   C C    . PRO A 1 74  ? -4.200  -3.358  1.916   0.016 31.93 ? 72  PRO A C    3  
ATOM   8174   O O    . PRO A 1 74  ? -5.134  -4.148  1.764   0.016 30.92 ? 72  PRO A O    3  
ATOM   8175   C CB   . PRO A 1 74  ? -4.427  -1.740  3.826   0.016 32.19 ? 72  PRO A CB   3  
ATOM   8176   C CG   . PRO A 1 74  ? -5.806  -1.849  4.263   0.016 30.84 ? 72  PRO A CG   3  
ATOM   8177   C CD   . PRO A 1 74  ? -6.662  -1.279  3.138   0.016 29.58 ? 72  PRO A CD   3  
ATOM   8178   H HA   . PRO A 1 74  ? -3.807  -1.336  1.892   0.016 32.42 ? 72  PRO A HA   3  
ATOM   8179   H HB2  . PRO A 1 74  ? -3.891  -2.452  4.213   0.016 32.95 ? 72  PRO A HB2  3  
ATOM   8180   H HB3  . PRO A 1 74  ? -4.061  -0.870  4.050   0.016 32.68 ? 72  PRO A HB3  3  
ATOM   8181   H HG2  . PRO A 1 74  ? -6.024  -2.780  4.424   0.016 30.73 ? 72  PRO A HG2  3  
ATOM   8182   H HG3  . PRO A 1 74  ? -5.919  -1.322  5.072   0.016 31.02 ? 72  PRO A HG3  3  
ATOM   8183   H HD2  . PRO A 1 74  ? -7.496  -1.762  3.069   0.016 28.77 ? 72  PRO A HD2  3  
ATOM   8184   H HD3  . PRO A 1 74  ? -6.810  -0.332  3.270   0.016 29.44 ? 72  PRO A HD3  3  
ATOM   8185   N N    . GLU A 1 75  ? -2.907  -3.678  1.754   0.016 33.38 ? 73  GLU A N    3  
ATOM   8186   C CA   . GLU A 1 75  ? -2.447  -5.030  1.465   0.016 33.87 ? 73  GLU A CA   3  
ATOM   8187   C C    . GLU A 1 75  ? -3.096  -6.063  2.365   0.016 33.56 ? 73  GLU A C    3  
ATOM   8188   O O    . GLU A 1 75  ? -3.372  -7.184  1.922   0.016 33.27 ? 73  GLU A O    3  
ATOM   8189   C CB   . GLU A 1 75  ? -0.925  -5.114  1.663   0.016 35.73 ? 73  GLU A CB   3  
ATOM   8190   C CG   . GLU A 1 75  ? -0.320  -6.430  1.292   0.016 36.40 ? 73  GLU A CG   3  
ATOM   8191   C CD   . GLU A 1 75  ? 0.147   -6.422  -0.140  0.016 37.99 ? 73  GLU A CD   3  
ATOM   8192   O OE1  . GLU A 1 75  ? 1.382   -6.484  -0.363  0.016 39.54 ? 73  GLU A OE1  3  
ATOM   8193   O OE2  . GLU A 1 75  ? -0.733  -6.282  -1.033  0.016 37.83 ? 73  GLU A OE2  3  
ATOM   8194   H H    . GLU A 1 75  ? -2.268  -3.111  1.811   0.016 34.17 ? 73  GLU A H    3  
ATOM   8195   H HA   . GLU A 1 75  ? -2.654  -5.243  0.542   0.016 33.37 ? 73  GLU A HA   3  
ATOM   8196   H HB2  . GLU A 1 75  ? -0.499  -4.435  1.117   0.016 36.08 ? 73  GLU A HB2  3  
ATOM   8197   H HB3  . GLU A 1 75  ? -0.721  -4.957  2.598   0.016 36.34 ? 73  GLU A HB3  3  
ATOM   8198   H HG2  . GLU A 1 75  ? 0.445   -6.602  1.861   0.016 36.77 ? 73  GLU A HG2  3  
ATOM   8199   H HG3  . GLU A 1 75  ? -0.979  -7.133  1.391   0.016 35.57 ? 73  GLU A HG3  3  
ATOM   8200   N N    . ASP A 1 76  ? -3.309  -5.681  3.611   0.016 33.85 ? 74  ASP A N    3  
ATOM   8201   C CA   . ASP A 1 76  ? -3.742  -6.475  4.749   0.016 33.75 ? 74  ASP A CA   3  
ATOM   8202   C C    . ASP A 1 76  ? -5.224  -6.908  4.703   0.016 32.25 ? 74  ASP A C    3  
ATOM   8203   O O    . ASP A 1 76  ? -5.654  -7.663  5.579   0.016 32.39 ? 74  ASP A O    3  
ATOM   8204   C CB   . ASP A 1 76  ? -3.485  -5.612  5.997   0.016 34.15 ? 74  ASP A CB   3  
ATOM   8205   C CG   . ASP A 1 76  ? -3.307  -6.416  7.240   0.016 34.96 ? 74  ASP A CG   3  
ATOM   8206   O OD1  . ASP A 1 76  ? -4.016  -7.426  7.399   0.016 34.30 ? 74  ASP A OD1  3  
ATOM   8207   O OD2  . ASP A 1 76  ? -2.470  -6.015  8.080   0.016 36.39 ? 74  ASP A OD2  3  
ATOM   8208   H H    . ASP A 1 76  ? -3.171  -4.867  3.850   0.016 34.26 ? 74  ASP A H    3  
ATOM   8209   H HA   . ASP A 1 76  ? -3.191  -7.268  4.815   0.016 34.63 ? 74  ASP A HA   3  
ATOM   8210   H HB2  . ASP A 1 76  ? -2.681  -5.089  5.859   0.016 34.99 ? 74  ASP A HB2  3  
ATOM   8211   H HB3  . ASP A 1 76  ? -4.235  -5.010  6.131   0.016 33.19 ? 74  ASP A HB3  3  
ATOM   8212   N N    . ILE A 1 77  ? -6.017  -6.416  3.754   0.016 30.97 ? 75  ILE A N    3  
ATOM   8213   C CA   . ILE A 1 77  ? -7.450  -6.687  3.683   0.016 29.66 ? 75  ILE A CA   3  
ATOM   8214   C C    . ILE A 1 77  ? -7.767  -7.112  2.256   0.016 29.09 ? 75  ILE A C    3  
ATOM   8215   O O    . ILE A 1 77  ? -7.576  -6.326  1.325   0.016 28.95 ? 75  ILE A O    3  
ATOM   8216   C CB   . ILE A 1 77  ? -8.303  -5.459  4.059   0.016 28.78 ? 75  ILE A CB   3  
ATOM   8217   C CG1  . ILE A 1 77  ? -7.900  -4.933  5.445   0.016 29.57 ? 75  ILE A CG1  3  
ATOM   8218   C CG2  . ILE A 1 77  ? -9.800  -5.795  3.996   0.016 27.58 ? 75  ILE A CG2  3  
ATOM   8219   C CD1  . ILE A 1 77  ? -8.651  -3.670  5.957   0.016 29.05 ? 75  ILE A CD1  3  
ATOM   8220   H H    . ILE A 1 77  ? -5.740  -5.904  3.122   0.016 30.92 ? 75  ILE A H    3  
ATOM   8221   H HA   . ILE A 1 77  ? -7.672  -7.404  4.293   0.016 29.86 ? 75  ILE A HA   3  
ATOM   8222   H HB   . ILE A 1 77  ? -8.128  -4.764  3.408   0.016 28.63 ? 75  ILE A HB   3  
ATOM   8223   H HG12 . ILE A 1 77  ? -8.058  -5.638  6.084   0.016 29.71 ? 75  ILE A HG12 3  
ATOM   8224   H HG13 . ILE A 1 77  ? -6.953  -4.717  5.423   0.016 30.48 ? 75  ILE A HG13 3  
ATOM   8225   H HG21 . ILE A 1 77  ? -10.314 -4.992  4.163   0.016 27.09 ? 75  ILE A HG21 3  
ATOM   8226   H HG22 . ILE A 1 77  ? -10.016 -6.140  3.118   0.016 27.21 ? 75  ILE A HG22 3  
ATOM   8227   H HG23 . ILE A 1 77  ? -10.008 -6.456  4.670   0.016 27.78 ? 75  ILE A HG23 3  
ATOM   8228   H HD11 . ILE A 1 77  ? -9.606  -3.787  5.836   0.016 28.17 ? 75  ILE A HD11 3  
ATOM   8229   H HD12 . ILE A 1 77  ? -8.454  -3.554  6.898   0.016 29.69 ? 75  ILE A HD12 3  
ATOM   8230   H HD13 . ILE A 1 77  ? -8.347  -2.890  5.464   0.016 29.08 ? 75  ILE A HD13 3  
ATOM   8231   N N    . PRO A 1 78  ? -8.296  -8.317  2.017   0.016 28.87 ? 76  PRO A N    3  
ATOM   8232   C CA   . PRO A 1 78  ? -8.626  -8.688  0.643   0.016 28.49 ? 76  PRO A CA   3  
ATOM   8233   C C    . PRO A 1 78  ? -9.640  -7.719  0.059   0.016 27.36 ? 76  PRO A C    3  
ATOM   8234   O O    . PRO A 1 78  ? -10.634 -7.388  0.699   0.016 26.60 ? 76  PRO A O    3  
ATOM   8235   C CB   . PRO A 1 78  ? -9.196  -10.110 0.779   0.016 28.54 ? 76  PRO A CB   3  
ATOM   8236   C CG   . PRO A 1 78  ? -8.599  -10.621 2.067   0.016 29.36 ? 76  PRO A CG   3  
ATOM   8237   C CD   . PRO A 1 78  ? -8.496  -9.423  2.962   0.016 29.23 ? 76  PRO A CD   3  
ATOM   8238   H HA   . PRO A 1 78  ? -7.830  -8.694  0.094   0.016 29.10 ? 76  PRO A HA   3  
ATOM   8239   H HB2  . PRO A 1 78  ? -10.161 -10.069 0.834   0.016 27.82 ? 76  PRO A HB2  3  
ATOM   8240   H HB3  . PRO A 1 78  ? -8.916  -10.653 0.027   0.016 28.91 ? 76  PRO A HB3  3  
ATOM   8241   H HG2  . PRO A 1 78  ? -9.181  -11.288 2.462   0.016 29.25 ? 76  PRO A HG2  3  
ATOM   8242   H HG3  . PRO A 1 78  ? -7.722  -10.990 1.895   0.016 30.18 ? 76  PRO A HG3  3  
ATOM   8243   H HD2  . PRO A 1 78  ? -9.327  -9.300  3.452   0.016 28.66 ? 76  PRO A HD2  3  
ATOM   8244   H HD3  . PRO A 1 78  ? -7.733  -9.502  3.556   0.016 30.05 ? 76  PRO A HD3  3  
ATOM   8245   N N    . ASP A 1 79  ? -9.379  -7.309  -1.173  0.016 27.41 ? 77  ASP A N    3  
ATOM   8246   C CA   . ASP A 1 79  ? -10.213 -6.367  -1.915  0.016 26.58 ? 77  ASP A CA   3  
ATOM   8247   C C    . ASP A 1 79  ? -11.243 -7.148  -2.714  0.016 26.15 ? 77  ASP A C    3  
ATOM   8248   O O    . ASP A 1 79  ? -10.983 -7.560  -3.824  0.016 26.62 ? 77  ASP A O    3  
ATOM   8249   C CB   . ASP A 1 79  ? -9.331  -5.536  -2.832  0.016 27.18 ? 77  ASP A CB   3  
ATOM   8250   C CG   . ASP A 1 79  ? -10.031 -4.322  -3.388  0.016 26.52 ? 77  ASP A CG   3  
ATOM   8251   O OD1  . ASP A 1 79  ? -11.275 -4.344  -3.465  0.016 25.68 ? 77  ASP A OD1  3  
ATOM   8252   O OD2  . ASP A 1 79  ? -9.319  -3.344  -3.737  0.016 26.97 ? 77  ASP A OD2  3  
ATOM   8253   H H    . ASP A 1 79  ? -8.694  -7.560  -1.621  0.016 28.01 ? 77  ASP A H    3  
ATOM   8254   H HA   . ASP A 1 79  ? -10.667 -5.776  -1.296  0.016 26.08 ? 77  ASP A HA   3  
ATOM   8255   H HB2  . ASP A 1 79  ? -8.552  -5.246  -2.332  0.016 27.55 ? 77  ASP A HB2  3  
ATOM   8256   H HB3  . ASP A 1 79  ? -9.053  -6.086  -3.581  0.016 27.77 ? 77  ASP A HB3  3  
ATOM   8257   N N    . TYR A 1 80  ? -12.446 -7.297  -2.158  0.016 25.40 ? 78  TYR A N    3  
ATOM   8258   C CA   . TYR A 1 80  ? -13.501 -8.088  -2.789  0.016 25.13 ? 78  TYR A CA   3  
ATOM   8259   C C    . TYR A 1 80  ? -13.845 -7.530  -4.158  0.016 25.03 ? 78  TYR A C    3  
ATOM   8260   O O    . TYR A 1 80  ? -14.219 -8.268  -5.073  0.016 25.38 ? 78  TYR A O    3  
ATOM   8261   C CB   . TYR A 1 80  ? -14.731 -8.063  -1.883  0.016 24.39 ? 78  TYR A CB   3  
ATOM   8262   C CG   . TYR A 1 80  ? -15.987 -8.814  -2.323  0.016 24.22 ? 78  TYR A CG   3  
ATOM   8263   C CD1  . TYR A 1 80  ? -16.194 -10.107 -1.898  0.016 24.74 ? 78  TYR A CD1  3  
ATOM   8264   C CD2  . TYR A 1 80  ? -16.976 -8.205  -3.091  0.016 23.67 ? 78  TYR A CD2  3  
ATOM   8265   C CE1  . TYR A 1 80  ? -17.311 -10.821 -2.259  0.016 24.75 ? 78  TYR A CE1  3  
ATOM   8266   C CE2  . TYR A 1 80  ? -18.154 -8.901  -3.446  0.016 23.69 ? 78  TYR A CE2  3  
ATOM   8267   C CZ   . TYR A 1 80  ? -18.303 -10.232 -3.024  0.016 24.26 ? 78  TYR A CZ   3  
ATOM   8268   O OH   . TYR A 1 80  ? -19.412 -11.042 -3.323  0.016 24.49 ? 78  TYR A OH   3  
ATOM   8269   H H    . TYR A 1 80  ? -12.686 -6.932  -1.417  0.016 25.12 ? 78  TYR A H    3  
ATOM   8270   H HA   . TYR A 1 80  ? -13.201 -9.007  -2.882  0.016 25.64 ? 78  TYR A HA   3  
ATOM   8271   H HB2  . TYR A 1 80  ? -14.468 -8.422  -1.022  0.016 24.58 ? 78  TYR A HB2  3  
ATOM   8272   H HB3  . TYR A 1 80  ? -14.985 -7.136  -1.766  0.016 23.93 ? 78  TYR A HB3  3  
ATOM   8273   H HD1  . TYR A 1 80  ? -15.536 -10.519 -1.387  0.016 25.17 ? 78  TYR A HD1  3  
ATOM   8274   H HD2  . TYR A 1 80  ? -16.859 -7.323  -3.366  0.016 23.37 ? 78  TYR A HD2  3  
ATOM   8275   H HE1  . TYR A 1 80  ? -17.416 -11.694 -1.964  0.016 25.18 ? 78  TYR A HE1  3  
ATOM   8276   H HE2  . TYR A 1 80  ? -18.798 -8.494  -3.975  0.016 23.42 ? 78  TYR A HE2  3  
ATOM   8277   H HH   . TYR A 1 80  ? -20.002 -10.579 -3.699  0.016 24.17 ? 78  TYR A HH   3  
ATOM   8278   N N    . PHE A 1 81  ? -13.767 -6.211  -4.289  0.016 24.67 ? 79  PHE A N    3  
ATOM   8279   C CA   . PHE A 1 81  ? -14.295 -5.511  -5.440  0.016 24.53 ? 79  PHE A CA   3  
ATOM   8280   C C    . PHE A 1 81  ? -13.327 -5.531  -6.621  0.016 25.51 ? 79  PHE A C    3  
ATOM   8281   O O    . PHE A 1 81  ? -13.734 -5.806  -7.755  0.016 25.86 ? 79  PHE A O    3  
ATOM   8282   C CB   . PHE A 1 81  ? -14.643 -4.088  -4.986  0.016 23.87 ? 79  PHE A CB   3  
ATOM   8283   C CG   . PHE A 1 81  ? -15.599 -4.070  -3.830  0.016 23.08 ? 79  PHE A CG   3  
ATOM   8284   C CD1  . PHE A 1 81  ? -15.169 -3.782  -2.546  0.016 22.93 ? 79  PHE A CD1  3  
ATOM   8285   C CD2  . PHE A 1 81  ? -16.921 -4.421  -4.023  0.016 22.71 ? 79  PHE A CD2  3  
ATOM   8286   C CE1  . PHE A 1 81  ? -16.025 -3.837  -1.487  0.016 22.41 ? 79  PHE A CE1  3  
ATOM   8287   C CE2  . PHE A 1 81  ? -17.780 -4.470  -2.971  0.016 22.19 ? 79  PHE A CE2  3  
ATOM   8288   C CZ   . PHE A 1 81  ? -17.343 -4.150  -1.697  0.016 22.02 ? 79  PHE A CZ   3  
ATOM   8289   H H    . PHE A 1 81  ? -13.421 -5.693  -3.700  0.016 24.56 ? 79  PHE A H    3  
ATOM   8290   H HA   . PHE A 1 81  ? -15.118 -5.943  -5.717  0.016 24.33 ? 79  PHE A HA   3  
ATOM   8291   H HB2  . PHE A 1 81  ? -13.825 -3.668  -4.686  0.016 24.11 ? 79  PHE A HB2  3  
ATOM   8292   H HB3  . PHE A 1 81  ? -15.036 -3.601  -5.725  0.016 23.85 ? 79  PHE A HB3  3  
ATOM   8293   H HD1  . PHE A 1 81  ? -14.280 -3.569  -2.397  0.016 23.29 ? 79  PHE A HD1  3  
ATOM   8294   H HD2  . PHE A 1 81  ? -17.221 -4.631  -4.877  0.016 22.94 ? 79  PHE A HD2  3  
ATOM   8295   H HE1  . PHE A 1 81  ? -15.727 -3.619  -0.633  0.016 22.42 ? 79  PHE A HE1  3  
ATOM   8296   H HE2  . PHE A 1 81  ? -18.674 -4.684  -3.108  0.016 22.04 ? 79  PHE A HE2  3  
ATOM   8297   H HZ   . PHE A 1 81  ? -17.935 -4.173  -0.982  0.016 21.76 ? 79  PHE A HZ   3  
ATOM   8298   N N    . LYS A 1 82  ? -12.029 -5.288  -6.386  0.016 26.16 ? 80  LYS A N    3  
ATOM   8299   C CA   . LYS A 1 82  ? -11.099 -5.409  -7.501  0.016 27.29 ? 80  LYS A CA   3  
ATOM   8300   C C    . LYS A 1 82  ? -10.938 -6.866  -7.924  0.016 27.97 ? 80  LYS A C    3  
ATOM   8301   O O    . LYS A 1 82  ? -10.718 -7.136  -9.107  0.016 28.80 ? 80  LYS A O    3  
ATOM   8302   C CB   . LYS A 1 82  ? -9.762  -4.765  -7.143  0.016 27.99 ? 80  LYS A CB   3  
ATOM   8303   C CG   . LYS A 1 82  ? -9.863  -3.261  -6.923  0.016 27.58 ? 80  LYS A CG   3  
ATOM   8304   C CD   . LYS A 1 82  ? -8.498  -2.587  -6.772  0.016 28.57 ? 80  LYS A CD   3  
ATOM   8305   C CE   . LYS A 1 82  ? -8.637  -1.051  -6.526  0.016 28.23 ? 80  LYS A CE   3  
ATOM   8306   N NZ   . LYS A 1 82  ? -9.019  -0.691  -5.152  0.016 27.29 ? 80  LYS A NZ   3  
ATOM   8307   H H    . LYS A 1 82  ? -11.681 -5.074  -5.631  0.016 26.06 ? 80  LYS A H    3  
ATOM   8308   H HA   . LYS A 1 82  ? -11.458 -4.935  -8.265  0.016 27.33 ? 80  LYS A HA   3  
ATOM   8309   H HB2  . LYS A 1 82  ? -9.433  -5.150  -6.319  0.016 27.98 ? 80  LYS A HB2  3  
ATOM   8310   H HB3  . LYS A 1 82  ? -9.134  -4.924  -7.865  0.016 28.86 ? 80  LYS A HB3  3  
ATOM   8311   H HG2  . LYS A 1 82  ? -10.318 -2.872  -7.682  0.016 27.52 ? 80  LYS A HG2  3  
ATOM   8312   H HG3  . LYS A 1 82  ? -10.366 -3.098  -6.111  0.016 26.84 ? 80  LYS A HG3  3  
ATOM   8313   H HD2  . LYS A 1 82  ? -8.030  -2.966  -6.014  0.016 28.73 ? 80  LYS A HD2  3  
ATOM   8314   H HD3  . LYS A 1 82  ? -7.992  -2.721  -7.586  0.016 29.40 ? 80  LYS A HD3  3  
ATOM   8315   H HE2  . LYS A 1 82  ? -7.786  -0.625  -6.710  0.016 29.04 ? 80  LYS A HE2  3  
ATOM   8316   H HE3  . LYS A 1 82  ? -9.314  -0.704  -7.123  0.016 27.98 ? 80  LYS A HE3  3  
ATOM   8317   H HZ1  . LYS A 1 82  ? -8.994  0.191   -5.057  0.016 27.14 ? 80  LYS A HZ1  3  
ATOM   8318   H HZ2  . LYS A 1 82  ? -9.847  -0.971  -4.981  0.016 26.62 ? 80  LYS A HZ2  3  
ATOM   8319   H HZ3  . LYS A 1 82  ? -8.459  -1.059  -4.569  0.016 27.61 ? 80  LYS A HZ3  3  
ATOM   8320   N N    . GLN A 1 83  ? -11.113 -7.815  -6.991  0.016 27.75 ? 81  GLN A N    3  
ATOM   8321   C CA   . GLN A 1 83  ? -10.989 -9.233  -7.333  0.016 28.52 ? 81  GLN A CA   3  
ATOM   8322   C C    . GLN A 1 83  ? -12.095 -9.679  -8.285  0.016 28.35 ? 81  GLN A C    3  
ATOM   8323   O O    . GLN A 1 83  ? -11.905 -10.627 -9.070  0.016 29.25 ? 81  GLN A O    3  
ATOM   8324   C CB   . GLN A 1 83  ? -11.016 -10.119 -6.062  0.016 28.48 ? 81  GLN A CB   3  
ATOM   8325   C CG   . GLN A 1 83  ? -9.906  -9.827  -5.060  0.016 29.54 ? 81  GLN A CG   3  
ATOM   8326   C CD   . GLN A 1 83  ? -9.723  -10.854 -3.983  0.016 29.36 ? 81  GLN A CD   3  
ATOM   8327   O OE1  . GLN A 1 83  ? -10.494 -10.976 -3.045  0.016 28.68 ? 81  GLN A OE1  3  
ATOM   8328   N NE2  . GLN A 1 83  ? -8.638  -11.551 -4.094  0.016 30.15 ? 81  GLN A NE2  3  
ATOM   8329   H H    . GLN A 1 83  ? -11.303 -7.661  -6.167  0.016 27.27 ? 81  GLN A H    3  
ATOM   8330   H HA   . GLN A 1 83  ? -10.138 -9.365  -7.776  0.016 29.35 ? 81  GLN A HA   3  
ATOM   8331   H HB2  . GLN A 1 83  ? -11.869 -10.014 -5.616  0.016 27.80 ? 81  GLN A HB2  3  
ATOM   8332   H HB3  . GLN A 1 83  ? -10.910 -11.041 -6.334  0.016 28.59 ? 81  GLN A HB3  3  
ATOM   8333   H HG2  . GLN A 1 83  ? -9.079  -9.792  -5.555  0.016 30.03 ? 81  GLN A HG2  3  
ATOM   8334   H HG3  . GLN A 1 83  ? -10.026 -8.990  -4.640  0.016 30.07 ? 81  GLN A HG3  3  
ATOM   8335   H HE21 . GLN A 1 83  ? -8.450  -12.156 -3.515  0.016 30.04 ? 81  GLN A HE21 3  
ATOM   8336   H HE22 . GLN A 1 83  ? -8.103  -11.402 -4.753  0.016 30.83 ? 81  GLN A HE22 3  
ATOM   8337   N N    . ALA A 1 84  ? -13.241 -8.986  -8.259  0.016 27.39 ? 82  ALA A N    3  
ATOM   8338   C CA   . ALA A 1 84  ? -14.397 -9.442  -9.010  0.016 27.35 ? 82  ALA A CA   3  
ATOM   8339   C C    . ALA A 1 84  ? -14.276 -9.164  -10.493 0.016 28.26 ? 82  ALA A C    3  
ATOM   8340   O O    . ALA A 1 84  ? -15.075 -9.690  -11.261 0.016 28.65 ? 82  ALA A O    3  
ATOM   8341   C CB   . ALA A 1 84  ? -15.680 -8.798  -8.460  0.016 26.21 ? 82  ALA A CB   3  
ATOM   8342   H H    . ALA A 1 84  ? -13.364 -8.263  -7.813  0.016 26.83 ? 82  ALA A H    3  
ATOM   8343   H HA   . ALA A 1 84  ? -14.480 -10.404 -8.898  0.016 27.61 ? 82  ALA A HA   3  
ATOM   8344   H HB1  . ALA A 1 84  ? -16.448 -9.160  -8.927  0.016 26.18 ? 82  ALA A HB1  3  
ATOM   8345   H HB2  . ALA A 1 84  ? -15.755 -8.992  -7.515  0.016 25.71 ? 82  ALA A HB2  3  
ATOM   8346   H HB3  . ALA A 1 84  ? -15.625 -7.839  -8.601  0.016 26.15 ? 82  ALA A HB3  3  
ATOM   8347   N N    . PHE A 1 85  ? -13.286 -8.392  -10.920 0.016 28.80 ? 83  PHE A N    3  
ATOM   8348   C CA   . PHE A 1 85  ? -13.133 -8.084  -12.334 0.016 29.88 ? 83  PHE A CA   3  
ATOM   8349   C C    . PHE A 1 85  ? -12.214 -9.094  -13.057 0.016 31.37 ? 83  PHE A C    3  
ATOM   8350   O O    . PHE A 1 85  ? -11.356 -9.709  -12.425 0.016 31.53 ? 83  PHE A O    3  
ATOM   8351   C CB   . PHE A 1 85  ? -12.676 -6.638  -12.428 0.016 29.75 ? 83  PHE A CB   3  
ATOM   8352   C CG   . PHE A 1 85  ? -13.776 -5.718  -12.031 0.016 28.55 ? 83  PHE A CG   3  
ATOM   8353   C CD1  . PHE A 1 85  ? -13.866 -5.216  -10.745 0.016 27.41 ? 83  PHE A CD1  3  
ATOM   8354   C CD2  . PHE A 1 85  ? -14.801 -5.508  -12.894 0.016 28.69 ? 83  PHE A CD2  3  
ATOM   8355   C CE1  . PHE A 1 85  ? -14.959 -4.450  -10.366 0.016 26.39 ? 83  PHE A CE1  3  
ATOM   8356   C CE2  . PHE A 1 85  ? -15.882 -4.740  -12.543 0.016 27.70 ? 83  PHE A CE2  3  
ATOM   8357   C CZ   . PHE A 1 85  ? -15.971 -4.207  -11.274 0.016 26.52 ? 83  PHE A CZ   3  
ATOM   8358   H H    . PHE A 1 85  ? -12.696 -8.028  -10.412 0.016 28.65 ? 83  PHE A H    3  
ATOM   8359   H HA   . PHE A 1 85  ? -14.005 -8.139  -12.750 0.016 29.82 ? 83  PHE A HA   3  
ATOM   8360   H HB2  . PHE A 1 85  ? -11.935 -6.504  -11.819 0.016 29.68 ? 83  PHE A HB2  3  
ATOM   8361   H HB3  . PHE A 1 85  ? -12.401 -6.443  -13.333 0.016 30.64 ? 83  PHE A HB3  3  
ATOM   8362   H HD1  . PHE A 1 85  ? -13.188 -5.385  -10.135 0.016 27.42 ? 83  PHE A HD1  3  
ATOM   8363   H HD2  . PHE A 1 85  ? -14.754 -5.871  -13.748 0.016 29.58 ? 83  PHE A HD2  3  
ATOM   8364   H HE1  . PHE A 1 85  ? -15.003 -4.087  -9.510  0.016 25.73 ? 83  PHE A HE1  3  
ATOM   8365   H HE2  . PHE A 1 85  ? -16.561 -4.585  -13.159 0.016 27.91 ? 83  PHE A HE2  3  
ATOM   8366   H HZ   . PHE A 1 85  ? -16.701 -3.684  -11.039 0.016 25.92 ? 83  PHE A HZ   3  
ATOM   8367   N N    . PRO A 1 86  ? -12.419 -9.286  -14.373 0.016 32.58 ? 84  PRO A N    3  
ATOM   8368   C CA   . PRO A 1 86  ? -13.254 -8.476  -15.269 0.016 32.79 ? 84  PRO A CA   3  
ATOM   8369   C C    . PRO A 1 86  ? -14.757 -8.743  -15.288 0.016 32.38 ? 84  PRO A C    3  
ATOM   8370   O O    . PRO A 1 86  ? -15.458 -7.869  -15.795 0.016 32.83 ? 84  PRO A O    3  
ATOM   8371   C CB   . PRO A 1 86  ? -12.671 -8.802  -16.651 0.016 34.72 ? 84  PRO A CB   3  
ATOM   8372   C CG   . PRO A 1 86  ? -12.252 -10.223 -16.527 0.016 35.38 ? 84  PRO A CG   3  
ATOM   8373   C CD   . PRO A 1 86  ? -11.725 -10.372 -15.117 0.016 34.17 ? 84  PRO A CD   3  
ATOM   8374   H HA   . PRO A 1 86  ? -13.114 -7.534  -15.089 0.016 32.26 ? 84  PRO A HA   3  
ATOM   8375   H HB2  . PRO A 1 86  ? -13.354 -8.701  -17.331 0.016 35.19 ? 84  PRO A HB2  3  
ATOM   8376   H HB3  . PRO A 1 86  ? -11.912 -8.226  -16.834 0.016 35.06 ? 84  PRO A HB3  3  
ATOM   8377   H HG2  . PRO A 1 86  ? -13.018 -10.798 -16.665 0.016 35.37 ? 84  PRO A HG2  3  
ATOM   8378   H HG3  . PRO A 1 86  ? -11.558 -10.413 -17.175 0.016 36.60 ? 84  PRO A HG3  3  
ATOM   8379   H HD2  . PRO A 1 86  ? -11.966 -11.240 -14.758 0.016 34.06 ? 84  PRO A HD2  3  
ATOM   8380   H HD3  . PRO A 1 86  ? -10.765 -10.235 -15.098 0.016 34.63 ? 84  PRO A HD3  3  
ATOM   8381   N N    . GLU A 1 87  ? -15.238 -9.849  -14.710 0.016 31.70 ? 85  GLU A N    3  
ATOM   8382   C CA   . GLU A 1 87  ? -16.654 -10.212 -14.814 0.016 31.61 ? 85  GLU A CA   3  
ATOM   8383   C C    . GLU A 1 87  ? -17.533 -9.149  -14.206 0.016 30.26 ? 85  GLU A C    3  
ATOM   8384   O O    . GLU A 1 87  ? -18.568 -8.777  -14.782 0.016 30.45 ? 85  GLU A O    3  
ATOM   8385   C CB   . GLU A 1 87  ? -16.956 -11.517 -14.076 0.016 31.72 ? 85  GLU A CB   3  
ATOM   8386   C CG   . GLU A 1 87  ? -16.231 -12.755 -14.533 0.016 33.36 ? 85  GLU A CG   3  
ATOM   8387   C CD   . GLU A 1 87  ? -14.724 -12.685 -14.305 0.016 33.47 ? 85  GLU A CD   3  
ATOM   8388   O OE1  . GLU A 1 87  ? -14.039 -13.694 -14.558 0.016 34.60 ? 85  GLU A OE1  3  
ATOM   8389   O OE2  . GLU A 1 87  ? -14.213 -11.625 -13.909 0.016 32.54 ? 85  GLU A OE2  3  
ATOM   8390   H H    . GLU A 1 87  ? -14.774 -10.363 -14.218 0.016 31.39 ? 85  GLU A H    3  
ATOM   8391   H HA   . GLU A 1 87  ? -16.898 -10.314 -15.747 0.016 32.57 ? 85  GLU A HA   3  
ATOM   8392   H HB2  . GLU A 1 87  ? -16.745 -11.381 -13.139 0.016 31.02 ? 85  GLU A HB2  3  
ATOM   8393   H HB3  . GLU A 1 87  ? -17.903 -11.703 -14.167 0.016 31.50 ? 85  GLU A HB3  3  
ATOM   8394   H HG2  . GLU A 1 87  ? -16.575 -13.508 -14.027 0.016 33.71 ? 85  GLU A HG2  3  
ATOM   8395   H HG3  . GLU A 1 87  ? -16.397 -12.893 -15.479 0.016 34.18 ? 85  GLU A HG3  3  
ATOM   8396   N N    . GLY A 1 88  ? -17.152 -8.693  -13.027 0.016 29.05 ? 86  GLY A N    3  
ATOM   8397   C CA   . GLY A 1 88  ? -17.885 -7.681  -12.292 0.016 27.86 ? 86  GLY A CA   3  
ATOM   8398   C C    . GLY A 1 88  ? -18.575 -8.212  -11.056 0.016 26.86 ? 86  GLY A C    3  
ATOM   8399   O O    . GLY A 1 88  ? -18.346 -9.335  -10.582 0.016 27.02 ? 86  GLY A O    3  
ATOM   8400   H H    . GLY A 1 88  ? -16.441 -8.958  -12.627 0.016 28.98 ? 86  GLY A H    3  
ATOM   8401   H HA2  . GLY A 1 88  ? -17.273 -6.986  -12.013 0.016 27.54 ? 86  GLY A HA2  3  
ATOM   8402   H HA3  . GLY A 1 88  ? -18.558 -7.294  -12.868 0.016 28.14 ? 86  GLY A HA3  3  
ATOM   8403   N N    . TYR A 1 89  ? -19.452 -7.359  -10.530 0.016 25.93 ? 87  TYR A N    3  
ATOM   8404   C CA   . TYR A 1 89  ? -20.261 -7.689  -9.379  0.016 25.12 ? 87  TYR A CA   3  
ATOM   8405   C C    . TYR A 1 89  ? -21.532 -6.843  -9.459  0.016 24.65 ? 87  TYR A C    3  
ATOM   8406   O O    . TYR A 1 89  ? -21.635 -5.919  -10.265 0.016 24.82 ? 87  TYR A O    3  
ATOM   8407   C CB   . TYR A 1 89  ? -19.498 -7.444  -8.073  0.016 24.39 ? 87  TYR A CB   3  
ATOM   8408   C CG   . TYR A 1 89  ? -19.273 -5.975  -7.790  0.016 23.72 ? 87  TYR A CG   3  
ATOM   8409   C CD1  . TYR A 1 89  ? -19.993 -5.338  -6.807  0.016 22.88 ? 87  TYR A CD1  3  
ATOM   8410   C CD2  . TYR A 1 89  ? -18.347 -5.250  -8.493  0.016 24.07 ? 87  TYR A CD2  3  
ATOM   8411   C CE1  . TYR A 1 89  ? -19.818 -4.006  -6.558  0.016 22.39 ? 87  TYR A CE1  3  
ATOM   8412   C CE2  . TYR A 1 89  ? -18.164 -3.924  -8.231  0.016 23.58 ? 87  TYR A CE2  3  
ATOM   8413   C CZ   . TYR A 1 89  ? -18.895 -3.315  -7.264  0.016 22.73 ? 87  TYR A CZ   3  
ATOM   8414   O OH   . TYR A 1 89  ? -18.669 -1.966  -7.038  0.016 22.38 ? 87  TYR A OH   3  
ATOM   8415   H H    . TYR A 1 89  ? -19.591 -6.570  -10.837 0.016 25.83 ? 87  TYR A H    3  
ATOM   8416   H HA   . TYR A 1 89  ? -20.525 -8.621  -9.414  0.016 25.49 ? 87  TYR A HA   3  
ATOM   8417   H HB2  . TYR A 1 89  ? -20.010 -7.813  -7.337  0.016 24.09 ? 87  TYR A HB2  3  
ATOM   8418   H HB3  . TYR A 1 89  ? -18.633 -7.876  -8.114  0.016 24.78 ? 87  TYR A HB3  3  
ATOM   8419   H HD1  . TYR A 1 89  ? -20.631 -5.813  -6.325  0.016 22.74 ? 87  TYR A HD1  3  
ATOM   8420   H HD2  . TYR A 1 89  ? -17.845 -5.653  -9.161  0.016 24.73 ? 87  TYR A HD2  3  
ATOM   8421   H HE1  . TYR A 1 89  ? -20.309 -3.589  -5.890  0.016 21.92 ? 87  TYR A HE1  3  
ATOM   8422   H HE2  . TYR A 1 89  ? -17.537 -3.432  -8.711  0.016 23.91 ? 87  TYR A HE2  3  
ATOM   8423   H HH   . TYR A 1 89  ? -18.799 -1.788  -6.228  0.016 21.97 ? 87  TYR A HH   3  
ATOM   8424   N N    . SER A 1 90  ? -22.493 -7.193  -8.623  0.016 24.21 ? 88  SER A N    3  
ATOM   8425   C CA   . SER A 1 90  ? -23.718 -6.418  -8.505  0.016 23.78 ? 88  SER A CA   3  
ATOM   8426   C C    . SER A 1 90  ? -23.918 -6.036  -7.055  0.016 22.89 ? 88  SER A C    3  
ATOM   8427   O O    . SER A 1 90  ? -23.303 -6.589  -6.149  0.016 22.72 ? 88  SER A O    3  
ATOM   8428   C CB   . SER A 1 90  ? -24.935 -7.196  -8.973  0.016 24.45 ? 88  SER A CB   3  
ATOM   8429   O OG   . SER A 1 90  ? -24.970 -8.433  -8.254  0.016 24.66 ? 88  SER A OG   3  
ATOM   8430   H H    . SER A 1 90  ? -22.463 -7.874  -8.103  0.016 24.22 ? 88  SER A H    3  
ATOM   8431   H HA   . SER A 1 90  ? -23.645 -5.610  -9.034  0.016 23.76 ? 88  SER A HA   3  
ATOM   8432   H HB2  . SER A 1 90  ? -25.741 -6.694  -8.782  0.016 24.19 ? 88  SER A HB2  3  
ATOM   8433   H HB3  . SER A 1 90  ? -24.867 -7.362  -9.925  0.016 25.12 ? 88  SER A HB3  3  
ATOM   8434   H HG   . SER A 1 90  ? -25.086 -8.291  -7.434  0.016 24.16 ? 88  SER A HG   3  
ATOM   8435   N N    . TRP A 1 91  ? -24.833 -5.102  -6.825  0.016 22.47 ? 89  TRP A N    3  
ATOM   8436   C CA   . TRP A 1 91  ? -25.213 -4.775  -5.465  0.016 21.85 ? 89  TRP A CA   3  
ATOM   8437   C C    . TRP A 1 91  ? -26.688 -4.405  -5.439  0.016 21.88 ? 89  TRP A C    3  
ATOM   8438   O O    . TRP A 1 91  ? -27.272 -3.973  -6.445  0.016 22.23 ? 89  TRP A O    3  
ATOM   8439   C CB   . TRP A 1 91  ? -24.323 -3.668  -4.815  0.016 21.23 ? 89  TRP A CB   3  
ATOM   8440   C CG   . TRP A 1 91  ? -24.199 -2.287  -5.463  0.016 21.02 ? 89  TRP A CG   3  
ATOM   8441   C CD1  . TRP A 1 91  ? -23.115 -1.788  -6.129  0.016 21.17 ? 89  TRP A CD1  3  
ATOM   8442   C CD2  . TRP A 1 91  ? -25.168 -1.238  -5.438  0.016 20.76 ? 89  TRP A CD2  3  
ATOM   8443   N NE1  . TRP A 1 91  ? -23.354 -0.497  -6.533  0.016 21.03 ? 89  TRP A NE1  3  
ATOM   8444   C CE2  . TRP A 1 91  ? -24.619 -0.146  -6.149  0.016 20.77 ? 89  TRP A CE2  3  
ATOM   8445   C CE3  . TRP A 1 91  ? -26.452 -1.136  -4.933  0.016 20.67 ? 89  TRP A CE3  3  
ATOM   8446   C CZ2  . TRP A 1 91  ? -25.309 1.063   -6.331  0.016 20.63 ? 89  TRP A CZ2  3  
ATOM   8447   C CZ3  . TRP A 1 91  ? -27.159 0.067   -5.143  0.016 20.54 ? 89  TRP A CZ3  3  
ATOM   8448   C CH2  . TRP A 1 91  ? -26.565 1.143   -5.827  0.016 20.50 ? 89  TRP A CH2  3  
ATOM   8449   H H    . TRP A 1 91  ? -25.245 -4.664  -7.436  0.016 22.62 ? 89  TRP A H    3  
ATOM   8450   H HA   . TRP A 1 91  ? -25.098 -5.567  -4.934  0.016 21.97 ? 89  TRP A HA   3  
ATOM   8451   H HB2  . TRP A 1 91  ? -24.663 -3.520  -3.920  0.016 20.96 ? 89  TRP A HB2  3  
ATOM   8452   H HB3  . TRP A 1 91  ? -23.424 -4.018  -4.758  0.016 21.33 ? 89  TRP A HB3  3  
ATOM   8453   H HD1  . TRP A 1 91  ? -22.323 -2.252  -6.268  0.016 21.41 ? 89  TRP A HD1  3  
ATOM   8454   H HE1  . TRP A 1 91  ? -22.811 -0.006  -6.977  0.016 21.18 ? 89  TRP A HE1  3  
ATOM   8455   H HE3  . TRP A 1 91  ? -26.838 -1.851  -4.485  0.016 20.78 ? 89  TRP A HE3  3  
ATOM   8456   H HZ2  . TRP A 1 91  ? -24.923 1.767   -6.798  0.016 20.71 ? 89  TRP A HZ2  3  
ATOM   8457   H HZ3  . TRP A 1 91  ? -28.018 0.163   -4.802  0.016 20.56 ? 89  TRP A HZ3  3  
ATOM   8458   H HH2  . TRP A 1 91  ? -27.050 1.929   -5.941  0.016 20.46 ? 89  TRP A HH2  3  
ATOM   8459   N N    . GLU A 1 92  ? -27.284 -4.647  -4.283  0.016 21.70 ? 90  GLU A N    3  
ATOM   8460   C CA   . GLU A 1 92  ? -28.671 -4.337  -3.973  0.016 21.82 ? 90  GLU A CA   3  
ATOM   8461   C C    . GLU A 1 92  ? -28.654 -3.627  -2.623  0.016 21.28 ? 90  GLU A C    3  
ATOM   8462   O O    . GLU A 1 92  ? -27.954 -4.054  -1.698  0.016 21.17 ? 90  GLU A O    3  
ATOM   8463   C CB   . GLU A 1 92  ? -29.533 -5.630  -3.951  0.016 22.58 ? 90  GLU A CB   3  
ATOM   8464   C CG   . GLU A 1 92  ? -29.395 -6.495  -5.241  0.016 23.29 ? 90  GLU A CG   3  
ATOM   8465   C CD   . GLU A 1 92  ? -29.790 -7.991  -5.078  0.016 24.28 ? 90  GLU A CD   3  
ATOM   8466   O OE1  . GLU A 1 92  ? -28.891 -8.794  -4.731  0.016 24.52 ? 90  GLU A OE1  3  
ATOM   8467   O OE2  . GLU A 1 92  ? -30.951 -8.390  -5.344  0.016 25.01 ? 90  GLU A OE2  3  
ATOM   8468   H H    . GLU A 1 92  ? -26.879 -5.008  -3.617  0.016 21.58 ? 90  GLU A H    3  
ATOM   8469   H HA   . GLU A 1 92  ? -29.032 -3.732  -4.638  0.016 21.89 ? 90  GLU A HA   3  
ATOM   8470   H HB2  . GLU A 1 92  ? -29.287 -6.147  -3.174  0.016 22.53 ? 90  GLU A HB2  3  
ATOM   8471   H HB3  . GLU A 1 92  ? -30.462 -5.381  -3.884  0.016 22.82 ? 90  GLU A HB3  3  
ATOM   8472   H HG2  . GLU A 1 92  ? -29.968 -6.120  -5.924  0.016 23.41 ? 90  GLU A HG2  3  
ATOM   8473   H HG3  . GLU A 1 92  ? -28.478 -6.453  -5.543  0.016 23.14 ? 90  GLU A HG3  3  
ATOM   8474   N N    . ARG A 1 93  ? -29.408 -2.523  -2.509  0.016 21.06 ? 91  ARG A N    3  
ATOM   8475   C CA   . ARG A 1 93  ? -29.297 -1.654  -1.352  0.016 20.65 ? 91  ARG A CA   3  
ATOM   8476   C C    . ARG A 1 93  ? -30.663 -1.124  -0.937  0.016 20.89 ? 91  ARG A C    3  
ATOM   8477   O O    . ARG A 1 93  ? -31.462 -0.716  -1.779  0.016 21.12 ? 91  ARG A O    3  
ATOM   8478   C CB   . ARG A 1 93  ? -28.379 -0.474  -1.662  0.016 20.17 ? 91  ARG A CB   3  
ATOM   8479   C CG   . ARG A 1 93  ? -28.146 0.426   -0.485  0.016 19.89 ? 91  ARG A CG   3  
ATOM   8480   C CD   . ARG A 1 93  ? -27.134 1.493   -0.827  0.016 19.58 ? 91  ARG A CD   3  
ATOM   8481   N NE   . ARG A 1 93  ? -25.828 0.970   -1.219  0.016 19.58 ? 91  ARG A NE   3  
ATOM   8482   C CZ   . ARG A 1 93  ? -24.978 1.642   -1.983  0.016 19.53 ? 91  ARG A CZ   3  
ATOM   8483   N NH1  . ARG A 1 93  ? -25.324 2.832   -2.472  0.016 19.46 ? 91  ARG A NH1  3  
ATOM   8484   N NH2  . ARG A 1 93  ? -23.805 1.144   -2.280  0.016 19.66 ? 91  ARG A NH2  3  
ATOM   8485   H H    . ARG A 1 93  ? -29.993 -2.275  -3.083  0.016 21.23 ? 91  ARG A H    3  
ATOM   8486   H HA   . ARG A 1 93  ? -28.927 -2.149  -0.612  0.016 20.66 ? 91  ARG A HA   3  
ATOM   8487   H HB2  . ARG A 1 93  ? -27.519 -0.807  -1.962  0.016 20.11 ? 91  ARG A HB2  3  
ATOM   8488   H HB3  . ARG A 1 93  ? -28.788 0.047   -2.367  0.016 20.22 ? 91  ARG A HB3  3  
ATOM   8489   H HG2  . ARG A 1 93  ? -28.990 0.848   -0.252  0.016 19.98 ? 91  ARG A HG2  3  
ATOM   8490   H HG3  . ARG A 1 93  ? -27.811 -0.086  0.265   0.016 19.97 ? 91  ARG A HG3  3  
ATOM   8491   H HD2  . ARG A 1 93  ? -27.489 2.038   -1.539  0.016 19.59 ? 91  ARG A HD2  3  
ATOM   8492   H HD3  . ARG A 1 93  ? -26.982 2.007   -0.042  0.016 19.50 ? 91  ARG A HD3  3  
ATOM   8493   H HE   . ARG A 1 93  ? -25.567 0.231   -0.881  0.016 19.66 ? 91  ARG A HE   3  
ATOM   8494   H HH11 . ARG A 1 93  ? -26.083 3.180   -2.283  0.016 19.42 ? 91  ARG A HH11 3  
ATOM   8495   H HH12 . ARG A 1 93  ? -24.771 3.256   -2.974  0.016 19.52 ? 91  ARG A HH12 3  
ATOM   8496   H HH21 . ARG A 1 93  ? -23.574 0.374   -1.974  0.016 19.76 ? 91  ARG A HH21 3  
ATOM   8497   H HH22 . ARG A 1 93  ? -23.273 1.579   -2.790  0.016 19.72 ? 91  ARG A HH22 3  
ATOM   8498   N N    . SER A 1 94  ? -30.900 -1.103  0.356   0.016 20.98 ? 92  SER A N    3  
ATOM   8499   C CA   . SER A 1 94  ? -32.063 -0.443  0.916   0.016 21.27 ? 92  SER A CA   3  
ATOM   8500   C C    . SER A 1 94  ? -31.589 0.753   1.723   0.016 20.92 ? 92  SER A C    3  
ATOM   8501   O O    . SER A 1 94  ? -30.531 0.720   2.367   0.016 20.72 ? 92  SER A O    3  
ATOM   8502   C CB   . SER A 1 94  ? -32.897 -1.365  1.802   0.016 22.00 ? 92  SER A CB   3  
ATOM   8503   O OG   . SER A 1 94  ? -32.088 -1.909  2.818   0.016 22.04 ? 92  SER A OG   3  
ATOM   8504   H H    . SER A 1 94  ? -30.388 -1.454  0.947   0.016 20.95 ? 92  SER A H    3  
ATOM   8505   H HA   . SER A 1 94  ? -32.625 -0.133  0.191   0.016 21.36 ? 92  SER A HA   3  
ATOM   8506   H HB2  . SER A 1 94  ? -33.613 -0.852  2.206   0.016 22.29 ? 92  SER A HB2  3  
ATOM   8507   H HB3  . SER A 1 94  ? -33.266 -2.073  1.259   0.016 22.29 ? 92  SER A HB3  3  
ATOM   8508   H HG   . SER A 1 94  ? -32.453 -1.795  3.565   0.016 22.40 ? 92  SER A HG   3  
ATOM   8509   N N    . MET A 1 95  ? -32.346 1.828   1.609   0.016 20.95 ? 93  MET A N    3  
ATOM   8510   C CA   . MET A 1 95  ? -31.994 3.091   2.217   0.016 20.72 ? 93  MET A CA   3  
ATOM   8511   C C    . MET A 1 95  ? -33.263 3.570   2.917   0.016 21.28 ? 93  MET A C    3  
ATOM   8512   O O    . MET A 1 95  ? -34.157 4.115   2.263   0.016 21.44 ? 93  MET A O    3  
ATOM   8513   C CB   . MET A 1 95  ? -31.502 4.054   1.142   0.016 20.29 ? 93  MET A CB   3  
ATOM   8514   C CG   . MET A 1 95  ? -30.179 3.659   0.524   0.016 19.87 ? 93  MET A CG   3  
ATOM   8515   S SD   . MET A 1 95  ? -29.902 4.397   -1.100  0.016 19.74 ? 93  MET A SD   3  
ATOM   8516   C CE   . MET A 1 95  ? -30.951 3.275   -2.110  0.016 20.19 ? 93  MET A CE   3  
ATOM   8517   H H    . MET A 1 95  ? -33.077 1.855   1.164   0.016 21.18 ? 93  MET A H    3  
ATOM   8518   H HA   . MET A 1 95  ? -31.285 2.960   2.864   0.016 20.64 ? 93  MET A HA   3  
ATOM   8519   H HB2  . MET A 1 95  ? -32.161 4.100   0.435   0.016 20.42 ? 93  MET A HB2  3  
ATOM   8520   H HB3  . MET A 1 95  ? -31.386 4.930   1.542   0.016 20.31 ? 93  MET A HB3  3  
ATOM   8521   H HG2  . MET A 1 95  ? -29.482 3.915   1.132   0.016 19.76 ? 93  MET A HG2  3  
ATOM   8522   H HG3  . MET A 1 95  ? -30.155 2.696   0.405   0.016 19.90 ? 93  MET A HG3  3  
ATOM   8523   H HE1  . MET A 1 95  ? -30.837 3.492   -3.048  0.016 20.24 ? 93  MET A HE1  3  
ATOM   8524   H HE2  . MET A 1 95  ? -30.682 2.361   -1.943  0.016 20.25 ? 93  MET A HE2  3  
ATOM   8525   H HE3  . MET A 1 95  ? -31.880 3.376   -1.866  0.016 20.44 ? 93  MET A HE3  3  
ATOM   8526   N N    . THR A 1 96  ? -33.333 3.358   4.233   0.016 21.71 ? 94  THR A N    3  
ATOM   8527   C CA   . THR A 1 96  ? -34.527 3.602   5.040   0.016 22.50 ? 94  THR A CA   3  
ATOM   8528   C C    . THR A 1 96  ? -34.396 4.981   5.683   0.016 22.59 ? 94  THR A C    3  
ATOM   8529   O O    . THR A 1 96  ? -33.607 5.141   6.610   0.016 22.67 ? 94  THR A O    3  
ATOM   8530   C CB   . THR A 1 96  ? -34.690 2.559   6.161   0.016 23.24 ? 94  THR A CB   3  
ATOM   8531   O OG1  . THR A 1 96  ? -34.745 1.231   5.631   0.016 23.25 ? 94  THR A OG1  3  
ATOM   8532   C CG2  . THR A 1 96  ? -35.978 2.825   6.945   0.016 24.27 ? 94  THR A CG2  3  
ATOM   8533   H H    . THR A 1 96  ? -32.678 3.059   4.697   0.016 21.66 ? 94  THR A H    3  
ATOM   8534   H HA   . THR A 1 96  ? -35.312 3.584   4.471   0.016 22.65 ? 94  THR A HA   3  
ATOM   8535   H HB   . THR A 1 96  ? -33.946 2.626   6.778   0.016 23.20 ? 94  THR A HB   3  
ATOM   8536   H HG1  . THR A 1 96  ? -35.066 0.706   6.205   0.016 23.74 ? 94  THR A HG1  3  
ATOM   8537   H HG21 . THR A 1 96  ? -36.128 2.114   7.583   0.016 24.83 ? 94  THR A HG21 3  
ATOM   8538   H HG22 . THR A 1 96  ? -35.911 3.660   7.432   0.016 24.31 ? 94  THR A HG22 3  
ATOM   8539   H HG23 . THR A 1 96  ? -36.733 2.869   6.341   0.016 24.48 ? 94  THR A HG23 3  
ATOM   8540   N N    . TYR A 1 97  ? -35.175 5.952   5.231   0.016 22.76 ? 95  TYR A N    3  
ATOM   8541   C CA   . TYR A 1 97  ? -35.052 7.294   5.796   0.016 22.94 ? 95  TYR A CA   3  
ATOM   8542   C C    . TYR A 1 97  ? -35.954 7.461   7.031   0.016 24.02 ? 95  TYR A C    3  
ATOM   8543   O O    . TYR A 1 97  ? -37.018 6.841   7.165   0.016 24.68 ? 95  TYR A O    3  
ATOM   8544   C CB   . TYR A 1 97  ? -35.349 8.364   4.734   0.016 22.64 ? 95  TYR A CB   3  
ATOM   8545   C CG   . TYR A 1 97  ? -34.320 8.545   3.601   0.016 21.80 ? 95  TYR A CG   3  
ATOM   8546   C CD1  . TYR A 1 97  ? -34.402 7.840   2.396   0.016 21.46 ? 95  TYR A CD1  3  
ATOM   8547   C CD2  . TYR A 1 97  ? -33.296 9.476   3.722   0.016 21.52 ? 95  TYR A CD2  3  
ATOM   8548   C CE1  . TYR A 1 97  ? -33.460 8.046   1.372   0.016 20.88 ? 95  TYR A CE1  3  
ATOM   8549   C CE2  . TYR A 1 97  ? -32.381 9.689   2.717   0.016 20.94 ? 95  TYR A CE2  3  
ATOM   8550   C CZ   . TYR A 1 97  ? -32.461 8.998   1.538   0.016 20.62 ? 95  TYR A CZ   3  
ATOM   8551   O OH   . TYR A 1 97  ? -31.517 9.227   0.559   0.016 20.21 ? 95  TYR A OH   3  
ATOM   8552   H H    . TYR A 1 97  ? -35.775 5.872   4.622   0.016 22.85 ? 95  TYR A H    3  
ATOM   8553   H HA   . TYR A 1 97  ? -34.159 7.416   6.121   0.016 22.69 ? 95  TYR A HA   3  
ATOM   8554   H HB2  . TYR A 1 97  ? -36.205 8.176   4.324   0.016 22.89 ? 95  TYR A HB2  3  
ATOM   8555   H HB3  . TYR A 1 97  ? -35.399 9.221   5.186   0.016 22.90 ? 95  TYR A HB3  3  
ATOM   8556   H HD1  . TYR A 1 97  ? -35.079 7.212   2.279   0.016 21.74 ? 95  TYR A HD1  3  
ATOM   8557   H HD2  . TYR A 1 97  ? -33.226 9.968   4.506   0.016 21.84 ? 95  TYR A HD2  3  
ATOM   8558   H HE1  . TYR A 1 97  ? -33.523 7.569   0.577   0.016 20.77 ? 95  TYR A HE1  3  
ATOM   8559   H HE2  . TYR A 1 97  ? -31.706 10.319  2.841   0.016 20.87 ? 95  TYR A HE2  3  
ATOM   8560   H HH   . TYR A 1 97  ? -31.400 8.534   0.100   0.016 20.08 ? 95  TYR A HH   3  
ATOM   8561   N N    . GLU A 1 98  ? -35.490 8.310   7.951   0.016 24.37 ? 96  GLU A N    3  
ATOM   8562   C CA   . GLU A 1 98  ? -36.123 8.469   9.258   0.016 25.57 ? 96  GLU A CA   3  
ATOM   8563   C C    . GLU A 1 98  ? -37.610 8.844   9.206   0.016 26.32 ? 96  GLU A C    3  
ATOM   8564   O O    . GLU A 1 98  ? -38.290 8.664   10.211  0.016 27.50 ? 96  GLU A O    3  
ATOM   8565   C CB   . GLU A 1 98  ? -35.387 9.520   10.089  0.016 25.91 ? 96  GLU A CB   3  
ATOM   8566   C CG   . GLU A 1 98  ? -35.309 10.915  9.441   0.016 26.14 ? 96  GLU A CG   3  
ATOM   8567   C CD   . GLU A 1 98  ? -34.857 11.984  10.411  0.016 26.64 ? 96  GLU A CD   3  
ATOM   8568   O OE1  . GLU A 1 98  ? -35.668 12.897  10.647  0.016 27.62 ? 96  GLU A OE1  3  
ATOM   8569   O OE2  . GLU A 1 98  ? -33.712 11.940  10.918  0.016 26.16 ? 96  GLU A OE2  3  
ATOM   8570   H H    . GLU A 1 98  ? -34.794 8.799   7.838   0.016 24.03 ? 96  GLU A H    3  
ATOM   8571   H HA   . GLU A 1 98  ? -36.048 7.624   9.728   0.016 25.86 ? 96  GLU A HA   3  
ATOM   8572   H HB2  . GLU A 1 98  ? -35.839 9.617   10.940  0.016 26.70 ? 96  GLU A HB2  3  
ATOM   8573   H HB3  . GLU A 1 98  ? -34.481 9.216   10.242  0.016 25.32 ? 96  GLU A HB3  3  
ATOM   8574   H HG2  . GLU A 1 98  ? -34.676 10.899  8.706   0.016 25.44 ? 96  GLU A HG2  3  
ATOM   8575   H HG3  . GLU A 1 98  ? -36.189 11.158  9.111   0.016 26.83 ? 96  GLU A HG3  3  
ATOM   8576   N N    . ASP A 1 99  ? -38.123 9.365   8.090   0.016 25.83 ? 97  ASP A N    3  
ATOM   8577   C CA   . ASP A 1 99  ? -39.499 9.860   7.998   0.016 26.61 ? 97  ASP A CA   3  
ATOM   8578   C C    . ASP A 1 99  ? -40.308 9.080   6.964   0.016 26.69 ? 97  ASP A C    3  
ATOM   8579   O O    . ASP A 1 99  ? -41.392 9.501   6.546   0.016 27.02 ? 97  ASP A O    3  
ATOM   8580   C CB   . ASP A 1 99  ? -39.509 11.352  7.673   0.016 26.36 ? 97  ASP A CB   3  
ATOM   8581   C CG   . ASP A 1 99  ? -39.002 11.628  6.287   0.016 25.36 ? 97  ASP A CG   3  
ATOM   8582   O OD1  . ASP A 1 99  ? -38.406 10.686  5.736   0.016 24.71 ? 97  ASP A OD1  3  
ATOM   8583   O OD2  . ASP A 1 99  ? -39.204 12.743  5.741   0.016 25.36 ? 97  ASP A OD2  3  
ATOM   8584   H H    . ASP A 1 99  ? -37.686 9.443   7.355   0.016 25.12 ? 97  ASP A H    3  
ATOM   8585   H HA   . ASP A 1 99  ? -39.937 9.743   8.855   0.016 27.46 ? 97  ASP A HA   3  
ATOM   8586   H HB2  . ASP A 1 99  ? -40.422 11.675  7.739   0.016 27.07 ? 97  ASP A HB2  3  
ATOM   8587   H HB3  . ASP A 1 99  ? -38.935 11.817  8.299   0.016 26.28 ? 97  ASP A HB3  3  
ATOM   8588   N N    . GLN A 1 100 ? -39.752 7.969   6.499   0.016 26.57 ? 98  GLN A N    3  
ATOM   8589   C CA   . GLN A 1 100 ? -40.483 6.806   5.984   0.016 26.67 ? 98  GLN A CA   3  
ATOM   8590   C C    . GLN A 1 100 ? -40.450 6.745   4.468   0.016 25.87 ? 98  GLN A C    3  
ATOM   8591   O O    . GLN A 1 100 ? -40.939 5.774   3.885   0.016 26.22 ? 98  GLN A O    3  
ATOM   8592   C CB   . GLN A 1 100 ? -41.960 6.749   6.427   0.016 28.09 ? 98  GLN A CB   3  
ATOM   8593   C CG   . GLN A 1 100 ? -42.207 6.709   7.954   0.016 29.14 ? 98  GLN A CG   3  
ATOM   8594   C CD   . GLN A 1 100 ? -43.708 6.777   8.318   0.016 30.74 ? 98  GLN A CD   3  
ATOM   8595   O OE1  . GLN A 1 100 ? -44.422 7.765   8.019   0.016 31.56 ? 98  GLN A OE1  3  
ATOM   8596   N NE2  . GLN A 1 100 ? -44.196 5.728   8.962   0.016 31.32 ? 98  GLN A NE2  3  
ATOM   8597   H H    . GLN A 1 100 ? -38.900 7.871   6.439   0.016 26.52 ? 98  GLN A H    3  
ATOM   8598   H HA   . GLN A 1 100 ? -40.042 6.008   6.321   0.016 26.55 ? 98  GLN A HA   3  
ATOM   8599   H HB2  . GLN A 1 100 ? -42.450 7.505   6.068   0.016 28.28 ? 98  GLN A HB2  3  
ATOM   8600   H HB3  . GLN A 1 100 ? -42.331 5.933   6.057   0.016 28.27 ? 98  GLN A HB3  3  
ATOM   8601   H HG2  . GLN A 1 100 ? -41.849 5.878   8.304   0.016 28.93 ? 98  GLN A HG2  3  
ATOM   8602   H HG3  . GLN A 1 100 ? -41.768 7.456   8.386   0.016 29.14 ? 98  GLN A HG3  3  
ATOM   8603   H HE21 . GLN A 1 100 ? -45.040 5.679   9.115   0.016 31.94 ? 98  GLN A HE21 3  
ATOM   8604   H HE22 . GLN A 1 100 ? -43.671 5.101   9.227   0.016 31.12 ? 98  GLN A HE22 3  
ATOM   8605   N N    . GLY A 1 101 ? -39.954 7.776   3.795   0.016 24.98 ? 99  GLY A N    3  
ATOM   8606   C CA   . GLY A 1 101 ? -39.504 7.559   2.446   0.016 24.27 ? 99  GLY A CA   3  
ATOM   8607   C C    . GLY A 1 101 ? -38.526 6.402   2.442   0.016 23.65 ? 99  GLY A C    3  
ATOM   8608   O O    . GLY A 1 101 ? -37.764 6.194   3.390   0.016 23.47 ? 99  GLY A O    3  
ATOM   8609   H H    . GLY A 1 101 ? -39.886 8.575   4.092   0.016 24.87 ? 99  GLY A H    3  
ATOM   8610   H HA2  . GLY A 1 101 ? -40.246 7.343   1.862   0.016 24.69 ? 99  GLY A HA2  3  
ATOM   8611   H HA3  . GLY A 1 101 ? -39.049 8.344   2.109   0.016 23.85 ? 99  GLY A HA3  3  
ATOM   8612   N N    . ILE A 1 102 ? -38.567 5.622   1.404   0.016 23.46 ? 100 ILE A N    3  
ATOM   8613   C CA   . ILE A 1 102 ? -37.552 4.600   1.361   0.016 23.02 ? 100 ILE A CA   3  
ATOM   8614   C C    . ILE A 1 102 ? -37.210 4.310   -0.085  0.016 22.72 ? 100 ILE A C    3  
ATOM   8615   O O    . ILE A 1 102 ? -38.053 4.392   -0.987  0.016 23.21 ? 100 ILE A O    3  
ATOM   8616   C CB   . ILE A 1 102 ? -37.951 3.387   2.231   0.016 23.76 ? 100 ILE A CB   3  
ATOM   8617   C CG1  . ILE A 1 102 ? -37.461 2.074   1.642   0.016 23.39 ? 100 ILE A CG1  3  
ATOM   8618   C CG2  . ILE A 1 102 ? -39.396 3.355   2.579   0.016 24.71 ? 100 ILE A CG2  3  
ATOM   8619   C CD1  . ILE A 1 102 ? -38.468 1.455   0.812   0.016 23.67 ? 100 ILE A CD1  3  
ATOM   8620   H H    . ILE A 1 102 ? -39.123 5.650   0.750   0.016 23.65 ? 100 ILE A H    3  
ATOM   8621   H HA   . ILE A 1 102 ? -36.742 4.966   1.749   0.016 22.57 ? 100 ILE A HA   3  
ATOM   8622   H HB   . ILE A 1 102 ? -37.491 3.513   3.075   0.016 23.98 ? 100 ILE A HB   3  
ATOM   8623   H HG12 . ILE A 1 102 ? -36.658 2.205   1.123   0.016 22.74 ? 100 ILE A HG12 3  
ATOM   8624   H HG13 . ILE A 1 102 ? -37.264 1.479   2.382   0.016 23.72 ? 100 ILE A HG13 3  
ATOM   8625   H HG21 . ILE A 1 102 ? -39.611 2.484   2.941   0.016 25.21 ? 100 ILE A HG21 3  
ATOM   8626   H HG22 . ILE A 1 102 ? -39.561 4.025   3.253   0.016 25.05 ? 100 ILE A HG22 3  
ATOM   8627   H HG23 . ILE A 1 102 ? -39.928 3.535   1.791   0.016 24.59 ? 100 ILE A HG23 3  
ATOM   8628   H HD11 . ILE A 1 102 ? -39.042 2.144   0.457   0.016 23.54 ? 100 ILE A HD11 3  
ATOM   8629   H HD12 . ILE A 1 102 ? -38.027 1.016   0.070   0.016 23.37 ? 100 ILE A HD12 3  
ATOM   8630   H HD13 . ILE A 1 102 ? -38.975 0.823   1.348   0.016 24.39 ? 100 ILE A HD13 3  
ATOM   8631   N N    . CYS A 1 103 ? -35.941 4.100   -0.303  0.016 22.06 ? 101 CYS A N    3  
ATOM   8632   C CA   . CYS A 1 103 ? -35.397 3.886   -1.613  0.016 21.86 ? 101 CYS A CA   3  
ATOM   8633   C C    . CYS A 1 103 ? -34.779 2.513   -1.596  0.016 21.76 ? 101 CYS A C    3  
ATOM   8634   O O    . CYS A 1 103 ? -34.129 2.139   -0.618  0.016 21.48 ? 101 CYS A O    3  
ATOM   8635   C CB   . CYS A 1 103 ? -34.348 4.920   -1.947  0.016 21.25 ? 101 CYS A CB   3  
ATOM   8636   S SG   . CYS A 1 103 ? -35.045 6.601   -1.887  0.016 21.41 ? 101 CYS A SG   3  
ATOM   8637   H H    . CYS A 1 103 ? -35.354 4.080   0.319   0.016 21.79 ? 101 CYS A H    3  
ATOM   8638   H HA   . CYS A 1 103 ? -36.104 3.922   -2.272  0.016 22.32 ? 101 CYS A HA   3  
ATOM   8639   H HB2  . CYS A 1 103 ? -33.636 4.866   -1.292  0.016 20.88 ? 101 CYS A HB2  3  
ATOM   8640   H HB3  . CYS A 1 103 ? -33.996 4.759   -2.834  0.016 21.24 ? 101 CYS A HB3  3  
ATOM   8641   H HG   . CYS A 1 103 ? -35.705 6.753   -2.873  0.016 21.80 ? 101 CYS A HG   3  
ATOM   8642   N N    . ILE A 1 104 ? -35.000 1.781   -2.659  0.016 22.09 ? 102 ILE A N    3  
ATOM   8643   C CA   . ILE A 1 104 ? -34.310 0.529   -2.872  0.016 22.09 ? 102 ILE A CA   3  
ATOM   8644   C C    . ILE A 1 104 ? -33.726 0.624   -4.265  0.016 22.01 ? 102 ILE A C    3  
ATOM   8645   O O    . ILE A 1 104 ? -34.277 1.302   -5.141  0.016 22.41 ? 102 ILE A O    3  
ATOM   8646   C CB   . ILE A 1 104 ? -35.225 -0.692  -2.664  0.016 22.95 ? 102 ILE A CB   3  
ATOM   8647   C CG1  . ILE A 1 104 ? -36.567 -0.536  -3.263  0.016 23.75 ? 102 ILE A CG1  3  
ATOM   8648   C CG2  . ILE A 1 104 ? -35.448 -0.882  -1.185  0.016 23.20 ? 102 ILE A CG2  3  
ATOM   8649   C CD1  . ILE A 1 104 ? -37.386 -1.871  -3.081  0.016 24.83 ? 102 ILE A CD1  3  
ATOM   8650   H H    . ILE A 1 104 ? -35.550 1.982   -3.284  0.016 22.40 ? 102 ILE A H    3  
ATOM   8651   H HA   . ILE A 1 104 ? -33.585 0.445   -2.234  0.016 21.71 ? 102 ILE A HA   3  
ATOM   8652   H HB   . ILE A 1 104 ? -34.798 -1.485  -3.037  0.016 22.97 ? 102 ILE A HB   3  
ATOM   8653   H HG12 . ILE A 1 104 ? -37.027 0.172   -2.798  0.016 23.81 ? 102 ILE A HG12 3  
ATOM   8654   H HG13 . ILE A 1 104 ? -36.474 -0.322  -4.204  0.016 23.69 ? 102 ILE A HG13 3  
ATOM   8655   H HG21 . ILE A 1 104 ? -36.013 -0.170  -0.848  0.016 23.20 ? 102 ILE A HG21 3  
ATOM   8656   H HG22 . ILE A 1 104 ? -35.855 -1.744  -1.030  0.016 23.85 ? 102 ILE A HG22 3  
ATOM   8657   H HG23 . ILE A 1 104 ? -34.589 -0.862  -0.735  0.016 22.82 ? 102 ILE A HG23 3  
ATOM   8658   H HD11 . ILE A 1 104 ? -38.177 -1.831  -3.641  0.016 25.45 ? 102 ILE A HD11 3  
ATOM   8659   H HD12 . ILE A 1 104 ? -36.827 -2.611  -3.349  0.016 24.91 ? 102 ILE A HD12 3  
ATOM   8660   H HD13 . ILE A 1 104 ? -37.643 -1.983  -2.154  0.016 24.93 ? 102 ILE A HD13 3  
ATOM   8661   N N    . ALA A 1 105 ? -32.558 0.030   -4.442  0.016 21.63 ? 103 ALA A N    3  
ATOM   8662   C CA   . ALA A 1 105 ? -31.810 0.210   -5.662  0.016 21.73 ? 103 ALA A CA   3  
ATOM   8663   C C    . ALA A 1 105 ? -30.916 -0.982  -5.911  0.016 21.91 ? 103 ALA A C    3  
ATOM   8664   O O    . ALA A 1 105 ? -30.440 -1.600  -4.970  0.016 21.76 ? 103 ALA A O    3  
ATOM   8665   C CB   . ALA A 1 105 ? -30.959 1.445   -5.580  0.016 21.15 ? 103 ALA A CB   3  
ATOM   8666   H H    . ALA A 1 105 ? -32.189 -0.482  -3.862  0.016 21.40 ? 103 ALA A H    3  
ATOM   8667   H HA   . ALA A 1 105 ? -32.412 0.289   -6.417  0.016 22.22 ? 103 ALA A HA   3  
ATOM   8668   H HB1  . ALA A 1 105 ? -30.445 1.544   -6.395  0.016 21.34 ? 103 ALA A HB1  3  
ATOM   8669   H HB2  . ALA A 1 105 ? -31.559 2.198   -5.460  0.016 21.11 ? 103 ALA A HB2  3  
ATOM   8670   H HB3  . ALA A 1 105 ? -30.366 1.366   -4.818  0.016 20.75 ? 103 ALA A HB3  3  
ATOM   8671   N N    . THR A 1 106 ? -30.632 -1.217  -7.191  0.016 22.38 ? 104 THR A N    3  
ATOM   8672   C CA   . THR A 1 106 ? -29.713 -2.258  -7.617  0.016 22.67 ? 104 THR A CA   3  
ATOM   8673   C C    . THR A 1 106 ? -28.713 -1.673  -8.600  0.016 22.82 ? 104 THR A C    3  
ATOM   8674   O O    . THR A 1 106 ? -29.007 -0.705  -9.311  0.016 23.09 ? 104 THR A O    3  
ATOM   8675   C CB   . THR A 1 106 ? -30.459 -3.402  -8.308  0.016 23.67 ? 104 THR A CB   3  
ATOM   8676   O OG1  . THR A 1 106 ? -31.050 -2.914  -9.501  0.016 24.42 ? 104 THR A OG1  3  
ATOM   8677   C CG2  . THR A 1 106 ? -31.547 -3.968  -7.436  0.016 23.80 ? 104 THR A CG2  3  
ATOM   8678   H H    . THR A 1 106 ? -30.957 -0.771  -7.846  0.016 22.61 ? 104 THR A H    3  
ATOM   8679   H HA   . THR A 1 106 ? -29.229 -2.599  -6.852  0.016 22.28 ? 104 THR A HA   3  
ATOM   8680   H HB   . THR A 1 106 ? -29.826 -4.105  -8.525  0.016 23.87 ? 104 THR A HB   3  
ATOM   8681   H HG1  . THR A 1 106 ? -30.463 -2.792  -10.086 0.016 24.56 ? 104 THR A HG1  3  
ATOM   8682   H HG21 . THR A 1 106 ? -32.045 -4.634  -7.932  0.016 24.54 ? 104 THR A HG21 3  
ATOM   8683   H HG22 . THR A 1 106 ? -31.163 -4.382  -6.648  0.016 23.41 ? 104 THR A HG22 3  
ATOM   8684   H HG23 . THR A 1 106 ? -32.154 -3.263  -7.158  0.016 23.69 ? 104 THR A HG23 3  
ATOM   8685   N N    . SER A 1 107 ? -27.537 -2.294  -8.677  0.016 22.83 ? 105 SER A N    3  
ATOM   8686   C CA   . SER A 1 107 ? -26.570 -1.901  -9.685  0.016 23.22 ? 105 SER A CA   3  
ATOM   8687   C C    . SER A 1 107 ? -25.819 -3.121  -10.180 0.016 23.88 ? 105 SER A C    3  
ATOM   8688   O O    . SER A 1 107 ? -25.425 -3.975  -9.387  0.016 23.63 ? 105 SER A O    3  
ATOM   8689   C CB   . SER A 1 107 ? -25.548 -0.884  -9.172  0.016 22.57 ? 105 SER A CB   3  
ATOM   8690   O OG   . SER A 1 107 ? -24.654 -0.555  -10.223 0.016 23.18 ? 105 SER A OG   3  
ATOM   8691   H H    . SER A 1 107 ? -27.288 -2.929  -8.159  0.016 22.68 ? 105 SER A H    3  
ATOM   8692   H HA   . SER A 1 107 ? -27.034 -1.516  -10.437 0.016 23.67 ? 105 SER A HA   3  
ATOM   8693   H HB2  . SER A 1 107 ? -25.995 -0.085  -8.849  0.016 22.21 ? 105 SER A HB2  3  
ATOM   8694   H HB3  . SER A 1 107 ? -25.038 -1.293  -8.462  0.016 22.24 ? 105 SER A HB3  3  
ATOM   8695   H HG   . SER A 1 107 ? -25.079 -0.311  -10.905 0.016 23.56 ? 105 SER A HG   3  
ATOM   8696   N N    . ASP A 1 108 ? -25.625 -3.182  -11.483 0.016 24.83 ? 106 ASP A N    3  
ATOM   8697   C CA   . ASP A 1 108 ? -24.850 -4.251  -12.098 0.016 25.64 ? 106 ASP A CA   3  
ATOM   8698   C C    . ASP A 1 108 ? -23.634 -3.612  -12.762 0.016 25.93 ? 106 ASP A C    3  
ATOM   8699   O O    . ASP A 1 108 ? -23.782 -2.753  -13.639 0.016 26.49 ? 106 ASP A O    3  
ATOM   8700   C CB   . ASP A 1 108 ? -25.722 -5.018  -13.096 0.016 26.91 ? 106 ASP A CB   3  
ATOM   8701   C CG   . ASP A 1 108 ? -25.205 -6.394  -13.373 0.016 27.63 ? 106 ASP A CG   3  
ATOM   8702   O OD1  . ASP A 1 108 ? -24.809 -6.647  -14.521 0.016 28.95 ? 106 ASP A OD1  3  
ATOM   8703   O OD2  . ASP A 1 108 ? -25.210 -7.225  -12.437 0.016 26.98 ? 106 ASP A OD2  3  
ATOM   8704   H H    . ASP A 1 108 ? -25.927 -2.610  -12.044 0.016 25.13 ? 106 ASP A H    3  
ATOM   8705   H HA   . ASP A 1 108 ? -24.553 -4.870  -11.417 0.016 25.30 ? 106 ASP A HA   3  
ATOM   8706   H HB2  . ASP A 1 108 ? -26.606 -5.130  -12.718 0.016 26.79 ? 106 ASP A HB2  3  
ATOM   8707   H HB3  . ASP A 1 108 ? -25.771 -4.528  -13.931 0.016 27.52 ? 106 ASP A HB3  3  
ATOM   8708   N N    . ILE A 1 109 ? -22.434 -4.032  -12.354 0.016 25.73 ? 107 ILE A N    3  
ATOM   8709   C CA   . ILE A 1 109 ? -21.197 -3.366  -12.742 0.016 26.00 ? 107 ILE A CA   3  
ATOM   8710   C C    . ILE A 1 109 ? -20.346 -4.340  -13.539 0.016 27.14 ? 107 ILE A C    3  
ATOM   8711   O O    . ILE A 1 109 ? -20.018 -5.438  -13.067 0.016 27.13 ? 107 ILE A O    3  
ATOM   8712   C CB   . ILE A 1 109 ? -20.453 -2.810  -11.519 0.016 24.97 ? 107 ILE A CB   3  
ATOM   8713   C CG1  . ILE A 1 109 ? -21.320 -1.742  -10.843 0.016 24.09 ? 107 ILE A CG1  3  
ATOM   8714   C CG2  . ILE A 1 109 ? -19.078 -2.208  -11.882 0.016 25.46 ? 107 ILE A CG2  3  
ATOM   8715   C CD1  . ILE A 1 109 ? -20.740 -1.278  -9.582  0.016 23.13 ? 107 ILE A CD1  3  
ATOM   8716   H H    . ILE A 1 109 ? -22.316 -4.715  -11.852 0.016 25.53 ? 107 ILE A H    3  
ATOM   8717   H HA   . ILE A 1 109 ? -21.407 -2.621  -13.325 0.016 26.27 ? 107 ILE A HA   3  
ATOM   8718   H HB   . ILE A 1 109 ? -20.318 -3.531  -10.886 0.016 24.69 ? 107 ILE A HB   3  
ATOM   8719   H HG12 . ILE A 1 109 ? -21.391 -0.980  -11.433 0.016 24.23 ? 107 ILE A HG12 3  
ATOM   8720   H HG13 . ILE A 1 109 ? -22.199 -2.102  -10.658 0.016 24.14 ? 107 ILE A HG13 3  
ATOM   8721   H HG21 . ILE A 1 109 ? -19.122 -1.243  -11.788 0.016 25.76 ? 107 ILE A HG21 3  
ATOM   8722   H HG22 . ILE A 1 109 ? -18.415 -2.555  -11.267 0.016 24.91 ? 107 ILE A HG22 3  
ATOM   8723   H HG23 . ILE A 1 109 ? -18.838 -2.432  -12.793 0.016 26.12 ? 107 ILE A HG23 3  
ATOM   8724   H HD11 . ILE A 1 109 ? -20.501 -0.342  -9.668  0.016 22.72 ? 107 ILE A HD11 3  
ATOM   8725   H HD12 . ILE A 1 109 ? -21.395 -1.386  -8.876  0.016 22.93 ? 107 ILE A HD12 3  
ATOM   8726   H HD13 . ILE A 1 109 ? -19.950 -1.806  -9.386  0.016 23.22 ? 107 ILE A HD13 3  
ATOM   8727   N N    . THR A 1 110 ? -20.022 -3.935  -14.747 0.016 28.27 ? 108 THR A N    3  
ATOM   8728   C CA   . THR A 1 110 ? -19.180 -4.666  -15.663 0.016 29.59 ? 108 THR A CA   3  
ATOM   8729   C C    . THR A 1 110 ? -18.023 -3.775  -16.070 0.016 30.01 ? 108 THR A C    3  
ATOM   8730   O O    . THR A 1 110 ? -17.912 -2.620  -15.657 0.016 29.24 ? 108 THR A O    3  
ATOM   8731   C CB   . THR A 1 110 ? -19.961 -5.093  -16.902 0.016 31.03 ? 108 THR A CB   3  
ATOM   8732   O OG1  . THR A 1 110 ? -20.543 -3.921  -17.514 0.016 31.20 ? 108 THR A OG1  3  
ATOM   8733   C CG2  . THR A 1 110 ? -21.050 -6.085  -16.555 0.016 31.03 ? 108 THR A CG2  3  
ATOM   8734   H H    . THR A 1 110 ? -20.307 -3.201  -15.085 0.016 28.38 ? 108 THR A H    3  
ATOM   8735   H HA   . THR A 1 110 ? -18.818 -5.455  -15.233 0.016 29.47 ? 108 THR A HA   3  
ATOM   8736   H HB   . THR A 1 110 ? -19.354 -5.520  -17.527 0.016 32.04 ? 108 THR A HB   3  
ATOM   8737   H HG1  . THR A 1 110 ? -21.125 -4.143  -18.077 0.016 31.96 ? 108 THR A HG1  3  
ATOM   8738   H HG21 . THR A 1 110 ? -21.571 -6.287  -17.348 0.016 31.99 ? 108 THR A HG21 3  
ATOM   8739   H HG22 . THR A 1 110 ? -20.650 -6.908  -16.229 0.016 31.17 ? 108 THR A HG22 3  
ATOM   8740   H HG23 . THR A 1 110 ? -21.637 -5.728  -15.875 0.016 30.06 ? 108 THR A HG23 3  
ATOM   8741   N N    . MET A 1 111 ? -17.144 -4.332  -16.892 0.016 31.42 ? 109 MET A N    3  
ATOM   8742   C CA   . MET A 1 111 ? -16.072 -3.533  -17.440 0.016 32.13 ? 109 MET A CA   3  
ATOM   8743   C C    . MET A 1 111 ? -15.632 -4.117  -18.760 0.016 34.10 ? 109 MET A C    3  
ATOM   8744   O O    . MET A 1 111 ? -16.049 -5.217  -19.141 0.016 34.71 ? 109 MET A O    3  
ATOM   8745   C CB   . MET A 1 111 ? -14.878 -3.489  -16.499 0.016 31.53 ? 109 MET A CB   3  
ATOM   8746   C CG   . MET A 1 111 ? -13.798 -4.510  -16.798 0.016 31.16 ? 109 MET A CG   3  
ATOM   8747   S SD   . MET A 1 111 ? -12.870 -4.775  -15.289 0.016 32.27 ? 109 MET A SD   3  
ATOM   8748   C CE   . MET A 1 111 ? -11.250 -4.215  -15.781 0.016 34.39 ? 109 MET A CE   3  
ATOM   8749   H H    . MET A 1 111 ? -17.150 -5.155  -17.136 0.016 32.10 ? 109 MET A H    3  
ATOM   8750   H HA   . MET A 1 111 ? -16.381 -2.626  -17.577 0.016 31.90 ? 109 MET A HA   3  
ATOM   8751   H HB2  . MET A 1 111 ? -14.480 -2.607  -16.553 0.016 30.61 ? 109 MET A HB2  3  
ATOM   8752   H HB3  . MET A 1 111 ? -15.190 -3.656  -15.597 0.016 32.43 ? 109 MET A HB3  3  
ATOM   8753   H HG2  . MET A 1 111 ? -14.192 -5.358  -17.057 0.016 31.55 ? 109 MET A HG2  3  
ATOM   8754   H HG3  . MET A 1 111 ? -13.200 -4.173  -17.483 0.016 30.05 ? 109 MET A HG3  3  
ATOM   8755   H HE1  . MET A 1 111 ? -10.613 -4.442  -15.086 0.016 35.18 ? 109 MET A HE1  3  
ATOM   8756   H HE2  . MET A 1 111 ? -11.006 -4.651  -16.610 0.016 34.88 ? 109 MET A HE2  3  
ATOM   8757   H HE3  . MET A 1 111 ? -11.276 -3.256  -15.904 0.016 34.35 ? 109 MET A HE3  3  
ATOM   8758   N N    . GLU A 1 112 ? -14.782 -3.363  -19.444 0.016 35.25 ? 110 GLU A N    3  
ATOM   8759   C CA   . GLU A 1 112 ? -13.788 -3.935  -20.352 0.016 37.38 ? 110 GLU A CA   3  
ATOM   8760   C C    . GLU A 1 112 ? -12.846 -2.814  -20.756 0.016 38.39 ? 110 GLU A C    3  
ATOM   8761   O O    . GLU A 1 112 ? -13.267 -1.662  -20.903 0.016 37.75 ? 110 GLU A O    3  
ATOM   8762   C CB   . GLU A 1 112 ? -14.426 -4.593  -21.570 0.016 38.45 ? 110 GLU A CB   3  
ATOM   8763   C CG   . GLU A 1 112 ? -14.256 -6.114  -21.605 0.016 39.44 ? 110 GLU A CG   3  
ATOM   8764   C CD   . GLU A 1 112 ? -12.952 -6.589  -22.283 0.016 41.43 ? 110 GLU A CD   3  
ATOM   8765   O OE1  . GLU A 1 112 ? -13.051 -7.389  -23.241 0.016 43.12 ? 110 GLU A OE1  3  
ATOM   8766   O OE2  . GLU A 1 112 ? -11.847 -6.171  -21.873 0.016 41.47 ? 110 GLU A OE2  3  
ATOM   8767   H H    . GLU A 1 112 ? -14.758 -2.505  -19.401 0.016 34.95 ? 110 GLU A H    3  
ATOM   8768   H HA   . GLU A 1 112 ? -13.274 -4.604  -19.874 0.016 37.61 ? 110 GLU A HA   3  
ATOM   8769   H HB2  . GLU A 1 112 ? -15.377 -4.393  -21.568 0.016 37.48 ? 110 GLU A HB2  3  
ATOM   8770   H HB3  . GLU A 1 112 ? -14.016 -4.227  -22.370 0.016 39.62 ? 110 GLU A HB3  3  
ATOM   8771   H HG2  . GLU A 1 112 ? -14.255 -6.449  -20.694 0.016 38.39 ? 110 GLU A HG2  3  
ATOM   8772   H HG3  . GLU A 1 112 ? -15.003 -6.498  -22.090 0.016 39.94 ? 110 GLU A HG3  3  
ATOM   8773   N N    . GLY A 1 113 ? -11.581 -3.145  -20.884 0.016 40.06 ? 111 GLY A N    3  
ATOM   8774   C CA   . GLY A 1 113 ? -10.584 -2.136  -21.138 0.016 40.82 ? 111 GLY A CA   3  
ATOM   8775   C C    . GLY A 1 113 ? -10.365 -1.322  -19.883 0.016 38.93 ? 111 GLY A C    3  
ATOM   8776   O O    . GLY A 1 113 ? -10.242 -1.856  -18.776 0.016 37.57 ? 111 GLY A O    3  
ATOM   8777   H H    . GLY A 1 113 ? -11.273 -3.945  -20.826 0.016 40.84 ? 111 GLY A H    3  
ATOM   8778   H HA2  . GLY A 1 113 ? -9.746  -2.550  -21.393 0.016 41.94 ? 111 GLY A HA2  3  
ATOM   8779   H HA3  . GLY A 1 113 ? -10.882 -1.548  -21.849 0.016 41.50 ? 111 GLY A HA3  3  
ATOM   8780   N N    . ASP A 1 114 ? -10.319 -0.013  -20.057 0.016 38.94 ? 112 ASP A N    3  
ATOM   8781   C CA   . ASP A 1 114 ? -10.033 0.915   -18.976 0.016 37.41 ? 112 ASP A CA   3  
ATOM   8782   C C    . ASP A 1 114 ? -11.297 1.558   -18.409 0.016 35.79 ? 112 ASP A C    3  
ATOM   8783   O O    . ASP A 1 114 ? -11.199 2.583   -17.730 0.016 34.95 ? 112 ASP A O    3  
ATOM   8784   C CB   . ASP A 1 114 ? -9.060  1.990   -19.468 0.016 38.59 ? 112 ASP A CB   3  
ATOM   8785   C CG   . ASP A 1 114 ? -9.703  2.935   -20.465 0.016 39.67 ? 112 ASP A CG   3  
ATOM   8786   O OD1  . ASP A 1 114 ? -10.694 2.505   -21.076 0.016 40.07 ? 112 ASP A OD1  3  
ATOM   8787   O OD2  . ASP A 1 114 ? -9.242  4.098   -20.639 0.016 40.25 ? 112 ASP A OD2  3  
ATOM   8788   H H    . ASP A 1 114 ? -10.455 0.373   -20.813 0.016 39.92 ? 112 ASP A H    3  
ATOM   8789   H HA   . ASP A 1 114 ? -9.600  0.429   -18.257 0.016 36.80 ? 112 ASP A HA   3  
ATOM   8790   H HB2  . ASP A 1 114 ? -8.757  2.516   -18.710 0.016 37.68 ? 112 ASP A HB2  3  
ATOM   8791   H HB3  . ASP A 1 114 ? -8.306  1.563   -19.904 0.016 39.71 ? 112 ASP A HB3  3  
ATOM   8792   N N    . CYS A 1 115 ? -12.473 0.951   -18.623 0.016 35.48 ? 113 CYS A N    3  
ATOM   8793   C CA   . CYS A 1 115 ? -13.748 1.589   -18.286 0.016 34.14 ? 113 CYS A CA   3  
ATOM   8794   C C    . CYS A 1 115 ? -14.705 0.624   -17.593 0.016 32.64 ? 113 CYS A C    3  
ATOM   8795   O O    . CYS A 1 115 ? -14.921 -0.485  -18.079 0.016 33.08 ? 113 CYS A O    3  
ATOM   8796   C CB   . CYS A 1 115 ? -14.420 2.123   -19.555 0.016 35.23 ? 113 CYS A CB   3  
ATOM   8797   S SG   . CYS A 1 115 ? -15.821 3.238   -19.262 0.016 34.01 ? 113 CYS A SG   3  
ATOM   8798   H H    . CYS A 1 115 ? -12.559 0.168   -18.967 0.016 36.10 ? 113 CYS A H    3  
ATOM   8799   H HA   . CYS A 1 115 ? -13.587 2.339   -17.693 0.016 33.61 ? 113 CYS A HA   3  
ATOM   8800   H HB2  . CYS A 1 115 ? -13.758 2.601   -20.078 0.016 36.50 ? 113 CYS A HB2  3  
ATOM   8801   H HB3  . CYS A 1 115 ? -14.755 1.369   -20.065 0.016 35.47 ? 113 CYS A HB3  3  
ATOM   8802   H HG   . CYS A 1 115 ? -16.749 2.608   -18.842 0.016 33.06 ? 113 CYS A HG   3  
ATOM   8803   N N    . PHE A 1 116 ? -15.330 1.073   -16.500 0.016 31.04 ? 114 PHE A N    3  
ATOM   8804   C CA   . PHE A 1 116 ? -16.459 0.363   -15.914 0.016 29.78 ? 114 PHE A CA   3  
ATOM   8805   C C    . PHE A 1 116 ? -17.786 0.844   -16.501 0.016 29.88 ? 114 PHE A C    3  
ATOM   8806   O O    . PHE A 1 116 ? -17.931 2.011   -16.919 0.016 30.30 ? 114 PHE A O    3  
ATOM   8807   C CB   . PHE A 1 116 ? -16.554 0.568   -14.397 0.016 28.21 ? 114 PHE A CB   3  
ATOM   8808   C CG   . PHE A 1 116 ? -15.337 0.183   -13.607 0.016 28.05 ? 114 PHE A CG   3  
ATOM   8809   C CD1  . PHE A 1 116 ? -15.140 -1.124  -13.196 0.016 27.94 ? 114 PHE A CD1  3  
ATOM   8810   C CD2  . PHE A 1 116 ? -14.455 1.145   -13.170 0.016 28.03 ? 114 PHE A CD2  3  
ATOM   8811   C CE1  . PHE A 1 116 ? -14.055 -1.461  -12.420 0.016 27.87 ? 114 PHE A CE1  3  
ATOM   8812   C CE2  . PHE A 1 116 ? -13.382 0.821   -12.387 0.016 27.99 ? 114 PHE A CE2  3  
ATOM   8813   C CZ   . PHE A 1 116 ? -13.177 -0.505  -12.016 0.016 27.91 ? 114 PHE A CZ   3  
ATOM   8814   H H    . PHE A 1 116 ? -15.112 1.788   -16.081 0.016 30.75 ? 114 PHE A H    3  
ATOM   8815   H HA   . PHE A 1 116 ? -16.372 -0.582  -16.094 0.016 30.00 ? 114 PHE A HA   3  
ATOM   8816   H HB2  . PHE A 1 116 ? -16.743 1.501   -14.216 0.016 28.04 ? 114 PHE A HB2  3  
ATOM   8817   H HB3  . PHE A 1 116 ? -17.287 0.025   -14.072 0.016 27.54 ? 114 PHE A HB3  3  
ATOM   8818   H HD1  . PHE A 1 116 ? -15.735 -1.786  -13.465 0.016 28.03 ? 114 PHE A HD1  3  
ATOM   8819   H HD2  . PHE A 1 116 ? -14.588 2.032   -13.418 0.016 28.14 ? 114 PHE A HD2  3  
ATOM   8820   H HE1  . PHE A 1 116 ? -13.925 -2.344  -12.170 0.016 27.88 ? 114 PHE A HE1  3  
ATOM   8821   H HE2  . PHE A 1 116 ? -12.781 1.479   -12.126 0.016 28.12 ? 114 PHE A HE2  3  
ATOM   8822   H HZ   . PHE A 1 116 ? -12.443 -0.738  -11.499 0.016 27.98 ? 114 PHE A HZ   3  
ATOM   8823   N N    . PHE A 1 117 ? -18.782 -0.038  -16.435 0.016 29.55 ? 115 PHE A N    3  
ATOM   8824   C CA   . PHE A 1 117 ? -20.148 0.234   -16.859 0.016 29.64 ? 115 PHE A CA   3  
ATOM   8825   C C    . PHE A 1 117 ? -21.122 -0.146  -15.746 0.016 28.23 ? 115 PHE A C    3  
ATOM   8826   O O    . PHE A 1 117 ? -21.075 -1.269  -15.239 0.016 27.88 ? 115 PHE A O    3  
ATOM   8827   C CB   . PHE A 1 117 ? -20.494 -0.539  -18.131 0.016 31.19 ? 115 PHE A CB   3  
ATOM   8828   C CG   . PHE A 1 117 ? -19.601 -0.221  -19.308 0.016 32.89 ? 115 PHE A CG   3  
ATOM   8829   C CD1  . PHE A 1 117 ? -18.366 -0.823  -19.463 0.016 33.62 ? 115 PHE A CD1  3  
ATOM   8830   C CD2  . PHE A 1 117 ? -20.006 0.701   -20.251 0.016 33.92 ? 115 PHE A CD2  3  
ATOM   8831   C CE1  . PHE A 1 117 ? -17.556 -0.508  -20.559 0.016 35.40 ? 115 PHE A CE1  3  
ATOM   8832   C CE2  . PHE A 1 117 ? -19.216 1.015   -21.340 0.016 35.71 ? 115 PHE A CE2  3  
ATOM   8833   C CZ   . PHE A 1 117 ? -17.988 0.418   -21.488 0.016 36.45 ? 115 PHE A CZ   3  
ATOM   8834   H H    . PHE A 1 117 ? -18.690 -0.830  -16.118 0.016 29.32 ? 115 PHE A H    3  
ATOM   8835   H HA   . PHE A 1 117 ? -20.241 1.180   -17.045 0.016 29.76 ? 115 PHE A HA   3  
ATOM   8836   H HB2  . PHE A 1 117 ? -20.429 -1.490  -17.951 0.016 31.17 ? 115 PHE A HB2  3  
ATOM   8837   H HB3  . PHE A 1 117 ? -21.404 -0.317  -18.382 0.016 31.24 ? 115 PHE A HB3  3  
ATOM   8838   H HD1  . PHE A 1 117 ? -18.073 -1.442  -18.835 0.016 33.01 ? 115 PHE A HD1  3  
ATOM   8839   H HD2  . PHE A 1 117 ? -20.826 1.101   -20.159 0.016 33.51 ? 115 PHE A HD2  3  
ATOM   8840   H HE1  . PHE A 1 117 ? -16.725 -0.916  -20.658 0.016 35.97 ? 115 PHE A HE1  3  
ATOM   8841   H HE2  . PHE A 1 117 ? -19.512 1.637   -21.963 0.016 36.48 ? 115 PHE A HE2  3  
ATOM   8842   H HZ   . PHE A 1 117 ? -17.455 0.628   -22.220 0.016 37.76 ? 115 PHE A HZ   3  
ATOM   8843   N N    . TYR A 1 118 ? -22.013 0.774   -15.360 0.016 27.55 ? 116 TYR A N    3  
ATOM   8844   C CA   . TYR A 1 118 ? -23.037 0.471   -14.364 0.016 26.46 ? 116 TYR A CA   3  
ATOM   8845   C C    . TYR A 1 118 ? -24.432 0.538   -14.969 0.016 27.00 ? 116 TYR A C    3  
ATOM   8846   O O    . TYR A 1 118 ? -24.774 1.513   -15.650 0.016 27.55 ? 116 TYR A O    3  
ATOM   8847   C CB   . TYR A 1 118 ? -23.023 1.420   -13.157 0.016 25.20 ? 116 TYR A CB   3  
ATOM   8848   C CG   . TYR A 1 118 ? -21.702 1.895   -12.614 0.016 24.85 ? 116 TYR A CG   3  
ATOM   8849   C CD1  . TYR A 1 118 ? -21.614 3.108   -11.943 0.016 24.19 ? 116 TYR A CD1  3  
ATOM   8850   C CD2  . TYR A 1 118 ? -20.528 1.188   -12.786 0.016 25.33 ? 116 TYR A CD2  3  
ATOM   8851   C CE1  . TYR A 1 118 ? -20.422 3.577   -11.452 0.016 24.06 ? 116 TYR A CE1  3  
ATOM   8852   C CE2  . TYR A 1 118 ? -19.327 1.658   -12.289 0.016 25.18 ? 116 TYR A CE2  3  
ATOM   8853   C CZ   . TYR A 1 118 ? -19.277 2.862   -11.629 0.016 24.57 ? 116 TYR A CZ   3  
ATOM   8854   O OH   . TYR A 1 118 ? -18.086 3.322   -11.148 0.016 24.62 ? 116 TYR A OH   3  
ATOM   8855   H H    . TYR A 1 118 ? -22.038 1.577   -15.659 0.016 27.78 ? 116 TYR A H    3  
ATOM   8856   H HA   . TYR A 1 118 ? -22.902 -0.431  -14.033 0.016 26.30 ? 116 TYR A HA   3  
ATOM   8857   H HB2  . TYR A 1 118 ? -23.495 2.220   -13.431 0.016 25.33 ? 116 TYR A HB2  3  
ATOM   8858   H HB3  . TYR A 1 118 ? -23.513 1.007   -12.433 0.016 24.58 ? 116 TYR A HB3  3  
ATOM   8859   H HD1  . TYR A 1 118 ? -22.388 3.608   -11.816 0.016 23.91 ? 116 TYR A HD1  3  
ATOM   8860   H HD2  . TYR A 1 118 ? -20.549 0.373   -13.235 0.016 25.85 ? 116 TYR A HD2  3  
ATOM   8861   H HE1  . TYR A 1 118 ? -20.392 4.389   -11.004 0.016 23.71 ? 116 TYR A HE1  3  
ATOM   8862   H HE2  . TYR A 1 118 ? -18.548 1.170   -12.413 0.016 25.59 ? 116 TYR A HE2  3  
ATOM   8863   H HH   . TYR A 1 118 ? -17.454 2.948   -11.550 0.016 25.22 ? 116 TYR A HH   3  
ATOM   8864   N N    . GLU A 1 119 ? -25.265 -0.452  -14.650 0.016 26.93 ? 117 GLU A N    3  
ATOM   8865   C CA   . GLU A 1 119 ? -26.708 -0.355  -14.866 0.016 27.33 ? 117 GLU A CA   3  
ATOM   8866   C C    . GLU A 1 119 ? -27.399 -0.302  -13.506 0.016 26.08 ? 117 GLU A C    3  
ATOM   8867   O O    . GLU A 1 119 ? -27.368 -1.267  -12.734 0.016 25.57 ? 117 GLU A O    3  
ATOM   8868   C CB   . GLU A 1 119 ? -27.254 -1.490  -15.738 0.016 28.65 ? 117 GLU A CB   3  
ATOM   8869   C CG   . GLU A 1 119 ? -28.387 -0.949  -16.623 0.016 29.82 ? 117 GLU A CG   3  
ATOM   8870   C CD   . GLU A 1 119 ? -27.943 0.184   -17.573 0.016 30.62 ? 117 GLU A CD   3  
ATOM   8871   O OE1  . GLU A 1 119 ? -28.793 0.724   -18.337 0.016 30.79 ? 117 GLU A OE1  3  
ATOM   8872   O OE2  . GLU A 1 119 ? -26.728 0.509   -17.586 0.016 31.30 ? 117 GLU A OE2  3  
ATOM   8873   H H    . GLU A 1 119 ? -25.016 -1.188  -14.287 0.016 26.72 ? 117 GLU A H    3  
ATOM   8874   H HA   . GLU A 1 119 ? -26.897 0.488   -15.300 0.016 27.66 ? 117 GLU A HA   3  
ATOM   8875   H HB2  . GLU A 1 119 ? -26.550 -1.837  -16.305 0.016 29.28 ? 117 GLU A HB2  3  
ATOM   8876   H HB3  . GLU A 1 119 ? -27.613 -2.187  -15.173 0.016 28.30 ? 117 GLU A HB3  3  
ATOM   8877   H HG2  . GLU A 1 119 ? -28.740 -1.636  -17.188 0.016 30.78 ? 117 GLU A HG2  3  
ATOM   8878   H HG3  . GLU A 1 119 ? -29.087 -0.604  -16.047 0.016 29.29 ? 117 GLU A HG3  3  
ATOM   8879   N N    . ILE A 1 120 ? -27.959 0.870   -13.194 0.016 25.65 ? 118 ILE A N    3  
ATOM   8880   C CA   . ILE A 1 120 ? -28.550 1.177   -11.898 0.016 24.53 ? 118 ILE A CA   3  
ATOM   8881   C C    . ILE A 1 120 ? -30.058 1.308   -12.044 0.016 24.92 ? 118 ILE A C    3  
ATOM   8882   O O    . ILE A 1 120 ? -30.543 1.998   -12.950 0.016 25.71 ? 118 ILE A O    3  
ATOM   8883   C CB   . ILE A 1 120 ? -28.008 2.494   -11.305 0.016 23.79 ? 118 ILE A CB   3  
ATOM   8884   C CG1  . ILE A 1 120 ? -26.491 2.505   -11.188 0.016 23.74 ? 118 ILE A CG1  3  
ATOM   8885   C CG2  . ILE A 1 120 ? -28.650 2.738   -9.939  0.016 22.77 ? 118 ILE A CG2  3  
ATOM   8886   C CD1  . ILE A 1 120 ? -25.941 3.896   -10.866 0.016 23.46 ? 118 ILE A CD1  3  
ATOM   8887   H H    . ILE A 1 120 ? -27.992 1.525   -13.746 0.016 26.09 ? 118 ILE A H    3  
ATOM   8888   H HA   . ILE A 1 120 ? -28.352 0.454   -11.284 0.016 24.14 ? 118 ILE A HA   3  
ATOM   8889   H HB   . ILE A 1 120 ? -28.270 3.214   -11.897 0.016 24.18 ? 118 ILE A HB   3  
ATOM   8890   H HG12 . ILE A 1 120 ? -26.220 1.900   -10.479 0.016 23.29 ? 118 ILE A HG12 3  
ATOM   8891   H HG13 . ILE A 1 120 ? -26.108 2.218   -12.033 0.016 24.49 ? 118 ILE A HG13 3  
ATOM   8892   H HG21 . ILE A 1 120 ? -29.500 3.183   -10.063 0.016 22.86 ? 118 ILE A HG21 3  
ATOM   8893   H HG22 . ILE A 1 120 ? -28.798 1.876   -9.517  0.016 22.64 ? 118 ILE A HG22 3  
ATOM   8894   H HG23 . ILE A 1 120 ? -28.061 3.282   -9.398  0.016 22.31 ? 118 ILE A HG23 3  
ATOM   8895   H HD11 . ILE A 1 120 ? -25.072 3.996   -11.282 0.016 23.43 ? 118 ILE A HD11 3  
ATOM   8896   H HD12 . ILE A 1 120 ? -26.552 4.555   -11.227 0.016 24.05 ? 118 ILE A HD12 3  
ATOM   8897   H HD13 . ILE A 1 120 ? -25.870 4.007   -9.906  0.016 22.84 ? 118 ILE A HD13 3  
ATOM   8898   N N    . ARG A 1 121 ? -30.791 0.670   -11.137 0.016 24.54 ? 119 ARG A N    3  
ATOM   8899   C CA   . ARG A 1 121 ? -32.215 0.908   -10.930 0.016 24.82 ? 119 ARG A CA   3  
ATOM   8900   C C    . ARG A 1 121 ? -32.387 1.549   -9.556  0.016 23.77 ? 119 ARG A C    3  
ATOM   8901   O O    . ARG A 1 121 ? -31.783 1.098   -8.573  0.016 22.97 ? 119 ARG A O    3  
ATOM   8902   C CB   . ARG A 1 121 ? -33.018 -0.401  -11.043 0.016 25.55 ? 119 ARG A CB   3  
ATOM   8903   C CG   . ARG A 1 121 ? -34.555 -0.277  -10.877 0.016 26.13 ? 119 ARG A CG   3  
ATOM   8904   C CD   . ARG A 1 121 ? -35.253 0.328   -12.099 0.016 27.29 ? 119 ARG A CD   3  
ATOM   8905   N NE   . ARG A 1 121 ? -36.556 0.906   -11.756 0.016 27.59 ? 119 ARG A NE   3  
ATOM   8906   C CZ   . ARG A 1 121 ? -37.343 1.547   -12.622 0.016 28.68 ? 119 ARG A CZ   3  
ATOM   8907   N NH1  . ARG A 1 121 ? -36.953 1.707   -13.886 0.016 29.62 ? 119 ARG A NH1  3  
ATOM   8908   N NH2  . ARG A 1 121 ? -38.489 2.092   -12.206 0.016 28.95 ? 119 ARG A NH2  3  
ATOM   8909   H H    . ARG A 1 121 ? -30.470 0.083   -10.600 0.016 24.18 ? 119 ARG A H    3  
ATOM   8910   H HA   . ARG A 1 121 ? -32.542 1.514   -11.609 0.016 25.37 ? 119 ARG A HA   3  
ATOM   8911   H HB2  . ARG A 1 121 ? -32.848 -0.786  -11.915 0.016 26.29 ? 119 ARG A HB2  3  
ATOM   8912   H HB3  . ARG A 1 121 ? -32.703 -1.005  -10.357 0.016 25.07 ? 119 ARG A HB3  3  
ATOM   8913   H HG2  . ARG A 1 121 ? -34.930 -1.161  -10.732 0.016 26.51 ? 119 ARG A HG2  3  
ATOM   8914   H HG3  . ARG A 1 121 ? -34.743 0.287   -10.112 0.016 25.50 ? 119 ARG A HG3  3  
ATOM   8915   H HD2  . ARG A 1 121 ? -34.701 1.034   -12.468 0.016 27.11 ? 119 ARG A HD2  3  
ATOM   8916   H HD3  . ARG A 1 121 ? -35.399 -0.365  -12.763 0.016 28.17 ? 119 ARG A HD3  3  
ATOM   8917   H HE   . ARG A 1 121 ? -36.882 0.725   -10.980 0.016 27.23 ? 119 ARG A HE   3  
ATOM   8918   H HH11 . ARG A 1 121 ? -36.206 1.380   -14.155 0.016 29.52 ? 119 ARG A HH11 3  
ATOM   8919   H HH12 . ARG A 1 121 ? -37.456 2.130   -14.439 0.016 30.41 ? 119 ARG A HH12 3  
ATOM   8920   H HH21 . ARG A 1 121 ? -38.740 1.991   -11.392 0.016 28.44 ? 119 ARG A HH21 3  
ATOM   8921   H HH22 . ARG A 1 121 ? -39.001 2.503   -12.762 0.016 29.72 ? 119 ARG A HH22 3  
ATOM   8922   N N    . PHE A 1 122 ? -33.156 2.642   -9.499  0.016 23.90 ? 120 PHE A N    3  
ATOM   8923   C CA   . PHE A 1 122 ? -33.333 3.405   -8.266  0.016 23.10 ? 120 PHE A CA   3  
ATOM   8924   C C    . PHE A 1 122 ? -34.809 3.711   -8.117  0.016 23.64 ? 120 PHE A C    3  
ATOM   8925   O O    . PHE A 1 122 ? -35.387 4.394   -8.965  0.016 24.37 ? 120 PHE A O    3  
ATOM   8926   C CB   . PHE A 1 122 ? -32.545 4.709   -8.275  0.016 22.64 ? 120 PHE A CB   3  
ATOM   8927   C CG   . PHE A 1 122 ? -32.543 5.423   -6.950  0.016 21.91 ? 120 PHE A CG   3  
ATOM   8928   C CD1  . PHE A 1 122 ? -33.648 6.120   -6.519  0.016 22.10 ? 120 PHE A CD1  3  
ATOM   8929   C CD2  . PHE A 1 122 ? -31.423 5.413   -6.143  0.016 21.19 ? 120 PHE A CD2  3  
ATOM   8930   C CE1  . PHE A 1 122 ? -33.641 6.758   -5.308  0.016 21.60 ? 120 PHE A CE1  3  
ATOM   8931   C CE2  . PHE A 1 122 ? -31.418 6.051   -4.933  0.016 20.73 ? 120 PHE A CE2  3  
ATOM   8932   C CZ   . PHE A 1 122 ? -32.537 6.736   -4.518  0.016 20.94 ? 120 PHE A CZ   3  
ATOM   8933   H H    . PHE A 1 122 ? -33.585 2.958   -10.170 0.016 24.52 ? 120 PHE A H    3  
ATOM   8934   H HA   . PHE A 1 122 ? -33.042 2.880   -7.504  0.016 22.64 ? 120 PHE A HA   3  
ATOM   8935   H HB2  . PHE A 1 122 ? -31.624 4.529   -8.523  0.016 22.48 ? 120 PHE A HB2  3  
ATOM   8936   H HB3  . PHE A 1 122 ? -32.957 5.293   -8.930  0.016 23.13 ? 120 PHE A HB3  3  
ATOM   8937   H HD1  . PHE A 1 122 ? -34.408 6.139   -7.047  0.016 22.67 ? 120 PHE A HD1  3  
ATOM   8938   H HD2  . PHE A 1 122 ? -30.668 4.948   -6.420  0.016 21.12 ? 120 PHE A HD2  3  
ATOM   8939   H HE1  . PHE A 1 122 ? -34.397 7.220   -5.027  0.016 21.82 ? 120 PHE A HE1  3  
ATOM   8940   H HE2  . PHE A 1 122 ? -30.660 6.033   -4.397  0.016 20.37 ? 120 PHE A HE2  3  
ATOM   8941   H HZ   . PHE A 1 122 ? -32.533 7.173   -3.700  0.016 20.73 ? 120 PHE A HZ   3  
ATOM   8942   N N    . ASP A 1 123 ? -35.410 3.231   -7.045  0.016 23.41 ? 121 ASP A N    3  
ATOM   8943   C CA   . ASP A 1 123 ? -36.807 3.480   -6.800  0.016 24.03 ? 121 ASP A CA   3  
ATOM   8944   C C    . ASP A 1 123 ? -36.977 4.010   -5.396  0.016 23.48 ? 121 ASP A C    3  
ATOM   8945   O O    . ASP A 1 123 ? -36.370 3.529   -4.440  0.016 22.89 ? 121 ASP A O    3  
ATOM   8946   C CB   . ASP A 1 123 ? -37.674 2.216   -7.029  0.016 25.01 ? 121 ASP A CB   3  
ATOM   8947   C CG   . ASP A 1 123 ? -37.767 1.864   -8.486  0.016 25.88 ? 121 ASP A CG   3  
ATOM   8948   O OD1  . ASP A 1 123 ? -38.633 2.430   -9.199  0.016 26.83 ? 121 ASP A OD1  3  
ATOM   8949   O OD2  . ASP A 1 123 ? -36.947 1.052   -8.937  0.016 25.74 ? 121 ASP A OD2  3  
ATOM   8950   H H    . ASP A 1 123 ? -35.026 2.768   -6.437  0.016 22.99 ? 121 ASP A H    3  
ATOM   8951   H HA   . ASP A 1 123 ? -37.114 4.161   -7.415  0.016 24.36 ? 121 ASP A HA   3  
ATOM   8952   H HB2  . ASP A 1 123 ? -37.271 1.472   -6.560  0.016 24.75 ? 121 ASP A HB2  3  
ATOM   8953   H HB3  . ASP A 1 123 ? -38.571 2.373   -6.697  0.016 25.48 ? 121 ASP A HB3  3  
ATOM   8954   N N    . GLY A 1 124 ? -37.767 5.054   -5.302  0.016 23.81 ? 122 GLY A N    3  
ATOM   8955   C CA   . GLY A 1 124 ? -38.109 5.625   -4.023  0.016 23.57 ? 122 GLY A CA   3  
ATOM   8956   C C    . GLY A 1 124 ? -39.577 5.974   -4.006  0.016 24.51 ? 122 GLY A C    3  
ATOM   8957   O O    . GLY A 1 124 ? -40.153 6.432   -4.994  0.016 25.19 ? 122 GLY A O    3  
ATOM   8958   H H    . GLY A 1 124 ? -38.128 5.444   -5.975  0.016 24.26 ? 122 GLY A H    3  
ATOM   8959   H HA2  . GLY A 1 124 ? -37.927 5.006   -3.306  0.016 23.42 ? 122 GLY A HA2  3  
ATOM   8960   H HA3  . GLY A 1 124 ? -37.596 6.435   -3.876  0.016 23.08 ? 122 GLY A HA3  3  
ATOM   8961   N N    . THR A 1 125 ? -40.166 5.756   -2.859  0.016 24.67 ? 123 THR A N    3  
ATOM   8962   C CA   . THR A 1 125 ? -41.571 6.020   -2.715  0.016 25.71 ? 123 THR A CA   3  
ATOM   8963   C C    . THR A 1 125 ? -41.827 6.526   -1.328  0.016 25.73 ? 123 THR A C    3  
ATOM   8964   O O    . THR A 1 125 ? -41.011 6.366   -0.418  0.016 25.04 ? 123 THR A O    3  
ATOM   8965   C CB   . THR A 1 125 ? -42.454 4.813   -2.908  0.016 26.77 ? 123 THR A CB   3  
ATOM   8966   O OG1  . THR A 1 125 ? -43.793 5.267   -2.753  0.016 27.89 ? 123 THR A OG1  3  
ATOM   8967   C CG2  . THR A 1 125 ? -42.180 3.776   -1.823  0.016 26.62 ? 123 THR A CG2  3  
ATOM   8968   H H    . THR A 1 125 ? -39.773 5.483   -2.149  0.016 24.28 ? 123 THR A H    3  
ATOM   8969   H HA   . THR A 1 125 ? -41.843 6.707   -3.345  0.016 25.91 ? 123 THR A HA   3  
ATOM   8970   H HB   . THR A 1 125 ? -42.318 4.410   -3.782  0.016 26.94 ? 123 THR A HB   3  
ATOM   8971   H HG1  . THR A 1 125 ? -43.904 5.997   -3.164  0.016 27.96 ? 123 THR A HG1  3  
ATOM   8972   H HG21 . THR A 1 125 ? -41.252 3.513   -1.884  0.016 26.07 ? 123 THR A HG21 3  
ATOM   8973   H HG22 . THR A 1 125 ? -42.331 4.130   -0.938  0.016 26.34 ? 123 THR A HG22 3  
ATOM   8974   H HG23 . THR A 1 125 ? -42.744 3.000   -1.945  0.016 27.46 ? 123 THR A HG23 3  
ATOM   8975   N N    . ASN A 1 126 ? -43.009 7.139   -1.193  0.016 26.67 ? 124 ASN A N    3  
ATOM   8976   C CA   . ASN A 1 126 ? -43.585 7.507   0.075   0.016 27.15 ? 124 ASN A CA   3  
ATOM   8977   C C    . ASN A 1 126 ? -42.682 8.468   0.861   0.016 26.41 ? 124 ASN A C    3  
ATOM   8978   O O    . ASN A 1 126 ? -42.558 8.368   2.074   0.016 26.64 ? 124 ASN A O    3  
ATOM   8979   C CB   . ASN A 1 126 ? -43.960 6.238   0.859   0.016 27.48 ? 124 ASN A CB   3  
ATOM   8980   C CG   . ASN A 1 126 ? -44.765 5.212   -0.007  0.016 28.57 ? 124 ASN A CG   3  
ATOM   8981   O OD1  . ASN A 1 126 ? -44.366 4.059   -0.147  0.016 28.32 ? 124 ASN A OD1  3  
ATOM   8982   N ND2  . ASN A 1 126 ? -45.881 5.634   -0.575  0.016 29.92 ? 124 ASN A ND2  3  
ATOM   8983   H H    . ASN A 1 126 ? -43.509 7.343   -1.860  0.016 27.13 ? 124 ASN A H    3  
ATOM   8984   H HA   . ASN A 1 126 ? -44.416 7.978   -0.101  0.016 27.97 ? 124 ASN A HA   3  
ATOM   8985   H HB2  . ASN A 1 126 ? -43.161 5.803   1.187   0.016 26.75 ? 124 ASN A HB2  3  
ATOM   8986   H HB3  . ASN A 1 126 ? -44.520 6.500   1.604   0.016 27.89 ? 124 ASN A HB3  3  
ATOM   8987   H HD21 . ASN A 1 126 ? -46.076 6.474   -0.595  0.016 30.14 ? 124 ASN A HD21 3  
ATOM   8988   H HD22 . ASN A 1 126 ? -46.415 5.063   -0.926  0.016 30.66 ? 124 ASN A HD22 3  
ATOM   8989   N N    . PHE A 1 127 ? -42.066 9.436   0.213   0.016 25.69 ? 125 PHE A N    3  
ATOM   8990   C CA   . PHE A 1 127 ? -41.520 10.560  0.977   0.016 25.27 ? 125 PHE A CA   3  
ATOM   8991   C C    . PHE A 1 127 ? -42.641 11.552  1.270   0.016 26.24 ? 125 PHE A C    3  
ATOM   8992   O O    . PHE A 1 127 ? -43.540 11.710  0.441   0.016 26.97 ? 125 PHE A O    3  
ATOM   8993   C CB   . PHE A 1 127 ? -40.411 11.246  0.223   0.016 24.52 ? 125 PHE A CB   3  
ATOM   8994   C CG   . PHE A 1 127 ? -39.200 10.404  0.123   0.016 23.52 ? 125 PHE A CG   3  
ATOM   8995   C CD1  . PHE A 1 127 ? -38.127 10.602  0.978   0.016 23.16 ? 125 PHE A CD1  3  
ATOM   8996   C CD2  . PHE A 1 127 ? -39.159 9.379   -0.785  0.016 23.11 ? 125 PHE A CD2  3  
ATOM   8997   C CE1  . PHE A 1 127 ? -37.018 9.809   0.888   0.016 22.39 ? 125 PHE A CE1  3  
ATOM   8998   C CE2  . PHE A 1 127 ? -38.079 8.577   -0.863  0.016 22.33 ? 125 PHE A CE2  3  
ATOM   8999   C CZ   . PHE A 1 127 ? -36.992 8.794   -0.051  0.016 21.95 ? 125 PHE A CZ   3  
ATOM   9000   H H    . PHE A 1 127 ? -41.955 9.481   -0.638  0.016 25.56 ? 125 PHE A H    3  
ATOM   9001   H HA   . PHE A 1 127 ? -41.152 10.242  1.810   0.016 24.99 ? 125 PHE A HA   3  
ATOM   9002   H HB2  . PHE A 1 127 ? -40.705 11.458  -0.675  0.016 24.78 ? 125 PHE A HB2  3  
ATOM   9003   H HB3  . PHE A 1 127 ? -40.179 12.055  0.700   0.016 24.55 ? 125 PHE A HB3  3  
ATOM   9004   H HD1  . PHE A 1 127 ? -38.150 11.292  1.598   0.016 23.54 ? 125 PHE A HD1  3  
ATOM   9005   H HD2  . PHE A 1 127 ? -39.881 9.226   -1.349  0.016 23.46 ? 125 PHE A HD2  3  
ATOM   9006   H HE1  . PHE A 1 127 ? -36.294 9.947   1.453   0.016 22.28 ? 125 PHE A HE1  3  
ATOM   9007   H HE2  . PHE A 1 127 ? -38.062 7.898   -1.497  0.016 22.17 ? 125 PHE A HE2  3  
ATOM   9008   H HZ   . PHE A 1 127 ? -36.251 8.235   -0.112  0.016 21.52 ? 125 PHE A HZ   3  
ATOM   9009   N N    . PRO A 1 128 ? -42.652 12.181  2.440   0.016 26.45 ? 126 PRO A N    3  
ATOM   9010   C CA   . PRO A 1 128 ? -43.617 13.278  2.693   0.016 27.53 ? 126 PRO A CA   3  
ATOM   9011   C C    . PRO A 1 128 ? -43.468 14.362  1.639   0.016 27.47 ? 126 PRO A C    3  
ATOM   9012   O O    . PRO A 1 128 ? -42.336 14.730  1.298   0.016 26.91 ? 126 PRO A O    3  
ATOM   9013   C CB   . PRO A 1 128 ? -43.219 13.787  4.089   0.016 27.75 ? 126 PRO A CB   3  
ATOM   9014   C CG   . PRO A 1 128 ? -42.321 12.779  4.684   0.016 27.18 ? 126 PRO A CG   3  
ATOM   9015   C CD   . PRO A 1 128 ? -42.061 11.674  3.691   0.016 26.09 ? 126 PRO A CD   3  
ATOM   9016   H HA   . PRO A 1 128 ? -44.526 12.944  2.717   0.016 28.23 ? 126 PRO A HA   3  
ATOM   9017   H HB2  . PRO A 1 128 ? -42.747 14.626  3.999   0.016 27.46 ? 126 PRO A HB2  3  
ATOM   9018   H HB3  . PRO A 1 128 ? -44.009 13.900  4.636   0.016 28.65 ? 126 PRO A HB3  3  
ATOM   9019   H HG2  . PRO A 1 128 ? -41.487 13.199  4.939   0.016 27.09 ? 126 PRO A HG2  3  
ATOM   9020   H HG3  . PRO A 1 128 ? -42.754 12.405  5.468   0.016 27.74 ? 126 PRO A HG3  3  
ATOM   9021   H HD2  . PRO A 1 128 ? -41.107 11.522  3.597   0.016 25.52 ? 126 PRO A HD2  3  
ATOM   9022   H HD3  . PRO A 1 128 ? -42.518 10.867  3.972   0.016 25.92 ? 126 PRO A HD3  3  
ATOM   9023   N N    . PRO A 1 129 ? -44.575 14.852  1.047   0.016 28.28 ? 127 PRO A N    3  
ATOM   9024   C CA   . PRO A 1 129 ? -44.508 16.116  0.289   0.016 28.36 ? 127 PRO A CA   3  
ATOM   9025   C C    . PRO A 1 129 ? -43.919 17.245  1.116   0.016 28.26 ? 127 PRO A C    3  
ATOM   9026   O O    . PRO A 1 129 ? -43.321 18.179  0.583   0.016 27.97 ? 127 PRO A O    3  
ATOM   9027   C CB   . PRO A 1 129 ? -45.986 16.380  -0.068  0.016 29.70 ? 127 PRO A CB   3  
ATOM   9028   C CG   . PRO A 1 129 ? -46.571 15.046  -0.222  0.016 30.19 ? 127 PRO A CG   3  
ATOM   9029   C CD   . PRO A 1 129 ? -45.801 14.098  0.717   0.016 29.21 ? 127 PRO A CD   3  
ATOM   9030   H HA   . PRO A 1 129 ? -43.994 15.996  -0.524  0.016 27.81 ? 127 PRO A HA   3  
ATOM   9031   H HB2  . PRO A 1 129 ? -46.418 16.855  0.657   0.016 30.27 ? 127 PRO A HB2  3  
ATOM   9032   H HB3  . PRO A 1 129 ? -46.054 16.889  -0.891  0.016 29.75 ? 127 PRO A HB3  3  
ATOM   9033   H HG2  . PRO A 1 129 ? -47.507 15.080  0.032   0.016 31.04 ? 127 PRO A HG2  3  
ATOM   9034   H HG3  . PRO A 1 129 ? -46.490 14.761  -1.145  0.016 30.43 ? 127 PRO A HG3  3  
ATOM   9035   H HD2  . PRO A 1 129 ? -46.312 13.909  1.520   0.016 29.69 ? 127 PRO A HD2  3  
ATOM   9036   H HD3  . PRO A 1 129 ? -45.568 13.285  0.243   0.016 28.84 ? 127 PRO A HD3  3  
ATOM   9037   N N    . ASN A 1 130 ? -44.090 17.123  2.424   0.016 28.60 ? 128 ASN A N    3  
ATOM   9038   C CA   . ASN A 1 130 ? -43.735 18.000  3.510   0.016 28.84 ? 128 ASN A CA   3  
ATOM   9039   C C    . ASN A 1 130 ? -42.228 18.169  3.682   0.016 27.92 ? 128 ASN A C    3  
ATOM   9040   O O    . ASN A 1 130 ? -41.766 19.290  3.933   0.016 28.19 ? 128 ASN A O    3  
ATOM   9041   C CB   . ASN A 1 130 ? -44.364 17.420  4.787   0.016 30.14 ? 128 ASN A CB   3  
ATOM   9042   C CG   . ASN A 1 130 ? -45.834 16.963  4.567   0.016 30.84 ? 128 ASN A CG   3  
ATOM   9043   O OD1  . ASN A 1 130 ? -46.100 16.020  3.817   0.016 30.27 ? 128 ASN A OD1  3  
ATOM   9044   N ND2  . ASN A 1 130 ? -46.788 17.670  5.194   0.016 32.23 ? 128 ASN A ND2  3  
ATOM   9045   H H    . ASN A 1 130 ? -44.465 16.413  2.734   0.016 28.79 ? 128 ASN A H    3  
ATOM   9046   H HA   . ASN A 1 130 ? -44.111 18.882  3.352   0.016 28.93 ? 128 ASN A HA   3  
ATOM   9047   H HB2  . ASN A 1 130 ? -43.848 16.656  5.076   0.016 30.12 ? 128 ASN A HB2  3  
ATOM   9048   H HB3  . ASN A 1 130 ? -44.352 18.093  5.482   0.016 30.71 ? 128 ASN A HB3  3  
ATOM   9049   H HD21 . ASN A 1 130 ? -46.592 18.181  5.857   0.016 32.67 ? 128 ASN A HD21 3  
ATOM   9050   H HD22 . ASN A 1 130 ? -47.604 17.609  4.929   0.016 32.77 ? 128 ASN A HD22 3  
ATOM   9051   N N    . GLY A 1 131 ? -41.464 17.081  3.506   0.016 26.96 ? 129 GLY A N    3  
ATOM   9052   C CA   . GLY A 1 131 ? -40.185 16.906  4.153   0.016 26.24 ? 129 GLY A CA   3  
ATOM   9053   C C    . GLY A 1 131 ? -39.029 17.351  3.290   0.016 25.36 ? 129 GLY A C    3  
ATOM   9054   O O    . GLY A 1 131 ? -39.194 17.909  2.205   0.016 25.26 ? 129 GLY A O    3  
ATOM   9055   H H    . GLY A 1 131 ? -41.677 16.425  2.993   0.016 26.78 ? 129 GLY A H    3  
ATOM   9056   H HA2  . GLY A 1 131 ? -40.171 17.413  4.977   0.016 26.64 ? 129 GLY A HA2  3  
ATOM   9057   H HA3  . GLY A 1 131 ? -40.063 15.973  4.372   0.016 26.03 ? 129 GLY A HA3  3  
ATOM   9058   N N    . PRO A 1 132 ? -37.815 17.096  3.793   0.016 24.86 ? 130 PRO A N    3  
ATOM   9059   C CA   . PRO A 1 132 ? -36.612 17.720  3.196   0.016 24.30 ? 130 PRO A CA   3  
ATOM   9060   C C    . PRO A 1 132 ? -36.235 17.186  1.839   0.016 23.63 ? 130 PRO A C    3  
ATOM   9061   O O    . PRO A 1 132 ? -35.539 17.878  1.100   0.016 23.49 ? 130 PRO A O    3  
ATOM   9062   C CB   . PRO A 1 132 ? -35.522 17.445  4.234   0.016 24.09 ? 130 PRO A CB   3  
ATOM   9063   C CG   . PRO A 1 132 ? -36.039 16.260  5.025   0.016 24.16 ? 130 PRO A CG   3  
ATOM   9064   C CD   . PRO A 1 132 ? -37.523 16.439  5.074   0.016 24.97 ? 130 PRO A CD   3  
ATOM   9065   H HA   . PRO A 1 132 ? -36.746 18.680  3.132   0.016 24.67 ? 130 PRO A HA   3  
ATOM   9066   H HB2  . PRO A 1 132 ? -34.679 17.257  3.794   0.016 23.59 ? 130 PRO A HB2  3  
ATOM   9067   H HB3  . PRO A 1 132 ? -35.435 18.210  4.820   0.016 24.59 ? 130 PRO A HB3  3  
ATOM   9068   H HG2  . PRO A 1 132 ? -35.815 15.433  4.565   0.016 23.66 ? 130 PRO A HG2  3  
ATOM   9069   H HG3  . PRO A 1 132 ? -35.663 16.274  5.920   0.016 24.33 ? 130 PRO A HG3  3  
ATOM   9070   H HD2  . PRO A 1 132 ? -37.969 15.582  5.135   0.016 25.05 ? 130 PRO A HD2  3  
ATOM   9071   H HD3  . PRO A 1 132 ? -37.771 17.015  5.813   0.016 25.56 ? 130 PRO A HD3  3  
ATOM   9072   N N    . VAL A 1 133 ? -36.673 15.985  1.476   0.016 23.37 ? 131 VAL A N    3  
ATOM   9073   C CA   . VAL A 1 133 ? -36.363 15.450  0.161   0.016 22.91 ? 131 VAL A CA   3  
ATOM   9074   C C    . VAL A 1 133 ? -37.227 16.108  -0.907  0.016 23.43 ? 131 VAL A C    3  
ATOM   9075   O O    . VAL A 1 133 ? -36.723 16.602  -1.920  0.016 23.38 ? 131 VAL A O    3  
ATOM   9076   C CB   . VAL A 1 133 ? -36.528 13.915  0.173   0.016 22.61 ? 131 VAL A CB   3  
ATOM   9077   C CG1  . VAL A 1 133 ? -36.422 13.368  -1.239  0.016 22.41 ? 131 VAL A CG1  3  
ATOM   9078   C CG2  . VAL A 1 133 ? -35.497 13.309  1.091   0.016 22.14 ? 131 VAL A CG2  3  
ATOM   9079   H H    . VAL A 1 133 ? -37.159 15.479  1.965   0.016 23.56 ? 131 VAL A H    3  
ATOM   9080   H HA   . VAL A 1 133 ? -35.437 15.631  -0.048  0.016 22.57 ? 131 VAL A HA   3  
ATOM   9081   H HB   . VAL A 1 133 ? -37.404 13.694  0.517   0.016 23.02 ? 131 VAL A HB   3  
ATOM   9082   H HG11 . VAL A 1 133 ? -36.323 12.403  -1.199  0.016 22.24 ? 131 VAL A HG11 3  
ATOM   9083   H HG12 . VAL A 1 133 ? -37.220 13.599  -1.738  0.016 22.85 ? 131 VAL A HG12 3  
ATOM   9084   H HG13 . VAL A 1 133 ? -35.642 13.762  -1.663  0.016 22.13 ? 131 VAL A HG13 3  
ATOM   9085   H HG21 . VAL A 1 133 ? -35.809 12.442  1.396   0.016 22.01 ? 131 VAL A HG21 3  
ATOM   9086   H HG22 . VAL A 1 133 ? -34.663 13.213  0.610   0.016 21.81 ? 131 VAL A HG22 3  
ATOM   9087   H HG23 . VAL A 1 133 ? -35.376 13.888  1.857   0.016 22.43 ? 131 VAL A HG23 3  
ATOM   9088   N N    . MET A 1 134 ? -38.539 16.131  -0.708  0.016 24.10 ? 132 MET A N    3  
ATOM   9089   C CA   . MET A 1 134 ? -39.373 16.732  -1.741  0.016 24.76 ? 132 MET A CA   3  
ATOM   9090   C C    . MET A 1 134 ? -39.351 18.263  -1.701  0.016 25.14 ? 132 MET A C    3  
ATOM   9091   O O    . MET A 1 134 ? -39.747 18.867  -2.686  0.016 25.48 ? 132 MET A O    3  
ATOM   9092   C CB   . MET A 1 134 ? -40.814 16.215  -1.644  0.016 25.56 ? 132 MET A CB   3  
ATOM   9093   C CG   . MET A 1 134 ? -40.966 14.704  -2.005  0.016 25.35 ? 132 MET A CG   3  
ATOM   9094   S SD   . MET A 1 134 ? -40.548 14.132  -3.677  0.016 24.81 ? 132 MET A SD   3  
ATOM   9095   C CE   . MET A 1 134 ? -41.231 15.425  -4.736  0.016 25.71 ? 132 MET A CE   3  
ATOM   9096   H H    . MET A 1 134 ? -38.946 15.828  -0.021  0.016 24.27 ? 132 MET A H    3  
ATOM   9097   H HA   . MET A 1 134 ? -39.037 16.452  -2.606  0.016 24.59 ? 132 MET A HA   3  
ATOM   9098   H HB2  . MET A 1 134 ? -41.117 16.334  -0.732  0.016 25.89 ? 132 MET A HB2  3  
ATOM   9099   H HB3  . MET A 1 134 ? -41.378 16.724  -2.239  0.016 26.04 ? 132 MET A HB3  3  
ATOM   9100   H HG2  . MET A 1 134 ? -40.406 14.196  -1.402  0.016 25.01 ? 132 MET A HG2  3  
ATOM   9101   H HG3  . MET A 1 134 ? -41.890 14.456  -1.851  0.016 26.01 ? 132 MET A HG3  3  
ATOM   9102   H HE1  . MET A 1 134 ? -42.175 15.252  -4.873  0.016 26.39 ? 132 MET A HE1  3  
ATOM   9103   H HE2  . MET A 1 134 ? -41.112 16.293  -4.318  0.016 25.74 ? 132 MET A HE2  3  
ATOM   9104   H HE3  . MET A 1 134 ? -40.768 15.412  -5.586  0.016 25.61 ? 132 MET A HE3  3  
ATOM   9105   N N    . GLN A 1 135 ? -38.934 18.892  -0.595  0.016 25.20 ? 133 GLN A N    3  
ATOM   9106   C CA   . GLN A 1 135 ? -38.736 20.346  -0.555  0.016 25.62 ? 133 GLN A CA   3  
ATOM   9107   C C    . GLN A 1 135 ? -37.300 20.747  -0.905  0.016 25.17 ? 133 GLN A C    3  
ATOM   9108   O O    . GLN A 1 135 ? -36.989 21.948  -0.910  0.016 25.63 ? 133 GLN A O    3  
ATOM   9109   C CB   . GLN A 1 135 ? -39.099 20.910  0.833   0.016 25.97 ? 133 GLN A CB   3  
ATOM   9110   C CG   . GLN A 1 135 ? -40.547 21.510  1.028   0.016 26.99 ? 133 GLN A CG   3  
ATOM   9111   C CD   . GLN A 1 135 ? -40.746 22.797  0.225   0.016 27.74 ? 133 GLN A CD   3  
ATOM   9112   O OE1  . GLN A 1 135 ? -41.065 22.701  -0.958  0.016 27.85 ? 133 GLN A OE1  3  
ATOM   9113   N NE2  . GLN A 1 135 ? -40.523 24.016  0.844   0.016 28.37 ? 133 GLN A NE2  3  
ATOM   9114   H H    . GLN A 1 135 ? -38.758 18.504  0.149   0.016 25.08 ? 133 GLN A H    3  
ATOM   9115   H HA   . GLN A 1 135 ? -39.321 20.759  -1.202  0.016 26.17 ? 133 GLN A HA   3  
ATOM   9116   H HB2  . GLN A 1 135 ? -38.979 20.209  1.492   0.016 25.59 ? 133 GLN A HB2  3  
ATOM   9117   H HB3  . GLN A 1 135 ? -38.484 21.633  1.025   0.016 26.08 ? 133 GLN A HB3  3  
ATOM   9118   H HG2  . GLN A 1 135 ? -41.202 20.868  0.713   0.016 27.01 ? 133 GLN A HG2  3  
ATOM   9119   H HG3  . GLN A 1 135 ? -40.698 21.706  1.969   0.016 27.27 ? 133 GLN A HG3  3  
ATOM   9120   H HE21 . GLN A 1 135 ? -40.335 24.057  1.684   0.016 28.38 ? 133 GLN A HE21 3  
ATOM   9121   H HE22 . GLN A 1 135 ? -40.570 24.742  0.385   0.016 28.84 ? 133 GLN A HE22 3  
ATOM   9122   N N    . LYS A 1 136 ? -36.419 19.783  -1.202  0.016 24.42 ? 134 LYS A N    3  
ATOM   9123   C CA   . LYS A 1 136 ? -34.996 20.056  -1.519  0.016 24.08 ? 134 LYS A CA   3  
ATOM   9124   C C    . LYS A 1 136 ? -34.322 20.939  -0.460  0.016 24.26 ? 134 LYS A C    3  
ATOM   9125   O O    . LYS A 1 136 ? -33.776 22.006  -0.750  0.016 24.66 ? 134 LYS A O    3  
ATOM   9126   C CB   . LYS A 1 136 ? -34.826 20.661  -2.922  0.016 24.53 ? 134 LYS A CB   3  
ATOM   9127   C CG   . LYS A 1 136 ? -35.340 19.821  -4.090  0.016 24.51 ? 134 LYS A CG   3  
ATOM   9128   C CD   . LYS A 1 136 ? -35.179 20.537  -5.427  0.016 25.26 ? 134 LYS A CD   3  
ATOM   9129   C CE   . LYS A 1 136 ? -35.766 19.775  -6.589  0.016 25.72 ? 134 LYS A CE   3  
ATOM   9130   N NZ   . LYS A 1 136 ? -34.777 18.897  -7.389  0.016 25.43 ? 134 LYS A NZ   3  
ATOM   9131   H H    . LYS A 1 136 ? -36.617 18.952  -1.231  0.016 24.16 ? 134 LYS A H    3  
ATOM   9132   H HA   . LYS A 1 136 ? -34.531 19.201  -1.516  0.016 23.58 ? 134 LYS A HA   3  
ATOM   9133   H HB2  . LYS A 1 136 ? -35.270 21.523  -2.949  0.016 25.08 ? 134 LYS A HB2  3  
ATOM   9134   H HB3  . LYS A 1 136 ? -33.880 20.785  -3.079  0.016 24.44 ? 134 LYS A HB3  3  
ATOM   9135   H HG2  . LYS A 1 136 ? -34.837 18.994  -4.134  0.016 24.03 ? 134 LYS A HG2  3  
ATOM   9136   H HG3  . LYS A 1 136 ? -36.282 19.637  -3.958  0.016 24.65 ? 134 LYS A HG3  3  
ATOM   9137   H HD2  . LYS A 1 136 ? -35.641 21.390  -5.381  0.016 25.72 ? 134 LYS A HD2  3  
ATOM   9138   H HD3  . LYS A 1 136 ? -34.235 20.690  -5.604  0.016 25.13 ? 134 LYS A HD3  3  
ATOM   9139   H HE2  . LYS A 1 136 ? -36.458 19.190  -6.242  0.016 25.62 ? 134 LYS A HE2  3  
ATOM   9140   H HE3  . LYS A 1 136 ? -36.164 20.416  -7.203  0.016 26.41 ? 134 LYS A HE3  3  
ATOM   9141   H HZ1  . LYS A 1 136 ? -34.302 18.380  -6.840  0.016 24.83 ? 134 LYS A HZ1  3  
ATOM   9142   H HZ2  . LYS A 1 136 ? -35.224 18.378  -7.956  0.016 25.80 ? 134 LYS A HZ2  3  
ATOM   9143   H HZ3  . LYS A 1 136 ? -34.218 19.413  -7.857  0.016 25.60 ? 134 LYS A HZ3  3  
ATOM   9144   N N    . LYS A 1 137 ? -34.338 20.460  0.780   0.016 24.10 ? 135 LYS A N    3  
ATOM   9145   C CA   . LYS A 1 137 ? -33.686 21.122  1.905   0.016 24.47 ? 135 LYS A CA   3  
ATOM   9146   C C    . LYS A 1 137 ? -32.388 20.448  2.322   0.016 24.00 ? 135 LYS A C    3  
ATOM   9147   O O    . LYS A 1 137 ? -31.886 20.722  3.414   0.016 24.38 ? 135 LYS A O    3  
ATOM   9148   C CB   . LYS A 1 137 ? -34.623 21.177  3.115   0.016 25.02 ? 135 LYS A CB   3  
ATOM   9149   C CG   . LYS A 1 137 ? -35.945 21.903  2.917   0.016 25.74 ? 135 LYS A CG   3  
ATOM   9150   C CD   . LYS A 1 137 ? -35.666 23.367  2.689   0.016 26.43 ? 135 LYS A CD   3  
ATOM   9151   C CE   . LYS A 1 137 ? -36.948 24.203  2.464   0.016 27.20 ? 135 LYS A CE   3  
ATOM   9152   N NZ   . LYS A 1 137 ? -36.602 25.550  1.947   0.016 27.86 ? 135 LYS A NZ   3  
ATOM   9153   H H    . LYS A 1 137 ? -34.731 19.730  0.999   0.016 23.88 ? 135 LYS A H    3  
ATOM   9154   H HA   . LYS A 1 137 ? -33.468 22.037  1.649   0.016 24.86 ? 135 LYS A HA   3  
ATOM   9155   H HB2  . LYS A 1 137 ? -34.845 20.263  3.366   0.016 24.72 ? 135 LYS A HB2  3  
ATOM   9156   H HB3  . LYS A 1 137 ? -34.154 21.602  3.848   0.016 25.34 ? 135 LYS A HB3  3  
ATOM   9157   H HG2  . LYS A 1 137 ? -36.405 21.545  2.143   0.016 25.54 ? 135 LYS A HG2  3  
ATOM   9158   H HG3  . LYS A 1 137 ? -36.489 21.811  3.714   0.016 26.08 ? 135 LYS A HG3  3  
ATOM   9159   H HD2  . LYS A 1 137 ? -35.200 23.719  3.461   0.016 26.78 ? 135 LYS A HD2  3  
ATOM   9160   H HD3  . LYS A 1 137 ? -35.106 23.458  1.904   0.016 26.17 ? 135 LYS A HD3  3  
ATOM   9161   H HE2  . LYS A 1 137 ? -37.510 23.766  1.809   0.016 26.96 ? 135 LYS A HE2  3  
ATOM   9162   H HE3  . LYS A 1 137 ? -37.424 24.298  3.304   0.016 27.64 ? 135 LYS A HE3  3  
ATOM   9163   H HZ1  . LYS A 1 137 ? -36.053 25.960  2.514   0.016 27.82 ? 135 LYS A HZ1  3  
ATOM   9164   H HZ2  . LYS A 1 137 ? -36.199 25.477  1.157   0.016 27.76 ? 135 LYS A HZ2  3  
ATOM   9165   H HZ3  . LYS A 1 137 ? -37.338 26.040  1.851   0.016 28.50 ? 135 LYS A HZ3  3  
ATOM   9166   N N    . THR A 1 138 ? -31.870 19.509  1.530   0.016 23.30 ? 136 THR A N    3  
ATOM   9167   C CA   . THR A 1 138 ? -30.672 18.798  1.931   0.016 22.94 ? 136 THR A CA   3  
ATOM   9168   C C    . THR A 1 138 ? -29.449 19.529  1.416   0.016 23.11 ? 136 THR A C    3  
ATOM   9169   O O    . THR A 1 138 ? -29.459 20.066  0.313   0.016 23.21 ? 136 THR A O    3  
ATOM   9170   C CB   . THR A 1 138 ? -30.678 17.356  1.409   0.016 22.23 ? 136 THR A CB   3  
ATOM   9171   O OG1  . THR A 1 138 ? -30.506 17.351  -0.019  0.016 21.97 ? 136 THR A OG1  3  
ATOM   9172   C CG2  . THR A 1 138 ? -31.997 16.691  1.741   0.016 22.24 ? 136 THR A CG2  3  
ATOM   9173   H H    . THR A 1 138 ? -32.180 19.275  0.765   0.016 23.12 ? 136 THR A H    3  
ATOM   9174   H HA   . THR A 1 138 ? -30.625 18.768  2.900   0.016 23.20 ? 136 THR A HA   3  
ATOM   9175   H HB   . THR A 1 138 ? -29.963 16.864  1.831   0.016 22.07 ? 136 THR A HB   3  
ATOM   9176   H HG1  . THR A 1 138 ? -29.708 17.521  -0.216  0.016 21.98 ? 136 THR A HG1  3  
ATOM   9177   H HG21 . THR A 1 138 ? -32.040 15.809  1.341   0.016 21.87 ? 136 THR A HG21 3  
ATOM   9178   H HG22 . THR A 1 138 ? -32.095 16.609  2.701   0.016 22.53 ? 136 THR A HG22 3  
ATOM   9179   H HG23 . THR A 1 138 ? -32.733 17.217  1.394   0.016 22.47 ? 136 THR A HG23 3  
ATOM   9180   N N    . LEU A 1 139 ? -28.384 19.503  2.202   0.016 23.27 ? 137 LEU A N    3  
ATOM   9181   C CA   . LEU A 1 139 ? -27.136 20.176  1.838   0.016 23.67 ? 137 LEU A CA   3  
ATOM   9182   C C    . LEU A 1 139 ? -26.082 19.227  1.282   0.016 23.24 ? 137 LEU A C    3  
ATOM   9183   O O    . LEU A 1 139 ? -25.491 19.504  0.232   0.016 23.43 ? 137 LEU A O    3  
ATOM   9184   C CB   . LEU A 1 139 ? -26.570 20.887  3.067   0.016 24.49 ? 137 LEU A CB   3  
ATOM   9185   C CG   . LEU A 1 139 ? -27.448 21.932  3.733   0.016 25.19 ? 137 LEU A CG   3  
ATOM   9186   C CD1  . LEU A 1 139 ? -26.687 22.545  4.875   0.016 26.14 ? 137 LEU A CD1  3  
ATOM   9187   C CD2  . LEU A 1 139 ? -27.836 22.982  2.676   0.016 25.48 ? 137 LEU A CD2  3  
ATOM   9188   H H    . LEU A 1 139 ? -28.354 19.106  2.961   0.016 23.26 ? 137 LEU A H    3  
ATOM   9189   H HA   . LEU A 1 139 ? -27.325 20.834  1.154   0.016 23.87 ? 137 LEU A HA   3  
ATOM   9190   H HB2  . LEU A 1 139 ? -26.376 20.208  3.730   0.016 24.37 ? 137 LEU A HB2  3  
ATOM   9191   H HB3  . LEU A 1 139 ? -25.748 21.331  2.809   0.016 24.85 ? 137 LEU A HB3  3  
ATOM   9192   H HG   . LEU A 1 139 ? -28.251 21.521  4.083   0.016 24.96 ? 137 LEU A HG   3  
ATOM   9193   H HD11 . LEU A 1 139 ? -26.007 23.134  4.515   0.016 26.42 ? 137 LEU A HD11 3  
ATOM   9194   H HD12 . LEU A 1 139 ? -27.296 23.050  5.434   0.016 26.69 ? 137 LEU A HD12 3  
ATOM   9195   H HD13 . LEU A 1 139 ? -26.269 21.845  5.394   0.016 26.04 ? 137 LEU A HD13 3  
ATOM   9196   H HD21 . LEU A 1 139 ? -27.029 23.285  2.237   0.016 25.80 ? 137 LEU A HD21 3  
ATOM   9197   H HD22 . LEU A 1 139 ? -28.434 22.590  2.021   0.016 24.99 ? 137 LEU A HD22 3  
ATOM   9198   H HD23 . LEU A 1 139 ? -28.277 23.726  3.115   0.016 25.97 ? 137 LEU A HD23 3  
ATOM   9199   N N    . LYS A 1 140 ? -25.806 18.141  2.000   0.016 22.84 ? 138 LYS A N    3  
ATOM   9200   C CA   . LYS A 1 140 ? -24.752 17.178  1.688   0.016 22.56 ? 138 LYS A CA   3  
ATOM   9201   C C    . LYS A 1 140 ? -24.862 16.026  2.683   0.016 22.25 ? 138 LYS A C    3  
ATOM   9202   O O    . LYS A 1 140 ? -25.498 16.153  3.728   0.016 22.47 ? 138 LYS A O    3  
ATOM   9203   C CB   . LYS A 1 140 ? -23.356 17.805  1.809   0.016 23.29 ? 138 LYS A CB   3  
ATOM   9204   C CG   . LYS A 1 140 ? -23.091 18.444  3.181   0.016 24.06 ? 138 LYS A CG   3  
ATOM   9205   C CD   . LYS A 1 140 ? -21.628 18.845  3.360   0.016 25.01 ? 138 LYS A CD   3  
ATOM   9206   C CE   . LYS A 1 140 ? -21.142 18.541  4.745   0.016 25.28 ? 138 LYS A CE   3  
ATOM   9207   N NZ   . LYS A 1 140 ? -19.654 18.295  4.802   0.016 25.74 ? 138 LYS A NZ   3  
ATOM   9208   H H    . LYS A 1 140 ? -26.235 17.939  2.716   0.016 22.80 ? 138 LYS A H    3  
ATOM   9209   H HA   . LYS A 1 140 ? -24.879 16.836  0.790   0.016 22.23 ? 138 LYS A HA   3  
ATOM   9210   H HB2  . LYS A 1 140 ? -22.686 17.129  1.656   0.016 23.16 ? 138 LYS A HB2  3  
ATOM   9211   H HB3  . LYS A 1 140 ? -23.269 18.500  1.140   0.016 23.56 ? 138 LYS A HB3  3  
ATOM   9212   H HG2  . LYS A 1 140 ? -23.624 19.247  3.269   0.016 24.26 ? 138 LYS A HG2  3  
ATOM   9213   H HG3  . LYS A 1 140 ? -23.333 17.825  3.878   0.016 23.91 ? 138 LYS A HG3  3  
ATOM   9214   H HD2  . LYS A 1 140 ? -21.078 18.345  2.739   0.016 25.01 ? 138 LYS A HD2  3  
ATOM   9215   H HD3  . LYS A 1 140 ? -21.525 19.797  3.198   0.016 25.62 ? 138 LYS A HD3  3  
ATOM   9216   H HE2  . LYS A 1 140 ? -21.367 19.263  5.338   0.016 25.91 ? 138 LYS A HE2  3  
ATOM   9217   H HE3  . LYS A 1 140 ? -21.582 17.735  5.062   0.016 24.66 ? 138 LYS A HE3  3  
ATOM   9218   H HZ1  . LYS A 1 140 ? -19.377 18.274  5.647   0.016 26.07 ? 138 LYS A HZ1  3  
ATOM   9219   H HZ2  . LYS A 1 140 ? -19.458 17.518  4.416   0.016 25.24 ? 138 LYS A HZ2  3  
ATOM   9220   H HZ3  . LYS A 1 140 ? -19.228 18.949  4.376   0.016 26.31 ? 138 LYS A HZ3  3  
ATOM   9221   N N    . TRP A 1 141 ? -24.199 14.910  2.366   0.016 21.88 ? 139 TRP A N    3  
ATOM   9222   C CA   . TRP A 1 141 ? -24.075 13.812  3.317   0.016 21.77 ? 139 TRP A CA   3  
ATOM   9223   C C    . TRP A 1 141 ? -22.966 14.027  4.341   0.016 22.49 ? 139 TRP A C    3  
ATOM   9224   O O    . TRP A 1 141 ? -21.870 14.439  3.984   0.016 22.91 ? 139 TRP A O    3  
ATOM   9225   C CB   . TRP A 1 141 ? -23.767 12.510  2.570   0.016 21.17 ? 139 TRP A CB   3  
ATOM   9226   C CG   . TRP A 1 141 ? -24.888 11.988  1.704   0.016 20.61 ? 139 TRP A CG   3  
ATOM   9227   C CD1  . TRP A 1 141 ? -25.003 12.115  0.345   0.016 20.42 ? 139 TRP A CD1  3  
ATOM   9228   C CD2  . TRP A 1 141 ? -26.041 11.226  2.124   0.016 20.36 ? 139 TRP A CD2  3  
ATOM   9229   N NE1  . TRP A 1 141 ? -26.151 11.507  -0.091  0.016 20.09 ? 139 TRP A NE1  3  
ATOM   9230   C CE2  . TRP A 1 141 ? -26.806 10.969  0.979   0.016 20.04 ? 139 TRP A CE2  3  
ATOM   9231   C CE3  . TRP A 1 141 ? -26.509 10.780  3.354   0.016 20.55 ? 139 TRP A CE3  3  
ATOM   9232   C CZ2  . TRP A 1 141 ? -27.998 10.252  1.017   0.016 19.91 ? 139 TRP A CZ2  3  
ATOM   9233   C CZ3  . TRP A 1 141 ? -27.710 10.053  3.380   0.016 20.39 ? 139 TRP A CZ3  3  
ATOM   9234   C CH2  . TRP A 1 141 ? -28.427 9.814   2.215   0.016 20.07 ? 139 TRP A CH2  3  
ATOM   9235   H H    . TRP A 1 141 ? -23.821 14.766  1.611   0.016 21.77 ? 139 TRP A H    3  
ATOM   9236   H HA   . TRP A 1 141 ? -24.910 13.720  3.799   0.016 21.73 ? 139 TRP A HA   3  
ATOM   9237   H HB2  . TRP A 1 141 ? -23.000 12.651  1.999   0.016 21.27 ? 139 TRP A HB2  3  
ATOM   9238   H HB3  . TRP A 1 141 ? -23.552 11.837  3.230   0.016 21.20 ? 139 TRP A HB3  3  
ATOM   9239   H HD1  . TRP A 1 141 ? -24.396 12.557  -0.201  0.016 20.61 ? 139 TRP A HD1  3  
ATOM   9240   H HE1  . TRP A 1 141 ? -26.419 11.473  -0.904  0.016 20.04 ? 139 TRP A HE1  3  
ATOM   9241   H HE3  . TRP A 1 141 ? -26.029 10.944  4.131   0.016 20.89 ? 139 TRP A HE3  3  
ATOM   9242   H HZ2  . TRP A 1 141 ? -28.482 10.085  0.241   0.016 19.81 ? 139 TRP A HZ2  3  
ATOM   9243   H HZ3  . TRP A 1 141 ? -28.045 9.738   4.189   0.016 20.63 ? 139 TRP A HZ3  3  
ATOM   9244   H HH2  . TRP A 1 141 ? -29.224 9.339   2.259   0.016 20.08 ? 139 TRP A HH2  3  
ATOM   9245   N N    . LYS A 1 142 ? -23.229 13.645  5.597   0.016 22.73 ? 140 LYS A N    3  
ATOM   9246   C CA   . LYS A 1 142 ? -22.227 13.575  6.671   0.016 23.67 ? 140 LYS A CA   3  
ATOM   9247   C C    . LYS A 1 142 ? -21.078 12.582  6.371   0.016 23.80 ? 140 LYS A C    3  
ATOM   9248   O O    . LYS A 1 142 ? -20.587 12.485  5.246   0.016 23.92 ? 140 LYS A O    3  
ATOM   9249   C CB   . LYS A 1 142 ? -22.897 13.242  8.016   0.016 24.11 ? 140 LYS A CB   3  
ATOM   9250   C CG   . LYS A 1 142 ? -23.453 14.512  8.727   0.016 24.71 ? 140 LYS A CG   3  
ATOM   9251   C CD   . LYS A 1 142 ? -24.378 14.272  9.956   0.016 25.55 ? 140 LYS A CD   3  
ATOM   9252   C CE   . LYS A 1 142 ? -23.690 13.796  11.244  0.016 26.25 ? 140 LYS A CE   3  
ATOM   9253   N NZ   . LYS A 1 142 ? -24.530 12.692  11.910  0.016 25.53 ? 140 LYS A NZ   3  
ATOM   9254   H H    . LYS A 1 142 ? -24.014 13.445  5.866   0.016 22.45 ? 140 LYS A H    3  
ATOM   9255   H HA   . LYS A 1 142 ? -21.814 14.449  6.765   0.016 24.15 ? 140 LYS A HA   3  
ATOM   9256   H HB2  . LYS A 1 142 ? -23.628 12.624  7.870   0.016 23.60 ? 140 LYS A HB2  3  
ATOM   9257   H HB3  . LYS A 1 142 ? -22.264 12.868  8.641   0.016 24.69 ? 140 LYS A HB3  3  
ATOM   9258   H HG2  . LYS A 1 142 ? -22.697 15.040  9.032   0.016 25.21 ? 140 LYS A HG2  3  
ATOM   9259   H HG3  . LYS A 1 142 ? -23.960 15.023  8.078   0.016 24.19 ? 140 LYS A HG3  3  
ATOM   9260   H HD2  . LYS A 1 142 ? -24.805 15.118  10.177  0.016 26.19 ? 140 LYS A HD2  3  
ATOM   9261   H HD3  . LYS A 1 142 ? -25.059 13.623  9.728   0.016 25.16 ? 140 LYS A HD3  3  
ATOM   9262   H HE2  . LYS A 1 142 ? -22.813 13.441  11.029  0.016 26.48 ? 140 LYS A HE2  3  
ATOM   9263   H HE3  . LYS A 1 142 ? -23.613 14.535  11.866  0.016 27.08 ? 140 LYS A HE3  3  
ATOM   9264   H HZ1  . LYS A 1 142 ? -24.028 12.220  12.475  0.016 25.70 ? 140 LYS A HZ1  3  
ATOM   9265   H HZ2  . LYS A 1 142 ? -25.209 13.052  12.359  0.016 25.81 ? 140 LYS A HZ2  3  
ATOM   9266   H HZ3  . LYS A 1 142 ? -24.850 12.142  11.290  0.016 24.74 ? 140 LYS A HZ3  3  
ATOM   9267   N N    . SER A 1 143 ? -20.680 11.817  7.430   0.016 24.07 ? 141 SER A N    3  
ATOM   9268   C CA   . SER A 1 143 ? -19.328 11.558  7.971   0.016 24.90 ? 141 SER A CA   3  
ATOM   9269   C C    . SER A 1 143 ? -18.751 10.182  7.712   0.016 24.66 ? 141 SER A C    3  
ATOM   9270   O O    . SER A 1 143 ? -17.672 9.841   8.205   0.016 25.53 ? 141 SER A O    3  
ATOM   9271   C CB   . SER A 1 143 ? -19.358 11.694  9.504   0.016 26.19 ? 141 SER A CB   3  
ATOM   9272   O OG   . SER A 1 143 ? -19.532 13.024  9.949   0.016 27.14 ? 141 SER A OG   3  
ATOM   9273   H H    . SER A 1 143 ? -21.257 11.364  7.882   0.016 23.88 ? 141 SER A H    3  
ATOM   9274   H HA   . SER A 1 143 ? -18.711 12.226  7.631   0.016 24.94 ? 141 SER A HA   3  
ATOM   9275   H HB2  . SER A 1 143 ? -20.089 11.158  9.850   0.016 26.19 ? 141 SER A HB2  3  
ATOM   9276   H HB3  . SER A 1 143 ? -18.523 11.352  9.858   0.016 26.52 ? 141 SER A HB3  3  
ATOM   9277   H HG   . SER A 1 143 ? -18.800 13.435  9.922   0.016 27.16 ? 141 SER A HG   3  
ATOM   9278   N N    . PRO A 1 144 ? -19.441 9.348   6.978   0.016 23.65 ? 142 PRO A N    3  
ATOM   9279   C CA   . PRO A 1 144 ? -19.666 7.985   7.437   0.016 23.46 ? 142 PRO A CA   3  
ATOM   9280   C C    . PRO A 1 144 ? -18.419 7.119   7.382   0.016 23.85 ? 142 PRO A C    3  
ATOM   9281   O O    . PRO A 1 144 ? -17.652 7.159   6.413   0.016 23.63 ? 142 PRO A O    3  
ATOM   9282   C CB   . PRO A 1 144 ? -20.733 7.504   6.444   0.016 22.38 ? 142 PRO A CB   3  
ATOM   9283   C CG   . PRO A 1 144 ? -20.272 8.163   5.168   0.016 22.11 ? 142 PRO A CG   3  
ATOM   9284   C CD   . PRO A 1 144 ? -19.761 9.509   5.546   0.016 22.78 ? 142 PRO A CD   3  
ATOM   9285   H HA   . PRO A 1 144 ? -20.021 7.994   8.343   0.016 23.85 ? 142 PRO A HA   3  
ATOM   9286   H HB2  . PRO A 1 144 ? -20.713 6.540   6.359   0.016 22.20 ? 142 PRO A HB2  3  
ATOM   9287   H HB3  . PRO A 1 144 ? -21.603 7.823   6.728   0.016 22.26 ? 142 PRO A HB3  3  
ATOM   9288   H HG2  . PRO A 1 144 ? -19.550 7.649   4.774   0.016 22.21 ? 142 PRO A HG2  3  
ATOM   9289   H HG3  . PRO A 1 144 ? -21.018 8.235   4.550   0.016 21.57 ? 142 PRO A HG3  3  
ATOM   9290   H HD2  . PRO A 1 144 ? -18.964 9.724   5.039   0.016 22.97 ? 142 PRO A HD2  3  
ATOM   9291   H HD3  . PRO A 1 144 ? -20.452 10.173  5.426   0.016 22.58 ? 142 PRO A HD3  3  
ATOM   9292   N N    . THR A 1 145 ? -18.180 6.412   8.491   0.016 24.63 ? 143 THR A N    3  
ATOM   9293   C CA   . THR A 1 145 ? -17.458 5.128   8.493   0.016 24.71 ? 143 THR A CA   3  
ATOM   9294   C C    . THR A 1 145 ? -18.495 4.021   8.343   0.016 24.09 ? 143 THR A C    3  
ATOM   9295   O O    . THR A 1 145 ? -19.502 4.011   9.044   0.016 24.43 ? 143 THR A O    3  
ATOM   9296   C CB   . THR A 1 145 ? -16.660 4.905   9.788   0.016 26.05 ? 143 THR A CB   3  
ATOM   9297   O OG1  . THR A 1 145 ? -15.765 6.001   10.016  0.016 26.88 ? 143 THR A OG1  3  
ATOM   9298   C CG2  . THR A 1 145 ? -15.829 3.589   9.728   0.016 26.24 ? 143 THR A CG2  3  
ATOM   9299   H H    . THR A 1 145 ? -18.432 6.654   9.275   0.016 25.22 ? 143 THR A H    3  
ATOM   9300   H HA   . THR A 1 145 ? -16.848 5.082   7.741   0.016 24.43 ? 143 THR A HA   3  
ATOM   9301   H HB   . THR A 1 145 ? -17.277 4.840   10.534  0.016 26.36 ? 143 THR A HB   3  
ATOM   9302   H HG1  . THR A 1 145 ? -15.410 6.232   9.290   0.016 26.52 ? 143 THR A HG1  3  
ATOM   9303   H HG21 . THR A 1 145 ? -14.886 3.793   9.826   0.016 27.16 ? 143 THR A HG21 3  
ATOM   9304   H HG22 . THR A 1 145 ? -16.093 3.001   10.453  0.016 26.09 ? 143 THR A HG22 3  
ATOM   9305   H HG23 . THR A 1 145 ? -15.971 3.133   8.883   0.016 25.72 ? 143 THR A HG23 3  
ATOM   9306   N N    . GLY A 1 146 ? -18.295 3.141   7.389   0.016 23.33 ? 144 GLY A N    3  
ATOM   9307   C CA   . GLY A 1 146 ? -19.175 2.015   7.206   0.016 22.94 ? 144 GLY A CA   3  
ATOM   9308   C C    . GLY A 1 146 ? -18.551 0.711   7.668   0.016 23.41 ? 144 GLY A C    3  
ATOM   9309   O O    . GLY A 1 146 ? -17.347 0.638   7.916   0.016 23.90 ? 144 GLY A O    3  
ATOM   9310   H H    . GLY A 1 146 ? -17.647 3.178   6.827   0.016 23.12 ? 144 GLY A H    3  
ATOM   9311   H HA2  . GLY A 1 146 ? -19.970 2.143   7.735   0.016 23.11 ? 144 GLY A HA2  3  
ATOM   9312   H HA3  . GLY A 1 146 ? -19.418 1.939   6.272   0.016 22.31 ? 144 GLY A HA3  3  
ATOM   9313   N N    . LYS A 1 147 ? -19.415 -0.303  7.804   0.016 23.39 ? 145 LYS A N    3  
ATOM   9314   C CA   . LYS A 1 147 ? -19.058 -1.626  8.323   0.016 23.85 ? 145 LYS A CA   3  
ATOM   9315   C C    . LYS A 1 147 ? -19.456 -2.709  7.320   0.016 23.20 ? 145 LYS A C    3  
ATOM   9316   O O    . LYS A 1 147 ? -20.644 -2.974  7.115   0.016 22.45 ? 145 LYS A O    3  
ATOM   9317   C CB   . LYS A 1 147 ? -19.750 -1.895  9.672   0.016 24.44 ? 145 LYS A CB   3  
ATOM   9318   C CG   . LYS A 1 147 ? -20.015 -3.433  9.998   0.016 25.04 ? 145 LYS A CG   3  
ATOM   9319   C CD   . LYS A 1 147 ? -21.239 -3.788  10.883  0.016 25.87 ? 145 LYS A CD   3  
ATOM   9320   C CE   . LYS A 1 147 ? -21.137 -5.263  11.415  0.016 27.25 ? 145 LYS A CE   3  
ATOM   9321   N NZ   . LYS A 1 147 ? -19.721 -5.753  11.583  0.016 27.71 ? 145 LYS A NZ   3  
ATOM   9322   H H    . LYS A 1 147 ? -20.243 -0.244  7.581   0.016 23.17 ? 145 LYS A H    3  
ATOM   9323   H HA   . LYS A 1 147 ? -18.100 -1.675  8.453   0.016 24.38 ? 145 LYS A HA   3  
ATOM   9324   H HB2  . LYS A 1 147 ? -19.201 -1.522  10.381  0.016 25.01 ? 145 LYS A HB2  3  
ATOM   9325   H HB3  . LYS A 1 147 ? -20.607 -1.437  9.666   0.016 24.00 ? 145 LYS A HB3  3  
ATOM   9326   H HG2  . LYS A 1 147 ? -20.085 -3.978  9.206   0.016 24.54 ? 145 LYS A HG2  3  
ATOM   9327   H HG3  . LYS A 1 147 ? -19.246 -3.705  10.507  0.016 25.53 ? 145 LYS A HG3  3  
ATOM   9328   H HD2  . LYS A 1 147 ? -21.263 -3.186  11.646  0.016 25.79 ? 145 LYS A HD2  3  
ATOM   9329   H HD3  . LYS A 1 147 ? -22.044 -3.685  10.357  0.016 25.75 ? 145 LYS A HD3  3  
ATOM   9330   H HE2  . LYS A 1 147 ? -21.549 -5.307  12.288  0.016 27.44 ? 145 LYS A HE2  3  
ATOM   9331   H HE3  . LYS A 1 147 ? -21.616 -5.862  10.837  0.016 27.82 ? 145 LYS A HE3  3  
ATOM   9332   H HZ1  . LYS A 1 147 ? -19.243 -5.146  12.026  0.016 28.53 ? 145 LYS A HZ1  3  
ATOM   9333   H HZ2  . LYS A 1 147 ? -19.707 -6.515  12.042  0.016 27.80 ? 145 LYS A HZ2  3  
ATOM   9334   H HZ3  . LYS A 1 147 ? -19.345 -5.885  10.788  0.016 27.18 ? 145 LYS A HZ3  3  
ATOM   9335   N N    . MET A 1 148 ? -18.441 -3.387  6.763   0.016 23.67 ? 146 MET A N    3  
ATOM   9336   C CA   . MET A 1 148 ? -18.596 -4.501  5.833   0.016 23.41 ? 146 MET A CA   3  
ATOM   9337   C C    . MET A 1 148 ? -18.244 -5.747  6.604   0.016 24.19 ? 146 MET A C    3  
ATOM   9338   O O    . MET A 1 148 ? -17.342 -5.730  7.438   0.016 25.02 ? 146 MET A O    3  
ATOM   9339   C CB   . MET A 1 148 ? -17.661 -4.510  4.604   0.016 23.39 ? 146 MET A CB   3  
ATOM   9340   C CG   . MET A 1 148 ? -16.955 -3.302  4.290   0.016 22.75 ? 146 MET A CG   3  
ATOM   9341   S SD   . MET A 1 148 ? -16.484 -2.895  5.949   0.016 22.99 ? 146 MET A SD   3  
ATOM   9342   C CE   . MET A 1 148 ? -17.056 -1.161  5.760   0.016 22.35 ? 146 MET A CE   3  
ATOM   9343   H H    . MET A 1 148 ? -17.645 -3.264  7.008   0.016 24.26 ? 146 MET A H    3  
ATOM   9344   H HA   . MET A 1 148 ? -19.513 -4.545  5.532   0.016 22.90 ? 146 MET A HA   3  
ATOM   9345   H HB2  . MET A 1 148 ? -16.969 -5.157  4.795   0.016 23.96 ? 146 MET A HB2  3  
ATOM   9346   H HB3  . MET A 1 148 ? -18.160 -4.808  3.835   0.016 23.33 ? 146 MET A HB3  3  
ATOM   9347   H HG2  . MET A 1 148 ? -16.189 -3.465  3.720   0.016 22.64 ? 146 MET A HG2  3  
ATOM   9348   H HG3  . MET A 1 148 ? -17.555 -2.635  3.928   0.016 22.31 ? 146 MET A HG3  3  
ATOM   9349   H HE1  . MET A 1 148 ? -16.541 -0.571  6.307   0.016 22.50 ? 146 MET A HE1  3  
ATOM   9350   H HE2  . MET A 1 148 ? -16.946 -0.882  4.839   0.016 21.83 ? 146 MET A HE2  3  
ATOM   9351   H HE3  . MET A 1 148 ? -17.994 -1.105  5.975   0.016 22.49 ? 146 MET A HE3  3  
ATOM   9352   N N    . TYR A 1 149 ? -18.874 -6.844  6.240   0.016 24.08 ? 147 TYR A N    3  
ATOM   9353   C CA   . TYR A 1 149 ? -18.753 -8.035  7.046   0.016 24.91 ? 147 TYR A CA   3  
ATOM   9354   C C    . TYR A 1 149 ? -19.416 -9.127  6.233   0.016 24.68 ? 147 TYR A C    3  
ATOM   9355   O O    . TYR A 1 149 ? -20.217 -8.850  5.356   0.016 23.97 ? 147 TYR A O    3  
ATOM   9356   C CB   . TYR A 1 149 ? -19.378 -7.825  8.424   0.016 25.54 ? 147 TYR A CB   3  
ATOM   9357   C CG   . TYR A 1 149 ? -20.850 -7.800  8.402   0.016 25.05 ? 147 TYR A CG   3  
ATOM   9358   C CD1  . TYR A 1 149 ? -21.576 -8.973  8.296   0.016 25.41 ? 147 TYR A CD1  3  
ATOM   9359   C CD2  . TYR A 1 149 ? -21.535 -6.604  8.495   0.016 24.34 ? 147 TYR A CD2  3  
ATOM   9360   C CE1  . TYR A 1 149 ? -22.923 -8.960  8.262   0.016 25.07 ? 147 TYR A CE1  3  
ATOM   9361   C CE2  . TYR A 1 149 ? -22.876 -6.585  8.472   0.016 23.97 ? 147 TYR A CE2  3  
ATOM   9362   C CZ   . TYR A 1 149 ? -23.582 -7.767  8.361   0.016 24.34 ? 147 TYR A CZ   3  
ATOM   9363   O OH   . TYR A 1 149 ? -24.954 -7.774  8.332   0.016 24.02 ? 147 TYR A OH   3  
ATOM   9364   H H    . TYR A 1 149 ? -19.356 -6.928  5.535   0.016 23.62 ? 147 TYR A H    3  
ATOM   9365   H HA   . TYR A 1 149 ? -17.812 -8.251  7.164   0.016 25.36 ? 147 TYR A HA   3  
ATOM   9366   H HB2  . TYR A 1 149 ? -19.154 -8.520  9.041   0.016 26.11 ? 147 TYR A HB2  3  
ATOM   9367   H HB3  . TYR A 1 149 ? -19.072 -6.976  8.773   0.016 25.89 ? 147 TYR A HB3  3  
ATOM   9368   H HD1  . TYR A 1 149 ? -21.124 -9.788  8.229   0.016 25.96 ? 147 TYR A HD1  3  
ATOM   9369   H HD2  . TYR A 1 149 ? -21.058 -5.810  8.572   0.016 24.19 ? 147 TYR A HD2  3  
ATOM   9370   H HE1  . TYR A 1 149 ? -23.402 -9.754  8.189   0.016 25.42 ? 147 TYR A HE1  3  
ATOM   9371   H HE2  . TYR A 1 149 ? -23.328 -5.787  8.534   0.016 23.55 ? 147 TYR A HE2  3  
ATOM   9372   H HH   . TYR A 1 149 ? -25.228 -8.277  7.717   0.016 24.09 ? 147 TYR A HH   3  
ATOM   9373   N N    . VAL A 1 150 ? -19.050 -10.383 6.497   0.016 25.43 ? 148 VAL A N    3  
ATOM   9374   C CA   . VAL A 1 150 ? -19.407 -11.476 5.605   0.016 25.43 ? 148 VAL A CA   3  
ATOM   9375   C C    . VAL A 1 150 ? -20.489 -12.345 6.236   0.016 25.98 ? 148 VAL A C    3  
ATOM   9376   O O    . VAL A 1 150 ? -20.467 -12.581 7.445   0.016 26.73 ? 148 VAL A O    3  
ATOM   9377   C CB   . VAL A 1 150 ? -18.149 -12.300 5.272   0.016 25.98 ? 148 VAL A CB   3  
ATOM   9378   C CG1  . VAL A 1 150 ? -18.481 -13.690 4.686   0.016 26.19 ? 148 VAL A CG1  3  
ATOM   9379   C CG2  . VAL A 1 150 ? -17.270 -11.481 4.321   0.016 25.59 ? 148 VAL A CG2  3  
ATOM   9380   H H    . VAL A 1 150 ? -18.598 -10.619 7.184   0.016 26.02 ? 148 VAL A H    3  
ATOM   9381   H HA   . VAL A 1 150 ? -19.754 -11.115 4.775   0.016 24.84 ? 148 VAL A HA   3  
ATOM   9382   H HB   . VAL A 1 150 ? -17.656 -12.438 6.094   0.016 26.62 ? 148 VAL A HB   3  
ATOM   9383   H HG11 . VAL A 1 150 ? -19.056 -14.183 5.293   0.016 26.84 ? 148 VAL A HG11 3  
ATOM   9384   H HG12 . VAL A 1 150 ? -18.920 -13.581 3.827   0.016 25.80 ? 148 VAL A HG12 3  
ATOM   9385   H HG13 . VAL A 1 150 ? -17.647 -14.171 4.572   0.016 26.19 ? 148 VAL A HG13 3  
ATOM   9386   H HG21 . VAL A 1 150 ? -17.566 -10.561 4.323   0.016 25.06 ? 148 VAL A HG21 3  
ATOM   9387   H HG22 . VAL A 1 150 ? -16.355 -11.521 4.635   0.016 26.09 ? 148 VAL A HG22 3  
ATOM   9388   H HG23 . VAL A 1 150 ? -17.334 -11.850 3.427   0.016 25.49 ? 148 VAL A HG23 3  
ATOM   9389   N N    . GLU A 1 151 ? -21.443 -12.797 5.408   0.016 25.77 ? 149 GLU A N    3  
ATOM   9390   C CA   . GLU A 1 151 ? -22.379 -13.900 5.700   0.016 26.51 ? 149 GLU A CA   3  
ATOM   9391   C C    . GLU A 1 151 ? -21.913 -15.200 5.048   0.016 27.06 ? 149 GLU A C    3  
ATOM   9392   O O    . GLU A 1 151 ? -22.155 -15.400 3.852   0.016 27.20 ? 149 GLU A O    3  
ATOM   9393   C CB   . GLU A 1 151 ? -23.746 -13.564 5.119   0.016 26.11 ? 149 GLU A CB   3  
ATOM   9394   C CG   . GLU A 1 151 ? -24.961 -13.557 6.092   0.016 26.90 ? 149 GLU A CG   3  
ATOM   9395   C CD   . GLU A 1 151 ? -25.182 -12.177 6.663   0.016 27.06 ? 149 GLU A CD   3  
ATOM   9396   O OE1  . GLU A 1 151 ? -24.400 -11.302 6.260   0.016 26.92 ? 149 GLU A OE1  3  
ATOM   9397   O OE2  . GLU A 1 151 ? -26.049 -11.966 7.529   0.016 27.39 ? 149 GLU A OE2  3  
ATOM   9398   H H    . GLU A 1 151 ? -21.580 -12.449 4.634   0.016 25.28 ? 149 GLU A H    3  
ATOM   9399   H HA   . GLU A 1 151 ? -22.464 -14.028 6.656   0.016 27.07 ? 149 GLU A HA   3  
ATOM   9400   H HB2  . GLU A 1 151 ? -23.686 -12.691 4.703   0.016 25.49 ? 149 GLU A HB2  3  
ATOM   9401   H HB3  . GLU A 1 151 ? -23.938 -14.214 4.428   0.016 26.03 ? 149 GLU A HB3  3  
ATOM   9402   H HG2  . GLU A 1 151 ? -25.758 -13.821 5.604   0.016 26.73 ? 149 GLU A HG2  3  
ATOM   9403   H HG3  . GLU A 1 151 ? -24.797 -14.166 6.826   0.016 27.63 ? 149 GLU A HG3  3  
ATOM   9404   N N    . ASP A 1 152 ? -21.279 -16.104 5.807   0.016 27.52 ? 150 ASP A N    3  
ATOM   9405   C CA   . ASP A 1 152 ? -20.742 -17.356 5.258   0.016 28.35 ? 150 ASP A CA   3  
ATOM   9406   C C    . ASP A 1 152 ? -20.611 -17.365 3.736   0.016 28.17 ? 150 ASP A C    3  
ATOM   9407   O O    . ASP A 1 152 ? -20.934 -18.360 3.079   0.016 28.99 ? 150 ASP A O    3  
ATOM   9408   C CB   . ASP A 1 152 ? -21.569 -18.596 5.695   0.016 29.48 ? 150 ASP A CB   3  
ATOM   9409   C CG   . ASP A 1 152 ? -22.965 -18.695 5.015   0.016 29.65 ? 150 ASP A CG   3  
ATOM   9410   O OD1  . ASP A 1 152 ? -23.069 -19.367 3.953   0.016 30.46 ? 150 ASP A OD1  3  
ATOM   9411   O OD2  . ASP A 1 152 ? -23.964 -18.128 5.549   0.016 29.09 ? 150 ASP A OD2  3  
ATOM   9412   H H    . ASP A 1 152 ? -21.131 -16.010 6.653   0.016 27.43 ? 150 ASP A H    3  
ATOM   9413   H HA   . ASP A 1 152 ? -19.837 -17.445 5.579   0.016 28.46 ? 150 ASP A HA   3  
ATOM   9414   H HB2  . ASP A 1 152 ? -21.088 -19.360 5.371   0.016 30.10 ? 150 ASP A HB2  3  
ATOM   9415   H HB3  . ASP A 1 152 ? -21.661 -18.638 6.659   0.016 29.62 ? 150 ASP A HB3  3  
ATOM   9416   N N    . GLY A 1 153 ? -20.131 -16.276 3.162   0.016 27.24 ? 151 GLY A N    3  
ATOM   9417   C CA   . GLY A 1 153 ? -19.848 -16.280 1.742   0.016 27.15 ? 151 GLY A CA   3  
ATOM   9418   C C    . GLY A 1 153 ? -20.379 -15.137 0.903   0.016 26.18 ? 151 GLY A C    3  
ATOM   9419   O O    . GLY A 1 153 ? -20.061 -15.083 -0.285  0.016 26.17 ? 151 GLY A O    3  
ATOM   9420   H H    . GLY A 1 153 ? -19.967 -15.530 3.560   0.016 26.71 ? 151 GLY A H    3  
ATOM   9421   H HA2  . GLY A 1 153 ? -18.885 -16.294 1.636   0.016 27.54 ? 151 GLY A HA2  3  
ATOM   9422   H HA3  . GLY A 1 153 ? -20.184 -17.101 1.353   0.016 27.49 ? 151 GLY A HA3  3  
ATOM   9423   N N    . VAL A 1 154 ? -21.191 -14.231 1.449   0.016 25.50 ? 152 VAL A N    3  
ATOM   9424   C CA   . VAL A 1 154 ? -21.599 -13.045 0.702   0.016 24.66 ? 152 VAL A CA   3  
ATOM   9425   C C    . VAL A 1 154 ? -21.226 -11.814 1.536   0.016 24.15 ? 152 VAL A C    3  
ATOM   9426   O O    . VAL A 1 154 ? -21.455 -11.777 2.755   0.016 24.44 ? 152 VAL A O    3  
ATOM   9427   C CB   . VAL A 1 154 ? -23.097 -13.063 0.318   0.016 24.60 ? 152 VAL A CB   3  
ATOM   9428   C CG1  . VAL A 1 154 ? -23.322 -13.328 -1.226  0.016 24.69 ? 152 VAL A CG1  3  
ATOM   9429   C CG2  . VAL A 1 154 ? -23.797 -14.126 1.030   0.016 25.47 ? 152 VAL A CG2  3  
ATOM   9430   H H    . VAL A 1 154 ? -21.515 -14.281 2.245   0.016 25.58 ? 152 VAL A H    3  
ATOM   9431   H HA   . VAL A 1 154 ? -21.097 -12.994 -0.122  0.016 24.67 ? 152 VAL A HA   3  
ATOM   9432   H HB   . VAL A 1 154 ? -23.517 -12.214 0.547   0.016 24.16 ? 152 VAL A HB   3  
ATOM   9433   H HG11 . VAL A 1 154 ? -22.472 -13.457 -1.671  0.016 25.24 ? 152 VAL A HG11 3  
ATOM   9434   H HG12 . VAL A 1 154 ? -23.870 -14.118 -1.328  0.016 24.74 ? 152 VAL A HG12 3  
ATOM   9435   H HG13 . VAL A 1 154 ? -23.787 -12.569 -1.613  0.016 24.27 ? 152 VAL A HG13 3  
ATOM   9436   H HG21 . VAL A 1 154 ? -23.662 -13.987 1.983   0.016 25.65 ? 152 VAL A HG21 3  
ATOM   9437   H HG22 . VAL A 1 154 ? -24.743 -14.106 0.818   0.016 25.48 ? 152 VAL A HG22 3  
ATOM   9438   H HG23 . VAL A 1 154 ? -23.419 -14.965 0.717   0.016 25.95 ? 152 VAL A HG23 3  
ATOM   9439   N N    . LEU A 1 155 ? -20.605 -10.846 0.895   0.016 23.58 ? 153 LEU A N    3  
ATOM   9440   C CA   . LEU A 1 155 ? -20.226 -9.609  1.579   0.016 23.22 ? 153 LEU A CA   3  
ATOM   9441   C C    . LEU A 1 155 ? -21.410 -8.657  1.675   0.016 22.69 ? 153 LEU A C    3  
ATOM   9442   O O    . LEU A 1 155 ? -22.152 -8.470  0.704   0.016 22.40 ? 153 LEU A O    3  
ATOM   9443   C CB   . LEU A 1 155 ? -19.056 -8.926  0.865   0.016 23.05 ? 153 LEU A CB   3  
ATOM   9444   C CG   . LEU A 1 155 ? -18.474 -7.629  1.451   0.016 22.83 ? 153 LEU A CG   3  
ATOM   9445   C CD1  . LEU A 1 155 ? -18.267 -7.747  2.947   0.016 23.52 ? 153 LEU A CD1  3  
ATOM   9446   C CD2  . LEU A 1 155 ? -17.162 -7.351  0.777   0.016 22.52 ? 153 LEU A CD2  3  
ATOM   9447   H H    . LEU A 1 155 ? -20.398 -10.871 0.061   0.016 23.50 ? 153 LEU A H    3  
ATOM   9448   H HA   . LEU A 1 155 ? -19.947 -9.825  2.482   0.016 23.58 ? 153 LEU A HA   3  
ATOM   9449   H HB2  . LEU A 1 155 ? -18.330 -9.565  0.841   0.016 23.49 ? 153 LEU A HB2  3  
ATOM   9450   H HB3  . LEU A 1 155 ? -19.339 -8.730  -0.041  0.016 22.82 ? 153 LEU A HB3  3  
ATOM   9451   H HG   . LEU A 1 155 ? -19.076 -6.888  1.278   0.016 22.59 ? 153 LEU A HG   3  
ATOM   9452   H HD11 . LEU A 1 155 ? -17.589 -7.114  3.228   0.016 23.51 ? 153 LEU A HD11 3  
ATOM   9453   H HD12 . LEU A 1 155 ? -19.104 -7.550  3.393   0.016 23.74 ? 153 LEU A HD12 3  
ATOM   9454   H HD13 . LEU A 1 155 ? -17.981 -8.647  3.160   0.016 23.84 ? 153 LEU A HD13 3  
ATOM   9455   H HD21 . LEU A 1 155 ? -16.834 -6.487  1.074   0.016 22.31 ? 153 LEU A HD21 3  
ATOM   9456   H HD22 . LEU A 1 155 ? -16.538 -8.050  1.031   0.016 22.89 ? 153 LEU A HD22 3  
ATOM   9457   H HD23 . LEU A 1 155 ? -17.292 -7.356  -0.184  0.016 22.28 ? 153 LEU A HD23 3  
ATOM   9458   N N    . LYS A 1 156 ? -21.579 -8.058  2.858   0.016 22.73 ? 154 LYS A N    3  
ATOM   9459   C CA   . LYS A 1 156 ? -22.654 -7.106  3.138   0.016 22.39 ? 154 LYS A CA   3  
ATOM   9460   C C    . LYS A 1 156 ? -22.061 -5.845  3.739   0.016 22.12 ? 154 LYS A C    3  
ATOM   9461   O O    . LYS A 1 156 ? -20.911 -5.810  4.146   0.016 22.42 ? 154 LYS A O    3  
ATOM   9462   C CB   . LYS A 1 156 ? -23.719 -7.598  4.149   0.016 22.97 ? 154 LYS A CB   3  
ATOM   9463   C CG   . LYS A 1 156 ? -24.439 -8.922  3.872   0.016 23.51 ? 154 LYS A CG   3  
ATOM   9464   C CD   . LYS A 1 156 ? -25.736 -8.816  3.011   0.016 23.24 ? 154 LYS A CD   3  
ATOM   9465   C CE   . LYS A 1 156 ? -26.346 -10.224 2.763   0.016 24.02 ? 154 LYS A CE   3  
ATOM   9466   N NZ   . LYS A 1 156 ? -26.759 -10.833 4.058   0.016 24.55 ? 154 LYS A NZ   3  
ATOM   9467   H H    . LYS A 1 156 ? -21.059 -8.188  3.527   0.016 23.05 ? 154 LYS A H    3  
ATOM   9468   H HA   . LYS A 1 156 ? -23.101 -6.865  2.314   0.016 22.10 ? 154 LYS A HA   3  
ATOM   9469   H HB2  . LYS A 1 156 ? -23.286 -7.683  5.014   0.016 23.29 ? 154 LYS A HB2  3  
ATOM   9470   H HB3  . LYS A 1 156 ? -24.400 -6.910  4.199   0.016 22.79 ? 154 LYS A HB3  3  
ATOM   9471   H HG2  . LYS A 1 156 ? -23.823 -9.505  3.401   0.016 23.76 ? 154 LYS A HG2  3  
ATOM   9472   H HG3  . LYS A 1 156 ? -24.687 -9.310  4.724   0.016 23.94 ? 154 LYS A HG3  3  
ATOM   9473   H HD2  . LYS A 1 156 ? -26.404 -8.297  3.481   0.016 22.89 ? 154 LYS A HD2  3  
ATOM   9474   H HD3  . LYS A 1 156 ? -25.518 -8.404  2.167   0.016 23.09 ? 154 LYS A HD3  3  
ATOM   9475   H HE2  . LYS A 1 156 ? -27.128 -10.154 2.195   0.016 23.98 ? 154 LYS A HE2  3  
ATOM   9476   H HE3  . LYS A 1 156 ? -25.677 -10.792 2.354   0.016 24.39 ? 154 LYS A HE3  3  
ATOM   9477   H HZ1  . LYS A 1 156 ? -26.042 -10.988 4.561   0.016 25.01 ? 154 LYS A HZ1  3  
ATOM   9478   H HZ2  . LYS A 1 156 ? -27.303 -10.279 4.492   0.016 24.24 ? 154 LYS A HZ2  3  
ATOM   9479   H HZ3  . LYS A 1 156 ? -27.182 -11.606 3.912   0.016 24.82 ? 154 LYS A HZ3  3  
ATOM   9480   N N    . GLY A 1 157 ? -22.861 -4.793  3.783   0.016 21.67 ? 155 GLY A N    3  
ATOM   9481   C CA   . GLY A 1 157 ? -22.437 -3.551  4.399   0.016 21.56 ? 155 GLY A CA   3  
ATOM   9482   C C    . GLY A 1 157 ? -23.567 -2.925  5.190   0.016 21.44 ? 155 GLY A C    3  
ATOM   9483   O O    . GLY A 1 157 ? -24.749 -3.149  4.899   0.016 21.09 ? 155 GLY A O    3  
ATOM   9484   H H    . GLY A 1 157 ? -23.657 -4.773  3.465   0.016 21.50 ? 155 GLY A H    3  
ATOM   9485   H HA2  . GLY A 1 157 ? -21.685 -3.717  4.989   0.016 21.97 ? 155 GLY A HA2  3  
ATOM   9486   H HA3  . GLY A 1 157 ? -22.153 -2.934  3.706   0.016 21.27 ? 155 GLY A HA3  3  
ATOM   9487   N N    . ASP A 1 158 ? -23.193 -2.208  6.251   0.016 21.90 ? 156 ASP A N    3  
ATOM   9488   C CA   . ASP A 1 158 ? -24.117 -1.454  7.086   0.016 21.99 ? 156 ASP A CA   3  
ATOM   9489   C C    . ASP A 1 158 ? -23.470 -0.103  7.353   0.016 21.94 ? 156 ASP A C    3  
ATOM   9490   O O    . ASP A 1 158 ? -22.243 -0.005  7.432   0.016 22.27 ? 156 ASP A O    3  
ATOM   9491   C CB   . ASP A 1 158 ? -24.440 -2.104  8.450   0.016 22.89 ? 156 ASP A CB   3  
ATOM   9492   C CG   . ASP A 1 158 ? -24.142 -3.579  8.516   0.016 23.24 ? 156 ASP A CG   3  
ATOM   9493   O OD1  . ASP A 1 158 ? -23.923 -4.200  7.450   0.016 22.81 ? 156 ASP A OD1  3  
ATOM   9494   O OD2  . ASP A 1 158 ? -24.176 -4.130  9.643   0.016 24.15 ? 156 ASP A OD2  3  
ATOM   9495   H H    . ASP A 1 158 ? -22.377 -2.132  6.512   0.016 22.26 ? 156 ASP A H    3  
ATOM   9496   H HA   . ASP A 1 158 ? -24.940 -1.319  6.598   0.016 21.65 ? 156 ASP A HA   3  
ATOM   9497   H HB2  . ASP A 1 158 ? -23.897 -1.678  9.130   0.016 23.31 ? 156 ASP A HB2  3  
ATOM   9498   H HB3  . ASP A 1 158 ? -25.381 -1.979  8.654   0.016 22.99 ? 156 ASP A HB3  3  
ATOM   9499   N N    . VAL A 1 159 ? -24.275 0.945   7.473   0.016 21.69 ? 157 VAL A N    3  
ATOM   9500   C CA   . VAL A 1 159 ? -23.719 2.245   7.803   0.016 21.88 ? 157 VAL A CA   3  
ATOM   9501   C C    . VAL A 1 159 ? -24.893 3.208   7.988   0.016 21.96 ? 157 VAL A C    3  
ATOM   9502   O O    . VAL A 1 159 ? -25.920 3.127   7.294   0.016 21.57 ? 157 VAL A O    3  
ATOM   9503   C CB   . VAL A 1 159 ? -22.647 2.695   6.763   0.016 21.42 ? 157 VAL A CB   3  
ATOM   9504   C CG1  . VAL A 1 159 ? -22.623 1.881   5.392   0.016 20.71 ? 157 VAL A CG1  3  
ATOM   9505   C CG2  . VAL A 1 159 ? -22.687 4.193   6.487   0.016 21.67 ? 157 VAL A CG2  3  
ATOM   9506   H H    . VAL A 1 159 ? -25.127 0.936   7.371   0.016 21.49 ? 157 VAL A H    3  
ATOM   9507   H HA   . VAL A 1 159 ? -23.268 2.175   8.656   0.016 22.45 ? 157 VAL A HA   3  
ATOM   9508   H HB   . VAL A 1 159 ? -21.797 2.533   7.181   0.016 21.59 ? 157 VAL A HB   3  
ATOM   9509   H HG11 . VAL A 1 159 ? -22.352 2.475   4.678   0.016 20.56 ? 157 VAL A HG11 3  
ATOM   9510   H HG12 . VAL A 1 159 ? -21.981 1.162   5.463   0.016 20.64 ? 157 VAL A HG12 3  
ATOM   9511   H HG13 . VAL A 1 159 ? -23.505 1.524   5.200   0.016 20.59 ? 157 VAL A HG13 3  
ATOM   9512   H HG21 . VAL A 1 159 ? -22.035 4.400   5.802   0.016 21.51 ? 157 VAL A HG21 3  
ATOM   9513   H HG22 . VAL A 1 159 ? -23.569 4.447   6.177   0.016 21.49 ? 157 VAL A HG22 3  
ATOM   9514   H HG23 . VAL A 1 159 ? -22.470 4.666   7.307   0.016 22.26 ? 157 VAL A HG23 3  
ATOM   9515   N N    . GLU A 1 160 ? -24.797 4.016   9.034   0.016 22.66 ? 158 GLU A N    3  
ATOM   9516   C CA   . GLU A 1 160 ? -25.851 4.950   9.382   0.016 22.98 ? 158 GLU A CA   3  
ATOM   9517   C C    . GLU A 1 160 ? -25.501 6.263   8.706   0.016 22.67 ? 158 GLU A C    3  
ATOM   9518   O O    . GLU A 1 160 ? -24.511 6.888   9.069   0.016 23.11 ? 158 GLU A O    3  
ATOM   9519   C CB   . GLU A 1 160 ? -25.940 5.139   10.885  0.016 24.18 ? 158 GLU A CB   3  
ATOM   9520   C CG   . GLU A 1 160 ? -26.568 4.013   11.656  0.016 24.59 ? 158 GLU A CG   3  
ATOM   9521   C CD   . GLU A 1 160 ? -26.657 4.350   13.113  0.016 25.90 ? 158 GLU A CD   3  
ATOM   9522   O OE1  . GLU A 1 160 ? -25.860 5.213   13.579  0.016 26.85 ? 158 GLU A OE1  3  
ATOM   9523   O OE2  . GLU A 1 160 ? -27.545 3.787   13.784  0.016 26.15 ? 158 GLU A OE2  3  
ATOM   9524   H H    . GLU A 1 160 ? -24.120 4.048   9.562   0.016 23.05 ? 158 GLU A H    3  
ATOM   9525   H HA   . GLU A 1 160 ? -26.706 4.633   9.057   0.016 22.75 ? 158 GLU A HA   3  
ATOM   9526   H HB2  . GLU A 1 160 ? -25.041 5.258   11.224  0.016 24.53 ? 158 GLU A HB2  3  
ATOM   9527   H HB3  . GLU A 1 160 ? -26.459 5.938   11.061  0.016 24.48 ? 158 GLU A HB3  3  
ATOM   9528   H HG2  . GLU A 1 160 ? -27.468 3.865   11.330  0.016 24.11 ? 158 GLU A HG2  3  
ATOM   9529   H HG3  . GLU A 1 160 ? -26.039 3.206   11.557  0.016 24.62 ? 158 GLU A HG3  3  
ATOM   9530   N N    . MET A 1 161 ? -26.298 6.667   7.724   0.016 22.01 ? 159 MET A N    3  
ATOM   9531   C CA   . MET A 1 161 ? -26.013 7.848   6.931   0.016 21.68 ? 159 MET A CA   3  
ATOM   9532   C C    . MET A 1 161 ? -26.852 9.007   7.472   0.016 22.12 ? 159 MET A C    3  
ATOM   9533   O O    . MET A 1 161 ? -27.772 8.820   8.273   0.016 22.62 ? 159 MET A O    3  
ATOM   9534   C CB   . MET A 1 161 ? -26.284 7.584   5.450   0.016 20.87 ? 159 MET A CB   3  
ATOM   9535   C CG   . MET A 1 161 ? -25.384 6.460   4.854   0.016 20.55 ? 159 MET A CG   3  
ATOM   9536   S SD   . MET A 1 161 ? -23.809 7.061   4.288   0.016 20.57 ? 159 MET A SD   3  
ATOM   9537   C CE   . MET A 1 161 ? -24.308 7.803   2.732   0.016 20.11 ? 159 MET A CE   3  
ATOM   9538   H H    . MET A 1 161 ? -27.025 6.270   7.500   0.016 21.83 ? 159 MET A H    3  
ATOM   9539   H HA   . MET A 1 161 ? -25.078 8.067   7.025   0.016 21.84 ? 159 MET A HA   3  
ATOM   9540   H HB2  . MET A 1 161 ? -27.208 7.334   5.335   0.016 20.78 ? 159 MET A HB2  3  
ATOM   9541   H HB3  . MET A 1 161 ? -26.109 8.389   4.946   0.016 20.77 ? 159 MET A HB3  3  
ATOM   9542   H HG2  . MET A 1 161 ? -25.225 5.788   5.530   0.016 20.82 ? 159 MET A HG2  3  
ATOM   9543   H HG3  . MET A 1 161 ? -25.824 6.064   4.093   0.016 20.22 ? 159 MET A HG3  3  
ATOM   9544   H HE1  . MET A 1 161 ? -24.750 8.645   2.912   0.016 20.19 ? 159 MET A HE1  3  
ATOM   9545   H HE2  . MET A 1 161 ? -23.516 7.956   2.196   0.016 20.20 ? 159 MET A HE2  3  
ATOM   9546   H HE3  . MET A 1 161 ? -24.917 7.215   2.270   0.016 19.83 ? 159 MET A HE3  3  
ATOM   9547   N N    . ALA A 1 162 ? -26.473 10.222  7.087   0.016 22.11 ? 160 ALA A N    3  
ATOM   9548   C CA   . ALA A 1 162 ? -27.278 11.375  7.462   0.016 22.54 ? 160 ALA A CA   3  
ATOM   9549   C C    . ALA A 1 162 ? -27.026 12.515  6.487   0.016 22.27 ? 160 ALA A C    3  
ATOM   9550   O O    . ALA A 1 162 ? -25.892 12.753  6.068   0.016 22.22 ? 160 ALA A O    3  
ATOM   9551   C CB   . ALA A 1 162 ? -26.968 11.832  8.893   0.016 23.61 ? 160 ALA A CB   3  
ATOM   9552   H H    . ALA A 1 162 ? -25.776 10.400  6.620   0.016 21.93 ? 160 ALA A H    3  
ATOM   9553   H HA   . ALA A 1 162 ? -28.215 11.144  7.408   0.016 22.47 ? 160 ALA A HA   3  
ATOM   9554   H HB1  . ALA A 1 162 ? -26.007 11.906  8.993   0.016 23.78 ? 160 ALA A HB1  3  
ATOM   9555   H HB2  . ALA A 1 162 ? -27.377 12.696  9.044   0.016 23.93 ? 160 ALA A HB2  3  
ATOM   9556   H HB3  . ALA A 1 162 ? -27.317 11.189  9.527   0.016 23.90 ? 160 ALA A HB3  3  
ATOM   9557   N N    . LEU A 1 163 ? -28.106 13.201  6.130   0.016 22.23 ? 161 LEU A N    3  
ATOM   9558   C CA   . LEU A 1 163 ? -28.042 14.379  5.281   0.016 22.21 ? 161 LEU A CA   3  
ATOM   9559   C C    . LEU A 1 163 ? -28.151 15.606  6.166   0.016 23.08 ? 161 LEU A C    3  
ATOM   9560   O O    . LEU A 1 163 ? -28.943 15.635  7.106   0.016 23.61 ? 161 LEU A O    3  
ATOM   9561   C CB   . LEU A 1 163 ? -29.166 14.378  4.240   0.016 21.83 ? 161 LEU A CB   3  
ATOM   9562   C CG   . LEU A 1 163 ? -28.849 13.540  3.005   0.016 21.14 ? 161 LEU A CG   3  
ATOM   9563   C CD1  . LEU A 1 163 ? -30.063 13.299  2.138   0.016 20.97 ? 161 LEU A CD1  3  
ATOM   9564   C CD2  . LEU A 1 163 ? -27.796 14.180  2.155   0.016 21.00 ? 161 LEU A CD2  3  
ATOM   9565   H H    . LEU A 1 163 ? -28.902 13.008  6.378   0.016 22.29 ? 161 LEU A H    3  
ATOM   9566   H HA   . LEU A 1 163 ? -27.187 14.408  4.831   0.016 22.04 ? 161 LEU A HA   3  
ATOM   9567   H HB2  . LEU A 1 163 ? -29.976 14.037  4.644   0.016 22.02 ? 161 LEU A HB2  3  
ATOM   9568   H HB3  . LEU A 1 163 ? -29.319 15.285  3.930   0.016 21.97 ? 161 LEU A HB3  3  
ATOM   9569   H HG   . LEU A 1 163 ? -28.513 12.681  3.300   0.016 21.04 ? 161 LEU A HG   3  
ATOM   9570   H HD11 . LEU A 1 163 ? -29.785 13.212  1.214   0.016 20.86 ? 161 LEU A HD11 3  
ATOM   9571   H HD12 . LEU A 1 163 ? -30.494 12.481  2.432   0.016 20.75 ? 161 LEU A HD12 3  
ATOM   9572   H HD13 . LEU A 1 163 ? -30.675 14.049  2.226   0.016 21.31 ? 161 LEU A HD13 3  
ATOM   9573   H HD21 . LEU A 1 163 ? -27.650 13.618  1.384   0.016 20.67 ? 161 LEU A HD21 3  
ATOM   9574   H HD22 . LEU A 1 163 ? -28.095 15.051  1.864   0.016 21.10 ? 161 LEU A HD22 3  
ATOM   9575   H HD23 . LEU A 1 163 ? -26.977 14.253  2.665   0.016 21.25 ? 161 LEU A HD23 3  
ATOM   9576   N N    . LEU A 1 164 ? -27.294 16.580  5.902   0.016 23.38 ? 162 LEU A N    3  
ATOM   9577   C CA   . LEU A 1 164 ? -27.442 17.871  6.559   0.016 24.30 ? 162 LEU A CA   3  
ATOM   9578   C C    . LEU A 1 164 ? -28.509 18.684  5.849   0.016 24.25 ? 162 LEU A C    3  
ATOM   9579   O O    . LEU A 1 164 ? -28.665 18.597  4.636   0.016 23.66 ? 162 LEU A O    3  
ATOM   9580   C CB   . LEU A 1 164 ? -26.100 18.596  6.539   0.016 24.79 ? 162 LEU A CB   3  
ATOM   9581   C CG   . LEU A 1 164 ? -24.987 17.894  7.295   0.016 25.14 ? 162 LEU A CG   3  
ATOM   9582   C CD1  . LEU A 1 164 ? -23.708 18.681  7.209   0.016 25.84 ? 162 LEU A CD1  3  
ATOM   9583   C CD2  . LEU A 1 164 ? -25.330 17.641  8.767   0.016 25.93 ? 162 LEU A CD2  3  
ATOM   9584   H H    . LEU A 1 164 ? -26.641 16.529  5.352   0.016 23.16 ? 162 LEU A H    3  
ATOM   9585   H HA   . LEU A 1 164 ? -27.722 17.739  7.476   0.016 24.76 ? 162 LEU A HA   3  
ATOM   9586   H HB2  . LEU A 1 164 ? -25.817 18.686  5.616   0.016 24.38 ? 162 LEU A HB2  3  
ATOM   9587   H HB3  . LEU A 1 164 ? -26.223 19.474  6.940   0.016 25.44 ? 162 LEU A HB3  3  
ATOM   9588   H HG   . LEU A 1 164 ? -24.834 17.033  6.878   0.016 24.53 ? 162 LEU A HG   3  
ATOM   9589   H HD11 . LEU A 1 164 ? -23.046 18.261  7.777   0.016 26.11 ? 162 LEU A HD11 3  
ATOM   9590   H HD12 . LEU A 1 164 ? -23.405 18.684  6.288   0.016 25.43 ? 162 LEU A HD12 3  
ATOM   9591   H HD13 . LEU A 1 164 ? -23.868 19.590  7.511   0.016 26.54 ? 162 LEU A HD13 3  
ATOM   9592   H HD21 . LEU A 1 164 ? -25.536 18.487  9.195   0.016 26.49 ? 162 LEU A HD21 3  
ATOM   9593   H HD22 . LEU A 1 164 ? -26.085 17.038  8.828   0.016 25.52 ? 162 LEU A HD22 3  
ATOM   9594   H HD23 . LEU A 1 164 ? -24.560 17.234  9.194   0.016 26.40 ? 162 LEU A HD23 3  
ATOM   9595   N N    . LEU A 1 165 ? -29.224 19.517  6.612   0.016 25.04 ? 163 LEU A N    3  
ATOM   9596   C CA   . LEU A 1 165 ? -30.394 20.245  6.130   0.016 25.19 ? 163 LEU A CA   3  
ATOM   9597   C C    . LEU A 1 165 ? -30.220 21.760  6.206   0.016 26.06 ? 163 LEU A C    3  
ATOM   9598   O O    . LEU A 1 165 ? -29.527 22.271  7.075   0.016 26.87 ? 163 LEU A O    3  
ATOM   9599   C CB   . LEU A 1 165 ? -31.617 19.923  6.959   0.016 25.60 ? 163 LEU A CB   3  
ATOM   9600   C CG   . LEU A 1 165 ? -32.032 18.452  7.012   0.016 24.95 ? 163 LEU A CG   3  
ATOM   9601   C CD1  . LEU A 1 165 ? -33.226 18.329  7.902   0.016 25.64 ? 163 LEU A CD1  3  
ATOM   9602   C CD2  . LEU A 1 165 ? -32.332 17.976  5.602   0.016 24.04 ? 163 LEU A CD2  3  
ATOM   9603   H H    . LEU A 1 165 ? -29.046 19.655  7.438   0.016 25.58 ? 163 LEU A H    3  
ATOM   9604   H HA   . LEU A 1 165 ? -30.578 20.013  5.211   0.016 24.63 ? 163 LEU A HA   3  
ATOM   9605   H HB2  . LEU A 1 165 ? -31.447 20.196  7.872   0.016 26.24 ? 163 LEU A HB2  3  
ATOM   9606   H HB3  . LEU A 1 165 ? -32.362 20.425  6.598   0.016 25.81 ? 163 LEU A HB3  3  
ATOM   9607   H HG   . LEU A 1 165 ? -31.305 17.925  7.378   0.016 24.83 ? 163 LEU A HG   3  
ATOM   9608   H HD11 . LEU A 1 165 ? -33.876 17.732  7.501   0.016 25.28 ? 163 LEU A HD11 3  
ATOM   9609   H HD12 . LEU A 1 165 ? -32.936 17.983  8.761   0.016 26.18 ? 163 LEU A HD12 3  
ATOM   9610   H HD13 . LEU A 1 165 ? -33.626 19.205  8.018   0.016 26.01 ? 163 LEU A HD13 3  
ATOM   9611   H HD21 . LEU A 1 165 ? -32.936 17.221  5.631   0.016 23.90 ? 163 LEU A HD21 3  
ATOM   9612   H HD22 . LEU A 1 165 ? -32.741 18.701  5.105   0.016 24.19 ? 163 LEU A HD22 3  
ATOM   9613   H HD23 . LEU A 1 165 ? -31.498 17.719  5.177   0.016 23.60 ? 163 LEU A HD23 3  
ATOM   9614   N N    . GLU A 1 166 ? -30.922 22.460  5.329   0.016 26.04 ? 164 GLU A N    3  
ATOM   9615   C CA   . GLU A 1 166 ? -31.103 23.902  5.512   0.016 27.04 ? 164 GLU A CA   3  
ATOM   9616   C C    . GLU A 1 166 ? -31.453 24.216  6.967   0.016 28.02 ? 164 GLU A C    3  
ATOM   9617   O O    . GLU A 1 166 ? -32.289 23.548  7.588   0.016 27.96 ? 164 GLU A O    3  
ATOM   9618   C CB   . GLU A 1 166 ? -32.168 24.402  4.535   0.016 27.03 ? 164 GLU A CB   3  
ATOM   9619   C CG   . GLU A 1 166 ? -32.696 25.929  4.652   0.016 28.14 ? 164 GLU A CG   3  
ATOM   9620   C CD   . GLU A 1 166 ? -31.608 27.089  4.552   0.016 28.81 ? 164 GLU A CD   3  
ATOM   9621   O OE1  . GLU A 1 166 ? -31.095 27.588  5.562   0.016 29.43 ? 164 GLU A OE1  3  
ATOM   9622   O OE2  . GLU A 1 166 ? -31.256 27.557  3.462   0.016 28.95 ? 164 GLU A OE2  3  
ATOM   9623   H H    . GLU A 1 166 ? -31.296 22.142  4.626   0.016 25.58 ? 164 GLU A H    3  
ATOM   9624   H HA   . GLU A 1 166 ? -30.269 24.342  5.300   0.016 27.25 ? 164 GLU A HA   3  
ATOM   9625   H HB2  . GLU A 1 166 ? -31.810 24.298  3.637   0.016 26.45 ? 164 GLU A HB2  3  
ATOM   9626   H HB3  . GLU A 1 166 ? -32.943 23.827  4.633   0.016 27.09 ? 164 GLU A HB3  3  
ATOM   9627   H HG2  . GLU A 1 166 ? -33.320 26.070  3.921   0.016 27.92 ? 164 GLU A HG2  3  
ATOM   9628   H HG3  . GLU A 1 166 ? -33.170 26.026  5.493   0.016 28.74 ? 164 GLU A HG3  3  
ATOM   9629   N N    . GLY A 1 167 ? -30.775 25.213  7.539   0.016 29.09 ? 165 GLY A N    3  
ATOM   9630   C CA   . GLY A 1 167 ? -31.064 25.611  8.904   0.016 30.28 ? 165 GLY A CA   3  
ATOM   9631   C C    . GLY A 1 167 ? -30.303 24.920  10.025  0.016 30.68 ? 165 GLY A C    3  
ATOM   9632   O O    . GLY A 1 167 ? -30.425 25.348  11.175  0.016 31.84 ? 165 GLY A O    3  
ATOM   9633   H H    . GLY A 1 167 ? -30.152 25.663  7.158   0.016 29.24 ? 165 GLY A H    3  
ATOM   9634   H HA2  . GLY A 1 167 ? -30.895 26.564  8.985   0.016 31.06 ? 165 GLY A HA2  3  
ATOM   9635   H HA3  . GLY A 1 167 ? -32.009 25.462  9.070   0.016 30.26 ? 165 GLY A HA3  3  
ATOM   9636   N N    . GLY A 1 168 ? -29.562 23.850  9.762   0.016 29.86 ? 166 GLY A N    3  
ATOM   9637   C CA   . GLY A 1 168 ? -28.670 23.294  10.769  0.016 30.39 ? 166 GLY A CA   3  
ATOM   9638   C C    . GLY A 1 168 ? -29.022 21.920  11.299  0.016 29.74 ? 166 GLY A C    3  
ATOM   9639   O O    . GLY A 1 168 ? -28.255 21.394  12.116  0.016 29.98 ? 166 GLY A O    3  
ATOM   9640   H H    . GLY A 1 168 ? -29.561 23.417  9.017   0.016 29.06 ? 166 GLY A H    3  
ATOM   9641   H HA2  . GLY A 1 168 ? -27.771 23.258  10.407  0.016 30.31 ? 166 GLY A HA2  3  
ATOM   9642   H HA3  . GLY A 1 168 ? -28.647 23.887  11.535  0.016 31.46 ? 166 GLY A HA3  3  
ATOM   9643   N N    . GLY A 1 169 ? -30.143 21.328  10.886  0.016 29.11 ? 167 GLY A N    3  
ATOM   9644   C CA   . GLY A 1 169 ? -30.528 20.008  11.346  0.016 28.71 ? 167 GLY A CA   3  
ATOM   9645   C C    . GLY A 1 169 ? -29.889 18.859  10.562  0.016 27.42 ? 167 GLY A C    3  
ATOM   9646   O O    . GLY A 1 169 ? -29.066 19.030  9.661   0.016 26.82 ? 167 GLY A O    3  
ATOM   9647   H H    . GLY A 1 169 ? -30.703 21.677  10.336  0.016 28.98 ? 167 GLY A H    3  
ATOM   9648   H HA2  . GLY A 1 169 ? -30.285 19.907  12.279  0.016 29.49 ? 167 GLY A HA2  3  
ATOM   9649   H HA3  . GLY A 1 169 ? -31.490 19.916  11.274  0.016 28.66 ? 167 GLY A HA3  3  
ATOM   9650   N N    . HIS A 1 170 ? -30.308 17.658  10.925  0.016 27.12 ? 168 HIS A N    3  
ATOM   9651   C CA   . HIS A 1 170 ? -29.847 16.462  10.250  0.016 25.99 ? 168 HIS A CA   3  
ATOM   9652   C C    . HIS A 1 170 ? -31.035 15.546  9.970   0.016 25.60 ? 168 HIS A C    3  
ATOM   9653   O O    . HIS A 1 170 ? -32.101 15.659  10.571  0.016 26.32 ? 168 HIS A O    3  
ATOM   9654   C CB   . HIS A 1 170 ? -28.786 15.712  11.066  0.016 26.24 ? 168 HIS A CB   3  
ATOM   9655   C CG   . HIS A 1 170 ? -29.305 15.090  12.329  0.016 27.24 ? 168 HIS A CG   3  
ATOM   9656   N ND1  . HIS A 1 170 ? -30.432 14.289  12.377  0.016 27.21 ? 168 HIS A ND1  3  
ATOM   9657   C CD2  . HIS A 1 170 ? -28.829 15.135  13.594  0.016 28.47 ? 168 HIS A CD2  3  
ATOM   9658   C CE1  . HIS A 1 170 ? -30.631 13.881  13.618  0.016 28.39 ? 168 HIS A CE1  3  
ATOM   9659   N NE2  . HIS A 1 170 ? -29.664 14.369  14.372  0.016 29.17 ? 168 HIS A NE2  3  
ATOM   9660   H H    . HIS A 1 170 ? -30.862 17.509  11.563  0.016 27.63 ? 168 HIS A H    3  
ATOM   9661   H HA   . HIS A 1 170 ? -29.456 16.706  9.398   0.016 25.42 ? 168 HIS A HA   3  
ATOM   9662   H HB2  . HIS A 1 170 ? -28.424 14.999  10.522  0.016 25.51 ? 168 HIS A HB2  3  
ATOM   9663   H HB3  . HIS A 1 170 ? -28.081 16.330  11.303  0.016 26.60 ? 168 HIS A HB3  3  
ATOM   9664   H HD1  . HIS A 1 170 ? -30.940 14.081  11.719  0.016 26.64 ? 168 HIS A HD1  3  
ATOM   9665   H HD2  . HIS A 1 170 ? -28.072 15.595  13.883  0.016 28.89 ? 168 HIS A HD2  3  
ATOM   9666   H HE1  . HIS A 1 170 ? -31.324 13.332  13.906  0.016 28.71 ? 168 HIS A HE1  3  
ATOM   9667   H HE2  . HIS A 1 170 ? -29.584 14.246  15.219  0.016 30.08 ? 168 HIS A HE2  3  
ATOM   9668   N N    . TYR A 1 171 ? -30.819 14.619  9.047   0.016 24.59 ? 169 TYR A N    3  
ATOM   9669   C CA   . TYR A 1 171 ? -31.894 13.777  8.526   0.016 24.16 ? 169 TYR A CA   3  
ATOM   9670   C C    . TYR A 1 171 ? -31.277 12.422  8.252   0.016 23.54 ? 169 TYR A C    3  
ATOM   9671   O O    . TYR A 1 171 ? -30.466 12.297  7.344   0.016 22.83 ? 169 TYR A O    3  
ATOM   9672   C CB   . TYR A 1 171 ? -32.468 14.382  7.244   0.016 23.64 ? 169 TYR A CB   3  
ATOM   9673   C CG   . TYR A 1 171 ? -33.545 13.577  6.505   0.016 23.29 ? 169 TYR A CG   3  
ATOM   9674   C CD1  . TYR A 1 171 ? -34.725 13.223  7.107   0.016 23.91 ? 169 TYR A CD1  3  
ATOM   9675   C CD2  . TYR A 1 171 ? -33.377 13.258  5.172   0.016 22.53 ? 169 TYR A CD2  3  
ATOM   9676   C CE1  . TYR A 1 171 ? -35.695 12.528  6.399   0.016 23.76 ? 169 TYR A CE1  3  
ATOM   9677   C CE2  . TYR A 1 171 ? -34.334 12.563  4.466   0.016 22.40 ? 169 TYR A CE2  3  
ATOM   9678   C CZ   . TYR A 1 171 ? -35.477 12.198  5.083   0.016 23.00 ? 169 TYR A CZ   3  
ATOM   9679   O OH   . TYR A 1 171 ? -36.414 11.519  4.341   0.016 23.01 ? 169 TYR A OH   3  
ATOM   9680   H H    . TYR A 1 171 ? -30.049 14.455  8.704   0.016 24.22 ? 169 TYR A H    3  
ATOM   9681   H HA   . TYR A 1 171 ? -32.597 13.686  9.184   0.016 24.75 ? 169 TYR A HA   3  
ATOM   9682   H HB2  . TYR A 1 171 ? -32.847 15.246  7.467   0.016 24.11 ? 169 TYR A HB2  3  
ATOM   9683   H HB3  . TYR A 1 171 ? -31.741 14.498  6.618   0.016 23.18 ? 169 TYR A HB3  3  
ATOM   9684   H HD1  . TYR A 1 171 ? -34.868 13.440  8.000   0.016 24.54 ? 169 TYR A HD1  3  
ATOM   9685   H HD2  . TYR A 1 171 ? -32.588 13.499  4.745   0.016 22.21 ? 169 TYR A HD2  3  
ATOM   9686   H HE1  . TYR A 1 171 ? -36.485 12.277  6.816   0.016 24.28 ? 169 TYR A HE1  3  
ATOM   9687   H HE2  . TYR A 1 171 ? -34.192 12.346  3.574   0.016 22.01 ? 169 TYR A HE2  3  
ATOM   9688   H HH   . TYR A 1 171 ? -36.126 11.401  3.562   0.016 22.62 ? 169 TYR A HH   3  
ATOM   9689   N N    . ARG A 1 172 ? -31.681 11.411  9.021   0.016 23.91 ? 170 ARG A N    3  
ATOM   9690   C CA   . ARG A 1 172 ? -30.964 10.142  9.064   0.016 23.61 ? 170 ARG A CA   3  
ATOM   9691   C C    . ARG A 1 172 ? -31.610 9.074   8.185   0.016 22.97 ? 170 ARG A C    3  
ATOM   9692   O O    . ARG A 1 172 ? -32.788 9.148   7.832   0.016 23.03 ? 170 ARG A O    3  
ATOM   9693   C CB   . ARG A 1 172 ? -30.911 9.640   10.503  0.016 24.63 ? 170 ARG A CB   3  
ATOM   9694   C CG   . ARG A 1 172 ? -29.934 10.394  11.378  0.016 25.34 ? 170 ARG A CG   3  
ATOM   9695   C CD   . ARG A 1 172 ? -29.899 9.808   12.744  0.016 26.52 ? 170 ARG A CD   3  
ATOM   9696   N NE   . ARG A 1 172 ? -28.722 10.141  13.552  0.016 27.26 ? 170 ARG A NE   3  
ATOM   9697   C CZ   . ARG A 1 172 ? -27.482 9.668   13.343  0.016 27.22 ? 170 ARG A CZ   3  
ATOM   9698   N NH1  . ARG A 1 172 ? -27.208 8.859   12.319  0.016 26.44 ? 170 ARG A NH1  3  
ATOM   9699   N NH2  . ARG A 1 172 ? -26.492 10.001  14.185  0.016 28.16 ? 170 ARG A NH2  3  
ATOM   9700   H H    . ARG A 1 172 ? -32.377 11.436  9.520   0.016 24.40 ? 170 ARG A H    3  
ATOM   9701   H HA   . ARG A 1 172 ? -30.059 10.285  8.753   0.016 23.32 ? 170 ARG A HA   3  
ATOM   9702   H HB2  . ARG A 1 172 ? -31.793 9.742   10.893  0.016 25.12 ? 170 ARG A HB2  3  
ATOM   9703   H HB3  . ARG A 1 172 ? -30.651 8.705   10.500  0.016 24.48 ? 170 ARG A HB3  3  
ATOM   9704   H HG2  . ARG A 1 172 ? -29.045 10.331  10.999  0.016 24.95 ? 170 ARG A HG2  3  
ATOM   9705   H HG3  . ARG A 1 172 ? -30.210 11.319  11.453  0.016 25.57 ? 170 ARG A HG3  3  
ATOM   9706   H HD2  . ARG A 1 172 ? -30.684 10.113  13.221  0.016 27.11 ? 170 ARG A HD2  3  
ATOM   9707   H HD3  . ARG A 1 172 ? -29.926 8.840   12.666  0.016 26.37 ? 170 ARG A HD3  3  
ATOM   9708   H HE   . ARG A 1 172 ? -28.879 10.422  14.349  0.016 27.98 ? 170 ARG A HE   3  
ATOM   9709   H HH11 . ARG A 1 172 ? -27.832 8.621   11.777  0.016 25.94 ? 170 ARG A HH11 3  
ATOM   9710   H HH12 . ARG A 1 172 ? -26.405 8.571   12.201  0.016 26.47 ? 170 ARG A HH12 3  
ATOM   9711   H HH21 . ARG A 1 172 ? -26.654 10.530  14.846  0.016 28.74 ? 170 ARG A HH21 3  
ATOM   9712   H HH22 . ARG A 1 172 ? -25.689 9.720   14.050  0.016 28.23 ? 170 ARG A HH22 3  
ATOM   9713   N N    . CYS A 1 173 ? -30.802 8.099   7.806   0.016 22.49 ? 171 CYS A N    3  
ATOM   9714   C CA   . CYS A 1 173 ? -31.308 6.979   7.027   0.016 21.97 ? 171 CYS A CA   3  
ATOM   9715   C C    . CYS A 1 173 ? -30.335 5.816   7.146   0.016 22.02 ? 171 CYS A C    3  
ATOM   9716   O O    . CYS A 1 173 ? -29.123 5.996   7.010   0.016 21.95 ? 171 CYS A O    3  
ATOM   9717   C CB   . CYS A 1 173 ? -31.527 7.438   5.573   0.016 21.21 ? 171 CYS A CB   3  
ATOM   9718   S SG   . CYS A 1 173 ? -31.317 6.259   4.247   0.016 20.83 ? 171 CYS A SG   3  
ATOM   9719   H H    . CYS A 1 173 ? -29.962 8.066   7.982   0.016 22.52 ? 171 CYS A H    3  
ATOM   9720   H HA   . CYS A 1 173 ? -32.165 6.710   7.395   0.016 22.25 ? 171 CYS A HA   3  
ATOM   9721   H HB2  . CYS A 1 173 ? -32.413 7.784   5.487   0.016 21.27 ? 171 CYS A HB2  3  
ATOM   9722   H HB3  . CYS A 1 173 ? -30.897 8.153   5.396   0.016 20.99 ? 171 CYS A HB3  3  
ATOM   9723   H HG   . CYS A 1 173 ? -30.151 6.048   4.364   0.016 20.80 ? 171 CYS A HG   3  
ATOM   9724   N N    . ASP A 1 174 ? -30.881 4.616   7.379   0.016 22.24 ? 172 ASP A N    3  
ATOM   9725   C CA   . ASP A 1 174 ? -30.081 3.394   7.510   0.016 22.29 ? 172 ASP A CA   3  
ATOM   9726   C C    . ASP A 1 174 ? -29.823 2.806   6.126   0.016 21.54 ? 172 ASP A C    3  
ATOM   9727   O O    . ASP A 1 174 ? -30.774 2.542   5.387   0.016 21.43 ? 172 ASP A O    3  
ATOM   9728   C CB   . ASP A 1 174 ? -30.819 2.349   8.355   0.016 23.11 ? 172 ASP A CB   3  
ATOM   9729   C CG   . ASP A 1 174 ? -30.929 2.723   9.804   0.016 23.99 ? 172 ASP A CG   3  
ATOM   9730   O OD1  . ASP A 1 174 ? -31.875 2.247   10.441  0.016 24.13 ? 172 ASP A OD1  3  
ATOM   9731   O OD2  . ASP A 1 174 ? -30.100 3.481   10.335  0.016 24.68 ? 172 ASP A OD2  3  
ATOM   9732   H H    . ASP A 1 174 ? -31.723 4.488   7.462   0.016 22.44 ? 172 ASP A H    3  
ATOM   9733   H HA   . ASP A 1 174 ? -29.232 3.597   7.927   0.016 22.41 ? 172 ASP A HA   3  
ATOM   9734   H HB2  . ASP A 1 174 ? -31.716 2.256   8.001   0.016 22.97 ? 172 ASP A HB2  3  
ATOM   9735   H HB3  . ASP A 1 174 ? -30.347 1.501   8.305   0.016 23.35 ? 172 ASP A HB3  3  
ATOM   9736   N N    . PHE A 1 175 ? -28.554 2.534   5.800   0.016 21.20 ? 173 PHE A N    3  
ATOM   9737   C CA   . PHE A 1 175 ? -28.181 1.916   4.532   0.016 20.71 ? 173 PHE A CA   3  
ATOM   9738   C C    . PHE A 1 175 ? -27.771 0.458   4.753   0.016 21.06 ? 173 PHE A C    3  
ATOM   9739   O O    . PHE A 1 175 ? -27.018 0.160   5.684   0.016 21.52 ? 173 PHE A O    3  
ATOM   9740   C CB   . PHE A 1 175 ? -26.993 2.642   3.895   0.016 20.34 ? 173 PHE A CB   3  
ATOM   9741   C CG   . PHE A 1 175 ? -27.344 3.800   2.974   0.016 19.98 ? 173 PHE A CG   3  
ATOM   9742   C CD1  . PHE A 1 175 ? -28.054 4.891   3.400   0.016 20.01 ? 173 PHE A CD1  3  
ATOM   9743   C CD2  . PHE A 1 175 ? -26.896 3.796   1.670   0.016 19.74 ? 173 PHE A CD2  3  
ATOM   9744   C CE1  . PHE A 1 175 ? -28.332 5.967   2.518   0.016 19.78 ? 173 PHE A CE1  3  
ATOM   9745   C CE2  . PHE A 1 175 ? -27.156 4.854   0.794   0.016 19.56 ? 173 PHE A CE2  3  
ATOM   9746   C CZ   . PHE A 1 175 ? -27.886 5.923   1.215   0.016 19.57 ? 173 PHE A CZ   3  
ATOM   9747   H H    . PHE A 1 175 ? -27.884 2.696   6.308   0.016 21.34 ? 173 PHE A H    3  
ATOM   9748   H HA   . PHE A 1 175 ? -28.933 1.931   3.919   0.016 20.55 ? 173 PHE A HA   3  
ATOM   9749   H HB2  . PHE A 1 175 ? -26.443 2.998   4.608   0.016 20.59 ? 173 PHE A HB2  3  
ATOM   9750   H HB3  . PHE A 1 175 ? -26.475 2.001   3.383   0.016 20.19 ? 173 PHE A HB3  3  
ATOM   9751   H HD1  . PHE A 1 175 ? -28.362 4.922   4.278   0.016 20.27 ? 173 PHE A HD1  3  
ATOM   9752   H HD2  . PHE A 1 175 ? -26.400 3.070   1.377   0.016 19.79 ? 173 PHE A HD2  3  
ATOM   9753   H HE1  . PHE A 1 175 ? -28.823 6.694   2.816   0.016 19.86 ? 173 PHE A HE1  3  
ATOM   9754   H HE2  . PHE A 1 175 ? -26.853 4.815   -0.083  0.016 19.52 ? 173 PHE A HE2  3  
ATOM   9755   H HZ   . PHE A 1 175 ? -28.063 6.624   0.634   0.016 19.51 ? 173 PHE A HZ   3  
ATOM   9756   N N    . LYS A 1 176 ? -28.241 -0.426  3.879   0.016 20.97 ? 174 LYS A N    3  
ATOM   9757   C CA   . LYS A 1 176 ? -27.824 -1.825  3.880   0.016 21.28 ? 174 LYS A CA   3  
ATOM   9758   C C    . LYS A 1 176 ? -27.581 -2.282  2.458   0.016 20.93 ? 174 LYS A C    3  
ATOM   9759   O O    . LYS A 1 176 ? -28.430 -2.082  1.594   0.016 20.88 ? 174 LYS A O    3  
ATOM   9760   C CB   . LYS A 1 176 ? -28.875 -2.725  4.500   0.016 21.99 ? 174 LYS A CB   3  
ATOM   9761   C CG   . LYS A 1 176 ? -28.825 -2.687  5.973   0.016 22.58 ? 174 LYS A CG   3  
ATOM   9762   C CD   . LYS A 1 176 ? -30.141 -3.069  6.553   0.016 23.31 ? 174 LYS A CD   3  
ATOM   9763   C CE   . LYS A 1 176 ? -30.281 -2.574  7.968   0.016 24.31 ? 174 LYS A CE   3  
ATOM   9764   N NZ   . LYS A 1 176 ? -29.250 -1.649  8.527   0.016 24.52 ? 174 LYS A NZ   3  
ATOM   9765   H H    . LYS A 1 176 ? -28.819 -0.249  3.274   0.016 20.80 ? 174 LYS A H    3  
ATOM   9766   H HA   . LYS A 1 176 ? -27.009 -1.909  4.393   0.016 21.38 ? 174 LYS A HA   3  
ATOM   9767   H HB2  . LYS A 1 176 ? -29.749 -2.437  4.199   0.016 21.95 ? 174 LYS A HB2  3  
ATOM   9768   H HB3  . LYS A 1 176 ? -28.714 -3.640  4.222   0.016 22.27 ? 174 LYS A HB3  3  
ATOM   9769   H HG2  . LYS A 1 176 ? -28.157 -3.312  6.288   0.016 22.32 ? 174 LYS A HG2  3  
ATOM   9770   H HG3  . LYS A 1 176 ? -28.594 -1.787  6.240   0.016 22.92 ? 174 LYS A HG3  3  
ATOM   9771   H HD2  . LYS A 1 176 ? -30.857 -2.698  6.021   0.016 23.46 ? 174 LYS A HD2  3  
ATOM   9772   H HD3  . LYS A 1 176 ? -30.205 -4.037  6.570   0.016 23.14 ? 174 LYS A HD3  3  
ATOM   9773   H HE2  . LYS A 1 176 ? -31.131 -2.119  8.039   0.016 24.49 ? 174 LYS A HE2  3  
ATOM   9774   H HE3  . LYS A 1 176 ? -30.288 -3.352  8.547   0.016 24.87 ? 174 LYS A HE3  3  
ATOM   9775   H HZ1  . LYS A 1 176 ? -29.515 -1.351  9.322   0.016 25.23 ? 174 LYS A HZ1  3  
ATOM   9776   H HZ2  . LYS A 1 176 ? -28.472 -2.080  8.622   0.016 24.08 ? 174 LYS A HZ2  3  
ATOM   9777   H HZ3  . LYS A 1 176 ? -29.142 -0.952  7.985   0.016 24.46 ? 174 LYS A HZ3  3  
ATOM   9778   N N    . THR A 1 177 ? -26.464 -2.961  2.225   0.016 20.87 ? 175 THR A N    3  
ATOM   9779   C CA   . THR A 1 177 ? -26.147 -3.400  0.877   0.016 20.70 ? 175 THR A CA   3  
ATOM   9780   C C    . THR A 1 177 ? -25.749 -4.865  0.864   0.016 21.14 ? 175 THR A C    3  
ATOM   9781   O O    . THR A 1 177 ? -25.173 -5.344  1.841   0.016 21.39 ? 175 THR A O    3  
ATOM   9782   C CB   . THR A 1 177 ? -25.013 -2.557  0.313   0.016 20.32 ? 175 THR A CB   3  
ATOM   9783   O OG1  . THR A 1 177 ? -25.371 -1.160  0.387   0.016 20.00 ? 175 THR A OG1  3  
ATOM   9784   C CG2  . THR A 1 177 ? -24.773 -2.949  -1.132  0.016 20.35 ? 175 THR A CG2  3  
ATOM   9785   H H    . THR A 1 177 ? -25.885 -3.171  2.824   0.016 21.02 ? 175 THR A H    3  
ATOM   9786   H HA   . THR A 1 177 ? -26.926 -3.293  0.313   0.016 20.71 ? 175 THR A HA   3  
ATOM   9787   H HB   . THR A 1 177 ? -24.206 -2.718  0.828   0.016 20.40 ? 175 THR A HB   3  
ATOM   9788   H HG1  . THR A 1 177 ? -26.190 -1.074  0.239   0.016 20.04 ? 175 THR A HG1  3  
ATOM   9789   H HG21 . THR A 1 177 ? -24.576 -2.161  -1.655  0.016 20.17 ? 175 THR A HG21 3  
ATOM   9790   H HG22 . THR A 1 177 ? -24.026 -3.564  -1.198  0.016 20.56 ? 175 THR A HG22 3  
ATOM   9791   H HG23 . THR A 1 177 ? -25.562 -3.378  -1.495  0.016 20.47 ? 175 THR A HG23 3  
ATOM   9792   N N    . THR A 1 178 ? -26.070 -5.579  -0.229  0.016 21.37 ? 176 THR A N    3  
ATOM   9793   C CA   . THR A 1 178 ? -25.371 -6.823  -0.558  0.016 21.85 ? 176 THR A CA   3  
ATOM   9794   C C    . THR A 1 178 ? -24.725 -6.717  -1.934  0.016 21.84 ? 176 THR A C    3  
ATOM   9795   O O    . THR A 1 178 ? -25.364 -6.340  -2.919  0.016 21.75 ? 176 THR A O    3  
ATOM   9796   C CB   . THR A 1 178 ? -26.261 -8.096  -0.461  0.016 22.50 ? 176 THR A CB   3  
ATOM   9797   O OG1  . THR A 1 178 ? -26.323 -8.853  -1.700  0.016 23.07 ? 176 THR A OG1  3  
ATOM   9798   C CG2  . THR A 1 178 ? -27.600 -7.839  0.120   0.016 22.74 ? 176 THR A CG2  3  
ATOM   9799   H H    . THR A 1 178 ? -26.687 -5.377  -0.786  0.016 21.34 ? 176 THR A H    3  
ATOM   9800   H HA   . THR A 1 178 ? -24.659 -6.946  0.087   0.016 21.90 ? 176 THR A HA   3  
ATOM   9801   H HB   . THR A 1 178 ? -25.820 -8.694  0.163   0.016 22.55 ? 176 THR A HB   3  
ATOM   9802   H HG1  . THR A 1 178 ? -26.546 -8.363  -2.343  0.016 23.07 ? 176 THR A HG1  3  
ATOM   9803   H HG21 . THR A 1 178 ? -28.221 -8.502  -0.232  0.016 23.19 ? 176 THR A HG21 3  
ATOM   9804   H HG22 . THR A 1 178 ? -27.555 -7.927  1.082   0.016 22.37 ? 176 THR A HG22 3  
ATOM   9805   H HG23 . THR A 1 178 ? -27.943 -6.960  -0.108  0.016 22.94 ? 176 THR A HG23 3  
ATOM   9806   N N    . TYR A 1 179 ? -23.446 -7.086  -1.967  0.016 22.04 ? 177 TYR A N    3  
ATOM   9807   C CA   . TYR A 1 179 ? -22.613 -7.098  -3.155  0.016 22.16 ? 177 TYR A CA   3  
ATOM   9808   C C    . TYR A 1 179 ? -22.316 -8.546  -3.507  0.016 22.88 ? 177 TYR A C    3  
ATOM   9809   O O    . TYR A 1 179 ? -21.695 -9.262  -2.715  0.016 23.24 ? 177 TYR A O    3  
ATOM   9810   C CB   . TYR A 1 179 ? -21.293 -6.351  -2.901  0.016 22.09 ? 177 TYR A CB   3  
ATOM   9811   C CG   . TYR A 1 179 ? -21.404 -4.990  -2.207  0.016 21.54 ? 177 TYR A CG   3  
ATOM   9812   C CD1  . TYR A 1 179 ? -21.440 -3.819  -2.936  0.016 21.33 ? 177 TYR A CD1  3  
ATOM   9813   C CD2  . TYR A 1 179 ? -21.378 -4.897  -0.826  0.016 21.36 ? 177 TYR A CD2  3  
ATOM   9814   C CE1  . TYR A 1 179 ? -21.537 -2.585  -2.321  0.016 20.92 ? 177 TYR A CE1  3  
ATOM   9815   C CE2  . TYR A 1 179 ? -21.461 -3.658  -0.191  0.016 20.96 ? 177 TYR A CE2  3  
ATOM   9816   C CZ   . TYR A 1 179 ? -21.533 -2.503  -0.951  0.016 20.72 ? 177 TYR A CZ   3  
ATOM   9817   O OH   . TYR A 1 179 ? -21.632 -1.275  -0.328  0.016 20.41 ? 177 TYR A OH   3  
ATOM   9818   H H    . TYR A 1 179 ? -23.022 -7.354  -1.270  0.016 22.18 ? 177 TYR A H    3  
ATOM   9819   H HA   . TYR A 1 179 ? -23.079 -6.676  -3.890  0.016 21.96 ? 177 TYR A HA   3  
ATOM   9820   H HB2  . TYR A 1 179 ? -20.748 -6.910  -2.328  0.016 22.28 ? 177 TYR A HB2  3  
ATOM   9821   H HB3  . TYR A 1 179 ? -20.851 -6.214  -3.754  0.016 22.33 ? 177 TYR A HB3  3  
ATOM   9822   H HD1  . TYR A 1 179 ? -21.452 -3.863  -3.863  0.016 21.57 ? 177 TYR A HD1  3  
ATOM   9823   H HD2  . TYR A 1 179 ? -21.338 -5.673  -0.317  0.016 21.60 ? 177 TYR A HD2  3  
ATOM   9824   H HE1  . TYR A 1 179 ? -21.583 -1.813  -2.834  0.016 20.86 ? 177 TYR A HE1  3  
ATOM   9825   H HE2  . TYR A 1 179 ? -21.466 -3.611  0.737   0.016 20.95 ? 177 TYR A HE2  3  
ATOM   9826   H HH   . TYR A 1 179 ? -21.470 -0.655  -0.871  0.016 20.28 ? 177 TYR A HH   3  
ATOM   9827   N N    . LYS A 1 180 ? -22.791 -8.995  -4.670  0.016 23.23 ? 178 LYS A N    3  
ATOM   9828   C CA   . LYS A 1 180 ? -22.541 -10.370 -5.117  0.016 24.09 ? 178 LYS A CA   3  
ATOM   9829   C C    . LYS A 1 180 ? -21.563 -10.319 -6.284  0.016 24.55 ? 178 LYS A C    3  
ATOM   9830   O O    . LYS A 1 180 ? -21.888 -9.788  -7.347  0.016 24.80 ? 178 LYS A O    3  
ATOM   9831   C CB   . LYS A 1 180 ? -23.802 -11.112 -5.531  0.016 24.59 ? 178 LYS A CB   3  
ATOM   9832   C CG   . LYS A 1 180 ? -23.524 -12.673 -5.677  0.016 25.70 ? 178 LYS A CG   3  
ATOM   9833   C CD   . LYS A 1 180 ? -24.289 -13.413 -6.828  0.016 26.45 ? 178 LYS A CD   3  
ATOM   9834   C CE   . LYS A 1 180 ? -23.571 -13.374 -8.167  0.016 27.13 ? 178 LYS A CE   3  
ATOM   9835   N NZ   . LYS A 1 180 ? -22.623 -12.185 -8.286  0.016 26.52 ? 178 LYS A NZ   3  
ATOM   9836   H H    . LYS A 1 180 ? -23.267 -8.533  -5.215  0.016 23.08 ? 178 LYS A H    3  
ATOM   9837   H HA   . LYS A 1 180 ? -22.134 -10.877 -4.397  0.016 24.23 ? 178 LYS A HA   3  
ATOM   9838   H HB2  . LYS A 1 180 ? -24.482 -10.988 -4.850  0.016 24.44 ? 178 LYS A HB2  3  
ATOM   9839   H HB3  . LYS A 1 180 ? -24.103 -10.766 -6.384  0.016 24.52 ? 178 LYS A HB3  3  
ATOM   9840   H HG2  . LYS A 1 180 ? -22.574 -12.808 -5.814  0.016 25.88 ? 178 LYS A HG2  3  
ATOM   9841   H HG3  . LYS A 1 180 ? -23.784 -13.107 -4.847  0.016 25.89 ? 178 LYS A HG3  3  
ATOM   9842   H HD2  . LYS A 1 180 ? -24.413 -14.341 -6.579  0.016 27.04 ? 178 LYS A HD2  3  
ATOM   9843   H HD3  . LYS A 1 180 ? -25.155 -12.982 -6.946  0.016 26.09 ? 178 LYS A HD3  3  
ATOM   9844   H HE2  . LYS A 1 180 ? -23.046 -14.186 -8.264  0.016 27.59 ? 178 LYS A HE2  3  
ATOM   9845   H HE3  . LYS A 1 180 ? -24.222 -13.319 -8.887  0.016 27.71 ? 178 LYS A HE3  3  
ATOM   9846   H HZ1  . LYS A 1 180 ? -22.143 -12.257 -9.028  0.016 27.03 ? 178 LYS A HZ1  3  
ATOM   9847   H HZ2  . LYS A 1 180 ? -23.078 -11.422 -8.318  0.016 26.35 ? 178 LYS A HZ2  3  
ATOM   9848   H HZ3  . LYS A 1 180 ? -22.075 -12.173 -7.594  0.016 25.92 ? 178 LYS A HZ3  3  
ATOM   9849   N N    . ALA A 1 181 ? -20.381 -10.900 -6.090  0.016 24.81 ? 179 ALA A N    3  
ATOM   9850   C CA   . ALA A 1 181 ? -19.382 -11.032 -7.146  0.016 25.57 ? 179 ALA A CA   3  
ATOM   9851   C C    . ALA A 1 181 ? -19.781 -12.120 -8.150  0.016 26.53 ? 179 ALA A C    3  
ATOM   9852   O O    . ALA A 1 181 ? -20.412 -13.120 -7.802  0.016 26.76 ? 179 ALA A O    3  
ATOM   9853   C CB   . ALA A 1 181 ? -18.026 -11.348 -6.520  0.016 25.87 ? 179 ALA A CB   3  
ATOM   9854   H H    . ALA A 1 181 ? -20.133 -11.233 -5.341  0.016 24.63 ? 179 ALA A H    3  
ATOM   9855   H HA   . ALA A 1 181 ? -19.306 -10.194 -7.627  0.016 25.44 ? 179 ALA A HA   3  
ATOM   9856   H HB1  . ALA A 1 181 ? -17.322 -11.053 -7.119  0.016 26.29 ? 179 ALA A HB1  3  
ATOM   9857   H HB2  . ALA A 1 181 ? -17.956 -10.888 -5.671  0.016 25.34 ? 179 ALA A HB2  3  
ATOM   9858   H HB3  . ALA A 1 181 ? -17.962 -12.303 -6.377  0.016 26.25 ? 179 ALA A HB3  3  
ATOM   9859   N N    . LYS A 1 182 ? -19.415 -11.926 -9.415  0.016 27.28 ? 180 LYS A N    3  
ATOM   9860   C CA   . LYS A 1 182 ? -19.932 -12.817 -10.455 0.016 28.40 ? 180 LYS A CA   3  
ATOM   9861   C C    . LYS A 1 182 ? -19.134 -14.134 -10.519 0.016 29.29 ? 180 LYS A C    3  
ATOM   9862   O O    . LYS A 1 182 ? -19.440 -15.022 -11.331 0.016 30.12 ? 180 LYS A O    3  
ATOM   9863   C CB   . LYS A 1 182 ? -19.944 -12.091 -11.801 0.016 29.16 ? 180 LYS A CB   3  
ATOM   9864   C CG   . LYS A 1 182 ? -21.040 -12.587 -12.741 0.016 30.77 ? 180 LYS A CG   3  
ATOM   9865   C CD   . LYS A 1 182 ? -20.991 -11.871 -14.057 0.016 32.16 ? 180 LYS A CD   3  
ATOM   9866   C CE   . LYS A 1 182 ? -21.887 -10.651 -14.034 0.016 32.00 ? 180 LYS A CE   3  
ATOM   9867   N NZ   . LYS A 1 182 ? -21.335 -9.690  -13.060 0.016 30.83 ? 180 LYS A NZ   3  
ATOM   9868   H H    . LYS A 1 182 ? -18.875 -11.321 -9.688  0.016 27.27 ? 180 LYS A H    3  
ATOM   9869   H HA   . LYS A 1 182 ? -20.849 -13.040 -10.244 0.016 28.24 ? 180 LYS A HA   3  
ATOM   9870   H HB2  . LYS A 1 182 ? -20.072 -11.147 -11.641 0.016 29.10 ? 180 LYS A HB2  3  
ATOM   9871   H HB3  . LYS A 1 182 ? -19.091 -12.230 -12.237 0.016 28.85 ? 180 LYS A HB3  3  
ATOM   9872   H HG2  . LYS A 1 182 ? -20.899 -13.530 -12.914 0.016 30.87 ? 180 LYS A HG2  3  
ATOM   9873   H HG3  . LYS A 1 182 ? -21.912 -12.451 -12.340 0.016 31.04 ? 180 LYS A HG3  3  
ATOM   9874   H HD2  . LYS A 1 182 ? -20.085 -11.566 -14.218 0.016 32.67 ? 180 LYS A HD2  3  
ATOM   9875   H HD3  . LYS A 1 182 ? -21.281 -12.465 -14.765 0.016 32.95 ? 180 LYS A HD3  3  
ATOM   9876   H HE2  . LYS A 1 182 ? -21.904 -10.242 -14.914 0.016 33.07 ? 180 LYS A HE2  3  
ATOM   9877   H HE3  . LYS A 1 182 ? -22.781 -10.903 -13.755 0.016 31.78 ? 180 LYS A HE3  3  
ATOM   9878   H HZ1  . LYS A 1 182 ? -21.564 -9.935  -12.237 0.016 30.25 ? 180 LYS A HZ1  3  
ATOM   9879   H HZ2  . LYS A 1 182 ? -20.446 -9.676  -13.121 0.016 31.36 ? 180 LYS A HZ2  3  
ATOM   9880   H HZ3  . LYS A 1 182 ? -21.659 -8.870  -13.216 0.016 30.28 ? 180 LYS A HZ3  3  
ATOM   9881   N N    . LYS A 1 183 ? -18.140 -14.274 -9.653  0.016 29.27 ? 181 LYS A N    3  
ATOM   9882   C CA   . LYS A 1 183 ? -17.314 -15.474 -9.511  0.016 30.09 ? 181 LYS A CA   3  
ATOM   9883   C C    . LYS A 1 183 ? -16.764 -15.467 -8.082  0.016 29.33 ? 181 LYS A C    3  
ATOM   9884   O O    . LYS A 1 183 ? -16.789 -14.439 -7.402  0.016 28.27 ? 181 LYS A O    3  
ATOM   9885   C CB   . LYS A 1 183 ? -16.178 -15.512 -10.556 0.016 31.14 ? 181 LYS A CB   3  
ATOM   9886   C CG   . LYS A 1 183 ? -15.406 -16.857 -10.641 0.016 32.35 ? 181 LYS A CG   3  
ATOM   9887   C CD   . LYS A 1 183 ? -14.190 -16.807 -11.625 0.016 33.54 ? 181 LYS A CD   3  
ATOM   9888   C CE   . LYS A 1 183 ? -13.591 -15.349 -11.755 0.016 33.10 ? 181 LYS A CE   3  
ATOM   9889   N NZ   . LYS A 1 183 ? -13.149 -14.729 -10.446 0.016 31.98 ? 181 LYS A NZ   3  
ATOM   9890   H H    . LYS A 1 183 ? -17.909 -13.656 -9.102  0.016 28.83 ? 181 LYS A H    3  
ATOM   9891   H HA   . LYS A 1 183 ? -17.861 -16.268 -9.630  0.016 30.63 ? 181 LYS A HA   3  
ATOM   9892   H HB2  . LYS A 1 183 ? -16.547 -15.351 -11.439 0.016 31.65 ? 181 LYS A HB2  3  
ATOM   9893   H HB3  . LYS A 1 183 ? -15.564 -14.802 -10.326 0.016 30.70 ? 181 LYS A HB3  3  
ATOM   9894   H HG2  . LYS A 1 183 ? -15.072 -17.086 -9.761  0.016 31.95 ? 181 LYS A HG2  3  
ATOM   9895   H HG3  . LYS A 1 183 ? -16.019 -17.541 -10.958 0.016 32.92 ? 181 LYS A HG3  3  
ATOM   9896   H HD2  . LYS A 1 183 ? -13.489 -17.402 -11.307 0.016 33.80 ? 181 LYS A HD2  3  
ATOM   9897   H HD3  . LYS A 1 183 ? -14.481 -17.098 -12.505 0.016 34.46 ? 181 LYS A HD3  3  
ATOM   9898   H HE2  . LYS A 1 183 ? -12.809 -15.387 -12.333 0.016 34.03 ? 181 LYS A HE2  3  
ATOM   9899   H HE3  . LYS A 1 183 ? -14.257 -14.760 -12.149 0.016 32.78 ? 181 LYS A HE3  3  
ATOM   9900   H HZ1  . LYS A 1 183 ? -13.155 -15.341 -9.800  0.016 31.53 ? 181 LYS A HZ1  3  
ATOM   9901   H HZ2  . LYS A 1 183 ? -12.325 -14.401 -10.526 0.016 32.45 ? 181 LYS A HZ2  3  
ATOM   9902   H HZ3  . LYS A 1 183 ? -13.705 -14.072 -10.224 0.016 31.39 ? 181 LYS A HZ3  3  
ATOM   9903   N N    . ASP A 1 184 ? -16.269 -16.613 -7.613  0.016 30.00 ? 182 ASP A N    3  
ATOM   9904   C CA   . ASP A 1 184 ? -15.729 -16.687 -6.257  0.016 29.55 ? 182 ASP A CA   3  
ATOM   9905   C C    . ASP A 1 184 ? -14.381 -15.976 -6.190  0.016 29.50 ? 182 ASP A C    3  
ATOM   9906   O O    . ASP A 1 184 ? -13.524 -16.170 -7.057  0.016 30.35 ? 182 ASP A O    3  
ATOM   9907   C CB   . ASP A 1 184 ? -15.563 -18.137 -5.793  0.016 30.45 ? 182 ASP A CB   3  
ATOM   9908   C CG   . ASP A 1 184 ? -16.838 -18.953 -5.903  0.016 30.66 ? 182 ASP A CG   3  
ATOM   9909   O OD1  . ASP A 1 184 ? -17.165 -19.388 -7.030  0.016 31.69 ? 182 ASP A OD1  3  
ATOM   9910   O OD2  . ASP A 1 184 ? -17.469 -19.224 -4.858  0.016 29.95 ? 182 ASP A OD2  3  
ATOM   9911   H H    . ASP A 1 184 ? -16.235 -17.349 -8.053  0.016 30.78 ? 182 ASP A H    3  
ATOM   9912   H HA   . ASP A 1 184 ? -16.340 -16.253 -5.645  0.016 28.84 ? 182 ASP A HA   3  
ATOM   9913   H HB2  . ASP A 1 184 ? -14.881 -18.559 -6.334  0.016 31.23 ? 182 ASP A HB2  3  
ATOM   9914   H HB3  . ASP A 1 184 ? -15.296 -18.140 -4.861  0.016 30.26 ? 182 ASP A HB3  3  
ATOM   9915   N N    . VAL A 1 185 ? -14.216 -15.137 -5.167  0.016 28.65 ? 183 VAL A N    3  
ATOM   9916   C CA   . VAL A 1 185 ? -12.996 -14.391 -4.896  0.016 28.64 ? 183 VAL A CA   3  
ATOM   9917   C C    . VAL A 1 185 ? -12.637 -14.650 -3.435  0.016 28.51 ? 183 VAL A C    3  
ATOM   9918   O O    . VAL A 1 185 ? -13.377 -15.307 -2.707  0.016 28.29 ? 183 VAL A O    3  
ATOM   9919   C CB   . VAL A 1 185 ? -13.161 -12.880 -5.178  0.016 27.87 ? 183 VAL A CB   3  
ATOM   9920   C CG1  . VAL A 1 185 ? -13.517 -12.664 -6.626  0.016 28.23 ? 183 VAL A CG1  3  
ATOM   9921   C CG2  . VAL A 1 185 ? -14.232 -12.281 -4.251  0.016 26.79 ? 183 VAL A CG2  3  
ATOM   9922   H H    . VAL A 1 185 ? -14.824 -14.988 -4.581  0.016 28.17 ? 183 VAL A H    3  
ATOM   9923   H HA   . VAL A 1 185 ? -12.277 -14.726 -5.454  0.016 29.38 ? 183 VAL A HA   3  
ATOM   9924   H HB   . VAL A 1 185 ? -12.323 -12.425 -5.029  0.016 27.99 ? 183 VAL A HB   3  
ATOM   9925   H HG11 . VAL A 1 185 ? -13.282 -11.754 -6.871  0.016 27.95 ? 183 VAL A HG11 3  
ATOM   9926   H HG12 . VAL A 1 185 ? -13.023 -13.296 -7.171  0.016 29.05 ? 183 VAL A HG12 3  
ATOM   9927   H HG13 . VAL A 1 185 ? -14.471 -12.805 -6.743  0.016 28.03 ? 183 VAL A HG13 3  
ATOM   9928   H HG21 . VAL A 1 185 ? -14.230 -11.317 -4.366  0.016 26.37 ? 183 VAL A HG21 3  
ATOM   9929   H HG22 . VAL A 1 185 ? -15.097 -12.640 -4.509  0.016 26.76 ? 183 VAL A HG22 3  
ATOM   9930   H HG23 . VAL A 1 185 ? -14.055 -12.499 -3.323  0.016 26.68 ? 183 VAL A HG23 3  
ATOM   9931   N N    . ARG A 1 186 ? -11.476 -14.165 -3.010  0.016 28.86 ? 184 ARG A N    3  
ATOM   9932   C CA   . ARG A 1 186 ? -11.110 -14.247 -1.598  0.016 28.94 ? 184 ARG A CA   3  
ATOM   9933   C C    . ARG A 1 186 ? -12.002 -13.315 -0.779  0.016 27.91 ? 184 ARG A C    3  
ATOM   9934   O O    . ARG A 1 186 ? -12.089 -12.130 -1.093  0.016 27.29 ? 184 ARG A O    3  
ATOM   9935   C CB   . ARG A 1 186 ? -9.652  -13.854 -1.418  0.016 29.65 ? 184 ARG A CB   3  
ATOM   9936   C CG   . ARG A 1 186 ? -9.206  -13.697 0.020   0.016 29.87 ? 184 ARG A CG   3  
ATOM   9937   C CD   . ARG A 1 186 ? -9.352  -14.987 0.806   0.016 30.54 ? 184 ARG A CD   3  
ATOM   9938   N NE   . ARG A 1 186 ? -8.332  -15.952 0.417   0.016 31.76 ? 184 ARG A NE   3  
ATOM   9939   C CZ   . ARG A 1 186 ? -8.448  -17.269 0.559   0.016 32.51 ? 184 ARG A CZ   3  
ATOM   9940   N NH1  . ARG A 1 186 ? -9.552  -17.804 1.051   0.016 32.19 ? 184 ARG A NH1  3  
ATOM   9941   N NH2  . ARG A 1 186 ? -7.441  -18.050 0.192   0.016 33.70 ? 184 ARG A NH2  3  
ATOM   9942   H H    . ARG A 1 186 ? -10.891 -13.785 -3.509  0.016 29.14 ? 184 ARG A H    3  
ATOM   9943   H HA   . ARG A 1 186 ? -11.222 -15.154 -1.282  0.016 29.36 ? 184 ARG A HA   3  
ATOM   9944   H HB2  . ARG A 1 186 ? -9.093  -14.536 -1.823  0.016 30.42 ? 184 ARG A HB2  3  
ATOM   9945   H HB3  . ARG A 1 186 ? -9.505  -13.005 -1.865  0.016 29.38 ? 184 ARG A HB3  3  
ATOM   9946   H HG2  . ARG A 1 186 ? -8.272  -13.438 0.039   0.016 30.40 ? 184 ARG A HG2  3  
ATOM   9947   H HG3  . ARG A 1 186 ? -9.748  -13.018 0.451   0.016 29.19 ? 184 ARG A HG3  3  
ATOM   9948   H HD2  . ARG A 1 186 ? -9.233  -14.801 1.748   0.016 30.64 ? 184 ARG A HD2  3  
ATOM   9949   H HD3  . ARG A 1 186 ? -10.229 -15.367 0.649   0.016 30.18 ? 184 ARG A HD3  3  
ATOM   9950   H HE   . ARG A 1 186 ? -7.695  -15.668 -0.080  0.016 32.01 ? 184 ARG A HE   3  
ATOM   9951   H HH11 . ARG A 1 186 ? -10.207 -17.308 1.296   0.016 31.50 ? 184 ARG A HH11 3  
ATOM   9952   H HH12 . ARG A 1 186 ? -9.609  -18.656 1.131   0.016 32.75 ? 184 ARG A HH12 3  
ATOM   9953   H HH21 . ARG A 1 186 ? -6.728  -17.701 -0.132  0.016 34.00 ? 184 ARG A HH21 3  
ATOM   9954   H HH22 . ARG A 1 186 ? -7.507  -18.902 0.268   0.016 34.23 ? 184 ARG A HH22 3  
ATOM   9955   N N    . LEU A 1 187 ? -12.622 -13.828 0.295   0.016 27.89 ? 185 LEU A N    3  
ATOM   9956   C CA   . LEU A 1 187 ? -13.586 -13.018 1.052   0.016 27.11 ? 185 LEU A CA   3  
ATOM   9957   C C    . LEU A 1 187 ? -12.902 -12.350 2.247   0.016 27.34 ? 185 LEU A C    3  
ATOM   9958   O O    . LEU A 1 187 ? -12.330 -13.050 3.092   0.016 28.26 ? 185 LEU A O    3  
ATOM   9959   C CB   . LEU A 1 187 ? -14.749 -13.863 1.555   0.016 27.24 ? 185 LEU A CB   3  
ATOM   9960   C CG   . LEU A 1 187 ? -15.641 -14.635 0.558   0.016 27.03 ? 185 LEU A CG   3  
ATOM   9961   C CD1  . LEU A 1 187 ? -14.917 -15.217 -0.630  0.016 27.29 ? 185 LEU A CD1  3  
ATOM   9962   C CD2  . LEU A 1 187 ? -16.337 -15.729 1.301   0.016 27.69 ? 185 LEU A CD2  3  
ATOM   9963   H H    . LEU A 1 187 ? -12.503 -14.620 0.603   0.016 28.39 ? 185 LEU A H    3  
ATOM   9964   H HA   . LEU A 1 187 ? -13.948 -12.336 0.464   0.016 26.50 ? 185 LEU A HA   3  
ATOM   9965   H HB2  . LEU A 1 187 ? -14.391 -14.524 2.165   0.016 27.95 ? 185 LEU A HB2  3  
ATOM   9966   H HB3  . LEU A 1 187 ? -15.335 -13.278 2.054   0.016 26.95 ? 185 LEU A HB3  3  
ATOM   9967   H HG   . LEU A 1 187 ? -16.317 -14.027 0.212   0.016 26.39 ? 185 LEU A HG   3  
ATOM   9968   H HD11 . LEU A 1 187 ? -15.544 -15.725 -1.171  0.016 27.47 ? 185 LEU A HD11 3  
ATOM   9969   H HD12 . LEU A 1 187 ? -14.580 -14.462 -1.139  0.016 26.81 ? 185 LEU A HD12 3  
ATOM   9970   H HD13 . LEU A 1 187 ? -14.187 -15.783 -0.334  0.016 27.87 ? 185 LEU A HD13 3  
ATOM   9971   H HD21 . LEU A 1 187 ? -16.920 -16.198 0.685   0.016 27.67 ? 185 LEU A HD21 3  
ATOM   9972   H HD22 . LEU A 1 187 ? -15.675 -16.337 1.663   0.016 28.37 ? 185 LEU A HD22 3  
ATOM   9973   H HD23 . LEU A 1 187 ? -16.852 -15.338 2.024   0.016 27.57 ? 185 LEU A HD23 3  
ATOM   9974   N N    . PRO A 1 188 ? -12.971 -11.022 2.385   0.016 26.68 ? 186 PRO A N    3  
ATOM   9975   C CA   . PRO A 1 188 ? -12.290 -10.359 3.502   0.016 27.09 ? 186 PRO A CA   3  
ATOM   9976   C C    . PRO A 1 188 ? -12.950 -10.685 4.832   0.016 27.42 ? 186 PRO A C    3  
ATOM   9977   O O    . PRO A 1 188 ? -14.085 -11.133 4.899   0.016 27.09 ? 186 PRO A O    3  
ATOM   9978   C CB   . PRO A 1 188 ? -12.454 -8.864  3.191   0.016 26.30 ? 186 PRO A CB   3  
ATOM   9979   C CG   . PRO A 1 188 ? -13.756 -8.823  2.495   0.016 25.39 ? 186 PRO A CG   3  
ATOM   9980   C CD   . PRO A 1 188 ? -13.845 -10.085 1.663   0.016 25.69 ? 186 PRO A CD   3  
ATOM   9981   H HA   . PRO A 1 188 ? -11.348 -10.588 3.528   0.016 27.73 ? 186 PRO A HA   3  
ATOM   9982   H HB2  . PRO A 1 188 ? -12.486 -8.365  4.021   0.016 26.37 ? 186 PRO A HB2  3  
ATOM   9983   H HB3  . PRO A 1 188 ? -11.735 -8.548  2.621   0.016 26.45 ? 186 PRO A HB3  3  
ATOM   9984   H HG2  . PRO A 1 188 ? -14.459 -8.803  3.156   0.016 25.22 ? 186 PRO A HG2  3  
ATOM   9985   H HG3  . PRO A 1 188 ? -13.806 -8.041  1.928   0.016 24.94 ? 186 PRO A HG3  3  
ATOM   9986   H HD2  . PRO A 1 188 ? -14.756 -10.421 1.649   0.016 25.41 ? 186 PRO A HD2  3  
ATOM   9987   H HD3  . PRO A 1 188 ? -13.506 -9.938  0.765   0.016 25.68 ? 186 PRO A HD3  3  
ATOM   9988   N N    . ASP A 1 189 ? -12.203 -10.454 5.897   0.016 28.27 ? 187 ASP A N    3  
ATOM   9989   C CA   . ASP A 1 189 ? -12.761 -10.433 7.228   0.016 28.69 ? 187 ASP A CA   3  
ATOM   9990   C C    . ASP A 1 189 ? -13.401 -9.078  7.470   0.016 27.81 ? 187 ASP A C    3  
ATOM   9991   O O    . ASP A 1 189 ? -13.184 -8.135  6.715   0.016 27.13 ? 187 ASP A O    3  
ATOM   9992   C CB   . ASP A 1 189 ? -11.681 -10.698 8.274   0.016 30.00 ? 187 ASP A CB   3  
ATOM   9993   C CG   . ASP A 1 189 ? -11.013 -12.054 8.090   0.016 31.07 ? 187 ASP A CG   3  
ATOM   9994   O OD1  . ASP A 1 189 ? -11.721 -13.027 7.742   0.016 31.13 ? 187 ASP A OD1  3  
ATOM   9995   O OD2  . ASP A 1 189 ? -9.780  -12.135 8.298   0.016 31.99 ? 187 ASP A OD2  3  
ATOM   9996   H H    . ASP A 1 189 ? -11.358 -10.303 5.870   0.016 28.72 ? 187 ASP A H    3  
ATOM   9997   H HA   . ASP A 1 189 ? -13.446 -11.110 7.298   0.016 28.84 ? 187 ASP A HA   3  
ATOM   9998   H HB2  . ASP A 1 189 ? -10.989 -10.026 8.204   0.016 29.93 ? 187 ASP A HB2  3  
ATOM   9999   H HB3  . ASP A 1 189 ? -12.082 -10.666 9.156   0.016 30.37 ? 187 ASP A HB3  3  
ATOM   10000  N N    . ALA A 1 190 ? -14.140 -8.974  8.571   0.016 28.03 ? 188 ALA A N    3  
ATOM   10001  C CA   . ALA A 1 190 ? -14.823 -7.719  8.876   0.016 27.38 ? 188 ALA A CA   3  
ATOM   10002  C C    . ALA A 1 190 ? -13.841 -6.562  8.791   0.016 27.57 ? 188 ALA A C    3  
ATOM   10003  O O    . ALA A 1 190 ? -12.712 -6.649  9.274   0.016 28.62 ? 188 ALA A O    3  
ATOM   10004  C CB   . ALA A 1 190 ? -15.444 -7.773  10.266  0.016 27.96 ? 188 ALA A CB   3  
ATOM   10005  H H    . ALA A 1 190 ? -14.258 -9.597  9.149   0.016 28.61 ? 188 ALA A H    3  
ATOM   10006  H HA   . ALA A 1 190 ? -15.523 -7.562  8.226   0.016 26.56 ? 188 ALA A HA   3  
ATOM   10007  H HB1  . ALA A 1 190 ? -16.238 -8.321  10.231  0.016 28.31 ? 188 ALA A HB1  3  
ATOM   10008  H HB2  . ALA A 1 190 ? -14.803 -8.154  10.882  0.016 28.69 ? 188 ALA A HB2  3  
ATOM   10009  H HB3  . ALA A 1 190 ? -15.680 -6.878  10.549  0.016 27.37 ? 188 ALA A HB3  3  
ATOM   10010  N N    . HIS A 1 191 ? -14.269 -5.479  8.161   0.016 26.68 ? 189 HIS A N    3  
ATOM   10011  C CA   . HIS A 1 191 ? -13.448 -4.275  8.153   0.016 26.83 ? 189 HIS A CA   3  
ATOM   10012  C C    . HIS A 1 191 ? -14.357 -3.070  8.031   0.016 25.88 ? 189 HIS A C    3  
ATOM   10013  O O    . HIS A 1 191 ? -15.552 -3.148  8.289   0.016 25.09 ? 189 HIS A O    3  
ATOM   10014  C CB   . HIS A 1 191 ? -12.397 -4.318  7.056   0.016 26.90 ? 189 HIS A CB   3  
ATOM   10015  C CG   . HIS A 1 191 ? -12.942 -4.414  5.680   0.016 25.85 ? 189 HIS A CG   3  
ATOM   10016  N ND1  . HIS A 1 191 ? -13.419 -5.592  5.154   0.016 25.55 ? 189 HIS A ND1  3  
ATOM   10017  C CD2  . HIS A 1 191 ? -13.046 -3.490  4.697   0.016 25.19 ? 189 HIS A CD2  3  
ATOM   10018  C CE1  . HIS A 1 191 ? -13.797 -5.386  3.907   0.016 24.80 ? 189 HIS A CE1  3  
ATOM   10019  N NE2  . HIS A 1 191 ? -13.586 -4.115  3.605   0.016 24.56 ? 189 HIS A NE2  3  
ATOM   10020  H H    . HIS A 1 191 ? -15.008 -5.415  7.730   0.016 26.05 ? 189 HIS A H    3  
ATOM   10021  H HA   . HIS A 1 191 ? -12.982 -4.209  8.998   0.016 27.63 ? 189 HIS A HA   3  
ATOM   10022  H HB2  . HIS A 1 191 ? -11.853 -3.514  7.101   0.016 27.22 ? 189 HIS A HB2  3  
ATOM   10023  H HB3  . HIS A 1 191 ? -11.841 -5.099  7.200   0.016 27.48 ? 189 HIS A HB3  3  
ATOM   10024  H HD1  . HIS A 1 191 ? -13.454 -6.339  5.573   0.016 25.90 ? 189 HIS A HD1  3  
ATOM   10025  H HD2  . HIS A 1 191 ? -12.791 -2.599  4.755   0.016 25.27 ? 189 HIS A HD2  3  
ATOM   10026  H HE1  . HIS A 1 191 ? -14.165 -6.025  3.341   0.016 24.57 ? 189 HIS A HE1  3  
ATOM   10027  H HE2  . HIS A 1 191 ? -13.760 -3.745  2.852   0.016 24.17 ? 189 HIS A HE2  3  
ATOM   10028  N N    . GLU A 1 192 ? -13.756 -1.925  7.758   0.016 26.08 ? 190 GLU A N    3  
ATOM   10029  C CA   . GLU A 1 192 ? -14.454 -0.656  7.848   0.016 25.37 ? 190 GLU A CA   3  
ATOM   10030  C C    . GLU A 1 192 ? -14.000 0.176   6.656   0.016 24.96 ? 190 GLU A C    3  
ATOM   10031  O O    . GLU A 1 192 ? -12.992 -0.126  6.022   0.016 25.49 ? 190 GLU A O    3  
ATOM   10032  C CB   . GLU A 1 192 ? -14.158 -0.008  9.226   0.016 26.18 ? 190 GLU A CB   3  
ATOM   10033  C CG   . GLU A 1 192 ? -13.296 -0.965  10.186  0.016 27.37 ? 190 GLU A CG   3  
ATOM   10034  C CD   . GLU A 1 192 ? -13.984 -2.290  10.649  0.016 27.17 ? 190 GLU A CD   3  
ATOM   10035  O OE1  . GLU A 1 192 ? -15.204 -2.456  10.454  0.016 26.09 ? 190 GLU A OE1  3  
ATOM   10036  O OE2  . GLU A 1 192 ? -13.280 -3.203  11.181  0.016 28.23 ? 190 GLU A OE2  3  
ATOM   10037  H H    . GLU A 1 192 ? -12.938 -1.851  7.517   0.016 26.68 ? 190 GLU A H    3  
ATOM   10038  H HA   . GLU A 1 192 ? -15.402 -0.807  7.812   0.016 24.76 ? 190 GLU A HA   3  
ATOM   10039  H HB2  . GLU A 1 192 ? -13.664 0.811   9.083   0.016 26.53 ? 190 GLU A HB2  3  
ATOM   10040  H HB3  . GLU A 1 192 ? -14.997 0.178   9.671   0.016 25.73 ? 190 GLU A HB3  3  
ATOM   10041  H HG2  . GLU A 1 192 ? -12.497 -1.226  9.709   0.016 28.05 ? 190 GLU A HG2  3  
ATOM   10042  H HG3  . GLU A 1 192 ? -13.007 -0.491  10.971  0.016 27.76 ? 190 GLU A HG3  3  
ATOM   10043  N N    . VAL A 1 193 ? -14.757 1.197   6.293   0.016 24.14 ? 191 VAL A N    3  
ATOM   10044  C CA   . VAL A 1 193 ? -14.391 1.994   5.132   0.016 23.82 ? 191 VAL A CA   3  
ATOM   10045  C C    . VAL A 1 193 ? -14.796 3.425   5.394   0.016 23.74 ? 191 VAL A C    3  
ATOM   10046  O O    . VAL A 1 193 ? -15.939 3.668   5.782   0.016 23.06 ? 191 VAL A O    3  
ATOM   10047  C CB   . VAL A 1 193 ? -15.072 1.485   3.857   0.016 22.98 ? 191 VAL A CB   3  
ATOM   10048  C CG1  . VAL A 1 193 ? -14.838 2.408   2.708   0.016 22.63 ? 191 VAL A CG1  3  
ATOM   10049  C CG2  . VAL A 1 193 ? -14.512 0.073   3.542   0.016 23.33 ? 191 VAL A CG2  3  
ATOM   10050  H H    . VAL A 1 193 ? -15.477 1.443   6.686   0.016 23.82 ? 191 VAL A H    3  
ATOM   10051  H HA   . VAL A 1 193 ? -13.430 1.973   5.008   0.016 24.39 ? 191 VAL A HA   3  
ATOM   10052  H HB   . VAL A 1 193 ? -16.029 1.417   4.001   0.016 22.54 ? 191 VAL A HB   3  
ATOM   10053  H HG11 . VAL A 1 193 ? -14.316 3.181   2.976   0.016 23.12 ? 191 VAL A HG11 3  
ATOM   10054  H HG12 . VAL A 1 193 ? -14.363 1.932   2.010   0.016 22.40 ? 191 VAL A HG12 3  
ATOM   10055  H HG13 . VAL A 1 193 ? -15.697 2.710   2.376   0.016 22.25 ? 191 VAL A HG13 3  
ATOM   10056  H HG21 . VAL A 1 193 ? -15.066 -0.585  3.978   0.016 22.90 ? 191 VAL A HG21 3  
ATOM   10057  H HG22 . VAL A 1 193 ? -14.499 -0.083  2.589   0.016 23.70 ? 191 VAL A HG22 3  
ATOM   10058  H HG23 . VAL A 1 193 ? -13.606 0.025   3.879   0.016 23.74 ? 191 VAL A HG23 3  
ATOM   10059  N N    . ASP A 1 194 ? -13.874 4.359   5.159   0.016 24.51 ? 192 ASP A N    3  
ATOM   10060  C CA   . ASP A 1 194 ? -14.180 5.776   5.355   0.016 24.68 ? 192 ASP A CA   3  
ATOM   10061  C C    . ASP A 1 194 ? -14.683 6.336   4.028   0.016 24.18 ? 192 ASP A C    3  
ATOM   10062  O O    . ASP A 1 194 ? -14.236 5.924   2.957   0.016 24.28 ? 192 ASP A O    3  
ATOM   10063  C CB   . ASP A 1 194 ? -12.995 6.562   5.969   0.016 26.00 ? 192 ASP A CB   3  
ATOM   10064  C CG   . ASP A 1 194 ? -11.748 6.728   5.051   0.016 26.47 ? 192 ASP A CG   3  
ATOM   10065  O OD1  . ASP A 1 194 ? -10.681 6.118   5.374   0.016 27.28 ? 192 ASP A OD1  3  
ATOM   10066  O OD2  . ASP A 1 194 ? -11.773 7.578   4.112   0.016 26.12 ? 192 ASP A OD2  3  
ATOM   10067  H H    . ASP A 1 194 ? -13.076 4.198   4.881   0.016 25.03 ? 192 ASP A H    3  
ATOM   10068  H HA   . ASP A 1 194 ? -14.912 5.834   5.985   0.016 24.36 ? 192 ASP A HA   3  
ATOM   10069  H HB2  . ASP A 1 194 ? -13.305 7.450   6.200   0.016 26.25 ? 192 ASP A HB2  3  
ATOM   10070  H HB3  . ASP A 1 194 ? -12.709 6.103   6.775   0.016 26.46 ? 192 ASP A HB3  3  
ATOM   10071  N N    . HIS A 1 195 ? -15.716 7.181   4.105   0.016 23.74 ? 193 HIS A N    3  
ATOM   10072  C CA   . HIS A 1 195 ? -16.302 7.831   2.946   0.016 23.08 ? 193 HIS A CA   3  
ATOM   10073  C C    . HIS A 1 195 ? -16.408 9.338   3.100   0.016 23.11 ? 193 HIS A C    3  
ATOM   10074  O O    . HIS A 1 195 ? -16.684 9.854   4.192   0.016 23.15 ? 193 HIS A O    3  
ATOM   10075  C CB   . HIS A 1 195 ? -17.724 7.378   2.685   0.016 22.20 ? 193 HIS A CB   3  
ATOM   10076  C CG   . HIS A 1 195 ? -17.883 6.730   1.360   0.016 21.81 ? 193 HIS A CG   3  
ATOM   10077  N ND1  . HIS A 1 195 ? -17.533 5.415   1.138   0.016 21.29 ? 193 HIS A ND1  3  
ATOM   10078  C CD2  . HIS A 1 195 ? -18.315 7.216   0.178   0.016 22.03 ? 193 HIS A CD2  3  
ATOM   10079  C CE1  . HIS A 1 195 ? -17.740 5.125   -0.138  0.016 21.22 ? 193 HIS A CE1  3  
ATOM   10080  N NE2  . HIS A 1 195 ? -18.213 6.203   -0.739  0.016 21.66 ? 193 HIS A NE2  3  
ATOM   10081  H H    . HIS A 1 195 ? -16.110 7.384   4.840   0.016 23.88 ? 193 HIS A H    3  
ATOM   10082  H HA   . HIS A 1 195 ? -15.762 7.640   2.164   0.016 23.35 ? 193 HIS A HA   3  
ATOM   10083  H HB2  . HIS A 1 195 ? -17.978 6.731   3.363   0.016 22.34 ? 193 HIS A HB2  3  
ATOM   10084  H HB3  . HIS A 1 195 ? -18.314 8.150   2.719   0.016 21.89 ? 193 HIS A HB3  3  
ATOM   10085  H HD1  . HIS A 1 195 ? -17.218 4.878   1.730   0.016 21.13 ? 193 HIS A HD1  3  
ATOM   10086  H HD2  . HIS A 1 195 ? -18.608 8.084   0.010   0.016 22.45 ? 193 HIS A HD2  3  
ATOM   10087  H HE1  . HIS A 1 195 ? -17.598 4.300   -0.544  0.016 21.00 ? 193 HIS A HE1  3  
ATOM   10088  H HE2  . HIS A 1 195 ? -18.433 6.246   -1.563  0.016 21.80 ? 193 HIS A HE2  3  
ATOM   10089  N N    . ARG A 1 196 ? -16.256 9.999   1.953   0.016 23.25 ? 194 ARG A N    3  
ATOM   10090  C CA   . ARG A 1 196 ? -16.710 11.369  1.692   0.016 23.39 ? 194 ARG A CA   3  
ATOM   10091  C C    . ARG A 1 196 ? -17.283 11.451  0.286   0.016 22.97 ? 194 ARG A C    3  
ATOM   10092  O O    . ARG A 1 196 ? -16.612 11.078  -0.679  0.016 23.27 ? 194 ARG A O    3  
ATOM   10093  C CB   . ARG A 1 196 ? -15.576 12.365  1.805   0.016 24.52 ? 194 ARG A CB   3  
ATOM   10094  C CG   . ARG A 1 196 ? -14.955 12.318  3.134   0.016 25.23 ? 194 ARG A CG   3  
ATOM   10095  C CD   . ARG A 1 196 ? -13.720 11.459  3.112   0.016 25.68 ? 194 ARG A CD   3  
ATOM   10096  N NE   . ARG A 1 196 ? -12.706 11.933  2.141   0.016 26.38 ? 194 ARG A NE   3  
ATOM   10097  C CZ   . ARG A 1 196 ? -12.151 13.138  2.202   0.016 27.51 ? 194 ARG A CZ   3  
ATOM   10098  N NH1  . ARG A 1 196 ? -12.517 13.996  3.154   0.016 28.09 ? 194 ARG A NH1  3  
ATOM   10099  N NH2  . ARG A 1 196 ? -11.257 13.521  1.305   0.016 28.21 ? 194 ARG A NH2  3  
ATOM   10100  H H    . ARG A 1 196 ? -15.859 9.651   1.275   0.016 23.36 ? 194 ARG A H    3  
ATOM   10101  H HA   . ARG A 1 196 ? -17.401 11.619  2.323   0.016 23.17 ? 194 ARG A HA   3  
ATOM   10102  H HB2  . ARG A 1 196 ? -14.905 12.148  1.142   0.016 24.83 ? 194 ARG A HB2  3  
ATOM   10103  H HB3  . ARG A 1 196 ? -15.911 13.266  1.654   0.016 24.65 ? 194 ARG A HB3  3  
ATOM   10104  H HG2  . ARG A 1 196 ? -14.759 13.216  3.425   0.016 25.93 ? 194 ARG A HG2  3  
ATOM   10105  H HG3  . ARG A 1 196 ? -15.601 11.904  3.736   0.016 24.82 ? 194 ARG A HG3  3  
ATOM   10106  H HD2  . ARG A 1 196 ? -13.308 11.466  3.994   0.016 26.29 ? 194 ARG A HD2  3  
ATOM   10107  H HD3  . ARG A 1 196 ? -13.968 10.532  2.893   0.016 25.05 ? 194 ARG A HD3  3  
ATOM   10108  H HE   . ARG A 1 196 ? -12.649 11.532  1.385   0.016 26.29 ? 194 ARG A HE   3  
ATOM   10109  H HH11 . ARG A 1 196 ? -13.090 13.787  3.749   0.016 27.73 ? 194 ARG A HH11 3  
ATOM   10110  H HH12 . ARG A 1 196 ? -12.164 14.781  3.178   0.016 28.90 ? 194 ARG A HH12 3  
ATOM   10111  H HH21 . ARG A 1 196 ? -11.023 12.989  0.670   0.016 27.92 ? 194 ARG A HH21 3  
ATOM   10112  H HH22 . ARG A 1 196 ? -10.927 14.312  1.343   0.016 29.04 ? 194 ARG A HH22 3  
ATOM   10113  N N    . ILE A 1 197 ? -18.511 11.944  0.162   0.016 22.44 ? 195 ILE A N    3  
ATOM   10114  C CA   . ILE A 1 197 ? -19.114 12.201  -1.144  0.016 22.24 ? 195 ILE A CA   3  
ATOM   10115  C C    . ILE A 1 197 ? -19.439 13.678  -1.205  0.016 22.60 ? 195 ILE A C    3  
ATOM   10116  O O    . ILE A 1 197 ? -20.024 14.214  -0.261  0.016 22.64 ? 195 ILE A O    3  
ATOM   10117  C CB   . ILE A 1 197 ? -20.418 11.415  -1.387  0.016 21.43 ? 195 ILE A CB   3  
ATOM   10118  C CG1  . ILE A 1 197 ? -21.079 11.828  -2.717  0.016 21.48 ? 195 ILE A CG1  3  
ATOM   10119  C CG2  . ILE A 1 197 ? -21.435 11.754  -0.306  0.016 21.07 ? 195 ILE A CG2  3  
ATOM   10120  C CD1  . ILE A 1 197 ? -21.112 10.771  -3.854  0.016 21.10 ? 195 ILE A CD1  3  
ATOM   10121  H H    . ILE A 1 197 ? -19.013 12.147  0.826   0.016 22.29 ? 195 ILE A H    3  
ATOM   10122  H HA   . ILE A 1 197 ? -18.479 12.005  -1.848  0.016 22.56 ? 195 ILE A HA   3  
ATOM   10123  H HB   . ILE A 1 197 ? -20.235 10.460  -1.391  0.016 21.28 ? 195 ILE A HB   3  
ATOM   10124  H HG12 . ILE A 1 197 ? -22.004 12.048  -2.532  0.016 21.45 ? 195 ILE A HG12 3  
ATOM   10125  H HG13 . ILE A 1 197 ? -20.646 12.606  -3.085  0.016 21.97 ? 195 ILE A HG13 3  
ATOM   10126  H HG21 . ILE A 1 197 ? -21.870 12.596  -0.519  0.016 21.24 ? 195 ILE A HG21 3  
ATOM   10127  H HG22 . ILE A 1 197 ? -22.095 11.045  -0.271  0.016 20.66 ? 195 ILE A HG22 3  
ATOM   10128  H HG23 . ILE A 1 197 ? -20.997 11.829  0.556   0.016 21.19 ? 195 ILE A HG23 3  
ATOM   10129  H HD11 . ILE A 1 197 ? -20.992 9.885   -3.480  0.016 20.80 ? 195 ILE A HD11 3  
ATOM   10130  H HD12 . ILE A 1 197 ? -21.971 10.815  -4.301  0.016 21.43 ? 195 ILE A HD12 3  
ATOM   10131  H HD13 . ILE A 1 197 ? -20.409 10.976  -4.491  0.016 20.93 ? 195 ILE A HD13 3  
ATOM   10132  N N    . GLU A 1 198 ? -19.137 14.302  -2.344  0.016 22.96 ? 196 GLU A N    3  
ATOM   10133  C CA   . GLU A 1 198 ? -19.366 15.735  -2.543  0.016 23.56 ? 196 GLU A CA   3  
ATOM   10134  C C    . GLU A 1 198 ? -19.909 16.002  -3.940  0.016 23.68 ? 196 GLU A C    3  
ATOM   10135  O O    . GLU A 1 198 ? -19.344 15.552  -4.932  0.016 24.01 ? 196 GLU A O    3  
ATOM   10136  C CB   . GLU A 1 198 ? -18.077 16.556  -2.369  0.016 24.62 ? 196 GLU A CB   3  
ATOM   10137  C CG   . GLU A 1 198 ? -18.213 18.120  -2.652  0.016 25.28 ? 196 GLU A CG   3  
ATOM   10138  C CD   . GLU A 1 198 ? -18.129 19.014  -1.379  0.016 25.11 ? 196 GLU A CD   3  
ATOM   10139  O OE1  . GLU A 1 198 ? -18.739 18.718  -0.327  0.016 24.28 ? 196 GLU A OE1  3  
ATOM   10140  O OE2  . GLU A 1 198 ? -17.458 20.068  -1.414  0.016 25.97 ? 196 GLU A OE2  3  
ATOM   10141  H H    . GLU A 1 198 ? -18.813 13.905  -3.031  0.016 22.94 ? 196 GLU A H    3  
ATOM   10142  H HA   . GLU A 1 198 ? -20.019 16.048  -1.900  0.016 23.37 ? 196 GLU A HA   3  
ATOM   10143  H HB2  . GLU A 1 198 ? -17.754 16.439  -1.462  0.016 24.64 ? 196 GLU A HB2  3  
ATOM   10144  H HB3  . GLU A 1 198 ? -17.418 16.218  -2.993  0.016 25.01 ? 196 GLU A HB3  3  
ATOM   10145  H HG2  . GLU A 1 198 ? -17.468 18.379  -3.219  0.016 26.06 ? 196 GLU A HG2  3  
ATOM   10146  H HG3  . GLU A 1 198 ? -19.042 18.308  -3.113  0.016 25.17 ? 196 GLU A HG3  3  
ATOM   10147  N N    . ILE A 1 199 ? -20.954 16.812  -4.030  0.016 23.62 ? 197 ILE A N    3  
ATOM   10148  C CA   . ILE A 1 199 ? -21.273 17.429  -5.316  0.016 24.13 ? 197 ILE A CA   3  
ATOM   10149  C C    . ILE A 1 199 ? -20.339 18.623  -5.534  0.016 25.25 ? 197 ILE A C    3  
ATOM   10150  O O    . ILE A 1 199 ? -20.406 19.615  -4.793  0.016 25.60 ? 197 ILE A O    3  
ATOM   10151  C CB   . ILE A 1 199 ? -22.742 17.843  -5.399  0.016 23.84 ? 197 ILE A CB   3  
ATOM   10152  C CG1  . ILE A 1 199 ? -23.648 16.631  -5.306  0.016 22.99 ? 197 ILE A CG1  3  
ATOM   10153  C CG2  . ILE A 1 199 ? -22.955 18.518  -6.714  0.016 24.63 ? 197 ILE A CG2  3  
ATOM   10154  C CD1  . ILE A 1 199 ? -25.157 16.890  -5.228  0.016 22.90 ? 197 ILE A CD1  3  
ATOM   10155  H H    . ILE A 1 199 ? -21.484 17.000  -3.388  0.016 23.37 ? 197 ILE A H    3  
ATOM   10156  H HA   . ILE A 1 199 ? -21.112 16.788  -6.028  0.016 24.11 ? 197 ILE A HA   3  
ATOM   10157  H HB   . ILE A 1 199 ? -22.947 18.457  -4.675  0.016 23.82 ? 197 ILE A HB   3  
ATOM   10158  H HG12 . ILE A 1 199 ? -23.486 16.071  -6.082  0.016 23.02 ? 197 ILE A HG12 3  
ATOM   10159  H HG13 . ILE A 1 199 ? -23.415 16.137  -4.503  0.016 22.56 ? 197 ILE A HG13 3  
ATOM   10160  H HG21 . ILE A 1 199 ? -23.903 18.577  -6.909  0.016 24.51 ? 197 ILE A HG21 3  
ATOM   10161  H HG22 . ILE A 1 199 ? -22.577 19.410  -6.671  0.016 25.25 ? 197 ILE A HG22 3  
ATOM   10162  H HG23 . ILE A 1 199 ? -22.508 18.000  -7.402  0.016 24.74 ? 197 ILE A HG23 3  
ATOM   10163  H HD11 . ILE A 1 199 ? -25.614 16.092  -5.529  0.016 22.38 ? 197 ILE A HD11 3  
ATOM   10164  H HD12 . ILE A 1 199 ? -25.403 17.069  -4.307  0.016 23.08 ? 197 ILE A HD12 3  
ATOM   10165  H HD13 . ILE A 1 199 ? -25.402 17.634  -5.795  0.016 23.29 ? 197 ILE A HD13 3  
ATOM   10166  N N    . LEU A 1 200 ? -19.478 18.519  -6.564  0.016 25.96 ? 198 LEU A N    3  
ATOM   10167  C CA   . LEU A 1 200 ? -18.498 19.553  -6.930  0.016 27.26 ? 198 LEU A CA   3  
ATOM   10168  C C    . LEU A 1 200 ? -19.197 20.805  -7.433  0.016 27.87 ? 198 LEU A C    3  
ATOM   10169  O O    . LEU A 1 200 ? -18.754 21.931  -7.180  0.016 28.71 ? 198 LEU A O    3  
ATOM   10170  C CB   . LEU A 1 200 ? -17.555 19.077  -8.055  0.016 28.00 ? 198 LEU A CB   3  
ATOM   10171  C CG   . LEU A 1 200 ? -16.246 18.268  -7.917  0.016 28.41 ? 198 LEU A CG   3  
ATOM   10172  C CD1  . LEU A 1 200 ? -15.056 18.961  -8.678  0.016 29.75 ? 198 LEU A CD1  3  
ATOM   10173  C CD2  . LEU A 1 200 ? -15.939 18.070  -6.457  0.016 27.49 ? 198 LEU A CD2  3  
ATOM   10174  H H    . LEU A 1 200 ? -19.449 17.835  -7.082  0.016 25.80 ? 198 LEU A H    3  
ATOM   10175  H HA   . LEU A 1 200 ? -17.978 19.760  -6.149  0.016 27.45 ? 198 LEU A HA   3  
ATOM   10176  H HB2  . LEU A 1 200 ? -18.116 18.577  -8.668  0.016 27.54 ? 198 LEU A HB2  3  
ATOM   10177  H HB3  . LEU A 1 200 ? -17.281 19.883  -8.519  0.016 28.87 ? 198 LEU A HB3  3  
ATOM   10178  H HG   . LEU A 1 200 ? -16.363 17.398  -8.326  0.016 28.62 ? 198 LEU A HG   3  
ATOM   10179  H HD11 . LEU A 1 200 ? -14.423 18.278  -8.943  0.016 30.55 ? 198 LEU A HD11 3  
ATOM   10180  H HD12 . LEU A 1 200 ? -15.393 19.416  -9.463  0.016 29.62 ? 198 LEU A HD12 3  
ATOM   10181  H HD13 . LEU A 1 200 ? -14.622 19.602  -8.092  0.016 30.02 ? 198 LEU A HD13 3  
ATOM   10182  H HD21 . LEU A 1 200 ? -16.662 17.560  -6.060  0.016 26.66 ? 198 LEU A HD21 3  
ATOM   10183  H HD22 . LEU A 1 200 ? -15.098 17.592  -6.383  0.016 27.90 ? 198 LEU A HD22 3  
ATOM   10184  H HD23 . LEU A 1 200 ? -15.869 18.929  -6.014  0.016 27.43 ? 198 LEU A HD23 3  
ATOM   10185  N N    . SER A 1 201 ? -20.232 20.602  -8.230  0.016 27.64 ? 199 SER A N    3  
ATOM   10186  C CA   . SER A 1 201 ? -20.878 21.659  -8.978  0.016 28.36 ? 199 SER A CA   3  
ATOM   10187  C C    . SER A 1 201 ? -22.146 21.098  -9.601  0.016 27.74 ? 199 SER A C    3  
ATOM   10188  O O    . SER A 1 201 ? -22.350 19.875  -9.675  0.016 27.00 ? 199 SER A O    3  
ATOM   10189  C CB   . SER A 1 201 ? -19.953 22.212  -10.053 0.016 29.84 ? 199 SER A CB   3  
ATOM   10190  O OG   . SER A 1 201 ? -19.862 21.324  -11.148 0.016 30.00 ? 199 SER A OG   3  
ATOM   10191  H H    . SER A 1 201 ? -20.591 19.832  -8.362  0.016 27.13 ? 199 SER A H    3  
ATOM   10192  H HA   . SER A 1 201 ? -21.114 22.375  -8.373  0.016 28.42 ? 199 SER A HA   3  
ATOM   10193  H HB2  . SER A 1 201 ? -20.299 23.063  -10.367 0.016 30.45 ? 199 SER A HB2  3  
ATOM   10194  H HB3  . SER A 1 201 ? -19.070 22.333  -9.671  0.016 30.20 ? 199 SER A HB3  3  
ATOM   10195  H HG   . SER A 1 201 ? -19.421 20.647  -10.926 0.016 29.41 ? 199 SER A HG   3  
ATOM   10196  N N    . HIS A 1 202 ? -23.000 22.007  -10.043 0.016 28.21 ? 200 HIS A N    3  
ATOM   10197  C CA   . HIS A 1 202 ? -24.295 21.630  -10.574 0.016 27.81 ? 200 HIS A CA   3  
ATOM   10198  C C    . HIS A 1 202 ? -24.911 22.842  -11.252 0.016 28.88 ? 200 HIS A C    3  
ATOM   10199  O O    . HIS A 1 202 ? -24.666 23.981  -10.842 0.016 29.39 ? 200 HIS A O    3  
ATOM   10200  C CB   . HIS A 1 202 ? -25.208 21.108  -9.454  0.016 26.59 ? 200 HIS A CB   3  
ATOM   10201  C CG   . HIS A 1 202 ? -25.363 22.060  -8.315  0.016 26.77 ? 200 HIS A CG   3  
ATOM   10202  N ND1  . HIS A 1 202 ? -26.429 22.928  -8.229  0.016 27.41 ? 200 HIS A ND1  3  
ATOM   10203  C CD2  . HIS A 1 202 ? -24.579 22.314  -7.243  0.016 26.55 ? 200 HIS A CD2  3  
ATOM   10204  C CE1  . HIS A 1 202 ? -26.319 23.644  -7.123  0.016 27.55 ? 200 HIS A CE1  3  
ATOM   10205  N NE2  . HIS A 1 202 ? -25.206 23.290  -6.509  0.016 27.03 ? 200 HIS A NE2  3  
ATOM   10206  H H    . HIS A 1 202 ? -22.852 22.850  -10.039 0.016 28.85 ? 200 HIS A H    3  
ATOM   10207  H HA   . HIS A 1 202 ? -24.174 20.940  -11.235 0.016 27.80 ? 200 HIS A HA   3  
ATOM   10208  H HB2  . HIS A 1 202 ? -26.092 20.945  -9.815  0.016 26.34 ? 200 HIS A HB2  3  
ATOM   10209  H HB3  . HIS A 1 202 ? -24.840 20.285  -9.102  0.016 26.06 ? 200 HIS A HB3  3  
ATOM   10210  H HD1  . HIS A 1 202 ? -27.081 22.972  -8.788  0.016 27.77 ? 200 HIS A HD1  3  
ATOM   10211  H HD2  . HIS A 1 202 ? -23.784 21.889  -7.026  0.016 26.21 ? 200 HIS A HD2  3  
ATOM   10212  H HE1  . HIS A 1 202 ? -26.910 24.299  -6.834  0.016 27.99 ? 200 HIS A HE1  3  
ATOM   10213  H HE2  . HIS A 1 202 ? -24.916 23.634  -5.776  0.016 27.10 ? 200 HIS A HE2  3  
ATOM   10214  N N    . ASP A 1 203 ? -25.676 22.598  -12.311 0.016 29.36 ? 201 ASP A N    3  
ATOM   10215  C CA   . ASP A 1 203 ? -26.453 23.690  -12.890 0.016 30.29 ? 201 ASP A CA   3  
ATOM   10216  C C    . ASP A 1 203 ? -27.686 23.939  -12.029 0.016 29.53 ? 201 ASP A C    3  
ATOM   10217  O O    . ASP A 1 203 ? -27.912 23.299  -10.998 0.016 28.34 ? 201 ASP A O    3  
ATOM   10218  C CB   . ASP A 1 203 ? -26.812 23.419  -14.352 0.016 31.60 ? 201 ASP A CB   3  
ATOM   10219  C CG   . ASP A 1 203 ? -27.751 22.238  -14.537 0.016 31.26 ? 201 ASP A CG   3  
ATOM   10220  O OD1  . ASP A 1 203 ? -28.101 21.571  -13.540 0.016 30.02 ? 201 ASP A OD1  3  
ATOM   10221  O OD2  . ASP A 1 203 ? -28.128 21.972  -15.704 0.016 32.45 ? 201 ASP A OD2  3  
ATOM   10222  H H    . ASP A 1 203 ? -25.756 21.842  -12.708 0.016 29.26 ? 201 ASP A H    3  
ATOM   10223  H HA   . ASP A 1 203 ? -25.914 24.497  -12.870 0.016 30.76 ? 201 ASP A HA   3  
ATOM   10224  H HB2  . ASP A 1 203 ? -27.260 24.199  -14.709 0.016 32.16 ? 201 ASP A HB2  3  
ATOM   10225  H HB3  . ASP A 1 203 ? -26.001 23.248  -14.852 0.016 32.30 ? 201 ASP A HB3  3  
ATOM   10226  N N    . LYS A 1 204 ? -28.489 24.919  -12.445 0.016 30.37 ? 202 LYS A N    3  
ATOM   10227  C CA   . LYS A 1 204 ? -29.515 25.461  -11.564 0.016 29.99 ? 202 LYS A CA   3  
ATOM   10228  C C    . LYS A 1 204 ? -30.415 24.377  -11.000 0.016 28.93 ? 202 LYS A C    3  
ATOM   10229  O O    . LYS A 1 204 ? -30.719 24.367  -9.798  0.016 28.12 ? 202 LYS A O    3  
ATOM   10230  C CB   . LYS A 1 204 ? -30.331 26.517  -12.325 0.016 31.33 ? 202 LYS A CB   3  
ATOM   10231  C CG   . LYS A 1 204 ? -29.600 27.844  -12.585 0.016 32.55 ? 202 LYS A CG   3  
ATOM   10232  C CD   . LYS A 1 204 ? -30.519 28.998  -12.205 0.016 33.89 ? 202 LYS A CD   3  
ATOM   10233  C CE   . LYS A 1 204 ? -29.843 30.340  -12.303 0.016 34.87 ? 202 LYS A CE   3  
ATOM   10234  N NZ   . LYS A 1 204 ? -28.540 30.386  -11.562 0.016 34.28 ? 202 LYS A NZ   3  
ATOM   10235  H H    . LYS A 1 204 ? -28.460 25.276  -13.224 0.016 31.22 ? 202 LYS A H    3  
ATOM   10236  H HA   . LYS A 1 204 ? -29.084 25.898  -10.812 0.016 29.69 ? 202 LYS A HA   3  
ATOM   10237  H HB2  . LYS A 1 204 ? -30.581 26.156  -13.190 0.016 31.72 ? 202 LYS A HB2  3  
ATOM   10238  H HB3  . LYS A 1 204 ? -31.129 26.717  -11.811 0.016 31.18 ? 202 LYS A HB3  3  
ATOM   10239  H HG2  . LYS A 1 204 ? -28.791 27.878  -12.049 0.016 32.19 ? 202 LYS A HG2  3  
ATOM   10240  H HG3  . LYS A 1 204 ? -29.381 27.924  -13.528 0.016 32.98 ? 202 LYS A HG3  3  
ATOM   10241  H HD2  . LYS A 1 204 ? -31.272 29.009  -12.817 0.016 34.67 ? 202 LYS A HD2  3  
ATOM   10242  H HD3  . LYS A 1 204 ? -30.833 28.877  -11.295 0.016 33.52 ? 202 LYS A HD3  3  
ATOM   10243  H HE2  . LYS A 1 204 ? -29.671 30.540  -13.236 0.016 35.04 ? 202 LYS A HE2  3  
ATOM   10244  H HE3  . LYS A 1 204 ? -30.427 31.011  -11.922 0.016 35.92 ? 202 LYS A HE3  3  
ATOM   10245  H HZ1  . LYS A 1 204 ? -28.375 29.604  -11.174 0.016 34.20 ? 202 LYS A HZ1  3  
ATOM   10246  H HZ2  . LYS A 1 204 ? -27.876 30.574  -12.123 0.016 33.39 ? 202 LYS A HZ2  3  
ATOM   10247  H HZ3  . LYS A 1 204 ? -28.576 31.015  -10.934 0.016 34.98 ? 202 LYS A HZ3  3  
ATOM   10248  N N    . ASP A 1 205 ? -30.763 23.395  -11.836 0.016 29.03 ? 203 ASP A N    3  
ATOM   10249  C CA   . ASP A 1 205 ? -31.765 22.390  -11.521 0.016 28.17 ? 203 ASP A CA   3  
ATOM   10250  C C    . ASP A 1 205 ? -31.143 21.028  -11.226 0.016 27.51 ? 203 ASP A C    3  
ATOM   10251  O O    . ASP A 1 205 ? -31.852 20.049  -11.015 0.016 27.41 ? 203 ASP A O    3  
ATOM   10252  C CB   . ASP A 1 205 ? -32.733 22.322  -12.696 0.016 28.94 ? 203 ASP A CB   3  
ATOM   10253  C CG   . ASP A 1 205 ? -34.023 21.698  -12.325 0.016 28.60 ? 203 ASP A CG   3  
ATOM   10254  O OD1  . ASP A 1 205 ? -35.037 22.392  -12.526 0.016 28.90 ? 203 ASP A OD1  3  
ATOM   10255  O OD2  . ASP A 1 205 ? -34.017 20.549  -11.809 0.016 28.14 ? 203 ASP A OD2  3  
ATOM   10256  H H    . ASP A 1 205 ? -30.420 23.287  -12.616 0.016 29.70 ? 203 ASP A H    3  
ATOM   10257  H HA   . ASP A 1 205 ? -32.261 22.665  -10.737 0.016 27.59 ? 203 ASP A HA   3  
ATOM   10258  H HB2  . ASP A 1 205 ? -32.929 23.228  -12.974 0.016 29.86 ? 203 ASP A HB2  3  
ATOM   10259  H HB3  . ASP A 1 205 ? -32.340 21.838  -13.437 0.016 28.91 ? 203 ASP A HB3  3  
ATOM   10260  N N    . TYR A 1 206 ? -29.830 20.986  -11.118 0.016 27.23 ? 204 TYR A N    3  
ATOM   10261  C CA   . TYR A 1 206 ? -29.100 19.740  -10.966 0.016 26.55 ? 204 TYR A CA   3  
ATOM   10262  C C    . TYR A 1 206 ? -29.325 18.837  -12.163 0.016 27.07 ? 204 TYR A C    3  
ATOM   10263  O O    . TYR A 1 206 ? -29.083 17.645  -12.094 0.016 26.48 ? 204 TYR A O    3  
ATOM   10264  C CB   . TYR A 1 206 ? -29.478 19.017  -9.666  0.016 25.32 ? 204 TYR A CB   3  
ATOM   10265  C CG   . TYR A 1 206 ? -29.023 19.698  -8.412  0.016 24.91 ? 204 TYR A CG   3  
ATOM   10266  C CD1  . TYR A 1 206 ? -29.650 20.856  -7.947  0.016 25.31 ? 204 TYR A CD1  3  
ATOM   10267  C CD2  . TYR A 1 206 ? -27.957 19.217  -7.688  0.016 24.32 ? 204 TYR A CD2  3  
ATOM   10268  C CE1  . TYR A 1 206 ? -29.215 21.493  -6.805  0.016 25.15 ? 204 TYR A CE1  3  
ATOM   10269  C CE2  . TYR A 1 206 ? -27.517 19.849  -6.538  0.016 24.18 ? 204 TYR A CE2  3  
ATOM   10270  C CZ   . TYR A 1 206 ? -28.145 20.983  -6.096  0.016 24.61 ? 204 TYR A CZ   3  
ATOM   10271  O OH   . TYR A 1 206 ? -27.650 21.576  -4.949  0.016 24.67 ? 204 TYR A OH   3  
ATOM   10272  H H    . TYR A 1 206 ? -29.322 21.679  -11.132 0.016 27.51 ? 204 TYR A H    3  
ATOM   10273  H HA   . TYR A 1 206 ? -28.153 19.945  -10.938 0.016 26.70 ? 204 TYR A HA   3  
ATOM   10274  H HB2  . TYR A 1 206 ? -30.437 18.904  -9.614  0.016 25.25 ? 204 TYR A HB2  3  
ATOM   10275  H HB3  . TYR A 1 206 ? -29.047 18.147  -9.685  0.016 24.96 ? 204 TYR A HB3  3  
ATOM   10276  H HD1  . TYR A 1 206 ? -30.371 21.198  -8.420  0.016 25.78 ? 204 TYR A HD1  3  
ATOM   10277  H HD2  . TYR A 1 206 ? -27.521 18.451  -7.984  0.016 24.09 ? 204 TYR A HD2  3  
ATOM   10278  H HE1  . TYR A 1 206 ? -29.648 22.258  -6.507  0.016 25.50 ? 204 TYR A HE1  3  
ATOM   10279  H HE2  . TYR A 1 206 ? -26.794 19.512  -6.064  0.016 23.88 ? 204 TYR A HE2  3  
ATOM   10280  H HH   . TYR A 1 206 ? -26.910 21.242  -4.741  0.016 24.55 ? 204 TYR A HH   3  
ATOM   10281  N N    . ASN A 1 207 ? -29.761 19.391  -13.286 0.016 28.32 ? 205 ASN A N    3  
ATOM   10282  C CA   . ASN A 1 207 ? -29.738 18.626  -14.521 0.016 29.17 ? 205 ASN A CA   3  
ATOM   10283  C C    . ASN A 1 207 ? -28.316 18.252  -14.914 0.016 29.28 ? 205 ASN A C    3  
ATOM   10284  O O    . ASN A 1 207 ? -28.112 17.249  -15.605 0.016 29.47 ? 205 ASN A O    3  
ATOM   10285  C CB   . ASN A 1 207 ? -30.388 19.407  -15.651 0.016 30.76 ? 205 ASN A CB   3  
ATOM   10286  C CG   . ASN A 1 207 ? -31.894 19.549  -15.486 0.016 30.94 ? 205 ASN A CG   3  
ATOM   10287  O OD1  . ASN A 1 207 ? -32.551 18.823  -14.731 0.016 30.60 ? 205 ASN A OD1  3  
ATOM   10288  N ND2  . ASN A 1 207 ? -32.442 20.494  -16.210 0.016 31.59 ? 205 ASN A ND2  3  
ATOM   10289  H H    . ASN A 1 207 ? -30.064 20.192  -13.365 0.016 28.80 ? 205 ASN A H    3  
ATOM   10290  H HA   . ASN A 1 207 ? -30.247 17.811  -14.395 0.016 28.81 ? 205 ASN A HA   3  
ATOM   10291  H HB2  . ASN A 1 207 ? -30.000 20.295  -15.680 0.016 31.12 ? 205 ASN A HB2  3  
ATOM   10292  H HB3  . ASN A 1 207 ? -30.220 18.956  -16.491 0.016 31.47 ? 205 ASN A HB3  3  
ATOM   10293  H HD21 . ASN A 1 207 ? -32.004 20.827  -16.870 0.016 32.08 ? 205 ASN A HD21 3  
ATOM   10294  H HD22 . ASN A 1 207 ? -33.234 20.776  -16.028 0.016 31.60 ? 205 ASN A HD22 3  
ATOM   10295  N N    . LYS A 1 208 ? -27.334 19.047  -14.498 0.016 29.33 ? 206 LYS A N    3  
ATOM   10296  C CA   . LYS A 1 208 ? -25.923 18.761  -14.693 0.016 29.59 ? 206 LYS A CA   3  
ATOM   10297  C C    . LYS A 1 208 ? -25.273 18.790  -13.315 0.016 28.46 ? 206 LYS A C    3  
ATOM   10298  O O    . LYS A 1 208 ? -25.480 19.748  -12.563 0.016 28.34 ? 206 LYS A O    3  
ATOM   10299  C CB   . LYS A 1 208 ? -25.280 19.783  -15.651 0.016 31.22 ? 206 LYS A CB   3  
ATOM   10300  C CG   . LYS A 1 208 ? -25.823 19.738  -17.071 0.016 32.68 ? 206 LYS A CG   3  
ATOM   10301  C CD   . LYS A 1 208 ? -24.961 20.627  -17.979 0.016 34.44 ? 206 LYS A CD   3  
ATOM   10302  C CE   . LYS A 1 208 ? -25.352 20.588  -19.473 0.016 36.22 ? 206 LYS A CE   3  
ATOM   10303  N NZ   . LYS A 1 208 ? -24.221 21.007  -20.391 0.016 37.94 ? 206 LYS A NZ   3  
ATOM   10304  H H    . LYS A 1 208 ? -27.467 19.775  -14.069 0.016 29.29 ? 206 LYS A H    3  
ATOM   10305  H HA   . LYS A 1 208 ? -25.815 17.876  -15.072 0.016 29.56 ? 206 LYS A HA   3  
ATOM   10306  H HB2  . LYS A 1 208 ? -25.444 20.675  -15.304 0.016 31.34 ? 206 LYS A HB2  3  
ATOM   10307  H HB3  . LYS A 1 208 ? -24.325 19.623  -15.697 0.016 31.36 ? 206 LYS A HB3  3  
ATOM   10308  H HG2  . LYS A 1 208 ? -25.775 18.827  -17.406 0.016 32.66 ? 206 LYS A HG2  3  
ATOM   10309  H HG3  . LYS A 1 208 ? -26.738 20.057  -17.082 0.016 32.68 ? 206 LYS A HG3  3  
ATOM   10310  H HD2  . LYS A 1 208 ? -25.031 21.547  -17.676 0.016 34.55 ? 206 LYS A HD2  3  
ATOM   10311  H HD3  . LYS A 1 208 ? -24.040 20.328  -17.904 0.016 34.47 ? 206 LYS A HD3  3  
ATOM   10312  H HE2  . LYS A 1 208 ? -25.607 19.681  -19.711 0.016 35.96 ? 206 LYS A HE2  3  
ATOM   10313  H HE3  . LYS A 1 208 ? -26.097 21.193  -19.623 0.016 36.70 ? 206 LYS A HE3  3  
ATOM   10314  H HZ1  . LYS A 1 208 ? -23.509 20.494  -20.245 0.016 38.12 ? 206 LYS A HZ1  3  
ATOM   10315  H HZ2  . LYS A 1 208 ? -24.467 20.922  -21.243 0.016 39.12 ? 206 LYS A HZ2  3  
ATOM   10316  H HZ3  . LYS A 1 208 ? -24.000 21.855  -20.238 0.016 37.74 ? 206 LYS A HZ3  3  
ATOM   10317  N N    . VAL A 1 209 ? -24.537 17.725  -12.968 0.016 27.75 ? 207 VAL A N    3  
ATOM   10318  C CA   . VAL A 1 209 ? -23.909 17.566  -11.656 0.016 26.75 ? 207 VAL A CA   3  
ATOM   10319  C C    . VAL A 1 209 ? -22.522 16.953  -11.835 0.016 26.99 ? 207 VAL A C    3  
ATOM   10320  O O    . VAL A 1 209 ? -22.359 15.986  -12.591 0.016 27.19 ? 207 VAL A O    3  
ATOM   10321  C CB   . VAL A 1 209 ? -24.753 16.662  -10.730 0.016 25.47 ? 207 VAL A CB   3  
ATOM   10322  C CG1  . VAL A 1 209 ? -24.010 16.258  -9.458  0.016 24.61 ? 207 VAL A CG1  3  
ATOM   10323  C CG2  . VAL A 1 209 ? -26.076 17.307  -10.408 0.016 25.32 ? 207 VAL A CG2  3  
ATOM   10324  H H    . VAL A 1 209 ? -24.381 17.074  -13.500 0.016 27.93 ? 207 VAL A H    3  
ATOM   10325  H HA   . VAL A 1 209 ? -23.810 18.429  -11.233 0.016 26.89 ? 207 VAL A HA   3  
ATOM   10326  H HB   . VAL A 1 209 ? -24.939 15.834  -11.206 0.016 25.45 ? 207 VAL A HB   3  
ATOM   10327  H HG11 . VAL A 1 209 ? -24.596 15.678  -8.947  0.016 23.95 ? 207 VAL A HG11 3  
ATOM   10328  H HG12 . VAL A 1 209 ? -23.198 15.780  -9.675  0.016 24.79 ? 207 VAL A HG12 3  
ATOM   10329  H HG13 . VAL A 1 209 ? -23.812 17.050  -8.937  0.016 24.64 ? 207 VAL A HG13 3  
ATOM   10330  H HG21 . VAL A 1 209 ? -26.419 16.934  -9.581  0.016 24.58 ? 207 VAL A HG21 3  
ATOM   10331  H HG22 . VAL A 1 209 ? -25.941 18.262  -10.311 0.016 25.71 ? 207 VAL A HG22 3  
ATOM   10332  H HG23 . VAL A 1 209 ? -26.693 17.138  -11.135 0.016 25.70 ? 207 VAL A HG23 3  
ATOM   10333  N N    . ARG A 1 210 ? -21.542 17.492  -11.118 0.016 27.09 ? 208 ARG A N    3  
ATOM   10334  C CA   . ARG A 1 210 ? -20.209 16.908  -11.019 0.016 27.22 ? 208 ARG A CA   3  
ATOM   10335  C C    . ARG A 1 210 ? -20.014 16.405  -9.602  0.016 26.09 ? 208 ARG A C    3  
ATOM   10336  O O    . ARG A 1 210 ? -20.143 17.161  -8.636  0.016 25.80 ? 208 ARG A O    3  
ATOM   10337  C CB   . ARG A 1 210 ? -19.133 17.924  -11.396 0.016 28.50 ? 208 ARG A CB   3  
ATOM   10338  C CG   . ARG A 1 210 ? -17.678 17.396  -11.328 0.016 28.83 ? 208 ARG A CG   3  
ATOM   10339  C CD   . ARG A 1 210 ? -16.704 18.404  -12.014 0.016 30.51 ? 208 ARG A CD   3  
ATOM   10340  N NE   . ARG A 1 210 ? -17.468 19.498  -12.648 0.016 31.51 ? 208 ARG A NE   3  
ATOM   10341  C CZ   . ARG A 1 210 ? -17.038 20.736  -12.925 0.016 32.88 ? 208 ARG A CZ   3  
ATOM   10342  N NH1  . ARG A 1 210 ? -15.773 21.146  -12.716 0.016 33.45 ? 208 ARG A NH1  3  
ATOM   10343  N NH2  . ARG A 1 210 ? -17.894 21.560  -13.484 0.016 33.85 ? 208 ARG A NH2  3  
ATOM   10344  H H    . ARG A 1 210 ? -21.625 18.219  -10.671 0.016 27.17 ? 208 ARG A H    3  
ATOM   10345  H HA   . ARG A 1 210 ? -20.140 16.152  -11.625 0.016 27.34 ? 208 ARG A HA   3  
ATOM   10346  H HB2  . ARG A 1 210 ? -19.340 18.179  -12.304 0.016 29.29 ? 208 ARG A HB2  3  
ATOM   10347  H HB3  . ARG A 1 210 ? -19.200 18.684  -10.802 0.016 28.44 ? 208 ARG A HB3  3  
ATOM   10348  H HG2  . ARG A 1 210 ? -17.412 17.281  -10.405 0.016 28.31 ? 208 ARG A HG2  3  
ATOM   10349  H HG3  . ARG A 1 210 ? -17.627 16.545  -11.791 0.016 28.64 ? 208 ARG A HG3  3  
ATOM   10350  H HD2  . ARG A 1 210 ? -16.113 18.779  -11.348 0.016 30.70 ? 208 ARG A HD2  3  
ATOM   10351  H HD3  . ARG A 1 210 ? -16.196 17.939  -12.696 0.016 30.88 ? 208 ARG A HD3  3  
ATOM   10352  H HE   . ARG A 1 210 ? -18.092 19.237  -13.179 0.016 31.28 ? 208 ARG A HE   3  
ATOM   10353  H HH11 . ARG A 1 210 ? -15.202 20.615  -12.352 0.016 32.94 ? 208 ARG A HH11 3  
ATOM   10354  H HH12 . ARG A 1 210 ? -15.538 21.948  -12.922 0.016 34.41 ? 208 ARG A HH12 3  
ATOM   10355  H HH21 . ARG A 1 210 ? -18.701 21.308  -13.635 0.016 33.60 ? 208 ARG A HH21 3  
ATOM   10356  H HH22 . ARG A 1 210 ? -17.646 22.358  -13.692 0.016 34.80 ? 208 ARG A HH22 3  
ATOM   10357  N N    . LEU A 1 211 ? -19.727 15.110  -9.482  0.016 25.60 ? 209 LEU A N    3  
ATOM   10358  C CA   . LEU A 1 211 ? -19.786 14.409  -8.219  0.016 24.56 ? 209 LEU A CA   3  
ATOM   10359  C C    . LEU A 1 211 ? -18.448 13.745  -7.960  0.016 24.78 ? 209 LEU A C    3  
ATOM   10360  O O    . LEU A 1 211 ? -17.899 13.106  -8.856  0.016 25.31 ? 209 LEU A O    3  
ATOM   10361  C CB   . LEU A 1 211 ? -20.890 13.354  -8.269  0.016 23.74 ? 209 LEU A CB   3  
ATOM   10362  C CG   . LEU A 1 211 ? -21.163 12.530  -7.025  0.016 22.77 ? 209 LEU A CG   3  
ATOM   10363  C CD1  . LEU A 1 211 ? -21.790 13.410  -5.968  0.016 22.46 ? 209 LEU A CD1  3  
ATOM   10364  C CD2  . LEU A 1 211 ? -22.083 11.350  -7.374  0.016 22.27 ? 209 LEU A CD2  3  
ATOM   10365  H H    . LEU A 1 211 ? -19.487 14.617  -10.142 0.016 25.96 ? 209 LEU A H    3  
ATOM   10366  H HA   . LEU A 1 211 ? -19.963 15.031  -7.499  0.016 24.39 ? 209 LEU A HA   3  
ATOM   10367  H HB2  . LEU A 1 211 ? -21.721 13.791  -8.502  0.016 23.73 ? 209 LEU A HB2  3  
ATOM   10368  H HB3  . LEU A 1 211 ? -20.658 12.732  -8.973  0.016 24.00 ? 209 LEU A HB3  3  
ATOM   10369  H HG   . LEU A 1 211 ? -20.329 12.176  -6.677  0.016 22.83 ? 209 LEU A HG   3  
ATOM   10370  H HD11 . LEU A 1 211 ? -22.653 13.708  -6.296  0.016 22.45 ? 209 LEU A HD11 3  
ATOM   10371  H HD12 . LEU A 1 211 ? -21.906 12.902  -5.151  0.016 21.97 ? 209 LEU A HD12 3  
ATOM   10372  H HD13 . LEU A 1 211 ? -21.214 14.173  -5.811  0.016 22.89 ? 209 LEU A HD13 3  
ATOM   10373  H HD21 . LEU A 1 211 ? -22.141 10.768  -6.602  0.016 21.80 ? 209 LEU A HD21 3  
ATOM   10374  H HD22 . LEU A 1 211 ? -22.959 11.692  -7.605  0.016 22.18 ? 209 LEU A HD22 3  
ATOM   10375  H HD23 . LEU A 1 211 ? -21.712 10.877  -8.131  0.016 22.66 ? 209 LEU A HD23 3  
ATOM   10376  N N    . TYR A 1 212 ? -17.963 13.888  -6.730  0.016 24.52 ? 210 TYR A N    3  
ATOM   10377  C CA   . TYR A 1 212 ? -16.693 13.363  -6.269  0.016 24.91 ? 210 TYR A CA   3  
ATOM   10378  C C    . TYR A 1 212 ? -16.906 12.447  -5.072  0.016 24.09 ? 210 TYR A C    3  
ATOM   10379  O O    . TYR A 1 212 ? -17.776 12.683  -4.233  0.016 23.47 ? 210 TYR A O    3  
ATOM   10380  C CB   . TYR A 1 212 ? -15.760 14.502  -5.866  0.016 25.91 ? 210 TYR A CB   3  
ATOM   10381  C CG   . TYR A 1 212 ? -14.370 14.054  -5.543  0.016 26.48 ? 210 TYR A CG   3  
ATOM   10382  C CD1  . TYR A 1 212 ? -13.914 13.981  -4.236  0.016 26.28 ? 210 TYR A CD1  3  
ATOM   10383  C CD2  . TYR A 1 212 ? -13.523 13.678  -6.548  0.016 27.36 ? 210 TYR A CD2  3  
ATOM   10384  C CE1  . TYR A 1 212 ? -12.625 13.579  -3.972  0.016 26.98 ? 210 TYR A CE1  3  
ATOM   10385  C CE2  . TYR A 1 212 ? -12.252 13.273  -6.293  0.016 28.04 ? 210 TYR A CE2  3  
ATOM   10386  C CZ   . TYR A 1 212 ? -11.799 13.226  -5.023  0.016 27.84 ? 210 TYR A CZ   3  
ATOM   10387  O OH   . TYR A 1 212 ? -10.501 12.818  -4.834  0.016 28.71 ? 210 TYR A OH   3  
ATOM   10388  H H    . TYR A 1 212 ? -18.385 14.301  -6.108  0.016 24.20 ? 210 TYR A H    3  
ATOM   10389  H HA   . TYR A 1 212 ? -16.277 12.849  -6.977  0.016 25.22 ? 210 TYR A HA   3  
ATOM   10390  H HB2  . TYR A 1 212 ? -15.708 15.130  -6.600  0.016 26.56 ? 210 TYR A HB2  3  
ATOM   10391  H HB3  . TYR A 1 212 ? -16.120 14.939  -5.079  0.016 25.69 ? 210 TYR A HB3  3  
ATOM   10392  H HD1  . TYR A 1 212 ? -14.470 14.230  -3.535  0.016 25.79 ? 210 TYR A HD1  3  
ATOM   10393  H HD2  . TYR A 1 212 ? -13.817 13.718  -7.428  0.016 27.63 ? 210 TYR A HD2  3  
ATOM   10394  H HE1  . TYR A 1 212 ? -12.314 13.541  -3.098  0.016 26.97 ? 210 TYR A HE1  3  
ATOM   10395  H HE2  . TYR A 1 212 ? -11.687 13.034  -6.993  0.016 28.72 ? 210 TYR A HE2  3  
ATOM   10396  H HH   . TYR A 1 212 ? -10.263 12.962  -4.042  0.016 28.73 ? 210 TYR A HH   3  
ATOM   10397  N N    . GLU A 1 213 ? -16.121 11.371  -5.018  0.016 24.26 ? 211 GLU A N    3  
ATOM   10398  C CA   . GLU A 1 213 ? -16.015 10.570  -3.810  0.016 23.69 ? 211 GLU A CA   3  
ATOM   10399  C C    . GLU A 1 213 ? -14.596 10.056  -3.607  0.016 24.45 ? 211 GLU A C    3  
ATOM   10400  O O    . GLU A 1 213 ? -13.865 9.798   -4.563  0.016 25.14 ? 211 GLU A O    3  
ATOM   10401  C CB   . GLU A 1 213 ? -16.949 9.384   -3.837  0.016 23.01 ? 211 GLU A CB   3  
ATOM   10402  C CG   . GLU A 1 213 ? -18.226 9.523   -3.001  0.016 22.18 ? 211 GLU A CG   3  
ATOM   10403  C CD   . GLU A 1 213 ? -18.832 8.144   -2.873  0.016 21.68 ? 211 GLU A CD   3  
ATOM   10404  O OE1  . GLU A 1 213 ? -19.730 7.907   -2.059  0.016 21.88 ? 211 GLU A OE1  3  
ATOM   10405  O OE2  . GLU A 1 213 ? -18.343 7.255   -3.596  0.016 21.29 ? 211 GLU A OE2  3  
ATOM   10406  H H    . GLU A 1 213 ? -15.649 11.087  -5.675  0.016 24.80 ? 211 GLU A H    3  
ATOM   10407  H HA   . GLU A 1 213 ? -16.258 11.119  -3.050  0.016 23.39 ? 211 GLU A HA   3  
ATOM   10408  H HB2  . GLU A 1 213 ? -17.226 9.231   -4.753  0.016 23.29 ? 211 GLU A HB2  3  
ATOM   10409  H HB3  . GLU A 1 213 ? -16.465 8.612   -3.509  0.016 22.99 ? 211 GLU A HB3  3  
ATOM   10410  H HG2  . GLU A 1 213 ? -18.033 9.880   -2.120  0.016 22.18 ? 211 GLU A HG2  3  
ATOM   10411  H HG3  . GLU A 1 213 ? -18.829 10.098  -3.471  0.016 22.04 ? 211 GLU A HG3  3  
ATOM   10412  N N    . HIS A 1 214 ? -14.244 9.919   -2.337  0.016 24.46 ? 212 HIS A N    3  
ATOM   10413  C CA   . HIS A 1 214 ? -12.964 9.407   -1.889  0.016 25.17 ? 212 HIS A CA   3  
ATOM   10414  C C    . HIS A 1 214 ? -13.217 8.455   -0.728  0.016 24.53 ? 212 HIS A C    3  
ATOM   10415  O O    . HIS A 1 214 ? -13.949 8.798   0.206   0.016 24.00 ? 212 HIS A O    3  
ATOM   10416  C CB   . HIS A 1 214 ? -12.066 10.556  -1.469  0.016 26.19 ? 212 HIS A CB   3  
ATOM   10417  C CG   . HIS A 1 214 ? -10.749 10.114  -0.954  0.016 27.17 ? 212 HIS A CG   3  
ATOM   10418  N ND1  . HIS A 1 214 ? -9.981  9.170   -1.602  0.016 26.95 ? 212 HIS A ND1  3  
ATOM   10419  C CD2  . HIS A 1 214 ? -10.077 10.444  0.173   0.016 28.55 ? 212 HIS A CD2  3  
ATOM   10420  C CE1  . HIS A 1 214 ? -8.879  8.960   -0.910  0.016 28.14 ? 212 HIS A CE1  3  
ATOM   10421  N NE2  . HIS A 1 214 ? -8.910  9.725   0.169   0.016 29.14 ? 212 HIS A NE2  3  
ATOM   10422  H H    . HIS A 1 214 ? -14.757 10.135  -1.687  0.016 24.14 ? 212 HIS A H    3  
ATOM   10423  H HA   . HIS A 1 214 ? -12.537 8.929   -2.609  0.016 25.53 ? 212 HIS A HA   3  
ATOM   10424  H HB2  . HIS A 1 214 ? -11.916 11.137  -2.229  0.016 26.64 ? 212 HIS A HB2  3  
ATOM   10425  H HB3  . HIS A 1 214 ? -12.502 11.044  -0.755  0.016 25.90 ? 212 HIS A HB3  3  
ATOM   10426  H HD1  . HIS A 1 214 ? -10.182 8.787   -2.347  0.016 26.24 ? 212 HIS A HD1  3  
ATOM   10427  H HD2  . HIS A 1 214 ? -10.347 11.057  0.817   0.016 29.10 ? 212 HIS A HD2  3  
ATOM   10428  H HE1  . HIS A 1 214 ? -8.201  8.372   -1.147  0.016 28.32 ? 212 HIS A HE1  3  
ATOM   10429  H HE2  . HIS A 1 214 ? -8.308  9.761   0.778   0.016 30.08 ? 212 HIS A HE2  3  
ATOM   10430  N N    . ALA A 1 215 ? -12.652 7.246   -0.811  0.016 24.68 ? 213 ALA A N    3  
ATOM   10431  C CA   . ALA A 1 215 ? -12.993 6.183   0.123   0.016 24.23 ? 213 ALA A CA   3  
ATOM   10432  C C    . ALA A 1 215 ? -11.774 5.322   0.429   0.016 25.10 ? 213 ALA A C    3  
ATOM   10433  O O    . ALA A 1 215 ? -10.992 5.004   -0.470  0.016 25.69 ? 213 ALA A O    3  
ATOM   10434  C CB   . ALA A 1 215 ? -14.110 5.303   -0.446  0.016 23.35 ? 213 ALA A CB   3  
ATOM   10435  H H    . ALA A 1 215 ? -12.071 7.023   -1.403  0.016 25.13 ? 213 ALA A H    3  
ATOM   10436  H HA   . ALA A 1 215 ? -13.296 6.589   0.948   0.016 24.07 ? 213 ALA A HA   3  
ATOM   10437  H HB1  . ALA A 1 215 ? -14.929 5.823   -0.474  0.016 22.99 ? 213 ALA A HB1  3  
ATOM   10438  H HB2  . ALA A 1 215 ? -13.871 5.012   -1.338  0.016 23.62 ? 213 ALA A HB2  3  
ATOM   10439  H HB3  . ALA A 1 215 ? -14.228 4.536   0.134   0.016 23.04 ? 213 ALA A HB3  3  
ATOM   10440  N N    . GLU A 1 216 ? -11.630 4.942   1.689   0.016 25.31 ? 214 GLU A N    3  
ATOM   10441  C CA   . GLU A 1 216 ? -10.485 4.130   2.102   0.016 26.23 ? 214 GLU A CA   3  
ATOM   10442  C C    . GLU A 1 216 ? -10.935 3.065   3.100   0.016 26.05 ? 214 GLU A C    3  
ATOM   10443  O O    . GLU A 1 216 ? -11.755 3.329   3.981   0.016 25.76 ? 214 GLU A O    3  
ATOM   10444  C CB   . GLU A 1 216 ? -9.373  4.991   2.730   0.016 27.50 ? 214 GLU A CB   3  
ATOM   10445  C CG   . GLU A 1 216 ? -8.214  4.168   3.373   0.016 28.79 ? 214 GLU A CG   3  
ATOM   10446  C CD   . GLU A 1 216 ? -7.414  4.903   4.477   0.016 30.16 ? 214 GLU A CD   3  
ATOM   10447  O OE1  . GLU A 1 216 ? -6.319  5.395   4.170   0.016 31.19 ? 214 GLU A OE1  3  
ATOM   10448  O OE2  . GLU A 1 216 ? -7.864  4.958   5.656   0.016 30.28 ? 214 GLU A OE2  3  
ATOM   10449  H H    . GLU A 1 216 ? -12.178 5.129   2.323   0.016 25.03 ? 214 GLU A H    3  
ATOM   10450  H HA   . GLU A 1 216 ? -10.112 3.689   1.323   0.016 26.31 ? 214 GLU A HA   3  
ATOM   10451  H HB2  . GLU A 1 216 ? -8.993  5.545   2.032   0.016 27.55 ? 214 GLU A HB2  3  
ATOM   10452  H HB3  . GLU A 1 216 ? -9.763  5.548   3.414   0.016 27.60 ? 214 GLU A HB3  3  
ATOM   10453  H HG2  . GLU A 1 216 ? -8.556  3.359   3.772   0.016 28.86 ? 214 GLU A HG2  3  
ATOM   10454  H HG3  . GLU A 1 216 ? -7.584  3.943   2.670   0.016 28.80 ? 214 GLU A HG3  3  
ATOM   10455  N N    . ALA A 1 217 ? -10.386 1.854   2.967   0.016 26.34 ? 215 ALA A N    3  
ATOM   10456  C CA   . ALA A 1 217 ? -10.683 0.778   3.900   0.016 26.34 ? 215 ALA A CA   3  
ATOM   10457  C C    . ALA A 1 217 ? -9.586  0.610   4.951   0.016 27.68 ? 215 ALA A C    3  
ATOM   10458  O O    . ALA A 1 217 ? -8.403  0.888   4.698   0.016 28.63 ? 215 ALA A O    3  
ATOM   10459  C CB   . ALA A 1 217 ? -10.864 -0.538  3.138   0.016 25.89 ? 215 ALA A CB   3  
ATOM   10460  H H    . ALA A 1 217 ? -9.848  1.633   2.336   0.016 26.62 ? 215 ALA A H    3  
ATOM   10461  H HA   . ALA A 1 217 ? -11.512 0.976   4.357   0.016 25.88 ? 215 ALA A HA   3  
ATOM   10462  H HB1  . ALA A 1 217 ? -11.042 -1.250  3.772   0.016 26.01 ? 215 ALA A HB1  3  
ATOM   10463  H HB2  . ALA A 1 217 ? -11.610 -0.439  2.526   0.016 25.13 ? 215 ALA A HB2  3  
ATOM   10464  H HB3  . ALA A 1 217 ? -10.056 -0.728  2.639   0.016 26.35 ? 215 ALA A HB3  3  
ATOM   10465  N N    . ARG A 1 218 ? -9.999  0.193   6.157   0.016 27.92 ? 216 ARG A N    3  
ATOM   10466  C CA   . ARG A 1 218 ? -9.072  -0.105  7.246   0.016 29.31 ? 216 ARG A CA   3  
ATOM   10467  C C    . ARG A 1 218 ? -9.774  -1.046  8.229   0.016 29.31 ? 216 ARG A C    3  
ATOM   10468  O O    . ARG A 1 218 ? -10.967 -1.309  8.117   0.016 28.26 ? 216 ARG A O    3  
ATOM   10469  C CB   . ARG A 1 218 ? -8.567  1.191   7.934   0.016 30.49 ? 216 ARG A CB   3  
ATOM   10470  C CG   . ARG A 1 218 ? -7.271  1.841   7.270   0.016 31.47 ? 216 ARG A CG   3  
ATOM   10471  C CD   . ARG A 1 218 ? -5.947  1.818   8.122   0.016 33.31 ? 216 ARG A CD   3  
ATOM   10472  N NE   . ARG A 1 218 ? -5.626  3.172   8.612   0.016 33.67 ? 216 ARG A NE   3  
ATOM   10473  C CZ   . ARG A 1 218 ? -4.406  3.714   8.697   0.016 35.25 ? 216 ARG A CZ   3  
ATOM   10474  N NH1  . ARG A 1 218 ? -3.318  3.039   8.336   0.016 36.69 ? 216 ARG A NH1  3  
ATOM   10475  N NH2  . ARG A 1 218 ? -4.274  4.953   9.153   0.016 35.54 ? 216 ARG A NH2  3  
ATOM   10476  H H    . ARG A 1 218 ? -10.823 0.073   6.366   0.016 27.39 ? 216 ARG A H    3  
ATOM   10477  H HA   . ARG A 1 218 ? -8.306  -0.570  6.880   0.016 29.62 ? 216 ARG A HA   3  
ATOM   10478  H HB2  . ARG A 1 218 ? -9.281  1.845   7.898   0.016 29.99 ? 216 ARG A HB2  3  
ATOM   10479  H HB3  . ARG A 1 218 ? -8.361  0.998   8.860   0.016 31.27 ? 216 ARG A HB3  3  
ATOM   10480  H HG2  . ARG A 1 218 ? -7.072  1.373   6.448   0.016 31.59 ? 216 ARG A HG2  3  
ATOM   10481  H HG3  . ARG A 1 218 ? -7.456  2.771   7.070   0.016 30.92 ? 216 ARG A HG3  3  
ATOM   10482  H HD2  . ARG A 1 218 ? -6.064  1.238   8.891   0.016 34.12 ? 216 ARG A HD2  3  
ATOM   10483  H HD3  . ARG A 1 218 ? -5.216  1.498   7.567   0.016 33.59 ? 216 ARG A HD3  3  
ATOM   10484  H HE   . ARG A 1 218 ? -6.278  3.641   8.917   0.016 32.78 ? 216 ARG A HE   3  
ATOM   10485  H HH11 . ARG A 1 218 ? -3.382  2.237   8.036   0.016 36.58 ? 216 ARG A HH11 3  
ATOM   10486  H HH12 . ARG A 1 218 ? -2.545  3.409   8.400   0.016 37.80 ? 216 ARG A HH12 3  
ATOM   10487  H HH21 . ARG A 1 218 ? -4.968  5.400   9.393   0.016 34.69 ? 216 ARG A HH21 3  
ATOM   10488  H HH22 . ARG A 1 218 ? -3.493  5.307   9.215   0.016 36.65 ? 216 ARG A HH22 3  
ATOM   10489  N N    . TYR A 1 219 ? -9.016  -1.589  9.179   0.016 30.66 ? 217 TYR A N    3  
ATOM   10490  C CA   . TYR A 1 219 ? -9.664  -2.389  10.219  0.016 30.86 ? 217 TYR A CA   3  
ATOM   10491  C C    . TYR A 1 219 ? -10.169 -1.462  11.309  0.016 31.19 ? 217 TYR A C    3  
ATOM   10492  O O    . TYR A 1 219 ? -9.479  -0.501  11.648  0.016 31.92 ? 217 TYR A O    3  
ATOM   10493  C CB   . TYR A 1 219 ? -8.720  -3.436  10.811  0.016 32.29 ? 217 TYR A CB   3  
ATOM   10494  C CG   . TYR A 1 219 ? -8.529  -4.671  9.942   0.016 31.90 ? 217 TYR A CG   3  
ATOM   10495  C CD1  . TYR A 1 219 ? -7.280  -4.982  9.417   0.016 32.74 ? 217 TYR A CD1  3  
ATOM   10496  C CD2  . TYR A 1 219 ? -9.601  -5.530  9.651   0.016 30.83 ? 217 TYR A CD2  3  
ATOM   10497  C CE1  . TYR A 1 219 ? -7.102  -6.092  8.620   0.016 32.49 ? 217 TYR A CE1  3  
ATOM   10498  C CE2  . TYR A 1 219 ? -9.423  -6.668  8.858   0.016 30.61 ? 217 TYR A CE2  3  
ATOM   10499  C CZ   . TYR A 1 219 ? -8.168  -6.936  8.351   0.016 31.44 ? 217 TYR A CZ   3  
ATOM   10500  O OH   . TYR A 1 219 ? -7.928  -8.024  7.555   0.016 31.38 ? 217 TYR A OH   3  
ATOM   10501  H H    . TYR A 1 219 ? -8.162  -1.522  9.242   0.016 31.53 ? 217 TYR A H    3  
ATOM   10502  H HA   . TYR A 1 219 ? -10.422 -2.859  9.843   0.016 29.98 ? 217 TYR A HA   3  
ATOM   10503  H HB2  . TYR A 1 219 ? -7.850  -3.033  10.952  0.016 33.12 ? 217 TYR A HB2  3  
ATOM   10504  H HB3  . TYR A 1 219 ? -9.087  -3.722  11.661  0.016 32.80 ? 217 TYR A HB3  3  
ATOM   10505  H HD1  . TYR A 1 219 ? -6.558  -4.425  9.593   0.016 33.55 ? 217 TYR A HD1  3  
ATOM   10506  H HD2  . TYR A 1 219 ? -10.442 -5.342  9.999   0.016 30.35 ? 217 TYR A HD2  3  
ATOM   10507  H HE1  . TYR A 1 219 ? -6.260  -6.288  8.277   0.016 33.14 ? 217 TYR A HE1  3  
ATOM   10508  H HE2  . TYR A 1 219 ? -10.142 -7.226  8.667   0.016 30.00 ? 217 TYR A HE2  3  
ATOM   10509  H HH   . TYR A 1 219 ? -7.160  -7.968  7.219   0.016 31.63 ? 217 TYR A HH   3  
HETATM 10510  O O    . HOH B 2 .   ? -11.877 -12.129 -2.943  0.016 27.93 ? 301 HOH A O    3  
HETATM 10511  O O    . HOH B 2 .   ? -19.373 14.389  8.693   0.016 26.41 ? 302 HOH A O    3  
HETATM 10512  O O    . HOH B 2 .   ? -28.935 13.093  -22.063 0.016 36.87 ? 303 HOH A O    3  
HETATM 10513  O O    . HOH B 2 .   ? -38.250 5.279   5.047   0.016 25.47 ? 304 HOH A O    3  
HETATM 10514  O O    . HOH B 2 .   ? -28.323 -8.068  -2.952  0.016 23.30 ? 305 HOH A O    3  
HETATM 10515  O O    . HOH B 2 .   ? -20.786 -11.585 -1.969  0.016 24.21 ? 306 HOH A O    3  
HETATM 10516  O O    . HOH B 2 .   ? -30.953 5.323   10.268  0.016 24.32 ? 307 HOH A O    3  
HETATM 10517  O O    . HOH B 2 .   ? -26.572 -9.875  5.844   0.016 25.82 ? 308 HOH A O    3  
HETATM 10518  O O    . HOH B 2 .   ? -23.772 -18.545 7.552   0.016 31.20 ? 309 HOH A O    3  
HETATM 10519  O O    . HOH B 2 .   ? -29.287 9.080   15.222  0.016 29.09 ? 310 HOH A O    3  
HETATM 10520  O O    . HOH B 2 .   ? -27.935 -0.071  8.117   0.016 22.86 ? 311 HOH A O    3  
HETATM 10521  O O    . HOH B 2 .   ? -7.593  -10.868 -2.298  0.016 30.07 ? 312 HOH A O    3  
HETATM 10522  O O    . HOH B 2 .   ? -13.280 -13.234 5.426   0.016 28.32 ? 313 HOH A O    3  
HETATM 10523  O O    . HOH B 2 .   ? -26.773 12.481  12.477  0.016 26.78 ? 314 HOH A O    3  
HETATM 10524  O O    . HOH B 2 .   ? -7.442  11.670  -11.014 0.016 34.49 ? 315 HOH A O    3  
HETATM 10525  O O    . HOH B 2 .   ? -23.937 -16.104 2.439   0.016 26.99 ? 316 HOH A O    3  
HETATM 10526  O O    . HOH B 2 .   ? -7.093  -3.536  -2.856  0.016 28.89 ? 317 HOH A O    3  
HETATM 10527  O O    . HOH B 2 .   ? -16.551 21.801  -10.500 0.016 31.76 ? 318 HOH A O    3  
HETATM 10528  O O    . HOH B 2 .   ? -6.271  -6.518  -0.726  0.016 29.91 ? 319 HOH A O    3  
HETATM 10529  O O    . HOH B 2 .   ? -21.653 -0.824  2.069   0.016 20.46 ? 320 HOH A O    3  
HETATM 10530  O O    . HOH B 2 .   ? -16.093 -19.129 -9.217  0.016 32.47 ? 321 HOH A O    3  
HETATM 10531  O O    . HOH B 2 .   ? -17.444 -7.252  -17.101 0.016 32.60 ? 322 HOH A O    3  
HETATM 10532  O O    . HOH B 2 .   ? -36.389 24.291  -1.528  0.016 26.72 ? 323 HOH A O    3  
HETATM 10533  O O    . HOH B 2 .   ? -40.878 3.067   -8.201  0.016 27.85 ? 324 HOH A O    3  
HETATM 10534  O O    . HOH B 2 .   ? -9.173  -8.804  -10.329 0.016 31.34 ? 325 HOH A O    3  
HETATM 10535  O O    . HOH B 2 .   ? -34.678 15.538  10.746  0.016 26.99 ? 326 HOH A O    3  
HETATM 10536  O O    . HOH B 2 .   ? -38.617 16.530  -19.053 0.016 35.98 ? 327 HOH A O    3  
HETATM 10537  O O    . HOH B 2 .   ? -14.470 10.101  5.532   0.016 26.30 ? 328 HOH A O    3  
HETATM 10538  O O    . HOH B 2 .   ? -31.467 7.303   -1.189  0.016 20.02 ? 329 HOH A O    3  
HETATM 10539  O O    . HOH B 2 .   ? -28.053 24.128  -4.621  0.016 26.10 ? 330 HOH A O    3  
HETATM 10540  O O    . HOH B 2 .   ? -39.740 14.564  1.476   0.016 24.70 ? 331 HOH A O    3  
HETATM 10541  O O    . HOH B 2 .   ? -22.395 13.191  -18.184 0.016 31.73 ? 332 HOH A O    3  
HETATM 10542  O O    . HOH B 2 .   ? -24.918 -5.307  -16.767 0.016 30.53 ? 333 HOH A O    3  
HETATM 10543  O O    . HOH B 2 .   ? -25.589 20.447  -3.764  0.016 24.03 ? 334 HOH A O    3  
HETATM 10544  O O    . HOH B 2 .   ? -25.076 18.293  -2.077  0.016 22.79 ? 335 HOH A O    3  
HETATM 10545  O O    . HOH B 2 .   ? -20.300 -4.201  -20.132 0.016 34.50 ? 336 HOH A O    3  
HETATM 10546  O O    . HOH B 2 .   ? -16.332 -11.826 -10.323 0.016 28.57 ? 337 HOH A O    3  
HETATM 10547  O O    . HOH B 2 .   ? -33.434 -3.939  -10.112 0.016 26.39 ? 338 HOH A O    3  
HETATM 10548  O O    . HOH B 2 .   ? -32.710 22.756  10.113  0.016 29.03 ? 339 HOH A O    3  
HETATM 10549  O O    . HOH B 2 .   ? -40.904 11.963  -15.710 0.016 32.92 ? 340 HOH A O    3  
HETATM 10550  O O    . HOH B 2 .   ? -14.209 9.116   -18.918 0.016 35.09 ? 341 HOH A O    3  
HETATM 10551  O O    . HOH B 2 .   ? -32.502 17.596  -8.016  0.016 24.03 ? 342 HOH A O    3  
HETATM 10552  O O    . HOH B 2 .   ? -24.124 -1.534  -18.246 0.016 31.19 ? 343 HOH A O    3  
HETATM 10553  O O    . HOH B 2 .   ? -17.434 -4.703  9.933   0.016 26.32 ? 344 HOH A O    3  
HETATM 10554  O O    . HOH B 2 .   ? -24.626 14.311  -2.544  0.016 21.18 ? 345 HOH A O    3  
HETATM 10555  O O    . HOH B 2 .   ? -25.735 -7.657  -5.623  0.016 23.45 ? 346 HOH A O    3  
HETATM 10556  O O    . HOH B 2 .   ? -11.765 -1.764  -4.132  0.016 25.02 ? 347 HOH A O    3  
HETATM 10557  O O    . HOH B 2 .   ? -18.816 5.063   -9.145  0.016 23.18 ? 348 HOH A O    3  
HETATM 10558  O O    . HOH B 2 .   ? -32.774 17.625  -11.813 0.016 27.86 ? 349 HOH A O    3  
HETATM 10559  O O    . HOH B 2 .   ? -24.282 21.908  -0.141  0.016 24.98 ? 350 HOH A O    3  
HETATM 10560  O O    . HOH B 2 .   ? -37.890 8.701   -17.814 0.016 33.56 ? 351 HOH A O    3  
HETATM 10561  O O    . HOH B 2 .   ? -38.177 13.515  3.345   0.016 23.96 ? 352 HOH A O    3  
HETATM 10562  O O    . HOH B 2 .   ? -18.539 -3.628  2.112   0.016 21.92 ? 353 HOH A O    3  
HETATM 10563  O O    . HOH B 2 .   ? -19.226 -17.591 -0.986  0.016 28.20 ? 354 HOH A O    3  
HETATM 10564  O O    . HOH B 2 .   ? -11.114 -15.578 -8.226  0.016 31.73 ? 355 HOH A O    3  
HETATM 10565  O O    . HOH B 2 .   ? -13.255 -6.294  0.265   0.016 24.58 ? 356 HOH A O    3  
HETATM 10566  O O    . HOH B 2 .   ? -33.377 23.996  -2.608  0.016 25.83 ? 357 HOH A O    3  
HETATM 10567  O O    . HOH B 2 .   ? -27.765 18.867  13.089  0.016 29.87 ? 358 HOH A O    3  
HETATM 10568  O O    . HOH B 2 .   ? -16.081 3.418   -2.727  0.016 22.12 ? 359 HOH A O    3  
HETATM 10569  O O    . HOH B 2 .   ? -32.032 19.199  -1.386  0.016 22.97 ? 360 HOH A O    3  
HETATM 10570  O O    . HOH B 2 .   ? -9.641  -12.205 -9.002  0.016 31.40 ? 361 HOH A O    3  
HETATM 10571  O O    . HOH B 2 .   ? -29.575 -2.728  -11.946 0.016 25.39 ? 362 HOH A O    3  
HETATM 10572  O O    . HOH B 2 .   ? -4.262  10.312  -9.535  0.016 35.77 ? 363 HOH A O    3  
HETATM 10573  O O    . HOH B 2 .   ? -34.905 0.399   -15.210 0.016 31.29 ? 364 HOH A O    3  
HETATM 10574  O O    . HOH B 2 .   ? -38.545 4.925   -14.553 0.016 30.61 ? 365 HOH A O    3  
HETATM 10575  O O    . HOH B 2 .   ? -27.600 15.409  -13.142 0.016 26.49 ? 366 HOH A O    3  
HETATM 10576  O O    . HOH B 2 .   ? -32.213 0.201   4.956   0.016 22.19 ? 367 HOH A O    3  
HETATM 10577  O O    . HOH B 2 .   ? -14.557 -17.774 -2.192  0.016 29.44 ? 368 HOH A O    3  
HETATM 10578  O O    . HOH B 2 .   ? -41.408 5.789   -7.428  0.016 27.26 ? 369 HOH A O    3  
HETATM 10579  O O    . HOH B 2 .   ? -35.273 -0.472  -7.256  0.016 24.35 ? 370 HOH A O    3  
HETATM 10580  O O    . HOH B 2 .   ? -4.942  -3.900  -1.604  0.016 30.73 ? 371 HOH A O    3  
HETATM 10581  O O    . HOH B 2 .   ? -45.650 10.151  -0.611  0.016 28.98 ? 372 HOH A O    3  
HETATM 10582  O O    . HOH B 2 .   ? -22.482 17.524  -1.745  0.016 23.06 ? 373 HOH A O    3  
HETATM 10583  O O    . HOH B 2 .   ? -34.250 4.616   9.330   0.016 24.59 ? 374 HOH A O    3  
HETATM 10584  O O    . HOH B 2 .   ? -21.884 20.271  -12.855 0.016 30.03 ? 375 HOH A O    3  
HETATM 10585  O O    . HOH B 2 .   ? -28.045 19.936  -2.163  0.016 23.17 ? 376 HOH A O    3  
HETATM 10586  O O    . HOH B 2 .   ? -38.394 14.120  -19.846 0.016 36.97 ? 377 HOH A O    3  
HETATM 10587  O O    . HOH B 2 .   ? -7.012  -8.240  -2.526  0.016 29.98 ? 378 HOH A O    3  
HETATM 10588  O O    . HOH B 2 .   ? -4.179  0.923   -3.173  0.016 31.90 ? 379 HOH A O    3  
HETATM 10589  O O    . HOH B 2 .   ? -32.202 17.677  13.098  0.016 29.45 ? 380 HOH A O    3  
HETATM 10590  O O    . HOH B 2 .   ? -5.133  -9.146  0.747   0.016 32.14 ? 381 HOH A O    3  
HETATM 10591  O O    . HOH B 2 .   ? -22.799 15.034  -0.381  0.016 21.88 ? 382 HOH A O    3  
HETATM 10592  O O    . HOH B 2 .   ? -22.055 11.190  11.825  0.016 25.96 ? 383 HOH A O    3  
HETATM 10593  O O    . HOH B 2 .   ? -16.370 7.568   -19.585 0.016 34.67 ? 384 HOH A O    3  
HETATM 10594  O O    . HOH B 2 .   ? -17.311 -17.313 -2.650  0.016 28.73 ? 385 HOH A O    3  
HETATM 10595  O O    . HOH B 2 .   ? -23.188 -3.167  -16.509 0.016 29.48 ? 386 HOH A O    3  
HETATM 10596  O O    . HOH B 2 .   ? -34.725 22.418  6.415   0.016 27.10 ? 387 HOH A O    3  
HETATM 10597  O O    . HOH B 2 .   ? -23.457 2.043   -9.461  0.016 22.12 ? 388 HOH A O    3  
HETATM 10598  O O    . HOH B 2 .   ? -12.410 -16.642 1.139   0.016 29.78 ? 389 HOH A O    3  
HETATM 10599  O O    . HOH B 2 .   ? -17.895 4.428   -4.293  0.016 21.52 ? 390 HOH A O    3  
HETATM 10600  O O    . HOH B 2 .   ? -33.249 16.547  -19.991 0.016 35.20 ? 391 HOH A O    3  
HETATM 10601  O O    . HOH B 2 .   ? -6.277  10.675  -5.635  0.016 32.57 ? 392 HOH A O    3  
HETATM 10602  O O    . HOH B 2 .   ? -40.572 4.233   -12.131 0.016 32.01 ? 393 HOH A O    3  
HETATM 1060