data_5F1B
# 
_entry.id   5F1B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5F1B         
WWPDB D_1000215827 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          5F18 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5F1B 
_pdbx_database_status.recvd_initial_deposition_date   2015-11-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, H.'  1 
'Shi, Y.'   2 
'Song, J.'  3 
'Qi, J.'    4 
'Lu, G.'    5 
'Yan, J.'   6 
'Gao, G.F.' 7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            164 
_citation.language                  ? 
_citation.page_first                258 
_citation.page_last                 268 
_citation.title                     'Ebola Viral Glycoprotein Bound to Its Endosomal Receptor Niemann-Pick C1.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2015.12.044 
_citation.pdbx_database_id_PubMed   26771495 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, H.'  1 ? 
primary 'Shi, Y.'   2 ? 
primary 'Song, J.'  3 ? 
primary 'Qi, J.'    4 ? 
primary 'Lu, G.'    5 ? 
primary 'Yan, J.'   6 ? 
primary 'Gao, G.F.' 7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5F1B 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     107.261 
_cell.length_a_esd                 ? 
_cell.length_b                     107.261 
_cell.length_b_esd                 ? 
_cell.length_c                     93.777 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5F1B 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer  man GP1                                                                                       17194.543 1   ? ? 
'UNP RESIDUES 32-188'  ? 
2 polymer  man GP2                                                                                       14882.807 1   ? ? 
'UNP RESIDUES 509-598' ? 
3 polymer  man 'Niemann-Pick C1 protein'                                                                 29436.582 1   ? ? 
'UNP RESIDUES 374-620' ? 
4 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ? ? ? ? 
5 water    nat water                                                                                     18.015    171 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 GP1,2,GP 
2 GP1,2,GP 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;RSIPLGVIHNSVLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYN
LEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQ
;
;RSIPLGVIHNSVLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYN
LEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQ
;
A ? 
2 'polypeptide(L)' no no 
;PKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTFSILNRK
AIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDHHHHHH
;
;PKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTFSILNRK
AIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDHHHHHH
;
B ? 
3 'polypeptide(L)' no no 
;MTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLIIRAPLTDKHIYQPYPSGADVPFGPPLDIQILHQVLDLQIAIEN
ITASYDNETVTLQDICLAPLSPYNTNCTILSVLNYFQNSHSVLDHKKGDDFFVYADYHTHFLYCVRAPASLNDTSLLHDP
CLGTFGGPVFPWLVLGGYDDQNYNNATALVITFPVNNYYNDTEKLQRAQAWEKEFINFVKNYKNPNLTISFTAERSIEDE
LNRESDSDLEHHHHHH
;
;MTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLIIRAPLTDKHIYQPYPSGADVPFGPPLDIQILHQVLDLQIAIEN
ITASYDNETVTLQDICLAPLSPYNTNCTILSVLNYFQNSHSVLDHKKGDDFFVYADYHTHFLYCVRAPASLNDTSLLHDP
CLGTFGGPVFPWLVLGGYDDQNYNNATALVITFPVNNYYNDTEKLQRAQAWEKEFINFVKNYKNPNLTISFTAERSIEDE
LNRESDSDLEHHHHHH
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   SER n 
1 3   ILE n 
1 4   PRO n 
1 5   LEU n 
1 6   GLY n 
1 7   VAL n 
1 8   ILE n 
1 9   HIS n 
1 10  ASN n 
1 11  SER n 
1 12  VAL n 
1 13  LEU n 
1 14  GLN n 
1 15  VAL n 
1 16  SER n 
1 17  ASP n 
1 18  VAL n 
1 19  ASP n 
1 20  LYS n 
1 21  LEU n 
1 22  VAL n 
1 23  CYS n 
1 24  ARG n 
1 25  ASP n 
1 26  LYS n 
1 27  LEU n 
1 28  SER n 
1 29  SER n 
1 30  THR n 
1 31  ASN n 
1 32  GLN n 
1 33  LEU n 
1 34  ARG n 
1 35  SER n 
1 36  VAL n 
1 37  GLY n 
1 38  LEU n 
1 39  ASN n 
1 40  LEU n 
1 41  GLU n 
1 42  GLY n 
1 43  ASN n 
1 44  GLY n 
1 45  VAL n 
1 46  ALA n 
1 47  THR n 
1 48  ASP n 
1 49  VAL n 
1 50  PRO n 
1 51  SER n 
1 52  ALA n 
1 53  THR n 
1 54  LYS n 
1 55  ARG n 
1 56  TRP n 
1 57  GLY n 
1 58  PHE n 
1 59  ARG n 
1 60  SER n 
1 61  GLY n 
1 62  VAL n 
1 63  PRO n 
1 64  PRO n 
1 65  LYS n 
1 66  VAL n 
1 67  VAL n 
1 68  ASN n 
1 69  TYR n 
1 70  GLU n 
1 71  ALA n 
1 72  GLY n 
1 73  GLU n 
1 74  TRP n 
1 75  ALA n 
1 76  GLU n 
1 77  ASN n 
1 78  CYS n 
1 79  TYR n 
1 80  ASN n 
1 81  LEU n 
1 82  GLU n 
1 83  ILE n 
1 84  LYS n 
1 85  LYS n 
1 86  PRO n 
1 87  ASP n 
1 88  GLY n 
1 89  SER n 
1 90  GLU n 
1 91  CYS n 
1 92  LEU n 
1 93  PRO n 
1 94  ALA n 
1 95  ALA n 
1 96  PRO n 
1 97  ASP n 
1 98  GLY n 
1 99  ILE n 
1 100 ARG n 
1 101 GLY n 
1 102 PHE n 
1 103 PRO n 
1 104 ARG n 
1 105 CYS n 
1 106 ARG n 
1 107 TYR n 
1 108 VAL n 
1 109 HIS n 
1 110 LYS n 
1 111 VAL n 
1 112 SER n 
1 113 GLY n 
1 114 THR n 
1 115 GLY n 
1 116 PRO n 
1 117 CYS n 
1 118 ALA n 
1 119 GLY n 
1 120 ASP n 
1 121 PHE n 
1 122 ALA n 
1 123 PHE n 
1 124 HIS n 
1 125 LYS n 
1 126 GLU n 
1 127 GLY n 
1 128 ALA n 
1 129 PHE n 
1 130 PHE n 
1 131 LEU n 
1 132 TYR n 
1 133 ASP n 
1 134 ARG n 
1 135 LEU n 
1 136 ALA n 
1 137 SER n 
1 138 THR n 
1 139 VAL n 
1 140 ILE n 
1 141 TYR n 
1 142 ARG n 
1 143 GLY n 
1 144 THR n 
1 145 THR n 
1 146 PHE n 
1 147 ALA n 
1 148 GLU n 
1 149 GLY n 
1 150 VAL n 
1 151 VAL n 
1 152 ALA n 
1 153 PHE n 
1 154 LEU n 
1 155 ILE n 
1 156 LEU n 
1 157 PRO n 
1 158 GLN n 
2 1   PRO n 
2 2   LYS n 
2 3   CYS n 
2 4   ASN n 
2 5   PRO n 
2 6   ASN n 
2 7   LEU n 
2 8   HIS n 
2 9   TYR n 
2 10  TRP n 
2 11  THR n 
2 12  THR n 
2 13  GLN n 
2 14  ASP n 
2 15  GLU n 
2 16  GLY n 
2 17  ALA n 
2 18  ALA n 
2 19  ILE n 
2 20  GLY n 
2 21  LEU n 
2 22  ALA n 
2 23  TRP n 
2 24  ILE n 
2 25  PRO n 
2 26  TYR n 
2 27  PHE n 
2 28  GLY n 
2 29  PRO n 
2 30  ALA n 
2 31  ALA n 
2 32  GLU n 
2 33  GLY n 
2 34  ILE n 
2 35  TYR n 
2 36  THR n 
2 37  GLU n 
2 38  GLY n 
2 39  LEU n 
2 40  MET n 
2 41  HIS n 
2 42  ASN n 
2 43  GLN n 
2 44  ASP n 
2 45  GLY n 
2 46  LEU n 
2 47  ILE n 
2 48  CYS n 
2 49  GLY n 
2 50  LEU n 
2 51  ARG n 
2 52  GLN n 
2 53  LEU n 
2 54  ALA n 
2 55  ASN n 
2 56  GLU n 
2 57  THR n 
2 58  THR n 
2 59  GLN n 
2 60  ALA n 
2 61  LEU n 
2 62  GLN n 
2 63  LEU n 
2 64  PHE n 
2 65  LEU n 
2 66  ARG n 
2 67  ALA n 
2 68  THR n 
2 69  THR n 
2 70  GLU n 
2 71  LEU n 
2 72  ARG n 
2 73  THR n 
2 74  PHE n 
2 75  SER n 
2 76  ILE n 
2 77  LEU n 
2 78  ASN n 
2 79  ARG n 
2 80  LYS n 
2 81  ALA n 
2 82  ILE n 
2 83  ASP n 
2 84  PHE n 
2 85  LEU n 
2 86  LEU n 
2 87  GLN n 
2 88  ARG n 
2 89  TRP n 
2 90  GLY n 
2 91  GLY n 
2 92  THR n 
2 93  CYS n 
2 94  HIS n 
2 95  ILE n 
2 96  LEU n 
2 97  GLY n 
2 98  PRO n 
2 99  ASP n 
2 100 CYS n 
2 101 CYS n 
2 102 ILE n 
2 103 GLU n 
2 104 PRO n 
2 105 HIS n 
2 106 ASP n 
2 107 TRP n 
2 108 THR n 
2 109 LYS n 
2 110 ASN n 
2 111 ILE n 
2 112 THR n 
2 113 ASP n 
2 114 LYS n 
2 115 ILE n 
2 116 ASP n 
2 117 GLN n 
2 118 ILE n 
2 119 ILE n 
2 120 HIS n 
2 121 ASP n 
2 122 PHE n 
2 123 VAL n 
2 124 ASP n 
2 125 HIS n 
2 126 HIS n 
2 127 HIS n 
2 128 HIS n 
2 129 HIS n 
2 130 HIS n 
3 1   MET n 
3 2   THR n 
3 3   THR n 
3 4   ASN n 
3 5   PRO n 
3 6   VAL n 
3 7   ASP n 
3 8   LEU n 
3 9   TRP n 
3 10  SER n 
3 11  ALA n 
3 12  PRO n 
3 13  SER n 
3 14  SER n 
3 15  GLN n 
3 16  ALA n 
3 17  ARG n 
3 18  LEU n 
3 19  GLU n 
3 20  LYS n 
3 21  GLU n 
3 22  TYR n 
3 23  PHE n 
3 24  ASP n 
3 25  GLN n 
3 26  HIS n 
3 27  PHE n 
3 28  GLY n 
3 29  PRO n 
3 30  PHE n 
3 31  PHE n 
3 32  ARG n 
3 33  THR n 
3 34  GLU n 
3 35  GLN n 
3 36  LEU n 
3 37  ILE n 
3 38  ILE n 
3 39  ARG n 
3 40  ALA n 
3 41  PRO n 
3 42  LEU n 
3 43  THR n 
3 44  ASP n 
3 45  LYS n 
3 46  HIS n 
3 47  ILE n 
3 48  TYR n 
3 49  GLN n 
3 50  PRO n 
3 51  TYR n 
3 52  PRO n 
3 53  SER n 
3 54  GLY n 
3 55  ALA n 
3 56  ASP n 
3 57  VAL n 
3 58  PRO n 
3 59  PHE n 
3 60  GLY n 
3 61  PRO n 
3 62  PRO n 
3 63  LEU n 
3 64  ASP n 
3 65  ILE n 
3 66  GLN n 
3 67  ILE n 
3 68  LEU n 
3 69  HIS n 
3 70  GLN n 
3 71  VAL n 
3 72  LEU n 
3 73  ASP n 
3 74  LEU n 
3 75  GLN n 
3 76  ILE n 
3 77  ALA n 
3 78  ILE n 
3 79  GLU n 
3 80  ASN n 
3 81  ILE n 
3 82  THR n 
3 83  ALA n 
3 84  SER n 
3 85  TYR n 
3 86  ASP n 
3 87  ASN n 
3 88  GLU n 
3 89  THR n 
3 90  VAL n 
3 91  THR n 
3 92  LEU n 
3 93  GLN n 
3 94  ASP n 
3 95  ILE n 
3 96  CYS n 
3 97  LEU n 
3 98  ALA n 
3 99  PRO n 
3 100 LEU n 
3 101 SER n 
3 102 PRO n 
3 103 TYR n 
3 104 ASN n 
3 105 THR n 
3 106 ASN n 
3 107 CYS n 
3 108 THR n 
3 109 ILE n 
3 110 LEU n 
3 111 SER n 
3 112 VAL n 
3 113 LEU n 
3 114 ASN n 
3 115 TYR n 
3 116 PHE n 
3 117 GLN n 
3 118 ASN n 
3 119 SER n 
3 120 HIS n 
3 121 SER n 
3 122 VAL n 
3 123 LEU n 
3 124 ASP n 
3 125 HIS n 
3 126 LYS n 
3 127 LYS n 
3 128 GLY n 
3 129 ASP n 
3 130 ASP n 
3 131 PHE n 
3 132 PHE n 
3 133 VAL n 
3 134 TYR n 
3 135 ALA n 
3 136 ASP n 
3 137 TYR n 
3 138 HIS n 
3 139 THR n 
3 140 HIS n 
3 141 PHE n 
3 142 LEU n 
3 143 TYR n 
3 144 CYS n 
3 145 VAL n 
3 146 ARG n 
3 147 ALA n 
3 148 PRO n 
3 149 ALA n 
3 150 SER n 
3 151 LEU n 
3 152 ASN n 
3 153 ASP n 
3 154 THR n 
3 155 SER n 
3 156 LEU n 
3 157 LEU n 
3 158 HIS n 
3 159 ASP n 
3 160 PRO n 
3 161 CYS n 
3 162 LEU n 
3 163 GLY n 
3 164 THR n 
3 165 PHE n 
3 166 GLY n 
3 167 GLY n 
3 168 PRO n 
3 169 VAL n 
3 170 PHE n 
3 171 PRO n 
3 172 TRP n 
3 173 LEU n 
3 174 VAL n 
3 175 LEU n 
3 176 GLY n 
3 177 GLY n 
3 178 TYR n 
3 179 ASP n 
3 180 ASP n 
3 181 GLN n 
3 182 ASN n 
3 183 TYR n 
3 184 ASN n 
3 185 ASN n 
3 186 ALA n 
3 187 THR n 
3 188 ALA n 
3 189 LEU n 
3 190 VAL n 
3 191 ILE n 
3 192 THR n 
3 193 PHE n 
3 194 PRO n 
3 195 VAL n 
3 196 ASN n 
3 197 ASN n 
3 198 TYR n 
3 199 TYR n 
3 200 ASN n 
3 201 ASP n 
3 202 THR n 
3 203 GLU n 
3 204 LYS n 
3 205 LEU n 
3 206 GLN n 
3 207 ARG n 
3 208 ALA n 
3 209 GLN n 
3 210 ALA n 
3 211 TRP n 
3 212 GLU n 
3 213 LYS n 
3 214 GLU n 
3 215 PHE n 
3 216 ILE n 
3 217 ASN n 
3 218 PHE n 
3 219 VAL n 
3 220 LYS n 
3 221 ASN n 
3 222 TYR n 
3 223 LYS n 
3 224 ASN n 
3 225 PRO n 
3 226 ASN n 
3 227 LEU n 
3 228 THR n 
3 229 ILE n 
3 230 SER n 
3 231 PHE n 
3 232 THR n 
3 233 ALA n 
3 234 GLU n 
3 235 ARG n 
3 236 SER n 
3 237 ILE n 
3 238 GLU n 
3 239 ASP n 
3 240 GLU n 
3 241 LEU n 
3 242 ASN n 
3 243 ARG n 
3 244 GLU n 
3 245 SER n 
3 246 ASP n 
3 247 SER n 
3 248 ASP n 
3 249 LEU n 
3 250 GLU n 
3 251 HIS n 
3 252 HIS n 
3 253 HIS n 
3 254 HIS n 
3 255 HIS n 
3 256 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 158 ZEBOV ? GP   ? Kikwit-95 ? ? ? ? 'Zaire ebolavirus' 128951 ? ? ? ? ? ? ? ? 
'Trichoplusia ni'  7111 ? ? ? ? ? ? ? ? 'High Five cells' ? ? ? ? ? baculovirus pFastbac1 ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 130 ZEBOV ? GP   ? Kikwit-95 ? ? ? ? 'Zaire ebolavirus' 128951 ? ? ? ? ? ? ? ? 
'Trichoplusia ni'  7111 ? ? ? ? ? ? ? ? 'High Five cells' ? ? ? ? ? baculovirus pFastbac1 ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 256 Human ? NPC1 ? ?         ? ? ? ? 'Homo sapiens'     9606   ? ? ? ? ? ? ? ? 
'Escherichia coli' 562  ? ? ? ? ? ? ? ? ?                 ? ? ? ? ? ?           ?         ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP VGP_EBOZ5  P87666 ? 1 
;SIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNL
EIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQ
;
32  
2 UNP VGP_EBOZ5  P87666 ? 2 
;PKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTFSILNRK
AIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVD
;
509 
3 UNP NPC1_HUMAN O15118 ? 3 
;TTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLIIRAPLTDKHIYQPYPSGADVPFGPPLDIQILHQVLDLQIAIENI
TASYDNETVTLQDICLAPLSPYNTNCTILSVLNYFQNSHSVLDHKKGDDFFVYADYHTHFLYCVRAPASLNDTSLLHDPC
LGTFGGPVFPWLVLGGYDDQNYNNATALVITFPVNNYYNDTEKLQRAQAWEKEFINFVKNYKNPNLTISFTAERSIEDEL
NRESDSD
;
374 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5F1B A 2 ? 158 ? P87666 32  ? 188 ? 32  188 
2 2 5F1B B 1 ? 124 ? P87666 509 ? 632 ? 509 632 
3 3 5F1B C 2 ? 248 ? O15118 374 ? 620 ? 2   248 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5F1B ARG A 1   ? UNP P87666 ?   ?  'expression tag'      31  1  
1 5F1B VAL A 12  ? UNP P87666 THR 42 'engineered mutation' 42  2  
2 5F1B HIS B 125 ? UNP P87666 ?   ?  'expression tag'      633 3  
2 5F1B HIS B 126 ? UNP P87666 ?   ?  'expression tag'      634 4  
2 5F1B HIS B 127 ? UNP P87666 ?   ?  'expression tag'      635 5  
2 5F1B HIS B 128 ? UNP P87666 ?   ?  'expression tag'      636 6  
2 5F1B HIS B 129 ? UNP P87666 ?   ?  'expression tag'      637 7  
2 5F1B HIS B 130 ? UNP P87666 ?   ?  'expression tag'      638 8  
3 5F1B MET C 1   ? UNP O15118 ?   ?  'expression tag'      1   9  
3 5F1B LEU C 249 ? UNP O15118 ?   ?  'expression tag'      249 10 
3 5F1B GLU C 250 ? UNP O15118 ?   ?  'expression tag'      250 11 
3 5F1B HIS C 251 ? UNP O15118 ?   ?  'expression tag'      251 12 
3 5F1B HIS C 252 ? UNP O15118 ?   ?  'expression tag'      252 13 
3 5F1B HIS C 253 ? UNP O15118 ?   ?  'expression tag'      253 14 
3 5F1B HIS C 254 ? UNP O15118 ?   ?  'expression tag'      254 15 
3 5F1B HIS C 255 ? UNP O15118 ?   ?  'expression tag'      255 16 
3 5F1B HIS C 256 ? UNP O15118 ?   ?  'expression tag'      256 17 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5F1B 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.53 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.41 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15% (v/v) pentaerythritolpropoxylate, 0.2M sodium chloride, pH 5.5, 0.1M MES-NaOH' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-06-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL19U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9793 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL19U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5F1B 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.3 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       27329 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  19.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            32.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5F1B 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.30 
_refine.ls_d_res_low                             41.858 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     27310 
_refine.ls_number_reflns_R_free                  1369 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.97 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1837 
_refine.ls_R_factor_R_free                       0.2301 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1813 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3CSY 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.61 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.28 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3657 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             171 
_refine_hist.number_atoms_total               3828 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        41.858 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 3761 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.152  ? 5123 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.571 ? 1333 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.052  ? 567  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 667  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2992 2.3813  . . 141 2557 100.00 . . . 0.2800 . 0.2343 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3813 2.4767  . . 127 2567 100.00 . . . 0.2849 . 0.2130 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4767 2.5894  . . 146 2584 100.00 . . . 0.2513 . 0.2061 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5894 2.7259  . . 137 2594 100.00 . . . 0.2677 . 0.2071 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7259 2.8966  . . 142 2586 100.00 . . . 0.2719 . 0.1978 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8966 3.1202  . . 109 2603 100.00 . . . 0.2875 . 0.2022 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1202 3.4340  . . 144 2601 100.00 . . . 0.2563 . 0.1971 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4340 3.9306  . . 145 2587 100.00 . . . 0.1976 . 0.1713 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9306 4.9509  . . 137 2605 100.00 . . . 0.1904 . 0.1467 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9509 41.8651 . . 141 2657 100.00 . . . 0.2222 . 0.1748 . . . . . . . . . . 
# 
_struct.entry_id                     5F1B 
_struct.title                        
'Structural basis of Ebola virus entry: viral glycoprotein bound to its endosomal receptor Niemann-Pick C1' 
_struct.pdbx_descriptor              'GP1, GP2, Niemann-Pick C1 protein' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5F1B 
_struct_keywords.text            'Ebola virus, glycoprotein, NPC1-C, VIRAL PROTEIN-TRANSPORT PROTEIN complex' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN/TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 29  ? ASN A 31  ? SER A 59  ASN A 61  5 ? 3  
HELX_P HELX_P2  AA2 ASP A 48  ? THR A 53  ? ASP A 78  THR A 83  1 ? 6  
HELX_P HELX_P3  AA3 ALA B 30  ? GLY B 33  ? ALA B 538 GLY B 541 5 ? 4  
HELX_P HELX_P4  AA4 GLN B 43  ? THR B 68  ? GLN B 551 THR B 576 1 ? 26 
HELX_P HELX_P5  AA5 SER B 75  ? ARG B 88  ? SER B 583 ARG B 596 1 ? 14 
HELX_P HELX_P6  AA6 GLU C 19  ? HIS C 26  ? GLU C 19  HIS C 26  1 ? 8  
HELX_P HELX_P7  AA7 GLY C 60  ? LEU C 63  ? GLY C 60  LEU C 63  5 ? 4  
HELX_P HELX_P8  AA8 ASP C 64  ? ASN C 80  ? ASP C 64  ASN C 80  1 ? 17 
HELX_P HELX_P9  AA9 THR C 91  ? CYS C 96  ? THR C 91  CYS C 96  1 ? 6  
HELX_P HELX_P10 AB1 SER C 111 ? GLN C 117 ? SER C 111 GLN C 117 5 ? 7  
HELX_P HELX_P11 AB2 SER C 119 ? ASP C 124 ? SER C 119 ASP C 124 1 ? 6  
HELX_P HELX_P12 AB3 ASP C 136 ? VAL C 145 ? ASP C 136 VAL C 145 1 ? 10 
HELX_P HELX_P13 AB4 PHE C 170 ? VAL C 174 ? PHE C 170 VAL C 174 1 ? 5  
HELX_P HELX_P14 AB5 ASN C 182 ? ALA C 186 ? ASN C 182 ALA C 186 5 ? 5  
HELX_P HELX_P15 AB6 ASP C 201 ? ASN C 221 ? ASP C 201 ASN C 221 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 78  SG  ? ? ? 1_555 A CYS 105 SG ? ? A CYS 108 A CYS 135 1_555 ? ? ? ? ? ? ? 2.072 ? ?               
disulf2 disulf ?    ? A CYS 91  SG  ? ? ? 1_555 A CYS 117 SG ? ? A CYS 121 A CYS 147 1_555 ? ? ? ? ? ? ? 2.062 ? ?               
disulf3 disulf ?    ? B CYS 3   SG  ? ? ? 1_555 B CYS 48  SG ? ? B CYS 511 B CYS 556 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf4 disulf ?    ? C CYS 96  SG  ? ? ? 1_555 C CYS 107 SG ? ? C CYS 96  C CYS 107 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf5 disulf ?    ? C CYS 144 SG  ? ? ? 1_555 C CYS 161 SG ? ? C CYS 144 C CYS 161 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
covale1 covale one  ? B ASN 55  ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 563 D NAG 1   1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale2 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.454 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 28  C . ? GLY 28  C PRO 29  C ? PRO 29  C 1 0.44  
2 TYR 51  C . ? TYR 51  C PRO 52  C ? PRO 52  C 1 -0.28 
3 SER 101 C . ? SER 101 C PRO 102 C ? PRO 102 C 1 -3.71 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 7 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 13  ? SER A 16  ? LEU A 43  SER A 46  
AA1 2 LEU A 5   ? ILE A 8   ? LEU A 35  ILE A 38  
AA1 3 ALA A 147 ? ILE A 155 ? ALA A 177 ILE A 185 
AA1 4 LEU A 33  ? ASN A 39  ? LEU A 63  ASN A 69  
AA2 1 LEU A 13  ? SER A 16  ? LEU A 43  SER A 46  
AA2 2 LEU A 5   ? ILE A 8   ? LEU A 35  ILE A 38  
AA2 3 ALA A 147 ? ILE A 155 ? ALA A 177 ILE A 185 
AA2 4 PHE A 129 ? LEU A 131 ? PHE A 159 LEU A 161 
AA2 5 LEU A 135 ? SER A 137 ? LEU A 165 SER A 167 
AA2 6 VAL A 66  ? ASN A 68  ? VAL A 96  ASN A 98  
AA2 7 ARG B 72  ? THR B 73  ? ARG B 580 THR B 581 
AA3 1 TRP A 56  ? ARG A 59  ? TRP A 86  ARG A 89  
AA3 2 PHE A 121 ? HIS A 124 ? PHE A 151 HIS A 154 
AA4 1 ALA A 71  ? GLU A 73  ? ALA A 101 GLU A 103 
AA4 2 LEU B 7   ? THR B 12  ? LEU B 515 THR B 520 
AA4 3 TYR B 35  ? MET B 40  ? TYR B 543 MET B 548 
AA5 1 ALA A 75  ? LYS A 84  ? ALA A 105 LYS A 114 
AA5 2 CYS A 105 ? THR A 114 ? CYS A 135 THR A 144 
AA6 1 LEU C 175 ? GLY C 176 ? LEU C 175 GLY C 176 
AA6 2 ALA C 188 ? ASN C 196 ? ALA C 188 ASN C 196 
AA6 3 PHE C 31  ? ARG C 39  ? PHE C 31  ARG C 39  
AA6 4 THR C 228 ? SER C 230 ? THR C 228 SER C 230 
AA7 1 HIS C 46  ? TYR C 48  ? HIS C 46  TYR C 48  
AA7 2 VAL C 57  ? PHE C 59  ? VAL C 57  PHE C 59  
AA8 1 ALA C 83  ? TYR C 85  ? ALA C 83  TYR C 85  
AA8 2 GLU C 88  ? VAL C 90  ? GLU C 88  VAL C 90  
AA9 1 LYS C 127 ? GLY C 128 ? LYS C 127 GLY C 128 
AA9 2 VAL C 133 ? ALA C 135 ? VAL C 133 ALA C 135 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLN A 14  ? O GLN A 44  N VAL A 7   ? N VAL A 37  
AA1 2 3 N GLY A 6   ? N GLY A 36  O PHE A 153 ? O PHE A 183 
AA1 3 4 O LEU A 154 ? O LEU A 184 N ARG A 34  ? N ARG A 64  
AA2 1 2 O GLN A 14  ? O GLN A 44  N VAL A 7   ? N VAL A 37  
AA2 2 3 N GLY A 6   ? N GLY A 36  O PHE A 153 ? O PHE A 183 
AA2 3 4 O ALA A 147 ? O ALA A 177 N LEU A 131 ? N LEU A 161 
AA2 4 5 N PHE A 130 ? N PHE A 160 O SER A 137 ? O SER A 167 
AA2 5 6 O ALA A 136 ? O ALA A 166 N VAL A 67  ? N VAL A 97  
AA2 6 7 N VAL A 66  ? N VAL A 96  O THR B 73  ? O THR B 581 
AA3 1 2 N GLY A 57  ? N GLY A 87  O PHE A 123 ? O PHE A 153 
AA4 1 2 N GLY A 72  ? N GLY A 102 O TRP B 10  ? O TRP B 518 
AA4 2 3 N THR B 11  ? N THR B 519 O THR B 36  ? O THR B 544 
AA5 1 2 N ALA A 75  ? N ALA A 105 O ARG A 106 ? O ARG A 136 
AA6 1 2 N GLY C 176 ? N GLY C 176 O ALA C 188 ? O ALA C 188 
AA6 2 3 O VAL C 195 ? O VAL C 195 N ARG C 32  ? N ARG C 32  
AA6 3 4 N ILE C 37  ? N ILE C 37  O SER C 230 ? O SER C 230 
AA7 1 2 N HIS C 46  ? N HIS C 46  O PHE C 59  ? O PHE C 59  
AA8 1 2 N ALA C 83  ? N ALA C 83  O VAL C 90  ? O VAL C 90  
AA9 1 2 N LYS C 127 ? N LYS C 127 O TYR C 134 ? O TYR C 134 
# 
_atom_sites.entry_id                    5F1B 
_atom_sites.fract_transf_matrix[1][1]   0.009323 
_atom_sites.fract_transf_matrix[1][2]   0.005383 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010765 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010664 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 1   ? 46.925 -10.526 -286.188 1.00 112.81 ?  31  ARG A N   1 
ATOM   2    C CA  . ARG A 1 1   ? 47.868 -11.449 -286.806 1.00 116.14 ?  31  ARG A CA  1 
ATOM   3    C C   . ARG A 1 1   ? 47.705 -12.877 -286.276 1.00 114.79 ?  31  ARG A C   1 
ATOM   4    O O   . ARG A 1 1   ? 48.677 -13.632 -286.204 1.00 117.68 ?  31  ARG A O   1 
ATOM   5    C CB  . ARG A 1 1   ? 49.312 -10.976 -286.582 1.00 118.52 ?  31  ARG A CB  1 
ATOM   6    C CG  . ARG A 1 1   ? 49.744 -10.922 -285.117 1.00 124.07 ?  31  ARG A CG  1 
ATOM   7    C CD  . ARG A 1 1   ? 51.192 -10.462 -284.982 1.00 127.20 ?  31  ARG A CD  1 
ATOM   8    N NE  . ARG A 1 1   ? 51.367 -9.103  -285.486 1.00 127.73 ?  31  ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 1   ? 51.145 -8.003  -284.771 1.00 132.64 ?  31  ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 1   ? 50.740 -8.092  -283.507 1.00 131.25 ?  31  ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 1   ? 51.327 -6.809  -285.321 1.00 129.67 ?  31  ARG A NH2 1 
ATOM   12   N N   . SER A 1 2   ? 46.484 -13.247 -285.900 1.00 68.00  ?  32  SER A N   1 
ATOM   13   C CA  . SER A 1 2   ? 46.231 -14.596 -285.402 1.00 64.95  ?  32  SER A CA  1 
ATOM   14   C C   . SER A 1 2   ? 44.878 -15.143 -285.848 1.00 56.14  ?  32  SER A C   1 
ATOM   15   O O   . SER A 1 2   ? 43.844 -14.499 -285.699 1.00 51.56  ?  32  SER A O   1 
ATOM   16   C CB  . SER A 1 2   ? 46.334 -14.651 -283.866 1.00 70.84  ?  32  SER A CB  1 
ATOM   17   O OG  . SER A 1 2   ? 47.583 -14.159 -283.405 1.00 76.19  ?  32  SER A OG  1 
ATOM   18   N N   . ILE A 1 3   ? 44.915 -16.353 -286.394 1.00 51.20  ?  33  ILE A N   1 
ATOM   19   C CA  . ILE A 1 3   ? 43.731 -17.085 -286.826 1.00 52.18  ?  33  ILE A CA  1 
ATOM   20   C C   . ILE A 1 3   ? 42.865 -17.521 -285.637 1.00 52.89  ?  33  ILE A C   1 
ATOM   21   O O   . ILE A 1 3   ? 43.320 -18.278 -284.779 1.00 46.18  ?  33  ILE A O   1 
ATOM   22   C CB  . ILE A 1 3   ? 44.142 -18.322 -287.654 1.00 45.63  ?  33  ILE A CB  1 
ATOM   23   C CG1 . ILE A 1 3   ? 44.752 -17.874 -288.985 1.00 44.19  ?  33  ILE A CG1 1 
ATOM   24   C CG2 . ILE A 1 3   ? 42.954 -19.245 -287.882 1.00 47.12  ?  33  ILE A CG2 1 
ATOM   25   C CD1 . ILE A 1 3   ? 45.515 -18.964 -289.707 1.00 41.88  ?  33  ILE A CD1 1 
ATOM   26   N N   . PRO A 1 4   ? 41.615 -17.028 -285.584 1.00 50.87  ?  34  PRO A N   1 
ATOM   27   C CA  . PRO A 1 4   ? 40.653 -17.378 -284.529 1.00 51.11  ?  34  PRO A CA  1 
ATOM   28   C C   . PRO A 1 4   ? 40.345 -18.872 -284.485 1.00 54.37  ?  34  PRO A C   1 
ATOM   29   O O   . PRO A 1 4   ? 40.270 -19.534 -285.521 1.00 53.84  ?  34  PRO A O   1 
ATOM   30   C CB  . PRO A 1 4   ? 39.401 -16.587 -284.911 1.00 56.07  ?  34  PRO A CB  1 
ATOM   31   C CG  . PRO A 1 4   ? 39.897 -15.481 -285.802 1.00 54.24  ?  34  PRO A CG  1 
ATOM   32   C CD  . PRO A 1 4   ? 41.067 -16.042 -286.534 1.00 48.88  ?  34  PRO A CD  1 
ATOM   33   N N   . LEU A 1 5   ? 40.170 -19.390 -283.278 1.00 54.62  ?  35  LEU A N   1 
ATOM   34   C CA  . LEU A 1 5   ? 39.847 -20.789 -283.066 1.00 52.65  ?  35  LEU A CA  1 
ATOM   35   C C   . LEU A 1 5   ? 38.554 -20.887 -282.265 1.00 59.90  ?  35  LEU A C   1 
ATOM   36   O O   . LEU A 1 5   ? 38.447 -20.324 -281.179 1.00 68.39  ?  35  LEU A O   1 
ATOM   37   C CB  . LEU A 1 5   ? 40.998 -21.488 -282.344 1.00 59.59  ?  35  LEU A CB  1 
ATOM   38   C CG  . LEU A 1 5   ? 40.932 -22.986 -282.057 1.00 56.94  ?  35  LEU A CG  1 
ATOM   39   C CD1 . LEU A 1 5   ? 40.750 -23.778 -283.342 1.00 51.75  ?  35  LEU A CD1 1 
ATOM   40   C CD2 . LEU A 1 5   ? 42.202 -23.410 -281.333 1.00 52.97  ?  35  LEU A CD2 1 
ATOM   41   N N   . GLY A 1 6   ? 37.565 -21.586 -282.811 1.00 64.29  ?  36  GLY A N   1 
ATOM   42   C CA  . GLY A 1 6   ? 36.266 -21.700 -282.173 1.00 65.83  ?  36  GLY A CA  1 
ATOM   43   C C   . GLY A 1 6   ? 36.204 -22.859 -281.195 1.00 69.94  ?  36  GLY A C   1 
ATOM   44   O O   . GLY A 1 6   ? 36.610 -23.970 -281.516 1.00 68.16  ?  36  GLY A O   1 
ATOM   45   N N   . VAL A 1 7   ? 35.699 -22.593 -279.993 1.00 59.58  ?  37  VAL A N   1 
ATOM   46   C CA  . VAL A 1 7   ? 35.579 -23.621 -278.966 1.00 62.94  ?  37  VAL A CA  1 
ATOM   47   C C   . VAL A 1 7   ? 34.121 -23.901 -278.626 1.00 68.39  ?  37  VAL A C   1 
ATOM   48   O O   . VAL A 1 7   ? 33.378 -22.979 -278.290 1.00 70.52  ?  37  VAL A O   1 
ATOM   49   C CB  . VAL A 1 7   ? 36.344 -23.219 -277.682 1.00 67.48  ?  37  VAL A CB  1 
ATOM   50   C CG1 . VAL A 1 7   ? 36.425 -24.399 -276.731 1.00 68.72  ?  37  VAL A CG1 1 
ATOM   51   C CG2 . VAL A 1 7   ? 37.732 -22.721 -278.028 1.00 64.64  ?  37  VAL A CG2 1 
ATOM   52   N N   . ILE A 1 8   ? 33.714 -25.167 -278.734 1.00 100.52 ?  38  ILE A N   1 
ATOM   53   C CA  . ILE A 1 8   ? 32.330 -25.548 -278.471 1.00 109.22 ?  38  ILE A CA  1 
ATOM   54   C C   . ILE A 1 8   ? 32.193 -26.566 -277.364 1.00 110.94 ?  38  ILE A C   1 
ATOM   55   O O   . ILE A 1 8   ? 32.879 -27.579 -277.336 1.00 107.64 ?  38  ILE A O   1 
ATOM   56   C CB  . ILE A 1 8   ? 31.637 -26.095 -279.770 1.00 105.92 ?  38  ILE A CB  1 
ATOM   57   C CG1 . ILE A 1 8   ? 32.404 -27.244 -280.371 1.00 100.54 ?  38  ILE A CG1 1 
ATOM   58   C CG2 . ILE A 1 8   ? 31.471 -24.980 -280.782 1.00 105.57 ?  38  ILE A CG2 1 
ATOM   59   C CD1 . ILE A 1 8   ? 31.637 -27.955 -281.503 1.00 101.74 ?  38  ILE A CD1 1 
ATOM   60   N N   . HIS A 1 9   ? 31.271 -26.302 -276.444 1.00 155.43 ?  39  HIS A N   1 
ATOM   61   C CA  . HIS A 1 9   ? 30.945 -27.259 -275.393 1.00 157.62 ?  39  HIS A CA  1 
ATOM   62   C C   . HIS A 1 9   ? 29.761 -28.110 -275.848 1.00 158.80 ?  39  HIS A C   1 
ATOM   63   O O   . HIS A 1 9   ? 29.932 -29.075 -276.593 1.00 158.41 ?  39  HIS A O   1 
ATOM   64   C CB  . HIS A 1 9   ? 30.621 -26.535 -274.084 1.00 158.84 ?  39  HIS A CB  1 
ATOM   65   C CG  . HIS A 1 9   ? 31.832 -26.080 -273.330 1.00 157.42 ?  39  HIS A CG  1 
ATOM   66   N ND1 . HIS A 1 9   ? 32.918 -26.898 -273.103 1.00 153.41 ?  39  HIS A ND1 1 
ATOM   67   C CD2 . HIS A 1 9   ? 32.128 -24.892 -272.752 1.00 156.94 ?  39  HIS A CD2 1 
ATOM   68   C CE1 . HIS A 1 9   ? 33.831 -26.234 -272.417 1.00 154.65 ?  39  HIS A CE1 1 
ATOM   69   N NE2 . HIS A 1 9   ? 33.376 -25.014 -272.191 1.00 155.11 ?  39  HIS A NE2 1 
ATOM   70   N N   . ASN A 1 10  ? 28.562 -27.741 -275.408 1.00 104.05 ?  40  ASN A N   1 
ATOM   71   C CA  . ASN A 1 10  ? 27.340 -28.369 -275.891 1.00 103.03 ?  40  ASN A CA  1 
ATOM   72   C C   . ASN A 1 10  ? 26.778 -27.522 -277.024 1.00 105.19 ?  40  ASN A C   1 
ATOM   73   O O   . ASN A 1 10  ? 26.447 -28.027 -278.096 1.00 102.52 ?  40  ASN A O   1 
ATOM   74   C CB  . ASN A 1 10  ? 26.316 -28.497 -274.764 1.00 103.76 ?  40  ASN A CB  1 
ATOM   75   C CG  . ASN A 1 10  ? 26.825 -29.333 -273.606 1.00 101.33 ?  40  ASN A CG  1 
ATOM   76   O OD1 . ASN A 1 10  ? 26.483 -30.509 -273.477 1.00 100.75 ?  40  ASN A OD1 1 
ATOM   77   N ND2 . ASN A 1 10  ? 27.649 -28.730 -272.757 1.00 102.65 ?  40  ASN A ND2 1 
ATOM   78   N N   . SER A 1 11  ? 26.690 -26.222 -276.768 1.00 135.91 ?  41  SER A N   1 
ATOM   79   C CA  . SER A 1 11  ? 26.329 -25.229 -277.787 1.00 133.30 ?  41  SER A CA  1 
ATOM   80   C C   . SER A 1 11  ? 26.947 -23.864 -277.526 1.00 134.60 ?  41  SER A C   1 
ATOM   81   O O   . SER A 1 11  ? 26.479 -22.873 -278.061 1.00 131.23 ?  41  SER A O   1 
ATOM   82   C CB  . SER A 1 11  ? 24.805 -25.081 -277.909 1.00 133.99 ?  41  SER A CB  1 
ATOM   83   O OG  . SER A 1 11  ? 24.215 -26.326 -278.223 1.00 132.25 ?  41  SER A OG  1 
ATOM   84   N N   . VAL A 1 12  ? 27.998 -23.817 -276.710 1.00 140.17 ?  42  VAL A N   1 
ATOM   85   C CA  . VAL A 1 12  ? 28.606 -22.538 -276.372 1.00 141.40 ?  42  VAL A CA  1 
ATOM   86   C C   . VAL A 1 12  ? 29.640 -22.288 -277.496 1.00 133.94 ?  42  VAL A C   1 
ATOM   87   O O   . VAL A 1 12  ? 30.686 -22.971 -277.528 1.00 131.20 ?  42  VAL A O   1 
ATOM   88   C CB  . VAL A 1 12  ? 29.249 -22.460 -274.900 1.00 143.64 ?  42  VAL A CB  1 
ATOM   89   C CG1 . VAL A 1 12  ? 28.147 -22.404 -273.787 1.00 143.56 ?  42  VAL A CG1 1 
ATOM   90   C CG2 . VAL A 1 12  ? 30.502 -23.309 -274.591 1.00 143.43 ?  42  VAL A CG2 1 
ATOM   91   N N   . LEU A 1 13  ? 29.357 -21.417 -278.473 1.00 94.28  ?  43  LEU A N   1 
ATOM   92   C CA  . LEU A 1 13  ? 30.428 -21.105 -279.403 1.00 87.40  ?  43  LEU A CA  1 
ATOM   93   C C   . LEU A 1 13  ? 31.085 -19.826 -278.955 1.00 86.83  ?  43  LEU A C   1 
ATOM   94   O O   . LEU A 1 13  ? 30.600 -18.728 -279.264 1.00 85.30  ?  43  LEU A O   1 
ATOM   95   C CB  . LEU A 1 13  ? 29.916 -20.983 -280.818 1.00 83.32  ?  43  LEU A CB  1 
ATOM   96   C CG  . LEU A 1 13  ? 31.024 -20.767 -281.843 1.00 76.29  ?  43  LEU A CG  1 
ATOM   97   C CD1 . LEU A 1 13  ? 32.294 -21.577 -281.531 1.00 69.97  ?  43  LEU A CD1 1 
ATOM   98   C CD2 . LEU A 1 13  ? 30.558 -21.128 -283.242 1.00 68.86  ?  43  LEU A CD2 1 
ATOM   99   N N   . GLN A 1 14  ? 32.213 -19.978 -278.266 1.00 79.63  ?  44  GLN A N   1 
ATOM   100  C CA  . GLN A 1 14  ? 33.016 -18.825 -277.921 1.00 78.51  ?  44  GLN A CA  1 
ATOM   101  C C   . GLN A 1 14  ? 34.253 -18.744 -278.795 1.00 73.62  ?  44  GLN A C   1 
ATOM   102  O O   . GLN A 1 14  ? 35.099 -19.638 -278.801 1.00 70.66  ?  44  GLN A O   1 
ATOM   103  C CB  . GLN A 1 14  ? 33.413 -18.825 -276.433 1.00 82.09  ?  44  GLN A CB  1 
ATOM   104  C CG  . GLN A 1 14  ? 33.545 -20.170 -275.727 1.00 86.85  ?  44  GLN A CG  1 
ATOM   105  C CD  . GLN A 1 14  ? 33.447 -20.009 -274.214 1.00 95.13  ?  44  GLN A CD  1 
ATOM   106  O OE1 . GLN A 1 14  ? 32.560 -19.314 -273.712 1.00 95.39  ?  44  GLN A OE1 1 
ATOM   107  N NE2 . GLN A 1 14  ? 34.360 -20.642 -273.484 1.00 92.87  ?  44  GLN A NE2 1 
ATOM   108  N N   . VAL A 1 15  ? 34.332 -17.652 -279.542 1.00 92.04  ?  45  VAL A N   1 
ATOM   109  C CA  . VAL A 1 15  ? 35.495 -17.349 -280.350 1.00 89.23  ?  45  VAL A CA  1 
ATOM   110  C C   . VAL A 1 15  ? 36.675 -17.049 -279.439 1.00 91.64  ?  45  VAL A C   1 
ATOM   111  O O   . VAL A 1 15  ? 36.863 -15.921 -278.989 1.00 93.93  ?  45  VAL A O   1 
ATOM   112  C CB  . VAL A 1 15  ? 35.232 -16.157 -281.284 1.00 87.78  ?  45  VAL A CB  1 
ATOM   113  C CG1 . VAL A 1 15  ? 36.439 -15.900 -282.170 1.00 81.95  ?  45  VAL A CG1 1 
ATOM   114  C CG2 . VAL A 1 15  ? 33.979 -16.408 -282.120 1.00 79.56  ?  45  VAL A CG2 1 
ATOM   115  N N   . SER A 1 16  ? 37.452 -18.082 -279.146 1.00 79.37  ?  46  SER A N   1 
ATOM   116  C CA  . SER A 1 16  ? 38.636 -17.929 -278.321 1.00 85.02  ?  46  SER A CA  1 
ATOM   117  C C   . SER A 1 16  ? 39.893 -18.158 -279.152 1.00 90.20  ?  46  SER A C   1 
ATOM   118  O O   . SER A 1 16  ? 39.909 -17.933 -280.365 1.00 79.61  ?  46  SER A O   1 
ATOM   119  C CB  . SER A 1 16  ? 38.594 -18.907 -277.145 1.00 90.00  ?  46  SER A CB  1 
ATOM   120  O OG  . SER A 1 16  ? 39.360 -18.433 -276.053 1.00 104.41 ?  46  SER A OG  1 
ATOM   121  N N   . ASP A 1 17  ? 40.943 -18.600 -278.473 1.00 101.98 ?  47  ASP A N   1 
ATOM   122  C CA  . ASP A 1 17  ? 42.169 -19.065 -279.103 1.00 101.63 ?  47  ASP A CA  1 
ATOM   123  C C   . ASP A 1 17  ? 42.951 -19.727 -277.979 1.00 113.61 ?  47  ASP A C   1 
ATOM   124  O O   . ASP A 1 17  ? 42.419 -19.899 -276.883 1.00 119.13 ?  47  ASP A O   1 
ATOM   125  C CB  . ASP A 1 17  ? 42.952 -17.917 -279.753 1.00 101.86 ?  47  ASP A CB  1 
ATOM   126  C CG  . ASP A 1 17  ? 43.979 -18.404 -280.771 1.00 94.38  ?  47  ASP A CG  1 
ATOM   127  O OD1 . ASP A 1 17  ? 44.343 -19.598 -280.741 1.00 91.66  ?  47  ASP A OD1 1 
ATOM   128  O OD2 . ASP A 1 17  ? 44.424 -17.592 -281.605 1.00 84.91  -1 47  ASP A OD2 1 
ATOM   129  N N   . VAL A 1 18  ? 44.201 -20.100 -278.224 1.00 104.61 ?  48  VAL A N   1 
ATOM   130  C CA  . VAL A 1 18  ? 45.038 -20.611 -277.144 1.00 109.33 ?  48  VAL A CA  1 
ATOM   131  C C   . VAL A 1 18  ? 45.579 -19.424 -276.332 1.00 114.46 ?  48  VAL A C   1 
ATOM   132  O O   . VAL A 1 18  ? 46.182 -19.597 -275.270 1.00 111.34 ?  48  VAL A O   1 
ATOM   133  C CB  . VAL A 1 18  ? 46.180 -21.493 -277.679 1.00 95.26  ?  48  VAL A CB  1 
ATOM   134  C CG1 . VAL A 1 18  ? 45.635 -22.850 -278.094 1.00 92.48  ?  48  VAL A CG1 1 
ATOM   135  C CG2 . VAL A 1 18  ? 46.876 -20.818 -278.849 1.00 85.65  ?  48  VAL A CG2 1 
ATOM   136  N N   . ASP A 1 19  ? 45.315 -18.221 -276.848 1.00 141.70 ?  49  ASP A N   1 
ATOM   137  C CA  . ASP A 1 19  ? 45.538 -16.943 -276.165 1.00 143.26 ?  49  ASP A CA  1 
ATOM   138  C C   . ASP A 1 19  ? 44.444 -16.690 -275.109 1.00 149.97 ?  49  ASP A C   1 
ATOM   139  O O   . ASP A 1 19  ? 44.144 -15.547 -274.772 1.00 148.88 ?  49  ASP A O   1 
ATOM   140  C CB  . ASP A 1 19  ? 45.548 -15.806 -277.202 1.00 138.47 ?  49  ASP A CB  1 
ATOM   141  C CG  . ASP A 1 19  ? 46.170 -14.506 -276.683 1.00 141.59 ?  49  ASP A CG  1 
ATOM   142  O OD1 . ASP A 1 19  ? 46.198 -14.261 -275.456 1.00 141.34 ?  49  ASP A OD1 1 
ATOM   143  O OD2 . ASP A 1 19  ? 46.608 -13.699 -277.536 1.00 138.93 ?  49  ASP A OD2 1 
ATOM   144  N N   . LYS A 1 20  ? 43.842 -17.766 -274.603 1.00 130.97 ?  50  LYS A N   1 
ATOM   145  C CA  . LYS A 1 20  ? 42.741 -17.675 -273.646 1.00 134.58 ?  50  LYS A CA  1 
ATOM   146  C C   . LYS A 1 20  ? 42.321 -19.029 -273.089 1.00 142.72 ?  50  LYS A C   1 
ATOM   147  O O   . LYS A 1 20  ? 41.888 -19.117 -271.938 1.00 147.97 ?  50  LYS A O   1 
ATOM   148  C CB  . LYS A 1 20  ? 41.526 -17.019 -274.295 1.00 126.64 ?  50  LYS A CB  1 
ATOM   149  N N   . LEU A 1 21  ? 42.448 -20.063 -273.921 1.00 152.56 ?  51  LEU A N   1 
ATOM   150  C CA  . LEU A 1 21  ? 41.948 -21.403 -273.626 1.00 159.17 ?  51  LEU A CA  1 
ATOM   151  C C   . LEU A 1 21  ? 42.217 -21.799 -272.186 1.00 164.99 ?  51  LEU A C   1 
ATOM   152  O O   . LEU A 1 21  ? 43.308 -22.261 -271.851 1.00 169.35 ?  51  LEU A O   1 
ATOM   153  C CB  . LEU A 1 21  ? 42.572 -22.421 -274.577 1.00 126.09 ?  51  LEU A CB  1 
ATOM   154  C CG  . LEU A 1 21  ? 41.547 -23.322 -275.258 1.00 115.82 ?  51  LEU A CG  1 
ATOM   155  C CD1 . LEU A 1 21  ? 40.293 -22.522 -275.601 1.00 111.30 ?  51  LEU A CD1 1 
ATOM   156  C CD2 . LEU A 1 21  ? 42.149 -23.955 -276.496 1.00 105.10 ?  51  LEU A CD2 1 
ATOM   157  N N   . VAL A 1 22  ? 41.205 -21.587 -271.349 1.00 147.32 ?  52  VAL A N   1 
ATOM   158  C CA  . VAL A 1 22  ? 41.306 -21.760 -269.905 1.00 138.12 ?  52  VAL A CA  1 
ATOM   159  C C   . VAL A 1 22  ? 41.968 -23.073 -269.518 1.00 130.16 ?  52  VAL A C   1 
ATOM   160  O O   . VAL A 1 22  ? 41.866 -24.068 -270.237 1.00 124.38 ?  52  VAL A O   1 
ATOM   161  C CB  . VAL A 1 22  ? 39.919 -21.695 -269.239 1.00 131.26 ?  52  VAL A CB  1 
ATOM   162  N N   . CYS A 1 23  ? 42.634 -23.070 -268.366 1.00 133.56 ?  53  CYS A N   1 
ATOM   163  C CA  . CYS A 1 23  ? 43.366 -24.239 -267.887 1.00 127.85 ?  53  CYS A CA  1 
ATOM   164  C C   . CYS A 1 23  ? 42.411 -25.360 -267.465 1.00 123.42 ?  53  CYS A C   1 
ATOM   165  O O   . CYS A 1 23  ? 42.830 -26.359 -266.878 1.00 119.33 ?  53  CYS A O   1 
ATOM   166  C CB  . CYS A 1 23  ? 44.284 -23.848 -266.724 1.00 122.72 ?  53  CYS A CB  1 
ATOM   167  S SG  . CYS A 1 23  ? 45.858 -24.752 -266.658 1.00 117.63 ?  53  CYS A SG  1 
ATOM   168  N N   . ARG A 1 24  ? 41.128 -25.179 -267.767 1.00 119.60 ?  54  ARG A N   1 
ATOM   169  C CA  . ARG A 1 24  ? 40.117 -26.206 -267.560 1.00 117.33 ?  54  ARG A CA  1 
ATOM   170  C C   . ARG A 1 24  ? 39.587 -26.701 -268.901 1.00 114.04 ?  54  ARG A C   1 
ATOM   171  O O   . ARG A 1 24  ? 38.812 -27.656 -268.959 1.00 108.47 ?  54  ARG A O   1 
ATOM   172  C CB  . ARG A 1 24  ? 38.969 -25.671 -266.702 1.00 118.19 ?  54  ARG A CB  1 
ATOM   173  N N   . ASP A 1 25  ? 40.004 -26.043 -269.980 1.00 108.50 ?  55  ASP A N   1 
ATOM   174  C CA  . ASP A 1 25  ? 39.589 -26.449 -271.318 1.00 105.32 ?  55  ASP A CA  1 
ATOM   175  C C   . ASP A 1 25  ? 40.421 -27.638 -271.789 1.00 95.80  ?  55  ASP A C   1 
ATOM   176  O O   . ASP A 1 25  ? 41.653 -27.618 -271.717 1.00 90.65  ?  55  ASP A O   1 
ATOM   177  C CB  . ASP A 1 25  ? 39.700 -25.280 -272.299 1.00 112.34 ?  55  ASP A CB  1 
ATOM   178  C CG  . ASP A 1 25  ? 38.347 -24.684 -272.645 1.00 108.90 ?  55  ASP A CG  1 
ATOM   179  O OD1 . ASP A 1 25  ? 37.366 -24.979 -271.930 1.00 105.31 ?  55  ASP A OD1 1 
ATOM   180  O OD2 . ASP A 1 25  ? 38.263 -23.921 -273.626 1.00 111.07 ?  55  ASP A OD2 1 
ATOM   181  N N   . LYS A 1 26  ? 39.734 -28.671 -272.267 1.00 94.61  ?  56  LYS A N   1 
ATOM   182  C CA  . LYS A 1 26  ? 40.359 -29.966 -272.516 1.00 89.80  ?  56  LYS A CA  1 
ATOM   183  C C   . LYS A 1 26  ? 40.609 -30.259 -273.995 1.00 81.10  ?  56  LYS A C   1 
ATOM   184  O O   . LYS A 1 26  ? 39.670 -30.447 -274.773 1.00 76.59  ?  56  LYS A O   1 
ATOM   185  C CB  . LYS A 1 26  ? 39.499 -31.083 -271.916 1.00 88.38  ?  56  LYS A CB  1 
ATOM   186  N N   . LEU A 1 27  ? 41.886 -30.300 -274.368 1.00 69.24  ?  57  LEU A N   1 
ATOM   187  C CA  . LEU A 1 27  ? 42.301 -30.773 -275.683 1.00 57.44  ?  57  LEU A CA  1 
ATOM   188  C C   . LEU A 1 27  ? 43.162 -32.019 -275.510 1.00 53.75  ?  57  LEU A C   1 
ATOM   189  O O   . LEU A 1 27  ? 44.365 -31.930 -275.263 1.00 58.14  ?  57  LEU A O   1 
ATOM   190  C CB  . LEU A 1 27  ? 43.063 -29.686 -276.439 1.00 56.74  ?  57  LEU A CB  1 
ATOM   191  C CG  . LEU A 1 27  ? 43.561 -30.036 -277.846 1.00 55.43  ?  57  LEU A CG  1 
ATOM   192  C CD1 . LEU A 1 27  ? 42.395 -30.295 -278.788 1.00 49.79  ?  57  LEU A CD1 1 
ATOM   193  C CD2 . LEU A 1 27  ? 44.457 -28.929 -278.383 1.00 55.82  ?  57  LEU A CD2 1 
ATOM   194  N N   . SER A 1 28  ? 42.544 -33.185 -275.632 1.00 57.73  ?  58  SER A N   1 
ATOM   195  C CA  . SER A 1 28  ? 43.228 -34.430 -275.301 1.00 61.84  ?  58  SER A CA  1 
ATOM   196  C C   . SER A 1 28  ? 43.658 -35.184 -276.547 1.00 58.62  ?  58  SER A C   1 
ATOM   197  O O   . SER A 1 28  ? 44.435 -36.138 -276.471 1.00 58.77  ?  58  SER A O   1 
ATOM   198  C CB  . SER A 1 28  ? 42.332 -35.323 -274.441 1.00 63.16  ?  58  SER A CB  1 
ATOM   199  O OG  . SER A 1 28  ? 41.200 -35.762 -275.168 1.00 62.77  ?  58  SER A OG  1 
ATOM   200  N N   . SER A 1 29  ? 43.148 -34.761 -277.696 1.00 52.84  ?  59  SER A N   1 
ATOM   201  C CA  . SER A 1 29  ? 43.512 -35.415 -278.943 1.00 55.97  ?  59  SER A CA  1 
ATOM   202  C C   . SER A 1 29  ? 43.450 -34.470 -280.131 1.00 51.67  ?  59  SER A C   1 
ATOM   203  O O   . SER A 1 29  ? 42.644 -33.544 -280.187 1.00 51.11  ?  59  SER A O   1 
ATOM   204  C CB  . SER A 1 29  ? 42.610 -36.615 -279.204 1.00 52.51  ?  59  SER A CB  1 
ATOM   205  O OG  . SER A 1 29  ? 42.994 -37.260 -280.400 1.00 56.37  ?  59  SER A OG  1 
ATOM   206  N N   . THR A 1 30  ? 44.313 -34.716 -281.095 1.00 45.57  ?  60  THR A N   1 
ATOM   207  C CA  . THR A 1 30  ? 44.335 -33.883 -282.275 1.00 54.12  ?  60  THR A CA  1 
ATOM   208  C C   . THR A 1 30  ? 43.068 -34.145 -283.119 1.00 54.09  ?  60  THR A C   1 
ATOM   209  O O   . THR A 1 30  ? 42.687 -33.325 -283.947 1.00 47.97  ?  60  THR A O   1 
ATOM   210  C CB  . THR A 1 30  ? 45.614 -34.133 -283.076 1.00 50.16  ?  60  THR A CB  1 
ATOM   211  O OG1 . THR A 1 30  ? 45.848 -33.042 -283.970 1.00 61.37  ?  60  THR A OG1 1 
ATOM   212  C CG2 . THR A 1 30  ? 45.504 -35.430 -283.832 1.00 47.01  ?  60  THR A CG2 1 
ATOM   213  N N   . ASN A 1 31  ? 42.395 -35.267 -282.863 1.00 61.55  ?  61  ASN A N   1 
ATOM   214  C CA  . ASN A 1 31  ? 41.115 -35.576 -283.508 1.00 62.89  ?  61  ASN A CA  1 
ATOM   215  C C   . ASN A 1 31  ? 39.995 -34.595 -283.149 1.00 61.42  ?  61  ASN A C   1 
ATOM   216  O O   . ASN A 1 31  ? 38.947 -34.586 -283.790 1.00 58.20  ?  61  ASN A O   1 
ATOM   217  C CB  . ASN A 1 31  ? 40.662 -37.000 -283.156 1.00 65.33  ?  61  ASN A CB  1 
ATOM   218  C CG  . ASN A 1 31  ? 41.540 -38.067 -283.779 1.00 68.00  ?  61  ASN A CG  1 
ATOM   219  O OD1 . ASN A 1 31  ? 42.222 -37.823 -284.773 1.00 71.44  ?  61  ASN A OD1 1 
ATOM   220  N ND2 . ASN A 1 31  ? 41.525 -39.262 -283.199 1.00 69.24  ?  61  ASN A ND2 1 
ATOM   221  N N   . GLN A 1 32  ? 40.219 -33.775 -282.126 1.00 51.41  ?  62  GLN A N   1 
ATOM   222  C CA  . GLN A 1 32  ? 39.240 -32.770 -281.721 1.00 55.87  ?  62  GLN A CA  1 
ATOM   223  C C   . GLN A 1 32  ? 39.322 -31.495 -282.550 1.00 51.28  ?  62  GLN A C   1 
ATOM   224  O O   . GLN A 1 32  ? 38.476 -30.612 -282.420 1.00 49.60  ?  62  GLN A O   1 
ATOM   225  C CB  . GLN A 1 32  ? 39.416 -32.408 -280.244 1.00 56.12  ?  62  GLN A CB  1 
ATOM   226  C CG  . GLN A 1 32  ? 39.200 -33.555 -279.280 1.00 60.53  ?  62  GLN A CG  1 
ATOM   227  C CD  . GLN A 1 32  ? 39.451 -33.144 -277.845 1.00 62.00  ?  62  GLN A CD  1 
ATOM   228  O OE1 . GLN A 1 32  ? 40.323 -33.700 -277.178 1.00 62.24  ?  62  GLN A OE1 1 
ATOM   229  N NE2 . GLN A 1 32  ? 38.687 -32.166 -277.360 1.00 59.81  ?  62  GLN A NE2 1 
ATOM   230  N N   . LEU A 1 33  ? 40.354 -31.387 -283.379 1.00 52.12  ?  63  LEU A N   1 
ATOM   231  C CA  . LEU A 1 33  ? 40.540 -30.198 -284.200 1.00 52.66  ?  63  LEU A CA  1 
ATOM   232  C C   . LEU A 1 33  ? 39.936 -30.414 -285.586 1.00 45.80  ?  63  LEU A C   1 
ATOM   233  O O   . LEU A 1 33  ? 40.281 -31.359 -286.286 1.00 52.35  ?  63  LEU A O   1 
ATOM   234  C CB  . LEU A 1 33  ? 42.027 -29.844 -284.304 1.00 49.20  ?  63  LEU A CB  1 
ATOM   235  C CG  . LEU A 1 33  ? 42.713 -29.539 -282.970 1.00 50.14  ?  63  LEU A CG  1 
ATOM   236  C CD1 . LEU A 1 33  ? 44.224 -29.510 -283.120 1.00 51.38  ?  63  LEU A CD1 1 
ATOM   237  C CD2 . LEU A 1 33  ? 42.224 -28.224 -282.391 1.00 46.21  ?  63  LEU A CD2 1 
ATOM   238  N N   . ARG A 1 34  ? 39.014 -29.544 -285.971 1.00 46.74  ?  64  ARG A N   1 
ATOM   239  C CA  . ARG A 1 34  ? 38.401 -29.660 -287.283 1.00 51.58  ?  64  ARG A CA  1 
ATOM   240  C C   . ARG A 1 34  ? 38.346 -28.289 -287.949 1.00 48.37  ?  64  ARG A C   1 
ATOM   241  O O   . ARG A 1 34  ? 38.199 -27.258 -287.287 1.00 45.67  ?  64  ARG A O   1 
ATOM   242  C CB  . ARG A 1 34  ? 36.999 -30.287 -287.186 1.00 52.85  ?  64  ARG A CB  1 
ATOM   243  C CG  . ARG A 1 34  ? 36.720 -31.375 -288.258 1.00 63.95  ?  64  ARG A CG  1 
ATOM   244  C CD  . ARG A 1 34  ? 37.555 -32.673 -288.060 1.00 65.52  ?  64  ARG A CD  1 
ATOM   245  N NE  . ARG A 1 34  ? 37.309 -33.660 -289.122 1.00 73.45  ?  64  ARG A NE  1 
ATOM   246  C CZ  . ARG A 1 34  ? 38.139 -34.654 -289.455 1.00 76.08  ?  64  ARG A CZ  1 
ATOM   247  N NH1 . ARG A 1 34  ? 39.287 -34.819 -288.808 1.00 81.68  ?  64  ARG A NH1 1 
ATOM   248  N NH2 . ARG A 1 34  ? 37.824 -35.488 -290.442 1.00 69.32  ?  64  ARG A NH2 1 
ATOM   249  N N   . SER A 1 35  ? 38.521 -28.292 -289.265 1.00 48.95  ?  65  SER A N   1 
ATOM   250  C CA  . SER A 1 35  ? 38.335 -27.103 -290.086 1.00 43.99  ?  65  SER A CA  1 
ATOM   251  C C   . SER A 1 35  ? 37.087 -27.302 -290.933 1.00 45.58  ?  65  SER A C   1 
ATOM   252  O O   . SER A 1 35  ? 36.822 -28.402 -291.415 1.00 41.91  ?  65  SER A O   1 
ATOM   253  C CB  . SER A 1 35  ? 39.552 -26.854 -290.965 1.00 40.01  ?  65  SER A CB  1 
ATOM   254  O OG  . SER A 1 35  ? 39.871 -28.010 -291.709 1.00 42.90  ?  65  SER A OG  1 
ATOM   255  N N   . VAL A 1 36  ? 36.306 -26.244 -291.092 1.00 38.85  ?  66  VAL A N   1 
ATOM   256  C CA  . VAL A 1 36  ? 35.022 -26.361 -291.767 1.00 40.36  ?  66  VAL A CA  1 
ATOM   257  C C   . VAL A 1 36  ? 34.895 -25.278 -292.832 1.00 37.76  ?  66  VAL A C   1 
ATOM   258  O O   . VAL A 1 36  ? 35.340 -24.145 -292.635 1.00 37.20  ?  66  VAL A O   1 
ATOM   259  C CB  . VAL A 1 36  ? 33.839 -26.252 -290.761 1.00 44.14  ?  66  VAL A CB  1 
ATOM   260  C CG1 . VAL A 1 36  ? 32.509 -26.513 -291.460 1.00 47.62  ?  66  VAL A CG1 1 
ATOM   261  C CG2 . VAL A 1 36  ? 34.024 -27.233 -289.617 1.00 49.75  ?  66  VAL A CG2 1 
ATOM   262  N N   . GLY A 1 37  ? 34.295 -25.636 -293.959 1.00 36.47  ?  67  GLY A N   1 
ATOM   263  C CA  . GLY A 1 37  ? 34.045 -24.684 -295.017 1.00 35.61  ?  67  GLY A CA  1 
ATOM   264  C C   . GLY A 1 37  ? 32.576 -24.317 -295.057 1.00 38.60  ?  67  GLY A C   1 
ATOM   265  O O   . GLY A 1 37  ? 31.710 -25.182 -295.163 1.00 38.39  ?  67  GLY A O   1 
ATOM   266  N N   . LEU A 1 38  ? 32.285 -23.030 -294.961 1.00 36.18  ?  68  LEU A N   1 
ATOM   267  C CA  . LEU A 1 38  ? 30.907 -22.593 -295.072 1.00 38.03  ?  68  LEU A CA  1 
ATOM   268  C C   . LEU A 1 38  ? 30.688 -21.709 -296.294 1.00 38.52  ?  68  LEU A C   1 
ATOM   269  O O   . LEU A 1 38  ? 31.479 -20.857 -296.646 1.00 38.21  ?  68  LEU A O   1 
ATOM   270  C CB  . LEU A 1 38  ? 30.463 -21.874 -293.794 1.00 34.61  ?  68  LEU A CB  1 
ATOM   271  C CG  . LEU A 1 38  ? 30.488 -22.811 -292.578 1.00 43.40  ?  68  LEU A CG  1 
ATOM   272  C CD1 . LEU A 1 38  ? 30.387 -22.043 -291.290 1.00 41.41  ?  68  LEU A CD1 1 
ATOM   273  C CD2 . LEU A 1 38  ? 29.387 -23.870 -292.651 1.00 44.57  ?  68  LEU A CD2 1 
ATOM   274  N N   . ASN A 1 39  ? 29.550 -21.938 -296.908 1.00 39.28  ?  69  ASN A N   1 
ATOM   275  C CA  . ASN A 1 39  ? 29.107 -21.333 -298.149 1.00 38.89  ?  69  ASN A CA  1 
ATOM   276  C C   . ASN A 1 39  ? 28.541 -19.943 -298.007 1.00 43.65  ?  69  ASN A C   1 
ATOM   277  O O   . ASN A 1 39  ? 27.902 -19.622 -297.012 1.00 40.91  ?  69  ASN A O   1 
ATOM   278  C CB  . ASN A 1 39  ? 28.104 -22.331 -298.690 1.00 44.76  ?  69  ASN A CB  1 
ATOM   279  C CG  . ASN A 1 39  ? 28.760 -23.555 -299.279 1.00 39.71  ?  69  ASN A CG  1 
ATOM   280  O OD1 . ASN A 1 39  ? 29.511 -24.275 -298.624 1.00 54.60  ?  69  ASN A OD1 1 
ATOM   281  N ND2 . ASN A 1 39  ? 28.104 -24.017 -300.307 1.00 61.64  ?  69  ASN A ND2 1 
ATOM   282  N N   . LEU A 1 40  ? 28.819 -19.128 -299.014 1.00 47.39  ?  70  LEU A N   1 
ATOM   283  C CA  . LEU A 1 40  ? 28.304 -17.775 -299.104 1.00 47.64  ?  70  LEU A CA  1 
ATOM   284  C C   . LEU A 1 40  ? 27.285 -17.706 -300.224 1.00 54.73  ?  70  LEU A C   1 
ATOM   285  O O   . LEU A 1 40  ? 27.623 -17.434 -301.378 1.00 61.78  ?  70  LEU A O   1 
ATOM   286  C CB  . LEU A 1 40  ? 29.419 -16.754 -299.355 1.00 46.43  ?  70  LEU A CB  1 
ATOM   287  C CG  . LEU A 1 40  ? 30.307 -16.299 -298.192 1.00 54.81  ?  70  LEU A CG  1 
ATOM   288  C CD1 . LEU A 1 40  ? 30.929 -17.459 -297.437 1.00 54.16  ?  70  LEU A CD1 1 
ATOM   289  C CD2 . LEU A 1 40  ? 31.394 -15.348 -298.662 1.00 50.44  ?  70  LEU A CD2 1 
ATOM   290  N N   . GLU A 1 41  ? 26.037 -17.974 -299.882 1.00 46.32  ?  71  GLU A N   1 
ATOM   291  C CA  . GLU A 1 41  ? 24.962 -17.877 -300.842 1.00 45.84  ?  71  GLU A CA  1 
ATOM   292  C C   . GLU A 1 41  ? 23.705 -17.492 -300.080 1.00 45.10  ?  71  GLU A C   1 
ATOM   293  O O   . GLU A 1 41  ? 23.706 -17.474 -298.852 1.00 49.38  ?  71  GLU A O   1 
ATOM   294  C CB  . GLU A 1 41  ? 24.791 -19.190 -301.616 1.00 41.51  ?  71  GLU A CB  1 
ATOM   295  C CG  . GLU A 1 41  ? 24.424 -20.434 -300.778 1.00 51.13  ?  71  GLU A CG  1 
ATOM   296  C CD  . GLU A 1 41  ? 24.223 -21.700 -301.644 1.00 48.48  ?  71  GLU A CD  1 
ATOM   297  O OE1 . GLU A 1 41  ? 24.398 -21.618 -302.881 1.00 49.57  ?  71  GLU A OE1 1 
ATOM   298  O OE2 . GLU A 1 41  ? 23.883 -22.772 -301.093 1.00 46.07  -1 71  GLU A OE2 1 
ATOM   299  N N   . GLY A 1 42  ? 22.640 -17.171 -300.802 1.00 40.79  ?  72  GLY A N   1 
ATOM   300  C CA  . GLY A 1 42  ? 21.395 -16.789 -300.167 1.00 43.25  ?  72  GLY A CA  1 
ATOM   301  C C   . GLY A 1 42  ? 20.990 -15.390 -300.577 1.00 46.97  ?  72  GLY A C   1 
ATOM   302  O O   . GLY A 1 42  ? 21.442 -14.889 -301.613 1.00 44.99  ?  72  GLY A O   1 
ATOM   303  N N   . ASN A 1 43  ? 20.149 -14.759 -299.760 1.00 49.67  ?  73  ASN A N   1 
ATOM   304  C CA  . ASN A 1 43  ? 19.530 -13.480 -300.111 1.00 54.07  ?  73  ASN A CA  1 
ATOM   305  C C   . ASN A 1 43  ? 20.545 -12.370 -300.327 1.00 50.53  ?  73  ASN A C   1 
ATOM   306  O O   . ASN A 1 43  ? 21.404 -12.126 -299.483 1.00 53.50  ?  73  ASN A O   1 
ATOM   307  C CB  . ASN A 1 43  ? 18.526 -13.052 -299.035 1.00 60.11  ?  73  ASN A CB  1 
ATOM   308  C CG  . ASN A 1 43  ? 18.052 -11.617 -299.221 1.00 61.01  ?  73  ASN A CG  1 
ATOM   309  O OD1 . ASN A 1 43  ? 18.546 -10.701 -298.560 1.00 64.64  ?  73  ASN A OD1 1 
ATOM   310  N ND2 . ASN A 1 43  ? 17.104 -11.412 -300.134 1.00 53.80  ?  73  ASN A ND2 1 
ATOM   311  N N   . GLY A 1 44  ? 20.446 -11.708 -301.474 1.00 48.99  ?  74  GLY A N   1 
ATOM   312  C CA  . GLY A 1 44  ? 21.360 -10.633 -301.802 1.00 52.99  ?  74  GLY A CA  1 
ATOM   313  C C   . GLY A 1 44  ? 22.592 -11.116 -302.539 1.00 50.59  ?  74  GLY A C   1 
ATOM   314  O O   . GLY A 1 44  ? 23.432 -10.311 -302.948 1.00 51.01  ?  74  GLY A O   1 
ATOM   315  N N   . VAL A 1 45  ? 22.718 -12.432 -302.693 1.00 41.82  ?  75  VAL A N   1 
ATOM   316  C CA  . VAL A 1 45  ? 23.837 -12.983 -303.442 1.00 39.54  ?  75  VAL A CA  1 
ATOM   317  C C   . VAL A 1 45  ? 23.299 -13.537 -304.755 1.00 42.27  ?  75  VAL A C   1 
ATOM   318  O O   . VAL A 1 45  ? 22.636 -14.570 -304.788 1.00 41.56  ?  75  VAL A O   1 
ATOM   319  C CB  . VAL A 1 45  ? 24.586 -14.076 -302.670 1.00 45.94  ?  75  VAL A CB  1 
ATOM   320  C CG1 . VAL A 1 45  ? 25.730 -14.647 -303.535 1.00 40.38  ?  75  VAL A CG1 1 
ATOM   321  C CG2 . VAL A 1 45  ? 25.112 -13.526 -301.330 1.00 42.32  ?  75  VAL A CG2 1 
ATOM   322  N N   . ALA A 1 46  ? 23.576 -12.815 -305.831 1.00 36.16  ?  76  ALA A N   1 
ATOM   323  C CA  . ALA A 1 46  ? 23.022 -13.129 -307.129 1.00 38.64  ?  76  ALA A CA  1 
ATOM   324  C C   . ALA A 1 46  ? 23.532 -14.476 -307.635 1.00 35.30  ?  76  ALA A C   1 
ATOM   325  O O   . ALA A 1 46  ? 24.644 -14.880 -307.321 1.00 36.69  ?  76  ALA A O   1 
ATOM   326  C CB  . ALA A 1 46  ? 23.357 -12.024 -308.102 1.00 37.94  ?  76  ALA A CB  1 
ATOM   327  N N   . THR A 1 47  ? 22.722 -15.166 -308.428 1.00 36.52  ?  77  THR A N   1 
ATOM   328  C CA  . THR A 1 47  ? 23.072 -16.518 -308.843 1.00 36.55  ?  77  THR A CA  1 
ATOM   329  C C   . THR A 1 47  ? 23.443 -16.646 -310.318 1.00 37.12  ?  77  THR A C   1 
ATOM   330  O O   . THR A 1 47  ? 24.239 -17.516 -310.683 1.00 37.60  ?  77  THR A O   1 
ATOM   331  C CB  . THR A 1 47  ? 21.917 -17.506 -308.554 1.00 34.94  ?  77  THR A CB  1 
ATOM   332  O OG1 . THR A 1 47  ? 20.773 -17.158 -309.346 1.00 33.18  ?  77  THR A OG1 1 
ATOM   333  C CG2 . THR A 1 47  ? 21.549 -17.496 -307.065 1.00 34.60  ?  77  THR A CG2 1 
ATOM   334  N N   . ASP A 1 48  ? 22.859 -15.814 -311.176 1.00 38.29  ?  78  ASP A N   1 
ATOM   335  C CA  . ASP A 1 48  ? 23.148 -15.921 -312.610 1.00 35.76  ?  78  ASP A CA  1 
ATOM   336  C C   . ASP A 1 48  ? 24.610 -15.511 -312.865 1.00 30.77  ?  78  ASP A C   1 
ATOM   337  O O   . ASP A 1 48  ? 25.152 -14.654 -312.163 1.00 31.51  ?  78  ASP A O   1 
ATOM   338  C CB  . ASP A 1 48  ? 22.169 -15.065 -313.437 1.00 36.07  ?  78  ASP A CB  1 
ATOM   339  C CG  . ASP A 1 48  ? 22.403 -13.573 -313.269 1.00 39.48  ?  78  ASP A CG  1 
ATOM   340  O OD1 . ASP A 1 48  ? 21.941 -13.007 -312.260 1.00 34.61  ?  78  ASP A OD1 1 
ATOM   341  O OD2 . ASP A 1 48  ? 23.044 -12.958 -314.158 1.00 44.41  -1 78  ASP A OD2 1 
ATOM   342  N N   . VAL A 1 49  ? 25.246 -16.139 -313.849 1.00 32.55  ?  79  VAL A N   1 
ATOM   343  C CA  . VAL A 1 49  ? 26.677 -15.926 -314.099 1.00 30.75  ?  79  VAL A CA  1 
ATOM   344  C C   . VAL A 1 49  ? 27.068 -14.461 -314.377 1.00 31.18  ?  79  VAL A C   1 
ATOM   345  O O   . VAL A 1 49  ? 28.019 -13.974 -313.779 1.00 34.50  ?  79  VAL A O   1 
ATOM   346  C CB  . VAL A 1 49  ? 27.183 -16.820 -315.250 1.00 32.06  ?  79  VAL A CB  1 
ATOM   347  C CG1 . VAL A 1 49  ? 28.682 -16.543 -315.536 1.00 25.10  ?  79  VAL A CG1 1 
ATOM   348  C CG2 . VAL A 1 49  ? 26.947 -18.300 -314.903 1.00 30.14  ?  79  VAL A CG2 1 
ATOM   349  N N   . PRO A 1 50  ? 26.329 -13.744 -315.247 1.00 32.08  ?  80  PRO A N   1 
ATOM   350  C CA  . PRO A 1 50  ? 26.666 -12.320 -315.397 1.00 35.89  ?  80  PRO A CA  1 
ATOM   351  C C   . PRO A 1 50  ? 26.684 -11.533 -314.075 1.00 39.14  ?  80  PRO A C   1 
ATOM   352  O O   . PRO A 1 50  ? 27.559 -10.692 -313.887 1.00 40.79  ?  80  PRO A O   1 
ATOM   353  C CB  . PRO A 1 50  ? 25.565 -11.798 -316.325 1.00 34.96  ?  80  PRO A CB  1 
ATOM   354  C CG  . PRO A 1 50  ? 25.207 -12.981 -317.164 1.00 34.31  ?  80  PRO A CG  1 
ATOM   355  C CD  . PRO A 1 50  ? 25.302 -14.164 -316.221 1.00 37.19  ?  80  PRO A CD  1 
ATOM   356  N N   . SER A 1 51  ? 25.764 -11.814 -313.159 1.00 37.87  ?  81  SER A N   1 
ATOM   357  C CA  . SER A 1 51  ? 25.784 -11.105 -311.877 1.00 36.19  ?  81  SER A CA  1 
ATOM   358  C C   . SER A 1 51  ? 26.843 -11.683 -310.946 1.00 39.32  ?  81  SER A C   1 
ATOM   359  O O   . SER A 1 51  ? 27.402 -10.971 -310.107 1.00 38.50  ?  81  SER A O   1 
ATOM   360  C CB  . SER A 1 51  ? 24.412 -11.163 -311.213 1.00 36.11  ?  81  SER A CB  1 
ATOM   361  O OG  . SER A 1 51  ? 23.387 -10.831 -312.138 1.00 46.11  ?  81  SER A OG  1 
ATOM   362  N N   . ALA A 1 52  ? 27.126 -12.977 -311.094 1.00 36.30  ?  82  ALA A N   1 
ATOM   363  C CA  . ALA A 1 52  ? 28.053 -13.652 -310.184 1.00 32.89  ?  82  ALA A CA  1 
ATOM   364  C C   . ALA A 1 52  ? 29.508 -13.215 -310.408 1.00 33.48  ?  82  ALA A C   1 
ATOM   365  O O   . ALA A 1 52  ? 30.274 -13.067 -309.450 1.00 33.63  ?  82  ALA A O   1 
ATOM   366  C CB  . ALA A 1 52  ? 27.923 -15.159 -310.328 1.00 28.83  ?  82  ALA A CB  1 
ATOM   367  N N   . THR A 1 53  ? 29.879 -12.994 -311.667 1.00 31.66  ?  83  THR A N   1 
ATOM   368  C CA  . THR A 1 53  ? 31.256 -12.618 -312.007 1.00 30.89  ?  83  THR A CA  1 
ATOM   369  C C   . THR A 1 53  ? 31.656 -11.294 -311.376 1.00 33.75  ?  83  THR A C   1 
ATOM   370  O O   . THR A 1 53  ? 32.837 -11.064 -311.114 1.00 33.11  ?  83  THR A O   1 
ATOM   371  C CB  . THR A 1 53  ? 31.469 -12.515 -313.520 1.00 30.01  ?  83  THR A CB  1 
ATOM   372  O OG1 . THR A 1 53  ? 30.665 -11.455 -314.048 1.00 37.99  ?  83  THR A OG1 1 
ATOM   373  C CG2 . THR A 1 53  ? 31.110 -13.809 -314.200 1.00 26.75  ?  83  THR A CG2 1 
ATOM   374  N N   . LYS A 1 54  ? 30.671 -10.435 -311.112 1.00 35.23  ?  84  LYS A N   1 
ATOM   375  C CA  . LYS A 1 54  ? 30.925 -9.157  -310.446 1.00 33.76  ?  84  LYS A CA  1 
ATOM   376  C C   . LYS A 1 54  ? 31.631 -9.330  -309.098 1.00 35.82  ?  84  LYS A C   1 
ATOM   377  O O   . LYS A 1 54  ? 32.321 -8.420  -308.641 1.00 34.16  ?  84  LYS A O   1 
ATOM   378  C CB  . LYS A 1 54  ? 29.615 -8.389  -310.258 1.00 38.81  ?  84  LYS A CB  1 
ATOM   379  C CG  . LYS A 1 54  ? 28.986 -7.937  -311.576 1.00 41.47  ?  84  LYS A CG  1 
ATOM   380  C CD  . LYS A 1 54  ? 27.662 -7.199  -311.380 1.00 44.20  ?  84  LYS A CD  1 
ATOM   381  C CE  . LYS A 1 54  ? 27.058 -6.838  -312.735 1.00 53.98  ?  84  LYS A CE  1 
ATOM   382  N NZ  . LYS A 1 54  ? 25.685 -6.232  -312.659 1.00 62.03  ?  84  LYS A NZ  1 
ATOM   383  N N   . ARG A 1 55  ? 31.485 -10.498 -308.476 1.00 28.92  ?  85  ARG A N   1 
ATOM   384  C CA  . ARG A 1 55  ? 32.198 -10.789 -307.225 1.00 30.89  ?  85  ARG A CA  1 
ATOM   385  C C   . ARG A 1 55  ? 33.659 -11.239 -307.434 1.00 31.36  ?  85  ARG A C   1 
ATOM   386  O O   . ARG A 1 55  ? 34.413 -11.377 -306.476 1.00 30.74  ?  85  ARG A O   1 
ATOM   387  C CB  . ARG A 1 55  ? 31.435 -11.858 -306.426 1.00 31.32  ?  85  ARG A CB  1 
ATOM   388  C CG  . ARG A 1 55  ? 30.003 -11.442 -306.075 1.00 31.19  ?  85  ARG A CG  1 
ATOM   389  C CD  . ARG A 1 55  ? 29.338 -12.380 -305.069 1.00 26.16  ?  85  ARG A CD  1 
ATOM   390  N NE  . ARG A 1 55  ? 29.129 -13.725 -305.588 1.00 30.69  ?  85  ARG A NE  1 
ATOM   391  C CZ  . ARG A 1 55  ? 28.045 -14.110 -306.255 1.00 31.65  ?  85  ARG A CZ  1 
ATOM   392  N NH1 . ARG A 1 55  ? 27.068 -13.246 -306.503 1.00 31.39  ?  85  ARG A NH1 1 
ATOM   393  N NH2 . ARG A 1 55  ? 27.936 -15.360 -306.670 1.00 28.18  ?  85  ARG A NH2 1 
ATOM   394  N N   . TRP A 1 56  ? 34.060 -11.476 -308.682 1.00 33.28  ?  86  TRP A N   1 
ATOM   395  C CA  . TRP A 1 56  ? 35.408 -11.976 -308.959 1.00 31.87  ?  86  TRP A CA  1 
ATOM   396  C C   . TRP A 1 56  ? 36.167 -11.026 -309.890 1.00 35.17  ?  86  TRP A C   1 
ATOM   397  O O   . TRP A 1 56  ? 35.560 -10.187 -310.554 1.00 34.57  ?  86  TRP A O   1 
ATOM   398  C CB  . TRP A 1 56  ? 35.338 -13.388 -309.577 1.00 31.92  ?  86  TRP A CB  1 
ATOM   399  C CG  . TRP A 1 56  ? 34.291 -14.278 -308.939 1.00 27.49  ?  86  TRP A CG  1 
ATOM   400  C CD1 . TRP A 1 56  ? 33.977 -14.366 -307.610 1.00 29.30  ?  86  TRP A CD1 1 
ATOM   401  C CD2 . TRP A 1 56  ? 33.409 -15.179 -309.618 1.00 27.89  ?  86  TRP A CD2 1 
ATOM   402  N NE1 . TRP A 1 56  ? 32.957 -15.279 -307.421 1.00 26.87  ?  86  TRP A NE1 1 
ATOM   403  C CE2 . TRP A 1 56  ? 32.584 -15.780 -308.639 1.00 26.86  ?  86  TRP A CE2 1 
ATOM   404  C CE3 . TRP A 1 56  ? 33.233 -15.538 -310.961 1.00 28.12  ?  86  TRP A CE3 1 
ATOM   405  C CZ2 . TRP A 1 56  ? 31.602 -16.715 -308.963 1.00 30.91  ?  86  TRP A CZ2 1 
ATOM   406  C CZ3 . TRP A 1 56  ? 32.265 -16.470 -311.281 1.00 26.54  ?  86  TRP A CZ3 1 
ATOM   407  C CH2 . TRP A 1 56  ? 31.454 -17.047 -310.287 1.00 26.81  ?  86  TRP A CH2 1 
ATOM   408  N N   . GLY A 1 57  ? 37.492 -11.156 -309.939 1.00 34.31  ?  87  GLY A N   1 
ATOM   409  C CA  . GLY A 1 57  ? 38.295 -10.329 -310.827 1.00 35.35  ?  87  GLY A CA  1 
ATOM   410  C C   . GLY A 1 57  ? 39.688 -10.873 -311.119 1.00 35.52  ?  87  GLY A C   1 
ATOM   411  O O   . GLY A 1 57  ? 40.273 -11.602 -310.307 1.00 32.68  ?  87  GLY A O   1 
ATOM   412  N N   . PHE A 1 58  ? 40.228 -10.503 -312.276 1.00 35.51  ?  88  PHE A N   1 
ATOM   413  C CA  . PHE A 1 58  ? 41.559 -10.952 -312.687 1.00 35.46  ?  88  PHE A CA  1 
ATOM   414  C C   . PHE A 1 58  ? 42.678 -10.054 -312.183 1.00 36.25  ?  88  PHE A C   1 
ATOM   415  O O   . PHE A 1 58  ? 42.562 -8.832  -312.199 1.00 37.11  ?  88  PHE A O   1 
ATOM   416  C CB  . PHE A 1 58  ? 41.627 -11.067 -314.203 1.00 30.88  ?  88  PHE A CB  1 
ATOM   417  C CG  . PHE A 1 58  ? 40.909 -12.266 -314.734 1.00 35.71  ?  88  PHE A CG  1 
ATOM   418  C CD1 . PHE A 1 58  ? 39.582 -12.182 -315.123 1.00 34.78  ?  88  PHE A CD1 1 
ATOM   419  C CD2 . PHE A 1 58  ? 41.553 -13.492 -314.816 1.00 34.64  ?  88  PHE A CD2 1 
ATOM   420  C CE1 . PHE A 1 58  ? 38.911 -13.297 -315.610 1.00 35.30  ?  88  PHE A CE1 1 
ATOM   421  C CE2 . PHE A 1 58  ? 40.894 -14.606 -315.302 1.00 34.77  ?  88  PHE A CE2 1 
ATOM   422  C CZ  . PHE A 1 58  ? 39.564 -14.510 -315.697 1.00 33.91  ?  88  PHE A CZ  1 
ATOM   423  N N   . ARG A 1 59  ? 43.761 -10.685 -311.735 1.00 36.95  ?  89  ARG A N   1 
ATOM   424  C CA  . ARG A 1 59  ? 44.875 -9.997  -311.087 1.00 34.37  ?  89  ARG A CA  1 
ATOM   425  C C   . ARG A 1 59  ? 46.173 -10.743 -311.400 1.00 38.60  ?  89  ARG A C   1 
ATOM   426  O O   . ARG A 1 59  ? 46.186 -11.984 -311.476 1.00 35.81  ?  89  ARG A O   1 
ATOM   427  C CB  . ARG A 1 59  ? 44.636 -9.911  -309.567 1.00 35.27  ?  89  ARG A CB  1 
ATOM   428  C CG  . ARG A 1 59  ? 45.797 -9.398  -308.709 1.00 36.71  ?  89  ARG A CG  1 
ATOM   429  C CD  . ARG A 1 59  ? 46.022 -7.885  -308.834 1.00 38.18  ?  89  ARG A CD  1 
ATOM   430  N NE  . ARG A 1 59  ? 47.348 -7.487  -308.357 1.00 35.85  ?  89  ARG A NE  1 
ATOM   431  C CZ  . ARG A 1 59  ? 47.634 -7.107  -307.111 1.00 37.74  ?  89  ARG A CZ  1 
ATOM   432  N NH1 . ARG A 1 59  ? 48.877 -6.775  -306.802 1.00 37.56  ?  89  ARG A NH1 1 
ATOM   433  N NH2 . ARG A 1 59  ? 46.692 -7.049  -306.170 1.00 35.95  ?  89  ARG A NH2 1 
ATOM   434  N N   . SER A 1 60  ? 47.253 -9.987  -311.596 1.00 37.41  ?  90  SER A N   1 
ATOM   435  C CA  . SER A 1 60  ? 48.567 -10.567 -311.840 1.00 35.29  ?  90  SER A CA  1 
ATOM   436  C C   . SER A 1 60  ? 49.535 -10.193 -310.724 1.00 41.23  ?  90  SER A C   1 
ATOM   437  O O   . SER A 1 60  ? 49.343 -9.189  -310.032 1.00 40.48  ?  90  SER A O   1 
ATOM   438  C CB  . SER A 1 60  ? 49.116 -10.118 -313.198 1.00 38.44  ?  90  SER A CB  1 
ATOM   439  O OG  . SER A 1 60  ? 48.341 -10.673 -314.253 1.00 44.22  ?  90  SER A OG  1 
ATOM   440  N N   . GLY A 1 61  ? 50.555 -11.024 -310.540 1.00 31.83  ?  91  GLY A N   1 
ATOM   441  C CA  . GLY A 1 61  ? 51.576 -10.777 -309.547 1.00 31.92  ?  91  GLY A CA  1 
ATOM   442  C C   . GLY A 1 61  ? 51.299 -11.430 -308.212 1.00 33.96  ?  91  GLY A C   1 
ATOM   443  O O   . GLY A 1 61  ? 52.147 -11.411 -307.325 1.00 37.27  ?  91  GLY A O   1 
ATOM   444  N N   . VAL A 1 62  ? 50.107 -11.998 -308.053 1.00 34.80  ?  92  VAL A N   1 
ATOM   445  C CA  . VAL A 1 62  ? 49.757 -12.658 -306.797 1.00 32.90  ?  92  VAL A CA  1 
ATOM   446  C C   . VAL A 1 62  ? 49.682 -14.179 -306.985 1.00 30.98  ?  92  VAL A C   1 
ATOM   447  O O   . VAL A 1 62  ? 48.834 -14.684 -307.717 1.00 32.07  ?  92  VAL A O   1 
ATOM   448  C CB  . VAL A 1 62  ? 48.419 -12.110 -306.228 1.00 34.19  ?  92  VAL A CB  1 
ATOM   449  C CG1 . VAL A 1 62  ? 48.118 -12.716 -304.854 1.00 32.68  ?  92  VAL A CG1 1 
ATOM   450  C CG2 . VAL A 1 62  ? 48.474 -10.587 -306.123 1.00 31.96  ?  92  VAL A CG2 1 
ATOM   451  N N   . PRO A 1 63  ? 50.594 -14.912 -306.332 1.00 35.62  ?  93  PRO A N   1 
ATOM   452  C CA  . PRO A 1 63  ? 50.611 -16.382 -306.362 1.00 34.49  ?  93  PRO A CA  1 
ATOM   453  C C   . PRO A 1 63  ? 49.383 -17.007 -305.673 1.00 34.38  ?  93  PRO A C   1 
ATOM   454  O O   . PRO A 1 63  ? 49.027 -16.616 -304.557 1.00 34.78  ?  93  PRO A O   1 
ATOM   455  C CB  . PRO A 1 63  ? 51.897 -16.743 -305.599 1.00 34.95  ?  93  PRO A CB  1 
ATOM   456  C CG  . PRO A 1 63  ? 52.689 -15.459 -305.507 1.00 39.77  ?  93  PRO A CG  1 
ATOM   457  C CD  . PRO A 1 63  ? 51.664 -14.366 -305.480 1.00 35.57  ?  93  PRO A CD  1 
ATOM   458  N N   . PRO A 1 64  ? 48.743 -17.977 -306.333 1.00 30.80  ?  94  PRO A N   1 
ATOM   459  C CA  . PRO A 1 64  ? 47.586 -18.662 -305.737 1.00 28.25  ?  94  PRO A CA  1 
ATOM   460  C C   . PRO A 1 64  ? 47.956 -19.428 -304.463 1.00 31.08  ?  94  PRO A C   1 
ATOM   461  O O   . PRO A 1 64  ? 49.093 -19.859 -304.309 1.00 30.35  ?  94  PRO A O   1 
ATOM   462  C CB  . PRO A 1 64  ? 47.126 -19.624 -306.840 1.00 25.12  ?  94  PRO A CB  1 
ATOM   463  C CG  . PRO A 1 64  ? 48.264 -19.725 -307.789 1.00 29.27  ?  94  PRO A CG  1 
ATOM   464  C CD  . PRO A 1 64  ? 49.016 -18.424 -307.710 1.00 25.74  ?  94  PRO A CD  1 
ATOM   465  N N   . LYS A 1 65  ? 46.998 -19.576 -303.553 1.00 27.87  ?  95  LYS A N   1 
ATOM   466  C CA  . LYS A 1 65  ? 47.238 -20.292 -302.309 1.00 25.91  ?  95  LYS A CA  1 
ATOM   467  C C   . LYS A 1 65  ? 46.071 -21.240 -302.017 1.00 28.49  ?  95  LYS A C   1 
ATOM   468  O O   . LYS A 1 65  ? 44.920 -20.947 -302.334 1.00 29.76  ?  95  LYS A O   1 
ATOM   469  C CB  . LYS A 1 65  ? 47.451 -19.301 -301.157 1.00 28.70  ?  95  LYS A CB  1 
ATOM   470  C CG  . LYS A 1 65  ? 48.750 -18.517 -301.271 1.00 29.44  ?  95  LYS A CG  1 
ATOM   471  C CD  . LYS A 1 65  ? 49.955 -19.395 -300.876 1.00 29.69  ?  95  LYS A CD  1 
ATOM   472  C CE  . LYS A 1 65  ? 51.281 -18.800 -301.348 1.00 31.41  ?  95  LYS A CE  1 
ATOM   473  N NZ  . LYS A 1 65  ? 51.492 -17.398 -300.851 1.00 32.60  ?  95  LYS A NZ  1 
ATOM   474  N N   . VAL A 1 66  ? 46.387 -22.382 -301.421 1.00 30.23  ?  96  VAL A N   1 
ATOM   475  C CA  . VAL A 1 66  ? 45.403 -23.404 -301.117 1.00 29.29  ?  96  VAL A CA  1 
ATOM   476  C C   . VAL A 1 66  ? 45.466 -23.778 -299.632 1.00 30.94  ?  96  VAL A C   1 
ATOM   477  O O   . VAL A 1 66  ? 46.544 -23.784 -299.054 1.00 33.16  ?  96  VAL A O   1 
ATOM   478  C CB  . VAL A 1 66  ? 45.633 -24.652 -302.016 1.00 32.20  ?  96  VAL A CB  1 
ATOM   479  C CG1 . VAL A 1 66  ? 44.941 -25.891 -301.459 1.00 28.21  ?  96  VAL A CG1 1 
ATOM   480  C CG2 . VAL A 1 66  ? 45.175 -24.355 -303.455 1.00 32.42  ?  96  VAL A CG2 1 
ATOM   481  N N   . VAL A 1 67  ? 44.319 -24.060 -299.017 1.00 28.25  ?  97  VAL A N   1 
ATOM   482  C CA  . VAL A 1 67  ? 44.277 -24.518 -297.631 1.00 26.98  ?  97  VAL A CA  1 
ATOM   483  C C   . VAL A 1 67  ? 43.203 -25.602 -297.517 1.00 27.13  ?  97  VAL A C   1 
ATOM   484  O O   . VAL A 1 67  ? 42.140 -25.493 -298.145 1.00 29.41  ?  97  VAL A O   1 
ATOM   485  C CB  . VAL A 1 67  ? 44.015 -23.334 -296.662 1.00 32.04  ?  97  VAL A CB  1 
ATOM   486  C CG1 . VAL A 1 67  ? 42.811 -22.503 -297.095 1.00 26.41  ?  97  VAL A CG1 1 
ATOM   487  C CG2 . VAL A 1 67  ? 43.933 -23.794 -295.187 1.00 30.65  ?  97  VAL A CG2 1 
ATOM   488  N N   . ASN A 1 68  ? 43.466 -26.672 -296.767 1.00 28.31  ?  98  ASN A N   1 
ATOM   489  C CA  . ASN A 1 68  ? 42.473 -27.738 -296.705 1.00 33.81  ?  98  ASN A CA  1 
ATOM   490  C C   . ASN A 1 68  ? 41.376 -27.396 -295.703 1.00 35.33  ?  98  ASN A C   1 
ATOM   491  O O   . ASN A 1 68  ? 41.528 -26.495 -294.886 1.00 35.54  ?  98  ASN A O   1 
ATOM   492  C CB  . ASN A 1 68  ? 43.118 -29.098 -296.378 1.00 33.75  ?  98  ASN A CB  1 
ATOM   493  C CG  . ASN A 1 68  ? 43.421 -29.272 -294.911 1.00 37.06  ?  98  ASN A CG  1 
ATOM   494  O OD1 . ASN A 1 68  ? 44.135 -28.462 -294.320 1.00 40.72  ?  98  ASN A OD1 1 
ATOM   495  N ND2 . ASN A 1 68  ? 42.889 -30.339 -294.309 1.00 33.56  ?  98  ASN A ND2 1 
ATOM   496  N N   . TYR A 1 69  ? 40.248 -28.082 -295.826 1.00 33.27  ?  99  TYR A N   1 
ATOM   497  C CA  . TYR A 1 69  ? 39.160 -27.979 -294.862 1.00 36.94  ?  99  TYR A CA  1 
ATOM   498  C C   . TYR A 1 69  ? 38.513 -29.354 -294.890 1.00 34.68  ?  99  TYR A C   1 
ATOM   499  O O   . TYR A 1 69  ? 38.648 -30.064 -295.876 1.00 35.94  ?  99  TYR A O   1 
ATOM   500  C CB  . TYR A 1 69  ? 38.177 -26.832 -295.198 1.00 30.55  ?  99  TYR A CB  1 
ATOM   501  C CG  . TYR A 1 69  ? 37.304 -27.045 -296.420 1.00 35.83  ?  99  TYR A CG  1 
ATOM   502  C CD1 . TYR A 1 69  ? 37.735 -26.685 -297.704 1.00 32.18  ?  99  TYR A CD1 1 
ATOM   503  C CD2 . TYR A 1 69  ? 36.043 -27.588 -296.287 1.00 33.01  ?  99  TYR A CD2 1 
ATOM   504  C CE1 . TYR A 1 69  ? 36.913 -26.877 -298.814 1.00 28.54  ?  99  TYR A CE1 1 
ATOM   505  C CE2 . TYR A 1 69  ? 35.229 -27.782 -297.372 1.00 35.71  ?  99  TYR A CE2 1 
ATOM   506  C CZ  . TYR A 1 69  ? 35.656 -27.437 -298.634 1.00 34.42  ?  99  TYR A CZ  1 
ATOM   507  O OH  . TYR A 1 69  ? 34.795 -27.664 -299.690 1.00 28.89  ?  99  TYR A OH  1 
ATOM   508  N N   . GLU A 1 70  ? 37.850 -29.756 -293.810 1.00 40.78  ?  100 GLU A N   1 
ATOM   509  C CA  . GLU A 1 70  ? 37.508 -31.167 -293.643 1.00 44.54  ?  100 GLU A CA  1 
ATOM   510  C C   . GLU A 1 70  ? 36.033 -31.451 -293.810 1.00 43.19  ?  100 GLU A C   1 
ATOM   511  O O   . GLU A 1 70  ? 35.634 -32.597 -294.035 1.00 46.08  ?  100 GLU A O   1 
ATOM   512  C CB  . GLU A 1 70  ? 37.968 -31.661 -292.270 1.00 47.93  ?  100 GLU A CB  1 
ATOM   513  C CG  . GLU A 1 70  ? 39.466 -31.861 -292.164 1.00 55.91  ?  100 GLU A CG  1 
ATOM   514  C CD  . GLU A 1 70  ? 39.963 -31.827 -290.727 1.00 58.18  ?  100 GLU A CD  1 
ATOM   515  O OE1 . GLU A 1 70  ? 40.955 -32.514 -290.425 1.00 65.61  ?  100 GLU A OE1 1 
ATOM   516  O OE2 . GLU A 1 70  ? 39.373 -31.102 -289.902 1.00 62.14  -1 100 GLU A OE2 1 
ATOM   517  N N   . ALA A 1 71  ? 35.215 -30.417 -293.688 1.00 38.09  ?  101 ALA A N   1 
ATOM   518  C CA  . ALA A 1 71  ? 33.779 -30.596 -293.841 1.00 39.27  ?  101 ALA A CA  1 
ATOM   519  C C   . ALA A 1 71  ? 33.153 -29.315 -294.347 1.00 33.26  ?  101 ALA A C   1 
ATOM   520  O O   . ALA A 1 71  ? 33.628 -28.223 -294.035 1.00 36.97  ?  101 ALA A O   1 
ATOM   521  C CB  . ALA A 1 71  ? 33.143 -31.025 -292.515 1.00 37.12  ?  101 ALA A CB  1 
ATOM   522  N N   . GLY A 1 72  ? 32.090 -29.442 -295.128 1.00 31.31  ?  102 GLY A N   1 
ATOM   523  C CA  . GLY A 1 72  ? 31.356 -28.269 -295.564 1.00 35.67  ?  102 GLY A CA  1 
ATOM   524  C C   . GLY A 1 72  ? 29.873 -28.533 -295.684 1.00 39.80  ?  102 GLY A C   1 
ATOM   525  O O   . GLY A 1 72  ? 29.362 -29.485 -295.098 1.00 40.14  ?  102 GLY A O   1 
ATOM   526  N N   . GLU A 1 73  ? 29.171 -27.699 -296.446 1.00 39.54  ?  103 GLU A N   1 
ATOM   527  C CA  . GLU A 1 73  ? 27.727 -27.863 -296.567 1.00 40.25  ?  103 GLU A CA  1 
ATOM   528  C C   . GLU A 1 73  ? 27.258 -27.996 -298.000 1.00 41.17  ?  103 GLU A C   1 
ATOM   529  O O   . GLU A 1 73  ? 27.960 -27.622 -298.941 1.00 41.52  ?  103 GLU A O   1 
ATOM   530  C CB  . GLU A 1 73  ? 26.994 -26.699 -295.890 1.00 47.09  ?  103 GLU A CB  1 
ATOM   531  C CG  . GLU A 1 73  ? 27.503 -25.322 -296.249 1.00 43.78  ?  103 GLU A CG  1 
ATOM   532  C CD  . GLU A 1 73  ? 26.595 -24.222 -295.735 1.00 44.84  ?  103 GLU A CD  1 
ATOM   533  O OE1 . GLU A 1 73  ? 25.381 -24.481 -295.598 1.00 45.65  ?  103 GLU A OE1 1 
ATOM   534  O OE2 . GLU A 1 73  ? 27.085 -23.092 -295.497 1.00 44.54  -1 103 GLU A OE2 1 
ATOM   535  N N   . TRP A 1 74  ? 26.070 -28.567 -298.151 1.00 43.58  ?  104 TRP A N   1 
ATOM   536  C CA  . TRP A 1 74  ? 25.394 -28.604 -299.429 1.00 39.14  ?  104 TRP A CA  1 
ATOM   537  C C   . TRP A 1 74  ? 25.255 -27.185 -299.964 1.00 39.24  ?  104 TRP A C   1 
ATOM   538  O O   . TRP A 1 74  ? 24.860 -26.290 -299.235 1.00 34.59  ?  104 TRP A O   1 
ATOM   539  C CB  . TRP A 1 74  ? 24.015 -29.232 -299.302 1.00 40.60  ?  104 TRP A CB  1 
ATOM   540  C CG  . TRP A 1 74  ? 23.942 -30.716 -299.503 1.00 43.61  ?  104 TRP A CG  1 
ATOM   541  C CD1 . TRP A 1 74  ? 23.996 -31.677 -298.539 1.00 41.02  ?  104 TRP A CD1 1 
ATOM   542  C CD2 . TRP A 1 74  ? 23.761 -31.405 -300.754 1.00 38.29  ?  104 TRP A CD2 1 
ATOM   543  N NE1 . TRP A 1 74  ? 23.866 -32.918 -299.108 1.00 43.43  ?  104 TRP A NE1 1 
ATOM   544  C CE2 . TRP A 1 74  ? 23.721 -32.783 -300.457 1.00 35.96  ?  104 TRP A CE2 1 
ATOM   545  C CE3 . TRP A 1 74  ? 23.651 -30.987 -302.085 1.00 39.03  ?  104 TRP A CE3 1 
ATOM   546  C CZ2 . TRP A 1 74  ? 23.569 -33.755 -301.454 1.00 40.59  ?  104 TRP A CZ2 1 
ATOM   547  C CZ3 . TRP A 1 74  ? 23.501 -31.958 -303.082 1.00 41.87  ?  104 TRP A CZ3 1 
ATOM   548  C CH2 . TRP A 1 74  ? 23.462 -33.331 -302.755 1.00 42.63  ?  104 TRP A CH2 1 
ATOM   549  N N   . ALA A 1 75  ? 25.592 -26.997 -301.237 1.00 38.10  ?  105 ALA A N   1 
ATOM   550  C CA  . ALA A 1 75  ? 25.464 -25.707 -301.893 1.00 36.28  ?  105 ALA A CA  1 
ATOM   551  C C   . ALA A 1 75  ? 24.279 -25.735 -302.851 1.00 35.76  ?  105 ALA A C   1 
ATOM   552  O O   . ALA A 1 75  ? 24.119 -26.695 -303.592 1.00 35.02  ?  105 ALA A O   1 
ATOM   553  C CB  . ALA A 1 75  ? 26.741 -25.370 -302.643 1.00 35.50  ?  105 ALA A CB  1 
ATOM   554  N N   . GLU A 1 76  ? 23.446 -24.700 -302.831 1.00 30.74  ?  106 GLU A N   1 
ATOM   555  C CA  . GLU A 1 76  ? 22.343 -24.605 -303.791 1.00 35.87  ?  106 GLU A CA  1 
ATOM   556  C C   . GLU A 1 76  ? 22.892 -24.268 -305.173 1.00 36.64  ?  106 GLU A C   1 
ATOM   557  O O   . GLU A 1 76  ? 22.456 -24.832 -306.172 1.00 36.26  ?  106 GLU A O   1 
ATOM   558  C CB  . GLU A 1 76  ? 21.312 -23.552 -303.364 1.00 38.32  ?  106 GLU A CB  1 
ATOM   559  C CG  . GLU A 1 76  ? 20.702 -23.764 -301.953 1.00 38.08  ?  106 GLU A CG  1 
ATOM   560  C CD  . GLU A 1 76  ? 19.766 -24.972 -301.888 1.00 41.05  ?  106 GLU A CD  1 
ATOM   561  O OE1 . GLU A 1 76  ? 19.244 -25.398 -302.948 1.00 42.25  ?  106 GLU A OE1 1 
ATOM   562  O OE2 . GLU A 1 76  ? 19.560 -25.501 -300.778 1.00 41.66  -1 106 GLU A OE2 1 
ATOM   563  N N   . ASN A 1 77  ? 23.859 -23.354 -305.217 1.00 35.35  ?  107 ASN A N   1 
ATOM   564  C CA  . ASN A 1 77  ? 24.503 -22.976 -306.472 1.00 38.71  ?  107 ASN A CA  1 
ATOM   565  C C   . ASN A 1 77  ? 26.013 -23.167 -306.482 1.00 38.20  ?  107 ASN A C   1 
ATOM   566  O O   . ASN A 1 77  ? 26.716 -22.682 -305.601 1.00 37.15  ?  107 ASN A O   1 
ATOM   567  C CB  . ASN A 1 77  ? 24.202 -21.521 -306.808 1.00 32.77  ?  107 ASN A CB  1 
ATOM   568  C CG  . ASN A 1 77  ? 22.757 -21.303 -307.154 1.00 38.50  ?  107 ASN A CG  1 
ATOM   569  O OD1 . ASN A 1 77  ? 22.345 -21.533 -308.288 1.00 39.59  ?  107 ASN A OD1 1 
ATOM   570  N ND2 . ASN A 1 77  ? 21.970 -20.856 -306.177 1.00 37.16  ?  107 ASN A ND2 1 
ATOM   571  N N   . CYS A 1 78  ? 26.500 -23.865 -307.501 1.00 35.56  ?  108 CYS A N   1 
ATOM   572  C CA  . CYS A 1 78  ? 27.933 -23.958 -307.750 1.00 34.65  ?  108 CYS A CA  1 
ATOM   573  C C   . CYS A 1 78  ? 28.260 -23.414 -309.135 1.00 33.41  ?  108 CYS A C   1 
ATOM   574  O O   . CYS A 1 78  ? 27.355 -23.170 -309.943 1.00 29.49  ?  108 CYS A O   1 
ATOM   575  C CB  . CYS A 1 78  ? 28.411 -25.403 -307.620 1.00 29.61  ?  108 CYS A CB  1 
ATOM   576  S SG  . CYS A 1 78  ? 28.355 -26.032 -305.922 1.00 33.43  ?  108 CYS A SG  1 
ATOM   577  N N   . TYR A 1 79  ? 29.553 -23.236 -309.402 1.00 28.11  ?  109 TYR A N   1 
ATOM   578  C CA  . TYR A 1 79  ? 30.014 -22.691 -310.675 1.00 28.41  ?  109 TYR A CA  1 
ATOM   579  C C   . TYR A 1 79  ? 31.149 -23.533 -311.240 1.00 29.63  ?  109 TYR A C   1 
ATOM   580  O O   . TYR A 1 79  ? 31.947 -24.112 -310.488 1.00 29.97  ?  109 TYR A O   1 
ATOM   581  C CB  . TYR A 1 79  ? 30.449 -21.232 -310.509 1.00 27.15  ?  109 TYR A CB  1 
ATOM   582  C CG  . TYR A 1 79  ? 29.318 -20.364 -310.021 1.00 29.52  ?  109 TYR A CG  1 
ATOM   583  C CD1 . TYR A 1 79  ? 29.112 -20.148 -308.663 1.00 31.50  ?  109 TYR A CD1 1 
ATOM   584  C CD2 . TYR A 1 79  ? 28.419 -19.807 -310.923 1.00 30.03  ?  109 TYR A CD2 1 
ATOM   585  C CE1 . TYR A 1 79  ? 28.044 -19.374 -308.217 1.00 34.95  ?  109 TYR A CE1 1 
ATOM   586  C CE2 . TYR A 1 79  ? 27.366 -19.037 -310.499 1.00 27.52  ?  109 TYR A CE2 1 
ATOM   587  C CZ  . TYR A 1 79  ? 27.174 -18.820 -309.150 1.00 32.71  ?  109 TYR A CZ  1 
ATOM   588  O OH  . TYR A 1 79  ? 26.101 -18.056 -308.740 1.00 34.84  ?  109 TYR A OH  1 
ATOM   589  N N   . ASN A 1 80  ? 31.205 -23.600 -312.566 1.00 25.40  ?  110 ASN A N   1 
ATOM   590  C CA  . ASN A 1 80  ? 32.200 -24.387 -313.273 1.00 27.58  ?  110 ASN A CA  1 
ATOM   591  C C   . ASN A 1 80  ? 32.495 -23.649 -314.583 1.00 30.96  ?  110 ASN A C   1 
ATOM   592  O O   . ASN A 1 80  ? 31.674 -23.657 -315.510 1.00 28.44  ?  110 ASN A O   1 
ATOM   593  C CB  . ASN A 1 80  ? 31.691 -25.821 -313.509 1.00 25.62  ?  110 ASN A CB  1 
ATOM   594  C CG  . ASN A 1 80  ? 32.736 -26.740 -314.171 1.00 30.19  ?  110 ASN A CG  1 
ATOM   595  O OD1 . ASN A 1 80  ? 33.283 -26.422 -315.223 1.00 30.69  ?  110 ASN A OD1 1 
ATOM   596  N ND2 . ASN A 1 80  ? 32.976 -27.902 -313.566 1.00 26.86  ?  110 ASN A ND2 1 
ATOM   597  N N   . LEU A 1 81  ? 33.653 -22.993 -314.630 1.00 28.92  ?  111 LEU A N   1 
ATOM   598  C CA  . LEU A 1 81  ? 33.975 -22.045 -315.706 1.00 30.94  ?  111 LEU A CA  1 
ATOM   599  C C   . LEU A 1 81  ? 35.057 -22.562 -316.650 1.00 32.64  ?  111 LEU A C   1 
ATOM   600  O O   . LEU A 1 81  ? 36.028 -23.171 -316.206 1.00 33.30  ?  111 LEU A O   1 
ATOM   601  C CB  . LEU A 1 81  ? 34.428 -20.709 -315.119 1.00 28.73  ?  111 LEU A CB  1 
ATOM   602  C CG  . LEU A 1 81  ? 33.507 -20.069 -314.078 1.00 30.63  ?  111 LEU A CG  1 
ATOM   603  C CD1 . LEU A 1 81  ? 34.054 -18.723 -313.635 1.00 25.48  ?  111 LEU A CD1 1 
ATOM   604  C CD2 . LEU A 1 81  ? 32.077 -19.946 -314.617 1.00 29.95  ?  111 LEU A CD2 1 
ATOM   605  N N   . GLU A 1 82  ? 34.871 -22.330 -317.944 1.00 28.27  ?  112 GLU A N   1 
ATOM   606  C CA  . GLU A 1 82  ? 35.916 -22.552 -318.949 1.00 30.90  ?  112 GLU A CA  1 
ATOM   607  C C   . GLU A 1 82  ? 35.985 -21.326 -319.880 1.00 32.44  ?  112 GLU A C   1 
ATOM   608  O O   . GLU A 1 82  ? 34.972 -20.894 -320.431 1.00 31.93  ?  112 GLU A O   1 
ATOM   609  C CB  . GLU A 1 82  ? 35.652 -23.823 -319.759 1.00 35.08  ?  112 GLU A CB  1 
ATOM   610  C CG  . GLU A 1 82  ? 36.407 -23.874 -321.100 1.00 41.45  ?  112 GLU A CG  1 
ATOM   611  C CD  . GLU A 1 82  ? 37.919 -23.872 -320.916 1.00 44.12  ?  112 GLU A CD  1 
ATOM   612  O OE1 . GLU A 1 82  ? 38.647 -23.345 -321.790 1.00 40.70  ?  112 GLU A OE1 1 
ATOM   613  O OE2 . GLU A 1 82  ? 38.377 -24.391 -319.880 1.00 45.72  -1 112 GLU A OE2 1 
ATOM   614  N N   . ILE A 1 83  ? 37.176 -20.757 -320.029 1.00 33.32  ?  113 ILE A N   1 
ATOM   615  C CA  . ILE A 1 83  ? 37.342 -19.474 -320.703 1.00 32.38  ?  113 ILE A CA  1 
ATOM   616  C C   . ILE A 1 83  ? 38.548 -19.481 -321.644 1.00 35.71  ?  113 ILE A C   1 
ATOM   617  O O   . ILE A 1 83  ? 39.678 -19.717 -321.205 1.00 36.57  ?  113 ILE A O   1 
ATOM   618  C CB  . ILE A 1 83  ? 37.530 -18.310 -319.687 1.00 31.65  ?  113 ILE A CB  1 
ATOM   619  C CG1 . ILE A 1 83  ? 36.407 -18.291 -318.646 1.00 36.66  ?  113 ILE A CG1 1 
ATOM   620  C CG2 . ILE A 1 83  ? 37.571 -16.967 -320.412 1.00 35.21  ?  113 ILE A CG2 1 
ATOM   621  C CD1 . ILE A 1 83  ? 36.578 -17.217 -317.589 1.00 31.20  ?  113 ILE A CD1 1 
ATOM   622  N N   . LYS A 1 84  ? 38.303 -19.226 -322.928 1.00 32.09  ?  114 LYS A N   1 
ATOM   623  C CA  . LYS A 1 84  ? 39.380 -18.975 -323.894 1.00 34.55  ?  114 LYS A CA  1 
ATOM   624  C C   . LYS A 1 84  ? 39.754 -17.489 -323.949 1.00 34.66  ?  114 LYS A C   1 
ATOM   625  O O   . LYS A 1 84  ? 38.879 -16.613 -323.952 1.00 33.46  ?  114 LYS A O   1 
ATOM   626  C CB  . LYS A 1 84  ? 38.978 -19.445 -325.296 1.00 35.80  ?  114 LYS A CB  1 
ATOM   627  C CG  . LYS A 1 84  ? 38.586 -20.913 -325.402 1.00 35.52  ?  114 LYS A CG  1 
ATOM   628  C CD  . LYS A 1 84  ? 39.663 -21.812 -324.806 1.00 38.42  ?  114 LYS A CD  1 
ATOM   629  C CE  . LYS A 1 84  ? 39.253 -23.283 -324.852 1.00 39.02  ?  114 LYS A CE  1 
ATOM   630  N NZ  . LYS A 1 84  ? 39.124 -23.769 -326.242 1.00 47.72  ?  114 LYS A NZ  1 
ATOM   631  N N   . LYS A 1 85  ? 41.053 -17.205 -323.978 1.00 36.27  ?  115 LYS A N   1 
ATOM   632  C CA  . LYS A 1 85  ? 41.532 -15.855 -324.307 1.00 38.14  ?  115 LYS A CA  1 
ATOM   633  C C   . LYS A 1 85  ? 41.145 -15.497 -325.757 1.00 38.89  ?  115 LYS A C   1 
ATOM   634  O O   . LYS A 1 85  ? 40.740 -16.373 -326.525 1.00 33.59  ?  115 LYS A O   1 
ATOM   635  C CB  . LYS A 1 85  ? 43.047 -15.761 -324.125 1.00 35.11  ?  115 LYS A CB  1 
ATOM   636  C CG  . LYS A 1 85  ? 43.517 -15.997 -322.722 1.00 34.59  ?  115 LYS A CG  1 
ATOM   637  C CD  . LYS A 1 85  ? 44.969 -15.616 -322.595 1.00 41.02  ?  115 LYS A CD  1 
ATOM   638  C CE  . LYS A 1 85  ? 45.573 -16.118 -321.294 1.00 40.95  ?  115 LYS A CE  1 
ATOM   639  N NZ  . LYS A 1 85  ? 46.971 -15.591 -321.143 1.00 44.19  ?  115 LYS A NZ  1 
ATOM   640  N N   . PRO A 1 86  ? 41.243 -14.207 -326.127 1.00 38.33  ?  116 PRO A N   1 
ATOM   641  C CA  . PRO A 1 86  ? 40.947 -13.838 -327.522 1.00 40.86  ?  116 PRO A CA  1 
ATOM   642  C C   . PRO A 1 86  ? 41.792 -14.614 -328.548 1.00 39.36  ?  116 PRO A C   1 
ATOM   643  O O   . PRO A 1 86  ? 41.291 -14.918 -329.641 1.00 42.32  ?  116 PRO A O   1 
ATOM   644  C CB  . PRO A 1 86  ? 41.274 -12.341 -327.565 1.00 34.97  ?  116 PRO A CB  1 
ATOM   645  C CG  . PRO A 1 86  ? 41.023 -11.872 -326.165 1.00 38.54  ?  116 PRO A CG  1 
ATOM   646  C CD  . PRO A 1 86  ? 41.449 -13.022 -325.272 1.00 35.33  ?  116 PRO A CD  1 
ATOM   647  N N   . ASP A 1 87  ? 43.029 -14.961 -328.198 1.00 38.36  ?  117 ASP A N   1 
ATOM   648  C CA  . ASP A 1 87  ? 43.886 -15.705 -329.131 1.00 44.71  ?  117 ASP A CA  1 
ATOM   649  C C   . ASP A 1 87  ? 43.635 -17.216 -329.087 1.00 42.63  ?  117 ASP A C   1 
ATOM   650  O O   . ASP A 1 87  ? 44.334 -17.981 -329.746 1.00 45.95  ?  117 ASP A O   1 
ATOM   651  C CB  . ASP A 1 87  ? 45.385 -15.417 -328.880 1.00 42.15  ?  117 ASP A CB  1 
ATOM   652  C CG  . ASP A 1 87  ? 45.874 -15.872 -327.500 1.00 49.31  ?  117 ASP A CG  1 
ATOM   653  O OD1 . ASP A 1 87  ? 45.197 -16.680 -326.828 1.00 48.65  ?  117 ASP A OD1 1 
ATOM   654  O OD2 . ASP A 1 87  ? 46.971 -15.435 -327.095 1.00 51.80  -1 117 ASP A OD2 1 
ATOM   655  N N   . GLY A 1 88  ? 42.646 -17.637 -328.303 1.00 38.27  ?  118 GLY A N   1 
ATOM   656  C CA  . GLY A 1 88  ? 42.228 -19.028 -328.278 1.00 38.19  ?  118 GLY A CA  1 
ATOM   657  C C   . GLY A 1 88  ? 42.901 -19.928 -327.246 1.00 34.35  ?  118 GLY A C   1 
ATOM   658  O O   . GLY A 1 88  ? 42.475 -21.056 -327.031 1.00 39.39  ?  118 GLY A O   1 
ATOM   659  N N   . SER A 1 89  ? 43.959 -19.454 -326.609 1.00 34.64  ?  119 SER A N   1 
ATOM   660  C CA  . SER A 1 89  ? 44.609 -20.255 -325.580 1.00 35.22  ?  119 SER A CA  1 
ATOM   661  C C   . SER A 1 89  ? 43.752 -20.238 -324.301 1.00 36.38  ?  119 SER A C   1 
ATOM   662  O O   . SER A 1 89  ? 42.710 -19.589 -324.264 1.00 36.27  ?  119 SER A O   1 
ATOM   663  C CB  . SER A 1 89  ? 46.016 -19.736 -325.310 1.00 29.97  ?  119 SER A CB  1 
ATOM   664  O OG  . SER A 1 89  ? 45.960 -18.398 -324.841 1.00 35.81  ?  119 SER A OG  1 
ATOM   665  N N   . GLU A 1 90  ? 44.186 -20.949 -323.263 1.00 34.48  ?  120 GLU A N   1 
ATOM   666  C CA  . GLU A 1 90  ? 43.381 -21.097 -322.045 1.00 39.70  ?  120 GLU A CA  1 
ATOM   667  C C   . GLU A 1 90  ? 43.562 -19.926 -321.068 1.00 35.04  ?  120 GLU A C   1 
ATOM   668  O O   . GLU A 1 90  ? 44.687 -19.529 -320.745 1.00 35.90  ?  120 GLU A O   1 
ATOM   669  C CB  . GLU A 1 90  ? 43.716 -22.420 -321.337 1.00 35.75  ?  120 GLU A CB  1 
ATOM   670  C CG  . GLU A 1 90  ? 43.297 -23.685 -322.098 1.00 35.08  ?  120 GLU A CG  1 
ATOM   671  C CD  . GLU A 1 90  ? 41.790 -23.888 -322.126 1.00 39.31  ?  120 GLU A CD  1 
ATOM   672  O OE1 . GLU A 1 90  ? 41.311 -24.859 -322.740 1.00 43.30  ?  120 GLU A OE1 1 
ATOM   673  O OE2 . GLU A 1 90  ? 41.073 -23.077 -321.520 1.00 45.68  -1 120 GLU A OE2 1 
ATOM   674  N N   . CYS A 1 91  ? 42.447 -19.386 -320.586 1.00 31.95  ?  121 CYS A N   1 
ATOM   675  C CA  . CYS A 1 91  ? 42.494 -18.282 -319.629 1.00 27.82  ?  121 CYS A CA  1 
ATOM   676  C C   . CYS A 1 91  ? 42.666 -18.747 -318.168 1.00 32.57  ?  121 CYS A C   1 
ATOM   677  O O   . CYS A 1 91  ? 43.435 -18.153 -317.415 1.00 31.37  ?  121 CYS A O   1 
ATOM   678  C CB  . CYS A 1 91  ? 41.236 -17.427 -319.766 1.00 32.46  ?  121 CYS A CB  1 
ATOM   679  S SG  . CYS A 1 91  ? 40.965 -16.254 -318.421 1.00 40.62  ?  121 CYS A SG  1 
ATOM   680  N N   . LEU A 1 92  ? 41.958 -19.800 -317.763 1.00 35.51  ?  122 LEU A N   1 
ATOM   681  C CA  . LEU A 1 92  ? 42.095 -20.319 -316.388 1.00 32.78  ?  122 LEU A CA  1 
ATOM   682  C C   . LEU A 1 92  ? 43.086 -21.488 -316.323 1.00 31.93  ?  122 LEU A C   1 
ATOM   683  O O   . LEU A 1 92  ? 43.170 -22.303 -317.239 1.00 33.59  ?  122 LEU A O   1 
ATOM   684  C CB  . LEU A 1 92  ? 40.738 -20.754 -315.835 1.00 27.76  ?  122 LEU A CB  1 
ATOM   685  C CG  . LEU A 1 92  ? 39.669 -19.653 -315.865 1.00 32.34  ?  122 LEU A CG  1 
ATOM   686  C CD1 . LEU A 1 92  ? 38.280 -20.255 -315.751 1.00 30.19  ?  122 LEU A CD1 1 
ATOM   687  C CD2 . LEU A 1 92  ? 39.904 -18.597 -314.768 1.00 25.50  ?  122 LEU A CD2 1 
ATOM   688  N N   . PRO A 1 93  ? 43.847 -21.567 -315.232 1.00 28.85  ?  123 PRO A N   1 
ATOM   689  C CA  . PRO A 1 93  ? 44.797 -22.675 -315.073 1.00 29.23  ?  123 PRO A CA  1 
ATOM   690  C C   . PRO A 1 93  ? 44.073 -24.007 -314.896 1.00 32.10  ?  123 PRO A C   1 
ATOM   691  O O   . PRO A 1 93  ? 42.953 -24.018 -314.379 1.00 29.74  ?  123 PRO A O   1 
ATOM   692  C CB  . PRO A 1 93  ? 45.569 -22.295 -313.801 1.00 28.37  ?  123 PRO A CB  1 
ATOM   693  C CG  . PRO A 1 93  ? 44.569 -21.452 -313.001 1.00 28.64  ?  123 PRO A CG  1 
ATOM   694  C CD  . PRO A 1 93  ? 43.795 -20.678 -314.054 1.00 24.88  ?  123 PRO A CD  1 
ATOM   695  N N   . ALA A 1 94  ? 44.691 -25.107 -315.318 1.00 31.38  ?  124 ALA A N   1 
ATOM   696  C CA  . ALA A 1 94  ? 44.118 -26.430 -315.086 1.00 34.26  ?  124 ALA A CA  1 
ATOM   697  C C   . ALA A 1 94  ? 44.097 -26.734 -313.585 1.00 34.12  ?  124 ALA A C   1 
ATOM   698  O O   . ALA A 1 94  ? 44.962 -26.270 -312.836 1.00 29.66  ?  124 ALA A O   1 
ATOM   699  C CB  . ALA A 1 94  ? 44.906 -27.494 -315.827 1.00 34.30  ?  124 ALA A CB  1 
ATOM   700  N N   . ALA A 1 95  ? 43.111 -27.502 -313.142 1.00 33.42  ?  125 ALA A N   1 
ATOM   701  C CA  . ALA A 1 95  ? 43.060 -27.876 -311.730 1.00 31.07  ?  125 ALA A CA  1 
ATOM   702  C C   . ALA A 1 95  ? 44.325 -28.650 -311.391 1.00 29.93  ?  125 ALA A C   1 
ATOM   703  O O   . ALA A 1 95  ? 44.664 -29.614 -312.065 1.00 34.10  ?  125 ALA A O   1 
ATOM   704  C CB  . ALA A 1 95  ? 41.819 -28.702 -311.430 1.00 26.27  ?  125 ALA A CB  1 
ATOM   705  N N   . PRO A 1 96  ? 45.054 -28.200 -310.367 1.00 30.09  ?  126 PRO A N   1 
ATOM   706  C CA  . PRO A 1 96  ? 46.219 -28.963 -309.921 1.00 30.74  ?  126 PRO A CA  1 
ATOM   707  C C   . PRO A 1 96  ? 45.798 -30.363 -309.472 1.00 36.24  ?  126 PRO A C   1 
ATOM   708  O O   . PRO A 1 96  ? 44.648 -30.595 -309.069 1.00 33.17  ?  126 PRO A O   1 
ATOM   709  C CB  . PRO A 1 96  ? 46.762 -28.142 -308.736 1.00 32.29  ?  126 PRO A CB  1 
ATOM   710  C CG  . PRO A 1 96  ? 46.133 -26.772 -308.871 1.00 32.35  ?  126 PRO A CG  1 
ATOM   711  C CD  . PRO A 1 96  ? 44.818 -26.991 -309.558 1.00 33.31  ?  126 PRO A CD  1 
ATOM   712  N N   . ASP A 1 97  ? 46.744 -31.281 -309.569 1.00 31.30  ?  127 ASP A N   1 
ATOM   713  C CA  . ASP A 1 97  ? 46.610 -32.659 -309.117 1.00 34.86  ?  127 ASP A CA  1 
ATOM   714  C C   . ASP A 1 97  ? 45.970 -32.749 -307.721 1.00 31.67  ?  127 ASP A C   1 
ATOM   715  O O   . ASP A 1 97  ? 46.412 -32.091 -306.797 1.00 31.83  ?  127 ASP A O   1 
ATOM   716  C CB  . ASP A 1 97  ? 48.003 -33.301 -309.138 1.00 36.22  ?  127 ASP A CB  1 
ATOM   717  C CG  . ASP A 1 97  ? 47.977 -34.794 -308.905 1.00 47.58  ?  127 ASP A CG  1 
ATOM   718  O OD1 . ASP A 1 97  ? 49.068 -35.341 -308.606 1.00 52.89  ?  127 ASP A OD1 1 
ATOM   719  O OD2 . ASP A 1 97  ? 46.890 -35.416 -309.008 1.00 42.94  -1 127 ASP A OD2 1 
ATOM   720  N N   . GLY A 1 98  ? 44.905 -33.534 -307.594 1.00 28.24  ?  128 GLY A N   1 
ATOM   721  C CA  . GLY A 1 98  ? 44.223 -33.699 -306.321 1.00 30.03  ?  128 GLY A CA  1 
ATOM   722  C C   . GLY A 1 98  ? 43.157 -32.653 -305.997 1.00 34.52  ?  128 GLY A C   1 
ATOM   723  O O   . GLY A 1 98  ? 42.562 -32.690 -304.923 1.00 29.82  ?  128 GLY A O   1 
ATOM   724  N N   . ILE A 1 99  ? 42.911 -31.715 -306.910 1.00 32.21  ?  129 ILE A N   1 
ATOM   725  C CA  . ILE A 1 99  ? 41.857 -30.736 -306.695 1.00 30.77  ?  129 ILE A CA  1 
ATOM   726  C C   . ILE A 1 99  ? 40.661 -31.103 -307.566 1.00 31.97  ?  129 ILE A C   1 
ATOM   727  O O   . ILE A 1 99  ? 40.731 -31.028 -308.787 1.00 39.88  ?  129 ILE A O   1 
ATOM   728  C CB  . ILE A 1 99  ? 42.339 -29.287 -306.977 1.00 33.05  ?  129 ILE A CB  1 
ATOM   729  C CG1 . ILE A 1 99  ? 43.534 -28.979 -306.085 1.00 35.16  ?  129 ILE A CG1 1 
ATOM   730  C CG2 . ILE A 1 99  ? 41.258 -28.280 -306.629 1.00 33.55  ?  129 ILE A CG2 1 
ATOM   731  C CD1 . ILE A 1 99  ? 43.842 -27.501 -305.917 1.00 37.33  ?  129 ILE A CD1 1 
ATOM   732  N N   . ARG A 1 100 ? 39.583 -31.543 -306.922 1.00 31.43  ?  130 ARG A N   1 
ATOM   733  C CA  . ARG A 1 100 ? 38.356 -31.970 -307.601 1.00 34.45  ?  130 ARG A CA  1 
ATOM   734  C C   . ARG A 1 100 ? 37.204 -31.007 -307.296 1.00 31.92  ?  130 ARG A C   1 
ATOM   735  O O   . ARG A 1 100 ? 37.309 -30.157 -306.415 1.00 30.36  ?  130 ARG A O   1 
ATOM   736  C CB  . ARG A 1 100 ? 37.960 -33.389 -307.172 1.00 35.34  ?  130 ARG A CB  1 
ATOM   737  C CG  . ARG A 1 100 ? 38.987 -34.476 -307.466 1.00 32.88  ?  130 ARG A CG  1 
ATOM   738  C CD  . ARG A 1 100 ? 38.727 -35.708 -306.593 1.00 39.84  ?  130 ARG A CD  1 
ATOM   739  N NE  . ARG A 1 100 ? 38.926 -35.419 -305.170 1.00 36.54  ?  130 ARG A NE  1 
ATOM   740  C CZ  . ARG A 1 100 ? 40.110 -35.488 -304.568 1.00 37.42  ?  130 ARG A CZ  1 
ATOM   741  N NH1 . ARG A 1 100 ? 41.191 -35.846 -305.261 1.00 32.34  ?  130 ARG A NH1 1 
ATOM   742  N NH2 . ARG A 1 100 ? 40.224 -35.192 -303.283 1.00 36.70  ?  130 ARG A NH2 1 
ATOM   743  N N   . GLY A 1 101 ? 36.099 -31.149 -308.014 1.00 26.97  ?  131 GLY A N   1 
ATOM   744  C CA  . GLY A 1 101 ? 34.984 -30.247 -307.819 1.00 30.42  ?  131 GLY A CA  1 
ATOM   745  C C   . GLY A 1 101 ? 34.354 -30.339 -306.436 1.00 30.07  ?  131 GLY A C   1 
ATOM   746  O O   . GLY A 1 101 ? 34.362 -31.393 -305.796 1.00 31.79  ?  131 GLY A O   1 
ATOM   747  N N   . PHE A 1 102 ? 33.821 -29.216 -305.973 1.00 29.55  ?  132 PHE A N   1 
ATOM   748  C CA  . PHE A 1 102 ? 32.985 -29.201 -304.782 1.00 30.69  ?  132 PHE A CA  1 
ATOM   749  C C   . PHE A 1 102 ? 31.976 -30.363 -304.867 1.00 28.46  ?  132 PHE A C   1 
ATOM   750  O O   . PHE A 1 102 ? 31.298 -30.529 -305.872 1.00 30.68  ?  132 PHE A O   1 
ATOM   751  C CB  . PHE A 1 102 ? 32.287 -27.847 -304.651 1.00 28.37  ?  132 PHE A CB  1 
ATOM   752  C CG  . PHE A 1 102 ? 31.678 -27.611 -303.308 1.00 29.25  ?  132 PHE A CG  1 
ATOM   753  C CD1 . PHE A 1 102 ? 32.429 -27.074 -302.285 1.00 27.75  ?  132 PHE A CD1 1 
ATOM   754  C CD2 . PHE A 1 102 ? 30.356 -27.940 -303.068 1.00 29.46  ?  132 PHE A CD2 1 
ATOM   755  C CE1 . PHE A 1 102 ? 31.877 -26.867 -301.041 1.00 33.10  ?  132 PHE A CE1 1 
ATOM   756  C CE2 . PHE A 1 102 ? 29.797 -27.731 -301.830 1.00 32.60  ?  132 PHE A CE2 1 
ATOM   757  C CZ  . PHE A 1 102 ? 30.558 -27.190 -300.816 1.00 33.88  ?  132 PHE A CZ  1 
ATOM   758  N N   . PRO A 1 103 ? 31.920 -31.198 -303.826 1.00 32.42  ?  133 PRO A N   1 
ATOM   759  C CA  . PRO A 1 103 ? 31.263 -32.518 -303.900 1.00 31.22  ?  133 PRO A CA  1 
ATOM   760  C C   . PRO A 1 103 ? 29.733 -32.540 -303.723 1.00 31.95  ?  133 PRO A C   1 
ATOM   761  O O   . PRO A 1 103 ? 29.116 -33.565 -304.028 1.00 33.61  ?  133 PRO A O   1 
ATOM   762  C CB  . PRO A 1 103 ? 31.923 -33.288 -302.748 1.00 29.61  ?  133 PRO A CB  1 
ATOM   763  C CG  . PRO A 1 103 ? 32.212 -32.234 -301.721 1.00 31.02  ?  133 PRO A CG  1 
ATOM   764  C CD  . PRO A 1 103 ? 32.482 -30.927 -302.487 1.00 29.65  ?  133 PRO A CD  1 
ATOM   765  N N   . ARG A 1 104 ? 29.135 -31.457 -303.234 1.00 31.97  ?  134 ARG A N   1 
ATOM   766  C CA  . ARG A 1 104 ? 27.694 -31.460 -302.951 1.00 37.62  ?  134 ARG A CA  1 
ATOM   767  C C   . ARG A 1 104 ? 27.009 -30.178 -303.454 1.00 33.29  ?  134 ARG A C   1 
ATOM   768  O O   . ARG A 1 104 ? 26.867 -29.205 -302.716 1.00 34.77  ?  134 ARG A O   1 
ATOM   769  C CB  . ARG A 1 104 ? 27.442 -31.647 -301.441 1.00 37.98  ?  134 ARG A CB  1 
ATOM   770  C CG  . ARG A 1 104 ? 27.761 -33.045 -300.895 1.00 33.47  ?  134 ARG A CG  1 
ATOM   771  C CD  . ARG A 1 104 ? 27.005 -34.130 -301.648 1.00 42.61  ?  134 ARG A CD  1 
ATOM   772  N NE  . ARG A 1 104 ? 27.247 -35.484 -301.142 1.00 39.93  ?  134 ARG A NE  1 
ATOM   773  C CZ  . ARG A 1 104 ? 27.988 -36.395 -301.765 1.00 45.29  ?  134 ARG A CZ  1 
ATOM   774  N NH1 . ARG A 1 104 ? 28.154 -37.602 -301.234 1.00 42.65  ?  134 ARG A NH1 1 
ATOM   775  N NH2 . ARG A 1 104 ? 28.574 -36.097 -302.917 1.00 39.05  ?  134 ARG A NH2 1 
ATOM   776  N N   . CYS A 1 105 ? 26.586 -30.202 -304.715 1.00 34.91  ?  135 CYS A N   1 
ATOM   777  C CA  . CYS A 1 105 ? 25.932 -29.068 -305.362 1.00 29.73  ?  135 CYS A CA  1 
ATOM   778  C C   . CYS A 1 105 ? 24.527 -29.446 -305.810 1.00 33.90  ?  135 CYS A C   1 
ATOM   779  O O   . CYS A 1 105 ? 24.363 -30.413 -306.550 1.00 30.89  ?  135 CYS A O   1 
ATOM   780  C CB  . CYS A 1 105 ? 26.726 -28.606 -306.594 1.00 36.31  ?  135 CYS A CB  1 
ATOM   781  S SG  . CYS A 1 105 ? 28.426 -28.065 -306.317 1.00 41.83  ?  135 CYS A SG  1 
ATOM   782  N N   . ARG A 1 106 ? 23.519 -28.678 -305.404 1.00 27.83  ?  136 ARG A N   1 
ATOM   783  C CA  . ARG A 1 106 ? 22.178 -28.865 -305.954 1.00 28.90  ?  136 ARG A CA  1 
ATOM   784  C C   . ARG A 1 106 ? 22.159 -28.575 -307.446 1.00 29.47  ?  136 ARG A C   1 
ATOM   785  O O   . ARG A 1 106 ? 21.506 -29.276 -308.228 1.00 29.82  ?  136 ARG A O   1 
ATOM   786  C CB  . ARG A 1 106 ? 21.162 -27.964 -305.249 1.00 32.72  ?  136 ARG A CB  1 
ATOM   787  C CG  . ARG A 1 106 ? 21.045 -28.213 -303.763 1.00 32.10  ?  136 ARG A CG  1 
ATOM   788  C CD  . ARG A 1 106 ? 20.664 -29.663 -303.502 1.00 32.04  ?  136 ARG A CD  1 
ATOM   789  N NE  . ARG A 1 106 ? 20.531 -29.943 -302.075 1.00 36.69  ?  136 ARG A NE  1 
ATOM   790  C CZ  . ARG A 1 106 ? 20.407 -31.161 -301.554 1.00 38.95  ?  136 ARG A CZ  1 
ATOM   791  N NH1 . ARG A 1 106 ? 20.289 -31.311 -300.237 1.00 41.56  ?  136 ARG A NH1 1 
ATOM   792  N NH2 . ARG A 1 106 ? 20.408 -32.228 -302.343 1.00 31.53  ?  136 ARG A NH2 1 
ATOM   793  N N   . TYR A 1 107 ? 22.872 -27.521 -307.831 1.00 35.17  ?  137 TYR A N   1 
ATOM   794  C CA  . TYR A 1 107 ? 22.868 -27.054 -309.214 1.00 36.46  ?  137 TYR A CA  1 
ATOM   795  C C   . TYR A 1 107 ? 24.216 -26.435 -309.597 1.00 33.09  ?  137 TYR A C   1 
ATOM   796  O O   . TYR A 1 107 ? 24.780 -25.652 -308.836 1.00 33.94  ?  137 TYR A O   1 
ATOM   797  C CB  . TYR A 1 107 ? 21.745 -26.037 -309.434 1.00 35.10  ?  137 TYR A CB  1 
ATOM   798  C CG  . TYR A 1 107 ? 21.695 -25.564 -310.860 1.00 34.37  ?  137 TYR A CG  1 
ATOM   799  C CD1 . TYR A 1 107 ? 21.012 -26.286 -311.830 1.00 42.18  ?  137 TYR A CD1 1 
ATOM   800  C CD2 . TYR A 1 107 ? 22.381 -24.423 -311.253 1.00 38.64  ?  137 TYR A CD2 1 
ATOM   801  C CE1 . TYR A 1 107 ? 20.995 -25.870 -313.157 1.00 38.66  ?  137 TYR A CE1 1 
ATOM   802  C CE2 . TYR A 1 107 ? 22.365 -23.997 -312.560 1.00 37.95  ?  137 TYR A CE2 1 
ATOM   803  C CZ  . TYR A 1 107 ? 21.677 -24.720 -313.507 1.00 43.05  ?  137 TYR A CZ  1 
ATOM   804  O OH  . TYR A 1 107 ? 21.683 -24.276 -314.809 1.00 48.62  ?  137 TYR A OH  1 
ATOM   805  N N   . VAL A 1 108 ? 24.719 -26.785 -310.775 1.00 27.81  ?  138 VAL A N   1 
ATOM   806  C CA  . VAL A 1 108 ? 25.995 -26.254 -311.245 1.00 29.87  ?  138 VAL A CA  1 
ATOM   807  C C   . VAL A 1 108 ? 25.795 -25.349 -312.454 1.00 29.50  ?  138 VAL A C   1 
ATOM   808  O O   . VAL A 1 108 ? 25.255 -25.778 -313.475 1.00 28.92  ?  138 VAL A O   1 
ATOM   809  C CB  . VAL A 1 108 ? 27.003 -27.375 -311.641 1.00 31.63  ?  138 VAL A CB  1 
ATOM   810  C CG1 . VAL A 1 108 ? 28.356 -26.755 -312.032 1.00 24.85  ?  138 VAL A CG1 1 
ATOM   811  C CG2 . VAL A 1 108 ? 27.182 -28.383 -310.512 1.00 26.99  ?  138 VAL A CG2 1 
ATOM   812  N N   . HIS A 1 109 ? 26.207 -24.091 -312.323 1.00 31.70  ?  139 HIS A N   1 
ATOM   813  C CA  . HIS A 1 109 ? 26.280 -23.195 -313.473 1.00 34.33  ?  139 HIS A CA  1 
ATOM   814  C C   . HIS A 1 109 ? 27.548 -23.548 -314.253 1.00 30.98  ?  139 HIS A C   1 
ATOM   815  O O   . HIS A 1 109 ? 28.643 -23.077 -313.937 1.00 31.73  ?  139 HIS A O   1 
ATOM   816  C CB  . HIS A 1 109 ? 26.280 -21.726 -313.035 1.00 30.37  ?  139 HIS A CB  1 
ATOM   817  C CG  . HIS A 1 109 ? 25.072 -21.332 -312.237 1.00 36.99  ?  139 HIS A CG  1 
ATOM   818  N ND1 . HIS A 1 109 ? 23.969 -20.732 -312.806 1.00 40.08  ?  139 HIS A ND1 1 
ATOM   819  C CD2 . HIS A 1 109 ? 24.793 -21.448 -310.915 1.00 32.17  ?  139 HIS A CD2 1 
ATOM   820  C CE1 . HIS A 1 109 ? 23.064 -20.497 -311.874 1.00 34.30  ?  139 HIS A CE1 1 
ATOM   821  N NE2 . HIS A 1 109 ? 23.539 -20.924 -310.718 1.00 37.08  ?  139 HIS A NE2 1 
ATOM   822  N N   . LYS A 1 110 ? 27.398 -24.423 -315.239 1.00 32.89  ?  140 LYS A N   1 
ATOM   823  C CA  . LYS A 1 110 ? 28.527 -24.918 -316.012 1.00 37.38  ?  140 LYS A CA  1 
ATOM   824  C C   . LYS A 1 110 ? 28.565 -24.244 -317.376 1.00 41.82  ?  140 LYS A C   1 
ATOM   825  O O   . LYS A 1 110 ? 27.751 -24.545 -318.246 1.00 35.32  ?  140 LYS A O   1 
ATOM   826  C CB  . LYS A 1 110 ? 28.460 -26.437 -316.186 1.00 38.16  ?  140 LYS A CB  1 
ATOM   827  C CG  . LYS A 1 110 ? 29.627 -27.016 -317.000 1.00 40.17  ?  140 LYS A CG  1 
ATOM   828  C CD  . LYS A 1 110 ? 29.664 -28.536 -316.904 1.00 43.36  ?  140 LYS A CD  1 
ATOM   829  C CE  . LYS A 1 110 ? 30.783 -29.140 -317.753 1.00 49.37  ?  140 LYS A CE  1 
ATOM   830  N NZ  . LYS A 1 110 ? 32.138 -28.671 -317.326 1.00 54.60  ?  140 LYS A NZ  1 
ATOM   831  N N   . VAL A 1 111 ? 29.514 -23.330 -317.554 1.00 37.19  ?  141 VAL A N   1 
ATOM   832  C CA  . VAL A 1 111 ? 29.520 -22.485 -318.737 1.00 31.14  ?  141 VAL A CA  1 
ATOM   833  C C   . VAL A 1 111 ? 30.916 -22.305 -319.320 1.00 32.45  ?  141 VAL A C   1 
ATOM   834  O O   . VAL A 1 111 ? 31.951 -22.448 -318.642 1.00 27.43  ?  141 VAL A O   1 
ATOM   835  C CB  . VAL A 1 111 ? 28.918 -21.093 -318.436 1.00 33.93  ?  141 VAL A CB  1 
ATOM   836  C CG1 . VAL A 1 111 ? 27.410 -21.199 -318.191 1.00 31.71  ?  141 VAL A CG1 1 
ATOM   837  C CG2 . VAL A 1 111 ? 29.615 -20.457 -317.244 1.00 30.77  ?  141 VAL A CG2 1 
ATOM   838  N N   . SER A 1 112 ? 30.919 -21.985 -320.603 1.00 33.35  ?  142 SER A N   1 
ATOM   839  C CA  . SER A 1 112 ? 32.131 -21.969 -321.387 1.00 37.16  ?  142 SER A CA  1 
ATOM   840  C C   . SER A 1 112 ? 32.032 -20.909 -322.485 1.00 36.37  ?  142 SER A C   1 
ATOM   841  O O   . SER A 1 112 ? 30.966 -20.694 -323.076 1.00 34.24  ?  142 SER A O   1 
ATOM   842  C CB  . SER A 1 112 ? 32.379 -23.364 -321.971 1.00 32.75  ?  142 SER A CB  1 
ATOM   843  O OG  . SER A 1 112 ? 33.620 -23.432 -322.635 1.00 41.21  ?  142 SER A OG  1 
ATOM   844  N N   . GLY A 1 113 ? 33.141 -20.239 -322.753 1.00 30.96  ?  143 GLY A N   1 
ATOM   845  C CA  . GLY A 1 113 ? 33.169 -19.281 -323.839 1.00 31.44  ?  143 GLY A CA  1 
ATOM   846  C C   . GLY A 1 113 ? 34.507 -18.592 -323.928 1.00 32.36  ?  143 GLY A C   1 
ATOM   847  O O   . GLY A 1 113 ? 35.546 -19.196 -323.654 1.00 29.12  ?  143 GLY A O   1 
ATOM   848  N N   . THR A 1 114 ? 34.485 -17.324 -324.317 1.00 33.60  ?  144 THR A N   1 
ATOM   849  C CA  . THR A 1 114 ? 35.716 -16.564 -324.432 1.00 32.57  ?  144 THR A CA  1 
ATOM   850  C C   . THR A 1 114 ? 35.558 -15.205 -323.746 1.00 31.72  ?  144 THR A C   1 
ATOM   851  O O   . THR A 1 114 ? 34.455 -14.681 -323.604 1.00 33.82  ?  144 THR A O   1 
ATOM   852  C CB  . THR A 1 114 ? 36.146 -16.420 -325.938 1.00 35.23  ?  144 THR A CB  1 
ATOM   853  O OG1 . THR A 1 114 ? 37.330 -15.620 -326.047 1.00 35.08  ?  144 THR A OG1 1 
ATOM   854  C CG2 . THR A 1 114 ? 35.035 -15.835 -326.791 1.00 34.91  ?  144 THR A CG2 1 
ATOM   855  N N   . GLY A 1 115 ? 36.664 -14.653 -323.277 1.00 26.18  ?  145 GLY A N   1 
ATOM   856  C CA  . GLY A 1 115 ? 36.614 -13.396 -322.578 1.00 26.22  ?  145 GLY A CA  1 
ATOM   857  C C   . GLY A 1 115 ? 37.972 -12.747 -322.568 1.00 36.81  ?  145 GLY A C   1 
ATOM   858  O O   . GLY A 1 115 ? 38.954 -13.354 -322.994 1.00 33.98  ?  145 GLY A O   1 
ATOM   859  N N   . PRO A 1 116 ? 38.030 -11.503 -322.080 1.00 36.95  ?  146 PRO A N   1 
ATOM   860  C CA  . PRO A 1 116 ? 39.230 -10.658 -322.133 1.00 40.95  ?  146 PRO A CA  1 
ATOM   861  C C   . PRO A 1 116 ? 40.407 -11.196 -321.303 1.00 40.60  ?  146 PRO A C   1 
ATOM   862  O O   . PRO A 1 116 ? 41.558 -11.012 -321.708 1.00 42.17  ?  146 PRO A O   1 
ATOM   863  C CB  . PRO A 1 116 ? 38.733 -9.304  -321.591 1.00 40.50  ?  146 PRO A CB  1 
ATOM   864  C CG  . PRO A 1 116 ? 37.443 -9.610  -320.870 1.00 37.95  ?  146 PRO A CG  1 
ATOM   865  C CD  . PRO A 1 116 ? 36.849 -10.783 -321.576 1.00 31.58  ?  146 PRO A CD  1 
ATOM   866  N N   . CYS A 1 117 ? 40.121 -11.849 -320.179 1.00 41.67  ?  147 CYS A N   1 
ATOM   867  C CA  . CYS A 1 117 ? 41.149 -12.464 -319.331 1.00 40.32  ?  147 CYS A CA  1 
ATOM   868  C C   . CYS A 1 117 ? 42.297 -11.503 -319.035 1.00 41.37  ?  147 CYS A C   1 
ATOM   869  O O   . CYS A 1 117 ? 43.430 -11.745 -319.447 1.00 42.89  ?  147 CYS A O   1 
ATOM   870  C CB  . CYS A 1 117 ? 41.694 -13.744 -319.989 1.00 40.83  ?  147 CYS A CB  1 
ATOM   871  S SG  . CYS A 1 117 ? 42.487 -14.930 -318.846 1.00 44.43  ?  147 CYS A SG  1 
ATOM   872  N N   . ALA A 1 118 ? 42.003 -10.416 -318.324 1.00 44.96  ?  148 ALA A N   1 
ATOM   873  C CA  . ALA A 1 118 ? 42.989 -9.348  -318.124 1.00 45.50  ?  148 ALA A CA  1 
ATOM   874  C C   . ALA A 1 118 ? 43.847 -9.573  -316.891 1.00 42.31  ?  148 ALA A C   1 
ATOM   875  O O   . ALA A 1 118 ? 44.106 -8.642  -316.137 1.00 51.28  ?  148 ALA A O   1 
ATOM   876  C CB  . ALA A 1 118 ? 42.295 -7.982  -318.028 1.00 38.90  ?  148 ALA A CB  1 
ATOM   877  N N   . GLY A 1 119 ? 44.289 -10.803 -316.676 1.00 35.96  ?  149 GLY A N   1 
ATOM   878  C CA  . GLY A 1 119 ? 45.150 -11.086 -315.548 1.00 33.52  ?  149 GLY A CA  1 
ATOM   879  C C   . GLY A 1 119 ? 45.500 -12.549 -315.515 1.00 34.76  ?  149 GLY A C   1 
ATOM   880  O O   . GLY A 1 119 ? 44.876 -13.354 -316.207 1.00 35.41  ?  149 GLY A O   1 
ATOM   881  N N   . ASP A 1 120 ? 46.488 -12.894 -314.698 1.00 34.15  ?  150 ASP A N   1 
ATOM   882  C CA  . ASP A 1 120 ? 46.961 -14.271 -314.612 1.00 35.79  ?  150 ASP A CA  1 
ATOM   883  C C   . ASP A 1 120 ? 45.964 -15.180 -313.886 1.00 37.18  ?  150 ASP A C   1 
ATOM   884  O O   . ASP A 1 120 ? 45.742 -16.310 -314.304 1.00 31.86  ?  150 ASP A O   1 
ATOM   885  C CB  . ASP A 1 120 ? 48.325 -14.314 -313.917 1.00 40.27  ?  150 ASP A CB  1 
ATOM   886  C CG  . ASP A 1 120 ? 49.445 -13.717 -314.781 1.00 48.33  ?  150 ASP A CG  1 
ATOM   887  O OD1 . ASP A 1 120 ? 49.263 -13.607 -316.020 1.00 48.73  ?  150 ASP A OD1 1 
ATOM   888  O OD2 . ASP A 1 120 ? 50.504 -13.361 -314.219 1.00 47.00  -1 150 ASP A OD2 1 
ATOM   889  N N   . PHE A 1 121 ? 45.357 -14.677 -312.810 1.00 29.26  ?  151 PHE A N   1 
ATOM   890  C CA  . PHE A 1 121 ? 44.451 -15.490 -312.014 1.00 32.89  ?  151 PHE A CA  1 
ATOM   891  C C   . PHE A 1 121 ? 43.180 -14.735 -311.630 1.00 32.34  ?  151 PHE A C   1 
ATOM   892  O O   . PHE A 1 121 ? 43.181 -13.509 -311.466 1.00 29.29  ?  151 PHE A O   1 
ATOM   893  C CB  . PHE A 1 121 ? 45.156 -16.006 -310.754 1.00 31.40  ?  151 PHE A CB  1 
ATOM   894  C CG  . PHE A 1 121 ? 46.295 -16.958 -311.037 1.00 33.92  ?  151 PHE A CG  1 
ATOM   895  C CD1 . PHE A 1 121 ? 47.617 -16.529 -310.944 1.00 33.82  ?  151 PHE A CD1 1 
ATOM   896  C CD2 . PHE A 1 121 ? 46.048 -18.279 -311.399 1.00 32.23  ?  151 PHE A CD2 1 
ATOM   897  C CE1 . PHE A 1 121 ? 48.680 -17.403 -311.211 1.00 31.92  ?  151 PHE A CE1 1 
ATOM   898  C CE2 . PHE A 1 121 ? 47.112 -19.165 -311.660 1.00 31.62  ?  151 PHE A CE2 1 
ATOM   899  C CZ  . PHE A 1 121 ? 48.423 -18.719 -311.566 1.00 27.42  ?  151 PHE A CZ  1 
ATOM   900  N N   . ALA A 1 122 ? 42.094 -15.486 -311.520 1.00 30.84  ?  152 ALA A N   1 
ATOM   901  C CA  . ALA A 1 122 ? 40.815 -14.935 -311.088 1.00 36.24  ?  152 ALA A CA  1 
ATOM   902  C C   . ALA A 1 122 ? 40.642 -15.139 -309.587 1.00 33.75  ?  152 ALA A C   1 
ATOM   903  O O   . ALA A 1 122 ? 40.713 -16.268 -309.100 1.00 30.70  ?  152 ALA A O   1 
ATOM   904  C CB  . ALA A 1 122 ? 39.682 -15.576 -311.845 1.00 29.66  ?  152 ALA A CB  1 
ATOM   905  N N   . PHE A 1 123 ? 40.428 -14.035 -308.874 1.00 34.65  ?  153 PHE A N   1 
ATOM   906  C CA  . PHE A 1 123 ? 40.317 -14.014 -307.416 1.00 29.50  ?  153 PHE A CA  1 
ATOM   907  C C   . PHE A 1 123 ? 38.911 -13.637 -306.960 1.00 31.27  ?  153 PHE A C   1 
ATOM   908  O O   . PHE A 1 123 ? 38.061 -13.273 -307.776 1.00 32.47  ?  153 PHE A O   1 
ATOM   909  C CB  . PHE A 1 123 ? 41.322 -13.019 -306.824 1.00 28.59  ?  153 PHE A CB  1 
ATOM   910  C CG  . PHE A 1 123 ? 42.762 -13.429 -306.994 1.00 32.75  ?  153 PHE A CG  1 
ATOM   911  C CD1 . PHE A 1 123 ? 43.437 -13.179 -308.184 1.00 33.14  ?  153 PHE A CD1 1 
ATOM   912  C CD2 . PHE A 1 123 ? 43.444 -14.059 -305.963 1.00 34.48  ?  153 PHE A CD2 1 
ATOM   913  C CE1 . PHE A 1 123 ? 44.755 -13.551 -308.339 1.00 28.65  ?  153 PHE A CE1 1 
ATOM   914  C CE2 . PHE A 1 123 ? 44.766 -14.434 -306.112 1.00 34.10  ?  153 PHE A CE2 1 
ATOM   915  C CZ  . PHE A 1 123 ? 45.420 -14.179 -307.305 1.00 30.98  ?  153 PHE A CZ  1 
ATOM   916  N N   . HIS A 1 124 ? 38.671 -13.717 -305.654 1.00 30.71  ?  154 HIS A N   1 
ATOM   917  C CA  . HIS A 1 124 ? 37.412 -13.249 -305.080 1.00 27.52  ?  154 HIS A CA  1 
ATOM   918  C C   . HIS A 1 124 ? 37.562 -11.821 -304.556 1.00 29.84  ?  154 HIS A C   1 
ATOM   919  O O   . HIS A 1 124 ? 38.389 -11.561 -303.678 1.00 29.12  ?  154 HIS A O   1 
ATOM   920  C CB  . HIS A 1 124 ? 36.949 -14.170 -303.946 1.00 27.78  ?  154 HIS A CB  1 
ATOM   921  C CG  . HIS A 1 124 ? 35.472 -14.158 -303.746 1.00 28.50  ?  154 HIS A CG  1 
ATOM   922  N ND1 . HIS A 1 124 ? 34.819 -13.132 -303.099 1.00 31.40  ?  154 HIS A ND1 1 
ATOM   923  C CD2 . HIS A 1 124 ? 34.511 -15.026 -304.146 1.00 30.15  ?  154 HIS A CD2 1 
ATOM   924  C CE1 . HIS A 1 124 ? 33.519 -13.375 -303.100 1.00 34.99  ?  154 HIS A CE1 1 
ATOM   925  N NE2 . HIS A 1 124 ? 33.306 -14.515 -303.733 1.00 31.78  ?  154 HIS A NE2 1 
ATOM   926  N N   . LYS A 1 125 ? 36.749 -10.906 -305.074 1.00 31.18  ?  155 LYS A N   1 
ATOM   927  C CA  . LYS A 1 125 ? 36.848 -9.492  -304.699 1.00 36.15  ?  155 LYS A CA  1 
ATOM   928  C C   . LYS A 1 125 ? 36.492 -9.236  -303.240 1.00 35.49  ?  155 LYS A C   1 
ATOM   929  O O   . LYS A 1 125 ? 36.960 -8.262  -302.645 1.00 39.58  ?  155 LYS A O   1 
ATOM   930  C CB  . LYS A 1 125 ? 35.951 -8.630  -305.590 1.00 36.69  ?  155 LYS A CB  1 
ATOM   931  C CG  . LYS A 1 125 ? 36.424 -8.522  -307.035 1.00 35.53  ?  155 LYS A CG  1 
ATOM   932  C CD  . LYS A 1 125 ? 35.619 -7.459  -307.785 1.00 37.31  ?  155 LYS A CD  1 
ATOM   933  C CE  . LYS A 1 125 ? 36.229 -7.172  -309.141 1.00 36.71  ?  155 LYS A CE  1 
ATOM   934  N NZ  . LYS A 1 125 ? 35.637 -5.944  -309.755 1.00 41.09  ?  155 LYS A NZ  1 
ATOM   935  N N   . GLU A 1 126 ? 35.676 -10.106 -302.657 1.00 36.06  ?  156 GLU A N   1 
ATOM   936  C CA  . GLU A 1 126 ? 35.305 -9.930  -301.253 1.00 41.34  ?  156 GLU A CA  1 
ATOM   937  C C   . GLU A 1 126 ? 36.276 -10.650 -300.319 1.00 40.61  ?  156 GLU A C   1 
ATOM   938  O O   . GLU A 1 126 ? 36.102 -10.617 -299.107 1.00 45.76  ?  156 GLU A O   1 
ATOM   939  C CB  . GLU A 1 126 ? 33.869 -10.409 -301.014 1.00 44.61  ?  156 GLU A CB  1 
ATOM   940  C CG  . GLU A 1 126 ? 32.832 -9.568  -301.759 1.00 52.35  ?  156 GLU A CG  1 
ATOM   941  C CD  . GLU A 1 126 ? 31.450 -10.219 -301.846 1.00 58.35  ?  156 GLU A CD  1 
ATOM   942  O OE1 . GLU A 1 126 ? 31.255 -11.331 -301.303 1.00 57.31  ?  156 GLU A OE1 1 
ATOM   943  O OE2 . GLU A 1 126 ? 30.558 -9.618  -302.487 1.00 60.80  -1 156 GLU A OE2 1 
ATOM   944  N N   . GLY A 1 127 ? 37.304 -11.289 -300.878 1.00 35.40  ?  157 GLY A N   1 
ATOM   945  C CA  . GLY A 1 127 ? 38.318 -11.938 -300.064 1.00 31.80  ?  157 GLY A CA  1 
ATOM   946  C C   . GLY A 1 127 ? 37.918 -13.322 -299.594 1.00 30.16  ?  157 GLY A C   1 
ATOM   947  O O   . GLY A 1 127 ? 38.599 -13.947 -298.779 1.00 31.35  ?  157 GLY A O   1 
ATOM   948  N N   . ALA A 1 128 ? 36.806 -13.811 -300.112 1.00 25.28  ?  158 ALA A N   1 
ATOM   949  C CA  . ALA A 1 128 ? 36.387 -15.178 -299.841 1.00 30.59  ?  158 ALA A CA  1 
ATOM   950  C C   . ALA A 1 128 ? 37.237 -16.192 -300.615 1.00 31.38  ?  158 ALA A C   1 
ATOM   951  O O   . ALA A 1 128 ? 38.155 -15.826 -301.359 1.00 30.44  ?  158 ALA A O   1 
ATOM   952  C CB  . ALA A 1 128 ? 34.905 -15.353 -300.186 1.00 30.21  ?  158 ALA A CB  1 
ATOM   953  N N   . PHE A 1 129 ? 36.918 -17.469 -300.430 1.00 32.60  ?  159 PHE A N   1 
ATOM   954  C CA  . PHE A 1 129 ? 37.634 -18.552 -301.081 1.00 30.57  ?  159 PHE A CA  1 
ATOM   955  C C   . PHE A 1 129 ? 36.739 -19.245 -302.086 1.00 34.60  ?  159 PHE A C   1 
ATOM   956  O O   . PHE A 1 129 ? 35.513 -19.239 -301.943 1.00 31.48  ?  159 PHE A O   1 
ATOM   957  C CB  . PHE A 1 129 ? 38.136 -19.585 -300.062 1.00 30.64  ?  159 PHE A CB  1 
ATOM   958  C CG  . PHE A 1 129 ? 39.207 -19.063 -299.144 1.00 33.78  ?  159 PHE A CG  1 
ATOM   959  C CD1 . PHE A 1 129 ? 38.895 -18.642 -297.850 1.00 32.18  ?  159 PHE A CD1 1 
ATOM   960  C CD2 . PHE A 1 129 ? 40.521 -18.996 -299.570 1.00 27.93  ?  159 PHE A CD2 1 
ATOM   961  C CE1 . PHE A 1 129 ? 39.881 -18.164 -297.010 1.00 37.36  ?  159 PHE A CE1 1 
ATOM   962  C CE2 . PHE A 1 129 ? 41.506 -18.512 -298.745 1.00 29.44  ?  159 PHE A CE2 1 
ATOM   963  C CZ  . PHE A 1 129 ? 41.192 -18.092 -297.462 1.00 36.18  ?  159 PHE A CZ  1 
ATOM   964  N N   . PHE A 1 130 ? 37.356 -19.835 -303.102 1.00 25.17  ?  160 PHE A N   1 
ATOM   965  C CA  . PHE A 1 130 ? 36.660 -20.790 -303.942 1.00 26.35  ?  160 PHE A CA  1 
ATOM   966  C C   . PHE A 1 130 ? 36.849 -22.174 -303.313 1.00 28.81  ?  160 PHE A C   1 
ATOM   967  O O   . PHE A 1 130 ? 37.974 -22.674 -303.195 1.00 30.32  ?  160 PHE A O   1 
ATOM   968  C CB  . PHE A 1 130 ? 37.171 -20.727 -305.397 1.00 24.41  ?  160 PHE A CB  1 
ATOM   969  C CG  . PHE A 1 130 ? 37.141 -19.321 -305.974 1.00 27.29  ?  160 PHE A CG  1 
ATOM   970  C CD1 . PHE A 1 130 ? 38.274 -18.514 -305.941 1.00 21.78  ?  160 PHE A CD1 1 
ATOM   971  C CD2 . PHE A 1 130 ? 35.955 -18.782 -306.481 1.00 23.48  ?  160 PHE A CD2 1 
ATOM   972  C CE1 . PHE A 1 130 ? 38.237 -17.215 -306.436 1.00 23.55  ?  160 PHE A CE1 1 
ATOM   973  C CE2 . PHE A 1 130 ? 35.908 -17.473 -306.971 1.00 21.49  ?  160 PHE A CE2 1 
ATOM   974  C CZ  . PHE A 1 130 ? 37.048 -16.689 -306.949 1.00 20.82  ?  160 PHE A CZ  1 
ATOM   975  N N   . LEU A 1 131 ? 35.739 -22.772 -302.883 1.00 30.15  ?  161 LEU A N   1 
ATOM   976  C CA  . LEU A 1 131 ? 35.764 -24.078 -302.231 1.00 31.50  ?  161 LEU A CA  1 
ATOM   977  C C   . LEU A 1 131 ? 35.656 -25.214 -303.245 1.00 30.85  ?  161 LEU A C   1 
ATOM   978  O O   . LEU A 1 131 ? 34.687 -25.311 -303.986 1.00 27.73  ?  161 LEU A O   1 
ATOM   979  C CB  . LEU A 1 131 ? 34.638 -24.192 -301.209 1.00 32.55  ?  161 LEU A CB  1 
ATOM   980  C CG  . LEU A 1 131 ? 34.596 -23.145 -300.095 1.00 33.81  ?  161 LEU A CG  1 
ATOM   981  C CD1 . LEU A 1 131 ? 33.552 -23.540 -299.047 1.00 31.95  ?  161 LEU A CD1 1 
ATOM   982  C CD2 . LEU A 1 131 ? 35.959 -22.964 -299.446 1.00 28.41  ?  161 LEU A CD2 1 
ATOM   983  N N   . TYR A 1 132 ? 36.671 -26.069 -303.267 1.00 29.67  ?  162 TYR A N   1 
ATOM   984  C CA  . TYR A 1 132 ? 36.642 -27.272 -304.077 1.00 28.80  ?  162 TYR A CA  1 
ATOM   985  C C   . TYR A 1 132 ? 36.432 -28.459 -303.143 1.00 27.44  ?  162 TYR A C   1 
ATOM   986  O O   . TYR A 1 132 ? 35.888 -28.291 -302.050 1.00 29.88  ?  162 TYR A O   1 
ATOM   987  C CB  . TYR A 1 132 ? 37.932 -27.390 -304.894 1.00 29.59  ?  162 TYR A CB  1 
ATOM   988  C CG  . TYR A 1 132 ? 38.149 -26.175 -305.763 1.00 29.92  ?  162 TYR A CG  1 
ATOM   989  C CD1 . TYR A 1 132 ? 38.920 -25.107 -305.325 1.00 28.84  ?  162 TYR A CD1 1 
ATOM   990  C CD2 . TYR A 1 132 ? 37.530 -26.073 -307.003 1.00 26.58  ?  162 TYR A CD2 1 
ATOM   991  C CE1 . TYR A 1 132 ? 39.103 -23.981 -306.119 1.00 26.02  ?  162 TYR A CE1 1 
ATOM   992  C CE2 . TYR A 1 132 ? 37.700 -24.959 -307.795 1.00 27.73  ?  162 TYR A CE2 1 
ATOM   993  C CZ  . TYR A 1 132 ? 38.483 -23.917 -307.350 1.00 27.26  ?  162 TYR A CZ  1 
ATOM   994  O OH  . TYR A 1 132 ? 38.650 -22.813 -308.153 1.00 27.78  ?  162 TYR A OH  1 
ATOM   995  N N   . ASP A 1 133 ? 36.855 -29.650 -303.553 1.00 28.48  ?  163 ASP A N   1 
ATOM   996  C CA  . ASP A 1 133 ? 36.678 -30.832 -302.707 1.00 30.07  ?  163 ASP A CA  1 
ATOM   997  C C   . ASP A 1 133 ? 37.652 -30.862 -301.504 1.00 30.31  ?  163 ASP A C   1 
ATOM   998  O O   . ASP A 1 133 ? 38.730 -31.449 -301.567 1.00 30.87  ?  163 ASP A O   1 
ATOM   999  C CB  . ASP A 1 133 ? 36.820 -32.101 -303.544 1.00 30.34  ?  163 ASP A CB  1 
ATOM   1000 C CG  . ASP A 1 133 ? 36.621 -33.376 -302.719 1.00 38.76  ?  163 ASP A CG  1 
ATOM   1001 O OD1 . ASP A 1 133 ? 35.939 -33.330 -301.666 1.00 36.49  ?  163 ASP A OD1 1 
ATOM   1002 O OD2 . ASP A 1 133 ? 37.141 -34.429 -303.128 1.00 36.81  -1 163 ASP A OD2 1 
ATOM   1003 N N   . ARG A 1 134 ? 37.239 -30.231 -300.408 1.00 32.57  ?  164 ARG A N   1 
ATOM   1004 C CA  . ARG A 1 134 ? 38.010 -30.192 -299.159 1.00 37.24  ?  164 ARG A CA  1 
ATOM   1005 C C   . ARG A 1 134 ? 39.348 -29.481 -299.342 1.00 35.97  ?  164 ARG A C   1 
ATOM   1006 O O   . ARG A 1 134 ? 40.275 -29.667 -298.553 1.00 34.73  ?  164 ARG A O   1 
ATOM   1007 C CB  . ARG A 1 134 ? 38.220 -31.603 -298.584 1.00 37.02  ?  164 ARG A CB  1 
ATOM   1008 C CG  . ARG A 1 134 ? 37.010 -32.113 -297.786 1.00 42.38  ?  164 ARG A CG  1 
ATOM   1009 C CD  . ARG A 1 134 ? 37.065 -33.621 -297.583 1.00 42.30  ?  164 ARG A CD  1 
ATOM   1010 N NE  . ARG A 1 134 ? 37.267 -34.274 -298.864 1.00 42.10  ?  164 ARG A NE  1 
ATOM   1011 C CZ  . ARG A 1 134 ? 38.015 -35.353 -299.062 1.00 42.15  ?  164 ARG A CZ  1 
ATOM   1012 N NH1 . ARG A 1 134 ? 38.649 -35.932 -298.044 1.00 39.81  ?  164 ARG A NH1 1 
ATOM   1013 N NH2 . ARG A 1 134 ? 38.131 -35.842 -300.294 1.00 40.52  ?  164 ARG A NH2 1 
ATOM   1014 N N   . LEU A 1 135 ? 39.430 -28.657 -300.384 1.00 30.92  ?  165 LEU A N   1 
ATOM   1015 C CA  . LEU A 1 135 ? 40.518 -27.704 -300.533 1.00 30.13  ?  165 LEU A CA  1 
ATOM   1016 C C   . LEU A 1 135 ? 39.901 -26.367 -300.912 1.00 30.38  ?  165 LEU A C   1 
ATOM   1017 O O   . LEU A 1 135 ? 38.990 -26.309 -301.727 1.00 30.00  ?  165 LEU A O   1 
ATOM   1018 C CB  . LEU A 1 135 ? 41.532 -28.164 -301.578 1.00 27.79  ?  165 LEU A CB  1 
ATOM   1019 C CG  . LEU A 1 135 ? 42.319 -29.437 -301.263 1.00 32.28  ?  165 LEU A CG  1 
ATOM   1020 C CD1 . LEU A 1 135 ? 43.053 -29.935 -302.513 1.00 32.39  ?  165 LEU A CD1 1 
ATOM   1021 C CD2 . LEU A 1 135 ? 43.298 -29.222 -300.101 1.00 24.32  ?  165 LEU A CD2 1 
ATOM   1022 N N   . ALA A 1 136 ? 40.369 -25.308 -300.266 1.00 32.78  ?  166 ALA A N   1 
ATOM   1023 C CA  . ALA A 1 136 ? 39.919 -23.964 -300.544 1.00 33.21  ?  166 ALA A CA  1 
ATOM   1024 C C   . ALA A 1 136 ? 41.051 -23.207 -301.227 1.00 35.35  ?  166 ALA A C   1 
ATOM   1025 O O   . ALA A 1 136 ? 42.165 -23.178 -300.711 1.00 33.34  ?  166 ALA A O   1 
ATOM   1026 C CB  . ALA A 1 136 ? 39.502 -23.264 -299.259 1.00 33.82  ?  166 ALA A CB  1 
ATOM   1027 N N   . SER A 1 137 ? 40.775 -22.601 -302.378 1.00 34.34  ?  167 SER A N   1 
ATOM   1028 C CA  . SER A 1 137 ? 41.809 -21.845 -303.085 1.00 31.18  ?  167 SER A CA  1 
ATOM   1029 C C   . SER A 1 137 ? 41.462 -20.364 -303.195 1.00 30.62  ?  167 SER A C   1 
ATOM   1030 O O   . SER A 1 137 ? 40.294 -20.003 -303.240 1.00 30.80  ?  167 SER A O   1 
ATOM   1031 C CB  . SER A 1 137 ? 42.036 -22.418 -304.488 1.00 30.12  ?  167 SER A CB  1 
ATOM   1032 O OG  . SER A 1 137 ? 43.041 -21.679 -305.173 1.00 30.10  ?  167 SER A OG  1 
ATOM   1033 N N   . THR A 1 138 ? 42.479 -19.507 -303.257 1.00 27.75  ?  168 THR A N   1 
ATOM   1034 C CA  . THR A 1 138 ? 42.253 -18.094 -303.546 1.00 26.62  ?  168 THR A CA  1 
ATOM   1035 C C   . THR A 1 138 ? 41.874 -17.846 -305.019 1.00 28.19  ?  168 THR A C   1 
ATOM   1036 O O   . THR A 1 138 ? 41.589 -16.717 -305.413 1.00 30.23  ?  168 THR A O   1 
ATOM   1037 C CB  . THR A 1 138 ? 43.493 -17.229 -303.202 1.00 26.63  ?  168 THR A CB  1 
ATOM   1038 O OG1 . THR A 1 138 ? 44.652 -17.739 -303.873 1.00 29.72  ?  168 THR A OG1 1 
ATOM   1039 C CG2 . THR A 1 138 ? 43.749 -17.182 -301.670 1.00 25.99  ?  168 THR A CG2 1 
ATOM   1040 N N   . VAL A 1 139 ? 41.820 -18.905 -305.814 1.00 26.04  ?  169 VAL A N   1 
ATOM   1041 C CA  . VAL A 1 139 ? 41.804 -18.758 -307.263 1.00 25.73  ?  169 VAL A CA  1 
ATOM   1042 C C   . VAL A 1 139 ? 40.812 -19.703 -307.989 1.00 27.18  ?  169 VAL A C   1 
ATOM   1043 O O   . VAL A 1 139 ? 40.450 -20.758 -307.479 1.00 29.09  ?  169 VAL A O   1 
ATOM   1044 C CB  . VAL A 1 139 ? 43.278 -18.947 -307.744 1.00 31.30  ?  169 VAL A CB  1 
ATOM   1045 C CG1 . VAL A 1 139 ? 43.400 -19.748 -308.997 1.00 30.01  ?  169 VAL A CG1 1 
ATOM   1046 C CG2 . VAL A 1 139 ? 43.993 -17.587 -307.800 1.00 26.05  ?  169 VAL A CG2 1 
ATOM   1047 N N   . ILE A 1 140 ? 40.348 -19.310 -309.170 1.00 27.30  ?  170 ILE A N   1 
ATOM   1048 C CA  . ILE A 1 140 ? 39.473 -20.175 -309.955 1.00 27.05  ?  170 ILE A CA  1 
ATOM   1049 C C   . ILE A 1 140 ? 40.245 -21.086 -310.906 1.00 30.51  ?  170 ILE A C   1 
ATOM   1050 O O   . ILE A 1 140 ? 41.092 -20.627 -311.683 1.00 29.99  ?  170 ILE A O   1 
ATOM   1051 C CB  . ILE A 1 140 ? 38.456 -19.355 -310.770 1.00 27.64  ?  170 ILE A CB  1 
ATOM   1052 C CG1 . ILE A 1 140 ? 37.529 -18.576 -309.831 1.00 28.08  ?  170 ILE A CG1 1 
ATOM   1053 C CG2 . ILE A 1 140 ? 37.632 -20.257 -311.686 1.00 24.47  ?  170 ILE A CG2 1 
ATOM   1054 C CD1 . ILE A 1 140 ? 36.571 -17.620 -310.570 1.00 31.56  ?  170 ILE A CD1 1 
ATOM   1055 N N   . TYR A 1 141 ? 39.948 -22.384 -310.843 1.00 29.79  ?  171 TYR A N   1 
ATOM   1056 C CA  . TYR A 1 141 ? 40.559 -23.340 -311.753 1.00 30.39  ?  171 TYR A CA  1 
ATOM   1057 C C   . TYR A 1 141 ? 39.599 -23.727 -312.868 1.00 30.28  ?  171 TYR A C   1 
ATOM   1058 O O   . TYR A 1 141 ? 38.385 -23.808 -312.670 1.00 28.51  ?  171 TYR A O   1 
ATOM   1059 C CB  . TYR A 1 141 ? 41.026 -24.598 -311.006 1.00 29.14  ?  171 TYR A CB  1 
ATOM   1060 C CG  . TYR A 1 141 ? 41.989 -24.306 -309.892 1.00 28.75  ?  171 TYR A CG  1 
ATOM   1061 C CD1 . TYR A 1 141 ? 41.626 -24.509 -308.557 1.00 29.59  ?  171 TYR A CD1 1 
ATOM   1062 C CD2 . TYR A 1 141 ? 43.257 -23.817 -310.164 1.00 27.00  ?  171 TYR A CD2 1 
ATOM   1063 C CE1 . TYR A 1 141 ? 42.508 -24.230 -307.527 1.00 30.77  ?  171 TYR A CE1 1 
ATOM   1064 C CE2 . TYR A 1 141 ? 44.148 -23.533 -309.137 1.00 28.53  ?  171 TYR A CE2 1 
ATOM   1065 C CZ  . TYR A 1 141 ? 43.764 -23.735 -307.826 1.00 27.31  ?  171 TYR A CZ  1 
ATOM   1066 O OH  . TYR A 1 141 ? 44.645 -23.454 -306.818 1.00 30.35  ?  171 TYR A OH  1 
ATOM   1067 N N   . ARG A 1 142 ? 40.182 -23.973 -314.034 1.00 28.87  ?  172 ARG A N   1 
ATOM   1068 C CA  . ARG A 1 142 ? 39.471 -24.313 -315.268 1.00 35.86  ?  172 ARG A CA  1 
ATOM   1069 C C   . ARG A 1 142 ? 38.572 -25.547 -315.119 1.00 30.29  ?  172 ARG A C   1 
ATOM   1070 O O   . ARG A 1 142 ? 39.006 -26.567 -314.591 1.00 32.89  ?  172 ARG A O   1 
ATOM   1071 C CB  . ARG A 1 142 ? 40.518 -24.534 -316.378 1.00 31.63  ?  172 ARG A CB  1 
ATOM   1072 C CG  . ARG A 1 142 ? 40.014 -25.099 -317.680 1.00 40.92  ?  172 ARG A CG  1 
ATOM   1073 C CD  . ARG A 1 142 ? 41.180 -25.658 -318.526 1.00 35.01  ?  172 ARG A CD  1 
ATOM   1074 N NE  . ARG A 1 142 ? 42.364 -24.810 -318.437 1.00 36.14  ?  172 ARG A NE  1 
ATOM   1075 C CZ  . ARG A 1 142 ? 43.586 -25.182 -318.805 1.00 33.97  ?  172 ARG A CZ  1 
ATOM   1076 N NH1 . ARG A 1 142 ? 43.803 -26.393 -319.301 1.00 30.67  ?  172 ARG A NH1 1 
ATOM   1077 N NH2 . ARG A 1 142 ? 44.590 -24.334 -318.679 1.00 29.71  ?  172 ARG A NH2 1 
ATOM   1078 N N   . GLY A 1 143 ? 37.332 -25.452 -315.589 1.00 25.09  ?  173 GLY A N   1 
ATOM   1079 C CA  . GLY A 1 143 ? 36.423 -26.592 -315.648 1.00 25.75  ?  173 GLY A CA  1 
ATOM   1080 C C   . GLY A 1 143 ? 36.180 -27.360 -314.355 1.00 28.65  ?  173 GLY A C   1 
ATOM   1081 O O   . GLY A 1 143 ? 35.861 -28.545 -314.380 1.00 29.04  ?  173 GLY A O   1 
ATOM   1082 N N   . THR A 1 144 ? 36.331 -26.681 -313.222 1.00 27.56  ?  174 THR A N   1 
ATOM   1083 C CA  . THR A 1 144 ? 36.282 -27.327 -311.918 1.00 31.15  ?  174 THR A CA  1 
ATOM   1084 C C   . THR A 1 144 ? 35.222 -26.689 -311.022 1.00 26.36  ?  174 THR A C   1 
ATOM   1085 O O   . THR A 1 144 ? 35.241 -25.494 -310.751 1.00 26.13  ?  174 THR A O   1 
ATOM   1086 C CB  . THR A 1 144 ? 37.647 -27.264 -311.216 1.00 30.98  ?  174 THR A CB  1 
ATOM   1087 O OG1 . THR A 1 144 ? 38.653 -27.753 -312.114 1.00 34.13  ?  174 THR A OG1 1 
ATOM   1088 C CG2 . THR A 1 144 ? 37.631 -28.112 -309.951 1.00 27.04  ?  174 THR A CG2 1 
ATOM   1089 N N   . THR A 1 145 ? 34.292 -27.505 -310.568 1.00 28.35  ?  175 THR A N   1 
ATOM   1090 C CA  . THR A 1 145 ? 33.135 -26.996 -309.854 1.00 27.58  ?  175 THR A CA  1 
ATOM   1091 C C   . THR A 1 145 ? 33.516 -26.435 -308.488 1.00 27.20  ?  175 THR A C   1 
ATOM   1092 O O   . THR A 1 145 ? 34.195 -27.088 -307.699 1.00 30.41  ?  175 THR A O   1 
ATOM   1093 C CB  . THR A 1 145 ? 32.100 -28.101 -309.720 1.00 32.69  ?  175 THR A CB  1 
ATOM   1094 O OG1 . THR A 1 145 ? 31.707 -28.508 -311.042 1.00 30.46  ?  175 THR A OG1 1 
ATOM   1095 C CG2 . THR A 1 145 ? 30.890 -27.634 -308.914 1.00 25.78  ?  175 THR A CG2 1 
ATOM   1096 N N   . PHE A 1 146 ? 33.111 -25.202 -308.221 1.00 28.24  ?  176 PHE A N   1 
ATOM   1097 C CA  . PHE A 1 146 ? 33.374 -24.610 -306.918 1.00 30.37  ?  176 PHE A CA  1 
ATOM   1098 C C   . PHE A 1 146 ? 32.117 -24.007 -306.288 1.00 32.10  ?  176 PHE A C   1 
ATOM   1099 O O   . PHE A 1 146 ? 31.142 -23.672 -306.970 1.00 31.09  ?  176 PHE A O   1 
ATOM   1100 C CB  . PHE A 1 146 ? 34.469 -23.530 -307.008 1.00 28.59  ?  176 PHE A CB  1 
ATOM   1101 C CG  . PHE A 1 146 ? 34.117 -22.329 -307.903 1.00 30.73  ?  176 PHE A CG  1 
ATOM   1102 C CD1 . PHE A 1 146 ? 34.550 -22.281 -309.222 1.00 29.44  ?  176 PHE A CD1 1 
ATOM   1103 C CD2 . PHE A 1 146 ? 33.413 -21.235 -307.400 1.00 30.54  ?  176 PHE A CD2 1 
ATOM   1104 C CE1 . PHE A 1 146 ? 34.273 -21.175 -310.030 1.00 26.94  ?  176 PHE A CE1 1 
ATOM   1105 C CE2 . PHE A 1 146 ? 33.121 -20.127 -308.206 1.00 30.20  ?  176 PHE A CE2 1 
ATOM   1106 C CZ  . PHE A 1 146 ? 33.556 -20.103 -309.523 1.00 30.82  ?  176 PHE A CZ  1 
ATOM   1107 N N   . ALA A 1 147 ? 32.160 -23.879 -304.972 1.00 27.12  ?  177 ALA A N   1 
ATOM   1108 C CA  . ALA A 1 147 ? 31.225 -23.035 -304.248 1.00 27.41  ?  177 ALA A CA  1 
ATOM   1109 C C   . ALA A 1 147 ? 32.033 -21.890 -303.639 1.00 29.37  ?  177 ALA A C   1 
ATOM   1110 O O   . ALA A 1 147 ? 33.225 -22.050 -303.358 1.00 32.11  ?  177 ALA A O   1 
ATOM   1111 C CB  . ALA A 1 147 ? 30.498 -23.831 -303.172 1.00 33.41  ?  177 ALA A CB  1 
ATOM   1112 N N   . GLU A 1 148 ? 31.417 -20.730 -303.466 1.00 26.78  ?  178 GLU A N   1 
ATOM   1113 C CA  . GLU A 1 148 ? 32.102 -19.634 -302.782 1.00 31.48  ?  178 GLU A CA  1 
ATOM   1114 C C   . GLU A 1 148 ? 31.936 -19.826 -301.288 1.00 30.38  ?  178 GLU A C   1 
ATOM   1115 O O   . GLU A 1 148 ? 30.865 -20.225 -300.831 1.00 32.87  ?  178 GLU A O   1 
ATOM   1116 C CB  . GLU A 1 148 ? 31.561 -18.264 -303.213 1.00 31.34  ?  178 GLU A CB  1 
ATOM   1117 C CG  . GLU A 1 148 ? 31.687 -17.982 -304.700 1.00 28.91  ?  178 GLU A CG  1 
ATOM   1118 C CD  . GLU A 1 148 ? 30.873 -16.784 -305.131 1.00 33.09  ?  178 GLU A CD  1 
ATOM   1119 O OE1 . GLU A 1 148 ? 29.688 -16.963 -305.466 1.00 38.68  ?  178 GLU A OE1 1 
ATOM   1120 O OE2 . GLU A 1 148 ? 31.407 -15.653 -305.117 1.00 35.44  -1 178 GLU A OE2 1 
ATOM   1121 N N   . GLY A 1 149 ? 32.987 -19.537 -300.525 1.00 28.98  ?  179 GLY A N   1 
ATOM   1122 C CA  . GLY A 1 149 ? 32.932 -19.787 -299.099 1.00 28.75  ?  179 GLY A CA  1 
ATOM   1123 C C   . GLY A 1 149 ? 34.072 -19.303 -298.237 1.00 31.84  ?  179 GLY A C   1 
ATOM   1124 O O   . GLY A 1 149 ? 35.030 -18.665 -298.702 1.00 32.97  ?  179 GLY A O   1 
ATOM   1125 N N   . VAL A 1 150 ? 33.967 -19.629 -296.954 1.00 34.62  ?  180 VAL A N   1 
ATOM   1126 C CA  . VAL A 1 150 ? 34.968 -19.233 -295.971 1.00 37.56  ?  180 VAL A CA  1 
ATOM   1127 C C   . VAL A 1 150 ? 35.233 -20.391 -295.014 1.00 39.46  ?  180 VAL A C   1 
ATOM   1128 O O   . VAL A 1 150 ? 34.436 -21.329 -294.913 1.00 38.06  ?  180 VAL A O   1 
ATOM   1129 C CB  . VAL A 1 150 ? 34.520 -17.968 -295.196 1.00 41.65  ?  180 VAL A CB  1 
ATOM   1130 C CG1 . VAL A 1 150 ? 34.618 -16.735 -296.100 1.00 38.11  ?  180 VAL A CG1 1 
ATOM   1131 C CG2 . VAL A 1 150 ? 33.094 -18.133 -294.685 1.00 40.02  ?  180 VAL A CG2 1 
ATOM   1132 N N   . VAL A 1 151 ? 36.367 -20.333 -294.327 1.00 41.48  ?  181 VAL A N   1 
ATOM   1133 C CA  . VAL A 1 151 ? 36.809 -21.439 -293.492 1.00 39.63  ?  181 VAL A CA  1 
ATOM   1134 C C   . VAL A 1 151 ? 36.865 -21.024 -292.020 1.00 41.96  ?  181 VAL A C   1 
ATOM   1135 O O   . VAL A 1 151 ? 37.223 -19.895 -291.704 1.00 40.37  ?  181 VAL A O   1 
ATOM   1136 C CB  . VAL A 1 151 ? 38.195 -21.952 -293.952 1.00 37.73  ?  181 VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 151 ? 38.744 -23.015 -293.001 1.00 36.00  ?  181 VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 151 ? 38.107 -22.486 -295.377 1.00 37.83  ?  181 VAL A CG2 1 
ATOM   1139 N N   . ALA A 1 152 ? 36.479 -21.937 -291.134 1.00 34.89  ?  182 ALA A N   1 
ATOM   1140 C CA  . ALA A 1 152 ? 36.666 -21.754 -289.700 1.00 39.08  ?  182 ALA A CA  1 
ATOM   1141 C C   . ALA A 1 152 ? 37.405 -22.959 -289.124 1.00 36.63  ?  182 ALA A C   1 
ATOM   1142 O O   . ALA A 1 152 ? 37.349 -24.055 -289.681 1.00 33.11  ?  182 ALA A O   1 
ATOM   1143 C CB  . ALA A 1 152 ? 35.325 -21.563 -288.995 1.00 35.39  ?  182 ALA A CB  1 
ATOM   1144 N N   . PHE A 1 153 ? 38.096 -22.740 -288.011 1.00 41.99  ?  183 PHE A N   1 
ATOM   1145 C CA  . PHE A 1 153 ? 38.803 -23.802 -287.300 1.00 44.94  ?  183 PHE A CA  1 
ATOM   1146 C C   . PHE A 1 153 ? 38.209 -24.006 -285.898 1.00 48.03  ?  183 PHE A C   1 
ATOM   1147 O O   . PHE A 1 153 ? 38.040 -23.052 -285.138 1.00 48.27  ?  183 PHE A O   1 
ATOM   1148 C CB  . PHE A 1 153 ? 40.300 -23.478 -287.209 1.00 39.31  ?  183 PHE A CB  1 
ATOM   1149 C CG  . PHE A 1 153 ? 40.936 -23.158 -288.541 1.00 42.66  ?  183 PHE A CG  1 
ATOM   1150 C CD1 . PHE A 1 153 ? 41.024 -21.851 -288.983 1.00 35.44  ?  183 PHE A CD1 1 
ATOM   1151 C CD2 . PHE A 1 153 ? 41.438 -24.171 -289.352 1.00 40.32  ?  183 PHE A CD2 1 
ATOM   1152 C CE1 . PHE A 1 153 ? 41.606 -21.557 -290.199 1.00 38.11  ?  183 PHE A CE1 1 
ATOM   1153 C CE2 . PHE A 1 153 ? 42.018 -23.883 -290.573 1.00 34.57  ?  183 PHE A CE2 1 
ATOM   1154 C CZ  . PHE A 1 153 ? 42.106 -22.576 -290.997 1.00 35.12  ?  183 PHE A CZ  1 
ATOM   1155 N N   . LEU A 1 154 ? 37.897 -25.252 -285.561 1.00 50.16  ?  184 LEU A N   1 
ATOM   1156 C CA  . LEU A 1 154 ? 37.190 -25.546 -284.315 1.00 55.36  ?  184 LEU A CA  1 
ATOM   1157 C C   . LEU A 1 154 ? 37.895 -26.554 -283.411 1.00 56.84  ?  184 LEU A C   1 
ATOM   1158 O O   . LEU A 1 154 ? 38.664 -27.403 -283.877 1.00 51.52  ?  184 LEU A O   1 
ATOM   1159 C CB  . LEU A 1 154 ? 35.793 -26.080 -284.622 1.00 56.24  ?  184 LEU A CB  1 
ATOM   1160 C CG  . LEU A 1 154 ? 34.918 -25.278 -285.580 1.00 56.78  ?  184 LEU A CG  1 
ATOM   1161 C CD1 . LEU A 1 154 ? 33.718 -26.113 -285.989 1.00 58.87  ?  184 LEU A CD1 1 
ATOM   1162 C CD2 . LEU A 1 154 ? 34.482 -23.976 -284.931 1.00 60.03  ?  184 LEU A CD2 1 
ATOM   1163 N N   . ILE A 1 155 ? 37.613 -26.451 -282.115 1.00 55.88  ?  185 ILE A N   1 
ATOM   1164 C CA  . ILE A 1 155 ? 37.901 -27.527 -281.168 1.00 58.48  ?  185 ILE A CA  1 
ATOM   1165 C C   . ILE A 1 155 ? 36.597 -28.213 -280.751 1.00 59.08  ?  185 ILE A C   1 
ATOM   1166 O O   . ILE A 1 155 ? 35.739 -27.595 -280.126 1.00 63.56  ?  185 ILE A O   1 
ATOM   1167 C CB  . ILE A 1 155 ? 38.628 -27.021 -279.912 1.00 57.34  ?  185 ILE A CB  1 
ATOM   1168 C CG1 . ILE A 1 155 ? 39.926 -26.308 -280.292 1.00 63.52  ?  185 ILE A CG1 1 
ATOM   1169 C CG2 . ILE A 1 155 ? 38.911 -28.175 -278.962 1.00 56.11  ?  185 ILE A CG2 1 
ATOM   1170 C CD1 . ILE A 1 155 ? 40.834 -26.014 -279.104 1.00 57.66  ?  185 ILE A CD1 1 
ATOM   1171 N N   . LEU A 1 156 ? 36.458 -29.485 -281.115 1.00 66.16  ?  186 LEU A N   1 
ATOM   1172 C CA  . LEU A 1 156 ? 35.273 -30.281 -280.789 1.00 73.60  ?  186 LEU A CA  1 
ATOM   1173 C C   . LEU A 1 156 ? 35.425 -30.982 -279.441 1.00 77.35  ?  186 LEU A C   1 
ATOM   1174 O O   . LEU A 1 156 ? 36.544 -31.297 -279.032 1.00 77.69  ?  186 LEU A O   1 
ATOM   1175 C CB  . LEU A 1 156 ? 35.011 -31.331 -281.876 1.00 70.72  ?  186 LEU A CB  1 
ATOM   1176 C CG  . LEU A 1 156 ? 35.009 -30.905 -283.343 1.00 70.68  ?  186 LEU A CG  1 
ATOM   1177 C CD1 . LEU A 1 156 ? 34.780 -32.111 -284.243 1.00 66.48  ?  186 LEU A CD1 1 
ATOM   1178 C CD2 . LEU A 1 156 ? 33.961 -29.837 -283.601 1.00 66.00  ?  186 LEU A CD2 1 
ATOM   1179 N N   . PRO A 1 157 ? 34.297 -31.239 -278.750 1.00 77.65  ?  187 PRO A N   1 
ATOM   1180 C CA  . PRO A 1 157 ? 34.288 -32.002 -277.490 1.00 76.34  ?  187 PRO A CA  1 
ATOM   1181 C C   . PRO A 1 157 ? 34.893 -33.401 -277.625 1.00 74.91  ?  187 PRO A C   1 
ATOM   1182 O O   . PRO A 1 157 ? 34.947 -33.942 -278.732 1.00 72.78  ?  187 PRO A O   1 
ATOM   1183 C CB  . PRO A 1 157 ? 32.798 -32.097 -277.150 1.00 76.27  ?  187 PRO A CB  1 
ATOM   1184 C CG  . PRO A 1 157 ? 32.190 -30.907 -277.804 1.00 79.80  ?  187 PRO A CG  1 
ATOM   1185 C CD  . PRO A 1 157 ? 32.964 -30.701 -279.076 1.00 74.39  ?  187 PRO A CD  1 
ATOM   1186 N N   . GLN A 1 158 ? 35.337 -33.974 -276.508 1.00 94.24  ?  188 GLN A N   1 
ATOM   1187 C CA  . GLN A 1 158 ? 35.930 -35.312 -276.508 1.00 91.85  ?  188 GLN A CA  1 
ATOM   1188 C C   . GLN A 1 158 ? 34.913 -36.390 -276.884 1.00 94.44  ?  188 GLN A C   1 
ATOM   1189 O O   . GLN A 1 158 ? 33.743 -36.315 -276.503 1.00 93.11  ?  188 GLN A O   1 
ATOM   1190 C CB  . GLN A 1 158 ? 36.532 -35.632 -275.140 1.00 91.73  ?  188 GLN A CB  1 
ATOM   1191 C CG  . GLN A 1 158 ? 37.721 -34.774 -274.754 1.00 88.08  ?  188 GLN A CG  1 
ATOM   1192 C CD  . GLN A 1 158 ? 38.295 -35.167 -273.409 1.00 92.99  ?  188 GLN A CD  1 
ATOM   1193 O OE1 . GLN A 1 158 ? 38.691 -36.317 -273.205 1.00 92.72  ?  188 GLN A OE1 1 
ATOM   1194 N NE2 . GLN A 1 158 ? 38.348 -34.212 -272.482 1.00 92.84  ?  188 GLN A NE2 1 
ATOM   1195 N N   . PRO B 2 1   ? 23.651 -10.386 -289.730 1.00 141.95 ?  509 PRO B N   1 
ATOM   1196 C CA  . PRO B 2 1   ? 23.348 -10.334 -291.166 1.00 144.15 ?  509 PRO B CA  1 
ATOM   1197 C C   . PRO B 2 1   ? 23.186 -11.718 -291.819 1.00 144.51 ?  509 PRO B C   1 
ATOM   1198 O O   . PRO B 2 1   ? 23.622 -12.711 -291.231 1.00 144.08 ?  509 PRO B O   1 
ATOM   1199 C CB  . PRO B 2 1   ? 24.578 -9.620  -291.746 1.00 143.91 ?  509 PRO B CB  1 
ATOM   1200 C CG  . PRO B 2 1   ? 25.690 -10.091 -290.859 1.00 143.01 ?  509 PRO B CG  1 
ATOM   1201 C CD  . PRO B 2 1   ? 25.104 -10.359 -289.488 1.00 141.45 ?  509 PRO B CD  1 
ATOM   1202 N N   . LYS B 2 2   ? 22.542 -11.773 -292.990 1.00 126.95 ?  510 LYS B N   1 
ATOM   1203 C CA  . LYS B 2 2   ? 22.680 -12.907 -293.907 1.00 121.97 ?  510 LYS B CA  1 
ATOM   1204 C C   . LYS B 2 2   ? 22.812 -14.313 -293.323 1.00 115.02 ?  510 LYS B C   1 
ATOM   1205 O O   . LYS B 2 2   ? 23.860 -14.925 -293.585 1.00 117.82 ?  510 LYS B O   1 
ATOM   1206 C CB  . LYS B 2 2   ? 23.960 -12.705 -294.713 1.00 125.87 ?  510 LYS B CB  1 
ATOM   1207 C CG  . LYS B 2 2   ? 24.389 -11.301 -294.970 1.00 129.94 ?  510 LYS B CG  1 
ATOM   1208 C CD  . LYS B 2 2   ? 25.737 -11.227 -295.653 1.00 128.67 ?  510 LYS B CD  1 
ATOM   1209 C CE  . LYS B 2 2   ? 26.761 -11.541 -294.563 1.00 129.64 ?  510 LYS B CE  1 
ATOM   1210 N NZ  . LYS B 2 2   ? 27.931 -10.642 -294.526 1.00 128.88 ?  510 LYS B NZ  1 
ATOM   1211 N N   . CYS B 2 3   ? 21.868 -14.845 -292.539 1.00 78.89  ?  511 CYS B N   1 
ATOM   1212 C CA  . CYS B 2 3   ? 22.199 -16.130 -291.898 1.00 68.28  ?  511 CYS B CA  1 
ATOM   1213 C C   . CYS B 2 3   ? 21.234 -17.301 -292.155 1.00 67.06  ?  511 CYS B C   1 
ATOM   1214 O O   . CYS B 2 3   ? 20.032 -17.217 -291.832 1.00 70.64  ?  511 CYS B O   1 
ATOM   1215 C CB  . CYS B 2 3   ? 22.328 -15.969 -290.388 1.00 66.11  ?  511 CYS B CB  1 
ATOM   1216 S SG  . CYS B 2 3   ? 22.638 -17.580 -289.582 1.00 73.00  ?  511 CYS B SG  1 
ATOM   1217 N N   . ASN B 2 4   ? 21.794 -18.413 -292.643 1.00 51.97  ?  512 ASN B N   1 
ATOM   1218 C CA  . ASN B 2 4   ? 21.066 -19.661 -292.801 1.00 52.15  ?  512 ASN B CA  1 
ATOM   1219 C C   . ASN B 2 4   ? 21.244 -20.577 -291.585 1.00 54.26  ?  512 ASN B C   1 
ATOM   1220 O O   . ASN B 2 4   ? 22.317 -21.146 -291.375 1.00 49.46  ?  512 ASN B O   1 
ATOM   1221 C CB  . ASN B 2 4   ? 21.532 -20.367 -294.070 1.00 48.58  ?  512 ASN B CB  1 
ATOM   1222 C CG  . ASN B 2 4   ? 20.778 -21.650 -294.339 1.00 49.61  ?  512 ASN B CG  1 
ATOM   1223 O OD1 . ASN B 2 4   ? 19.659 -21.831 -293.870 1.00 53.19  ?  512 ASN B OD1 1 
ATOM   1224 N ND2 . ASN B 2 4   ? 21.388 -22.548 -295.103 1.00 50.70  ?  512 ASN B ND2 1 
ATOM   1225 N N   . PRO B 2 5   ? 20.184 -20.723 -290.779 1.00 65.98  ?  513 PRO B N   1 
ATOM   1226 C CA  . PRO B 2 5   ? 20.224 -21.473 -289.517 1.00 61.46  ?  513 PRO B CA  1 
ATOM   1227 C C   . PRO B 2 5   ? 20.388 -22.970 -289.749 1.00 62.58  ?  513 PRO B C   1 
ATOM   1228 O O   . PRO B 2 5   ? 20.893 -23.671 -288.885 1.00 64.55  ?  513 PRO B O   1 
ATOM   1229 C CB  . PRO B 2 5   ? 18.867 -21.164 -288.890 1.00 71.81  ?  513 PRO B CB  1 
ATOM   1230 C CG  . PRO B 2 5   ? 17.963 -20.956 -290.088 1.00 69.23  ?  513 PRO B CG  1 
ATOM   1231 C CD  . PRO B 2 5   ? 18.825 -20.251 -291.103 1.00 67.02  ?  513 PRO B CD  1 
ATOM   1232 N N   . ASN B 2 6   ? 19.958 -23.455 -290.906 1.00 64.92  ?  514 ASN B N   1 
ATOM   1233 C CA  . ASN B 2 6   ? 20.130 -24.860 -291.233 1.00 69.74  ?  514 ASN B CA  1 
ATOM   1234 C C   . ASN B 2 6   ? 21.540 -25.164 -291.722 1.00 68.61  ?  514 ASN B C   1 
ATOM   1235 O O   . ASN B 2 6   ? 22.116 -24.409 -292.507 1.00 69.01  ?  514 ASN B O   1 
ATOM   1236 C CB  . ASN B 2 6   ? 19.118 -25.297 -292.296 1.00 63.40  ?  514 ASN B CB  1 
ATOM   1237 C CG  . ASN B 2 6   ? 17.966 -26.088 -291.716 1.00 70.80  ?  514 ASN B CG  1 
ATOM   1238 O OD1 . ASN B 2 6   ? 17.594 -25.922 -290.544 1.00 72.54  ?  514 ASN B OD1 1 
ATOM   1239 N ND2 . ASN B 2 6   ? 17.401 -26.977 -292.532 1.00 70.05  ?  514 ASN B ND2 1 
ATOM   1240 N N   . LEU B 2 7   ? 22.082 -26.287 -291.269 1.00 55.73  ?  515 LEU B N   1 
ATOM   1241 C CA  . LEU B 2 7   ? 23.391 -26.732 -291.710 1.00 50.75  ?  515 LEU B CA  1 
ATOM   1242 C C   . LEU B 2 7   ? 23.300 -28.146 -292.249 1.00 49.47  ?  515 LEU B C   1 
ATOM   1243 O O   . LEU B 2 7   ? 23.433 -29.111 -291.505 1.00 54.61  ?  515 LEU B O   1 
ATOM   1244 C CB  . LEU B 2 7   ? 24.403 -26.667 -290.565 1.00 55.85  ?  515 LEU B CB  1 
ATOM   1245 C CG  . LEU B 2 7   ? 25.868 -26.911 -290.946 1.00 52.13  ?  515 LEU B CG  1 
ATOM   1246 C CD1 . LEU B 2 7   ? 26.315 -25.892 -291.988 1.00 51.45  ?  515 LEU B CD1 1 
ATOM   1247 C CD2 . LEU B 2 7   ? 26.775 -26.870 -289.724 1.00 51.70  ?  515 LEU B CD2 1 
ATOM   1248 N N   . HIS B 2 8   ? 23.061 -28.269 -293.547 1.00 46.66  ?  516 HIS B N   1 
ATOM   1249 C CA  . HIS B 2 8   ? 23.008 -29.569 -294.180 1.00 38.78  ?  516 HIS B CA  1 
ATOM   1250 C C   . HIS B 2 8   ? 24.427 -29.992 -294.601 1.00 48.32  ?  516 HIS B C   1 
ATOM   1251 O O   . HIS B 2 8   ? 24.807 -29.876 -295.771 1.00 52.34  ?  516 HIS B O   1 
ATOM   1252 C CB  . HIS B 2 8   ? 22.056 -29.525 -295.368 1.00 40.54  ?  516 HIS B CB  1 
ATOM   1253 C CG  . HIS B 2 8   ? 21.644 -30.875 -295.866 1.00 41.77  ?  516 HIS B CG  1 
ATOM   1254 N ND1 . HIS B 2 8   ? 20.713 -31.044 -296.869 1.00 46.61  ?  516 HIS B ND1 1 
ATOM   1255 C CD2 . HIS B 2 8   ? 22.021 -32.118 -295.491 1.00 46.92  ?  516 HIS B CD2 1 
ATOM   1256 C CE1 . HIS B 2 8   ? 20.539 -32.334 -297.095 1.00 44.77  ?  516 HIS B CE1 1 
ATOM   1257 N NE2 . HIS B 2 8   ? 21.323 -33.008 -296.273 1.00 52.86  ?  516 HIS B NE2 1 
ATOM   1258 N N   . TYR B 2 9   ? 25.197 -30.497 -293.641 1.00 49.34  ?  517 TYR B N   1 
ATOM   1259 C CA  . TYR B 2 9   ? 26.636 -30.693 -293.811 1.00 46.17  ?  517 TYR B CA  1 
ATOM   1260 C C   . TYR B 2 9   ? 27.016 -31.996 -294.501 1.00 44.71  ?  517 TYR B C   1 
ATOM   1261 O O   . TYR B 2 9   ? 26.234 -32.939 -294.556 1.00 48.25  ?  517 TYR B O   1 
ATOM   1262 C CB  . TYR B 2 9   ? 27.336 -30.632 -292.454 1.00 48.14  ?  517 TYR B CB  1 
ATOM   1263 C CG  . TYR B 2 9   ? 27.021 -31.827 -291.578 1.00 58.99  ?  517 TYR B CG  1 
ATOM   1264 C CD1 . TYR B 2 9   ? 27.826 -32.965 -291.598 1.00 55.02  ?  517 TYR B CD1 1 
ATOM   1265 C CD2 . TYR B 2 9   ? 25.910 -31.826 -290.742 1.00 62.00  ?  517 TYR B CD2 1 
ATOM   1266 C CE1 . TYR B 2 9   ? 27.535 -34.064 -290.807 1.00 62.00  ?  517 TYR B CE1 1 
ATOM   1267 C CE2 . TYR B 2 9   ? 25.614 -32.922 -289.940 1.00 65.40  ?  517 TYR B CE2 1 
ATOM   1268 C CZ  . TYR B 2 9   ? 26.429 -34.038 -289.977 1.00 65.73  ?  517 TYR B CZ  1 
ATOM   1269 O OH  . TYR B 2 9   ? 26.144 -35.130 -289.187 1.00 66.07  ?  517 TYR B OH  1 
ATOM   1270 N N   . TRP B 2 10  ? 28.229 -32.026 -295.043 1.00 43.32  ?  518 TRP B N   1 
ATOM   1271 C CA  . TRP B 2 10  ? 28.824 -33.263 -295.528 1.00 42.16  ?  518 TRP B CA  1 
ATOM   1272 C C   . TRP B 2 10  ? 30.204 -33.391 -294.884 1.00 42.54  ?  518 TRP B C   1 
ATOM   1273 O O   . TRP B 2 10  ? 30.797 -32.395 -294.487 1.00 42.56  ?  518 TRP B O   1 
ATOM   1274 C CB  . TRP B 2 10  ? 28.906 -33.302 -297.066 1.00 41.39  ?  518 TRP B CB  1 
ATOM   1275 C CG  . TRP B 2 10  ? 29.565 -32.100 -297.723 1.00 37.53  ?  518 TRP B CG  1 
ATOM   1276 C CD1 . TRP B 2 10  ? 28.934 -31.047 -298.327 1.00 39.80  ?  518 TRP B CD1 1 
ATOM   1277 C CD2 . TRP B 2 10  ? 30.972 -31.852 -297.858 1.00 38.63  ?  518 TRP B CD2 1 
ATOM   1278 N NE1 . TRP B 2 10  ? 29.862 -30.149 -298.821 1.00 38.84  ?  518 TRP B NE1 1 
ATOM   1279 C CE2 . TRP B 2 10  ? 31.121 -30.625 -298.549 1.00 42.52  ?  518 TRP B CE2 1 
ATOM   1280 C CE3 . TRP B 2 10  ? 32.125 -32.549 -297.471 1.00 38.77  ?  518 TRP B CE3 1 
ATOM   1281 C CZ2 . TRP B 2 10  ? 32.369 -30.076 -298.844 1.00 36.80  ?  518 TRP B CZ2 1 
ATOM   1282 C CZ3 . TRP B 2 10  ? 33.368 -32.000 -297.768 1.00 40.38  ?  518 TRP B CZ3 1 
ATOM   1283 C CH2 . TRP B 2 10  ? 33.479 -30.778 -298.450 1.00 35.44  ?  518 TRP B CH2 1 
ATOM   1284 N N   . THR B 2 11  ? 30.683 -34.619 -294.729 1.00 41.58  ?  519 THR B N   1 
ATOM   1285 C CA  . THR B 2 11  ? 32.037 -34.850 -294.244 1.00 42.77  ?  519 THR B CA  1 
ATOM   1286 C C   . THR B 2 11  ? 32.478 -36.261 -294.594 1.00 41.33  ?  519 THR B C   1 
ATOM   1287 O O   . THR B 2 11  ? 31.695 -37.047 -295.114 1.00 46.52  ?  519 THR B O   1 
ATOM   1288 C CB  . THR B 2 11  ? 32.156 -34.651 -292.715 1.00 53.49  ?  519 THR B CB  1 
ATOM   1289 O OG1 . THR B 2 11  ? 33.543 -34.669 -292.339 1.00 51.94  ?  519 THR B OG1 1 
ATOM   1290 C CG2 . THR B 2 11  ? 31.407 -35.750 -291.973 1.00 48.18  ?  519 THR B CG2 1 
ATOM   1291 N N   . THR B 2 12  ? 33.733 -36.580 -294.314 1.00 47.43  ?  520 THR B N   1 
ATOM   1292 C CA  . THR B 2 12  ? 34.210 -37.949 -294.479 1.00 59.84  ?  520 THR B CA  1 
ATOM   1293 C C   . THR B 2 12  ? 34.160 -38.713 -293.156 1.00 67.46  ?  520 THR B C   1 
ATOM   1294 O O   . THR B 2 12  ? 34.677 -38.225 -292.148 1.00 72.11  ?  520 THR B O   1 
ATOM   1295 C CB  . THR B 2 12  ? 35.655 -37.985 -294.989 1.00 57.87  ?  520 THR B CB  1 
ATOM   1296 O OG1 . THR B 2 12  ? 36.521 -37.497 -293.958 1.00 52.84  ?  520 THR B OG1 1 
ATOM   1297 C CG2 . THR B 2 12  ? 35.815 -37.125 -296.244 1.00 52.95  ?  520 THR B CG2 1 
ATOM   1298 N N   . GLN B 2 13  ? 33.547 -39.898 -293.165 1.00 81.60  ?  521 GLN B N   1 
ATOM   1299 C CA  . GLN B 2 13  ? 33.621 -40.834 -292.028 1.00 97.50  ?  521 GLN B CA  1 
ATOM   1300 C C   . GLN B 2 13  ? 33.151 -42.236 -292.407 1.00 95.96  ?  521 GLN B C   1 
ATOM   1301 O O   . GLN B 2 13  ? 32.646 -42.974 -291.556 1.00 100.59 ?  521 GLN B O   1 
ATOM   1302 C CB  . GLN B 2 13  ? 32.799 -40.333 -290.830 1.00 94.26  ?  521 GLN B CB  1 
ATOM   1303 C CG  . GLN B 2 13  ? 33.630 -39.664 -289.733 1.00 97.46  ?  521 GLN B CG  1 
ATOM   1304 C CD  . GLN B 2 13  ? 32.837 -38.636 -288.944 1.00 100.38 ?  521 GLN B CD  1 
ATOM   1305 O OE1 . GLN B 2 13  ? 31.627 -38.480 -289.138 1.00 97.06  ?  521 GLN B OE1 1 
ATOM   1306 N NE2 . GLN B 2 13  ? 33.518 -37.925 -288.047 1.00 95.77  ?  521 GLN B NE2 1 
ATOM   1307 N N   . ALA B 2 17  ? 34.396 -46.952 -294.672 1.00 136.21 ?  525 ALA B N   1 
ATOM   1308 C CA  . ALA B 2 17  ? 33.687 -48.219 -294.794 1.00 140.75 ?  525 ALA B CA  1 
ATOM   1309 C C   . ALA B 2 17  ? 34.519 -49.383 -294.244 1.00 145.18 ?  525 ALA B C   1 
ATOM   1310 O O   . ALA B 2 17  ? 35.260 -50.035 -294.979 1.00 155.26 ?  525 ALA B O   1 
ATOM   1311 C CB  . ALA B 2 17  ? 33.318 -48.471 -296.244 1.00 127.57 ?  525 ALA B CB  1 
ATOM   1312 N N   . ALA B 2 18  ? 34.375 -49.652 -292.950 1.00 129.85 ?  526 ALA B N   1 
ATOM   1313 C CA  . ALA B 2 18  ? 35.213 -50.644 -292.278 1.00 123.51 ?  526 ALA B CA  1 
ATOM   1314 C C   . ALA B 2 18  ? 34.534 -52.012 -292.132 1.00 125.90 ?  526 ALA B C   1 
ATOM   1315 O O   . ALA B 2 18  ? 34.601 -52.632 -291.068 1.00 122.14 ?  526 ALA B O   1 
ATOM   1316 C CB  . ALA B 2 18  ? 35.639 -50.127 -290.903 1.00 113.88 ?  526 ALA B CB  1 
ATOM   1317 N N   . ILE B 2 19  ? 33.883 -52.479 -293.195 1.00 104.29 ?  527 ILE B N   1 
ATOM   1318 C CA  . ILE B 2 19  ? 33.208 -53.776 -293.174 1.00 101.45 ?  527 ILE B CA  1 
ATOM   1319 C C   . ILE B 2 19  ? 33.348 -54.510 -294.509 1.00 93.58  ?  527 ILE B C   1 
ATOM   1320 O O   . ILE B 2 19  ? 32.915 -54.020 -295.551 1.00 86.29  ?  527 ILE B O   1 
ATOM   1321 C CB  . ILE B 2 19  ? 31.706 -53.630 -292.838 1.00 108.15 ?  527 ILE B CB  1 
ATOM   1322 C CG1 . ILE B 2 19  ? 31.102 -52.430 -293.579 1.00 110.06 ?  527 ILE B CG1 1 
ATOM   1323 C CG2 . ILE B 2 19  ? 31.500 -53.485 -291.333 1.00 107.50 ?  527 ILE B CG2 1 
ATOM   1324 C CD1 . ILE B 2 19  ? 29.631 -52.218 -293.292 1.00 105.74 ?  527 ILE B CD1 1 
ATOM   1325 N N   . GLY B 2 20  ? 33.938 -55.699 -294.470 1.00 88.28  ?  528 GLY B N   1 
ATOM   1326 C CA  . GLY B 2 20  ? 34.219 -56.442 -295.685 1.00 77.36  ?  528 GLY B CA  1 
ATOM   1327 C C   . GLY B 2 20  ? 35.483 -55.937 -296.360 1.00 68.06  ?  528 GLY B C   1 
ATOM   1328 O O   . GLY B 2 20  ? 36.418 -55.509 -295.690 1.00 63.26  ?  528 GLY B O   1 
ATOM   1329 N N   . LEU B 2 21  ? 35.511 -55.984 -297.689 1.00 63.61  ?  529 LEU B N   1 
ATOM   1330 C CA  . LEU B 2 21  ? 36.670 -55.521 -298.449 1.00 59.87  ?  529 LEU B CA  1 
ATOM   1331 C C   . LEU B 2 21  ? 36.594 -54.030 -298.785 1.00 54.03  ?  529 LEU B C   1 
ATOM   1332 O O   . LEU B 2 21  ? 37.373 -53.533 -299.594 1.00 54.40  ?  529 LEU B O   1 
ATOM   1333 C CB  . LEU B 2 21  ? 36.812 -56.330 -299.742 1.00 61.20  ?  529 LEU B CB  1 
ATOM   1334 C CG  . LEU B 2 21  ? 36.921 -57.846 -299.557 1.00 61.23  ?  529 LEU B CG  1 
ATOM   1335 C CD1 . LEU B 2 21  ? 37.149 -58.531 -300.889 1.00 53.85  ?  529 LEU B CD1 1 
ATOM   1336 C CD2 . LEU B 2 21  ? 38.032 -58.182 -298.570 1.00 59.11  ?  529 LEU B CD2 1 
ATOM   1337 N N   . ALA B 2 22  ? 35.666 -53.320 -298.153 1.00 46.49  ?  530 ALA B N   1 
ATOM   1338 C CA  . ALA B 2 22  ? 35.361 -51.949 -298.532 1.00 45.48  ?  530 ALA B CA  1 
ATOM   1339 C C   . ALA B 2 22  ? 36.489 -50.974 -298.196 1.00 43.87  ?  530 ALA B C   1 
ATOM   1340 O O   . ALA B 2 22  ? 36.561 -49.900 -298.780 1.00 34.49  ?  530 ALA B O   1 
ATOM   1341 C CB  . ALA B 2 22  ? 34.066 -51.502 -297.874 1.00 48.77  ?  530 ALA B CB  1 
ATOM   1342 N N   . TRP B 2 23  ? 37.361 -51.352 -297.262 1.00 41.58  ?  531 TRP B N   1 
ATOM   1343 C CA  . TRP B 2 23  ? 38.506 -50.518 -296.888 1.00 43.98  ?  531 TRP B CA  1 
ATOM   1344 C C   . TRP B 2 23  ? 39.627 -50.582 -297.935 1.00 34.69  ?  531 TRP B C   1 
ATOM   1345 O O   . TRP B 2 23  ? 40.505 -49.731 -297.966 1.00 31.98  ?  531 TRP B O   1 
ATOM   1346 C CB  . TRP B 2 23  ? 39.050 -50.935 -295.518 1.00 40.60  ?  531 TRP B CB  1 
ATOM   1347 C CG  . TRP B 2 23  ? 39.546 -52.351 -295.481 1.00 41.62  ?  531 TRP B CG  1 
ATOM   1348 C CD1 . TRP B 2 23  ? 38.826 -53.465 -295.144 1.00 40.58  ?  531 TRP B CD1 1 
ATOM   1349 C CD2 . TRP B 2 23  ? 40.865 -52.811 -295.800 1.00 36.60  ?  531 TRP B CD2 1 
ATOM   1350 N NE1 . TRP B 2 23  ? 39.613 -54.583 -295.229 1.00 39.80  ?  531 TRP B NE1 1 
ATOM   1351 C CE2 . TRP B 2 23  ? 40.877 -54.212 -295.628 1.00 39.15  ?  531 TRP B CE2 1 
ATOM   1352 C CE3 . TRP B 2 23  ? 42.048 -52.175 -296.207 1.00 37.05  ?  531 TRP B CE3 1 
ATOM   1353 C CZ2 . TRP B 2 23  ? 42.010 -54.994 -295.855 1.00 36.17  ?  531 TRP B CZ2 1 
ATOM   1354 C CZ3 . TRP B 2 23  ? 43.178 -52.949 -296.436 1.00 35.11  ?  531 TRP B CZ3 1 
ATOM   1355 C CH2 . TRP B 2 23  ? 43.151 -54.345 -296.256 1.00 37.25  ?  531 TRP B CH2 1 
ATOM   1356 N N   . ILE B 2 24  ? 39.591 -51.602 -298.777 1.00 36.78  ?  532 ILE B N   1 
ATOM   1357 C CA  . ILE B 2 24  ? 40.545 -51.744 -299.870 1.00 35.96  ?  532 ILE B CA  1 
ATOM   1358 C C   . ILE B 2 24  ? 40.204 -50.775 -300.999 1.00 34.92  ?  532 ILE B C   1 
ATOM   1359 O O   . ILE B 2 24  ? 39.102 -50.821 -301.539 1.00 39.11  ?  532 ILE B O   1 
ATOM   1360 C CB  . ILE B 2 24  ? 40.556 -53.194 -300.402 1.00 35.93  ?  532 ILE B CB  1 
ATOM   1361 C CG1 . ILE B 2 24  ? 40.995 -54.148 -299.283 1.00 40.15  ?  532 ILE B CG1 1 
ATOM   1362 C CG2 . ILE B 2 24  ? 41.421 -53.310 -301.663 1.00 32.81  ?  532 ILE B CG2 1 
ATOM   1363 C CD1 . ILE B 2 24  ? 40.711 -55.616 -299.555 1.00 40.95  ?  532 ILE B CD1 1 
ATOM   1364 N N   . PRO B 2 25  ? 41.144 -49.878 -301.345 1.00 39.25  ?  533 PRO B N   1 
ATOM   1365 C CA  . PRO B 2 25  ? 40.900 -48.862 -302.381 1.00 35.43  ?  533 PRO B CA  1 
ATOM   1366 C C   . PRO B 2 25  ? 40.293 -49.445 -303.644 1.00 33.72  ?  533 PRO B C   1 
ATOM   1367 O O   . PRO B 2 25  ? 39.311 -48.883 -304.139 1.00 34.74  ?  533 PRO B O   1 
ATOM   1368 C CB  . PRO B 2 25  ? 42.300 -48.290 -302.654 1.00 34.25  ?  533 PRO B CB  1 
ATOM   1369 C CG  . PRO B 2 25  ? 43.008 -48.434 -301.328 1.00 36.15  ?  533 PRO B CG  1 
ATOM   1370 C CD  . PRO B 2 25  ? 42.483 -49.736 -300.734 1.00 31.65  ?  533 PRO B CD  1 
ATOM   1371 N N   . TYR B 2 26  ? 40.838 -50.561 -304.126 1.00 34.43  ?  534 TYR B N   1 
ATOM   1372 C CA  . TYR B 2 26  ? 40.321 -51.213 -305.332 1.00 38.70  ?  534 TYR B CA  1 
ATOM   1373 C C   . TYR B 2 26  ? 38.818 -51.513 -305.234 1.00 38.90  ?  534 TYR B C   1 
ATOM   1374 O O   . TYR B 2 26  ? 38.100 -51.371 -306.217 1.00 39.41  ?  534 TYR B O   1 
ATOM   1375 C CB  . TYR B 2 26  ? 41.087 -52.517 -305.623 1.00 35.84  ?  534 TYR B CB  1 
ATOM   1376 C CG  . TYR B 2 26  ? 40.563 -53.294 -306.823 1.00 36.44  ?  534 TYR B CG  1 
ATOM   1377 C CD1 . TYR B 2 26  ? 40.846 -52.882 -308.117 1.00 39.43  ?  534 TYR B CD1 1 
ATOM   1378 C CD2 . TYR B 2 26  ? 39.788 -54.434 -306.659 1.00 39.46  ?  534 TYR B CD2 1 
ATOM   1379 C CE1 . TYR B 2 26  ? 40.369 -53.582 -309.225 1.00 40.13  ?  534 TYR B CE1 1 
ATOM   1380 C CE2 . TYR B 2 26  ? 39.304 -55.143 -307.757 1.00 36.94  ?  534 TYR B CE2 1 
ATOM   1381 C CZ  . TYR B 2 26  ? 39.598 -54.710 -309.037 1.00 41.87  ?  534 TYR B CZ  1 
ATOM   1382 O OH  . TYR B 2 26  ? 39.137 -55.398 -310.133 1.00 40.29  ?  534 TYR B OH  1 
ATOM   1383 N N   . PHE B 2 27  ? 38.355 -51.908 -304.046 1.00 38.07  ?  535 PHE B N   1 
ATOM   1384 C CA  . PHE B 2 27  ? 36.966 -52.337 -303.854 1.00 42.35  ?  535 PHE B CA  1 
ATOM   1385 C C   . PHE B 2 27  ? 36.075 -51.255 -303.256 1.00 43.09  ?  535 PHE B C   1 
ATOM   1386 O O   . PHE B 2 27  ? 34.850 -51.355 -303.310 1.00 46.32  ?  535 PHE B O   1 
ATOM   1387 C CB  . PHE B 2 27  ? 36.903 -53.586 -302.958 1.00 38.91  ?  535 PHE B CB  1 
ATOM   1388 C CG  . PHE B 2 27  ? 37.414 -54.838 -303.621 1.00 39.61  ?  535 PHE B CG  1 
ATOM   1389 C CD1 . PHE B 2 27  ? 38.614 -55.413 -303.218 1.00 41.16  ?  535 PHE B CD1 1 
ATOM   1390 C CD2 . PHE B 2 27  ? 36.697 -55.439 -304.649 1.00 40.10  ?  535 PHE B CD2 1 
ATOM   1391 C CE1 . PHE B 2 27  ? 39.097 -56.563 -303.830 1.00 39.02  ?  535 PHE B CE1 1 
ATOM   1392 C CE2 . PHE B 2 27  ? 37.169 -56.592 -305.273 1.00 37.36  ?  535 PHE B CE2 1 
ATOM   1393 C CZ  . PHE B 2 27  ? 38.371 -57.156 -304.863 1.00 42.03  ?  535 PHE B CZ  1 
ATOM   1394 N N   . GLY B 2 28  ? 36.693 -50.225 -302.685 1.00 39.12  ?  536 GLY B N   1 
ATOM   1395 C CA  . GLY B 2 28  ? 35.963 -49.189 -301.975 1.00 40.02  ?  536 GLY B CA  1 
ATOM   1396 C C   . GLY B 2 28  ? 35.190 -48.194 -302.821 1.00 37.31  ?  536 GLY B C   1 
ATOM   1397 O O   . GLY B 2 28  ? 35.114 -48.317 -304.052 1.00 37.17  ?  536 GLY B O   1 
ATOM   1398 N N   . PRO B 2 29  ? 34.602 -47.192 -302.154 1.00 39.27  ?  537 PRO B N   1 
ATOM   1399 C CA  . PRO B 2 29  ? 33.815 -46.139 -302.805 1.00 37.37  ?  537 PRO B CA  1 
ATOM   1400 C C   . PRO B 2 29  ? 34.684 -45.259 -303.691 1.00 37.94  ?  537 PRO B C   1 
ATOM   1401 O O   . PRO B 2 29  ? 35.887 -45.171 -303.460 1.00 36.71  ?  537 PRO B O   1 
ATOM   1402 C CB  . PRO B 2 29  ? 33.254 -45.321 -301.631 1.00 38.80  ?  537 PRO B CB  1 
ATOM   1403 C CG  . PRO B 2 29  ? 33.565 -46.101 -300.395 1.00 46.42  ?  537 PRO B CG  1 
ATOM   1404 C CD  . PRO B 2 29  ? 34.750 -46.959 -300.709 1.00 40.28  ?  537 PRO B CD  1 
ATOM   1405 N N   . ALA B 2 30  ? 34.075 -44.629 -304.691 1.00 39.25  ?  538 ALA B N   1 
ATOM   1406 C CA  . ALA B 2 30  ? 34.744 -43.625 -305.504 1.00 39.32  ?  538 ALA B CA  1 
ATOM   1407 C C   . ALA B 2 30  ? 34.860 -42.340 -304.708 1.00 41.99  ?  538 ALA B C   1 
ATOM   1408 O O   . ALA B 2 30  ? 34.286 -42.237 -303.624 1.00 39.50  ?  538 ALA B O   1 
ATOM   1409 C CB  . ALA B 2 30  ? 33.981 -43.380 -306.800 1.00 33.39  ?  538 ALA B CB  1 
ATOM   1410 N N   . ALA B 2 31  ? 35.583 -41.363 -305.257 1.00 41.11  ?  539 ALA B N   1 
ATOM   1411 C CA  . ALA B 2 31  ? 35.752 -40.047 -304.628 1.00 43.28  ?  539 ALA B CA  1 
ATOM   1412 C C   . ALA B 2 31  ? 34.428 -39.400 -304.205 1.00 39.21  ?  539 ALA B C   1 
ATOM   1413 O O   . ALA B 2 31  ? 34.368 -38.735 -303.176 1.00 37.75  ?  539 ALA B O   1 
ATOM   1414 C CB  . ALA B 2 31  ? 36.497 -39.111 -305.566 1.00 39.73  ?  539 ALA B CB  1 
ATOM   1415 N N   . GLU B 2 32  ? 33.379 -39.601 -304.996 1.00 45.95  ?  540 GLU B N   1 
ATOM   1416 C CA  . GLU B 2 32  ? 32.070 -39.017 -304.702 1.00 53.94  ?  540 GLU B CA  1 
ATOM   1417 C C   . GLU B 2 32  ? 31.328 -39.740 -303.576 1.00 53.96  ?  540 GLU B C   1 
ATOM   1418 O O   . GLU B 2 32  ? 30.329 -39.234 -303.073 1.00 55.69  ?  540 GLU B O   1 
ATOM   1419 C CB  . GLU B 2 32  ? 31.179 -39.021 -305.944 1.00 45.63  ?  540 GLU B CB  1 
ATOM   1420 C CG  . GLU B 2 32  ? 31.875 -38.659 -307.242 1.00 60.33  ?  540 GLU B CG  1 
ATOM   1421 C CD  . GLU B 2 32  ? 32.557 -39.859 -307.874 1.00 65.10  ?  540 GLU B CD  1 
ATOM   1422 O OE1 . GLU B 2 32  ? 32.037 -40.386 -308.885 1.00 71.74  ?  540 GLU B OE1 1 
ATOM   1423 O OE2 . GLU B 2 32  ? 33.611 -40.279 -307.347 1.00 62.17  -1 540 GLU B OE2 1 
ATOM   1424 N N   . GLY B 2 33  ? 31.809 -40.921 -303.192 1.00 39.85  ?  541 GLY B N   1 
ATOM   1425 C CA  . GLY B 2 33  ? 31.053 -41.778 -302.300 1.00 37.45  ?  541 GLY B CA  1 
ATOM   1426 C C   . GLY B 2 33  ? 31.664 -42.013 -300.934 1.00 40.76  ?  541 GLY B C   1 
ATOM   1427 O O   . GLY B 2 33  ? 31.303 -42.977 -300.267 1.00 40.42  ?  541 GLY B O   1 
ATOM   1428 N N   . ILE B 2 34  ? 32.579 -41.141 -300.515 1.00 38.22  ?  542 ILE B N   1 
ATOM   1429 C CA  . ILE B 2 34  ? 33.271 -41.299 -299.234 1.00 36.32  ?  542 ILE B CA  1 
ATOM   1430 C C   . ILE B 2 34  ? 32.672 -40.377 -298.186 1.00 37.67  ?  542 ILE B C   1 
ATOM   1431 O O   . ILE B 2 34  ? 33.189 -40.258 -297.080 1.00 40.81  ?  542 ILE B O   1 
ATOM   1432 C CB  . ILE B 2 34  ? 34.786 -40.979 -299.348 1.00 36.17  ?  542 ILE B CB  1 
ATOM   1433 C CG1 . ILE B 2 34  ? 34.982 -39.515 -299.762 1.00 38.73  ?  542 ILE B CG1 1 
ATOM   1434 C CG2 . ILE B 2 34  ? 35.471 -41.883 -300.360 1.00 34.75  ?  542 ILE B CG2 1 
ATOM   1435 C CD1 . ILE B 2 34  ? 36.449 -39.087 -299.861 1.00 45.35  ?  542 ILE B CD1 1 
ATOM   1436 N N   . TYR B 2 35  ? 31.596 -39.693 -298.545 1.00 38.22  ?  543 TYR B N   1 
ATOM   1437 C CA  . TYR B 2 35  ? 31.034 -38.688 -297.652 1.00 42.94  ?  543 TYR B CA  1 
ATOM   1438 C C   . TYR B 2 35  ? 29.839 -39.209 -296.869 1.00 46.11  ?  543 TYR B C   1 
ATOM   1439 O O   . TYR B 2 35  ? 29.052 -40.017 -297.369 1.00 41.24  ?  543 TYR B O   1 
ATOM   1440 C CB  . TYR B 2 35  ? 30.611 -37.440 -298.435 1.00 40.16  ?  543 TYR B CB  1 
ATOM   1441 C CG  . TYR B 2 35  ? 31.717 -36.838 -299.269 1.00 40.04  ?  543 TYR B CG  1 
ATOM   1442 C CD1 . TYR B 2 35  ? 31.798 -37.098 -300.630 1.00 39.31  ?  543 TYR B CD1 1 
ATOM   1443 C CD2 . TYR B 2 35  ? 32.688 -36.021 -298.697 1.00 45.11  ?  543 TYR B CD2 1 
ATOM   1444 C CE1 . TYR B 2 35  ? 32.805 -36.557 -301.406 1.00 38.81  ?  543 TYR B CE1 1 
ATOM   1445 C CE2 . TYR B 2 35  ? 33.705 -35.463 -299.480 1.00 42.85  ?  543 TYR B CE2 1 
ATOM   1446 C CZ  . TYR B 2 35  ? 33.748 -35.743 -300.830 1.00 36.14  ?  543 TYR B CZ  1 
ATOM   1447 O OH  . TYR B 2 35  ? 34.739 -35.223 -301.622 1.00 39.30  ?  543 TYR B OH  1 
ATOM   1448 N N   . THR B 2 36  ? 29.703 -38.730 -295.640 1.00 46.13  ?  544 THR B N   1 
ATOM   1449 C CA  . THR B 2 36  ? 28.455 -38.904 -294.915 1.00 50.83  ?  544 THR B CA  1 
ATOM   1450 C C   . THR B 2 36  ? 27.763 -37.554 -294.724 1.00 49.75  ?  544 THR B C   1 
ATOM   1451 O O   . THR B 2 36  ? 28.409 -36.506 -294.643 1.00 46.53  ?  544 THR B O   1 
ATOM   1452 C CB  . THR B 2 36  ? 28.665 -39.581 -293.548 1.00 50.98  ?  544 THR B CB  1 
ATOM   1453 O OG1 . THR B 2 36  ? 27.410 -39.638 -292.863 1.00 62.14  ?  544 THR B OG1 1 
ATOM   1454 C CG2 . THR B 2 36  ? 29.662 -38.810 -292.705 1.00 49.49  ?  544 THR B CG2 1 
ATOM   1455 N N   . GLU B 2 37  ? 26.439 -37.592 -294.663 1.00 56.55  ?  545 GLU B N   1 
ATOM   1456 C CA  . GLU B 2 37  ? 25.641 -36.378 -294.608 1.00 58.50  ?  545 GLU B CA  1 
ATOM   1457 C C   . GLU B 2 37  ? 24.782 -36.324 -293.353 1.00 65.29  ?  545 GLU B C   1 
ATOM   1458 O O   . GLU B 2 37  ? 24.478 -37.350 -292.745 1.00 64.71  ?  545 GLU B O   1 
ATOM   1459 C CB  . GLU B 2 37  ? 24.763 -36.271 -295.858 1.00 53.82  ?  545 GLU B CB  1 
ATOM   1460 C CG  . GLU B 2 37  ? 25.571 -36.146 -297.156 1.00 60.07  ?  545 GLU B CG  1 
ATOM   1461 C CD  . GLU B 2 37  ? 24.693 -36.108 -298.397 1.00 60.12  ?  545 GLU B CD  1 
ATOM   1462 O OE1 . GLU B 2 37  ? 23.585 -35.523 -298.334 1.00 60.59  ?  545 GLU B OE1 1 
ATOM   1463 O OE2 . GLU B 2 37  ? 25.109 -36.673 -299.430 1.00 55.37  -1 545 GLU B OE2 1 
ATOM   1464 N N   . GLY B 2 38  ? 24.396 -35.115 -292.968 1.00 58.41  ?  546 GLY B N   1 
ATOM   1465 C CA  . GLY B 2 38  ? 23.548 -34.923 -291.810 1.00 59.28  ?  546 GLY B CA  1 
ATOM   1466 C C   . GLY B 2 38  ? 22.941 -33.537 -291.778 1.00 58.50  ?  546 GLY B C   1 
ATOM   1467 O O   . GLY B 2 38  ? 23.414 -32.619 -292.456 1.00 53.81  ?  546 GLY B O   1 
ATOM   1468 N N   . LEU B 2 39  ? 21.887 -33.385 -290.981 1.00 57.59  ?  547 LEU B N   1 
ATOM   1469 C CA  . LEU B 2 39  ? 21.214 -32.101 -290.845 1.00 53.17  ?  547 LEU B CA  1 
ATOM   1470 C C   . LEU B 2 39  ? 21.213 -31.614 -289.392 1.00 54.47  ?  547 LEU B C   1 
ATOM   1471 O O   . LEU B 2 39  ? 20.558 -32.199 -288.531 1.00 59.01  ?  547 LEU B O   1 
ATOM   1472 C CB  . LEU B 2 39  ? 19.786 -32.201 -291.388 1.00 56.68  ?  547 LEU B CB  1 
ATOM   1473 C CG  . LEU B 2 39  ? 18.944 -30.929 -291.331 1.00 59.10  ?  547 LEU B CG  1 
ATOM   1474 C CD1 . LEU B 2 39  ? 19.629 -29.805 -292.116 1.00 51.10  ?  547 LEU B CD1 1 
ATOM   1475 C CD2 . LEU B 2 39  ? 17.538 -31.203 -291.856 1.00 56.94  ?  547 LEU B CD2 1 
ATOM   1476 N N   . MET B 2 40  ? 21.980 -30.556 -289.144 1.00 60.31  ?  548 MET B N   1 
ATOM   1477 C CA  . MET B 2 40  ? 22.045 -29.841 -287.870 1.00 65.89  ?  548 MET B CA  1 
ATOM   1478 C C   . MET B 2 40  ? 20.868 -28.890 -287.765 1.00 72.56  ?  548 MET B C   1 
ATOM   1479 O O   . MET B 2 40  ? 20.588 -28.206 -288.756 1.00 74.08  ?  548 MET B O   1 
ATOM   1480 C CB  . MET B 2 40  ? 23.353 -29.038 -287.794 1.00 70.88  ?  548 MET B CB  1 
ATOM   1481 C CG  . MET B 2 40  ? 24.632 -29.820 -287.922 1.00 72.50  ?  548 MET B CG  1 
ATOM   1482 S SD  . MET B 2 40  ? 25.514 -29.720 -286.370 1.00 83.00  ?  548 MET B SD  1 
ATOM   1483 C CE  . MET B 2 40  ? 25.502 -27.940 -286.160 1.00 72.54  ?  548 MET B CE  1 
ATOM   1484 N N   . HIS B 2 41  ? 20.206 -28.765 -286.612 1.00 93.61  ?  549 HIS B N   1 
ATOM   1485 C CA  . HIS B 2 41  ? 18.935 -28.057 -286.693 1.00 93.77  ?  549 HIS B CA  1 
ATOM   1486 C C   . HIS B 2 41  ? 18.405 -27.673 -285.295 1.00 96.13  ?  549 HIS B C   1 
ATOM   1487 O O   . HIS B 2 41  ? 18.782 -28.287 -284.293 1.00 93.73  ?  549 HIS B O   1 
ATOM   1488 C CB  . HIS B 2 41  ? 18.022 -28.953 -287.549 1.00 96.89  ?  549 HIS B CB  1 
ATOM   1489 C CG  . HIS B 2 41  ? 17.268 -30.015 -286.801 1.00 98.74  ?  549 HIS B CG  1 
ATOM   1490 N ND1 . HIS B 2 41  ? 17.872 -31.001 -286.081 1.00 101.27 ?  549 HIS B ND1 1 
ATOM   1491 C CD2 . HIS B 2 41  ? 15.983 -30.432 -287.010 1.00 93.39  ?  549 HIS B CD2 1 
ATOM   1492 C CE1 . HIS B 2 41  ? 16.960 -31.846 -285.640 1.00 109.02 ?  549 HIS B CE1 1 
ATOM   1493 N NE2 . HIS B 2 41  ? 15.799 -31.539 -286.217 1.00 106.52 ?  549 HIS B NE2 1 
ATOM   1494 N N   . ASN B 2 42  ? 17.564 -26.635 -285.250 1.00 90.88  ?  550 ASN B N   1 
ATOM   1495 C CA  . ASN B 2 42  ? 17.339 -25.742 -284.085 1.00 94.14  ?  550 ASN B CA  1 
ATOM   1496 C C   . ASN B 2 42  ? 18.525 -25.563 -283.124 1.00 93.30  ?  550 ASN B C   1 
ATOM   1497 O O   . ASN B 2 42  ? 18.391 -25.663 -281.894 1.00 94.29  ?  550 ASN B O   1 
ATOM   1498 C CB  . ASN B 2 42  ? 16.100 -26.166 -283.298 1.00 94.17  ?  550 ASN B CB  1 
ATOM   1499 C CG  . ASN B 2 42  ? 14.989 -25.130 -283.401 1.00 92.51  ?  550 ASN B CG  1 
ATOM   1500 O OD1 . ASN B 2 42  ? 15.140 -24.120 -284.102 1.00 93.28  ?  550 ASN B OD1 1 
ATOM   1501 N ND2 . ASN B 2 42  ? 13.857 -25.387 -282.745 1.00 91.87  ?  550 ASN B ND2 1 
ATOM   1502 N N   . GLN B 2 43  ? 19.681 -25.267 -283.713 1.00 70.35  ?  551 GLN B N   1 
ATOM   1503 C CA  . GLN B 2 43  ? 20.814 -24.723 -282.980 1.00 65.69  ?  551 GLN B CA  1 
ATOM   1504 C C   . GLN B 2 43  ? 21.238 -23.438 -283.667 1.00 57.51  ?  551 GLN B C   1 
ATOM   1505 O O   . GLN B 2 43  ? 22.361 -23.329 -284.152 1.00 50.65  ?  551 GLN B O   1 
ATOM   1506 C CB  . GLN B 2 43  ? 21.963 -25.716 -282.935 1.00 65.11  ?  551 GLN B CB  1 
ATOM   1507 C CG  . GLN B 2 43  ? 21.744 -26.886 -281.999 1.00 70.77  ?  551 GLN B CG  1 
ATOM   1508 C CD  . GLN B 2 43  ? 22.800 -27.953 -282.175 1.00 68.60  ?  551 GLN B CD  1 
ATOM   1509 O OE1 . GLN B 2 43  ? 23.776 -28.011 -281.425 1.00 70.89  ?  551 GLN B OE1 1 
ATOM   1510 N NE2 . GLN B 2 43  ? 22.614 -28.801 -283.178 1.00 60.94  ?  551 GLN B NE2 1 
ATOM   1511 N N   . ASP B 2 44  ? 20.324 -22.472 -283.708 1.00 70.98  ?  552 ASP B N   1 
ATOM   1512 C CA  . ASP B 2 44  ? 20.541 -21.233 -284.443 1.00 75.15  ?  552 ASP B CA  1 
ATOM   1513 C C   . ASP B 2 44  ? 21.757 -20.482 -283.930 1.00 75.25  ?  552 ASP B C   1 
ATOM   1514 O O   . ASP B 2 44  ? 22.600 -20.057 -284.719 1.00 73.67  ?  552 ASP B O   1 
ATOM   1515 C CB  . ASP B 2 44  ? 19.306 -20.334 -284.368 1.00 76.52  ?  552 ASP B CB  1 
ATOM   1516 C CG  . ASP B 2 44  ? 18.179 -20.813 -285.258 1.00 79.51  ?  552 ASP B CG  1 
ATOM   1517 O OD1 . ASP B 2 44  ? 18.202 -21.993 -285.674 1.00 80.21  ?  552 ASP B OD1 1 
ATOM   1518 O OD2 . ASP B 2 44  ? 17.265 -20.007 -285.539 1.00 79.15  -1 552 ASP B OD2 1 
ATOM   1519 N N   . GLY B 2 45  ? 21.844 -20.331 -282.609 1.00 66.49  ?  553 GLY B N   1 
ATOM   1520 C CA  . GLY B 2 45  ? 22.925 -19.587 -281.988 1.00 63.66  ?  553 GLY B CA  1 
ATOM   1521 C C   . GLY B 2 45  ? 24.299 -20.166 -282.269 1.00 65.61  ?  553 GLY B C   1 
ATOM   1522 O O   . GLY B 2 45  ? 25.278 -19.433 -282.405 1.00 65.71  ?  553 GLY B O   1 
ATOM   1523 N N   . LEU B 2 46  ? 24.373 -21.490 -282.344 1.00 59.58  ?  554 LEU B N   1 
ATOM   1524 C CA  . LEU B 2 46  ? 25.612 -22.170 -282.682 1.00 59.68  ?  554 LEU B CA  1 
ATOM   1525 C C   . LEU B 2 46  ? 25.931 -21.987 -284.169 1.00 60.61  ?  554 LEU B C   1 
ATOM   1526 O O   . LEU B 2 46  ? 26.953 -21.394 -284.529 1.00 55.90  ?  554 LEU B O   1 
ATOM   1527 C CB  . LEU B 2 46  ? 25.516 -23.656 -282.336 1.00 60.66  ?  554 LEU B CB  1 
ATOM   1528 C CG  . LEU B 2 46  ? 26.634 -24.553 -282.868 1.00 64.26  ?  554 LEU B CG  1 
ATOM   1529 C CD1 . LEU B 2 46  ? 27.981 -24.105 -282.304 1.00 71.14  ?  554 LEU B CD1 1 
ATOM   1530 C CD2 . LEU B 2 46  ? 26.368 -26.023 -282.563 1.00 66.77  ?  554 LEU B CD2 1 
ATOM   1531 N N   . ILE B 2 47  ? 25.037 -22.487 -285.018 1.00 62.93  ?  555 ILE B N   1 
ATOM   1532 C CA  . ILE B 2 47  ? 25.217 -22.451 -286.468 1.00 59.86  ?  555 ILE B CA  1 
ATOM   1533 C C   . ILE B 2 47  ? 25.479 -21.050 -287.006 1.00 58.31  ?  555 ILE B C   1 
ATOM   1534 O O   . ILE B 2 47  ? 26.441 -20.851 -287.744 1.00 56.76  ?  555 ILE B O   1 
ATOM   1535 C CB  . ILE B 2 47  ? 24.001 -23.057 -287.181 1.00 56.53  ?  555 ILE B CB  1 
ATOM   1536 C CG1 . ILE B 2 47  ? 24.124 -24.579 -287.162 1.00 57.56  ?  555 ILE B CG1 1 
ATOM   1537 C CG2 . ILE B 2 47  ? 23.917 -22.563 -288.614 1.00 58.68  ?  555 ILE B CG2 1 
ATOM   1538 C CD1 . ILE B 2 47  ? 22.817 -25.310 -287.137 1.00 64.87  ?  555 ILE B CD1 1 
ATOM   1539 N N   . CYS B 2 48  ? 24.653 -20.078 -286.626 1.00 56.70  ?  556 CYS B N   1 
ATOM   1540 C CA  . CYS B 2 48  ? 24.887 -18.698 -287.043 1.00 59.64  ?  556 CYS B CA  1 
ATOM   1541 C C   . CYS B 2 48  ? 26.172 -18.143 -286.436 1.00 58.66  ?  556 CYS B C   1 
ATOM   1542 O O   . CYS B 2 48  ? 26.775 -17.212 -286.975 1.00 57.60  ?  556 CYS B O   1 
ATOM   1543 C CB  . CYS B 2 48  ? 23.710 -17.795 -286.663 1.00 61.55  ?  556 CYS B CB  1 
ATOM   1544 S SG  . CYS B 2 48  ? 22.214 -18.073 -287.646 1.00 78.15  ?  556 CYS B SG  1 
ATOM   1545 N N   . GLY B 2 49  ? 26.581 -18.701 -285.302 1.00 51.92  ?  557 GLY B N   1 
ATOM   1546 C CA  . GLY B 2 49  ? 27.823 -18.283 -284.680 1.00 52.13  ?  557 GLY B CA  1 
ATOM   1547 C C   . GLY B 2 49  ? 29.003 -18.817 -285.474 1.00 52.46  ?  557 GLY B C   1 
ATOM   1548 O O   . GLY B 2 49  ? 30.044 -18.161 -285.576 1.00 46.10  ?  557 GLY B O   1 
ATOM   1549 N N   . LEU B 2 50  ? 28.828 -20.019 -286.027 1.00 54.56  ?  558 LEU B N   1 
ATOM   1550 C CA  . LEU B 2 50  ? 29.815 -20.640 -286.901 1.00 53.90  ?  558 LEU B CA  1 
ATOM   1551 C C   . LEU B 2 50  ? 30.039 -19.812 -288.161 1.00 51.34  ?  558 LEU B C   1 
ATOM   1552 O O   . LEU B 2 50  ? 31.177 -19.539 -288.528 1.00 49.01  ?  558 LEU B O   1 
ATOM   1553 C CB  . LEU B 2 50  ? 29.381 -22.051 -287.293 1.00 54.51  ?  558 LEU B CB  1 
ATOM   1554 C CG  . LEU B 2 50  ? 29.658 -23.181 -286.307 1.00 64.43  ?  558 LEU B CG  1 
ATOM   1555 C CD1 . LEU B 2 50  ? 29.168 -24.509 -286.882 1.00 63.22  ?  558 LEU B CD1 1 
ATOM   1556 C CD2 . LEU B 2 50  ? 31.147 -23.246 -285.985 1.00 67.94  ?  558 LEU B CD2 1 
ATOM   1557 N N   . ARG B 2 51  ? 28.948 -19.424 -288.815 1.00 45.47  ?  559 ARG B N   1 
ATOM   1558 C CA  . ARG B 2 51  ? 29.030 -18.594 -290.008 1.00 45.71  ?  559 ARG B CA  1 
ATOM   1559 C C   . ARG B 2 51  ? 29.785 -17.314 -289.690 1.00 47.09  ?  559 ARG B C   1 
ATOM   1560 O O   . ARG B 2 51  ? 30.621 -16.872 -290.479 1.00 47.50  ?  559 ARG B O   1 
ATOM   1561 C CB  . ARG B 2 51  ? 27.636 -18.285 -290.561 1.00 38.85  ?  559 ARG B CB  1 
ATOM   1562 C CG  . ARG B 2 51  ? 26.829 -19.538 -290.898 1.00 37.33  ?  559 ARG B CG  1 
ATOM   1563 C CD  . ARG B 2 51  ? 25.660 -19.235 -291.816 1.00 35.29  ?  559 ARG B CD  1 
ATOM   1564 N NE  . ARG B 2 51  ? 24.921 -20.449 -292.148 1.00 40.64  ?  559 ARG B NE  1 
ATOM   1565 C CZ  . ARG B 2 51  ? 25.239 -21.289 -293.130 1.00 43.61  ?  559 ARG B CZ  1 
ATOM   1566 N NH1 . ARG B 2 51  ? 24.496 -22.367 -293.337 1.00 38.05  ?  559 ARG B NH1 1 
ATOM   1567 N NH2 . ARG B 2 51  ? 26.308 -21.063 -293.899 1.00 42.23  ?  559 ARG B NH2 1 
ATOM   1568 N N   . GLN B 2 52  ? 29.520 -16.743 -288.517 1.00 48.96  ?  560 GLN B N   1 
ATOM   1569 C CA  . GLN B 2 52  ? 30.181 -15.503 -288.099 1.00 49.34  ?  560 GLN B CA  1 
ATOM   1570 C C   . GLN B 2 52  ? 31.681 -15.707 -287.870 1.00 47.35  ?  560 GLN B C   1 
ATOM   1571 O O   . GLN B 2 52  ? 32.498 -14.866 -288.262 1.00 45.92  ?  560 GLN B O   1 
ATOM   1572 C CB  . GLN B 2 52  ? 29.523 -14.944 -286.828 1.00 48.00  ?  560 GLN B CB  1 
ATOM   1573 C CG  . GLN B 2 52  ? 30.141 -13.653 -286.298 1.00 51.50  ?  560 GLN B CG  1 
ATOM   1574 C CD  . GLN B 2 52  ? 29.987 -12.471 -287.250 1.00 62.24  ?  560 GLN B CD  1 
ATOM   1575 O OE1 . GLN B 2 52  ? 29.100 -12.458 -288.106 1.00 73.25  ?  560 GLN B OE1 1 
ATOM   1576 N NE2 . GLN B 2 52  ? 30.846 -11.467 -287.094 1.00 60.00  ?  560 GLN B NE2 1 
ATOM   1577 N N   . LEU B 2 53  ? 32.033 -16.825 -287.239 1.00 42.01  ?  561 LEU B N   1 
ATOM   1578 C CA  . LEU B 2 53  ? 33.432 -17.164 -286.977 1.00 44.94  ?  561 LEU B CA  1 
ATOM   1579 C C   . LEU B 2 53  ? 34.248 -17.338 -288.267 1.00 42.87  ?  561 LEU B C   1 
ATOM   1580 O O   . LEU B 2 53  ? 35.320 -16.751 -288.404 1.00 39.82  ?  561 LEU B O   1 
ATOM   1581 C CB  . LEU B 2 53  ? 33.523 -18.440 -286.147 1.00 40.96  ?  561 LEU B CB  1 
ATOM   1582 C CG  . LEU B 2 53  ? 34.944 -18.977 -285.952 1.00 37.26  ?  561 LEU B CG  1 
ATOM   1583 C CD1 . LEU B 2 53  ? 35.769 -18.016 -285.122 1.00 46.28  ?  561 LEU B CD1 1 
ATOM   1584 C CD2 . LEU B 2 53  ? 34.916 -20.344 -285.307 1.00 45.47  ?  561 LEU B CD2 1 
ATOM   1585 N N   . ALA B 2 54  ? 33.740 -18.161 -289.188 1.00 38.82  ?  562 ALA B N   1 
ATOM   1586 C CA  . ALA B 2 54  ? 34.364 -18.361 -290.498 1.00 41.51  ?  562 ALA B CA  1 
ATOM   1587 C C   . ALA B 2 54  ? 34.569 -17.017 -291.183 1.00 41.38  ?  562 ALA B C   1 
ATOM   1588 O O   . ALA B 2 54  ? 35.629 -16.728 -291.728 1.00 40.34  ?  562 ALA B O   1 
ATOM   1589 C CB  . ALA B 2 54  ? 33.514 -19.280 -291.360 1.00 38.60  ?  562 ALA B CB  1 
ATOM   1590 N N   . ASN B 2 55  ? 33.565 -16.150 -291.105 1.00 45.31  ?  563 ASN B N   1 
ATOM   1591 C CA  . ASN B 2 55  ? 33.665 -14.797 -291.641 1.00 44.52  ?  563 ASN B CA  1 
ATOM   1592 C C   . ASN B 2 55  ? 34.758 -13.981 -290.997 1.00 47.12  ?  563 ASN B C   1 
ATOM   1593 O O   . ASN B 2 55  ? 35.489 -13.336 -291.667 1.00 44.98  ?  563 ASN B O   1 
ATOM   1594 C CB  . ASN B 2 55  ? 32.328 -14.040 -291.589 1.00 49.68  ?  563 ASN B CB  1 
ATOM   1595 C CG  . ASN B 2 55  ? 32.440 -12.577 -292.020 1.00 58.77  ?  563 ASN B CG  1 
ATOM   1596 O OD1 . ASN B 2 55  ? 32.945 -11.749 -291.301 1.00 62.62  ?  563 ASN B OD1 1 
ATOM   1597 N ND2 . ASN B 2 55  ? 31.941 -12.265 -293.186 1.00 68.17  ?  563 ASN B ND2 1 
ATOM   1598 N N   . GLU B 2 56  ? 34.859 -14.018 -289.688 1.00 52.86  ?  564 GLU B N   1 
ATOM   1599 C CA  . GLU B 2 56  ? 35.873 -13.232 -288.986 1.00 53.92  ?  564 GLU B CA  1 
ATOM   1600 C C   . GLU B 2 56  ? 37.274 -13.827 -289.132 1.00 53.44  ?  564 GLU B C   1 
ATOM   1601 O O   . GLU B 2 56  ? 38.272 -13.115 -288.999 1.00 54.54  ?  564 GLU B O   1 
ATOM   1602 C CB  . GLU B 2 56  ? 35.541 -13.099 -287.493 1.00 56.76  ?  564 GLU B CB  1 
ATOM   1603 C CG  . GLU B 2 56  ? 34.173 -12.515 -287.170 1.00 65.21  ?  564 GLU B CG  1 
ATOM   1604 C CD  . GLU B 2 56  ? 33.934 -12.400 -285.660 1.00 76.41  ?  564 GLU B CD  1 
ATOM   1605 O OE1 . GLU B 2 56  ? 34.901 -12.599 -284.886 1.00 76.09  ?  564 GLU B OE1 1 
ATOM   1606 O OE2 . GLU B 2 56  ? 32.787 -12.100 -285.252 1.00 72.20  -1 564 GLU B OE2 1 
ATOM   1607 N N   . THR B 2 57  ? 37.348 -15.130 -289.387 1.00 39.81  ?  565 THR B N   1 
ATOM   1608 C CA  . THR B 2 57  ? 38.635 -15.793 -289.586 1.00 41.28  ?  565 THR B CA  1 
ATOM   1609 C C   . THR B 2 57  ? 39.347 -15.347 -290.881 1.00 36.21  ?  565 THR B C   1 
ATOM   1610 O O   . THR B 2 57  ? 40.572 -15.301 -290.935 1.00 36.16  ?  565 THR B O   1 
ATOM   1611 C CB  . THR B 2 57  ? 38.457 -17.326 -289.603 1.00 42.48  ?  565 THR B CB  1 
ATOM   1612 O OG1 . THR B 2 57  ? 38.018 -17.765 -288.314 1.00 44.07  ?  565 THR B OG1 1 
ATOM   1613 C CG2 . THR B 2 57  ? 39.764 -18.040 -289.951 1.00 37.71  ?  565 THR B CG2 1 
ATOM   1614 N N   . THR B 2 58  ? 38.564 -14.986 -291.894 1.00 38.10  ?  566 THR B N   1 
ATOM   1615 C CA  . THR B 2 58  ? 39.061 -14.821 -293.250 1.00 38.48  ?  566 THR B CA  1 
ATOM   1616 C C   . THR B 2 58  ? 40.269 -13.894 -293.384 1.00 36.12  ?  566 THR B C   1 
ATOM   1617 O O   . THR B 2 58  ? 41.251 -14.260 -294.008 1.00 32.84  ?  566 THR B O   1 
ATOM   1618 C CB  . THR B 2 58  ? 37.953 -14.303 -294.189 1.00 37.86  ?  566 THR B CB  1 
ATOM   1619 O OG1 . THR B 2 58  ? 36.808 -15.161 -294.092 1.00 34.19  ?  566 THR B OG1 1 
ATOM   1620 C CG2 . THR B 2 58  ? 38.461 -14.308 -295.637 1.00 33.54  ?  566 THR B CG2 1 
ATOM   1621 N N   . GLN B 2 59  ? 40.206 -12.711 -292.789 1.00 39.38  ?  567 GLN B N   1 
ATOM   1622 C CA  . GLN B 2 59  ? 41.307 -11.766 -292.911 1.00 42.85  ?  567 GLN B CA  1 
ATOM   1623 C C   . GLN B 2 59  ? 42.626 -12.360 -292.408 1.00 43.05  ?  567 GLN B C   1 
ATOM   1624 O O   . GLN B 2 59  ? 43.642 -12.266 -293.093 1.00 43.35  ?  567 GLN B O   1 
ATOM   1625 C CB  . GLN B 2 59  ? 40.997 -10.471 -292.165 1.00 41.57  ?  567 GLN B CB  1 
ATOM   1626 C CG  . GLN B 2 59  ? 42.099 -9.442  -292.266 1.00 45.66  ?  567 GLN B CG  1 
ATOM   1627 C CD  . GLN B 2 59  ? 41.778 -8.156  -291.512 1.00 55.07  ?  567 GLN B CD  1 
ATOM   1628 O OE1 . GLN B 2 59  ? 40.757 -8.060  -290.836 1.00 57.59  ?  567 GLN B OE1 1 
ATOM   1629 N NE2 . GLN B 2 59  ? 42.656 -7.169  -291.620 1.00 59.58  ?  567 GLN B NE2 1 
ATOM   1630 N N   . ALA B 2 60  ? 42.601 -12.986 -291.231 1.00 41.23  ?  568 ALA B N   1 
ATOM   1631 C CA  . ALA B 2 60  ? 43.812 -13.551 -290.650 1.00 40.58  ?  568 ALA B CA  1 
ATOM   1632 C C   . ALA B 2 60  ? 44.338 -14.719 -291.486 1.00 40.18  ?  568 ALA B C   1 
ATOM   1633 O O   . ALA B 2 60  ? 45.548 -14.846 -291.688 1.00 39.04  ?  568 ALA B O   1 
ATOM   1634 C CB  . ALA B 2 60  ? 43.561 -13.998 -289.216 1.00 37.65  ?  568 ALA B CB  1 
ATOM   1635 N N   . LEU B 2 61  ? 43.429 -15.566 -291.967 1.00 35.80  ?  569 LEU B N   1 
ATOM   1636 C CA  . LEU B 2 61  ? 43.814 -16.730 -292.767 1.00 35.32  ?  569 LEU B CA  1 
ATOM   1637 C C   . LEU B 2 61  ? 44.444 -16.297 -294.090 1.00 34.44  ?  569 LEU B C   1 
ATOM   1638 O O   . LEU B 2 61  ? 45.470 -16.811 -294.522 1.00 35.65  ?  569 LEU B O   1 
ATOM   1639 C CB  . LEU B 2 61  ? 42.598 -17.618 -293.026 1.00 32.55  ?  569 LEU B CB  1 
ATOM   1640 C CG  . LEU B 2 61  ? 42.844 -18.854 -293.891 1.00 34.37  ?  569 LEU B CG  1 
ATOM   1641 C CD1 . LEU B 2 61  ? 43.855 -19.789 -293.221 1.00 32.90  ?  569 LEU B CD1 1 
ATOM   1642 C CD2 . LEU B 2 61  ? 41.534 -19.587 -294.195 1.00 32.32  ?  569 LEU B CD2 1 
ATOM   1643 N N   . GLN B 2 62  ? 43.800 -15.331 -294.718 1.00 34.13  ?  570 GLN B N   1 
ATOM   1644 C CA  . GLN B 2 62  ? 44.260 -14.743 -295.956 1.00 35.24  ?  570 GLN B CA  1 
ATOM   1645 C C   . GLN B 2 62  ? 45.676 -14.142 -295.787 1.00 38.77  ?  570 GLN B C   1 
ATOM   1646 O O   . GLN B 2 62  ? 46.547 -14.341 -296.630 1.00 36.46  ?  570 GLN B O   1 
ATOM   1647 C CB  . GLN B 2 62  ? 43.229 -13.702 -296.386 1.00 37.63  ?  570 GLN B CB  1 
ATOM   1648 C CG  . GLN B 2 62  ? 42.976 -13.557 -297.841 1.00 41.57  ?  570 GLN B CG  1 
ATOM   1649 C CD  . GLN B 2 62  ? 42.574 -14.828 -298.557 1.00 37.39  ?  570 GLN B CD  1 
ATOM   1650 O OE1 . GLN B 2 62  ? 43.405 -15.694 -298.790 1.00 34.52  ?  570 GLN B OE1 1 
ATOM   1651 N NE2 . GLN B 2 62  ? 41.313 -14.910 -298.982 1.00 34.02  ?  570 GLN B NE2 1 
ATOM   1652 N N   . LEU B 2 63  ? 45.917 -13.454 -294.669 1.00 36.76  ?  571 LEU B N   1 
ATOM   1653 C CA  . LEU B 2 63  ? 47.242 -12.900 -294.375 1.00 34.25  ?  571 LEU B CA  1 
ATOM   1654 C C   . LEU B 2 63  ? 48.274 -13.981 -294.052 1.00 34.47  ?  571 LEU B C   1 
ATOM   1655 O O   . LEU B 2 63  ? 49.449 -13.835 -294.383 1.00 36.96  ?  571 LEU B O   1 
ATOM   1656 C CB  . LEU B 2 63  ? 47.169 -11.909 -293.213 1.00 33.14  ?  571 LEU B CB  1 
ATOM   1657 C CG  . LEU B 2 63  ? 46.505 -10.576 -293.531 1.00 42.63  ?  571 LEU B CG  1 
ATOM   1658 C CD1 . LEU B 2 63  ? 46.367 -9.725  -292.263 1.00 36.71  ?  571 LEU B CD1 1 
ATOM   1659 C CD2 . LEU B 2 63  ? 47.297 -9.851  -294.640 1.00 36.18  ?  571 LEU B CD2 1 
ATOM   1660 N N   . PHE B 2 64  ? 47.846 -15.050 -293.387 1.00 34.37  ?  572 PHE B N   1 
ATOM   1661 C CA  . PHE B 2 64  ? 48.715 -16.205 -293.188 1.00 35.76  ?  572 PHE B CA  1 
ATOM   1662 C C   . PHE B 2 64  ? 49.149 -16.786 -294.542 1.00 38.53  ?  572 PHE B C   1 
ATOM   1663 O O   . PHE B 2 64  ? 50.341 -17.009 -294.775 1.00 33.11  ?  572 PHE B O   1 
ATOM   1664 C CB  . PHE B 2 64  ? 48.011 -17.274 -292.349 1.00 37.70  ?  572 PHE B CB  1 
ATOM   1665 C CG  . PHE B 2 64  ? 48.791 -18.551 -292.214 1.00 36.94  ?  572 PHE B CG  1 
ATOM   1666 C CD1 . PHE B 2 64  ? 49.710 -18.710 -291.190 1.00 39.91  ?  572 PHE B CD1 1 
ATOM   1667 C CD2 . PHE B 2 64  ? 48.604 -19.602 -293.111 1.00 39.20  ?  572 PHE B CD2 1 
ATOM   1668 C CE1 . PHE B 2 64  ? 50.439 -19.879 -291.063 1.00 41.26  ?  572 PHE B CE1 1 
ATOM   1669 C CE2 . PHE B 2 64  ? 49.340 -20.791 -292.990 1.00 33.25  ?  572 PHE B CE2 1 
ATOM   1670 C CZ  . PHE B 2 64  ? 50.245 -20.927 -291.968 1.00 40.89  ?  572 PHE B CZ  1 
ATOM   1671 N N   . LEU B 2 65  ? 48.175 -17.008 -295.430 1.00 38.35  ?  573 LEU B N   1 
ATOM   1672 C CA  . LEU B 2 65  ? 48.437 -17.615 -296.735 1.00 36.69  ?  573 LEU B CA  1 
ATOM   1673 C C   . LEU B 2 65  ? 49.332 -16.726 -297.610 1.00 37.78  ?  573 LEU B C   1 
ATOM   1674 O O   . LEU B 2 65  ? 50.186 -17.240 -298.338 1.00 35.99  ?  573 LEU B O   1 
ATOM   1675 C CB  . LEU B 2 65  ? 47.119 -17.940 -297.459 1.00 36.35  ?  573 LEU B CB  1 
ATOM   1676 C CG  . LEU B 2 65  ? 46.310 -19.074 -296.806 1.00 33.75  ?  573 LEU B CG  1 
ATOM   1677 C CD1 . LEU B 2 65  ? 44.940 -19.311 -297.460 1.00 31.39  ?  573 LEU B CD1 1 
ATOM   1678 C CD2 . LEU B 2 65  ? 47.126 -20.368 -296.774 1.00 33.69  ?  573 LEU B CD2 1 
ATOM   1679 N N   . ARG B 2 66  ? 49.155 -15.404 -297.529 1.00 37.25  ?  574 ARG B N   1 
ATOM   1680 C CA  . ARG B 2 66  ? 50.010 -14.482 -298.283 1.00 37.07  ?  574 ARG B CA  1 
ATOM   1681 C C   . ARG B 2 66  ? 51.480 -14.662 -297.893 1.00 37.68  ?  574 ARG B C   1 
ATOM   1682 O O   . ARG B 2 66  ? 52.369 -14.630 -298.737 1.00 39.83  ?  574 ARG B O   1 
ATOM   1683 C CB  . ARG B 2 66  ? 49.597 -13.025 -298.057 1.00 38.07  ?  574 ARG B CB  1 
ATOM   1684 C CG  . ARG B 2 66  ? 50.667 -12.021 -298.496 1.00 43.38  ?  574 ARG B CG  1 
ATOM   1685 C CD  . ARG B 2 66  ? 50.262 -10.596 -298.182 1.00 38.62  ?  574 ARG B CD  1 
ATOM   1686 N NE  . ARG B 2 66  ? 49.007 -10.275 -298.849 1.00 45.45  ?  574 ARG B NE  1 
ATOM   1687 C CZ  . ARG B 2 66  ? 48.261 -9.209  -298.578 1.00 46.22  ?  574 ARG B CZ  1 
ATOM   1688 N NH1 . ARG B 2 66  ? 48.650 -8.344  -297.649 1.00 50.12  ?  574 ARG B NH1 1 
ATOM   1689 N NH2 . ARG B 2 66  ? 47.126 -9.010  -299.243 1.00 44.96  ?  574 ARG B NH2 1 
ATOM   1690 N N   . ALA B 2 67  ? 51.718 -14.882 -296.609 1.00 31.60  ?  575 ALA B N   1 
ATOM   1691 C CA  . ALA B 2 67  ? 53.078 -14.944 -296.085 1.00 38.08  ?  575 ALA B CA  1 
ATOM   1692 C C   . ALA B 2 67  ? 53.714 -16.330 -296.181 1.00 34.96  ?  575 ALA B C   1 
ATOM   1693 O O   . ALA B 2 67  ? 54.932 -16.452 -296.081 1.00 34.29  ?  575 ALA B O   1 
ATOM   1694 C CB  . ALA B 2 67  ? 53.102 -14.467 -294.640 1.00 33.88  ?  575 ALA B CB  1 
ATOM   1695 N N   . THR B 2 68  ? 52.915 -17.377 -296.353 1.00 35.24  ?  576 THR B N   1 
ATOM   1696 C CA  . THR B 2 68  ? 53.510 -18.700 -296.461 1.00 32.74  ?  576 THR B CA  1 
ATOM   1697 C C   . THR B 2 68  ? 53.941 -18.937 -297.883 1.00 34.08  ?  576 THR B C   1 
ATOM   1698 O O   . THR B 2 68  ? 53.393 -18.362 -298.821 1.00 38.13  ?  576 THR B O   1 
ATOM   1699 C CB  . THR B 2 68  ? 52.569 -19.858 -296.043 1.00 34.56  ?  576 THR B CB  1 
ATOM   1700 O OG1 . THR B 2 68  ? 53.347 -21.053 -295.919 1.00 28.87  ?  576 THR B OG1 1 
ATOM   1701 C CG2 . THR B 2 68  ? 51.462 -20.106 -297.101 1.00 34.12  ?  576 THR B CG2 1 
ATOM   1702 N N   . THR B 2 69  ? 54.921 -19.810 -298.038 1.00 36.96  ?  577 THR B N   1 
ATOM   1703 C CA  . THR B 2 69  ? 55.439 -20.099 -299.350 1.00 38.10  ?  577 THR B CA  1 
ATOM   1704 C C   . THR B 2 69  ? 55.055 -21.508 -299.802 1.00 39.79  ?  577 THR B C   1 
ATOM   1705 O O   . THR B 2 69  ? 55.319 -21.891 -300.952 1.00 37.22  ?  577 THR B O   1 
ATOM   1706 C CB  . THR B 2 69  ? 56.958 -19.928 -299.373 1.00 38.51  ?  577 THR B CB  1 
ATOM   1707 O OG1 . THR B 2 69  ? 57.428 -20.059 -300.714 1.00 52.23  ?  577 THR B OG1 1 
ATOM   1708 C CG2 . THR B 2 69  ? 57.609 -20.968 -298.513 1.00 33.98  ?  577 THR B CG2 1 
ATOM   1709 N N   . GLU B 2 70  ? 54.418 -22.290 -298.933 1.00 35.56  ?  578 GLU B N   1 
ATOM   1710 C CA  . GLU B 2 70  ? 53.969 -23.582 -299.436 1.00 37.82  ?  578 GLU B CA  1 
ATOM   1711 C C   . GLU B 2 70  ? 52.611 -23.444 -300.136 1.00 33.65  ?  578 GLU B C   1 
ATOM   1712 O O   . GLU B 2 70  ? 51.801 -22.560 -299.835 1.00 33.73  ?  578 GLU B O   1 
ATOM   1713 C CB  . GLU B 2 70  ? 53.959 -24.659 -298.337 1.00 37.89  ?  578 GLU B CB  1 
ATOM   1714 C CG  . GLU B 2 70  ? 52.879 -24.667 -297.333 1.00 39.47  ?  578 GLU B CG  1 
ATOM   1715 C CD  . GLU B 2 70  ? 53.140 -25.740 -296.262 1.00 44.23  ?  578 GLU B CD  1 
ATOM   1716 O OE1 . GLU B 2 70  ? 53.564 -26.867 -296.626 1.00 37.08  ?  578 GLU B OE1 1 
ATOM   1717 O OE2 . GLU B 2 70  ? 52.954 -25.442 -295.058 1.00 39.61  -1 578 GLU B OE2 1 
ATOM   1718 N N   . LEU B 2 71  ? 52.413 -24.307 -301.122 1.00 28.87  ?  579 LEU B N   1 
ATOM   1719 C CA  . LEU B 2 71  ? 51.333 -24.178 -302.089 1.00 30.10  ?  579 LEU B CA  1 
ATOM   1720 C C   . LEU B 2 71  ? 50.011 -24.565 -301.461 1.00 31.83  ?  579 LEU B C   1 
ATOM   1721 O O   . LEU B 2 71  ? 48.981 -23.950 -301.715 1.00 32.38  ?  579 LEU B O   1 
ATOM   1722 C CB  . LEU B 2 71  ? 51.620 -25.057 -303.318 1.00 29.39  ?  579 LEU B CB  1 
ATOM   1723 C CG  . LEU B 2 71  ? 52.999 -24.803 -303.946 1.00 35.67  ?  579 LEU B CG  1 
ATOM   1724 C CD1 . LEU B 2 71  ? 53.308 -25.744 -305.111 1.00 29.33  ?  579 LEU B CD1 1 
ATOM   1725 C CD2 . LEU B 2 71  ? 53.083 -23.359 -304.400 1.00 32.29  ?  579 LEU B CD2 1 
ATOM   1726 N N   . ARG B 2 72  ? 50.057 -25.609 -300.646 1.00 26.41  ?  580 ARG B N   1 
ATOM   1727 C CA  . ARG B 2 72  ? 48.875 -26.130 -299.993 1.00 31.83  ?  580 ARG B CA  1 
ATOM   1728 C C   . ARG B 2 72  ? 49.172 -26.228 -298.506 1.00 34.42  ?  580 ARG B C   1 
ATOM   1729 O O   . ARG B 2 72  ? 50.098 -26.933 -298.100 1.00 36.43  ?  580 ARG B O   1 
ATOM   1730 C CB  . ARG B 2 72  ? 48.488 -27.493 -300.566 1.00 31.88  ?  580 ARG B CB  1 
ATOM   1731 C CG  . ARG B 2 72  ? 48.422 -27.532 -302.088 1.00 31.60  ?  580 ARG B CG  1 
ATOM   1732 C CD  . ARG B 2 72  ? 47.963 -28.905 -302.606 1.00 32.62  ?  580 ARG B CD  1 
ATOM   1733 N NE  . ARG B 2 72  ? 48.172 -29.033 -304.046 1.00 33.01  ?  580 ARG B NE  1 
ATOM   1734 C CZ  . ARG B 2 72  ? 47.551 -29.911 -304.828 1.00 35.10  ?  580 ARG B CZ  1 
ATOM   1735 N NH1 . ARG B 2 72  ? 46.683 -30.773 -304.313 1.00 30.71  ?  580 ARG B NH1 1 
ATOM   1736 N NH2 . ARG B 2 72  ? 47.812 -29.940 -306.131 1.00 35.64  ?  580 ARG B NH2 1 
ATOM   1737 N N   . THR B 2 73  ? 48.420 -25.490 -297.699 1.00 29.60  ?  581 THR B N   1 
ATOM   1738 C CA  . THR B 2 73  ? 48.645 -25.503 -296.254 1.00 35.04  ?  581 THR B CA  1 
ATOM   1739 C C   . THR B 2 73  ? 47.756 -26.541 -295.565 1.00 34.35  ?  581 THR B C   1 
ATOM   1740 O O   . THR B 2 73  ? 46.526 -26.437 -295.608 1.00 32.07  ?  581 THR B O   1 
ATOM   1741 C CB  . THR B 2 73  ? 48.393 -24.113 -295.634 1.00 35.37  ?  581 THR B CB  1 
ATOM   1742 O OG1 . THR B 2 73  ? 49.360 -23.176 -296.136 1.00 33.93  ?  581 THR B OG1 1 
ATOM   1743 C CG2 . THR B 2 73  ? 48.510 -24.181 -294.126 1.00 37.61  ?  581 THR B CG2 1 
ATOM   1744 N N   . PHE B 2 74  ? 48.392 -27.535 -294.940 1.00 37.39  ?  582 PHE B N   1 
ATOM   1745 C CA  . PHE B 2 74  ? 47.703 -28.617 -294.211 1.00 36.12  ?  582 PHE B CA  1 
ATOM   1746 C C   . PHE B 2 74  ? 47.956 -28.601 -292.700 1.00 39.71  ?  582 PHE B C   1 
ATOM   1747 O O   . PHE B 2 74  ? 47.342 -29.368 -291.953 1.00 39.65  ?  582 PHE B O   1 
ATOM   1748 C CB  . PHE B 2 74  ? 48.140 -29.988 -294.747 1.00 33.96  ?  582 PHE B CB  1 
ATOM   1749 C CG  . PHE B 2 74  ? 47.575 -30.316 -296.095 1.00 34.83  ?  582 PHE B CG  1 
ATOM   1750 C CD1 . PHE B 2 74  ? 48.251 -29.962 -297.255 1.00 30.98  ?  582 PHE B CD1 1 
ATOM   1751 C CD2 . PHE B 2 74  ? 46.357 -30.973 -296.202 1.00 34.66  ?  582 PHE B CD2 1 
ATOM   1752 C CE1 . PHE B 2 74  ? 47.716 -30.260 -298.508 1.00 31.79  ?  582 PHE B CE1 1 
ATOM   1753 C CE2 . PHE B 2 74  ? 45.823 -31.275 -297.447 1.00 34.60  ?  582 PHE B CE2 1 
ATOM   1754 C CZ  . PHE B 2 74  ? 46.498 -30.912 -298.601 1.00 32.54  ?  582 PHE B CZ  1 
ATOM   1755 N N   . SER B 2 75  ? 48.861 -27.737 -292.256 1.00 38.90  ?  583 SER B N   1 
ATOM   1756 C CA  . SER B 2 75  ? 49.452 -27.870 -290.932 1.00 38.46  ?  583 SER B CA  1 
ATOM   1757 C C   . SER B 2 75  ? 48.958 -26.862 -289.893 1.00 39.50  ?  583 SER B C   1 
ATOM   1758 O O   . SER B 2 75  ? 49.554 -26.749 -288.824 1.00 40.99  ?  583 SER B O   1 
ATOM   1759 C CB  . SER B 2 75  ? 50.973 -27.747 -291.046 1.00 37.99  ?  583 SER B CB  1 
ATOM   1760 O OG  . SER B 2 75  ? 51.325 -26.450 -291.494 1.00 39.87  ?  583 SER B OG  1 
ATOM   1761 N N   . ILE B 2 76  ? 47.892 -26.128 -290.203 1.00 36.53  ?  584 ILE B N   1 
ATOM   1762 C CA  . ILE B 2 76  ? 47.419 -25.067 -289.312 1.00 40.28  ?  584 ILE B CA  1 
ATOM   1763 C C   . ILE B 2 76  ? 46.893 -25.626 -287.974 1.00 44.25  ?  584 ILE B C   1 
ATOM   1764 O O   . ILE B 2 76  ? 47.197 -25.094 -286.896 1.00 41.14  ?  584 ILE B O   1 
ATOM   1765 C CB  . ILE B 2 76  ? 46.316 -24.218 -289.991 1.00 36.19  ?  584 ILE B CB  1 
ATOM   1766 C CG1 . ILE B 2 76  ? 46.928 -23.285 -291.038 1.00 39.39  ?  584 ILE B CG1 1 
ATOM   1767 C CG2 . ILE B 2 76  ? 45.577 -23.375 -288.975 1.00 38.16  ?  584 ILE B CG2 1 
ATOM   1768 C CD1 . ILE B 2 76  ? 45.890 -22.536 -291.884 1.00 35.18  ?  584 ILE B CD1 1 
ATOM   1769 N N   . LEU B 2 77  ? 46.119 -26.704 -288.051 1.00 39.41  ?  585 LEU B N   1 
ATOM   1770 C CA  . LEU B 2 77  ? 45.545 -27.320 -286.861 1.00 42.82  ?  585 LEU B CA  1 
ATOM   1771 C C   . LEU B 2 77  ? 46.618 -27.992 -285.999 1.00 45.64  ?  585 LEU B C   1 
ATOM   1772 O O   . LEU B 2 77  ? 46.566 -27.893 -284.776 1.00 44.91  ?  585 LEU B O   1 
ATOM   1773 C CB  . LEU B 2 77  ? 44.462 -28.330 -287.246 1.00 45.46  ?  585 LEU B CB  1 
ATOM   1774 C CG  . LEU B 2 77  ? 43.151 -27.741 -287.775 1.00 44.12  ?  585 LEU B CG  1 
ATOM   1775 C CD1 . LEU B 2 77  ? 42.201 -28.846 -288.205 1.00 42.15  ?  585 LEU B CD1 1 
ATOM   1776 C CD2 . LEU B 2 77  ? 42.500 -26.843 -286.728 1.00 44.70  ?  585 LEU B CD2 1 
ATOM   1777 N N   . ASN B 2 78  ? 47.590 -28.657 -286.628 1.00 41.72  ?  586 ASN B N   1 
ATOM   1778 C CA  . ASN B 2 78  ? 48.699 -29.231 -285.877 1.00 42.07  ?  586 ASN B CA  1 
ATOM   1779 C C   . ASN B 2 78  ? 49.513 -28.141 -285.194 1.00 45.07  ?  586 ASN B C   1 
ATOM   1780 O O   . ASN B 2 78  ? 49.944 -28.301 -284.053 1.00 45.65  ?  586 ASN B O   1 
ATOM   1781 C CB  . ASN B 2 78  ? 49.605 -30.083 -286.767 1.00 38.84  ?  586 ASN B CB  1 
ATOM   1782 C CG  . ASN B 2 78  ? 49.001 -31.448 -287.087 1.00 43.75  ?  586 ASN B CG  1 
ATOM   1783 O OD1 . ASN B 2 78  ? 48.100 -31.922 -286.399 1.00 45.35  ?  586 ASN B OD1 1 
ATOM   1784 N ND2 . ASN B 2 78  ? 49.501 -32.083 -288.135 1.00 47.39  ?  586 ASN B ND2 1 
ATOM   1785 N N   . ARG B 2 79  ? 49.710 -27.027 -285.886 1.00 41.92  ?  587 ARG B N   1 
ATOM   1786 C CA  . ARG B 2 79  ? 50.424 -25.894 -285.310 1.00 43.90  ?  587 ARG B CA  1 
ATOM   1787 C C   . ARG B 2 79  ? 49.679 -25.334 -284.102 1.00 48.43  ?  587 ARG B C   1 
ATOM   1788 O O   . ARG B 2 79  ? 50.297 -24.934 -283.105 1.00 48.43  ?  587 ARG B O   1 
ATOM   1789 C CB  . ARG B 2 79  ? 50.625 -24.799 -286.360 1.00 45.95  ?  587 ARG B CB  1 
ATOM   1790 C CG  . ARG B 2 79  ? 51.605 -23.716 -285.970 1.00 49.49  ?  587 ARG B CG  1 
ATOM   1791 C CD  . ARG B 2 79  ? 52.381 -23.211 -287.188 1.00 60.37  ?  587 ARG B CD  1 
ATOM   1792 N NE  . ARG B 2 79  ? 53.328 -22.158 -286.832 1.00 60.21  ?  587 ARG B NE  1 
ATOM   1793 C CZ  . ARG B 2 79  ? 53.121 -20.861 -287.039 1.00 65.75  ?  587 ARG B CZ  1 
ATOM   1794 N NH1 . ARG B 2 79  ? 54.035 -19.970 -286.663 1.00 54.91  ?  587 ARG B NH1 1 
ATOM   1795 N NH2 . ARG B 2 79  ? 52.003 -20.454 -287.630 1.00 67.80  ?  587 ARG B NH2 1 
ATOM   1796 N N   . LYS B 2 80  ? 48.353 -25.290 -284.196 1.00 42.41  ?  588 LYS B N   1 
ATOM   1797 C CA  . LYS B 2 80  ? 47.548 -24.806 -283.084 1.00 46.86  ?  588 LYS B CA  1 
ATOM   1798 C C   . LYS B 2 80  ? 47.762 -25.705 -281.867 1.00 47.24  ?  588 LYS B C   1 
ATOM   1799 O O   . LYS B 2 80  ? 47.985 -25.218 -280.767 1.00 47.56  ?  588 LYS B O   1 
ATOM   1800 C CB  . LYS B 2 80  ? 46.063 -24.749 -283.456 1.00 45.38  ?  588 LYS B CB  1 
ATOM   1801 C CG  . LYS B 2 80  ? 45.697 -23.631 -284.420 1.00 46.32  ?  588 LYS B CG  1 
ATOM   1802 C CD  . LYS B 2 80  ? 45.970 -22.273 -283.811 1.00 51.73  ?  588 LYS B CD  1 
ATOM   1803 C CE  . LYS B 2 80  ? 45.239 -21.174 -284.558 1.00 51.24  ?  588 LYS B CE  1 
ATOM   1804 N NZ  . LYS B 2 80  ? 45.621 -19.830 -284.046 1.00 60.63  ?  588 LYS B NZ  1 
ATOM   1805 N N   . ALA B 2 81  ? 47.721 -27.016 -282.096 1.00 41.96  ?  589 ALA B N   1 
ATOM   1806 C CA  . ALA B 2 81  ? 47.928 -28.017 -281.053 1.00 42.63  ?  589 ALA B CA  1 
ATOM   1807 C C   . ALA B 2 81  ? 49.269 -27.852 -280.351 1.00 44.16  ?  589 ALA B C   1 
ATOM   1808 O O   . ALA B 2 81  ? 49.355 -27.956 -279.131 1.00 43.02  ?  589 ALA B O   1 
ATOM   1809 C CB  . ALA B 2 81  ? 47.819 -29.404 -281.639 1.00 40.99  ?  589 ALA B CB  1 
ATOM   1810 N N   . ILE B 2 82  ? 50.314 -27.594 -281.125 1.00 42.95  ?  590 ILE B N   1 
ATOM   1811 C CA  . ILE B 2 82  ? 51.638 -27.367 -280.564 1.00 45.47  ?  590 ILE B CA  1 
ATOM   1812 C C   . ILE B 2 82  ? 51.653 -26.119 -279.694 1.00 47.73  ?  590 ILE B C   1 
ATOM   1813 O O   . ILE B 2 82  ? 52.169 -26.146 -278.583 1.00 49.05  ?  590 ILE B O   1 
ATOM   1814 C CB  . ILE B 2 82  ? 52.704 -27.227 -281.671 1.00 39.59  ?  590 ILE B CB  1 
ATOM   1815 C CG1 . ILE B 2 82  ? 52.860 -28.550 -282.427 1.00 40.21  ?  590 ILE B CG1 1 
ATOM   1816 C CG2 . ILE B 2 82  ? 54.044 -26.795 -281.082 1.00 38.54  ?  590 ILE B CG2 1 
ATOM   1817 C CD1 . ILE B 2 82  ? 53.748 -28.454 -283.654 1.00 39.16  ?  590 ILE B CD1 1 
ATOM   1818 N N   . ASP B 2 83  ? 51.086 -25.031 -280.212 1.00 51.13  ?  591 ASP B N   1 
ATOM   1819 C CA  . ASP B 2 83  ? 51.061 -23.753 -279.504 1.00 52.80  ?  591 ASP B CA  1 
ATOM   1820 C C   . ASP B 2 83  ? 50.324 -23.871 -278.179 1.00 56.07  ?  591 ASP B C   1 
ATOM   1821 O O   . ASP B 2 83  ? 50.714 -23.268 -277.185 1.00 54.00  ?  591 ASP B O   1 
ATOM   1822 C CB  . ASP B 2 83  ? 50.408 -22.667 -280.367 1.00 46.82  ?  591 ASP B CB  1 
ATOM   1823 C CG  . ASP B 2 83  ? 51.391 -22.012 -281.319 1.00 54.26  ?  591 ASP B CG  1 
ATOM   1824 O OD1 . ASP B 2 83  ? 52.595 -21.996 -280.988 1.00 56.42  ?  591 ASP B OD1 1 
ATOM   1825 O OD2 . ASP B 2 83  ? 50.965 -21.506 -282.385 1.00 51.61  -1 591 ASP B OD2 1 
ATOM   1826 N N   . PHE B 2 84  ? 49.250 -24.649 -278.191 1.00 49.35  ?  592 PHE B N   1 
ATOM   1827 C CA  . PHE B 2 84  ? 48.492 -24.978 -276.992 1.00 52.78  ?  592 PHE B CA  1 
ATOM   1828 C C   . PHE B 2 84  ? 49.401 -25.612 -275.939 1.00 54.24  ?  592 PHE B C   1 
ATOM   1829 O O   . PHE B 2 84  ? 49.400 -25.205 -274.777 1.00 56.98  ?  592 PHE B O   1 
ATOM   1830 C CB  . PHE B 2 84  ? 47.344 -25.914 -277.365 1.00 51.82  ?  592 PHE B CB  1 
ATOM   1831 C CG  . PHE B 2 84  ? 46.569 -26.437 -276.197 1.00 61.32  ?  592 PHE B CG  1 
ATOM   1832 C CD1 . PHE B 2 84  ? 45.477 -25.740 -275.709 1.00 69.69  ?  592 PHE B CD1 1 
ATOM   1833 C CD2 . PHE B 2 84  ? 46.906 -27.648 -275.609 1.00 57.45  ?  592 PHE B CD2 1 
ATOM   1834 C CE1 . PHE B 2 84  ? 44.746 -26.231 -274.637 1.00 74.50  ?  592 PHE B CE1 1 
ATOM   1835 C CE2 . PHE B 2 84  ? 46.180 -28.144 -274.538 1.00 62.82  ?  592 PHE B CE2 1 
ATOM   1836 C CZ  . PHE B 2 84  ? 45.097 -27.434 -274.053 1.00 62.99  ?  592 PHE B CZ  1 
ATOM   1837 N N   . LEU B 2 85  ? 50.190 -26.597 -276.360 1.00 51.85  ?  593 LEU B N   1 
ATOM   1838 C CA  . LEU B 2 85  ? 51.128 -27.267 -275.468 1.00 52.68  ?  593 LEU B CA  1 
ATOM   1839 C C   . LEU B 2 85  ? 52.299 -26.371 -275.043 1.00 55.19  ?  593 LEU B C   1 
ATOM   1840 O O   . LEU B 2 85  ? 52.751 -26.462 -273.905 1.00 56.41  ?  593 LEU B O   1 
ATOM   1841 C CB  . LEU B 2 85  ? 51.658 -28.544 -276.125 1.00 44.78  ?  593 LEU B CB  1 
ATOM   1842 C CG  . LEU B 2 85  ? 50.640 -29.660 -276.360 1.00 46.58  ?  593 LEU B CG  1 
ATOM   1843 C CD1 . LEU B 2 85  ? 51.131 -30.626 -277.428 1.00 40.36  ?  593 LEU B CD1 1 
ATOM   1844 C CD2 . LEU B 2 85  ? 50.352 -30.406 -275.058 1.00 49.49  ?  593 LEU B CD2 1 
ATOM   1845 N N   . LEU B 2 86  ? 52.790 -25.526 -275.951 1.00 50.10  ?  594 LEU B N   1 
ATOM   1846 C CA  . LEU B 2 86  ? 53.887 -24.603 -275.643 1.00 53.45  ?  594 LEU B CA  1 
ATOM   1847 C C   . LEU B 2 86  ? 53.416 -23.556 -274.637 1.00 56.89  ?  594 LEU B C   1 
ATOM   1848 O O   . LEU B 2 86  ? 54.164 -23.202 -273.723 1.00 56.71  ?  594 LEU B O   1 
ATOM   1849 C CB  . LEU B 2 86  ? 54.417 -23.917 -276.901 1.00 49.22  ?  594 LEU B CB  1 
ATOM   1850 C CG  . LEU B 2 86  ? 55.274 -24.735 -277.861 1.00 50.14  ?  594 LEU B CG  1 
ATOM   1851 C CD1 . LEU B 2 86  ? 55.609 -23.902 -279.092 1.00 42.87  ?  594 LEU B CD1 1 
ATOM   1852 C CD2 . LEU B 2 86  ? 56.543 -25.205 -277.164 1.00 49.85  ?  594 LEU B CD2 1 
ATOM   1853 N N   . GLN B 2 87  ? 52.177 -23.075 -274.800 1.00 59.91  ?  595 GLN B N   1 
ATOM   1854 C CA  . GLN B 2 87  ? 51.548 -22.245 -273.771 1.00 67.01  ?  595 GLN B CA  1 
ATOM   1855 C C   . GLN B 2 87  ? 51.622 -22.770 -272.361 1.00 68.39  ?  595 GLN B C   1 
ATOM   1856 O O   . GLN B 2 87  ? 52.035 -22.048 -271.464 1.00 65.73  ?  595 GLN B O   1 
ATOM   1857 C CB  . GLN B 2 87  ? 50.058 -21.963 -273.987 1.00 68.29  ?  595 GLN B CB  1 
ATOM   1858 C CG  . GLN B 2 87  ? 49.577 -20.461 -273.838 1.00 79.50  ?  595 GLN B CG  1 
ATOM   1859 C CD  . GLN B 2 87  ? 50.635 -19.275 -273.767 1.00 87.95  ?  595 GLN B CD  1 
ATOM   1860 O OE1 . GLN B 2 87  ? 50.269 -18.145 -274.145 1.00 97.05  ?  595 GLN B OE1 1 
ATOM   1861 N NE2 . GLN B 2 87  ? 51.945 -19.565 -273.533 1.00 77.28  ?  595 GLN B NE2 1 
ATOM   1862 N N   . ARG B 2 88  ? 51.139 -23.984 -272.151 1.00 70.93  ?  596 ARG B N   1 
ATOM   1863 C CA  . ARG B 2 88  ? 50.984 -24.475 -270.797 1.00 73.86  ?  596 ARG B CA  1 
ATOM   1864 C C   . ARG B 2 88  ? 51.971 -25.575 -270.448 1.00 69.20  ?  596 ARG B C   1 
ATOM   1865 O O   . ARG B 2 88  ? 51.611 -26.498 -269.731 1.00 83.13  ?  596 ARG B O   1 
ATOM   1866 C CB  . ARG B 2 88  ? 49.552 -24.987 -270.576 1.00 76.97  ?  596 ARG B CB  1 
ATOM   1867 C CG  . ARG B 2 88  ? 48.459 -23.922 -270.692 1.00 86.63  ?  596 ARG B CG  1 
ATOM   1868 C CD  . ARG B 2 88  ? 48.519 -22.922 -269.529 1.00 94.04  ?  596 ARG B CD  1 
ATOM   1869 N NE  . ARG B 2 88  ? 47.448 -21.923 -269.587 1.00 102.36 ?  596 ARG B NE  1 
ATOM   1870 C CZ  . ARG B 2 88  ? 47.552 -20.745 -270.199 1.00 105.12 ?  596 ARG B CZ  1 
ATOM   1871 N NH1 . ARG B 2 88  ? 48.679 -20.411 -270.810 1.00 107.88 ?  596 ARG B NH1 1 
ATOM   1872 N NH2 . ARG B 2 88  ? 46.530 -19.900 -270.200 1.00 109.44 ?  596 ARG B NH2 1 
ATOM   1873 N N   . TRP B 2 89  ? 53.201 -25.488 -270.948 1.00 64.02  ?  597 TRP B N   1 
ATOM   1874 C CA  . TRP B 2 89  ? 54.216 -26.511 -270.672 1.00 63.72  ?  597 TRP B CA  1 
ATOM   1875 C C   . TRP B 2 89  ? 55.569 -26.107 -271.237 1.00 58.52  ?  597 TRP B C   1 
ATOM   1876 O O   . TRP B 2 89  ? 56.570 -26.791 -271.032 1.00 61.27  ?  597 TRP B O   1 
ATOM   1877 C CB  . TRP B 2 89  ? 53.807 -27.877 -271.246 1.00 58.92  ?  597 TRP B CB  1 
ATOM   1878 N N   . GLY B 2 90  ? 55.593 -24.994 -271.957 1.00 73.56  ?  598 GLY B N   1 
ATOM   1879 C CA  . GLY B 2 90  ? 56.827 -24.493 -272.533 1.00 74.75  ?  598 GLY B CA  1 
ATOM   1880 C C   . GLY B 2 90  ? 57.771 -23.936 -271.483 1.00 81.17  ?  598 GLY B C   1 
ATOM   1881 O O   . GLY B 2 90  ? 58.543 -23.013 -271.756 1.00 83.12  ?  598 GLY B O   1 
ATOM   1882 N N   . LEU C 3 18  ? 18.684 -23.681 -355.275 1.00 138.47 ?  18  LEU C N   1 
ATOM   1883 C CA  . LEU C 3 18  ? 17.976 -23.124 -354.126 1.00 138.51 ?  18  LEU C CA  1 
ATOM   1884 C C   . LEU C 3 18  ? 17.838 -21.600 -354.188 1.00 141.37 ?  18  LEU C C   1 
ATOM   1885 O O   . LEU C 3 18  ? 17.141 -21.003 -353.353 1.00 138.81 ?  18  LEU C O   1 
ATOM   1886 C CB  . LEU C 3 18  ? 18.671 -23.567 -352.827 1.00 123.62 ?  18  LEU C CB  1 
ATOM   1887 C CG  . LEU C 3 18  ? 20.175 -23.324 -352.569 1.00 116.67 ?  18  LEU C CG  1 
ATOM   1888 C CD1 . LEU C 3 18  ? 20.616 -21.851 -352.427 1.00 106.94 ?  18  LEU C CD1 1 
ATOM   1889 C CD2 . LEU C 3 18  ? 20.632 -24.178 -351.373 1.00 108.87 ?  18  LEU C CD2 1 
ATOM   1890 N N   . GLU C 3 19  ? 18.471 -20.986 -355.190 1.00 161.33 ?  19  GLU C N   1 
ATOM   1891 C CA  . GLU C 3 19  ? 18.472 -19.534 -355.296 1.00 160.07 ?  19  GLU C CA  1 
ATOM   1892 C C   . GLU C 3 19  ? 17.480 -19.065 -356.355 1.00 167.58 ?  19  GLU C C   1 
ATOM   1893 O O   . GLU C 3 19  ? 16.714 -18.134 -356.099 1.00 165.68 ?  19  GLU C O   1 
ATOM   1894 C CB  . GLU C 3 19  ? 19.891 -19.011 -355.565 1.00 153.33 ?  19  GLU C CB  1 
ATOM   1895 C CG  . GLU C 3 19  ? 20.004 -17.728 -356.396 1.00 148.65 ?  19  GLU C CG  1 
ATOM   1896 C CD  . GLU C 3 19  ? 21.044 -16.776 -355.815 1.00 142.89 ?  19  GLU C CD  1 
ATOM   1897 O OE1 . GLU C 3 19  ? 21.748 -17.190 -354.868 1.00 136.71 ?  19  GLU C OE1 1 
ATOM   1898 O OE2 . GLU C 3 19  ? 21.134 -15.614 -356.269 1.00 134.46 -1 19  GLU C OE2 1 
ATOM   1899 N N   . LYS C 3 20  ? 17.452 -19.722 -357.514 1.00 125.80 ?  20  LYS C N   1 
ATOM   1900 C CA  . LYS C 3 20  ? 16.502 -19.336 -358.554 1.00 130.26 ?  20  LYS C CA  1 
ATOM   1901 C C   . LYS C 3 20  ? 15.057 -19.651 -358.182 1.00 140.19 ?  20  LYS C C   1 
ATOM   1902 O O   . LYS C 3 20  ? 14.154 -18.944 -358.641 1.00 140.88 ?  20  LYS C O   1 
ATOM   1903 C CB  . LYS C 3 20  ? 16.857 -19.999 -359.878 1.00 125.30 ?  20  LYS C CB  1 
ATOM   1904 C CG  . LYS C 3 20  ? 18.206 -19.572 -360.390 1.00 117.17 ?  20  LYS C CG  1 
ATOM   1905 C CD  . LYS C 3 20  ? 18.216 -18.056 -360.522 1.00 112.41 ?  20  LYS C CD  1 
ATOM   1906 C CE  . LYS C 3 20  ? 19.556 -17.529 -361.006 1.00 103.96 ?  20  LYS C CE  1 
ATOM   1907 N NZ  . LYS C 3 20  ? 19.585 -16.039 -361.039 1.00 95.65  ?  20  LYS C NZ  1 
ATOM   1908 N N   . GLU C 3 21  ? 14.853 -20.687 -357.352 1.00 185.98 ?  21  GLU C N   1 
ATOM   1909 C CA  . GLU C 3 21  ? 13.525 -21.011 -356.844 1.00 187.15 ?  21  GLU C CA  1 
ATOM   1910 C C   . GLU C 3 21  ? 13.064 -19.700 -356.258 1.00 191.04 ?  21  GLU C C   1 
ATOM   1911 O O   . GLU C 3 21  ? 11.937 -19.312 -356.518 1.00 196.54 ?  21  GLU C O   1 
ATOM   1912 C CB  . GLU C 3 21  ? 13.454 -22.077 -355.727 1.00 185.89 ?  21  GLU C CB  1 
ATOM   1913 C CG  . GLU C 3 21  ? 14.716 -22.828 -355.349 1.00 187.01 ?  21  GLU C CG  1 
ATOM   1914 C CD  . GLU C 3 21  ? 15.409 -23.470 -356.522 1.00 185.04 ?  21  GLU C CD  1 
ATOM   1915 O OE1 . GLU C 3 21  ? 14.856 -24.419 -357.124 1.00 187.04 ?  21  GLU C OE1 1 
ATOM   1916 O OE2 . GLU C 3 21  ? 16.475 -22.949 -356.898 1.00 182.91 -1 21  GLU C OE2 1 
ATOM   1917 N N   . TYR C 3 22  ? 13.931 -19.017 -355.492 1.00 166.26 ?  22  TYR C N   1 
ATOM   1918 C CA  . TYR C 3 22  ? 13.495 -17.795 -354.817 1.00 159.69 ?  22  TYR C CA  1 
ATOM   1919 C C   . TYR C 3 22  ? 13.226 -16.610 -355.747 1.00 157.06 ?  22  TYR C C   1 
ATOM   1920 O O   . TYR C 3 22  ? 12.307 -15.815 -355.506 1.00 151.36 ?  22  TYR C O   1 
ATOM   1921 C CB  . TYR C 3 22  ? 14.506 -17.365 -353.779 1.00 145.94 ?  22  TYR C CB  1 
ATOM   1922 C CG  . TYR C 3 22  ? 14.053 -16.202 -352.929 1.00 135.40 ?  22  TYR C CG  1 
ATOM   1923 C CD1 . TYR C 3 22  ? 13.681 -16.410 -351.609 1.00 128.67 ?  22  TYR C CD1 1 
ATOM   1924 C CD2 . TYR C 3 22  ? 14.068 -14.897 -353.405 1.00 129.73 ?  22  TYR C CD2 1 
ATOM   1925 C CE1 . TYR C 3 22  ? 13.249 -15.377 -350.826 1.00 125.41 ?  22  TYR C CE1 1 
ATOM   1926 C CE2 . TYR C 3 22  ? 13.639 -13.843 -352.617 1.00 125.82 ?  22  TYR C CE2 1 
ATOM   1927 C CZ  . TYR C 3 22  ? 13.241 -14.091 -351.319 1.00 124.06 ?  22  TYR C CZ  1 
ATOM   1928 O OH  . TYR C 3 22  ? 12.845 -13.053 -350.489 1.00 114.64 ?  22  TYR C OH  1 
ATOM   1929 N N   . PHE C 3 23  ? 14.017 -16.464 -356.804 1.00 150.91 ?  23  PHE C N   1 
ATOM   1930 C CA  . PHE C 3 23  ? 13.858 -15.295 -357.680 1.00 143.24 ?  23  PHE C CA  1 
ATOM   1931 C C   . PHE C 3 23  ? 12.740 -15.553 -358.671 1.00 145.46 ?  23  PHE C C   1 
ATOM   1932 O O   . PHE C 3 23  ? 12.189 -14.615 -359.236 1.00 134.22 ?  23  PHE C O   1 
ATOM   1933 C CB  . PHE C 3 23  ? 15.180 -14.937 -358.380 1.00 140.31 ?  23  PHE C CB  1 
ATOM   1934 C CG  . PHE C 3 23  ? 16.253 -14.535 -357.413 1.00 133.35 ?  23  PHE C CG  1 
ATOM   1935 C CD1 . PHE C 3 23  ? 16.339 -13.242 -356.942 1.00 125.36 ?  23  PHE C CD1 1 
ATOM   1936 C CD2 . PHE C 3 23  ? 17.139 -15.466 -356.930 1.00 133.37 ?  23  PHE C CD2 1 
ATOM   1937 C CE1 . PHE C 3 23  ? 17.304 -12.884 -356.022 1.00 112.39 ?  23  PHE C CE1 1 
ATOM   1938 C CE2 . PHE C 3 23  ? 18.098 -15.116 -356.012 1.00 121.68 ?  23  PHE C CE2 1 
ATOM   1939 C CZ  . PHE C 3 23  ? 18.187 -13.828 -355.559 1.00 108.60 ?  23  PHE C CZ  1 
ATOM   1940 N N   . ASP C 3 24  ? 12.352 -16.822 -358.816 1.00 159.81 ?  24  ASP C N   1 
ATOM   1941 C CA  . ASP C 3 24  ? 11.234 -17.205 -359.702 1.00 163.23 ?  24  ASP C CA  1 
ATOM   1942 C C   . ASP C 3 24  ? 9.842  -17.306 -359.026 1.00 159.04 ?  24  ASP C C   1 
ATOM   1943 O O   . ASP C 3 24  ? 8.822  -17.297 -359.704 1.00 152.90 ?  24  ASP C O   1 
ATOM   1944 C CB  . ASP C 3 24  ? 11.578 -18.525 -360.406 1.00 166.64 ?  24  ASP C CB  1 
ATOM   1945 C CG  . ASP C 3 24  ? 12.788 -18.387 -361.335 1.00 165.79 ?  24  ASP C CG  1 
ATOM   1946 O OD1 . ASP C 3 24  ? 12.589 -18.423 -362.568 1.00 164.45 ?  24  ASP C OD1 1 
ATOM   1947 O OD2 . ASP C 3 24  ? 13.926 -18.207 -360.844 1.00 164.11 -1 24  ASP C OD2 1 
ATOM   1948 N N   . GLN C 3 25  ? 9.817  -17.372 -357.692 1.00 144.02 ?  25  GLN C N   1 
ATOM   1949 C CA  . GLN C 3 25  ? 8.570  -17.363 -356.887 1.00 140.42 ?  25  GLN C CA  1 
ATOM   1950 C C   . GLN C 3 25  ? 8.077  -15.949 -356.489 1.00 135.81 ?  25  GLN C C   1 
ATOM   1951 O O   . GLN C 3 25  ? 6.866  -15.679 -356.507 1.00 133.63 ?  25  GLN C O   1 
ATOM   1952 C CB  . GLN C 3 25  ? 8.744  -18.234 -355.615 1.00 143.51 ?  25  GLN C CB  1 
ATOM   1953 C CG  . GLN C 3 25  ? 10.056 -18.073 -354.976 1.00 144.84 ?  25  GLN C CG  1 
ATOM   1954 C CD  . GLN C 3 25  ? 10.021 -18.379 -353.519 1.00 143.48 ?  25  GLN C CD  1 
ATOM   1955 O OE1 . GLN C 3 25  ? 9.567  -19.439 -353.087 1.00 142.67 ?  25  GLN C OE1 1 
ATOM   1956 N NE2 . GLN C 3 25  ? 10.520 -17.452 -352.739 1.00 137.50 ?  25  GLN C NE2 1 
ATOM   1957 N N   . HIS C 3 26  ? 8.996  -15.089 -356.057 1.00 152.22 ?  26  HIS C N   1 
ATOM   1958 C CA  . HIS C 3 26  ? 8.622  -13.751 -355.660 1.00 142.07 ?  26  HIS C CA  1 
ATOM   1959 C C   . HIS C 3 26  ? 8.959  -12.677 -356.688 1.00 129.36 ?  26  HIS C C   1 
ATOM   1960 O O   . HIS C 3 26  ? 8.215  -11.719 -356.805 1.00 125.85 ?  26  HIS C O   1 
ATOM   1961 C CB  . HIS C 3 26  ? 9.277  -13.332 -354.342 1.00 139.97 ?  26  HIS C CB  1 
ATOM   1962 C CG  . HIS C 3 26  ? 8.953  -14.211 -353.180 1.00 144.21 ?  26  HIS C CG  1 
ATOM   1963 N ND1 . HIS C 3 26  ? 7.695  -14.725 -352.940 1.00 148.25 ?  26  HIS C ND1 1 
ATOM   1964 C CD2 . HIS C 3 26  ? 9.698  -14.585 -352.108 1.00 145.37 ?  26  HIS C CD2 1 
ATOM   1965 C CE1 . HIS C 3 26  ? 7.686  -15.423 -351.819 1.00 150.22 ?  26  HIS C CE1 1 
ATOM   1966 N NE2 . HIS C 3 26  ? 8.920  -15.342 -351.295 1.00 149.13 ?  26  HIS C NE2 1 
ATOM   1967 N N   . PHE C 3 27  ? 10.104 -12.757 -357.361 1.00 96.61  ?  27  PHE C N   1 
ATOM   1968 C CA  . PHE C 3 27  ? 10.579 -11.589 -358.109 1.00 86.60  ?  27  PHE C CA  1 
ATOM   1969 C C   . PHE C 3 27  ? 10.197 -11.625 -359.596 1.00 84.26  ?  27  PHE C C   1 
ATOM   1970 O O   . PHE C 3 27  ? 9.142  -11.102 -359.985 1.00 76.23  ?  27  PHE C O   1 
ATOM   1971 C CB  . PHE C 3 27  ? 12.100 -11.443 -357.948 1.00 84.84  ?  27  PHE C CB  1 
ATOM   1972 C CG  . PHE C 3 27  ? 12.547 -11.221 -356.521 1.00 80.62  ?  27  PHE C CG  1 
ATOM   1973 C CD1 . PHE C 3 27  ? 11.661 -10.771 -355.555 1.00 76.44  ?  27  PHE C CD1 1 
ATOM   1974 C CD2 . PHE C 3 27  ? 13.854 -11.458 -356.150 1.00 80.67  ?  27  PHE C CD2 1 
ATOM   1975 C CE1 . PHE C 3 27  ? 12.077 -10.573 -354.244 1.00 73.20  ?  27  PHE C CE1 1 
ATOM   1976 C CE2 . PHE C 3 27  ? 14.275 -11.264 -354.851 1.00 73.24  ?  27  PHE C CE2 1 
ATOM   1977 C CZ  . PHE C 3 27  ? 13.390 -10.818 -353.899 1.00 70.29  ?  27  PHE C CZ  1 
ATOM   1978 N N   . GLY C 3 28  ? 11.037 -12.259 -360.412 1.00 114.50 ?  28  GLY C N   1 
ATOM   1979 C CA  . GLY C 3 28  ? 10.809 -12.333 -361.845 1.00 107.87 ?  28  GLY C CA  1 
ATOM   1980 C C   . GLY C 3 28  ? 9.420  -12.822 -362.201 1.00 107.50 ?  28  GLY C C   1 
ATOM   1981 O O   . GLY C 3 28  ? 8.860  -13.666 -361.499 1.00 112.51 ?  28  GLY C O   1 
ATOM   1982 N N   . PRO C 3 29  ? 8.850  -12.290 -363.293 1.00 87.20  ?  29  PRO C N   1 
ATOM   1983 C CA  . PRO C 3 29  ? 9.464  -11.287 -364.168 1.00 83.82  ?  29  PRO C CA  1 
ATOM   1984 C C   . PRO C 3 29  ? 9.127  -9.858  -363.765 1.00 83.17  ?  29  PRO C C   1 
ATOM   1985 O O   . PRO C 3 29  ? 9.472  -8.918  -364.487 1.00 82.94  ?  29  PRO C O   1 
ATOM   1986 C CB  . PRO C 3 29  ? 8.852  -11.609 -365.528 1.00 86.98  ?  29  PRO C CB  1 
ATOM   1987 C CG  . PRO C 3 29  ? 7.459  -12.053 -365.179 1.00 85.40  ?  29  PRO C CG  1 
ATOM   1988 C CD  . PRO C 3 29  ? 7.553  -12.749 -363.825 1.00 81.39  ?  29  PRO C CD  1 
ATOM   1989 N N   . PHE C 3 30  ? 8.447  -9.700  -362.633 1.00 90.44  ?  30  PHE C N   1 
ATOM   1990 C CA  . PHE C 3 30  ? 7.999  -8.386  -362.183 1.00 86.49  ?  30  PHE C CA  1 
ATOM   1991 C C   . PHE C 3 30  ? 9.112  -7.640  -361.467 1.00 80.47  ?  30  PHE C C   1 
ATOM   1992 O O   . PHE C 3 30  ? 9.036  -6.423  -361.291 1.00 80.46  ?  30  PHE C O   1 
ATOM   1993 C CB  . PHE C 3 30  ? 6.780  -8.519  -361.268 1.00 84.26  ?  30  PHE C CB  1 
ATOM   1994 C CG  . PHE C 3 30  ? 5.708  -9.414  -361.821 1.00 90.21  ?  30  PHE C CG  1 
ATOM   1995 C CD1 . PHE C 3 30  ? 5.289  -9.289  -363.140 1.00 90.10  ?  30  PHE C CD1 1 
ATOM   1996 C CD2 . PHE C 3 30  ? 5.136  -10.398 -361.033 1.00 91.74  ?  30  PHE C CD2 1 
ATOM   1997 C CE1 . PHE C 3 30  ? 4.309  -10.119 -363.656 1.00 86.98  ?  30  PHE C CE1 1 
ATOM   1998 C CE2 . PHE C 3 30  ? 4.158  -11.232 -361.542 1.00 87.01  ?  30  PHE C CE2 1 
ATOM   1999 C CZ  . PHE C 3 30  ? 3.744  -11.091 -362.855 1.00 83.98  ?  30  PHE C CZ  1 
ATOM   2000 N N   . PHE C 3 31  ? 10.145 -8.372  -361.059 1.00 73.76  ?  31  PHE C N   1 
ATOM   2001 C CA  . PHE C 3 31  ? 11.282 -7.757  -360.390 1.00 69.73  ?  31  PHE C CA  1 
ATOM   2002 C C   . PHE C 3 31  ? 12.619 -8.210  -360.949 1.00 68.45  ?  31  PHE C C   1 
ATOM   2003 O O   . PHE C 3 31  ? 12.900 -9.401  -361.063 1.00 71.17  ?  31  PHE C O   1 
ATOM   2004 C CB  . PHE C 3 31  ? 11.239 -8.033  -358.888 1.00 71.83  ?  31  PHE C CB  1 
ATOM   2005 C CG  . PHE C 3 31  ? 10.057 -7.426  -358.202 1.00 72.24  ?  31  PHE C CG  1 
ATOM   2006 C CD1 . PHE C 3 31  ? 10.082 -6.097  -357.803 1.00 67.01  ?  31  PHE C CD1 1 
ATOM   2007 C CD2 . PHE C 3 31  ? 8.924  -8.179  -357.948 1.00 73.68  ?  31  PHE C CD2 1 
ATOM   2008 C CE1 . PHE C 3 31  ? 8.993  -5.529  -357.170 1.00 64.47  ?  31  PHE C CE1 1 
ATOM   2009 C CE2 . PHE C 3 31  ? 7.831  -7.618  -357.314 1.00 72.76  ?  31  PHE C CE2 1 
ATOM   2010 C CZ  . PHE C 3 31  ? 7.864  -6.292  -356.926 1.00 68.59  ?  31  PHE C CZ  1 
ATOM   2011 N N   . ARG C 3 32  ? 13.430 -7.221  -361.300 1.00 65.62  ?  32  ARG C N   1 
ATOM   2012 C CA  . ARG C 3 32  ? 14.822 -7.404  -361.676 1.00 67.96  ?  32  ARG C CA  1 
ATOM   2013 C C   . ARG C 3 32  ? 15.679 -7.475  -360.405 1.00 61.06  ?  32  ARG C C   1 
ATOM   2014 O O   . ARG C 3 32  ? 15.285 -6.948  -359.364 1.00 55.93  ?  32  ARG C O   1 
ATOM   2015 C CB  . ARG C 3 32  ? 15.265 -6.244  -362.566 1.00 67.38  ?  32  ARG C CB  1 
ATOM   2016 C CG  . ARG C 3 32  ? 16.633 -6.381  -363.187 1.00 72.39  ?  32  ARG C CG  1 
ATOM   2017 C CD  . ARG C 3 32  ? 17.092 -5.027  -363.725 1.00 75.99  ?  32  ARG C CD  1 
ATOM   2018 N NE  . ARG C 3 32  ? 17.877 -5.115  -364.960 1.00 85.16  ?  32  ARG C NE  1 
ATOM   2019 C CZ  . ARG C 3 32  ? 19.018 -5.788  -365.110 1.00 86.75  ?  32  ARG C CZ  1 
ATOM   2020 N NH1 . ARG C 3 32  ? 19.571 -6.449  -364.094 1.00 81.22  ?  32  ARG C NH1 1 
ATOM   2021 N NH2 . ARG C 3 32  ? 19.629 -5.775  -366.288 1.00 85.71  ?  32  ARG C NH2 1 
ATOM   2022 N N   . THR C 3 33  ? 16.836 -8.124  -360.472 1.00 55.40  ?  33  THR C N   1 
ATOM   2023 C CA  . THR C 3 33  ? 17.724 -8.161  -359.308 1.00 61.76  ?  33  THR C CA  1 
ATOM   2024 C C   . THR C 3 33  ? 19.129 -7.647  -359.600 1.00 61.63  ?  33  THR C C   1 
ATOM   2025 O O   . THR C 3 33  ? 19.788 -8.089  -360.547 1.00 59.45  ?  33  THR C O   1 
ATOM   2026 C CB  . THR C 3 33  ? 17.850 -9.578  -358.731 1.00 60.77  ?  33  THR C CB  1 
ATOM   2027 O OG1 . THR C 3 33  ? 18.300 -10.473 -359.754 1.00 64.37  ?  33  THR C OG1 1 
ATOM   2028 C CG2 . THR C 3 33  ? 16.513 -10.048 -358.189 1.00 72.19  ?  33  THR C CG2 1 
ATOM   2029 N N   . GLU C 3 34  ? 19.569 -6.699  -358.777 1.00 56.32  ?  34  GLU C N   1 
ATOM   2030 C CA  . GLU C 3 34  ? 20.964 -6.281  -358.752 1.00 56.58  ?  34  GLU C CA  1 
ATOM   2031 C C   . GLU C 3 34  ? 21.685 -7.141  -357.726 1.00 57.53  ?  34  GLU C C   1 
ATOM   2032 O O   . GLU C 3 34  ? 21.255 -7.219  -356.576 1.00 55.88  ?  34  GLU C O   1 
ATOM   2033 C CB  . GLU C 3 34  ? 21.095 -4.798  -358.405 1.00 53.00  ?  34  GLU C CB  1 
ATOM   2034 C CG  . GLU C 3 34  ? 20.006 -3.897  -359.003 1.00 58.02  ?  34  GLU C CG  1 
ATOM   2035 C CD  . GLU C 3 34  ? 20.002 -3.852  -360.529 1.00 59.85  ?  34  GLU C CD  1 
ATOM   2036 O OE1 . GLU C 3 34  ? 20.984 -4.293  -361.175 1.00 60.44  ?  34  GLU C OE1 1 
ATOM   2037 O OE2 . GLU C 3 34  ? 19.003 -3.354  -361.084 1.00 63.43  ?  34  GLU C OE2 1 
ATOM   2038 N N   . GLN C 3 35  ? 22.767 -7.793  -358.137 1.00 49.82  ?  35  GLN C N   1 
ATOM   2039 C CA  . GLN C 3 35  ? 23.420 -8.764  -357.271 1.00 51.78  ?  35  GLN C CA  1 
ATOM   2040 C C   . GLN C 3 35  ? 24.939 -8.628  -357.239 1.00 54.68  ?  35  GLN C C   1 
ATOM   2041 O O   . GLN C 3 35  ? 25.590 -8.549  -358.282 1.00 57.45  ?  35  GLN C O   1 
ATOM   2042 C CB  . GLN C 3 35  ? 23.045 -10.184 -357.697 1.00 50.32  ?  35  GLN C CB  1 
ATOM   2043 C CG  . GLN C 3 35  ? 23.634 -11.249 -356.805 1.00 53.74  ?  35  GLN C CG  1 
ATOM   2044 C CD  . GLN C 3 35  ? 22.914 -12.574 -356.918 1.00 65.81  ?  35  GLN C CD  1 
ATOM   2045 O OE1 . GLN C 3 35  ? 21.749 -12.697 -356.533 1.00 70.14  ?  35  GLN C OE1 1 
ATOM   2046 N NE2 . GLN C 3 35  ? 23.608 -13.579 -357.437 1.00 62.38  ?  35  GLN C NE2 1 
ATOM   2047 N N   . LEU C 3 36  ? 25.498 -8.614  -356.030 1.00 48.90  ?  36  LEU C N   1 
ATOM   2048 C CA  . LEU C 3 36  ? 26.941 -8.583  -355.864 1.00 45.23  ?  36  LEU C CA  1 
ATOM   2049 C C   . LEU C 3 36  ? 27.444 -9.799  -355.106 1.00 46.56  ?  36  LEU C C   1 
ATOM   2050 O O   . LEU C 3 36  ? 26.765 -10.316 -354.219 1.00 48.84  ?  36  LEU C O   1 
ATOM   2051 C CB  . LEU C 3 36  ? 27.368 -7.324  -355.127 1.00 46.09  ?  36  LEU C CB  1 
ATOM   2052 C CG  . LEU C 3 36  ? 26.735 -6.016  -355.575 1.00 49.65  ?  36  LEU C CG  1 
ATOM   2053 C CD1 . LEU C 3 36  ? 27.269 -4.894  -354.703 1.00 47.98  ?  36  LEU C CD1 1 
ATOM   2054 C CD2 . LEU C 3 36  ? 27.023 -5.762  -357.043 1.00 57.79  ?  36  LEU C CD2 1 
ATOM   2055 N N   . ILE C 3 37  ? 28.641 -10.249 -355.468 1.00 48.03  ?  37  ILE C N   1 
ATOM   2056 C CA  . ILE C 3 37  ? 29.353 -11.275 -354.723 1.00 43.37  ?  37  ILE C CA  1 
ATOM   2057 C C   . ILE C 3 37  ? 30.574 -10.601 -354.131 1.00 46.38  ?  37  ILE C C   1 
ATOM   2058 O O   . ILE C 3 37  ? 31.339 -9.972  -354.859 1.00 44.62  ?  37  ILE C O   1 
ATOM   2059 C CB  . ILE C 3 37  ? 29.788 -12.469 -355.606 1.00 53.32  ?  37  ILE C CB  1 
ATOM   2060 C CG1 . ILE C 3 37  ? 28.659 -12.899 -356.548 1.00 54.97  ?  37  ILE C CG1 1 
ATOM   2061 C CG2 . ILE C 3 37  ? 30.303 -13.631 -354.749 1.00 46.47  ?  37  ILE C CG2 1 
ATOM   2062 C CD1 . ILE C 3 37  ? 27.391 -13.283 -355.842 1.00 54.46  ?  37  ILE C CD1 1 
ATOM   2063 N N   . ILE C 3 38  ? 30.744 -10.712 -352.816 1.00 43.98  ?  38  ILE C N   1 
ATOM   2064 C CA  . ILE C 3 38  ? 31.843 -10.053 -352.129 1.00 42.69  ?  38  ILE C CA  1 
ATOM   2065 C C   . ILE C 3 38  ? 32.724 -11.076 -351.418 1.00 41.95  ?  38  ILE C C   1 
ATOM   2066 O O   . ILE C 3 38  ? 32.242 -11.895 -350.629 1.00 42.47  ?  38  ILE C O   1 
ATOM   2067 C CB  . ILE C 3 38  ? 31.333 -9.000  -351.108 1.00 41.76  ?  38  ILE C CB  1 
ATOM   2068 C CG1 . ILE C 3 38  ? 30.533 -7.902  -351.812 1.00 41.98  ?  38  ILE C CG1 1 
ATOM   2069 C CG2 . ILE C 3 38  ? 32.493 -8.370  -350.335 1.00 35.11  ?  38  ILE C CG2 1 
ATOM   2070 C CD1 . ILE C 3 38  ? 29.053 -8.093  -351.759 1.00 45.92  ?  38  ILE C CD1 1 
ATOM   2071 N N   . ARG C 3 39  ? 34.017 -11.033 -351.712 1.00 39.37  ?  39  ARG C N   1 
ATOM   2072 C CA  . ARG C 3 39  ? 34.987 -11.874 -351.031 1.00 39.15  ?  39  ARG C CA  1 
ATOM   2073 C C   . ARG C 3 39  ? 36.000 -10.996 -350.328 1.00 39.08  ?  39  ARG C C   1 
ATOM   2074 O O   . ARG C 3 39  ? 36.096 -9.804  -350.614 1.00 39.55  ?  39  ARG C O   1 
ATOM   2075 C CB  . ARG C 3 39  ? 35.673 -12.822 -352.012 1.00 45.77  ?  39  ARG C CB  1 
ATOM   2076 C CG  . ARG C 3 39  ? 34.730 -13.860 -352.606 1.00 43.43  ?  39  ARG C CG  1 
ATOM   2077 C CD  . ARG C 3 39  ? 35.380 -14.616 -353.740 1.00 53.65  ?  39  ARG C CD  1 
ATOM   2078 N NE  . ARG C 3 39  ? 34.557 -15.740 -354.177 1.00 59.37  ?  39  ARG C NE  1 
ATOM   2079 C CZ  . ARG C 3 39  ? 33.702 -15.697 -355.195 1.00 60.21  ?  39  ARG C CZ  1 
ATOM   2080 N NH1 . ARG C 3 39  ? 33.551 -14.580 -355.898 1.00 62.52  ?  39  ARG C NH1 1 
ATOM   2081 N NH2 . ARG C 3 39  ? 32.996 -16.774 -355.510 1.00 63.39  ?  39  ARG C NH2 1 
ATOM   2082 N N   . ALA C 3 40  ? 36.730 -11.578 -349.383 1.00 38.42  ?  40  ALA C N   1 
ATOM   2083 C CA  . ALA C 3 40  ? 37.710 -10.838 -348.604 1.00 36.62  ?  40  ALA C CA  1 
ATOM   2084 C C   . ALA C 3 40  ? 39.070 -11.511 -348.733 1.00 42.69  ?  40  ALA C C   1 
ATOM   2085 O O   . ALA C 3 40  ? 39.498 -12.231 -347.832 1.00 41.45  ?  40  ALA C O   1 
ATOM   2086 C CB  . ALA C 3 40  ? 37.280 -10.753 -347.152 1.00 38.70  ?  40  ALA C CB  1 
ATOM   2087 N N   . PRO C 3 41  ? 39.755 -11.265 -349.864 1.00 49.27  ?  41  PRO C N   1 
ATOM   2088 C CA  . PRO C 3 41  ? 40.976 -11.958 -350.302 1.00 47.20  ?  41  PRO C CA  1 
ATOM   2089 C C   . PRO C 3 41  ? 42.165 -11.805 -349.354 1.00 47.29  ?  41  PRO C C   1 
ATOM   2090 O O   . PRO C 3 41  ? 43.089 -12.619 -349.405 1.00 50.04  ?  41  PRO C O   1 
ATOM   2091 C CB  . PRO C 3 41  ? 41.290 -11.284 -351.647 1.00 50.22  ?  41  PRO C CB  1 
ATOM   2092 C CG  . PRO C 3 41  ? 40.720 -9.902  -351.493 1.00 49.72  ?  41  PRO C CG  1 
ATOM   2093 C CD  . PRO C 3 41  ? 39.432 -10.123 -350.743 1.00 43.82  ?  41  PRO C CD  1 
ATOM   2094 N N   . LEU C 3 42  ? 42.141 -10.779 -348.513 1.00 43.24  ?  42  LEU C N   1 
ATOM   2095 C CA  . LEU C 3 42  ? 43.271 -10.458 -347.654 1.00 46.57  ?  42  LEU C CA  1 
ATOM   2096 C C   . LEU C 3 42  ? 42.991 -10.828 -346.199 1.00 49.21  ?  42  LEU C C   1 
ATOM   2097 O O   . LEU C 3 42  ? 43.784 -10.508 -345.313 1.00 50.13  ?  42  LEU C O   1 
ATOM   2098 C CB  . LEU C 3 42  ? 43.612 -8.959  -347.754 1.00 49.71  ?  42  LEU C CB  1 
ATOM   2099 C CG  . LEU C 3 42  ? 44.633 -8.455  -348.795 1.00 54.07  ?  42  LEU C CG  1 
ATOM   2100 C CD1 . LEU C 3 42  ? 44.369 -9.019  -350.161 1.00 45.19  ?  42  LEU C CD1 1 
ATOM   2101 C CD2 . LEU C 3 42  ? 44.673 -6.917  -348.855 1.00 47.82  ?  42  LEU C CD2 1 
ATOM   2102 N N   . THR C 3 43  ? 41.869 -11.497 -345.951 1.00 44.48  ?  43  THR C N   1 
ATOM   2103 C CA  . THR C 3 43  ? 41.442 -11.753 -344.576 1.00 43.34  ?  43  THR C CA  1 
ATOM   2104 C C   . THR C 3 43  ? 41.460 -13.238 -344.200 1.00 41.00  ?  43  THR C C   1 
ATOM   2105 O O   . THR C 3 43  ? 40.953 -14.086 -344.934 1.00 42.59  ?  43  THR C O   1 
ATOM   2106 C CB  . THR C 3 43  ? 40.026 -11.176 -344.325 1.00 45.84  ?  43  THR C CB  1 
ATOM   2107 O OG1 . THR C 3 43  ? 40.067 -9.747  -344.456 1.00 47.16  ?  43  THR C OG1 1 
ATOM   2108 C CG2 . THR C 3 43  ? 39.541 -11.522 -342.908 1.00 38.44  ?  43  THR C CG2 1 
ATOM   2109 N N   . ASP C 3 44  ? 42.063 -13.540 -343.053 1.00 52.92  ?  44  ASP C N   1 
ATOM   2110 C CA  . ASP C 3 44  ? 42.089 -14.899 -342.505 1.00 52.46  ?  44  ASP C CA  1 
ATOM   2111 C C   . ASP C 3 44  ? 40.739 -15.306 -341.938 1.00 48.70  ?  44  ASP C C   1 
ATOM   2112 O O   . ASP C 3 44  ? 40.010 -14.487 -341.384 1.00 42.56  ?  44  ASP C O   1 
ATOM   2113 C CB  . ASP C 3 44  ? 43.138 -15.028 -341.384 1.00 54.26  ?  44  ASP C CB  1 
ATOM   2114 C CG  . ASP C 3 44  ? 44.562 -14.804 -341.867 1.00 62.53  ?  44  ASP C CG  1 
ATOM   2115 O OD1 . ASP C 3 44  ? 44.883 -15.189 -343.018 1.00 57.72  ?  44  ASP C OD1 1 
ATOM   2116 O OD2 . ASP C 3 44  ? 45.365 -14.249 -341.079 1.00 67.17  -1 44  ASP C OD2 1 
ATOM   2117 N N   . LYS C 3 45  ? 40.415 -16.584 -342.046 1.00 54.37  ?  45  LYS C N   1 
ATOM   2118 C CA  . LYS C 3 45  ? 39.318 -17.111 -341.258 1.00 52.10  ?  45  LYS C CA  1 
ATOM   2119 C C   . LYS C 3 45  ? 39.717 -17.035 -339.783 1.00 50.33  ?  45  LYS C C   1 
ATOM   2120 O O   . LYS C 3 45  ? 40.892 -16.831 -339.463 1.00 51.83  ?  45  LYS C O   1 
ATOM   2121 C CB  . LYS C 3 45  ? 38.989 -18.541 -341.670 1.00 52.83  ?  45  LYS C CB  1 
ATOM   2122 C CG  . LYS C 3 45  ? 40.129 -19.505 -341.472 1.00 54.79  ?  45  LYS C CG  1 
ATOM   2123 C CD  . LYS C 3 45  ? 39.735 -20.892 -341.941 1.00 66.84  ?  45  LYS C CD  1 
ATOM   2124 C CE  . LYS C 3 45  ? 40.880 -21.878 -341.754 1.00 77.85  ?  45  LYS C CE  1 
ATOM   2125 N NZ  . LYS C 3 45  ? 40.514 -23.249 -342.208 1.00 79.64  ?  45  LYS C NZ  1 
ATOM   2126 N N   . HIS C 3 46  ? 38.747 -17.157 -338.885 1.00 40.32  ?  46  HIS C N   1 
ATOM   2127 C CA  . HIS C 3 46  ? 39.065 -17.188 -337.462 1.00 40.99  ?  46  HIS C CA  1 
ATOM   2128 C C   . HIS C 3 46  ? 38.133 -18.125 -336.699 1.00 39.74  ?  46  HIS C C   1 
ATOM   2129 O O   . HIS C 3 46  ? 37.181 -18.674 -337.258 1.00 39.27  ?  46  HIS C O   1 
ATOM   2130 C CB  . HIS C 3 46  ? 39.002 -15.783 -336.863 1.00 44.30  ?  46  HIS C CB  1 
ATOM   2131 C CG  . HIS C 3 46  ? 37.617 -15.227 -336.769 1.00 43.81  ?  46  HIS C CG  1 
ATOM   2132 N ND1 . HIS C 3 46  ? 36.899 -14.829 -337.876 1.00 42.59  ?  46  HIS C ND1 1 
ATOM   2133 C CD2 . HIS C 3 46  ? 36.819 -14.994 -335.699 1.00 43.05  ?  46  HIS C CD2 1 
ATOM   2134 C CE1 . HIS C 3 46  ? 35.715 -14.382 -337.494 1.00 39.64  ?  46  HIS C CE1 1 
ATOM   2135 N NE2 . HIS C 3 46  ? 35.644 -14.465 -336.176 1.00 38.19  ?  46  HIS C NE2 1 
ATOM   2136 N N   . ILE C 3 47  ? 38.416 -18.308 -335.417 1.00 45.15  ?  47  ILE C N   1 
ATOM   2137 C CA  . ILE C 3 47  ? 37.677 -19.265 -334.607 1.00 41.76  ?  47  ILE C CA  1 
ATOM   2138 C C   . ILE C 3 47  ? 37.136 -18.538 -333.366 1.00 41.40  ?  47  ILE C C   1 
ATOM   2139 O O   . ILE C 3 47  ? 37.849 -17.764 -332.711 1.00 37.97  ?  47  ILE C O   1 
ATOM   2140 C CB  . ILE C 3 47  ? 38.577 -20.477 -334.211 1.00 46.58  ?  47  ILE C CB  1 
ATOM   2141 C CG1 . ILE C 3 47  ? 39.096 -21.202 -335.452 1.00 43.28  ?  47  ILE C CG1 1 
ATOM   2142 C CG2 . ILE C 3 47  ? 37.820 -21.489 -333.369 1.00 42.00  ?  47  ILE C CG2 1 
ATOM   2143 C CD1 . ILE C 3 47  ? 40.027 -22.361 -335.122 1.00 44.41  ?  47  ILE C CD1 1 
ATOM   2144 N N   . TYR C 3 48  ? 35.860 -18.759 -333.074 1.00 36.50  ?  48  TYR C N   1 
ATOM   2145 C CA  . TYR C 3 48  ? 35.206 -18.097 -331.945 1.00 37.80  ?  48  TYR C CA  1 
ATOM   2146 C C   . TYR C 3 48  ? 34.472 -19.116 -331.056 1.00 37.08  ?  48  TYR C C   1 
ATOM   2147 O O   . TYR C 3 48  ? 33.985 -20.131 -331.563 1.00 35.92  ?  48  TYR C O   1 
ATOM   2148 C CB  . TYR C 3 48  ? 34.225 -17.021 -332.455 1.00 32.41  ?  48  TYR C CB  1 
ATOM   2149 C CG  . TYR C 3 48  ? 33.558 -16.230 -331.350 1.00 33.47  ?  48  TYR C CG  1 
ATOM   2150 C CD1 . TYR C 3 48  ? 34.230 -15.192 -330.714 1.00 34.26  ?  48  TYR C CD1 1 
ATOM   2151 C CD2 . TYR C 3 48  ? 32.260 -16.531 -330.933 1.00 31.63  ?  48  TYR C CD2 1 
ATOM   2152 C CE1 . TYR C 3 48  ? 33.624 -14.472 -329.691 1.00 36.99  ?  48  TYR C CE1 1 
ATOM   2153 C CE2 . TYR C 3 48  ? 31.650 -15.820 -329.923 1.00 32.27  ?  48  TYR C CE2 1 
ATOM   2154 C CZ  . TYR C 3 48  ? 32.337 -14.790 -329.306 1.00 36.50  ?  48  TYR C CZ  1 
ATOM   2155 O OH  . TYR C 3 48  ? 31.733 -14.081 -328.294 1.00 46.21  ?  48  TYR C OH  1 
ATOM   2156 N N   . GLN C 3 49  ? 34.389 -18.845 -329.750 1.00 39.21  ?  49  GLN C N   1 
ATOM   2157 C CA  . GLN C 3 49  ? 33.643 -19.718 -328.823 1.00 43.82  ?  49  GLN C CA  1 
ATOM   2158 C C   . GLN C 3 49  ? 32.427 -19.028 -328.194 1.00 40.27  ?  49  GLN C C   1 
ATOM   2159 O O   . GLN C 3 49  ? 32.554 -18.297 -327.212 1.00 40.19  ?  49  GLN C O   1 
ATOM   2160 C CB  . GLN C 3 49  ? 34.540 -20.233 -327.698 1.00 41.62  ?  49  GLN C CB  1 
ATOM   2161 C CG  . GLN C 3 49  ? 35.878 -20.727 -328.130 1.00 41.83  ?  49  GLN C CG  1 
ATOM   2162 C CD  . GLN C 3 49  ? 36.877 -19.599 -328.355 1.00 45.39  ?  49  GLN C CD  1 
ATOM   2163 O OE1 . GLN C 3 49  ? 36.528 -18.436 -328.282 1.00 51.42  ?  49  GLN C OE1 1 
ATOM   2164 N NE2 . GLN C 3 49  ? 38.109 -19.951 -328.712 1.00 42.25  ?  49  GLN C NE2 1 
ATOM   2165 N N   . PRO C 3 50  ? 31.233 -19.281 -328.739 1.00 35.20  ?  50  PRO C N   1 
ATOM   2166 C CA  . PRO C 3 50  ? 30.031 -18.671 -328.168 1.00 35.18  ?  50  PRO C CA  1 
ATOM   2167 C C   . PRO C 3 50  ? 29.671 -19.233 -326.788 1.00 43.29  ?  50  PRO C C   1 
ATOM   2168 O O   . PRO C 3 50  ? 29.749 -20.445 -326.560 1.00 34.67  ?  50  PRO C O   1 
ATOM   2169 C CB  . PRO C 3 50  ? 28.944 -19.017 -329.194 1.00 35.92  ?  50  PRO C CB  1 
ATOM   2170 C CG  . PRO C 3 50  ? 29.412 -20.253 -329.839 1.00 36.95  ?  50  PRO C CG  1 
ATOM   2171 C CD  . PRO C 3 50  ? 30.920 -20.146 -329.889 1.00 37.03  ?  50  PRO C CD  1 
ATOM   2172 N N   . TYR C 3 51  ? 29.318 -18.326 -325.880 1.00 44.11  ?  51  TYR C N   1 
ATOM   2173 C CA  . TYR C 3 51  ? 28.723 -18.649 -324.591 1.00 40.28  ?  51  TYR C CA  1 
ATOM   2174 C C   . TYR C 3 51  ? 27.354 -19.256 -324.864 1.00 40.61  ?  51  TYR C C   1 
ATOM   2175 O O   . TYR C 3 51  ? 26.690 -18.838 -325.798 1.00 44.25  ?  51  TYR C O   1 
ATOM   2176 C CB  . TYR C 3 51  ? 28.616 -17.374 -323.744 1.00 38.56  ?  51  TYR C CB  1 
ATOM   2177 C CG  . TYR C 3 51  ? 28.105 -17.530 -322.327 1.00 36.09  ?  51  TYR C CG  1 
ATOM   2178 C CD1 . TYR C 3 51  ? 28.982 -17.744 -321.275 1.00 36.77  ?  51  TYR C CD1 1 
ATOM   2179 C CD2 . TYR C 3 51  ? 26.748 -17.415 -322.036 1.00 36.00  ?  51  TYR C CD2 1 
ATOM   2180 C CE1 . TYR C 3 51  ? 28.525 -17.863 -319.966 1.00 36.78  ?  51  TYR C CE1 1 
ATOM   2181 C CE2 . TYR C 3 51  ? 26.280 -17.539 -320.731 1.00 37.99  ?  51  TYR C CE2 1 
ATOM   2182 C CZ  . TYR C 3 51  ? 27.179 -17.761 -319.705 1.00 35.02  ?  51  TYR C CZ  1 
ATOM   2183 O OH  . TYR C 3 51  ? 26.738 -17.890 -318.411 1.00 47.40  ?  51  TYR C OH  1 
ATOM   2184 N N   . PRO C 3 52  ? 26.921 -20.251 -324.067 1.00 40.88  ?  52  PRO C N   1 
ATOM   2185 C CA  . PRO C 3 52  ? 27.569 -20.899 -322.918 1.00 35.54  ?  52  PRO C CA  1 
ATOM   2186 C C   . PRO C 3 52  ? 28.244 -22.260 -323.196 1.00 38.10  ?  52  PRO C C   1 
ATOM   2187 O O   . PRO C 3 52  ? 28.874 -22.809 -322.292 1.00 36.53  ?  52  PRO C O   1 
ATOM   2188 C CB  . PRO C 3 52  ? 26.400 -21.085 -321.951 1.00 32.29  ?  52  PRO C CB  1 
ATOM   2189 C CG  . PRO C 3 52  ? 25.229 -21.380 -322.851 1.00 37.91  ?  52  PRO C CG  1 
ATOM   2190 C CD  . PRO C 3 52  ? 25.494 -20.630 -324.166 1.00 37.41  ?  52  PRO C CD  1 
ATOM   2191 N N   . SER C 3 53  ? 28.134 -22.786 -324.412 1.00 40.93  ?  53  SER C N   1 
ATOM   2192 C CA  . SER C 3 53  ? 28.734 -24.082 -324.752 1.00 44.58  ?  53  SER C CA  1 
ATOM   2193 C C   . SER C 3 53  ? 30.250 -24.019 -324.966 1.00 43.13  ?  53  SER C C   1 
ATOM   2194 O O   . SER C 3 53  ? 30.961 -24.988 -324.684 1.00 41.20  ?  53  SER C O   1 
ATOM   2195 C CB  . SER C 3 53  ? 28.074 -24.657 -326.011 1.00 43.73  ?  53  SER C CB  1 
ATOM   2196 O OG  . SER C 3 53  ? 28.362 -23.846 -327.143 1.00 54.02  ?  53  SER C OG  1 
ATOM   2197 N N   . GLY C 3 54  ? 30.736 -22.894 -325.483 1.00 37.73  ?  54  GLY C N   1 
ATOM   2198 C CA  . GLY C 3 54  ? 32.164 -22.698 -325.701 1.00 38.39  ?  54  GLY C CA  1 
ATOM   2199 C C   . GLY C 3 54  ? 32.824 -23.585 -326.750 1.00 33.95  ?  54  GLY C C   1 
ATOM   2200 O O   . GLY C 3 54  ? 34.046 -23.722 -326.778 1.00 42.17  ?  54  GLY C O   1 
ATOM   2201 N N   . ALA C 3 55  ? 32.027 -24.198 -327.611 1.00 42.73  ?  55  ALA C N   1 
ATOM   2202 C CA  . ALA C 3 55  ? 32.571 -25.007 -328.696 1.00 42.86  ?  55  ALA C CA  1 
ATOM   2203 C C   . ALA C 3 55  ? 33.293 -24.122 -329.708 1.00 47.09  ?  55  ALA C C   1 
ATOM   2204 O O   . ALA C 3 55  ? 32.918 -22.965 -329.898 1.00 46.35  ?  55  ALA C O   1 
ATOM   2205 C CB  . ALA C 3 55  ? 31.456 -25.793 -329.383 1.00 42.74  ?  55  ALA C CB  1 
ATOM   2206 N N   . ASP C 3 56  ? 34.329 -24.661 -330.346 1.00 47.80  ?  56  ASP C N   1 
ATOM   2207 C CA  . ASP C 3 56  ? 35.015 -23.960 -331.431 1.00 46.89  ?  56  ASP C CA  1 
ATOM   2208 C C   . ASP C 3 56  ? 34.149 -23.853 -332.680 1.00 52.01  ?  56  ASP C C   1 
ATOM   2209 O O   . ASP C 3 56  ? 33.779 -24.868 -333.280 1.00 52.86  ?  56  ASP C O   1 
ATOM   2210 C CB  . ASP C 3 56  ? 36.325 -24.660 -331.792 1.00 47.27  ?  56  ASP C CB  1 
ATOM   2211 C CG  . ASP C 3 56  ? 37.420 -24.378 -330.798 1.00 55.47  ?  56  ASP C CG  1 
ATOM   2212 O OD1 . ASP C 3 56  ? 38.364 -25.192 -330.704 1.00 69.44  ?  56  ASP C OD1 1 
ATOM   2213 O OD2 . ASP C 3 56  ? 37.331 -23.348 -330.100 1.00 50.84  ?  56  ASP C OD2 1 
ATOM   2214 N N   . VAL C 3 57  ? 33.824 -22.624 -333.069 1.00 39.14  ?  57  VAL C N   1 
ATOM   2215 C CA  . VAL C 3 57  ? 33.068 -22.396 -334.299 1.00 38.93  ?  57  VAL C CA  1 
ATOM   2216 C C   . VAL C 3 57  ? 33.923 -21.591 -335.290 1.00 38.46  ?  57  VAL C C   1 
ATOM   2217 O O   . VAL C 3 57  ? 34.389 -20.492 -334.975 1.00 34.36  ?  57  VAL C O   1 
ATOM   2218 C CB  . VAL C 3 57  ? 31.731 -21.680 -334.018 1.00 42.53  ?  57  VAL C CB  1 
ATOM   2219 C CG1 . VAL C 3 57  ? 30.900 -21.580 -335.290 1.00 33.45  ?  57  VAL C CG1 1 
ATOM   2220 C CG2 . VAL C 3 57  ? 30.946 -22.427 -332.911 1.00 35.17  ?  57  VAL C CG2 1 
ATOM   2221 N N   . PRO C 3 58  ? 34.185 -22.174 -336.473 1.00 42.16  ?  58  PRO C N   1 
ATOM   2222 C CA  . PRO C 3 58  ? 35.003 -21.465 -337.461 1.00 39.70  ?  58  PRO C CA  1 
ATOM   2223 C C   . PRO C 3 58  ? 34.173 -20.417 -338.191 1.00 40.23  ?  58  PRO C C   1 
ATOM   2224 O O   . PRO C 3 58  ? 33.007 -20.660 -338.521 1.00 37.01  ?  58  PRO C O   1 
ATOM   2225 C CB  . PRO C 3 58  ? 35.457 -22.578 -338.411 1.00 40.94  ?  58  PRO C CB  1 
ATOM   2226 C CG  . PRO C 3 58  ? 34.340 -23.596 -338.347 1.00 41.69  ?  58  PRO C CG  1 
ATOM   2227 C CD  . PRO C 3 58  ? 33.767 -23.512 -336.947 1.00 39.84  ?  58  PRO C CD  1 
ATOM   2228 N N   . PHE C 3 59  ? 34.762 -19.249 -338.418 1.00 38.72  ?  59  PHE C N   1 
ATOM   2229 C CA  . PHE C 3 59  ? 34.078 -18.213 -339.182 1.00 38.04  ?  59  PHE C CA  1 
ATOM   2230 C C   . PHE C 3 59  ? 34.905 -17.831 -340.398 1.00 38.48  ?  59  PHE C C   1 
ATOM   2231 O O   . PHE C 3 59  ? 36.086 -17.495 -340.270 1.00 37.67  ?  59  PHE C O   1 
ATOM   2232 C CB  . PHE C 3 59  ? 33.806 -16.987 -338.312 1.00 35.58  ?  59  PHE C CB  1 
ATOM   2233 C CG  . PHE C 3 59  ? 32.582 -17.113 -337.458 1.00 35.18  ?  59  PHE C CG  1 
ATOM   2234 C CD1 . PHE C 3 59  ? 32.622 -17.823 -336.263 1.00 36.48  ?  59  PHE C CD1 1 
ATOM   2235 C CD2 . PHE C 3 59  ? 31.386 -16.523 -337.846 1.00 34.40  ?  59  PHE C CD2 1 
ATOM   2236 C CE1 . PHE C 3 59  ? 31.481 -17.940 -335.474 1.00 34.06  ?  59  PHE C CE1 1 
ATOM   2237 C CE2 . PHE C 3 59  ? 30.245 -16.639 -337.063 1.00 33.49  ?  59  PHE C CE2 1 
ATOM   2238 C CZ  . PHE C 3 59  ? 30.294 -17.348 -335.881 1.00 34.16  ?  59  PHE C CZ  1 
ATOM   2239 N N   . GLY C 3 60  ? 34.272 -17.889 -341.571 1.00 32.15  ?  60  GLY C N   1 
ATOM   2240 C CA  . GLY C 3 60  ? 34.915 -17.542 -342.828 1.00 34.83  ?  60  GLY C CA  1 
ATOM   2241 C C   . GLY C 3 60  ? 35.476 -16.130 -342.913 1.00 36.95  ?  60  GLY C C   1 
ATOM   2242 O O   . GLY C 3 60  ? 35.057 -15.231 -342.172 1.00 33.08  ?  60  GLY C O   1 
ATOM   2243 N N   . PRO C 3 61  ? 36.435 -15.924 -343.830 1.00 39.31  ?  61  PRO C N   1 
ATOM   2244 C CA  . PRO C 3 61  ? 37.065 -14.609 -344.040 1.00 39.94  ?  61  PRO C CA  1 
ATOM   2245 C C   . PRO C 3 61  ? 36.079 -13.434 -344.118 1.00 35.04  ?  61  PRO C C   1 
ATOM   2246 O O   . PRO C 3 61  ? 36.316 -12.439 -343.429 1.00 33.91  ?  61  PRO C O   1 
ATOM   2247 C CB  . PRO C 3 61  ? 37.817 -14.785 -345.376 1.00 40.62  ?  61  PRO C CB  1 
ATOM   2248 C CG  . PRO C 3 61  ? 38.115 -16.255 -345.443 1.00 41.09  ?  61  PRO C CG  1 
ATOM   2249 C CD  . PRO C 3 61  ? 36.940 -16.944 -344.774 1.00 37.00  ?  61  PRO C CD  1 
ATOM   2250 N N   . PRO C 3 62  ? 34.991 -13.538 -344.911 1.00 38.72  ?  62  PRO C N   1 
ATOM   2251 C CA  . PRO C 3 62  ? 34.157 -12.331 -344.989 1.00 39.13  ?  62  PRO C CA  1 
ATOM   2252 C C   . PRO C 3 62  ? 33.233 -12.111 -343.777 1.00 43.57  ?  62  PRO C C   1 
ATOM   2253 O O   . PRO C 3 62  ? 32.410 -11.188 -343.812 1.00 40.64  ?  62  PRO C O   1 
ATOM   2254 C CB  . PRO C 3 62  ? 33.326 -12.567 -346.251 1.00 38.74  ?  62  PRO C CB  1 
ATOM   2255 C CG  . PRO C 3 62  ? 33.201 -14.056 -346.351 1.00 41.24  ?  62  PRO C CG  1 
ATOM   2256 C CD  . PRO C 3 62  ? 34.491 -14.610 -345.801 1.00 40.96  ?  62  PRO C CD  1 
ATOM   2257 N N   . LEU C 3 63  ? 33.348 -12.940 -342.740 1.00 34.19  ?  63  LEU C N   1 
ATOM   2258 C CA  . LEU C 3 63  ? 32.543 -12.747 -341.531 1.00 35.39  ?  63  LEU C CA  1 
ATOM   2259 C C   . LEU C 3 63  ? 33.401 -12.141 -340.431 1.00 33.66  ?  63  LEU C C   1 
ATOM   2260 O O   . LEU C 3 63  ? 32.982 -12.038 -339.278 1.00 40.51  ?  63  LEU C O   1 
ATOM   2261 C CB  . LEU C 3 63  ? 31.911 -14.066 -341.073 1.00 38.53  ?  63  LEU C CB  1 
ATOM   2262 C CG  . LEU C 3 63  ? 30.847 -14.633 -342.022 1.00 37.86  ?  63  LEU C CG  1 
ATOM   2263 C CD1 . LEU C 3 63  ? 30.273 -15.955 -341.512 1.00 38.55  ?  63  LEU C CD1 1 
ATOM   2264 C CD2 . LEU C 3 63  ? 29.738 -13.625 -342.264 1.00 34.05  ?  63  LEU C CD2 1 
ATOM   2265 N N   . ASP C 3 64  ? 34.616 -11.749 -340.797 1.00 37.63  ?  64  ASP C N   1 
ATOM   2266 C CA  . ASP C 3 64  ? 35.462 -10.926 -339.939 1.00 35.94  ?  64  ASP C CA  1 
ATOM   2267 C C   . ASP C 3 64  ? 34.740 -9.615  -339.655 1.00 38.12  ?  64  ASP C C   1 
ATOM   2268 O O   . ASP C 3 64  ? 34.067 -9.084  -340.537 1.00 41.00  ?  64  ASP C O   1 
ATOM   2269 C CB  . ASP C 3 64  ? 36.812 -10.676 -340.612 1.00 36.34  ?  64  ASP C CB  1 
ATOM   2270 C CG  . ASP C 3 64  ? 37.650 -9.651  -339.880 1.00 43.72  ?  64  ASP C CG  1 
ATOM   2271 O OD1 . ASP C 3 64  ? 38.572 -10.069 -339.149 1.00 46.18  ?  64  ASP C OD1 1 
ATOM   2272 O OD2 . ASP C 3 64  ? 37.401 -8.429  -340.045 1.00 41.38  -1 64  ASP C OD2 1 
ATOM   2273 N N   . ILE C 3 65  ? 34.868 -9.084  -338.444 1.00 35.49  ?  65  ILE C N   1 
ATOM   2274 C CA  . ILE C 3 65  ? 34.051 -7.935  -338.062 1.00 37.37  ?  65  ILE C CA  1 
ATOM   2275 C C   . ILE C 3 65  ? 34.410 -6.670  -338.866 1.00 38.44  ?  65  ILE C C   1 
ATOM   2276 O O   . ILE C 3 65  ? 33.526 -5.902  -339.241 1.00 38.23  ?  65  ILE C O   1 
ATOM   2277 C CB  . ILE C 3 65  ? 34.151 -7.648  -336.543 1.00 35.71  ?  65  ILE C CB  1 
ATOM   2278 C CG1 . ILE C 3 65  ? 33.192 -6.531  -336.140 1.00 35.42  ?  65  ILE C CG1 1 
ATOM   2279 C CG2 . ILE C 3 65  ? 35.575 -7.297  -336.126 1.00 35.48  ?  65  ILE C CG2 1 
ATOM   2280 C CD1 . ILE C 3 65  ? 31.783 -6.823  -336.432 1.00 33.82  ?  65  ILE C CD1 1 
ATOM   2281 N N   . GLN C 3 66  ? 35.694 -6.475  -339.155 1.00 40.50  ?  66  GLN C N   1 
ATOM   2282 C CA  . GLN C 3 66  ? 36.134 -5.318  -339.941 1.00 46.90  ?  66  GLN C CA  1 
ATOM   2283 C C   . GLN C 3 66  ? 35.658 -5.398  -341.392 1.00 39.23  ?  66  GLN C C   1 
ATOM   2284 O O   . GLN C 3 66  ? 35.300 -4.388  -341.984 1.00 42.78  ?  66  GLN C O   1 
ATOM   2285 C CB  . GLN C 3 66  ? 37.660 -5.181  -339.891 1.00 45.25  ?  66  GLN C CB  1 
ATOM   2286 C CG  . GLN C 3 66  ? 38.206 -5.223  -338.471 1.00 47.99  ?  66  GLN C CG  1 
ATOM   2287 C CD  . GLN C 3 66  ? 39.306 -4.212  -338.227 1.00 64.43  ?  66  GLN C CD  1 
ATOM   2288 O OE1 . GLN C 3 66  ? 39.050 -3.105  -337.743 1.00 69.18  ?  66  GLN C OE1 1 
ATOM   2289 N NE2 . GLN C 3 66  ? 40.546 -4.591  -338.542 1.00 67.23  ?  66  GLN C NE2 1 
ATOM   2290 N N   . ILE C 3 67  ? 35.647 -6.600  -341.957 1.00 34.08  ?  67  ILE C N   1 
ATOM   2291 C CA  . ILE C 3 67  ? 35.120 -6.795  -343.300 1.00 34.21  ?  67  ILE C CA  1 
ATOM   2292 C C   . ILE C 3 67  ? 33.636 -6.451  -343.367 1.00 34.83  ?  67  ILE C C   1 
ATOM   2293 O O   . ILE C 3 67  ? 33.192 -5.795  -344.311 1.00 36.94  ?  67  ILE C O   1 
ATOM   2294 C CB  . ILE C 3 67  ? 35.330 -8.233  -343.788 1.00 33.47  ?  67  ILE C CB  1 
ATOM   2295 C CG1 . ILE C 3 67  ? 36.825 -8.531  -343.906 1.00 40.05  ?  67  ILE C CG1 1 
ATOM   2296 C CG2 . ILE C 3 67  ? 34.633 -8.454  -345.138 1.00 33.09  ?  67  ILE C CG2 1 
ATOM   2297 C CD1 . ILE C 3 67  ? 37.554 -7.633  -344.909 1.00 37.73  ?  67  ILE C CD1 1 
ATOM   2298 N N   . LEU C 3 68  ? 32.874 -6.875  -342.362 1.00 36.03  ?  68  LEU C N   1 
ATOM   2299 C CA  . LEU C 3 68  ? 31.427 -6.648  -342.353 1.00 33.85  ?  68  LEU C CA  1 
ATOM   2300 C C   . LEU C 3 68  ? 31.102 -5.158  -342.257 1.00 31.56  ?  68  LEU C C   1 
ATOM   2301 O O   . LEU C 3 68  ? 30.146 -4.698  -342.869 1.00 30.96  ?  68  LEU C O   1 
ATOM   2302 C CB  . LEU C 3 68  ? 30.756 -7.427  -341.207 1.00 31.61  ?  68  LEU C CB  1 
ATOM   2303 C CG  . LEU C 3 68  ? 30.679 -8.944  -341.427 1.00 32.66  ?  68  LEU C CG  1 
ATOM   2304 C CD1 . LEU C 3 68  ? 30.374 -9.711  -340.144 1.00 33.20  ?  68  LEU C CD1 1 
ATOM   2305 C CD2 . LEU C 3 68  ? 29.643 -9.265  -342.481 1.00 30.91  ?  68  LEU C CD2 1 
ATOM   2306 N N   . HIS C 3 69  ? 31.892 -4.405  -341.494 1.00 31.71  ?  69  HIS C N   1 
ATOM   2307 C CA  . HIS C 3 69  ? 31.698 -2.956  -341.423 1.00 33.56  ?  69  HIS C CA  1 
ATOM   2308 C C   . HIS C 3 69  ? 31.974 -2.285  -342.779 1.00 32.58  ?  69  HIS C C   1 
ATOM   2309 O O   . HIS C 3 69  ? 31.316 -1.315  -343.133 1.00 31.49  ?  69  HIS C O   1 
ATOM   2310 C CB  . HIS C 3 69  ? 32.591 -2.327  -340.345 1.00 34.40  ?  69  HIS C CB  1 
ATOM   2311 C CG  . HIS C 3 69  ? 32.036 -2.413  -338.955 1.00 40.48  ?  69  HIS C CG  1 
ATOM   2312 N ND1 . HIS C 3 69  ? 30.914 -1.719  -338.557 1.00 37.91  ?  69  HIS C ND1 1 
ATOM   2313 C CD2 . HIS C 3 69  ? 32.464 -3.094  -337.864 1.00 39.94  ?  69  HIS C CD2 1 
ATOM   2314 C CE1 . HIS C 3 69  ? 30.669 -1.973  -337.283 1.00 38.32  ?  69  HIS C CE1 1 
ATOM   2315 N NE2 . HIS C 3 69  ? 31.594 -2.805  -336.840 1.00 36.44  ?  69  HIS C NE2 1 
ATOM   2316 N N   . GLN C 3 70  ? 32.938 -2.811  -343.533 1.00 32.64  ?  70  GLN C N   1 
ATOM   2317 C CA  . GLN C 3 70  ? 33.265 -2.264  -344.854 1.00 38.32  ?  70  GLN C CA  1 
ATOM   2318 C C   . GLN C 3 70  ? 32.245 -2.680  -345.911 1.00 37.43  ?  70  GLN C C   1 
ATOM   2319 O O   . GLN C 3 70  ? 31.924 -1.903  -346.811 1.00 36.30  ?  70  GLN C O   1 
ATOM   2320 C CB  . GLN C 3 70  ? 34.665 -2.702  -345.300 1.00 36.02  ?  70  GLN C CB  1 
ATOM   2321 C CG  . GLN C 3 70  ? 35.808 -2.063  -344.517 1.00 35.85  ?  70  GLN C CG  1 
ATOM   2322 C CD  . GLN C 3 70  ? 37.136 -2.755  -344.800 1.00 43.54  ?  70  GLN C CD  1 
ATOM   2323 O OE1 . GLN C 3 70  ? 37.763 -2.525  -345.833 1.00 36.75  ?  70  GLN C OE1 1 
ATOM   2324 N NE2 . GLN C 3 70  ? 37.551 -3.644  -343.889 1.00 42.90  ?  70  GLN C NE2 1 
ATOM   2325 N N   . VAL C 3 71  ? 31.747 -3.910  -345.814 1.00 34.11  ?  71  VAL C N   1 
ATOM   2326 C CA  . VAL C 3 71  ? 30.710 -4.343  -346.731 1.00 31.62  ?  71  VAL C CA  1 
ATOM   2327 C C   . VAL C 3 71  ? 29.471 -3.494  -346.482 1.00 35.11  ?  71  VAL C C   1 
ATOM   2328 O O   . VAL C 3 71  ? 28.814 -3.058  -347.429 1.00 36.27  ?  71  VAL C O   1 
ATOM   2329 C CB  . VAL C 3 71  ? 30.392 -5.840  -346.590 1.00 31.99  ?  71  VAL C CB  1 
ATOM   2330 C CG1 . VAL C 3 71  ? 29.148 -6.189  -347.382 1.00 29.49  ?  71  VAL C CG1 1 
ATOM   2331 C CG2 . VAL C 3 71  ? 31.569 -6.678  -347.097 1.00 31.78  ?  71  VAL C CG2 1 
ATOM   2332 N N   . LEU C 3 72  ? 29.169 -3.226  -345.214 1.00 31.34  ?  72  LEU C N   1 
ATOM   2333 C CA  . LEU C 3 72  ? 28.034 -2.364  -344.886 1.00 32.20  ?  72  LEU C CA  1 
ATOM   2334 C C   . LEU C 3 72  ? 28.252 -0.908  -345.359 1.00 32.96  ?  72  LEU C C   1 
ATOM   2335 O O   . LEU C 3 72  ? 27.298 -0.232  -345.743 1.00 33.58  ?  72  LEU C O   1 
ATOM   2336 C CB  . LEU C 3 72  ? 27.743 -2.396  -343.378 1.00 26.02  ?  72  LEU C CB  1 
ATOM   2337 C CG  . LEU C 3 72  ? 26.609 -1.486  -342.889 1.00 29.60  ?  72  LEU C CG  1 
ATOM   2338 C CD1 . LEU C 3 72  ? 25.280 -1.873  -343.533 1.00 28.30  ?  72  LEU C CD1 1 
ATOM   2339 C CD2 . LEU C 3 72  ? 26.491 -1.487  -341.366 1.00 31.96  ?  72  LEU C CD2 1 
ATOM   2340 N N   . ASP C 3 73  ? 29.492 -0.426  -345.336 1.00 36.12  ?  73  ASP C N   1 
ATOM   2341 C CA  . ASP C 3 73  ? 29.801 0.867   -345.950 1.00 36.07  ?  73  ASP C CA  1 
ATOM   2342 C C   . ASP C 3 73  ? 29.429 0.876   -347.439 1.00 37.35  ?  73  ASP C C   1 
ATOM   2343 O O   . ASP C 3 73  ? 28.803 1.813   -347.927 1.00 34.66  ?  73  ASP C O   1 
ATOM   2344 C CB  . ASP C 3 73  ? 31.277 1.212   -345.804 1.00 36.61  ?  73  ASP C CB  1 
ATOM   2345 C CG  . ASP C 3 73  ? 31.606 1.767   -344.448 1.00 43.43  ?  73  ASP C CG  1 
ATOM   2346 O OD1 . ASP C 3 73  ? 30.665 2.227   -343.767 1.00 47.48  ?  73  ASP C OD1 1 
ATOM   2347 O OD2 . ASP C 3 73  ? 32.802 1.753   -344.069 1.00 49.03  -1 73  ASP C OD2 1 
ATOM   2348 N N   . LEU C 3 74  ? 29.816 -0.185  -348.141 1.00 30.82  ?  74  LEU C N   1 
ATOM   2349 C CA  . LEU C 3 74  ? 29.507 -0.331  -349.550 1.00 34.15  ?  74  LEU C CA  1 
ATOM   2350 C C   . LEU C 3 74  ? 27.993 -0.345  -349.763 1.00 37.83  ?  74  LEU C C   1 
ATOM   2351 O O   . LEU C 3 74  ? 27.466 0.339   -350.656 1.00 35.06  ?  74  LEU C O   1 
ATOM   2352 C CB  . LEU C 3 74  ? 30.149 -1.603  -350.095 1.00 33.29  ?  74  LEU C CB  1 
ATOM   2353 C CG  . LEU C 3 74  ? 29.732 -2.118  -351.475 1.00 41.50  ?  74  LEU C CG  1 
ATOM   2354 C CD1 . LEU C 3 74  ? 30.287 -1.228  -352.610 1.00 34.95  ?  74  LEU C CD1 1 
ATOM   2355 C CD2 . LEU C 3 74  ? 30.171 -3.567  -351.646 1.00 34.84  ?  74  LEU C CD2 1 
ATOM   2356 N N   . GLN C 3 75  ? 27.295 -1.092  -348.913 1.00 33.36  ?  75  GLN C N   1 
ATOM   2357 C CA  . GLN C 3 75  ? 25.863 -1.311  -349.084 1.00 35.02  ?  75  GLN C CA  1 
ATOM   2358 C C   . GLN C 3 75  ? 25.047 -0.039  -348.842 1.00 32.33  ?  75  GLN C C   1 
ATOM   2359 O O   . GLN C 3 75  ? 24.103 0.260   -349.569 1.00 34.55  ?  75  GLN C O   1 
ATOM   2360 C CB  . GLN C 3 75  ? 25.399 -2.423  -348.145 1.00 35.59  ?  75  GLN C CB  1 
ATOM   2361 C CG  . GLN C 3 75  ? 23.952 -2.824  -348.309 1.00 36.24  ?  75  GLN C CG  1 
ATOM   2362 C CD  . GLN C 3 75  ? 23.555 -3.888  -347.305 1.00 37.96  ?  75  GLN C CD  1 
ATOM   2363 O OE1 . GLN C 3 75  ? 23.951 -5.035  -347.427 1.00 34.11  ?  75  GLN C OE1 1 
ATOM   2364 N NE2 . GLN C 3 75  ? 22.808 -3.492  -346.280 1.00 34.07  ?  75  GLN C NE2 1 
ATOM   2365 N N   . ILE C 3 76  ? 25.413 0.692   -347.801 1.00 28.76  ?  76  ILE C N   1 
ATOM   2366 C CA  . ILE C 3 76  ? 24.824 1.990   -347.505 1.00 31.10  ?  76  ILE C CA  1 
ATOM   2367 C C   . ILE C 3 76  ? 25.101 3.021   -348.625 1.00 37.45  ?  76  ILE C C   1 
ATOM   2368 O O   . ILE C 3 76  ? 24.237 3.849   -348.949 1.00 34.88  ?  76  ILE C O   1 
ATOM   2369 C CB  . ILE C 3 76  ? 25.353 2.509   -346.135 1.00 33.99  ?  76  ILE C CB  1 
ATOM   2370 C CG1 . ILE C 3 76  ? 24.799 1.635   -344.997 1.00 34.10  ?  76  ILE C CG1 1 
ATOM   2371 C CG2 . ILE C 3 76  ? 25.024 3.989   -345.908 1.00 24.87  ?  76  ILE C CG2 1 
ATOM   2372 C CD1 . ILE C 3 76  ? 25.334 2.002   -343.606 1.00 27.66  ?  76  ILE C CD1 1 
ATOM   2373 N N   . ALA C 3 77  ? 26.295 2.963   -349.216 1.00 31.01  ?  77  ALA C N   1 
ATOM   2374 C CA  . ALA C 3 77  ? 26.641 3.867   -350.311 1.00 35.07  ?  77  ALA C CA  1 
ATOM   2375 C C   . ALA C 3 77  ? 25.784 3.567   -351.543 1.00 36.03  ?  77  ALA C C   1 
ATOM   2376 O O   . ALA C 3 77  ? 25.331 4.481   -352.230 1.00 37.87  ?  77  ALA C O   1 
ATOM   2377 C CB  . ALA C 3 77  ? 28.141 3.766   -350.651 1.00 33.68  ?  77  ALA C CB  1 
ATOM   2378 N N   . ILE C 3 78  ? 25.561 2.283   -351.814 1.00 33.24  ?  78  ILE C N   1 
ATOM   2379 C CA  . ILE C 3 78  ? 24.682 1.867   -352.904 1.00 30.11  ?  78  ILE C CA  1 
ATOM   2380 C C   . ILE C 3 78  ? 23.255 2.368   -352.692 1.00 36.26  ?  78  ILE C C   1 
ATOM   2381 O O   . ILE C 3 78  ? 22.613 2.839   -353.643 1.00 33.96  ?  78  ILE C O   1 
ATOM   2382 C CB  . ILE C 3 78  ? 24.672 0.349   -353.058 1.00 29.44  ?  78  ILE C CB  1 
ATOM   2383 C CG1 . ILE C 3 78  ? 26.021 -0.128  -353.606 1.00 34.68  ?  78  ILE C CG1 1 
ATOM   2384 C CG2 . ILE C 3 78  ? 23.532 -0.103  -353.957 1.00 31.74  ?  78  ILE C CG2 1 
ATOM   2385 C CD1 . ILE C 3 78  ? 26.131 -1.643  -353.713 1.00 34.63  ?  78  ILE C CD1 1 
ATOM   2386 N N   . GLU C 3 79  ? 22.777 2.300   -351.444 1.00 34.70  ?  79  GLU C N   1 
ATOM   2387 C CA  . GLU C 3 79  ? 21.442 2.800   -351.111 1.00 39.22  ?  79  GLU C CA  1 
ATOM   2388 C C   . GLU C 3 79  ? 21.329 4.294   -351.339 1.00 37.45  ?  79  GLU C C   1 
ATOM   2389 O O   . GLU C 3 79  ? 20.234 4.794   -351.557 1.00 37.72  ?  79  GLU C O   1 
ATOM   2390 C CB  . GLU C 3 79  ? 21.058 2.509   -349.647 1.00 35.07  ?  79  GLU C CB  1 
ATOM   2391 C CG  . GLU C 3 79  ? 20.801 1.063   -349.308 1.00 39.04  ?  79  GLU C CG  1 
ATOM   2392 C CD  . GLU C 3 79  ? 20.335 0.889   -347.854 1.00 51.87  ?  79  GLU C CD  1 
ATOM   2393 O OE1 . GLU C 3 79  ? 21.073 0.251   -347.061 1.00 51.91  ?  79  GLU C OE1 1 
ATOM   2394 O OE2 . GLU C 3 79  ? 19.233 1.392   -347.506 1.00 44.17  -1 79  GLU C OE2 1 
ATOM   2395 N N   . ASN C 3 80  ? 22.458 4.999   -351.272 1.00 33.02  ?  80  ASN C N   1 
ATOM   2396 C CA  . ASN C 3 80  ? 22.472 6.449   -351.365 1.00 32.75  ?  80  ASN C CA  1 
ATOM   2397 C C   . ASN C 3 80  ? 22.713 6.923   -352.791 1.00 33.91  ?  80  ASN C C   1 
ATOM   2398 O O   . ASN C 3 80  ? 22.680 8.121   -353.063 1.00 33.27  ?  80  ASN C O   1 
ATOM   2399 C CB  . ASN C 3 80  ? 23.553 7.040   -350.446 1.00 33.70  ?  80  ASN C CB  1 
ATOM   2400 C CG  . ASN C 3 80  ? 23.173 6.980   -348.973 1.00 38.76  ?  80  ASN C CG  1 
ATOM   2401 O OD1 . ASN C 3 80  ? 22.003 7.073   -348.622 1.00 45.81  ?  80  ASN C OD1 1 
ATOM   2402 N ND2 . ASN C 3 80  ? 24.167 6.826   -348.108 1.00 42.81  ?  80  ASN C ND2 1 
ATOM   2403 N N   . ILE C 3 81  ? 22.988 5.980   -353.683 1.00 33.60  ?  81  ILE C N   1 
ATOM   2404 C CA  . ILE C 3 81  ? 23.296 6.310   -355.071 1.00 35.18  ?  81  ILE C CA  1 
ATOM   2405 C C   . ILE C 3 81  ? 22.105 6.993   -355.734 1.00 35.86  ?  81  ILE C C   1 
ATOM   2406 O O   . ILE C 3 81  ? 20.967 6.524   -355.635 1.00 35.30  ?  81  ILE C O   1 
ATOM   2407 C CB  . ILE C 3 81  ? 23.681 5.062   -355.886 1.00 35.31  ?  81  ILE C CB  1 
ATOM   2408 C CG1 . ILE C 3 81  ? 25.100 4.599   -355.535 1.00 32.95  ?  81  ILE C CG1 1 
ATOM   2409 C CG2 . ILE C 3 81  ? 23.589 5.350   -357.381 1.00 40.70  ?  81  ILE C CG2 1 
ATOM   2410 C CD1 . ILE C 3 81  ? 25.511 3.328   -356.276 1.00 33.66  ?  81  ILE C CD1 1 
ATOM   2411 N N   . THR C 3 82  ? 22.372 8.116   -356.389 1.00 38.60  ?  82  THR C N   1 
ATOM   2412 C CA  . THR C 3 82  ? 21.343 8.822   -357.147 1.00 38.76  ?  82  THR C CA  1 
ATOM   2413 C C   . THR C 3 82  ? 21.683 8.867   -358.642 1.00 42.06  ?  82  THR C C   1 
ATOM   2414 O O   . THR C 3 82  ? 22.840 8.739   -359.042 1.00 41.75  ?  82  THR C O   1 
ATOM   2415 C CB  . THR C 3 82  ? 21.151 10.253  -356.619 1.00 38.97  ?  82  THR C CB  1 
ATOM   2416 O OG1 . THR C 3 82  ? 22.333 11.024  -356.873 1.00 41.29  ?  82  THR C OG1 1 
ATOM   2417 C CG2 . THR C 3 82  ? 20.864 10.240  -355.106 1.00 34.26  ?  82  THR C CG2 1 
ATOM   2418 N N   . ALA C 3 83  ? 20.662 9.034   -359.470 1.00 39.28  ?  83  ALA C N   1 
ATOM   2419 C CA  . ALA C 3 83  ? 20.869 9.255   -360.882 1.00 35.11  ?  83  ALA C CA  1 
ATOM   2420 C C   . ALA C 3 83  ? 19.983 10.410  -361.340 1.00 41.49  ?  83  ALA C C   1 
ATOM   2421 O O   . ALA C 3 83  ? 18.890 10.612  -360.811 1.00 40.88  ?  83  ALA C O   1 
ATOM   2422 C CB  . ALA C 3 83  ? 20.581 7.979   -361.680 1.00 35.63  ?  83  ALA C CB  1 
ATOM   2423 N N   . SER C 3 84  ? 20.469 11.183  -362.305 1.00 38.83  ?  84  SER C N   1 
ATOM   2424 C CA  . SER C 3 84  ? 19.681 12.261  -362.888 1.00 40.01  ?  84  SER C CA  1 
ATOM   2425 C C   . SER C 3 84  ? 18.778 11.733  -364.006 1.00 39.76  ?  84  SER C C   1 
ATOM   2426 O O   . SER C 3 84  ? 19.231 11.007  -364.886 1.00 36.81  ?  84  SER C O   1 
ATOM   2427 C CB  . SER C 3 84  ? 20.600 13.360  -363.428 1.00 41.51  ?  84  SER C CB  1 
ATOM   2428 O OG  . SER C 3 84  ? 19.863 14.505  -363.806 1.00 47.76  ?  84  SER C OG  1 
ATOM   2429 N N   . TYR C 3 85  ? 17.495 12.069  -363.955 1.00 45.30  ?  85  TYR C N   1 
ATOM   2430 C CA  . TYR C 3 85  ? 16.606 11.785  -365.078 1.00 47.88  ?  85  TYR C CA  1 
ATOM   2431 C C   . TYR C 3 85  ? 15.548 12.854  -365.301 1.00 45.30  ?  85  TYR C C   1 
ATOM   2432 O O   . TYR C 3 85  ? 14.688 13.065  -364.450 1.00 45.67  ?  85  TYR C O   1 
ATOM   2433 C CB  . TYR C 3 85  ? 15.833 10.468  -364.899 1.00 41.73  ?  85  TYR C CB  1 
ATOM   2434 C CG  . TYR C 3 85  ? 15.047 10.110  -366.151 1.00 49.67  ?  85  TYR C CG  1 
ATOM   2435 C CD1 . TYR C 3 85  ? 15.619 9.335   -367.159 1.00 47.98  ?  85  TYR C CD1 1 
ATOM   2436 C CD2 . TYR C 3 85  ? 13.746 10.578  -366.341 1.00 49.09  ?  85  TYR C CD2 1 
ATOM   2437 C CE1 . TYR C 3 85  ? 14.909 9.023   -368.314 1.00 52.22  ?  85  TYR C CE1 1 
ATOM   2438 C CE2 . TYR C 3 85  ? 13.035 10.275  -367.487 1.00 52.56  ?  85  TYR C CE2 1 
ATOM   2439 C CZ  . TYR C 3 85  ? 13.615 9.498   -368.469 1.00 54.60  ?  85  TYR C CZ  1 
ATOM   2440 O OH  . TYR C 3 85  ? 12.897 9.203   -369.606 1.00 56.92  ?  85  TYR C OH  1 
ATOM   2441 N N   . ASP C 3 86  ? 15.609 13.489  -366.470 1.00 56.05  ?  86  ASP C N   1 
ATOM   2442 C CA  . ASP C 3 86  ? 14.931 14.755  -366.764 1.00 56.47  ?  86  ASP C CA  1 
ATOM   2443 C C   . ASP C 3 86  ? 15.314 15.740  -365.667 1.00 56.81  ?  86  ASP C C   1 
ATOM   2444 O O   . ASP C 3 86  ? 16.498 15.964  -365.438 1.00 65.00  ?  86  ASP C O   1 
ATOM   2445 C CB  . ASP C 3 86  ? 13.413 14.566  -366.864 1.00 55.72  ?  86  ASP C CB  1 
ATOM   2446 C CG  . ASP C 3 86  ? 13.004 13.783  -368.119 1.00 62.62  ?  86  ASP C CG  1 
ATOM   2447 O OD1 . ASP C 3 86  ? 13.863 13.599  -369.021 1.00 55.07  ?  86  ASP C OD1 1 
ATOM   2448 O OD2 . ASP C 3 86  ? 11.821 13.379  -368.219 1.00 66.59  -1 86  ASP C OD2 1 
ATOM   2449 N N   . ASN C 3 87  ? 14.347 16.317  -364.968 1.00 57.03  ?  87  ASN C N   1 
ATOM   2450 C CA  . ASN C 3 87  ? 14.714 17.220  -363.880 1.00 61.34  ?  87  ASN C CA  1 
ATOM   2451 C C   . ASN C 3 87  ? 14.633 16.565  -362.510 1.00 59.40  ?  87  ASN C C   1 
ATOM   2452 O O   . ASN C 3 87  ? 14.635 17.257  -361.494 1.00 58.54  ?  87  ASN C O   1 
ATOM   2453 C CB  . ASN C 3 87  ? 13.839 18.474  -363.901 1.00 68.28  ?  87  ASN C CB  1 
ATOM   2454 C CG  . ASN C 3 87  ? 14.258 19.448  -364.980 1.00 68.68  ?  87  ASN C CG  1 
ATOM   2455 O OD1 . ASN C 3 87  ? 15.239 20.174  -364.824 1.00 75.31  ?  87  ASN C OD1 1 
ATOM   2456 N ND2 . ASN C 3 87  ? 13.524 19.459  -366.089 1.00 69.39  ?  87  ASN C ND2 1 
ATOM   2457 N N   . GLU C 3 88  ? 14.570 15.233  -362.489 1.00 55.58  ?  88  GLU C N   1 
ATOM   2458 C CA  . GLU C 3 88  ? 14.400 14.487  -361.243 1.00 58.51  ?  88  GLU C CA  1 
ATOM   2459 C C   . GLU C 3 88  ? 15.702 13.866  -360.748 1.00 51.08  ?  88  GLU C C   1 
ATOM   2460 O O   . GLU C 3 88  ? 16.603 13.553  -361.527 1.00 44.74  ?  88  GLU C O   1 
ATOM   2461 C CB  . GLU C 3 88  ? 13.365 13.367  -361.413 1.00 58.18  ?  88  GLU C CB  1 
ATOM   2462 C CG  . GLU C 3 88  ? 12.086 13.765  -362.119 1.00 63.14  ?  88  GLU C CG  1 
ATOM   2463 C CD  . GLU C 3 88  ? 11.477 12.603  -362.894 1.00 63.76  ?  88  GLU C CD  1 
ATOM   2464 O OE1 . GLU C 3 88  ? 11.042 12.826  -364.043 1.00 69.12  ?  88  GLU C OE1 1 
ATOM   2465 O OE2 . GLU C 3 88  ? 11.437 11.471  -362.363 1.00 64.41  -1 88  GLU C OE2 1 
ATOM   2466 N N   . THR C 3 89  ? 15.777 13.669  -359.439 1.00 50.28  ?  89  THR C N   1 
ATOM   2467 C CA  . THR C 3 89  ? 16.841 12.876  -358.856 1.00 47.42  ?  89  THR C CA  1 
ATOM   2468 C C   . THR C 3 89  ? 16.252 11.517  -358.467 1.00 47.14  ?  89  THR C C   1 
ATOM   2469 O O   . THR C 3 89  ? 15.426 11.430  -357.558 1.00 50.67  ?  89  THR C O   1 
ATOM   2470 C CB  . THR C 3 89  ? 17.476 13.584  -357.639 1.00 46.88  ?  89  THR C CB  1 
ATOM   2471 O OG1 . THR C 3 89  ? 18.130 14.780  -358.078 1.00 47.85  ?  89  THR C OG1 1 
ATOM   2472 C CG2 . THR C 3 89  ? 18.507 12.688  -356.966 1.00 43.75  ?  89  THR C CG2 1 
ATOM   2473 N N   . VAL C 3 90  ? 16.660 10.469  -359.181 1.00 39.71  ?  90  VAL C N   1 
ATOM   2474 C CA  . VAL C 3 90  ? 16.184 9.110   -358.932 1.00 38.25  ?  90  VAL C CA  1 
ATOM   2475 C C   . VAL C 3 90  ? 16.990 8.414   -357.825 1.00 44.38  ?  90  VAL C C   1 
ATOM   2476 O O   . VAL C 3 90  ? 18.219 8.292   -357.903 1.00 39.65  ?  90  VAL C O   1 
ATOM   2477 C CB  . VAL C 3 90  ? 16.253 8.230   -360.208 1.00 36.44  ?  90  VAL C CB  1 
ATOM   2478 C CG1 . VAL C 3 90  ? 15.757 6.837   -359.911 1.00 36.25  ?  90  VAL C CG1 1 
ATOM   2479 C CG2 . VAL C 3 90  ? 15.450 8.844   -361.346 1.00 37.91  ?  90  VAL C CG2 1 
ATOM   2480 N N   . THR C 3 91  ? 16.290 7.956   -356.794 1.00 45.95  ?  91  THR C N   1 
ATOM   2481 C CA  . THR C 3 91  ? 16.909 7.189   -355.715 1.00 41.83  ?  91  THR C CA  1 
ATOM   2482 C C   . THR C 3 91  ? 16.550 5.716   -355.880 1.00 41.67  ?  91  THR C C   1 
ATOM   2483 O O   . THR C 3 91  ? 15.648 5.375   -356.650 1.00 42.18  ?  91  THR C O   1 
ATOM   2484 C CB  . THR C 3 91  ? 16.435 7.671   -354.344 1.00 40.63  ?  91  THR C CB  1 
ATOM   2485 O OG1 . THR C 3 91  ? 15.045 7.353   -354.206 1.00 43.84  ?  91  THR C OG1 1 
ATOM   2486 C CG2 . THR C 3 91  ? 16.611 9.185   -354.208 1.00 36.77  ?  91  THR C CG2 1 
ATOM   2487 N N   . LEU C 3 92  ? 17.241 4.838   -355.161 1.00 37.23  ?  92  LEU C N   1 
ATOM   2488 C CA  . LEU C 3 92  ? 16.867 3.431   -355.163 1.00 38.37  ?  92  LEU C CA  1 
ATOM   2489 C C   . LEU C 3 92  ? 15.470 3.254   -354.549 1.00 41.00  ?  92  LEU C C   1 
ATOM   2490 O O   . LEU C 3 92  ? 14.713 2.369   -354.954 1.00 41.74  ?  92  LEU C O   1 
ATOM   2491 C CB  . LEU C 3 92  ? 17.899 2.590   -354.411 1.00 40.19  ?  92  LEU C CB  1 
ATOM   2492 C CG  . LEU C 3 92  ? 17.537 1.133   -354.109 1.00 40.86  ?  92  LEU C CG  1 
ATOM   2493 C CD1 . LEU C 3 92  ? 17.311 0.349   -355.375 1.00 35.91  ?  92  LEU C CD1 1 
ATOM   2494 C CD2 . LEU C 3 92  ? 18.618 0.482   -353.271 1.00 44.30  ?  92  LEU C CD2 1 
ATOM   2495 N N   . GLN C 3 93  ? 15.126 4.119   -353.599 1.00 37.57  ?  93  GLN C N   1 
ATOM   2496 C CA  . GLN C 3 93  ? 13.809 4.082   -352.960 1.00 44.50  ?  93  GLN C CA  1 
ATOM   2497 C C   . GLN C 3 93  ? 12.655 4.410   -353.928 1.00 42.94  ?  93  GLN C C   1 
ATOM   2498 O O   . GLN C 3 93  ? 11.502 4.085   -353.649 1.00 39.97  ?  93  GLN C O   1 
ATOM   2499 C CB  . GLN C 3 93  ? 13.766 5.044   -351.756 1.00 41.42  ?  93  GLN C CB  1 
ATOM   2500 C CG  . GLN C 3 93  ? 14.747 4.684   -350.634 1.00 53.49  ?  93  GLN C CG  1 
ATOM   2501 C CD  . GLN C 3 93  ? 16.196 5.098   -350.937 1.00 57.78  ?  93  GLN C CD  1 
ATOM   2502 O OE1 . GLN C 3 93  ? 16.460 6.237   -351.341 1.00 53.23  ?  93  GLN C OE1 1 
ATOM   2503 N NE2 . GLN C 3 93  ? 17.136 4.166   -350.744 1.00 53.08  ?  93  GLN C NE2 1 
ATOM   2504 N N   . ASP C 3 94  ? 12.964 5.050   -355.055 1.00 39.57  ?  94  ASP C N   1 
ATOM   2505 C CA  . ASP C 3 94  ? 11.958 5.323   -356.082 1.00 40.49  ?  94  ASP C CA  1 
ATOM   2506 C C   . ASP C 3 94  ? 11.586 4.059   -356.847 1.00 38.05  ?  94  ASP C C   1 
ATOM   2507 O O   . ASP C 3 94  ? 10.472 3.926   -357.332 1.00 45.93  ?  94  ASP C O   1 
ATOM   2508 C CB  . ASP C 3 94  ? 12.454 6.380   -357.078 1.00 38.99  ?  94  ASP C CB  1 
ATOM   2509 C CG  . ASP C 3 94  ? 12.556 7.761   -356.470 1.00 42.99  ?  94  ASP C CG  1 
ATOM   2510 O OD1 . ASP C 3 94  ? 11.757 8.071   -355.566 1.00 45.39  ?  94  ASP C OD1 1 
ATOM   2511 O OD2 . ASP C 3 94  ? 13.432 8.543   -356.902 1.00 45.01  -1 94  ASP C OD2 1 
ATOM   2512 N N   . ILE C 3 95  ? 12.528 3.136   -356.968 1.00 35.51  ?  95  ILE C N   1 
ATOM   2513 C CA  . ILE C 3 95  ? 12.359 2.029   -357.898 1.00 37.55  ?  95  ILE C CA  1 
ATOM   2514 C C   . ILE C 3 95  ? 12.437 0.631   -357.269 1.00 39.06  ?  95  ILE C C   1 
ATOM   2515 O O   . ILE C 3 95  ? 12.340 -0.377  -357.977 1.00 42.72  ?  95  ILE C O   1 
ATOM   2516 C CB  . ILE C 3 95  ? 13.421 2.106   -359.024 1.00 39.28  ?  95  ILE C CB  1 
ATOM   2517 C CG1 . ILE C 3 95  ? 14.832 1.945   -358.452 1.00 38.57  ?  95  ILE C CG1 1 
ATOM   2518 C CG2 . ILE C 3 95  ? 13.291 3.414   -359.808 1.00 38.79  ?  95  ILE C CG2 1 
ATOM   2519 C CD1 . ILE C 3 95  ? 15.926 1.879   -359.519 1.00 33.78  ?  95  ILE C CD1 1 
ATOM   2520 N N   . CYS C 3 96  ? 12.620 0.564   -355.955 1.00 35.28  ?  96  CYS C N   1 
ATOM   2521 C CA  . CYS C 3 96  ? 12.898 -0.717  -355.311 1.00 43.13  ?  96  CYS C CA  1 
ATOM   2522 C C   . CYS C 3 96  ? 11.641 -1.441  -354.826 1.00 40.60  ?  96  CYS C C   1 
ATOM   2523 O O   . CYS C 3 96  ? 10.589 -0.839  -354.626 1.00 36.23  ?  96  CYS C O   1 
ATOM   2524 C CB  . CYS C 3 96  ? 13.844 -0.519  -354.126 1.00 37.31  ?  96  CYS C CB  1 
ATOM   2525 S SG  . CYS C 3 96  ? 13.036 0.249   -352.709 1.00 44.40  ?  96  CYS C SG  1 
ATOM   2526 N N   . LEU C 3 97  ? 11.765 -2.747  -354.654 1.00 38.95  ?  97  LEU C N   1 
ATOM   2527 C CA  . LEU C 3 97  ? 10.762 -3.501  -353.933 1.00 38.24  ?  97  LEU C CA  1 
ATOM   2528 C C   . LEU C 3 97  ? 10.798 -3.060  -352.468 1.00 39.25  ?  97  LEU C C   1 
ATOM   2529 O O   . LEU C 3 97  ? 11.756 -3.327  -351.736 1.00 37.73  ?  97  LEU C O   1 
ATOM   2530 C CB  . LEU C 3 97  ? 11.014 -4.999  -354.075 1.00 41.90  ?  97  LEU C CB  1 
ATOM   2531 C CG  . LEU C 3 97  ? 10.173 -5.958  -353.238 1.00 45.35  ?  97  LEU C CG  1 
ATOM   2532 C CD1 . LEU C 3 97  ? 8.694  -5.742  -353.491 1.00 44.84  ?  97  LEU C CD1 1 
ATOM   2533 C CD2 . LEU C 3 97  ? 10.577 -7.377  -353.580 1.00 52.43  ?  97  LEU C CD2 1 
ATOM   2534 N N   . ALA C 3 98  ? 9.769  -2.332  -352.064 1.00 35.34  ?  98  ALA C N   1 
ATOM   2535 C CA  . ALA C 3 98  ? 9.588  -1.966  -350.675 1.00 38.24  ?  98  ALA C CA  1 
ATOM   2536 C C   . ALA C 3 98  ? 8.285  -2.600  -350.216 1.00 40.54  ?  98  ALA C C   1 
ATOM   2537 O O   . ALA C 3 98  ? 7.235  -1.967  -350.280 1.00 43.25  ?  98  ALA C O   1 
ATOM   2538 C CB  . ALA C 3 98  ? 9.559  -0.467  -350.512 1.00 38.95  ?  98  ALA C CB  1 
ATOM   2539 N N   . PRO C 3 99  ? 8.354  -3.868  -349.774 1.00 43.68  ?  99  PRO C N   1 
ATOM   2540 C CA  . PRO C 3 99  ? 7.192  -4.731  -349.507 1.00 47.28  ?  99  PRO C CA  1 
ATOM   2541 C C   . PRO C 3 99  ? 6.201  -4.145  -348.497 1.00 48.81  ?  99  PRO C C   1 
ATOM   2542 O O   . PRO C 3 99  ? 5.016  -4.439  -348.563 1.00 51.25  ?  99  PRO C O   1 
ATOM   2543 C CB  . PRO C 3 99  ? 7.828  -6.018  -348.952 1.00 46.28  ?  99  PRO C CB  1 
ATOM   2544 C CG  . PRO C 3 99  ? 9.177  -5.594  -348.433 1.00 44.16  ?  99  PRO C CG  1 
ATOM   2545 C CD  . PRO C 3 99  ? 9.619  -4.519  -349.389 1.00 43.84  ?  99  PRO C CD  1 
ATOM   2546 N N   . LEU C 3 100 ? 6.675  -3.317  -347.582 1.00 53.26  ?  100 LEU C N   1 
ATOM   2547 C CA  . LEU C 3 100 ? 5.801  -2.807  -346.535 1.00 60.04  ?  100 LEU C CA  1 
ATOM   2548 C C   . LEU C 3 100 ? 5.487  -1.322  -346.698 1.00 64.05  ?  100 LEU C C   1 
ATOM   2549 O O   . LEU C 3 100 ? 5.294  -0.624  -345.712 1.00 68.73  ?  100 LEU C O   1 
ATOM   2550 C CB  . LEU C 3 100 ? 6.426  -3.072  -345.163 1.00 62.92  ?  100 LEU C CB  1 
ATOM   2551 C CG  . LEU C 3 100 ? 5.928  -4.284  -344.363 1.00 61.84  ?  100 LEU C CG  1 
ATOM   2552 C CD1 . LEU C 3 100 ? 5.576  -5.467  -345.243 1.00 59.23  ?  100 LEU C CD1 1 
ATOM   2553 C CD2 . LEU C 3 100 ? 6.948  -4.686  -343.306 1.00 54.58  ?  100 LEU C CD2 1 
ATOM   2554 N N   . SER C 3 101 ? 5.433  -0.843  -347.939 1.00 53.58  ?  101 SER C N   1 
ATOM   2555 C CA  . SER C 3 101 ? 5.061  0.550   -348.208 1.00 63.31  ?  101 SER C CA  1 
ATOM   2556 C C   . SER C 3 101 ? 3.574  0.785   -347.963 1.00 63.52  ?  101 SER C C   1 
ATOM   2557 O O   . SER C 3 101 ? 2.771  -0.122  -348.141 1.00 56.53  ?  101 SER C O   1 
ATOM   2558 C CB  . SER C 3 101 ? 5.400  0.939   -349.644 1.00 55.85  ?  101 SER C CB  1 
ATOM   2559 O OG  . SER C 3 101 ? 6.726  0.592   -349.961 1.00 60.90  ?  101 SER C OG  1 
ATOM   2560 N N   . PRO C 3 102 ? 3.199  2.008   -347.556 1.00 54.62  ?  102 PRO C N   1 
ATOM   2561 C CA  . PRO C 3 102 ? 4.043  3.166   -347.234 1.00 60.07  ?  102 PRO C CA  1 
ATOM   2562 C C   . PRO C 3 102 ? 4.525  3.113   -345.786 1.00 68.87  ?  102 PRO C C   1 
ATOM   2563 O O   . PRO C 3 102 ? 5.623  3.580   -345.487 1.00 68.84  ?  102 PRO C O   1 
ATOM   2564 C CB  . PRO C 3 102 ? 3.109  4.345   -347.467 1.00 52.53  ?  102 PRO C CB  1 
ATOM   2565 C CG  . PRO C 3 102 ? 1.760  3.799   -347.141 1.00 51.97  ?  102 PRO C CG  1 
ATOM   2566 C CD  . PRO C 3 102 ? 1.766  2.343   -347.499 1.00 52.94  ?  102 PRO C CD  1 
ATOM   2567 N N   . TYR C 3 103 ? 3.654  2.609   -344.915 1.00 125.91 ?  103 TYR C N   1 
ATOM   2568 C CA  . TYR C 3 103 ? 3.982  1.934   -343.661 1.00 137.55 ?  103 TYR C CA  1 
ATOM   2569 C C   . TYR C 3 103 ? 5.484  1.839   -343.331 1.00 132.90 ?  103 TYR C C   1 
ATOM   2570 O O   . TYR C 3 103 ? 5.926  2.315   -342.287 1.00 132.63 ?  103 TYR C O   1 
ATOM   2571 C CB  . TYR C 3 103 ? 3.322  0.546   -343.747 1.00 105.99 ?  103 TYR C CB  1 
ATOM   2572 C CG  . TYR C 3 103 ? 3.621  -0.484  -342.681 1.00 110.95 ?  103 TYR C CG  1 
ATOM   2573 C CD1 . TYR C 3 103 ? 3.957  -0.126  -341.382 1.00 112.28 ?  103 TYR C CD1 1 
ATOM   2574 C CD2 . TYR C 3 103 ? 3.557  -1.839  -342.992 1.00 107.24 ?  103 TYR C CD2 1 
ATOM   2575 C CE1 . TYR C 3 103 ? 4.227  -1.096  -340.425 1.00 112.33 ?  103 TYR C CE1 1 
ATOM   2576 C CE2 . TYR C 3 103 ? 3.823  -2.805  -342.051 1.00 107.31 ?  103 TYR C CE2 1 
ATOM   2577 C CZ  . TYR C 3 103 ? 4.158  -2.434  -340.771 1.00 105.94 ?  103 TYR C CZ  1 
ATOM   2578 O OH  . TYR C 3 103 ? 4.422  -3.410  -339.837 1.00 107.94 ?  103 TYR C OH  1 
ATOM   2579 N N   . ASN C 3 104 ? 6.257  1.241   -344.233 1.00 82.50  ?  104 ASN C N   1 
ATOM   2580 C CA  . ASN C 3 104 ? 7.697  1.055   -344.064 1.00 65.86  ?  104 ASN C CA  1 
ATOM   2581 C C   . ASN C 3 104 ? 8.361  1.113   -345.442 1.00 59.39  ?  104 ASN C C   1 
ATOM   2582 O O   . ASN C 3 104 ? 8.249  0.176   -346.229 1.00 56.25  ?  104 ASN C O   1 
ATOM   2583 C CB  . ASN C 3 104 ? 7.964  -0.279  -343.342 1.00 66.10  ?  104 ASN C CB  1 
ATOM   2584 C CG  . ASN C 3 104 ? 9.450  -0.630  -343.224 1.00 54.28  ?  104 ASN C CG  1 
ATOM   2585 O OD1 . ASN C 3 104 ? 10.335 0.173   -343.519 1.00 54.17  ?  104 ASN C OD1 1 
ATOM   2586 N ND2 . ASN C 3 104 ? 9.721  -1.851  -342.775 1.00 45.17  ?  104 ASN C ND2 1 
ATOM   2587 N N   . THR C 3 105 ? 9.043  2.213   -345.743 1.00 60.17  ?  105 THR C N   1 
ATOM   2588 C CA  . THR C 3 105 ? 9.520  2.437   -347.107 1.00 62.77  ?  105 THR C CA  1 
ATOM   2589 C C   . THR C 3 105 ? 10.904 1.863   -347.382 1.00 55.81  ?  105 THR C C   1 
ATOM   2590 O O   . THR C 3 105 ? 11.452 2.067   -348.461 1.00 56.00  ?  105 THR C O   1 
ATOM   2591 C CB  . THR C 3 105 ? 9.553  3.942   -347.464 1.00 63.30  ?  105 THR C CB  1 
ATOM   2592 O OG1 . THR C 3 105 ? 10.405 4.634   -346.547 1.00 57.38  ?  105 THR C OG1 1 
ATOM   2593 C CG2 . THR C 3 105 ? 8.156  4.543   -347.413 1.00 64.53  ?  105 THR C CG2 1 
ATOM   2594 N N   . ASN C 3 106 ? 11.465 1.136   -346.424 1.00 55.35  ?  106 ASN C N   1 
ATOM   2595 C CA  . ASN C 3 106 ? 12.779 0.534   -346.622 1.00 48.97  ?  106 ASN C CA  1 
ATOM   2596 C C   . ASN C 3 106 ? 12.791 -0.506  -347.733 1.00 47.65  ?  106 ASN C C   1 
ATOM   2597 O O   . ASN C 3 106 ? 11.958 -1.414  -347.757 1.00 42.24  ?  106 ASN C O   1 
ATOM   2598 C CB  . ASN C 3 106 ? 13.274 -0.099  -345.321 1.00 46.05  ?  106 ASN C CB  1 
ATOM   2599 C CG  . ASN C 3 106 ? 13.581 0.935   -344.258 1.00 46.42  ?  106 ASN C CG  1 
ATOM   2600 O OD1 . ASN C 3 106 ? 14.171 1.974   -344.544 1.00 51.31  ?  106 ASN C OD1 1 
ATOM   2601 N ND2 . ASN C 3 106 ? 13.159 0.668   -343.032 1.00 43.87  ?  106 ASN C ND2 1 
ATOM   2602 N N   . CYS C 3 107 ? 13.747 -0.354  -348.648 1.00 44.62  ?  107 CYS C N   1 
ATOM   2603 C CA  . CYS C 3 107 ? 13.966 -1.290  -349.736 1.00 39.64  ?  107 CYS C CA  1 
ATOM   2604 C C   . CYS C 3 107 ? 14.337 -2.663  -349.209 1.00 43.86  ?  107 CYS C C   1 
ATOM   2605 O O   . CYS C 3 107 ? 15.036 -2.779  -348.208 1.00 45.35  ?  107 CYS C O   1 
ATOM   2606 C CB  . CYS C 3 107 ? 15.076 -0.778  -350.667 1.00 42.50  ?  107 CYS C CB  1 
ATOM   2607 S SG  . CYS C 3 107 ? 14.656 0.737   -351.561 1.00 65.37  ?  107 CYS C SG  1 
ATOM   2608 N N   . THR C 3 108 ? 13.867 -3.704  -349.885 1.00 41.80  ?  108 THR C N   1 
ATOM   2609 C CA  . THR C 3 108 ? 14.317 -5.047  -349.582 1.00 48.01  ?  108 THR C CA  1 
ATOM   2610 C C   . THR C 3 108 ? 15.799 -5.162  -349.919 1.00 50.71  ?  108 THR C C   1 
ATOM   2611 O O   . THR C 3 108 ? 16.186 -4.970  -351.069 1.00 49.61  ?  108 THR C O   1 
ATOM   2612 C CB  . THR C 3 108 ? 13.543 -6.116  -350.378 1.00 42.60  ?  108 THR C CB  1 
ATOM   2613 O OG1 . THR C 3 108 ? 12.168 -6.085  -350.003 1.00 45.64  ?  108 THR C OG1 1 
ATOM   2614 C CG2 . THR C 3 108 ? 14.093 -7.495  -350.084 1.00 41.66  ?  108 THR C CG2 1 
ATOM   2615 N N   . ILE C 3 109 ? 16.622 -5.459  -348.918 1.00 49.14  ?  109 ILE C N   1 
ATOM   2616 C CA  . ILE C 3 109 ? 18.006 -5.831  -349.173 1.00 51.63  ?  109 ILE C CA  1 
ATOM   2617 C C   . ILE C 3 109 ? 18.288 -7.238  -348.666 1.00 46.51  ?  109 ILE C C   1 
ATOM   2618 O O   . ILE C 3 109 ? 18.270 -7.480  -347.459 1.00 50.66  ?  109 ILE C O   1 
ATOM   2619 C CB  . ILE C 3 109 ? 19.016 -4.882  -348.495 1.00 49.74  ?  109 ILE C CB  1 
ATOM   2620 C CG1 . ILE C 3 109 ? 18.593 -3.416  -348.622 1.00 51.25  ?  109 ILE C CG1 1 
ATOM   2621 C CG2 . ILE C 3 109 ? 20.415 -5.126  -349.063 1.00 49.75  ?  109 ILE C CG2 1 
ATOM   2622 C CD1 . ILE C 3 109 ? 18.745 -2.857  -349.995 1.00 54.52  ?  109 ILE C CD1 1 
ATOM   2623 N N   . LEU C 3 110 ? 18.557 -8.163  -349.572 1.00 36.32  ?  110 LEU C N   1 
ATOM   2624 C CA  . LEU C 3 110 ? 18.983 -9.488  -349.151 1.00 37.53  ?  110 LEU C CA  1 
ATOM   2625 C C   . LEU C 3 110 ? 20.485 -9.446  -348.897 1.00 39.48  ?  110 LEU C C   1 
ATOM   2626 O O   . LEU C 3 110 ? 21.298 -9.418  -349.829 1.00 38.84  ?  110 LEU C O   1 
ATOM   2627 C CB  . LEU C 3 110 ? 18.623 -10.555 -350.184 1.00 36.98  ?  110 LEU C CB  1 
ATOM   2628 C CG  . LEU C 3 110 ? 17.145 -10.747 -350.566 1.00 43.99  ?  110 LEU C CG  1 
ATOM   2629 C CD1 . LEU C 3 110 ? 16.987 -12.028 -351.369 1.00 49.81  ?  110 LEU C CD1 1 
ATOM   2630 C CD2 . LEU C 3 110 ? 16.189 -10.743 -349.371 1.00 42.76  ?  110 LEU C CD2 1 
ATOM   2631 N N   . SER C 3 111 ? 20.835 -9.429  -347.617 1.00 40.70  ?  111 SER C N   1 
ATOM   2632 C CA  . SER C 3 111 ? 22.214 -9.278  -347.181 1.00 40.02  ?  111 SER C CA  1 
ATOM   2633 C C   . SER C 3 111 ? 22.382 -9.778  -345.743 1.00 38.30  ?  111 SER C C   1 
ATOM   2634 O O   . SER C 3 111 ? 21.471 -9.642  -344.919 1.00 34.87  ?  111 SER C O   1 
ATOM   2635 C CB  . SER C 3 111 ? 22.636 -7.814  -347.278 1.00 34.62  ?  111 SER C CB  1 
ATOM   2636 O OG  . SER C 3 111 ? 23.835 -7.579  -346.569 1.00 35.88  ?  111 SER C OG  1 
ATOM   2637 N N   . VAL C 3 112 ? 23.554 -10.332 -345.444 1.00 33.17  ?  112 VAL C N   1 
ATOM   2638 C CA  . VAL C 3 112 ? 23.848 -10.812 -344.103 1.00 37.67  ?  112 VAL C CA  1 
ATOM   2639 C C   . VAL C 3 112 ? 23.832 -9.633  -343.115 1.00 37.78  ?  112 VAL C C   1 
ATOM   2640 O O   . VAL C 3 112 ? 23.550 -9.812  -341.921 1.00 33.63  ?  112 VAL C O   1 
ATOM   2641 C CB  . VAL C 3 112 ? 25.211 -11.553 -344.053 1.00 37.83  ?  112 VAL C CB  1 
ATOM   2642 C CG1 . VAL C 3 112 ? 26.369 -10.603 -344.416 1.00 34.82  ?  112 VAL C CG1 1 
ATOM   2643 C CG2 . VAL C 3 112 ? 25.435 -12.199 -342.679 1.00 36.03  ?  112 VAL C CG2 1 
ATOM   2644 N N   . LEU C 3 113 ? 24.095 -8.429  -343.629 1.00 32.10  ?  113 LEU C N   1 
ATOM   2645 C CA  . LEU C 3 113 ? 24.046 -7.216  -342.818 1.00 32.49  ?  113 LEU C CA  1 
ATOM   2646 C C   . LEU C 3 113 ? 22.630 -6.902  -342.339 1.00 32.62  ?  113 LEU C C   1 
ATOM   2647 O O   . LEU C 3 113 ? 22.448 -6.189  -341.352 1.00 30.08  ?  113 LEU C O   1 
ATOM   2648 C CB  . LEU C 3 113 ? 24.601 -6.006  -343.588 1.00 32.92  ?  113 LEU C CB  1 
ATOM   2649 C CG  . LEU C 3 113 ? 26.122 -5.844  -343.728 1.00 35.23  ?  113 LEU C CG  1 
ATOM   2650 C CD1 . LEU C 3 113 ? 26.831 -6.018  -342.385 1.00 35.43  ?  113 LEU C CD1 1 
ATOM   2651 C CD2 . LEU C 3 113 ? 26.719 -6.773  -344.767 1.00 38.86  ?  113 LEU C CD2 1 
ATOM   2652 N N   . ASN C 3 114 ? 21.614 -7.424  -343.019 1.00 31.86  ?  114 ASN C N   1 
ATOM   2653 C CA  . ASN C 3 114 ? 20.260 -7.144  -342.547 1.00 33.33  ?  114 ASN C CA  1 
ATOM   2654 C C   . ASN C 3 114 ? 19.882 -7.910  -341.261 1.00 36.62  ?  114 ASN C C   1 
ATOM   2655 O O   . ASN C 3 114 ? 18.896 -7.556  -340.606 1.00 35.40  ?  114 ASN C O   1 
ATOM   2656 C CB  . ASN C 3 114 ? 19.235 -7.416  -343.647 1.00 35.32  ?  114 ASN C CB  1 
ATOM   2657 C CG  . ASN C 3 114 ? 18.431 -6.164  -344.010 1.00 39.34  ?  114 ASN C CG  1 
ATOM   2658 O OD1 . ASN C 3 114 ? 18.281 -5.251  -343.188 1.00 39.16  ?  114 ASN C OD1 1 
ATOM   2659 N ND2 . ASN C 3 114 ? 17.917 -6.115  -345.238 1.00 42.14  ?  114 ASN C ND2 1 
ATOM   2660 N N   . TYR C 3 115 ? 20.673 -8.916  -340.872 1.00 32.85  ?  115 TYR C N   1 
ATOM   2661 C CA  . TYR C 3 115 ? 20.464 -9.567  -339.569 1.00 35.42  ?  115 TYR C CA  1 
ATOM   2662 C C   . TYR C 3 115 ? 20.754 -8.560  -338.466 1.00 34.90  ?  115 TYR C C   1 
ATOM   2663 O O   . TYR C 3 115 ? 20.320 -8.728  -337.329 1.00 36.23  ?  115 TYR C O   1 
ATOM   2664 C CB  . TYR C 3 115 ? 21.351 -10.810 -339.381 1.00 30.74  ?  115 TYR C CB  1 
ATOM   2665 C CG  . TYR C 3 115 ? 21.031 -11.967 -340.293 1.00 30.22  ?  115 TYR C CG  1 
ATOM   2666 C CD1 . TYR C 3 115 ? 19.719 -12.338 -340.541 1.00 35.57  ?  115 TYR C CD1 1 
ATOM   2667 C CD2 . TYR C 3 115 ? 22.043 -12.683 -340.917 1.00 30.82  ?  115 TYR C CD2 1 
ATOM   2668 C CE1 . TYR C 3 115 ? 19.423 -13.403 -341.386 1.00 36.68  ?  115 TYR C CE1 1 
ATOM   2669 C CE2 . TYR C 3 115 ? 21.757 -13.746 -341.762 1.00 33.21  ?  115 TYR C CE2 1 
ATOM   2670 C CZ  . TYR C 3 115 ? 20.443 -14.102 -341.989 1.00 35.81  ?  115 TYR C CZ  1 
ATOM   2671 O OH  . TYR C 3 115 ? 20.148 -15.151 -342.839 1.00 41.56  ?  115 TYR C OH  1 
ATOM   2672 N N   . PHE C 3 116 ? 21.493 -7.511  -338.823 1.00 34.28  ?  116 PHE C N   1 
ATOM   2673 C CA  . PHE C 3 116 ? 21.821 -6.425  -337.910 1.00 31.68  ?  116 PHE C CA  1 
ATOM   2674 C C   . PHE C 3 116 ? 21.096 -5.143  -338.327 1.00 34.15  ?  116 PHE C C   1 
ATOM   2675 O O   . PHE C 3 116 ? 21.485 -4.032  -337.936 1.00 34.55  ?  116 PHE C O   1 
ATOM   2676 C CB  . PHE C 3 116 ? 23.338 -6.204  -337.867 1.00 32.97  ?  116 PHE C CB  1 
ATOM   2677 C CG  . PHE C 3 116 ? 24.116 -7.458  -337.588 1.00 34.20  ?  116 PHE C CG  1 
ATOM   2678 C CD1 . PHE C 3 116 ? 24.518 -7.762  -336.297 1.00 34.67  ?  116 PHE C CD1 1 
ATOM   2679 C CD2 . PHE C 3 116 ? 24.420 -8.350  -338.613 1.00 31.60  ?  116 PHE C CD2 1 
ATOM   2680 C CE1 . PHE C 3 116 ? 25.219 -8.926  -336.027 1.00 34.13  ?  116 PHE C CE1 1 
ATOM   2681 C CE2 . PHE C 3 116 ? 25.110 -9.524  -338.354 1.00 37.78  ?  116 PHE C CE2 1 
ATOM   2682 C CZ  . PHE C 3 116 ? 25.520 -9.813  -337.055 1.00 35.64  ?  116 PHE C CZ  1 
ATOM   2683 N N   . GLN C 3 117 ? 20.043 -5.309  -339.124 1.00 30.78  ?  117 GLN C N   1 
ATOM   2684 C CA  . GLN C 3 117 ? 19.238 -4.186  -339.612 1.00 33.03  ?  117 GLN C CA  1 
ATOM   2685 C C   . GLN C 3 117 ? 20.112 -3.104  -340.276 1.00 33.12  ?  117 GLN C C   1 
ATOM   2686 O O   . GLN C 3 117 ? 19.877 -1.903  -340.107 1.00 33.91  ?  117 GLN C O   1 
ATOM   2687 C CB  . GLN C 3 117 ? 18.412 -3.575  -338.472 1.00 29.77  ?  117 GLN C CB  1 
ATOM   2688 C CG  . GLN C 3 117 ? 17.403 -4.538  -337.833 1.00 32.14  ?  117 GLN C CG  1 
ATOM   2689 C CD  . GLN C 3 117 ? 18.078 -5.607  -336.972 1.00 33.68  ?  117 GLN C CD  1 
ATOM   2690 O OE1 . GLN C 3 117 ? 18.013 -6.807  -337.269 1.00 31.99  ?  117 GLN C OE1 1 
ATOM   2691 N NE2 . GLN C 3 117 ? 18.750 -5.169  -335.920 1.00 28.76  ?  117 GLN C NE2 1 
ATOM   2692 N N   . ASN C 3 118 ? 21.139 -3.549  -340.991 1.00 31.58  ?  118 ASN C N   1 
ATOM   2693 C CA  . ASN C 3 118 ? 21.996 -2.667  -341.774 1.00 36.36  ?  118 ASN C CA  1 
ATOM   2694 C C   . ASN C 3 118 ? 22.593 -1.536  -340.935 1.00 33.06  ?  118 ASN C C   1 
ATOM   2695 O O   . ASN C 3 118 ? 22.758 -0.418  -341.403 1.00 34.59  ?  118 ASN C O   1 
ATOM   2696 C CB  . ASN C 3 118 ? 21.203 -2.107  -342.970 1.00 30.92  ?  118 ASN C CB  1 
ATOM   2697 C CG  . ASN C 3 118 ? 20.775 -3.198  -343.944 1.00 34.60  ?  118 ASN C CG  1 
ATOM   2698 O OD1 . ASN C 3 118 ? 21.386 -4.273  -343.992 1.00 31.06  ?  118 ASN C OD1 1 
ATOM   2699 N ND2 . ASN C 3 118 ? 19.735 -2.925  -344.735 1.00 33.60  ?  118 ASN C ND2 1 
ATOM   2700 N N   . SER C 3 119 ? 22.928 -1.841  -339.690 1.00 39.10  ?  119 SER C N   1 
ATOM   2701 C CA  . SER C 3 119 ? 23.408 -0.818  -338.762 1.00 39.61  ?  119 SER C CA  1 
ATOM   2702 C C   . SER C 3 119 ? 24.785 -1.131  -338.179 1.00 38.52  ?  119 SER C C   1 
ATOM   2703 O O   . SER C 3 119 ? 25.027 -2.241  -337.695 1.00 34.04  ?  119 SER C O   1 
ATOM   2704 C CB  . SER C 3 119 ? 22.415 -0.633  -337.619 1.00 30.29  ?  119 SER C CB  1 
ATOM   2705 O OG  . SER C 3 119 ? 23.080 -0.062  -336.515 1.00 37.37  ?  119 SER C OG  1 
ATOM   2706 N N   . HIS C 3 120 ? 25.676 -0.142  -338.217 1.00 36.86  ?  120 HIS C N   1 
ATOM   2707 C CA  . HIS C 3 120 ? 27.020 -0.297  -337.663 1.00 34.88  ?  120 HIS C CA  1 
ATOM   2708 C C   . HIS C 3 120 ? 26.968 -0.555  -336.169 1.00 32.81  ?  120 HIS C C   1 
ATOM   2709 O O   . HIS C 3 120 ? 27.731 -1.363  -335.643 1.00 34.81  ?  120 HIS C O   1 
ATOM   2710 C CB  . HIS C 3 120 ? 27.882 0.940   -337.937 1.00 33.26  ?  120 HIS C CB  1 
ATOM   2711 C CG  . HIS C 3 120 ? 28.314 1.072   -339.364 1.00 40.36  ?  120 HIS C CG  1 
ATOM   2712 N ND1 . HIS C 3 120 ? 29.286 0.270   -339.924 1.00 37.36  ?  120 HIS C ND1 1 
ATOM   2713 C CD2 . HIS C 3 120 ? 27.907 1.911   -340.348 1.00 35.68  ?  120 HIS C CD2 1 
ATOM   2714 C CE1 . HIS C 3 120 ? 29.460 0.607   -341.189 1.00 35.72  ?  120 HIS C CE1 1 
ATOM   2715 N NE2 . HIS C 3 120 ? 28.632 1.597   -341.473 1.00 38.02  ?  120 HIS C NE2 1 
ATOM   2716 N N   . SER C 3 121 ? 26.069 0.134   -335.485 1.00 33.03  ?  121 SER C N   1 
ATOM   2717 C CA  . SER C 3 121 ? 26.053 0.065   -334.038 1.00 40.64  ?  121 SER C CA  1 
ATOM   2718 C C   . SER C 3 121 ? 25.462 -1.279  -333.583 1.00 40.06  ?  121 SER C C   1 
ATOM   2719 O O   . SER C 3 121 ? 25.922 -1.855  -332.604 1.00 36.11  ?  121 SER C O   1 
ATOM   2720 C CB  . SER C 3 121 ? 25.275 1.245   -333.447 1.00 39.77  ?  121 SER C CB  1 
ATOM   2721 O OG  . SER C 3 121 ? 23.884 0.988   -333.430 1.00 49.87  ?  121 SER C OG  1 
ATOM   2722 N N   . VAL C 3 122 ? 24.464 -1.782  -334.310 1.00 34.70  ?  122 VAL C N   1 
ATOM   2723 C CA  . VAL C 3 122 ? 23.894 -3.095  -334.007 1.00 34.97  ?  122 VAL C CA  1 
ATOM   2724 C C   . VAL C 3 122 ? 24.935 -4.199  -334.253 1.00 35.93  ?  122 VAL C C   1 
ATOM   2725 O O   . VAL C 3 122 ? 25.069 -5.145  -333.463 1.00 33.04  ?  122 VAL C O   1 
ATOM   2726 C CB  . VAL C 3 122 ? 22.608 -3.363  -334.841 1.00 37.82  ?  122 VAL C CB  1 
ATOM   2727 C CG1 . VAL C 3 122 ? 22.117 -4.796  -334.645 1.00 34.57  ?  122 VAL C CG1 1 
ATOM   2728 C CG2 . VAL C 3 122 ? 21.494 -2.358  -334.457 1.00 34.19  ?  122 VAL C CG2 1 
ATOM   2729 N N   . LEU C 3 123 ? 25.686 -4.055  -335.341 1.00 31.18  ?  123 LEU C N   1 
ATOM   2730 C CA  . LEU C 3 123 ? 26.756 -4.981  -335.665 1.00 32.85  ?  123 LEU C CA  1 
ATOM   2731 C C   . LEU C 3 123 ? 27.796 -5.057  -334.532 1.00 36.79  ?  123 LEU C C   1 
ATOM   2732 O O   . LEU C 3 123 ? 28.372 -6.120  -334.272 1.00 30.54  ?  123 LEU C O   1 
ATOM   2733 C CB  . LEU C 3 123 ? 27.420 -4.563  -336.979 1.00 30.36  ?  123 LEU C CB  1 
ATOM   2734 C CG  . LEU C 3 123 ? 28.483 -5.460  -337.593 1.00 35.81  ?  123 LEU C CG  1 
ATOM   2735 C CD1 . LEU C 3 123 ? 27.971 -6.879  -337.764 1.00 31.33  ?  123 LEU C CD1 1 
ATOM   2736 C CD2 . LEU C 3 123 ? 28.958 -4.880  -338.950 1.00 37.22  ?  123 LEU C CD2 1 
ATOM   2737 N N   . ASP C 3 124 ? 28.017 -3.924  -333.866 1.00 31.72  ?  124 ASP C N   1 
ATOM   2738 C CA  . ASP C 3 124 ? 28.965 -3.826  -332.765 1.00 34.15  ?  124 ASP C CA  1 
ATOM   2739 C C   . ASP C 3 124 ? 28.356 -4.144  -331.390 1.00 35.40  ?  124 ASP C C   1 
ATOM   2740 O O   . ASP C 3 124 ? 29.085 -4.161  -330.403 1.00 34.72  ?  124 ASP C O   1 
ATOM   2741 C CB  . ASP C 3 124 ? 29.575 -2.421  -332.722 1.00 42.89  ?  124 ASP C CB  1 
ATOM   2742 C CG  . ASP C 3 124 ? 30.709 -2.236  -333.719 1.00 42.91  ?  124 ASP C CG  1 
ATOM   2743 O OD1 . ASP C 3 124 ? 31.163 -3.231  -334.317 1.00 41.85  ?  124 ASP C OD1 1 
ATOM   2744 O OD2 . ASP C 3 124 ? 31.139 -1.083  -333.913 1.00 49.37  -1 124 ASP C OD2 1 
ATOM   2745 N N   . HIS C 3 125 ? 27.041 -4.379  -331.324 1.00 34.77  ?  125 HIS C N   1 
ATOM   2746 C CA  . HIS C 3 125 ? 26.384 -4.755  -330.054 1.00 38.52  ?  125 HIS C CA  1 
ATOM   2747 C C   . HIS C 3 125 ? 27.122 -5.888  -329.374 1.00 36.85  ?  125 HIS C C   1 
ATOM   2748 O O   . HIS C 3 125 ? 27.391 -6.920  -329.989 1.00 38.62  ?  125 HIS C O   1 
ATOM   2749 C CB  . HIS C 3 125 ? 24.929 -5.182  -330.258 1.00 34.91  ?  125 HIS C CB  1 
ATOM   2750 C CG  . HIS C 3 125 ? 23.971 -4.042  -330.342 1.00 34.78  ?  125 HIS C CG  1 
ATOM   2751 N ND1 . HIS C 3 125 ? 22.625 -4.218  -330.581 1.00 37.62  ?  125 HIS C ND1 1 
ATOM   2752 C CD2 . HIS C 3 125 ? 24.161 -2.708  -330.216 1.00 34.94  ?  125 HIS C CD2 1 
ATOM   2753 C CE1 . HIS C 3 125 ? 22.026 -3.041  -330.606 1.00 38.62  ?  125 HIS C CE1 1 
ATOM   2754 N NE2 . HIS C 3 125 ? 22.936 -2.107  -330.390 1.00 44.59  ?  125 HIS C NE2 1 
ATOM   2755 N N   . LYS C 3 126 ? 27.447 -5.682  -328.103 1.00 42.87  ?  126 LYS C N   1 
ATOM   2756 C CA  . LYS C 3 126 ? 28.237 -6.634  -327.350 1.00 40.05  ?  126 LYS C CA  1 
ATOM   2757 C C   . LYS C 3 126 ? 27.833 -6.620  -325.886 1.00 40.86  ?  126 LYS C C   1 
ATOM   2758 O O   . LYS C 3 126 ? 27.788 -5.573  -325.268 1.00 41.71  ?  126 LYS C O   1 
ATOM   2759 C CB  . LYS C 3 126 ? 29.727 -6.310  -327.488 1.00 39.99  ?  126 LYS C CB  1 
ATOM   2760 C CG  . LYS C 3 126 ? 30.657 -7.371  -326.924 1.00 44.14  ?  126 LYS C CG  1 
ATOM   2761 C CD  . LYS C 3 126 ? 32.078 -7.138  -327.399 1.00 47.75  ?  126 LYS C CD  1 
ATOM   2762 C CE  . LYS C 3 126 ? 32.935 -6.457  -326.355 1.00 51.81  ?  126 LYS C CE  1 
ATOM   2763 N NZ  . LYS C 3 126 ? 33.719 -7.454  -325.564 1.00 50.77  ?  126 LYS C NZ  1 
ATOM   2764 N N   . LYS C 3 127 ? 27.529 -7.786  -325.333 1.00 42.26  ?  127 LYS C N   1 
ATOM   2765 C CA  . LYS C 3 127 ? 27.289 -7.887  -323.902 1.00 38.53  ?  127 LYS C CA  1 
ATOM   2766 C C   . LYS C 3 127 ? 28.369 -8.790  -323.330 1.00 42.08  ?  127 LYS C C   1 
ATOM   2767 O O   . LYS C 3 127 ? 28.377 -10.000 -323.597 1.00 36.09  ?  127 LYS C O   1 
ATOM   2768 C CB  . LYS C 3 127 ? 25.887 -8.433  -323.611 1.00 43.52  ?  127 LYS C CB  1 
ATOM   2769 C CG  . LYS C 3 127 ? 25.551 -8.608  -322.134 1.00 48.40  ?  127 LYS C CG  1 
ATOM   2770 C CD  . LYS C 3 127 ? 25.437 -7.259  -321.429 1.00 54.76  ?  127 LYS C CD  1 
ATOM   2771 C CE  . LYS C 3 127 ? 25.091 -7.421  -319.943 1.00 55.42  ?  127 LYS C CE  1 
ATOM   2772 N NZ  . LYS C 3 127 ? 25.065 -6.096  -319.252 1.00 63.95  ?  127 LYS C NZ  1 
ATOM   2773 N N   . GLY C 3 128 ? 29.303 -8.193  -322.586 1.00 32.73  ?  128 GLY C N   1 
ATOM   2774 C CA  . GLY C 3 128 ? 30.368 -8.943  -321.954 1.00 30.62  ?  128 GLY C CA  1 
ATOM   2775 C C   . GLY C 3 128 ? 30.871 -8.278  -320.693 1.00 34.30  ?  128 GLY C C   1 
ATOM   2776 O O   . GLY C 3 128 ? 30.521 -7.135  -320.423 1.00 29.91  ?  128 GLY C O   1 
ATOM   2777 N N   . ASP C 3 129 ? 31.690 -8.999  -319.921 1.00 35.25  ?  129 ASP C N   1 
ATOM   2778 C CA  . ASP C 3 129 ? 32.294 -8.461  -318.703 1.00 33.22  ?  129 ASP C CA  1 
ATOM   2779 C C   . ASP C 3 129 ? 33.767 -8.878  -318.609 1.00 34.53  ?  129 ASP C C   1 
ATOM   2780 O O   . ASP C 3 129 ? 34.391 -9.186  -319.619 1.00 38.81  ?  129 ASP C O   1 
ATOM   2781 C CB  . ASP C 3 129 ? 31.513 -8.922  -317.454 1.00 38.31  ?  129 ASP C CB  1 
ATOM   2782 C CG  . ASP C 3 129 ? 31.350 -10.452 -317.370 1.00 39.21  ?  129 ASP C CG  1 
ATOM   2783 O OD1 . ASP C 3 129 ? 30.301 -10.905 -316.865 1.00 42.20  ?  129 ASP C OD1 1 
ATOM   2784 O OD2 . ASP C 3 129 ? 32.253 -11.205 -317.799 1.00 33.73  ?  129 ASP C OD2 1 
ATOM   2785 N N   . ASP C 3 130 ? 34.317 -8.911  -317.399 1.00 36.47  ?  130 ASP C N   1 
ATOM   2786 C CA  . ASP C 3 130 ? 35.725 -9.262  -317.215 1.00 37.51  ?  130 ASP C CA  1 
ATOM   2787 C C   . ASP C 3 130 ? 36.003 -10.733 -317.484 1.00 35.69  ?  130 ASP C C   1 
ATOM   2788 O O   . ASP C 3 130 ? 37.155 -11.145 -317.525 1.00 38.15  ?  130 ASP C O   1 
ATOM   2789 C CB  . ASP C 3 130 ? 36.195 -8.925  -315.792 1.00 40.55  ?  130 ASP C CB  1 
ATOM   2790 C CG  . ASP C 3 130 ? 36.250 -7.439  -315.527 1.00 46.61  ?  130 ASP C CG  1 
ATOM   2791 O OD1 . ASP C 3 130 ? 36.530 -6.673  -316.474 1.00 51.94  ?  130 ASP C OD1 1 
ATOM   2792 O OD2 . ASP C 3 130 ? 36.013 -7.036  -314.365 1.00 56.16  ?  130 ASP C OD2 1 
ATOM   2793 N N   . PHE C 3 131 ? 34.946 -11.516 -317.666 1.00 33.59  ?  131 PHE C N   1 
ATOM   2794 C CA  . PHE C 3 131 ? 35.062 -12.964 -317.723 1.00 31.03  ?  131 PHE C CA  1 
ATOM   2795 C C   . PHE C 3 131 ? 34.591 -13.546 -319.042 1.00 32.96  ?  131 PHE C C   1 
ATOM   2796 O O   . PHE C 3 131 ? 35.319 -14.293 -319.678 1.00 33.55  ?  131 PHE C O   1 
ATOM   2797 C CB  . PHE C 3 131 ? 34.274 -13.602 -316.565 1.00 32.31  ?  131 PHE C CB  1 
ATOM   2798 C CG  . PHE C 3 131 ? 35.037 -13.653 -315.284 1.00 31.15  ?  131 PHE C CG  1 
ATOM   2799 C CD1 . PHE C 3 131 ? 35.637 -14.830 -314.873 1.00 28.27  ?  131 PHE C CD1 1 
ATOM   2800 C CD2 . PHE C 3 131 ? 35.175 -12.523 -314.500 1.00 31.14  ?  131 PHE C CD2 1 
ATOM   2801 C CE1 . PHE C 3 131 ? 36.350 -14.884 -313.692 1.00 29.33  ?  131 PHE C CE1 1 
ATOM   2802 C CE2 . PHE C 3 131 ? 35.890 -12.565 -313.320 1.00 35.62  ?  131 PHE C CE2 1 
ATOM   2803 C CZ  . PHE C 3 131 ? 36.488 -13.750 -312.916 1.00 32.07  ?  131 PHE C CZ  1 
ATOM   2804 N N   . PHE C 3 132 ? 33.363 -13.229 -319.440 1.00 31.88  ?  132 PHE C N   1 
ATOM   2805 C CA  . PHE C 3 132 ? 32.848 -13.729 -320.707 1.00 32.24  ?  132 PHE C CA  1 
ATOM   2806 C C   . PHE C 3 132 ? 32.349 -12.621 -321.629 1.00 32.04  ?  132 PHE C C   1 
ATOM   2807 O O   . PHE C 3 132 ? 32.007 -11.522 -321.187 1.00 32.25  ?  132 PHE C O   1 
ATOM   2808 C CB  . PHE C 3 132 ? 31.696 -14.713 -320.487 1.00 29.80  ?  132 PHE C CB  1 
ATOM   2809 C CG  . PHE C 3 132 ? 32.055 -15.914 -319.657 1.00 32.89  ?  132 PHE C CG  1 
ATOM   2810 C CD1 . PHE C 3 132 ? 31.817 -15.921 -318.285 1.00 32.82  ?  132 PHE C CD1 1 
ATOM   2811 C CD2 . PHE C 3 132 ? 32.606 -17.044 -320.245 1.00 28.80  ?  132 PHE C CD2 1 
ATOM   2812 C CE1 . PHE C 3 132 ? 32.132 -17.037 -317.514 1.00 32.02  ?  132 PHE C CE1 1 
ATOM   2813 C CE2 . PHE C 3 132 ? 32.918 -18.165 -319.486 1.00 29.65  ?  132 PHE C CE2 1 
ATOM   2814 C CZ  . PHE C 3 132 ? 32.684 -18.165 -318.117 1.00 29.00  ?  132 PHE C CZ  1 
ATOM   2815 N N   . VAL C 3 133 ? 32.321 -12.938 -322.920 1.00 32.73  ?  133 VAL C N   1 
ATOM   2816 C CA  . VAL C 3 133 ? 31.482 -12.239 -323.881 1.00 31.37  ?  133 VAL C CA  1 
ATOM   2817 C C   . VAL C 3 133 ? 30.249 -13.110 -324.048 1.00 29.05  ?  133 VAL C C   1 
ATOM   2818 O O   . VAL C 3 133 ? 30.337 -14.229 -324.562 1.00 31.48  ?  133 VAL C O   1 
ATOM   2819 C CB  . VAL C 3 133 ? 32.181 -12.029 -325.242 1.00 34.69  ?  133 VAL C CB  1 
ATOM   2820 C CG1 . VAL C 3 133 ? 31.214 -11.377 -326.241 1.00 34.24  ?  133 VAL C CG1 1 
ATOM   2821 C CG2 . VAL C 3 133 ? 33.459 -11.209 -325.074 1.00 27.01  ?  133 VAL C CG2 1 
ATOM   2822 N N   . TYR C 3 134 ? 29.106 -12.619 -323.584 1.00 30.32  ?  134 TYR C N   1 
ATOM   2823 C CA  . TYR C 3 134 ? 27.899 -13.434 -323.519 1.00 29.18  ?  134 TYR C CA  1 
ATOM   2824 C C   . TYR C 3 134 ? 27.144 -13.430 -324.837 1.00 33.61  ?  134 TYR C C   1 
ATOM   2825 O O   . TYR C 3 134 ? 26.396 -14.357 -325.131 1.00 37.66  ?  134 TYR C O   1 
ATOM   2826 C CB  . TYR C 3 134 ? 26.982 -12.941 -322.400 1.00 29.78  ?  134 TYR C CB  1 
ATOM   2827 C CG  . TYR C 3 134 ? 27.623 -12.967 -321.043 1.00 31.71  ?  134 TYR C CG  1 
ATOM   2828 C CD1 . TYR C 3 134 ? 27.804 -14.174 -320.363 1.00 32.47  ?  134 TYR C CD1 1 
ATOM   2829 C CD2 . TYR C 3 134 ? 28.049 -11.795 -320.428 1.00 30.08  ?  134 TYR C CD2 1 
ATOM   2830 C CE1 . TYR C 3 134 ? 28.403 -14.212 -319.118 1.00 28.44  ?  134 TYR C CE1 1 
ATOM   2831 C CE2 . TYR C 3 134 ? 28.640 -11.826 -319.165 1.00 30.22  ?  134 TYR C CE2 1 
ATOM   2832 C CZ  . TYR C 3 134 ? 28.815 -13.039 -318.521 1.00 29.83  ?  134 TYR C CZ  1 
ATOM   2833 O OH  . TYR C 3 134 ? 29.404 -13.094 -317.277 1.00 31.47  ?  134 TYR C OH  1 
ATOM   2834 N N   . ALA C 3 135 ? 27.347 -12.376 -325.619 1.00 30.83  ?  135 ALA C N   1 
ATOM   2835 C CA  . ALA C 3 135 ? 26.586 -12.138 -326.848 1.00 31.45  ?  135 ALA C CA  1 
ATOM   2836 C C   . ALA C 3 135 ? 27.312 -11.116 -327.706 1.00 28.62  ?  135 ALA C C   1 
ATOM   2837 O O   . ALA C 3 135 ? 27.813 -10.121 -327.192 1.00 31.89  ?  135 ALA C O   1 
ATOM   2838 C CB  . ALA C 3 135 ? 25.174 -11.648 -326.529 1.00 30.91  ?  135 ALA C CB  1 
ATOM   2839 N N   . ASP C 3 136 ? 27.381 -11.370 -329.006 1.00 37.13  ?  136 ASP C N   1 
ATOM   2840 C CA  . ASP C 3 136 ? 27.951 -10.413 -329.942 1.00 39.17  ?  136 ASP C CA  1 
ATOM   2841 C C   . ASP C 3 136 ? 27.430 -10.744 -331.333 1.00 37.93  ?  136 ASP C C   1 
ATOM   2842 O O   . ASP C 3 136 ? 26.417 -11.444 -331.462 1.00 39.58  ?  136 ASP C O   1 
ATOM   2843 C CB  . ASP C 3 136 ? 29.485 -10.431 -329.888 1.00 39.02  ?  136 ASP C CB  1 
ATOM   2844 C CG  . ASP C 3 136 ? 30.078 -11.726 -330.428 1.00 38.54  ?  136 ASP C CG  1 
ATOM   2845 O OD1 . ASP C 3 136 ? 29.329 -12.710 -330.615 1.00 38.04  ?  136 ASP C OD1 1 
ATOM   2846 O OD2 . ASP C 3 136 ? 31.303 -11.764 -330.650 1.00 38.48  -1 136 ASP C OD2 1 
ATOM   2847 N N   . TYR C 3 137 ? 28.118 -10.271 -332.371 1.00 34.30  ?  137 TYR C N   1 
ATOM   2848 C CA  . TYR C 3 137 ? 27.619 -10.453 -333.734 1.00 31.87  ?  137 TYR C CA  1 
ATOM   2849 C C   . TYR C 3 137 ? 27.721 -11.913 -334.151 1.00 29.39  ?  137 TYR C C   1 
ATOM   2850 O O   . TYR C 3 137 ? 26.888 -12.397 -334.921 1.00 32.94  ?  137 TYR C O   1 
ATOM   2851 C CB  . TYR C 3 137 ? 28.371 -9.540  -334.724 1.00 31.22  ?  137 TYR C CB  1 
ATOM   2852 C CG  . TYR C 3 137 ? 29.703 -10.066 -335.203 1.00 29.93  ?  137 TYR C CG  1 
ATOM   2853 C CD1 . TYR C 3 137 ? 29.812 -10.740 -336.422 1.00 29.49  ?  137 TYR C CD1 1 
ATOM   2854 C CD2 . TYR C 3 137 ? 30.856 -9.900  -334.437 1.00 30.40  ?  137 TYR C CD2 1 
ATOM   2855 C CE1 . TYR C 3 137 ? 31.041 -11.226 -336.868 1.00 30.39  ?  137 TYR C CE1 1 
ATOM   2856 C CE2 . TYR C 3 137 ? 32.088 -10.382 -334.877 1.00 31.95  ?  137 TYR C CE2 1 
ATOM   2857 C CZ  . TYR C 3 137 ? 32.174 -11.047 -336.088 1.00 32.47  ?  137 TYR C CZ  1 
ATOM   2858 O OH  . TYR C 3 137 ? 33.396 -11.529 -336.515 1.00 33.16  ?  137 TYR C OH  1 
ATOM   2859 N N   . HIS C 3 138 ? 28.745 -12.604 -333.641 1.00 35.11  ?  138 HIS C N   1 
ATOM   2860 C CA  . HIS C 3 138 ? 28.919 -14.046 -333.855 1.00 37.48  ?  138 HIS C CA  1 
ATOM   2861 C C   . HIS C 3 138 ? 27.671 -14.823 -333.455 1.00 35.40  ?  138 HIS C C   1 
ATOM   2862 O O   . HIS C 3 138 ? 27.110 -15.585 -334.251 1.00 36.41  ?  138 HIS C O   1 
ATOM   2863 C CB  . HIS C 3 138 ? 30.093 -14.610 -333.036 1.00 36.01  ?  138 HIS C CB  1 
ATOM   2864 C CG  . HIS C 3 138 ? 31.448 -14.130 -333.456 1.00 36.02  ?  138 HIS C CG  1 
ATOM   2865 N ND1 . HIS C 3 138 ? 32.156 -13.185 -332.741 1.00 35.81  ?  138 HIS C ND1 1 
ATOM   2866 C CD2 . HIS C 3 138 ? 32.263 -14.525 -334.465 1.00 36.22  ?  138 HIS C CD2 1 
ATOM   2867 C CE1 . HIS C 3 138 ? 33.333 -12.995 -333.311 1.00 34.26  ?  138 HIS C CE1 1 
ATOM   2868 N NE2 . HIS C 3 138 ? 33.426 -13.802 -334.353 1.00 37.04  ?  138 HIS C NE2 1 
ATOM   2869 N N   . THR C 3 139 ? 27.256 -14.648 -332.200 1.00 35.59  ?  139 THR C N   1 
ATOM   2870 C CA  . THR C 3 139 ? 26.140 -15.429 -331.672 1.00 32.53  ?  139 THR C CA  1 
ATOM   2871 C C   . THR C 3 139 ? 24.841 -14.976 -332.319 1.00 37.67  ?  139 THR C C   1 
ATOM   2872 O O   . THR C 3 139 ? 23.947 -15.785 -332.554 1.00 38.62  ?  139 THR C O   1 
ATOM   2873 C CB  . THR C 3 139 ? 26.033 -15.345 -330.113 1.00 34.28  ?  139 THR C CB  1 
ATOM   2874 O OG1 . THR C 3 139 ? 25.841 -13.995 -329.676 1.00 31.66  ?  139 THR C OG1 1 
ATOM   2875 C CG2 . THR C 3 139 ? 27.286 -15.901 -329.464 1.00 38.58  ?  139 THR C CG2 1 
ATOM   2876 N N   . HIS C 3 140 ? 24.738 -13.684 -332.624 1.00 36.45  ?  140 HIS C N   1 
ATOM   2877 C CA  . HIS C 3 140 ? 23.562 -13.201 -333.331 1.00 36.40  ?  140 HIS C CA  1 
ATOM   2878 C C   . HIS C 3 140 ? 23.482 -13.838 -334.722 1.00 33.50  ?  140 HIS C C   1 
ATOM   2879 O O   . HIS C 3 140 ? 22.418 -14.285 -335.152 1.00 32.43  ?  140 HIS C O   1 
ATOM   2880 C CB  . HIS C 3 140 ? 23.575 -11.685 -333.441 1.00 35.27  ?  140 HIS C CB  1 
ATOM   2881 C CG  . HIS C 3 140 ? 22.300 -11.117 -333.980 1.00 36.67  ?  140 HIS C CG  1 
ATOM   2882 N ND1 . HIS C 3 140 ? 21.116 -11.153 -333.276 1.00 36.57  ?  140 HIS C ND1 1 
ATOM   2883 C CD2 . HIS C 3 140 ? 22.024 -10.493 -335.151 1.00 35.81  ?  140 HIS C CD2 1 
ATOM   2884 C CE1 . HIS C 3 140 ? 20.164 -10.578 -333.989 1.00 36.89  ?  140 HIS C CE1 1 
ATOM   2885 N NE2 . HIS C 3 140 ? 20.689 -10.167 -335.130 1.00 37.45  ?  140 HIS C NE2 1 
ATOM   2886 N N   . PHE C 3 141 ? 24.620 -13.897 -335.407 1.00 33.89  ?  141 PHE C N   1 
ATOM   2887 C CA  . PHE C 3 141 ? 24.701 -14.593 -336.698 1.00 32.66  ?  141 PHE C CA  1 
ATOM   2888 C C   . PHE C 3 141 ? 24.269 -16.061 -336.604 1.00 33.20  ?  141 PHE C C   1 
ATOM   2889 O O   . PHE C 3 141 ? 23.409 -16.509 -337.360 1.00 33.41  ?  141 PHE C O   1 
ATOM   2890 C CB  . PHE C 3 141 ? 26.128 -14.515 -337.263 1.00 28.51  ?  141 PHE C CB  1 
ATOM   2891 C CG  . PHE C 3 141 ? 26.320 -15.298 -338.537 1.00 30.55  ?  141 PHE C CG  1 
ATOM   2892 C CD1 . PHE C 3 141 ? 26.751 -16.622 -338.502 1.00 28.94  ?  141 PHE C CD1 1 
ATOM   2893 C CD2 . PHE C 3 141 ? 26.072 -14.708 -339.772 1.00 30.57  ?  141 PHE C CD2 1 
ATOM   2894 C CE1 . PHE C 3 141 ? 26.936 -17.357 -339.681 1.00 36.31  ?  141 PHE C CE1 1 
ATOM   2895 C CE2 . PHE C 3 141 ? 26.254 -15.424 -340.951 1.00 34.09  ?  141 PHE C CE2 1 
ATOM   2896 C CZ  . PHE C 3 141 ? 26.686 -16.754 -340.907 1.00 38.03  ?  141 PHE C CZ  1 
ATOM   2897 N N   . LEU C 3 142 ? 24.871 -16.806 -335.678 1.00 36.14  ?  142 LEU C N   1 
ATOM   2898 C CA  . LEU C 3 142 ? 24.599 -18.242 -335.569 1.00 37.50  ?  142 LEU C CA  1 
ATOM   2899 C C   . LEU C 3 142 ? 23.128 -18.527 -335.308 1.00 37.51  ?  142 LEU C C   1 
ATOM   2900 O O   . LEU C 3 142 ? 22.565 -19.478 -335.859 1.00 43.18  ?  142 LEU C O   1 
ATOM   2901 C CB  . LEU C 3 142 ? 25.460 -18.866 -334.471 1.00 39.98  ?  142 LEU C CB  1 
ATOM   2902 C CG  . LEU C 3 142 ? 26.930 -18.954 -334.885 1.00 44.90  ?  142 LEU C CG  1 
ATOM   2903 C CD1 . LEU C 3 142 ? 27.827 -19.254 -333.686 1.00 39.36  ?  142 LEU C CD1 1 
ATOM   2904 C CD2 . LEU C 3 142 ? 27.117 -19.984 -336.008 1.00 36.11  ?  142 LEU C CD2 1 
ATOM   2905 N N   . TYR C 3 143 ? 22.501 -17.689 -334.489 1.00 34.27  ?  143 TYR C N   1 
ATOM   2906 C CA  . TYR C 3 143 ? 21.074 -17.811 -334.231 1.00 35.96  ?  143 TYR C CA  1 
ATOM   2907 C C   . TYR C 3 143 ? 20.236 -17.400 -335.456 1.00 41.45  ?  143 TYR C C   1 
ATOM   2908 O O   . TYR C 3 143 ? 19.323 -18.124 -335.869 1.00 41.09  ?  143 TYR C O   1 
ATOM   2909 C CB  . TYR C 3 143 ? 20.674 -16.967 -333.002 1.00 36.07  ?  143 TYR C CB  1 
ATOM   2910 C CG  . TYR C 3 143 ? 19.182 -16.976 -332.738 1.00 39.85  ?  143 TYR C CG  1 
ATOM   2911 C CD1 . TYR C 3 143 ? 18.608 -17.902 -331.866 1.00 41.38  ?  143 TYR C CD1 1 
ATOM   2912 C CD2 . TYR C 3 143 ? 18.339 -16.071 -333.382 1.00 39.32  ?  143 TYR C CD2 1 
ATOM   2913 C CE1 . TYR C 3 143 ? 17.224 -17.915 -331.639 1.00 41.65  ?  143 TYR C CE1 1 
ATOM   2914 C CE2 . TYR C 3 143 ? 16.974 -16.077 -333.166 1.00 41.01  ?  143 TYR C CE2 1 
ATOM   2915 C CZ  . TYR C 3 143 ? 16.418 -16.999 -332.300 1.00 43.69  ?  143 TYR C CZ  1 
ATOM   2916 O OH  . TYR C 3 143 ? 15.057 -16.984 -332.103 1.00 51.97  ?  143 TYR C OH  1 
ATOM   2917 N N   . CYS C 3 144 ? 20.543 -16.239 -336.035 1.00 36.59  ?  144 CYS C N   1 
ATOM   2918 C CA  . CYS C 3 144 ? 19.693 -15.671 -337.089 1.00 36.31  ?  144 CYS C CA  1 
ATOM   2919 C C   . CYS C 3 144 ? 19.623 -16.525 -338.352 1.00 35.44  ?  144 CYS C C   1 
ATOM   2920 O O   . CYS C 3 144 ? 18.604 -16.524 -339.040 1.00 39.63  ?  144 CYS C O   1 
ATOM   2921 C CB  . CYS C 3 144 ? 20.164 -14.260 -337.465 1.00 33.57  ?  144 CYS C CB  1 
ATOM   2922 S SG  . CYS C 3 144 ? 19.710 -12.993 -336.280 1.00 42.14  ?  144 CYS C SG  1 
ATOM   2923 N N   . VAL C 3 145 ? 20.694 -17.243 -338.670 1.00 35.90  ?  145 VAL C N   1 
ATOM   2924 C CA  . VAL C 3 145 ? 20.673 -18.080 -339.868 1.00 36.32  ?  145 VAL C CA  1 
ATOM   2925 C C   . VAL C 3 145 ? 19.758 -19.301 -339.663 1.00 40.96  ?  145 VAL C C   1 
ATOM   2926 O O   . VAL C 3 145 ? 19.295 -19.908 -340.632 1.00 42.48  ?  145 VAL C O   1 
ATOM   2927 C CB  . VAL C 3 145 ? 22.104 -18.534 -340.278 1.00 36.21  ?  145 VAL C CB  1 
ATOM   2928 C CG1 . VAL C 3 145 ? 22.951 -17.323 -340.683 1.00 36.14  ?  145 VAL C CG1 1 
ATOM   2929 C CG2 . VAL C 3 145 ? 22.793 -19.325 -339.168 1.00 35.12  ?  145 VAL C CG2 1 
ATOM   2930 N N   . ARG C 3 146 ? 19.484 -19.646 -338.403 1.00 43.59  ?  146 ARG C N   1 
ATOM   2931 C CA  . ARG C 3 146 ? 18.578 -20.755 -338.089 1.00 46.92  ?  146 ARG C CA  1 
ATOM   2932 C C   . ARG C 3 146 ? 17.128 -20.310 -337.966 1.00 47.01  ?  146 ARG C C   1 
ATOM   2933 O O   . ARG C 3 146 ? 16.211 -21.072 -338.265 1.00 52.32  ?  146 ARG C O   1 
ATOM   2934 C CB  . ARG C 3 146 ? 18.998 -21.455 -336.794 1.00 49.07  ?  146 ARG C CB  1 
ATOM   2935 C CG  . ARG C 3 146 ? 20.234 -22.323 -336.924 1.00 58.55  ?  146 ARG C CG  1 
ATOM   2936 C CD  . ARG C 3 146 ? 20.624 -22.893 -335.561 1.00 71.34  ?  146 ARG C CD  1 
ATOM   2937 N NE  . ARG C 3 146 ? 21.333 -24.165 -335.684 1.00 84.50  ?  146 ARG C NE  1 
ATOM   2938 C CZ  . ARG C 3 146 ? 21.672 -24.933 -334.656 1.00 88.63  ?  146 ARG C CZ  1 
ATOM   2939 N NH1 . ARG C 3 146 ? 21.352 -24.566 -333.420 1.00 86.08  ?  146 ARG C NH1 1 
ATOM   2940 N NH2 . ARG C 3 146 ? 22.317 -26.076 -334.864 1.00 89.97  ?  146 ARG C NH2 1 
ATOM   2941 N N   . ALA C 3 147 ? 16.929 -19.079 -337.507 1.00 46.12  ?  147 ALA C N   1 
ATOM   2942 C CA  . ALA C 3 147 ? 15.592 -18.525 -337.338 1.00 41.08  ?  147 ALA C CA  1 
ATOM   2943 C C   . ALA C 3 147 ? 15.502 -17.102 -337.891 1.00 41.55  ?  147 ALA C C   1 
ATOM   2944 O O   . ALA C 3 147 ? 15.341 -16.146 -337.127 1.00 41.56  ?  147 ALA C O   1 
ATOM   2945 C CB  . ALA C 3 147 ? 15.196 -18.550 -335.856 1.00 43.51  ?  147 ALA C CB  1 
ATOM   2946 N N   . PRO C 3 148 ? 15.580 -16.958 -339.224 1.00 46.83  ?  148 PRO C N   1 
ATOM   2947 C CA  . PRO C 3 148 ? 15.635 -15.628 -339.851 1.00 44.13  ?  148 PRO C CA  1 
ATOM   2948 C C   . PRO C 3 148 ? 14.434 -14.725 -339.565 1.00 45.32  ?  148 PRO C C   1 
ATOM   2949 O O   . PRO C 3 148 ? 14.565 -13.507 -339.708 1.00 41.18  ?  148 PRO C O   1 
ATOM   2950 C CB  . PRO C 3 148 ? 15.722 -15.945 -341.349 1.00 45.66  ?  148 PRO C CB  1 
ATOM   2951 C CG  . PRO C 3 148 ? 15.330 -17.387 -341.482 1.00 48.95  ?  148 PRO C CG  1 
ATOM   2952 C CD  . PRO C 3 148 ? 15.727 -18.042 -340.210 1.00 41.28  ?  148 PRO C CD  1 
ATOM   2953 N N   . ALA C 3 149 ? 13.303 -15.288 -339.145 1.00 48.21  ?  149 ALA C N   1 
ATOM   2954 C CA  . ALA C 3 149 ? 12.100 -14.475 -338.932 1.00 46.02  ?  149 ALA C CA  1 
ATOM   2955 C C   . ALA C 3 149 ? 11.952 -14.031 -337.484 1.00 45.58  ?  149 ALA C C   1 
ATOM   2956 O O   . ALA C 3 149 ? 10.954 -13.416 -337.119 1.00 50.74  ?  149 ALA C O   1 
ATOM   2957 C CB  . ALA C 3 149 ? 10.860 -15.234 -339.371 1.00 49.47  ?  149 ALA C CB  1 
ATOM   2958 N N   . SER C 3 150 ? 12.958 -14.317 -336.666 1.00 46.86  ?  150 SER C N   1 
ATOM   2959 C CA  . SER C 3 150 ? 12.873 -14.014 -335.243 1.00 43.69  ?  150 SER C CA  1 
ATOM   2960 C C   . SER C 3 150 ? 12.981 -12.523 -334.920 1.00 44.82  ?  150 SER C C   1 
ATOM   2961 O O   . SER C 3 150 ? 13.729 -11.769 -335.552 1.00 44.74  ?  150 SER C O   1 
ATOM   2962 C CB  . SER C 3 150 ? 13.953 -14.776 -334.470 1.00 46.42  ?  150 SER C CB  1 
ATOM   2963 O OG  . SER C 3 150 ? 13.838 -14.527 -333.073 1.00 47.72  ?  150 SER C OG  1 
ATOM   2964 N N   . LEU C 3 151 ? 12.227 -12.122 -333.906 1.00 48.26  ?  151 LEU C N   1 
ATOM   2965 C CA  . LEU C 3 151 ? 12.245 -10.765 -333.392 1.00 43.71  ?  151 LEU C CA  1 
ATOM   2966 C C   . LEU C 3 151 ? 13.124 -10.645 -332.152 1.00 41.45  ?  151 LEU C C   1 
ATOM   2967 O O   . LEU C 3 151 ? 13.291 -9.550  -331.621 1.00 44.63  ?  151 LEU C O   1 
ATOM   2968 C CB  . LEU C 3 151 ? 10.820 -10.317 -333.061 1.00 49.73  ?  151 LEU C CB  1 
ATOM   2969 C CG  . LEU C 3 151 ? 9.930  -9.886  -334.228 1.00 51.82  ?  151 LEU C CG  1 
ATOM   2970 C CD1 . LEU C 3 151 ? 8.493  -9.733  -333.766 1.00 56.86  ?  151 LEU C CD1 1 
ATOM   2971 C CD2 . LEU C 3 151 ? 10.447 -8.576  -334.792 1.00 54.42  ?  151 LEU C CD2 1 
ATOM   2972 N N   . ASN C 3 152 ? 13.685 -11.765 -331.696 1.00 42.58  ?  152 ASN C N   1 
ATOM   2973 C CA  . ASN C 3 152 ? 14.483 -11.797 -330.458 1.00 45.00  ?  152 ASN C CA  1 
ATOM   2974 C C   . ASN C 3 152 ? 15.430 -12.996 -330.468 1.00 41.98  ?  152 ASN C C   1 
ATOM   2975 O O   . ASN C 3 152 ? 14.978 -14.139 -330.468 1.00 44.96  ?  152 ASN C O   1 
ATOM   2976 C CB  . ASN C 3 152 ? 13.554 -11.851 -329.229 1.00 43.85  ?  152 ASN C CB  1 
ATOM   2977 C CG  . ASN C 3 152 ? 14.295 -11.679 -327.896 1.00 49.10  ?  152 ASN C CG  1 
ATOM   2978 O OD1 . ASN C 3 152 ? 15.483 -11.977 -327.777 1.00 50.31  ?  152 ASN C OD1 1 
ATOM   2979 N ND2 . ASN C 3 152 ? 13.571 -11.219 -326.878 1.00 47.25  ?  152 ASN C ND2 1 
ATOM   2980 N N   . ASP C 3 153 ? 16.738 -12.755 -330.463 1.00 42.23  ?  153 ASP C N   1 
ATOM   2981 C CA  . ASP C 3 153 ? 17.675 -13.877 -330.607 1.00 48.62  ?  153 ASP C CA  1 
ATOM   2982 C C   . ASP C 3 153 ? 17.951 -14.643 -329.298 1.00 47.79  ?  153 ASP C C   1 
ATOM   2983 O O   . ASP C 3 153 ? 18.871 -15.459 -329.239 1.00 48.73  ?  153 ASP C O   1 
ATOM   2984 C CB  . ASP C 3 153 ? 18.993 -13.397 -331.234 1.00 41.49  ?  153 ASP C CB  1 
ATOM   2985 C CG  . ASP C 3 153 ? 19.781 -12.461 -330.335 1.00 46.29  ?  153 ASP C CG  1 
ATOM   2986 O OD1 . ASP C 3 153 ? 19.371 -12.209 -329.184 1.00 43.56  ?  153 ASP C OD1 1 
ATOM   2987 O OD2 . ASP C 3 153 ? 20.818 -11.947 -330.806 1.00 51.35  -1 153 ASP C OD2 1 
ATOM   2988 N N   . THR C 3 154 ? 17.147 -14.383 -328.267 1.00 39.53  ?  154 THR C N   1 
ATOM   2989 C CA  . THR C 3 154 ? 17.196 -15.112 -326.981 1.00 45.01  ?  154 THR C CA  1 
ATOM   2990 C C   . THR C 3 154 ? 18.494 -14.893 -326.200 1.00 45.11  ?  154 THR C C   1 
ATOM   2991 O O   . THR C 3 154 ? 18.645 -15.385 -325.083 1.00 52.53  ?  154 THR C O   1 
ATOM   2992 C CB  . THR C 3 154 ? 16.989 -16.656 -327.148 1.00 38.85  ?  154 THR C CB  1 
ATOM   2993 O OG1 . THR C 3 154 ? 18.193 -17.277 -327.608 1.00 44.36  ?  154 THR C OG1 1 
ATOM   2994 C CG2 . THR C 3 154 ? 15.862 -16.974 -328.107 1.00 40.16  ?  154 THR C CG2 1 
ATOM   2995 N N   . SER C 3 155 ? 19.425 -14.146 -326.777 1.00 40.30  ?  155 SER C N   1 
ATOM   2996 C CA  . SER C 3 155 ? 20.672 -13.830 -326.101 1.00 40.70  ?  155 SER C CA  1 
ATOM   2997 C C   . SER C 3 155 ? 20.441 -12.716 -325.083 1.00 39.25  ?  155 SER C C   1 
ATOM   2998 O O   . SER C 3 155 ? 19.330 -12.213 -324.973 1.00 39.91  ?  155 SER C O   1 
ATOM   2999 C CB  . SER C 3 155 ? 21.736 -13.414 -327.115 1.00 37.23  ?  155 SER C CB  1 
ATOM   3000 O OG  . SER C 3 155 ? 21.548 -12.069 -327.510 1.00 35.76  ?  155 SER C OG  1 
ATOM   3001 N N   . LEU C 3 156 ? 21.488 -12.332 -324.348 1.00 37.66  ?  156 LEU C N   1 
ATOM   3002 C CA  . LEU C 3 156 ? 21.408 -11.186 -323.439 1.00 39.72  ?  156 LEU C CA  1 
ATOM   3003 C C   . LEU C 3 156 ? 21.269 -9.858  -324.197 1.00 42.31  ?  156 LEU C C   1 
ATOM   3004 O O   . LEU C 3 156 ? 20.858 -8.848  -323.624 1.00 41.60  ?  156 LEU C O   1 
ATOM   3005 C CB  . LEU C 3 156 ? 22.634 -11.126 -322.515 1.00 34.79  ?  156 LEU C CB  1 
ATOM   3006 C CG  . LEU C 3 156 ? 22.839 -12.297 -321.534 1.00 41.84  ?  156 LEU C CG  1 
ATOM   3007 C CD1 . LEU C 3 156 ? 24.006 -12.033 -320.585 1.00 34.11  ?  156 LEU C CD1 1 
ATOM   3008 C CD2 . LEU C 3 156 ? 21.567 -12.594 -320.742 1.00 41.48  ?  156 LEU C CD2 1 
ATOM   3009 N N   . LEU C 3 157 ? 21.615 -9.856  -325.480 1.00 39.54  ?  157 LEU C N   1 
ATOM   3010 C CA  . LEU C 3 157 ? 21.403 -8.671  -326.310 1.00 40.91  ?  157 LEU C CA  1 
ATOM   3011 C C   . LEU C 3 157 ? 19.962 -8.562  -326.834 1.00 41.05  ?  157 LEU C C   1 
ATOM   3012 O O   . LEU C 3 157 ? 19.499 -7.463  -327.129 1.00 42.87  ?  157 LEU C O   1 
ATOM   3013 C CB  . LEU C 3 157 ? 22.388 -8.660  -327.482 1.00 38.01  ?  157 LEU C CB  1 
ATOM   3014 C CG  . LEU C 3 157 ? 23.827 -8.304  -327.101 1.00 39.56  ?  157 LEU C CG  1 
ATOM   3015 C CD1 . LEU C 3 157 ? 24.782 -8.440  -328.288 1.00 35.02  ?  157 LEU C CD1 1 
ATOM   3016 C CD2 . LEU C 3 157 ? 23.883 -6.898  -326.513 1.00 36.93  ?  157 LEU C CD2 1 
ATOM   3017 N N   . HIS C 3 158 ? 19.265 -9.697  -326.929 1.00 38.86  ?  158 HIS C N   1 
ATOM   3018 C CA  . HIS C 3 158 ? 17.896 -9.784  -327.467 1.00 41.11  ?  158 HIS C CA  1 
ATOM   3019 C C   . HIS C 3 158 ? 17.648 -8.904  -328.711 1.00 42.04  ?  158 HIS C C   1 
ATOM   3020 O O   . HIS C 3 158 ? 16.675 -8.155  -328.788 1.00 41.07  ?  158 HIS C O   1 
ATOM   3021 C CB  . HIS C 3 158 ? 16.853 -9.472  -326.361 1.00 45.65  ?  158 HIS C CB  1 
ATOM   3022 C CG  . HIS C 3 158 ? 17.010 -8.131  -325.708 1.00 47.98  ?  158 HIS C CG  1 
ATOM   3023 N ND1 . HIS C 3 158 ? 16.510 -6.969  -326.259 1.00 49.05  ?  158 HIS C ND1 1 
ATOM   3024 C CD2 . HIS C 3 158 ? 17.594 -7.769  -324.538 1.00 50.61  ?  158 HIS C CD2 1 
ATOM   3025 C CE1 . HIS C 3 158 ? 16.787 -5.950  -325.463 1.00 50.70  ?  158 HIS C CE1 1 
ATOM   3026 N NE2 . HIS C 3 158 ? 17.448 -6.407  -324.413 1.00 47.44  ?  158 HIS C NE2 1 
ATOM   3027 N N   . ASP C 3 159 ? 18.536 -9.014  -329.693 1.00 43.91  ?  159 ASP C N   1 
ATOM   3028 C CA  . ASP C 3 159 ? 18.391 -8.267  -330.942 1.00 39.15  ?  159 ASP C CA  1 
ATOM   3029 C C   . ASP C 3 159 ? 17.536 -9.040  -331.942 1.00 34.67  ?  159 ASP C C   1 
ATOM   3030 O O   . ASP C 3 159 ? 17.560 -10.263 -331.963 1.00 39.40  ?  159 ASP C O   1 
ATOM   3031 C CB  . ASP C 3 159 ? 19.769 -7.952  -331.538 1.00 34.30  ?  159 ASP C CB  1 
ATOM   3032 C CG  . ASP C 3 159 ? 20.437 -6.775  -330.856 1.00 37.54  ?  159 ASP C CG  1 
ATOM   3033 O OD1 . ASP C 3 159 ? 19.714 -5.884  -330.364 1.00 43.78  ?  159 ASP C OD1 1 
ATOM   3034 O OD2 . ASP C 3 159 ? 21.680 -6.743  -330.795 1.00 40.08  -1 159 ASP C OD2 1 
ATOM   3035 N N   . PRO C 3 160 ? 16.772 -8.325  -332.773 1.00 34.21  ?  160 PRO C N   1 
ATOM   3036 C CA  . PRO C 3 160 ? 15.946 -9.003  -333.784 1.00 36.40  ?  160 PRO C CA  1 
ATOM   3037 C C   . PRO C 3 160 ? 16.756 -9.521  -334.986 1.00 33.49  ?  160 PRO C C   1 
ATOM   3038 O O   . PRO C 3 160 ? 17.900 -9.127  -335.194 1.00 32.97  ?  160 PRO C O   1 
ATOM   3039 C CB  . PRO C 3 160 ? 14.960 -7.911  -334.213 1.00 35.02  ?  160 PRO C CB  1 
ATOM   3040 C CG  . PRO C 3 160 ? 15.718 -6.618  -333.980 1.00 36.65  ?  160 PRO C CG  1 
ATOM   3041 C CD  . PRO C 3 160 ? 16.536 -6.869  -332.737 1.00 34.20  ?  160 PRO C CD  1 
ATOM   3042 N N   . CYS C 3 161 ? 16.153 -10.420 -335.752 1.00 35.35  ?  161 CYS C N   1 
ATOM   3043 C CA  . CYS C 3 161 ? 16.782 -10.998 -336.930 1.00 36.90  ?  161 CYS C CA  1 
ATOM   3044 C C   . CYS C 3 161 ? 16.203 -10.428 -338.230 1.00 41.32  ?  161 CYS C C   1 
ATOM   3045 O O   . CYS C 3 161 ? 16.868 -10.456 -339.265 1.00 41.32  ?  161 CYS C O   1 
ATOM   3046 C CB  . CYS C 3 161 ? 16.632 -12.529 -336.924 1.00 38.60  ?  161 CYS C CB  1 
ATOM   3047 S SG  . CYS C 3 161 ? 17.775 -13.409 -335.795 1.00 42.84  ?  161 CYS C SG  1 
ATOM   3048 N N   . LEU C 3 162 ? 14.969 -9.925  -338.173 1.00 41.41  ?  162 LEU C N   1 
ATOM   3049 C CA  . LEU C 3 162 ? 14.280 -9.419  -339.364 1.00 43.54  ?  162 LEU C CA  1 
ATOM   3050 C C   . LEU C 3 162 ? 15.026 -8.253  -340.015 1.00 41.86  ?  162 LEU C C   1 
ATOM   3051 O O   . LEU C 3 162 ? 15.533 -7.355  -339.337 1.00 39.24  ?  162 LEU C O   1 
ATOM   3052 C CB  . LEU C 3 162 ? 12.854 -8.971  -339.022 1.00 45.31  ?  162 LEU C CB  1 
ATOM   3053 C CG  . LEU C 3 162 ? 11.762 -10.017 -338.766 1.00 50.00  ?  162 LEU C CG  1 
ATOM   3054 C CD1 . LEU C 3 162 ? 10.463 -9.315  -338.376 1.00 46.64  ?  162 LEU C CD1 1 
ATOM   3055 C CD2 . LEU C 3 162 ? 11.546 -10.910 -339.985 1.00 45.01  ?  162 LEU C CD2 1 
ATOM   3056 N N   . GLY C 3 163 ? 15.091 -8.281  -341.341 1.00 44.29  ?  163 GLY C N   1 
ATOM   3057 C CA  . GLY C 3 163 ? 15.694 -7.205  -342.102 1.00 39.17  ?  163 GLY C CA  1 
ATOM   3058 C C   . GLY C 3 163 ? 14.915 -5.911  -341.954 1.00 42.52  ?  163 GLY C C   1 
ATOM   3059 O O   . GLY C 3 163 ? 13.769 -5.901  -341.496 1.00 40.89  ?  163 GLY C O   1 
ATOM   3060 N N   . THR C 3 164 ? 15.539 -4.815  -342.362 1.00 38.47  ?  164 THR C N   1 
ATOM   3061 C CA  . THR C 3 164 ? 14.939 -3.493  -342.234 1.00 40.53  ?  164 THR C CA  1 
ATOM   3062 C C   . THR C 3 164 ? 13.618 -3.365  -343.020 1.00 39.78  ?  164 THR C C   1 
ATOM   3063 O O   . THR C 3 164 ? 12.759 -2.553  -342.682 1.00 36.51  ?  164 THR C O   1 
ATOM   3064 C CB  . THR C 3 164 ? 15.940 -2.407  -342.690 1.00 38.12  ?  164 THR C CB  1 
ATOM   3065 O OG1 . THR C 3 164 ? 15.666 -1.190  -342.003 1.00 56.87  ?  164 THR C OG1 1 
ATOM   3066 C CG2 . THR C 3 164 ? 15.871 -2.169  -344.193 1.00 37.03  ?  164 THR C CG2 1 
ATOM   3067 N N   . PHE C 3 165 ? 13.450 -4.195  -344.045 1.00 37.92  ?  165 PHE C N   1 
ATOM   3068 C CA  . PHE C 3 165 ? 12.247 -4.189  -344.877 1.00 42.68  ?  165 PHE C CA  1 
ATOM   3069 C C   . PHE C 3 165 ? 11.107 -4.984  -344.224 1.00 44.83  ?  165 PHE C C   1 
ATOM   3070 O O   . PHE C 3 165 ? 10.015 -5.081  -344.777 1.00 40.43  ?  165 PHE C O   1 
ATOM   3071 C CB  . PHE C 3 165 ? 12.557 -4.757  -346.272 1.00 37.14  ?  165 PHE C CB  1 
ATOM   3072 C CG  . PHE C 3 165 ? 13.037 -6.179  -346.247 1.00 41.15  ?  165 PHE C CG  1 
ATOM   3073 C CD1 . PHE C 3 165 ? 14.378 -6.468  -346.039 1.00 38.91  ?  165 PHE C CD1 1 
ATOM   3074 C CD2 . PHE C 3 165 ? 12.147 -7.230  -346.412 1.00 40.73  ?  165 PHE C CD2 1 
ATOM   3075 C CE1 . PHE C 3 165 ? 14.824 -7.774  -346.006 1.00 38.46  ?  165 PHE C CE1 1 
ATOM   3076 C CE2 . PHE C 3 165 ? 12.586 -8.541  -346.383 1.00 40.68  ?  165 PHE C CE2 1 
ATOM   3077 C CZ  . PHE C 3 165 ? 13.926 -8.816  -346.178 1.00 41.51  ?  165 PHE C CZ  1 
ATOM   3078 N N   . GLY C 3 166 ? 11.371 -5.560  -343.052 1.00 48.70  ?  166 GLY C N   1 
ATOM   3079 C CA  . GLY C 3 166 ? 10.333 -6.205  -342.263 1.00 40.72  ?  166 GLY C CA  1 
ATOM   3080 C C   . GLY C 3 166 ? 10.100 -7.675  -342.561 1.00 44.55  ?  166 GLY C C   1 
ATOM   3081 O O   . GLY C 3 166 ? 9.067  -8.226  -342.194 1.00 53.94  ?  166 GLY C O   1 
ATOM   3082 N N   . GLY C 3 167 ? 11.064 -8.317  -343.210 1.00 40.42  ?  167 GLY C N   1 
ATOM   3083 C CA  . GLY C 3 167 ? 10.949 -9.721  -343.568 1.00 41.97  ?  167 GLY C CA  1 
ATOM   3084 C C   . GLY C 3 167 ? 12.236 -10.496 -343.329 1.00 44.79  ?  167 GLY C C   1 
ATOM   3085 O O   . GLY C 3 167 ? 13.295 -9.910  -343.081 1.00 37.12  ?  167 GLY C O   1 
ATOM   3086 N N   . PRO C 3 168 ? 12.156 -11.832 -343.395 1.00 49.34  ?  168 PRO C N   1 
ATOM   3087 C CA  . PRO C 3 168 ? 13.324 -12.664 -343.088 1.00 46.56  ?  168 PRO C CA  1 
ATOM   3088 C C   . PRO C 3 168 ? 14.347 -12.661 -344.216 1.00 46.21  ?  168 PRO C C   1 
ATOM   3089 O O   . PRO C 3 168 ? 13.985 -12.496 -345.383 1.00 49.83  ?  168 PRO C O   1 
ATOM   3090 C CB  . PRO C 3 168 ? 12.718 -14.058 -342.905 1.00 44.24  ?  168 PRO C CB  1 
ATOM   3091 C CG  . PRO C 3 168 ? 11.522 -14.043 -343.813 1.00 44.13  ?  168 PRO C CG  1 
ATOM   3092 C CD  . PRO C 3 168 ? 10.976 -12.640 -343.749 1.00 46.58  ?  168 PRO C CD  1 
ATOM   3093 N N   . VAL C 3 169 ? 15.613 -12.839 -343.852 1.00 47.61  ?  169 VAL C N   1 
ATOM   3094 C CA  . VAL C 3 169 ? 16.699 -12.979 -344.810 1.00 44.92  ?  169 VAL C CA  1 
ATOM   3095 C C   . VAL C 3 169 ? 17.238 -14.399 -344.721 1.00 45.83  ?  169 VAL C C   1 
ATOM   3096 O O   . VAL C 3 169 ? 17.931 -14.749 -343.764 1.00 47.34  ?  169 VAL C O   1 
ATOM   3097 C CB  . VAL C 3 169 ? 17.840 -11.967 -344.537 1.00 46.07  ?  169 VAL C CB  1 
ATOM   3098 C CG1 . VAL C 3 169 ? 19.020 -12.235 -345.465 1.00 43.76  ?  169 VAL C CG1 1 
ATOM   3099 C CG2 . VAL C 3 169 ? 17.338 -10.522 -344.682 1.00 43.73  ?  169 VAL C CG2 1 
ATOM   3100 N N   . PHE C 3 170 ? 16.924 -15.224 -345.709 1.00 38.28  ?  170 PHE C N   1 
ATOM   3101 C CA  . PHE C 3 170 ? 17.304 -16.623 -345.635 1.00 41.77  ?  170 PHE C CA  1 
ATOM   3102 C C   . PHE C 3 170 ? 18.776 -16.768 -345.944 1.00 43.56  ?  170 PHE C C   1 
ATOM   3103 O O   . PHE C 3 170 ? 19.266 -16.223 -346.934 1.00 42.83  ?  170 PHE C O   1 
ATOM   3104 C CB  . PHE C 3 170 ? 16.438 -17.466 -346.571 1.00 45.70  ?  170 PHE C CB  1 
ATOM   3105 C CG  . PHE C 3 170 ? 14.977 -17.381 -346.246 1.00 47.71  ?  170 PHE C CG  1 
ATOM   3106 C CD1 . PHE C 3 170 ? 14.471 -18.012 -345.117 1.00 48.32  ?  170 PHE C CD1 1 
ATOM   3107 C CD2 . PHE C 3 170 ? 14.118 -16.634 -347.034 1.00 51.11  ?  170 PHE C CD2 1 
ATOM   3108 C CE1 . PHE C 3 170 ? 13.130 -17.914 -344.792 1.00 46.87  ?  170 PHE C CE1 1 
ATOM   3109 C CE2 . PHE C 3 170 ? 12.780 -16.532 -346.718 1.00 49.65  ?  170 PHE C CE2 1 
ATOM   3110 C CZ  . PHE C 3 170 ? 12.285 -17.173 -345.595 1.00 49.76  ?  170 PHE C CZ  1 
ATOM   3111 N N   . PRO C 3 171 ? 19.491 -17.496 -345.074 1.00 45.93  ?  171 PRO C N   1 
ATOM   3112 C CA  . PRO C 3 171 ? 20.958 -17.551 -345.103 1.00 38.44  ?  171 PRO C CA  1 
ATOM   3113 C C   . PRO C 3 171 ? 21.516 -18.065 -346.433 1.00 41.45  ?  171 PRO C C   1 
ATOM   3114 O O   . PRO C 3 171 ? 22.579 -17.592 -346.843 1.00 39.94  ?  171 PRO C O   1 
ATOM   3115 C CB  . PRO C 3 171 ? 21.303 -18.508 -343.944 1.00 40.91  ?  171 PRO C CB  1 
ATOM   3116 C CG  . PRO C 3 171 ? 20.047 -19.292 -343.690 1.00 42.00  ?  171 PRO C CG  1 
ATOM   3117 C CD  . PRO C 3 171 ? 18.912 -18.361 -344.027 1.00 39.57  ?  171 PRO C CD  1 
ATOM   3118 N N   . TRP C 3 172 ? 20.814 -18.980 -347.104 1.00 44.82  ?  172 TRP C N   1 
ATOM   3119 C CA  . TRP C 3 172 ? 21.329 -19.579 -348.345 1.00 46.42  ?  172 TRP C CA  1 
ATOM   3120 C C   . TRP C 3 172 ? 21.214 -18.629 -349.547 1.00 50.17  ?  172 TRP C C   1 
ATOM   3121 O O   . TRP C 3 172 ? 21.668 -18.950 -350.653 1.00 48.30  ?  172 TRP C O   1 
ATOM   3122 C CB  . TRP C 3 172 ? 20.604 -20.905 -348.652 1.00 51.49  ?  172 TRP C CB  1 
ATOM   3123 C CG  . TRP C 3 172 ? 19.124 -20.761 -348.861 1.00 53.48  ?  172 TRP C CG  1 
ATOM   3124 C CD1 . TRP C 3 172 ? 18.486 -20.417 -350.019 1.00 58.71  ?  172 TRP C CD1 1 
ATOM   3125 C CD2 . TRP C 3 172 ? 18.094 -20.955 -347.878 1.00 51.19  ?  172 TRP C CD2 1 
ATOM   3126 N NE1 . TRP C 3 172 ? 17.126 -20.377 -349.818 1.00 56.05  ?  172 TRP C NE1 1 
ATOM   3127 C CE2 . TRP C 3 172 ? 16.860 -20.702 -348.517 1.00 53.22  ?  172 TRP C CE2 1 
ATOM   3128 C CE3 . TRP C 3 172 ? 18.099 -21.309 -346.528 1.00 49.62  ?  172 TRP C CE3 1 
ATOM   3129 C CZ2 . TRP C 3 172 ? 15.642 -20.795 -347.843 1.00 53.77  ?  172 TRP C CZ2 1 
ATOM   3130 C CZ3 . TRP C 3 172 ? 16.881 -21.405 -345.862 1.00 52.58  ?  172 TRP C CZ3 1 
ATOM   3131 C CH2 . TRP C 3 172 ? 15.673 -21.146 -346.521 1.00 52.89  ?  172 TRP C CH2 1 
ATOM   3132 N N   . LEU C 3 173 ? 20.610 -17.465 -349.329 1.00 42.35  ?  173 LEU C N   1 
ATOM   3133 C CA  . LEU C 3 173 ? 20.503 -16.451 -350.374 1.00 41.27  ?  173 LEU C CA  1 
ATOM   3134 C C   . LEU C 3 173 ? 21.544 -15.353 -350.229 1.00 41.56  ?  173 LEU C C   1 
ATOM   3135 O O   . LEU C 3 173 ? 21.756 -14.574 -351.158 1.00 39.12  ?  173 LEU C O   1 
ATOM   3136 C CB  . LEU C 3 173 ? 19.125 -15.813 -350.362 1.00 44.54  ?  173 LEU C CB  1 
ATOM   3137 C CG  . LEU C 3 173 ? 17.954 -16.753 -350.583 1.00 55.45  ?  173 LEU C CG  1 
ATOM   3138 C CD1 . LEU C 3 173 ? 16.702 -15.963 -350.343 1.00 55.89  ?  173 LEU C CD1 1 
ATOM   3139 C CD2 . LEU C 3 173 ? 17.989 -17.322 -351.988 1.00 60.98  ?  173 LEU C CD2 1 
ATOM   3140 N N   . VAL C 3 174 ? 22.183 -15.267 -349.063 1.00 40.94  ?  174 VAL C N   1 
ATOM   3141 C CA  . VAL C 3 174 ? 23.111 -14.160 -348.826 1.00 37.71  ?  174 VAL C CA  1 
ATOM   3142 C C   . VAL C 3 174 ? 24.517 -14.626 -348.486 1.00 35.56  ?  174 VAL C C   1 
ATOM   3143 O O   . VAL C 3 174 ? 25.383 -13.818 -348.152 1.00 35.09  ?  174 VAL C O   1 
ATOM   3144 C CB  . VAL C 3 174 ? 22.590 -13.233 -347.711 1.00 37.19  ?  174 VAL C CB  1 
ATOM   3145 C CG1 . VAL C 3 174 ? 21.208 -12.687 -348.108 1.00 32.03  ?  174 VAL C CG1 1 
ATOM   3146 C CG2 . VAL C 3 174 ? 22.551 -13.968 -346.361 1.00 34.87  ?  174 VAL C CG2 1 
ATOM   3147 N N   . LEU C 3 175 ? 24.746 -15.930 -348.591 1.00 34.11  ?  175 LEU C N   1 
ATOM   3148 C CA  . LEU C 3 175 ? 26.065 -16.495 -348.343 1.00 39.90  ?  175 LEU C CA  1 
ATOM   3149 C C   . LEU C 3 175 ? 26.417 -17.511 -349.431 1.00 39.90  ?  175 LEU C C   1 
ATOM   3150 O O   . LEU C 3 175 ? 25.538 -18.038 -350.114 1.00 40.77  ?  175 LEU C O   1 
ATOM   3151 C CB  . LEU C 3 175 ? 26.120 -17.156 -346.958 1.00 33.88  ?  175 LEU C CB  1 
ATOM   3152 C CG  . LEU C 3 175 ? 25.727 -16.306 -345.740 1.00 34.84  ?  175 LEU C CG  1 
ATOM   3153 C CD1 . LEU C 3 175 ? 25.469 -17.187 -344.515 1.00 40.49  ?  175 LEU C CD1 1 
ATOM   3154 C CD2 . LEU C 3 175 ? 26.799 -15.273 -345.424 1.00 29.67  ?  175 LEU C CD2 1 
ATOM   3155 N N   . GLY C 3 176 ? 27.705 -17.787 -349.586 1.00 45.55  ?  176 GLY C N   1 
ATOM   3156 C CA  . GLY C 3 176 ? 28.146 -18.834 -350.491 1.00 45.64  ?  176 GLY C CA  1 
ATOM   3157 C C   . GLY C 3 176 ? 29.479 -19.403 -350.047 1.00 45.19  ?  176 GLY C C   1 
ATOM   3158 O O   . GLY C 3 176 ? 30.198 -18.768 -349.277 1.00 48.80  ?  176 GLY C O   1 
ATOM   3159 N N   . GLY C 3 177 ? 29.807 -20.600 -350.525 1.00 47.29  ?  177 GLY C N   1 
ATOM   3160 C CA  . GLY C 3 177 ? 31.103 -21.210 -350.265 1.00 45.16  ?  177 GLY C CA  1 
ATOM   3161 C C   . GLY C 3 177 ? 31.177 -22.008 -348.970 1.00 49.44  ?  177 GLY C C   1 
ATOM   3162 O O   . GLY C 3 177 ? 32.259 -22.393 -348.526 1.00 49.51  ?  177 GLY C O   1 
ATOM   3163 N N   . TYR C 3 178 ? 30.021 -22.256 -348.366 1.00 43.81  ?  178 TYR C N   1 
ATOM   3164 C CA  . TYR C 3 178 ? 29.946 -22.986 -347.104 1.00 47.57  ?  178 TYR C CA  1 
ATOM   3165 C C   . TYR C 3 178 ? 29.558 -24.458 -347.305 1.00 47.74  ?  178 TYR C C   1 
ATOM   3166 O O   . TYR C 3 178 ? 28.919 -24.814 -348.291 1.00 49.57  ?  178 TYR C O   1 
ATOM   3167 C CB  . TYR C 3 178 ? 28.943 -22.304 -346.170 1.00 41.06  ?  178 TYR C CB  1 
ATOM   3168 C CG  . TYR C 3 178 ? 27.560 -22.200 -346.755 1.00 37.89  ?  178 TYR C CG  1 
ATOM   3169 C CD1 . TYR C 3 178 ? 26.629 -23.213 -346.572 1.00 44.68  ?  178 TYR C CD1 1 
ATOM   3170 C CD2 . TYR C 3 178 ? 27.185 -21.090 -347.510 1.00 39.33  ?  178 TYR C CD2 1 
ATOM   3171 C CE1 . TYR C 3 178 ? 25.355 -23.123 -347.116 1.00 47.51  ?  178 TYR C CE1 1 
ATOM   3172 C CE2 . TYR C 3 178 ? 25.916 -20.992 -348.055 1.00 40.16  ?  178 TYR C CE2 1 
ATOM   3173 C CZ  . TYR C 3 178 ? 25.006 -22.012 -347.855 1.00 41.44  ?  178 TYR C CZ  1 
ATOM   3174 O OH  . TYR C 3 178 ? 23.744 -21.924 -348.389 1.00 48.30  ?  178 TYR C OH  1 
ATOM   3175 N N   . ASP C 3 179 ? 29.929 -25.305 -346.353 1.00 57.13  ?  179 ASP C N   1 
ATOM   3176 C CA  . ASP C 3 179 ? 29.573 -26.722 -346.407 1.00 61.69  ?  179 ASP C CA  1 
ATOM   3177 C C   . ASP C 3 179 ? 28.270 -27.062 -345.676 1.00 63.99  ?  179 ASP C C   1 
ATOM   3178 O O   . ASP C 3 179 ? 28.108 -26.730 -344.501 1.00 66.59  ?  179 ASP C O   1 
ATOM   3179 C CB  . ASP C 3 179 ? 30.684 -27.563 -345.787 1.00 62.27  ?  179 ASP C CB  1 
ATOM   3180 C CG  . ASP C 3 179 ? 31.024 -27.119 -344.374 1.00 64.17  ?  179 ASP C CG  1 
ATOM   3181 O OD1 . ASP C 3 179 ? 30.953 -27.960 -343.455 1.00 66.57  ?  179 ASP C OD1 1 
ATOM   3182 O OD2 . ASP C 3 179 ? 31.361 -25.929 -344.180 1.00 62.75  -1 179 ASP C OD2 1 
ATOM   3183 N N   . ASP C 3 180 ? 27.353 -27.724 -346.377 1.00 75.13  ?  180 ASP C N   1 
ATOM   3184 C CA  . ASP C 3 180 ? 26.088 -28.176 -345.791 1.00 72.12  ?  180 ASP C CA  1 
ATOM   3185 C C   . ASP C 3 180 ? 25.357 -26.967 -345.210 1.00 73.08  ?  180 ASP C C   1 
ATOM   3186 O O   . ASP C 3 180 ? 25.106 -25.999 -345.920 1.00 77.80  ?  180 ASP C O   1 
ATOM   3187 C CB  . ASP C 3 180 ? 26.358 -29.215 -344.696 1.00 76.56  ?  180 ASP C CB  1 
ATOM   3188 C CG  . ASP C 3 180 ? 26.973 -30.491 -345.245 1.00 81.10  ?  180 ASP C CG  1 
ATOM   3189 O OD1 . ASP C 3 180 ? 26.442 -31.026 -346.244 1.00 86.11  ?  180 ASP C OD1 1 
ATOM   3190 O OD2 . ASP C 3 180 ? 27.995 -30.949 -344.691 1.00 80.12  -1 180 ASP C OD2 1 
ATOM   3191 N N   . GLN C 3 181 ? 25.008 -27.033 -343.926 1.00 73.24  ?  181 GLN C N   1 
ATOM   3192 C CA  . GLN C 3 181 ? 24.244 -25.972 -343.268 1.00 68.10  ?  181 GLN C CA  1 
ATOM   3193 C C   . GLN C 3 181 ? 25.135 -25.134 -342.348 1.00 63.11  ?  181 GLN C C   1 
ATOM   3194 O O   . GLN C 3 181 ? 24.638 -24.374 -341.514 1.00 63.03  ?  181 GLN C O   1 
ATOM   3195 C CB  . GLN C 3 181 ? 23.082 -26.555 -342.451 1.00 74.14  ?  181 GLN C CB  1 
ATOM   3196 C CG  . GLN C 3 181 ? 22.283 -27.660 -343.138 1.00 78.48  ?  181 GLN C CG  1 
ATOM   3197 C CD  . GLN C 3 181 ? 21.588 -27.197 -344.397 1.00 81.08  ?  181 GLN C CD  1 
ATOM   3198 O OE1 . GLN C 3 181 ? 21.380 -26.002 -344.603 1.00 82.17  ?  181 GLN C OE1 1 
ATOM   3199 N NE2 . GLN C 3 181 ? 21.226 -28.145 -345.254 1.00 81.39  ?  181 GLN C NE2 1 
ATOM   3200 N N   . ASN C 3 182 ? 26.447 -25.285 -342.489 1.00 46.38  ?  182 ASN C N   1 
ATOM   3201 C CA  . ASN C 3 182 ? 27.389 -24.530 -341.669 1.00 48.91  ?  182 ASN C CA  1 
ATOM   3202 C C   . ASN C 3 182 ? 27.691 -23.144 -342.265 1.00 46.33  ?  182 ASN C C   1 
ATOM   3203 O O   . ASN C 3 182 ? 28.815 -22.848 -342.683 1.00 44.22  ?  182 ASN C O   1 
ATOM   3204 C CB  . ASN C 3 182 ? 28.675 -25.336 -341.481 1.00 45.25  ?  182 ASN C CB  1 
ATOM   3205 C CG  . ASN C 3 182 ? 28.404 -26.738 -340.950 1.00 53.30  ?  182 ASN C CG  1 
ATOM   3206 O OD1 . ASN C 3 182 ? 27.569 -26.933 -340.063 1.00 51.48  ?  182 ASN C OD1 1 
ATOM   3207 N ND2 . ASN C 3 182 ? 29.098 -27.722 -341.504 1.00 53.40  ?  182 ASN C ND2 1 
ATOM   3208 N N   . TYR C 3 183 ? 26.667 -22.299 -342.274 1.00 43.96  ?  183 TYR C N   1 
ATOM   3209 C CA  . TYR C 3 183 ? 26.739 -20.959 -342.846 1.00 43.87  ?  183 TYR C CA  1 
ATOM   3210 C C   . TYR C 3 183 ? 27.940 -20.123 -342.387 1.00 41.63  ?  183 TYR C C   1 
ATOM   3211 O O   . TYR C 3 183 ? 28.447 -19.290 -343.139 1.00 38.67  ?  183 TYR C O   1 
ATOM   3212 C CB  . TYR C 3 183 ? 25.438 -20.222 -342.537 1.00 37.64  ?  183 TYR C CB  1 
ATOM   3213 C CG  . TYR C 3 183 ? 24.239 -20.899 -343.153 1.00 43.47  ?  183 TYR C CG  1 
ATOM   3214 C CD1 . TYR C 3 183 ? 24.120 -21.016 -344.536 1.00 45.27  ?  183 TYR C CD1 1 
ATOM   3215 C CD2 . TYR C 3 183 ? 23.223 -21.428 -342.357 1.00 45.04  ?  183 TYR C CD2 1 
ATOM   3216 C CE1 . TYR C 3 183 ? 23.015 -21.638 -345.113 1.00 47.82  ?  183 TYR C CE1 1 
ATOM   3217 C CE2 . TYR C 3 183 ? 22.120 -22.052 -342.922 1.00 45.35  ?  183 TYR C CE2 1 
ATOM   3218 C CZ  . TYR C 3 183 ? 22.024 -22.155 -344.300 1.00 49.96  ?  183 TYR C CZ  1 
ATOM   3219 O OH  . TYR C 3 183 ? 20.935 -22.773 -344.864 1.00 55.49  ?  183 TYR C OH  1 
ATOM   3220 N N   . ASN C 3 184 ? 28.404 -20.370 -341.168 1.00 38.12  ?  184 ASN C N   1 
ATOM   3221 C CA  . ASN C 3 184 ? 29.552 -19.662 -340.605 1.00 37.21  ?  184 ASN C CA  1 
ATOM   3222 C C   . ASN C 3 184 ? 30.858 -19.913 -341.364 1.00 38.39  ?  184 ASN C C   1 
ATOM   3223 O O   . ASN C 3 184 ? 31.817 -19.149 -341.230 1.00 40.37  ?  184 ASN C O   1 
ATOM   3224 C CB  . ASN C 3 184 ? 29.718 -20.051 -339.133 1.00 37.48  ?  184 ASN C CB  1 
ATOM   3225 C CG  . ASN C 3 184 ? 29.666 -21.551 -338.928 1.00 36.51  ?  184 ASN C CG  1 
ATOM   3226 O OD1 . ASN C 3 184 ? 28.609 -22.166 -339.030 1.00 36.76  ?  184 ASN C OD1 1 
ATOM   3227 N ND2 . ASN C 3 184 ? 30.813 -22.148 -338.676 1.00 37.40  ?  184 ASN C ND2 1 
ATOM   3228 N N   . ASN C 3 185 ? 30.895 -20.974 -342.168 1.00 40.79  ?  185 ASN C N   1 
ATOM   3229 C CA  . ASN C 3 185 ? 32.068 -21.264 -342.983 1.00 42.18  ?  185 ASN C CA  1 
ATOM   3230 C C   . ASN C 3 185 ? 32.071 -20.541 -344.341 1.00 44.58  ?  185 ASN C C   1 
ATOM   3231 O O   . ASN C 3 185 ? 32.935 -20.808 -345.182 1.00 44.08  ?  185 ASN C O   1 
ATOM   3232 C CB  . ASN C 3 185 ? 32.184 -22.769 -343.227 1.00 45.95  ?  185 ASN C CB  1 
ATOM   3233 C CG  . ASN C 3 185 ? 32.814 -23.508 -342.073 1.00 49.34  ?  185 ASN C CG  1 
ATOM   3234 O OD1 . ASN C 3 185 ? 33.706 -22.990 -341.406 1.00 48.26  ?  185 ASN C OD1 1 
ATOM   3235 N ND2 . ASN C 3 185 ? 32.361 -24.743 -341.838 1.00 46.64  ?  185 ASN C ND2 1 
ATOM   3236 N N   . ALA C 3 186 ? 31.110 -19.644 -344.556 1.00 40.71  ?  186 ALA C N   1 
ATOM   3237 C CA  . ALA C 3 186 ? 30.959 -18.960 -345.849 1.00 41.68  ?  186 ALA C CA  1 
ATOM   3238 C C   . ALA C 3 186 ? 32.225 -18.211 -346.259 1.00 40.44  ?  186 ALA C C   1 
ATOM   3239 O O   . ALA C 3 186 ? 32.905 -17.618 -345.417 1.00 36.11  ?  186 ALA C O   1 
ATOM   3240 C CB  . ALA C 3 186 ? 29.778 -18.005 -345.809 1.00 36.51  ?  186 ALA C CB  1 
ATOM   3241 N N   . THR C 3 187 ? 32.549 -18.270 -347.552 1.00 40.88  ?  187 THR C N   1 
ATOM   3242 C CA  . THR C 3 187 ? 33.708 -17.563 -348.102 1.00 40.51  ?  187 THR C CA  1 
ATOM   3243 C C   . THR C 3 187 ? 33.298 -16.422 -349.047 1.00 39.21  ?  187 THR C C   1 
ATOM   3244 O O   . THR C 3 187 ? 34.147 -15.696 -349.572 1.00 36.08  ?  187 THR C O   1 
ATOM   3245 C CB  . THR C 3 187 ? 34.652 -18.526 -348.859 1.00 37.93  ?  187 THR C CB  1 
ATOM   3246 O OG1 . THR C 3 187 ? 33.898 -19.264 -349.823 1.00 44.20  ?  187 THR C OG1 1 
ATOM   3247 C CG2 . THR C 3 187 ? 35.325 -19.508 -347.879 1.00 41.94  ?  187 THR C CG2 1 
ATOM   3248 N N   . ALA C 3 188 ? 31.995 -16.269 -349.259 1.00 38.82  ?  188 ALA C N   1 
ATOM   3249 C CA  . ALA C 3 188 ? 31.485 -15.154 -350.050 1.00 41.66  ?  188 ALA C CA  1 
ATOM   3250 C C   . ALA C 3 188 ? 30.183 -14.631 -349.459 1.00 40.76  ?  188 ALA C C   1 
ATOM   3251 O O   . ALA C 3 188 ? 29.385 -15.401 -348.914 1.00 44.72  ?  188 ALA C O   1 
ATOM   3252 C CB  . ALA C 3 188 ? 31.279 -15.569 -351.500 1.00 41.71  ?  188 ALA C CB  1 
ATOM   3253 N N   . LEU C 3 189 ? 29.983 -13.320 -349.543 1.00 36.35  ?  189 LEU C N   1 
ATOM   3254 C CA  . LEU C 3 189 ? 28.696 -12.729 -349.209 1.00 36.90  ?  189 LEU C CA  1 
ATOM   3255 C C   . LEU C 3 189 ? 27.947 -12.411 -350.497 1.00 41.58  ?  189 LEU C C   1 
ATOM   3256 O O   . LEU C 3 189 ? 28.551 -11.986 -351.491 1.00 39.93  ?  189 LEU C O   1 
ATOM   3257 C CB  . LEU C 3 189 ? 28.865 -11.466 -348.372 1.00 35.30  ?  189 LEU C CB  1 
ATOM   3258 C CG  . LEU C 3 189 ? 29.702 -11.572 -347.102 1.00 38.19  ?  189 LEU C CG  1 
ATOM   3259 C CD1 . LEU C 3 189 ? 29.817 -10.206 -346.412 1.00 30.91  ?  189 LEU C CD1 1 
ATOM   3260 C CD2 . LEU C 3 189 ? 29.095 -12.615 -346.162 1.00 35.92  ?  189 LEU C CD2 1 
ATOM   3261 N N   . VAL C 3 190 ? 26.635 -12.629 -350.486 1.00 39.52  ?  190 VAL C N   1 
ATOM   3262 C CA  . VAL C 3 190 ? 25.801 -12.261 -351.626 1.00 40.06  ?  190 VAL C CA  1 
ATOM   3263 C C   . VAL C 3 190 ? 24.859 -11.138 -351.209 1.00 40.70  ?  190 VAL C C   1 
ATOM   3264 O O   . VAL C 3 190 ? 24.160 -11.251 -350.202 1.00 40.28  ?  190 VAL C O   1 
ATOM   3265 C CB  . VAL C 3 190 ? 24.996 -13.468 -352.160 1.00 43.73  ?  190 VAL C CB  1 
ATOM   3266 C CG1 . VAL C 3 190 ? 24.271 -13.101 -353.455 1.00 41.61  ?  190 VAL C CG1 1 
ATOM   3267 C CG2 . VAL C 3 190 ? 25.921 -14.676 -352.373 1.00 40.16  ?  190 VAL C CG2 1 
ATOM   3268 N N   . ILE C 3 191 ? 24.859 -10.046 -351.966 1.00 40.62  ?  191 ILE C N   1 
ATOM   3269 C CA  . ILE C 3 191 ? 23.955 -8.942  -351.681 1.00 39.40  ?  191 ILE C CA  1 
ATOM   3270 C C   . ILE C 3 191 ? 23.046 -8.719  -352.880 1.00 45.90  ?  191 ILE C C   1 
ATOM   3271 O O   . ILE C 3 191 ? 23.509 -8.497  -353.997 1.00 44.47  ?  191 ILE C O   1 
ATOM   3272 C CB  . ILE C 3 191 ? 24.719 -7.649  -351.326 1.00 39.03  ?  191 ILE C CB  1 
ATOM   3273 C CG1 . ILE C 3 191 ? 25.614 -7.880  -350.104 1.00 39.02  ?  191 ILE C CG1 1 
ATOM   3274 C CG2 . ILE C 3 191 ? 23.757 -6.502  -351.066 1.00 35.84  ?  191 ILE C CG2 1 
ATOM   3275 C CD1 . ILE C 3 191 ? 26.296 -6.631  -349.604 1.00 35.43  ?  191 ILE C CD1 1 
ATOM   3276 N N   . THR C 3 192 ? 21.744 -8.809  -352.634 1.00 45.27  ?  192 THR C N   1 
ATOM   3277 C CA  . THR C 3 192 ? 20.743 -8.727  -353.684 1.00 41.35  ?  192 THR C CA  1 
ATOM   3278 C C   . THR C 3 192 ? 19.791 -7.560  -353.435 1.00 46.87  ?  192 THR C C   1 
ATOM   3279 O O   . THR C 3 192 ? 19.163 -7.489  -352.378 1.00 43.77  ?  192 THR C O   1 
ATOM   3280 C CB  . THR C 3 192 ? 19.920 -10.039 -353.793 1.00 49.35  ?  192 THR C CB  1 
ATOM   3281 O OG1 . THR C 3 192 ? 20.749 -11.103 -354.286 1.00 48.45  ?  192 THR C OG1 1 
ATOM   3282 C CG2 . THR C 3 192 ? 18.732 -9.852  -354.733 1.00 54.85  ?  192 THR C CG2 1 
ATOM   3283 N N   . PHE C 3 193 ? 19.723 -6.644  -354.405 1.00 52.52  ?  193 PHE C N   1 
ATOM   3284 C CA  . PHE C 3 193 ? 18.748 -5.549  -354.436 1.00 53.06  ?  193 PHE C CA  1 
ATOM   3285 C C   . PHE C 3 193 ? 17.667 -5.871  -355.485 1.00 55.59  ?  193 PHE C C   1 
ATOM   3286 O O   . PHE C 3 193 ? 17.926 -5.794  -356.687 1.00 54.51  ?  193 PHE C O   1 
ATOM   3287 C CB  . PHE C 3 193 ? 19.403 -4.194  -354.800 1.00 50.62  ?  193 PHE C CB  1 
ATOM   3288 C CG  . PHE C 3 193 ? 20.568 -3.788  -353.915 1.00 50.74  ?  193 PHE C CG  1 
ATOM   3289 C CD1 . PHE C 3 193 ? 20.400 -2.845  -352.904 1.00 46.37  ?  193 PHE C CD1 1 
ATOM   3290 C CD2 . PHE C 3 193 ? 21.837 -4.316  -354.120 1.00 47.93  ?  193 PHE C CD2 1 
ATOM   3291 C CE1 . PHE C 3 193 ? 21.472 -2.463  -352.084 1.00 40.51  ?  193 PHE C CE1 1 
ATOM   3292 C CE2 . PHE C 3 193 ? 22.914 -3.936  -353.313 1.00 43.89  ?  193 PHE C CE2 1 
ATOM   3293 C CZ  . PHE C 3 193 ? 22.730 -3.012  -352.292 1.00 36.96  ?  193 PHE C CZ  1 
ATOM   3294 N N   . PRO C 3 194 ? 16.459 -6.237  -355.042 1.00 44.97  ?  194 PRO C N   1 
ATOM   3295 C CA  . PRO C 3 194 ? 15.347 -6.376  -355.991 1.00 42.16  ?  194 PRO C CA  1 
ATOM   3296 C C   . PRO C 3 194 ? 14.861 -5.013  -356.498 1.00 39.65  ?  194 PRO C C   1 
ATOM   3297 O O   . PRO C 3 194 ? 14.619 -4.113  -355.693 1.00 37.82  ?  194 PRO C O   1 
ATOM   3298 C CB  . PRO C 3 194 ? 14.252 -7.071  -355.167 1.00 44.16  ?  194 PRO C CB  1 
ATOM   3299 C CG  . PRO C 3 194 ? 14.928 -7.570  -353.927 1.00 49.12  ?  194 PRO C CG  1 
ATOM   3300 C CD  . PRO C 3 194 ? 16.085 -6.650  -353.682 1.00 45.60  ?  194 PRO C CD  1 
ATOM   3301 N N   . VAL C 3 195 ? 14.728 -4.869  -357.814 1.00 53.35  ?  195 VAL C N   1 
ATOM   3302 C CA  . VAL C 3 195 ? 14.220 -3.635  -358.429 1.00 53.82  ?  195 VAL C CA  1 
ATOM   3303 C C   . VAL C 3 195 ? 13.006 -3.919  -359.320 1.00 54.33  ?  195 VAL C C   1 
ATOM   3304 O O   . VAL C 3 195 ? 12.998 -4.909  -360.047 1.00 55.23  ?  195 VAL C O   1 
ATOM   3305 C CB  . VAL C 3 195 ? 15.306 -2.937  -359.278 1.00 49.69  ?  195 VAL C CB  1 
ATOM   3306 C CG1 . VAL C 3 195 ? 14.751 -1.686  -359.930 1.00 50.07  ?  195 VAL C CG1 1 
ATOM   3307 C CG2 . VAL C 3 195 ? 16.512 -2.588  -358.416 1.00 54.70  ?  195 VAL C CG2 1 
ATOM   3308 N N   . ASN C 3 196 ? 11.988 -3.059  -359.256 1.00 56.54  ?  196 ASN C N   1 
ATOM   3309 C CA  . ASN C 3 196 ? 10.810 -3.184  -360.119 1.00 59.58  ?  196 ASN C CA  1 
ATOM   3310 C C   . ASN C 3 196 ? 11.170 -3.270  -361.594 1.00 61.34  ?  196 ASN C C   1 
ATOM   3311 O O   . ASN C 3 196 ? 11.945 -2.460  -362.102 1.00 64.60  ?  196 ASN C O   1 
ATOM   3312 C CB  . ASN C 3 196 ? 9.854  -2.007  -359.912 1.00 59.40  ?  196 ASN C CB  1 
ATOM   3313 C CG  . ASN C 3 196 ? 9.031  -2.131  -358.646 1.00 63.66  ?  196 ASN C CG  1 
ATOM   3314 O OD1 . ASN C 3 196 ? 8.088  -2.918  -358.591 1.00 72.88  ?  196 ASN C OD1 1 
ATOM   3315 N ND2 . ASN C 3 196 ? 9.366  -1.334  -357.627 1.00 55.93  ?  196 ASN C ND2 1 
ATOM   3316 N N   . ASN C 3 197 ? 10.597 -4.247  -362.285 1.00 70.33  ?  197 ASN C N   1 
ATOM   3317 C CA  . ASN C 3 197 ? 10.902 -4.429  -363.697 1.00 78.78  ?  197 ASN C CA  1 
ATOM   3318 C C   . ASN C 3 197 ? 10.233 -3.374  -364.585 1.00 75.86  ?  197 ASN C C   1 
ATOM   3319 O O   . ASN C 3 197 ? 10.779 -3.008  -365.624 1.00 78.81  ?  197 ASN C O   1 
ATOM   3320 C CB  . ASN C 3 197 ? 10.492 -5.828  -364.154 1.00 84.56  ?  197 ASN C CB  1 
ATOM   3321 C CG  . ASN C 3 197 ? 11.415 -6.377  -365.214 1.00 82.40  ?  197 ASN C CG  1 
ATOM   3322 O OD1 . ASN C 3 197 ? 11.365 -5.961  -366.371 1.00 94.54  ?  197 ASN C OD1 1 
ATOM   3323 N ND2 . ASN C 3 197 ? 12.274 -7.311  -364.825 1.00 81.74  ?  197 ASN C ND2 1 
ATOM   3324 N N   . TYR C 3 198 ? 9.060  -2.895  -364.170 1.00 60.85  ?  198 TYR C N   1 
ATOM   3325 C CA  . TYR C 3 198 ? 8.330  -1.843  -364.890 1.00 59.66  ?  198 TYR C CA  1 
ATOM   3326 C C   . TYR C 3 198 ? 8.100  -2.168  -366.373 1.00 64.65  ?  198 TYR C C   1 
ATOM   3327 O O   . TYR C 3 198 ? 8.153  -1.276  -367.223 1.00 57.75  ?  198 TYR C O   1 
ATOM   3328 C CB  . TYR C 3 198 ? 9.069  -0.502  -364.781 1.00 56.76  ?  198 TYR C CB  1 
ATOM   3329 C CG  . TYR C 3 198 ? 9.128  0.094   -363.388 1.00 56.67  ?  198 TYR C CG  1 
ATOM   3330 C CD1 . TYR C 3 198 ? 7.975  0.261   -362.620 1.00 48.56  ?  198 TYR C CD1 1 
ATOM   3331 C CD2 . TYR C 3 198 ? 10.346 0.483   -362.839 1.00 54.59  ?  198 TYR C CD2 1 
ATOM   3332 C CE1 . TYR C 3 198 ? 8.038  0.812   -361.349 1.00 48.35  ?  198 TYR C CE1 1 
ATOM   3333 C CE2 . TYR C 3 198 ? 10.422 1.027   -361.570 1.00 50.71  ?  198 TYR C CE2 1 
ATOM   3334 C CZ  . TYR C 3 198 ? 9.273  1.191   -360.827 1.00 51.96  ?  198 TYR C CZ  1 
ATOM   3335 O OH  . TYR C 3 198 ? 9.379  1.735   -359.566 1.00 45.84  ?  198 TYR C OH  1 
ATOM   3336 N N   . TYR C 3 199 ? 7.857  -3.443  -366.675 1.00 69.07  ?  199 TYR C N   1 
ATOM   3337 C CA  . TYR C 3 199 ? 7.535  -3.888  -368.032 1.00 71.04  ?  199 TYR C CA  1 
ATOM   3338 C C   . TYR C 3 199 ? 6.255  -3.220  -368.534 1.00 74.28  ?  199 TYR C C   1 
ATOM   3339 O O   . TYR C 3 199 ? 6.068  -3.012  -369.733 1.00 75.38  ?  199 TYR C O   1 
ATOM   3340 C CB  . TYR C 3 199 ? 7.369  -5.410  -368.067 1.00 75.32  ?  199 TYR C CB  1 
ATOM   3341 C CG  . TYR C 3 199 ? 6.175  -5.868  -367.262 1.00 77.59  ?  199 TYR C CG  1 
ATOM   3342 C CD1 . TYR C 3 199 ? 4.951  -6.113  -367.874 1.00 78.53  ?  199 TYR C CD1 1 
ATOM   3343 C CD2 . TYR C 3 199 ? 6.261  -6.012  -365.884 1.00 72.38  ?  199 TYR C CD2 1 
ATOM   3344 C CE1 . TYR C 3 199 ? 3.855  -6.505  -367.141 1.00 73.53  ?  199 TYR C CE1 1 
ATOM   3345 C CE2 . TYR C 3 199 ? 5.175  -6.402  -365.145 1.00 76.79  ?  199 TYR C CE2 1 
ATOM   3346 C CZ  . TYR C 3 199 ? 3.975  -6.648  -365.778 1.00 80.07  ?  199 TYR C CZ  1 
ATOM   3347 O OH  . TYR C 3 199 ? 2.891  -7.043  -365.041 1.00 80.34  ?  199 TYR C OH  1 
ATOM   3348 N N   . ASN C 3 200 ? 5.380  -2.896  -367.590 1.00 77.87  ?  200 ASN C N   1 
ATOM   3349 C CA  . ASN C 3 200 ? 4.079  -2.312  -367.869 1.00 81.21  ?  200 ASN C CA  1 
ATOM   3350 C C   . ASN C 3 200 ? 4.152  -0.792  -368.019 1.00 82.23  ?  200 ASN C C   1 
ATOM   3351 O O   . ASN C 3 200 ? 3.175  -0.148  -368.397 1.00 83.54  ?  200 ASN C O   1 
ATOM   3352 C CB  . ASN C 3 200 ? 3.110  -2.681  -366.738 1.00 80.50  ?  200 ASN C CB  1 
ATOM   3353 C CG  . ASN C 3 200 ? 1.661  -2.410  -367.086 1.00 84.36  ?  200 ASN C CG  1 
ATOM   3354 O OD1 . ASN C 3 200 ? 1.255  -2.522  -368.244 1.00 85.17  ?  200 ASN C OD1 1 
ATOM   3355 N ND2 . ASN C 3 200 ? 0.867  -2.053  -366.076 1.00 87.22  ?  200 ASN C ND2 1 
ATOM   3356 N N   . ASP C 3 201 ? 5.318  -0.221  -367.725 1.00 69.26  ?  201 ASP C N   1 
ATOM   3357 C CA  . ASP C 3 201 ? 5.439  1.226   -367.562 1.00 64.68  ?  201 ASP C CA  1 
ATOM   3358 C C   . ASP C 3 201 ? 6.780  1.782   -368.057 1.00 63.95  ?  201 ASP C C   1 
ATOM   3359 O O   . ASP C 3 201 ? 7.775  1.744   -367.332 1.00 61.66  ?  201 ASP C O   1 
ATOM   3360 C CB  . ASP C 3 201 ? 5.247  1.577   -366.088 1.00 63.40  ?  201 ASP C CB  1 
ATOM   3361 C CG  . ASP C 3 201 ? 5.013  3.048   -365.863 1.00 69.84  ?  201 ASP C CG  1 
ATOM   3362 O OD1 . ASP C 3 201 ? 5.392  3.865   -366.731 1.00 71.00  ?  201 ASP C OD1 1 
ATOM   3363 O OD2 . ASP C 3 201 ? 4.442  3.389   -364.808 1.00 72.14  -1 201 ASP C OD2 1 
ATOM   3364 N N   . THR C 3 202 ? 6.792  2.325   -369.273 1.00 63.48  ?  202 THR C N   1 
ATOM   3365 C CA  . THR C 3 202 ? 8.024  2.813   -369.899 1.00 61.13  ?  202 THR C CA  1 
ATOM   3366 C C   . THR C 3 202 ? 8.720  3.944   -369.132 1.00 65.35  ?  202 THR C C   1 
ATOM   3367 O O   . THR C 3 202 ? 9.945  3.950   -369.010 1.00 59.53  ?  202 THR C O   1 
ATOM   3368 C CB  . THR C 3 202 ? 7.769  3.309   -371.342 1.00 67.01  ?  202 THR C CB  1 
ATOM   3369 O OG1 . THR C 3 202 ? 6.461  3.892   -371.431 1.00 69.58  ?  202 THR C OG1 1 
ATOM   3370 C CG2 . THR C 3 202 ? 7.893  2.165   -372.334 1.00 64.45  ?  202 THR C CG2 1 
ATOM   3371 N N   . GLU C 3 203 ? 7.951  4.894   -368.615 1.00 67.63  ?  203 GLU C N   1 
ATOM   3372 C CA  . GLU C 3 203 ? 8.549  6.058   -367.983 1.00 67.14  ?  203 GLU C CA  1 
ATOM   3373 C C   . GLU C 3 203 ? 9.221  5.703   -366.648 1.00 66.26  ?  203 GLU C C   1 
ATOM   3374 O O   . GLU C 3 203 ? 10.301 6.220   -366.341 1.00 66.58  ?  203 GLU C O   1 
ATOM   3375 C CB  . GLU C 3 203 ? 7.498  7.162   -367.808 1.00 72.17  ?  203 GLU C CB  1 
ATOM   3376 C CG  . GLU C 3 203 ? 8.019  8.556   -368.194 1.00 79.61  ?  203 GLU C CG  1 
ATOM   3377 C CD  . GLU C 3 203 ? 8.245  8.708   -369.697 1.00 83.83  ?  203 GLU C CD  1 
ATOM   3378 O OE1 . GLU C 3 203 ? 7.354  8.318   -370.488 1.00 81.43  ?  203 GLU C OE1 1 
ATOM   3379 O OE2 . GLU C 3 203 ? 9.334  9.192   -370.086 1.00 87.72  -1 203 GLU C OE2 1 
ATOM   3380 N N   . LYS C 3 204 ? 8.611  4.822   -365.860 1.00 59.72  ?  204 LYS C N   1 
ATOM   3381 C CA  . LYS C 3 204 ? 9.296  4.325   -364.665 1.00 57.07  ?  204 LYS C CA  1 
ATOM   3382 C C   . LYS C 3 204 ? 10.514 3.498   -365.033 1.00 51.16  ?  204 LYS C C   1 
ATOM   3383 O O   . LYS C 3 204 ? 11.513 3.507   -364.316 1.00 50.99  ?  204 LYS C O   1 
ATOM   3384 C CB  . LYS C 3 204 ? 8.377  3.479   -363.786 1.00 54.46  ?  204 LYS C CB  1 
ATOM   3385 C CG  . LYS C 3 204 ? 7.696  4.233   -362.658 1.00 63.43  ?  204 LYS C CG  1 
ATOM   3386 C CD  . LYS C 3 204 ? 6.286  4.560   -363.051 1.00 74.91  ?  204 LYS C CD  1 
ATOM   3387 C CE  . LYS C 3 204 ? 5.295  4.392   -361.913 1.00 75.41  ?  204 LYS C CE  1 
ATOM   3388 N NZ  . LYS C 3 204 ? 3.929  4.842   -362.327 1.00 81.17  ?  204 LYS C NZ  1 
ATOM   3389 N N   . LEU C 3 205 ? 10.421 2.774   -366.143 1.00 47.35  ?  205 LEU C N   1 
ATOM   3390 C CA  . LEU C 3 205 ? 11.515 1.923   -366.587 1.00 47.64  ?  205 LEU C CA  1 
ATOM   3391 C C   . LEU C 3 205 ? 12.744 2.776   -366.869 1.00 48.35  ?  205 LEU C C   1 
ATOM   3392 O O   . LEU C 3 205 ? 13.845 2.436   -366.431 1.00 46.86  ?  205 LEU C O   1 
ATOM   3393 C CB  . LEU C 3 205 ? 11.117 1.116   -367.830 1.00 51.15  ?  205 LEU C CB  1 
ATOM   3394 C CG  . LEU C 3 205 ? 12.224 0.249   -368.443 1.00 54.92  ?  205 LEU C CG  1 
ATOM   3395 C CD1 . LEU C 3 205 ? 12.703 -0.795  -367.437 1.00 49.57  ?  205 LEU C CD1 1 
ATOM   3396 C CD2 . LEU C 3 205 ? 11.781 -0.414  -369.737 1.00 49.61  ?  205 LEU C CD2 1 
ATOM   3397 N N   . GLN C 3 206 ? 12.538 3.889   -367.580 1.00 50.19  ?  206 GLN C N   1 
ATOM   3398 C CA  . GLN C 3 206 ? 13.611 4.830   -367.916 1.00 52.02  ?  206 GLN C CA  1 
ATOM   3399 C C   . GLN C 3 206 ? 14.381 5.236   -366.673 1.00 45.01  ?  206 GLN C C   1 
ATOM   3400 O O   . GLN C 3 206 ? 15.608 5.262   -366.678 1.00 40.39  ?  206 GLN C O   1 
ATOM   3401 C CB  . GLN C 3 206 ? 13.070 6.104   -368.592 1.00 51.96  ?  206 GLN C CB  1 
ATOM   3402 C CG  . GLN C 3 206 ? 12.178 5.888   -369.786 1.00 55.70  ?  206 GLN C CG  1 
ATOM   3403 C CD  . GLN C 3 206 ? 12.785 4.933   -370.771 1.00 56.86  ?  206 GLN C CD  1 
ATOM   3404 O OE1 . GLN C 3 206 ? 13.753 5.264   -371.457 1.00 60.47  ?  206 GLN C OE1 1 
ATOM   3405 N NE2 . GLN C 3 206 ? 12.235 3.723   -370.836 1.00 56.47  ?  206 GLN C NE2 1 
ATOM   3406 N N   . ARG C 3 207 ? 13.636 5.565   -365.619 1.00 42.91  ?  207 ARG C N   1 
ATOM   3407 C CA  . ARG C 3 207 ? 14.214 6.062   -364.385 1.00 37.96  ?  207 ARG C CA  1 
ATOM   3408 C C   . ARG C 3 207 ? 14.979 4.943   -363.684 1.00 37.99  ?  207 ARG C C   1 
ATOM   3409 O O   . ARG C 3 207 ? 16.066 5.169   -363.161 1.00 33.00  ?  207 ARG C O   1 
ATOM   3410 C CB  . ARG C 3 207 ? 13.120 6.655   -363.488 1.00 41.67  ?  207 ARG C CB  1 
ATOM   3411 C CG  . ARG C 3 207 ? 12.639 8.019   -363.976 1.00 46.88  ?  207 ARG C CG  1 
ATOM   3412 C CD  . ARG C 3 207 ? 11.255 8.408   -363.458 1.00 55.77  ?  207 ARG C CD  1 
ATOM   3413 N NE  . ARG C 3 207 ? 10.815 9.706   -363.982 1.00 61.38  ?  207 ARG C NE  1 
ATOM   3414 C CZ  . ARG C 3 207 ? 10.390 9.918   -365.229 1.00 60.95  ?  207 ARG C CZ  1 
ATOM   3415 N NH1 . ARG C 3 207 ? 10.347 8.926   -366.103 1.00 55.85  ?  207 ARG C NH1 1 
ATOM   3416 N NH2 . ARG C 3 207 ? 10.015 11.131  -365.611 1.00 64.55  ?  207 ARG C NH2 1 
ATOM   3417 N N   . ALA C 3 208 ? 14.430 3.731   -363.726 1.00 41.63  ?  208 ALA C N   1 
ATOM   3418 C CA  . ALA C 3 208 ? 15.096 2.559   -363.161 1.00 43.14  ?  208 ALA C CA  1 
ATOM   3419 C C   . ALA C 3 208 ? 16.417 2.249   -363.883 1.00 43.82  ?  208 ALA C C   1 
ATOM   3420 O O   . ALA C 3 208 ? 17.415 1.916   -363.237 1.00 43.62  ?  208 ALA C O   1 
ATOM   3421 C CB  . ALA C 3 208 ? 14.173 1.348   -363.204 1.00 38.18  ?  208 ALA C CB  1 
ATOM   3422 N N   . GLN C 3 209 ? 16.418 2.362   -365.212 1.00 42.61  ?  209 GLN C N   1 
ATOM   3423 C CA  . GLN C 3 209 ? 17.622 2.111   -366.015 1.00 44.33  ?  209 GLN C CA  1 
ATOM   3424 C C   . GLN C 3 209 ? 18.698 3.182   -365.802 1.00 42.09  ?  209 GLN C C   1 
ATOM   3425 O O   . GLN C 3 209 ? 19.894 2.883   -365.847 1.00 39.91  ?  209 GLN C O   1 
ATOM   3426 C CB  . GLN C 3 209 ? 17.280 2.037   -367.506 1.00 41.91  ?  209 GLN C CB  1 
ATOM   3427 C CG  . GLN C 3 209 ? 16.430 0.846   -367.905 1.00 44.41  ?  209 GLN C CG  1 
ATOM   3428 C CD  . GLN C 3 209 ? 16.013 0.903   -369.369 1.00 54.30  ?  209 GLN C CD  1 
ATOM   3429 O OE1 . GLN C 3 209 ? 16.089 1.954   -370.018 1.00 58.81  ?  209 GLN C OE1 1 
ATOM   3430 N NE2 . GLN C 3 209 ? 15.584 -0.234  -369.900 1.00 60.64  ?  209 GLN C NE2 1 
ATOM   3431 N N   . ALA C 3 210 ? 18.273 4.424   -365.579 1.00 38.51  ?  210 ALA C N   1 
ATOM   3432 C CA  . ALA C 3 210 ? 19.219 5.485   -365.267 1.00 41.32  ?  210 ALA C CA  1 
ATOM   3433 C C   . ALA C 3 210 ? 19.926 5.172   -363.941 1.00 40.67  ?  210 ALA C C   1 
ATOM   3434 O O   . ALA C 3 210 ? 21.155 5.281   -363.835 1.00 35.31  ?  210 ALA C O   1 
ATOM   3435 C CB  . ALA C 3 210 ? 18.517 6.835   -365.201 1.00 34.61  ?  210 ALA C CB  1 
ATOM   3436 N N   . TRP C 3 211 ? 19.152 4.777   -362.932 1.00 37.09  ?  211 TRP C N   1 
ATOM   3437 C CA  . TRP C 3 211 ? 19.743 4.450   -361.634 1.00 37.69  ?  211 TRP C CA  1 
ATOM   3438 C C   . TRP C 3 211 ? 20.684 3.264   -361.780 1.00 37.12  ?  211 TRP C C   1 
ATOM   3439 O O   . TRP C 3 211 ? 21.776 3.255   -361.222 1.00 34.37  ?  211 TRP C O   1 
ATOM   3440 C CB  . TRP C 3 211 ? 18.674 4.148   -360.585 1.00 36.25  ?  211 TRP C CB  1 
ATOM   3441 C CG  . TRP C 3 211 ? 19.272 3.913   -359.217 1.00 38.44  ?  211 TRP C CG  1 
ATOM   3442 C CD1 . TRP C 3 211 ? 19.477 4.849   -358.235 1.00 35.84  ?  211 TRP C CD1 1 
ATOM   3443 C CD2 . TRP C 3 211 ? 19.783 2.676   -358.705 1.00 32.09  ?  211 TRP C CD2 1 
ATOM   3444 N NE1 . TRP C 3 211 ? 20.070 4.261   -357.144 1.00 33.87  ?  211 TRP C NE1 1 
ATOM   3445 C CE2 . TRP C 3 211 ? 20.263 2.932   -357.404 1.00 35.55  ?  211 TRP C CE2 1 
ATOM   3446 C CE3 . TRP C 3 211 ? 19.867 1.379   -359.214 1.00 36.12  ?  211 TRP C CE3 1 
ATOM   3447 C CZ2 . TRP C 3 211 ? 20.821 1.926   -356.604 1.00 34.64  ?  211 TRP C CZ2 1 
ATOM   3448 C CZ3 . TRP C 3 211 ? 20.422 0.386   -358.421 1.00 38.03  ?  211 TRP C CZ3 1 
ATOM   3449 C CH2 . TRP C 3 211 ? 20.889 0.666   -357.129 1.00 33.94  ?  211 TRP C CH2 1 
ATOM   3450 N N   . GLU C 3 212 ? 20.258 2.278   -362.561 1.00 40.49  ?  212 GLU C N   1 
ATOM   3451 C CA  . GLU C 3 212 ? 21.039 1.070   -362.760 1.00 43.72  ?  212 GLU C CA  1 
ATOM   3452 C C   . GLU C 3 212 ? 22.414 1.336   -363.367 1.00 45.51  ?  212 GLU C C   1 
ATOM   3453 O O   . GLU C 3 212 ? 23.400 0.723   -362.970 1.00 49.49  ?  212 GLU C O   1 
ATOM   3454 C CB  . GLU C 3 212 ? 20.267 0.093   -363.638 1.00 48.05  ?  212 GLU C CB  1 
ATOM   3455 C CG  . GLU C 3 212 ? 20.909 -1.264  -363.730 1.00 54.95  ?  212 GLU C CG  1 
ATOM   3456 C CD  . GLU C 3 212 ? 19.886 -2.374  -363.883 1.00 70.57  ?  212 GLU C CD  1 
ATOM   3457 O OE1 . GLU C 3 212 ? 18.686 -2.120  -363.614 1.00 69.26  ?  212 GLU C OE1 1 
ATOM   3458 O OE2 . GLU C 3 212 ? 20.290 -3.501  -364.254 1.00 71.02  -1 212 GLU C OE2 1 
ATOM   3459 N N   . LYS C 3 213 ? 22.476 2.247   -364.330 1.00 43.43  ?  213 LYS C N   1 
ATOM   3460 C CA  . LYS C 3 213 ? 23.731 2.594   -364.975 1.00 42.20  ?  213 LYS C CA  1 
ATOM   3461 C C   . LYS C 3 213 ? 24.724 3.187   -363.967 1.00 45.22  ?  213 LYS C C   1 
ATOM   3462 O O   . LYS C 3 213 ? 25.913 2.844   -363.964 1.00 45.65  ?  213 LYS C O   1 
ATOM   3463 C CB  . LYS C 3 213 ? 23.458 3.564   -366.129 1.00 48.01  ?  213 LYS C CB  1 
ATOM   3464 C CG  . LYS C 3 213 ? 24.679 4.222   -366.737 1.00 57.78  ?  213 LYS C CG  1 
ATOM   3465 C CD  . LYS C 3 213 ? 24.292 5.013   -367.991 1.00 61.47  ?  213 LYS C CD  1 
ATOM   3466 C CE  . LYS C 3 213 ? 25.520 5.626   -368.672 1.00 69.07  ?  213 LYS C CE  1 
ATOM   3467 N NZ  . LYS C 3 213 ? 25.217 6.122   -370.048 1.00 74.45  ?  213 LYS C NZ  1 
ATOM   3468 N N   . GLU C 3 214 ? 24.232 4.060   -363.094 1.00 42.89  ?  214 GLU C N   1 
ATOM   3469 C CA  . GLU C 3 214 ? 25.073 4.642   -362.052 1.00 41.64  ?  214 GLU C CA  1 
ATOM   3470 C C   . GLU C 3 214 ? 25.561 3.591   -361.041 1.00 43.76  ?  214 GLU C C   1 
ATOM   3471 O O   . GLU C 3 214 ? 26.700 3.647   -360.575 1.00 43.11  ?  214 GLU C O   1 
ATOM   3472 C CB  . GLU C 3 214 ? 24.318 5.760   -361.335 1.00 43.68  ?  214 GLU C CB  1 
ATOM   3473 C CG  . GLU C 3 214 ? 24.145 7.029   -362.168 1.00 48.73  ?  214 GLU C CG  1 
ATOM   3474 C CD  . GLU C 3 214 ? 25.473 7.718   -362.486 1.00 58.60  ?  214 GLU C CD  1 
ATOM   3475 O OE1 . GLU C 3 214 ? 25.969 8.511   -361.644 1.00 52.55  ?  214 GLU C OE1 1 
ATOM   3476 O OE2 . GLU C 3 214 ? 26.010 7.471   -363.588 1.00 68.37  -1 214 GLU C OE2 1 
ATOM   3477 N N   . PHE C 3 215 ? 24.705 2.623   -360.722 1.00 39.66  ?  215 PHE C N   1 
ATOM   3478 C CA  . PHE C 3 215 ? 25.053 1.573   -359.768 1.00 41.23  ?  215 PHE C CA  1 
ATOM   3479 C C   . PHE C 3 215 ? 26.136 0.622   -360.315 1.00 40.44  ?  215 PHE C C   1 
ATOM   3480 O O   . PHE C 3 215 ? 27.058 0.233   -359.589 1.00 38.88  ?  215 PHE C O   1 
ATOM   3481 C CB  . PHE C 3 215 ? 23.780 0.802   -359.373 1.00 37.70  ?  215 PHE C CB  1 
ATOM   3482 C CG  . PHE C 3 215 ? 24.029 -0.599  -358.869 1.00 39.71  ?  215 PHE C CG  1 
ATOM   3483 C CD1 . PHE C 3 215 ? 24.323 -0.834  -357.536 1.00 35.64  ?  215 PHE C CD1 1 
ATOM   3484 C CD2 . PHE C 3 215 ? 23.936 -1.685  -359.726 1.00 40.82  ?  215 PHE C CD2 1 
ATOM   3485 C CE1 . PHE C 3 215 ? 24.530 -2.128  -357.073 1.00 38.43  ?  215 PHE C CE1 1 
ATOM   3486 C CE2 . PHE C 3 215 ? 24.151 -2.976  -359.269 1.00 43.51  ?  215 PHE C CE2 1 
ATOM   3487 C CZ  . PHE C 3 215 ? 24.447 -3.197  -357.941 1.00 45.15  ?  215 PHE C CZ  1 
ATOM   3488 N N   . ILE C 3 216 ? 26.021 0.247   -361.585 1.00 36.82  ?  216 ILE C N   1 
ATOM   3489 C CA  . ILE C 3 216 ? 26.994 -0.651  -362.208 1.00 40.75  ?  216 ILE C CA  1 
ATOM   3490 C C   . ILE C 3 216 ? 28.380 -0.011  -362.195 1.00 40.26  ?  216 ILE C C   1 
ATOM   3491 O O   . ILE C 3 216 ? 29.376 -0.633  -361.827 1.00 37.35  ?  216 ILE C O   1 
ATOM   3492 C CB  . ILE C 3 216 ? 26.599 -1.011  -363.672 1.00 44.40  ?  216 ILE C CB  1 
ATOM   3493 C CG1 . ILE C 3 216 ? 25.259 -1.741  -363.703 1.00 43.14  ?  216 ILE C CG1 1 
ATOM   3494 C CG2 . ILE C 3 216 ? 27.672 -1.872  -364.338 1.00 37.45  ?  216 ILE C CG2 1 
ATOM   3495 C CD1 . ILE C 3 216 ? 24.739 -1.988  -365.104 1.00 47.49  ?  216 ILE C CD1 1 
ATOM   3496 N N   . ASN C 3 217 ? 28.421 1.255   -362.584 1.00 40.92  ?  217 ASN C N   1 
ATOM   3497 C CA  . ASN C 3 217 ? 29.659 1.998   -362.638 1.00 44.44  ?  217 ASN C CA  1 
ATOM   3498 C C   . ASN C 3 217 ? 30.292 2.221   -361.244 1.00 41.02  ?  217 ASN C C   1 
ATOM   3499 O O   . ASN C 3 217 ? 31.502 2.083   -361.072 1.00 38.46  ?  217 ASN C O   1 
ATOM   3500 C CB  . ASN C 3 217 ? 29.400 3.326   -363.350 1.00 41.76  ?  217 ASN C CB  1 
ATOM   3501 C CG  . ASN C 3 217 ? 30.662 4.055   -363.671 1.00 46.21  ?  217 ASN C CG  1 
ATOM   3502 O OD1 . ASN C 3 217 ? 31.437 3.638   -364.534 1.00 54.86  ?  217 ASN C OD1 1 
ATOM   3503 N ND2 . ASN C 3 217 ? 30.882 5.162   -362.987 1.00 47.85  ?  217 ASN C ND2 1 
ATOM   3504 N N   . PHE C 3 218 ? 29.473 2.554   -360.252 1.00 34.41  ?  218 PHE C N   1 
ATOM   3505 C CA  . PHE C 3 218 ? 29.969 2.710   -358.883 1.00 34.54  ?  218 PHE C CA  1 
ATOM   3506 C C   . PHE C 3 218 ? 30.599 1.405   -358.373 1.00 38.46  ?  218 PHE C C   1 
ATOM   3507 O O   . PHE C 3 218 ? 31.754 1.370   -357.924 1.00 34.61  ?  218 PHE C O   1 
ATOM   3508 C CB  . PHE C 3 218 ? 28.835 3.160   -357.957 1.00 30.56  ?  218 PHE C CB  1 
ATOM   3509 C CG  . PHE C 3 218 ? 29.258 3.361   -356.530 1.00 35.39  ?  218 PHE C CG  1 
ATOM   3510 C CD1 . PHE C 3 218 ? 28.961 2.407   -355.560 1.00 32.12  ?  218 PHE C CD1 1 
ATOM   3511 C CD2 . PHE C 3 218 ? 29.954 4.504   -356.151 1.00 30.73  ?  218 PHE C CD2 1 
ATOM   3512 C CE1 . PHE C 3 218 ? 29.349 2.589   -354.232 1.00 30.30  ?  218 PHE C CE1 1 
ATOM   3513 C CE2 . PHE C 3 218 ? 30.344 4.696   -354.825 1.00 34.43  ?  218 PHE C CE2 1 
ATOM   3514 C CZ  . PHE C 3 218 ? 30.043 3.737   -353.862 1.00 31.30  ?  218 PHE C CZ  1 
ATOM   3515 N N   . VAL C 3 219 ? 29.840 0.324   -358.487 1.00 38.63  ?  219 VAL C N   1 
ATOM   3516 C CA  . VAL C 3 219 ? 30.267 -0.961  -357.967 1.00 42.20  ?  219 VAL C CA  1 
ATOM   3517 C C   . VAL C 3 219 ? 31.426 -1.547  -358.772 1.00 47.66  ?  219 VAL C C   1 
ATOM   3518 O O   . VAL C 3 219 ? 32.295 -2.218  -358.206 1.00 42.11  ?  219 VAL C O   1 
ATOM   3519 C CB  . VAL C 3 219 ? 29.074 -1.947  -357.917 1.00 45.01  ?  219 VAL C CB  1 
ATOM   3520 C CG1 . VAL C 3 219 ? 29.544 -3.350  -357.626 1.00 53.24  ?  219 VAL C CG1 1 
ATOM   3521 C CG2 . VAL C 3 219 ? 28.083 -1.497  -356.837 1.00 39.20  ?  219 VAL C CG2 1 
ATOM   3522 N N   . LYS C 3 220 ? 31.478 -1.295  -360.078 1.00 50.72  ?  220 LYS C N   1 
ATOM   3523 C CA  . LYS C 3 220 ? 32.610 -1.850  -360.796 1.00 48.44  ?  220 LYS C CA  1 
ATOM   3524 C C   . LYS C 3 220 ? 33.890 -1.033  -360.515 1.00 50.33  ?  220 LYS C C   1 
ATOM   3525 O O   . LYS C 3 220 ? 34.970 -1.568  -360.685 1.00 49.24  ?  220 LYS C O   1 
ATOM   3526 C CB  . LYS C 3 220 ? 32.331 -1.991  -362.310 1.00 50.93  ?  220 LYS C CB  1 
ATOM   3527 C CG  . LYS C 3 220 ? 32.652 -0.808  -363.176 1.00 54.76  ?  220 LYS C CG  1 
ATOM   3528 C CD  . LYS C 3 220 ? 33.378 -1.176  -364.481 1.00 70.78  ?  220 LYS C CD  1 
ATOM   3529 C CE  . LYS C 3 220 ? 33.234 -0.099  -365.567 1.00 64.10  ?  220 LYS C CE  1 
ATOM   3530 N NZ  . LYS C 3 220 ? 33.876 1.215   -365.237 1.00 67.99  ?  220 LYS C NZ  1 
ATOM   3531 N N   . ASN C 3 221 ? 33.841 0.222   -360.058 1.00 43.60  ?  221 ASN C N   1 
ATOM   3532 C CA  . ASN C 3 221 ? 35.152 0.752   -359.689 1.00 42.32  ?  221 ASN C CA  1 
ATOM   3533 C C   . ASN C 3 221 ? 35.204 1.184   -358.222 1.00 44.87  ?  221 ASN C C   1 
ATOM   3534 O O   . ASN C 3 221 ? 35.802 2.199   -357.875 1.00 44.17  ?  221 ASN C O   1 
ATOM   3535 C CB  . ASN C 3 221 ? 35.642 1.930   -360.563 1.00 51.91  ?  221 ASN C CB  1 
ATOM   3536 C CG  . ASN C 3 221 ? 35.098 1.927   -361.973 1.00 54.47  ?  221 ASN C CG  1 
ATOM   3537 O OD1 . ASN C 3 221 ? 34.132 1.268   -362.248 1.00 68.67  ?  221 ASN C OD1 1 
ATOM   3538 N ND2 . ASN C 3 221 ? 35.864 2.490   -362.915 1.00 67.83  ?  221 ASN C ND2 1 
ATOM   3539 N N   . TYR C 3 222 ? 34.580 0.395   -357.363 1.00 40.91  ?  222 TYR C N   1 
ATOM   3540 C CA  . TYR C 3 222 ? 34.629 0.649   -355.935 1.00 41.18  ?  222 TYR C CA  1 
ATOM   3541 C C   . TYR C 3 222 ? 36.031 0.290   -355.441 1.00 38.44  ?  222 TYR C C   1 
ATOM   3542 O O   . TYR C 3 222 ? 36.491 -0.835  -355.614 1.00 39.14  ?  222 TYR C O   1 
ATOM   3543 C CB  . TYR C 3 222 ? 33.551 -0.154  -355.206 1.00 37.11  ?  222 TYR C CB  1 
ATOM   3544 C CG  . TYR C 3 222 ? 33.339 0.282   -353.788 1.00 36.97  ?  222 TYR C CG  1 
ATOM   3545 C CD1 . TYR C 3 222 ? 33.964 -0.378  -352.741 1.00 34.16  ?  222 TYR C CD1 1 
ATOM   3546 C CD2 . TYR C 3 222 ? 32.543 1.377   -353.495 1.00 35.99  ?  222 TYR C CD2 1 
ATOM   3547 C CE1 . TYR C 3 222 ? 33.778 0.027   -351.433 1.00 37.36  ?  222 TYR C CE1 1 
ATOM   3548 C CE2 . TYR C 3 222 ? 32.356 1.793   -352.194 1.00 33.08  ?  222 TYR C CE2 1 
ATOM   3549 C CZ  . TYR C 3 222 ? 32.971 1.110   -351.162 1.00 35.25  ?  222 TYR C CZ  1 
ATOM   3550 O OH  . TYR C 3 222 ? 32.793 1.522   -349.858 1.00 37.05  ?  222 TYR C OH  1 
ATOM   3551 N N   . LYS C 3 223 ? 36.729 1.261   -354.876 1.00 38.75  ?  223 LYS C N   1 
ATOM   3552 C CA  . LYS C 3 223 ? 38.127 1.062   -354.530 1.00 45.92  ?  223 LYS C CA  1 
ATOM   3553 C C   . LYS C 3 223 ? 38.286 0.684   -353.050 1.00 43.21  ?  223 LYS C C   1 
ATOM   3554 O O   . LYS C 3 223 ? 38.185 1.534   -352.160 1.00 36.77  ?  223 LYS C O   1 
ATOM   3555 C CB  . LYS C 3 223 ? 38.934 2.323   -354.854 1.00 46.13  ?  223 LYS C CB  1 
ATOM   3556 C CG  . LYS C 3 223 ? 40.456 2.149   -354.829 1.00 50.17  ?  223 LYS C CG  1 
ATOM   3557 C CD  . LYS C 3 223 ? 41.118 3.420   -354.281 1.00 55.68  ?  223 LYS C CD  1 
ATOM   3558 C CE  . LYS C 3 223 ? 42.573 3.558   -354.709 1.00 63.77  ?  223 LYS C CE  1 
ATOM   3559 N NZ  . LYS C 3 223 ? 42.757 4.752   -355.596 1.00 72.18  ?  223 LYS C NZ  1 
ATOM   3560 N N   . ASN C 3 224 ? 38.523 -0.602  -352.813 1.00 35.91  ?  224 ASN C N   1 
ATOM   3561 C CA  . ASN C 3 224 ? 38.784 -1.139  -351.477 1.00 40.51  ?  224 ASN C CA  1 
ATOM   3562 C C   . ASN C 3 224 ? 39.458 -2.480  -351.689 1.00 39.16  ?  224 ASN C C   1 
ATOM   3563 O O   . ASN C 3 224 ? 38.806 -3.461  -352.053 1.00 38.99  ?  224 ASN C O   1 
ATOM   3564 C CB  . ASN C 3 224 ? 37.500 -1.292  -350.634 1.00 36.63  ?  224 ASN C CB  1 
ATOM   3565 C CG  . ASN C 3 224 ? 37.789 -1.665  -349.163 1.00 37.67  ?  224 ASN C CG  1 
ATOM   3566 O OD1 . ASN C 3 224 ? 38.900 -2.068  -348.818 1.00 37.30  ?  224 ASN C OD1 1 
ATOM   3567 N ND2 . ASN C 3 224 ? 36.784 -1.519  -348.300 1.00 32.03  ?  224 ASN C ND2 1 
ATOM   3568 N N   . PRO C 3 225 ? 40.782 -2.519  -351.491 1.00 47.36  ?  225 PRO C N   1 
ATOM   3569 C CA  . PRO C 3 225 ? 41.542 -3.745  -351.751 1.00 49.63  ?  225 PRO C CA  1 
ATOM   3570 C C   . PRO C 3 225 ? 41.195 -4.868  -350.757 1.00 51.93  ?  225 PRO C C   1 
ATOM   3571 O O   . PRO C 3 225 ? 41.456 -6.030  -351.076 1.00 51.26  ?  225 PRO C O   1 
ATOM   3572 C CB  . PRO C 3 225 ? 42.997 -3.289  -351.602 1.00 52.81  ?  225 PRO C CB  1 
ATOM   3573 C CG  . PRO C 3 225 ? 42.930 -2.131  -350.646 1.00 48.14  ?  225 PRO C CG  1 
ATOM   3574 C CD  . PRO C 3 225 ? 41.620 -1.441  -350.933 1.00 44.41  ?  225 PRO C CD  1 
ATOM   3575 N N   . ASN C 3 226 ? 40.602 -4.536  -349.603 1.00 42.09  ?  226 ASN C N   1 
ATOM   3576 C CA  . ASN C 3 226 ? 40.102 -5.564  -348.676 1.00 43.65  ?  226 ASN C CA  1 
ATOM   3577 C C   . ASN C 3 226 ? 38.933 -6.358  -349.246 1.00 44.00  ?  226 ASN C C   1 
ATOM   3578 O O   . ASN C 3 226 ? 38.617 -7.444  -348.757 1.00 43.31  ?  226 ASN C O   1 
ATOM   3579 C CB  . ASN C 3 226 ? 39.670 -4.942  -347.348 1.00 39.20  ?  226 ASN C CB  1 
ATOM   3580 C CG  . ASN C 3 226 ? 40.808 -4.255  -346.639 1.00 38.32  ?  226 ASN C CG  1 
ATOM   3581 O OD1 . ASN C 3 226 ? 41.960 -4.682  -346.741 1.00 41.67  ?  226 ASN C OD1 1 
ATOM   3582 N ND2 . ASN C 3 226 ? 40.502 -3.179  -345.931 1.00 30.86  ?  226 ASN C ND2 1 
ATOM   3583 N N   . LEU C 3 227 ? 38.280 -5.809  -350.268 1.00 39.05  ?  227 LEU C N   1 
ATOM   3584 C CA  . LEU C 3 227 ? 37.115 -6.462  -350.853 1.00 41.83  ?  227 LEU C CA  1 
ATOM   3585 C C   . LEU C 3 227 ? 37.348 -6.806  -352.315 1.00 46.35  ?  227 LEU C C   1 
ATOM   3586 O O   . LEU C 3 227 ? 37.998 -6.057  -353.045 1.00 47.35  ?  227 LEU C O   1 
ATOM   3587 C CB  . LEU C 3 227 ? 35.868 -5.571  -350.728 1.00 38.38  ?  227 LEU C CB  1 
ATOM   3588 C CG  . LEU C 3 227 ? 35.469 -5.006  -349.354 1.00 42.01  ?  227 LEU C CG  1 
ATOM   3589 C CD1 . LEU C 3 227 ? 34.279 -4.065  -349.502 1.00 38.07  ?  227 LEU C CD1 1 
ATOM   3590 C CD2 . LEU C 3 227 ? 35.151 -6.107  -348.336 1.00 37.43  ?  227 LEU C CD2 1 
ATOM   3591 N N   . THR C 3 228 ? 36.817 -7.949  -352.732 1.00 47.41  ?  228 THR C N   1 
ATOM   3592 C CA  . THR C 3 228 ? 36.714 -8.289  -354.139 1.00 43.18  ?  228 THR C CA  1 
ATOM   3593 C C   . THR C 3 228 ? 35.238 -8.359  -354.483 1.00 49.31  ?  228 THR C C   1 
ATOM   3594 O O   . THR C 3 228 ? 34.509 -9.237  -354.009 1.00 48.61  ?  228 THR C O   1 
ATOM   3595 C CB  . THR C 3 228 ? 37.411 -9.623  -354.478 1.00 46.43  ?  228 THR C CB  1 
ATOM   3596 O OG1 . THR C 3 228 ? 38.824 -9.405  -354.542 1.00 54.96  ?  228 THR C OG1 1 
ATOM   3597 C CG2 . THR C 3 228 ? 36.945 -10.151 -355.830 1.00 44.81  ?  228 THR C CG2 1 
ATOM   3598 N N   . ILE C 3 229 ? 34.800 -7.409  -355.297 1.00 51.46  ?  229 ILE C N   1 
ATOM   3599 C CA  . ILE C 3 229 ? 33.399 -7.285  -355.662 1.00 49.85  ?  229 ILE C CA  1 
ATOM   3600 C C   . ILE C 3 229 ? 33.184 -7.717  -357.095 1.00 54.25  ?  229 ILE C C   1 
ATOM   3601 O O   . ILE C 3 229 ? 33.808 -7.176  -358.001 1.00 59.89  ?  229 ILE C O   1 
ATOM   3602 C CB  . ILE C 3 229 ? 32.913 -5.838  -355.487 1.00 49.11  ?  229 ILE C CB  1 
ATOM   3603 C CG1 . ILE C 3 229 ? 33.175 -5.372  -354.047 1.00 50.29  ?  229 ILE C CG1 1 
ATOM   3604 C CG2 . ILE C 3 229 ? 31.455 -5.720  -355.861 1.00 49.44  ?  229 ILE C CG2 1 
ATOM   3605 C CD1 . ILE C 3 229 ? 33.230 -3.864  -353.891 1.00 49.98  ?  229 ILE C CD1 1 
ATOM   3606 N N   . SER C 3 230 ? 32.309 -8.692  -357.306 1.00 50.43  ?  230 SER C N   1 
ATOM   3607 C CA  . SER C 3 230 ? 31.951 -9.088  -358.663 1.00 58.19  ?  230 SER C CA  1 
ATOM   3608 C C   . SER C 3 230 ? 30.437 -9.148  -358.844 1.00 62.36  ?  230 SER C C   1 
ATOM   3609 O O   . SER C 3 230 ? 29.673 -8.836  -357.927 1.00 60.80  ?  230 SER C O   1 
ATOM   3610 C CB  . SER C 3 230 ? 32.576 -10.441 -359.016 1.00 61.78  ?  230 SER C CB  1 
ATOM   3611 O OG  . SER C 3 230 ? 31.949 -11.498 -358.315 1.00 64.95  ?  230 SER C OG  1 
ATOM   3612 N N   . PHE C 3 231 ? 30.010 -9.554  -360.034 1.00 87.98  ?  231 PHE C N   1 
ATOM   3613 C CA  . PHE C 3 231 ? 28.590 -9.688  -360.346 1.00 93.46  ?  231 PHE C CA  1 
ATOM   3614 C C   . PHE C 3 231 ? 28.192 -11.152 -360.520 1.00 102.68 ?  231 PHE C C   1 
ATOM   3615 O O   . PHE C 3 231 ? 28.939 -12.052 -360.126 1.00 105.32 ?  231 PHE C O   1 
ATOM   3616 C CB  . PHE C 3 231 ? 28.246 -8.893  -361.602 1.00 87.47  ?  231 PHE C CB  1 
ATOM   3617 C CG  . PHE C 3 231 ? 28.187 -7.416  -361.376 1.00 88.70  ?  231 PHE C CG  1 
ATOM   3618 C CD1 . PHE C 3 231 ? 26.969 -6.761  -361.328 1.00 86.89  ?  231 PHE C CD1 1 
ATOM   3619 C CD2 . PHE C 3 231 ? 29.347 -6.682  -361.191 1.00 89.14  ?  231 PHE C CD2 1 
ATOM   3620 C CE1 . PHE C 3 231 ? 26.908 -5.399  -361.117 1.00 80.78  ?  231 PHE C CE1 1 
ATOM   3621 C CE2 . PHE C 3 231 ? 29.293 -5.312  -360.975 1.00 84.96  ?  231 PHE C CE2 1 
ATOM   3622 C CZ  . PHE C 3 231 ? 28.070 -4.671  -360.938 1.00 78.27  ?  231 PHE C CZ  1 
ATOM   3623 N N   . THR C 3 232 ? 27.029 -11.372 -361.136 1.00 125.92 ?  232 THR C N   1 
ATOM   3624 C CA  . THR C 3 232 ? 26.404 -12.698 -361.250 1.00 129.77 ?  232 THR C CA  1 
ATOM   3625 C C   . THR C 3 232 ? 26.278 -13.355 -359.878 1.00 123.64 ?  232 THR C C   1 
ATOM   3626 O O   . THR C 3 232 ? 25.767 -12.748 -358.934 1.00 115.55 ?  232 THR C O   1 
ATOM   3627 C CB  . THR C 3 232 ? 27.183 -13.653 -362.202 1.00 132.83 ?  232 THR C CB  1 
ATOM   3628 O OG1 . THR C 3 232 ? 28.195 -14.361 -361.472 1.00 134.16 ?  232 THR C OG1 1 
ATOM   3629 C CG2 . THR C 3 232 ? 27.809 -12.888 -363.369 1.00 129.30 ?  232 THR C CG2 1 
HETATM 3630 C C1  . NAG D 4 .   ? 32.083 -10.890 -293.628 1.00 92.49  ?  1   NAG D C1  1 
HETATM 3631 C C2  . NAG D 4 .   ? 32.203 -10.921 -295.131 1.00 88.52  ?  1   NAG D C2  1 
HETATM 3632 C C3  . NAG D 4 .   ? 32.272 -9.518  -295.685 1.00 98.14  ?  1   NAG D C3  1 
HETATM 3633 C C4  . NAG D 4 .   ? 31.053 -8.728  -295.202 1.00 103.07 ?  1   NAG D C4  1 
HETATM 3634 C C5  . NAG D 4 .   ? 30.784 -8.905  -293.701 1.00 101.12 ?  1   NAG D C5  1 
HETATM 3635 C C6  . NAG D 4 .   ? 29.423 -8.403  -293.283 1.00 99.58  ?  1   NAG D C6  1 
HETATM 3636 C C7  . NAG D 4 .   ? 33.372 -12.850 -296.161 1.00 76.09  ?  1   NAG D C7  1 
HETATM 3637 C C8  . NAG D 4 .   ? 34.701 -13.489 -296.444 1.00 61.29  ?  1   NAG D C8  1 
HETATM 3638 N N2  . NAG D 4 .   ? 33.432 -11.681 -295.504 1.00 80.37  ?  1   NAG D N2  1 
HETATM 3639 O O3  . NAG D 4 .   ? 32.302 -9.562  -297.101 1.00 90.61  ?  1   NAG D O3  1 
HETATM 3640 O O4  . NAG D 4 .   ? 31.273 -7.335  -295.438 1.00 111.53 ?  1   NAG D O4  1 
HETATM 3641 O O5  . NAG D 4 .   ? 30.839 -10.284 -293.337 1.00 95.68  ?  1   NAG D O5  1 
HETATM 3642 O O6  . NAG D 4 .   ? 28.403 -8.883  -294.150 1.00 104.09 ?  1   NAG D O6  1 
HETATM 3643 O O7  . NAG D 4 .   ? 32.317 -13.352 -296.515 1.00 73.27  ?  1   NAG D O7  1 
HETATM 3644 C C1  . NAG D 4 .   ? 30.764 -6.781  -296.682 1.00 129.64 ?  2   NAG D C1  1 
HETATM 3645 C C2  . NAG D 4 .   ? 29.888 -5.567  -296.458 1.00 133.32 ?  2   NAG D C2  1 
HETATM 3646 C C3  . NAG D 4 .   ? 29.549 -4.918  -297.791 1.00 137.89 ?  2   NAG D C3  1 
HETATM 3647 C C4  . NAG D 4 .   ? 30.838 -4.580  -298.538 1.00 139.99 ?  2   NAG D C4  1 
HETATM 3648 C C5  . NAG D 4 .   ? 31.763 -5.797  -298.623 1.00 131.43 ?  2   NAG D C5  1 
HETATM 3649 C C6  . NAG D 4 .   ? 33.134 -5.463  -299.168 1.00 131.17 ?  2   NAG D C6  1 
HETATM 3650 C C7  . NAG D 4 .   ? 28.252 -5.278  -294.644 1.00 134.79 ?  2   NAG D C7  1 
HETATM 3651 C C8  . NAG D 4 .   ? 29.104 -4.136  -294.182 1.00 130.13 ?  2   NAG D C8  1 
HETATM 3652 N N2  . NAG D 4 .   ? 28.662 -5.928  -295.735 1.00 136.66 ?  2   NAG D N2  1 
HETATM 3653 O O3  . NAG D 4 .   ? 28.784 -3.740  -297.577 1.00 140.14 ?  2   NAG D O3  1 
HETATM 3654 O O4  . NAG D 4 .   ? 30.525 -4.138  -299.856 1.00 140.03 ?  2   NAG D O4  1 
HETATM 3655 O O5  . NAG D 4 .   ? 31.969 -6.371  -297.321 1.00 124.73 ?  2   NAG D O5  1 
HETATM 3656 O O6  . NAG D 4 .   ? 34.042 -5.113  -298.131 1.00 128.75 ?  2   NAG D O6  1 
HETATM 3657 O O7  . NAG D 4 .   ? 27.222 -5.603  -294.051 1.00 137.67 ?  2   NAG D O7  1 
HETATM 3658 O O   . HOH E 5 .   ? 30.731 -25.883 -297.715 1.00 34.02  ?  201 HOH A O   1 
HETATM 3659 O O   . HOH E 5 .   ? 33.324 -6.121  -309.988 1.00 49.75  ?  202 HOH A O   1 
HETATM 3660 O O   . HOH E 5 .   ? 45.085 -10.478 -287.693 1.00 64.21  ?  203 HOH A O   1 
HETATM 3661 O O   . HOH E 5 .   ? 47.016 -23.323 -307.335 1.00 39.95  ?  204 HOH A O   1 
HETATM 3662 O O   . HOH E 5 .   ? 38.341 -19.859 -286.998 1.00 37.42  ?  205 HOH A O   1 
HETATM 3663 O O   . HOH E 5 .   ? 20.366 -18.158 -311.598 1.00 42.09  ?  206 HOH A O   1 
HETATM 3664 O O   . HOH E 5 .   ? 43.520 -17.350 -314.843 1.00 30.95  ?  207 HOH A O   1 
HETATM 3665 O O   . HOH E 5 .   ? 46.513 -16.011 -303.348 1.00 33.03  ?  208 HOH A O   1 
HETATM 3666 O O   . HOH E 5 .   ? 23.235 -25.856 -295.074 1.00 52.36  ?  209 HOH A O   1 
HETATM 3667 O O   . HOH E 5 .   ? 48.135 -13.232 -309.785 1.00 32.61  ?  210 HOH A O   1 
HETATM 3668 O O   . HOH E 5 .   ? 35.774 -23.325 -312.742 1.00 31.06  ?  211 HOH A O   1 
HETATM 3669 O O   . HOH E 5 .   ? 39.608 -9.557  -317.525 1.00 36.28  ?  212 HOH A O   1 
HETATM 3670 O O   . HOH E 5 .   ? 42.375 -18.309 -312.009 1.00 31.23  ?  213 HOH A O   1 
HETATM 3671 O O   . HOH E 5 .   ? 50.061 -15.441 -302.394 1.00 34.11  ?  214 HOH A O   1 
HETATM 3672 O O   . HOH E 5 .   ? 40.204 -37.658 -299.366 1.00 43.00  ?  215 HOH A O   1 
HETATM 3673 O O   . HOH E 5 .   ? 20.224 -28.174 -300.082 1.00 47.82  ?  216 HOH A O   1 
HETATM 3674 O O   . HOH E 5 .   ? 36.789 -24.342 -327.511 1.00 46.60  ?  217 HOH A O   1 
HETATM 3675 O O   . HOH E 5 .   ? 40.407 -15.081 -303.586 1.00 35.77  ?  218 HOH A O   1 
HETATM 3676 O O   . HOH E 5 .   ? 40.216 -21.479 -319.176 1.00 31.35  ?  219 HOH A O   1 
HETATM 3677 O O   . HOH E 5 .   ? 43.544 -36.644 -304.079 1.00 35.80  ?  220 HOH A O   1 
HETATM 3678 O O   . HOH E 5 .   ? 53.957 -17.299 -302.072 1.00 40.63  ?  221 HOH A O   1 
HETATM 3679 O O   . HOH E 5 .   ? 39.113 -16.987 -328.671 1.00 46.25  ?  222 HOH A O   1 
HETATM 3680 O O   . HOH E 5 .   ? 38.060 -13.501 -319.339 1.00 39.75  ?  223 HOH A O   1 
HETATM 3681 O O   . HOH E 5 .   ? 51.475 -20.276 -305.681 1.00 40.24  ?  224 HOH A O   1 
HETATM 3682 O O   . HOH E 5 .   ? 39.929 -31.657 -304.105 1.00 30.59  ?  225 HOH A O   1 
HETATM 3683 O O   . HOH E 5 .   ? 34.224 -8.442  -312.328 1.00 36.43  ?  226 HOH A O   1 
HETATM 3684 O O   . HOH E 5 .   ? 51.134 -14.091 -311.559 1.00 53.00  ?  227 HOH A O   1 
HETATM 3685 O O   . HOH E 5 .   ? 33.936 -34.012 -306.783 1.00 42.94  ?  228 HOH A O   1 
HETATM 3686 O O   . HOH E 5 .   ? 37.620 -26.949 -318.929 1.00 48.98  ?  229 HOH A O   1 
HETATM 3687 O O   . HOH E 5 .   ? 32.684 -9.481  -314.284 1.00 55.01  ?  230 HOH A O   1 
HETATM 3688 O O   . HOH E 5 .   ? 48.208 -17.273 -323.060 1.00 51.24  ?  231 HOH A O   1 
HETATM 3689 O O   . HOH E 5 .   ? 28.606 -8.767  -315.690 1.00 45.23  ?  232 HOH A O   1 
HETATM 3690 O O   . HOH E 5 .   ? 41.042 -28.477 -315.107 1.00 35.04  ?  233 HOH A O   1 
HETATM 3691 O O   . HOH E 5 .   ? 38.625 -30.485 -312.902 1.00 56.28  ?  234 HOH A O   1 
HETATM 3692 O O   . HOH E 5 .   ? 32.930 -25.236 -317.785 1.00 30.74  ?  235 HOH A O   1 
HETATM 3693 O O   . HOH E 5 .   ? 49.034 -22.404 -298.977 1.00 34.78  ?  236 HOH A O   1 
HETATM 3694 O O   . HOH E 5 .   ? 24.560 -30.755 -309.374 1.00 37.47  ?  237 HOH A O   1 
HETATM 3695 O O   . HOH E 5 .   ? 35.729 -22.189 -324.117 1.00 44.11  ?  238 HOH A O   1 
HETATM 3696 O O   . HOH E 5 .   ? 41.810 -36.610 -307.949 1.00 40.10  ?  239 HOH A O   1 
HETATM 3697 O O   . HOH E 5 .   ? 30.137 -30.898 -310.885 1.00 50.73  ?  240 HOH A O   1 
HETATM 3698 O O   . HOH E 5 .   ? 33.823 -38.762 -275.009 1.00 88.83  ?  241 HOH A O   1 
HETATM 3699 O O   . HOH E 5 .   ? 47.331 -24.880 -316.445 1.00 39.69  ?  242 HOH A O   1 
HETATM 3700 O O   . HOH E 5 .   ? 46.253 -22.894 -323.757 1.00 35.96  ?  243 HOH A O   1 
HETATM 3701 O O   . HOH E 5 .   ? 37.905 -17.822 -293.602 1.00 30.71  ?  244 HOH A O   1 
HETATM 3702 O O   . HOH E 5 .   ? 47.020 -7.189  -312.402 1.00 45.82  ?  245 HOH A O   1 
HETATM 3703 O O   . HOH E 5 .   ? 23.550 -28.897 -312.445 1.00 44.97  ?  246 HOH A O   1 
HETATM 3704 O O   . HOH E 5 .   ? 28.802 -40.379 -300.521 1.00 47.87  ?  247 HOH A O   1 
HETATM 3705 O O   . HOH E 5 .   ? 22.979 -17.353 -303.725 1.00 42.99  ?  248 HOH A O   1 
HETATM 3706 O O   . HOH E 5 .   ? 21.760 -22.278 -299.072 1.00 46.59  ?  249 HOH A O   1 
HETATM 3707 O O   . HOH E 5 .   ? 34.353 -30.405 -311.338 1.00 32.48  ?  250 HOH A O   1 
HETATM 3708 O O   . HOH E 5 .   ? 39.122 -8.372  -314.130 1.00 52.34  ?  251 HOH A O   1 
HETATM 3709 O O   . HOH E 5 .   ? 27.154 -32.564 -306.544 1.00 49.05  ?  252 HOH A O   1 
HETATM 3710 O O   . HOH E 5 .   ? 47.521 -12.307 -318.171 1.00 55.98  ?  253 HOH A O   1 
HETATM 3711 O O   . HOH E 5 .   ? 52.057 -11.585 -316.174 1.00 69.25  ?  254 HOH A O   1 
HETATM 3712 O O   . HOH E 5 .   ? 24.594 -24.552 -316.472 1.00 45.54  ?  255 HOH A O   1 
HETATM 3713 O O   . HOH E 5 .   ? 48.205 -16.515 -318.460 1.00 53.33  ?  256 HOH A O   1 
HETATM 3714 O O   . HOH E 5 .   ? 47.805 -17.476 -286.600 1.00 66.75  ?  257 HOH A O   1 
HETATM 3715 O O   . HOH E 5 .   ? 23.786 -22.353 -316.061 1.00 57.69  ?  258 HOH A O   1 
HETATM 3716 O O   . HOH E 5 .   ? 42.034 -8.681  -323.771 1.00 61.46  ?  259 HOH A O   1 
HETATM 3717 O O   . HOH E 5 .   ? 36.335 -32.764 -310.769 1.00 49.65  ?  260 HOH A O   1 
HETATM 3718 O O   . HOH E 5 .   ? 38.145 -14.940 -330.268 1.00 54.16  ?  261 HOH A O   1 
HETATM 3719 O O   . HOH E 5 .   ? 37.503 -10.430 -325.210 1.00 44.70  ?  262 HOH A O   1 
HETATM 3720 O O   . HOH E 5 .   ? 47.233 -25.603 -320.461 1.00 48.98  ?  263 HOH A O   1 
HETATM 3721 O O   . HOH E 5 .   ? 48.084 -19.912 -321.228 1.00 58.40  ?  264 HOH A O   1 
HETATM 3722 O O   . HOH E 5 .   ? 34.564 -35.737 -305.157 1.00 56.01  ?  265 HOH A O   1 
HETATM 3723 O O   . HOH E 5 .   ? 47.686 -14.095 -301.368 1.00 30.09  ?  266 HOH A O   1 
HETATM 3724 O O   . HOH E 5 .   ? 51.994 -17.550 -313.653 1.00 62.53  ?  267 HOH A O   1 
HETATM 3725 O O   . HOH E 5 .   ? 54.492 -14.642 -302.823 1.00 45.01  ?  268 HOH A O   1 
HETATM 3726 O O   . HOH E 5 .   ? 26.644 -32.093 -310.261 1.00 60.03  ?  269 HOH A O   1 
HETATM 3727 O O   . HOH E 5 .   ? 48.430 -23.901 -321.652 1.00 57.22  ?  270 HOH A O   1 
HETATM 3728 O O   . HOH E 5 .   ? 48.603 -27.093 -320.405 1.00 61.60  ?  271 HOH A O   1 
HETATM 3729 O O   . HOH E 5 .   ? 39.607 -8.585  -325.889 1.00 53.60  ?  272 HOH A O   1 
HETATM 3730 O O   . HOH E 5 .   ? 49.999 -20.804 -322.489 1.00 68.94  ?  273 HOH A O   1 
HETATM 3731 O O   . HOH E 5 .   ? 49.395 -22.779 -320.236 1.00 49.97  ?  274 HOH A O   1 
HETATM 3732 O O   . HOH E 5 .   ? 53.588 -18.743 -314.041 1.00 64.42  ?  275 HOH A O   1 
HETATM 3733 O O   . HOH E 5 .   ? 49.550 -24.269 -325.519 1.00 62.85  ?  276 HOH A O   1 
HETATM 3734 O O   . HOH E 5 .   ? 50.327 -26.150 -323.751 1.00 51.82  ?  277 HOH A O   1 
HETATM 3735 O O   . HOH F 5 .   ? 40.248 -12.474 -288.854 1.00 50.81  ?  801 HOH B O   1 
HETATM 3736 O O   . HOH F 5 .   ? 55.920 -20.400 -302.735 1.00 37.87  ?  802 HOH B O   1 
HETATM 3737 O O   . HOH F 5 .   ? 53.840 -26.031 -292.877 1.00 47.06  ?  803 HOH B O   1 
HETATM 3738 O O   . HOH F 5 .   ? 51.927 -23.169 -294.854 1.00 29.22  ?  804 HOH B O   1 
HETATM 3739 O O   . HOH F 5 .   ? 45.932 -15.069 -299.020 1.00 36.95  ?  805 HOH B O   1 
HETATM 3740 O O   . HOH F 5 .   ? 51.045 -11.782 -294.089 1.00 55.68  ?  806 HOH B O   1 
HETATM 3741 O O   . HOH F 5 .   ? 36.461 -37.061 -302.892 1.00 44.64  ?  807 HOH B O   1 
HETATM 3742 O O   . HOH F 5 .   ? 40.728 -47.327 -299.241 1.00 49.66  ?  808 HOH B O   1 
HETATM 3743 O O   . HOH F 5 .   ? 47.101 -29.909 -289.278 1.00 44.89  ?  809 HOH B O   1 
HETATM 3744 O O   . HOH F 5 .   ? 38.178 -46.822 -302.687 1.00 35.25  ?  810 HOH B O   1 
HETATM 3745 O O   . HOH F 5 .   ? 51.105 -28.066 -294.665 1.00 45.66  ?  811 HOH B O   1 
HETATM 3746 O O   . HOH F 5 .   ? 37.607 -11.535 -291.723 1.00 44.57  ?  812 HOH B O   1 
HETATM 3747 O O   . HOH F 5 .   ? 56.559 -24.290 -301.768 1.00 36.17  ?  813 HOH B O   1 
HETATM 3748 O O   . HOH F 5 .   ? 21.477 -35.914 -296.478 1.00 59.03  ?  814 HOH B O   1 
HETATM 3749 O O   . HOH F 5 .   ? 39.792 -54.746 -312.835 1.00 56.95  ?  815 HOH B O   1 
HETATM 3750 O O   . HOH F 5 .   ? 30.097 -17.052 -293.287 1.00 44.73  ?  816 HOH B O   1 
HETATM 3751 O O   . HOH F 5 .   ? 47.673 -13.734 -290.037 1.00 50.95  ?  817 HOH B O   1 
HETATM 3752 O O   . HOH F 5 .   ? 48.528 -23.077 -304.516 1.00 37.72  ?  818 HOH B O   1 
HETATM 3753 O O   . HOH F 5 .   ? 54.361 -28.374 -299.059 1.00 31.02  ?  819 HOH B O   1 
HETATM 3754 O O   . HOH F 5 .   ? 44.782 -28.365 -290.794 1.00 48.50  ?  820 HOH B O   1 
HETATM 3755 O O   . HOH F 5 .   ? 36.478 -52.615 -308.394 1.00 53.54  ?  821 HOH B O   1 
HETATM 3756 O O   . HOH F 5 .   ? 49.310 -26.995 -305.947 1.00 43.70  ?  822 HOH B O   1 
HETATM 3757 O O   . HOH F 5 .   ? 45.951 -26.144 -292.653 1.00 33.88  ?  823 HOH B O   1 
HETATM 3758 O O   . HOH F 5 .   ? 43.651 -51.231 -303.228 1.00 32.21  ?  824 HOH B O   1 
HETATM 3759 O O   . HOH F 5 .   ? 23.994 -18.216 -294.724 1.00 50.60  ?  825 HOH B O   1 
HETATM 3760 O O   . HOH F 5 .   ? 52.605 -17.720 -292.862 1.00 56.05  ?  826 HOH B O   1 
HETATM 3761 O O   . HOH F 5 .   ? 48.191 -11.893 -301.343 1.00 30.80  ?  827 HOH B O   1 
HETATM 3762 O O   . HOH F 5 .   ? 37.981 -12.398 -284.920 1.00 64.05  ?  828 HOH B O   1 
HETATM 3763 O O   . HOH F 5 .   ? 52.291 -13.581 -301.667 1.00 42.85  ?  829 HOH B O   1 
HETATM 3764 O O   . HOH F 5 .   ? 54.636 -26.571 -301.223 1.00 37.22  ?  830 HOH B O   1 
HETATM 3765 O O   . HOH F 5 .   ? 21.131 -27.962 -297.945 1.00 46.47  ?  831 HOH B O   1 
HETATM 3766 O O   . HOH G 5 .   ? 18.038 -3.405  -334.807 1.00 38.58  ?  301 HOH C O   1 
HETATM 3767 O O   . HOH G 5 .   ? 23.815 -13.124 -329.786 1.00 53.66  ?  302 HOH C O   1 
HETATM 3768 O O   . HOH G 5 .   ? 9.222  -1.762  -347.027 1.00 41.20  ?  303 HOH C O   1 
HETATM 3769 O O   . HOH G 5 .   ? 24.409 -17.911 -317.930 1.00 52.24  ?  304 HOH C O   1 
HETATM 3770 O O   . HOH G 5 .   ? 25.732 8.462   -365.743 1.00 65.16  ?  305 HOH C O   1 
HETATM 3771 O O   . HOH G 5 .   ? 37.474 3.912   -357.817 1.00 46.29  ?  306 HOH C O   1 
HETATM 3772 O O   . HOH G 5 .   ? 19.577 5.957   -353.577 1.00 37.81  ?  307 HOH C O   1 
HETATM 3773 O O   . HOH G 5 .   ? 26.443 -22.362 -326.909 1.00 57.44  ?  308 HOH C O   1 
HETATM 3774 O O   . HOH G 5 .   ? 17.410 12.585  -367.933 1.00 47.01  ?  309 HOH C O   1 
HETATM 3775 O O   . HOH G 5 .   ? 34.652 -3.069  -357.923 1.00 49.69  ?  310 HOH C O   1 
HETATM 3776 O O   . HOH G 5 .   ? 32.955 -9.883  -330.258 1.00 55.56  ?  311 HOH C O   1 
HETATM 3777 O O   . HOH G 5 .   ? 39.796 -18.535 -331.144 1.00 37.59  ?  312 HOH C O   1 
HETATM 3778 O O   . HOH G 5 .   ? 16.199 -12.027 -341.249 1.00 39.87  ?  313 HOH C O   1 
HETATM 3779 O O   . HOH G 5 .   ? 37.339 -13.974 -340.338 1.00 39.46  ?  314 HOH C O   1 
HETATM 3780 O O   . HOH G 5 .   ? 26.895 6.581   -352.718 1.00 33.46  ?  315 HOH C O   1 
HETATM 3781 O O   . HOH G 5 .   ? 31.866 -16.377 -325.004 1.00 47.66  ?  316 HOH C O   1 
HETATM 3782 O O   . HOH G 5 .   ? 34.842 0.885   -345.588 1.00 42.00  ?  317 HOH C O   1 
HETATM 3783 O O   . HOH G 5 .   ? 26.024 -21.427 -338.923 1.00 47.34  ?  318 HOH C O   1 
HETATM 3784 O O   . HOH G 5 .   ? 19.835 -15.396 -322.654 1.00 61.41  ?  319 HOH C O   1 
HETATM 3785 O O   . HOH G 5 .   ? 36.026 -10.912 -336.243 1.00 48.13  ?  320 HOH C O   1 
HETATM 3786 O O   . HOH G 5 .   ? 40.924 -17.656 -334.600 1.00 50.96  ?  321 HOH C O   1 
HETATM 3787 O O   . HOH G 5 .   ? 9.862  1.787   -354.718 1.00 57.96  ?  322 HOH C O   1 
HETATM 3788 O O   . HOH G 5 .   ? 21.549 -11.892 -351.679 1.00 42.45  ?  323 HOH C O   1 
HETATM 3789 O O   . HOH G 5 .   ? 23.769 -14.318 -324.272 1.00 41.40  ?  324 HOH C O   1 
HETATM 3790 O O   . HOH G 5 .   ? 33.945 -8.248  -322.182 1.00 40.10  ?  325 HOH C O   1 
HETATM 3791 O O   . HOH G 5 .   ? 40.353 -8.932  -347.198 1.00 44.15  ?  326 HOH C O   1 
HETATM 3792 O O   . HOH G 5 .   ? 36.484 -14.416 -348.787 1.00 33.36  ?  327 HOH C O   1 
HETATM 3793 O O   . HOH G 5 .   ? 29.294 -7.411  -331.957 1.00 34.44  ?  328 HOH C O   1 
HETATM 3794 O O   . HOH G 5 .   ? 26.931 -0.798  -330.234 1.00 41.56  ?  329 HOH C O   1 
HETATM 3795 O O   . HOH G 5 .   ? 25.459 -11.047 -347.690 1.00 38.63  ?  330 HOH C O   1 
HETATM 3796 O O   . HOH G 5 .   ? 17.291 5.799   -368.867 1.00 49.20  ?  331 HOH C O   1 
HETATM 3797 O O   . HOH G 5 .   ? 11.636 -12.170 -346.915 1.00 49.62  ?  332 HOH C O   1 
HETATM 3798 O O   . HOH G 5 .   ? 39.692 -2.075  -354.919 1.00 42.17  ?  333 HOH C O   1 
HETATM 3799 O O   . HOH G 5 .   ? 27.173 2.001   -366.351 1.00 55.80  ?  334 HOH C O   1 
HETATM 3800 O O   . HOH G 5 .   ? 22.439 -24.369 -348.960 1.00 74.78  ?  335 HOH C O   1 
HETATM 3801 O O   . HOH G 5 .   ? 28.698 4.298   -346.565 1.00 39.84  ?  336 HOH C O   1 
HETATM 3802 O O   . HOH G 5 .   ? 18.502 0.290   -338.918 1.00 54.26  ?  337 HOH C O   1 
HETATM 3803 O O   . HOH G 5 .   ? 39.986 -5.144  -354.879 1.00 49.59  ?  338 HOH C O   1 
HETATM 3804 O O   . HOH G 5 .   ? 28.949 -15.608 -326.697 1.00 37.87  ?  339 HOH C O   1 
HETATM 3805 O O   . HOH G 5 .   ? 18.954 9.765   -367.455 1.00 50.61  ?  340 HOH C O   1 
HETATM 3806 O O   . HOH G 5 .   ? 34.071 -0.145  -347.893 1.00 33.94  ?  341 HOH C O   1 
HETATM 3807 O O   . HOH G 5 .   ? 24.303 -21.660 -336.673 1.00 49.27  ?  342 HOH C O   1 
HETATM 3808 O O   . HOH G 5 .   ? 43.159 -11.286 -341.532 1.00 60.37  ?  343 HOH C O   1 
HETATM 3809 O O   . HOH G 5 .   ? 10.799 -8.690  -349.958 1.00 46.14  ?  344 HOH C O   1 
HETATM 3810 O O   . HOH G 5 .   ? 23.557 -8.868  -331.585 1.00 40.80  ?  345 HOH C O   1 
HETATM 3811 O O   . HOH G 5 .   ? 36.615 -3.429  -354.037 1.00 54.73  ?  346 HOH C O   1 
HETATM 3812 O O   . HOH G 5 .   ? 13.956 15.015  -357.520 1.00 56.30  ?  347 HOH C O   1 
HETATM 3813 O O   . HOH G 5 .   ? 34.156 -11.603 -355.780 1.00 62.60  ?  348 HOH C O   1 
HETATM 3814 O O   . HOH G 5 .   ? 25.720 -7.884  -332.476 1.00 37.07  ?  349 HOH C O   1 
HETATM 3815 O O   . HOH G 5 .   ? 17.907 -21.896 -342.410 1.00 55.64  ?  350 HOH C O   1 
HETATM 3816 O O   . HOH G 5 .   ? 23.272 -26.700 -348.215 1.00 64.24  ?  351 HOH C O   1 
HETATM 3817 O O   . HOH G 5 .   ? 24.653 2.605   -339.073 1.00 39.93  ?  352 HOH C O   1 
HETATM 3818 O O   . HOH G 5 .   ? 22.644 -23.799 -339.256 1.00 51.01  ?  353 HOH C O   1 
HETATM 3819 O O   . HOH G 5 .   ? 18.394 -3.299  -331.780 1.00 53.63  ?  354 HOH C O   1 
HETATM 3820 O O   . HOH G 5 .   ? 38.488 -11.602 -336.258 1.00 59.45  ?  355 HOH C O   1 
HETATM 3821 O O   . HOH G 5 .   ? 25.190 -3.990  -323.950 1.00 56.25  ?  356 HOH C O   1 
HETATM 3822 O O   . HOH G 5 .   ? 25.901 -2.851  -326.763 1.00 56.22  ?  357 HOH C O   1 
HETATM 3823 O O   . HOH G 5 .   ? 25.532 -19.071 -330.061 1.00 63.27  ?  358 HOH C O   1 
HETATM 3824 O O   . HOH G 5 .   ? 22.901 -15.828 -319.196 1.00 58.73  ?  359 HOH C O   1 
HETATM 3825 O O   . HOH G 5 .   ? 32.314 -7.183  -331.083 1.00 51.04  ?  360 HOH C O   1 
HETATM 3826 O O   . HOH G 5 .   ? 20.884 8.146   -368.071 1.00 50.73  ?  361 HOH C O   1 
HETATM 3827 O O   . HOH G 5 .   ? 9.201  -8.975  -347.411 1.00 54.27  ?  362 HOH C O   1 
HETATM 3828 O O   . HOH G 5 .   ? 25.179 -21.626 -331.184 1.00 62.76  ?  363 HOH C O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 1   ? 1.4624 1.4298 1.3941 0.0712  0.0266  -0.0089 31  ARG A N   
2    C CA  . ARG A 1   ? 1.5036 1.4692 1.4399 0.0651  0.0275  -0.0053 31  ARG A CA  
3    C C   . ARG A 1   ? 1.4845 1.4569 1.4199 0.0634  0.0320  -0.0020 31  ARG A C   
4    O O   . ARG A 1   ? 1.5214 1.4918 1.4581 0.0598  0.0319  0.0001  31  ARG A O   
5    C CB  . ARG A 1   ? 1.5368 1.4935 1.4730 0.0642  0.0226  -0.0066 31  ARG A CB  
6    C CG  . ARG A 1   ? 1.6096 1.5651 1.5392 0.0678  0.0205  -0.0088 31  ARG A CG  
7    C CD  . ARG A 1   ? 1.6522 1.5984 1.5825 0.0664  0.0153  -0.0097 31  ARG A CD  
8    N NE  . ARG A 1   ? 1.6605 1.6000 1.5927 0.0680  0.0103  -0.0125 31  ARG A NE  
9    C CZ  . ARG A 1   ? 1.7253 1.6615 1.6530 0.0734  0.0063  -0.0170 31  ARG A CZ  
10   N NH1 . ARG A 1   ? 1.7092 1.6483 1.6295 0.0781  0.0067  -0.0194 31  ARG A NH1 
11   N NH2 . ARG A 1   ? 1.6887 1.6188 1.6193 0.0743  0.0016  -0.0190 31  ARG A NH2 
12   N N   . SER A 2   ? 0.8899 0.8706 0.8233 0.0658  0.0357  -0.0012 32  SER A N   
13   C CA  . SER A 2   ? 0.8489 0.8368 0.7821 0.0642  0.0398  0.0024  32  SER A CA  
14   C C   . SER A 2   ? 0.7335 0.7299 0.6694 0.0640  0.0442  0.0050  32  SER A C   
15   O O   . SER A 2   ? 0.6750 0.6749 0.6090 0.0681  0.0449  0.0034  32  SER A O   
16   C CB  . SER A 2   ? 0.9251 0.9152 0.8514 0.0685  0.0395  0.0009  32  SER A CB  
17   O OG  . SER A 2   ? 0.9964 0.9784 0.9202 0.0687  0.0350  -0.0015 32  SER A OG  
18   N N   . ILE A 3   ? 0.6684 0.6679 0.6089 0.0591  0.0470  0.0092  33  ILE A N   
19   C CA  . ILE A 3   ? 0.6771 0.6846 0.6210 0.0581  0.0510  0.0125  33  ILE A CA  
20   C C   . ILE A 3   ? 0.6843 0.7007 0.6246 0.0618  0.0538  0.0138  33  ILE A C   
21   O O   . ILE A 3   ? 0.5991 0.6178 0.5376 0.0614  0.0545  0.0154  33  ILE A O   
22   C CB  . ILE A 3   ? 0.5921 0.5999 0.5418 0.0519  0.0526  0.0164  33  ILE A CB  
23   C CG1 . ILE A 3   ? 0.5750 0.5755 0.5285 0.0486  0.0505  0.0155  33  ILE A CG1 
24   C CG2 . ILE A 3   ? 0.6070 0.6234 0.5601 0.0508  0.0564  0.0202  33  ILE A CG2 
25   C CD1 . ILE A 3   ? 0.5448 0.5436 0.5029 0.0430  0.0512  0.0184  33  ILE A CD1 
26   N N   . PRO A 4   ? 0.6573 0.6790 0.5967 0.0656  0.0554  0.0134  34  PRO A N   
27   C CA  . PRO A 4   ? 0.6580 0.6894 0.5944 0.0696  0.0584  0.0150  34  PRO A CA  
28   C C   . PRO A 4   ? 0.6955 0.7343 0.6362 0.0660  0.0619  0.0207  34  PRO A C   
29   O O   . PRO A 4   ? 0.6868 0.7252 0.6336 0.0611  0.0627  0.0234  34  PRO A O   
30   C CB  . PRO A 4   ? 0.7196 0.7542 0.6564 0.0730  0.0594  0.0140  34  PRO A CB  
31   C CG  . PRO A 4   ? 0.6994 0.7246 0.6369 0.0724  0.0558  0.0101  34  PRO A CG  
32   C CD  . PRO A 4   ? 0.6323 0.6512 0.5736 0.0664  0.0543  0.0112  34  PRO A CD  
33   N N   . LEU A 5   ? 0.6975 0.7429 0.6348 0.0685  0.0636  0.0224  35  LEU A N   
34   C CA  . LEU A 5   ? 0.6686 0.7218 0.6100 0.0655  0.0666  0.0281  35  LEU A CA  
35   C C   . LEU A 5   ? 0.7572 0.8215 0.6971 0.0701  0.0699  0.0305  35  LEU A C   
36   O O   . LEU A 5   ? 0.8661 0.9329 0.7994 0.0757  0.0699  0.0284  35  LEU A O   
37   C CB  . LEU A 5   ? 0.7576 0.8089 0.6975 0.0635  0.0657  0.0289  35  LEU A CB  
38   C CG  . LEU A 5   ? 0.7203 0.7785 0.6646 0.0599  0.0680  0.0346  35  LEU A CG  
39   C CD1 . LEU A 5   ? 0.6521 0.7095 0.6045 0.0541  0.0687  0.0376  35  LEU A CD1 
40   C CD2 . LEU A 5   ? 0.6722 0.7267 0.6140 0.0584  0.0664  0.0342  35  LEU A CD2 
41   N N   . GLY A 6   ? 0.8086 0.8796 0.7546 0.0680  0.0725  0.0351  36  GLY A N   
42   C CA  . GLY A 6   ? 0.8244 0.9066 0.7703 0.0721  0.0758  0.0382  36  GLY A CA  
43   C C   . GLY A 6   ? 0.8732 0.9643 0.8200 0.0717  0.0780  0.0433  36  GLY A C   
44   O O   . GLY A 6   ? 0.8488 0.9399 0.8010 0.0663  0.0781  0.0469  36  GLY A O   
45   N N   . VAL A 7   ? 0.7412 0.8398 0.6826 0.0776  0.0798  0.0436  37  VAL A N   
46   C CA  . VAL A 7   ? 0.7805 0.8886 0.7223 0.0778  0.0821  0.0487  37  VAL A CA  
47   C C   . VAL A 7   ? 0.8443 0.9652 0.7889 0.0809  0.0859  0.0538  37  VAL A C   
48   O O   . VAL A 7   ? 0.8717 0.9958 0.8118 0.0869  0.0870  0.0516  37  VAL A O   
49   C CB  . VAL A 7   ? 0.8413 0.9483 0.7742 0.0821  0.0811  0.0455  37  VAL A CB  
50   C CG1 . VAL A 7   ? 0.8537 0.9694 0.7878 0.0811  0.0831  0.0511  37  VAL A CG1 
51   C CG2 . VAL A 7   ? 0.8108 0.9045 0.7407 0.0798  0.0771  0.0401  37  VAL A CG2 
52   N N   . ILE A 8   ? 1.2463 1.3745 1.1985 0.0769  0.0877  0.0606  38  ILE A N   
53   C CA  . ILE A 8   ? 1.3509 1.4918 1.3072 0.0792  0.0912  0.0665  38  ILE A CA  
54   C C   . ILE A 8   ? 1.3686 1.5204 1.3261 0.0797  0.0934  0.0727  38  ILE A C   
55   O O   . ILE A 8   ? 1.3258 1.4768 1.2872 0.0747  0.0925  0.0755  38  ILE A O   
56   C CB  . ILE A 8   ? 1.3058 1.4468 1.2720 0.0740  0.0912  0.0702  38  ILE A CB  
57   C CG1 . ILE A 8   ? 1.2369 1.3735 1.2095 0.0666  0.0894  0.0727  38  ILE A CG1 
58   C CG2 . ILE A 8   ? 1.3046 1.4372 1.2695 0.0747  0.0897  0.0648  38  ILE A CG2 
59   C CD1 . ILE A 8   ? 1.2484 1.3865 1.2309 0.0619  0.0894  0.0771  38  ILE A CD1 
60   N N   . HIS A 9   ? 1.9295 2.0923 1.8840 0.0858  0.0964  0.0750  39  HIS A N   
61   C CA  . HIS A 9   ? 1.9524 2.1277 1.9087 0.0868  0.0990  0.0819  39  HIS A CA  
62   C C   . HIS A 9   ? 1.9606 2.1457 1.9275 0.0842  0.1012  0.0899  39  HIS A C   
63   O O   . HIS A 9   ? 1.9534 2.1365 1.9289 0.0775  0.0998  0.0934  39  HIS A O   
64   C CB  . HIS A 9   ? 1.9686 2.1512 1.9155 0.0953  0.1012  0.0803  39  HIS A CB  
65   C CG  . HIS A 9   ? 1.9561 2.1316 1.8934 0.0973  0.0991  0.0745  39  HIS A CG  
66   N ND1 . HIS A 9   ? 1.9062 2.0781 1.8446 0.0926  0.0973  0.0756  39  HIS A ND1 
67   C CD2 . HIS A 9   ? 1.9551 2.1262 1.8818 0.1037  0.0981  0.0676  39  HIS A CD2 
68   C CE1 . HIS A 9   ? 1.9271 2.0927 1.8560 0.0958  0.0954  0.0698  39  HIS A CE1 
69   N NE2 . HIS A 9   ? 1.9356 2.1005 1.8572 0.1025  0.0957  0.0648  39  HIS A NE2 
70   N N   . ASN A 10  ? 1.2638 1.4594 1.2302 0.0898  0.1044  0.0927  40  ASN A N   
71   C CA  . ASN A 10  ? 1.2446 1.4492 1.2210 0.0879  0.1063  0.1000  40  ASN A CA  
72   C C   . ASN A 10  ? 1.2736 1.4719 1.2513 0.0880  0.1055  0.0963  40  ASN A C   
73   O O   . ASN A 10  ? 1.2376 1.4336 1.2240 0.0827  0.1044  0.0989  40  ASN A O   
74   C CB  . ASN A 10  ? 1.2485 1.4693 1.2245 0.0939  0.1105  0.1061  40  ASN A CB  
75   C CG  . ASN A 10  ? 1.2158 1.4438 1.1905 0.0940  0.1114  0.1102  40  ASN A CG  
76   O OD1 . ASN A 10  ? 1.2026 1.4392 1.1861 0.0904  0.1122  0.1184  40  ASN A OD1 
77   N ND2 . ASN A 10  ? 1.2373 1.4618 1.2012 0.0981  0.1109  0.1046  40  ASN A ND2 
78   N N   . SER A 11  ? 1.6665 1.8620 1.6355 0.0942  0.1059  0.0900  41  SER A N   
79   C CA  . SER A 11  ? 1.6361 1.8240 1.6048 0.0947  0.1048  0.0851  41  SER A CA  
80   C C   . SER A 11  ? 1.6590 1.8382 1.6169 0.0997  0.1032  0.0760  41  SER A C   
81   O O   . SER A 11  ? 1.6180 1.7936 1.5744 0.1023  0.1029  0.0721  41  SER A O   
82   C CB  . SER A 11  ? 1.6397 1.8379 1.6132 0.0979  0.1078  0.0899  41  SER A CB  
83   O OG  . SER A 11  ? 1.6115 1.8172 1.5960 0.0930  0.1087  0.0985  41  SER A OG  
84   N N   . VAL A 12  ? 1.7331 1.9089 1.6839 0.1010  0.1020  0.0727  42  VAL A N   
85   C CA  . VAL A 12  ? 1.7549 1.9225 1.6953 0.1060  0.1001  0.0643  42  VAL A CA  
86   C C   . VAL A 12  ? 1.6650 1.8175 1.6067 0.1002  0.0959  0.0592  42  VAL A C   
87   O O   . VAL A 12  ? 1.6316 1.7790 1.5743 0.0953  0.0940  0.0594  42  VAL A O   
88   C CB  . VAL A 12  ? 1.7853 1.9559 1.7163 0.1110  0.1004  0.0625  42  VAL A CB  
89   C CG1 . VAL A 12  ? 1.7804 1.9659 1.7084 0.1185  0.1047  0.0664  42  VAL A CG1 
90   C CG2 . VAL A 12  ? 1.7842 1.9505 1.7151 0.1061  0.0985  0.0632  42  VAL A CG2 
91   N N   . LEU A 13  ? 1.1646 1.3104 1.1073 0.1001  0.0945  0.0553  43  LEU A N   
92   C CA  . LEU A 13  ? 1.0819 1.2139 1.0248 0.0954  0.0905  0.0504  43  LEU A CA  
93   C C   . LEU A 13  ? 1.0805 1.2047 1.0139 0.1004  0.0880  0.0425  43  LEU A C   
94   O O   . LEU A 13  ? 1.0627 1.1843 0.9939 0.1041  0.0874  0.0386  43  LEU A O   
95   C CB  . LEU A 13  ? 1.0292 1.1574 0.9791 0.0914  0.0898  0.0508  43  LEU A CB  
96   C CG  . LEU A 13  ? 0.9443 1.0591 0.8951 0.0862  0.0860  0.0466  43  LEU A CG  
97   C CD1 . LEU A 13  ? 0.8660 0.9766 0.8161 0.0822  0.0845  0.0469  43  LEU A CD1 
98   C CD2 . LEU A 13  ? 0.8482 0.9608 0.8073 0.0808  0.0857  0.0490  43  LEU A CD2 
99   N N   . GLN A 14  ? 0.9924 1.1124 0.9208 0.1002  0.0862  0.0404  44  GLN A N   
100  C CA  . GLN A 14  ? 0.9840 1.0948 0.9041 0.1039  0.0829  0.0329  44  GLN A CA  
101  C C   . GLN A 14  ? 0.9258 1.0237 0.8478 0.0981  0.0789  0.0297  44  GLN A C   
102  O O   . GLN A 14  ? 0.8882 0.9840 0.8126 0.0932  0.0782  0.0319  44  GLN A O   
103  C CB  . GLN A 14  ? 1.0309 1.1455 0.9427 0.1091  0.0832  0.0318  44  GLN A CB  
104  C CG  . GLN A 14  ? 1.0876 1.2107 1.0016 0.1066  0.0856  0.0381  44  GLN A CG  
105  C CD  . GLN A 14  ? 1.1929 1.3232 1.0982 0.1137  0.0870  0.0377  44  GLN A CD  
106  O OE1 . GLN A 14  ? 1.1957 1.3320 1.0966 0.1206  0.0888  0.0364  44  GLN A OE1 
107  N NE2 . GLN A 14  ? 1.1654 1.2952 1.0682 0.1121  0.0862  0.0386  44  GLN A NE2 
108  N N   . VAL A 15  ? 1.1621 1.2516 1.0833 0.0988  0.0763  0.0247  45  VAL A N   
109  C CA  . VAL A 15  ? 1.1302 1.2075 1.0527 0.0943  0.0723  0.0213  45  VAL A CA  
110  C C   . VAL A 15  ? 1.1650 1.2364 1.0804 0.0963  0.0694  0.0174  45  VAL A C   
111  O O   . VAL A 15  ? 1.1978 1.2645 1.1067 0.1014  0.0668  0.0119  45  VAL A O   
112  C CB  . VAL A 15  ? 1.1138 1.1844 1.0371 0.0953  0.0700  0.0170  45  VAL A CB  
113  C CG1 . VAL A 15  ? 1.0434 1.1019 0.9686 0.0904  0.0661  0.0142  45  VAL A CG1 
114  C CG2 . VAL A 15  ? 1.0055 1.0822 0.9353 0.0939  0.0729  0.0208  45  VAL A CG2 
115  N N   . SER A 16  ? 1.0091 1.0807 0.9258 0.0922  0.0696  0.0204  46  SER A N   
116  C CA  . SER A 16  ? 1.0846 1.1506 0.9953 0.0932  0.0668  0.0174  46  SER A CA  
117  C C   . SER A 16  ? 1.1523 1.2081 1.0669 0.0867  0.0637  0.0166  46  SER A C   
118  O O   . SER A 16  ? 1.0182 1.0688 0.9379 0.0831  0.0627  0.0162  46  SER A O   
119  C CB  . SER A 16  ? 1.1454 1.2204 1.0539 0.0943  0.0694  0.0214  46  SER A CB  
120  O OG  . SER A 16  ? 1.3318 1.4034 1.2320 0.0983  0.0670  0.0176  46  SER A OG  
121  N N   . ASP A 17  ? 1.3033 1.3563 1.2153 0.0854  0.0622  0.0166  47  ASP A N   
122  C CA  . ASP A 17  ? 1.3002 1.3452 1.2162 0.0791  0.0600  0.0171  47  ASP A CA  
123  C C   . ASP A 17  ? 1.4526 1.4989 1.3650 0.0790  0.0597  0.0183  47  ASP A C   
124  O O   . ASP A 17  ? 1.5214 1.5756 1.4293 0.0833  0.0617  0.0194  47  ASP A O   
125  C CB  . ASP A 17  ? 1.3074 1.3405 1.2223 0.0789  0.0555  0.0119  47  ASP A CB  
126  C CG  . ASP A 17  ? 1.2130 1.2389 1.1340 0.0719  0.0539  0.0131  47  ASP A CG  
127  O OD1 . ASP A 17  ? 1.1765 1.2051 1.1010 0.0676  0.0556  0.0172  47  ASP A OD1 
128  O OD2 . ASP A 17  ? 1.0953 1.1131 1.0178 0.0708  0.0510  0.0102  47  ASP A OD2 
129  N N   . VAL A 18  ? 1.3404 1.3794 1.2548 0.0743  0.0573  0.0183  48  VAL A N   
130  C CA  . VAL A 18  ? 1.4013 1.4405 1.3121 0.0743  0.0565  0.0190  48  VAL A CA  
131  C C   . VAL A 18  ? 1.4713 1.5040 1.3735 0.0797  0.0526  0.0132  48  VAL A C   
132  O O   . VAL A 18  ? 1.4335 1.4662 1.3307 0.0813  0.0515  0.0128  48  VAL A O   
133  C CB  . VAL A 18  ? 1.2231 1.2570 1.1394 0.0673  0.0554  0.0213  48  VAL A CB  
134  C CG1 . VAL A 18  ? 1.1828 1.2246 1.1064 0.0629  0.0592  0.0273  48  VAL A CG1 
135  C CG2 . VAL A 18  ? 1.1039 1.1272 1.0233 0.0645  0.0524  0.0184  48  VAL A CG2 
136  N N   . ASP A 19  ? 1.8185 1.8461 1.7193 0.0825  0.0505  0.0089  49  ASP A N   
137  C CA  . ASP A 19  ? 1.8428 1.8649 1.7357 0.0886  0.0467  0.0030  49  ASP A CA  
138  C C   . ASP A 19  ? 1.9269 1.9581 1.8130 0.0958  0.0491  0.0023  49  ASP A C   
139  O O   . ASP A 19  ? 1.9160 1.9446 1.7963 0.1018  0.0469  -0.0026 49  ASP A O   
140  C CB  . ASP A 19  ? 1.7841 1.7980 1.6791 0.0886  0.0437  -0.0008 49  ASP A CB  
141  C CG  . ASP A 19  ? 1.8287 1.8337 1.7173 0.0932  0.0382  -0.0069 49  ASP A CG  
142  O OD1 . ASP A 19  ? 1.8277 1.8341 1.7085 0.0985  0.0371  -0.0092 49  ASP A OD1 
143  O OD2 . ASP A 19  ? 1.7969 1.7934 1.6885 0.0917  0.0347  -0.0094 49  ASP A OD2 
144  N N   . LYS A 20  ? 1.6824 1.7245 1.5695 0.0955  0.0535  0.0073  50  LYS A N   
145  C CA  . LYS A 20  ? 1.7264 1.7789 1.6081 0.1021  0.0566  0.0078  50  LYS A CA  
146  C C   . LYS A 20  ? 1.8249 1.8890 1.7089 0.1004  0.0611  0.0144  50  LYS A C   
147  O O   . LYS A 20  ? 1.8908 1.9628 1.7688 0.1056  0.0629  0.0150  50  LYS A O   
148  C CB  . LYS A 20  ? 1.6242 1.6800 1.5076 0.1049  0.0584  0.0069  50  LYS A CB  
149  N N   . LEU A 21  ? 1.9461 2.0114 1.8391 0.0932  0.0628  0.0192  51  LEU A N   
150  C CA  . LEU A 21  ? 2.0247 2.1010 1.9222 0.0907  0.0669  0.0261  51  LEU A CA  
151  C C   . LEU A 21  ? 2.0985 2.1804 1.9898 0.0939  0.0675  0.0274  51  LEU A C   
152  O O   . LEU A 21  ? 2.1554 2.2328 2.0462 0.0907  0.0655  0.0276  51  LEU A O   
153  C CB  . LEU A 21  ? 1.6038 1.6766 1.5103 0.0823  0.0668  0.0298  51  LEU A CB  
154  C CG  . LEU A 21  ? 1.4681 1.5494 1.3830 0.0791  0.0706  0.0356  51  LEU A CG  
155  C CD1 . LEU A 21  ? 1.4097 1.4950 1.3240 0.0835  0.0722  0.0343  51  LEU A CD1 
156  C CD2 . LEU A 21  ? 1.3318 1.4068 1.2549 0.0715  0.0695  0.0371  51  LEU A CD2 
157  N N   . VAL A 22  ? 1.8730 1.9649 1.7595 0.1003  0.0703  0.0281  52  VAL A N   
158  C CA  . VAL A 22  ? 1.7570 1.8551 1.6359 0.1050  0.0710  0.0287  52  VAL A CA  
159  C C   . VAL A 22  ? 1.6537 1.7551 1.5365 0.0997  0.0717  0.0341  52  VAL A C   
160  O O   . VAL A 22  ? 1.5766 1.6805 1.4687 0.0934  0.0734  0.0392  52  VAL A O   
161  C CB  . VAL A 22  ? 1.6666 1.7782 1.5426 0.1115  0.0752  0.0312  52  VAL A CB  
162  N N   . CYS A 23  ? 1.6993 1.8005 1.5748 0.1024  0.0702  0.0328  53  CYS A N   
163  C CA  . CYS A 23  ? 1.6253 1.7289 1.5036 0.0978  0.0705  0.0374  53  CYS A CA  
164  C C   . CYS A 23  ? 1.5625 1.6815 1.4456 0.0974  0.0754  0.0453  53  CYS A C   
165  O O   . CYS A 23  ? 1.5084 1.6320 1.3935 0.0945  0.0760  0.0499  53  CYS A O   
166  C CB  . CYS A 23  ? 1.5648 1.6643 1.4335 0.1013  0.0674  0.0337  53  CYS A CB  
167  S SG  . CYS A 23  ? 1.5017 1.5937 1.3740 0.0938  0.0645  0.0355  53  CYS A SG  
168  N N   . ARG A 24  ? 1.5107 1.6376 1.3959 0.1003  0.0786  0.0471  54  ARG A N   
169  C CA  . ARG A 24  ? 1.4751 1.6165 1.3665 0.0995  0.0831  0.0552  54  ARG A CA  
170  C C   . ARG A 24  ? 1.4297 1.5709 1.3323 0.0937  0.0843  0.0585  54  ARG A C   
171  O O   . ARG A 24  ? 1.3532 1.5050 1.2631 0.0916  0.0874  0.0655  54  ARG A O   
172  C CB  . ARG A 24  ? 1.4845 1.6370 1.3693 0.1081  0.0863  0.0556  54  ARG A CB  
173  N N   . ASP A 25  ? 1.3632 1.4924 1.2670 0.0913  0.0815  0.0534  55  ASP A N   
174  C CA  . ASP A 25  ? 1.3201 1.4477 1.2338 0.0858  0.0821  0.0559  55  ASP A CA  
175  C C   . ASP A 25  ? 1.1979 1.3224 1.1196 0.0777  0.0810  0.0595  55  ASP A C   
176  O O   . ASP A 25  ? 1.1364 1.2519 1.0559 0.0752  0.0780  0.0566  55  ASP A O   
177  C CB  . ASP A 25  ? 1.4132 1.5298 1.3253 0.0865  0.0797  0.0493  55  ASP A CB  
178  C CG  . ASP A 25  ? 1.3676 1.4900 1.2802 0.0906  0.0821  0.0494  55  ASP A CG  
179  O OD1 . ASP A 25  ? 1.3181 1.4529 1.2302 0.0944  0.0856  0.0536  55  ASP A OD1 
180  O OD2 . ASP A 25  ? 1.3971 1.5120 1.3108 0.0900  0.0806  0.0455  55  ASP A OD2 
181  N N   . LYS A 26  ? 1.1772 1.3091 1.1083 0.0737  0.0833  0.0660  56  LYS A N   
182  C CA  . LYS A 26  ? 1.1138 1.2454 1.0528 0.0667  0.0826  0.0705  56  LYS A CA  
183  C C   . LYS A 26  ? 1.0038 1.1271 0.9506 0.0604  0.0811  0.0700  56  LYS A C   
184  O O   . LYS A 26  ? 0.9435 1.0704 0.8963 0.0593  0.0825  0.0725  56  LYS A O   
185  C CB  . LYS A 26  ? 1.0891 1.2351 1.0338 0.0663  0.0858  0.0788  56  LYS A CB  
186  N N   . LEU A 27  ? 0.8572 0.9697 0.8039 0.0566  0.0781  0.0668  57  LEU A N   
187  C CA  . LEU A 27  ? 0.7077 0.8128 0.6619 0.0503  0.0766  0.0668  57  LEU A CA  
188  C C   . LEU A 27  ? 0.6594 0.7642 0.6188 0.0448  0.0757  0.0705  57  LEU A C   
189  O O   . LEU A 27  ? 0.7185 0.8159 0.6748 0.0435  0.0734  0.0677  57  LEU A O   
190  C CB  . LEU A 27  ? 0.7045 0.7967 0.6547 0.0504  0.0738  0.0599  57  LEU A CB  
191  C CG  . LEU A 27  ? 0.6885 0.7725 0.6453 0.0445  0.0723  0.0593  57  LEU A CG  
192  C CD1 . LEU A 27  ? 0.6134 0.7018 0.5766 0.0433  0.0739  0.0619  57  LEU A CD1 
193  C CD2 . LEU A 27  ? 0.6989 0.7708 0.6512 0.0450  0.0694  0.0528  57  LEU A CD2 
194  N N   . SER A 28  ? 0.7044 0.8172 0.6720 0.0416  0.0772  0.0768  58  SER A N   
195  C CA  . SER A 28  ? 0.7540 0.8685 0.7270 0.0369  0.0764  0.0810  58  SER A CA  
196  C C   . SER A 28  ? 0.7127 0.8206 0.6939 0.0305  0.0748  0.0816  58  SER A C   
197  O O   . SER A 28  ? 0.7136 0.8201 0.6994 0.0262  0.0735  0.0839  58  SER A O   
198  C CB  . SER A 28  ? 0.7647 0.8932 0.7417 0.0377  0.0788  0.0883  58  SER A CB  
199  O OG  . SER A 28  ? 0.7555 0.8896 0.7401 0.0363  0.0801  0.0923  58  SER A OG  
200  N N   . SER A 29  ? 0.6401 0.7442 0.6234 0.0301  0.0747  0.0796  59  SER A N   
201  C CA  . SER A 29  ? 0.6794 0.7772 0.6699 0.0246  0.0731  0.0797  59  SER A CA  
202  C C   . SER A 29  ? 0.6283 0.7178 0.6170 0.0251  0.0723  0.0746  59  SER A C   
203  O O   . SER A 29  ? 0.6218 0.7132 0.6068 0.0291  0.0734  0.0728  59  SER A O   
204  C CB  . SER A 29  ? 0.6298 0.7358 0.6298 0.0216  0.0739  0.0862  59  SER A CB  
205  O OG  . SER A 29  ? 0.6787 0.7781 0.6852 0.0165  0.0720  0.0860  59  SER A OG  
206  N N   . THR A 30  ? 0.5531 0.6336 0.5446 0.0210  0.0703  0.0725  60  THR A N   
207  C CA  . THR A 30  ? 0.6645 0.7371 0.6547 0.0211  0.0695  0.0681  60  THR A CA  
208  C C   . THR A 30  ? 0.6609 0.7380 0.6565 0.0205  0.0705  0.0706  60  THR A C   
209  O O   . THR A 30  ? 0.5851 0.6584 0.5792 0.0217  0.0704  0.0675  60  THR A O   
210  C CB  . THR A 30  ? 0.6171 0.6796 0.6090 0.0170  0.0673  0.0656  60  THR A CB  
211  O OG1 . THR A 30  ? 0.7629 0.8174 0.7514 0.0181  0.0664  0.0607  60  THR A OG1 
212  C CG2 . THR A 30  ? 0.5741 0.6376 0.5746 0.0122  0.0668  0.0692  60  THR A CG2 
213  N N   . ASN A 31  ? 0.7504 0.8357 0.7525 0.0186  0.0713  0.0764  61  ASN A N   
214  C CA  . ASN A 31  ? 0.7637 0.8543 0.7715 0.0182  0.0721  0.0795  61  ASN A CA  
215  C C   . ASN A 31  ? 0.7445 0.8410 0.7483 0.0233  0.0742  0.0792  61  ASN A C   
216  O O   . ASN A 31  ? 0.7015 0.8010 0.7089 0.0234  0.0748  0.0809  61  ASN A O   
217  C CB  . ASN A 31  ? 0.7891 0.8880 0.8052 0.0152  0.0722  0.0864  61  ASN A CB  
218  C CG  . ASN A 31  ? 0.8229 0.9161 0.8448 0.0098  0.0699  0.0870  61  ASN A CG  
219  O OD1 . ASN A 31  ? 0.8698 0.9536 0.8908 0.0080  0.0684  0.0828  61  ASN A OD1 
220  N ND2 . ASN A 31  ? 0.8345 0.9338 0.8625 0.0073  0.0695  0.0923  61  ASN A ND2 
221  N N   . GLN A 32  ? 0.6198 0.7176 0.6159 0.0277  0.0752  0.0769  62  GLN A N   
222  C CA  . GLN A 32  ? 0.6762 0.7790 0.6675 0.0333  0.0771  0.0760  62  GLN A CA  
223  C C   . GLN A 32  ? 0.6224 0.7169 0.6092 0.0351  0.0762  0.0699  62  GLN A C   
224  O O   . GLN A 32  ? 0.6012 0.6988 0.5847 0.0395  0.0775  0.0686  62  GLN A O   
225  C CB  . GLN A 32  ? 0.6800 0.7879 0.6645 0.0378  0.0783  0.0758  62  GLN A CB  
226  C CG  . GLN A 32  ? 0.7311 0.8491 0.7196 0.0368  0.0796  0.0823  62  GLN A CG  
227  C CD  . GLN A 32  ? 0.7507 0.8732 0.7316 0.0415  0.0807  0.0818  62  GLN A CD  
228  O OE1 . GLN A 32  ? 0.7542 0.8763 0.7345 0.0398  0.0798  0.0827  62  GLN A OE1 
229  N NE2 . GLN A 32  ? 0.7236 0.8504 0.6985 0.0475  0.0824  0.0801  62  GLN A NE2 
230  N N   . LEU A 33  ? 0.6365 0.7205 0.6232 0.0320  0.0740  0.0662  63  LEU A N   
231  C CA  . LEU A 33  ? 0.6473 0.7231 0.6303 0.0333  0.0728  0.0607  63  LEU A CA  
232  C C   . LEU A 33  ? 0.5592 0.6332 0.5480 0.0304  0.0725  0.0615  63  LEU A C   
233  O O   . LEU A 33  ? 0.6410 0.7126 0.6353 0.0258  0.0715  0.0633  63  LEU A O   
234  C CB  . LEU A 33  ? 0.6082 0.6739 0.5875 0.0319  0.0705  0.0565  63  LEU A CB  
235  C CG  . LEU A 33  ? 0.6219 0.6881 0.5950 0.0348  0.0703  0.0551  63  LEU A CG  
236  C CD1 . LEU A 33  ? 0.6413 0.6980 0.6129 0.0322  0.0678  0.0523  63  LEU A CD1 
237  C CD2 . LEU A 33  ? 0.5743 0.6415 0.5401 0.0409  0.0706  0.0517  63  LEU A CD2 
238  N N   . ARG A 34  ? 0.5712 0.6463 0.5586 0.0333  0.0733  0.0601  64  ARG A N   
239  C CA  . ARG A 34  ? 0.6313 0.7046 0.6237 0.0308  0.0728  0.0606  64  ARG A CA  
240  C C   . ARG A 34  ? 0.5941 0.6613 0.5824 0.0332  0.0721  0.0556  64  ARG A C   
241  O O   . ARG A 34  ? 0.5615 0.6295 0.5441 0.0378  0.0726  0.0529  64  ARG A O   
242  C CB  . ARG A 34  ? 0.6423 0.7256 0.6402 0.0311  0.0746  0.0661  64  ARG A CB  
243  C CG  . ARG A 34  ? 0.7804 0.8631 0.7865 0.0260  0.0735  0.0693  64  ARG A CG  
244  C CD  . ARG A 34  ? 0.7992 0.8812 0.8092 0.0219  0.0724  0.0718  64  ARG A CD  
245  N NE  . ARG A 34  ? 0.8976 0.9781 0.9150 0.0174  0.0709  0.0743  64  ARG A NE  
246  C CZ  . ARG A 34  ? 0.9310 1.0076 0.9520 0.0132  0.0692  0.0749  64  ARG A CZ  
247  N NH1 . ARG A 34  ? 1.0038 1.0777 1.0219 0.0127  0.0689  0.0736  64  ARG A NH1 
248  N NH2 . ARG A 34  ? 0.8438 0.9190 0.8712 0.0097  0.0676  0.0768  64  ARG A NH2 
249  N N   . SER A 35  ? 0.6026 0.6636 0.5938 0.0300  0.0707  0.0542  65  SER A N   
250  C CA  . SER A 35  ? 0.5423 0.5982 0.5311 0.0316  0.0699  0.0503  65  SER A CA  
251  C C   . SER A 35  ? 0.5595 0.6191 0.5533 0.0307  0.0707  0.0528  65  SER A C   
252  O O   . SER A 35  ? 0.5105 0.5720 0.5101 0.0272  0.0705  0.0563  65  SER A O   
253  C CB  . SER A 35  ? 0.4954 0.5412 0.4834 0.0289  0.0677  0.0469  65  SER A CB  
254  O OG  . SER A 35  ? 0.5308 0.5751 0.5240 0.0242  0.0671  0.0491  65  SER A OG  
255  N N   . VAL A 36  ? 0.4746 0.5351 0.4664 0.0340  0.0712  0.0510  66  VAL A N   
256  C CA  . VAL A 36  ? 0.4908 0.5556 0.4871 0.0337  0.0720  0.0536  66  VAL A CA  
257  C C   . VAL A 36  ? 0.4603 0.5190 0.4554 0.0342  0.0708  0.0499  66  VAL A C   
258  O O   . VAL A 36  ? 0.4562 0.5109 0.4462 0.0370  0.0701  0.0457  66  VAL A O   
259  C CB  . VAL A 36  ? 0.5353 0.6102 0.5315 0.0378  0.0744  0.0567  66  VAL A CB  
260  C CG1 . VAL A 36  ? 0.5758 0.6555 0.5779 0.0369  0.0751  0.0602  66  VAL A CG1 
261  C CG2 . VAL A 36  ? 0.6040 0.6853 0.6010 0.0377  0.0756  0.0604  66  VAL A CG2 
262  N N   . GLY A 37  ? 0.4425 0.5007 0.4424 0.0314  0.0703  0.0516  67  GLY A N   
263  C CA  . GLY A 37  ? 0.4334 0.4868 0.4328 0.0316  0.0692  0.0487  67  GLY A CA  
264  C C   . GLY A 37  ? 0.4685 0.5282 0.4701 0.0339  0.0706  0.0508  67  GLY A C   
265  O O   . GLY A 37  ? 0.4622 0.5275 0.4690 0.0324  0.0713  0.0552  67  GLY A O   
266  N N   . LEU A 38  ? 0.4393 0.4980 0.4374 0.0376  0.0707  0.0476  68  LEU A N   
267  C CA  . LEU A 38  ? 0.4601 0.5243 0.4604 0.0399  0.0719  0.0493  68  LEU A CA  
268  C C   . LEU A 38  ? 0.4680 0.5268 0.4688 0.0392  0.0704  0.0467  68  LEU A C   
269  O O   . LEU A 38  ? 0.4675 0.5194 0.4650 0.0395  0.0688  0.0425  68  LEU A O   
270  C CB  . LEU A 38  ? 0.4163 0.4862 0.4125 0.0456  0.0737  0.0486  68  LEU A CB  
271  C CG  . LEU A 38  ? 0.5253 0.6023 0.5215 0.0464  0.0755  0.0521  68  LEU A CG  
272  C CD1 . LEU A 38  ? 0.5007 0.5816 0.4911 0.0523  0.0770  0.0503  68  LEU A CD1 
273  C CD2 . LEU A 38  ? 0.5352 0.6203 0.5381 0.0447  0.0770  0.0584  68  LEU A CD2 
274  N N   . ASN A 39  ? 0.4748 0.5373 0.4804 0.0383  0.0709  0.0497  69  ASN A N   
275  C CA  . ASN A 39  ? 0.4706 0.5292 0.4780 0.0370  0.0696  0.0485  69  ASN A CA  
276  C C   . ASN A 39  ? 0.5314 0.5906 0.5366 0.0412  0.0699  0.0458  69  ASN A C   
277  O O   . ASN A 39  ? 0.4951 0.5604 0.4989 0.0453  0.0717  0.0466  69  ASN A O   
278  C CB  . ASN A 39  ? 0.5412 0.6043 0.5551 0.0343  0.0699  0.0534  69  ASN A CB  
279  C CG  . ASN A 39  ? 0.4775 0.5374 0.4940 0.0295  0.0685  0.0549  69  ASN A CG  
280  O OD1 . ASN A 39  ? 0.6663 0.7264 0.6818 0.0287  0.0687  0.0555  69  ASN A OD1 
281  N ND2 . ASN A 39  ? 0.7539 0.8133 0.7749 0.0266  0.0674  0.0571  69  ASN A ND2 
282  N N   . LEU A 40  ? 0.5811 0.6338 0.5857 0.0402  0.0680  0.0428  70  LEU A N   
283  C CA  . LEU A 40  ? 0.5850 0.6370 0.5882 0.0436  0.0676  0.0401  70  LEU A CA  
284  C C   . LEU A 40  ? 0.6730 0.7257 0.6809 0.0417  0.0673  0.0420  70  LEU A C   
285  O O   . LEU A 40  ? 0.7639 0.8108 0.7727 0.0390  0.0653  0.0406  70  LEU A O   
286  C CB  . LEU A 40  ? 0.5736 0.6177 0.5728 0.0441  0.0654  0.0351  70  LEU A CB  
287  C CG  . LEU A 40  ? 0.6820 0.7246 0.6759 0.0474  0.0651  0.0321  70  LEU A CG  
288  C CD1 . LEU A 40  ? 0.6735 0.7180 0.6663 0.0461  0.0662  0.0340  70  LEU A CD1 
289  C CD2 . LEU A 40  ? 0.6303 0.6645 0.6217 0.0471  0.0623  0.0278  70  LEU A CD2 
290  N N   . GLU A 41  ? 0.5629 0.6231 0.5740 0.0432  0.0691  0.0456  71  GLU A N   
291  C CA  . GLU A 41  ? 0.5549 0.6164 0.5707 0.0418  0.0688  0.0477  71  GLU A CA  
292  C C   . GLU A 41  ? 0.5423 0.6118 0.5595 0.0460  0.0710  0.0499  71  GLU A C   
293  O O   . GLU A 41  ? 0.5957 0.6701 0.6103 0.0497  0.0729  0.0500  71  GLU A O   
294  C CB  . GLU A 41  ? 0.4983 0.5599 0.5188 0.0369  0.0681  0.0516  71  GLU A CB  
295  C CG  . GLU A 41  ? 0.6169 0.6856 0.6402 0.0365  0.0698  0.0564  71  GLU A CG  
296  C CD  . GLU A 41  ? 0.5819 0.6498 0.6103 0.0316  0.0684  0.0600  71  GLU A CD  
297  O OE1 . GLU A 41  ? 0.5974 0.6594 0.6267 0.0286  0.0663  0.0586  71  GLU A OE1 
298  O OE2 . GLU A 41  ? 0.5484 0.6218 0.5802 0.0307  0.0692  0.0643  71  GLU A OE2 
299  N N   . GLY A 42  ? 0.4858 0.5570 0.5071 0.0457  0.0709  0.0516  72  GLY A N   
300  C CA  . GLY A 42  ? 0.5137 0.5928 0.5369 0.0497  0.0730  0.0538  72  GLY A CA  
301  C C   . GLY A 42  ? 0.5619 0.6386 0.5843 0.0523  0.0722  0.0506  72  GLY A C   
302  O O   . GLY A 42  ? 0.5392 0.6087 0.5615 0.0498  0.0698  0.0479  72  GLY A O   
303  N N   . ASN A 43  ? 0.5941 0.6769 0.6161 0.0574  0.0742  0.0509  73  ASN A N   
304  C CA  . ASN A 43  ? 0.6501 0.7319 0.6724 0.0601  0.0736  0.0484  73  ASN A CA  
305  C C   . ASN A 43  ? 0.6097 0.6831 0.6273 0.0610  0.0711  0.0422  73  ASN A C   
306  O O   . ASN A 43  ? 0.6496 0.7213 0.6620 0.0635  0.0710  0.0390  73  ASN A O   
307  C CB  . ASN A 43  ? 0.7238 0.8142 0.7458 0.0661  0.0765  0.0497  73  ASN A CB  
308  C CG  . ASN A 43  ? 0.7360 0.8247 0.7574 0.0698  0.0757  0.0462  73  ASN A CG  
309  O OD1 . ASN A 43  ? 0.7844 0.8709 0.8006 0.0740  0.0752  0.0414  73  ASN A OD1 
310  N ND2 . ASN A 43  ? 0.6426 0.7321 0.6695 0.0680  0.0753  0.0484  73  ASN A ND2 
311  N N   . GLY A 44  ? 0.5911 0.6593 0.6109 0.0588  0.0689  0.0408  74  GLY A N   
312  C CA  . GLY A 44  ? 0.6455 0.7060 0.6621 0.0593  0.0662  0.0355  74  GLY A CA  
313  C C   . GLY A 44  ? 0.6178 0.6712 0.6333 0.0544  0.0641  0.0346  74  GLY A C   
314  O O   . GLY A 44  ? 0.6259 0.6727 0.6395 0.0540  0.0616  0.0308  74  GLY A O   
315  N N   . VAL A 45  ? 0.5056 0.5607 0.5227 0.0508  0.0650  0.0380  75  VAL A N   
316  C CA  . VAL A 45  ? 0.4792 0.5279 0.4954 0.0463  0.0633  0.0373  75  VAL A CA  
317  C C   . VAL A 45  ? 0.5123 0.5603 0.5333 0.0418  0.0624  0.0403  75  VAL A C   
318  O O   . VAL A 45  ? 0.5009 0.5531 0.5251 0.0400  0.0636  0.0443  75  VAL A O   
319  C CB  . VAL A 45  ? 0.5605 0.6104 0.5745 0.0455  0.0644  0.0384  75  VAL A CB  
320  C CG1 . VAL A 45  ? 0.4925 0.5359 0.5060 0.0408  0.0626  0.0377  75  VAL A CG1 
321  C CG2 . VAL A 45  ? 0.5161 0.5669 0.5250 0.0502  0.0651  0.0354  75  VAL A CG2 
322  N N   . ALA A 46  ? 0.4367 0.4790 0.4581 0.0400  0.0602  0.0383  76  ALA A N   
323  C CA  . ALA A 46  ? 0.4672 0.5084 0.4926 0.0362  0.0591  0.0406  76  ALA A CA  
324  C C   . ALA A 46  ? 0.4253 0.4648 0.4511 0.0319  0.0587  0.0426  76  ALA A C   
325  O O   . ALA A 46  ? 0.4449 0.4816 0.4675 0.0313  0.0586  0.0411  76  ALA A O   
326  C CB  . ALA A 46  ? 0.4602 0.4959 0.4855 0.0354  0.0567  0.0378  76  ALA A CB  
327  N N   . THR A 47  ? 0.4390 0.4799 0.4688 0.0291  0.0583  0.0459  77  THR A N   
328  C CA  . THR A 47  ? 0.4394 0.4792 0.4700 0.0254  0.0578  0.0480  77  THR A CA  
329  C C   . THR A 47  ? 0.4485 0.4825 0.4793 0.0217  0.0555  0.0473  77  THR A C   
330  O O   . THR A 47  ? 0.4561 0.4869 0.4856 0.0191  0.0547  0.0472  77  THR A O   
331  C CB  . THR A 47  ? 0.4154 0.4614 0.4507 0.0248  0.0588  0.0528  77  THR A CB  
332  O OG1 . THR A 47  ? 0.3914 0.4385 0.4307 0.0241  0.0580  0.0547  77  THR A OG1 
333  C CG2 . THR A 47  ? 0.4090 0.4617 0.4441 0.0287  0.0615  0.0540  77  THR A CG2 
334  N N   . ASP A 48  ? 0.4632 0.4959 0.4957 0.0214  0.0543  0.0470  78  ASP A N   
335  C CA  . ASP A 48  ? 0.4329 0.4606 0.4654 0.0180  0.0520  0.0466  78  ASP A CA  
336  C C   . ASP A 48  ? 0.3729 0.3951 0.4010 0.0177  0.0513  0.0431  78  ASP A C   
337  O O   . ASP A 48  ? 0.3831 0.4049 0.4091 0.0203  0.0518  0.0407  78  ASP A O   
338  C CB  . ASP A 48  ? 0.4357 0.4636 0.4711 0.0178  0.0509  0.0472  78  ASP A CB  
339  C CG  . ASP A 48  ? 0.4797 0.5065 0.5139 0.0204  0.0508  0.0443  78  ASP A CG  
340  O OD1 . ASP A 48  ? 0.4167 0.4471 0.4513 0.0238  0.0522  0.0440  78  ASP A OD1 
341  O OD2 . ASP A 48  ? 0.5441 0.5664 0.5770 0.0192  0.0491  0.0424  78  ASP A OD2 
342  N N   . VAL A 49  ? 0.3972 0.4154 0.4242 0.0147  0.0499  0.0429  79  VAL A N   
343  C CA  . VAL A 49  ? 0.3772 0.3908 0.4004 0.0142  0.0493  0.0403  79  VAL A CA  
344  C C   . VAL A 49  ? 0.3837 0.3950 0.4061 0.0156  0.0485  0.0380  79  VAL A C   
345  O O   . VAL A 49  ? 0.4270 0.4368 0.4471 0.0171  0.0487  0.0359  79  VAL A O   
346  C CB  . VAL A 49  ? 0.3952 0.4053 0.4175 0.0110  0.0480  0.0407  79  VAL A CB  
347  C CG1 . VAL A 49  ? 0.3098 0.3156 0.3285 0.0108  0.0476  0.0383  79  VAL A CG1 
348  C CG2 . VAL A 49  ? 0.3701 0.3818 0.3934 0.0097  0.0484  0.0427  79  VAL A CG2 
349  N N   . PRO A 50  ? 0.3943 0.4056 0.4190 0.0151  0.0472  0.0385  80  PRO A N   
350  C CA  . PRO A 50  ? 0.4432 0.4526 0.4677 0.0165  0.0462  0.0365  80  PRO A CA  
351  C C   . PRO A 50  ? 0.4840 0.4952 0.5081 0.0202  0.0471  0.0348  80  PRO A C   
352  O O   . PRO A 50  ? 0.5061 0.5147 0.5288 0.0214  0.0462  0.0326  80  PRO A O   
353  C CB  . PRO A 50  ? 0.4301 0.4405 0.4579 0.0156  0.0451  0.0379  80  PRO A CB  
354  C CG  . PRO A 50  ? 0.4217 0.4318 0.4499 0.0126  0.0447  0.0400  80  PRO A CG  
355  C CD  . PRO A 50  ? 0.4579 0.4700 0.4852 0.0129  0.0463  0.0408  80  PRO A CD  
356  N N   . SER A 51  ? 0.4659 0.4817 0.4913 0.0221  0.0487  0.0359  81  SER A N   
357  C CA  . SER A 51  ? 0.4444 0.4620 0.4686 0.0260  0.0496  0.0341  81  SER A CA  
358  C C   . SER A 51  ? 0.4856 0.5023 0.5062 0.0268  0.0505  0.0329  81  SER A C   
359  O O   . SER A 51  ? 0.4762 0.4919 0.4947 0.0296  0.0503  0.0305  81  SER A O   
360  C CB  . SER A 51  ? 0.4407 0.4640 0.4674 0.0282  0.0512  0.0359  81  SER A CB  
361  O OG  . SER A 51  ? 0.5658 0.5901 0.5963 0.0270  0.0504  0.0375  81  SER A OG  
362  N N   . ALA A 52  ? 0.4474 0.4643 0.4675 0.0243  0.0513  0.0346  82  ALA A N   
363  C CA  . ALA A 52  ? 0.4053 0.4218 0.4225 0.0248  0.0523  0.0339  82  ALA A CA  
364  C C   . ALA A 52  ? 0.4155 0.4266 0.4300 0.0243  0.0510  0.0315  82  ALA A C   
365  O O   . ALA A 52  ? 0.4185 0.4289 0.4305 0.0261  0.0513  0.0298  82  ALA A O   
366  C CB  . ALA A 52  ? 0.3532 0.3712 0.3712 0.0222  0.0532  0.0366  82  ALA A CB  
367  N N   . THR A 53  ? 0.3934 0.4011 0.4085 0.0218  0.0494  0.0315  83  THR A N   
368  C CA  . THR A 53  ? 0.3858 0.3888 0.3990 0.0211  0.0481  0.0298  83  THR A CA  
369  C C   . THR A 53  ? 0.4227 0.4242 0.4353 0.0239  0.0469  0.0275  83  THR A C   
370  O O   . THR A 53  ? 0.4163 0.4146 0.4271 0.0242  0.0461  0.0261  83  THR A O   
371  C CB  . THR A 53  ? 0.3753 0.3757 0.3894 0.0183  0.0467  0.0306  83  THR A CB  
372  O OG1 . THR A 53  ? 0.4753 0.4763 0.4919 0.0190  0.0455  0.0306  83  THR A OG1 
373  C CG2 . THR A 53  ? 0.3337 0.3348 0.3480 0.0157  0.0474  0.0325  83  THR A CG2 
374  N N   . LYS A 54  ? 0.4402 0.4439 0.4545 0.0262  0.0466  0.0270  84  LYS A N   
375  C CA  . LYS A 54  ? 0.4221 0.4244 0.4361 0.0294  0.0451  0.0244  84  LYS A CA  
376  C C   . LYS A 54  ? 0.4494 0.4514 0.4601 0.0318  0.0457  0.0227  84  LYS A C   
377  O O   . LYS A 54  ? 0.4297 0.4288 0.4394 0.0337  0.0438  0.0204  84  LYS A O   
378  C CB  . LYS A 54  ? 0.4844 0.4898 0.5006 0.0318  0.0451  0.0242  84  LYS A CB  
379  C CG  . LYS A 54  ? 0.5170 0.5221 0.5367 0.0297  0.0439  0.0255  84  LYS A CG  
380  C CD  . LYS A 54  ? 0.5497 0.5580 0.5719 0.0321  0.0440  0.0255  84  LYS A CD  
381  C CE  . LYS A 54  ? 0.6725 0.6804 0.6983 0.0296  0.0427  0.0271  84  LYS A CE  
382  N NZ  . LYS A 54  ? 0.7722 0.7835 0.8011 0.0315  0.0429  0.0275  84  LYS A NZ  
383  N N   . ARG A 55  ? 0.3616 0.3665 0.3707 0.0315  0.0480  0.0240  85  ARG A N   
384  C CA  . ARG A 55  ? 0.3876 0.3924 0.3935 0.0334  0.0487  0.0227  85  ARG A CA  
385  C C   . ARG A 55  ? 0.3956 0.3961 0.3999 0.0311  0.0479  0.0225  85  ARG A C   
386  O O   . ARG A 55  ? 0.3890 0.3885 0.3907 0.0325  0.0480  0.0213  85  ARG A O   
387  C CB  . ARG A 55  ? 0.3915 0.4017 0.3969 0.0341  0.0515  0.0246  85  ARG A CB  
388  C CG  . ARG A 55  ? 0.3876 0.4028 0.3947 0.0368  0.0525  0.0251  85  ARG A CG  
389  C CD  . ARG A 55  ? 0.3220 0.3433 0.3286 0.0382  0.0552  0.0272  85  ARG A CD  
390  N NE  . ARG A 55  ? 0.3782 0.4012 0.3868 0.0346  0.0564  0.0305  85  ARG A NE  
391  C CZ  . ARG A 55  ? 0.3882 0.4142 0.4004 0.0330  0.0569  0.0332  85  ARG A CZ  
392  N NH1 . ARG A 55  ? 0.3836 0.4113 0.3978 0.0347  0.0567  0.0331  85  ARG A NH1 
393  N NH2 . ARG A 55  ? 0.3432 0.3702 0.3571 0.0298  0.0575  0.0360  85  ARG A NH2 
394  N N   . TRP A 56  ? 0.4201 0.4182 0.4259 0.0278  0.0472  0.0237  86  TRP A N   
395  C CA  . TRP A 56  ? 0.4039 0.3984 0.4084 0.0257  0.0468  0.0238  86  TRP A CA  
396  C C   . TRP A 56  ? 0.4467 0.4372 0.4525 0.0247  0.0444  0.0233  86  TRP A C   
397  O O   . TRP A 56  ? 0.4382 0.4289 0.4463 0.0249  0.0432  0.0233  86  TRP A O   
398  C CB  . TRP A 56  ? 0.4041 0.3998 0.4088 0.0226  0.0485  0.0260  86  TRP A CB  
399  C CG  . TRP A 56  ? 0.3464 0.3468 0.3514 0.0231  0.0505  0.0274  86  TRP A CG  
400  C CD1 . TRP A 56  ? 0.3687 0.3722 0.3725 0.0256  0.0517  0.0270  86  TRP A CD1 
401  C CD2 . TRP A 56  ? 0.3499 0.3528 0.3569 0.0210  0.0514  0.0297  86  TRP A CD2 
402  N NE1 . TRP A 56  ? 0.3359 0.3441 0.3411 0.0252  0.0534  0.0292  86  TRP A NE1 
403  C CE2 . TRP A 56  ? 0.3352 0.3429 0.3426 0.0223  0.0531  0.0309  86  TRP A CE2 
404  C CE3 . TRP A 56  ? 0.3529 0.3545 0.3612 0.0182  0.0507  0.0309  86  TRP A CE3 
405  C CZ2 . TRP A 56  ? 0.3845 0.3955 0.3943 0.0207  0.0539  0.0335  86  TRP A CZ2 
406  C CZ3 . TRP A 56  ? 0.3313 0.3357 0.3415 0.0168  0.0514  0.0330  86  TRP A CZ3 
407  C CH2 . TRP A 56  ? 0.3328 0.3418 0.3440 0.0179  0.0529  0.0344  86  TRP A CH2 
408  N N   . GLY A 57  ? 0.4372 0.4244 0.4421 0.0237  0.0437  0.0232  87  GLY A N   
409  C CA  . GLY A 57  ? 0.4509 0.4347 0.4574 0.0226  0.0415  0.0234  87  GLY A CA  
410  C C   . GLY A 57  ? 0.4542 0.4353 0.4599 0.0207  0.0415  0.0243  87  GLY A C   
411  O O   . GLY A 57  ? 0.4191 0.3998 0.4228 0.0209  0.0425  0.0240  87  GLY A O   
412  N N   . PHE A 58  ? 0.4541 0.4336 0.4616 0.0191  0.0404  0.0256  88  PHE A N   
413  C CA  . PHE A 58  ? 0.4542 0.4316 0.4614 0.0174  0.0404  0.0268  88  PHE A CA  
414  C C   . PHE A 58  ? 0.4650 0.4392 0.4732 0.0185  0.0381  0.0264  88  PHE A C   
415  O O   . PHE A 58  ? 0.4755 0.4486 0.4859 0.0197  0.0356  0.0259  88  PHE A O   
416  C CB  . PHE A 58  ? 0.3957 0.3735 0.4041 0.0153  0.0406  0.0287  88  PHE A CB  
417  C CG  . PHE A 58  ? 0.4567 0.4366 0.4634 0.0138  0.0428  0.0293  88  PHE A CG  
418  C CD1 . PHE A 58  ? 0.4440 0.4262 0.4515 0.0138  0.0430  0.0293  88  PHE A CD1 
419  C CD2 . PHE A 58  ? 0.4440 0.4235 0.4488 0.0126  0.0444  0.0298  88  PHE A CD2 
420  C CE1 . PHE A 58  ? 0.4503 0.4342 0.4568 0.0124  0.0445  0.0300  88  PHE A CE1 
421  C CE2 . PHE A 58  ? 0.4455 0.4265 0.4491 0.0113  0.0458  0.0303  88  PHE A CE2 
422  C CZ  . PHE A 58  ? 0.4335 0.4167 0.4380 0.0112  0.0458  0.0304  88  PHE A CZ  
423  N N   . ARG A 59  ? 0.4749 0.4474 0.4817 0.0179  0.0387  0.0267  89  ARG A N   
424  C CA  . ARG A 59  ? 0.4430 0.4123 0.4507 0.0189  0.0364  0.0263  89  ARG A CA  
425  C C   . ARG A 59  ? 0.4971 0.4650 0.5046 0.0170  0.0372  0.0281  89  ARG A C   
426  O O   . ARG A 59  ? 0.4620 0.4311 0.4674 0.0158  0.0398  0.0285  89  ARG A O   
427  C CB  . ARG A 59  ? 0.4554 0.4241 0.4608 0.0213  0.0360  0.0239  89  ARG A CB  
428  C CG  . ARG A 59  ? 0.4747 0.4397 0.4803 0.0223  0.0336  0.0232  89  ARG A CG  
429  C CD  . ARG A 59  ? 0.4932 0.4555 0.5020 0.0236  0.0296  0.0228  89  ARG A CD  
430  N NE  . ARG A 59  ? 0.4646 0.4230 0.4745 0.0238  0.0270  0.0232  89  ARG A NE  
431  C CZ  . ARG A 59  ? 0.4900 0.4457 0.4983 0.0260  0.0249  0.0210  89  ARG A CZ  
432  N NH1 . ARG A 59  ? 0.4885 0.4404 0.4983 0.0258  0.0223  0.0218  89  ARG A NH1 
433  N NH2 . ARG A 59  ? 0.4680 0.4249 0.4732 0.0286  0.0253  0.0182  89  ARG A NH2 
434  N N   . SER A 60  ? 0.4820 0.4474 0.4920 0.0169  0.0349  0.0294  90  SER A N   
435  C CA  . SER A 60  ? 0.4555 0.4196 0.4659 0.0155  0.0356  0.0313  90  SER A CA  
436  C C   . SER A 60  ? 0.5317 0.4924 0.5424 0.0165  0.0335  0.0308  90  SER A C   
437  O O   . SER A 60  ? 0.5225 0.4814 0.5341 0.0183  0.0307  0.0293  90  SER A O   
438  C CB  . SER A 60  ? 0.4942 0.4588 0.5076 0.0142  0.0349  0.0342  90  SER A CB  
439  O OG  . SER A 60  ? 0.5667 0.5342 0.5790 0.0131  0.0371  0.0348  90  SER A OG  
440  N N   . GLY A 61  ? 0.4132 0.3729 0.4232 0.0154  0.0347  0.0319  91  GLY A N   
441  C CA  . GLY A 61  ? 0.4153 0.3717 0.4257 0.0160  0.0327  0.0317  91  GLY A CA  
442  C C   . GLY A 61  ? 0.4425 0.3985 0.4492 0.0170  0.0336  0.0293  91  GLY A C   
443  O O   . GLY A 61  ? 0.4854 0.4387 0.4919 0.0175  0.0323  0.0291  91  GLY A O   
444  N N   . VAL A 62  ? 0.4530 0.4120 0.4571 0.0175  0.0358  0.0277  92  VAL A N   
445  C CA  . VAL A 62  ? 0.4299 0.3895 0.4307 0.0185  0.0370  0.0258  92  VAL A CA  
446  C C   . VAL A 62  ? 0.4053 0.3673 0.4045 0.0167  0.0404  0.0267  92  VAL A C   
447  O O   . VAL A 62  ? 0.4182 0.3831 0.4173 0.0159  0.0423  0.0270  92  VAL A O   
448  C CB  . VAL A 62  ? 0.4461 0.4077 0.4454 0.0209  0.0366  0.0234  92  VAL A CB  
449  C CG1 . VAL A 62  ? 0.4277 0.3904 0.4235 0.0224  0.0377  0.0218  92  VAL A CG1 
450  C CG2 . VAL A 62  ? 0.4182 0.3770 0.4192 0.0228  0.0329  0.0224  92  VAL A CG2 
451  N N   . PRO A 63  ? 0.4648 0.4255 0.4631 0.0160  0.0409  0.0271  93  PRO A N   
452  C CA  . PRO A 63  ? 0.4503 0.4128 0.4475 0.0143  0.0438  0.0279  93  PRO A CA  
453  C C   . PRO A 63  ? 0.4485 0.4145 0.4435 0.0151  0.0454  0.0266  93  PRO A C   
454  O O   . PRO A 63  ? 0.4539 0.4203 0.4473 0.0171  0.0447  0.0251  93  PRO A O   
455  C CB  . PRO A 63  ? 0.4570 0.4169 0.4541 0.0138  0.0432  0.0284  93  PRO A CB  
456  C CG  . PRO A 63  ? 0.5186 0.4749 0.5174 0.0148  0.0401  0.0286  93  PRO A CG  
457  C CD  . PRO A 63  ? 0.4653 0.4222 0.4639 0.0168  0.0385  0.0269  93  PRO A CD  
458  N N   . PRO A 64  ? 0.4021 0.3709 0.3972 0.0137  0.0476  0.0274  94  PRO A N   
459  C CA  . PRO A 64  ? 0.3690 0.3415 0.3629 0.0141  0.0491  0.0269  94  PRO A CA  
460  C C   . PRO A 64  ? 0.4052 0.3782 0.3977 0.0143  0.0498  0.0269  94  PRO A C   
461  O O   . PRO A 64  ? 0.3966 0.3673 0.3893 0.0131  0.0496  0.0275  94  PRO A O   
462  C CB  . PRO A 64  ? 0.3285 0.3027 0.3234 0.0121  0.0506  0.0281  94  PRO A CB  
463  C CG  . PRO A 64  ? 0.3816 0.3530 0.3774 0.0107  0.0504  0.0290  94  PRO A CG  
464  C CD  . PRO A 64  ? 0.3377 0.3063 0.3341 0.0118  0.0484  0.0288  94  PRO A CD  
465  N N   . LYS A 65  ? 0.3638 0.3402 0.3550 0.0157  0.0505  0.0264  95  LYS A N   
466  C CA  . LYS A 65  ? 0.3390 0.3167 0.3289 0.0160  0.0512  0.0266  95  LYS A CA  
467  C C   . LYS A 65  ? 0.3698 0.3527 0.3600 0.0158  0.0531  0.0276  95  LYS A C   
468  O O   . LYS A 65  ? 0.3847 0.3704 0.3754 0.0167  0.0535  0.0276  95  LYS A O   
469  C CB  . LYS A 65  ? 0.3755 0.3520 0.3631 0.0188  0.0496  0.0248  95  LYS A CB  
470  C CG  . LYS A 65  ? 0.3865 0.3576 0.3743 0.0187  0.0473  0.0242  95  LYS A CG  
471  C CD  . LYS A 65  ? 0.3903 0.3594 0.3783 0.0169  0.0476  0.0253  95  LYS A CD  
472  C CE  . LYS A 65  ? 0.4133 0.3774 0.4028 0.0161  0.0456  0.0257  95  LYS A CE  
473  N NZ  . LYS A 65  ? 0.4296 0.3907 0.4182 0.0185  0.0426  0.0240  95  LYS A NZ  
474  N N   . VAL A 66  ? 0.3913 0.3756 0.3818 0.0145  0.0541  0.0289  96  VAL A N   
475  C CA  . VAL A 66  ? 0.3773 0.3667 0.3690 0.0139  0.0557  0.0305  96  VAL A CA  
476  C C   . VAL A 66  ? 0.3978 0.3899 0.3881 0.0151  0.0563  0.0310  96  VAL A C   
477  O O   . VAL A 66  ? 0.4272 0.4166 0.4163 0.0149  0.0556  0.0306  96  VAL A O   
478  C CB  . VAL A 66  ? 0.4134 0.4023 0.4077 0.0108  0.0562  0.0321  96  VAL A CB  
479  C CG1 . VAL A 66  ? 0.3607 0.3543 0.3569 0.0098  0.0573  0.0342  96  VAL A CG1 
480  C CG2 . VAL A 66  ? 0.4163 0.4040 0.4117 0.0100  0.0559  0.0318  96  VAL A CG2 
481  N N   . VAL A 67  ? 0.3617 0.3595 0.3522 0.0163  0.0575  0.0322  97  VAL A N   
482  C CA  . VAL A 67  ? 0.3448 0.3463 0.3341 0.0174  0.0583  0.0332  97  VAL A CA  
483  C C   . VAL A 67  ? 0.3436 0.3514 0.3359 0.0164  0.0598  0.0362  97  VAL A C   
484  O O   . VAL A 67  ? 0.3712 0.3813 0.3651 0.0166  0.0602  0.0368  97  VAL A O   
485  C CB  . VAL A 67  ? 0.4099 0.4122 0.3953 0.0215  0.0579  0.0312  97  VAL A CB  
486  C CG1 . VAL A 67  ? 0.3378 0.3424 0.3233 0.0236  0.0581  0.0305  97  VAL A CG1 
487  C CG2 . VAL A 67  ? 0.3914 0.3982 0.3750 0.0231  0.0588  0.0322  97  VAL A CG2 
488  N N   . ASN A 68  ? 0.3572 0.3676 0.3507 0.0152  0.0604  0.0383  98  ASN A N   
489  C CA  . ASN A 68  ? 0.4237 0.4400 0.4209 0.0140  0.0615  0.0416  98  ASN A CA  
490  C C   . ASN A 68  ? 0.4410 0.4642 0.4372 0.0171  0.0628  0.0428  98  ASN A C   
491  O O   . ASN A 68  ? 0.4450 0.4683 0.4371 0.0202  0.0629  0.0409  98  ASN A O   
492  C CB  . ASN A 68  ? 0.4219 0.4387 0.4218 0.0112  0.0614  0.0438  98  ASN A CB  
493  C CG  . ASN A 68  ? 0.4633 0.4835 0.4615 0.0125  0.0621  0.0448  98  ASN A CG  
494  O OD1 . ASN A 68  ? 0.5119 0.5293 0.5059 0.0144  0.0617  0.0425  98  ASN A OD1 
495  N ND2 . ASN A 68  ? 0.4158 0.4420 0.4172 0.0115  0.0629  0.0484  98  ASN A ND2 
496  N N   . TYR A 69  ? 0.4117 0.4405 0.4118 0.0165  0.0637  0.0459  99  TYR A N   
497  C CA  . TYR A 69  ? 0.4557 0.4923 0.4557 0.0192  0.0652  0.0481  99  TYR A CA  
498  C C   . TYR A 69  ? 0.4233 0.4652 0.4291 0.0167  0.0656  0.0527  99  TYR A C   
499  O O   . TYR A 69  ? 0.4391 0.4780 0.4485 0.0134  0.0644  0.0533  99  TYR A O   
500  C CB  . TYR A 69  ? 0.3748 0.4126 0.3734 0.0222  0.0657  0.0466  99  TYR A CB  
501  C CG  . TYR A 69  ? 0.4403 0.4781 0.4429 0.0203  0.0653  0.0479  99  TYR A CG  
502  C CD1 . TYR A 69  ? 0.3963 0.4274 0.3989 0.0185  0.0638  0.0455  99  TYR A CD1 
503  C CD2 . TYR A 69  ? 0.4009 0.4458 0.4076 0.0204  0.0663  0.0517  99  TYR A CD2 
504  C CE1 . TYR A 69  ? 0.3490 0.3802 0.3551 0.0169  0.0633  0.0466  99  TYR A CE1 
505  C CE2 . TYR A 69  ? 0.4338 0.4787 0.4443 0.0187  0.0656  0.0529  99  TYR A CE2 
506  C CZ  . TYR A 69  ? 0.4199 0.4578 0.4299 0.0169  0.0641  0.0503  99  TYR A CZ  
507  O OH  . TYR A 69  ? 0.3486 0.3867 0.3623 0.0153  0.0633  0.0516  99  TYR A OH  
508  N N   . GLU A 70  ? 0.4975 0.5473 0.5045 0.0182  0.0670  0.0560  100 GLU A N   
509  C CA  . GLU A 70  ? 0.5416 0.5962 0.5545 0.0154  0.0670  0.0607  100 GLU A CA  
510  C C   . GLU A 70  ? 0.5206 0.5821 0.5382 0.0158  0.0677  0.0646  100 GLU A C   
511  O O   . GLU A 70  ? 0.5542 0.6186 0.5779 0.0129  0.0669  0.0685  100 GLU A O   
512  C CB  . GLU A 70  ? 0.5835 0.6424 0.5954 0.0162  0.0679  0.0626  100 GLU A CB  
513  C CG  . GLU A 70  ? 0.6875 0.7400 0.6971 0.0144  0.0668  0.0602  100 GLU A CG  
514  C CD  . GLU A 70  ? 0.7162 0.7720 0.7224 0.0164  0.0677  0.0607  100 GLU A CD  
515  O OE1 . GLU A 70  ? 0.8108 0.8643 0.8176 0.0142  0.0670  0.0610  100 GLU A OE1 
516  O OE2 . GLU A 70  ? 0.7659 0.8265 0.7686 0.0204  0.0692  0.0606  100 GLU A OE2 
517  N N   . ALA A 71  ? 0.4560 0.5202 0.4711 0.0192  0.0689  0.0637  101 ALA A N   
518  C CA  . ALA A 71  ? 0.4672 0.5381 0.4869 0.0198  0.0697  0.0675  101 ALA A CA  
519  C C   . ALA A 71  ? 0.3924 0.4619 0.4093 0.0226  0.0702  0.0647  101 ALA A C   
520  O O   . ALA A 71  ? 0.4424 0.5089 0.4534 0.0255  0.0706  0.0606  101 ALA A O   
521  C CB  . ALA A 71  ? 0.4360 0.5171 0.4573 0.0219  0.0717  0.0721  101 ALA A CB  
522  N N   . GLY A 72  ? 0.3656 0.4371 0.3870 0.0216  0.0698  0.0669  102 GLY A N   
523  C CA  . GLY A 72  ? 0.4216 0.4927 0.4411 0.0242  0.0703  0.0649  102 GLY A CA  
524  C C   . GLY A 72  ? 0.4696 0.5480 0.4946 0.0246  0.0711  0.0695  102 GLY A C   
525  O O   . GLY A 72  ? 0.4701 0.5554 0.4997 0.0239  0.0717  0.0745  102 GLY A O   
526  N N   . GLU A 73  ? 0.4668 0.5437 0.4917 0.0256  0.0709  0.0681  103 GLU A N   
527  C CA  . GLU A 73  ? 0.4718 0.5555 0.5021 0.0262  0.0716  0.0725  103 GLU A CA  
528  C C   . GLU A 73  ? 0.4836 0.5630 0.5178 0.0230  0.0694  0.0727  103 GLU A C   
529  O O   . GLU A 73  ? 0.4916 0.5627 0.5231 0.0214  0.0678  0.0685  103 GLU A O   
530  C CB  . GLU A 73  ? 0.5578 0.6465 0.5850 0.0313  0.0739  0.0717  103 GLU A CB  
531  C CG  . GLU A 73  ? 0.5202 0.6021 0.5412 0.0335  0.0735  0.0656  103 GLU A CG  
532  C CD  . GLU A 73  ? 0.5326 0.6194 0.5516 0.0385  0.0755  0.0650  103 GLU A CD  
533  O OE1 . GLU A 73  ? 0.5388 0.6331 0.5625 0.0394  0.0768  0.0695  103 GLU A OE1 
534  O OE2 . GLU A 73  ? 0.5321 0.6151 0.5453 0.0416  0.0755  0.0602  103 GLU A OE2 
535  N N   . TRP A 74  ? 0.5100 0.5952 0.5506 0.0222  0.0693  0.0778  104 TRP A N   
536  C CA  . TRP A 74  ? 0.4535 0.5357 0.4980 0.0198  0.0673  0.0783  104 TRP A CA  
537  C C   . TRP A 74  ? 0.4575 0.5359 0.4976 0.0221  0.0677  0.0740  104 TRP A C   
538  O O   . TRP A 74  ? 0.3981 0.4806 0.4357 0.0261  0.0699  0.0734  104 TRP A O   
539  C CB  . TRP A 74  ? 0.4667 0.5570 0.5188 0.0194  0.0674  0.0849  104 TRP A CB  
540  C CG  . TRP A 74  ? 0.5023 0.5936 0.5610 0.0154  0.0652  0.0893  104 TRP A CG  
541  C CD1 . TRP A 74  ? 0.4663 0.5638 0.5285 0.0150  0.0657  0.0936  104 TRP A CD1 
542  C CD2 . TRP A 74  ? 0.4352 0.5214 0.4983 0.0114  0.0617  0.0899  104 TRP A CD2 
543  N NE1 . TRP A 74  ? 0.4950 0.5913 0.5638 0.0109  0.0626  0.0970  104 TRP A NE1 
544  C CE2 . TRP A 74  ? 0.4026 0.4919 0.4718 0.0087  0.0601  0.0946  104 TRP A CE2 
545  C CE3 . TRP A 74  ? 0.4473 0.5264 0.5094 0.0099  0.0596  0.0869  104 TRP A CE3 
546  C CZ2 . TRP A 74  ? 0.4609 0.5460 0.5353 0.0047  0.0562  0.0961  104 TRP A CZ2 
547  C CZ3 . TRP A 74  ? 0.4829 0.5581 0.5498 0.0060  0.0560  0.0884  104 TRP A CZ3 
548  C CH2 . TRP A 74  ? 0.4896 0.5676 0.5625 0.0035  0.0542  0.0928  104 TRP A CH2 
549  N N   . ALA A 75  ? 0.4459 0.5164 0.4853 0.0196  0.0655  0.0710  105 ALA A N   
550  C CA  . ALA A 75  ? 0.4252 0.4918 0.4614 0.0212  0.0654  0.0672  105 ALA A CA  
551  C C   . ALA A 75  ? 0.4167 0.4842 0.4579 0.0198  0.0642  0.0698  105 ALA A C   
552  O O   . ALA A 75  ? 0.4065 0.4723 0.4518 0.0162  0.0620  0.0719  105 ALA A O   
553  C CB  . ALA A 75  ? 0.4199 0.4774 0.4514 0.0196  0.0639  0.0622  105 ALA A CB  
554  N N   . GLU A 76  ? 0.3523 0.4225 0.3933 0.0225  0.0653  0.0695  106 GLU A N   
555  C CA  . GLU A 76  ? 0.4156 0.4861 0.4611 0.0212  0.0640  0.0716  106 GLU A CA  
556  C C   . GLU A 76  ? 0.4290 0.4906 0.4724 0.0186  0.0616  0.0678  106 GLU A C   
557  O O   . GLU A 76  ? 0.4238 0.4832 0.4708 0.0156  0.0593  0.0695  106 GLU A O   
558  C CB  . GLU A 76  ? 0.4447 0.5206 0.4907 0.0251  0.0661  0.0723  106 GLU A CB  
559  C CG  . GLU A 76  ? 0.4379 0.5236 0.4855 0.0284  0.0690  0.0762  106 GLU A CG  
560  C CD  . GLU A 76  ? 0.4707 0.5628 0.5261 0.0263  0.0686  0.0830  106 GLU A CD  
561  O OE1 . GLU A 76  ? 0.4853 0.5748 0.5453 0.0230  0.0661  0.0849  106 GLU A OE1 
562  O OE2 . GLU A 76  ? 0.4754 0.5750 0.5325 0.0280  0.0705  0.0867  106 GLU A OE2 
563  N N   . ASN A 77  ? 0.4164 0.4730 0.4539 0.0200  0.0618  0.0628  107 ASN A N   
564  C CA  . ASN A 77  ? 0.4623 0.5110 0.4975 0.0178  0.0597  0.0593  107 ASN A CA  
565  C C   . ASN A 77  ? 0.4592 0.5023 0.4900 0.0168  0.0592  0.0559  107 ASN A C   
566  O O   . ASN A 77  ? 0.4472 0.4903 0.4741 0.0192  0.0606  0.0538  107 ASN A O   
567  C CB  . ASN A 77  ? 0.3881 0.4354 0.4214 0.0201  0.0599  0.0566  107 ASN A CB  
568  C CG  . ASN A 77  ? 0.4579 0.5092 0.4958 0.0204  0.0599  0.0597  107 ASN A CG  
569  O OD1 . ASN A 77  ? 0.4717 0.5203 0.5121 0.0177  0.0579  0.0606  107 ASN A OD1 
570  N ND2 . ASN A 77  ? 0.4382 0.4962 0.4773 0.0238  0.0621  0.0613  107 ASN A ND2 
571  N N   . CYS A 78  ? 0.4273 0.4653 0.4584 0.0135  0.0571  0.0554  108 CYS A N   
572  C CA  . CYS A 78  ? 0.4192 0.4513 0.4462 0.0124  0.0565  0.0522  108 CYS A CA  
573  C C   . CYS A 78  ? 0.4060 0.4320 0.4312 0.0110  0.0548  0.0496  108 CYS A C   
574  O O   . CYS A 78  ? 0.3556 0.3817 0.3830 0.0104  0.0537  0.0506  108 CYS A O   
575  C CB  . CYS A 78  ? 0.3550 0.3867 0.3835 0.0100  0.0557  0.0539  108 CYS A CB  
576  S SG  . CYS A 78  ? 0.4006 0.4391 0.4305 0.0116  0.0579  0.0567  108 CYS A SG  
577  N N   . TYR A 79  ? 0.3419 0.3628 0.3633 0.0106  0.0544  0.0466  109 TYR A N   
578  C CA  . TYR A 79  ? 0.3482 0.3637 0.3676 0.0095  0.0530  0.0442  109 TYR A CA  
579  C C   . TYR A 79  ? 0.3658 0.3767 0.3833 0.0074  0.0520  0.0431  109 TYR A C   
580  O O   . TYR A 79  ? 0.3704 0.3813 0.3870 0.0074  0.0527  0.0429  109 TYR A O   
581  C CB  . TYR A 79  ? 0.3336 0.3477 0.3502 0.0118  0.0535  0.0415  109 TYR A CB  
582  C CG  . TYR A 79  ? 0.3617 0.3800 0.3800 0.0142  0.0544  0.0423  109 TYR A CG  
583  C CD1 . TYR A 79  ? 0.3855 0.4080 0.4034 0.0169  0.0561  0.0427  109 TYR A CD1 
584  C CD2 . TYR A 79  ? 0.3675 0.3858 0.3877 0.0138  0.0534  0.0428  109 TYR A CD2 
585  C CE1 . TYR A 79  ? 0.4273 0.4541 0.4467 0.0194  0.0570  0.0434  109 TYR A CE1 
586  C CE2 . TYR A 79  ? 0.3337 0.3560 0.3558 0.0160  0.0542  0.0436  109 TYR A CE2 
587  C CZ  . TYR A 79  ? 0.3983 0.4248 0.4199 0.0189  0.0560  0.0439  109 TYR A CZ  
588  O OH  . TYR A 79  ? 0.4233 0.4540 0.4467 0.0215  0.0569  0.0446  109 TYR A OH  
589  N N   . ASN A 80  ? 0.3136 0.3209 0.3307 0.0057  0.0503  0.0424  110 ASN A N   
590  C CA  . ASN A 80  ? 0.3432 0.3461 0.3584 0.0040  0.0493  0.0413  110 ASN A CA  
591  C C   . ASN A 80  ? 0.3881 0.3872 0.4010 0.0036  0.0483  0.0395  110 ASN A C   
592  O O   . ASN A 80  ? 0.3559 0.3547 0.3700 0.0027  0.0469  0.0402  110 ASN A O   
593  C CB  . ASN A 80  ? 0.3173 0.3207 0.3354 0.0020  0.0479  0.0433  110 ASN A CB  
594  C CG  . ASN A 80  ? 0.3774 0.3763 0.3935 0.0005  0.0467  0.0419  110 ASN A CG  
595  O OD1 . ASN A 80  ? 0.3859 0.3810 0.3991 0.0002  0.0460  0.0400  110 ASN A OD1 
596  N ND2 . ASN A 80  ? 0.3343 0.3340 0.3521 -0.0004 0.0465  0.0430  110 ASN A ND2 
597  N N   . LEU A 81  ? 0.3641 0.3607 0.3741 0.0044  0.0489  0.0374  111 LEU A N   
598  C CA  . LEU A 81  ? 0.3912 0.3851 0.3993 0.0045  0.0482  0.0361  111 LEU A CA  
599  C C   . LEU A 81  ? 0.4148 0.4049 0.4203 0.0034  0.0476  0.0350  111 LEU A C   
600  O O   . LEU A 81  ? 0.4240 0.4128 0.4283 0.0033  0.0483  0.0345  111 LEU A O   
601  C CB  . LEU A 81  ? 0.3634 0.3575 0.3706 0.0064  0.0491  0.0350  111 LEU A CB  
602  C CG  . LEU A 81  ? 0.3856 0.3835 0.3948 0.0082  0.0499  0.0355  111 LEU A CG  
603  C CD1 . LEU A 81  ? 0.3210 0.3181 0.3290 0.0102  0.0501  0.0339  111 LEU A CD1 
604  C CD2 . LEU A 81  ? 0.3754 0.3755 0.3872 0.0078  0.0492  0.0370  111 LEU A CD2 
605  N N   . GLU A 82  ? 0.3604 0.3488 0.3650 0.0028  0.0464  0.0348  112 GLU A N   
606  C CA  . GLU A 82  ? 0.3957 0.3809 0.3973 0.0024  0.0460  0.0337  112 GLU A CA  
607  C C   . GLU A 82  ? 0.4157 0.4003 0.4164 0.0028  0.0456  0.0334  112 GLU A C   
608  O O   . GLU A 82  ? 0.4085 0.3941 0.4104 0.0025  0.0446  0.0341  112 GLU A O   
609  C CB  . GLU A 82  ? 0.4494 0.4330 0.4504 0.0011  0.0446  0.0337  112 GLU A CB  
610  C CG  . GLU A 82  ? 0.5323 0.5129 0.5297 0.0011  0.0439  0.0326  112 GLU A CG  
611  C CD  . GLU A 82  ? 0.5673 0.5465 0.5626 0.0018  0.0453  0.0317  112 GLU A CD  
612  O OE1 . GLU A 82  ? 0.5251 0.5032 0.5181 0.0023  0.0455  0.0313  112 GLU A OE1 
613  O OE2 . GLU A 82  ? 0.5872 0.5667 0.5834 0.0018  0.0462  0.0317  112 GLU A OE2 
614  N N   . ILE A 83  ? 0.4279 0.4112 0.4269 0.0035  0.0463  0.0328  113 ILE A N   
615  C CA  . ILE A 83  ? 0.4160 0.3993 0.4150 0.0040  0.0459  0.0330  113 ILE A CA  
616  C C   . ILE A 83  ? 0.4597 0.4412 0.4561 0.0040  0.0460  0.0329  113 ILE A C   
617  O O   . ILE A 83  ? 0.4712 0.4517 0.4668 0.0044  0.0470  0.0326  113 ILE A O   
618  C CB  . ILE A 83  ? 0.4059 0.3902 0.4067 0.0052  0.0464  0.0329  113 ILE A CB  
619  C CG1 . ILE A 83  ? 0.4678 0.4544 0.4708 0.0057  0.0466  0.0330  113 ILE A CG1 
620  C CG2 . ILE A 83  ? 0.4506 0.4350 0.4523 0.0056  0.0455  0.0333  113 ILE A CG2 
621  C CD1 . ILE A 83  ? 0.3980 0.3854 0.4022 0.0074  0.0469  0.0325  113 ILE A CD1 
622  N N   . LYS A 84  ? 0.4141 0.3955 0.4095 0.0037  0.0451  0.0333  114 LYS A N   
623  C CA  . LYS A 84  ? 0.4463 0.4270 0.4395 0.0041  0.0454  0.0337  114 LYS A CA  
624  C C   . LYS A 84  ? 0.4466 0.4284 0.4418 0.0047  0.0452  0.0348  114 LYS A C   
625  O O   . LYS A 84  ? 0.4303 0.4133 0.4278 0.0046  0.0443  0.0352  114 LYS A O   
626  C CB  . LYS A 84  ? 0.4631 0.4433 0.4537 0.0037  0.0444  0.0336  114 LYS A CB  
627  C CG  . LYS A 84  ? 0.4607 0.4393 0.4495 0.0032  0.0438  0.0325  114 LYS A CG  
628  C CD  . LYS A 84  ? 0.4983 0.4755 0.4858 0.0036  0.0450  0.0317  114 LYS A CD  
629  C CE  . LYS A 84  ? 0.5069 0.4825 0.4933 0.0031  0.0441  0.0306  114 LYS A CE  
630  N NZ  . LYS A 84  ? 0.6186 0.5928 0.6016 0.0033  0.0428  0.0299  114 LYS A NZ  
631  N N   . LYS A 85  ? 0.4673 0.4486 0.4621 0.0053  0.0459  0.0354  115 LYS A N   
632  C CA  . LYS A 85  ? 0.4899 0.4723 0.4868 0.0057  0.0453  0.0369  115 LYS A CA  
633  C C   . LYS A 85  ? 0.4993 0.4830 0.4954 0.0054  0.0445  0.0381  115 LYS A C   
634  O O   . LYS A 85  ? 0.4333 0.4166 0.4264 0.0051  0.0446  0.0375  115 LYS A O   
635  C CB  . LYS A 85  ? 0.4517 0.4336 0.4487 0.0063  0.0462  0.0378  115 LYS A CB  
636  C CG  . LYS A 85  ? 0.4453 0.4258 0.4432 0.0066  0.0467  0.0369  115 LYS A CG  
637  C CD  . LYS A 85  ? 0.5266 0.5066 0.5253 0.0071  0.0471  0.0382  115 LYS A CD  
638  C CE  . LYS A 85  ? 0.5262 0.5046 0.5251 0.0073  0.0477  0.0372  115 LYS A CE  
639  N NZ  . LYS A 85  ? 0.5669 0.5447 0.5674 0.0077  0.0477  0.0389  115 LYS A NZ  
640  N N   . PRO A 86  ? 0.4909 0.4759 0.4896 0.0055  0.0436  0.0398  116 PRO A N   
641  C CA  . PRO A 86  ? 0.5226 0.5093 0.5207 0.0052  0.0428  0.0412  116 PRO A CA  
642  C C   . PRO A 86  ? 0.5048 0.4918 0.4988 0.0057  0.0439  0.0418  116 PRO A C   
643  O O   . PRO A 86  ? 0.5430 0.5307 0.5344 0.0056  0.0435  0.0419  116 PRO A O   
644  C CB  . PRO A 86  ? 0.4460 0.4342 0.4483 0.0053  0.0417  0.0433  116 PRO A CB  
645  C CG  . PRO A 86  ? 0.4907 0.4777 0.4960 0.0056  0.0411  0.0421  116 PRO A CG  
646  C CD  . PRO A 86  ? 0.4515 0.4367 0.4543 0.0059  0.0427  0.0403  116 PRO A CD  
647  N N   . ASP A 87  ? 0.4925 0.4791 0.4859 0.0064  0.0452  0.0421  117 ASP A N   
648  C CA  . ASP A 87  ? 0.5741 0.5611 0.5636 0.0073  0.0465  0.0426  117 ASP A CA  
649  C C   . ASP A 87  ? 0.5499 0.5347 0.5352 0.0075  0.0471  0.0400  117 ASP A C   
650  O O   . ASP A 87  ? 0.5931 0.5779 0.5749 0.0085  0.0480  0.0398  117 ASP A O   
651  C CB  . ASP A 87  ? 0.5410 0.5288 0.5318 0.0081  0.0476  0.0445  117 ASP A CB  
652  C CG  . ASP A 87  ? 0.6320 0.6175 0.6240 0.0080  0.0483  0.0431  117 ASP A CG  
653  O OD1 . ASP A 87  ? 0.6247 0.6082 0.6155 0.0076  0.0483  0.0407  117 ASP A OD1 
654  O OD2 . ASP A 87  ? 0.6628 0.6485 0.6570 0.0084  0.0487  0.0448  117 ASP A OD2 
655  N N   . GLY A 88  ? 0.4949 0.4781 0.4810 0.0066  0.0464  0.0381  118 GLY A N   
656  C CA  . GLY A 88  ? 0.4956 0.4768 0.4787 0.0064  0.0463  0.0360  118 GLY A CA  
657  C C   . GLY A 88  ? 0.4475 0.4269 0.4305 0.0066  0.0474  0.0348  118 GLY A C   
658  O O   . GLY A 88  ? 0.5124 0.4902 0.4940 0.0062  0.0470  0.0331  118 GLY A O   
659  N N   . SER A 89  ? 0.4506 0.4304 0.4354 0.0070  0.0485  0.0358  119 SER A N   
660  C CA  . SER A 89  ? 0.4583 0.4366 0.4433 0.0070  0.0495  0.0348  119 SER A CA  
661  C C   . SER A 89  ? 0.4723 0.4500 0.4598 0.0061  0.0490  0.0339  119 SER A C   
662  O O   . SER A 89  ? 0.4700 0.4487 0.4592 0.0056  0.0479  0.0341  119 SER A O   
663  C CB  . SER A 89  ? 0.3913 0.3700 0.3775 0.0077  0.0506  0.0364  119 SER A CB  
664  O OG  . SER A 89  ? 0.4637 0.4434 0.4535 0.0074  0.0499  0.0378  119 SER A OG  
665  N N   . GLU A 90  ? 0.4485 0.4251 0.4365 0.0059  0.0497  0.0331  120 GLU A N   
666  C CA  . GLU A 90  ? 0.5139 0.4906 0.5040 0.0053  0.0494  0.0324  120 GLU A CA  
667  C C   . GLU A 90  ? 0.4537 0.4311 0.4465 0.0056  0.0494  0.0330  120 GLU A C   
668  O O   . GLU A 90  ? 0.4646 0.4414 0.4580 0.0061  0.0499  0.0337  120 GLU A O   
669  C CB  . GLU A 90  ? 0.4645 0.4398 0.4539 0.0049  0.0500  0.0315  120 GLU A CB  
670  C CG  . GLU A 90  ? 0.4571 0.4314 0.4444 0.0045  0.0493  0.0305  120 GLU A CG  
671  C CD  . GLU A 90  ? 0.5101 0.4850 0.4985 0.0037  0.0479  0.0303  120 GLU A CD  
672  O OE1 . GLU A 90  ? 0.5614 0.5353 0.5485 0.0033  0.0467  0.0295  120 GLU A OE1 
673  O OE2 . GLU A 90  ? 0.5894 0.5660 0.5801 0.0035  0.0478  0.0309  120 GLU A OE2 
674  N N   . CYS A 91  ? 0.4136 0.3921 0.4082 0.0055  0.0487  0.0328  121 CYS A N   
675  C CA  . CYS A 91  ? 0.3604 0.3393 0.3573 0.0062  0.0484  0.0330  121 CYS A CA  
676  C C   . CYS A 91  ? 0.4205 0.3992 0.4178 0.0065  0.0491  0.0322  121 CYS A C   
677  O O   . CYS A 91  ? 0.4053 0.3832 0.4034 0.0072  0.0490  0.0322  121 CYS A O   
678  C CB  . CYS A 91  ? 0.4181 0.3985 0.4167 0.0064  0.0473  0.0331  121 CYS A CB  
679  S SG  . CYS A 91  ? 0.5204 0.5014 0.5215 0.0077  0.0468  0.0325  121 CYS A SG  
680  N N   . LEU A 92  ? 0.4577 0.4370 0.4546 0.0059  0.0495  0.0317  122 LEU A N   
681  C CA  . LEU A 92  ? 0.4228 0.4024 0.4202 0.0062  0.0502  0.0313  122 LEU A CA  
682  C C   . LEU A 92  ? 0.4130 0.3910 0.4091 0.0055  0.0510  0.0312  122 LEU A C   
683  O O   . LEU A 92  ? 0.4347 0.4120 0.4296 0.0048  0.0509  0.0311  122 LEU A O   
684  C CB  . LEU A 92  ? 0.3581 0.3400 0.3566 0.0060  0.0502  0.0313  122 LEU A CB  
685  C CG  . LEU A 92  ? 0.4150 0.3986 0.4150 0.0068  0.0495  0.0314  122 LEU A CG  
686  C CD1 . LEU A 92  ? 0.3867 0.3727 0.3879 0.0064  0.0495  0.0320  122 LEU A CD1 
687  C CD2 . LEU A 92  ? 0.3282 0.3121 0.3288 0.0085  0.0495  0.0308  122 LEU A CD2 
688  N N   . PRO A 93  ? 0.3741 0.3516 0.3705 0.0058  0.0515  0.0310  123 PRO A N   
689  C CA  . PRO A 93  ? 0.3796 0.3557 0.3751 0.0051  0.0523  0.0310  123 PRO A CA  
690  C C   . PRO A 93  ? 0.4156 0.3925 0.4114 0.0041  0.0523  0.0309  123 PRO A C   
691  O O   . PRO A 93  ? 0.3846 0.3638 0.3817 0.0042  0.0521  0.0312  123 PRO A O   
692  C CB  . PRO A 93  ? 0.3688 0.3443 0.3648 0.0057  0.0526  0.0310  123 PRO A CB  
693  C CG  . PRO A 93  ? 0.3712 0.3487 0.3681 0.0068  0.0521  0.0306  123 PRO A CG  
694  C CD  . PRO A 93  ? 0.3234 0.3015 0.3206 0.0070  0.0514  0.0307  123 PRO A CD  
695  N N   . ALA A 94  ? 0.4073 0.3828 0.4023 0.0034  0.0525  0.0308  124 ALA A N   
696  C CA  . ALA A 94  ? 0.4432 0.4193 0.4392 0.0024  0.0521  0.0308  124 ALA A CA  
697  C C   . ALA A 94  ? 0.4404 0.4180 0.4380 0.0022  0.0527  0.0314  124 ALA A C   
698  O O   . ALA A 94  ? 0.3842 0.3613 0.3816 0.0027  0.0534  0.0313  124 ALA A O   
699  C CB  . ALA A 94  ? 0.4449 0.4186 0.4396 0.0019  0.0520  0.0302  124 ALA A CB  
700  N N   . ALA A 95  ? 0.4302 0.4099 0.4297 0.0015  0.0522  0.0321  125 ALA A N   
701  C CA  . ALA A 95  ? 0.3992 0.3810 0.4003 0.0014  0.0528  0.0330  125 ALA A CA  
702  C C   . ALA A 95  ? 0.3855 0.3654 0.3864 0.0007  0.0532  0.0328  125 ALA A C   
703  O O   . ALA A 95  ? 0.4389 0.4169 0.4398 -0.0002 0.0526  0.0325  125 ALA A O   
704  C CB  . ALA A 95  ? 0.3366 0.3214 0.3404 0.0005  0.0521  0.0344  125 ALA A CB  
705  N N   . PRO A 96  ? 0.3876 0.3676 0.3881 0.0013  0.0541  0.0328  126 PRO A N   
706  C CA  . PRO A 96  ? 0.3964 0.3747 0.3971 0.0006  0.0544  0.0329  126 PRO A CA  
707  C C   . PRO A 96  ? 0.4647 0.4446 0.4678 -0.0008 0.0540  0.0340  126 PRO A C   
708  O O   . PRO A 96  ? 0.4241 0.4072 0.4290 -0.0010 0.0536  0.0351  126 PRO A O   
709  C CB  . PRO A 96  ? 0.4160 0.3947 0.4160 0.0016  0.0551  0.0330  126 PRO A CB  
710  C CG  . PRO A 96  ? 0.4170 0.3964 0.4159 0.0031  0.0550  0.0324  126 PRO A CG  
711  C CD  . PRO A 96  ? 0.4282 0.4096 0.4280 0.0028  0.0545  0.0327  126 PRO A CD  
712  N N   . ASP A 97  ? 0.4026 0.3803 0.4062 -0.0017 0.0539  0.0338  127 ASP A N   
713  C CA  . ASP A 97  ? 0.4465 0.4252 0.4528 -0.0032 0.0532  0.0348  127 ASP A CA  
714  C C   . ASP A 97  ? 0.4040 0.3868 0.4124 -0.0034 0.0535  0.0366  127 ASP A C   
715  O O   . ASP A 97  ? 0.4062 0.3898 0.4135 -0.0025 0.0545  0.0367  127 ASP A O   
716  C CB  . ASP A 97  ? 0.4647 0.4404 0.4709 -0.0038 0.0534  0.0343  127 ASP A CB  
717  C CG  . ASP A 97  ? 0.6076 0.5835 0.6169 -0.0053 0.0523  0.0351  127 ASP A CG  
718  O OD1 . ASP A 97  ? 0.6752 0.6494 0.6850 -0.0059 0.0525  0.0350  127 ASP A OD1 
719  O OD2 . ASP A 97  ? 0.5474 0.5253 0.5590 -0.0061 0.0509  0.0359  127 ASP A OD2 
720  N N   . GLY A 98  ? 0.3587 0.3443 0.3700 -0.0043 0.0525  0.0381  128 GLY A N   
721  C CA  . GLY A 98  ? 0.3789 0.3694 0.3926 -0.0043 0.0530  0.0404  128 GLY A CA  
722  C C   . GLY A 98  ? 0.4349 0.4288 0.4478 -0.0027 0.0538  0.0409  128 GLY A C   
723  O O   . GLY A 98  ? 0.3734 0.3718 0.3877 -0.0023 0.0544  0.0428  128 GLY A O   
724  N N   . ILE A 99  ? 0.4070 0.3991 0.4176 -0.0017 0.0537  0.0393  129 ILE A N   
725  C CA  . ILE A 99  ? 0.3880 0.3831 0.3981 -0.0002 0.0543  0.0397  129 ILE A CA  
726  C C   . ILE A 99  ? 0.4020 0.3982 0.4143 -0.0009 0.0530  0.0406  129 ILE A C   
727  O O   . ILE A 99  ? 0.5037 0.4967 0.5150 -0.0013 0.0521  0.0393  129 ILE A O   
728  C CB  . ILE A 99  ? 0.4188 0.4115 0.4253 0.0015  0.0549  0.0375  129 ILE A CB  
729  C CG1 . ILE A 99  ? 0.4466 0.4379 0.4513 0.0022  0.0557  0.0368  129 ILE A CG1 
730  C CG2 . ILE A 99  ? 0.4242 0.4202 0.4304 0.0033  0.0554  0.0378  129 ILE A CG2 
731  C CD1 . ILE A 99  ? 0.4756 0.4655 0.4774 0.0042  0.0560  0.0352  129 ILE A CD1 
732  N N   . ARG A 100 ? 0.3925 0.3936 0.4082 -0.0011 0.0530  0.0432  130 ARG A N   
733  C CA  . ARG A 100 ? 0.4292 0.4319 0.4479 -0.0020 0.0515  0.0447  130 ARG A CA  
734  C C   . ARG A 100 ? 0.3956 0.4024 0.4146 -0.0003 0.0524  0.0458  130 ARG A C   
735  O O   . ARG A 100 ? 0.3759 0.3848 0.3930 0.0016  0.0542  0.0454  130 ARG A O   
736  C CB  . ARG A 100 ? 0.4380 0.4433 0.4616 -0.0038 0.0502  0.0476  130 ARG A CB  
737  C CG  . ARG A 100 ? 0.4080 0.4094 0.4320 -0.0055 0.0489  0.0468  130 ARG A CG  
738  C CD  . ARG A 100 ? 0.4931 0.4982 0.5223 -0.0069 0.0481  0.0500  130 ARG A CD  
739  N NE  . ARG A 100 ? 0.4500 0.4594 0.4790 -0.0060 0.0502  0.0515  130 ARG A NE  
740  C CZ  . ARG A 100 ? 0.4623 0.4701 0.4893 -0.0059 0.0512  0.0504  130 ARG A CZ  
741  N NH1 . ARG A 100 ? 0.4004 0.4027 0.4259 -0.0068 0.0504  0.0480  130 ARG A NH1 
742  N NH2 . ARG A 100 ? 0.4520 0.4638 0.4786 -0.0049 0.0529  0.0516  130 ARG A NH2 
743  N N   . GLY A 101 ? 0.3319 0.3396 0.3533 -0.0009 0.0512  0.0470  131 GLY A N   
744  C CA  . GLY A 101 ? 0.3741 0.3856 0.3961 0.0007  0.0520  0.0480  131 GLY A CA  
745  C C   . GLY A 101 ? 0.3667 0.3848 0.3910 0.0019  0.0535  0.0509  131 GLY A C   
746  O O   . GLY A 101 ? 0.3866 0.4074 0.4140 0.0007  0.0532  0.0533  131 GLY A O   
747  N N   . PHE A 102 ? 0.3596 0.3807 0.3825 0.0043  0.0551  0.0506  132 PHE A N   
748  C CA  . PHE A 102 ? 0.3710 0.3991 0.3960 0.0059  0.0566  0.0536  132 PHE A CA  
749  C C   . PHE A 102 ? 0.3394 0.3715 0.3706 0.0041  0.0553  0.0579  132 PHE A C   
750  O O   . PHE A 102 ? 0.3673 0.3979 0.4007 0.0027  0.0536  0.0585  132 PHE A O   
751  C CB  . PHE A 102 ? 0.3415 0.3717 0.3647 0.0088  0.0579  0.0526  132 PHE A CB  
752  C CG  . PHE A 102 ? 0.3501 0.3873 0.3739 0.0114  0.0599  0.0548  132 PHE A CG  
753  C CD1 . PHE A 102 ? 0.3323 0.3698 0.3520 0.0137  0.0614  0.0529  132 PHE A CD1 
754  C CD2 . PHE A 102 ? 0.3492 0.3927 0.3774 0.0118  0.0603  0.0587  132 PHE A CD2 
755  C CE1 . PHE A 102 ? 0.3980 0.4421 0.4176 0.0165  0.0633  0.0547  132 PHE A CE1 
756  C CE2 . PHE A 102 ? 0.3865 0.4371 0.4151 0.0145  0.0624  0.0609  132 PHE A CE2 
757  C CZ  . PHE A 102 ? 0.4041 0.4550 0.4281 0.0170  0.0640  0.0587  132 PHE A CZ  
758  N N   . PRO A 103 ? 0.3870 0.4239 0.4210 0.0038  0.0559  0.0609  133 PRO A N   
759  C CA  . PRO A 103 ? 0.3686 0.4084 0.4091 0.0014  0.0541  0.0651  133 PRO A CA  
760  C C   . PRO A 103 ? 0.3740 0.4205 0.4196 0.0020  0.0542  0.0695  133 PRO A C   
761  O O   . PRO A 103 ? 0.3925 0.4405 0.4439 -0.0002 0.0520  0.0730  133 PRO A O   
762  C CB  . PRO A 103 ? 0.3470 0.3897 0.3884 0.0011  0.0549  0.0668  133 PRO A CB  
763  C CG  . PRO A 103 ? 0.3656 0.4109 0.4022 0.0044  0.0578  0.0653  133 PRO A CG  
764  C CD  . PRO A 103 ? 0.3516 0.3917 0.3831 0.0058  0.0581  0.0608  133 PRO A CD  
765  N N   . ARG A 104 ? 0.3735 0.4239 0.4172 0.0050  0.0565  0.0695  134 ARG A N   
766  C CA  . ARG A 104 ? 0.4410 0.4986 0.4896 0.0059  0.0570  0.0740  134 ARG A CA  
767  C C   . ARG A 104 ? 0.3870 0.4442 0.4335 0.0080  0.0578  0.0722  134 ARG A C   
768  O O   . ARG A 104 ? 0.4058 0.4662 0.4492 0.0113  0.0603  0.0713  134 ARG A O   
769  C CB  . ARG A 104 ? 0.4423 0.5084 0.4924 0.0080  0.0594  0.0775  134 ARG A CB  
770  C CG  . ARG A 104 ? 0.3829 0.4515 0.4374 0.0056  0.0584  0.0811  134 ARG A CG  
771  C CD  . ARG A 104 ? 0.4960 0.5649 0.5580 0.0024  0.0552  0.0850  134 ARG A CD  
772  N NE  . ARG A 104 ? 0.4595 0.5309 0.5267 0.0001  0.0537  0.0887  134 ARG A NE  
773  C CZ  . ARG A 104 ? 0.5290 0.5944 0.5974 -0.0030 0.0508  0.0873  134 ARG A CZ  
774  N NH1 . ARG A 104 ? 0.4930 0.5611 0.5666 -0.0049 0.0494  0.0909  134 ARG A NH1 
775  N NH2 . ARG A 104 ? 0.4543 0.5110 0.5185 -0.0039 0.0493  0.0824  134 ARG A NH2 
776  N N   . CYS A 105 ? 0.4084 0.4614 0.4565 0.0061  0.0556  0.0717  135 CYS A N   
777  C CA  . CYS A 105 ? 0.3436 0.3956 0.3902 0.0075  0.0559  0.0701  135 CYS A CA  
778  C C   . CYS A 105 ? 0.3931 0.4488 0.4462 0.0064  0.0545  0.0746  135 CYS A C   
779  O O   . CYS A 105 ? 0.3546 0.4078 0.4114 0.0034  0.0516  0.0761  135 CYS A O   
780  C CB  . CYS A 105 ? 0.4313 0.4747 0.4736 0.0062  0.0543  0.0653  135 CYS A CB  
781  S SG  . CYS A 105 ? 0.5054 0.5434 0.5405 0.0072  0.0554  0.0602  135 CYS A SG  
782  N N   . ARG A 106 ? 0.3138 0.3751 0.3683 0.0089  0.0563  0.0764  136 ARG A N   
783  C CA  . ARG A 106 ? 0.3245 0.3887 0.3850 0.0079  0.0549  0.0804  136 ARG A CA  
784  C C   . ARG A 106 ? 0.3345 0.3913 0.3939 0.0059  0.0522  0.0776  136 ARG A C   
785  O O   . ARG A 106 ? 0.3378 0.3935 0.4019 0.0033  0.0494  0.0802  136 ARG A O   
786  C CB  . ARG A 106 ? 0.3700 0.4414 0.4317 0.0114  0.0577  0.0825  136 ARG A CB  
787  C CG  . ARG A 106 ? 0.3591 0.4388 0.4218 0.0139  0.0605  0.0857  136 ARG A CG  
788  C CD  . ARG A 106 ? 0.3545 0.4384 0.4243 0.0113  0.0589  0.0914  136 ARG A CD  
789  N NE  . ARG A 106 ? 0.4101 0.5028 0.4813 0.0137  0.0617  0.0950  136 ARG A NE  
790  C CZ  . ARG A 106 ? 0.4353 0.5326 0.5121 0.0119  0.0609  0.1000  136 ARG A CZ  
791  N NH1 . ARG A 106 ? 0.4652 0.5710 0.5428 0.0144  0.0636  0.1033  136 ARG A NH1 
792  N NH2 . ARG A 106 ? 0.3410 0.4345 0.4226 0.0078  0.0571  0.1018  136 ARG A NH2 
793  N N   . TYR A 107 ? 0.4104 0.4623 0.4636 0.0071  0.0530  0.0725  137 TYR A N   
794  C CA  . TYR A 107 ? 0.4294 0.4750 0.4810 0.0057  0.0510  0.0698  137 TYR A CA  
795  C C   . TYR A 107 ? 0.3912 0.4302 0.4359 0.0060  0.0512  0.0643  137 TYR A C   
796  O O   . TYR A 107 ? 0.4030 0.4428 0.4439 0.0085  0.0535  0.0621  137 TYR A O   
797  C CB  . TYR A 107 ? 0.4107 0.4590 0.4638 0.0073  0.0517  0.0708  137 TYR A CB  
798  C CG  . TYR A 107 ? 0.4040 0.4462 0.4557 0.0057  0.0494  0.0684  137 TYR A CG  
799  C CD1 . TYR A 107 ? 0.5022 0.5427 0.5579 0.0029  0.0463  0.0707  137 TYR A CD1 
800  C CD2 . TYR A 107 ? 0.4612 0.4993 0.5076 0.0069  0.0501  0.0639  137 TYR A CD2 
801  C CE1 . TYR A 107 ? 0.4601 0.4949 0.5140 0.0015  0.0442  0.0684  137 TYR A CE1 
802  C CE2 . TYR A 107 ? 0.4547 0.4876 0.4998 0.0055  0.0481  0.0620  137 TYR A CE2 
803  C CZ  . TYR A 107 ? 0.5186 0.5499 0.5671 0.0029  0.0453  0.0641  137 TYR A CZ  
804  O OH  . TYR A 107 ? 0.5914 0.6177 0.6382 0.0016  0.0433  0.0621  137 TYR A OH  
805  N N   . VAL A 108 ? 0.3270 0.3595 0.3702 0.0036  0.0488  0.0623  138 VAL A N   
806  C CA  . VAL A 108 ? 0.3570 0.3836 0.3943 0.0037  0.0489  0.0577  138 VAL A CA  
807  C C   . VAL A 108 ? 0.3542 0.3770 0.3897 0.0035  0.0478  0.0556  138 VAL A C   
808  O O   . VAL A 108 ? 0.3469 0.3676 0.3844 0.0015  0.0454  0.0565  138 VAL A O   
809  C CB  . VAL A 108 ? 0.3812 0.4033 0.4172 0.0015  0.0472  0.0565  138 VAL A CB  
810  C CG1 . VAL A 108 ? 0.2991 0.3158 0.3293 0.0020  0.0478  0.0521  138 VAL A CG1 
811  C CG2 . VAL A 108 ? 0.3204 0.3462 0.3589 0.0013  0.0479  0.0589  138 VAL A CG2 
812  N N   . HIS A 109 ? 0.3834 0.4054 0.4155 0.0055  0.0493  0.0529  139 HIS A N   
813  C CA  . HIS A 109 ? 0.4188 0.4368 0.4488 0.0053  0.0482  0.0506  139 HIS A CA  
814  C C   . HIS A 109 ? 0.3797 0.3917 0.4057 0.0038  0.0471  0.0479  139 HIS A C   
815  O O   . HIS A 109 ? 0.3910 0.4011 0.4135 0.0048  0.0482  0.0455  139 HIS A O   
816  C CB  . HIS A 109 ? 0.3689 0.3881 0.3971 0.0080  0.0498  0.0489  139 HIS A CB  
817  C CG  . HIS A 109 ? 0.4495 0.4747 0.4811 0.0099  0.0512  0.0513  139 HIS A CG  
818  N ND1 . HIS A 109 ? 0.4873 0.5139 0.5217 0.0100  0.0505  0.0525  139 HIS A ND1 
819  C CD2 . HIS A 109 ? 0.3864 0.4168 0.4190 0.0121  0.0532  0.0528  139 HIS A CD2 
820  C CE1 . HIS A 109 ? 0.4113 0.4437 0.4483 0.0122  0.0522  0.0547  139 HIS A CE1 
821  N NE2 . HIS A 109 ? 0.4459 0.4809 0.4819 0.0136  0.0539  0.0549  139 HIS A NE2 
822  N N   . LYS A 110 ? 0.4045 0.4138 0.4313 0.0015  0.0448  0.0485  140 LYS A N   
823  C CA  . LYS A 110 ? 0.4643 0.4685 0.4876 0.0003  0.0437  0.0462  140 LYS A CA  
824  C C   . LYS A 110 ? 0.5225 0.5231 0.5435 -0.0001 0.0424  0.0446  140 LYS A C   
825  O O   . LYS A 110 ? 0.4399 0.4397 0.4625 -0.0014 0.0403  0.0456  140 LYS A O   
826  C CB  . LYS A 110 ? 0.4738 0.4769 0.4990 -0.0016 0.0418  0.0476  140 LYS A CB  
827  C CG  . LYS A 110 ? 0.5023 0.5001 0.5237 -0.0025 0.0407  0.0450  140 LYS A CG  
828  C CD  . LYS A 110 ? 0.5424 0.5393 0.5659 -0.0040 0.0388  0.0461  140 LYS A CD  
829  C CE  . LYS A 110 ? 0.6215 0.6132 0.6412 -0.0046 0.0376  0.0434  140 LYS A CE  
830  N NZ  . LYS A 110 ? 0.6893 0.6799 0.7053 -0.0034 0.0401  0.0412  140 LYS A NZ  
831  N N   . VAL A 111 ? 0.4657 0.4643 0.4832 0.0009  0.0435  0.0422  141 VAL A N   
832  C CA  . VAL A 111 ? 0.3904 0.3866 0.4060 0.0008  0.0425  0.0410  141 VAL A CA  
833  C C   . VAL A 111 ? 0.4097 0.4023 0.4211 0.0009  0.0427  0.0387  141 VAL A C   
834  O O   . VAL A 111 ? 0.3468 0.3388 0.3566 0.0015  0.0441  0.0377  141 VAL A O   
835  C CB  . VAL A 111 ? 0.4245 0.4232 0.4415 0.0022  0.0434  0.0412  141 VAL A CB  
836  C CG1 . VAL A 111 ? 0.3938 0.3961 0.4152 0.0020  0.0430  0.0438  141 VAL A CG1 
837  C CG2 . VAL A 111 ? 0.3842 0.3844 0.4004 0.0042  0.0455  0.0402  141 VAL A CG2 
838  N N   . SER A 112 ? 0.4224 0.4127 0.4321 0.0003  0.0414  0.0381  142 SER A N   
839  C CA  . SER A 112 ? 0.4730 0.4602 0.4788 0.0003  0.0414  0.0365  142 SER A CA  
840  C C   . SER A 112 ? 0.4635 0.4500 0.4682 0.0004  0.0407  0.0362  142 SER A C   
841  O O   . SER A 112 ? 0.4358 0.4230 0.4421 -0.0003 0.0393  0.0372  142 SER A O   
842  C CB  . SER A 112 ? 0.4185 0.4031 0.4226 -0.0008 0.0400  0.0360  142 SER A CB  
843  O OG  . SER A 112 ? 0.5279 0.5099 0.5281 -0.0004 0.0403  0.0344  142 SER A OG  
844  N N   . GLY A 113 ? 0.3961 0.3816 0.3986 0.0011  0.0415  0.0353  143 GLY A N   
845  C CA  . GLY A 113 ? 0.4027 0.3878 0.4043 0.0011  0.0407  0.0354  143 GLY A CA  
846  C C   . GLY A 113 ? 0.4151 0.3995 0.4150 0.0020  0.0418  0.0349  143 GLY A C   
847  O O   . GLY A 113 ? 0.3751 0.3583 0.3731 0.0023  0.0427  0.0341  143 GLY A O   
848  N N   . THR A 114 ? 0.4301 0.4154 0.4311 0.0024  0.0414  0.0354  144 THR A N   
849  C CA  . THR A 114 ? 0.4174 0.4024 0.4178 0.0031  0.0420  0.0355  144 THR A CA  
850  C C   . THR A 114 ? 0.4051 0.3914 0.4088 0.0040  0.0419  0.0358  144 THR A C   
851  O O   . THR A 114 ? 0.4305 0.4181 0.4366 0.0039  0.0412  0.0361  144 THR A O   
852  C CB  . THR A 114 ? 0.4521 0.4366 0.4500 0.0028  0.0413  0.0361  144 THR A CB  
853  O OG1 . THR A 114 ? 0.4499 0.4347 0.4480 0.0035  0.0419  0.0368  144 THR A OG1 
854  C CG2 . THR A 114 ? 0.4472 0.4327 0.4464 0.0021  0.0398  0.0370  144 THR A CG2 
855  N N   . GLY A 115 ? 0.3350 0.3207 0.3388 0.0048  0.0424  0.0357  145 GLY A N   
856  C CA  . GLY A 115 ? 0.3343 0.3207 0.3412 0.0058  0.0418  0.0357  145 GLY A CA  
857  C C   . GLY A 115 ? 0.4687 0.4542 0.4759 0.0064  0.0416  0.0361  145 GLY A C   
858  O O   . GLY A 115 ? 0.4339 0.4185 0.4388 0.0060  0.0424  0.0365  145 GLY A O   
859  N N   . PRO A 116 ? 0.4693 0.4550 0.4795 0.0073  0.0405  0.0362  146 PRO A N   
860  C CA  . PRO A 116 ? 0.5198 0.5047 0.5315 0.0077  0.0396  0.0372  146 PRO A CA  
861  C C   . PRO A 116 ? 0.5164 0.4996 0.5266 0.0082  0.0406  0.0366  146 PRO A C   
862  O O   . PRO A 116 ? 0.5364 0.5190 0.5468 0.0081  0.0404  0.0380  146 PRO A O   
863  C CB  . PRO A 116 ? 0.5128 0.4978 0.5282 0.0087  0.0377  0.0368  146 PRO A CB  
864  C CG  . PRO A 116 ? 0.4803 0.4662 0.4955 0.0093  0.0383  0.0352  146 PRO A CG  
865  C CD  . PRO A 116 ? 0.4002 0.3869 0.4129 0.0080  0.0396  0.0356  146 PRO A CD  
866  N N   . CYS A 117 ? 0.5305 0.5132 0.5395 0.0088  0.0416  0.0349  147 CYS A N   
867  C CA  . CYS A 117 ? 0.5145 0.4957 0.5219 0.0092  0.0425  0.0343  147 CYS A CA  
868  C C   . CYS A 117 ? 0.5276 0.5073 0.5371 0.0099  0.0412  0.0350  147 CYS A C   
869  O O   . CYS A 117 ? 0.5472 0.5262 0.5562 0.0094  0.0416  0.0363  147 CYS A O   
870  C CB  . CYS A 117 ? 0.5219 0.5028 0.5265 0.0081  0.0441  0.0348  147 CYS A CB  
871  S SG  . CYS A 117 ? 0.5686 0.5482 0.5712 0.0082  0.0457  0.0338  147 CYS A SG  
872  N N   . ALA A 118 ? 0.5724 0.5517 0.5843 0.0111  0.0394  0.0342  148 ALA A N   
873  C CA  . ALA A 118 ? 0.5788 0.5564 0.5934 0.0118  0.0373  0.0351  148 ALA A CA  
874  C C   . ALA A 118 ? 0.5394 0.5149 0.5532 0.0127  0.0373  0.0340  148 ALA A C   
875  O O   . ALA A 118 ? 0.6529 0.6268 0.6686 0.0140  0.0352  0.0332  148 ALA A O   
876  C CB  . ALA A 118 ? 0.4940 0.4718 0.5121 0.0128  0.0348  0.0346  148 ALA A CB  
877  N N   . GLY A 119 ? 0.4600 0.4353 0.4709 0.0120  0.0395  0.0338  149 GLY A N   
878  C CA  . GLY A 119 ? 0.4301 0.4034 0.4401 0.0127  0.0396  0.0330  149 GLY A CA  
879  C C   . GLY A 119 ? 0.4467 0.4203 0.4538 0.0117  0.0421  0.0330  149 GLY A C   
880  O O   . GLY A 119 ? 0.4549 0.4301 0.4605 0.0107  0.0436  0.0331  149 GLY A O   
881  N N   . ASP A 120 ? 0.4397 0.4115 0.4462 0.0119  0.0423  0.0329  150 ASP A N   
882  C CA  . ASP A 120 ? 0.4613 0.4330 0.4655 0.0109  0.0444  0.0330  150 ASP A CA  
883  C C   . ASP A 120 ? 0.4791 0.4522 0.4812 0.0110  0.0458  0.0313  150 ASP A C   
884  O O   . ASP A 120 ? 0.4119 0.3860 0.4126 0.0099  0.0474  0.0315  150 ASP A O   
885  C CB  . ASP A 120 ? 0.5186 0.4880 0.5233 0.0110  0.0440  0.0335  150 ASP A CB  
886  C CG  . ASP A 120 ? 0.6203 0.5888 0.6273 0.0106  0.0431  0.0360  150 ASP A CG  
887  O OD1 . ASP A 120 ? 0.6246 0.5948 0.6321 0.0100  0.0434  0.0373  150 ASP A OD1 
888  O OD2 . ASP A 120 ? 0.6036 0.5701 0.6121 0.0108  0.0419  0.0367  150 ASP A OD2 
889  N N   . PHE A 121 ? 0.3788 0.3522 0.3810 0.0125  0.0451  0.0299  151 PHE A N   
890  C CA  . PHE A 121 ? 0.4246 0.3999 0.4252 0.0128  0.0465  0.0288  151 PHE A CA  
891  C C   . PHE A 121 ? 0.4168 0.3940 0.4179 0.0144  0.0459  0.0278  151 PHE A C   
892  O O   . PHE A 121 ? 0.3781 0.3544 0.3805 0.0158  0.0440  0.0271  151 PHE A O   
893  C CB  . PHE A 121 ? 0.4064 0.3808 0.4057 0.0133  0.0469  0.0282  151 PHE A CB  
894  C CG  . PHE A 121 ? 0.4390 0.4119 0.4378 0.0117  0.0479  0.0293  151 PHE A CG  
895  C CD1 . PHE A 121 ? 0.4384 0.4086 0.4380 0.0117  0.0469  0.0299  151 PHE A CD1 
896  C CD2 . PHE A 121 ? 0.4174 0.3916 0.4154 0.0103  0.0496  0.0297  151 PHE A CD2 
897  C CE1 . PHE A 121 ? 0.4148 0.3838 0.4141 0.0104  0.0479  0.0310  151 PHE A CE1 
898  C CE2 . PHE A 121 ? 0.4103 0.3831 0.4079 0.0090  0.0504  0.0305  151 PHE A CE2 
899  C CZ  . PHE A 121 ? 0.3578 0.3281 0.3560 0.0091  0.0497  0.0311  151 PHE A CZ  
900  N N   . ALA A 122 ? 0.3971 0.3771 0.3977 0.0141  0.0473  0.0277  152 ALA A N   
901  C CA  . ALA A 122 ? 0.4644 0.4469 0.4656 0.0157  0.0471  0.0270  152 ALA A CA  
902  C C   . ALA A 122 ? 0.4329 0.4168 0.4327 0.0176  0.0478  0.0260  152 ALA A C   
903  O O   . ALA A 122 ? 0.3942 0.3793 0.3930 0.0168  0.0493  0.0266  152 ALA A O   
904  C CB  . ALA A 122 ? 0.3800 0.3650 0.3818 0.0145  0.0481  0.0280  152 ALA A CB  
905  N N   . PHE A 123 ? 0.4444 0.4280 0.4441 0.0201  0.0465  0.0245  153 PHE A N   
906  C CA  . PHE A 123 ? 0.3794 0.3642 0.3773 0.0225  0.0469  0.0233  153 PHE A CA  
907  C C   . PHE A 123 ? 0.4005 0.3891 0.3986 0.0247  0.0475  0.0227  153 PHE A C   
908  O O   . PHE A 123 ? 0.4147 0.4045 0.4147 0.0243  0.0473  0.0232  153 PHE A O   
909  C CB  . PHE A 123 ? 0.3694 0.3504 0.3666 0.0241  0.0446  0.0216  153 PHE A CB  
910  C CG  . PHE A 123 ? 0.4233 0.4009 0.4203 0.0223  0.0442  0.0223  153 PHE A CG  
911  C CD1 . PHE A 123 ? 0.4283 0.4037 0.4272 0.0204  0.0433  0.0236  153 PHE A CD1 
912  C CD2 . PHE A 123 ? 0.4460 0.4231 0.4410 0.0226  0.0448  0.0221  153 PHE A CD2 
913  C CE1 . PHE A 123 ? 0.3723 0.3450 0.3713 0.0189  0.0430  0.0245  153 PHE A CE1 
914  C CE2 . PHE A 123 ? 0.4421 0.4161 0.4372 0.0209  0.0444  0.0229  153 PHE A CE2 
915  C CZ  . PHE A 123 ? 0.4027 0.3746 0.3999 0.0191  0.0436  0.0241  153 PHE A CZ  
916  N N   . HIS A 124 ? 0.3933 0.3840 0.3894 0.0272  0.0482  0.0218  154 HIS A N   
917  C CA  . HIS A 124 ? 0.3518 0.3462 0.3478 0.0300  0.0488  0.0212  154 HIS A CA  
918  C C   . HIS A 124 ? 0.3822 0.3743 0.3773 0.0333  0.0465  0.0185  154 HIS A C   
919  O O   . HIS A 124 ? 0.3747 0.3645 0.3675 0.0349  0.0454  0.0169  154 HIS A O   
920  C CB  . HIS A 124 ? 0.3540 0.3530 0.3484 0.0312  0.0511  0.0220  154 HIS A CB  
921  C CG  . HIS A 124 ? 0.3610 0.3654 0.3565 0.0329  0.0526  0.0230  154 HIS A CG  
922  N ND1 . HIS A 124 ? 0.3974 0.4035 0.3920 0.0368  0.0522  0.0212  154 HIS A ND1 
923  C CD2 . HIS A 124 ? 0.3797 0.3883 0.3776 0.0313  0.0543  0.0256  154 HIS A CD2 
924  C CE1 . HIS A 124 ? 0.4406 0.4518 0.4369 0.0376  0.0539  0.0229  154 HIS A CE1 
925  N NE2 . HIS A 124 ? 0.3987 0.4115 0.3972 0.0342  0.0551  0.0257  154 HIS A NE2 
926  N N   . LYS A 125 ? 0.3983 0.3910 0.3953 0.0344  0.0455  0.0179  155 LYS A N   
927  C CA  . LYS A 125 ? 0.4622 0.4523 0.4590 0.0375  0.0428  0.0152  155 LYS A CA  
928  C C   . LYS A 125 ? 0.4543 0.4464 0.4478 0.0418  0.0431  0.0131  155 LYS A C   
929  O O   . LYS A 125 ? 0.5076 0.4965 0.4997 0.0446  0.0405  0.0105  155 LYS A O   
930  C CB  . LYS A 125 ? 0.4679 0.4586 0.4678 0.0377  0.0418  0.0153  155 LYS A CB  
931  C CG  . LYS A 125 ? 0.4530 0.4410 0.4559 0.0340  0.0406  0.0169  155 LYS A CG  
932  C CD  . LYS A 125 ? 0.4745 0.4627 0.4805 0.0346  0.0390  0.0166  155 LYS A CD  
933  C CE  . LYS A 125 ? 0.4668 0.4523 0.4757 0.0314  0.0374  0.0181  155 LYS A CE  
934  N NZ  . LYS A 125 ? 0.5213 0.5063 0.5335 0.0322  0.0352  0.0177  155 LYS A NZ  
935  N N   . GLU A 126 ? 0.4601 0.4576 0.4524 0.0426  0.0462  0.0144  156 GLU A N   
936  C CA  . GLU A 126 ? 0.5271 0.5275 0.5161 0.0470  0.0469  0.0128  156 GLU A CA  
937  C C   . GLU A 126 ? 0.5193 0.5188 0.5050 0.0470  0.0473  0.0126  156 GLU A C   
938  O O   . GLU A 126 ? 0.5848 0.5867 0.5671 0.0505  0.0480  0.0113  156 GLU A O   
939  C CB  . GLU A 126 ? 0.5659 0.5734 0.5557 0.0483  0.0499  0.0146  156 GLU A CB  
940  C CG  . GLU A 126 ? 0.6626 0.6711 0.6554 0.0491  0.0493  0.0145  156 GLU A CG  
941  C CD  . GLU A 126 ? 0.7356 0.7510 0.7305 0.0491  0.0523  0.0174  156 GLU A CD  
942  O OE1 . GLU A 126 ? 0.7212 0.7408 0.7155 0.0486  0.0548  0.0197  156 GLU A OE1 
943  O OE2 . GLU A 126 ? 0.7654 0.7818 0.7631 0.0494  0.0520  0.0176  156 GLU A OE2 
944  N N   . GLY A 127 ? 0.4541 0.4503 0.4407 0.0431  0.0470  0.0139  157 GLY A N   
945  C CA  . GLY A 127 ? 0.4098 0.4047 0.3937 0.0427  0.0472  0.0138  157 GLY A CA  
946  C C   . GLY A 127 ? 0.3874 0.3876 0.3709 0.0417  0.0504  0.0164  157 GLY A C   
947  O O   . GLY A 127 ? 0.4032 0.4034 0.3845 0.0416  0.0509  0.0166  157 GLY A O   
948  N N   . ALA A 128 ? 0.3233 0.3281 0.3093 0.0407  0.0525  0.0186  158 ALA A N   
949  C CA  . ALA A 128 ? 0.3885 0.3984 0.3754 0.0390  0.0552  0.0217  158 ALA A CA  
950  C C   . ALA A 128 ? 0.3988 0.4059 0.3874 0.0344  0.0552  0.0235  158 ALA A C   
951  O O   . ALA A 128 ? 0.3887 0.3903 0.3777 0.0326  0.0534  0.0224  158 ALA A O   
952  C CB  . ALA A 128 ? 0.3809 0.3964 0.3705 0.0394  0.0569  0.0238  158 ALA A CB  
953  N N   . PHE A 129 ? 0.4126 0.4237 0.4025 0.0327  0.0572  0.0263  159 PHE A N   
954  C CA  . PHE A 129 ? 0.3870 0.3960 0.3786 0.0286  0.0573  0.0279  159 PHE A CA  
955  C C   . PHE A 129 ? 0.4360 0.4474 0.4313 0.0261  0.0580  0.0304  159 PHE A C   
956  O O   . PHE A 129 ? 0.3944 0.4106 0.3912 0.0274  0.0591  0.0318  159 PHE A O   
957  C CB  . PHE A 129 ? 0.3875 0.3986 0.3780 0.0282  0.0584  0.0292  159 PHE A CB  
958  C CG  . PHE A 129 ? 0.4296 0.4375 0.4165 0.0300  0.0574  0.0269  159 PHE A CG  
959  C CD1 . PHE A 129 ? 0.4093 0.4203 0.3931 0.0339  0.0578  0.0259  159 PHE A CD1 
960  C CD2 . PHE A 129 ? 0.3576 0.3595 0.3441 0.0281  0.0558  0.0258  159 PHE A CD2 
961  C CE1 . PHE A 129 ? 0.4772 0.4849 0.4575 0.0356  0.0565  0.0237  159 PHE A CE1 
962  C CE2 . PHE A 129 ? 0.3788 0.3775 0.3624 0.0296  0.0545  0.0239  159 PHE A CE2 
963  C CZ  . PHE A 129 ? 0.4644 0.4656 0.4448 0.0333  0.0547  0.0227  159 PHE A CZ  
964  N N   . PHE A 130 ? 0.3173 0.3252 0.3140 0.0227  0.0574  0.0309  160 PHE A N   
965  C CA  . PHE A 130 ? 0.3305 0.3403 0.3304 0.0201  0.0578  0.0333  160 PHE A CA  
966  C C   . PHE A 130 ? 0.3605 0.3728 0.3614 0.0186  0.0588  0.0355  160 PHE A C   
967  O O   . PHE A 130 ? 0.3809 0.3902 0.3808 0.0172  0.0585  0.0351  160 PHE A O   
968  C CB  . PHE A 130 ? 0.3073 0.3122 0.3079 0.0176  0.0565  0.0327  160 PHE A CB  
969  C CG  . PHE A 130 ? 0.3449 0.3472 0.3448 0.0189  0.0553  0.0307  160 PHE A CG  
970  C CD1 . PHE A 130 ? 0.2772 0.2752 0.2752 0.0196  0.0541  0.0287  160 PHE A CD1 
971  C CD2 . PHE A 130 ? 0.2954 0.2999 0.2969 0.0196  0.0552  0.0311  160 PHE A CD2 
972  C CE1 . PHE A 130 ? 0.3004 0.2961 0.2983 0.0208  0.0526  0.0271  160 PHE A CE1 
973  C CE2 . PHE A 130 ? 0.2710 0.2733 0.2723 0.0209  0.0539  0.0294  160 PHE A CE2 
974  C CZ  . PHE A 130 ? 0.2645 0.2624 0.2641 0.0214  0.0526  0.0275  160 PHE A CZ  
975  N N   . LEU A 131 ? 0.3747 0.3928 0.3779 0.0189  0.0599  0.0381  161 LEU A N   
976  C CA  . LEU A 131 ? 0.3901 0.4115 0.3951 0.0176  0.0607  0.0408  161 LEU A CA  
977  C C   . LEU A 131 ? 0.3812 0.4014 0.3897 0.0140  0.0598  0.0426  161 LEU A C   
978  O O   . LEU A 131 ? 0.3403 0.3619 0.3515 0.0132  0.0593  0.0439  161 LEU A O   
979  C CB  . LEU A 131 ? 0.4005 0.4294 0.4069 0.0198  0.0623  0.0433  161 LEU A CB  
980  C CG  . LEU A 131 ? 0.4170 0.4480 0.4197 0.0240  0.0633  0.0415  161 LEU A CG  
981  C CD1 . LEU A 131 ? 0.3901 0.4295 0.3944 0.0261  0.0652  0.0447  161 LEU A CD1 
982  C CD2 . LEU A 131 ? 0.3512 0.3783 0.3501 0.0245  0.0628  0.0392  161 LEU A CD2 
983  N N   . TYR A 132 ? 0.3672 0.3846 0.3756 0.0119  0.0593  0.0426  162 TYR A N   
984  C CA  . TYR A 132 ? 0.3555 0.3718 0.3671 0.0088  0.0582  0.0441  162 TYR A CA  
985  C C   . TYR A 132 ? 0.3357 0.3566 0.3503 0.0080  0.0587  0.0473  162 TYR A C   
986  O O   . TYR A 132 ? 0.3648 0.3910 0.3795 0.0099  0.0601  0.0488  162 TYR A O   
987  C CB  . TYR A 132 ? 0.3682 0.3780 0.3779 0.0072  0.0572  0.0418  162 TYR A CB  
988  C CG  . TYR A 132 ? 0.3746 0.3805 0.3817 0.0081  0.0568  0.0393  162 TYR A CG  
989  C CD1 . TYR A 132 ? 0.3627 0.3664 0.3666 0.0100  0.0571  0.0371  162 TYR A CD1 
990  C CD2 . TYR A 132 ? 0.3324 0.3370 0.3406 0.0072  0.0558  0.0392  162 TYR A CD2 
991  C CE1 . TYR A 132 ? 0.3286 0.3292 0.3310 0.0107  0.0564  0.0351  162 TYR A CE1 
992  C CE2 . TYR A 132 ? 0.3485 0.3502 0.3548 0.0079  0.0553  0.0372  162 TYR A CE2 
993  C CZ  . TYR A 132 ? 0.3442 0.3439 0.3478 0.0096  0.0556  0.0353  162 TYR A CZ  
994  O OH  . TYR A 132 ? 0.3520 0.3490 0.3544 0.0103  0.0549  0.0337  162 TYR A OH  
995  N N   . ASP A 133 ? 0.3487 0.3678 0.3657 0.0053  0.0575  0.0482  163 ASP A N   
996  C CA  . ASP A 133 ? 0.3662 0.3896 0.3867 0.0041  0.0576  0.0515  163 ASP A CA  
997  C C   . ASP A 133 ? 0.3698 0.3938 0.3880 0.0050  0.0588  0.0511  163 ASP A C   
998  O O   . ASP A 133 ? 0.3782 0.3986 0.3961 0.0034  0.0581  0.0502  163 ASP A O   
999  C CB  . ASP A 133 ? 0.3693 0.3901 0.3933 0.0010  0.0555  0.0525  163 ASP A CB  
1000 C CG  . ASP A 133 ? 0.4729 0.4982 0.5017 -0.0004 0.0551  0.0562  163 ASP A CG  
1001 O OD1 . ASP A 133 ? 0.4415 0.4733 0.4718 0.0009  0.0565  0.0590  163 ASP A OD1 
1002 O OD2 . ASP A 133 ? 0.4484 0.4708 0.4793 -0.0028 0.0534  0.0564  163 ASP A OD2 
1003 N N   . ARG A 134 ? 0.3973 0.4261 0.4140 0.0077  0.0604  0.0518  164 ARG A N   
1004 C CA  . ARG A 134 ? 0.4569 0.4870 0.4711 0.0089  0.0615  0.0515  164 ARG A CA  
1005 C C   . ARG A 134 ? 0.4446 0.4679 0.4542 0.0093  0.0611  0.0476  164 ARG A C   
1006 O O   . ARG A 134 ? 0.4297 0.4521 0.4377 0.0093  0.0613  0.0472  164 ARG A O   
1007 C CB  . ARG A 134 ? 0.4518 0.4848 0.4699 0.0067  0.0612  0.0548  164 ARG A CB  
1008 C CG  . ARG A 134 ? 0.5156 0.5572 0.5376 0.0074  0.0621  0.0593  164 ARG A CG  
1009 C CD  . ARG A 134 ? 0.5119 0.5559 0.5394 0.0044  0.0610  0.0629  164 ARG A CD  
1010 N NE  . ARG A 134 ? 0.5102 0.5489 0.5404 0.0014  0.0588  0.0621  164 ARG A NE  
1011 C CZ  . ARG A 134 ? 0.5109 0.5468 0.5436 -0.0013 0.0573  0.0625  164 ARG A CZ  
1012 N NH1 . ARG A 134 ? 0.4804 0.5184 0.5138 -0.0018 0.0577  0.0640  164 ARG A NH1 
1013 N NH2 . ARG A 134 ? 0.4915 0.5223 0.5259 -0.0034 0.0552  0.0614  164 ARG A NH2 
1014 N N   . LEU A 135 ? 0.3827 0.4014 0.3906 0.0095  0.0604  0.0451  165 LEU A N   
1015 C CA  . LEU A 135 ? 0.3760 0.3891 0.3798 0.0104  0.0600  0.0417  165 LEU A CA  
1016 C C   . LEU A 135 ? 0.3798 0.3925 0.3818 0.0127  0.0600  0.0399  165 LEU A C   
1017 O O   . LEU A 135 ? 0.3741 0.3879 0.3780 0.0123  0.0598  0.0405  165 LEU A O   
1018 C CB  . LEU A 135 ? 0.3481 0.3554 0.3524 0.0078  0.0589  0.0406  165 LEU A CB  
1019 C CG  . LEU A 135 ? 0.4046 0.4113 0.4107 0.0055  0.0587  0.0419  165 LEU A CG  
1020 C CD1 . LEU A 135 ? 0.4074 0.4089 0.4143 0.0033  0.0576  0.0409  165 LEU A CD1 
1021 C CD2 . LEU A 135 ? 0.3047 0.3108 0.3084 0.0065  0.0591  0.0413  165 LEU A CD2 
1022 N N   . ALA A 136 ? 0.4120 0.4233 0.4103 0.0153  0.0600  0.0377  166 ALA A N   
1023 C CA  . ALA A 136 ? 0.4183 0.4286 0.4148 0.0176  0.0597  0.0357  166 ALA A CA  
1024 C C   . ALA A 136 ? 0.4483 0.4519 0.4430 0.0172  0.0582  0.0331  166 ALA A C   
1025 O O   . ALA A 136 ? 0.4244 0.4251 0.4173 0.0172  0.0577  0.0321  166 ALA A O   
1026 C CB  . ALA A 136 ? 0.4257 0.4397 0.4196 0.0213  0.0604  0.0351  166 ALA A CB  
1027 N N   . SER A 137 ? 0.4360 0.4374 0.4315 0.0168  0.0574  0.0322  167 SER A N   
1028 C CA  . SER A 137 ? 0.3982 0.3939 0.3925 0.0164  0.0560  0.0303  167 SER A CA  
1029 C C   . SER A 137 ? 0.3918 0.3865 0.3850 0.0188  0.0550  0.0285  167 SER A C   
1030 O O   . SER A 137 ? 0.3929 0.3908 0.3867 0.0201  0.0554  0.0287  167 SER A O   
1031 C CB  . SER A 137 ? 0.3850 0.3783 0.3811 0.0135  0.0557  0.0310  167 SER A CB  
1032 O OG  . SER A 137 ? 0.3866 0.3751 0.3819 0.0133  0.0545  0.0297  167 SER A OG  
1033 N N   . THR A 138 ? 0.3575 0.3476 0.3493 0.0194  0.0535  0.0268  168 THR A N   
1034 C CA  . THR A 138 ? 0.3438 0.3322 0.3353 0.0213  0.0520  0.0251  168 THR A CA  
1035 C C   . THR A 138 ? 0.3632 0.3508 0.3569 0.0197  0.0516  0.0256  168 THR A C   
1036 O O   . THR A 138 ? 0.3893 0.3757 0.3834 0.0210  0.0503  0.0246  168 THR A O   
1037 C CB  . THR A 138 ? 0.3461 0.3296 0.3362 0.0223  0.0499  0.0235  168 THR A CB  
1038 O OG1 . THR A 138 ? 0.3859 0.3662 0.3771 0.0196  0.0497  0.0244  168 THR A OG1 
1039 C CG2 . THR A 138 ? 0.3386 0.3228 0.3260 0.0246  0.0498  0.0224  168 THR A CG2 
1040 N N   . VAL A 139 ? 0.3355 0.3236 0.3305 0.0171  0.0525  0.0272  169 VAL A N   
1041 C CA  . VAL A 139 ? 0.3317 0.3181 0.3281 0.0155  0.0520  0.0276  169 VAL A CA  
1042 C C   . VAL A 139 ? 0.3486 0.3376 0.3465 0.0138  0.0529  0.0291  169 VAL A C   
1043 O O   . VAL A 139 ? 0.3718 0.3634 0.3702 0.0131  0.0540  0.0303  169 VAL A O   
1044 C CB  . VAL A 139 ? 0.4036 0.3860 0.3998 0.0139  0.0514  0.0277  169 VAL A CB  
1045 C CG1 . VAL A 139 ? 0.3872 0.3689 0.3841 0.0116  0.0519  0.0288  169 VAL A CG1 
1046 C CG2 . VAL A 139 ? 0.3382 0.3174 0.3343 0.0152  0.0496  0.0267  169 VAL A CG2 
1047 N N   . ILE A 140 ? 0.3499 0.3384 0.3489 0.0131  0.0523  0.0293  170 ILE A N   
1048 C CA  . ILE A 140 ? 0.3457 0.3360 0.3460 0.0115  0.0527  0.0306  170 ILE A CA  
1049 C C   . ILE A 140 ? 0.3904 0.3782 0.3905 0.0092  0.0526  0.0310  170 ILE A C   
1050 O O   . ILE A 140 ? 0.3851 0.3700 0.3844 0.0089  0.0520  0.0305  170 ILE A O   
1051 C CB  . ILE A 140 ? 0.3525 0.3437 0.3540 0.0119  0.0520  0.0307  170 ILE A CB  
1052 C CG1 . ILE A 140 ? 0.3569 0.3512 0.3589 0.0143  0.0522  0.0303  170 ILE A CG1 
1053 C CG2 . ILE A 140 ? 0.3116 0.3039 0.3144 0.0100  0.0519  0.0320  170 ILE A CG2 
1054 C CD1 . ILE A 140 ? 0.4003 0.3953 0.4037 0.0148  0.0514  0.0303  170 ILE A CD1 
1055 N N   . TYR A 141 ? 0.3806 0.3697 0.3815 0.0079  0.0530  0.0321  171 TYR A N   
1056 C CA  . TYR A 141 ? 0.3891 0.3758 0.3896 0.0061  0.0527  0.0322  171 TYR A CA  
1057 C C   . TYR A 141 ? 0.3873 0.3745 0.3887 0.0050  0.0519  0.0328  171 TYR A C   
1058 O O   . TYR A 141 ? 0.3633 0.3533 0.3665 0.0051  0.0517  0.0338  171 TYR A O   
1059 C CB  . TYR A 141 ? 0.3731 0.3601 0.3740 0.0051  0.0533  0.0329  171 TYR A CB  
1060 C CG  . TYR A 141 ? 0.3686 0.3551 0.3685 0.0060  0.0539  0.0324  171 TYR A CG  
1061 C CD1 . TYR A 141 ? 0.3781 0.3676 0.3786 0.0068  0.0546  0.0330  171 TYR A CD1 
1062 C CD2 . TYR A 141 ? 0.3480 0.3311 0.3465 0.0062  0.0538  0.0315  171 TYR A CD2 
1063 C CE1 . TYR A 141 ? 0.3937 0.3824 0.3930 0.0077  0.0550  0.0325  171 TYR A CE1 
1064 C CE2 . TYR A 141 ? 0.3680 0.3502 0.3658 0.0070  0.0541  0.0311  171 TYR A CE2 
1065 C CZ  . TYR A 141 ? 0.3517 0.3365 0.3496 0.0077  0.0546  0.0314  171 TYR A CZ  
1066 O OH  . TYR A 141 ? 0.3909 0.3746 0.3878 0.0086  0.0547  0.0309  171 TYR A OH  
1067 N N   . ARG A 142 ? 0.3708 0.3551 0.3709 0.0042  0.0513  0.0323  172 ARG A N   
1068 C CA  . ARG A 142 ? 0.4594 0.4433 0.4596 0.0033  0.0502  0.0325  172 ARG A CA  
1069 C C   . ARG A 142 ? 0.3879 0.3732 0.3900 0.0021  0.0495  0.0336  172 ARG A C   
1070 O O   . ARG A 142 ? 0.4206 0.4057 0.4233 0.0014  0.0496  0.0338  172 ARG A O   
1071 C CB  . ARG A 142 ? 0.4078 0.3885 0.4056 0.0029  0.0499  0.0317  172 ARG A CB  
1072 C CG  . ARG A 142 ? 0.5261 0.5057 0.5231 0.0021  0.0486  0.0315  172 ARG A CG  
1073 C CD  . ARG A 142 ? 0.4531 0.4298 0.4474 0.0021  0.0487  0.0306  172 ARG A CD  
1074 N NE  . ARG A 142 ? 0.4679 0.4440 0.4612 0.0030  0.0499  0.0305  172 ARG A NE  
1075 C CZ  . ARG A 142 ? 0.4416 0.4159 0.4332 0.0033  0.0505  0.0301  172 ARG A CZ  
1076 N NH1 . ARG A 142 ? 0.4007 0.3735 0.3910 0.0029  0.0501  0.0294  172 ARG A NH1 
1077 N NH2 . ARG A 142 ? 0.3878 0.3618 0.3791 0.0040  0.0514  0.0305  172 ARG A NH2 
1078 N N   . GLY A 143 ? 0.3209 0.3077 0.3246 0.0018  0.0485  0.0344  173 GLY A N   
1079 C CA  . GLY A 143 ? 0.3282 0.3160 0.3343 0.0005  0.0472  0.0357  173 GLY A CA  
1080 C C   . GLY A 143 ? 0.3629 0.3537 0.3718 0.0002  0.0478  0.0373  173 GLY A C   
1081 O O   . GLY A 143 ? 0.3671 0.3580 0.3781 -0.0010 0.0465  0.0384  173 GLY A O   
1082 N N   . THR A 144 ? 0.3484 0.3415 0.3573 0.0016  0.0495  0.0375  174 THR A N   
1083 C CA  . THR A 144 ? 0.3921 0.3883 0.4030 0.0016  0.0503  0.0390  174 THR A CA  
1084 C C   . THR A 144 ? 0.3292 0.3303 0.3419 0.0030  0.0513  0.0405  174 THR A C   
1085 O O   . THR A 144 ? 0.3267 0.3283 0.3378 0.0048  0.0523  0.0394  174 THR A O   
1086 C CB  . THR A 144 ? 0.3912 0.3859 0.3999 0.0021  0.0515  0.0377  174 THR A CB  
1087 O OG1 . THR A 144 ? 0.4332 0.4235 0.4401 0.0011  0.0508  0.0363  174 THR A OG1 
1088 C CG2 . THR A 144 ? 0.3396 0.3374 0.3504 0.0019  0.0522  0.0394  174 THR A CG2 
1089 N N   . THR A 145 ? 0.3519 0.3567 0.3683 0.0024  0.0510  0.0431  175 THR A N   
1090 C CA  . THR A 145 ? 0.3397 0.3497 0.3583 0.0038  0.0520  0.0450  175 THR A CA  
1091 C C   . THR A 145 ? 0.3346 0.3473 0.3516 0.0060  0.0540  0.0447  175 THR A C   
1092 O O   . THR A 145 ? 0.3751 0.3884 0.3919 0.0057  0.0546  0.0451  175 THR A O   
1093 C CB  . THR A 145 ? 0.4017 0.4153 0.4252 0.0024  0.0509  0.0485  175 THR A CB  
1094 O OG1 . THR A 145 ? 0.3742 0.3846 0.3987 0.0006  0.0486  0.0485  175 THR A OG1 
1095 C CG2 . THR A 145 ? 0.3111 0.3310 0.3372 0.0041  0.0522  0.0511  175 THR A CG2 
1096 N N   . PHE A 146 ? 0.3477 0.3619 0.3634 0.0083  0.0550  0.0438  176 PHE A N   
1097 C CA  . PHE A 146 ? 0.3744 0.3913 0.3883 0.0108  0.0566  0.0433  176 PHE A CA  
1098 C C   . PHE A 146 ? 0.3940 0.4164 0.4094 0.0132  0.0577  0.0448  176 PHE A C   
1099 O O   . PHE A 146 ? 0.3801 0.4035 0.3976 0.0131  0.0572  0.0456  176 PHE A O   
1100 C CB  . PHE A 146 ? 0.3548 0.3671 0.3646 0.0121  0.0566  0.0399  176 PHE A CB  
1101 C CG  . PHE A 146 ? 0.3826 0.3929 0.3918 0.0128  0.0558  0.0383  176 PHE A CG  
1102 C CD1 . PHE A 146 ? 0.3680 0.3738 0.3767 0.0110  0.0545  0.0373  176 PHE A CD1 
1103 C CD2 . PHE A 146 ? 0.3796 0.3924 0.3885 0.0155  0.0564  0.0378  176 PHE A CD2 
1104 C CE1 . PHE A 146 ? 0.3370 0.3413 0.3453 0.0116  0.0537  0.0362  176 PHE A CE1 
1105 C CE2 . PHE A 146 ? 0.3759 0.3869 0.3848 0.0161  0.0555  0.0365  176 PHE A CE2 
1106 C CZ  . PHE A 146 ? 0.3852 0.3919 0.3938 0.0140  0.0541  0.0358  176 PHE A CZ  
1107 N N   . ALA A 147 ? 0.3300 0.3562 0.3444 0.0155  0.0593  0.0452  177 ALA A N   
1108 C CA  . ALA A 147 ? 0.3320 0.3631 0.3464 0.0187  0.0606  0.0456  177 ALA A CA  
1109 C C   . ALA A 147 ? 0.3592 0.3878 0.3690 0.0215  0.0610  0.0421  177 ALA A C   
1110 O O   . ALA A 147 ? 0.3959 0.4211 0.4032 0.0210  0.0606  0.0405  177 ALA A O   
1111 C CB  . ALA A 147 ? 0.4047 0.4431 0.4218 0.0196  0.0622  0.0493  177 ALA A CB  
1112 N N   . GLU A 148 ? 0.3262 0.3562 0.3351 0.0245  0.0613  0.0408  178 GLU A N   
1113 C CA  . GLU A 148 ? 0.3878 0.4156 0.3925 0.0275  0.0612  0.0375  178 GLU A CA  
1114 C C   . GLU A 148 ? 0.3727 0.4057 0.3758 0.0305  0.0629  0.0383  178 GLU A C   
1115 O O   . GLU A 148 ? 0.4013 0.4408 0.4067 0.0315  0.0644  0.0412  178 GLU A O   
1116 C CB  . GLU A 148 ? 0.3866 0.4132 0.3909 0.0296  0.0604  0.0355  178 GLU A CB  
1117 C CG  . GLU A 148 ? 0.3568 0.3787 0.3627 0.0269  0.0587  0.0348  178 GLU A CG  
1118 C CD  . GLU A 148 ? 0.4094 0.4316 0.4163 0.0287  0.0580  0.0338  178 GLU A CD  
1119 O OE1 . GLU A 148 ? 0.4780 0.5039 0.4879 0.0285  0.0586  0.0360  178 GLU A OE1 
1120 O OE2 . GLU A 148 ? 0.4411 0.4597 0.4459 0.0304  0.0568  0.0308  178 GLU A OE2 
1121 N N   . GLY A 149 ? 0.3572 0.3876 0.3564 0.0319  0.0626  0.0359  179 GLY A N   
1122 C CA  . GLY A 149 ? 0.3533 0.3886 0.3505 0.0346  0.0642  0.0367  179 GLY A CA  
1123 C C   . GLY A 149 ? 0.3951 0.4270 0.3875 0.0366  0.0635  0.0336  179 GLY A C   
1124 O O   . GLY A 149 ? 0.4123 0.4375 0.4029 0.0359  0.0615  0.0307  179 GLY A O   
1125 N N   . VAL A 150 ? 0.4294 0.4662 0.4198 0.0390  0.0650  0.0346  180 VAL A N   
1126 C CA  . VAL A 150 ? 0.4691 0.5032 0.4547 0.0412  0.0643  0.0319  180 VAL A CA  
1127 C C   . VAL A 150 ? 0.4918 0.5302 0.4772 0.0405  0.0657  0.0346  180 VAL A C   
1128 O O   . VAL A 150 ? 0.4709 0.5156 0.4598 0.0395  0.0675  0.0386  180 VAL A O   
1129 C CB  . VAL A 150 ? 0.5218 0.5573 0.5035 0.0467  0.0642  0.0290  180 VAL A CB  
1130 C CG1 . VAL A 150 ? 0.4789 0.5085 0.4606 0.0471  0.0619  0.0258  180 VAL A CG1 
1131 C CG2 . VAL A 150 ? 0.4977 0.5420 0.4807 0.0494  0.0667  0.0317  180 VAL A CG2 
1132 N N   . VAL A 151 ? 0.5198 0.5548 0.5016 0.0410  0.0648  0.0327  181 VAL A N   
1133 C CA  . VAL A 151 ? 0.4953 0.5334 0.4771 0.0399  0.0659  0.0351  181 VAL A CA  
1134 C C   . VAL A 151 ? 0.5255 0.5668 0.5022 0.0445  0.0665  0.0339  181 VAL A C   
1135 O O   . VAL A 151 ? 0.5080 0.5455 0.4803 0.0476  0.0650  0.0300  181 VAL A O   
1136 C CB  . VAL A 151 ? 0.4733 0.5046 0.4556 0.0359  0.0643  0.0344  181 VAL A CB  
1137 C CG1 . VAL A 151 ? 0.4506 0.4846 0.4326 0.0349  0.0651  0.0366  181 VAL A CG1 
1138 C CG2 . VAL A 151 ? 0.4740 0.5027 0.4609 0.0317  0.0638  0.0357  181 VAL A CG2 
1139 N N   . ALA A 152 ? 0.4332 0.4818 0.4105 0.0449  0.0685  0.0374  182 ALA A N   
1140 C CA  . ALA A 152 ? 0.4869 0.5388 0.4592 0.0489  0.0692  0.0367  182 ALA A CA  
1141 C C   . ALA A 152 ? 0.4551 0.5084 0.4284 0.0461  0.0696  0.0394  182 ALA A C   
1142 O O   . ALA A 152 ? 0.4083 0.4630 0.3869 0.0418  0.0701  0.0428  182 ALA A O   
1143 C CB  . ALA A 152 ? 0.4372 0.4984 0.4089 0.0533  0.0717  0.0386  182 ALA A CB  
1144 N N   . PHE A 153 ? 0.5248 0.5777 0.4930 0.0486  0.0692  0.0377  183 PHE A N   
1145 C CA  . PHE A 153 ? 0.5614 0.6160 0.5299 0.0465  0.0695  0.0401  183 PHE A CA  
1146 C C   . PHE A 153 ? 0.5985 0.6622 0.5641 0.0506  0.0717  0.0423  183 PHE A C   
1147 O O   . PHE A 153 ? 0.6033 0.6678 0.5629 0.0558  0.0716  0.0394  183 PHE A O   
1148 C CB  . PHE A 153 ? 0.4943 0.5400 0.4595 0.0454  0.0669  0.0366  183 PHE A CB  
1149 C CG  . PHE A 153 ? 0.5387 0.5758 0.5063 0.0420  0.0649  0.0345  183 PHE A CG  
1150 C CD1 . PHE A 153 ? 0.4501 0.4816 0.4151 0.0442  0.0631  0.0304  183 PHE A CD1 
1151 C CD2 . PHE A 153 ? 0.5081 0.5430 0.4808 0.0368  0.0647  0.0367  183 PHE A CD2 
1152 C CE1 . PHE A 153 ? 0.4854 0.5097 0.4528 0.0412  0.0613  0.0289  183 PHE A CE1 
1153 C CE2 . PHE A 153 ? 0.4372 0.4647 0.4117 0.0340  0.0630  0.0349  183 PHE A CE2 
1154 C CZ  . PHE A 153 ? 0.4467 0.4692 0.4186 0.0362  0.0614  0.0312  183 PHE A CZ  
1155 N N   . LEU A 154 ? 0.6218 0.6925 0.5916 0.0484  0.0734  0.0475  184 LEU A N   
1156 C CA  . LEU A 154 ? 0.6848 0.7657 0.6529 0.0520  0.0759  0.0506  184 LEU A CA  
1157 C C   . LEU A 154 ? 0.7025 0.7863 0.6708 0.0503  0.0761  0.0535  184 LEU A C   
1158 O O   . LEU A 154 ? 0.6352 0.7150 0.6074 0.0453  0.0749  0.0547  184 LEU A O   
1159 C CB  . LEU A 154 ? 0.6910 0.7809 0.6651 0.0518  0.0782  0.0556  184 LEU A CB  
1160 C CG  . LEU A 154 ? 0.6978 0.7862 0.6733 0.0528  0.0782  0.0540  184 LEU A CG  
1161 C CD1 . LEU A 154 ? 0.7192 0.8155 0.7021 0.0510  0.0800  0.0599  184 LEU A CD1 
1162 C CD2 . LEU A 154 ? 0.7408 0.8306 0.7096 0.0594  0.0788  0.0504  184 LEU A CD2 
1163 N N   . ILE A 155 ? 0.6895 0.7803 0.6533 0.0548  0.0776  0.0544  185 ILE A N   
1164 C CA  . ILE A 155 ? 0.7201 0.8170 0.6850 0.0536  0.0786  0.0587  185 ILE A CA  
1165 C C   . ILE A 155 ? 0.7219 0.8316 0.6913 0.0548  0.0817  0.0651  185 ILE A C   
1166 O O   . ILE A 155 ? 0.7776 0.8940 0.7433 0.0602  0.0836  0.0651  185 ILE A O   
1167 C CB  . ILE A 155 ? 0.7087 0.8048 0.6653 0.0576  0.0781  0.0558  185 ILE A CB  
1168 C CG1 . ILE A 155 ? 0.7925 0.8759 0.7452 0.0564  0.0747  0.0499  185 ILE A CG1 
1169 C CG2 . ILE A 155 ? 0.6902 0.7931 0.6485 0.0561  0.0791  0.0607  185 ILE A CG2 
1170 C CD1 . ILE A 155 ? 0.7213 0.8027 0.6667 0.0592  0.0734  0.0475  185 ILE A CD1 
1171 N N   . LEU A 156 ? 0.8077 0.9209 0.7852 0.0498  0.0819  0.0704  186 LEU A N   
1172 C CA  . LEU A 156 ? 0.8959 1.0212 0.8794 0.0501  0.0844  0.0774  186 LEU A CA  
1173 C C   . LEU A 156 ? 0.9409 1.0748 0.9234 0.0514  0.0857  0.0815  186 LEU A C   
1174 O O   . LEU A 156 ? 0.9473 1.0768 0.9276 0.0495  0.0843  0.0802  186 LEU A O   
1175 C CB  . LEU A 156 ? 0.8564 0.9811 0.8498 0.0440  0.0834  0.0813  186 LEU A CB  
1176 C CG  . LEU A 156 ? 0.8581 0.9738 0.8536 0.0415  0.0816  0.0778  186 LEU A CG  
1177 C CD1 . LEU A 156 ? 0.8016 0.9175 0.8066 0.0357  0.0805  0.0821  186 LEU A CD1 
1178 C CD2 . LEU A 156 ? 0.7989 0.9167 0.7921 0.0457  0.0830  0.0761  186 LEU A CD2 
1179 N N   . PRO A 157 ? 0.9398 1.0862 0.9243 0.0545  0.0886  0.0869  187 PRO A N   
1180 C CA  . PRO A 157 ? 0.9198 1.0763 0.9045 0.0556  0.0902  0.0921  187 PRO A CA  
1181 C C   . PRO A 157 ? 0.8992 1.0555 0.8916 0.0491  0.0886  0.0965  187 PRO A C   
1182 O O   . PRO A 157 ? 0.8715 1.0227 0.8709 0.0440  0.0869  0.0972  187 PRO A O   
1183 C CB  . PRO A 157 ? 0.9133 1.0829 0.9015 0.0590  0.0933  0.0979  187 PRO A CB  
1184 C CG  . PRO A 157 ? 0.9605 1.1263 0.9453 0.0624  0.0937  0.0933  187 PRO A CG  
1185 C CD  . PRO A 157 ? 0.8961 1.0481 0.8821 0.0577  0.0905  0.0882  187 PRO A CD  
1186 N N   . GLN A 158 ? 1.1426 1.3045 1.1337 0.0496  0.0892  0.0995  188 GLN A N   
1187 C CA  . GLN A 158 ? 1.1098 1.2721 1.1082 0.0437  0.0877  0.1039  188 GLN A CA  
1188 C C   . GLN A 158 ? 1.1358 1.3067 1.1456 0.0405  0.0882  0.1117  188 GLN A C   
1189 O O   . GLN A 158 ? 1.1148 1.2965 1.1265 0.0439  0.0907  0.1162  188 GLN A O   
1190 C CB  . GLN A 158 ? 1.1079 1.2753 1.1022 0.0453  0.0883  0.1057  188 GLN A CB  
1191 C CG  . GLN A 158 ? 1.0682 1.2261 1.0524 0.0474  0.0870  0.0984  188 GLN A CG  
1192 C CD  . GLN A 158 ? 1.1299 1.2930 1.1103 0.0488  0.0874  0.1006  188 GLN A CD  
1193 O OE1 . GLN A 158 ? 1.1234 1.2893 1.1102 0.0443  0.0866  0.1053  188 GLN A OE1 
1194 N NE2 . GLN A 158 ? 1.1309 1.2954 1.1011 0.0550  0.0884  0.0971  188 GLN A NE2 
1195 N N   . PRO B 1   ? 1.7782 1.8688 1.7464 0.1025  0.0781  0.0224  509 PRO B N   
1196 C CA  . PRO B 1   ? 1.8051 1.8919 1.7800 0.0972  0.0768  0.0238  509 PRO B CA  
1197 C C   . PRO B 1   ? 1.8066 1.8964 1.7877 0.0907  0.0784  0.0300  509 PRO B C   
1198 O O   . PRO B 1   ? 1.8005 1.8932 1.7805 0.0893  0.0797  0.0326  509 PRO B O   
1199 C CB  . PRO B 1   ? 1.8068 1.8817 1.7796 0.0949  0.0723  0.0185  509 PRO B CB  
1200 C CG  . PRO B 1   ? 1.7977 1.8708 1.7652 0.0951  0.0718  0.0172  509 PRO B CG  
1201 C CD  . PRO B 1   ? 1.7762 1.8587 1.7397 0.1010  0.0751  0.0186  509 PRO B CD  
1202 N N   . LYS B 2   ? 1.5823 1.6714 1.5697 0.0869  0.0781  0.0324  510 LYS B N   
1203 C CA  . LYS B 2   ? 1.5177 1.6059 1.5106 0.0799  0.0780  0.0367  510 LYS B CA  
1204 C C   . LYS B 2   ? 1.4275 1.5213 1.4214 0.0779  0.0802  0.0414  510 LYS B C   
1205 O O   . LYS B 2   ? 1.4649 1.5534 1.4582 0.0737  0.0786  0.0410  510 LYS B O   
1206 C CB  . LYS B 2   ? 1.5712 1.6484 1.5628 0.0757  0.0745  0.0330  510 LYS B CB  
1207 C CG  . LYS B 2   ? 1.6261 1.6961 1.6148 0.0779  0.0715  0.0272  510 LYS B CG  
1208 C CD  . LYS B 2   ? 1.6136 1.6739 1.6013 0.0737  0.0683  0.0244  510 LYS B CD  
1209 C CE  . LYS B 2   ? 1.6281 1.6874 1.6103 0.0753  0.0682  0.0227  510 LYS B CE  
1210 N NZ  . LYS B 2   ? 1.6227 1.6732 1.6009 0.0761  0.0646  0.0175  510 LYS B NZ  
1211 N N   . CYS B 3   ? 0.9659 1.0702 0.9614 0.0807  0.0835  0.0460  511 CYS B N   
1212 C CA  . CYS B 3   ? 0.8297 0.9387 0.8258 0.0787  0.0850  0.0501  511 CYS B CA  
1213 C C   . CYS B 3   ? 0.8090 0.9260 0.8129 0.0757  0.0869  0.0577  511 CYS B C   
1214 O O   . CYS B 3   ? 0.8506 0.9762 0.8573 0.0789  0.0894  0.0613  511 CYS B O   
1215 C CB  . CYS B 3   ? 0.8025 0.9171 0.7924 0.0848  0.0870  0.0492  511 CYS B CB  
1216 S SG  . CYS B 3   ? 0.8869 1.0085 0.8784 0.0823  0.0890  0.0550  511 CYS B SG  
1217 N N   . ASN B 4   ? 0.6177 0.7320 0.6248 0.0698  0.0858  0.0602  512 ASN B N   
1218 C CA  . ASN B 4   ? 0.6153 0.7365 0.6298 0.0665  0.0870  0.0674  512 ASN B CA  
1219 C C   . ASN B 4   ? 0.6396 0.7685 0.6534 0.0678  0.0891  0.0711  512 ASN B C   
1220 O O   . ASN B 4   ? 0.5810 0.7059 0.5925 0.0653  0.0880  0.0700  512 ASN B O   
1221 C CB  . ASN B 4   ? 0.5711 0.6850 0.5898 0.0596  0.0842  0.0679  512 ASN B CB  
1222 C CG  . ASN B 4   ? 0.5794 0.6993 0.6062 0.0559  0.0846  0.0751  512 ASN B CG  
1223 O OD1 . ASN B 4   ? 0.6202 0.7496 0.6510 0.0582  0.0868  0.0801  512 ASN B OD1 
1224 N ND2 . ASN B 4   ? 0.5941 0.7086 0.6238 0.0502  0.0822  0.0758  512 ASN B ND2 
1225 N N   . PRO B 5   ? 0.7837 0.9238 0.7996 0.0717  0.0921  0.0759  513 PRO B N   
1226 C CA  . PRO B 5   ? 0.7237 0.8727 0.7388 0.0738  0.0945  0.0798  513 PRO B CA  
1227 C C   . PRO B 5   ? 0.7350 0.8859 0.7567 0.0679  0.0937  0.0855  513 PRO B C   
1228 O O   . PRO B 5   ? 0.7593 0.9138 0.7797 0.0680  0.0946  0.0875  513 PRO B O   
1229 C CB  . PRO B 5   ? 0.8502 1.0108 0.8673 0.0791  0.0979  0.0839  513 PRO B CB  
1230 C CG  . PRO B 5   ? 0.8160 0.9749 0.8396 0.0766  0.0969  0.0855  513 PRO B CG  
1231 C CD  . PRO B 5   ? 0.7935 0.9391 0.8138 0.0739  0.0935  0.0785  513 PRO B CD  
1232 N N   . ASN B 6   ? 0.7632 0.9114 0.7920 0.0630  0.0919  0.0881  514 ASN B N   
1233 C CA  . ASN B 6   ? 0.8219 0.9706 0.8572 0.0573  0.0905  0.0931  514 ASN B CA  
1234 C C   . ASN B 6   ? 0.8122 0.9502 0.8445 0.0530  0.0876  0.0885  514 ASN B C   
1235 O O   . ASN B 6   ? 0.8217 0.9500 0.8502 0.0521  0.0858  0.0827  514 ASN B O   
1236 C CB  . ASN B 6   ? 0.7384 0.8881 0.7826 0.0536  0.0892  0.0976  514 ASN B CB  
1237 C CG  . ASN B 6   ? 0.8254 0.9876 0.8771 0.0544  0.0912  0.1062  514 ASN B CG  
1238 O OD1 . ASN B 6   ? 0.8449 1.0166 0.8947 0.0593  0.0944  0.1086  514 ASN B OD1 
1239 N ND2 . ASN B 6   ? 0.8128 0.9754 0.8733 0.0496  0.0891  0.1113  514 ASN B ND2 
1240 N N   . LEU B 7   ? 0.6477 0.7877 0.6820 0.0504  0.0873  0.0916  515 LEU B N   
1241 C CA  . LEU B 7   ? 0.5885 0.7191 0.6207 0.0462  0.0847  0.0881  515 LEU B CA  
1242 C C   . LEU B 7   ? 0.5694 0.7006 0.6098 0.0406  0.0828  0.0933  515 LEU B C   
1243 O O   . LEU B 7   ? 0.6316 0.7685 0.6747 0.0397  0.0833  0.0976  515 LEU B O   
1244 C CB  . LEU B 7   ? 0.6552 0.7860 0.6807 0.0486  0.0858  0.0857  515 LEU B CB  
1245 C CG  . LEU B 7   ? 0.6126 0.7332 0.6349 0.0450  0.0833  0.0813  515 LEU B CG  
1246 C CD1 . LEU B 7   ? 0.6087 0.7188 0.6274 0.0445  0.0814  0.0749  515 LEU B CD1 
1247 C CD2 . LEU B 7   ? 0.6088 0.7305 0.6250 0.0475  0.0843  0.0795  515 LEU B CD2 
1248 N N   . HIS B 8   ? 0.5344 0.6598 0.5787 0.0368  0.0804  0.0929  516 HIS B N   
1249 C CA  . HIS B 8   ? 0.4324 0.5569 0.4841 0.0315  0.0779  0.0970  516 HIS B CA  
1250 C C   . HIS B 8   ? 0.5574 0.6724 0.6061 0.0280  0.0755  0.0928  516 HIS B C   
1251 O O   . HIS B 8   ? 0.6114 0.7176 0.6596 0.0252  0.0732  0.0893  516 HIS B O   
1252 C CB  . HIS B 8   ? 0.4535 0.5763 0.5106 0.0294  0.0761  0.0986  516 HIS B CB  
1253 C CG  . HIS B 8   ? 0.4656 0.5899 0.5316 0.0248  0.0736  0.1042  516 HIS B CG  
1254 N ND1 . HIS B 8   ? 0.5251 0.6486 0.5971 0.0226  0.0716  0.1067  516 HIS B ND1 
1255 C CD2 . HIS B 8   ? 0.5287 0.6551 0.5989 0.0220  0.0724  0.1078  516 HIS B CD2 
1256 C CE1 . HIS B 8   ? 0.4990 0.6238 0.5784 0.0187  0.0691  0.1115  516 HIS B CE1 
1257 N NE2 . HIS B 8   ? 0.6011 0.7277 0.6797 0.0182  0.0695  0.1123  516 HIS B NE2 
1258 N N   . TYR B 9   ? 0.5703 0.6873 0.6170 0.0283  0.0763  0.0933  517 TYR B N   
1259 C CA  . TYR B 9   ? 0.5343 0.6429 0.5769 0.0260  0.0748  0.0888  517 TYR B CA  
1260 C C   . TYR B 9   ? 0.5153 0.6202 0.5635 0.0206  0.0718  0.0909  517 TYR B C   
1261 O O   . TYR B 9   ? 0.5557 0.6660 0.6117 0.0186  0.0709  0.0967  517 TYR B O   
1262 C CB  . TYR B 9   ? 0.5598 0.6718 0.5975 0.0288  0.0767  0.0882  517 TYR B CB  
1263 C CG  . TYR B 9   ? 0.6923 0.8133 0.7356 0.0278  0.0774  0.0950  517 TYR B CG  
1264 C CD1 . TYR B 9   ? 0.6419 0.7605 0.6882 0.0237  0.0755  0.0963  517 TYR B CD1 
1265 C CD2 . TYR B 9   ? 0.7257 0.8581 0.7718 0.0310  0.0799  0.1002  517 TYR B CD2 
1266 C CE1 . TYR B 9   ? 0.7255 0.8526 0.7777 0.0227  0.0758  0.1027  517 TYR B CE1 
1267 C CE2 . TYR B 9   ? 0.7639 0.9053 0.8158 0.0301  0.0804  0.1070  517 TYR B CE2 
1268 C CZ  . TYR B 9   ? 0.7679 0.9064 0.8229 0.0258  0.0783  0.1082  517 TYR B CZ  
1269 O OH  . TYR B 9   ? 0.7672 0.9146 0.8285 0.0247  0.0785  0.1151  517 TYR B OH  
1270 N N   . TRP B 10  ? 0.5019 0.5975 0.5465 0.0184  0.0701  0.0862  518 TRP B N   
1271 C CA  . TRP B 10  ? 0.4871 0.5790 0.5360 0.0139  0.0674  0.0874  518 TRP B CA  
1272 C C   . TRP B 10  ? 0.4946 0.5831 0.5388 0.0137  0.0678  0.0845  518 TRP B C   
1273 O O   . TRP B 10  ? 0.4980 0.5839 0.5351 0.0166  0.0692  0.0803  518 TRP B O   
1274 C CB  . TRP B 10  ? 0.4798 0.5631 0.5298 0.0109  0.0646  0.0847  518 TRP B CB  
1275 C CG  . TRP B 10  ? 0.4359 0.5112 0.4787 0.0122  0.0648  0.0781  518 TRP B CG  
1276 C CD1 . TRP B 10  ? 0.4658 0.5398 0.5067 0.0140  0.0652  0.0761  518 TRP B CD1 
1277 C CD2 . TRP B 10  ? 0.4542 0.5220 0.4915 0.0116  0.0644  0.0732  518 TRP B CD2 
1278 N NE1 . TRP B 10  ? 0.4583 0.5245 0.4930 0.0146  0.0650  0.0703  518 TRP B NE1 
1279 C CE2 . TRP B 10  ? 0.5069 0.5693 0.5394 0.0132  0.0645  0.0686  518 TRP B CE2 
1280 C CE3 . TRP B 10  ? 0.4572 0.5223 0.4936 0.0100  0.0638  0.0725  518 TRP B CE3 
1281 C CZ2 . TRP B 10  ? 0.4389 0.4937 0.4659 0.0131  0.0641  0.0636  518 TRP B CZ2 
1282 C CZ3 . TRP B 10  ? 0.4820 0.5394 0.5127 0.0099  0.0635  0.0674  518 TRP B CZ3 
1283 C CH2 . TRP B 10  ? 0.4226 0.4751 0.4489 0.0115  0.0636  0.0632  518 TRP B CH2 
1284 N N   . THR B 11  ? 0.4810 0.5696 0.5293 0.0106  0.0662  0.0871  519 THR B N   
1285 C CA  . THR B 11  ? 0.4985 0.5832 0.5432 0.0098  0.0661  0.0845  519 THR B CA  
1286 C C   . THR B 11  ? 0.4790 0.5617 0.5296 0.0054  0.0635  0.0868  519 THR B C   
1287 O O   . THR B 11  ? 0.5418 0.6265 0.5993 0.0032  0.0616  0.0906  519 THR B O   
1288 C CB  . THR B 11  ? 0.6330 0.7248 0.6747 0.0130  0.0688  0.0862  519 THR B CB  
1289 O OG1 . THR B 11  ? 0.6167 0.7032 0.6538 0.0124  0.0685  0.0827  519 THR B OG1 
1290 C CG2 . THR B 11  ? 0.5600 0.6617 0.6091 0.0120  0.0690  0.0934  519 THR B CG2 
1291 N N   . THR B 12  ? 0.5585 0.6369 0.6066 0.0042  0.0630  0.0846  520 THR B N   
1292 C CA  . THR B 12  ? 0.7143 0.7913 0.7680 0.0003  0.0606  0.0868  520 THR B CA  
1293 C C   . THR B 12  ? 0.8069 0.8922 0.8641 0.0003  0.0615  0.0919  520 THR B C   
1294 O O   . THR B 12  ? 0.8668 0.9542 0.9190 0.0026  0.0636  0.0909  520 THR B O   
1295 C CB  . THR B 12  ? 0.6939 0.7614 0.7436 -0.0013 0.0594  0.0818  520 THR B CB  
1296 O OG1 . THR B 12  ? 0.6319 0.6997 0.6761 0.0006  0.0614  0.0801  520 THR B OG1 
1297 C CG2 . THR B 12  ? 0.6356 0.6951 0.6811 -0.0009 0.0589  0.0767  520 THR B CG2 
1298 N N   . GLN B 13  ? 0.9816 1.0715 1.0475 -0.0023 0.0596  0.0974  521 GLN B N   
1299 C CA  . GLN B 13  ? 1.1789 1.2762 1.2494 -0.0032 0.0597  0.1027  521 GLN B CA  
1300 C C   . GLN B 13  ? 1.1553 1.2545 1.2361 -0.0071 0.0563  0.1078  521 GLN B C   
1301 O O   . GLN B 13  ? 1.2090 1.3171 1.2961 -0.0076 0.0563  0.1141  521 GLN B O   
1302 C CB  . GLN B 13  ? 1.1346 1.2427 1.2042 0.0005  0.0630  0.1065  521 GLN B CB  
1303 C CG  . GLN B 13  ? 1.1774 1.2863 1.2392 0.0034  0.0657  0.1039  521 GLN B CG  
1304 C CD  . GLN B 13  ? 1.2135 1.3298 1.2708 0.0083  0.0691  0.1047  521 GLN B CD  
1305 O OE1 . GLN B 13  ? 1.1685 1.2902 1.2293 0.0095  0.0697  0.1078  521 GLN B OE1 
1306 N NE2 . GLN B 13  ? 1.1577 1.2739 1.2073 0.0114  0.0712  0.1017  521 GLN B NE2 
1307 N N   . ALA B 17  ? 1.6620 1.7455 1.7680 -0.0218 0.0406  0.1115  525 ALA B N   
1308 C CA  . ALA B 17  ? 1.7146 1.8016 1.8318 -0.0248 0.0364  0.1173  525 ALA B CA  
1309 C C   . ALA B 17  ? 1.7689 1.8560 1.8912 -0.0275 0.0342  0.1193  525 ALA B C   
1310 O O   . ALA B 17  ? 1.8989 1.9780 2.0222 -0.0296 0.0311  0.1160  525 ALA B O   
1311 C CB  . ALA B 17  ? 1.5495 1.6289 1.6686 -0.0262 0.0326  0.1148  525 ALA B CB  
1312 N N   . ALA B 18  ? 1.5705 1.6671 1.6962 -0.0273 0.0359  0.1248  526 ALA B N   
1313 C CA  . ALA B 18  ? 1.4885 1.5860 1.6185 -0.0297 0.0344  0.1269  526 ALA B CA  
1314 C C   . ALA B 18  ? 1.5126 1.6155 1.6557 -0.0329 0.0300  0.1342  526 ALA B C   
1315 O O   . ALA B 18  ? 1.4606 1.5710 1.6090 -0.0339 0.0302  0.1397  526 ALA B O   
1316 C CB  . ALA B 18  ? 1.3658 1.4700 1.4911 -0.0276 0.0388  0.1282  526 ALA B CB  
1317 N N   . ILE B 19  ? 1.2383 1.3373 1.3868 -0.0345 0.0259  0.1345  527 ILE B N   
1318 C CA  . ILE B 19  ? 1.1967 1.2998 1.3582 -0.0376 0.0209  0.1413  527 ILE B CA  
1319 C C   . ILE B 19  ? 1.0993 1.1922 1.2642 -0.0399 0.0152  0.1378  527 ILE B C   
1320 O O   . ILE B 19  ? 1.0099 1.0973 1.1715 -0.0390 0.0144  0.1343  527 ILE B O   
1321 C CB  . ILE B 19  ? 1.2760 1.3894 1.4436 -0.0367 0.0213  0.1485  527 ILE B CB  
1322 C CG1 . ILE B 19  ? 1.3037 1.4141 1.4638 -0.0339 0.0238  0.1445  527 ILE B CG1 
1323 C CG2 . ILE B 19  ? 1.2633 1.3891 1.4321 -0.0353 0.0253  0.1546  527 ILE B CG2 
1324 C CD1 . ILE B 19  ? 1.2439 1.3641 1.4096 -0.0328 0.0245  0.1513  527 ILE B CD1 
1325 N N   . GLY B 20  ? 1.0306 1.1211 1.2023 -0.0429 0.0110  0.1390  528 GLY B N   
1326 C CA  . GLY B 20  ? 0.8950 0.9752 1.0693 -0.0448 0.0055  0.1351  528 GLY B CA  
1327 C C   . GLY B 20  ? 0.7843 0.8540 0.9479 -0.0436 0.0072  0.1260  528 GLY B C   
1328 O O   . GLY B 20  ? 0.7254 0.7954 0.8828 -0.0426 0.0111  0.1238  528 GLY B O   
1329 N N   . LEU B 21  ? 0.7319 0.7921 0.8930 -0.0435 0.0041  0.1208  529 LEU B N   
1330 C CA  . LEU B 21  ? 0.6911 0.7414 0.8424 -0.0422 0.0056  0.1124  529 LEU B CA  
1331 C C   . LEU B 21  ? 0.6213 0.6702 0.7616 -0.0390 0.0106  0.1081  529 LEU B C   
1332 O O   . LEU B 21  ? 0.6314 0.6721 0.7635 -0.0377 0.0117  0.1013  529 LEU B O   
1333 C CB  . LEU B 21  ? 0.7103 0.7511 0.8640 -0.0433 -0.0002 0.1087  529 LEU B CB  
1334 C CG  . LEU B 21  ? 0.7069 0.7476 0.8718 -0.0464 -0.0061 0.1123  529 LEU B CG  
1335 C CD1 . LEU B 21  ? 0.6167 0.6470 0.7822 -0.0468 -0.0116 0.1074  529 LEU B CD1 
1336 C CD2 . LEU B 21  ? 0.6793 0.7221 0.8445 -0.0473 -0.0041 0.1128  529 LEU B CD2 
1337 N N   . ALA B 22  ? 0.5230 0.5800 0.6632 -0.0377 0.0137  0.1121  530 ALA B N   
1338 C CA  . ALA B 22  ? 0.5136 0.5696 0.6449 -0.0348 0.0177  0.1086  530 ALA B CA  
1339 C C   . ALA B 22  ? 0.4975 0.5510 0.6184 -0.0326 0.0226  0.1035  530 ALA B C   
1340 O O   . ALA B 22  ? 0.3827 0.4323 0.4954 -0.0304 0.0251  0.0989  530 ALA B O   
1341 C CB  . ALA B 22  ? 0.5509 0.6168 0.6855 -0.0338 0.0195  0.1146  530 ALA B CB  
1342 N N   . TRP B 23  ? 0.4676 0.5231 0.5891 -0.0334 0.0237  0.1045  531 TRP B N   
1343 C CA  . TRP B 23  ? 0.5020 0.5548 0.6144 -0.0317 0.0279  0.1000  531 TRP B CA  
1344 C C   . TRP B 23  ? 0.3895 0.4314 0.4970 -0.0319 0.0267  0.0934  531 TRP B C   
1345 O O   . TRP B 23  ? 0.3592 0.3974 0.4585 -0.0302 0.0298  0.0889  531 TRP B O   
1346 C CB  . TRP B 23  ? 0.4563 0.5150 0.5713 -0.0325 0.0293  0.1037  531 TRP B CB  
1347 C CG  . TRP B 23  ? 0.4671 0.5242 0.5901 -0.0357 0.0251  0.1056  531 TRP B CG  
1348 C CD1 . TRP B 23  ? 0.4485 0.5111 0.5823 -0.0381 0.0215  0.1119  531 TRP B CD1 
1349 C CD2 . TRP B 23  ? 0.4066 0.4561 0.5278 -0.0368 0.0240  0.1014  531 TRP B CD2 
1350 N NE1 . TRP B 23  ? 0.4382 0.4969 0.5771 -0.0406 0.0180  0.1116  531 TRP B NE1 
1351 C CE2 . TRP B 23  ? 0.4352 0.4858 0.5663 -0.0398 0.0196  0.1051  531 TRP B CE2 
1352 C CE3 . TRP B 23  ? 0.4178 0.4598 0.5303 -0.0355 0.0262  0.0951  531 TRP B CE3 
1353 C CZ2 . TRP B 23  ? 0.3990 0.4435 0.5315 -0.0414 0.0174  0.1025  531 TRP B CZ2 
1354 C CZ3 . TRP B 23  ? 0.3946 0.4308 0.5085 -0.0370 0.0242  0.0927  531 TRP B CZ3 
1355 C CH2 . TRP B 23  ? 0.4181 0.4555 0.5417 -0.0399 0.0199  0.0962  531 TRP B CH2 
1356 N N   . ILE B 24  ? 0.4158 0.4531 0.5287 -0.0338 0.0220  0.0929  532 ILE B N   
1357 C CA  . ILE B 24  ? 0.4101 0.4374 0.5187 -0.0337 0.0205  0.0867  532 ILE B CA  
1358 C C   . ILE B 24  ? 0.4008 0.4235 0.5025 -0.0315 0.0215  0.0824  532 ILE B C   
1359 O O   . ILE B 24  ? 0.4526 0.4763 0.5572 -0.0316 0.0194  0.0840  532 ILE B O   
1360 C CB  . ILE B 24  ? 0.4082 0.4320 0.5249 -0.0361 0.0147  0.0876  532 ILE B CB  
1361 C CG1 . ILE B 24  ? 0.4579 0.4862 0.5816 -0.0384 0.0137  0.0919  532 ILE B CG1 
1362 C CG2 . ILE B 24  ? 0.3738 0.3874 0.4855 -0.0354 0.0131  0.0810  532 ILE B CG2 
1363 C CD1 . ILE B 24  ? 0.4649 0.4921 0.5989 -0.0411 0.0075  0.0946  532 ILE B CD1 
1364 N N   . PRO B 25  ? 0.4602 0.4780 0.5531 -0.0297 0.0247  0.0772  533 PRO B N   
1365 C CA  . PRO B 25  ? 0.4155 0.4292 0.5014 -0.0276 0.0259  0.0731  533 PRO B CA  
1366 C C   . PRO B 25  ? 0.3946 0.4037 0.4831 -0.0282 0.0216  0.0719  533 PRO B C   
1367 O O   . PRO B 25  ? 0.4075 0.4176 0.4950 -0.0273 0.0215  0.0722  533 PRO B O   
1368 C CB  . PRO B 25  ? 0.4050 0.4130 0.4834 -0.0263 0.0285  0.0680  533 PRO B CB  
1369 C CG  . PRO B 25  ? 0.4274 0.4393 0.5069 -0.0270 0.0305  0.0702  533 PRO B CG  
1370 C CD  . PRO B 25  ? 0.3657 0.3820 0.4549 -0.0295 0.0272  0.0752  533 PRO B CD  
1371 N N   . TYR B 26  ? 0.4040 0.4083 0.4959 -0.0295 0.0179  0.0705  534 TYR B N   
1372 C CA  . TYR B 26  ? 0.4590 0.4582 0.5532 -0.0299 0.0131  0.0690  534 TYR B CA  
1373 C C   . TYR B 26  ? 0.4576 0.4617 0.5588 -0.0311 0.0103  0.0739  534 TYR B C   
1374 O O   . TYR B 26  ? 0.4653 0.4664 0.5656 -0.0305 0.0081  0.0726  534 TYR B O   
1375 C CB  . TYR B 26  ? 0.4231 0.4174 0.5213 -0.0313 0.0091  0.0676  534 TYR B CB  
1376 C CG  . TYR B 26  ? 0.4317 0.4204 0.5325 -0.0315 0.0035  0.0659  534 TYR B CG  
1377 C CD1 . TYR B 26  ? 0.4742 0.4560 0.5678 -0.0295 0.0033  0.0603  534 TYR B CD1 
1378 C CD2 . TYR B 26  ? 0.4661 0.4565 0.5768 -0.0338 -0.0019 0.0699  534 TYR B CD2 
1379 C CE1 . TYR B 26  ? 0.4842 0.4607 0.5796 -0.0294 -0.0021 0.0584  534 TYR B CE1 
1380 C CE2 . TYR B 26  ? 0.4353 0.4201 0.5483 -0.0339 -0.0075 0.0682  534 TYR B CE2 
1381 C CZ  . TYR B 26  ? 0.5027 0.4805 0.6078 -0.0317 -0.0076 0.0623  534 TYR B CZ  
1382 O OH  . TYR B 26  ? 0.4841 0.4560 0.5909 -0.0315 -0.0133 0.0602  534 TYR B OH  
1383 N N   . PHE B 27  ? 0.4422 0.4539 0.5503 -0.0326 0.0104  0.0798  535 PHE B N   
1384 C CA  . PHE B 27  ? 0.4918 0.5090 0.6082 -0.0340 0.0075  0.0855  535 PHE B CA  
1385 C C   . PHE B 27  ? 0.4994 0.5239 0.6140 -0.0326 0.0115  0.0886  535 PHE B C   
1386 O O   . PHE B 27  ? 0.5371 0.5656 0.6571 -0.0332 0.0096  0.0927  535 PHE B O   
1387 C CB  . PHE B 27  ? 0.4433 0.4651 0.5700 -0.0366 0.0044  0.0910  535 PHE B CB  
1388 C CG  . PHE B 27  ? 0.4530 0.4680 0.5840 -0.0382 -0.0012 0.0890  535 PHE B CG  
1389 C CD1 . PHE B 27  ? 0.4733 0.4861 0.6045 -0.0389 -0.0011 0.0875  535 PHE B CD1 
1390 C CD2 . PHE B 27  ? 0.4594 0.4700 0.5944 -0.0388 -0.0068 0.0886  535 PHE B CD2 
1391 C CE1 . PHE B 27  ? 0.4470 0.4534 0.5822 -0.0401 -0.0063 0.0854  535 PHE B CE1 
1392 C CE2 . PHE B 27  ? 0.4256 0.4295 0.5643 -0.0399 -0.0123 0.0864  535 PHE B CE2 
1393 C CZ  . PHE B 27  ? 0.4854 0.4873 0.6242 -0.0405 -0.0120 0.0847  535 PHE B CZ  
1394 N N   . GLY B 28  ? 0.4509 0.4771 0.5582 -0.0308 0.0169  0.0866  536 GLY B N   
1395 C CA  . GLY B 28  ? 0.4606 0.4940 0.5659 -0.0291 0.0210  0.0893  536 GLY B CA  
1396 C C   . GLY B 28  ? 0.4284 0.4602 0.5292 -0.0274 0.0219  0.0872  536 GLY B C   
1397 O O   . GLY B 28  ? 0.4293 0.4543 0.5286 -0.0275 0.0191  0.0839  536 GLY B O   
1398 N N   . PRO B 29  ? 0.4519 0.4899 0.5503 -0.0255 0.0258  0.0892  537 PRO B N   
1399 C CA  . PRO B 29  ? 0.4293 0.4669 0.5237 -0.0237 0.0272  0.0877  537 PRO B CA  
1400 C C   . PRO B 29  ? 0.4423 0.4721 0.5273 -0.0222 0.0288  0.0808  537 PRO B C   
1401 O O   . PRO B 29  ? 0.4291 0.4558 0.5098 -0.0218 0.0305  0.0777  537 PRO B O   
1402 C CB  . PRO B 29  ? 0.4447 0.4912 0.5384 -0.0219 0.0314  0.0912  537 PRO B CB  
1403 C CG  . PRO B 29  ? 0.5376 0.5900 0.6363 -0.0230 0.0317  0.0954  537 PRO B CG  
1404 C CD  . PRO B 29  ? 0.4620 0.5077 0.5607 -0.0248 0.0294  0.0925  537 PRO B CD  
1405 N N   . ALA B 30  ? 0.4608 0.4876 0.5430 -0.0213 0.0283  0.0788  538 ALA B N   
1406 C CA  . ALA B 30  ? 0.4666 0.4873 0.5401 -0.0195 0.0303  0.0729  538 ALA B CA  
1407 C C   . ALA B 30  ? 0.5008 0.5254 0.5691 -0.0172 0.0351  0.0725  538 ALA B C   
1408 O O   . ALA B 30  ? 0.4659 0.4979 0.5371 -0.0167 0.0368  0.0765  538 ALA B O   
1409 C CB  . ALA B 30  ? 0.3931 0.4100 0.4658 -0.0194 0.0280  0.0714  538 ALA B CB  
1410 N N   . ALA B 31  ? 0.4938 0.5136 0.5545 -0.0156 0.0371  0.0676  539 ALA B N   
1411 C CA  . ALA B 31  ? 0.5223 0.5446 0.5776 -0.0132 0.0412  0.0664  539 ALA B CA  
1412 C C   . ALA B 31  ? 0.4679 0.4967 0.5251 -0.0119 0.0425  0.0696  539 ALA B C   
1413 O O   . ALA B 31  ? 0.4484 0.4821 0.5039 -0.0101 0.0455  0.0707  539 ALA B O   
1414 C CB  . ALA B 31  ? 0.4819 0.4976 0.5300 -0.0119 0.0422  0.0612  539 ALA B CB  
1415 N N   . GLU B 32  ? 0.5522 0.5810 0.6128 -0.0126 0.0402  0.0711  540 GLU B N   
1416 C CA  . GLU B 32  ? 0.6505 0.6854 0.7134 -0.0115 0.0413  0.0743  540 GLU B CA  
1417 C C   . GLU B 32  ? 0.6457 0.6890 0.7156 -0.0120 0.0413  0.0805  540 GLU B C   
1418 O O   . GLU B 32  ? 0.6648 0.7145 0.7366 -0.0106 0.0429  0.0836  540 GLU B O   
1419 C CB  . GLU B 32  ? 0.5457 0.5777 0.6104 -0.0122 0.0385  0.0742  540 GLU B CB  
1420 C CG  . GLU B 32  ? 0.7366 0.7600 0.7955 -0.0122 0.0375  0.0687  540 GLU B CG  
1421 C CD  . GLU B 32  ? 0.7984 0.8162 0.8588 -0.0143 0.0341  0.0674  540 GLU B CD  
1422 O OE1 . GLU B 32  ? 0.8828 0.8973 0.9455 -0.0155 0.0305  0.0673  540 GLU B OE1 
1423 O OE2 . GLU B 32  ? 0.7620 0.7788 0.8214 -0.0146 0.0348  0.0663  540 GLU B OE2 
1424 N N   . GLY B 33  ? 0.4655 0.5090 0.5397 -0.0141 0.0394  0.0824  541 GLY B N   
1425 C CA  . GLY B 33  ? 0.4298 0.4812 0.5121 -0.0151 0.0385  0.0888  541 GLY B CA  
1426 C C   . GLY B 33  ? 0.4699 0.5265 0.5525 -0.0147 0.0408  0.0908  541 GLY B C   
1427 O O   . GLY B 33  ? 0.4614 0.5234 0.5511 -0.0162 0.0395  0.0960  541 GLY B O   
1428 N N   . ILE B 34  ? 0.4408 0.4956 0.5158 -0.0127 0.0441  0.0869  542 ILE B N   
1429 C CA  . ILE B 34  ? 0.4156 0.4744 0.4898 -0.0121 0.0462  0.0881  542 ILE B CA  
1430 C C   . ILE B 34  ? 0.4309 0.4975 0.5028 -0.0090 0.0500  0.0902  542 ILE B C   
1431 O O   . ILE B 34  ? 0.4703 0.5405 0.5399 -0.0078 0.0522  0.0908  542 ILE B O   
1432 C CB  . ILE B 34  ? 0.4185 0.4701 0.4858 -0.0119 0.0472  0.0826  542 ILE B CB  
1433 C CG1 . ILE B 34  ? 0.4548 0.5028 0.5140 -0.0093 0.0495  0.0778  542 ILE B CG1 
1434 C CG2 . ILE B 34  ? 0.4025 0.4465 0.4714 -0.0146 0.0437  0.0803  542 ILE B CG2 
1435 C CD1 . ILE B 34  ? 0.5430 0.5843 0.5957 -0.0089 0.0505  0.0727  542 ILE B CD1 
1436 N N   . TYR B 35  ? 0.4370 0.5060 0.5090 -0.0075 0.0506  0.0910  543 TYR B N   
1437 C CA  . TYR B 35  ? 0.4956 0.5713 0.5646 -0.0039 0.0543  0.0921  543 TYR B CA  
1438 C C   . TYR B 35  ? 0.5299 0.6161 0.6061 -0.0036 0.0547  0.0993  543 TYR B C   
1439 O O   . TYR B 35  ? 0.4651 0.5529 0.5489 -0.0059 0.0519  0.1032  543 TYR B O   
1440 C CB  . TYR B 35  ? 0.4631 0.5355 0.5273 -0.0019 0.0553  0.0884  543 TYR B CB  
1441 C CG  . TYR B 35  ? 0.4672 0.5297 0.5245 -0.0020 0.0549  0.0818  543 TYR B CG  
1442 C CD1 . TYR B 35  ? 0.4600 0.5155 0.5181 -0.0042 0.0521  0.0795  543 TYR B CD1 
1443 C CD2 . TYR B 35  ? 0.5344 0.5948 0.5847 0.0001  0.0572  0.0780  543 TYR B CD2 
1444 C CE1 . TYR B 35  ? 0.4584 0.5057 0.5105 -0.0042 0.0520  0.0739  543 TYR B CE1 
1445 C CE2 . TYR B 35  ? 0.5105 0.5623 0.5553 -0.0001 0.0568  0.0724  543 TYR B CE2 
1446 C CZ  . TYR B 35  ? 0.4272 0.4729 0.4730 -0.0022 0.0543  0.0706  543 TYR B CZ  
1447 O OH  . TYR B 35  ? 0.4715 0.5094 0.5122 -0.0023 0.0540  0.0657  543 TYR B OH  
1448 N N   . THR B 36  ? 0.5284 0.6220 0.6024 -0.0006 0.0580  0.1011  544 THR B N   
1449 C CA  . THR B 36  ? 0.5824 0.6869 0.6620 0.0007  0.0592  0.1078  544 THR B CA  
1450 C C   . THR B 36  ? 0.5693 0.6769 0.6439 0.0050  0.0625  0.1063  544 THR B C   
1451 O O   . THR B 36  ? 0.5328 0.6362 0.5991 0.0074  0.0643  0.1008  544 THR B O   
1452 C CB  . THR B 36  ? 0.5807 0.6934 0.6629 0.0010  0.0606  0.1124  544 THR B CB  
1453 O OG1 . THR B 36  ? 0.7166 0.8405 0.8040 0.0028  0.0622  0.1190  544 THR B OG1 
1454 C CG2 . THR B 36  ? 0.5652 0.6767 0.6385 0.0038  0.0635  0.1081  544 THR B CG2 
1455 N N   . GLU B 37  ? 0.6511 0.7662 0.7314 0.0058  0.0628  0.1115  545 GLU B N   
1456 C CA  . GLU B 37  ? 0.6759 0.7941 0.7526 0.0097  0.0655  0.1105  545 GLU B CA  
1457 C C   . GLU B 37  ? 0.7570 0.8877 0.8361 0.0130  0.0686  0.1164  545 GLU B C   
1458 O O   . GLU B 37  ? 0.7449 0.8829 0.8310 0.0116  0.0681  0.1227  545 GLU B O   
1459 C CB  . GLU B 37  ? 0.6164 0.7314 0.6970 0.0081  0.0633  0.1109  545 GLU B CB  
1460 C CG  . GLU B 37  ? 0.7009 0.8036 0.7779 0.0056  0.0606  0.1046  545 GLU B CG  
1461 C CD  . GLU B 37  ? 0.7013 0.8008 0.7821 0.0039  0.0581  0.1051  545 GLU B CD  
1462 O OE1 . GLU B 37  ? 0.7049 0.8098 0.7875 0.0060  0.0596  0.1077  545 GLU B OE1 
1463 O OE2 . GLU B 37  ? 0.6434 0.7352 0.7254 0.0007  0.0547  0.1031  545 GLU B OE2 
1464 N N   . GLY B 38  ? 0.6708 0.8043 0.7443 0.0175  0.0718  0.1143  546 GLY B N   
1465 C CA  . GLY B 38  ? 0.6774 0.8230 0.7521 0.0215  0.0751  0.1193  546 GLY B CA  
1466 C C   . GLY B 38  ? 0.6687 0.8157 0.7381 0.0262  0.0778  0.1164  546 GLY B C   
1467 O O   . GLY B 38  ? 0.6144 0.7526 0.6775 0.0268  0.0774  0.1097  546 GLY B O   
1468 N N   . LEU B 39  ? 0.6526 0.8108 0.7246 0.0297  0.0806  0.1217  547 LEU B N   
1469 C CA  . LEU B 39  ? 0.5973 0.7581 0.6647 0.0347  0.0833  0.1195  547 LEU B CA  
1470 C C   . LEU B 39  ? 0.6128 0.7822 0.6748 0.0404  0.0872  0.1201  547 LEU B C   
1471 O O   . LEU B 39  ? 0.6648 0.8456 0.7316 0.0418  0.0891  0.1270  547 LEU B O   
1472 C CB  . LEU B 39  ? 0.6373 0.8035 0.7128 0.0343  0.0831  0.1250  547 LEU B CB  
1473 C CG  . LEU B 39  ? 0.6681 0.8373 0.7402 0.0393  0.0858  0.1234  547 LEU B CG  
1474 C CD1 . LEU B 39  ? 0.5734 0.7309 0.6375 0.0398  0.0848  0.1144  547 LEU B CD1 
1475 C CD2 . LEU B 39  ? 0.6357 0.8108 0.7171 0.0383  0.0853  0.1298  547 LEU B CD2 
1476 N N   . MET B 40  ? 0.6920 0.8557 0.7440 0.0437  0.0883  0.1128  548 MET B N   
1477 C CA  . MET B 40  ? 0.7629 0.9327 0.8078 0.0498  0.0916  0.1114  548 MET B CA  
1478 C C   . MET B 40  ? 0.8457 1.0214 0.8900 0.0547  0.0941  0.1122  548 MET B C   
1479 O O   . MET B 40  ? 0.8670 1.0365 0.9112 0.0541  0.0929  0.1088  548 MET B O   
1480 C CB  . MET B 40  ? 0.8328 0.9925 0.8677 0.0509  0.0909  0.1029  548 MET B CB  
1481 C CG  . MET B 40  ? 0.8558 1.0085 0.8903 0.0464  0.0885  0.1012  548 MET B CG  
1482 S SD  . MET B 40  ? 0.9902 1.1465 1.0169 0.0502  0.0904  0.0997  548 MET B SD  
1483 C CE  . MET B 40  ? 0.8624 1.0150 0.8789 0.0567  0.0918  0.0923  548 MET B CE  
1484 N N   . HIS B 41  ? 1.1086 1.2961 1.1521 0.0599  0.0976  0.1161  549 HIS B N   
1485 C CA  . HIS B 41  ? 1.1079 1.3017 1.1533 0.0638  0.0997  0.1181  549 HIS B CA  
1486 C C   . HIS B 41  ? 1.1350 1.3410 1.1766 0.0709  0.1040  0.1206  549 HIS B C   
1487 O O   . HIS B 41  ? 1.1029 1.3150 1.1434 0.0718  0.1052  0.1235  549 HIS B O   
1488 C CB  . HIS B 41  ? 1.1426 1.3392 1.1997 0.0590  0.0981  0.1250  549 HIS B CB  
1489 C CG  . HIS B 41  ? 1.1589 1.3688 1.2241 0.0589  0.0997  0.1348  549 HIS B CG  
1490 N ND1 . HIS B 41  ? 1.1892 1.4028 1.2558 0.0571  0.0995  0.1381  549 HIS B ND1 
1491 C CD2 . HIS B 41  ? 1.0850 1.3035 1.1598 0.0584  0.1002  0.1425  549 HIS B CD2 
1492 C CE1 . HIS B 41  ? 1.2804 1.5059 1.3560 0.0568  0.1006  0.1474  549 HIS B CE1 
1493 N NE2 . HIS B 41  ? 1.2459 1.4745 1.3268 0.0574  0.1009  0.1505  549 HIS B NE2 
1494 N N   . ASN B 42  ? 1.0682 1.2774 1.1074 0.0761  0.1061  0.1192  550 ASN B N   
1495 C CA  . ASN B 42  ? 1.1099 1.3259 1.1411 0.0842  0.1096  0.1172  550 ASN B CA  
1496 C C   . ASN B 42  ? 1.1034 1.3167 1.1250 0.0867  0.1098  0.1123  550 ASN B C   
1497 O O   . ASN B 42  ? 1.1137 1.3368 1.1320 0.0915  0.1128  0.1149  550 ASN B O   
1498 C CB  . ASN B 42  ? 1.1029 1.3352 1.1398 0.0878  0.1134  0.1261  550 ASN B CB  
1499 C CG  . ASN B 42  ? 1.0807 1.3171 1.1171 0.0931  0.1156  0.1257  550 ASN B CG  
1500 O OD1 . ASN B 42  ? 1.0950 1.3219 1.1272 0.0937  0.1142  0.1187  550 ASN B OD1 
1501 N ND2 . ASN B 42  ? 1.0662 1.3170 1.1074 0.0968  0.1191  0.1334  550 ASN B ND2 
1502 N N   . GLN B 43  ? 0.8188 1.0187 0.8357 0.0835  0.1066  0.1052  551 GLN B N   
1503 C CA  . GLN B 43  ? 0.7649 0.9595 0.7716 0.0865  0.1062  0.0986  551 GLN B CA  
1504 C C   . GLN B 43  ? 0.6673 0.8501 0.6679 0.0877  0.1042  0.0898  551 GLN B C   
1505 O O   . GLN B 43  ? 0.5851 0.7566 0.5827 0.0843  0.1012  0.0846  551 GLN B O   
1506 C CB  . GLN B 43  ? 0.7588 0.9487 0.7663 0.0811  0.1041  0.0990  551 GLN B CB  
1507 C CG  . GLN B 43  ? 0.8252 1.0267 0.8369 0.0807  0.1061  0.1069  551 GLN B CG  
1508 C CD  . GLN B 43  ? 0.7986 0.9948 0.8130 0.0744  0.1035  0.1077  551 GLN B CD  
1509 O OE1 . GLN B 43  ? 0.8303 1.0246 0.8387 0.0753  0.1033  0.1051  551 GLN B OE1 
1510 N NE2 . GLN B 43  ? 0.6993 0.8930 0.7229 0.0681  0.1014  0.1113  551 GLN B NE2 
1511 N N   . ASP B 44  ? 0.8372 1.0230 0.8366 0.0926  0.1057  0.0886  552 ASP B N   
1512 C CA  . ASP B 44  ? 0.8950 1.0704 0.8901 0.0937  0.1036  0.0811  552 ASP B CA  
1513 C C   . ASP B 44  ? 0.9023 1.0694 0.8874 0.0963  0.1019  0.0732  552 ASP B C   
1514 O O   . ASP B 44  ? 0.8869 1.0421 0.8702 0.0931  0.0986  0.0678  552 ASP B O   
1515 C CB  . ASP B 44  ? 0.9102 1.0918 0.9054 0.0994  0.1059  0.0814  552 ASP B CB  
1516 C CG  . ASP B 44  ? 0.9432 1.1291 0.9487 0.0959  0.1064  0.0876  552 ASP B CG  
1517 O OD1 . ASP B 44  ? 0.9492 1.1364 0.9620 0.0900  0.1056  0.0930  552 ASP B OD1 
1518 O OD2 . ASP B 44  ? 0.9377 1.1256 0.9441 0.0992  0.1074  0.0870  552 ASP B OD2 
1519 N N   . GLY B 45  ? 0.7913 0.9649 0.7700 0.1021  0.1040  0.0729  553 GLY B N   
1520 C CA  . GLY B 45  ? 0.7612 0.9277 0.7300 0.1053  0.1023  0.0656  553 GLY B CA  
1521 C C   . GLY B 45  ? 0.7892 0.9464 0.7574 0.0995  0.0993  0.0637  553 GLY B C   
1522 O O   . GLY B 45  ? 0.7959 0.9425 0.7583 0.0996  0.0964  0.0569  553 GLY B O   
1523 N N   . LEU B 46  ? 0.7093 0.8705 0.6838 0.0943  0.0998  0.0698  554 LEU B N   
1524 C CA  . LEU B 46  ? 0.7131 0.8662 0.6884 0.0883  0.0971  0.0687  554 LEU B CA  
1525 C C   . LEU B 46  ? 0.7273 0.8694 0.7064 0.0828  0.0941  0.0660  554 LEU B C   
1526 O O   . LEU B 46  ? 0.6726 0.8039 0.6474 0.0817  0.0913  0.0600  554 LEU B O   
1527 C CB  . LEU B 46  ? 0.7208 0.8818 0.7023 0.0845  0.0985  0.0764  554 LEU B CB  
1528 C CG  . LEU B 46  ? 0.7680 0.9213 0.7524 0.0775  0.0958  0.0764  554 LEU B CG  
1529 C CD1 . LEU B 46  ? 0.8606 1.0061 0.8365 0.0787  0.0940  0.0704  554 LEU B CD1 
1530 C CD2 . LEU B 46  ? 0.7944 0.9564 0.7863 0.0739  0.0970  0.0845  554 LEU B CD2 
1531 N N   . ILE B 47  ? 0.7527 0.8980 0.7401 0.0795  0.0946  0.0707  555 ILE B N   
1532 C CA  . ILE B 47  ? 0.7154 0.8517 0.7072 0.0741  0.0920  0.0690  555 ILE B CA  
1533 C C   . ILE B 47  ? 0.7004 0.8277 0.6872 0.0763  0.0901  0.0618  555 ILE B C   
1534 O O   . ILE B 47  ? 0.6847 0.8016 0.6704 0.0728  0.0872  0.0578  555 ILE B O   
1535 C CB  . ILE B 47  ? 0.6683 0.8104 0.6691 0.0715  0.0929  0.0752  555 ILE B CB  
1536 C CG1 . ILE B 47  ? 0.6778 0.8239 0.6853 0.0664  0.0928  0.0814  555 ILE B CG1 
1537 C CG2 . ILE B 47  ? 0.6975 0.8310 0.7010 0.0682  0.0905  0.0723  555 ILE B CG2 
1538 C CD1 . ILE B 47  ? 0.7640 0.9209 0.7798 0.0660  0.0947  0.0893  555 ILE B CD1 
1539 N N   . CYS B 48  ? 0.6796 0.8110 0.6636 0.0822  0.0916  0.0603  556 CYS B N   
1540 C CA  . CYS B 48  ? 0.7211 0.8443 0.7005 0.0847  0.0896  0.0535  556 CYS B CA  
1541 C C   . CYS B 48  ? 0.7138 0.8297 0.6851 0.0866  0.0876  0.0475  556 CYS B C   
1542 O O   . CYS B 48  ? 0.7045 0.8109 0.6730 0.0865  0.0847  0.0418  556 CYS B O   
1543 C CB  . CYS B 48  ? 0.7436 0.8734 0.7217 0.0911  0.0917  0.0532  556 CYS B CB  
1544 S SG  . CYS B 48  ? 0.9487 1.0842 0.9363 0.0889  0.0933  0.0589  556 CYS B SG  
1545 N N   . GLY B 49  ? 0.6281 0.7486 0.5958 0.0884  0.0888  0.0489  557 GLY B N   
1546 C CA  . GLY B 49  ? 0.6356 0.7493 0.5959 0.0899  0.0867  0.0437  557 GLY B CA  
1547 C C   . GLY B 49  ? 0.6421 0.7465 0.6047 0.0831  0.0839  0.0428  557 GLY B C   
1548 O O   . GLY B 49  ? 0.5661 0.6611 0.5244 0.0830  0.0810  0.0374  557 GLY B O   
1549 N N   . LEU B 50  ? 0.6654 0.7725 0.6351 0.0776  0.0847  0.0482  558 LEU B N   
1550 C CA  . LEU B 50  ? 0.6586 0.7577 0.6315 0.0710  0.0823  0.0479  558 LEU B CA  
1551 C C   . LEU B 50  ? 0.6291 0.7187 0.6029 0.0689  0.0797  0.0438  558 LEU B C   
1552 O O   . LEU B 50  ? 0.6033 0.6838 0.5749 0.0667  0.0771  0.0401  558 LEU B O   
1553 C CB  . LEU B 50  ? 0.6620 0.7665 0.6428 0.0660  0.0836  0.0546  558 LEU B CB  
1554 C CG  . LEU B 50  ? 0.7853 0.8962 0.7667 0.0653  0.0850  0.0588  558 LEU B CG  
1555 C CD1 . LEU B 50  ? 0.7656 0.8808 0.7558 0.0600  0.0854  0.0653  558 LEU B CD1 
1556 C CD2 . LEU B 50  ? 0.8338 0.9371 0.8106 0.0637  0.0829  0.0552  558 LEU B CD2 
1557 N N   . ARG B 51  ? 0.5527 0.6449 0.5300 0.0696  0.0805  0.0449  559 ARG B N   
1558 C CA  . ARG B 51  ? 0.5580 0.6422 0.5365 0.0680  0.0782  0.0415  559 ARG B CA  
1559 C C   . ARG B 51  ? 0.5801 0.6573 0.5519 0.0716  0.0759  0.0350  559 ARG B C   
1560 O O   . ARG B 51  ? 0.5884 0.6564 0.5599 0.0689  0.0731  0.0317  559 ARG B O   
1561 C CB  . ARG B 51  ? 0.4681 0.5572 0.4508 0.0691  0.0796  0.0437  559 ARG B CB  
1562 C CG  . ARG B 51  ? 0.4441 0.5401 0.4341 0.0655  0.0813  0.0504  559 ARG B CG  
1563 C CD  . ARG B 51  ? 0.4159 0.5137 0.4111 0.0650  0.0817  0.0522  559 ARG B CD  
1564 N NE  . ARG B 51  ? 0.4793 0.5832 0.4818 0.0614  0.0828  0.0588  559 ARG B NE  
1565 C CZ  . ARG B 51  ? 0.5168 0.6164 0.5239 0.0554  0.0811  0.0605  559 ARG B CZ  
1566 N NH1 . ARG B 51  ? 0.4422 0.5476 0.4561 0.0527  0.0818  0.0665  559 ARG B NH1 
1567 N NH2 . ARG B 51  ? 0.5033 0.5930 0.5084 0.0524  0.0785  0.0563  559 ARG B NH2 
1568 N N   . GLN B 52  ? 0.6041 0.6855 0.5705 0.0777  0.0770  0.0333  560 GLN B N   
1569 C CA  . GLN B 52  ? 0.6133 0.6882 0.5731 0.0818  0.0745  0.0269  560 GLN B CA  
1570 C C   . GLN B 52  ? 0.5916 0.6591 0.5482 0.0794  0.0720  0.0246  560 GLN B C   
1571 O O   . GLN B 52  ? 0.5773 0.6357 0.5318 0.0791  0.0687  0.0201  560 GLN B O   
1572 C CB  . GLN B 52  ? 0.5959 0.6776 0.5502 0.0894  0.0763  0.0258  560 GLN B CB  
1573 C CG  . GLN B 52  ? 0.6449 0.7200 0.5920 0.0943  0.0733  0.0190  560 GLN B CG  
1574 C CD  . GLN B 52  ? 0.7826 0.8509 0.7312 0.0945  0.0706  0.0151  560 GLN B CD  
1575 O OE1 . GLN B 52  ? 0.9195 0.9901 0.8734 0.0929  0.0717  0.0174  560 GLN B OE1 
1576 N NE2 . GLN B 52  ? 0.7586 0.8184 0.7027 0.0966  0.0668  0.0094  560 GLN B NE2 
1577 N N   . LEU B 53  ? 0.5227 0.5942 0.4793 0.0777  0.0736  0.0279  561 LEU B N   
1578 C CA  . LEU B 53  ? 0.5628 0.6280 0.5169 0.0752  0.0715  0.0264  561 LEU B CA  
1579 C C   . LEU B 53  ? 0.5379 0.5946 0.4963 0.0690  0.0692  0.0258  561 LEU B C   
1580 O O   . LEU B 53  ? 0.5030 0.5512 0.4587 0.0685  0.0662  0.0220  561 LEU B O   
1581 C CB  . LEU B 53  ? 0.5098 0.5819 0.4645 0.0740  0.0738  0.0309  561 LEU B CB  
1582 C CG  . LEU B 53  ? 0.4654 0.5316 0.4187 0.0706  0.0719  0.0301  561 LEU B CG  
1583 C CD1 . LEU B 53  ? 0.5839 0.6447 0.5296 0.0747  0.0695  0.0248  561 LEU B CD1 
1584 C CD2 . LEU B 53  ? 0.5663 0.6397 0.5217 0.0686  0.0743  0.0353  561 LEU B CD2 
1585 N N   . ALA B 54  ? 0.4837 0.5427 0.4485 0.0646  0.0705  0.0298  562 ALA B N   
1586 C CA  . ALA B 54  ? 0.5189 0.5707 0.4876 0.0591  0.0686  0.0296  562 ALA B CA  
1587 C C   . ALA B 54  ? 0.5201 0.5646 0.4875 0.0603  0.0659  0.0251  562 ALA B C   
1588 O O   . ALA B 54  ? 0.5097 0.5463 0.4768 0.0579  0.0634  0.0227  562 ALA B O   
1589 C CB  . ALA B 54  ? 0.4784 0.5345 0.4538 0.0553  0.0702  0.0342  562 ALA B CB  
1590 N N   . ASN B 55  ? 0.5691 0.6166 0.5357 0.0644  0.0665  0.0239  563 ASN B N   
1591 C CA  . ASN B 55  ? 0.5616 0.6028 0.5270 0.0662  0.0638  0.0195  563 ASN B CA  
1592 C C   . ASN B 55  ? 0.5985 0.6332 0.5586 0.0687  0.0608  0.0149  563 ASN B C   
1593 O O   . ASN B 55  ? 0.5738 0.6009 0.5343 0.0671  0.0579  0.0124  563 ASN B O   
1594 C CB  . ASN B 55  ? 0.6252 0.6714 0.5909 0.0704  0.0650  0.0192  563 ASN B CB  
1595 C CG  . ASN B 55  ? 0.7429 0.7827 0.7073 0.0727  0.0619  0.0145  563 ASN B CG  
1596 O OD1 . ASN B 55  ? 0.7945 0.8308 0.7540 0.0766  0.0598  0.0104  563 ASN B OD1 
1597 N ND2 . ASN B 55  ? 0.8610 0.8993 0.8300 0.0704  0.0614  0.0151  563 ASN B ND2 
1598 N N   . GLU B 56  ? 0.6718 0.7097 0.6268 0.0727  0.0615  0.0141  564 GLU B N   
1599 C CA  . GLU B 56  ? 0.6892 0.7207 0.6387 0.0754  0.0583  0.0095  564 GLU B CA  
1600 C C   . GLU B 56  ? 0.6851 0.7106 0.6350 0.0709  0.0566  0.0099  564 GLU B C   
1601 O O   . GLU B 56  ? 0.7022 0.7203 0.6496 0.0716  0.0531  0.0064  564 GLU B O   
1602 C CB  . GLU B 56  ? 0.7255 0.7624 0.6688 0.0815  0.0595  0.0084  564 GLU B CB  
1603 C CG  . GLU B 56  ? 0.8307 0.8743 0.7728 0.0869  0.0614  0.0080  564 GLU B CG  
1604 C CD  . GLU B 56  ? 0.9730 1.0221 0.9083 0.0933  0.0626  0.0067  564 GLU B CD  
1605 O OE1 . GLU B 56  ? 0.9713 1.0176 0.9023 0.0937  0.0612  0.0053  564 GLU B OE1 
1606 O OE2 . GLU B 56  ? 0.9176 0.9738 0.8517 0.0981  0.0649  0.0071  564 GLU B OE2 
1607 N N   . THR B 57  ? 0.5101 0.5389 0.4635 0.0665  0.0589  0.0142  565 THR B N   
1608 C CA  . THR B 57  ? 0.5301 0.5538 0.4844 0.0620  0.0576  0.0149  565 THR B CA  
1609 C C   . THR B 57  ? 0.4675 0.4830 0.4252 0.0583  0.0550  0.0137  565 THR B C   
1610 O O   . THR B 57  ? 0.4692 0.4784 0.4263 0.0563  0.0527  0.0125  565 THR B O   
1611 C CB  . THR B 57  ? 0.5422 0.5717 0.5001 0.0582  0.0606  0.0199  565 THR B CB  
1612 O OG1 . THR B 57  ? 0.5609 0.5978 0.5156 0.0615  0.0628  0.0214  565 THR B OG1 
1613 C CG2 . THR B 57  ? 0.4831 0.5071 0.4426 0.0534  0.0593  0.0207  565 THR B CG2 
1614 N N   . THR B 58  ? 0.4901 0.5062 0.4514 0.0575  0.0553  0.0141  566 THR B N   
1615 C CA  . THR B 58  ? 0.4954 0.5058 0.4608 0.0533  0.0537  0.0141  566 THR B CA  
1616 C C   . THR B 58  ? 0.4689 0.4707 0.4328 0.0534  0.0498  0.0109  566 THR B C   
1617 O O   . THR B 58  ? 0.4281 0.4254 0.3942 0.0495  0.0488  0.0117  566 THR B O   
1618 C CB  . THR B 58  ? 0.4859 0.4981 0.4545 0.0535  0.0542  0.0144  566 THR B CB  
1619 O OG1 . THR B 58  ? 0.4361 0.4563 0.4066 0.0534  0.0576  0.0178  566 THR B OG1 
1620 C CG2 . THR B 58  ? 0.4316 0.4386 0.4043 0.0489  0.0529  0.0151  566 THR B CG2 
1621 N N   . GLN B 59  ? 0.5120 0.5116 0.4725 0.0579  0.0475  0.0073  567 GLN B N   
1622 C CA  . GLN B 59  ? 0.5590 0.5502 0.5188 0.0581  0.0432  0.0044  567 GLN B CA  
1623 C C   . GLN B 59  ? 0.5632 0.5509 0.5215 0.0560  0.0422  0.0048  567 GLN B C   
1624 O O   . GLN B 59  ? 0.5680 0.5500 0.5289 0.0528  0.0401  0.0051  567 GLN B O   
1625 C CB  . GLN B 59  ? 0.5447 0.5343 0.5007 0.0638  0.0406  0.0002  567 GLN B CB  
1626 C CG  . GLN B 59  ? 0.5994 0.5803 0.5552 0.0641  0.0355  -0.0027 567 GLN B CG  
1627 C CD  . GLN B 59  ? 0.7205 0.6994 0.6725 0.0700  0.0324  -0.0071 567 GLN B CD  
1628 O OE1 . GLN B 59  ? 0.7517 0.7359 0.7006 0.0742  0.0343  -0.0082 567 GLN B OE1 
1629 N NE2 . GLN B 59  ? 0.7800 0.7511 0.7325 0.0704  0.0274  -0.0097 567 GLN B NE2 
1630 N N   . ALA B 60  ? 0.5402 0.5317 0.4947 0.0579  0.0438  0.0052  568 ALA B N   
1631 C CA  . ALA B 60  ? 0.5335 0.5219 0.4865 0.0562  0.0428  0.0056  568 ALA B CA  
1632 C C   . ALA B 60  ? 0.5269 0.5154 0.4845 0.0504  0.0446  0.0093  568 ALA B C   
1633 O O   . ALA B 60  ? 0.5139 0.4969 0.4725 0.0477  0.0428  0.0095  568 ALA B O   
1634 C CB  . ALA B 60  ? 0.4965 0.4898 0.4444 0.0595  0.0443  0.0055  568 ALA B CB  
1635 N N   . LEU B 61  ? 0.4684 0.4629 0.4287 0.0486  0.0480  0.0122  569 LEU B N   
1636 C CA  . LEU B 61  ? 0.4609 0.4557 0.4254 0.0434  0.0497  0.0155  569 LEU B CA  
1637 C C   . LEU B 61  ? 0.4506 0.4394 0.4187 0.0404  0.0478  0.0152  569 LEU B C   
1638 O O   . LEU B 61  ? 0.4665 0.4517 0.4364 0.0370  0.0473  0.0164  569 LEU B O   
1639 C CB  . LEU B 61  ? 0.4226 0.4248 0.3895 0.0425  0.0531  0.0185  569 LEU B CB  
1640 C CG  . LEU B 61  ? 0.4439 0.4466 0.4153 0.0374  0.0546  0.0217  569 LEU B CG  
1641 C CD1 . LEU B 61  ? 0.4258 0.4277 0.3966 0.0355  0.0547  0.0230  569 LEU B CD1 
1642 C CD2 . LEU B 61  ? 0.4146 0.4244 0.3889 0.0368  0.0573  0.0246  569 LEU B CD2 
1643 N N   . GLN B 62  ? 0.4466 0.4347 0.4156 0.0419  0.0468  0.0138  570 GLN B N   
1644 C CA  . GLN B 62  ? 0.4612 0.4443 0.4333 0.0397  0.0450  0.0135  570 GLN B CA  
1645 C C   . GLN B 62  ? 0.5084 0.4845 0.4800 0.0394  0.0415  0.0121  570 GLN B C   
1646 O O   . GLN B 62  ? 0.4795 0.4520 0.4540 0.0361  0.0408  0.0134  570 GLN B O   
1647 C CB  . GLN B 62  ? 0.4909 0.4751 0.4637 0.0421  0.0443  0.0120  570 GLN B CB  
1648 C CG  . GLN B 62  ? 0.5397 0.5230 0.5167 0.0394  0.0443  0.0132  570 GLN B CG  
1649 C CD  . GLN B 62  ? 0.4847 0.4716 0.4642 0.0359  0.0474  0.0164  570 GLN B CD  
1650 O OE1 . GLN B 62  ? 0.4486 0.4341 0.4291 0.0328  0.0479  0.0180  570 GLN B OE1 
1651 N NE2 . GLN B 62  ? 0.4401 0.4315 0.4211 0.0362  0.0491  0.0173  570 GLN B NE2 
1652 N N   . LEU B 63  ? 0.4849 0.4591 0.4526 0.0430  0.0393  0.0095  571 LEU B N   
1653 C CA  . LEU B 63  ? 0.4555 0.4229 0.4227 0.0429  0.0357  0.0082  571 LEU B CA  
1654 C C   . LEU B 63  ? 0.4586 0.4251 0.4259 0.0400  0.0366  0.0103  571 LEU B C   
1655 O O   . LEU B 63  ? 0.4912 0.4525 0.4604 0.0379  0.0344  0.0108  571 LEU B O   
1656 C CB  . LEU B 63  ? 0.4437 0.4092 0.4064 0.0479  0.0328  0.0047  571 LEU B CB  
1657 C CG  . LEU B 63  ? 0.5643 0.5283 0.5273 0.0509  0.0304  0.0021  571 LEU B CG  
1658 C CD1 . LEU B 63  ? 0.4914 0.4540 0.4493 0.0563  0.0277  -0.0018 571 LEU B CD1 
1659 C CD2 . LEU B 63  ? 0.4829 0.4411 0.4508 0.0484  0.0272  0.0026  571 LEU B CD2 
1660 N N   . PHE B 64  ? 0.4562 0.4281 0.4218 0.0399  0.0396  0.0116  572 PHE B N   
1661 C CA  . PHE B 64  ? 0.4735 0.4452 0.4398 0.0367  0.0408  0.0139  572 PHE B CA  
1662 C C   . PHE B 64  ? 0.5075 0.4778 0.4787 0.0322  0.0418  0.0164  572 PHE B C   
1663 O O   . PHE B 64  ? 0.4397 0.4059 0.4126 0.0298  0.0407  0.0173  572 PHE B O   
1664 C CB  . PHE B 64  ? 0.4965 0.4750 0.4609 0.0372  0.0441  0.0154  572 PHE B CB  
1665 C CG  . PHE B 64  ? 0.4862 0.4651 0.4523 0.0337  0.0454  0.0180  572 PHE B CG  
1666 C CD1 . PHE B 64  ? 0.5255 0.5021 0.4889 0.0341  0.0441  0.0176  572 PHE B CD1 
1667 C CD2 . PHE B 64  ? 0.5127 0.4941 0.4828 0.0300  0.0478  0.0208  572 PHE B CD2 
1668 C CE1 . PHE B 64  ? 0.5418 0.5188 0.5071 0.0308  0.0452  0.0201  572 PHE B CE1 
1669 C CE2 . PHE B 64  ? 0.4367 0.4182 0.4084 0.0268  0.0489  0.0231  572 PHE B CE2 
1670 C CZ  . PHE B 64  ? 0.5349 0.5144 0.5044 0.0272  0.0477  0.0228  572 PHE B CZ  
1671 N N   . LEU B 65  ? 0.5032 0.4772 0.4767 0.0314  0.0439  0.0174  573 LEU B N   
1672 C CA  . LEU B 65  ? 0.4811 0.4545 0.4586 0.0275  0.0451  0.0195  573 LEU B CA  
1673 C C   . LEU B 65  ? 0.4961 0.4637 0.4757 0.0266  0.0424  0.0191  573 LEU B C   
1674 O O   . LEU B 65  ? 0.4732 0.4387 0.4554 0.0236  0.0427  0.0208  573 LEU B O   
1675 C CB  . LEU B 65  ? 0.4747 0.4529 0.4537 0.0271  0.0474  0.0205  573 LEU B CB  
1676 C CG  . LEU B 65  ? 0.4398 0.4242 0.4183 0.0271  0.0502  0.0221  573 LEU B CG  
1677 C CD1 . LEU B 65  ? 0.4077 0.3969 0.3880 0.0269  0.0521  0.0232  573 LEU B CD1 
1678 C CD2 . LEU B 65  ? 0.4386 0.4228 0.4186 0.0238  0.0512  0.0243  573 LEU B CD2 
1679 N N   . ARG B 66  ? 0.4904 0.4556 0.4693 0.0292  0.0398  0.0169  574 ARG B N   
1680 C CA  . ARG B 66  ? 0.4891 0.4489 0.4705 0.0285  0.0369  0.0169  574 ARG B CA  
1681 C C   . ARG B 66  ? 0.4982 0.4536 0.4800 0.0271  0.0351  0.0177  574 ARG B C   
1682 O O   . ARG B 66  ? 0.5252 0.4778 0.5103 0.0248  0.0344  0.0194  574 ARG B O   
1683 C CB  . ARG B 66  ? 0.5027 0.4605 0.4833 0.0318  0.0338  0.0143  574 ARG B CB  
1684 C CG  . ARG B 66  ? 0.5710 0.5228 0.5543 0.0314  0.0298  0.0143  574 ARG B CG  
1685 C CD  . ARG B 66  ? 0.5117 0.4612 0.4944 0.0349  0.0262  0.0115  574 ARG B CD  
1686 N NE  . ARG B 66  ? 0.5968 0.5499 0.5804 0.0356  0.0276  0.0111  574 ARG B NE  
1687 C CZ  . ARG B 66  ? 0.6069 0.5596 0.5895 0.0390  0.0255  0.0085  574 ARG B CZ  
1688 N NH1 . ARG B 66  ? 0.6583 0.6071 0.6390 0.0420  0.0217  0.0059  574 ARG B NH1 
1689 N NH2 . ARG B 66  ? 0.5894 0.5457 0.5733 0.0393  0.0271  0.0085  574 ARG B NH2 
1690 N N   . ALA B 67  ? 0.4223 0.3775 0.4008 0.0287  0.0346  0.0166  575 ALA B N   
1691 C CA  . ALA B 67  ? 0.5058 0.4565 0.4845 0.0278  0.0325  0.0171  575 ALA B CA  
1692 C C   . ALA B 67  ? 0.4655 0.4174 0.4454 0.0245  0.0351  0.0197  575 ALA B C   
1693 O O   . ALA B 67  ? 0.4577 0.4059 0.4391 0.0229  0.0337  0.0208  575 ALA B O   
1694 C CB  . ALA B 67  ? 0.4546 0.4038 0.4289 0.0312  0.0303  0.0146  575 ALA B CB  
1695 N N   . THR B 68  ? 0.4674 0.4245 0.4471 0.0234  0.0387  0.0207  576 THR B N   
1696 C CA  . THR B 68  ? 0.4348 0.3929 0.4161 0.0203  0.0408  0.0230  576 THR B CA  
1697 C C   . THR B 68  ? 0.4509 0.4078 0.4360 0.0175  0.0416  0.0248  576 THR B C   
1698 O O   . THR B 68  ? 0.5017 0.4591 0.4881 0.0178  0.0416  0.0246  576 THR B O   
1699 C CB  . THR B 68  ? 0.4562 0.4204 0.4364 0.0199  0.0440  0.0238  576 THR B CB  
1700 O OG1 . THR B 68  ? 0.3837 0.3479 0.3654 0.0172  0.0453  0.0258  576 THR B OG1 
1701 C CG2 . THR B 68  ? 0.4489 0.4167 0.4308 0.0192  0.0461  0.0244  576 THR B CG2 
1702 N N   . THR B 69  ? 0.4872 0.4429 0.4742 0.0150  0.0424  0.0267  577 THR B N   
1703 C CA  . THR B 69  ? 0.5009 0.4556 0.4912 0.0127  0.0432  0.0285  577 THR B CA  
1704 C C   . THR B 69  ? 0.5208 0.4790 0.5120 0.0106  0.0463  0.0297  577 THR B C   
1705 O O   . THR B 69  ? 0.4876 0.4457 0.4810 0.0090  0.0473  0.0309  577 THR B O   
1706 C CB  . THR B 69  ? 0.5068 0.4570 0.4992 0.0115  0.0415  0.0298  577 THR B CB  
1707 O OG1 . THR B 69  ? 0.6798 0.6294 0.6753 0.0098  0.0423  0.0316  577 THR B OG1 
1708 C CG2 . THR B 69  ? 0.4497 0.3997 0.4416 0.0102  0.0422  0.0307  577 THR B CG2 
1709 N N   . GLU B 70  ? 0.4666 0.4282 0.4562 0.0108  0.0476  0.0295  578 GLU B N   
1710 C CA  . GLU B 70  ? 0.4936 0.4585 0.4847 0.0088  0.0500  0.0308  578 GLU B CA  
1711 C C   . GLU B 70  ? 0.4398 0.4080 0.4308 0.0095  0.0510  0.0303  578 GLU B C   
1712 O O   . GLU B 70  ? 0.4410 0.4105 0.4303 0.0118  0.0504  0.0290  578 GLU B O   
1713 C CB  . GLU B 70  ? 0.4939 0.4613 0.4845 0.0081  0.0510  0.0316  578 GLU B CB  
1714 C CG  . GLU B 70  ? 0.5131 0.4849 0.5016 0.0099  0.0515  0.0311  578 GLU B CG  
1715 C CD  . GLU B 70  ? 0.5727 0.5467 0.5612 0.0089  0.0523  0.0325  578 GLU B CD  
1716 O OE1 . GLU B 70  ? 0.4812 0.4553 0.4724 0.0063  0.0532  0.0341  578 GLU B OE1 
1717 O OE2 . GLU B 70  ? 0.5146 0.4901 0.5004 0.0109  0.0518  0.0319  578 GLU B OE2 
1718 N N   . LEU B 71  ? 0.3781 0.3475 0.3711 0.0077  0.0524  0.0313  579 LEU B N   
1719 C CA  . LEU B 71  ? 0.3929 0.3644 0.3863 0.0078  0.0530  0.0310  579 LEU B CA  
1720 C C   . LEU B 71  ? 0.4134 0.3897 0.4062 0.0086  0.0540  0.0311  579 LEU B C   
1721 O O   . LEU B 71  ? 0.4199 0.3981 0.4122 0.0100  0.0540  0.0305  579 LEU B O   
1722 C CB  . LEU B 71  ? 0.3834 0.3543 0.3788 0.0057  0.0539  0.0320  579 LEU B CB  
1723 C CG  . LEU B 71  ? 0.4641 0.4309 0.4603 0.0050  0.0534  0.0324  579 LEU B CG  
1724 C CD1 . LEU B 71  ? 0.3834 0.3498 0.3810 0.0034  0.0544  0.0332  579 LEU B CD1 
1725 C CD2 . LEU B 71  ? 0.4220 0.3870 0.4178 0.0064  0.0520  0.0318  579 LEU B CD2 
1726 N N   . ARG B 72  ? 0.3438 0.3223 0.3372 0.0077  0.0548  0.0323  580 ARG B N   
1727 C CA  . ARG B 72  ? 0.4107 0.3944 0.4042 0.0083  0.0558  0.0331  580 ARG B CA  
1728 C C   . ARG B 72  ? 0.4436 0.4288 0.4355 0.0093  0.0558  0.0334  580 ARG B C   
1729 O O   . ARG B 72  ? 0.4692 0.4530 0.4618 0.0078  0.0557  0.0342  580 ARG B O   
1730 C CB  . ARG B 72  ? 0.4097 0.3955 0.4061 0.0059  0.0567  0.0348  580 ARG B CB  
1731 C CG  . ARG B 72  ? 0.4065 0.3901 0.4041 0.0048  0.0565  0.0344  580 ARG B CG  
1732 C CD  . ARG B 72  ? 0.4178 0.4033 0.4183 0.0027  0.0568  0.0359  580 ARG B CD  
1733 N NE  . ARG B 72  ? 0.4235 0.4061 0.4245 0.0017  0.0565  0.0352  580 ARG B NE  
1734 C CZ  . ARG B 72  ? 0.4491 0.4326 0.4520 0.0004  0.0562  0.0358  580 ARG B CZ  
1735 N NH1 . ARG B 72  ? 0.3915 0.3787 0.3967 -0.0003 0.0562  0.0374  580 ARG B NH1 
1736 N NH2 . ARG B 72  ? 0.4570 0.4377 0.4596 -0.0001 0.0559  0.0350  580 ARG B NH2 
1737 N N   . THR B 73  ? 0.3825 0.3704 0.3720 0.0120  0.0558  0.0326  581 THR B N   
1738 C CA  . THR B 73  ? 0.4515 0.4410 0.4387 0.0135  0.0558  0.0326  581 THR B CA  
1739 C C   . THR B 73  ? 0.4402 0.4363 0.4287 0.0132  0.0574  0.0350  581 THR B C   
1740 O O   . THR B 73  ? 0.4097 0.4103 0.3985 0.0145  0.0583  0.0355  581 THR B O   
1741 C CB  . THR B 73  ? 0.4572 0.4460 0.4406 0.0172  0.0547  0.0303  581 THR B CB  
1742 O OG1 . THR B 73  ? 0.4412 0.4238 0.4241 0.0173  0.0527  0.0285  581 THR B OG1 
1743 C CG2 . THR B 73  ? 0.4858 0.4769 0.4663 0.0191  0.0547  0.0303  581 THR B CG2 
1744 N N   . PHE B 74  ? 0.4780 0.4748 0.4677 0.0115  0.0576  0.0366  582 PHE B N   
1745 C CA  . PHE B 74  ? 0.4592 0.4624 0.4508 0.0109  0.0589  0.0394  582 PHE B CA  
1746 C C   . PHE B 74  ? 0.5048 0.5105 0.4936 0.0126  0.0591  0.0399  582 PHE B C   
1747 O O   . PHE B 74  ? 0.5015 0.5134 0.4917 0.0126  0.0602  0.0425  582 PHE B O   
1748 C CB  . PHE B 74  ? 0.4306 0.4332 0.4267 0.0071  0.0590  0.0415  582 PHE B CB  
1749 C CG  . PHE B 74  ? 0.4408 0.4428 0.4398 0.0056  0.0590  0.0417  582 PHE B CG  
1750 C CD1 . PHE B 74  ? 0.3940 0.3903 0.3929 0.0046  0.0582  0.0399  582 PHE B CD1 
1751 C CD2 . PHE B 74  ? 0.4359 0.4433 0.4379 0.0051  0.0597  0.0440  582 PHE B CD2 
1752 C CE1 . PHE B 74  ? 0.4037 0.3995 0.4048 0.0034  0.0582  0.0400  582 PHE B CE1 
1753 C CE2 . PHE B 74  ? 0.4345 0.4411 0.4391 0.0038  0.0594  0.0441  582 PHE B CE2 
1754 C CZ  . PHE B 74  ? 0.4106 0.4113 0.4145 0.0030  0.0586  0.0419  582 PHE B CZ  
1755 N N   . SER B 75  ? 0.4972 0.4983 0.4824 0.0141  0.0577  0.0375  583 SER B N   
1756 C CA  . SER B 75  ? 0.4922 0.4941 0.4749 0.0150  0.0574  0.0379  583 SER B CA  
1757 C C   . SER B 75  ? 0.5065 0.5106 0.4840 0.0194  0.0572  0.0361  583 SER B C   
1758 O O   . SER B 75  ? 0.5265 0.5301 0.5009 0.0207  0.0564  0.0357  583 SER B O   
1759 C CB  . SER B 75  ? 0.4887 0.4835 0.4711 0.0134  0.0556  0.0367  583 SER B CB  
1760 O OG  . SER B 75  ? 0.5151 0.5046 0.4952 0.0151  0.0540  0.0338  583 SER B OG  
1761 N N   . ILE B 76  ? 0.4684 0.4748 0.4448 0.0219  0.0577  0.0350  584 ILE B N   
1762 C CA  . ILE B 76  ? 0.5170 0.5250 0.4883 0.0266  0.0574  0.0329  584 ILE B CA  
1763 C C   . ILE B 76  ? 0.5656 0.5810 0.5349 0.0285  0.0589  0.0349  584 ILE B C   
1764 O O   . ILE B 76  ? 0.5278 0.5430 0.4923 0.0316  0.0581  0.0333  584 ILE B O   
1765 C CB  . ILE B 76  ? 0.4649 0.4742 0.4360 0.0288  0.0578  0.0315  584 ILE B CB  
1766 C CG1 . ILE B 76  ? 0.5078 0.5095 0.4792 0.0281  0.0557  0.0288  584 ILE B CG1 
1767 C CG2 . ILE B 76  ? 0.4902 0.5032 0.4564 0.0338  0.0580  0.0299  584 ILE B CG2 
1768 C CD1 . ILE B 76  ? 0.4539 0.4566 0.4261 0.0295  0.0560  0.0278  584 ILE B CD1 
1769 N N   . LEU B 77  ? 0.5007 0.5227 0.4741 0.0268  0.0610  0.0386  585 LEU B N   
1770 C CA  . LEU B 77  ? 0.5414 0.5716 0.5140 0.0283  0.0627  0.0414  585 LEU B CA  
1771 C C   . LEU B 77  ? 0.5777 0.6068 0.5496 0.0268  0.0620  0.0425  585 LEU B C   
1772 O O   . LEU B 77  ? 0.5685 0.6014 0.5365 0.0296  0.0624  0.0428  585 LEU B O   
1773 C CB  . LEU B 77  ? 0.5705 0.6078 0.5488 0.0264  0.0647  0.0456  585 LEU B CB  
1774 C CG  . LEU B 77  ? 0.5522 0.5930 0.5310 0.0287  0.0658  0.0455  585 LEU B CG  
1775 C CD1 . LEU B 77  ? 0.5231 0.5702 0.5083 0.0262  0.0673  0.0500  585 LEU B CD1 
1776 C CD2 . LEU B 77  ? 0.5600 0.6053 0.5333 0.0342  0.0667  0.0442  585 LEU B CD2 
1777 N N   . ASN B 78  ? 0.5285 0.5526 0.5041 0.0225  0.0610  0.0431  586 ASN B N   
1778 C CA  . ASN B 78  ? 0.5337 0.5560 0.5089 0.0208  0.0601  0.0439  586 ASN B CA  
1779 C C   . ASN B 78  ? 0.5755 0.5924 0.5445 0.0237  0.0581  0.0403  586 ASN B C   
1780 O O   . ASN B 78  ? 0.5834 0.6017 0.5495 0.0248  0.0578  0.0408  586 ASN B O   
1781 C CB  . ASN B 78  ? 0.4926 0.5100 0.4729 0.0160  0.0594  0.0449  586 ASN B CB  
1782 C CG  . ASN B 78  ? 0.5509 0.5739 0.5375 0.0129  0.0608  0.0490  586 ASN B CG  
1783 O OD1 . ASN B 78  ? 0.5683 0.5991 0.5557 0.0139  0.0622  0.0518  586 ASN B OD1 
1784 N ND2 . ASN B 78  ? 0.5968 0.6158 0.5879 0.0092  0.0602  0.0493  586 ASN B ND2 
1785 N N   . ARG B 79  ? 0.5384 0.5491 0.5055 0.0250  0.0566  0.0368  587 ARG B N   
1786 C CA  . ARG B 79  ? 0.5671 0.5722 0.5287 0.0279  0.0541  0.0333  587 ARG B CA  
1787 C C   . ARG B 79  ? 0.6247 0.6348 0.5805 0.0329  0.0546  0.0322  587 ARG B C   
1788 O O   . ARG B 79  ? 0.6271 0.6351 0.5781 0.0351  0.0528  0.0306  587 ARG B O   
1789 C CB  . ARG B 79  ? 0.5952 0.5937 0.5569 0.0282  0.0524  0.0302  587 ARG B CB  
1790 C CG  . ARG B 79  ? 0.6439 0.6350 0.6016 0.0302  0.0490  0.0269  587 ARG B CG  
1791 C CD  . ARG B 79  ? 0.7831 0.7667 0.7439 0.0278  0.0472  0.0258  587 ARG B CD  
1792 N NE  . ARG B 79  ? 0.7845 0.7609 0.7423 0.0295  0.0436  0.0231  587 ARG B NE  
1793 C CZ  . ARG B 79  ? 0.8565 0.8295 0.8122 0.0325  0.0414  0.0201  587 ARG B CZ  
1794 N NH1 . ARG B 79  ? 0.7222 0.6885 0.6757 0.0338  0.0376  0.0178  587 ARG B NH1 
1795 N NH2 . ARG B 79  ? 0.8813 0.8575 0.8374 0.0340  0.0427  0.0194  587 ARG B NH2 
1796 N N   . LYS B 80  ? 0.5462 0.5630 0.5023 0.0350  0.0568  0.0331  588 LYS B N   
1797 C CA  . LYS B 80  ? 0.6024 0.6250 0.5530 0.0402  0.0576  0.0324  588 LYS B CA  
1798 C C   . LYS B 80  ? 0.6058 0.6338 0.5552 0.0402  0.0586  0.0352  588 LYS B C   
1799 O O   . LYS B 80  ? 0.6118 0.6401 0.5551 0.0438  0.0576  0.0334  588 LYS B O   
1800 C CB  . LYS B 80  ? 0.5807 0.6104 0.5330 0.0420  0.0602  0.0337  588 LYS B CB  
1801 C CG  . LYS B 80  ? 0.5942 0.6194 0.5463 0.0434  0.0591  0.0304  588 LYS B CG  
1802 C CD  . LYS B 80  ? 0.6664 0.6871 0.6118 0.0482  0.0566  0.0257  588 LYS B CD  
1803 C CE  . LYS B 80  ? 0.6609 0.6799 0.6060 0.0505  0.0561  0.0230  588 LYS B CE  
1804 N NZ  . LYS B 80  ? 0.7837 0.7971 0.7229 0.0550  0.0529  0.0182  588 LYS B NZ  
1805 N N   . ALA B 81  ? 0.5356 0.5677 0.4909 0.0360  0.0603  0.0395  589 ALA B N   
1806 C CA  . ALA B 81  ? 0.5422 0.5799 0.4978 0.0351  0.0612  0.0430  589 ALA B CA  
1807 C C   . ALA B 81  ? 0.5648 0.5964 0.5167 0.0348  0.0588  0.0412  589 ALA B C   
1808 O O   . ALA B 81  ? 0.5505 0.5858 0.4983 0.0372  0.0589  0.0418  589 ALA B O   
1809 C CB  . ALA B 81  ? 0.5176 0.5586 0.4811 0.0300  0.0626  0.0476  589 ALA B CB  
1810 N N   . ILE B 82  ? 0.5521 0.5744 0.5056 0.0320  0.0565  0.0391  590 ILE B N   
1811 C CA  . ILE B 82  ? 0.5872 0.6028 0.5378 0.0316  0.0538  0.0374  590 ILE B CA  
1812 C C   . ILE B 82  ? 0.6192 0.6326 0.5618 0.0370  0.0518  0.0334  590 ILE B C   
1813 O O   . ILE B 82  ? 0.6373 0.6507 0.5756 0.0385  0.0507  0.0331  590 ILE B O   
1814 C CB  . ILE B 82  ? 0.5145 0.5209 0.4689 0.0278  0.0518  0.0361  590 ILE B CB  
1815 C CG1 . ILE B 82  ? 0.5193 0.5273 0.4812 0.0226  0.0534  0.0398  590 ILE B CG1 
1816 C CG2 . ILE B 82  ? 0.5047 0.5037 0.4560 0.0278  0.0486  0.0341  590 ILE B CG2 
1817 C CD1 . ILE B 82  ? 0.5073 0.5074 0.4731 0.0192  0.0520  0.0388  590 ILE B CD1 
1818 N N   . ASP B 83  ? 0.6637 0.6749 0.6042 0.0400  0.0512  0.0302  591 ASP B N   
1819 C CA  . ASP B 83  ? 0.6883 0.6966 0.6214 0.0455  0.0489  0.0258  591 ASP B CA  
1820 C C   . ASP B 83  ? 0.7288 0.7454 0.6564 0.0500  0.0505  0.0265  591 ASP B C   
1821 O O   . ASP B 83  ? 0.7055 0.7199 0.6265 0.0537  0.0483  0.0238  591 ASP B O   
1822 C CB  . ASP B 83  ? 0.6134 0.6191 0.5463 0.0477  0.0483  0.0228  591 ASP B CB  
1823 C CG  . ASP B 83  ? 0.7103 0.7058 0.6456 0.0453  0.0451  0.0206  591 ASP B CG  
1824 O OD1 . ASP B 83  ? 0.7398 0.7294 0.6744 0.0438  0.0425  0.0200  591 ASP B OD1 
1825 O OD2 . ASP B 83  ? 0.6763 0.6702 0.6144 0.0449  0.0452  0.0196  591 ASP B OD2 
1826 N N   . PHE B 84  ? 0.6395 0.6657 0.5700 0.0497  0.0543  0.0302  592 PHE B N   
1827 C CA  . PHE B 84  ? 0.6810 0.7169 0.6075 0.0534  0.0565  0.0322  592 PHE B CA  
1828 C C   . PHE B 84  ? 0.7002 0.7363 0.6246 0.0524  0.0556  0.0337  592 PHE B C   
1829 O O   . PHE B 84  ? 0.7366 0.7747 0.6538 0.0570  0.0549  0.0321  592 PHE B O   
1830 C CB  . PHE B 84  ? 0.6636 0.7094 0.5960 0.0518  0.0604  0.0371  592 PHE B CB  
1831 C CG  . PHE B 84  ? 0.7810 0.8379 0.7109 0.0549  0.0631  0.0404  592 PHE B CG  
1832 C CD1 . PHE B 84  ? 0.8865 0.9496 0.8116 0.0609  0.0647  0.0393  592 PHE B CD1 
1833 C CD2 . PHE B 84  ? 0.7293 0.7912 0.6623 0.0519  0.0641  0.0450  592 PHE B CD2 
1834 C CE1 . PHE B 84  ? 0.9444 1.0188 0.8675 0.0640  0.0675  0.0429  592 PHE B CE1 
1835 C CE2 . PHE B 84  ? 0.7943 0.8673 0.7254 0.0547  0.0667  0.0487  592 PHE B CE2 
1836 C CZ  . PHE B 84  ? 0.7960 0.8754 0.7220 0.0609  0.0684  0.0477  592 PHE B CZ  
1837 N N   . LEU B 85  ? 0.6687 0.7024 0.5992 0.0466  0.0554  0.0366  593 LEU B N   
1838 C CA  . LEU B 85  ? 0.6796 0.7130 0.6091 0.0448  0.0544  0.0383  593 LEU B CA  
1839 C C   . LEU B 85  ? 0.7165 0.7401 0.6405 0.0463  0.0502  0.0339  593 LEU B C   
1840 O O   . LEU B 85  ? 0.7332 0.7576 0.6524 0.0480  0.0491  0.0339  593 LEU B O   
1841 C CB  . LEU B 85  ? 0.5767 0.6099 0.5149 0.0381  0.0551  0.0424  593 LEU B CB  
1842 C CG  . LEU B 85  ? 0.5941 0.6372 0.5385 0.0360  0.0587  0.0476  593 LEU B CG  
1843 C CD1 . LEU B 85  ? 0.5134 0.5535 0.4665 0.0297  0.0587  0.0500  593 LEU B CD1 
1844 C CD2 . LEU B 85  ? 0.6283 0.6809 0.5712 0.0373  0.0602  0.0514  593 LEU B CD2 
1845 N N   . LEU B 86  ? 0.6548 0.6692 0.5796 0.0456  0.0477  0.0304  594 LEU B N   
1846 C CA  . LEU B 86  ? 0.7020 0.7064 0.6223 0.0469  0.0433  0.0264  594 LEU B CA  
1847 C C   . LEU B 86  ? 0.7484 0.7537 0.6596 0.0539  0.0418  0.0225  594 LEU B C   
1848 O O   . LEU B 86  ? 0.7493 0.7505 0.6551 0.0558  0.0387  0.0205  594 LEU B O   
1849 C CB  . LEU B 86  ? 0.6503 0.6456 0.5743 0.0447  0.0410  0.0241  594 LEU B CB  
1850 C CG  . LEU B 86  ? 0.6605 0.6520 0.5924 0.0382  0.0412  0.0269  594 LEU B CG  
1851 C CD1 . LEU B 86  ? 0.5700 0.5539 0.5049 0.0371  0.0393  0.0246  594 LEU B CD1 
1852 C CD2 . LEU B 86  ? 0.6582 0.6458 0.5900 0.0359  0.0391  0.0280  594 LEU B CD2 
1853 N N   . GLN B 87  ? 0.7854 0.7960 0.6948 0.0577  0.0439  0.0215  595 GLN B N   
1854 C CA  . GLN B 87  ? 0.8772 0.8909 0.7778 0.0648  0.0433  0.0183  595 GLN B CA  
1855 C C   . GLN B 87  ? 0.8945 0.9141 0.7898 0.0672  0.0440  0.0198  595 GLN B C   
1856 O O   . GLN B 87  ? 0.8647 0.8804 0.7523 0.0715  0.0409  0.0162  595 GLN B O   
1857 C CB  . GLN B 87  ? 0.8911 0.9127 0.7911 0.0686  0.0466  0.0183  595 GLN B CB  
1858 C CG  . GLN B 87  ? 1.0364 1.0545 0.9297 0.0752  0.0443  0.0126  595 GLN B CG  
1859 C CD  . GLN B 87  ? 1.1490 1.1546 1.0381 0.0768  0.0383  0.0070  595 GLN B CD  
1860 O OE1 . GLN B 87  ? 1.2662 1.2678 1.1534 0.0802  0.0364  0.0029  595 GLN B OE1 
1861 N NE2 . GLN B 87  ? 1.0159 1.0148 0.9057 0.0734  0.0354  0.0073  595 GLN B NE2 
1862 N N   . ARG B 88  ? 0.9222 0.9514 0.8212 0.0649  0.0479  0.0252  596 ARG B N   
1863 C CA  . ARG B 88  ? 0.9585 0.9954 0.8525 0.0677  0.0492  0.0272  596 ARG B CA  
1864 C C   . ARG B 88  ? 0.8984 0.9348 0.7959 0.0626  0.0487  0.0309  596 ARG B C   
1865 O O   . ARG B 88  ? 1.0716 1.1174 0.9696 0.0623  0.0514  0.0353  596 ARG B O   
1866 C CB  . ARG B 88  ? 0.9932 1.0434 0.8881 0.0701  0.0540  0.0310  596 ARG B CB  
1867 C CG  . ARG B 88  ? 1.1161 1.1686 1.0067 0.0762  0.0549  0.0276  596 ARG B CG  
1868 C CD  . ARG B 88  ? 1.2143 1.2654 1.0936 0.0836  0.0526  0.0228  596 ARG B CD  
1869 N NE  . ARG B 88  ? 1.3201 1.3738 1.1951 0.0898  0.0534  0.0195  596 ARG B NE  
1870 C CZ  . ARG B 88  ? 1.3587 1.4034 1.2320 0.0916  0.0503  0.0141  596 ARG B CZ  
1871 N NH1 . ARG B 88  ? 1.3968 1.4298 1.2725 0.0878  0.0462  0.0116  596 ARG B NH1 
1872 N NH2 . ARG B 88  ? 1.4136 1.4615 1.2832 0.0974  0.0513  0.0114  596 ARG B NH2 
1873 N N   . TRP B 89  ? 0.8354 0.8613 0.7357 0.0584  0.0454  0.0295  597 TRP B N   
1874 C CA  . TRP B 89  ? 0.8308 0.8555 0.7349 0.0533  0.0448  0.0329  597 TRP B CA  
1875 C C   . TRP B 89  ? 0.7685 0.7805 0.6746 0.0499  0.0407  0.0304  597 TRP B C   
1876 O O   . TRP B 89  ? 0.8033 0.8125 0.7123 0.0459  0.0395  0.0326  597 TRP B O   
1877 C CB  . TRP B 89  ? 0.7644 0.7964 0.6778 0.0481  0.0486  0.0388  597 TRP B CB  
1878 N N   . GLY B 90  ? 0.9617 0.9664 0.8668 0.0516  0.0385  0.0262  598 GLY B N   
1879 C CA  . GLY B 90  ? 0.9799 0.9729 0.8872 0.0488  0.0344  0.0240  598 GLY B CA  
1880 C C   . GLY B 90  ? 1.0656 1.0523 0.9663 0.0512  0.0299  0.0213  598 GLY B C   
1881 O O   . GLY B 90  ? 1.0939 1.0706 0.9936 0.0515  0.0256  0.0179  598 GLY B O   
1882 N N   . LEU C 18  ? 1.8066 1.7363 1.7184 -0.0029 -0.0428 0.0285  18  LEU C N   
1883 C CA  . LEU C 18  ? 1.8023 1.7344 1.7260 -0.0067 -0.0410 0.0322  18  LEU C CA  
1884 C C   . LEU C 18  ? 1.8348 1.7735 1.7630 -0.0086 -0.0375 0.0362  18  LEU C C   
1885 O O   . LEU C 18  ? 1.7985 1.7394 1.7364 -0.0117 -0.0363 0.0393  18  LEU C O   
1886 C CB  . LEU C 18  ? 1.6121 1.5451 1.5397 -0.0062 -0.0373 0.0313  18  LEU C CB  
1887 C CG  . LEU C 18  ? 1.5239 1.4615 1.4475 -0.0034 -0.0316 0.0300  18  LEU C CG  
1888 C CD1 . LEU C 18  ? 1.3971 1.3423 1.3239 -0.0042 -0.0263 0.0332  18  LEU C CD1 
1889 C CD2 . LEU C 18  ? 1.4245 1.3605 1.3514 -0.0030 -0.0301 0.0284  18  LEU C CD2 
1890 N N   . GLU C 19  ? 2.0887 2.0308 2.0101 -0.0066 -0.0361 0.0361  19  GLU C N   
1891 C CA  . GLU C 19  ? 2.0693 2.0180 1.9948 -0.0082 -0.0328 0.0400  19  GLU C CA  
1892 C C   . GLU C 19  ? 2.1649 2.1128 2.0896 -0.0099 -0.0368 0.0418  19  GLU C C   
1893 O O   . GLU C 19  ? 2.1373 2.0878 2.0700 -0.0130 -0.0364 0.0454  19  GLU C O   
1894 C CB  . GLU C 19  ? 1.9838 1.9382 1.9041 -0.0053 -0.0279 0.0397  19  GLU C CB  
1895 C CG  . GLU C 19  ? 1.9227 1.8830 1.8425 -0.0057 -0.0264 0.0430  19  GLU C CG  
1896 C CD  . GLU C 19  ? 1.8461 1.8135 1.7695 -0.0052 -0.0205 0.0451  19  GLU C CD  
1897 O OE1 . GLU C 19  ? 1.7674 1.7347 1.6922 -0.0042 -0.0176 0.0436  19  GLU C OE1 
1898 O OE2 . GLU C 19  ? 1.7369 1.7097 1.6623 -0.0061 -0.0190 0.0484  19  GLU C OE2 
1899 N N   . LYS C 20  ? 1.6402 1.5842 1.5555 -0.0078 -0.0408 0.0393  20  LYS C N   
1900 C CA  . LYS C 20  ? 1.6975 1.6402 1.6115 -0.0093 -0.0451 0.0410  20  LYS C CA  
1901 C C   . LYS C 20  ? 1.8225 1.7601 1.7440 -0.0129 -0.0497 0.0423  20  LYS C C   
1902 O O   . LYS C 20  ? 1.8298 1.7682 1.7549 -0.0155 -0.0518 0.0453  20  LYS C O   
1903 C CB  . LYS C 20  ? 1.6399 1.5795 1.5412 -0.0057 -0.0484 0.0377  20  LYS C CB  
1904 C CG  . LYS C 20  ? 1.5374 1.4830 1.4314 -0.0021 -0.0438 0.0372  20  LYS C CG  
1905 C CD  . LYS C 20  ? 1.4728 1.4261 1.3721 -0.0042 -0.0404 0.0420  20  LYS C CD  
1906 C CE  . LYS C 20  ? 1.3655 1.3257 1.2589 -0.0009 -0.0357 0.0425  20  LYS C CE  
1907 N NZ  . LYS C 20  ? 1.2555 1.2233 1.1554 -0.0032 -0.0325 0.0475  20  LYS C NZ  
1908 N N   . GLU C 21  ? 2.4030 2.3359 2.3273 -0.0131 -0.0513 0.0405  21  GLU C N   
1909 C CA  . GLU C 21  ? 2.4164 2.3453 2.3491 -0.0165 -0.0553 0.0423  21  GLU C CA  
1910 C C   . GLU C 21  ? 2.4605 2.3953 2.4030 -0.0196 -0.0517 0.0469  21  GLU C C   
1911 O O   . GLU C 21  ? 2.5287 2.4627 2.4763 -0.0224 -0.0547 0.0497  21  GLU C O   
1912 C CB  . GLU C 21  ? 2.4003 2.3254 2.3374 -0.0167 -0.0559 0.0409  21  GLU C CB  
1913 C CG  . GLU C 21  ? 2.4164 2.3412 2.3479 -0.0133 -0.0532 0.0371  21  GLU C CG  
1914 C CD  . GLU C 21  ? 2.3968 2.3183 2.3156 -0.0094 -0.0557 0.0330  21  GLU C CD  
1915 O OE1 . GLU C 21  ? 2.4257 2.3403 2.3406 -0.0089 -0.0620 0.0308  21  GLU C OE1 
1916 O OE2 . GLU C 21  ? 2.3702 2.2964 2.2832 -0.0069 -0.0514 0.0322  21  GLU C OE2 
1917 N N   . TYR C 22  ? 2.1436 2.0844 2.0890 -0.0190 -0.0455 0.0476  22  TYR C N   
1918 C CA  . TYR C 22  ? 2.0553 2.0015 2.0105 -0.0217 -0.0423 0.0517  22  TYR C CA  
1919 C C   . TYR C 22  ? 2.0208 1.9707 1.9759 -0.0229 -0.0424 0.0544  22  TYR C C   
1920 O O   . TYR C 22  ? 1.9453 1.8970 1.9087 -0.0259 -0.0427 0.0578  22  TYR C O   
1921 C CB  . TYR C 22  ? 1.8787 1.8297 1.8366 -0.0206 -0.0362 0.0516  22  TYR C CB  
1922 C CG  . TYR C 22  ? 1.7400 1.6960 1.7084 -0.0231 -0.0331 0.0552  22  TYR C CG  
1923 C CD1 . TYR C 22  ? 1.6522 1.6082 1.6284 -0.0242 -0.0316 0.0559  22  TYR C CD1 
1924 C CD2 . TYR C 22  ? 1.6660 1.6269 1.6364 -0.0240 -0.0315 0.0578  22  TYR C CD2 
1925 C CE1 . TYR C 22  ? 1.6065 1.5668 1.5918 -0.0260 -0.0290 0.0589  22  TYR C CE1 
1926 C CE2 . TYR C 22  ? 1.6119 1.5768 1.5918 -0.0261 -0.0291 0.0609  22  TYR C CE2 
1927 C CZ  . TYR C 22  ? 1.5873 1.5519 1.5744 -0.0269 -0.0277 0.0612  22  TYR C CZ  
1928 O OH  . TYR C 22  ? 1.4636 1.4323 1.4598 -0.0284 -0.0252 0.0638  22  TYR C OH  
1929 N N   . PHE C 23  ? 1.9455 1.8968 1.8915 -0.0205 -0.0422 0.0531  23  PHE C N   
1930 C CA  . PHE C 23  ? 1.8469 1.8026 1.7930 -0.0216 -0.0420 0.0561  23  PHE C CA  
1931 C C   . PHE C 23  ? 1.8771 1.8283 1.8212 -0.0231 -0.0480 0.0566  23  PHE C C   
1932 O O   . PHE C 23  ? 1.7330 1.6869 1.6799 -0.0251 -0.0489 0.0597  23  PHE C O   
1933 C CB  . PHE C 23  ? 1.8109 1.7713 1.7489 -0.0184 -0.0388 0.0552  23  PHE C CB  
1934 C CG  . PHE C 23  ? 1.7202 1.6853 1.6612 -0.0173 -0.0330 0.0553  23  PHE C CG  
1935 C CD1 . PHE C 23  ? 1.6144 1.5855 1.5634 -0.0190 -0.0296 0.0588  23  PHE C CD1 
1936 C CD2 . PHE C 23  ? 1.7226 1.6858 1.6590 -0.0145 -0.0313 0.0519  23  PHE C CD2 
1937 C CE1 . PHE C 23  ? 1.4478 1.4228 1.3998 -0.0180 -0.0247 0.0589  23  PHE C CE1 
1938 C CE2 . PHE C 23  ? 1.5722 1.5395 1.5117 -0.0136 -0.0262 0.0521  23  PHE C CE2 
1939 C CZ  . PHE C 23  ? 1.4021 1.3751 1.3492 -0.0154 -0.0230 0.0556  23  PHE C CZ  
1940 N N   . ASP C 24  ? 2.0626 2.0068 2.0027 -0.0223 -0.0525 0.0538  24  ASP C N   
1941 C CA  . ASP C 24  ? 2.1083 2.0470 2.0466 -0.0238 -0.0591 0.0541  24  ASP C CA  
1942 C C   . ASP C 24  ? 2.0527 1.9883 2.0017 -0.0276 -0.0621 0.0567  24  ASP C C   
1943 O O   . ASP C 24  ? 1.9758 1.9082 1.9257 -0.0296 -0.0670 0.0583  24  ASP C O   
1944 C CB  . ASP C 24  ? 2.1573 2.0896 2.0845 -0.0206 -0.0632 0.0494  24  ASP C CB  
1945 C CG  . ASP C 24  ? 2.1494 2.0848 2.0652 -0.0166 -0.0610 0.0472  24  ASP C CG  
1946 O OD1 . ASP C 24  ? 2.1356 2.0692 2.0437 -0.0156 -0.0646 0.0466  24  ASP C OD1 
1947 O OD2 . ASP C 24  ? 2.1270 2.0668 2.0415 -0.0145 -0.0556 0.0464  24  ASP C OD2 
1948 N N   . GLN C 25  ? 1.8593 1.7963 1.8165 -0.0286 -0.0590 0.0575  25  GLN C N   
1949 C CA  . GLN C 25  ? 1.8104 1.7460 1.7788 -0.0320 -0.0607 0.0606  25  GLN C CA  
1950 C C   . GLN C 25  ? 1.7469 1.6887 1.7248 -0.0346 -0.0574 0.0649  25  GLN C C   
1951 O O   . GLN C 25  ? 1.7172 1.6579 1.7022 -0.0376 -0.0603 0.0681  25  GLN C O   
1952 C CB  . GLN C 25  ? 1.8487 1.7828 1.8211 -0.0314 -0.0592 0.0593  25  GLN C CB  
1953 C CG  . GLN C 25  ? 1.8650 1.8033 1.8349 -0.0290 -0.0533 0.0574  25  GLN C CG  
1954 C CD  . GLN C 25  ? 1.8449 1.7842 1.8224 -0.0295 -0.0505 0.0579  25  GLN C CD  
1955 O OE1 . GLN C 25  ? 1.8355 1.7704 1.8149 -0.0298 -0.0535 0.0573  25  GLN C OE1 
1956 N NE2 . GLN C 25  ? 1.7658 1.7111 1.7476 -0.0294 -0.0449 0.0592  25  GLN C NE2 
1957 N N   . HIS C 26  ? 1.9524 1.9003 1.9310 -0.0335 -0.0517 0.0651  26  HIS C N   
1958 C CA  . HIS C 26  ? 1.8190 1.7725 1.8064 -0.0357 -0.0488 0.0688  26  HIS C CA  
1959 C C   . HIS C 26  ? 1.6578 1.6153 1.6420 -0.0357 -0.0482 0.0702  26  HIS C C   
1960 O O   . HIS C 26  ? 1.6102 1.5703 1.6012 -0.0382 -0.0486 0.0736  26  HIS C O   
1961 C CB  . HIS C 26  ? 1.7892 1.7472 1.7819 -0.0349 -0.0430 0.0688  26  HIS C CB  
1962 C CG  . HIS C 26  ? 1.8423 1.7978 1.8394 -0.0349 -0.0428 0.0681  26  HIS C CG  
1963 N ND1 . HIS C 26  ? 1.8926 1.8447 1.8957 -0.0371 -0.0465 0.0699  26  HIS C ND1 
1964 C CD2 . HIS C 26  ? 1.8563 1.8130 1.8541 -0.0333 -0.0391 0.0664  26  HIS C CD2 
1965 C CE1 . HIS C 26  ? 1.9166 1.8678 1.9232 -0.0366 -0.0452 0.0694  26  HIS C CE1 
1966 N NE2 . HIS C 26  ? 1.9030 1.8570 1.9063 -0.0343 -0.0406 0.0670  26  HIS C NE2 
1967 N N   . PHE C 27  ? 1.2457 1.2046 1.2206 -0.0330 -0.0468 0.0680  27  PHE C N   
1968 C CA  . PHE C 27  ? 1.1174 1.0820 1.0910 -0.0329 -0.0450 0.0700  27  PHE C CA  
1969 C C   . PHE C 27  ? 1.0907 1.0534 1.0575 -0.0332 -0.0495 0.0705  27  PHE C C   
1970 O O   . PHE C 27  ? 0.9874 0.9498 0.9592 -0.0360 -0.0524 0.0734  27  PHE C O   
1971 C CB  . PHE C 27  ? 1.0955 1.0642 1.0640 -0.0298 -0.0402 0.0683  27  PHE C CB  
1972 C CG  . PHE C 27  ? 1.0390 1.0101 1.0141 -0.0297 -0.0357 0.0682  27  PHE C CG  
1973 C CD1 . PHE C 27  ? 0.9823 0.9539 0.9680 -0.0322 -0.0352 0.0703  27  PHE C CD1 
1974 C CD2 . PHE C 27  ? 1.0404 1.0135 1.0112 -0.0268 -0.0319 0.0660  27  PHE C CD2 
1975 C CE1 . PHE C 27  ? 0.9387 0.9125 0.9300 -0.0317 -0.0312 0.0700  27  PHE C CE1 
1976 C CE2 . PHE C 27  ? 0.9438 0.9189 0.9203 -0.0266 -0.0280 0.0658  27  PHE C CE2 
1977 C CZ  . PHE C 27  ? 0.9029 0.8784 0.8895 -0.0290 -0.0276 0.0677  27  PHE C CZ  
1978 N N   . GLY C 28  ? 1.4779 1.4394 1.4333 -0.0300 -0.0501 0.0676  28  GLY C N   
1979 C CA  . GLY C 28  ? 1.3970 1.3570 1.3445 -0.0295 -0.0541 0.0675  28  GLY C CA  
1980 C C   . GLY C 28  ? 1.3937 1.3474 1.3432 -0.0320 -0.0602 0.0681  28  GLY C C   
1981 O O   . GLY C 28  ? 1.4579 1.4064 1.4106 -0.0327 -0.0622 0.0668  28  GLY C O   
1982 N N   . PRO C 29  ? 1.1371 1.0913 1.0849 -0.0334 -0.0634 0.0703  29  PRO C N   
1983 C CA  . PRO C 29  ? 1.0932 1.0539 1.0375 -0.0327 -0.0614 0.0723  29  PRO C CA  
1984 C C   . PRO C 29  ? 1.0791 1.0461 1.0348 -0.0359 -0.0587 0.0771  29  PRO C C   
1985 O O   . PRO C 29  ? 1.0747 1.0473 1.0294 -0.0360 -0.0576 0.0796  29  PRO C O   
1986 C CB  . PRO C 29  ? 1.1370 1.0939 1.0738 -0.0327 -0.0672 0.0721  29  PRO C CB  
1987 C CG  . PRO C 29  ? 1.1169 1.0674 1.0605 -0.0360 -0.0719 0.0728  29  PRO C CG  
1988 C CD  . PRO C 29  ? 1.0653 1.0132 1.0138 -0.0357 -0.0699 0.0709  29  PRO C CD  
1989 N N   . PHE C 30  ? 1.1679 1.1340 1.1342 -0.0384 -0.0579 0.0783  30  PHE C N   
1990 C CA  . PHE C 30  ? 1.1125 1.0837 1.0902 -0.0413 -0.0559 0.0825  30  PHE C CA  
1991 C C   . PHE C 30  ? 1.0331 1.0107 1.0137 -0.0400 -0.0500 0.0828  30  PHE C C   
1992 O O   . PHE C 30  ? 1.0287 1.0115 1.0170 -0.0417 -0.0481 0.0862  30  PHE C O   
1993 C CB  . PHE C 30  ? 1.0820 1.0498 1.0698 -0.0442 -0.0574 0.0837  30  PHE C CB  
1994 C CG  . PHE C 30  ? 1.1604 1.1212 1.1461 -0.0455 -0.0634 0.0833  30  PHE C CG  
1995 C CD1 . PHE C 30  ? 1.1611 1.1205 1.1417 -0.0463 -0.0677 0.0844  30  PHE C CD1 
1996 C CD2 . PHE C 30  ? 1.1806 1.1361 1.1691 -0.0458 -0.0650 0.0819  30  PHE C CD2 
1997 C CE1 . PHE C 30  ? 1.1246 1.0770 1.1031 -0.0475 -0.0737 0.0839  30  PHE C CE1 
1998 C CE2 . PHE C 30  ? 1.1234 1.0722 1.1104 -0.0470 -0.0710 0.0817  30  PHE C CE2 
1999 C CZ  . PHE C 30  ? 1.0873 1.0344 1.0693 -0.0479 -0.0754 0.0826  30  PHE C CZ  
2000 N N   . PHE C 31  ? 0.9503 0.9273 0.9248 -0.0368 -0.0473 0.0795  31  PHE C N   
2001 C CA  . PHE C 31  ? 0.8967 0.8793 0.8733 -0.0353 -0.0420 0.0796  31  PHE C CA  
2002 C C   . PHE C 31  ? 0.8835 0.8678 0.8493 -0.0315 -0.0401 0.0773  31  PHE C C   
2003 O O   . PHE C 31  ? 0.9222 0.9019 0.8800 -0.0291 -0.0412 0.0736  31  PHE C O   
2004 C CB  . PHE C 31  ? 0.9216 0.9028 0.9049 -0.0354 -0.0394 0.0783  31  PHE C CB  
2005 C CG  . PHE C 31  ? 0.9230 0.9041 0.9178 -0.0387 -0.0402 0.0809  31  PHE C CG  
2006 C CD1 . PHE C 31  ? 0.8521 0.8386 0.8555 -0.0401 -0.0377 0.0839  31  PHE C CD1 
2007 C CD2 . PHE C 31  ? 0.9422 0.9178 0.9395 -0.0402 -0.0435 0.0805  31  PHE C CD2 
2008 C CE1 . PHE C 31  ? 0.8163 0.8029 0.8301 -0.0427 -0.0384 0.0862  31  PHE C CE1 
2009 C CE2 . PHE C 31  ? 0.9269 0.9028 0.9349 -0.0430 -0.0440 0.0832  31  PHE C CE2 
2010 C CZ  . PHE C 31  ? 0.8696 0.8511 0.8856 -0.0441 -0.0414 0.0859  31  PHE C CZ  
2011 N N   . ARG C 32  ? 0.8453 0.8365 0.8116 -0.0309 -0.0373 0.0798  32  ARG C N   
2012 C CA  . ARG C 32  ? 0.8765 0.8711 0.8346 -0.0273 -0.0344 0.0786  32  ARG C CA  
2013 C C   . ARG C 32  ? 0.7876 0.7834 0.7492 -0.0260 -0.0299 0.0771  32  ARG C C   
2014 O O   . ARG C 32  ? 0.7192 0.7154 0.6906 -0.0281 -0.0286 0.0782  32  ARG C O   
2015 C CB  . ARG C 32  ? 0.8665 0.8685 0.8250 -0.0275 -0.0335 0.0827  32  ARG C CB  
2016 C CG  . ARG C 32  ? 0.9313 0.9379 0.8811 -0.0238 -0.0308 0.0823  32  ARG C CG  
2017 C CD  . ARG C 32  ? 0.9728 0.9879 0.9267 -0.0246 -0.0292 0.0875  32  ARG C CD  
2018 N NE  . ARG C 32  ? 1.0907 1.1101 1.0348 -0.0216 -0.0290 0.0883  32  ARG C NE  
2019 C CZ  . ARG C 32  ? 1.1134 1.1341 1.0488 -0.0175 -0.0264 0.0861  32  ARG C CZ  
2020 N NH1 . ARG C 32  ? 1.0443 1.0621 0.9797 -0.0160 -0.0239 0.0828  32  ARG C NH1 
2021 N NH2 . ARG C 32  ? 1.1015 1.1268 1.0284 -0.0148 -0.0262 0.0875  32  ARG C NH2 
2022 N N   . THR C 33  ? 0.7183 0.7147 0.6720 -0.0224 -0.0276 0.0746  33  THR C N   
2023 C CA  . THR C 33  ? 0.7974 0.7952 0.7542 -0.0212 -0.0234 0.0735  33  THR C CA  
2024 C C   . THR C 33  ? 0.7944 0.7988 0.7483 -0.0187 -0.0197 0.0749  33  THR C C   
2025 O O   . THR C 33  ? 0.7696 0.7753 0.7139 -0.0159 -0.0197 0.0741  33  THR C O   
2026 C CB  . THR C 33  ? 0.7885 0.7801 0.7403 -0.0193 -0.0236 0.0688  33  THR C CB  
2027 O OG1 . THR C 33  ? 0.8387 0.8284 0.7786 -0.0162 -0.0251 0.0663  33  THR C OG1 
2028 C CG2 . THR C 33  ? 0.9336 0.9192 0.8903 -0.0219 -0.0268 0.0679  33  THR C CG2 
2029 N N   . GLU C 34  ? 0.7230 0.7317 0.6854 -0.0197 -0.0167 0.0772  34  GLU C N   
2030 C CA  . GLU C 34  ? 0.7247 0.7392 0.6859 -0.0175 -0.0129 0.0786  34  GLU C CA  
2031 C C   . GLU C 34  ? 0.7383 0.7499 0.6977 -0.0154 -0.0103 0.0750  34  GLU C C   
2032 O O   . GLU C 34  ? 0.7163 0.7249 0.6819 -0.0168 -0.0099 0.0737  34  GLU C O   
2033 C CB  . GLU C 34  ? 0.6739 0.6943 0.6456 -0.0196 -0.0116 0.0830  34  GLU C CB  
2034 C CG  . GLU C 34  ? 0.7352 0.7569 0.7125 -0.0228 -0.0146 0.0864  34  GLU C CG  
2035 C CD  . GLU C 34  ? 0.7597 0.7843 0.7300 -0.0221 -0.0166 0.0884  34  GLU C CD  
2036 O OE1 . GLU C 34  ? 0.7693 0.7964 0.7309 -0.0189 -0.0151 0.0879  34  GLU C OE1 
2037 O OE2 . GLU C 34  ? 0.8041 0.8286 0.7775 -0.0247 -0.0196 0.0905  34  GLU C OE2 
2038 N N   . GLN C 35  ? 0.6431 0.6559 0.5939 -0.0119 -0.0084 0.0734  35  GLN C N   
2039 C CA  . GLN C 35  ? 0.6700 0.6794 0.6179 -0.0098 -0.0063 0.0697  35  GLN C CA  
2040 C C   . GLN C 35  ? 0.7059 0.7203 0.6512 -0.0069 -0.0024 0.0705  35  GLN C C   
2041 O O   . GLN C 35  ? 0.7416 0.7603 0.6808 -0.0047 -0.0018 0.0720  35  GLN C O   
2042 C CB  . GLN C 35  ? 0.6567 0.6597 0.5955 -0.0081 -0.0089 0.0653  35  GLN C CB  
2043 C CG  . GLN C 35  ? 0.7023 0.7013 0.6384 -0.0062 -0.0072 0.0614  35  GLN C CG  
2044 C CD  . GLN C 35  ? 0.8595 0.8509 0.7902 -0.0057 -0.0107 0.0572  35  GLN C CD  
2045 O OE1 . GLN C 35  ? 0.9140 0.9014 0.8495 -0.0084 -0.0134 0.0570  35  GLN C OE1 
2046 N NE2 . GLN C 35  ? 0.8199 0.8095 0.7407 -0.0021 -0.0107 0.0541  35  GLN C NE2 
2047 N N   . LEU C 36  ? 0.6312 0.6454 0.5814 -0.0069 0.0003  0.0697  36  LEU C N   
2048 C CA  . LEU C 36  ? 0.5840 0.6022 0.5322 -0.0042 0.0040  0.0703  36  LEU C CA  
2049 C C   . LEU C 36  ? 0.6038 0.6174 0.5478 -0.0022 0.0054  0.0659  36  LEU C C   
2050 O O   . LEU C 36  ? 0.6336 0.6418 0.5804 -0.0036 0.0044  0.0633  36  LEU C O   
2051 C CB  . LEU C 36  ? 0.5900 0.6129 0.5483 -0.0059 0.0059  0.0740  36  LEU C CB  
2052 C CG  . LEU C 36  ? 0.6314 0.6583 0.5968 -0.0087 0.0042  0.0784  36  LEU C CG  
2053 C CD1 . LEU C 36  ? 0.6057 0.6363 0.5809 -0.0099 0.0060  0.0813  36  LEU C CD1 
2054 C CD2 . LEU C 36  ? 0.7347 0.7666 0.6944 -0.0074 0.0036  0.0813  36  LEU C CD2 
2055 N N   . ILE C 37  ? 0.6238 0.6398 0.5612 0.0012  0.0078  0.0654  37  ILE C N   
2056 C CA  . ILE C 37  ? 0.5670 0.5797 0.5012 0.0034  0.0097  0.0618  37  ILE C CA  
2057 C C   . ILE C 37  ? 0.6019 0.6198 0.5407 0.0041  0.0135  0.0644  37  ILE C C   
2058 O O   . ILE C 37  ? 0.5778 0.6019 0.5155 0.0054  0.0150  0.0679  37  ILE C O   
2059 C CB  . ILE C 37  ? 0.6976 0.7083 0.6200 0.0072  0.0092  0.0585  37  ILE C CB  
2060 C CG1 . ILE C 37  ? 0.7215 0.7285 0.6388 0.0067  0.0050  0.0570  37  ILE C CG1 
2061 C CG2 . ILE C 37  ? 0.6132 0.6193 0.5330 0.0089  0.0105  0.0543  37  ILE C CG2 
2062 C CD1 . ILE C 37  ? 0.7157 0.7160 0.6374 0.0037  0.0020  0.0548  37  ILE C CD1 
2063 N N   . ILE C 38  ? 0.5705 0.5859 0.5146 0.0031  0.0148  0.0630  38  ILE C N   
2064 C CA  . ILE C 38  ? 0.5510 0.5706 0.5003 0.0035  0.0180  0.0654  38  ILE C CA  
2065 C C   . ILE C 38  ? 0.5438 0.5607 0.4895 0.0058  0.0202  0.0622  38  ILE C C   
2066 O O   . ILE C 38  ? 0.5523 0.5635 0.4979 0.0052  0.0195  0.0586  38  ILE C O   
2067 C CB  . ILE C 38  ? 0.5356 0.5554 0.4958 0.0002  0.0176  0.0673  38  ILE C CB  
2068 C CG1 . ILE C 38  ? 0.5359 0.5588 0.5004 -0.0020 0.0154  0.0708  38  ILE C CG1 
2069 C CG2 . ILE C 38  ? 0.4485 0.4718 0.4139 0.0007  0.0204  0.0694  38  ILE C CG2 
2070 C CD1 . ILE C 38  ? 0.5869 0.6051 0.5527 -0.0043 0.0124  0.0690  38  ILE C CD1 
2071 N N   . ARG C 39  ? 0.5105 0.5318 0.4536 0.0084  0.0230  0.0639  39  ARG C N   
2072 C CA  . ARG C 39  ? 0.5092 0.5287 0.4497 0.0105  0.0254  0.0615  39  ARG C CA  
2073 C C   . ARG C 39  ? 0.5045 0.5284 0.4520 0.0102  0.0280  0.0649  39  ARG C C   
2074 O O   . ARG C 39  ? 0.5070 0.5359 0.4599 0.0090  0.0280  0.0693  39  ARG C O   
2075 C CB  . ARG C 39  ? 0.5963 0.6165 0.5264 0.0144  0.0263  0.0598  39  ARG C CB  
2076 C CG  . ARG C 39  ? 0.5708 0.5855 0.4937 0.0150  0.0232  0.0556  39  ARG C CG  
2077 C CD  . ARG C 39  ? 0.7033 0.7194 0.6156 0.0193  0.0238  0.0543  39  ARG C CD  
2078 N NE  . ARG C 39  ? 0.7804 0.7900 0.6855 0.0201  0.0205  0.0496  39  ARG C NE  
2079 C CZ  . ARG C 39  ? 0.7926 0.8015 0.6937 0.0200  0.0175  0.0495  39  ARG C CZ  
2080 N NH1 . ARG C 39  ? 0.8191 0.8338 0.7224 0.0190  0.0175  0.0539  39  ARG C NH1 
2081 N NH2 . ARG C 39  ? 0.8370 0.8395 0.7320 0.0208  0.0142  0.0451  39  ARG C NH2 
2082 N N   . ALA C 40  ? 0.4968 0.5185 0.4446 0.0111  0.0300  0.0629  40  ALA C N   
2083 C CA  . ALA C 40  ? 0.4707 0.4957 0.4251 0.0108  0.0322  0.0658  40  ALA C CA  
2084 C C   . ALA C 40  ? 0.5486 0.5754 0.4981 0.0141  0.0351  0.0656  40  ALA C C   
2085 O O   . ALA C 40  ? 0.5342 0.5575 0.4833 0.0147  0.0363  0.0629  40  ALA C O   
2086 C CB  . ALA C 40  ? 0.4963 0.5169 0.4571 0.0085  0.0317  0.0639  40  ALA C CB  
2087 N N   . PRO C 41  ? 0.6312 0.6639 0.5771 0.0164  0.0362  0.0688  41  PRO C N   
2088 C CA  . PRO C 41  ? 0.6061 0.6414 0.5458 0.0202  0.0390  0.0688  41  PRO C CA  
2089 C C   . PRO C 41  ? 0.6051 0.6418 0.5497 0.0206  0.0416  0.0704  41  PRO C C   
2090 O O   . PRO C 41  ? 0.6416 0.6785 0.5813 0.0235  0.0438  0.0692  41  PRO C O   
2091 C CB  . PRO C 41  ? 0.6425 0.6853 0.5801 0.0218  0.0394  0.0735  41  PRO C CB  
2092 C CG  . PRO C 41  ? 0.6324 0.6777 0.5791 0.0183  0.0377  0.0775  41  PRO C CG  
2093 C CD  . PRO C 41  ? 0.5594 0.5975 0.5082 0.0153  0.0351  0.0734  41  PRO C CD  
2094 N N   . LEU C 42  ? 0.5505 0.5879 0.5045 0.0178  0.0411  0.0730  42  LEU C N   
2095 C CA  . LEU C 42  ? 0.5903 0.6293 0.5497 0.0179  0.0431  0.0752  42  LEU C CA  
2096 C C   . LEU C 42  ? 0.6248 0.6574 0.5875 0.0161  0.0426  0.0715  42  LEU C C   
2097 O O   . LEU C 42  ? 0.6346 0.6675 0.6025 0.0158  0.0437  0.0729  42  LEU C O   
2098 C CB  . LEU C 42  ? 0.6252 0.6701 0.5933 0.0164  0.0426  0.0814  42  LEU C CB  
2099 C CG  . LEU C 42  ? 0.6777 0.7310 0.6456 0.0186  0.0444  0.0872  42  LEU C CG  
2100 C CD1 . LEU C 42  ? 0.5675 0.6232 0.5262 0.0211  0.0447  0.0866  42  LEU C CD1 
2101 C CD2 . LEU C 42  ? 0.5937 0.6521 0.5713 0.0163  0.0428  0.0932  42  LEU C CD2 
2102 N N   . THR C 43  ? 0.5678 0.5947 0.5277 0.0150  0.0409  0.0669  43  THR C N   
2103 C CA  . THR C 43  ? 0.5538 0.5753 0.5175 0.0131  0.0403  0.0638  43  THR C CA  
2104 C C   . THR C 43  ? 0.5280 0.5443 0.4855 0.0145  0.0409  0.0589  43  THR C C   
2105 O O   . THR C 43  ? 0.5510 0.5653 0.5018 0.0156  0.0400  0.0563  43  THR C O   
2106 C CB  . THR C 43  ? 0.5849 0.6040 0.5526 0.0102  0.0375  0.0631  43  THR C CB  
2107 O OG1 . THR C 43  ? 0.5979 0.6214 0.5726 0.0088  0.0368  0.0676  43  THR C OG1 
2108 C CG2 . THR C 43  ? 0.4918 0.5057 0.4628 0.0087  0.0371  0.0598  43  THR C CG2 
2109 N N   . ASP C 44  ? 0.6788 0.6929 0.6390 0.0143  0.0422  0.0577  44  ASP C N   
2110 C CA  . ASP C 44  ? 0.6760 0.6852 0.6320 0.0152  0.0426  0.0533  44  ASP C CA  
2111 C C   . ASP C 44  ? 0.6299 0.6340 0.5866 0.0131  0.0403  0.0500  44  ASP C C   
2112 O O   . ASP C 44  ? 0.5502 0.5542 0.5127 0.0108  0.0391  0.0510  44  ASP C O   
2113 C CB  . ASP C 44  ? 0.6980 0.7066 0.6571 0.0155  0.0446  0.0534  44  ASP C CB  
2114 C CG  . ASP C 44  ? 0.8014 0.8147 0.7599 0.0177  0.0471  0.0567  44  ASP C CG  
2115 O OD1 . ASP C 44  ? 0.7416 0.7574 0.6941 0.0202  0.0478  0.0571  44  ASP C OD1 
2116 O OD2 . ASP C 44  ? 0.8579 0.8725 0.8218 0.0172  0.0482  0.0589  44  ASP C OD2 
2117 N N   . LYS C 45  ? 0.7049 0.7050 0.6561 0.0140  0.0396  0.0462  45  LYS C N   
2118 C CA  . LYS C 45  ? 0.6771 0.6724 0.6300 0.0121  0.0377  0.0434  45  LYS C CA  
2119 C C   . LYS C 45  ? 0.6533 0.6474 0.6115 0.0110  0.0391  0.0432  45  LYS C C   
2120 O O   . LYS C 45  ? 0.6713 0.6674 0.6306 0.0121  0.0412  0.0446  45  LYS C O   
2121 C CB  . LYS C 45  ? 0.6900 0.6811 0.6363 0.0134  0.0364  0.0396  45  LYS C CB  
2122 C CG  . LYS C 45  ? 0.7164 0.7065 0.6590 0.0157  0.0383  0.0379  45  LYS C CG  
2123 C CD  . LYS C 45  ? 0.8725 0.8582 0.8089 0.0171  0.0363  0.0340  45  LYS C CD  
2124 C CE  . LYS C 45  ? 1.0135 0.9981 0.9463 0.0195  0.0381  0.0321  45  LYS C CE  
2125 N NZ  . LYS C 45  ? 1.0397 1.0197 0.9666 0.0210  0.0358  0.0281  45  LYS C NZ  
2126 N N   . HIS C 46  ? 0.5264 0.5176 0.4880 0.0090  0.0377  0.0417  46  HIS C N   
2127 C CA  . HIS C 46  ? 0.5338 0.5238 0.4998 0.0082  0.0389  0.0412  46  HIS C CA  
2128 C C   . HIS C 46  ? 0.5192 0.5052 0.4856 0.0071  0.0375  0.0384  46  HIS C C   
2129 O O   . HIS C 46  ? 0.5147 0.4987 0.4787 0.0067  0.0355  0.0371  46  HIS C O   
2130 C CB  . HIS C 46  ? 0.5727 0.5651 0.5453 0.0069  0.0390  0.0438  46  HIS C CB  
2131 C CG  . HIS C 46  ? 0.5655 0.5575 0.5414 0.0050  0.0370  0.0439  46  HIS C CG  
2132 N ND1 . HIS C 46  ? 0.5500 0.5433 0.5248 0.0046  0.0354  0.0450  46  HIS C ND1 
2133 C CD2 . HIS C 46  ? 0.5548 0.5455 0.5353 0.0036  0.0364  0.0433  46  HIS C CD2 
2134 C CE1 . HIS C 46  ? 0.5117 0.5042 0.4904 0.0028  0.0339  0.0450  46  HIS C CE1 
2135 N NE2 . HIS C 46  ? 0.4926 0.4837 0.4748 0.0023  0.0345  0.0440  46  HIS C NE2 
2136 N N   . ILE C 47  ? 0.5870 0.5719 0.5565 0.0066  0.0386  0.0378  47  ILE C N   
2137 C CA  . ILE C 47  ? 0.5450 0.5266 0.5152 0.0057  0.0376  0.0356  47  ILE C CA  
2138 C C   . ILE C 47  ? 0.5381 0.5204 0.5144 0.0042  0.0379  0.0364  47  ILE C C   
2139 O O   . ILE C 47  ? 0.4932 0.4771 0.4724 0.0044  0.0393  0.0376  47  ILE C O   
2140 C CB  . ILE C 47  ? 0.6076 0.5871 0.5749 0.0069  0.0387  0.0336  47  ILE C CB  
2141 C CG1 . ILE C 47  ? 0.5682 0.5471 0.5292 0.0088  0.0385  0.0325  47  ILE C CG1 
2142 C CG2 . ILE C 47  ? 0.5502 0.5268 0.5189 0.0058  0.0375  0.0318  47  ILE C CG2 
2143 C CD1 . ILE C 47  ? 0.5840 0.5609 0.5423 0.0102  0.0395  0.0306  47  ILE C CD1 
2144 N N   . TYR C 48  ? 0.4758 0.4569 0.4541 0.0029  0.0362  0.0359  48  TYR C N   
2145 C CA  . TYR C 48  ? 0.4901 0.4722 0.4739 0.0018  0.0364  0.0365  48  TYR C CA  
2146 C C   . TYR C 48  ? 0.4812 0.4615 0.4662 0.0011  0.0358  0.0353  48  TYR C C   
2147 O O   . TYR C 48  ? 0.4681 0.4462 0.4507 0.0008  0.0342  0.0343  48  TYR C O   
2148 C CB  . TYR C 48  ? 0.4205 0.4042 0.4069 0.0009  0.0350  0.0381  48  TYR C CB  
2149 C CG  . TYR C 48  ? 0.4316 0.4166 0.4235 0.0002  0.0352  0.0387  48  TYR C CG  
2150 C CD1 . TYR C 48  ? 0.4402 0.4267 0.4350 0.0007  0.0363  0.0396  48  TYR C CD1 
2151 C CD2 . TYR C 48  ? 0.4076 0.3921 0.4019 -0.0008 0.0341  0.0386  48  TYR C CD2 
2152 C CE1 . TYR C 48  ? 0.4728 0.4603 0.4722 0.0006  0.0364  0.0398  48  TYR C CE1 
2153 C CE2 . TYR C 48  ? 0.4137 0.3997 0.4127 -0.0010 0.0344  0.0391  48  TYR C CE2 
2154 C CZ  . TYR C 48  ? 0.4661 0.4535 0.4673 -0.0002 0.0356  0.0395  48  TYR C CZ  
2155 O OH  . TYR C 48  ? 0.5872 0.5758 0.5926 0.0001  0.0358  0.0397  48  TYR C OH  
2156 N N   . GLN C 49  ? 0.5067 0.4877 0.4955 0.0009  0.0369  0.0355  49  GLN C N   
2157 C CA  . GLN C 49  ? 0.5647 0.5449 0.5554 0.0002  0.0365  0.0349  49  GLN C CA  
2158 C C   . GLN C 49  ? 0.5174 0.4996 0.5129 -0.0005 0.0360  0.0361  49  GLN C C   
2159 O O   . GLN C 49  ? 0.5150 0.4988 0.5132 -0.0001 0.0373  0.0364  49  GLN C O   
2160 C CB  . GLN C 49  ? 0.5369 0.5168 0.5278 0.0008  0.0382  0.0341  49  GLN C CB  
2161 C CG  . GLN C 49  ? 0.5412 0.5198 0.5283 0.0017  0.0392  0.0332  49  GLN C CG  
2162 C CD  . GLN C 49  ? 0.5859 0.5659 0.5727 0.0026  0.0405  0.0341  49  GLN C CD  
2163 O OE1 . GLN C 49  ? 0.6608 0.6426 0.6504 0.0024  0.0404  0.0352  49  GLN C OE1 
2164 N NE2 . GLN C 49  ? 0.5473 0.5267 0.5312 0.0036  0.0416  0.0337  49  GLN C NE2 
2165 N N   . PRO C 50  ? 0.4532 0.4350 0.4495 -0.0016 0.0341  0.0367  50  PRO C N   
2166 C CA  . PRO C 50  ? 0.4507 0.4345 0.4517 -0.0021 0.0337  0.0380  50  PRO C CA  
2167 C C   . PRO C 50  ? 0.5520 0.5369 0.5559 -0.0020 0.0347  0.0382  50  PRO C C   
2168 O O   . PRO C 50  ? 0.4436 0.4272 0.4466 -0.0024 0.0343  0.0377  50  PRO C O   
2169 C CB  . PRO C 50  ? 0.4603 0.4432 0.4612 -0.0033 0.0312  0.0387  50  PRO C CB  
2170 C CG  . PRO C 50  ? 0.4758 0.4556 0.4724 -0.0034 0.0300  0.0374  50  PRO C CG  
2171 C CD  . PRO C 50  ? 0.4781 0.4576 0.4712 -0.0021 0.0319  0.0361  50  PRO C CD  
2172 N N   . TYR C 51  ? 0.5605 0.5479 0.5678 -0.0014 0.0358  0.0388  51  TYR C N   
2173 C CA  . TYR C 51  ? 0.5102 0.4997 0.5207 -0.0011 0.0367  0.0395  51  TYR C CA  
2174 C C   . TYR C 51  ? 0.5133 0.5033 0.5264 -0.0023 0.0350  0.0411  51  TYR C C   
2175 O O   . TYR C 51  ? 0.5594 0.5490 0.5730 -0.0031 0.0334  0.0418  51  TYR C O   
2176 C CB  . TYR C 51  ? 0.4867 0.4787 0.4998 0.0003  0.0381  0.0396  51  TYR C CB  
2177 C CG  . TYR C 51  ? 0.4536 0.4483 0.4695 0.0013  0.0395  0.0401  51  TYR C CG  
2178 C CD1 . TYR C 51  ? 0.4625 0.4574 0.4772 0.0024  0.0411  0.0392  51  TYR C CD1 
2179 C CD2 . TYR C 51  ? 0.4503 0.4477 0.4700 0.0013  0.0391  0.0418  51  TYR C CD2 
2180 C CE1 . TYR C 51  ? 0.4609 0.4587 0.4778 0.0036  0.0424  0.0397  51  TYR C CE1 
2181 C CE2 . TYR C 51  ? 0.4736 0.4741 0.4957 0.0025  0.0406  0.0426  51  TYR C CE2 
2182 C CZ  . TYR C 51  ? 0.4365 0.4373 0.4570 0.0037  0.0423  0.0415  51  TYR C CZ  
2183 O OH  . TYR C 51  ? 0.5914 0.5957 0.6139 0.0052  0.0438  0.0423  51  TYR C OH  
2184 N N   . PRO C 52  ? 0.5158 0.5068 0.5309 -0.0026 0.0351  0.0420  52  PRO C N   
2185 C CA  . PRO C 52  ? 0.4479 0.4397 0.4629 -0.0019 0.0367  0.0416  52  PRO C CA  
2186 C C   . PRO C 52  ? 0.4820 0.4709 0.4946 -0.0027 0.0358  0.0407  52  PRO C C   
2187 O O   . PRO C 52  ? 0.4622 0.4515 0.4745 -0.0022 0.0371  0.0403  52  PRO C O   
2188 C CB  . PRO C 52  ? 0.4038 0.3993 0.4236 -0.0018 0.0371  0.0438  52  PRO C CB  
2189 C CG  . PRO C 52  ? 0.4745 0.4695 0.4965 -0.0033 0.0345  0.0455  52  PRO C CG  
2190 C CD  . PRO C 52  ? 0.4700 0.4623 0.4890 -0.0037 0.0334  0.0442  52  PRO C CD  
2191 N N   . SER C 53  ? 0.5196 0.5055 0.5301 -0.0037 0.0335  0.0403  53  SER C N   
2192 C CA  . SER C 53  ? 0.5677 0.5505 0.5757 -0.0042 0.0322  0.0391  53  SER C CA  
2193 C C   . SER C 53  ? 0.5515 0.5324 0.5549 -0.0032 0.0336  0.0369  53  SER C C   
2194 O O   . SER C 53  ? 0.5280 0.5074 0.5301 -0.0032 0.0337  0.0360  53  SER C O   
2195 C CB  . SER C 53  ? 0.5581 0.5382 0.5652 -0.0053 0.0289  0.0392  53  SER C CB  
2196 O OG  . SER C 53  ? 0.6901 0.6689 0.6936 -0.0049 0.0286  0.0381  53  SER C OG  
2197 N N   . GLY C 54  ? 0.4837 0.4648 0.4851 -0.0025 0.0346  0.0363  54  GLY C N   
2198 C CA  . GLY C 54  ? 0.4938 0.4736 0.4914 -0.0014 0.0361  0.0348  54  GLY C CA  
2199 C C   . GLY C 54  ? 0.4400 0.4167 0.4332 -0.0013 0.0349  0.0333  54  GLY C C   
2200 O O   . GLY C 54  ? 0.5454 0.5211 0.5358 -0.0004 0.0362  0.0322  54  GLY C O   
2201 N N   . ALA C 55  ? 0.5520 0.5269 0.5445 -0.0021 0.0323  0.0333  55  ALA C N   
2202 C CA  . ALA C 55  ? 0.5563 0.5280 0.5440 -0.0015 0.0308  0.0315  55  ALA C CA  
2203 C C   . ALA C 55  ? 0.6111 0.5831 0.5949 -0.0004 0.0317  0.0311  55  ALA C C   
2204 O O   . ALA C 55  ? 0.6006 0.5746 0.5859 -0.0006 0.0322  0.0323  55  ALA C O   
2205 C CB  . ALA C 55  ? 0.5554 0.5250 0.5435 -0.0025 0.0272  0.0316  55  ALA C CB  
2206 N N   . ASP C 56  ? 0.6222 0.5924 0.6015 0.0008  0.0320  0.0295  56  ASP C N   
2207 C CA  . ASP C 56  ? 0.6118 0.5826 0.5871 0.0021  0.0327  0.0294  56  ASP C CA  
2208 C C   . ASP C 56  ? 0.6777 0.6476 0.6508 0.0018  0.0302  0.0294  56  ASP C C   
2209 O O   . ASP C 56  ? 0.6903 0.6573 0.6609 0.0020  0.0277  0.0280  56  ASP C O   
2210 C CB  . ASP C 56  ? 0.6187 0.5881 0.5895 0.0038  0.0337  0.0277  56  ASP C CB  
2211 C CG  . ASP C 56  ? 0.7214 0.6923 0.6938 0.0042  0.0366  0.0282  56  ASP C CG  
2212 O OD1 . ASP C 56  ? 0.8996 0.8691 0.8698 0.0053  0.0373  0.0269  56  ASP C OD1 
2213 O OD2 . ASP C 56  ? 0.6608 0.6340 0.6368 0.0036  0.0379  0.0297  56  ASP C OD2 
2214 N N   . VAL C 57  ? 0.5135 0.4858 0.4878 0.0015  0.0305  0.0310  57  VAL C N   
2215 C CA  . VAL C 57  ? 0.5117 0.4835 0.4839 0.0013  0.0283  0.0313  57  VAL C CA  
2216 C C   . VAL C 57  ? 0.5063 0.4800 0.4749 0.0027  0.0295  0.0319  57  VAL C C   
2217 O O   . VAL C 57  ? 0.4525 0.4292 0.4236 0.0027  0.0315  0.0335  57  VAL C O   
2218 C CB  . VAL C 57  ? 0.5552 0.5283 0.5325 -0.0005 0.0271  0.0331  57  VAL C CB  
2219 C CG1 . VAL C 57  ? 0.4412 0.4133 0.4163 -0.0010 0.0244  0.0333  57  VAL C CG1 
2220 C CG2 . VAL C 57  ? 0.4609 0.4331 0.4424 -0.0017 0.0264  0.0331  57  VAL C CG2 
2221 N N   . PRO C 58  ? 0.5557 0.5278 0.5185 0.0040  0.0283  0.0305  58  PRO C N   
2222 C CA  . PRO C 58  ? 0.5249 0.4996 0.4841 0.0056  0.0296  0.0315  58  PRO C CA  
2223 C C   . PRO C 58  ? 0.5305 0.5072 0.4910 0.0045  0.0283  0.0334  58  PRO C C   
2224 O O   . PRO C 58  ? 0.4902 0.4650 0.4511 0.0033  0.0256  0.0331  58  PRO C O   
2225 C CB  . PRO C 58  ? 0.5437 0.5159 0.4959 0.0077  0.0285  0.0291  58  PRO C CB  
2226 C CG  . PRO C 58  ? 0.5546 0.5226 0.5069 0.0066  0.0251  0.0273  58  PRO C CG  
2227 C CD  . PRO C 58  ? 0.5288 0.4970 0.4880 0.0044  0.0255  0.0282  58  PRO C CD  
2228 N N   . PHE C 59  ? 0.5096 0.4901 0.4714 0.0048  0.0301  0.0357  59  PHE C N   
2229 C CA  . PHE C 59  ? 0.4999 0.4825 0.4631 0.0039  0.0290  0.0377  59  PHE C CA  
2230 C C   . PHE C 59  ? 0.5061 0.4915 0.4647 0.0057  0.0298  0.0389  59  PHE C C   
2231 O O   . PHE C 59  ? 0.4949 0.4828 0.4535 0.0070  0.0322  0.0400  59  PHE C O   
2232 C CB  . PHE C 59  ? 0.4656 0.4506 0.4358 0.0024  0.0299  0.0399  59  PHE C CB  
2233 C CG  . PHE C 59  ? 0.4595 0.4429 0.4343 0.0005  0.0285  0.0394  59  PHE C CG  
2234 C CD1 . PHE C 59  ? 0.4760 0.4576 0.4525 0.0004  0.0293  0.0380  59  PHE C CD1 
2235 C CD2 . PHE C 59  ? 0.4486 0.4324 0.4260 -0.0010 0.0266  0.0407  59  PHE C CD2 
2236 C CE1 . PHE C 59  ? 0.4443 0.4249 0.4250 -0.0011 0.0282  0.0380  59  PHE C CE1 
2237 C CE2 . PHE C 59  ? 0.4361 0.4187 0.4178 -0.0025 0.0255  0.0406  59  PHE C CE2 
2238 C CZ  . PHE C 59  ? 0.4444 0.4257 0.4278 -0.0025 0.0264  0.0394  59  PHE C CZ  
2239 N N   . GLY C 60  ? 0.4271 0.4122 0.3821 0.0059  0.0276  0.0389  60  GLY C N   
2240 C CA  . GLY C 60  ? 0.4617 0.4498 0.4120 0.0077  0.0281  0.0402  60  GLY C CA  
2241 C C   . GLY C 60  ? 0.4853 0.4787 0.4397 0.0074  0.0299  0.0440  60  GLY C C   
2242 O O   . GLY C 60  ? 0.4338 0.4282 0.3949 0.0054  0.0299  0.0456  60  GLY C O   
2243 N N   . PRO C 61  ? 0.5154 0.5123 0.4658 0.0095  0.0313  0.0455  61  PRO C N   
2244 C CA  . PRO C 61  ? 0.5203 0.5227 0.4747 0.0094  0.0328  0.0497  61  PRO C CA  
2245 C C   . PRO C 61  ? 0.4557 0.4597 0.4159 0.0068  0.0310  0.0521  61  PRO C C   
2246 O O   . PRO C 61  ? 0.4385 0.4446 0.4054 0.0056  0.0317  0.0543  61  PRO C O   
2247 C CB  . PRO C 61  ? 0.5300 0.5357 0.4777 0.0122  0.0336  0.0508  61  PRO C CB  
2248 C CG  . PRO C 61  ? 0.5395 0.5414 0.4802 0.0144  0.0338  0.0468  61  PRO C CG  
2249 C CD  . PRO C 61  ? 0.4892 0.4853 0.4311 0.0124  0.0314  0.0436  61  PRO C CD  
2250 N N   . PRO C 62  ? 0.5034 0.5062 0.4614 0.0060  0.0285  0.0515  62  PRO C N   
2251 C CA  . PRO C 62  ? 0.5060 0.5108 0.4700 0.0037  0.0270  0.0542  62  PRO C CA  
2252 C C   . PRO C 62  ? 0.5610 0.5630 0.5315 0.0013  0.0261  0.0532  62  PRO C C   
2253 O O   . PRO C 62  ? 0.5218 0.5249 0.4973 -0.0006 0.0246  0.0550  62  PRO C O   
2254 C CB  . PRO C 62  ? 0.5028 0.5071 0.4619 0.0036  0.0246  0.0540  62  PRO C CB  
2255 C CG  . PRO C 62  ? 0.5384 0.5379 0.4906 0.0051  0.0239  0.0499  62  PRO C CG  
2256 C CD  . PRO C 62  ? 0.5353 0.5351 0.4857 0.0072  0.0267  0.0489  62  PRO C CD  
2257 N N   . LEU C 63  ? 0.4434 0.4419 0.4138 0.0016  0.0269  0.0505  63  LEU C N   
2258 C CA  . LEU C 63  ? 0.4573 0.4538 0.4337 -0.0002 0.0264  0.0497  63  LEU C CA  
2259 C C   . LEU C 63  ? 0.4333 0.4313 0.4145 0.0000  0.0285  0.0505  63  LEU C C   
2260 O O   . LEU C 63  ? 0.5191 0.5156 0.5046 -0.0009 0.0286  0.0496  63  LEU C O   
2261 C CB  . LEU C 63  ? 0.4994 0.4913 0.4733 -0.0004 0.0255  0.0465  63  LEU C CB  
2262 C CG  . LEU C 63  ? 0.4928 0.4824 0.4632 -0.0010 0.0227  0.0456  63  LEU C CG  
2263 C CD1 . LEU C 63  ? 0.5036 0.4886 0.4724 -0.0011 0.0214  0.0428  63  LEU C CD1 
2264 C CD2 . LEU C 63  ? 0.4424 0.4334 0.4177 -0.0030 0.0209  0.0478  63  LEU C CD2 
2265 N N   . ASP C 64  ? 0.4829 0.4839 0.4631 0.0013  0.0301  0.0524  64  ASP C N   
2266 C CA  . ASP C 64  ? 0.4591 0.4620 0.4444 0.0014  0.0315  0.0539  64  ASP C CA  
2267 C C   . ASP C 64  ? 0.4838 0.4882 0.4763 -0.0004 0.0300  0.0559  64  ASP C C   
2268 O O   . ASP C 64  ? 0.5196 0.5256 0.5127 -0.0013 0.0283  0.0575  64  ASP C O   
2269 C CB  . ASP C 64  ? 0.4636 0.4701 0.4471 0.0030  0.0330  0.0564  64  ASP C CB  
2270 C CG  . ASP C 64  ? 0.5542 0.5630 0.5440 0.0029  0.0338  0.0588  64  ASP C CG  
2271 O OD1 . ASP C 64  ? 0.5859 0.5937 0.5752 0.0039  0.0354  0.0579  64  ASP C OD1 
2272 O OD2 . ASP C 64  ? 0.5219 0.5332 0.5171 0.0017  0.0324  0.0615  64  ASP C OD2 
2273 N N   . ILE C 65  ? 0.4490 0.4528 0.4468 -0.0007 0.0303  0.0556  65  ILE C N   
2274 C CA  . ILE C 65  ? 0.4704 0.4749 0.4747 -0.0021 0.0287  0.0567  65  ILE C CA  
2275 C C   . ILE C 65  ? 0.4814 0.4899 0.4894 -0.0025 0.0276  0.0606  65  ILE C C   
2276 O O   . ILE C 65  ? 0.4771 0.4867 0.4887 -0.0038 0.0257  0.0619  65  ILE C O   
2277 C CB  . ILE C 65  ? 0.4485 0.4513 0.4572 -0.0019 0.0291  0.0554  65  ILE C CB  
2278 C CG1 . ILE C 65  ? 0.4425 0.4458 0.4576 -0.0030 0.0273  0.0560  65  ILE C CG1 
2279 C CG2 . ILE C 65  ? 0.4447 0.4487 0.4547 -0.0009 0.0303  0.0565  65  ILE C CG2 
2280 C CD1 . ILE C 65  ? 0.4227 0.4250 0.4374 -0.0041 0.0262  0.0551  65  ILE C CD1 
2281 N N   . GLN C 66  ? 0.5067 0.5178 0.5144 -0.0015 0.0287  0.0626  66  GLN C N   
2282 C CA  . GLN C 66  ? 0.5849 0.6004 0.5965 -0.0018 0.0277  0.0669  66  GLN C CA  
2283 C C   . GLN C 66  ? 0.4883 0.5061 0.4962 -0.0022 0.0270  0.0685  66  GLN C C   
2284 O O   . GLN C 66  ? 0.5309 0.5516 0.5431 -0.0033 0.0252  0.0714  66  GLN C O   
2285 C CB  . GLN C 66  ? 0.5632 0.5810 0.5751 -0.0005 0.0292  0.0691  66  GLN C CB  
2286 C CG  . GLN C 66  ? 0.5979 0.6130 0.6126 0.0000  0.0299  0.0673  66  GLN C CG  
2287 C CD  . GLN C 66  ? 0.8034 0.8210 0.8239 0.0002  0.0294  0.0708  66  GLN C CD  
2288 O OE1 . GLN C 66  ? 0.8612 0.8789 0.8885 -0.0007 0.0273  0.0719  66  GLN C OE1 
2289 N NE2 . GLN C 66  ? 0.8389 0.8585 0.8571 0.0015  0.0312  0.0726  66  GLN C NE2 
2290 N N   . ILE C 67  ? 0.4261 0.4426 0.4263 -0.0011 0.0281  0.0665  67  ILE C N   
2291 C CA  . ILE C 67  ? 0.4287 0.4468 0.4245 -0.0012 0.0271  0.0674  67  ILE C CA  
2292 C C   . ILE C 67  ? 0.4361 0.4526 0.4347 -0.0032 0.0247  0.0668  67  ILE C C   
2293 O O   . ILE C 67  ? 0.4616 0.4808 0.4613 -0.0041 0.0232  0.0693  67  ILE C O   
2294 C CB  . ILE C 67  ? 0.4230 0.4390 0.4098 0.0006  0.0283  0.0647  67  ILE C CB  
2295 C CG1 . ILE C 67  ? 0.5064 0.5248 0.4904 0.0028  0.0308  0.0658  67  ILE C CG1 
2296 C CG2 . ILE C 67  ? 0.4195 0.4364 0.4014 0.0006  0.0268  0.0651  67  ILE C CG2 
2297 C CD1 . ILE C 67  ? 0.4746 0.4992 0.4599 0.0034  0.0311  0.0706  67  ILE C CD1 
2298 N N   . LEU C 68  ? 0.4522 0.4646 0.4520 -0.0039 0.0245  0.0637  68  LEU C N   
2299 C CA  . LEU C 68  ? 0.4243 0.4350 0.4268 -0.0057 0.0224  0.0631  68  LEU C CA  
2300 C C   . LEU C 68  ? 0.3918 0.4051 0.4023 -0.0071 0.0208  0.0659  68  LEU C C   
2301 O O   . LEU C 68  ? 0.3834 0.3974 0.3958 -0.0086 0.0189  0.0671  68  LEU C O   
2302 C CB  . LEU C 68  ? 0.3973 0.4037 0.3999 -0.0059 0.0226  0.0596  68  LEU C CB  
2303 C CG  . LEU C 68  ? 0.4142 0.4174 0.4095 -0.0051 0.0231  0.0568  68  LEU C CG  
2304 C CD1 . LEU C 68  ? 0.4219 0.4216 0.4179 -0.0050 0.0238  0.0539  68  LEU C CD1 
2305 C CD2 . LEU C 68  ? 0.3932 0.3955 0.3856 -0.0060 0.0209  0.0568  68  LEU C CD2 
2306 N N   . HIS C 69  ? 0.3916 0.4062 0.4070 -0.0067 0.0214  0.0670  69  HIS C N   
2307 C CA  . HIS C 69  ? 0.4115 0.4286 0.4349 -0.0079 0.0196  0.0697  69  HIS C CA  
2308 C C   . HIS C 69  ? 0.3975 0.4191 0.4214 -0.0084 0.0186  0.0738  69  HIS C C   
2309 O O   . HIS C 69  ? 0.3813 0.4047 0.4106 -0.0099 0.0164  0.0759  69  HIS C O   
2310 C CB  . HIS C 69  ? 0.4205 0.4376 0.4488 -0.0071 0.0201  0.0699  69  HIS C CB  
2311 C CG  . HIS C 69  ? 0.4979 0.5114 0.5287 -0.0069 0.0202  0.0667  69  HIS C CG  
2312 N ND1 . HIS C 69  ? 0.4639 0.4766 0.4998 -0.0079 0.0184  0.0662  69  HIS C ND1 
2313 C CD2 . HIS C 69  ? 0.4927 0.5035 0.5215 -0.0057 0.0219  0.0639  69  HIS C CD2 
2314 C CE1 . HIS C 69  ? 0.4698 0.4797 0.5066 -0.0071 0.0192  0.0633  69  HIS C CE1 
2315 N NE2 . HIS C 69  ? 0.4478 0.4565 0.4803 -0.0058 0.0212  0.0619  69  HIS C NE2 
2316 N N   . GLN C 70  ? 0.3992 0.4231 0.4178 -0.0071 0.0201  0.0750  70  GLN C N   
2317 C CA  . GLN C 70  ? 0.4695 0.4984 0.4879 -0.0073 0.0194  0.0792  70  GLN C CA  
2318 C C   . GLN C 70  ? 0.4600 0.4886 0.4737 -0.0080 0.0183  0.0788  70  GLN C C   
2319 O O   . GLN C 70  ? 0.4436 0.4758 0.4598 -0.0091 0.0166  0.0821  70  GLN C O   
2320 C CB  . GLN C 70  ? 0.4409 0.4728 0.4548 -0.0052 0.0217  0.0808  70  GLN C CB  
2321 C CG  . GLN C 70  ? 0.4365 0.4698 0.4560 -0.0046 0.0224  0.0827  70  GLN C CG  
2322 C CD  . GLN C 70  ? 0.5349 0.5703 0.5492 -0.0024 0.0250  0.0836  70  GLN C CD  
2323 O OE1 . GLN C 70  ? 0.4475 0.4881 0.4606 -0.0016 0.0256  0.0874  70  GLN C OE1 
2324 N NE2 . GLN C 70  ? 0.5291 0.5606 0.5404 -0.0012 0.0268  0.0801  70  GLN C NE2 
2325 N N   . VAL C 71  ? 0.4215 0.4459 0.4286 -0.0074 0.0189  0.0749  71  VAL C N   
2326 C CA  . VAL C 71  ? 0.3917 0.4150 0.3947 -0.0082 0.0173  0.0743  71  VAL C CA  
2327 C C   . VAL C 71  ? 0.4339 0.4565 0.4438 -0.0106 0.0149  0.0749  71  VAL C C   
2328 O O   . VAL C 71  ? 0.4477 0.4721 0.4582 -0.0119 0.0130  0.0770  71  VAL C O   
2329 C CB  . VAL C 71  ? 0.4006 0.4190 0.3960 -0.0072 0.0178  0.0699  71  VAL C CB  
2330 C CG1 . VAL C 71  ? 0.3704 0.3869 0.3630 -0.0084 0.0155  0.0692  71  VAL C CG1 
2331 C CG2 . VAL C 71  ? 0.4001 0.4196 0.3879 -0.0046 0.0199  0.0694  71  VAL C CG2 
2332 N N   . LEU C 72  ? 0.3850 0.4052 0.4004 -0.0112 0.0150  0.0733  72  LEU C N   
2333 C CA  . LEU C 72  ? 0.3938 0.4135 0.4163 -0.0131 0.0129  0.0739  72  LEU C CA  
2334 C C   . LEU C 72  ? 0.3996 0.4239 0.4289 -0.0142 0.0113  0.0781  72  LEU C C   
2335 O O   . LEU C 72  ? 0.4057 0.4307 0.4393 -0.0159 0.0092  0.0796  72  LEU C O   
2336 C CB  . LEU C 72  ? 0.3152 0.3318 0.3416 -0.0129 0.0136  0.0711  72  LEU C CB  
2337 C CG  . LEU C 72  ? 0.3583 0.3744 0.3921 -0.0144 0.0117  0.0715  72  LEU C CG  
2338 C CD1 . LEU C 72  ? 0.3427 0.3575 0.3752 -0.0159 0.0101  0.0713  72  LEU C CD1 
2339 C CD2 . LEU C 72  ? 0.3878 0.4014 0.4250 -0.0135 0.0126  0.0688  72  LEU C CD2 
2340 N N   . ASP C 73  ? 0.4380 0.4653 0.4690 -0.0132 0.0123  0.0803  73  ASP C N   
2341 C CA  . ASP C 73  ? 0.4337 0.4659 0.4710 -0.0142 0.0106  0.0850  73  ASP C CA  
2342 C C   . ASP C 73  ? 0.4499 0.4853 0.4840 -0.0150 0.0095  0.0877  73  ASP C C   
2343 O O   . ASP C 73  ? 0.4132 0.4509 0.4528 -0.0168 0.0072  0.0904  73  ASP C O   
2344 C CB  . ASP C 73  ? 0.4389 0.4743 0.4778 -0.0129 0.0118  0.0874  73  ASP C CB  
2345 C CG  . ASP C 73  ? 0.5239 0.5572 0.5691 -0.0126 0.0116  0.0862  73  ASP C CG  
2346 O OD1 . ASP C 73  ? 0.5744 0.6052 0.6244 -0.0136 0.0100  0.0845  73  ASP C OD1 
2347 O OD2 . ASP C 73  ? 0.5944 0.6287 0.6398 -0.0113 0.0129  0.0870  73  ASP C OD2 
2348 N N   . LEU C 74  ? 0.3702 0.4056 0.3952 -0.0136 0.0111  0.0868  74  LEU C N   
2349 C CA  . LEU C 74  ? 0.4131 0.4512 0.4334 -0.0138 0.0102  0.0888  74  LEU C CA  
2350 C C   . LEU C 74  ? 0.4604 0.4956 0.4815 -0.0159 0.0079  0.0875  74  LEU C C   
2351 O O   . LEU C 74  ? 0.4235 0.4616 0.4470 -0.0174 0.0058  0.0905  74  LEU C O   
2352 C CB  . LEU C 74  ? 0.4059 0.4434 0.4156 -0.0114 0.0123  0.0869  74  LEU C CB  
2353 C CG  . LEU C 74  ? 0.5120 0.5507 0.5142 -0.0110 0.0114  0.0873  74  LEU C CG  
2354 C CD1 . LEU C 74  ? 0.4261 0.4721 0.4298 -0.0110 0.0110  0.0929  74  LEU C CD1 
2355 C CD2 . LEU C 74  ? 0.4321 0.4679 0.4239 -0.0084 0.0132  0.0837  74  LEU C CD2 
2356 N N   . GLN C 75  ? 0.4060 0.4357 0.4258 -0.0159 0.0081  0.0833  75  GLN C N   
2357 C CA  . GLN C 75  ? 0.4280 0.4546 0.4479 -0.0176 0.0060  0.0820  75  GLN C CA  
2358 C C   . GLN C 75  ? 0.3902 0.4181 0.4199 -0.0199 0.0039  0.0842  75  GLN C C   
2359 O O   . GLN C 75  ? 0.4178 0.4461 0.4487 -0.0217 0.0017  0.0856  75  GLN C O   
2360 C CB  . GLN C 75  ? 0.4381 0.4591 0.4551 -0.0170 0.0069  0.0774  75  GLN C CB  
2361 C CG  . GLN C 75  ? 0.4476 0.4651 0.4643 -0.0187 0.0048  0.0762  75  GLN C CG  
2362 C CD  . GLN C 75  ? 0.4716 0.4843 0.4864 -0.0181 0.0056  0.0723  75  GLN C CD  
2363 O OE1 . GLN C 75  ? 0.4260 0.4363 0.4335 -0.0166 0.0065  0.0700  75  GLN C OE1 
2364 N NE2 . GLN C 75  ? 0.4206 0.4319 0.4420 -0.0190 0.0054  0.0717  75  GLN C NE2 
2365 N N   . ILE C 76  ? 0.3426 0.3709 0.3792 -0.0197 0.0044  0.0842  76  ILE C N   
2366 C CA  . ILE C 76  ? 0.3686 0.3982 0.4148 -0.0214 0.0023  0.0862  76  ILE C CA  
2367 C C   . ILE C 76  ? 0.4461 0.4811 0.4959 -0.0226 0.0005  0.0912  76  ILE C C   
2368 O O   . ILE C 76  ? 0.4112 0.4473 0.4669 -0.0246 -0.0019 0.0931  76  ILE C O   
2369 C CB  . ILE C 76  ? 0.4036 0.4323 0.4555 -0.0204 0.0031  0.0849  76  ILE C CB  
2370 C CG1 . ILE C 76  ? 0.4074 0.4312 0.4571 -0.0196 0.0045  0.0804  76  ILE C CG1 
2371 C CG2 . ILE C 76  ? 0.2840 0.3147 0.3462 -0.0217 0.0007  0.0874  76  ILE C CG2 
2372 C CD1 . ILE C 76  ? 0.3248 0.3473 0.3787 -0.0182 0.0055  0.0787  76  ILE C CD1 
2373 N N   . ALA C 77  ? 0.3643 0.4030 0.4109 -0.0214 0.0017  0.0934  77  ALA C N   
2374 C CA  . ALA C 77  ? 0.4128 0.4574 0.4624 -0.0224 0.0003  0.0986  77  ALA C CA  
2375 C C   . ALA C 77  ? 0.4262 0.4715 0.4712 -0.0236 -0.0011 0.0996  77  ALA C C   
2376 O O   . ALA C 77  ? 0.4467 0.4953 0.4969 -0.0255 -0.0034 0.1032  77  ALA C O   
2377 C CB  . ALA C 77  ? 0.3948 0.4436 0.4414 -0.0205 0.0022  0.1010  77  ALA C CB  
2378 N N   . ILE C 78  ? 0.3951 0.4371 0.4306 -0.0224 0.0000  0.0964  78  ILE C N   
2379 C CA  . ILE C 78  ? 0.3573 0.3989 0.3878 -0.0234 -0.0016 0.0966  78  ILE C CA  
2380 C C   . ILE C 78  ? 0.4340 0.4731 0.4708 -0.0260 -0.0042 0.0964  78  ILE C C   
2381 O O   . ILE C 78  ? 0.4037 0.4449 0.4418 -0.0278 -0.0065 0.0992  78  ILE C O   
2382 C CB  . ILE C 78  ? 0.3539 0.3912 0.3735 -0.0216 -0.0003 0.0926  78  ILE C CB  
2383 C CG1 . ILE C 78  ? 0.4215 0.4621 0.4340 -0.0189 0.0020  0.0933  78  ILE C CG1 
2384 C CG2 . ILE C 78  ? 0.3851 0.4203 0.4005 -0.0228 -0.0027 0.0921  78  ILE C CG2 
2385 C CD1 . ILE C 78  ? 0.4258 0.4621 0.4277 -0.0167 0.0032  0.0890  78  ILE C CD1 
2386 N N   . GLU C 79  ? 0.4142 0.4492 0.4550 -0.0262 -0.0038 0.0934  79  GLU C N   
2387 C CA  . GLU C 79  ? 0.4699 0.5028 0.5174 -0.0283 -0.0060 0.0933  79  GLU C CA  
2388 C C   . GLU C 79  ? 0.4429 0.4800 0.5000 -0.0301 -0.0080 0.0973  79  GLU C C   
2389 O O   . GLU C 79  ? 0.4449 0.4815 0.5068 -0.0322 -0.0103 0.0984  79  GLU C O   
2390 C CB  . GLU C 79  ? 0.4179 0.4465 0.4682 -0.0277 -0.0048 0.0896  79  GLU C CB  
2391 C CG  . GLU C 79  ? 0.4723 0.4962 0.5150 -0.0266 -0.0035 0.0856  79  GLU C CG  
2392 C CD  . GLU C 79  ? 0.6346 0.6551 0.6812 -0.0261 -0.0025 0.0826  79  GLU C CD  
2393 O OE1 . GLU C 79  ? 0.6366 0.6556 0.6800 -0.0242 -0.0001 0.0801  79  GLU C OE1 
2394 O OE2 . GLU C 79  ? 0.5353 0.5549 0.5881 -0.0274 -0.0039 0.0829  79  GLU C OE2 
2395 N N   . ASN C 80  ? 0.3844 0.4254 0.4447 -0.0293 -0.0074 0.0997  80  ASN C N   
2396 C CA  . ASN C 80  ? 0.3763 0.4212 0.4468 -0.0309 -0.0096 0.1036  80  ASN C CA  
2397 C C   . ASN C 80  ? 0.3892 0.4397 0.4593 -0.0320 -0.0110 0.1086  80  ASN C C   
2398 O O   . ASN C 80  ? 0.3771 0.4314 0.4557 -0.0336 -0.0133 0.1125  80  ASN C O   
2399 C CB  . ASN C 80  ? 0.3863 0.4324 0.4619 -0.0295 -0.0087 0.1039  80  ASN C CB  
2400 C CG  . ASN C 80  ? 0.4509 0.4922 0.5297 -0.0287 -0.0081 0.0997  80  ASN C CG  
2401 O OD1 . ASN C 80  ? 0.5401 0.5786 0.6217 -0.0297 -0.0092 0.0980  80  ASN C OD1 
2402 N ND2 . ASN C 80  ? 0.5027 0.5431 0.5809 -0.0268 -0.0063 0.0981  80  ASN C ND2 
2403 N N   . ILE C 81  ? 0.3884 0.4396 0.4486 -0.0310 -0.0098 0.1084  81  ILE C N   
2404 C CA  . ILE C 81  ? 0.4071 0.4640 0.4654 -0.0316 -0.0108 0.1130  81  ILE C CA  
2405 C C   . ILE C 81  ? 0.4138 0.4715 0.4770 -0.0345 -0.0140 0.1154  81  ILE C C   
2406 O O   . ILE C 81  ? 0.4088 0.4619 0.4704 -0.0355 -0.0150 0.1127  81  ILE C O   
2407 C CB  . ILE C 81  ? 0.4131 0.4698 0.4587 -0.0296 -0.0090 0.1116  81  ILE C CB  
2408 C CG1 . ILE C 81  ? 0.3841 0.4423 0.4255 -0.0267 -0.0059 0.1110  81  ILE C CG1 
2409 C CG2 . ILE C 81  ? 0.4805 0.5424 0.5235 -0.0303 -0.0105 0.1159  81  ILE C CG2 
2410 C CD1 . ILE C 81  ? 0.3976 0.4552 0.4263 -0.0242 -0.0040 0.1090  81  ILE C CD1 
2411 N N   . THR C 82  ? 0.4443 0.5081 0.5142 -0.0359 -0.0158 0.1208  82  THR C N   
2412 C CA  . THR C 82  ? 0.4443 0.5096 0.5190 -0.0387 -0.0190 0.1237  82  THR C CA  
2413 C C   . THR C 82  ? 0.4856 0.5570 0.5556 -0.0389 -0.0195 0.1282  82  THR C C   
2414 O O   . THR C 82  ? 0.4814 0.5573 0.5475 -0.0370 -0.0177 0.1304  82  THR C O   
2415 C CB  . THR C 82  ? 0.4417 0.5089 0.5300 -0.0407 -0.0214 0.1264  82  THR C CB  
2416 O OG1 . THR C 82  ? 0.4675 0.5411 0.5604 -0.0403 -0.0214 0.1310  82  THR C OG1 
2417 C CG2 . THR C 82  ? 0.3825 0.4441 0.4751 -0.0400 -0.0207 0.1219  82  THR C CG2 
2418 N N   . ALA C 83  ? 0.4502 0.5218 0.5204 -0.0411 -0.0220 0.1297  83  ALA C N   
2419 C CA  . ALA C 83  ? 0.3965 0.4742 0.4635 -0.0415 -0.0230 0.1344  83  ALA C CA  
2420 C C   . ALA C 83  ? 0.4731 0.5534 0.5499 -0.0451 -0.0267 0.1386  83  ALA C C   
2421 O O   . ALA C 83  ? 0.4652 0.5408 0.5472 -0.0470 -0.0284 0.1365  83  ALA C O   
2422 C CB  . ALA C 83  ? 0.4084 0.4834 0.4619 -0.0401 -0.0224 0.1317  83  ALA C CB  
2423 N N   . SER C 84  ? 0.4358 0.5238 0.5156 -0.0458 -0.0278 0.1446  84  SER C N   
2424 C CA  . SER C 84  ? 0.4468 0.5380 0.5356 -0.0492 -0.0314 0.1491  84  SER C CA  
2425 C C   . SER C 84  ? 0.4464 0.5367 0.5276 -0.0503 -0.0329 0.1492  84  SER C C   
2426 O O   . SER C 84  ? 0.4118 0.5044 0.4823 -0.0483 -0.0316 0.1496  84  SER C O   
2427 C CB  . SER C 84  ? 0.4603 0.5605 0.5564 -0.0498 -0.0322 0.1561  84  SER C CB  
2428 O OG  . SER C 84  ? 0.5350 0.6380 0.6418 -0.0533 -0.0360 0.1604  84  SER C OG  
2429 N N   . TYR C 85  ? 0.5160 0.6028 0.6025 -0.0531 -0.0357 0.1487  85  TYR C N   
2430 C CA  . TYR C 85  ? 0.5504 0.6370 0.6317 -0.0547 -0.0379 0.1498  85  TYR C CA  
2431 C C   . TYR C 85  ? 0.5138 0.6013 0.6062 -0.0586 -0.0417 0.1531  85  TYR C C   
2432 O O   . TYR C 85  ? 0.5179 0.6004 0.6170 -0.0600 -0.0427 0.1506  85  TYR C O   
2433 C CB  . TYR C 85  ? 0.4785 0.5569 0.5501 -0.0537 -0.0374 0.1438  85  TYR C CB  
2434 C CG  . TYR C 85  ? 0.5813 0.6595 0.6463 -0.0550 -0.0399 0.1450  85  TYR C CG  
2435 C CD1 . TYR C 85  ? 0.5633 0.6438 0.6158 -0.0525 -0.0390 0.1452  85  TYR C CD1 
2436 C CD2 . TYR C 85  ? 0.5727 0.6486 0.6439 -0.0584 -0.0433 0.1462  85  TYR C CD2 
2437 C CE1 . TYR C 85  ? 0.6193 0.6994 0.6654 -0.0535 -0.0416 0.1462  85  TYR C CE1 
2438 C CE2 . TYR C 85  ? 0.6187 0.6944 0.6841 -0.0596 -0.0459 0.1475  85  TYR C CE2 
2439 C CZ  . TYR C 85  ? 0.6480 0.7256 0.7007 -0.0571 -0.0451 0.1474  85  TYR C CZ  
2440 O OH  . TYR C 85  ? 0.6797 0.7568 0.7263 -0.0582 -0.0479 0.1484  85  TYR C OH  
2441 N N   . ASP C 86  ? 0.6472 0.7415 0.7411 -0.0601 -0.0436 0.1589  86  ASP C N   
2442 C CA  . ASP C 86  ? 0.6472 0.7448 0.7535 -0.0639 -0.0472 0.1637  86  ASP C CA  
2443 C C   . ASP C 86  ? 0.6470 0.7454 0.7662 -0.0643 -0.0473 0.1644  86  ASP C C   
2444 O O   . ASP C 86  ? 0.7489 0.8514 0.8691 -0.0625 -0.0456 0.1660  86  ASP C O   
2445 C CB  . ASP C 86  ? 0.6394 0.7311 0.7465 -0.0664 -0.0498 0.1617  86  ASP C CB  
2446 C CG  . ASP C 86  ? 0.7307 0.8223 0.8263 -0.0664 -0.0508 0.1620  86  ASP C CG  
2447 O OD1 . ASP C 86  ? 0.6355 0.7329 0.7238 -0.0647 -0.0497 0.1648  86  ASP C OD1 
2448 O OD2 . ASP C 86  ? 0.7833 0.8693 0.8774 -0.0680 -0.0527 0.1598  86  ASP C OD2 
2449 N N   . ASN C 87  ? 0.6478 0.7422 0.7766 -0.0665 -0.0494 0.1630  87  ASN C N   
2450 C CA  . ASN C 87  ? 0.6986 0.7931 0.8390 -0.0665 -0.0497 0.1630  87  ASN C CA  
2451 C C   . ASN C 87  ? 0.6772 0.7643 0.8153 -0.0642 -0.0473 0.1563  87  ASN C C   
2452 O O   . ASN C 87  ? 0.6637 0.7493 0.8112 -0.0642 -0.0479 0.1552  87  ASN C O   
2453 C CB  . ASN C 87  ? 0.7815 0.8772 0.9356 -0.0699 -0.0538 0.1663  87  ASN C CB  
2454 C CG  . ASN C 87  ? 0.7816 0.8860 0.9418 -0.0720 -0.0563 0.1738  87  ASN C CG  
2455 O OD1 . ASN C 87  ? 0.8618 0.9712 1.0285 -0.0715 -0.0566 0.1772  87  ASN C OD1 
2456 N ND2 . ASN C 87  ? 0.7907 0.8971 0.9489 -0.0743 -0.0583 0.1768  87  ASN C ND2 
2457 N N   . GLU C 88  ? 0.6344 0.7171 0.7602 -0.0623 -0.0447 0.1519  88  GLU C N   
2458 C CA  . GLU C 88  ? 0.6748 0.7506 0.7978 -0.0602 -0.0424 0.1456  88  GLU C CA  
2459 C C   . GLU C 88  ? 0.5828 0.6589 0.6992 -0.0569 -0.0389 0.1435  88  GLU C C   
2460 O O   . GLU C 88  ? 0.5033 0.5837 0.6130 -0.0557 -0.0377 0.1457  88  GLU C O   
2461 C CB  . GLU C 88  ? 0.6754 0.7452 0.7900 -0.0604 -0.0422 0.1419  88  GLU C CB  
2462 C CG  . GLU C 88  ? 0.7369 0.8064 0.8557 -0.0637 -0.0456 0.1443  88  GLU C CG  
2463 C CD  . GLU C 88  ? 0.7497 0.8157 0.8572 -0.0637 -0.0458 0.1426  88  GLU C CD  
2464 O OE1 . GLU C 88  ? 0.8170 0.8856 0.9236 -0.0658 -0.0483 0.1461  88  GLU C OE1 
2465 O OE2 . GLU C 88  ? 0.7622 0.8229 0.8619 -0.0617 -0.0438 0.1378  88  GLU C OE2 
2466 N N   . THR C 89  ? 0.5736 0.6451 0.6919 -0.0553 -0.0373 0.1391  89  THR C N   
2467 C CA  . THR C 89  ? 0.5401 0.6104 0.6512 -0.0521 -0.0338 0.1360  89  THR C CA  
2468 C C   . THR C 89  ? 0.5420 0.6055 0.6436 -0.0508 -0.0319 0.1304  89  THR C C   
2469 O O   . THR C 89  ? 0.5872 0.6458 0.6922 -0.0511 -0.0321 0.1271  89  THR C O   
2470 C CB  . THR C 89  ? 0.5306 0.6006 0.6500 -0.0510 -0.0334 0.1351  89  THR C CB  
2471 O OG1 . THR C 89  ? 0.5378 0.6143 0.6658 -0.0522 -0.0354 0.1407  89  THR C OG1 
2472 C CG2 . THR C 89  ? 0.4941 0.5622 0.6059 -0.0478 -0.0297 0.1316  89  THR C CG2 
2473 N N   . VAL C 90  ? 0.4518 0.5153 0.5417 -0.0493 -0.0303 0.1296  90  VAL C N   
2474 C CA  . VAL C 90  ? 0.4386 0.4959 0.5190 -0.0481 -0.0290 0.1246  90  VAL C CA  
2475 C C   . VAL C 90  ? 0.5184 0.5728 0.5952 -0.0451 -0.0256 0.1204  90  VAL C C   
2476 O O   . VAL C 90  ? 0.4586 0.5161 0.5318 -0.0431 -0.0236 0.1211  90  VAL C O   
2477 C CB  . VAL C 90  ? 0.4193 0.4772 0.4882 -0.0475 -0.0291 0.1251  90  VAL C CB  
2478 C CG1 . VAL C 90  ? 0.4220 0.4731 0.4820 -0.0462 -0.0282 0.1199  90  VAL C CG1 
2479 C CG2 . VAL C 90  ? 0.4360 0.4968 0.5077 -0.0503 -0.0325 0.1292  90  VAL C CG2 
2480 N N   . THR C 91  ? 0.5398 0.5885 0.6177 -0.0449 -0.0251 0.1162  91  THR C N   
2481 C CA  . THR C 91  ? 0.4901 0.5354 0.5640 -0.0423 -0.0220 0.1120  91  THR C CA  
2482 C C   . THR C 91  ? 0.4932 0.5337 0.5566 -0.0412 -0.0212 0.1083  91  THR C C   
2483 O O   . THR C 91  ? 0.5010 0.5399 0.5616 -0.0427 -0.0232 0.1088  91  THR C O   
2484 C CB  . THR C 91  ? 0.4729 0.5155 0.5554 -0.0424 -0.0218 0.1099  91  THR C CB  
2485 O OG1 . THR C 91  ? 0.5144 0.5530 0.5981 -0.0438 -0.0232 0.1084  91  THR C OG1 
2486 C CG2 . THR C 91  ? 0.4189 0.4655 0.5126 -0.0436 -0.0236 0.1133  91  THR C CG2 
2487 N N   . LEU C 92  ? 0.4396 0.4776 0.4975 -0.0387 -0.0184 0.1048  92  LEU C N   
2488 C CA  . LEU C 92  ? 0.4587 0.4916 0.5076 -0.0377 -0.0179 0.1011  92  LEU C CA  
2489 C C   . LEU C 92  ? 0.4921 0.5203 0.5454 -0.0393 -0.0193 0.0994  92  LEU C C   
2490 O O   . LEU C 92  ? 0.5044 0.5289 0.5526 -0.0398 -0.0206 0.0980  92  LEU C O   
2491 C CB  . LEU C 92  ? 0.4841 0.5153 0.5274 -0.0348 -0.0147 0.0977  92  LEU C CB  
2492 C CG  . LEU C 92  ? 0.4971 0.5225 0.5327 -0.0337 -0.0141 0.0935  92  LEU C CG  
2493 C CD1 . LEU C 92  ? 0.4378 0.4621 0.4645 -0.0336 -0.0158 0.0935  92  LEU C CD1 
2494 C CD2 . LEU C 92  ? 0.5423 0.5667 0.5741 -0.0310 -0.0109 0.0906  92  LEU C CD2 
2495 N N   . GLN C 93  ? 0.4453 0.4740 0.5083 -0.0400 -0.0192 0.0997  93  GLN C N   
2496 C CA  . GLN C 93  ? 0.5324 0.5577 0.6006 -0.0413 -0.0203 0.0986  93  GLN C CA  
2497 C C   . GLN C 93  ? 0.5119 0.5372 0.5826 -0.0441 -0.0236 0.1013  93  GLN C C   
2498 O O   . GLN C 93  ? 0.4746 0.4967 0.5476 -0.0452 -0.0247 0.1006  93  GLN C O   
2499 C CB  . GLN C 93  ? 0.4899 0.5161 0.5677 -0.0409 -0.0194 0.0983  93  GLN C CB  
2500 C CG  . GLN C 93  ? 0.6438 0.6691 0.7196 -0.0382 -0.0163 0.0953  93  GLN C CG  
2501 C CD  . GLN C 93  ? 0.6975 0.7265 0.7716 -0.0370 -0.0153 0.0966  93  GLN C CD  
2502 O OE1 . GLN C 93  ? 0.6365 0.6695 0.7166 -0.0381 -0.0167 0.0999  93  GLN C OE1 
2503 N NE2 . GLN C 93  ? 0.6408 0.6687 0.7071 -0.0349 -0.0129 0.0944  93  GLN C NE2 
2504 N N   . ASP C 94  ? 0.4678 0.4971 0.5384 -0.0453 -0.0252 0.1048  94  ASP C N   
2505 C CA  . ASP C 94  ? 0.4788 0.5085 0.5509 -0.0479 -0.0285 0.1075  94  ASP C CA  
2506 C C   . ASP C 94  ? 0.4526 0.4785 0.5147 -0.0478 -0.0296 0.1060  94  ASP C C   
2507 O O   . ASP C 94  ? 0.5528 0.5765 0.6158 -0.0499 -0.0323 0.1070  94  ASP C O   
2508 C CB  . ASP C 94  ? 0.4570 0.4925 0.5319 -0.0492 -0.0299 0.1120  94  ASP C CB  
2509 C CG  . ASP C 94  ? 0.5027 0.5416 0.5892 -0.0499 -0.0301 0.1141  94  ASP C CG  
2510 O OD1 . ASP C 94  ? 0.5315 0.5680 0.6250 -0.0505 -0.0304 0.1128  94  ASP C OD1 
2511 O OD2 . ASP C 94  ? 0.5259 0.5698 0.6146 -0.0499 -0.0302 0.1171  94  ASP C OD2 
2512 N N   . ILE C 95  ? 0.4239 0.4490 0.4765 -0.0454 -0.0278 0.1037  95  ILE C N   
2513 C CA  . ILE C 95  ? 0.4541 0.4762 0.4964 -0.0449 -0.0292 0.1025  95  ILE C CA  
2514 C C   . ILE C 95  ? 0.4773 0.4940 0.5128 -0.0429 -0.0280 0.0980  95  ILE C C   
2515 O O   . ILE C 95  ? 0.5277 0.5413 0.5543 -0.0422 -0.0294 0.0964  95  ILE C O   
2516 C CB  . ILE C 95  ? 0.4770 0.5035 0.5121 -0.0436 -0.0289 0.1042  95  ILE C CB  
2517 C CG1 . ILE C 95  ? 0.4682 0.4968 0.5003 -0.0407 -0.0252 0.1027  95  ILE C CG1 
2518 C CG2 . ILE C 95  ? 0.4668 0.4989 0.5082 -0.0458 -0.0306 0.1092  95  ILE C CG2 
2519 C CD1 . ILE C 95  ? 0.4087 0.4418 0.4330 -0.0388 -0.0244 0.1043  95  ILE C CD1 
2520 N N   . CYS C 96  ? 0.4285 0.4440 0.4681 -0.0419 -0.0255 0.0959  96  CYS C N   
2521 C CA  . CYS C 96  ? 0.5314 0.5427 0.5648 -0.0398 -0.0239 0.0919  96  CYS C CA  
2522 C C   . CYS C 96  ? 0.5005 0.5065 0.5358 -0.0410 -0.0256 0.0905  96  CYS C C   
2523 O O   . CYS C 96  ? 0.4423 0.4484 0.4856 -0.0431 -0.0271 0.0924  96  CYS C O   
2524 C CB  . CYS C 96  ? 0.4563 0.4691 0.4922 -0.0379 -0.0202 0.0903  96  CYS C CB  
2525 S SG  . CYS C 96  ? 0.5422 0.5548 0.5901 -0.0389 -0.0195 0.0905  96  CYS C SG  
2526 N N   . LEU C 97  ? 0.4832 0.4850 0.5116 -0.0395 -0.0255 0.0874  97  LEU C N   
2527 C CA  . LEU C 97  ? 0.4748 0.4721 0.5058 -0.0402 -0.0265 0.0861  97  LEU C CA  
2528 C C   . LEU C 97  ? 0.4846 0.4834 0.5233 -0.0396 -0.0234 0.0856  97  LEU C C   
2529 O O   . LEU C 97  ? 0.4659 0.4652 0.5024 -0.0374 -0.0204 0.0834  97  LEU C O   
2530 C CB  . LEU C 97  ? 0.5259 0.5185 0.5478 -0.0385 -0.0272 0.0829  97  LEU C CB  
2531 C CG  . LEU C 97  ? 0.5704 0.5584 0.5944 -0.0389 -0.0280 0.0815  97  LEU C CG  
2532 C CD1 . LEU C 97  ? 0.5623 0.5487 0.5925 -0.0417 -0.0314 0.0840  97  LEU C CD1 
2533 C CD2 . LEU C 97  ? 0.6647 0.6483 0.6792 -0.0372 -0.0293 0.0784  97  LEU C CD2 
2534 N N   . ALA C 98  ? 0.4319 0.4314 0.4796 -0.0415 -0.0242 0.0877  98  ALA C N   
2535 C CA  . ALA C 98  ? 0.4658 0.4663 0.5208 -0.0408 -0.0217 0.0871  98  ALA C CA  
2536 C C   . ALA C 98  ? 0.4947 0.4921 0.5534 -0.0419 -0.0232 0.0874  98  ALA C C   
2537 O O   . ALA C 98  ? 0.5264 0.5246 0.5922 -0.0438 -0.0248 0.0899  98  ALA C O   
2538 C CB  . ALA C 98  ? 0.4706 0.4754 0.5338 -0.0415 -0.0212 0.0893  98  ALA C CB  
2539 N N   . PRO C 99  ? 0.5372 0.5312 0.5914 -0.0407 -0.0228 0.0851  99  PRO C N   
2540 C CA  . PRO C 99  ? 0.5831 0.5738 0.6395 -0.0418 -0.0248 0.0857  99  PRO C CA  
2541 C C   . PRO C 99  ? 0.5984 0.5910 0.6651 -0.0424 -0.0238 0.0875  99  PRO C C   
2542 O O   . PRO C 99  ? 0.6286 0.6195 0.6993 -0.0440 -0.0261 0.0894  99  PRO C O   
2543 C CB  . PRO C 99  ? 0.5735 0.5614 0.6237 -0.0398 -0.0235 0.0826  99  PRO C CB  
2544 C CG  . PRO C 99  ? 0.5464 0.5371 0.5943 -0.0375 -0.0197 0.0806  99  PRO C CG  
2545 C CD  . PRO C 99  ? 0.5416 0.5352 0.5890 -0.0382 -0.0202 0.0821  99  PRO C CD  
2546 N N   . LEU C 100 ? 0.6523 0.6483 0.7231 -0.0409 -0.0205 0.0869  100 LEU C N   
2547 C CA  . LEU C 100 ? 0.7344 0.7324 0.8143 -0.0408 -0.0192 0.0882  100 LEU C CA  
2548 C C   . LEU C 100 ? 0.7818 0.7831 0.8687 -0.0416 -0.0195 0.0902  100 LEU C C   
2549 O O   . LEU C 100 ? 0.8382 0.8420 0.9314 -0.0404 -0.0175 0.0901  100 LEU C O   
2550 C CB  . LEU C 100 ? 0.7706 0.7696 0.8503 -0.0380 -0.0155 0.0857  100 LEU C CB  
2551 C CG  . LEU C 100 ? 0.7576 0.7547 0.8372 -0.0373 -0.0149 0.0853  100 LEU C CG  
2552 C CD1 . LEU C 100 ? 0.7276 0.7205 0.8022 -0.0389 -0.0182 0.0857  100 LEU C CD1 
2553 C CD2 . LEU C 100 ? 0.6666 0.6642 0.7430 -0.0346 -0.0114 0.0824  100 LEU C CD2 
2554 N N   . SER C 101 ? 0.6495 0.6509 0.7353 -0.0437 -0.0222 0.0919  101 SER C N   
2555 C CA  . SER C 101 ? 0.7693 0.7738 0.8624 -0.0449 -0.0230 0.0942  101 SER C CA  
2556 C C   . SER C 101 ? 0.7691 0.7737 0.8705 -0.0464 -0.0244 0.0967  101 SER C C   
2557 O O   . SER C 101 ? 0.6818 0.6836 0.7823 -0.0475 -0.0261 0.0976  101 SER C O   
2558 C CB  . SER C 101 ? 0.6759 0.6808 0.7654 -0.0467 -0.0256 0.0957  101 SER C CB  
2559 O OG  . SER C 101 ? 0.7425 0.7474 0.8238 -0.0453 -0.0244 0.0937  101 SER C OG  
2560 N N   . PRO C 102 ? 0.6527 0.6603 0.7624 -0.0463 -0.0239 0.0980  102 PRO C N   
2561 C CA  . PRO C 102 ? 0.7198 0.7305 0.8321 -0.0450 -0.0224 0.0971  102 PRO C CA  
2562 C C   . PRO C 102 ? 0.8307 0.8423 0.9438 -0.0417 -0.0188 0.0943  102 PRO C C   
2563 O O   . PRO C 102 ? 0.8304 0.8433 0.9419 -0.0401 -0.0173 0.0925  102 PRO C O   
2564 C CB  . PRO C 102 ? 0.6205 0.6333 0.7422 -0.0466 -0.0242 0.0999  102 PRO C CB  
2565 C CG  . PRO C 102 ? 0.6125 0.6240 0.7381 -0.0474 -0.0248 0.1014  102 PRO C CG  
2566 C CD  . PRO C 102 ? 0.6285 0.6366 0.7465 -0.0479 -0.0255 0.1008  102 PRO C CD  
2567 N N   . TYR C 103 ? 1.5522 1.5634 1.6685 -0.0409 -0.0177 0.0943  103 TYR C N   
2568 C CA  . TYR C 103 ? 1.7003 1.7113 1.8146 -0.0380 -0.0145 0.0918  103 TYR C CA  
2569 C C   . TYR C 103 ? 1.6435 1.6545 1.7516 -0.0360 -0.0124 0.0887  103 TYR C C   
2570 O O   . TYR C 103 ? 1.6388 1.6514 1.7490 -0.0334 -0.0100 0.0868  103 TYR C O   
2571 C CB  . TYR C 103 ? 1.3025 1.3109 1.4138 -0.0389 -0.0152 0.0926  103 TYR C CB  
2572 C CG  . TYR C 103 ? 1.3665 1.3743 1.4746 -0.0367 -0.0125 0.0905  103 TYR C CG  
2573 C CD1 . TYR C 103 ? 1.3819 1.3920 1.4923 -0.0336 -0.0092 0.0887  103 TYR C CD1 
2574 C CD2 . TYR C 103 ? 1.3224 1.3270 1.4251 -0.0375 -0.0136 0.0905  103 TYR C CD2 
2575 C CE1 . TYR C 103 ? 1.3836 1.3934 1.4910 -0.0317 -0.0068 0.0871  103 TYR C CE1 
2576 C CE2 . TYR C 103 ? 1.3244 1.3285 1.4246 -0.0356 -0.0114 0.0889  103 TYR C CE2 
2577 C CZ  . TYR C 103 ? 1.3053 1.3122 1.4078 -0.0328 -0.0079 0.0873  103 TYR C CZ  
2578 O OH  . TYR C 103 ? 1.3315 1.3382 1.4316 -0.0310 -0.0058 0.0860  103 TYR C OH  
2579 N N   . ASN C 104 ? 1.0084 1.0175 1.1089 -0.0370 -0.0133 0.0882  104 ASN C N   
2580 C CA  . ASN C 104 ? 0.7997 0.8087 0.8940 -0.0352 -0.0115 0.0856  104 ASN C CA  
2581 C C   . ASN C 104 ? 0.7196 0.7283 0.8087 -0.0369 -0.0134 0.0865  104 ASN C C   
2582 O O   . ASN C 104 ? 0.6825 0.6888 0.7658 -0.0380 -0.0149 0.0867  104 ASN C O   
2583 C CB  . ASN C 104 ? 0.8052 0.8121 0.8942 -0.0337 -0.0095 0.0834  104 ASN C CB  
2584 C CG  . ASN C 104 ? 0.6580 0.6645 0.7399 -0.0320 -0.0076 0.0809  104 ASN C CG  
2585 O OD1 . ASN C 104 ? 0.6561 0.6642 0.7377 -0.0317 -0.0075 0.0807  104 ASN C OD1 
2586 N ND2 . ASN C 104 ? 0.5451 0.5495 0.6219 -0.0310 -0.0063 0.0791  104 ASN C ND2 
2587 N N   . THR C 105 ? 0.7280 0.7392 0.8192 -0.0369 -0.0136 0.0872  105 THR C N   
2588 C CA  . THR C 105 ? 0.7618 0.7737 0.8494 -0.0386 -0.0157 0.0889  105 THR C CA  
2589 C C   . THR C 105 ? 0.6766 0.6883 0.7558 -0.0372 -0.0142 0.0872  105 THR C C   
2590 O O   . THR C 105 ? 0.6797 0.6927 0.7554 -0.0380 -0.0155 0.0886  105 THR C O   
2591 C CB  . THR C 105 ? 0.7650 0.7803 0.8597 -0.0396 -0.0171 0.0912  105 THR C CB  
2592 O OG1 . THR C 105 ? 0.6886 0.7056 0.7861 -0.0375 -0.0152 0.0898  105 THR C OG1 
2593 C CG2 . THR C 105 ? 0.7778 0.7934 0.8807 -0.0412 -0.0189 0.0932  105 THR C CG2 
2594 N N   . ASN C 106 ? 0.6724 0.6827 0.7482 -0.0350 -0.0116 0.0844  106 ASN C N   
2595 C CA  . ASN C 106 ? 0.5943 0.6043 0.6622 -0.0335 -0.0101 0.0827  106 ASN C CA  
2596 C C   . ASN C 106 ? 0.5810 0.5888 0.6408 -0.0343 -0.0116 0.0827  106 ASN C C   
2597 O O   . ASN C 106 ? 0.5141 0.5188 0.5721 -0.0350 -0.0127 0.0822  106 ASN C O   
2598 C CB  . ASN C 106 ? 0.5582 0.5669 0.6246 -0.0311 -0.0072 0.0797  106 ASN C CB  
2599 C CG  . ASN C 106 ? 0.5601 0.5709 0.6329 -0.0297 -0.0057 0.0792  106 ASN C CG  
2600 O OD1 . ASN C 106 ? 0.6202 0.6335 0.6959 -0.0298 -0.0062 0.0804  106 ASN C OD1 
2601 N ND2 . ASN C 106 ? 0.5272 0.5372 0.6025 -0.0283 -0.0040 0.0775  106 ASN C ND2 
2602 N N   . CYS C 107 ? 0.5437 0.5532 0.5986 -0.0341 -0.0118 0.0834  107 CYS C N   
2603 C CA  . CYS C 107 ? 0.4841 0.4918 0.5301 -0.0342 -0.0130 0.0831  107 CYS C CA  
2604 C C   . CYS C 107 ? 0.5409 0.5452 0.5804 -0.0324 -0.0115 0.0798  107 CYS C C   
2605 O O   . CYS C 107 ? 0.5596 0.5641 0.5994 -0.0306 -0.0088 0.0779  107 CYS C O   
2606 C CB  . CYS C 107 ? 0.5204 0.5317 0.5628 -0.0337 -0.0128 0.0846  107 CYS C CB  
2607 S SG  . CYS C 107 ? 0.8061 0.8219 0.8556 -0.0361 -0.0152 0.0891  107 CYS C SG  
2608 N N   . THR C 108 ? 0.5179 0.5187 0.5515 -0.0328 -0.0136 0.0790  108 THR C N   
2609 C CA  . THR C 108 ? 0.5999 0.5974 0.6267 -0.0311 -0.0127 0.0759  108 THR C CA  
2610 C C   . THR C 108 ? 0.6358 0.6350 0.6559 -0.0289 -0.0106 0.0748  108 THR C C   
2611 O O   . THR C 108 ? 0.6228 0.6236 0.6384 -0.0289 -0.0117 0.0760  108 THR C O   
2612 C CB  . THR C 108 ? 0.5347 0.5278 0.5563 -0.0320 -0.0160 0.0754  108 THR C CB  
2613 O OG1 . THR C 108 ? 0.5714 0.5629 0.5997 -0.0339 -0.0178 0.0767  108 THR C OG1 
2614 C CG2 . THR C 108 ? 0.5263 0.5158 0.5409 -0.0300 -0.0153 0.0721  108 THR C CG2 
2615 N N   . ILE C 109 ? 0.6161 0.6153 0.6357 -0.0271 -0.0077 0.0728  109 ILE C N   
2616 C CA  . ILE C 109 ? 0.6497 0.6498 0.6624 -0.0249 -0.0057 0.0714  109 ILE C CA  
2617 C C   . ILE C 109 ? 0.5880 0.5842 0.5951 -0.0233 -0.0049 0.0681  109 ILE C C   
2618 O O   . ILE C 109 ? 0.6397 0.6349 0.6501 -0.0228 -0.0032 0.0667  109 ILE C O   
2619 C CB  . ILE C 109 ? 0.6230 0.6271 0.6398 -0.0239 -0.0029 0.0722  109 ILE C CB  
2620 C CG1 . ILE C 109 ? 0.6382 0.6459 0.6631 -0.0256 -0.0038 0.0754  109 ILE C CG1 
2621 C CG2 . ILE C 109 ? 0.6248 0.6307 0.6346 -0.0218 -0.0013 0.0719  109 ILE C CG2 
2622 C CD1 . ILE C 109 ? 0.6793 0.6900 0.7023 -0.0264 -0.0055 0.0782  109 ILE C CD1 
2623 N N   . LEU C 110 ? 0.4624 0.4564 0.4611 -0.0223 -0.0062 0.0667  110 LEU C N   
2624 C CA  . LEU C 110 ? 0.4809 0.4712 0.4740 -0.0206 -0.0056 0.0634  110 LEU C CA  
2625 C C   . LEU C 110 ? 0.5058 0.4986 0.4956 -0.0182 -0.0022 0.0625  110 LEU C C   
2626 O O   . LEU C 110 ? 0.4991 0.4937 0.4830 -0.0168 -0.0019 0.0627  110 LEU C O   
2627 C CB  . LEU C 110 ? 0.4777 0.4640 0.4632 -0.0202 -0.0088 0.0619  110 LEU C CB  
2628 C CG  . LEU C 110 ? 0.5668 0.5500 0.5548 -0.0225 -0.0128 0.0629  110 LEU C CG  
2629 C CD1 . LEU C 110 ? 0.6448 0.6230 0.6246 -0.0216 -0.0160 0.0606  110 LEU C CD1 
2630 C CD2 . LEU C 110 ? 0.5487 0.5307 0.5452 -0.0242 -0.0127 0.0635  110 LEU C CD2 
2631 N N   . SER C 111 ? 0.5199 0.5129 0.5137 -0.0177 0.0003  0.0615  111 SER C N   
2632 C CA  . SER C 111 ? 0.5110 0.5063 0.5033 -0.0157 0.0035  0.0609  111 SER C CA  
2633 C C   . SER C 111 ? 0.4889 0.4825 0.4838 -0.0151 0.0055  0.0589  111 SER C C   
2634 O O   . SER C 111 ? 0.4439 0.4365 0.4447 -0.0164 0.0051  0.0591  111 SER C O   
2635 C CB  . SER C 111 ? 0.4392 0.4395 0.4366 -0.0162 0.0046  0.0639  111 SER C CB  
2636 O OG  . SER C 111 ? 0.4543 0.4566 0.4524 -0.0147 0.0075  0.0636  111 SER C OG  
2637 N N   . VAL C 112 ? 0.4255 0.4189 0.4161 -0.0131 0.0078  0.0572  112 VAL C N   
2638 C CA  . VAL C 112 ? 0.4822 0.4742 0.4748 -0.0124 0.0098  0.0554  112 VAL C CA  
2639 C C   . VAL C 112 ? 0.4800 0.4748 0.4806 -0.0130 0.0113  0.0568  112 VAL C C   
2640 O O   . VAL C 112 ? 0.4265 0.4204 0.4307 -0.0130 0.0123  0.0558  112 VAL C O   
2641 C CB  . VAL C 112 ? 0.4863 0.4780 0.4729 -0.0101 0.0119  0.0535  112 VAL C CB  
2642 C CG1 . VAL C 112 ? 0.4468 0.4428 0.4334 -0.0091 0.0138  0.0554  112 VAL C CG1 
2643 C CG2 . VAL C 112 ? 0.4636 0.4534 0.4519 -0.0095 0.0137  0.0515  112 VAL C CG2 
2644 N N   . LEU C 113 ? 0.4060 0.4044 0.4093 -0.0134 0.0113  0.0593  113 LEU C N   
2645 C CA  . LEU C 113 ? 0.4075 0.4083 0.4184 -0.0139 0.0121  0.0607  113 LEU C CA  
2646 C C   . LEU C 113 ? 0.4075 0.4075 0.4244 -0.0155 0.0106  0.0611  113 LEU C C   
2647 O O   . LEU C 113 ? 0.3730 0.3739 0.3958 -0.0155 0.0114  0.0612  113 LEU C O   
2648 C CB  . LEU C 113 ? 0.4110 0.4158 0.4240 -0.0142 0.0117  0.0636  113 LEU C CB  
2649 C CG  . LEU C 113 ? 0.4403 0.4475 0.4507 -0.0125 0.0137  0.0642  113 LEU C CG  
2650 C CD1 . LEU C 113 ? 0.4426 0.4488 0.4546 -0.0113 0.0159  0.0623  113 LEU C CD1 
2651 C CD2 . LEU C 113 ? 0.4893 0.4962 0.4911 -0.0113 0.0139  0.0636  113 LEU C CD2 
2652 N N   . ASN C 114 ? 0.3990 0.3971 0.4144 -0.0168 0.0084  0.0613  114 ASN C N   
2653 C CA  . ASN C 114 ? 0.4158 0.4133 0.4372 -0.0182 0.0071  0.0621  114 ASN C CA  
2654 C C   . ASN C 114 ? 0.4576 0.4532 0.4806 -0.0176 0.0083  0.0603  114 ASN C C   
2655 O O   . ASN C 114 ? 0.4401 0.4361 0.4689 -0.0183 0.0081  0.0610  114 ASN C O   
2656 C CB  . ASN C 114 ? 0.4419 0.4380 0.4619 -0.0200 0.0041  0.0633  114 ASN C CB  
2657 C CG  . ASN C 114 ? 0.4899 0.4884 0.5164 -0.0217 0.0025  0.0660  114 ASN C CG  
2658 O OD1 . ASN C 114 ? 0.4848 0.4852 0.5178 -0.0216 0.0035  0.0666  114 ASN C OD1 
2659 N ND2 . ASN C 114 ? 0.5261 0.5243 0.5507 -0.0231 -0.0001 0.0675  114 ASN C ND2 
2660 N N   . TYR C 115 ? 0.4121 0.4059 0.4302 -0.0162 0.0098  0.0581  115 TYR C N   
2661 C CA  . TYR C 115 ? 0.4443 0.4371 0.4643 -0.0155 0.0112  0.0567  115 TYR C CA  
2662 C C   . TYR C 115 ? 0.4352 0.4305 0.4605 -0.0146 0.0133  0.0568  115 TYR C C   
2663 O O   . TYR C 115 ? 0.4509 0.4463 0.4795 -0.0141 0.0144  0.0563  115 TYR C O   
2664 C CB  . TYR C 115 ? 0.3878 0.3783 0.4018 -0.0143 0.0123  0.0544  115 TYR C CB  
2665 C CG  . TYR C 115 ? 0.3841 0.3714 0.3927 -0.0148 0.0100  0.0537  115 TYR C CG  
2666 C CD1 . TYR C 115 ? 0.4517 0.4373 0.4626 -0.0163 0.0074  0.0547  115 TYR C CD1 
2667 C CD2 . TYR C 115 ? 0.3946 0.3804 0.3961 -0.0135 0.0102  0.0521  115 TYR C CD2 
2668 C CE1 . TYR C 115 ? 0.4685 0.4506 0.4745 -0.0168 0.0047  0.0539  115 TYR C CE1 
2669 C CE2 . TYR C 115 ? 0.4277 0.4102 0.4240 -0.0137 0.0077  0.0511  115 TYR C CE2 
2670 C CZ  . TYR C 115 ? 0.4605 0.4409 0.4591 -0.0153 0.0048  0.0519  115 TYR C CZ  
2671 O OH  . TYR C 115 ? 0.5362 0.5129 0.5298 -0.0154 0.0017  0.0508  115 TYR C OH  
2672 N N   . PHE C 116 ? 0.4264 0.4238 0.4525 -0.0143 0.0137  0.0577  116 PHE C N   
2673 C CA  . PHE C 116 ? 0.3910 0.3905 0.4222 -0.0134 0.0149  0.0578  116 PHE C CA  
2674 C C   . PHE C 116 ? 0.4197 0.4212 0.4567 -0.0146 0.0132  0.0599  116 PHE C C   
2675 O O   . PHE C 116 ? 0.4227 0.4261 0.4639 -0.0140 0.0135  0.0604  116 PHE C O   
2676 C CB  . PHE C 116 ? 0.4079 0.4082 0.4364 -0.0121 0.0164  0.0572  116 PHE C CB  
2677 C CG  . PHE C 116 ? 0.4261 0.4244 0.4488 -0.0110 0.0180  0.0552  116 PHE C CG  
2678 C CD1 . PHE C 116 ? 0.4321 0.4298 0.4554 -0.0097 0.0200  0.0535  116 PHE C CD1 
2679 C CD2 . PHE C 116 ? 0.3957 0.3927 0.4121 -0.0112 0.0174  0.0550  116 PHE C CD2 
2680 C CE1 . PHE C 116 ? 0.4275 0.4234 0.4458 -0.0088 0.0213  0.0518  116 PHE C CE1 
2681 C CE2 . PHE C 116 ? 0.4764 0.4714 0.4877 -0.0101 0.0187  0.0530  116 PHE C CE2 
2682 C CZ  . PHE C 116 ? 0.4491 0.4435 0.4615 -0.0090 0.0207  0.0515  116 PHE C CZ  
2683 N N   . GLN C 117 ? 0.3770 0.3781 0.4145 -0.0163 0.0112  0.0612  117 GLN C N   
2684 C CA  . GLN C 117 ? 0.4031 0.4059 0.4461 -0.0176 0.0093  0.0635  117 GLN C CA  
2685 C C   . GLN C 117 ? 0.4030 0.4082 0.4470 -0.0177 0.0088  0.0650  117 GLN C C   
2686 O O   . GLN C 117 ? 0.4103 0.4175 0.4606 -0.0180 0.0080  0.0662  117 GLN C O   
2687 C CB  . GLN C 117 ? 0.3591 0.3629 0.4090 -0.0171 0.0098  0.0633  117 GLN C CB  
2688 C CG  . GLN C 117 ? 0.3895 0.3919 0.4398 -0.0171 0.0102  0.0627  117 GLN C CG  
2689 C CD  . GLN C 117 ? 0.4110 0.4119 0.4570 -0.0155 0.0124  0.0605  117 GLN C CD  
2690 O OE1 . GLN C 117 ? 0.3917 0.3905 0.4333 -0.0160 0.0121  0.0600  117 GLN C OE1 
2691 N NE2 . GLN C 117 ? 0.3478 0.3498 0.3952 -0.0136 0.0143  0.0591  117 GLN C NE2 
2692 N N   . ASN C 118 ? 0.3855 0.3907 0.4236 -0.0174 0.0093  0.0649  118 ASN C N   
2693 C CA  . ASN C 118 ? 0.4450 0.4530 0.4836 -0.0175 0.0088  0.0670  118 ASN C CA  
2694 C C   . ASN C 118 ? 0.4007 0.4105 0.4451 -0.0166 0.0093  0.0673  118 ASN C C   
2695 O O   . ASN C 118 ? 0.4177 0.4300 0.4665 -0.0173 0.0079  0.0697  118 ASN C O   
2696 C CB  . ASN C 118 ? 0.3751 0.3845 0.4155 -0.0196 0.0062  0.0696  118 ASN C CB  
2697 C CG  . ASN C 118 ? 0.4245 0.4320 0.4583 -0.0203 0.0052  0.0693  118 ASN C CG  
2698 O OD1 . ASN C 118 ? 0.3825 0.3882 0.4096 -0.0191 0.0063  0.0675  118 ASN C OD1 
2699 N ND2 . ASN C 118 ? 0.4111 0.4187 0.4467 -0.0221 0.0028  0.0711  118 ASN C ND2 
2700 N N   . SER C 119 ? 0.4775 0.4859 0.5221 -0.0150 0.0111  0.0649  119 SER C N   
2701 C CA  . SER C 119 ? 0.4819 0.4913 0.5320 -0.0139 0.0113  0.0647  119 SER C CA  
2702 C C   . SER C 119 ? 0.4692 0.4782 0.5162 -0.0122 0.0132  0.0635  119 SER C C   
2703 O O   . SER C 119 ? 0.4147 0.4218 0.4569 -0.0113 0.0151  0.0614  119 SER C O   
2704 C CB  . SER C 119 ? 0.3628 0.3711 0.4172 -0.0133 0.0115  0.0631  119 SER C CB  
2705 O OG  . SER C 119 ? 0.4515 0.4599 0.5086 -0.0115 0.0123  0.0618  119 SER C OG  
2706 N N   . HIS C 120 ? 0.4464 0.4572 0.4968 -0.0119 0.0126  0.0650  120 HIS C N   
2707 C CA  . HIS C 120 ? 0.4221 0.4326 0.4706 -0.0104 0.0140  0.0643  120 HIS C CA  
2708 C C   . HIS C 120 ? 0.3964 0.4047 0.4456 -0.0087 0.0153  0.0612  120 HIS C C   
2709 O O   . HIS C 120 ? 0.4236 0.4305 0.4685 -0.0076 0.0173  0.0596  120 HIS C O   
2710 C CB  . HIS C 120 ? 0.3991 0.4121 0.4526 -0.0104 0.0125  0.0670  120 HIS C CB  
2711 C CG  . HIS C 120 ? 0.4885 0.5045 0.5405 -0.0116 0.0118  0.0704  120 HIS C CG  
2712 N ND1 . HIS C 120 ? 0.4522 0.4691 0.4981 -0.0110 0.0135  0.0709  120 HIS C ND1 
2713 C CD2 . HIS C 120 ? 0.4271 0.4459 0.4828 -0.0132 0.0096  0.0735  120 HIS C CD2 
2714 C CE1 . HIS C 120 ? 0.4305 0.4507 0.4761 -0.0120 0.0126  0.0743  120 HIS C CE1 
2715 N NE2 . HIS C 120 ? 0.4573 0.4787 0.5088 -0.0134 0.0102  0.0760  120 HIS C NE2 
2716 N N   . SER C 121 ? 0.3976 0.4055 0.4519 -0.0085 0.0143  0.0604  121 SER C N   
2717 C CA  . SER C 121 ? 0.4942 0.5005 0.5494 -0.0066 0.0154  0.0577  121 SER C CA  
2718 C C   . SER C 121 ? 0.4890 0.4937 0.5395 -0.0063 0.0175  0.0557  121 SER C C   
2719 O O   . SER C 121 ? 0.4402 0.4436 0.4883 -0.0048 0.0192  0.0536  121 SER C O   
2720 C CB  . SER C 121 ? 0.4808 0.4874 0.5429 -0.0059 0.0136  0.0574  121 SER C CB  
2721 O OG  . SER C 121 ? 0.6084 0.6151 0.6714 -0.0065 0.0137  0.0571  121 SER C OG  
2722 N N   . VAL C 122 ? 0.4215 0.4263 0.4708 -0.0077 0.0171  0.0565  122 VAL C N   
2723 C CA  . VAL C 122 ? 0.4267 0.4301 0.4721 -0.0077 0.0186  0.0551  122 VAL C CA  
2724 C C   . VAL C 122 ? 0.4414 0.4435 0.4802 -0.0075 0.0201  0.0544  122 VAL C C   
2725 O O   . VAL C 122 ? 0.4061 0.4069 0.4422 -0.0066 0.0217  0.0525  122 VAL C O   
2726 C CB  . VAL C 122 ? 0.4625 0.4661 0.5085 -0.0096 0.0173  0.0565  122 VAL C CB  
2727 C CG1 . VAL C 122 ? 0.4232 0.4251 0.4652 -0.0097 0.0183  0.0555  122 VAL C CG1 
2728 C CG2 . VAL C 122 ? 0.4138 0.4187 0.4666 -0.0096 0.0161  0.0571  122 VAL C CG2 
2729 N N   . LEU C 123 ? 0.3817 0.3846 0.4183 -0.0082 0.0194  0.0559  123 LEU C N   
2730 C CA  . LEU C 123 ? 0.4052 0.4073 0.4357 -0.0078 0.0208  0.0553  123 LEU C CA  
2731 C C   . LEU C 123 ? 0.4554 0.4568 0.4857 -0.0061 0.0225  0.0537  123 LEU C C   
2732 O O   . LEU C 123 ? 0.3783 0.3782 0.4039 -0.0054 0.0241  0.0523  123 LEU C O   
2733 C CB  . LEU C 123 ? 0.3735 0.3775 0.4026 -0.0084 0.0199  0.0577  123 LEU C CB  
2734 C CG  . LEU C 123 ? 0.4448 0.4485 0.4674 -0.0078 0.0212  0.0575  123 LEU C CG  
2735 C CD1 . LEU C 123 ? 0.3908 0.3919 0.4078 -0.0079 0.0216  0.0556  123 LEU C CD1 
2736 C CD2 . LEU C 123 ? 0.4619 0.4684 0.4838 -0.0083 0.0202  0.0604  123 LEU C CD2 
2737 N N   . ASP C 124 ? 0.3892 0.3914 0.4246 -0.0054 0.0220  0.0540  124 ASP C N   
2738 C CA  . ASP C 124 ? 0.4201 0.4215 0.4558 -0.0037 0.0231  0.0526  124 ASP C CA  
2739 C C   . ASP C 124 ? 0.4361 0.4362 0.4726 -0.0025 0.0241  0.0501  124 ASP C C   
2740 O O   . ASP C 124 ? 0.4279 0.4271 0.4641 -0.0010 0.0251  0.0487  124 ASP C O   
2741 C CB  . ASP C 124 ? 0.5287 0.5313 0.5696 -0.0034 0.0214  0.0541  124 ASP C CB  
2742 C CG  . ASP C 124 ? 0.5288 0.5330 0.5685 -0.0039 0.0212  0.0565  124 ASP C CG  
2743 O OD1 . ASP C 124 ? 0.5173 0.5214 0.5514 -0.0041 0.0226  0.0566  124 ASP C OD1 
2744 O OD2 . ASP C 124 ? 0.6086 0.6142 0.6531 -0.0041 0.0194  0.0586  124 ASP C OD2 
2745 N N   . HIS C 125 ? 0.4278 0.4280 0.4654 -0.0030 0.0239  0.0499  125 HIS C N   
2746 C CA  . HIS C 125 ? 0.4751 0.4749 0.5135 -0.0017 0.0251  0.0480  125 HIS C CA  
2747 C C   . HIS C 125 ? 0.4559 0.4543 0.4898 -0.0009 0.0271  0.0464  125 HIS C C   
2748 O O   . HIS C 125 ? 0.4800 0.4776 0.5096 -0.0018 0.0277  0.0466  125 HIS C O   
2749 C CB  . HIS C 125 ? 0.4288 0.4292 0.4683 -0.0026 0.0248  0.0486  125 HIS C CB  
2750 C CG  . HIS C 125 ? 0.4249 0.4267 0.4699 -0.0028 0.0232  0.0495  125 HIS C CG  
2751 N ND1 . HIS C 125 ? 0.4599 0.4625 0.5070 -0.0037 0.0227  0.0505  125 HIS C ND1 
2752 C CD2 . HIS C 125 ? 0.4252 0.4278 0.4746 -0.0020 0.0218  0.0497  125 HIS C CD2 
2753 C CE1 . HIS C 125 ? 0.4703 0.4742 0.5226 -0.0035 0.0212  0.0512  125 HIS C CE1 
2754 N NE2 . HIS C 125 ? 0.5455 0.5493 0.5993 -0.0025 0.0206  0.0507  125 HIS C NE2 
2755 N N   . LYS C 126 ? 0.5320 0.5302 0.5668 0.0010  0.0281  0.0448  126 LYS C N   
2756 C CA  . LYS C 126 ? 0.4979 0.4949 0.5290 0.0018  0.0299  0.0434  126 LYS C CA  
2757 C C   . LYS C 126 ? 0.5076 0.5050 0.5400 0.0038  0.0310  0.0418  126 LYS C C   
2758 O O   . LYS C 126 ? 0.5171 0.5150 0.5527 0.0053  0.0303  0.0411  126 LYS C O   
2759 C CB  . LYS C 126 ? 0.4979 0.4940 0.5277 0.0022  0.0299  0.0435  126 LYS C CB  
2760 C CG  . LYS C 126 ? 0.5522 0.5469 0.5779 0.0027  0.0317  0.0423  126 LYS C CG  
2761 C CD  . LYS C 126 ? 0.5986 0.5928 0.6230 0.0026  0.0316  0.0431  126 LYS C CD  
2762 C CE  . LYS C 126 ? 0.6497 0.6430 0.6760 0.0042  0.0314  0.0422  126 LYS C CE  
2763 N NZ  . LYS C 126 ? 0.6381 0.6301 0.6609 0.0049  0.0333  0.0408  126 LYS C NZ  
2764 N N   . LYS C 127 ? 0.5261 0.5235 0.5562 0.0039  0.0326  0.0412  127 LYS C N   
2765 C CA  . LYS C 127 ? 0.4783 0.4766 0.5091 0.0059  0.0340  0.0398  127 LYS C CA  
2766 C C   . LYS C 127 ? 0.5250 0.5219 0.5519 0.0063  0.0354  0.0388  127 LYS C C   
2767 O O   . LYS C 127 ? 0.4501 0.4466 0.4745 0.0051  0.0362  0.0391  127 LYS C O   
2768 C CB  . LYS C 127 ? 0.5403 0.5406 0.5726 0.0059  0.0346  0.0406  127 LYS C CB  
2769 C CG  . LYS C 127 ? 0.6013 0.6033 0.6342 0.0082  0.0362  0.0396  127 LYS C CG  
2770 C CD  . LYS C 127 ? 0.6807 0.6835 0.7163 0.0106  0.0357  0.0384  127 LYS C CD  
2771 C CE  . LYS C 127 ? 0.6884 0.6934 0.7240 0.0134  0.0374  0.0373  127 LYS C CE  
2772 N NZ  . LYS C 127 ? 0.7957 0.8008 0.8333 0.0162  0.0366  0.0356  127 LYS C NZ  
2773 N N   . GLY C 128 ? 0.4069 0.4029 0.4337 0.0079  0.0355  0.0375  128 GLY C N   
2774 C CA  . GLY C 128 ? 0.3817 0.3764 0.4053 0.0083  0.0368  0.0365  128 GLY C CA  
2775 C C   . GLY C 128 ? 0.4283 0.4226 0.4525 0.0107  0.0369  0.0348  128 GLY C C   
2776 O O   . GLY C 128 ? 0.3716 0.3663 0.3987 0.0121  0.0356  0.0343  128 GLY C O   
2777 N N   . ASP C 129 ? 0.4414 0.4348 0.4630 0.0113  0.0382  0.0339  129 ASP C N   
2778 C CA  . ASP C 129 ? 0.4160 0.4086 0.4375 0.0135  0.0382  0.0322  129 ASP C CA  
2779 C C   . ASP C 129 ? 0.4342 0.4246 0.4533 0.0131  0.0385  0.0320  129 ASP C C   
2780 O O   . ASP C 129 ? 0.4890 0.4785 0.5072 0.0113  0.0383  0.0332  129 ASP C O   
2781 C CB  . ASP C 129 ? 0.4800 0.4748 0.5010 0.0154  0.0397  0.0313  129 ASP C CB  
2782 C CG  . ASP C 129 ? 0.4918 0.4876 0.5105 0.0141  0.0417  0.0321  129 ASP C CG  
2783 O OD1 . ASP C 129 ? 0.5285 0.5270 0.5480 0.0147  0.0428  0.0326  129 ASP C OD1 
2784 O OD2 . ASP C 129 ? 0.4237 0.4177 0.4402 0.0125  0.0421  0.0324  129 ASP C OD2 
2785 N N   . ASP C 130 ? 0.4594 0.4490 0.4772 0.0148  0.0389  0.0305  130 ASP C N   
2786 C CA  . ASP C 130 ? 0.4740 0.4613 0.4899 0.0145  0.0391  0.0304  130 ASP C CA  
2787 C C   . ASP C 130 ? 0.4519 0.4393 0.4650 0.0128  0.0411  0.0311  130 ASP C C   
2788 O O   . ASP C 130 ? 0.4840 0.4698 0.4956 0.0122  0.0414  0.0313  130 ASP C O   
2789 C CB  . ASP C 130 ? 0.5131 0.4994 0.5283 0.0168  0.0389  0.0285  130 ASP C CB  
2790 C CG  . ASP C 130 ? 0.5893 0.5745 0.6073 0.0186  0.0363  0.0275  130 ASP C CG  
2791 O OD1 . ASP C 130 ? 0.6562 0.6405 0.6766 0.0176  0.0345  0.0287  130 ASP C OD1 
2792 O OD2 . ASP C 130 ? 0.7104 0.6956 0.7280 0.0212  0.0360  0.0256  130 ASP C OD2 
2793 N N   . PHE C 131 ? 0.4246 0.4140 0.4374 0.0121  0.0421  0.0316  131 PHE C N   
2794 C CA  . PHE C 131 ? 0.3930 0.3825 0.4036 0.0108  0.0436  0.0320  131 PHE C CA  
2795 C C   . PHE C 131 ? 0.4175 0.4071 0.4277 0.0088  0.0434  0.0333  131 PHE C C   
2796 O O   . PHE C 131 ? 0.4262 0.4144 0.4343 0.0076  0.0436  0.0336  131 PHE C O   
2797 C CB  . PHE C 131 ? 0.4084 0.4002 0.4190 0.0118  0.0449  0.0317  131 PHE C CB  
2798 C CG  . PHE C 131 ? 0.3943 0.3856 0.4036 0.0133  0.0457  0.0305  131 PHE C CG  
2799 C CD1 . PHE C 131 ? 0.3586 0.3495 0.3660 0.0126  0.0469  0.0306  131 PHE C CD1 
2800 C CD2 . PHE C 131 ? 0.3941 0.3851 0.4040 0.0156  0.0449  0.0292  131 PHE C CD2 
2801 C CE1 . PHE C 131 ? 0.3726 0.3630 0.3787 0.0139  0.0475  0.0297  131 PHE C CE1 
2802 C CE2 . PHE C 131 ? 0.4516 0.4419 0.4600 0.0171  0.0453  0.0280  131 PHE C CE2 
2803 C CZ  . PHE C 131 ? 0.4074 0.3974 0.4138 0.0162  0.0466  0.0283  131 PHE C CZ  
2804 N N   . PHE C 132 ? 0.4026 0.3940 0.4148 0.0085  0.0427  0.0339  132 PHE C N   
2805 C CA  . PHE C 132 ? 0.4073 0.3985 0.4191 0.0067  0.0421  0.0350  132 PHE C CA  
2806 C C   . PHE C 132 ? 0.4040 0.3956 0.4178 0.0064  0.0406  0.0358  132 PHE C C   
2807 O O   . PHE C 132 ? 0.4055 0.3980 0.4219 0.0076  0.0400  0.0355  132 PHE C O   
2808 C CB  . PHE C 132 ? 0.3756 0.3685 0.3881 0.0061  0.0425  0.0357  132 PHE C CB  
2809 C CG  . PHE C 132 ? 0.4152 0.4081 0.4263 0.0061  0.0438  0.0354  132 PHE C CG  
2810 C CD1 . PHE C 132 ? 0.4133 0.4082 0.4254 0.0076  0.0450  0.0352  132 PHE C CD1 
2811 C CD2 . PHE C 132 ? 0.3649 0.3559 0.3736 0.0047  0.0437  0.0354  132 PHE C CD2 
2812 C CE1 . PHE C 132 ? 0.4034 0.3986 0.4145 0.0075  0.0460  0.0352  132 PHE C CE1 
2813 C CE2 . PHE C 132 ? 0.3759 0.3669 0.3838 0.0046  0.0447  0.0353  132 PHE C CE2 
2814 C CZ  . PHE C 132 ? 0.3665 0.3597 0.3757 0.0059  0.0458  0.0353  132 PHE C CZ  
2815 N N   . VAL C 133 ? 0.4133 0.4042 0.4260 0.0048  0.0398  0.0367  133 VAL C N   
2816 C CA  . VAL C 133 ? 0.3951 0.3869 0.4097 0.0041  0.0384  0.0377  133 VAL C CA  
2817 C C   . VAL C 133 ? 0.3655 0.3580 0.3804 0.0031  0.0382  0.0384  133 VAL C C   
2818 O O   . VAL C 133 ? 0.3974 0.3888 0.4098 0.0020  0.0382  0.0384  133 VAL C O   
2819 C CB  . VAL C 133 ? 0.4381 0.4290 0.4510 0.0031  0.0375  0.0386  133 VAL C CB  
2820 C CG1 . VAL C 133 ? 0.4314 0.4232 0.4463 0.0021  0.0359  0.0399  133 VAL C CG1 
2821 C CG2 . VAL C 133 ? 0.3409 0.3312 0.3541 0.0039  0.0376  0.0386  133 VAL C CG2 
2822 N N   . TYR C 134 ? 0.3798 0.3743 0.3980 0.0036  0.0380  0.0388  134 TYR C N   
2823 C CA  . TYR C 134 ? 0.3646 0.3603 0.3840 0.0029  0.0379  0.0398  134 TYR C CA  
2824 C C   . TYR C 134 ? 0.4206 0.4159 0.4405 0.0011  0.0361  0.0411  134 TYR C C   
2825 O O   . TYR C 134 ? 0.4718 0.4670 0.4919 0.0000  0.0355  0.0420  134 TYR C O   
2826 C CB  . TYR C 134 ? 0.3700 0.3686 0.3930 0.0044  0.0387  0.0401  134 TYR C CB  
2827 C CG  . TYR C 134 ? 0.3945 0.3936 0.4166 0.0063  0.0403  0.0388  134 TYR C CG  
2828 C CD1 . TYR C 134 ? 0.4044 0.4040 0.4252 0.0063  0.0415  0.0389  134 TYR C CD1 
2829 C CD2 . TYR C 134 ? 0.3736 0.3729 0.3965 0.0083  0.0404  0.0375  134 TYR C CD2 
2830 C CE1 . TYR C 134 ? 0.3535 0.3536 0.3733 0.0080  0.0430  0.0378  134 TYR C CE1 
2831 C CE2 . TYR C 134 ? 0.3755 0.3752 0.3973 0.0102  0.0417  0.0362  134 TYR C CE2 
2832 C CZ  . TYR C 134 ? 0.3710 0.3712 0.3911 0.0100  0.0431  0.0364  134 TYR C CZ  
2833 O OH  . TYR C 134 ? 0.3921 0.3927 0.4110 0.0118  0.0443  0.0352  134 TYR C OH  
2834 N N   . ALA C 135 ? 0.3852 0.3803 0.4057 0.0009  0.0351  0.0413  135 ALA C N   
2835 C CA  . ALA C 135 ? 0.3929 0.3879 0.4143 -0.0006 0.0333  0.0426  135 ALA C CA  
2836 C C   . ALA C 135 ? 0.3573 0.3519 0.3782 -0.0007 0.0325  0.0428  135 ALA C C   
2837 O O   . ALA C 135 ? 0.3979 0.3931 0.4207 0.0004  0.0328  0.0424  135 ALA C O   
2838 C CB  . ALA C 135 ? 0.3838 0.3810 0.4097 -0.0005 0.0328  0.0438  135 ALA C CB  
2839 N N   . ASP C 136 ? 0.4662 0.4598 0.4848 -0.0020 0.0313  0.0436  136 ASP C N   
2840 C CA  . ASP C 136 ? 0.4920 0.4859 0.5105 -0.0023 0.0304  0.0444  136 ASP C CA  
2841 C C   . ASP C 136 ? 0.4770 0.4705 0.4937 -0.0038 0.0287  0.0455  136 ASP C C   
2842 O O   . ASP C 136 ? 0.4980 0.4909 0.5148 -0.0047 0.0279  0.0457  136 ASP C O   
2843 C CB  . ASP C 136 ? 0.4911 0.4844 0.5070 -0.0015 0.0315  0.0438  136 ASP C CB  
2844 C CG  . ASP C 136 ? 0.4873 0.4790 0.4979 -0.0017 0.0320  0.0432  136 ASP C CG  
2845 O OD1 . ASP C 136 ? 0.4819 0.4725 0.4910 -0.0024 0.0315  0.0428  136 ASP C OD1 
2846 O OD2 . ASP C 136 ? 0.4876 0.4789 0.4957 -0.0011 0.0328  0.0431  136 ASP C OD2 
2847 N N   . TYR C 137 ? 0.4315 0.4253 0.4465 -0.0041 0.0281  0.0464  137 TYR C N   
2848 C CA  . TYR C 137 ? 0.4014 0.3950 0.4144 -0.0054 0.0264  0.0475  137 TYR C CA  
2849 C C   . TYR C 137 ? 0.3726 0.3639 0.3802 -0.0055 0.0264  0.0463  137 TYR C C   
2850 O O   . TYR C 137 ? 0.4183 0.4086 0.4246 -0.0065 0.0246  0.0466  137 TYR C O   
2851 C CB  . TYR C 137 ? 0.3928 0.3880 0.4053 -0.0054 0.0259  0.0491  137 TYR C CB  
2852 C CG  . TYR C 137 ? 0.3782 0.3732 0.3858 -0.0045 0.0271  0.0487  137 TYR C CG  
2853 C CD1 . TYR C 137 ? 0.3746 0.3690 0.3770 -0.0046 0.0264  0.0489  137 TYR C CD1 
2854 C CD2 . TYR C 137 ? 0.3840 0.3793 0.3919 -0.0033 0.0287  0.0483  137 TYR C CD2 
2855 C CE1 . TYR C 137 ? 0.3875 0.3820 0.3851 -0.0034 0.0276  0.0486  137 TYR C CE1 
2856 C CE2 . TYR C 137 ? 0.4051 0.4003 0.4087 -0.0024 0.0299  0.0483  137 TYR C CE2 
2857 C CZ  . TYR C 137 ? 0.4134 0.4084 0.4119 -0.0023 0.0294  0.0484  137 TYR C CZ  
2858 O OH  . TYR C 137 ? 0.4234 0.4188 0.4176 -0.0011 0.0308  0.0484  137 TYR C OH  
2859 N N   . HIS C 138 ? 0.4464 0.4367 0.4511 -0.0044 0.0280  0.0449  138 HIS C N   
2860 C CA  . HIS C 138 ? 0.4788 0.4667 0.4788 -0.0042 0.0279  0.0434  138 HIS C CA  
2861 C C   . HIS C 138 ? 0.4523 0.4388 0.4539 -0.0052 0.0267  0.0432  138 HIS C C   
2862 O O   . HIS C 138 ? 0.4665 0.4512 0.4658 -0.0059 0.0248  0.0430  138 HIS C O   
2863 C CB  . HIS C 138 ? 0.4611 0.4482 0.4591 -0.0030 0.0300  0.0420  138 HIS C CB  
2864 C CG  . HIS C 138 ? 0.4615 0.4496 0.4574 -0.0019 0.0312  0.0424  138 HIS C CG  
2865 N ND1 . HIS C 138 ? 0.4573 0.4471 0.4563 -0.0013 0.0324  0.0430  138 HIS C ND1 
2866 C CD2 . HIS C 138 ? 0.4657 0.4536 0.4568 -0.0012 0.0313  0.0423  138 HIS C CD2 
2867 C CE1 . HIS C 138 ? 0.4382 0.4288 0.4349 -0.0005 0.0332  0.0437  138 HIS C CE1 
2868 N NE2 . HIS C 138 ? 0.4752 0.4650 0.4670 -0.0003 0.0328  0.0433  138 HIS C NE2 
2869 N N   . THR C 139 ? 0.4530 0.4406 0.4589 -0.0050 0.0277  0.0432  139 THR C N   
2870 C CA  . THR C 139 ? 0.4136 0.4006 0.4217 -0.0058 0.0269  0.0435  139 THR C CA  
2871 C C   . THR C 139 ? 0.4776 0.4652 0.4886 -0.0071 0.0248  0.0451  139 THR C C   
2872 O O   . THR C 139 ? 0.4898 0.4762 0.5013 -0.0081 0.0230  0.0457  139 THR C O   
2873 C CB  . THR C 139 ? 0.4340 0.4228 0.4458 -0.0049 0.0288  0.0434  139 THR C CB  
2874 O OG1 . THR C 139 ? 0.3987 0.3899 0.4143 -0.0043 0.0295  0.0440  139 THR C OG1 
2875 C CG2 . THR C 139 ? 0.4896 0.4776 0.4986 -0.0038 0.0306  0.0418  139 THR C CG2 
2876 N N   . HIS C 140 ? 0.4607 0.4502 0.4740 -0.0071 0.0248  0.0461  140 HIS C N   
2877 C CA  . HIS C 140 ? 0.4590 0.4490 0.4751 -0.0085 0.0227  0.0478  140 HIS C CA  
2878 C C   . HIS C 140 ? 0.4245 0.4122 0.4361 -0.0095 0.0204  0.0478  140 HIS C C   
2879 O O   . HIS C 140 ? 0.4110 0.3976 0.4236 -0.0107 0.0183  0.0487  140 HIS C O   
2880 C CB  . HIS C 140 ? 0.4428 0.4351 0.4622 -0.0083 0.0229  0.0488  140 HIS C CB  
2881 C CG  . HIS C 140 ? 0.4589 0.4521 0.4821 -0.0097 0.0210  0.0506  140 HIS C CG  
2882 N ND1 . HIS C 140 ? 0.4558 0.4500 0.4837 -0.0100 0.0208  0.0516  140 HIS C ND1 
2883 C CD2 . HIS C 140 ? 0.4481 0.4415 0.4712 -0.0108 0.0192  0.0519  140 HIS C CD2 
2884 C CE1 . HIS C 140 ? 0.4588 0.4535 0.4895 -0.0113 0.0190  0.0533  140 HIS C CE1 
2885 N NE2 . HIS C 140 ? 0.4670 0.4612 0.4949 -0.0119 0.0179  0.0535  140 HIS C NE2 
2886 N N   . PHE C 141 ? 0.4313 0.4184 0.4380 -0.0087 0.0209  0.0469  141 PHE C N   
2887 C CA  . PHE C 141 ? 0.4183 0.4031 0.4196 -0.0090 0.0189  0.0464  141 PHE C CA  
2888 C C   . PHE C 141 ? 0.4269 0.4085 0.4261 -0.0093 0.0174  0.0452  141 PHE C C   
2889 O O   . PHE C 141 ? 0.4304 0.4102 0.4289 -0.0104 0.0146  0.0456  141 PHE C O   
2890 C CB  . PHE C 141 ? 0.3673 0.3525 0.3635 -0.0076 0.0203  0.0456  141 PHE C CB  
2891 C CG  . PHE C 141 ? 0.3959 0.3790 0.3857 -0.0073 0.0185  0.0447  141 PHE C CG  
2892 C CD1 . PHE C 141 ? 0.3781 0.3582 0.3634 -0.0064 0.0183  0.0425  141 PHE C CD1 
2893 C CD2 . PHE C 141 ? 0.3964 0.3804 0.3845 -0.0078 0.0169  0.0460  141 PHE C CD2 
2894 C CE1 . PHE C 141 ? 0.4743 0.4522 0.4532 -0.0057 0.0164  0.0414  141 PHE C CE1 
2895 C CE2 . PHE C 141 ? 0.4439 0.4259 0.4255 -0.0071 0.0153  0.0450  141 PHE C CE2 
2896 C CZ  . PHE C 141 ? 0.4965 0.4753 0.4732 -0.0059 0.0150  0.0425  141 PHE C CZ  
2897 N N   . LEU C 142 ? 0.4646 0.4455 0.4632 -0.0084 0.0190  0.0439  142 LEU C N   
2898 C CA  . LEU C 142 ? 0.4833 0.4612 0.4803 -0.0086 0.0174  0.0428  142 LEU C CA  
2899 C C   . LEU C 142 ? 0.4819 0.4595 0.4837 -0.0102 0.0153  0.0444  142 LEU C C   
2900 O O   . LEU C 142 ? 0.5552 0.5298 0.5556 -0.0110 0.0123  0.0442  142 LEU C O   
2901 C CB  . LEU C 142 ? 0.5148 0.4927 0.5114 -0.0076 0.0197  0.0415  142 LEU C CB  
2902 C CG  . LEU C 142 ? 0.5792 0.5565 0.5703 -0.0060 0.0213  0.0398  142 LEU C CG  
2903 C CD1 . LEU C 142 ? 0.5086 0.4866 0.5004 -0.0050 0.0239  0.0388  142 LEU C CD1 
2904 C CD2 . LEU C 142 ? 0.4710 0.4449 0.4562 -0.0056 0.0189  0.0382  142 LEU C CD2 
2905 N N   . TYR C 143 ? 0.4379 0.4185 0.4455 -0.0106 0.0166  0.0461  143 TYR C N   
2906 C CA  . TYR C 143 ? 0.4574 0.4386 0.4704 -0.0120 0.0149  0.0482  143 TYR C CA  
2907 C C   . TYR C 143 ? 0.5272 0.5075 0.5402 -0.0133 0.0120  0.0495  143 TYR C C   
2908 O O   . TYR C 143 ? 0.5231 0.5012 0.5370 -0.0146 0.0090  0.0504  143 TYR C O   
2909 C CB  . TYR C 143 ? 0.4555 0.4406 0.4744 -0.0115 0.0174  0.0496  143 TYR C CB  
2910 C CG  . TYR C 143 ? 0.5010 0.4874 0.5258 -0.0127 0.0159  0.0522  143 TYR C CG  
2911 C CD1 . TYR C 143 ? 0.5191 0.5061 0.5471 -0.0129 0.0158  0.0533  143 TYR C CD1 
2912 C CD2 . TYR C 143 ? 0.4931 0.4805 0.5206 -0.0137 0.0146  0.0538  143 TYR C CD2 
2913 C CE1 . TYR C 143 ? 0.5199 0.5086 0.5539 -0.0140 0.0145  0.0563  143 TYR C CE1 
2914 C CE2 . TYR C 143 ? 0.5121 0.5008 0.5453 -0.0147 0.0133  0.0564  143 TYR C CE2 
2915 C CZ  . TYR C 143 ? 0.5447 0.5341 0.5811 -0.0148 0.0133  0.0577  143 TYR C CZ  
2916 O OH  . TYR C 143 ? 0.6469 0.6381 0.6895 -0.0158 0.0121  0.0608  143 TYR C OH  
2917 N N   . CYS C 144 ? 0.4654 0.4472 0.4776 -0.0132 0.0127  0.0497  144 CYS C N   
2918 C CA  . CYS C 144 ? 0.4617 0.4432 0.4748 -0.0145 0.0102  0.0512  144 CYS C CA  
2919 C C   . CYS C 144 ? 0.4536 0.4315 0.4614 -0.0151 0.0070  0.0504  144 CYS C C   
2920 O O   . CYS C 144 ? 0.5067 0.4834 0.5159 -0.0165 0.0040  0.0518  144 CYS C O   
2921 C CB  . CYS C 144 ? 0.4260 0.4102 0.4395 -0.0142 0.0116  0.0517  144 CYS C CB  
2922 S SG  . CYS C 144 ? 0.5306 0.5188 0.5517 -0.0139 0.0138  0.0532  144 CYS C SG  
2923 N N   . VAL C 145 ? 0.4623 0.4381 0.4638 -0.0138 0.0073  0.0481  145 VAL C N   
2924 C CA  . VAL C 145 ? 0.4707 0.4428 0.4663 -0.0138 0.0041  0.0469  145 VAL C CA  
2925 C C   . VAL C 145 ? 0.5300 0.4987 0.5274 -0.0148 0.0009  0.0470  145 VAL C C   
2926 O O   . VAL C 145 ? 0.5514 0.5166 0.5458 -0.0153 -0.0029 0.0465  145 VAL C O   
2927 C CB  . VAL C 145 ? 0.4722 0.4432 0.4604 -0.0117 0.0054  0.0442  145 VAL C CB  
2928 C CG1 . VAL C 145 ? 0.4706 0.4451 0.4574 -0.0108 0.0079  0.0448  145 VAL C CG1 
2929 C CG2 . VAL C 145 ? 0.4585 0.4290 0.4469 -0.0107 0.0074  0.0427  145 VAL C CG2 
2930 N N   . ARG C 146 ? 0.5613 0.5311 0.5638 -0.0151 0.0022  0.0477  146 ARG C N   
2931 C CA  . ARG C 146 ? 0.6032 0.5706 0.6089 -0.0162 -0.0007 0.0486  146 ARG C CA  
2932 C C   . ARG C 146 ? 0.6016 0.5705 0.6142 -0.0181 -0.0023 0.0519  146 ARG C C   
2933 O O   . ARG C 146 ? 0.6691 0.6353 0.6837 -0.0194 -0.0061 0.0531  146 ARG C O   
2934 C CB  . ARG C 146 ? 0.6295 0.5978 0.6373 -0.0155 0.0014  0.0482  146 ARG C CB  
2935 C CG  . ARG C 146 ? 0.7524 0.7181 0.7540 -0.0139 0.0018  0.0451  146 ARG C CG  
2936 C CD  . ARG C 146 ? 0.9130 0.8801 0.9176 -0.0134 0.0041  0.0451  146 ARG C CD  
2937 N NE  . ARG C 146 ? 1.0822 1.0457 1.0827 -0.0126 0.0026  0.0427  146 ARG C NE  
2938 C CZ  . ARG C 146 ? 1.1337 1.0976 1.1362 -0.0124 0.0037  0.0425  146 ARG C CZ  
2939 N NH1 . ARG C 146 ? 1.0981 1.0660 1.1064 -0.0127 0.0063  0.0446  146 ARG C NH1 
2940 N NH2 . ARG C 146 ? 1.1532 1.1134 1.1519 -0.0116 0.0021  0.0402  146 ARG C NH2 
2941 N N   . ALA C 147 ? 0.5876 0.5606 0.6042 -0.0181 0.0004  0.0535  147 ALA C N   
2942 C CA  . ALA C 147 ? 0.5208 0.4959 0.5443 -0.0196 -0.0005 0.0567  147 ALA C CA  
2943 C C   . ALA C 147 ? 0.5257 0.5031 0.5499 -0.0199 0.0004  0.0574  147 ALA C C   
2944 O O   . ALA C 147 ? 0.5230 0.5042 0.5518 -0.0195 0.0031  0.0585  147 ALA C O   
2945 C CB  . ALA C 147 ? 0.5482 0.5269 0.5783 -0.0193 0.0020  0.0584  147 ALA C CB  
2946 N N   . PRO C 148 ? 0.5950 0.5700 0.6146 -0.0204 -0.0021 0.0568  148 PRO C N   
2947 C CA  . PRO C 148 ? 0.5599 0.5371 0.5797 -0.0207 -0.0013 0.0575  148 PRO C CA  
2948 C C   . PRO C 148 ? 0.5715 0.5515 0.5990 -0.0220 -0.0015 0.0605  148 PRO C C   
2949 O O   . PRO C 148 ? 0.5176 0.5003 0.5467 -0.0219 -0.0001 0.0611  148 PRO C O   
2950 C CB  . PRO C 148 ? 0.5825 0.5564 0.5961 -0.0211 -0.0047 0.0566  148 PRO C CB  
2951 C CG  . PRO C 148 ? 0.6262 0.5957 0.6379 -0.0215 -0.0079 0.0559  148 PRO C CG  
2952 C CD  . PRO C 148 ? 0.5283 0.4985 0.5419 -0.0205 -0.0056 0.0552  148 PRO C CD  
2953 N N   . ALA C 149 ? 0.6066 0.5861 0.6391 -0.0232 -0.0032 0.0625  149 ALA C N   
2954 C CA  . ALA C 149 ? 0.5755 0.5577 0.6155 -0.0243 -0.0035 0.0656  149 ALA C CA  
2955 C C   . ALA C 149 ? 0.5665 0.5529 0.6123 -0.0231 0.0001  0.0665  149 ALA C C   
2956 O O   . ALA C 149 ? 0.6289 0.6180 0.6812 -0.0236 0.0003  0.0690  149 ALA C O   
2957 C CB  . ALA C 149 ? 0.6190 0.5987 0.6619 -0.0263 -0.0076 0.0680  149 ALA C CB  
2958 N N   . SER C 150 ? 0.5834 0.5705 0.6266 -0.0213 0.0029  0.0643  150 SER C N   
2959 C CA  . SER C 150 ? 0.5404 0.5313 0.5882 -0.0198 0.0062  0.0649  150 SER C CA  
2960 C C   . SER C 150 ? 0.5527 0.5470 0.6032 -0.0188 0.0086  0.0648  150 SER C C   
2961 O O   . SER C 150 ? 0.5528 0.5467 0.6002 -0.0187 0.0088  0.0634  150 SER C O   
2962 C CB  . SER C 150 ? 0.5764 0.5668 0.6204 -0.0183 0.0084  0.0626  150 SER C CB  
2963 O OG  . SER C 150 ? 0.5902 0.5845 0.6383 -0.0167 0.0115  0.0631  150 SER C OG  
2964 N N   . LEU C 151 ? 0.5931 0.5909 0.6497 -0.0180 0.0102  0.0665  151 LEU C N   
2965 C CA  . LEU C 151 ? 0.5333 0.5344 0.5932 -0.0166 0.0124  0.0663  151 LEU C CA  
2966 C C   . LEU C 151 ? 0.5045 0.5074 0.5632 -0.0140 0.0158  0.0642  151 LEU C C   
2967 O O   . LEU C 151 ? 0.5433 0.5485 0.6041 -0.0124 0.0174  0.0635  151 LEU C O   
2968 C CB  . LEU C 151 ? 0.6060 0.6100 0.6734 -0.0169 0.0120  0.0693  151 LEU C CB  
2969 C CG  . LEU C 151 ? 0.6320 0.6349 0.7018 -0.0192 0.0090  0.0714  151 LEU C CG  
2970 C CD1 . LEU C 151 ? 0.6923 0.6982 0.7698 -0.0194 0.0088  0.0748  151 LEU C CD1 
2971 C CD2 . LEU C 151 ? 0.6651 0.6683 0.7343 -0.0191 0.0090  0.0702  151 LEU C CD2 
2972 N N   . ASN C 152 ? 0.5202 0.5220 0.5757 -0.0136 0.0165  0.0632  152 ASN C N   
2973 C CA  . ASN C 152 ? 0.5507 0.5542 0.6050 -0.0112 0.0196  0.0614  152 ASN C CA  
2974 C C   . ASN C 152 ? 0.5151 0.5159 0.5641 -0.0114 0.0197  0.0598  152 ASN C C   
2975 O O   . ASN C 152 ? 0.5530 0.5528 0.6023 -0.0124 0.0184  0.0610  152 ASN C O   
2976 C CB  . ASN C 152 ? 0.5330 0.5404 0.5928 -0.0098 0.0213  0.0633  152 ASN C CB  
2977 C CG  . ASN C 152 ? 0.5991 0.6087 0.6579 -0.0071 0.0246  0.0614  152 ASN C CG  
2978 O OD1 . ASN C 152 ? 0.6166 0.6243 0.6705 -0.0066 0.0254  0.0591  152 ASN C OD1 
2979 N ND2 . ASN C 152 ? 0.5727 0.5865 0.6360 -0.0051 0.0264  0.0626  152 ASN C ND2 
2980 N N   . ASP C 153 ? 0.5203 0.5198 0.5646 -0.0104 0.0209  0.0571  153 ASP C N   
2981 C CA  . ASP C 153 ? 0.6038 0.6006 0.6429 -0.0106 0.0208  0.0555  153 ASP C CA  
2982 C C   . ASP C 153 ? 0.5927 0.5909 0.6321 -0.0092 0.0229  0.0551  153 ASP C C   
2983 O O   . ASP C 153 ? 0.6067 0.6028 0.6420 -0.0091 0.0233  0.0535  153 ASP C O   
2984 C CB  . ASP C 153 ? 0.5158 0.5109 0.5498 -0.0101 0.0212  0.0533  153 ASP C CB  
2985 C CG  . ASP C 153 ? 0.5758 0.5728 0.6103 -0.0082 0.0238  0.0520  153 ASP C CG  
2986 O OD1 . ASP C 153 ? 0.5392 0.5387 0.5772 -0.0068 0.0255  0.0523  153 ASP C OD1 
2987 O OD2 . ASP C 153 ? 0.6412 0.6372 0.6726 -0.0078 0.0241  0.0507  153 ASP C OD2 
2988 N N   . THR C 154 ? 0.4853 0.4870 0.5297 -0.0082 0.0244  0.0567  154 THR C N   
2989 C CA  . THR C 154 ? 0.5536 0.5575 0.5992 -0.0070 0.0263  0.0570  154 THR C CA  
2990 C C   . THR C 154 ? 0.5560 0.5599 0.5980 -0.0051 0.0288  0.0543  154 THR C C   
2991 O O   . THR C 154 ? 0.6492 0.6551 0.6918 -0.0038 0.0306  0.0544  154 THR C O   
2992 C CB  . THR C 154 ? 0.4763 0.4784 0.5214 -0.0085 0.0246  0.0582  154 THR C CB  
2993 O OG1 . THR C 154 ? 0.5493 0.5477 0.5885 -0.0088 0.0241  0.0557  154 THR C OG1 
2994 C CG2 . THR C 154 ? 0.4924 0.4933 0.5402 -0.0107 0.0213  0.0606  154 THR C CG2 
2995 N N   . SER C 155 ? 0.4969 0.4989 0.5355 -0.0049 0.0288  0.0523  155 SER C N   
2996 C CA  . SER C 155 ? 0.5030 0.5047 0.5387 -0.0031 0.0308  0.0499  155 SER C CA  
2997 C C   . SER C 155 ? 0.4826 0.4874 0.5214 -0.0009 0.0326  0.0497  155 SER C C   
2998 O O   . SER C 155 ? 0.4887 0.4960 0.5318 -0.0007 0.0323  0.0513  155 SER C O   
2999 C CB  . SER C 155 ? 0.4613 0.4602 0.4930 -0.0037 0.0300  0.0484  155 SER C CB  
3000 O OG  . SER C 155 ? 0.4417 0.4415 0.4755 -0.0035 0.0295  0.0485  155 SER C OG  
3001 N N   . LEU C 156 ? 0.4631 0.4679 0.4998 0.0008  0.0342  0.0476  156 LEU C N   
3002 C CA  . LEU C 156 ? 0.4877 0.4947 0.5266 0.0033  0.0353  0.0468  156 LEU C CA  
3003 C C   . LEU C 156 ? 0.5202 0.5266 0.5610 0.0031  0.0339  0.0466  156 LEU C C   
3004 O O   . LEU C 156 ? 0.5095 0.5178 0.5533 0.0049  0.0342  0.0463  156 LEU C O   
3005 C CB  . LEU C 156 ? 0.4265 0.4328 0.4625 0.0051  0.0369  0.0445  156 LEU C CB  
3006 C CG  . LEU C 156 ? 0.5161 0.5233 0.5505 0.0057  0.0386  0.0446  156 LEU C CG  
3007 C CD1 . LEU C 156 ? 0.4192 0.4259 0.4511 0.0076  0.0400  0.0423  156 LEU C CD1 
3008 C CD2 . LEU C 156 ? 0.5089 0.5202 0.5470 0.0066  0.0396  0.0465  156 LEU C CD2 
3009 N N   . LEU C 157 ? 0.4864 0.4905 0.5255 0.0010  0.0322  0.0469  157 LEU C N   
3010 C CA  . LEU C 157 ? 0.5030 0.5070 0.5444 0.0004  0.0305  0.0474  157 LEU C CA  
3011 C C   . LEU C 157 ? 0.5031 0.5085 0.5483 -0.0008 0.0293  0.0496  157 LEU C C   
3012 O O   . LEU C 157 ? 0.5247 0.5310 0.5733 -0.0006 0.0282  0.0501  157 LEU C O   
3013 C CB  . LEU C 157 ? 0.4683 0.4698 0.5062 -0.0011 0.0293  0.0471  157 LEU C CB  
3014 C CG  . LEU C 157 ? 0.4891 0.4894 0.5246 0.0001  0.0302  0.0454  157 LEU C CG  
3015 C CD1 . LEU C 157 ? 0.4334 0.4319 0.4654 -0.0013 0.0293  0.0457  157 LEU C CD1 
3016 C CD2 . LEU C 157 ? 0.4542 0.4556 0.4932 0.0019  0.0299  0.0448  157 LEU C CD2 
3017 N N   . HIS C 158 ? 0.4753 0.4808 0.5205 -0.0019 0.0291  0.0510  158 HIS C N   
3018 C CA  . HIS C 158 ? 0.5022 0.5088 0.5511 -0.0034 0.0277  0.0535  158 HIS C CA  
3019 C C   . HIS C 158 ? 0.5139 0.5194 0.5640 -0.0050 0.0255  0.0542  158 HIS C C   
3020 O O   . HIS C 158 ? 0.4995 0.5069 0.5542 -0.0050 0.0248  0.0556  158 HIS C O   
3021 C CB  . HIS C 158 ? 0.5568 0.5672 0.6106 -0.0015 0.0291  0.0546  158 HIS C CB  
3022 C CG  . HIS C 158 ? 0.5851 0.5971 0.6409 0.0009  0.0300  0.0532  158 HIS C CG  
3023 N ND1 . HIS C 158 ? 0.5974 0.6098 0.6567 0.0007  0.0286  0.0537  158 HIS C ND1 
3024 C CD2 . HIS C 158 ? 0.6183 0.6314 0.6733 0.0037  0.0319  0.0512  158 HIS C CD2 
3025 C CE1 . HIS C 158 ? 0.6174 0.6310 0.6780 0.0033  0.0294  0.0519  158 HIS C CE1 
3026 N NE2 . HIS C 158 ? 0.5770 0.5908 0.6348 0.0052  0.0314  0.0503  158 HIS C NE2 
3027 N N   . ASP C 159 ? 0.5398 0.5428 0.5858 -0.0062 0.0244  0.0535  159 ASP C N   
3028 C CA  . ASP C 159 ? 0.4795 0.4818 0.5261 -0.0078 0.0223  0.0544  159 ASP C CA  
3029 C C   . ASP C 159 ? 0.4235 0.4244 0.4696 -0.0101 0.0201  0.0562  159 ASP C C   
3030 O O   . ASP C 159 ? 0.4848 0.4842 0.5282 -0.0106 0.0199  0.0561  159 ASP C O   
3031 C CB  . ASP C 159 ? 0.4200 0.4208 0.4625 -0.0078 0.0222  0.0531  159 ASP C CB  
3032 C CG  . ASP C 159 ? 0.4599 0.4620 0.5045 -0.0060 0.0231  0.0521  159 ASP C CG  
3033 O OD1 . ASP C 159 ? 0.5367 0.5405 0.5861 -0.0052 0.0230  0.0524  159 ASP C OD1 
3034 O OD2 . ASP C 159 ? 0.4934 0.4945 0.5348 -0.0053 0.0239  0.0508  159 ASP C OD2 
3035 N N   . PRO C 160 ? 0.4165 0.4179 0.4656 -0.0115 0.0182  0.0579  160 PRO C N   
3036 C CA  . PRO C 160 ? 0.4449 0.4446 0.4936 -0.0137 0.0157  0.0596  160 PRO C CA  
3037 C C   . PRO C 160 ? 0.4110 0.4079 0.4534 -0.0148 0.0143  0.0587  160 PRO C C   
3038 O O   . PRO C 160 ? 0.4056 0.4024 0.4448 -0.0140 0.0151  0.0574  160 PRO C O   
3039 C CB  . PRO C 160 ? 0.4251 0.4265 0.4792 -0.0146 0.0143  0.0615  160 PRO C CB  
3040 C CG  . PRO C 160 ? 0.4447 0.4476 0.5000 -0.0133 0.0153  0.0604  160 PRO C CG  
3041 C CD  . PRO C 160 ? 0.4142 0.4175 0.4678 -0.0110 0.0180  0.0583  160 PRO C CD  
3042 N N   . CYS C 161 ? 0.4359 0.4306 0.4766 -0.0164 0.0120  0.0596  161 CYS C N   
3043 C CA  . CYS C 161 ? 0.4587 0.4505 0.4930 -0.0171 0.0103  0.0587  161 CYS C CA  
3044 C C   . CYS C 161 ? 0.5146 0.5061 0.5492 -0.0189 0.0076  0.0604  161 CYS C C   
3045 O O   . CYS C 161 ? 0.5167 0.5070 0.5462 -0.0191 0.0066  0.0597  161 CYS C O   
3046 C CB  . CYS C 161 ? 0.4822 0.4711 0.5134 -0.0175 0.0091  0.0581  161 CYS C CB  
3047 S SG  . CYS C 161 ? 0.5370 0.5255 0.5651 -0.0155 0.0119  0.0557  161 CYS C SG  
3048 N N   . LEU C 162 ? 0.5133 0.5060 0.5540 -0.0200 0.0064  0.0626  162 LEU C N   
3049 C CA  . LEU C 162 ? 0.5401 0.5324 0.5817 -0.0219 0.0036  0.0644  162 LEU C CA  
3050 C C   . LEU C 162 ? 0.5186 0.5126 0.5592 -0.0218 0.0039  0.0644  162 LEU C C   
3051 O O   . LEU C 162 ? 0.4837 0.4802 0.5271 -0.0206 0.0060  0.0640  162 LEU C O   
3052 C CB  . LEU C 162 ? 0.5595 0.5534 0.6087 -0.0230 0.0027  0.0669  162 LEU C CB  
3053 C CG  . LEU C 162 ? 0.6186 0.6110 0.6701 -0.0239 0.0012  0.0683  162 LEU C CG  
3054 C CD1 . LEU C 162 ? 0.5724 0.5674 0.6321 -0.0246 0.0009  0.0711  162 LEU C CD1 
3055 C CD2 . LEU C 162 ? 0.5582 0.5467 0.6052 -0.0256 -0.0025 0.0685  162 LEU C CD2 
3056 N N   . GLY C 163 ? 0.5511 0.5439 0.5880 -0.0230 0.0016  0.0650  163 GLY C N   
3057 C CA  . GLY C 163 ? 0.4856 0.4805 0.5220 -0.0231 0.0015  0.0658  163 GLY C CA  
3058 C C   . GLY C 163 ? 0.5245 0.5221 0.5687 -0.0241 0.0011  0.0679  163 GLY C C   
3059 O O   . GLY C 163 ? 0.5022 0.4998 0.5516 -0.0248 0.0004  0.0690  163 GLY C O   
3060 N N   . THR C 164 ? 0.4721 0.4721 0.5174 -0.0240 0.0013  0.0687  164 THR C N   
3061 C CA  . THR C 164 ? 0.4949 0.4974 0.5478 -0.0248 0.0006  0.0706  164 THR C CA  
3062 C C   . THR C 164 ? 0.4845 0.4866 0.5405 -0.0271 -0.0022 0.0729  164 THR C C   
3063 O O   . THR C 164 ? 0.4401 0.4437 0.5032 -0.0277 -0.0027 0.0744  164 THR C O   
3064 C CB  . THR C 164 ? 0.4633 0.4684 0.5167 -0.0245 0.0008  0.0714  164 THR C CB  
3065 O OG1 . THR C 164 ? 0.6974 0.7048 0.7585 -0.0242 0.0010  0.0721  164 THR C OG1 
3066 C CG2 . THR C 164 ? 0.4500 0.4557 0.5011 -0.0263 -0.0016 0.0735  164 THR C CG2 
3067 N N   . PHE C 165 ? 0.4635 0.4633 0.5140 -0.0282 -0.0042 0.0732  165 PHE C N   
3068 C CA  . PHE C 165 ? 0.5235 0.5223 0.5761 -0.0305 -0.0073 0.0754  165 PHE C CA  
3069 C C   . PHE C 165 ? 0.5503 0.5471 0.6058 -0.0310 -0.0079 0.0756  165 PHE C C   
3070 O O   . PHE C 165 ? 0.4942 0.4899 0.5522 -0.0329 -0.0105 0.0776  165 PHE C O   
3071 C CB  . PHE C 165 ? 0.4563 0.4533 0.5014 -0.0313 -0.0096 0.0755  165 PHE C CB  
3072 C CG  . PHE C 165 ? 0.5108 0.5044 0.5483 -0.0301 -0.0093 0.0730  165 PHE C CG  
3073 C CD1 . PHE C 165 ? 0.4840 0.4781 0.5162 -0.0281 -0.0070 0.0709  165 PHE C CD1 
3074 C CD2 . PHE C 165 ? 0.5071 0.4971 0.5434 -0.0311 -0.0117 0.0729  165 PHE C CD2 
3075 C CE1 . PHE C 165 ? 0.4816 0.4725 0.5072 -0.0269 -0.0068 0.0685  165 PHE C CE1 
3076 C CE2 . PHE C 165 ? 0.5098 0.4964 0.5395 -0.0299 -0.0119 0.0706  165 PHE C CE2 
3077 C CZ  . PHE C 165 ? 0.5219 0.5090 0.5462 -0.0278 -0.0094 0.0682  165 PHE C CZ  
3078 N N   . GLY C 166 ? 0.5995 0.5960 0.6550 -0.0292 -0.0054 0.0738  166 GLY C N   
3079 C CA  . GLY C 166 ? 0.4973 0.4930 0.5568 -0.0294 -0.0055 0.0745  166 GLY C CA  
3080 C C   . GLY C 166 ? 0.5485 0.5405 0.6035 -0.0300 -0.0073 0.0740  166 GLY C C   
3081 O O   . GLY C 166 ? 0.6665 0.6577 0.7252 -0.0307 -0.0084 0.0755  166 GLY C O   
3082 N N   . GLY C 167 ? 0.4997 0.4895 0.5467 -0.0294 -0.0077 0.0720  167 GLY C N   
3083 C CA  . GLY C 167 ? 0.5224 0.5081 0.5643 -0.0297 -0.0099 0.0711  167 GLY C CA  
3084 C C   . GLY C 167 ? 0.5607 0.5452 0.5957 -0.0277 -0.0081 0.0680  167 GLY C C   
3085 O O   . GLY C 167 ? 0.4634 0.4501 0.4967 -0.0263 -0.0053 0.0668  167 GLY C O   
3086 N N   . PRO C 168 ? 0.6208 0.6016 0.6521 -0.0277 -0.0098 0.0669  168 PRO C N   
3087 C CA  . PRO C 168 ? 0.5882 0.5676 0.6134 -0.0257 -0.0081 0.0639  168 PRO C CA  
3088 C C   . PRO C 168 ? 0.5868 0.5652 0.6038 -0.0249 -0.0086 0.0622  168 PRO C C   
3089 O O   . PRO C 168 ? 0.6338 0.6110 0.6484 -0.0259 -0.0114 0.0630  168 PRO C O   
3090 C CB  . PRO C 168 ? 0.5601 0.5358 0.5850 -0.0262 -0.0106 0.0637  168 PRO C CB  
3091 C CG  . PRO C 168 ? 0.5588 0.5324 0.5856 -0.0284 -0.0148 0.0659  168 PRO C CG  
3092 C CD  . PRO C 168 ? 0.5864 0.5640 0.6195 -0.0294 -0.0137 0.0684  168 PRO C CD  
3093 N N   . VAL C 169 ? 0.6057 0.5847 0.6185 -0.0229 -0.0058 0.0600  169 VAL C N   
3094 C CA  . VAL C 169 ? 0.5745 0.5530 0.5793 -0.0215 -0.0058 0.0583  169 VAL C CA  
3095 C C   . VAL C 169 ? 0.5892 0.5640 0.5881 -0.0201 -0.0063 0.0555  169 VAL C C   
3096 O O   . VAL C 169 ? 0.6082 0.5834 0.6072 -0.0189 -0.0036 0.0541  169 VAL C O   
3097 C CB  . VAL C 169 ? 0.5877 0.5703 0.5926 -0.0202 -0.0021 0.0583  169 VAL C CB  
3098 C CG1 . VAL C 169 ? 0.5612 0.5437 0.5579 -0.0186 -0.0018 0.0568  169 VAL C CG1 
3099 C CG2 . VAL C 169 ? 0.5548 0.5409 0.5658 -0.0216 -0.0021 0.0610  169 VAL C CG2 
3100 N N   . PHE C 170 ? 0.4966 0.4675 0.4903 -0.0203 -0.0099 0.0546  170 PHE C N   
3101 C CA  . PHE C 170 ? 0.5439 0.5107 0.5326 -0.0190 -0.0111 0.0519  170 PHE C CA  
3102 C C   . PHE C 170 ? 0.5688 0.5363 0.5501 -0.0164 -0.0088 0.0495  170 PHE C C   
3103 O O   . PHE C 170 ? 0.5605 0.5296 0.5373 -0.0157 -0.0086 0.0497  170 PHE C O   
3104 C CB  . PHE C 170 ? 0.5962 0.5582 0.5820 -0.0199 -0.0163 0.0516  170 PHE C CB  
3105 C CG  . PHE C 170 ? 0.6193 0.5806 0.6128 -0.0225 -0.0188 0.0544  170 PHE C CG  
3106 C CD1 . PHE C 170 ? 0.6254 0.5860 0.6247 -0.0231 -0.0187 0.0550  170 PHE C CD1 
3107 C CD2 . PHE C 170 ? 0.6615 0.6234 0.6572 -0.0242 -0.0210 0.0567  170 PHE C CD2 
3108 C CE1 . PHE C 170 ? 0.6044 0.5651 0.6113 -0.0253 -0.0207 0.0580  170 PHE C CE1 
3109 C CE2 . PHE C 170 ? 0.6405 0.6020 0.6438 -0.0265 -0.0231 0.0595  170 PHE C CE2 
3110 C CZ  . PHE C 170 ? 0.6403 0.6013 0.6492 -0.0270 -0.0229 0.0602  170 PHE C CZ  
3111 N N   . PRO C 171 ? 0.5992 0.5660 0.5797 -0.0151 -0.0068 0.0476  171 PRO C N   
3112 C CA  . PRO C 171 ? 0.5058 0.4740 0.4808 -0.0127 -0.0037 0.0457  171 PRO C CA  
3113 C C   . PRO C 171 ? 0.5476 0.5138 0.5134 -0.0108 -0.0056 0.0438  171 PRO C C   
3114 O O   . PRO C 171 ? 0.5289 0.4979 0.4907 -0.0091 -0.0031 0.0436  171 PRO C O   
3115 C CB  . PRO C 171 ? 0.5372 0.5037 0.5135 -0.0120 -0.0025 0.0440  171 PRO C CB  
3116 C CG  . PRO C 171 ? 0.5509 0.5140 0.5310 -0.0137 -0.0060 0.0446  171 PRO C CG  
3117 C CD  . PRO C 171 ? 0.5180 0.4827 0.5030 -0.0159 -0.0075 0.0475  171 PRO C CD  
3118 N N   . TRP C 172 ? 0.5929 0.5544 0.5555 -0.0110 -0.0099 0.0425  172 TRP C N   
3119 C CA  . TRP C 172 ? 0.6173 0.5763 0.5703 -0.0088 -0.0120 0.0402  172 TRP C CA  
3120 C C   . TRP C 172 ? 0.6648 0.6264 0.6149 -0.0089 -0.0126 0.0419  172 TRP C C   
3121 O O   . TRP C 172 ? 0.6442 0.6048 0.5860 -0.0068 -0.0140 0.0403  172 TRP C O   
3122 C CB  . TRP C 172 ? 0.6845 0.6370 0.6349 -0.0089 -0.0170 0.0381  172 TRP C CB  
3123 C CG  . TRP C 172 ? 0.7087 0.6592 0.6641 -0.0117 -0.0210 0.0402  172 TRP C CG  
3124 C CD1 . TRP C 172 ? 0.7762 0.7257 0.7289 -0.0124 -0.0242 0.0411  172 TRP C CD1 
3125 C CD2 . TRP C 172 ? 0.6772 0.6267 0.6413 -0.0142 -0.0221 0.0421  172 TRP C CD2 
3126 N NE1 . TRP C 172 ? 0.7407 0.6885 0.7002 -0.0153 -0.0274 0.0434  172 TRP C NE1 
3127 C CE2 . TRP C 172 ? 0.7025 0.6505 0.6691 -0.0164 -0.0260 0.0442  172 TRP C CE2 
3128 C CE3 . TRP C 172 ? 0.6550 0.6052 0.6251 -0.0148 -0.0201 0.0425  172 TRP C CE3 
3129 C CZ2 . TRP C 172 ? 0.7069 0.6540 0.6821 -0.0190 -0.0279 0.0467  172 TRP C CZ2 
3130 C CZ3 . TRP C 172 ? 0.6899 0.6396 0.6683 -0.0173 -0.0219 0.0451  172 TRP C CZ3 
3131 C CH2 . TRP C 172 ? 0.6935 0.6417 0.6744 -0.0194 -0.0257 0.0472  172 TRP C CH2 
3132 N N   . LEU C 173 ? 0.5623 0.5274 0.5193 -0.0112 -0.0117 0.0451  173 LEU C N   
3133 C CA  . LEU C 173 ? 0.5480 0.5163 0.5036 -0.0116 -0.0121 0.0473  173 LEU C CA  
3134 C C   . LEU C 173 ? 0.5493 0.5236 0.5061 -0.0107 -0.0077 0.0490  173 LEU C C   
3135 O O   . LEU C 173 ? 0.5180 0.4957 0.4727 -0.0105 -0.0076 0.0508  173 LEU C O   
3136 C CB  . LEU C 173 ? 0.5871 0.5553 0.5498 -0.0148 -0.0145 0.0501  173 LEU C CB  
3137 C CG  . LEU C 173 ? 0.7272 0.6897 0.6899 -0.0161 -0.0194 0.0493  173 LEU C CG  
3138 C CD1 . LEU C 173 ? 0.7295 0.6932 0.7009 -0.0192 -0.0206 0.0527  173 LEU C CD1 
3139 C CD2 . LEU C 173 ? 0.8014 0.7607 0.7549 -0.0146 -0.0230 0.0476  173 LEU C CD2 
3140 N N   . VAL C 174 ? 0.5397 0.5156 0.5003 -0.0104 -0.0043 0.0487  174 VAL C N   
3141 C CA  . VAL C 174 ? 0.4961 0.4776 0.4592 -0.0098 -0.0005 0.0506  174 VAL C CA  
3142 C C   . VAL C 174 ? 0.4700 0.4523 0.4288 -0.0072 0.0026  0.0488  174 VAL C C   
3143 O O   . VAL C 174 ? 0.4618 0.4484 0.4230 -0.0066 0.0057  0.0503  174 VAL C O   
3144 C CB  . VAL C 174 ? 0.4855 0.4691 0.4584 -0.0120 0.0009  0.0527  174 VAL C CB  
3145 C CG1 . VAL C 174 ? 0.4187 0.4020 0.3962 -0.0146 -0.0021 0.0548  174 VAL C CG1 
3146 C CG2 . VAL C 174 ? 0.4559 0.4371 0.4319 -0.0120 0.0021  0.0509  174 VAL C CG2 
3147 N N   . LEU C 175 ? 0.4549 0.4331 0.4078 -0.0055 0.0015  0.0456  175 LEU C N   
3148 C CA  . LEU C 175 ? 0.5296 0.5082 0.4780 -0.0028 0.0043  0.0437  175 LEU C CA  
3149 C C   . LEU C 175 ? 0.5339 0.5097 0.4724 -0.0001 0.0024  0.0410  175 LEU C C   
3150 O O   . LEU C 175 ? 0.5472 0.5193 0.4827 -0.0006 -0.0015 0.0399  175 LEU C O   
3151 C CB  . LEU C 175 ? 0.4530 0.4292 0.4052 -0.0032 0.0054  0.0421  175 LEU C CB  
3152 C CG  . LEU C 175 ? 0.4613 0.4396 0.4228 -0.0054 0.0072  0.0441  175 LEU C CG  
3153 C CD1 . LEU C 175 ? 0.5329 0.5082 0.4974 -0.0059 0.0073  0.0424  175 LEU C CD1 
3154 C CD2 . LEU C 175 ? 0.3934 0.3767 0.3571 -0.0047 0.0108  0.0459  175 LEU C CD2 
3155 N N   . GLY C 176 ? 0.6067 0.5842 0.5400 0.0027  0.0050  0.0399  176 GLY C N   
3156 C CA  . GLY C 176 ? 0.6118 0.5867 0.5355 0.0059  0.0035  0.0368  176 GLY C CA  
3157 C C   . GLY C 176 ? 0.6069 0.5825 0.5275 0.0086  0.0067  0.0351  176 GLY C C   
3158 O O   . GLY C 176 ? 0.6499 0.6291 0.5752 0.0082  0.0103  0.0369  176 GLY C O   
3159 N N   . GLY C 177 ? 0.6374 0.6091 0.5503 0.0114  0.0052  0.0315  177 GLY C N   
3160 C CA  . GLY C 177 ? 0.6115 0.5837 0.5206 0.0144  0.0080  0.0296  177 GLY C CA  
3161 C C   . GLY C 177 ? 0.6655 0.6342 0.5788 0.0134  0.0084  0.0277  177 GLY C C   
3162 O O   . GLY C 177 ? 0.6666 0.6361 0.5785 0.0153  0.0112  0.0266  177 GLY C O   
3163 N N   . TYR C 178 ? 0.5937 0.5587 0.5122 0.0105  0.0056  0.0275  178 TYR C N   
3164 C CA  . TYR C 178 ? 0.6408 0.6027 0.5640 0.0093  0.0057  0.0262  178 TYR C CA  
3165 C C   . TYR C 178 ? 0.6465 0.6019 0.5657 0.0103  0.0016  0.0224  178 TYR C C   
3166 O O   . TYR C 178 ? 0.6721 0.6244 0.5867 0.0109  -0.0023 0.0212  178 TYR C O   
3167 C CB  . TYR C 178 ? 0.5549 0.5177 0.4874 0.0056  0.0056  0.0288  178 TYR C CB  
3168 C CG  . TYR C 178 ? 0.5152 0.4757 0.4489 0.0036  0.0015  0.0295  178 TYR C CG  
3169 C CD1 . TYR C 178 ? 0.6025 0.5577 0.5373 0.0025  -0.0026 0.0280  178 TYR C CD1 
3170 C CD2 . TYR C 178 ? 0.5322 0.4960 0.4663 0.0028  0.0014  0.0321  178 TYR C CD2 
3171 C CE1 . TYR C 178 ? 0.6387 0.5917 0.5749 0.0006  -0.0066 0.0289  178 TYR C CE1 
3172 C CE2 . TYR C 178 ? 0.5429 0.5046 0.4782 0.0009  -0.0025 0.0329  178 TYR C CE2 
3173 C CZ  . TYR C 178 ? 0.5607 0.5169 0.4970 -0.0002 -0.0064 0.0313  178 TYR C CZ  
3174 O OH  . TYR C 178 ? 0.6477 0.6017 0.5856 -0.0021 -0.0105 0.0324  178 TYR C OH  
3175 N N   . ASP C 179 ? 0.7654 0.7185 0.6866 0.0105  0.0022  0.0208  179 ASP C N   
3176 C CA  . ASP C 179 ? 0.8262 0.7730 0.7449 0.0112  -0.0020 0.0174  179 ASP C CA  
3177 C C   . ASP C 179 ? 0.8539 0.7976 0.7799 0.0078  -0.0053 0.0184  179 ASP C C   
3178 O O   . ASP C 179 ? 0.8836 0.8294 0.8171 0.0055  -0.0031 0.0205  179 ASP C O   
3179 C CB  . ASP C 179 ? 0.8343 0.7802 0.7515 0.0132  0.0000  0.0152  179 ASP C CB  
3180 C CG  . ASP C 179 ? 0.8548 0.8039 0.7796 0.0112  0.0039  0.0173  179 ASP C CG  
3181 O OD1 . ASP C 179 ? 0.8848 0.8313 0.8132 0.0103  0.0031  0.0164  179 ASP C OD1 
3182 O OD2 . ASP C 179 ? 0.8342 0.7884 0.7616 0.0105  0.0076  0.0201  179 ASP C OD2 
3183 N N   . ASP C 180 ? 0.9973 0.9361 0.9211 0.0075  -0.0107 0.0171  180 ASP C N   
3184 C CA  . ASP C 180 ? 0.9580 0.8936 0.8888 0.0045  -0.0144 0.0182  180 ASP C CA  
3185 C C   . ASP C 180 ? 0.9661 0.9062 0.9046 0.0013  -0.0123 0.0224  180 ASP C C   
3186 O O   . ASP C 180 ? 1.0255 0.9680 0.9627 0.0010  -0.0118 0.0239  180 ASP C O   
3187 C CB  . ASP C 180 ? 1.0137 0.9470 0.9481 0.0042  -0.0145 0.0170  180 ASP C CB  
3188 C CG  . ASP C 180 ? 1.0753 1.0036 1.0027 0.0072  -0.0174 0.0128  180 ASP C CG  
3189 O OD1 . ASP C 180 ? 1.1417 1.0654 1.0645 0.0082  -0.0224 0.0108  180 ASP C OD1 
3190 O OD2 . ASP C 180 ? 1.0629 0.9917 0.9894 0.0088  -0.0148 0.0112  180 ASP C OD2 
3191 N N   . GLN C 181 ? 0.9651 0.9062 0.9116 -0.0008 -0.0111 0.0241  181 GLN C N   
3192 C CA  . GLN C 181 ? 0.8960 0.8411 0.8502 -0.0035 -0.0092 0.0279  181 GLN C CA  
3193 C C   . GLN C 181 ? 0.8303 0.7806 0.7872 -0.0033 -0.0035 0.0291  181 GLN C C   
3194 O O   . GLN C 181 ? 0.8258 0.7794 0.7895 -0.0052 -0.0016 0.0317  181 GLN C O   
3195 C CB  . GLN C 181 ? 0.9707 0.9138 0.9325 -0.0061 -0.0121 0.0296  181 GLN C CB  
3196 C CG  . GLN C 181 ? 1.0282 0.9653 0.9884 -0.0064 -0.0183 0.0283  181 GLN C CG  
3197 C CD  . GLN C 181 ? 1.0627 0.9984 1.0196 -0.0067 -0.0215 0.0286  181 GLN C CD  
3198 O OE1 . GLN C 181 ? 1.0747 1.0144 1.0330 -0.0075 -0.0192 0.0308  181 GLN C OE1 
3199 N NE2 . GLN C 181 ? 1.0699 0.9999 1.0225 -0.0059 -0.0269 0.0265  181 GLN C NE2 
3200 N N   . ASN C 182 ? 0.6198 0.5708 0.5714 -0.0008 -0.0009 0.0271  182 ASN C N   
3201 C CA  . ASN C 182 ? 0.6497 0.6052 0.6035 -0.0004 0.0042  0.0281  182 ASN C CA  
3202 C C   . ASN C 182 ? 0.6158 0.5758 0.5686 -0.0002 0.0066  0.0300  182 ASN C C   
3203 O O   . ASN C 182 ? 0.5899 0.5519 0.5382 0.0019  0.0091  0.0294  182 ASN C O   
3204 C CB  . ASN C 182 ? 0.6052 0.5596 0.5545 0.0020  0.0059  0.0255  182 ASN C CB  
3205 C CG  . ASN C 182 ? 0.7082 0.6582 0.6587 0.0017  0.0031  0.0237  182 ASN C CG  
3206 O OD1 . ASN C 182 ? 0.6831 0.6328 0.6402 -0.0005 0.0021  0.0252  182 ASN C OD1 
3207 N ND2 . ASN C 182 ? 0.7126 0.6594 0.6569 0.0041  0.0018  0.0206  182 ASN C ND2 
3208 N N   . TYR C 183 ? 0.5837 0.5452 0.5413 -0.0023 0.0057  0.0324  183 TYR C N   
3209 C CA  . TYR C 183 ? 0.5812 0.5467 0.5390 -0.0025 0.0072  0.0346  183 TYR C CA  
3210 C C   . TYR C 183 ? 0.5511 0.5209 0.5096 -0.0015 0.0117  0.0355  183 TYR C C   
3211 O O   . TYR C 183 ? 0.5134 0.4863 0.4697 -0.0006 0.0129  0.0367  183 TYR C O   
3212 C CB  . TYR C 183 ? 0.4996 0.4662 0.4644 -0.0052 0.0060  0.0372  183 TYR C CB  
3213 C CG  . TYR C 183 ? 0.5750 0.5376 0.5392 -0.0064 0.0013  0.0369  183 TYR C CG  
3214 C CD1 . TYR C 183 ? 0.6004 0.5613 0.5585 -0.0056 -0.0014 0.0361  183 TYR C CD1 
3215 C CD2 . TYR C 183 ? 0.5936 0.5543 0.5636 -0.0082 -0.0005 0.0377  183 TYR C CD2 
3216 C CE1 . TYR C 183 ? 0.6342 0.5909 0.5918 -0.0067 -0.0061 0.0359  183 TYR C CE1 
3217 C CE2 . TYR C 183 ? 0.5986 0.5556 0.5688 -0.0094 -0.0051 0.0378  183 TYR C CE2 
3218 C CZ  . TYR C 183 ? 0.6598 0.6146 0.6238 -0.0087 -0.0081 0.0367  183 TYR C CZ  
3219 O OH  . TYR C 183 ? 0.7312 0.6818 0.6953 -0.0099 -0.0131 0.0368  183 TYR C OH  
3220 N N   . ASN C 184 ? 0.5055 0.4756 0.4672 -0.0015 0.0139  0.0351  184 ASN C N   
3221 C CA  . ASN C 184 ? 0.4924 0.4660 0.4553 -0.0005 0.0178  0.0359  184 ASN C CA  
3222 C C   . ASN C 184 ? 0.5093 0.4836 0.4655 0.0021  0.0192  0.0347  184 ASN C C   
3223 O O   . ASN C 184 ? 0.5331 0.5109 0.4900 0.0029  0.0221  0.0361  184 ASN C O   
3224 C CB  . ASN C 184 ? 0.4945 0.4677 0.4618 -0.0010 0.0194  0.0354  184 ASN C CB  
3225 C CG  . ASN C 184 ? 0.4845 0.4535 0.4493 -0.0006 0.0178  0.0329  184 ASN C CG  
3226 O OD1 . ASN C 184 ? 0.4881 0.4545 0.4541 -0.0017 0.0147  0.0327  184 ASN C OD1 
3227 N ND2 . ASN C 184 ? 0.4969 0.4655 0.4587 0.0011  0.0195  0.0313  184 ASN C ND2 
3228 N N   . ASN C 185 ? 0.5429 0.5140 0.4928 0.0035  0.0171  0.0324  185 ASN C N   
3229 C CA  . ASN C 185 ? 0.5626 0.5344 0.5056 0.0065  0.0184  0.0312  185 ASN C CA  
3230 C C   . ASN C 185 ? 0.5934 0.5679 0.5324 0.0074  0.0179  0.0326  185 ASN C C   
3231 O O   . ASN C 185 ? 0.5890 0.5644 0.5214 0.0101  0.0187  0.0318  185 ASN C O   
3232 C CB  . ASN C 185 ? 0.6138 0.5808 0.5514 0.0081  0.0163  0.0277  185 ASN C CB  
3233 C CG  . ASN C 185 ? 0.6565 0.6222 0.5962 0.0083  0.0179  0.0263  185 ASN C CG  
3234 O OD1 . ASN C 185 ? 0.6409 0.6096 0.5830 0.0086  0.0214  0.0275  185 ASN C OD1 
3235 N ND2 . ASN C 185 ? 0.6241 0.5850 0.5631 0.0082  0.0152  0.0239  185 ASN C ND2 
3236 N N   . ALA C 186 ? 0.5427 0.5186 0.4855 0.0052  0.0166  0.0349  186 ALA C N   
3237 C CA  . ALA C 186 ? 0.5552 0.5336 0.4947 0.0057  0.0157  0.0365  186 ALA C CA  
3238 C C   . ALA C 186 ? 0.5384 0.5221 0.4761 0.0076  0.0190  0.0385  186 ALA C C   
3239 O O   . ALA C 186 ? 0.4811 0.4675 0.4235 0.0073  0.0218  0.0400  186 ALA C O   
3240 C CB  . ALA C 186 ? 0.4874 0.4669 0.4329 0.0028  0.0141  0.0390  186 ALA C CB  
3241 N N   . THR C 187 ? 0.5457 0.5309 0.4765 0.0098  0.0184  0.0385  187 THR C N   
3242 C CA  . THR C 187 ? 0.5398 0.5307 0.4688 0.0118  0.0214  0.0410  187 THR C CA  
3243 C C   . THR C 187 ? 0.5215 0.5167 0.4515 0.0109  0.0206  0.0445  187 THR C C   
3244 O O   . THR C 187 ? 0.4802 0.4809 0.4096 0.0123  0.0228  0.0474  187 THR C O   
3245 C CB  . THR C 187 ? 0.5103 0.5008 0.4302 0.0158  0.0222  0.0387  187 THR C CB  
3246 O OG1 . THR C 187 ? 0.5932 0.5800 0.5064 0.0168  0.0186  0.0361  187 THR C OG1 
3247 C CG2 . THR C 187 ? 0.5621 0.5495 0.4818 0.0168  0.0236  0.0359  187 THR C CG2 
3248 N N   . ALA C 188 ? 0.5167 0.5096 0.4485 0.0086  0.0175  0.0444  188 ALA C N   
3249 C CA  . ALA C 188 ? 0.5509 0.5475 0.4847 0.0073  0.0164  0.0478  188 ALA C CA  
3250 C C   . ALA C 188 ? 0.5376 0.5323 0.4789 0.0036  0.0143  0.0487  188 ALA C C   
3251 O O   . ALA C 188 ? 0.5891 0.5787 0.5312 0.0025  0.0124  0.0462  188 ALA C O   
3252 C CB  . ALA C 188 ? 0.5544 0.5508 0.4797 0.0092  0.0143  0.0470  188 ALA C CB  
3253 N N   . LEU C 189 ? 0.4783 0.4773 0.4255 0.0018  0.0147  0.0524  189 LEU C N   
3254 C CA  . LEU C 189 ? 0.4835 0.4813 0.4374 -0.0013 0.0125  0.0535  189 LEU C CA  
3255 C C   . LEU C 189 ? 0.5433 0.5420 0.4945 -0.0020 0.0097  0.0549  189 LEU C C   
3256 O O   . LEU C 189 ? 0.5223 0.5251 0.4697 -0.0005 0.0104  0.0569  189 LEU C O   
3257 C CB  . LEU C 189 ? 0.4589 0.4603 0.4218 -0.0030 0.0143  0.0564  189 LEU C CB  
3258 C CG  . LEU C 189 ? 0.4946 0.4958 0.4605 -0.0024 0.0171  0.0555  189 LEU C CG  
3259 C CD1 . LEU C 189 ? 0.3983 0.4030 0.3730 -0.0039 0.0181  0.0584  189 LEU C CD1 
3260 C CD2 . LEU C 189 ? 0.4675 0.4634 0.4337 -0.0029 0.0164  0.0521  189 LEU C CD2 
3261 N N   . VAL C 190 ? 0.5179 0.5127 0.4709 -0.0041 0.0067  0.0542  190 VAL C N   
3262 C CA  . VAL C 190 ? 0.5251 0.5204 0.4765 -0.0051 0.0037  0.0557  190 VAL C CA  
3263 C C   . VAL C 190 ? 0.5295 0.5264 0.4903 -0.0084 0.0029  0.0586  190 VAL C C   
3264 O O   . VAL C 190 ? 0.5233 0.5175 0.4898 -0.0101 0.0025  0.0578  190 VAL C O   
3265 C CB  . VAL C 190 ? 0.5756 0.5650 0.5209 -0.0048 0.0001  0.0526  190 VAL C CB  
3266 C CG1 . VAL C 190 ? 0.5495 0.5395 0.4920 -0.0055 -0.0030 0.0542  190 VAL C CG1 
3267 C CG2 . VAL C 190 ? 0.5341 0.5211 0.4706 -0.0013 0.0008  0.0491  190 VAL C CG2 
3268 N N   . ILE C 191 ? 0.5263 0.5279 0.4891 -0.0092 0.0026  0.0620  191 ILE C N   
3269 C CA  . ILE C 191 ? 0.5074 0.5105 0.4791 -0.0122 0.0015  0.0648  191 ILE C CA  
3270 C C   . ILE C 191 ? 0.5903 0.5934 0.5602 -0.0135 -0.0018 0.0663  191 ILE C C   
3271 O O   . ILE C 191 ? 0.5729 0.5791 0.5377 -0.0123 -0.0020 0.0678  191 ILE C O   
3272 C CB  . ILE C 191 ? 0.4987 0.5075 0.4768 -0.0124 0.0039  0.0680  191 ILE C CB  
3273 C CG1 . ILE C 191 ? 0.4982 0.5065 0.4781 -0.0112 0.0069  0.0664  191 ILE C CG1 
3274 C CG2 . ILE C 191 ? 0.4548 0.4649 0.4421 -0.0154 0.0024  0.0706  191 ILE C CG2 
3275 C CD1 . ILE C 191 ? 0.4487 0.4618 0.4358 -0.0116 0.0087  0.0693  191 ILE C CD1 
3276 N N   . THR C 192 ? 0.5822 0.5818 0.5560 -0.0158 -0.0044 0.0660  192 THR C N   
3277 C CA  . THR C 192 ? 0.5334 0.5319 0.5057 -0.0173 -0.0080 0.0672  192 THR C CA  
3278 C C   . THR C 192 ? 0.5995 0.5999 0.5815 -0.0204 -0.0091 0.0703  192 THR C C   
3279 O O   . THR C 192 ? 0.5586 0.5572 0.5473 -0.0218 -0.0089 0.0699  192 THR C O   
3280 C CB  . THR C 192 ? 0.6385 0.6303 0.6062 -0.0173 -0.0111 0.0641  192 THR C CB  
3281 O OG1 . THR C 192 ? 0.6311 0.6210 0.5889 -0.0142 -0.0109 0.0611  192 THR C OG1 
3282 C CG2 . THR C 192 ? 0.7086 0.6989 0.6764 -0.0194 -0.0152 0.0656  192 THR C CG2 
3283 N N   . PHE C 193 ? 0.6694 0.6738 0.6522 -0.0213 -0.0101 0.0736  193 PHE C N   
3284 C CA  . PHE C 193 ? 0.6728 0.6790 0.6642 -0.0243 -0.0118 0.0767  193 PHE C CA  
3285 C C   . PHE C 193 ? 0.7068 0.7103 0.6950 -0.0258 -0.0159 0.0771  193 PHE C C   
3286 O O   . PHE C 193 ? 0.6944 0.6999 0.6768 -0.0251 -0.0170 0.0784  193 PHE C O   
3287 C CB  . PHE C 193 ? 0.6383 0.6511 0.6340 -0.0247 -0.0106 0.0806  193 PHE C CB  
3288 C CG  . PHE C 193 ? 0.6378 0.6537 0.6365 -0.0232 -0.0071 0.0806  193 PHE C CG  
3289 C CD1 . PHE C 193 ? 0.5787 0.5959 0.5873 -0.0246 -0.0062 0.0818  193 PHE C CD1 
3290 C CD2 . PHE C 193 ? 0.6040 0.6213 0.5957 -0.0204 -0.0047 0.0796  193 PHE C CD2 
3291 C CE1 . PHE C 193 ? 0.5028 0.5223 0.5142 -0.0232 -0.0034 0.0818  193 PHE C CE1 
3292 C CE2 . PHE C 193 ? 0.5509 0.5709 0.5458 -0.0192 -0.0017 0.0799  193 PHE C CE2 
3293 C CZ  . PHE C 193 ? 0.4596 0.4804 0.4642 -0.0206 -0.0012 0.0810  193 PHE C CZ  
3294 N N   . PRO C 194 ? 0.5726 0.5716 0.5646 -0.0277 -0.0181 0.0763  194 PRO C N   
3295 C CA  . PRO C 194 ? 0.5382 0.5348 0.5289 -0.0295 -0.0222 0.0774  194 PRO C CA  
3296 C C   . PRO C 194 ? 0.5027 0.5037 0.5001 -0.0319 -0.0233 0.0816  194 PRO C C   
3297 O O   . PRO C 194 ? 0.4757 0.4789 0.4824 -0.0334 -0.0220 0.0832  194 PRO C O   
3298 C CB  . PRO C 194 ? 0.5639 0.5552 0.5586 -0.0309 -0.0239 0.0759  194 PRO C CB  
3299 C CG  . PRO C 194 ? 0.6269 0.6174 0.6222 -0.0292 -0.0206 0.0734  194 PRO C CG  
3300 C CD  . PRO C 194 ? 0.5798 0.5759 0.5768 -0.0280 -0.0169 0.0745  194 PRO C CD  
3301 N N   . VAL C 195 ? 0.6774 0.6796 0.6700 -0.0323 -0.0257 0.0832  195 VAL C N   
3302 C CA  . VAL C 195 ? 0.6800 0.6862 0.6786 -0.0348 -0.0272 0.0874  195 VAL C CA  
3303 C C   . VAL C 195 ? 0.6882 0.6910 0.6851 -0.0368 -0.0317 0.0881  195 VAL C C   
3304 O O   . VAL C 195 ? 0.7039 0.7031 0.6915 -0.0354 -0.0338 0.0860  195 VAL C O   
3305 C CB  . VAL C 195 ? 0.6267 0.6394 0.6221 -0.0335 -0.0257 0.0898  195 VAL C CB  
3306 C CG1 . VAL C 195 ? 0.6278 0.6447 0.6298 -0.0362 -0.0276 0.0944  195 VAL C CG1 
3307 C CG2 . VAL C 195 ? 0.6882 0.7043 0.6860 -0.0317 -0.0216 0.0896  195 VAL C CG2 
3308 N N   . ASN C 196 ? 0.7129 0.7165 0.7188 -0.0399 -0.0335 0.0910  196 ASN C N   
3309 C CA  . ASN C 196 ? 0.7526 0.7533 0.7580 -0.0421 -0.0379 0.0924  196 ASN C CA  
3310 C C   . ASN C 196 ? 0.7774 0.7797 0.7737 -0.0413 -0.0399 0.0932  196 ASN C C   
3311 O O   . ASN C 196 ? 0.8168 0.8251 0.8128 -0.0407 -0.0383 0.0956  196 ASN C O   
3312 C CB  . ASN C 196 ? 0.7456 0.7485 0.7627 -0.0455 -0.0390 0.0961  196 ASN C CB  
3313 C CG  . ASN C 196 ? 0.7978 0.7978 0.8231 -0.0466 -0.0385 0.0952  196 ASN C CG  
3314 O OD1 . ASN C 196 ? 0.9165 0.9113 0.9414 -0.0476 -0.0411 0.0943  196 ASN C OD1 
3315 N ND2 . ASN C 196 ? 0.6963 0.6995 0.7293 -0.0464 -0.0353 0.0958  196 ASN C ND2 
3316 N N   . ASN C 197 ? 0.8954 0.8924 0.8845 -0.0411 -0.0435 0.0914  197 ASN C N   
3317 C CA  . ASN C 197 ? 1.0053 1.0033 0.9846 -0.0398 -0.0456 0.0917  197 ASN C CA  
3318 C C   . ASN C 197 ? 0.9657 0.9672 0.9493 -0.0426 -0.0481 0.0962  197 ASN C C   
3319 O O   . ASN C 197 ? 1.0034 1.0093 0.9816 -0.0416 -0.0483 0.0980  197 ASN C O   
3320 C CB  . ASN C 197 ? 1.0842 1.0747 1.0541 -0.0384 -0.0493 0.0880  197 ASN C CB  
3321 C CG  . ASN C 197 ? 1.0609 1.0523 1.0177 -0.0348 -0.0494 0.0862  197 ASN C CG  
3322 O OD1 . ASN C 197 ? 1.2150 1.2093 1.1677 -0.0349 -0.0513 0.0883  197 ASN C OD1 
3323 N ND2 . ASN C 197 ? 1.0554 1.0448 1.0055 -0.0315 -0.0474 0.0823  197 ASN C ND2 
3324 N N   . TYR C 198 ? 0.7730 0.7727 0.7665 -0.0461 -0.0500 0.0982  198 TYR C N   
3325 C CA  . TYR C 198 ? 0.7548 0.7577 0.7542 -0.0493 -0.0525 0.1027  198 TYR C CA  
3326 C C   . TYR C 198 ? 0.8215 0.8234 0.8116 -0.0491 -0.0564 0.1032  198 TYR C C   
3327 O O   . TYR C 198 ? 0.7321 0.7392 0.7232 -0.0503 -0.0572 0.1069  198 TYR C O   
3328 C CB  . TYR C 198 ? 0.7133 0.7243 0.7191 -0.0497 -0.0493 0.1061  198 TYR C CB  
3329 C CG  . TYR C 198 ? 0.7081 0.7205 0.7247 -0.0503 -0.0462 0.1063  198 TYR C CG  
3330 C CD1 . TYR C 198 ? 0.6033 0.6125 0.6291 -0.0528 -0.0474 0.1066  198 TYR C CD1 
3331 C CD2 . TYR C 198 ? 0.6799 0.6968 0.6973 -0.0483 -0.0421 0.1061  198 TYR C CD2 
3332 C CE1 . TYR C 198 ? 0.5972 0.6078 0.6323 -0.0530 -0.0445 0.1065  198 TYR C CE1 
3333 C CE2 . TYR C 198 ? 0.6273 0.6452 0.6540 -0.0486 -0.0395 0.1059  198 TYR C CE2 
3334 C CZ  . TYR C 198 ? 0.6414 0.6561 0.6766 -0.0509 -0.0407 0.1060  198 TYR C CZ  
3335 O OH  . TYR C 198 ? 0.5607 0.5766 0.6045 -0.0508 -0.0380 0.1056  198 TYR C OH  
3336 N N   . TYR C 199 ? 0.8827 0.8779 0.8638 -0.0476 -0.0591 0.0996  199 TYR C N   
3337 C CA  . TYR C 199 ? 0.9116 0.9045 0.8833 -0.0472 -0.0635 0.0995  199 TYR C CA  
3338 C C   . TYR C 199 ? 0.9505 0.9428 0.9291 -0.0513 -0.0676 0.1032  199 TYR C C   
3339 O O   . TYR C 199 ? 0.9657 0.9592 0.9392 -0.0517 -0.0705 0.1050  199 TYR C O   
3340 C CB  . TYR C 199 ? 0.9716 0.9562 0.9341 -0.0450 -0.0662 0.0946  199 TYR C CB  
3341 C CG  . TYR C 199 ? 0.9999 0.9780 0.9700 -0.0476 -0.0688 0.0940  199 TYR C CG  
3342 C CD1 . TYR C 199 ? 1.0134 0.9864 0.9841 -0.0501 -0.0745 0.0951  199 TYR C CD1 
3343 C CD2 . TYR C 199 ? 0.9319 0.9093 0.9091 -0.0477 -0.0656 0.0928  199 TYR C CD2 
3344 C CE1 . TYR C 199 ? 0.9493 0.9169 0.9277 -0.0526 -0.0767 0.0952  199 TYR C CE1 
3345 C CE2 . TYR C 199 ? 0.9870 0.9593 0.9714 -0.0500 -0.0677 0.0929  199 TYR C CE2 
3346 C CZ  . TYR C 199 ? 1.0298 0.9974 1.0150 -0.0525 -0.0732 0.0942  199 TYR C CZ  
3347 O OH  . TYR C 199 ? 1.0322 0.9951 1.0252 -0.0547 -0.0753 0.0947  199 TYR C OH  
3348 N N   . ASN C 200 ? 0.9927 0.9832 0.9829 -0.0543 -0.0676 0.1045  200 ASN C N   
3349 C CA  . ASN C 200 ? 1.0326 1.0220 1.0309 -0.0584 -0.0713 0.1080  200 ASN C CA  
3350 C C   . ASN C 200 ? 1.0400 1.0371 1.0471 -0.0606 -0.0696 0.1128  200 ASN C C   
3351 O O   . ASN C 200 ? 1.0544 1.0517 1.0681 -0.0640 -0.0725 0.1162  200 ASN C O   
3352 C CB  . ASN C 200 ? 1.0224 1.0067 1.0294 -0.0602 -0.0719 0.1074  200 ASN C CB  
3353 C CG  . ASN C 200 ? 1.0700 1.0515 1.0839 -0.0641 -0.0765 0.1105  200 ASN C CG  
3354 O OD1 . ASN C 200 ? 1.0826 1.0623 1.0912 -0.0650 -0.0807 0.1115  200 ASN C OD1 
3355 N ND2 . ASN C 200 ? 1.1025 1.0835 1.1282 -0.0663 -0.0756 0.1120  200 ASN C ND2 
3356 N N   . ASP C 201 ? 0.8736 0.8769 0.8810 -0.0587 -0.0651 0.1131  201 ASP C N   
3357 C CA  . ASP C 201 ? 0.8098 0.8202 0.8276 -0.0607 -0.0633 0.1174  201 ASP C CA  
3358 C C   . ASP C 201 ? 0.7995 0.8174 0.8131 -0.0585 -0.0603 0.1188  201 ASP C C   
3359 O O   . ASP C 201 ? 0.7698 0.7899 0.7831 -0.0561 -0.0563 0.1172  201 ASP C O   
3360 C CB  . ASP C 201 ? 0.7900 0.8001 0.8187 -0.0614 -0.0604 0.1168  201 ASP C CB  
3361 C CG  . ASP C 201 ? 0.8656 0.8813 0.9067 -0.0640 -0.0597 0.1211  201 ASP C CG  
3362 O OD1 . ASP C 201 ? 0.8783 0.8996 0.9196 -0.0648 -0.0603 0.1245  201 ASP C OD1 
3363 O OD2 . ASP C 201 ? 0.8918 0.9063 0.9427 -0.0653 -0.0588 0.1211  201 ASP C OD2 
3364 N N   . THR C 202 ? 0.7929 0.8150 0.8039 -0.0594 -0.0624 0.1223  202 THR C N   
3365 C CA  . THR C 202 ? 0.7621 0.7919 0.7687 -0.0573 -0.0600 0.1244  202 THR C CA  
3366 C C   . THR C 202 ? 0.8099 0.8462 0.8269 -0.0577 -0.0563 0.1270  202 THR C C   
3367 O O   . THR C 202 ? 0.7359 0.7765 0.7494 -0.0549 -0.0529 0.1267  202 THR C O   
3368 C CB  . THR C 202 ? 0.8364 0.8701 0.8398 -0.0586 -0.0631 0.1284  202 THR C CB  
3369 O OG1 . THR C 202 ? 0.8665 0.8983 0.8790 -0.0629 -0.0667 0.1311  202 THR C OG1 
3370 C CG2 . THR C 202 ? 0.8101 0.8403 0.7982 -0.0558 -0.0653 0.1255  202 THR C CG2 
3371 N N   . GLU C 203 ? 0.8342 0.8713 0.8642 -0.0612 -0.0572 0.1296  203 GLU C N   
3372 C CA  . GLU C 203 ? 0.8225 0.8656 0.8628 -0.0617 -0.0546 0.1324  203 GLU C CA  
3373 C C   . GLU C 203 ? 0.8116 0.8529 0.8531 -0.0594 -0.0507 0.1287  203 GLU C C   
3374 O O   . GLU C 203 ? 0.8133 0.8597 0.8569 -0.0579 -0.0478 0.1298  203 GLU C O   
3375 C CB  . GLU C 203 ? 0.8814 0.9255 0.9351 -0.0658 -0.0570 0.1359  203 GLU C CB  
3376 C CG  . GLU C 203 ? 0.9702 1.0228 1.0319 -0.0672 -0.0568 0.1413  203 GLU C CG  
3377 C CD  . GLU C 203 ? 1.0241 1.0816 1.0793 -0.0675 -0.0588 0.1450  203 GLU C CD  
3378 O OE1 . GLU C 203 ? 0.9963 1.0505 1.0472 -0.0690 -0.0622 0.1452  203 GLU C OE1 
3379 O OE2 . GLU C 203 ? 1.0714 1.1360 1.1256 -0.0661 -0.0570 0.1478  203 GLU C OE2 
3380 N N   . LYS C 204 ? 0.7315 0.7657 0.7720 -0.0590 -0.0508 0.1246  204 LYS C N   
3381 C CA  . LYS C 204 ? 0.6988 0.7311 0.7387 -0.0565 -0.0471 0.1208  204 LYS C CA  
3382 C C   . LYS C 204 ? 0.6276 0.6608 0.6555 -0.0527 -0.0449 0.1185  204 LYS C C   
3383 O O   . LYS C 204 ? 0.6247 0.6598 0.6528 -0.0506 -0.0414 0.1172  204 LYS C O   
3384 C CB  . LYS C 204 ? 0.6678 0.6927 0.7088 -0.0568 -0.0477 0.1172  204 LYS C CB  
3385 C CG  . LYS C 204 ? 0.7773 0.8018 0.8311 -0.0587 -0.0471 0.1179  204 LYS C CG  
3386 C CD  . LYS C 204 ? 0.9213 0.9438 0.9810 -0.0621 -0.0509 0.1202  204 LYS C CD  
3387 C CE  . LYS C 204 ? 0.9266 0.9449 0.9939 -0.0631 -0.0507 0.1188  204 LYS C CE  
3388 N NZ  . LYS C 204 ? 0.9977 1.0147 1.0719 -0.0665 -0.0544 0.1217  204 LYS C NZ  
3389 N N   . LEU C 205 ? 0.5834 0.6150 0.6008 -0.0519 -0.0470 0.1179  205 LEU C N   
3390 C CA  . LEU C 205 ? 0.5909 0.6233 0.5960 -0.0480 -0.0452 0.1156  205 LEU C CA  
3391 C C   . LEU C 205 ? 0.5966 0.6377 0.6029 -0.0467 -0.0424 0.1190  205 LEU C C   
3392 O O   . LEU C 205 ? 0.5784 0.6210 0.5810 -0.0437 -0.0390 0.1172  205 LEU C O   
3393 C CB  . LEU C 205 ? 0.6400 0.6695 0.6339 -0.0472 -0.0486 0.1146  205 LEU C CB  
3394 C CG  . LEU C 205 ? 0.6920 0.7224 0.6723 -0.0428 -0.0470 0.1122  205 LEU C CG  
3395 C CD1 . LEU C 205 ? 0.6272 0.6526 0.6037 -0.0402 -0.0445 0.1070  205 LEU C CD1 
3396 C CD2 . LEU C 205 ? 0.6293 0.6571 0.5987 -0.0420 -0.0508 0.1114  205 LEU C CD2 
3397 N N   . GLN C 206 ? 0.6160 0.6628 0.6281 -0.0490 -0.0440 0.1242  206 GLN C N   
3398 C CA  . GLN C 206 ? 0.6353 0.6911 0.6502 -0.0483 -0.0419 0.1286  206 GLN C CA  
3399 C C   . GLN C 206 ? 0.5436 0.6009 0.5659 -0.0475 -0.0385 0.1280  206 GLN C C   
3400 O O   . GLN C 206 ? 0.4845 0.5464 0.5038 -0.0449 -0.0356 0.1288  206 GLN C O   
3401 C CB  . GLN C 206 ? 0.6298 0.6909 0.6536 -0.0518 -0.0445 0.1345  206 GLN C CB  
3402 C CG  . GLN C 206 ? 0.6793 0.7391 0.6978 -0.0533 -0.0484 0.1357  206 GLN C CG  
3403 C CD  . GLN C 206 ? 0.6990 0.7593 0.7024 -0.0497 -0.0481 0.1340  206 GLN C CD  
3404 O OE1 . GLN C 206 ? 0.7433 0.8111 0.7431 -0.0478 -0.0465 0.1372  206 GLN C OE1 
3405 N NE2 . GLN C 206 ? 0.6996 0.7520 0.6941 -0.0486 -0.0497 0.1292  206 GLN C NE2 
3406 N N   . ARG C 207 ? 0.5150 0.5684 0.5469 -0.0497 -0.0389 0.1268  207 ARG C N   
3407 C CA  . ARG C 207 ? 0.4494 0.5037 0.4892 -0.0492 -0.0362 0.1262  207 ARG C CA  
3408 C C   . ARG C 207 ? 0.4535 0.5043 0.4855 -0.0458 -0.0331 0.1213  207 ARG C C   
3409 O O   . ARG C 207 ? 0.3888 0.4428 0.4222 -0.0440 -0.0302 0.1216  207 ARG C O   
3410 C CB  . ARG C 207 ? 0.4936 0.5447 0.5450 -0.0521 -0.0377 0.1260  207 ARG C CB  
3411 C CG  . ARG C 207 ? 0.5545 0.6104 0.6162 -0.0553 -0.0403 0.1313  207 ARG C CG  
3412 C CD  . ARG C 207 ? 0.6655 0.7174 0.7362 -0.0583 -0.0426 0.1310  207 ARG C CD  
3413 N NE  . ARG C 207 ? 0.7316 0.7882 0.8122 -0.0614 -0.0453 0.1361  207 ARG C NE  
3414 C CZ  . ARG C 207 ? 0.7260 0.7850 0.8047 -0.0633 -0.0480 0.1396  207 ARG C CZ  
3415 N NH1 . ARG C 207 ? 0.6661 0.7232 0.7329 -0.0622 -0.0487 0.1383  207 ARG C NH1 
3416 N NH2 . ARG C 207 ? 0.7668 0.8302 0.8555 -0.0662 -0.0504 0.1443  207 ARG C NH2 
3417 N N   . ALA C 208 ? 0.5046 0.5488 0.5284 -0.0449 -0.0339 0.1172  208 ALA C N   
3418 C CA  . ALA C 208 ? 0.5277 0.5681 0.5434 -0.0417 -0.0313 0.1125  208 ALA C CA  
3419 C C   . ALA C 208 ? 0.5378 0.5828 0.5443 -0.0384 -0.0292 0.1130  208 ALA C C   
3420 O O   . ALA C 208 ? 0.5357 0.5813 0.5402 -0.0359 -0.0259 0.1112  208 ALA C O   
3421 C CB  . ALA C 208 ? 0.4697 0.5023 0.4789 -0.0416 -0.0334 0.1084  208 ALA C CB  
3422 N N   . GLN C 209 ? 0.5232 0.5718 0.5241 -0.0382 -0.0309 0.1157  209 GLN C N   
3423 C CA  . GLN C 209 ? 0.5461 0.6000 0.5381 -0.0349 -0.0289 0.1168  209 GLN C CA  
3424 C C   . GLN C 209 ? 0.5126 0.5747 0.5118 -0.0346 -0.0263 0.1213  209 GLN C C   
3425 O O   . GLN C 209 ? 0.4856 0.5512 0.4797 -0.0314 -0.0233 0.1212  209 GLN C O   
3426 C CB  . GLN C 209 ? 0.5172 0.5734 0.5018 -0.0348 -0.0316 0.1189  209 GLN C CB  
3427 C CG  . GLN C 209 ? 0.5546 0.6030 0.5299 -0.0342 -0.0344 0.1145  209 GLN C CG  
3428 C CD  . GLN C 209 ? 0.6813 0.7318 0.6500 -0.0344 -0.0375 0.1168  209 GLN C CD  
3429 O OE1 . GLN C 209 ? 0.7345 0.7921 0.7079 -0.0359 -0.0380 0.1222  209 GLN C OE1 
3430 N NE2 . GLN C 209 ? 0.7673 0.8117 0.7252 -0.0327 -0.0399 0.1128  209 GLN C NE2 
3431 N N   . ALA C 210 ? 0.4622 0.5274 0.4736 -0.0379 -0.0276 0.1252  210 ALA C N   
3432 C CA  . ALA C 210 ? 0.4927 0.5649 0.5125 -0.0380 -0.0258 0.1295  210 ALA C CA  
3433 C C   . ALA C 210 ? 0.4846 0.5541 0.5064 -0.0363 -0.0227 0.1261  210 ALA C C   
3434 O O   . ALA C 210 ? 0.4156 0.4896 0.4366 -0.0341 -0.0200 0.1276  210 ALA C O   
3435 C CB  . ALA C 210 ? 0.4024 0.4773 0.4355 -0.0420 -0.0284 0.1338  210 ALA C CB  
3436 N N   . TRP C 211 ? 0.4409 0.5030 0.4652 -0.0373 -0.0231 0.1218  211 TRP C N   
3437 C CA  . TRP C 211 ? 0.4489 0.5081 0.4750 -0.0357 -0.0203 0.1184  211 TRP C CA  
3438 C C   . TRP C 211 ? 0.4460 0.5042 0.4602 -0.0319 -0.0176 0.1153  211 TRP C C   
3439 O O   . TRP C 211 ? 0.4103 0.4706 0.4249 -0.0300 -0.0148 0.1152  211 TRP C O   
3440 C CB  . TRP C 211 ? 0.4317 0.4836 0.4618 -0.0372 -0.0212 0.1144  211 TRP C CB  
3441 C CG  . TRP C 211 ? 0.4596 0.5090 0.4921 -0.0357 -0.0185 0.1113  211 TRP C CG  
3442 C CD1 . TRP C 211 ? 0.4227 0.4734 0.4655 -0.0365 -0.0179 0.1123  211 TRP C CD1 
3443 C CD2 . TRP C 211 ? 0.3833 0.4286 0.4075 -0.0329 -0.0161 0.1067  211 TRP C CD2 
3444 N NE1 . TRP C 211 ? 0.3994 0.4470 0.4405 -0.0344 -0.0152 0.1087  211 TRP C NE1 
3445 C CE2 . TRP C 211 ? 0.4255 0.4699 0.4555 -0.0324 -0.0140 0.1053  211 TRP C CE2 
3446 C CE3 . TRP C 211 ? 0.4393 0.4813 0.4519 -0.0309 -0.0157 0.1036  211 TRP C CE3 
3447 C CZ2 . TRP C 211 ? 0.4169 0.4576 0.4416 -0.0300 -0.0115 0.1011  211 TRP C CZ2 
3448 C CZ3 . TRP C 211 ? 0.4664 0.5046 0.4740 -0.0285 -0.0133 0.0993  211 TRP C CZ3 
3449 C CH2 . TRP C 211 ? 0.4127 0.4504 0.4265 -0.0281 -0.0111 0.0983  211 TRP C CH2 
3450 N N   . GLU C 212 ? 0.4932 0.5483 0.4972 -0.0309 -0.0188 0.1130  212 GLU C N   
3451 C CA  . GLU C 212 ? 0.5385 0.5919 0.5307 -0.0271 -0.0167 0.1095  212 GLU C CA  
3452 C C   . GLU C 212 ? 0.5598 0.6210 0.5485 -0.0244 -0.0142 0.1129  212 GLU C C   
3453 O O   . GLU C 212 ? 0.6118 0.6729 0.5959 -0.0215 -0.0112 0.1108  212 GLU C O   
3454 C CB  . GLU C 212 ? 0.5983 0.6471 0.5804 -0.0266 -0.0193 0.1069  212 GLU C CB  
3455 C CG  . GLU C 212 ? 0.6907 0.7363 0.6608 -0.0226 -0.0177 0.1023  212 GLU C CG  
3456 C CD  . GLU C 212 ? 0.8935 0.9308 0.8571 -0.0228 -0.0206 0.0978  212 GLU C CD  
3457 O OE1 . GLU C 212 ? 0.8760 0.9096 0.8459 -0.0261 -0.0234 0.0979  212 GLU C OE1 
3458 O OE2 . GLU C 212 ? 0.9037 0.9382 0.8564 -0.0195 -0.0204 0.0943  212 GLU C OE2 
3459 N N   . LYS C 213 ? 0.5302 0.5984 0.5215 -0.0255 -0.0153 0.1183  213 LYS C N   
3460 C CA  . LYS C 213 ? 0.5126 0.5892 0.5016 -0.0231 -0.0130 0.1225  213 LYS C CA  
3461 C C   . LYS C 213 ? 0.5470 0.6266 0.5444 -0.0229 -0.0104 0.1241  213 LYS C C   
3462 O O   . LYS C 213 ? 0.5528 0.6357 0.5458 -0.0197 -0.0073 0.1245  213 LYS C O   
3463 C CB  . LYS C 213 ? 0.5828 0.6665 0.5749 -0.0249 -0.0152 0.1286  213 LYS C CB  
3464 C CG  . LYS C 213 ? 0.7027 0.7967 0.6959 -0.0232 -0.0131 0.1345  213 LYS C CG  
3465 C CD  . LYS C 213 ? 0.7468 0.8475 0.7414 -0.0248 -0.0155 0.1403  213 LYS C CD  
3466 C CE  . LYS C 213 ? 0.8390 0.9508 0.8345 -0.0229 -0.0134 0.1468  213 LYS C CE  
3467 N NZ  . LYS C 213 ? 0.9055 1.0241 0.8991 -0.0236 -0.0154 0.1520  213 LYS C NZ  
3468 N N   . GLU C 214 ? 0.5140 0.5922 0.5233 -0.0260 -0.0116 0.1250  214 GLU C N   
3469 C CA  . GLU C 214 ? 0.4949 0.5748 0.5125 -0.0259 -0.0098 0.1262  214 GLU C CA  
3470 C C   . GLU C 214 ? 0.5253 0.5995 0.5378 -0.0235 -0.0071 0.1205  214 GLU C C   
3471 O O   . GLU C 214 ? 0.5158 0.5927 0.5294 -0.0216 -0.0045 0.1214  214 GLU C O   
3472 C CB  . GLU C 214 ? 0.5167 0.5955 0.5475 -0.0295 -0.0122 0.1276  214 GLU C CB  
3473 C CG  . GLU C 214 ? 0.5757 0.6616 0.6144 -0.0320 -0.0146 0.1342  214 GLU C CG  
3474 C CD  . GLU C 214 ? 0.6965 0.7911 0.7388 -0.0308 -0.0132 0.1399  214 GLU C CD  
3475 O OE1 . GLU C 214 ? 0.6162 0.7120 0.6683 -0.0315 -0.0132 0.1416  214 GLU C OE1 
3476 O OE2 . GLU C 214 ? 0.8208 0.9209 0.8559 -0.0290 -0.0122 0.1428  214 GLU C OE2 
3477 N N   . PHE C 215 ? 0.4778 0.5442 0.4849 -0.0235 -0.0078 0.1151  215 PHE C N   
3478 C CA  . PHE C 215 ? 0.5011 0.5618 0.5036 -0.0214 -0.0055 0.1097  215 PHE C CA  
3479 C C   . PHE C 215 ? 0.4943 0.5568 0.4856 -0.0174 -0.0029 0.1086  215 PHE C C   
3480 O O   . PHE C 215 ? 0.4750 0.5370 0.4653 -0.0154 -0.0002 0.1069  215 PHE C O   
3481 C CB  . PHE C 215 ? 0.4599 0.5124 0.4601 -0.0227 -0.0074 0.1049  215 PHE C CB  
3482 C CG  . PHE C 215 ? 0.4901 0.5368 0.4818 -0.0201 -0.0057 0.0993  215 PHE C CG  
3483 C CD1 . PHE C 215 ? 0.4386 0.4819 0.4338 -0.0198 -0.0038 0.0965  215 PHE C CD1 
3484 C CD2 . PHE C 215 ? 0.5088 0.5531 0.4891 -0.0181 -0.0063 0.0968  215 PHE C CD2 
3485 C CE1 . PHE C 215 ? 0.4781 0.5162 0.4660 -0.0176 -0.0025 0.0916  215 PHE C CE1 
3486 C CE2 . PHE C 215 ? 0.5471 0.5859 0.5201 -0.0159 -0.0052 0.0918  215 PHE C CE2 
3487 C CZ  . PHE C 215 ? 0.5676 0.6034 0.5446 -0.0157 -0.0032 0.0893  215 PHE C CZ  
3488 N N   . ILE C 216 ? 0.4505 0.5151 0.4333 -0.0162 -0.0038 0.1094  216 ILE C N   
3489 C CA  . ILE C 216 ? 0.5034 0.5700 0.4750 -0.0120 -0.0014 0.1083  216 ILE C CA  
3490 C C   . ILE C 216 ? 0.4934 0.5680 0.4684 -0.0104 0.0015  0.1128  216 ILE C C   
3491 O O   . ILE C 216 ? 0.4578 0.5325 0.4287 -0.0075 0.0044  0.1111  216 ILE C O   
3492 C CB  . ILE C 216 ? 0.5522 0.6205 0.5143 -0.0108 -0.0033 0.1089  216 ILE C CB  
3493 C CG1 . ILE C 216 ? 0.5403 0.6002 0.4986 -0.0122 -0.0065 0.1043  216 ILE C CG1 
3494 C CG2 . ILE C 216 ? 0.4671 0.5382 0.4175 -0.0059 -0.0007 0.1079  216 ILE C CG2 
3495 C CD1 . ILE C 216 ? 0.5978 0.6587 0.5477 -0.0115 -0.0090 0.1049  216 ILE C CD1 
3496 N N   . ASN C 217 ? 0.4966 0.5779 0.4801 -0.0125 0.0005  0.1189  217 ASN C N   
3497 C CA  . ASN C 217 ? 0.5369 0.6264 0.5253 -0.0114 0.0027  0.1243  217 ASN C CA  
3498 C C   . ASN C 217 ? 0.4917 0.5792 0.4877 -0.0118 0.0043  0.1233  217 ASN C C   
3499 O O   . ASN C 217 ? 0.4584 0.5494 0.4534 -0.0093 0.0071  0.1247  217 ASN C O   
3500 C CB  . ASN C 217 ? 0.4978 0.5945 0.4945 -0.0140 0.0005  0.1311  217 ASN C CB  
3501 C CG  . ASN C 217 ? 0.5495 0.6558 0.5505 -0.0128 0.0023  0.1377  217 ASN C CG  
3502 O OD1 . ASN C 217 ? 0.6599 0.7717 0.6529 -0.0095 0.0045  0.1396  217 ASN C OD1 
3503 N ND2 . ASN C 217 ? 0.5652 0.6738 0.5791 -0.0152 0.0014  0.1413  217 ASN C ND2 
3504 N N   . PHE C 218 ? 0.4074 0.4891 0.4109 -0.0147 0.0025  0.1210  218 PHE C N   
3505 C CA  . PHE C 218 ? 0.4077 0.4867 0.4178 -0.0149 0.0038  0.1193  218 PHE C CA  
3506 C C   . PHE C 218 ? 0.4618 0.5364 0.4630 -0.0117 0.0067  0.1143  218 PHE C C   
3507 O O   . PHE C 218 ? 0.4120 0.4889 0.4141 -0.0099 0.0092  0.1152  218 PHE C O   
3508 C CB  . PHE C 218 ? 0.3566 0.4298 0.3746 -0.0181 0.0014  0.1170  218 PHE C CB  
3509 C CG  . PHE C 218 ? 0.4167 0.4868 0.4413 -0.0182 0.0024  0.1151  218 PHE C CG  
3510 C CD1 . PHE C 218 ? 0.3790 0.4418 0.3998 -0.0174 0.0035  0.1091  218 PHE C CD1 
3511 C CD2 . PHE C 218 ? 0.3528 0.4273 0.3873 -0.0190 0.0020  0.1194  218 PHE C CD2 
3512 C CE1 . PHE C 218 ? 0.3549 0.4150 0.3813 -0.0174 0.0044  0.1073  218 PHE C CE1 
3513 C CE2 . PHE C 218 ? 0.3988 0.4702 0.4390 -0.0189 0.0027  0.1175  218 PHE C CE2 
3514 C CZ  . PHE C 218 ? 0.3630 0.4272 0.3989 -0.0181 0.0040  0.1114  218 PHE C CZ  
3515 N N   . VAL C 219 ? 0.4688 0.5372 0.4616 -0.0111 0.0062  0.1091  219 VAL C N   
3516 C CA  . VAL C 219 ? 0.5183 0.5818 0.5032 -0.0084 0.0084  0.1039  219 VAL C CA  
3517 C C   . VAL C 219 ? 0.5888 0.6570 0.5649 -0.0046 0.0111  0.1050  219 VAL C C   
3518 O O   . VAL C 219 ? 0.5201 0.5869 0.4930 -0.0022 0.0137  0.1027  219 VAL C O   
3519 C CB  . VAL C 219 ? 0.5585 0.6140 0.5375 -0.0090 0.0066  0.0984  219 VAL C CB  
3520 C CG1 . VAL C 219 ? 0.6674 0.7183 0.6371 -0.0060 0.0085  0.0933  219 VAL C CG1 
3521 C CG2 . VAL C 219 ? 0.4836 0.5343 0.4716 -0.0123 0.0048  0.0969  219 VAL C CG2 
3522 N N   . LYS C 220 ? 0.6271 0.7010 0.5992 -0.0037 0.0105  0.1086  220 LYS C N   
3523 C CA  . LYS C 220 ? 0.5993 0.6781 0.5630 0.0005  0.0133  0.1097  220 LYS C CA  
3524 C C   . LYS C 220 ? 0.6184 0.7046 0.5893 0.0011  0.0157  0.1151  220 LYS C C   
3525 O O   . LYS C 220 ? 0.6054 0.6945 0.5708 0.0046  0.0187  0.1154  220 LYS C O   
3526 C CB  . LYS C 220 ? 0.6324 0.7151 0.5877 0.0020  0.0123  0.1114  220 LYS C CB  
3527 C CG  . LYS C 220 ? 0.6758 0.7684 0.6363 0.0013  0.0120  0.1189  220 LYS C CG  
3528 C CD  . LYS C 220 ? 0.8797 0.9794 0.8302 0.0055  0.0138  0.1214  220 LYS C CD  
3529 C CE  . LYS C 220 ? 0.7910 0.8995 0.7451 0.0042  0.0124  0.1284  220 LYS C CE  
3530 N NZ  . LYS C 220 ? 0.8334 0.9492 0.8006 0.0021  0.0129  0.1355  220 LYS C NZ  
3531 N N   . ASN C 221 ? 0.5281 0.6171 0.5112 -0.0020 0.0145  0.1194  221 ASN C N   
3532 C CA  . ASN C 221 ? 0.5082 0.6029 0.4971 -0.0010 0.0167  0.1237  221 ASN C CA  
3533 C C   . ASN C 221 ? 0.5387 0.6290 0.5373 -0.0032 0.0163  0.1223  221 ASN C C   
3534 O O   . ASN C 221 ? 0.5251 0.6196 0.5335 -0.0044 0.0160  0.1270  221 ASN C O   
3535 C CB  . ASN C 221 ? 0.6240 0.7291 0.6191 -0.0015 0.0163  0.1321  221 ASN C CB  
3536 C CG  . ASN C 221 ? 0.6571 0.7664 0.6461 -0.0010 0.0151  0.1341  221 ASN C CG  
3537 O OD1 . ASN C 221 ? 0.8411 0.9448 0.8231 -0.0012 0.0137  0.1295  221 ASN C OD1 
3538 N ND2 . ASN C 221 ? 0.8227 0.9421 0.8125 0.0004  0.0162  0.1410  221 ASN C ND2 
3539 N N   . TYR C 222 ? 0.4924 0.5740 0.4881 -0.0036 0.0161  0.1158  222 TYR C N   
3540 C CA  . TYR C 222 ? 0.4949 0.5718 0.4981 -0.0051 0.0160  0.1137  222 TYR C CA  
3541 C C   . TYR C 222 ? 0.4599 0.5385 0.4621 -0.0025 0.0191  0.1141  222 TYR C C   
3542 O O   . TYR C 222 ? 0.4725 0.5496 0.4653 0.0004  0.0214  0.1111  222 TYR C O   
3543 C CB  . TYR C 222 ? 0.4475 0.5152 0.4475 -0.0060 0.0150  0.1069  222 TYR C CB  
3544 C CG  . TYR C 222 ? 0.4443 0.5077 0.4528 -0.0079 0.0143  0.1051  222 TYR C CG  
3545 C CD1 . TYR C 222 ? 0.4104 0.4700 0.4175 -0.0065 0.0164  0.1017  222 TYR C CD1 
3546 C CD2 . TYR C 222 ? 0.4287 0.4920 0.4466 -0.0110 0.0116  0.1068  222 TYR C CD2 
3547 C CE1 . TYR C 222 ? 0.4499 0.5056 0.4642 -0.0080 0.0158  0.0999  222 TYR C CE1 
3548 C CE2 . TYR C 222 ? 0.3907 0.4501 0.4160 -0.0123 0.0109  0.1050  222 TYR C CE2 
3549 C CZ  . TYR C 222 ? 0.4201 0.4757 0.4434 -0.0107 0.0130  0.1015  222 TYR C CZ  
3550 O OH  . TYR C 222 ? 0.4419 0.4938 0.4720 -0.0117 0.0123  0.0995  222 TYR C OH  
3551 N N   . LYS C 223 ? 0.4595 0.5414 0.4716 -0.0035 0.0189  0.1182  223 LYS C N   
3552 C CA  . LYS C 223 ? 0.5494 0.6340 0.5615 -0.0012 0.0216  0.1199  223 LYS C CA  
3553 C C   . LYS C 223 ? 0.5166 0.5942 0.5308 -0.0014 0.0222  0.1153  223 LYS C C   
3554 O O   . LYS C 223 ? 0.4324 0.5085 0.4561 -0.0036 0.0204  0.1160  223 LYS C O   
3555 C CB  . LYS C 223 ? 0.5460 0.6390 0.5677 -0.0019 0.0209  0.1278  223 LYS C CB  
3556 C CG  . LYS C 223 ? 0.5956 0.6935 0.6170 0.0008  0.0238  0.1311  223 LYS C CG  
3557 C CD  . LYS C 223 ? 0.6598 0.7613 0.6944 -0.0010 0.0221  0.1368  223 LYS C CD  
3558 C CE  . LYS C 223 ? 0.7591 0.8686 0.7951 0.0013  0.0244  0.1430  223 LYS C CE  
3559 N NZ  . LYS C 223 ? 0.8599 0.9786 0.9039 0.0000  0.0225  0.1513  223 LYS C NZ  
3560 N N   . ASN C 224 ? 0.4286 0.5021 0.4338 0.0009  0.0246  0.1104  224 ASN C N   
3561 C CA  . ASN C 224 ? 0.4886 0.5560 0.4945 0.0011  0.0256  0.1060  224 ASN C CA  
3562 C C   . ASN C 224 ? 0.4754 0.5417 0.4709 0.0044  0.0287  0.1030  224 ASN C C   
3563 O O   . ASN C 224 ? 0.4772 0.5398 0.4643 0.0053  0.0288  0.0987  224 ASN C O   
3564 C CB  . ASN C 224 ? 0.4416 0.5014 0.4488 -0.0011 0.0236  0.1009  224 ASN C CB  
3565 C CG  . ASN C 224 ? 0.4560 0.5102 0.4652 -0.0011 0.0245  0.0971  224 ASN C CG  
3566 O OD1 . ASN C 224 ? 0.4516 0.5065 0.4593 0.0008  0.0268  0.0973  224 ASN C OD1 
3567 N ND2 . ASN C 224 ? 0.3851 0.4340 0.3979 -0.0030 0.0228  0.0938  224 ASN C ND2 
3568 N N   . PRO C 225 ? 0.5778 0.6475 0.5743 0.0063  0.0311  0.1055  225 PRO C N   
3569 C CA  . PRO C 225 ? 0.6097 0.6792 0.5968 0.0098  0.0341  0.1032  225 PRO C CA  
3570 C C   . PRO C 225 ? 0.6432 0.7041 0.6258 0.0100  0.0347  0.0962  225 PRO C C   
3571 O O   . PRO C 225 ? 0.6383 0.6976 0.6119 0.0126  0.0365  0.0930  225 PRO C O   
3572 C CB  . PRO C 225 ? 0.6465 0.7217 0.6384 0.0111  0.0361  0.1083  225 PRO C CB  
3573 C CG  . PRO C 225 ? 0.5837 0.6581 0.5874 0.0080  0.0339  0.1106  225 PRO C CG  
3574 C CD  . PRO C 225 ? 0.5357 0.6090 0.5426 0.0053  0.0307  0.1105  225 PRO C CD  
3575 N N   . ASN C 226 ? 0.5182 0.5740 0.5070 0.0074  0.0330  0.0939  226 ASN C N   
3576 C CA  . ASN C 226 ? 0.5418 0.5899 0.5269 0.0073  0.0332  0.0876  226 ASN C CA  
3577 C C   . ASN C 226 ? 0.5499 0.5941 0.5278 0.0072  0.0319  0.0836  226 ASN C C   
3578 O O   . ASN C 226 ? 0.5447 0.5832 0.5177 0.0078  0.0323  0.0786  226 ASN C O   
3579 C CB  . ASN C 226 ? 0.4840 0.5281 0.4774 0.0047  0.0317  0.0864  226 ASN C CB  
3580 C CG  . ASN C 226 ? 0.4697 0.5162 0.4701 0.0048  0.0324  0.0896  226 ASN C CG  
3581 O OD1 . ASN C 226 ? 0.5122 0.5610 0.5100 0.0069  0.0348  0.0909  226 ASN C OD1 
3582 N ND2 . ASN C 226 ? 0.3724 0.4183 0.3817 0.0026  0.0303  0.0910  226 ASN C ND2 
3583 N N   . LEU C 227 ? 0.4862 0.5335 0.4640 0.0064  0.0302  0.0860  227 LEU C N   
3584 C CA  . LEU C 227 ? 0.5247 0.5684 0.4963 0.0061  0.0285  0.0826  227 LEU C CA  
3585 C C   . LEU C 227 ? 0.5832 0.6310 0.5467 0.0085  0.0289  0.0840  227 LEU C C   
3586 O O   . LEU C 227 ? 0.5930 0.6479 0.5583 0.0093  0.0297  0.0892  227 LEU C O   
3587 C CB  . LEU C 227 ? 0.4792 0.5217 0.4574 0.0027  0.0255  0.0834  227 LEU C CB  
3588 C CG  . LEU C 227 ? 0.5234 0.5625 0.5103 0.0003  0.0246  0.0824  227 LEU C CG  
3589 C CD1 . LEU C 227 ? 0.4715 0.5107 0.4644 -0.0026 0.0217  0.0838  227 LEU C CD1 
3590 C CD2 . LEU C 227 ? 0.4687 0.5009 0.4525 0.0005  0.0252  0.0769  227 LEU C CD2 
3591 N N   . THR C 228 ? 0.6012 0.6446 0.5558 0.0099  0.0283  0.0796  228 THR C N   
3592 C CA  . THR C 228 ? 0.5495 0.5956 0.4957 0.0120  0.0279  0.0801  228 THR C CA  
3593 C C   . THR C 228 ? 0.6288 0.6708 0.5740 0.0099  0.0244  0.0780  228 THR C C   
3594 O O   . THR C 228 ? 0.6232 0.6582 0.5657 0.0093  0.0230  0.0732  228 THR C O   
3595 C CB  . THR C 228 ? 0.5946 0.6391 0.5304 0.0161  0.0297  0.0765  228 THR C CB  
3596 O OG1 . THR C 228 ? 0.7004 0.7510 0.6368 0.0185  0.0330  0.0799  228 THR C OG1 
3597 C CG2 . THR C 228 ? 0.5771 0.6220 0.5034 0.0182  0.0282  0.0753  228 THR C CG2 
3598 N N   . ILE C 229 ? 0.6537 0.7001 0.6015 0.0085  0.0229  0.0820  229 ILE C N   
3599 C CA  . ILE C 229 ? 0.6342 0.6775 0.5823 0.0060  0.0195  0.0809  229 ILE C CA  
3600 C C   . ILE C 229 ? 0.6925 0.7375 0.6312 0.0081  0.0183  0.0809  229 ILE C C   
3601 O O   . ILE C 229 ? 0.7620 0.8141 0.6993 0.0096  0.0194  0.0851  229 ILE C O   
3602 C CB  . ILE C 229 ? 0.6201 0.6667 0.5790 0.0025  0.0180  0.0854  229 ILE C CB  
3603 C CG1 . ILE C 229 ? 0.6326 0.6775 0.6005 0.0008  0.0190  0.0853  229 ILE C CG1 
3604 C CG2 . ILE C 229 ? 0.6253 0.6686 0.5846 0.0000  0.0146  0.0844  229 ILE C CG2 
3605 C CD1 . ILE C 229 ? 0.6235 0.6733 0.6021 -0.0016 0.0183  0.0904  229 ILE C CD1 
3606 N N   . SER C 230 ? 0.6484 0.6869 0.5806 0.0084  0.0160  0.0762  230 SER C N   
3607 C CA  . SER C 230 ? 0.7495 0.7887 0.6726 0.0102  0.0142  0.0757  230 SER C CA  
3608 C C   . SER C 230 ? 0.8039 0.8378 0.7278 0.0073  0.0101  0.0740  230 SER C C   
3609 O O   . SER C 230 ? 0.7827 0.8130 0.7145 0.0039  0.0089  0.0735  230 SER C O   
3610 C CB  . SER C 230 ? 0.7997 0.8362 0.7115 0.0146  0.0152  0.0714  230 SER C CB  
3611 O OG  . SER C 230 ? 0.8434 0.8711 0.7533 0.0141  0.0135  0.0659  230 SER C OG  
3612 N N   . PHE C 231 ? 1.1313 1.1647 1.0468 0.0088  0.0079  0.0731  231 PHE C N   
3613 C CA  . PHE C 231 ? 1.2026 1.2308 1.1178 0.0063  0.0036  0.0716  231 PHE C CA  
3614 C C   . PHE C 231 ? 1.3250 1.3455 1.2309 0.0084  0.0013  0.0657  231 PHE C C   
3615 O O   . PHE C 231 ? 1.3607 1.3789 1.2621 0.0112  0.0030  0.0624  231 PHE C O   
3616 C CB  . PHE C 231 ? 1.1253 1.1589 1.0392 0.0059  0.0020  0.0756  231 PHE C CB  
3617 C CG  . PHE C 231 ? 1.1352 1.1747 1.0602 0.0026  0.0027  0.0813  231 PHE C CG  
3618 C CD1 . PHE C 231 ? 1.1106 1.1483 1.0424 -0.0014 -0.0004 0.0827  231 PHE C CD1 
3619 C CD2 . PHE C 231 ? 1.1370 1.1837 1.0662 0.0035  0.0061  0.0853  231 PHE C CD2 
3620 C CE1 . PHE C 231 ? 1.0280 1.0709 0.9703 -0.0043 0.0000  0.0877  231 PHE C CE1 
3621 C CE2 . PHE C 231 ? 1.0787 1.1306 1.0188 0.0005  0.0062  0.0905  231 PHE C CE2 
3622 C CZ  . PHE C 231 ? 0.9925 1.0424 0.9390 -0.0034 0.0031  0.0915  231 PHE C CZ  
3623 N N   . THR C 232 ? 1.6215 1.6379 1.5249 0.0070  -0.0029 0.0645  232 THR C N   
3624 C CA  . THR C 232 ? 1.6755 1.6834 1.5717 0.0081  -0.0063 0.0591  232 THR C CA  
3625 C C   . THR C 232 ? 1.5982 1.6004 1.4993 0.0069  -0.0059 0.0559  232 THR C C   
3626 O O   . THR C 232 ? 1.4925 1.4944 1.4036 0.0033  -0.0055 0.0576  232 THR C O   
3627 C CB  . THR C 232 ? 1.7187 1.7266 1.6018 0.0134  -0.0062 0.0561  232 THR C CB  
3628 O OG1 . THR C 232 ? 1.7364 1.7433 1.6178 0.0160  -0.0031 0.0534  232 THR C OG1 
3629 C CG2 . THR C 232 ? 1.6725 1.6889 1.5513 0.0156  -0.0045 0.0601  232 THR C CG2 
3630 C C1  . NAG D .   ? 1.1712 1.2033 1.1396 0.0722  0.0582  0.0109  1   NAG D C1  
3631 C C2  . NAG D .   ? 1.1206 1.1485 1.0943 0.0670  0.0570  0.0122  1   NAG D C2  
3632 C C3  . NAG D .   ? 1.2441 1.2664 1.2184 0.0685  0.0537  0.0085  1   NAG D C3  
3633 C C4  . NAG D .   ? 1.3053 1.3323 1.2786 0.0739  0.0546  0.0072  1   NAG D C4  
3634 C C5  . NAG D .   ? 1.2805 1.3129 1.2486 0.0792  0.0565  0.0065  1   NAG D C5  
3635 C C6  . NAG D .   ? 1.2588 1.2979 1.2267 0.0842  0.0584  0.0064  1   NAG D C6  
3636 C C7  . NAG D .   ? 0.9627 0.9880 0.9405 0.0575  0.0579  0.0170  1   NAG D C7  
3637 C C8  . NAG D .   ? 0.7769 0.7970 0.7547 0.0535  0.0568  0.0173  1   NAG D C8  
3638 N N2  . NAG D .   ? 1.0187 1.0420 0.9930 0.0622  0.0561  0.0131  1   NAG D N2  
3639 O O3  . NAG D .   ? 1.1481 1.1674 1.1273 0.0638  0.0529  0.0101  1   NAG D O3  
3640 O O4  . NAG D .   ? 1.4145 1.4356 1.3875 0.0762  0.0508  0.0030  1   NAG D O4  
3641 O O5  . NAG D .   ? 1.2099 1.2473 1.1782 0.0768  0.0596  0.0105  1   NAG D O5  
3642 O O6  . NAG D .   ? 1.3126 1.3563 1.2862 0.0814  0.0608  0.0105  1   NAG D O6  
3643 O O7  . NAG D .   ? 0.9240 0.9548 0.9051 0.0567  0.0601  0.0200  1   NAG D O7  
3644 C C1  . NAG D .   ? 1.6427 1.6621 1.6208 0.0739  0.0498  0.0036  2   NAG D C1  
3645 C C2  . NAG D .   ? 1.6891 1.7094 1.6669 0.0790  0.0486  0.0008  2   NAG D C2  
3646 C C3  . NAG D .   ? 1.7462 1.7637 1.7294 0.0762  0.0468  0.0012  2   NAG D C3  
3647 C C4  . NAG D .   ? 1.7750 1.7842 1.7596 0.0725  0.0431  0.0000  2   NAG D C4  
3648 C C5  . NAG D .   ? 1.6672 1.6756 1.6511 0.0681  0.0444  0.0025  2   NAG D C5  
3649 C C6  . NAG D .   ? 1.6662 1.6669 1.6508 0.0651  0.0409  0.0014  2   NAG D C6  
3650 C C7  . NAG D .   ? 1.7058 1.7373 1.6783 0.0892  0.0525  -0.0005 2   NAG D C7  
3651 C C8  . NAG D .   ? 1.6505 1.6747 1.6192 0.0926  0.0480  -0.0060 2   NAG D C8  
3652 N N2  . NAG D .   ? 1.7288 1.7579 1.7056 0.0827  0.0525  0.0025  2   NAG D N2  
3653 O O3  . NAG D .   ? 1.7745 1.7925 1.7579 0.0810  0.0455  -0.0017 2   NAG D O3  
3654 O O4  . NAG D .   ? 1.7744 1.7818 1.7643 0.0693  0.0418  0.0012  2   NAG D O4  
3655 O O5  . NAG D .   ? 1.5830 1.5944 1.5620 0.0709  0.0461  0.0020  2   NAG D O5  
3656 O O6  . NAG D .   ? 1.6382 1.6352 1.6184 0.0680  0.0387  -0.0016 2   NAG D O6  
3657 O O7  . NAG D .   ? 1.7398 1.7793 1.7116 0.0924  0.0560  0.0013  2   NAG D O7  
3658 O O   . HOH E .   ? 0.4053 0.4661 0.4211 0.0259  0.0687  0.0576  201 HOH A O   
3659 O O   . HOH E .   ? 0.6283 0.6199 0.6422 0.0332  0.0378  0.0186  202 HOH A O   
3660 O O   . HOH E .   ? 0.8423 0.8174 0.7800 0.0702  0.0313  -0.0068 203 HOH A O   
3661 O O   . HOH E .   ? 0.5148 0.4921 0.5109 0.0075  0.0540  0.0306  204 HOH A O   
3662 O O   . HOH E .   ? 0.4736 0.5195 0.4289 0.0591  0.0661  0.0276  205 HOH A O   
3663 O O   . HOH E .   ? 0.5048 0.5461 0.5481 0.0173  0.0539  0.0571  206 HOH A O   
3664 O O   . HOH E .   ? 0.3995 0.3772 0.3991 0.0091  0.0487  0.0308  207 HOH A O   
3665 O O   . HOH E .   ? 0.4307 0.4032 0.4211 0.0214  0.0454  0.0224  208 HOH A O   
3666 O O   . HOH E .   ? 0.6142 0.7254 0.6498 0.0392  0.0790  0.0816  209 HOH A O   
3667 O O   . HOH E .   ? 0.4234 0.3891 0.4263 0.0155  0.0406  0.0284  210 HOH A O   
3668 O O   . HOH E .   ? 0.3925 0.3881 0.3996 0.0057  0.0512  0.0359  211 HOH A O   
3669 O O   . HOH E .   ? 0.4611 0.4427 0.4748 0.0129  0.0385  0.0318  212 HOH A O   
3670 O O   . HOH E .   ? 0.4022 0.3832 0.4012 0.0107  0.0501  0.0293  213 HOH A O   
3671 O O   . HOH E .   ? 0.4479 0.4095 0.4386 0.0206  0.0407  0.0227  214 HOH A O   
3672 O O   . HOH E .   ? 0.5230 0.5508 0.5599 -0.0069 0.0540  0.0621  215 HOH A O   
3673 O O   . HOH E .   ? 0.5498 0.6533 0.6139 0.0226  0.0687  0.0937  216 HOH A O   
3674 O O   . HOH E .   ? 0.6049 0.5779 0.5878 0.0019  0.0385  0.0297  217 HOH A O   
3675 O O   . HOH E .   ? 0.4593 0.4488 0.4508 0.0275  0.0494  0.0215  218 HOH A O   
3676 O O   . HOH E .   ? 0.4051 0.3851 0.4010 0.0042  0.0485  0.0317  219 HOH A O   
3677 O O   . HOH E .   ? 0.4455 0.4447 0.4701 -0.0080 0.0514  0.0472  220 HOH A O   
3678 O O   . HOH E .   ? 0.5319 0.4863 0.5255 0.0151  0.0407  0.0272  221 HOH A O   
3679 O O   . HOH E .   ? 0.5948 0.5786 0.5839 0.0042  0.0426  0.0373  222 HOH A O   
3680 O O   . HOH E .   ? 0.5062 0.4910 0.5131 0.0086  0.0435  0.0331  223 HOH A O   
3681 O O   . HOH E .   ? 0.5228 0.4880 0.5183 0.0100  0.0493  0.0298  224 HOH A O   
3682 O O   . HOH E .   ? 0.3793 0.3876 0.3955 0.0004  0.0555  0.0459  225 HOH A O   
3683 O O   . HOH E .   ? 0.4598 0.4509 0.4736 0.0244  0.0405  0.0241  226 HOH A O   
3684 O O   . HOH E .   ? 0.6816 0.6446 0.6876 0.0118  0.0417  0.0339  227 HOH A O   
3685 O O   . HOH E .   ? 0.5255 0.5446 0.5615 -0.0043 0.0483  0.0570  228 HOH A O   
3686 O O   . HOH E .   ? 0.6273 0.6070 0.6267 -0.0001 0.0447  0.0325  229 HOH A O   
3687 O O   . HOH E .   ? 0.6932 0.6877 0.7094 0.0201  0.0420  0.0278  230 HOH A O   
3688 O O   . HOH E .   ? 0.6576 0.6363 0.6529 0.0079  0.0504  0.0402  231 HOH A O   
3689 O O   . HOH E .   ? 0.5640 0.5663 0.5883 0.0197  0.0419  0.0311  232 HOH A O   
3690 O O   . HOH E .   ? 0.4502 0.4301 0.4509 0.0001  0.0493  0.0324  233 HOH A O   
3691 O O   . HOH E .   ? 0.7135 0.7014 0.7235 -0.0021 0.0478  0.0373  234 HOH A O   
3692 O O   . HOH E .   ? 0.3893 0.3797 0.3991 -0.0001 0.0438  0.0380  235 HOH A O   
3693 O O   . HOH E .   ? 0.4519 0.4307 0.4388 0.0153  0.0522  0.0281  236 HOH A O   
3694 O O   . HOH E .   ? 0.4430 0.4823 0.4986 -0.0012 0.0455  0.0719  237 HOH A O   
3695 O O   . HOH E .   ? 0.5674 0.5470 0.5615 0.0012  0.0416  0.0328  238 HOH A O   
3696 O O   . HOH E .   ? 0.5025 0.4946 0.5263 -0.0082 0.0470  0.0438  239 HOH A O   
3697 O O   . HOH E .   ? 0.6258 0.6410 0.6606 -0.0028 0.0451  0.0551  240 HOH A O   
3698 O O   . HOH E .   ? 1.0504 1.2498 1.0749 0.0389  0.0909  0.1309  241 HOH A O   
3699 O O   . HOH E .   ? 0.5145 0.4863 0.5071 0.0041  0.0536  0.0310  242 HOH A O   
3700 O O   . HOH E .   ? 0.4695 0.4438 0.4532 0.0070  0.0517  0.0323  243 HOH A O   
3701 O O   . HOH E .   ? 0.3904 0.4137 0.3629 0.0469  0.0603  0.0236  244 HOH A O   
3702 O O   . HOH E .   ? 0.5866 0.5502 0.6040 0.0183  0.0286  0.0302  245 HOH A O   
3703 O O   . HOH E .   ? 0.5426 0.5718 0.5941 -0.0020 0.0421  0.0670  246 HOH A O   
3704 O O   . HOH E .   ? 0.5543 0.6249 0.6398 -0.0103 0.0446  0.0975  247 HOH A O   
3705 O O   . HOH E .   ? 0.5162 0.5751 0.5420 0.0367  0.0660  0.0507  248 HOH A O   
3706 O O   . HOH E .   ? 0.5476 0.6399 0.5826 0.0389  0.0746  0.0707  249 HOH A O   
3707 O O   . HOH E .   ? 0.4036 0.4057 0.4248 -0.0020 0.0472  0.0454  250 HOH A O   
3708 O O   . HOH E .   ? 0.6650 0.6452 0.6785 0.0188  0.0368  0.0267  251 HOH A O   
3709 O O   . HOH E .   ? 0.5890 0.6323 0.6426 -0.0011 0.0487  0.0723  252 HOH A O   
3710 O O   . HOH E .   ? 0.7144 0.6886 0.7239 0.0097  0.0421  0.0386  253 HOH A O   
3711 O O   . HOH E .   ? 0.8828 0.8500 0.8985 0.0103  0.0390  0.0429  254 HOH A O   
3712 O O   . HOH E .   ? 0.5610 0.5734 0.5959 -0.0005 0.0413  0.0537  255 HOH A O   
3713 O O   . HOH E .   ? 0.6838 0.6579 0.6844 0.0080  0.0485  0.0370  256 HOH A O   
3714 O O   . HOH E .   ? 0.8679 0.8562 0.8121 0.0506  0.0438  0.0114  257 HOH A O   
3715 O O   . HOH E .   ? 0.7134 0.7299 0.7487 0.0027  0.0439  0.0533  258 HOH A O   
3716 O O   . HOH E .   ? 0.7777 0.7629 0.7945 0.0074  0.0369  0.0429  259 HOH A O   
3717 O O   . HOH E .   ? 0.6220 0.6203 0.6442 -0.0045 0.0460  0.0449  260 HOH A O   
3718 O O   . HOH E .   ? 0.6928 0.6801 0.6848 0.0035  0.0404  0.0404  261 HOH A O   
3719 O O   . HOH E .   ? 0.5662 0.5544 0.5778 0.0052  0.0382  0.0400  262 HOH A O   
3720 O O   . HOH E .   ? 0.6346 0.6052 0.6212 0.0053  0.0529  0.0301  263 HOH A O   
3721 O O   . HOH E .   ? 0.7506 0.7257 0.7427 0.0072  0.0521  0.0360  264 HOH A O   
3722 O O   . HOH E .   ? 0.6876 0.7113 0.7290 -0.0061 0.0481  0.0610  265 HOH A O   
3723 O O   . HOH E .   ? 0.3966 0.3626 0.3839 0.0263  0.0400  0.0187  266 HOH A O   
3724 O O   . HOH E .   ? 0.8026 0.7686 0.8049 0.0083  0.0485  0.0363  267 HOH A O   
3725 O O   . HOH E .   ? 0.5880 0.5368 0.5853 0.0171  0.0348  0.0270  268 HOH A O   
3726 O O   . HOH E .   ? 0.7339 0.7621 0.7848 -0.0044 0.0424  0.0668  269 HOH A O   
3727 O O   . HOH E .   ? 0.7388 0.7107 0.7246 0.0068  0.0539  0.0323  270 HOH A O   
3728 O O   . HOH E .   ? 0.7955 0.7640 0.7809 0.0055  0.0539  0.0294  271 HOH A O   
3729 O O   . HOH E .   ? 0.6771 0.6661 0.6932 0.0056  0.0363  0.0438  272 HOH A O   
3730 O O   . HOH E .   ? 0.8850 0.8601 0.8744 0.0083  0.0542  0.0376  273 HOH A O   
3731 O O   . HOH E .   ? 0.6458 0.6177 0.6353 0.0067  0.0543  0.0339  274 HOH A O   
3732 O O   . HOH E .   ? 0.8269 0.7920 0.8290 0.0074  0.0504  0.0381  275 HOH A O   
3733 O O   . HOH E .   ? 0.8122 0.7859 0.7897 0.0105  0.0551  0.0331  276 HOH A O   
3734 O O   . HOH E .   ? 0.6733 0.6434 0.6523 0.0095  0.0557  0.0310  277 HOH A O   
3735 O O   . HOH F .   ? 0.6601 0.6657 0.6048 0.0703  0.0475  0.0026  801 HOH B O   
3736 O O   . HOH F .   ? 0.4960 0.4506 0.4924 0.0091  0.0455  0.0317  802 HOH B O   
3737 O O   . HOH F .   ? 0.6096 0.5858 0.5927 0.0113  0.0510  0.0327  803 HOH B O   
3738 O O   . HOH F .   ? 0.3848 0.3596 0.3659 0.0163  0.0498  0.0281  804 HOH B O   
3739 O O   . HOH F .   ? 0.4827 0.4576 0.4637 0.0307  0.0436  0.0170  805 HOH B O   
3740 O O   . HOH F .   ? 0.7322 0.6814 0.7018 0.0402  0.0258  0.0076  806 HOH B O   
3741 O O   . HOH F .   ? 0.5422 0.5691 0.5848 -0.0072 0.0497  0.0629  807 HOH B O   
3742 O O   . HOH F .   ? 0.5912 0.6216 0.6741 -0.0255 0.0348  0.0798  808 HOH B O   
3743 O O   . HOH F .   ? 0.5657 0.5875 0.5525 0.0156  0.0616  0.0456  809 HOH B O   
3744 O O   . HOH F .   ? 0.4114 0.4336 0.4943 -0.0244 0.0290  0.0762  810 HOH B O   
3745 O O   . HOH F .   ? 0.5856 0.5735 0.5757 0.0083  0.0558  0.0364  811 HOH B O   
3746 O O   . HOH F .   ? 0.5755 0.5859 0.5319 0.0681  0.0500  0.0048  812 HOH B O   
3747 O O   . HOH F .   ? 0.4730 0.4312 0.4699 0.0045  0.0504  0.0339  813 HOH B O   
3748 O O   . HOH F .   ? 0.6737 0.8018 0.7675 0.0098  0.0634  0.1215  814 HOH B O   
3749 O O   . HOH F .   ? 0.7054 0.6629 0.7956 -0.0264 -0.0143 0.0481  815 HOH B O   
3750 O O   . HOH F .   ? 0.5519 0.6133 0.5342 0.0602  0.0713  0.0338  816 HOH B O   
3751 O O   . HOH F .   ? 0.6707 0.6423 0.6229 0.0510  0.0357  0.0049  817 HOH B O   
3752 O O   . HOH F .   ? 0.4877 0.4635 0.4819 0.0091  0.0535  0.0301  818 HOH B O   
3753 O O   . HOH F .   ? 0.4035 0.3746 0.4006 0.0017  0.0545  0.0357  819 HOH B O   
3754 O O   . HOH F .   ? 0.6105 0.6351 0.5970 0.0195  0.0627  0.0434  820 HOH B O   
3755 O O   . HOH F .   ? 0.6449 0.6375 0.7520 -0.0317 -0.0031 0.0717  821 HOH B O   
3756 O O   . HOH F .   ? 0.5622 0.5380 0.5604 0.0031  0.0557  0.0328  822 HOH B O   
3757 O O   . HOH F .   ? 0.4317 0.4410 0.4146 0.0201  0.0595  0.0361  823 HOH B O   
3758 O O   . HOH F .   ? 0.3783 0.3778 0.4675 -0.0303 0.0203  0.0670  824 HOH B O   
3759 O O   . HOH F .   ? 0.6084 0.7002 0.6138 0.0604  0.0792  0.0524  825 HOH B O   
3760 O O   . HOH F .   ? 0.7331 0.6936 0.7029 0.0289  0.0381  0.0177  826 HOH B O   
3761 O O   . HOH F .   ? 0.4071 0.3671 0.3958 0.0292  0.0343  0.0163  827 HOH B O   
3762 O O   . HOH F .   ? 0.8263 0.8531 0.7543 0.0880  0.0534  0.0005  828 HOH B O   
3763 O O   . HOH F .   ? 0.5612 0.5129 0.5538 0.0220  0.0337  0.0221  829 HOH B O   
3764 O O   . HOH F .   ? 0.4838 0.4500 0.4805 0.0031  0.0535  0.0341  830 HOH B O   
3765 O O   . HOH F .   ? 0.5326 0.6431 0.5898 0.0278  0.0731  0.0928  831 HOH B O   
3766 O O   . HOH G .   ? 0.4680 0.4729 0.5251 -0.0122 0.0145  0.0595  301 HOH C O   
3767 O O   . HOH G .   ? 0.6743 0.6678 0.6966 -0.0054 0.0278  0.0464  302 HOH C O   
3768 O O   . HOH G .   ? 0.4984 0.5003 0.5669 -0.0374 -0.0152 0.0842  303 HOH C O   
3769 O O   . HOH G .   ? 0.6483 0.6589 0.6777 0.0056  0.0438  0.0463  304 HOH C O   
3770 O O   . HOH G .   ? 0.7760 0.8881 0.8117 -0.0306 -0.0151 0.1523  305 HOH C O   
3771 O O   . HOH G .   ? 0.5427 0.6494 0.5667 -0.0049 0.0162  0.1383  306 HOH C O   
3772 O O   . HOH G .   ? 0.4427 0.4856 0.5085 -0.0356 -0.0145 0.1054  307 HOH C O   
3773 O O   . HOH G .   ? 0.7297 0.7129 0.7399 -0.0057 0.0284  0.0414  308 HOH C O   
3774 O O   . HOH G .   ? 0.5355 0.6387 0.6118 -0.0553 -0.0400 0.1619  309 HOH C O   
3775 O O   . HOH G .   ? 0.6168 0.6880 0.5833 0.0036  0.0196  0.1030  310 HOH C O   
3776 O O   . HOH G .   ? 0.7019 0.6951 0.7139 0.0002  0.0332  0.0445  311 HOH C O   
3777 O O   . HOH G .   ? 0.4887 0.4715 0.4681 0.0056  0.0425  0.0365  312 HOH C O   
3778 O O   . HOH G .   ? 0.5030 0.4874 0.5247 -0.0211 0.0009  0.0598  313 HOH C O   
3779 O O   . HOH G .   ? 0.5102 0.5092 0.4801 0.0060  0.0349  0.0489  314 HOH C O   
3780 O O   . HOH G .   ? 0.3828 0.4424 0.4461 -0.0262 -0.0050 0.1125  315 HOH C O   
3781 O O   . HOH G .   ? 0.6057 0.5936 0.6115 0.0013  0.0390  0.0372  316 HOH C O   
3782 O O   . HOH G .   ? 0.5062 0.5473 0.5423 -0.0087 0.0164  0.0915  317 HOH C O   
3783 O O   . HOH G .   ? 0.6189 0.5856 0.5941 -0.0057 0.0108  0.0363  318 HOH C O   
3784 O O   . HOH G .   ? 0.7609 0.7705 0.8019 0.0003  0.0356  0.0522  319 HOH C O   
3785 O O   . HOH G .   ? 0.6119 0.6103 0.6064 0.0011  0.0337  0.0506  320 HOH C O   
3786 O O   . HOH G .   ? 0.6589 0.6469 0.6307 0.0084  0.0427  0.0402  321 HOH C O   
3787 O O   . HOH G .   ? 0.7094 0.7227 0.7702 -0.0467 -0.0285 0.0986  322 HOH C O   
3788 O O   . HOH G .   ? 0.5538 0.5412 0.5179 -0.0133 -0.0059 0.0576  323 HOH C O   
3789 O O   . HOH G .   ? 0.5150 0.5150 0.5429 0.0001  0.0352  0.0451  324 HOH C O   
3790 O O   . HOH G .   ? 0.5041 0.4943 0.5251 0.0085  0.0359  0.0363  325 HOH C O   
3791 O O   . HOH G .   ? 0.5580 0.5921 0.5277 0.0108  0.0366  0.0743  326 HOH C O   
3792 O O   . HOH G .   ? 0.4405 0.4505 0.3766 0.0137  0.0293  0.0529  327 HOH C O   
3793 O O   . HOH G .   ? 0.4296 0.4267 0.4523 -0.0029 0.0276  0.0483  328 HOH C O   
3794 O O   . HOH G .   ? 0.5083 0.5103 0.5605 -0.0008 0.0196  0.0503  329 HOH C O   
3795 O O   . HOH G .   ? 0.4992 0.4947 0.4738 -0.0092 0.0083  0.0566  330 HOH C O   
3796 O O   . HOH G .   ? 0.5943 0.6716 0.6036 -0.0417 -0.0343 0.1367  331 HOH C O   
3797 O O   . HOH G .   ? 0.6304 0.6049 0.6500 -0.0302 -0.0188 0.0674  332 HOH C O   
3798 O O   . HOH G .   ? 0.5113 0.5929 0.4979 0.0074  0.0292  0.1120  333 HOH C O   
3799 O O   . HOH G .   ? 0.6846 0.7781 0.6573 -0.0132 -0.0050 0.1279  334 HOH C O   
3800 O O   . HOH G .   ? 0.9889 0.9302 0.9223 -0.0020 -0.0206 0.0279  335 HOH C O   
3801 O O   . HOH G .   ? 0.4716 0.5108 0.5311 -0.0187 0.0035  0.0934  336 HOH C O   
3802 O O   . HOH G .   ? 0.6622 0.6719 0.7276 -0.0178 0.0064  0.0673  337 HOH C O   
3803 O O   . HOH G .   ? 0.6162 0.6879 0.5801 0.0135  0.0331  0.1000  338 HOH C O   
3804 O O   . HOH G .   ? 0.4796 0.4693 0.4899 -0.0009 0.0353  0.0399  339 HOH C O   
3805 O O   . HOH G .   ? 0.5926 0.6889 0.6414 -0.0466 -0.0325 0.1513  340 HOH C O   
3806 O O   . HOH G .   ? 0.4073 0.4516 0.4308 -0.0083 0.0169  0.0923  341 HOH C O   
3807 O O   . HOH G .   ? 0.6383 0.6066 0.6270 -0.0087 0.0108  0.0393  342 HOH C O   
3808 O O   . HOH G .   ? 0.7663 0.7849 0.7426 0.0118  0.0428  0.0643  343 HOH C O   
3809 O O   . HOH G .   ? 0.5828 0.5644 0.6060 -0.0345 -0.0226 0.0743  344 HOH C O   
3810 O O   . HOH G .   ? 0.5077 0.5050 0.5377 -0.0060 0.0250  0.0492  345 HOH C O   
3811 O O   . HOH G .   ? 0.6790 0.7418 0.6587 0.0036  0.0246  0.0982  346 HOH C O   
3812 O O   . HOH G .   ? 0.6454 0.7101 0.7837 -0.0574 -0.0404 0.1356  347 HOH C O   
3813 O O   . HOH G .   ? 0.8098 0.8388 0.7298 0.0150  0.0209  0.0657  348 HOH C O   
3814 O O   . HOH G .   ? 0.4614 0.4588 0.4882 -0.0055 0.0251  0.0492  349 HOH C O   
3815 O O   . HOH G .   ? 0.7232 0.6784 0.7124 -0.0166 -0.0133 0.0454  350 HOH C O   
3816 O O   . HOH G .   ? 0.8591 0.7930 0.7888 0.0008  -0.0229 0.0223  351 HOH C O   
3817 O O   . HOH G .   ? 0.4790 0.4941 0.5442 -0.0143 0.0071  0.0700  352 HOH C O   
3818 O O   . HOH G .   ? 0.6664 0.6239 0.6479 -0.0099 -0.0008 0.0374  353 HOH C O   
3819 O O   . HOH G .   ? 0.6573 0.6635 0.7169 -0.0070 0.0188  0.0556  354 HOH C O   
3820 O O   . HOH G .   ? 0.7564 0.7560 0.7465 0.0037  0.0370  0.0513  355 HOH C O   
3821 O O   . HOH G .   ? 0.6971 0.6986 0.7414 0.0085  0.0294  0.0403  356 HOH C O   
3822 O O   . HOH G .   ? 0.6963 0.6968 0.7430 0.0040  0.0253  0.0440  357 HOH C O   
3823 O O   . HOH G .   ? 0.8042 0.7877 0.8121 -0.0064 0.0260  0.0423  358 HOH C O   
3824 O O   . HOH G .   ? 0.7290 0.7403 0.7622 0.0059  0.0421  0.0469  359 HOH C O   
3825 O O   . HOH G .   ? 0.6406 0.6371 0.6614 -0.0006 0.0298  0.0479  360 HOH C O   
3826 O O   . HOH G .   ? 0.5999 0.6997 0.6278 -0.0390 -0.0268 0.1489  361 HOH C O   
3827 O O   . HOH G .   ? 0.6804 0.6622 0.7192 -0.0354 -0.0205 0.0759  362 HOH C O   
3828 O O   . HOH G .   ? 0.8013 0.7786 0.8049 -0.0077 0.0211  0.0412  363 HOH C O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   31  31  ARG ARG A . n 
A 1 2   SER 2   32  32  SER SER A . n 
A 1 3   ILE 3   33  33  ILE ILE A . n 
A 1 4   PRO 4   34  34  PRO PRO A . n 
A 1 5   LEU 5   35  35  LEU LEU A . n 
A 1 6   GLY 6   36  36  GLY GLY A . n 
A 1 7   VAL 7   37  37  VAL VAL A . n 
A 1 8   ILE 8   38  38  ILE ILE A . n 
A 1 9   HIS 9   39  39  HIS HIS A . n 
A 1 10  ASN 10  40  40  ASN ASN A . n 
A 1 11  SER 11  41  41  SER SER A . n 
A 1 12  VAL 12  42  42  VAL VAL A . n 
A 1 13  LEU 13  43  43  LEU LEU A . n 
A 1 14  GLN 14  44  44  GLN GLN A . n 
A 1 15  VAL 15  45  45  VAL VAL A . n 
A 1 16  SER 16  46  46  SER SER A . n 
A 1 17  ASP 17  47  47  ASP ASP A . n 
A 1 18  VAL 18  48  48  VAL VAL A . n 
A 1 19  ASP 19  49  49  ASP ASP A . n 
A 1 20  LYS 20  50  50  LYS LYS A . n 
A 1 21  LEU 21  51  51  LEU LEU A . n 
A 1 22  VAL 22  52  52  VAL VAL A . n 
A 1 23  CYS 23  53  53  CYS CYS A . n 
A 1 24  ARG 24  54  54  ARG ARG A . n 
A 1 25  ASP 25  55  55  ASP ASP A . n 
A 1 26  LYS 26  56  56  LYS LYS A . n 
A 1 27  LEU 27  57  57  LEU LEU A . n 
A 1 28  SER 28  58  58  SER SER A . n 
A 1 29  SER 29  59  59  SER SER A . n 
A 1 30  THR 30  60  60  THR THR A . n 
A 1 31  ASN 31  61  61  ASN ASN A . n 
A 1 32  GLN 32  62  62  GLN GLN A . n 
A 1 33  LEU 33  63  63  LEU LEU A . n 
A 1 34  ARG 34  64  64  ARG ARG A . n 
A 1 35  SER 35  65  65  SER SER A . n 
A 1 36  VAL 36  66  66  VAL VAL A . n 
A 1 37  GLY 37  67  67  GLY GLY A . n 
A 1 38  LEU 38  68  68  LEU LEU A . n 
A 1 39  ASN 39  69  69  ASN ASN A . n 
A 1 40  LEU 40  70  70  LEU LEU A . n 
A 1 41  GLU 41  71  71  GLU GLU A . n 
A 1 42  GLY 42  72  72  GLY GLY A . n 
A 1 43  ASN 43  73  73  ASN ASN A . n 
A 1 44  GLY 44  74  74  GLY GLY A . n 
A 1 45  VAL 45  75  75  VAL VAL A . n 
A 1 46  ALA 46  76  76  ALA ALA A . n 
A 1 47  THR 47  77  77  THR THR A . n 
A 1 48  ASP 48  78  78  ASP ASP A . n 
A 1 49  VAL 49  79  79  VAL VAL A . n 
A 1 50  PRO 50  80  80  PRO PRO A . n 
A 1 51  SER 51  81  81  SER SER A . n 
A 1 52  ALA 52  82  82  ALA ALA A . n 
A 1 53  THR 53  83  83  THR THR A . n 
A 1 54  LYS 54  84  84  LYS LYS A . n 
A 1 55  ARG 55  85  85  ARG ARG A . n 
A 1 56  TRP 56  86  86  TRP TRP A . n 
A 1 57  GLY 57  87  87  GLY GLY A . n 
A 1 58  PHE 58  88  88  PHE PHE A . n 
A 1 59  ARG 59  89  89  ARG ARG A . n 
A 1 60  SER 60  90  90  SER SER A . n 
A 1 61  GLY 61  91  91  GLY GLY A . n 
A 1 62  VAL 62  92  92  VAL VAL A . n 
A 1 63  PRO 63  93  93  PRO PRO A . n 
A 1 64  PRO 64  94  94  PRO PRO A . n 
A 1 65  LYS 65  95  95  LYS LYS A . n 
A 1 66  VAL 66  96  96  VAL VAL A . n 
A 1 67  VAL 67  97  97  VAL VAL A . n 
A 1 68  ASN 68  98  98  ASN ASN A . n 
A 1 69  TYR 69  99  99  TYR TYR A . n 
A 1 70  GLU 70  100 100 GLU GLU A . n 
A 1 71  ALA 71  101 101 ALA ALA A . n 
A 1 72  GLY 72  102 102 GLY GLY A . n 
A 1 73  GLU 73  103 103 GLU GLU A . n 
A 1 74  TRP 74  104 104 TRP TRP A . n 
A 1 75  ALA 75  105 105 ALA ALA A . n 
A 1 76  GLU 76  106 106 GLU GLU A . n 
A 1 77  ASN 77  107 107 ASN ASN A . n 
A 1 78  CYS 78  108 108 CYS CYS A . n 
A 1 79  TYR 79  109 109 TYR TYR A . n 
A 1 80  ASN 80  110 110 ASN ASN A . n 
A 1 81  LEU 81  111 111 LEU LEU A . n 
A 1 82  GLU 82  112 112 GLU GLU A . n 
A 1 83  ILE 83  113 113 ILE ILE A . n 
A 1 84  LYS 84  114 114 LYS LYS A . n 
A 1 85  LYS 85  115 115 LYS LYS A . n 
A 1 86  PRO 86  116 116 PRO PRO A . n 
A 1 87  ASP 87  117 117 ASP ASP A . n 
A 1 88  GLY 88  118 118 GLY GLY A . n 
A 1 89  SER 89  119 119 SER SER A . n 
A 1 90  GLU 90  120 120 GLU GLU A . n 
A 1 91  CYS 91  121 121 CYS CYS A . n 
A 1 92  LEU 92  122 122 LEU LEU A . n 
A 1 93  PRO 93  123 123 PRO PRO A . n 
A 1 94  ALA 94  124 124 ALA ALA A . n 
A 1 95  ALA 95  125 125 ALA ALA A . n 
A 1 96  PRO 96  126 126 PRO PRO A . n 
A 1 97  ASP 97  127 127 ASP ASP A . n 
A 1 98  GLY 98  128 128 GLY GLY A . n 
A 1 99  ILE 99  129 129 ILE ILE A . n 
A 1 100 ARG 100 130 130 ARG ARG A . n 
A 1 101 GLY 101 131 131 GLY GLY A . n 
A 1 102 PHE 102 132 132 PHE PHE A . n 
A 1 103 PRO 103 133 133 PRO PRO A . n 
A 1 104 ARG 104 134 134 ARG ARG A . n 
A 1 105 CYS 105 135 135 CYS CYS A . n 
A 1 106 ARG 106 136 136 ARG ARG A . n 
A 1 107 TYR 107 137 137 TYR TYR A . n 
A 1 108 VAL 108 138 138 VAL VAL A . n 
A 1 109 HIS 109 139 139 HIS HIS A . n 
A 1 110 LYS 110 140 140 LYS LYS A . n 
A 1 111 VAL 111 141 141 VAL VAL A . n 
A 1 112 SER 112 142 142 SER SER A . n 
A 1 113 GLY 113 143 143 GLY GLY A . n 
A 1 114 THR 114 144 144 THR THR A . n 
A 1 115 GLY 115 145 145 GLY GLY A . n 
A 1 116 PRO 116 146 146 PRO PRO A . n 
A 1 117 CYS 117 147 147 CYS CYS A . n 
A 1 118 ALA 118 148 148 ALA ALA A . n 
A 1 119 GLY 119 149 149 GLY GLY A . n 
A 1 120 ASP 120 150 150 ASP ASP A . n 
A 1 121 PHE 121 151 151 PHE PHE A . n 
A 1 122 ALA 122 152 152 ALA ALA A . n 
A 1 123 PHE 123 153 153 PHE PHE A . n 
A 1 124 HIS 124 154 154 HIS HIS A . n 
A 1 125 LYS 125 155 155 LYS LYS A . n 
A 1 126 GLU 126 156 156 GLU GLU A . n 
A 1 127 GLY 127 157 157 GLY GLY A . n 
A 1 128 ALA 128 158 158 ALA ALA A . n 
A 1 129 PHE 129 159 159 PHE PHE A . n 
A 1 130 PHE 130 160 160 PHE PHE A . n 
A 1 131 LEU 131 161 161 LEU LEU A . n 
A 1 132 TYR 132 162 162 TYR TYR A . n 
A 1 133 ASP 133 163 163 ASP ASP A . n 
A 1 134 ARG 134 164 164 ARG ARG A . n 
A 1 135 LEU 135 165 165 LEU LEU A . n 
A 1 136 ALA 136 166 166 ALA ALA A . n 
A 1 137 SER 137 167 167 SER SER A . n 
A 1 138 THR 138 168 168 THR THR A . n 
A 1 139 VAL 139 169 169 VAL VAL A . n 
A 1 140 ILE 140 170 170 ILE ILE A . n 
A 1 141 TYR 141 171 171 TYR TYR A . n 
A 1 142 ARG 142 172 172 ARG ARG A . n 
A 1 143 GLY 143 173 173 GLY GLY A . n 
A 1 144 THR 144 174 174 THR THR A . n 
A 1 145 THR 145 175 175 THR THR A . n 
A 1 146 PHE 146 176 176 PHE PHE A . n 
A 1 147 ALA 147 177 177 ALA ALA A . n 
A 1 148 GLU 148 178 178 GLU GLU A . n 
A 1 149 GLY 149 179 179 GLY GLY A . n 
A 1 150 VAL 150 180 180 VAL VAL A . n 
A 1 151 VAL 151 181 181 VAL VAL A . n 
A 1 152 ALA 152 182 182 ALA ALA A . n 
A 1 153 PHE 153 183 183 PHE PHE A . n 
A 1 154 LEU 154 184 184 LEU LEU A . n 
A 1 155 ILE 155 185 185 ILE ILE A . n 
A 1 156 LEU 156 186 186 LEU LEU A . n 
A 1 157 PRO 157 187 187 PRO PRO A . n 
A 1 158 GLN 158 188 188 GLN GLN A . n 
B 2 1   PRO 1   509 509 PRO PRO B . n 
B 2 2   LYS 2   510 510 LYS LYS B . n 
B 2 3   CYS 3   511 511 CYS CYS B . n 
B 2 4   ASN 4   512 512 ASN ASN B . n 
B 2 5   PRO 5   513 513 PRO PRO B . n 
B 2 6   ASN 6   514 514 ASN ASN B . n 
B 2 7   LEU 7   515 515 LEU LEU B . n 
B 2 8   HIS 8   516 516 HIS HIS B . n 
B 2 9   TYR 9   517 517 TYR TYR B . n 
B 2 10  TRP 10  518 518 TRP TRP B . n 
B 2 11  THR 11  519 519 THR THR B . n 
B 2 12  THR 12  520 520 THR THR B . n 
B 2 13  GLN 13  521 521 GLN GLN B . n 
B 2 14  ASP 14  522 ?   ?   ?   B . n 
B 2 15  GLU 15  523 ?   ?   ?   B . n 
B 2 16  GLY 16  524 ?   ?   ?   B . n 
B 2 17  ALA 17  525 525 ALA ALA B . n 
B 2 18  ALA 18  526 526 ALA ALA B . n 
B 2 19  ILE 19  527 527 ILE ILE B . n 
B 2 20  GLY 20  528 528 GLY GLY B . n 
B 2 21  LEU 21  529 529 LEU LEU B . n 
B 2 22  ALA 22  530 530 ALA ALA B . n 
B 2 23  TRP 23  531 531 TRP TRP B . n 
B 2 24  ILE 24  532 532 ILE ILE B . n 
B 2 25  PRO 25  533 533 PRO PRO B . n 
B 2 26  TYR 26  534 534 TYR TYR B . n 
B 2 27  PHE 27  535 535 PHE PHE B . n 
B 2 28  GLY 28  536 536 GLY GLY B . n 
B 2 29  PRO 29  537 537 PRO PRO B . n 
B 2 30  ALA 30  538 538 ALA ALA B . n 
B 2 31  ALA 31  539 539 ALA ALA B . n 
B 2 32  GLU 32  540 540 GLU GLU B . n 
B 2 33  GLY 33  541 541 GLY GLY B . n 
B 2 34  ILE 34  542 542 ILE ILE B . n 
B 2 35  TYR 35  543 543 TYR TYR B . n 
B 2 36  THR 36  544 544 THR THR B . n 
B 2 37  GLU 37  545 545 GLU GLU B . n 
B 2 38  GLY 38  546 546 GLY GLY B . n 
B 2 39  LEU 39  547 547 LEU LEU B . n 
B 2 40  MET 40  548 548 MET MET B . n 
B 2 41  HIS 41  549 549 HIS HIS B . n 
B 2 42  ASN 42  550 550 ASN ASN B . n 
B 2 43  GLN 43  551 551 GLN GLN B . n 
B 2 44  ASP 44  552 552 ASP ASP B . n 
B 2 45  GLY 45  553 553 GLY GLY B . n 
B 2 46  LEU 46  554 554 LEU LEU B . n 
B 2 47  ILE 47  555 555 ILE ILE B . n 
B 2 48  CYS 48  556 556 CYS CYS B . n 
B 2 49  GLY 49  557 557 GLY GLY B . n 
B 2 50  LEU 50  558 558 LEU LEU B . n 
B 2 51  ARG 51  559 559 ARG ARG B . n 
B 2 52  GLN 52  560 560 GLN GLN B . n 
B 2 53  LEU 53  561 561 LEU LEU B . n 
B 2 54  ALA 54  562 562 ALA ALA B . n 
B 2 55  ASN 55  563 563 ASN ASN B . n 
B 2 56  GLU 56  564 564 GLU GLU B . n 
B 2 57  THR 57  565 565 THR THR B . n 
B 2 58  THR 58  566 566 THR THR B . n 
B 2 59  GLN 59  567 567 GLN GLN B . n 
B 2 60  ALA 60  568 568 ALA ALA B . n 
B 2 61  LEU 61  569 569 LEU LEU B . n 
B 2 62  GLN 62  570 570 GLN GLN B . n 
B 2 63  LEU 63  571 571 LEU LEU B . n 
B 2 64  PHE 64  572 572 PHE PHE B . n 
B 2 65  LEU 65  573 573 LEU LEU B . n 
B 2 66  ARG 66  574 574 ARG ARG B . n 
B 2 67  ALA 67  575 575 ALA ALA B . n 
B 2 68  THR 68  576 576 THR THR B . n 
B 2 69  THR 69  577 577 THR THR B . n 
B 2 70  GLU 70  578 578 GLU GLU B . n 
B 2 71  LEU 71  579 579 LEU LEU B . n 
B 2 72  ARG 72  580 580 ARG ARG B . n 
B 2 73  THR 73  581 581 THR THR B . n 
B 2 74  PHE 74  582 582 PHE PHE B . n 
B 2 75  SER 75  583 583 SER SER B . n 
B 2 76  ILE 76  584 584 ILE ILE B . n 
B 2 77  LEU 77  585 585 LEU LEU B . n 
B 2 78  ASN 78  586 586 ASN ASN B . n 
B 2 79  ARG 79  587 587 ARG ARG B . n 
B 2 80  LYS 80  588 588 LYS LYS B . n 
B 2 81  ALA 81  589 589 ALA ALA B . n 
B 2 82  ILE 82  590 590 ILE ILE B . n 
B 2 83  ASP 83  591 591 ASP ASP B . n 
B 2 84  PHE 84  592 592 PHE PHE B . n 
B 2 85  LEU 85  593 593 LEU LEU B . n 
B 2 86  LEU 86  594 594 LEU LEU B . n 
B 2 87  GLN 87  595 595 GLN GLN B . n 
B 2 88  ARG 88  596 596 ARG ARG B . n 
B 2 89  TRP 89  597 597 TRP TRP B . n 
B 2 90  GLY 90  598 598 GLY GLY B . n 
B 2 91  GLY 91  599 ?   ?   ?   B . n 
B 2 92  THR 92  600 ?   ?   ?   B . n 
B 2 93  CYS 93  601 ?   ?   ?   B . n 
B 2 94  HIS 94  602 ?   ?   ?   B . n 
B 2 95  ILE 95  603 ?   ?   ?   B . n 
B 2 96  LEU 96  604 ?   ?   ?   B . n 
B 2 97  GLY 97  605 ?   ?   ?   B . n 
B 2 98  PRO 98  606 ?   ?   ?   B . n 
B 2 99  ASP 99  607 ?   ?   ?   B . n 
B 2 100 CYS 100 608 ?   ?   ?   B . n 
B 2 101 CYS 101 609 ?   ?   ?   B . n 
B 2 102 ILE 102 610 ?   ?   ?   B . n 
B 2 103 GLU 103 611 ?   ?   ?   B . n 
B 2 104 PRO 104 612 ?   ?   ?   B . n 
B 2 105 HIS 105 613 ?   ?   ?   B . n 
B 2 106 ASP 106 614 ?   ?   ?   B . n 
B 2 107 TRP 107 615 ?   ?   ?   B . n 
B 2 108 THR 108 616 ?   ?   ?   B . n 
B 2 109 LYS 109 617 ?   ?   ?   B . n 
B 2 110 ASN 110 618 ?   ?   ?   B . n 
B 2 111 ILE 111 619 ?   ?   ?   B . n 
B 2 112 THR 112 620 ?   ?   ?   B . n 
B 2 113 ASP 113 621 ?   ?   ?   B . n 
B 2 114 LYS 114 622 ?   ?   ?   B . n 
B 2 115 ILE 115 623 ?   ?   ?   B . n 
B 2 116 ASP 116 624 ?   ?   ?   B . n 
B 2 117 GLN 117 625 ?   ?   ?   B . n 
B 2 118 ILE 118 626 ?   ?   ?   B . n 
B 2 119 ILE 119 627 ?   ?   ?   B . n 
B 2 120 HIS 120 628 ?   ?   ?   B . n 
B 2 121 ASP 121 629 ?   ?   ?   B . n 
B 2 122 PHE 122 630 ?   ?   ?   B . n 
B 2 123 VAL 123 631 ?   ?   ?   B . n 
B 2 124 ASP 124 632 ?   ?   ?   B . n 
B 2 125 HIS 125 633 ?   ?   ?   B . n 
B 2 126 HIS 126 634 ?   ?   ?   B . n 
B 2 127 HIS 127 635 ?   ?   ?   B . n 
B 2 128 HIS 128 636 ?   ?   ?   B . n 
B 2 129 HIS 129 637 ?   ?   ?   B . n 
B 2 130 HIS 130 638 ?   ?   ?   B . n 
C 3 1   MET 1   1   ?   ?   ?   C . n 
C 3 2   THR 2   2   ?   ?   ?   C . n 
C 3 3   THR 3   3   ?   ?   ?   C . n 
C 3 4   ASN 4   4   ?   ?   ?   C . n 
C 3 5   PRO 5   5   ?   ?   ?   C . n 
C 3 6   VAL 6   6   ?   ?   ?   C . n 
C 3 7   ASP 7   7   ?   ?   ?   C . n 
C 3 8   LEU 8   8   ?   ?   ?   C . n 
C 3 9   TRP 9   9   ?   ?   ?   C . n 
C 3 10  SER 10  10  ?   ?   ?   C . n 
C 3 11  ALA 11  11  ?   ?   ?   C . n 
C 3 12  PRO 12  12  ?   ?   ?   C . n 
C 3 13  SER 13  13  ?   ?   ?   C . n 
C 3 14  SER 14  14  ?   ?   ?   C . n 
C 3 15  GLN 15  15  ?   ?   ?   C . n 
C 3 16  ALA 16  16  ?   ?   ?   C . n 
C 3 17  ARG 17  17  ?   ?   ?   C . n 
C 3 18  LEU 18  18  18  LEU LEU C . n 
C 3 19  GLU 19  19  19  GLU GLU C . n 
C 3 20  LYS 20  20  20  LYS LYS C . n 
C 3 21  GLU 21  21  21  GLU GLU C . n 
C 3 22  TYR 22  22  22  TYR TYR C . n 
C 3 23  PHE 23  23  23  PHE PHE C . n 
C 3 24  ASP 24  24  24  ASP ASP C . n 
C 3 25  GLN 25  25  25  GLN GLN C . n 
C 3 26  HIS 26  26  26  HIS HIS C . n 
C 3 27  PHE 27  27  27  PHE PHE C . n 
C 3 28  GLY 28  28  28  GLY GLY C . n 
C 3 29  PRO 29  29  29  PRO PRO C . n 
C 3 30  PHE 30  30  30  PHE PHE C . n 
C 3 31  PHE 31  31  31  PHE PHE C . n 
C 3 32  ARG 32  32  32  ARG ARG C . n 
C 3 33  THR 33  33  33  THR THR C . n 
C 3 34  GLU 34  34  34  GLU GLU C . n 
C 3 35  GLN 35  35  35  GLN GLN C . n 
C 3 36  LEU 36  36  36  LEU LEU C . n 
C 3 37  ILE 37  37  37  ILE ILE C . n 
C 3 38  ILE 38  38  38  ILE ILE C . n 
C 3 39  ARG 39  39  39  ARG ARG C . n 
C 3 40  ALA 40  40  40  ALA ALA C . n 
C 3 41  PRO 41  41  41  PRO PRO C . n 
C 3 42  LEU 42  42  42  LEU LEU C . n 
C 3 43  THR 43  43  43  THR THR C . n 
C 3 44  ASP 44  44  44  ASP ASP C . n 
C 3 45  LYS 45  45  45  LYS LYS C . n 
C 3 46  HIS 46  46  46  HIS HIS C . n 
C 3 47  ILE 47  47  47  ILE ILE C . n 
C 3 48  TYR 48  48  48  TYR TYR C . n 
C 3 49  GLN 49  49  49  GLN GLN C . n 
C 3 50  PRO 50  50  50  PRO PRO C . n 
C 3 51  TYR 51  51  51  TYR TYR C . n 
C 3 52  PRO 52  52  52  PRO PRO C . n 
C 3 53  SER 53  53  53  SER SER C . n 
C 3 54  GLY 54  54  54  GLY GLY C . n 
C 3 55  ALA 55  55  55  ALA ALA C . n 
C 3 56  ASP 56  56  56  ASP ASP C . n 
C 3 57  VAL 57  57  57  VAL VAL C . n 
C 3 58  PRO 58  58  58  PRO PRO C . n 
C 3 59  PHE 59  59  59  PHE PHE C . n 
C 3 60  GLY 60  60  60  GLY GLY C . n 
C 3 61  PRO 61  61  61  PRO PRO C . n 
C 3 62  PRO 62  62  62  PRO PRO C . n 
C 3 63  LEU 63  63  63  LEU LEU C . n 
C 3 64  ASP 64  64  64  ASP ASP C . n 
C 3 65  ILE 65  65  65  ILE ILE C . n 
C 3 66  GLN 66  66  66  GLN GLN C . n 
C 3 67  ILE 67  67  67  ILE ILE C . n 
C 3 68  LEU 68  68  68  LEU LEU C . n 
C 3 69  HIS 69  69  69  HIS HIS C . n 
C 3 70  GLN 70  70  70  GLN GLN C . n 
C 3 71  VAL 71  71  71  VAL VAL C . n 
C 3 72  LEU 72  72  72  LEU LEU C . n 
C 3 73  ASP 73  73  73  ASP ASP C . n 
C 3 74  LEU 74  74  74  LEU LEU C . n 
C 3 75  GLN 75  75  75  GLN GLN C . n 
C 3 76  ILE 76  76  76  ILE ILE C . n 
C 3 77  ALA 77  77  77  ALA ALA C . n 
C 3 78  ILE 78  78  78  ILE ILE C . n 
C 3 79  GLU 79  79  79  GLU GLU C . n 
C 3 80  ASN 80  80  80  ASN ASN C . n 
C 3 81  ILE 81  81  81  ILE ILE C . n 
C 3 82  THR 82  82  82  THR THR C . n 
C 3 83  ALA 83  83  83  ALA ALA C . n 
C 3 84  SER 84  84  84  SER SER C . n 
C 3 85  TYR 85  85  85  TYR TYR C . n 
C 3 86  ASP 86  86  86  ASP ASP C . n 
C 3 87  ASN 87  87  87  ASN ASN C . n 
C 3 88  GLU 88  88  88  GLU GLU C . n 
C 3 89  THR 89  89  89  THR THR C . n 
C 3 90  VAL 90  90  90  VAL VAL C . n 
C 3 91  THR 91  91  91  THR THR C . n 
C 3 92  LEU 92  92  92  LEU LEU C . n 
C 3 93  GLN 93  93  93  GLN GLN C . n 
C 3 94  ASP 94  94  94  ASP ASP C . n 
C 3 95  ILE 95  95  95  ILE ILE C . n 
C 3 96  CYS 96  96  96  CYS CYS C . n 
C 3 97  LEU 97  97  97  LEU LEU C . n 
C 3 98  ALA 98  98  98  ALA ALA C . n 
C 3 99  PRO 99  99  99  PRO PRO C . n 
C 3 100 LEU 100 100 100 LEU LEU C . n 
C 3 101 SER 101 101 101 SER SER C . n 
C 3 102 PRO 102 102 102 PRO PRO C . n 
C 3 103 TYR 103 103 103 TYR TYR C . n 
C 3 104 ASN 104 104 104 ASN ASN C . n 
C 3 105 THR 105 105 105 THR THR C . n 
C 3 106 ASN 106 106 106 ASN ASN C . n 
C 3 107 CYS 107 107 107 CYS CYS C . n 
C 3 108 THR 108 108 108 THR THR C . n 
C 3 109 ILE 109 109 109 ILE ILE C . n 
C 3 110 LEU 110 110 110 LEU LEU C . n 
C 3 111 SER 111 111 111 SER SER C . n 
C 3 112 VAL 112 112 112 VAL VAL C . n 
C 3 113 LEU 113 113 113 LEU LEU C . n 
C 3 114 ASN 114 114 114 ASN ASN C . n 
C 3 115 TYR 115 115 115 TYR TYR C . n 
C 3 116 PHE 116 116 116 PHE PHE C . n 
C 3 117 GLN 117 117 117 GLN GLN C . n 
C 3 118 ASN 118 118 118 ASN ASN C . n 
C 3 119 SER 119 119 119 SER SER C . n 
C 3 120 HIS 120 120 120 HIS HIS C . n 
C 3 121 SER 121 121 121 SER SER C . n 
C 3 122 VAL 122 122 122 VAL VAL C . n 
C 3 123 LEU 123 123 123 LEU LEU C . n 
C 3 124 ASP 124 124 124 ASP ASP C . n 
C 3 125 HIS 125 125 125 HIS HIS C . n 
C 3 126 LYS 126 126 126 LYS LYS C . n 
C 3 127 LYS 127 127 127 LYS LYS C . n 
C 3 128 GLY 128 128 128 GLY GLY C . n 
C 3 129 ASP 129 129 129 ASP ASP C . n 
C 3 130 ASP 130 130 130 ASP ASP C . n 
C 3 131 PHE 131 131 131 PHE PHE C . n 
C 3 132 PHE 132 132 132 PHE PHE C . n 
C 3 133 VAL 133 133 133 VAL VAL C . n 
C 3 134 TYR 134 134 134 TYR TYR C . n 
C 3 135 ALA 135 135 135 ALA ALA C . n 
C 3 136 ASP 136 136 136 ASP ASP C . n 
C 3 137 TYR 137 137 137 TYR TYR C . n 
C 3 138 HIS 138 138 138 HIS HIS C . n 
C 3 139 THR 139 139 139 THR THR C . n 
C 3 140 HIS 140 140 140 HIS HIS C . n 
C 3 141 PHE 141 141 141 PHE PHE C . n 
C 3 142 LEU 142 142 142 LEU LEU C . n 
C 3 143 TYR 143 143 143 TYR TYR C . n 
C 3 144 CYS 144 144 144 CYS CYS C . n 
C 3 145 VAL 145 145 145 VAL VAL C . n 
C 3 146 ARG 146 146 146 ARG ARG C . n 
C 3 147 ALA 147 147 147 ALA ALA C . n 
C 3 148 PRO 148 148 148 PRO PRO C . n 
C 3 149 ALA 149 149 149 ALA ALA C . n 
C 3 150 SER 150 150 150 SER SER C . n 
C 3 151 LEU 151 151 151 LEU LEU C . n 
C 3 152 ASN 152 152 152 ASN ASN C . n 
C 3 153 ASP 153 153 153 ASP ASP C . n 
C 3 154 THR 154 154 154 THR THR C . n 
C 3 155 SER 155 155 155 SER SER C . n 
C 3 156 LEU 156 156 156 LEU LEU C . n 
C 3 157 LEU 157 157 157 LEU LEU C . n 
C 3 158 HIS 158 158 158 HIS HIS C . n 
C 3 159 ASP 159 159 159 ASP ASP C . n 
C 3 160 PRO 160 160 160 PRO PRO C . n 
C 3 161 CYS 161 161 161 CYS CYS C . n 
C 3 162 LEU 162 162 162 LEU LEU C . n 
C 3 163 GLY 163 163 163 GLY GLY C . n 
C 3 164 THR 164 164 164 THR THR C . n 
C 3 165 PHE 165 165 165 PHE PHE C . n 
C 3 166 GLY 166 166 166 GLY GLY C . n 
C 3 167 GLY 167 167 167 GLY GLY C . n 
C 3 168 PRO 168 168 168 PRO PRO C . n 
C 3 169 VAL 169 169 169 VAL VAL C . n 
C 3 170 PHE 170 170 170 PHE PHE C . n 
C 3 171 PRO 171 171 171 PRO PRO C . n 
C 3 172 TRP 172 172 172 TRP TRP C . n 
C 3 173 LEU 173 173 173 LEU LEU C . n 
C 3 174 VAL 174 174 174 VAL VAL C . n 
C 3 175 LEU 175 175 175 LEU LEU C . n 
C 3 176 GLY 176 176 176 GLY GLY C . n 
C 3 177 GLY 177 177 177 GLY GLY C . n 
C 3 178 TYR 178 178 178 TYR TYR C . n 
C 3 179 ASP 179 179 179 ASP ASP C . n 
C 3 180 ASP 180 180 180 ASP ASP C . n 
C 3 181 GLN 181 181 181 GLN GLN C . n 
C 3 182 ASN 182 182 182 ASN ASN C . n 
C 3 183 TYR 183 183 183 TYR TYR C . n 
C 3 184 ASN 184 184 184 ASN ASN C . n 
C 3 185 ASN 185 185 185 ASN ASN C . n 
C 3 186 ALA 186 186 186 ALA ALA C . n 
C 3 187 THR 187 187 187 THR THR C . n 
C 3 188 ALA 188 188 188 ALA ALA C . n 
C 3 189 LEU 189 189 189 LEU LEU C . n 
C 3 190 VAL 190 190 190 VAL VAL C . n 
C 3 191 ILE 191 191 191 ILE ILE C . n 
C 3 192 THR 192 192 192 THR THR C . n 
C 3 193 PHE 193 193 193 PHE PHE C . n 
C 3 194 PRO 194 194 194 PRO PRO C . n 
C 3 195 VAL 195 195 195 VAL VAL C . n 
C 3 196 ASN 196 196 196 ASN ASN C . n 
C 3 197 ASN 197 197 197 ASN ASN C . n 
C 3 198 TYR 198 198 198 TYR TYR C . n 
C 3 199 TYR 199 199 199 TYR TYR C . n 
C 3 200 ASN 200 200 200 ASN ASN C . n 
C 3 201 ASP 201 201 201 ASP ASP C . n 
C 3 202 THR 202 202 202 THR THR C . n 
C 3 203 GLU 203 203 203 GLU GLU C . n 
C 3 204 LYS 204 204 204 LYS LYS C . n 
C 3 205 LEU 205 205 205 LEU LEU C . n 
C 3 206 GLN 206 206 206 GLN GLN C . n 
C 3 207 ARG 207 207 207 ARG ARG C . n 
C 3 208 ALA 208 208 208 ALA ALA C . n 
C 3 209 GLN 209 209 209 GLN GLN C . n 
C 3 210 ALA 210 210 210 ALA ALA C . n 
C 3 211 TRP 211 211 211 TRP TRP C . n 
C 3 212 GLU 212 212 212 GLU GLU C . n 
C 3 213 LYS 213 213 213 LYS LYS C . n 
C 3 214 GLU 214 214 214 GLU GLU C . n 
C 3 215 PHE 215 215 215 PHE PHE C . n 
C 3 216 ILE 216 216 216 ILE ILE C . n 
C 3 217 ASN 217 217 217 ASN ASN C . n 
C 3 218 PHE 218 218 218 PHE PHE C . n 
C 3 219 VAL 219 219 219 VAL VAL C . n 
C 3 220 LYS 220 220 220 LYS LYS C . n 
C 3 221 ASN 221 221 221 ASN ASN C . n 
C 3 222 TYR 222 222 222 TYR TYR C . n 
C 3 223 LYS 223 223 223 LYS LYS C . n 
C 3 224 ASN 224 224 224 ASN ASN C . n 
C 3 225 PRO 225 225 225 PRO PRO C . n 
C 3 226 ASN 226 226 226 ASN ASN C . n 
C 3 227 LEU 227 227 227 LEU LEU C . n 
C 3 228 THR 228 228 228 THR THR C . n 
C 3 229 ILE 229 229 229 ILE ILE C . n 
C 3 230 SER 230 230 230 SER SER C . n 
C 3 231 PHE 231 231 231 PHE PHE C . n 
C 3 232 THR 232 232 232 THR THR C . n 
C 3 233 ALA 233 233 ?   ?   ?   C . n 
C 3 234 GLU 234 234 ?   ?   ?   C . n 
C 3 235 ARG 235 235 ?   ?   ?   C . n 
C 3 236 SER 236 236 ?   ?   ?   C . n 
C 3 237 ILE 237 237 ?   ?   ?   C . n 
C 3 238 GLU 238 238 ?   ?   ?   C . n 
C 3 239 ASP 239 239 ?   ?   ?   C . n 
C 3 240 GLU 240 240 ?   ?   ?   C . n 
C 3 241 LEU 241 241 ?   ?   ?   C . n 
C 3 242 ASN 242 242 ?   ?   ?   C . n 
C 3 243 ARG 243 243 ?   ?   ?   C . n 
C 3 244 GLU 244 244 ?   ?   ?   C . n 
C 3 245 SER 245 245 ?   ?   ?   C . n 
C 3 246 ASP 246 246 ?   ?   ?   C . n 
C 3 247 SER 247 247 ?   ?   ?   C . n 
C 3 248 ASP 248 248 ?   ?   ?   C . n 
C 3 249 LEU 249 249 ?   ?   ?   C . n 
C 3 250 GLU 250 250 ?   ?   ?   C . n 
C 3 251 HIS 251 251 ?   ?   ?   C . n 
C 3 252 HIS 252 252 ?   ?   ?   C . n 
C 3 253 HIS 253 253 ?   ?   ?   C . n 
C 3 254 HIS 254 254 ?   ?   ?   C . n 
C 3 255 HIS 255 255 ?   ?   ?   C . n 
C 3 256 HIS 256 256 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 HOH 1  201 26  HOH HOH A . 
E 5 HOH 2  202 73  HOH HOH A . 
E 5 HOH 3  203 113 HOH HOH A . 
E 5 HOH 4  204 21  HOH HOH A . 
E 5 HOH 5  205 17  HOH HOH A . 
E 5 HOH 6  206 60  HOH HOH A . 
E 5 HOH 7  207 7   HOH HOH A . 
E 5 HOH 8  208 8   HOH HOH A . 
E 5 HOH 9  209 141 HOH HOH A . 
E 5 HOH 10 210 3   HOH HOH A . 
E 5 HOH 11 211 6   HOH HOH A . 
E 5 HOH 12 212 4   HOH HOH A . 
E 5 HOH 13 213 1   HOH HOH A . 
E 5 HOH 14 214 37  HOH HOH A . 
E 5 HOH 15 215 51  HOH HOH A . 
E 5 HOH 16 216 56  HOH HOH A . 
E 5 HOH 17 217 89  HOH HOH A . 
E 5 HOH 18 218 19  HOH HOH A . 
E 5 HOH 19 219 2   HOH HOH A . 
E 5 HOH 20 220 61  HOH HOH A . 
E 5 HOH 21 221 58  HOH HOH A . 
E 5 HOH 22 222 30  HOH HOH A . 
E 5 HOH 23 223 54  HOH HOH A . 
E 5 HOH 24 224 63  HOH HOH A . 
E 5 HOH 25 225 9   HOH HOH A . 
E 5 HOH 26 226 47  HOH HOH A . 
E 5 HOH 27 227 144 HOH HOH A . 
E 5 HOH 28 228 81  HOH HOH A . 
E 5 HOH 29 229 105 HOH HOH A . 
E 5 HOH 30 230 146 HOH HOH A . 
E 5 HOH 31 231 104 HOH HOH A . 
E 5 HOH 32 232 77  HOH HOH A . 
E 5 HOH 33 233 23  HOH HOH A . 
E 5 HOH 34 234 163 HOH HOH A . 
E 5 HOH 35 235 15  HOH HOH A . 
E 5 HOH 36 236 35  HOH HOH A . 
E 5 HOH 37 237 100 HOH HOH A . 
E 5 HOH 38 238 70  HOH HOH A . 
E 5 HOH 39 239 31  HOH HOH A . 
E 5 HOH 40 240 106 HOH HOH A . 
E 5 HOH 41 241 128 HOH HOH A . 
E 5 HOH 42 242 27  HOH HOH A . 
E 5 HOH 43 243 48  HOH HOH A . 
E 5 HOH 44 244 11  HOH HOH A . 
E 5 HOH 45 245 83  HOH HOH A . 
E 5 HOH 46 246 84  HOH HOH A . 
E 5 HOH 47 247 86  HOH HOH A . 
E 5 HOH 48 248 62  HOH HOH A . 
E 5 HOH 49 249 41  HOH HOH A . 
E 5 HOH 50 250 46  HOH HOH A . 
E 5 HOH 51 251 103 HOH HOH A . 
E 5 HOH 52 252 137 HOH HOH A . 
E 5 HOH 53 253 127 HOH HOH A . 
E 5 HOH 54 254 122 HOH HOH A . 
E 5 HOH 55 255 126 HOH HOH A . 
E 5 HOH 56 256 152 HOH HOH A . 
E 5 HOH 57 257 134 HOH HOH A . 
E 5 HOH 58 258 167 HOH HOH A . 
E 5 HOH 59 259 161 HOH HOH A . 
E 5 HOH 60 260 96  HOH HOH A . 
E 5 HOH 61 261 157 HOH HOH A . 
E 5 HOH 62 262 53  HOH HOH A . 
E 5 HOH 63 263 57  HOH HOH A . 
E 5 HOH 64 264 154 HOH HOH A . 
E 5 HOH 65 265 169 HOH HOH A . 
E 5 HOH 66 266 116 HOH HOH A . 
E 5 HOH 67 267 76  HOH HOH A . 
E 5 HOH 68 268 138 HOH HOH A . 
E 5 HOH 69 269 145 HOH HOH A . 
E 5 HOH 70 270 55  HOH HOH A . 
E 5 HOH 71 271 162 HOH HOH A . 
E 5 HOH 72 272 95  HOH HOH A . 
E 5 HOH 73 273 171 HOH HOH A . 
E 5 HOH 74 274 92  HOH HOH A . 
E 5 HOH 75 275 136 HOH HOH A . 
E 5 HOH 76 276 158 HOH HOH A . 
E 5 HOH 77 277 151 HOH HOH A . 
F 5 HOH 1  801 71  HOH HOH B . 
F 5 HOH 2  802 25  HOH HOH B . 
F 5 HOH 3  803 121 HOH HOH B . 
F 5 HOH 4  804 5   HOH HOH B . 
F 5 HOH 5  805 64  HOH HOH B . 
F 5 HOH 6  806 170 HOH HOH B . 
F 5 HOH 7  807 140 HOH HOH B . 
F 5 HOH 8  808 142 HOH HOH B . 
F 5 HOH 9  809 75  HOH HOH B . 
F 5 HOH 10 810 14  HOH HOH B . 
F 5 HOH 11 811 68  HOH HOH B . 
F 5 HOH 12 812 32  HOH HOH B . 
F 5 HOH 13 813 20  HOH HOH B . 
F 5 HOH 14 814 79  HOH HOH B . 
F 5 HOH 15 815 98  HOH HOH B . 
F 5 HOH 16 816 148 HOH HOH B . 
F 5 HOH 17 817 124 HOH HOH B . 
F 5 HOH 18 818 132 HOH HOH B . 
F 5 HOH 19 819 36  HOH HOH B . 
F 5 HOH 20 820 129 HOH HOH B . 
F 5 HOH 21 821 139 HOH HOH B . 
F 5 HOH 22 822 117 HOH HOH B . 
F 5 HOH 23 823 18  HOH HOH B . 
F 5 HOH 24 824 39  HOH HOH B . 
F 5 HOH 25 825 90  HOH HOH B . 
F 5 HOH 26 826 107 HOH HOH B . 
F 5 HOH 27 827 101 HOH HOH B . 
F 5 HOH 28 828 125 HOH HOH B . 
F 5 HOH 29 829 149 HOH HOH B . 
F 5 HOH 30 830 67  HOH HOH B . 
F 5 HOH 31 831 43  HOH HOH B . 
G 5 HOH 1  301 72  HOH HOH C . 
G 5 HOH 2  302 50  HOH HOH C . 
G 5 HOH 3  303 13  HOH HOH C . 
G 5 HOH 4  304 65  HOH HOH C . 
G 5 HOH 5  305 166 HOH HOH C . 
G 5 HOH 6  306 45  HOH HOH C . 
G 5 HOH 7  307 87  HOH HOH C . 
G 5 HOH 8  308 160 HOH HOH C . 
G 5 HOH 9  309 97  HOH HOH C . 
G 5 HOH 10 310 153 HOH HOH C . 
G 5 HOH 11 311 150 HOH HOH C . 
G 5 HOH 12 312 114 HOH HOH C . 
G 5 HOH 13 313 10  HOH HOH C . 
G 5 HOH 14 314 28  HOH HOH C . 
G 5 HOH 15 315 42  HOH HOH C . 
G 5 HOH 16 316 29  HOH HOH C . 
G 5 HOH 17 317 59  HOH HOH C . 
G 5 HOH 18 318 118 HOH HOH C . 
G 5 HOH 19 319 82  HOH HOH C . 
G 5 HOH 20 320 93  HOH HOH C . 
G 5 HOH 21 321 110 HOH HOH C . 
G 5 HOH 22 322 108 HOH HOH C . 
G 5 HOH 23 323 33  HOH HOH C . 
G 5 HOH 24 324 38  HOH HOH C . 
G 5 HOH 25 325 131 HOH HOH C . 
G 5 HOH 26 326 16  HOH HOH C . 
G 5 HOH 27 327 40  HOH HOH C . 
G 5 HOH 28 328 12  HOH HOH C . 
G 5 HOH 29 329 85  HOH HOH C . 
G 5 HOH 30 330 22  HOH HOH C . 
G 5 HOH 31 331 88  HOH HOH C . 
G 5 HOH 32 332 143 HOH HOH C . 
G 5 HOH 33 333 91  HOH HOH C . 
G 5 HOH 34 334 109 HOH HOH C . 
G 5 HOH 35 335 135 HOH HOH C . 
G 5 HOH 36 336 80  HOH HOH C . 
G 5 HOH 37 337 78  HOH HOH C . 
G 5 HOH 38 338 156 HOH HOH C . 
G 5 HOH 39 339 34  HOH HOH C . 
G 5 HOH 40 340 74  HOH HOH C . 
G 5 HOH 41 341 24  HOH HOH C . 
G 5 HOH 42 342 123 HOH HOH C . 
G 5 HOH 43 343 120 HOH HOH C . 
G 5 HOH 44 344 69  HOH HOH C . 
G 5 HOH 45 345 119 HOH HOH C . 
G 5 HOH 46 346 102 HOH HOH C . 
G 5 HOH 47 347 133 HOH HOH C . 
G 5 HOH 48 348 52  HOH HOH C . 
G 5 HOH 49 349 66  HOH HOH C . 
G 5 HOH 50 350 94  HOH HOH C . 
G 5 HOH 51 351 164 HOH HOH C . 
G 5 HOH 52 352 44  HOH HOH C . 
G 5 HOH 53 353 49  HOH HOH C . 
G 5 HOH 54 354 111 HOH HOH C . 
G 5 HOH 55 355 165 HOH HOH C . 
G 5 HOH 56 356 168 HOH HOH C . 
G 5 HOH 57 357 159 HOH HOH C . 
G 5 HOH 58 358 130 HOH HOH C . 
G 5 HOH 59 359 112 HOH HOH C . 
G 5 HOH 60 360 155 HOH HOH C . 
G 5 HOH 61 361 115 HOH HOH C . 
G 5 HOH 62 362 147 HOH HOH C . 
G 5 HOH 63 363 99  HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6290  ? 
1 MORE         -24   ? 
1 'SSA (A^2)'  23250 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-01-20 
2 'Structure model' 1 1 2016-01-27 
3 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' Advisory               
3 3 'Structure model' 'Atomic model'         
4 3 'Structure model' 'Data collection'      
5 3 'Structure model' 'Derived calculations' 
6 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' atom_site                     
2  3 'Structure model' atom_site_anisotrop           
3  3 'Structure model' chem_comp                     
4  3 'Structure model' entity                        
5  3 'Structure model' pdbx_branch_scheme            
6  3 'Structure model' pdbx_chem_comp_identifier     
7  3 'Structure model' pdbx_entity_branch            
8  3 'Structure model' pdbx_entity_branch_descriptor 
9  3 'Structure model' pdbx_entity_branch_link       
10 3 'Structure model' pdbx_entity_branch_list       
11 3 'Structure model' pdbx_entity_nonpoly           
12 3 'Structure model' pdbx_nonpoly_scheme           
13 3 'Structure model' pdbx_struct_assembly_gen      
14 3 'Structure model' pdbx_struct_oper_list         
15 3 'Structure model' pdbx_validate_close_contact   
16 3 'Structure model' struct_asym                   
17 3 'Structure model' struct_conn                   
18 3 'Structure model' struct_site                   
19 3 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_atom_site.auth_asym_id'                     
2  3 'Structure model' '_atom_site.auth_seq_id'                      
3  3 'Structure model' '_atom_site.label_asym_id'                    
4  3 'Structure model' '_atom_site_anisotrop.pdbx_auth_asym_id'      
5  3 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id'       
6  3 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id'     
7  3 'Structure model' '_chem_comp.name'                             
8  3 'Structure model' '_chem_comp.type'                             
9  3 'Structure model' '_entity.formula_weight'                      
10 3 'Structure model' '_entity.pdbx_description'                    
11 3 'Structure model' '_entity.pdbx_number_of_molecules'            
12 3 'Structure model' '_entity.type'                                
13 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
14 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
15 3 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 
16 3 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'  
17 3 'Structure model' '_struct_conn.pdbx_role'                      
18 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
19 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
20 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
21 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
22 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         30.2833 
_pdbx_refine_tls.origin_y         -16.3893 
_pdbx_refine_tls.origin_z         -320.9409 
_pdbx_refine_tls.T[1][1]          0.2617 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          0.0041 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          0.0421 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          0.2557 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          0.0374 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          0.2749 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          0.3580 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          -0.1253 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          0.2223 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          0.2324 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          -0.1891 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          0.1052 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          -0.0216 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          -0.0146 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          0.0127 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          -0.0221 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          0.0372 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          0.0583 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          0.0118 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          -0.0441 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          -0.0000 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   all 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.8.4_1496 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .          2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .          3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .          4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NZ B LYS 510 ? ? O6 D NAG 1   ? ? 1.86 
2 1 O  A HOH 263 ? ? O  A HOH 271 ? ? 2.02 
3 1 O  A HOH 267 ? ? O  A HOH 275 ? ? 2.03 
4 1 O  A HOH 270 ? ? O  A HOH 274 ? ? 2.05 
5 1 O  B GLU 564 ? ? O  B HOH 801 ? ? 2.08 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A HOH 251 ? ? 1_555 O   B HOH 815 ? ? 3_655 2.00 
2 1 ND2 B ASN 550 ? ? 1_555 O   C HOH 329 ? ? 5_555 2.07 
3 1 OH  A TYR 137 ? ? 1_555 ND2 C ASN 217 ? ? 5_555 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 39  ? ? -93.64  -97.70  
2  1 SER A 41  ? ? -150.61 19.33   
3  1 VAL A 45  ? ? -67.49  92.78   
4  1 SER A 46  ? ? -111.94 -152.69 
5  1 ASP A 49  ? ? -76.37  25.53   
6  1 LYS A 50  ? ? -173.40 -32.46  
7  1 LEU A 51  ? ? -41.71  95.82   
8  1 VAL A 52  ? ? -47.42  150.67  
9  1 ALA A 148 ? ? -89.24  42.60   
10 1 TYR A 162 ? ? -106.10 -155.50 
11 1 LYS B 510 ? ? 36.51   59.28   
12 1 ALA B 526 ? ? -98.41  44.07   
13 1 ASN B 550 ? ? 28.74   49.24   
14 1 TRP B 597 ? ? -174.14 -5.25   
15 1 PHE C 27  ? ? -96.02  -87.28  
16 1 ASP C 86  ? ? 52.30   -123.71 
17 1 TYR C 103 ? ? 1.35    -57.14  
18 1 ASP C 129 ? ? -137.56 -155.90 
19 1 THR C 154 ? ? 65.79   -2.95   
20 1 ASP C 180 ? ? 56.83   -124.76 
21 1 ASN C 224 ? ? -160.89 103.37  
22 1 PHE C 231 ? ? -111.15 -163.27 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ASN 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     69 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.070 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 275 ? 6.21 . 
2 1 O ? A HOH 276 ? 6.70 . 
3 1 O ? A HOH 277 ? 7.87 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 50  ? CG  ? A LYS 20 CG  
2  1 Y 1 A LYS 50  ? CD  ? A LYS 20 CD  
3  1 Y 1 A LYS 50  ? CE  ? A LYS 20 CE  
4  1 Y 1 A LYS 50  ? NZ  ? A LYS 20 NZ  
5  1 Y 1 A VAL 52  ? CG1 ? A VAL 22 CG1 
6  1 Y 1 A VAL 52  ? CG2 ? A VAL 22 CG2 
7  1 Y 1 A ARG 54  ? CG  ? A ARG 24 CG  
8  1 Y 1 A ARG 54  ? CD  ? A ARG 24 CD  
9  1 Y 1 A ARG 54  ? NE  ? A ARG 24 NE  
10 1 Y 1 A ARG 54  ? CZ  ? A ARG 24 CZ  
11 1 Y 1 A ARG 54  ? NH1 ? A ARG 24 NH1 
12 1 Y 1 A ARG 54  ? NH2 ? A ARG 24 NH2 
13 1 Y 1 A LYS 56  ? CG  ? A LYS 26 CG  
14 1 Y 1 A LYS 56  ? CD  ? A LYS 26 CD  
15 1 Y 1 A LYS 56  ? CE  ? A LYS 26 CE  
16 1 Y 1 A LYS 56  ? NZ  ? A LYS 26 NZ  
17 1 Y 1 B TRP 597 ? CG  ? B TRP 89 CG  
18 1 Y 1 B TRP 597 ? CD1 ? B TRP 89 CD1 
19 1 Y 1 B TRP 597 ? CD2 ? B TRP 89 CD2 
20 1 Y 1 B TRP 597 ? NE1 ? B TRP 89 NE1 
21 1 Y 1 B TRP 597 ? CE2 ? B TRP 89 CE2 
22 1 Y 1 B TRP 597 ? CE3 ? B TRP 89 CE3 
23 1 Y 1 B TRP 597 ? CZ2 ? B TRP 89 CZ2 
24 1 Y 1 B TRP 597 ? CZ3 ? B TRP 89 CZ3 
25 1 Y 1 B TRP 597 ? CH2 ? B TRP 89 CH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B ASP 522 ? B ASP 14  
2  1 Y 1 B GLU 523 ? B GLU 15  
3  1 Y 1 B GLY 524 ? B GLY 16  
4  1 Y 1 B GLY 599 ? B GLY 91  
5  1 Y 1 B THR 600 ? B THR 92  
6  1 Y 1 B CYS 601 ? B CYS 93  
7  1 Y 1 B HIS 602 ? B HIS 94  
8  1 Y 1 B ILE 603 ? B ILE 95  
9  1 Y 1 B LEU 604 ? B LEU 96  
10 1 Y 1 B GLY 605 ? B GLY 97  
11 1 Y 1 B PRO 606 ? B PRO 98  
12 1 Y 1 B ASP 607 ? B ASP 99  
13 1 Y 1 B CYS 608 ? B CYS 100 
14 1 Y 1 B CYS 609 ? B CYS 101 
15 1 Y 1 B ILE 610 ? B ILE 102 
16 1 Y 1 B GLU 611 ? B GLU 103 
17 1 Y 1 B PRO 612 ? B PRO 104 
18 1 Y 1 B HIS 613 ? B HIS 105 
19 1 Y 1 B ASP 614 ? B ASP 106 
20 1 Y 1 B TRP 615 ? B TRP 107 
21 1 Y 1 B THR 616 ? B THR 108 
22 1 Y 1 B LYS 617 ? B LYS 109 
23 1 Y 1 B ASN 618 ? B ASN 110 
24 1 Y 1 B ILE 619 ? B ILE 111 
25 1 Y 1 B THR 620 ? B THR 112 
26 1 Y 1 B ASP 621 ? B ASP 113 
27 1 Y 1 B LYS 622 ? B LYS 114 
28 1 Y 1 B ILE 623 ? B ILE 115 
29 1 Y 1 B ASP 624 ? B ASP 116 
30 1 Y 1 B GLN 625 ? B GLN 117 
31 1 Y 1 B ILE 626 ? B ILE 118 
32 1 Y 1 B ILE 627 ? B ILE 119 
33 1 Y 1 B HIS 628 ? B HIS 120 
34 1 Y 1 B ASP 629 ? B ASP 121 
35 1 Y 1 B PHE 630 ? B PHE 122 
36 1 Y 1 B VAL 631 ? B VAL 123 
37 1 Y 1 B ASP 632 ? B ASP 124 
38 1 Y 1 B HIS 633 ? B HIS 125 
39 1 Y 1 B HIS 634 ? B HIS 126 
40 1 Y 1 B HIS 635 ? B HIS 127 
41 1 Y 1 B HIS 636 ? B HIS 128 
42 1 Y 1 B HIS 637 ? B HIS 129 
43 1 Y 1 B HIS 638 ? B HIS 130 
44 1 Y 1 C MET 1   ? C MET 1   
45 1 Y 1 C THR 2   ? C THR 2   
46 1 Y 1 C THR 3   ? C THR 3   
47 1 Y 1 C ASN 4   ? C ASN 4   
48 1 Y 1 C PRO 5   ? C PRO 5   
49 1 Y 1 C VAL 6   ? C VAL 6   
50 1 Y 1 C ASP 7   ? C ASP 7   
51 1 Y 1 C LEU 8   ? C LEU 8   
52 1 Y 1 C TRP 9   ? C TRP 9   
53 1 Y 1 C SER 10  ? C SER 10  
54 1 Y 1 C ALA 11  ? C ALA 11  
55 1 Y 1 C PRO 12  ? C PRO 12  
56 1 Y 1 C SER 13  ? C SER 13  
57 1 Y 1 C SER 14  ? C SER 14  
58 1 Y 1 C GLN 15  ? C GLN 15  
59 1 Y 1 C ALA 16  ? C ALA 16  
60 1 Y 1 C ARG 17  ? C ARG 17  
61 1 Y 1 C ALA 233 ? C ALA 233 
62 1 Y 1 C GLU 234 ? C GLU 234 
63 1 Y 1 C ARG 235 ? C ARG 235 
64 1 Y 1 C SER 236 ? C SER 236 
65 1 Y 1 C ILE 237 ? C ILE 237 
66 1 Y 1 C GLU 238 ? C GLU 238 
67 1 Y 1 C ASP 239 ? C ASP 239 
68 1 Y 1 C GLU 240 ? C GLU 240 
69 1 Y 1 C LEU 241 ? C LEU 241 
70 1 Y 1 C ASN 242 ? C ASN 242 
71 1 Y 1 C ARG 243 ? C ARG 243 
72 1 Y 1 C GLU 244 ? C GLU 244 
73 1 Y 1 C SER 245 ? C SER 245 
74 1 Y 1 C ASP 246 ? C ASP 246 
75 1 Y 1 C SER 247 ? C SER 247 
76 1 Y 1 C ASP 248 ? C ASP 248 
77 1 Y 1 C LEU 249 ? C LEU 249 
78 1 Y 1 C GLU 250 ? C GLU 250 
79 1 Y 1 C HIS 251 ? C HIS 251 
80 1 Y 1 C HIS 252 ? C HIS 252 
81 1 Y 1 C HIS 253 ? C HIS 253 
82 1 Y 1 C HIS 254 ? C HIS 254 
83 1 Y 1 C HIS 255 ? C HIS 255 
84 1 Y 1 C HIS 256 ? C HIS 256 
# 
_pdbx_audit_support.funding_organization   'China Ministry of Science and Technology National 973 Project' 
_pdbx_audit_support.country                China 
_pdbx_audit_support.grant_number           '2013CB531502 and 2014CB542503' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
D 4 NAG 1 D NAG 1 B NAG 701 n 
D 4 NAG 2 D NAG 2 B NAG 702 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   4 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 4 DGlcpNAcb1-4DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 4 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 4 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  4 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
4 NAG 1 n 
4 NAG 2 n 
# 
_pdbx_entity_nonpoly.entity_id   5 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#