data_5F4T
# 
_entry.id   5F4T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5F4T         
WWPDB D_1000216017 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5F4E unspecified 
PDB . 5F4Q unspecified 
PDB . 5F4V unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5F4T 
_pdbx_database_status.recvd_initial_deposition_date   2015-12-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Aydin, H.'   1 
'Sultana, A.' 2 
'Lee, J.E.'   3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            534 
_citation.language                  ? 
_citation.page_first                562 
_citation.page_last                 565 
_citation.title                     'Molecular architecture of the human sperm IZUMO1 and egg JUNO fertilization complex.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature18595 
_citation.pdbx_database_id_PubMed   27309818 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Aydin, H.'       1 
primary 'Sultana, A.'     2 
primary 'Li, S.'          3 
primary 'Thavalingam, A.' 4 
primary 'Lee, J.E.'       5 
# 
_cell.entry_id           5F4T 
_cell.length_a           126.039 
_cell.length_b           126.039 
_cell.length_c           60.895 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              9 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5F4T 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Izumo sperm-egg fusion protein 1' 27181.240 1 ? ? 'UNP residues 22-254' ? 
2 non-polymer man N-ACETYL-D-GLUCOSAMINE             221.208   1 ? ? ?                     ? 
3 water       nat water                              18.015    4 ? ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Oocyte binding/fusion factor,OBF,Sperm-specific protein izumo' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;CVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSD
VKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMILD
CELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLPGRVLPR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;CVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSD
VKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMILD
CELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLPGRVLPR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   VAL n 
1 3   ILE n 
1 4   CYS n 
1 5   ASP n 
1 6   PRO n 
1 7   SER n 
1 8   VAL n 
1 9   VAL n 
1 10  LEU n 
1 11  ALA n 
1 12  LEU n 
1 13  LYS n 
1 14  SER n 
1 15  LEU n 
1 16  GLU n 
1 17  LYS n 
1 18  ASP n 
1 19  TYR n 
1 20  LEU n 
1 21  PRO n 
1 22  GLY n 
1 23  HIS n 
1 24  LEU n 
1 25  ASP n 
1 26  ALA n 
1 27  LYS n 
1 28  HIS n 
1 29  HIS n 
1 30  LYS n 
1 31  ALA n 
1 32  MET n 
1 33  MET n 
1 34  GLU n 
1 35  ARG n 
1 36  VAL n 
1 37  GLU n 
1 38  ASN n 
1 39  ALA n 
1 40  VAL n 
1 41  LYS n 
1 42  ASP n 
1 43  PHE n 
1 44  GLN n 
1 45  GLU n 
1 46  LEU n 
1 47  SER n 
1 48  LEU n 
1 49  ASN n 
1 50  GLU n 
1 51  ASP n 
1 52  ALA n 
1 53  TYR n 
1 54  MET n 
1 55  GLY n 
1 56  VAL n 
1 57  VAL n 
1 58  ASP n 
1 59  GLU n 
1 60  ALA n 
1 61  THR n 
1 62  LEU n 
1 63  GLN n 
1 64  LYS n 
1 65  GLY n 
1 66  SER n 
1 67  TRP n 
1 68  SER n 
1 69  LEU n 
1 70  LEU n 
1 71  LYS n 
1 72  ASP n 
1 73  LEU n 
1 74  LYS n 
1 75  ARG n 
1 76  ILE n 
1 77  THR n 
1 78  ASP n 
1 79  SER n 
1 80  ASP n 
1 81  VAL n 
1 82  LYS n 
1 83  GLY n 
1 84  ASP n 
1 85  LEU n 
1 86  PHE n 
1 87  VAL n 
1 88  LYS n 
1 89  GLU n 
1 90  LEU n 
1 91  PHE n 
1 92  TRP n 
1 93  MET n 
1 94  LEU n 
1 95  HIS n 
1 96  LEU n 
1 97  GLN n 
1 98  LYS n 
1 99  GLU n 
1 100 THR n 
1 101 PHE n 
1 102 ALA n 
1 103 THR n 
1 104 TYR n 
1 105 VAL n 
1 106 ALA n 
1 107 ARG n 
1 108 PHE n 
1 109 GLN n 
1 110 LYS n 
1 111 GLU n 
1 112 ALA n 
1 113 TYR n 
1 114 CYS n 
1 115 PRO n 
1 116 ASN n 
1 117 LYS n 
1 118 CYS n 
1 119 GLY n 
1 120 VAL n 
1 121 MET n 
1 122 LEU n 
1 123 GLN n 
1 124 THR n 
1 125 LEU n 
1 126 ILE n 
1 127 TRP n 
1 128 CYS n 
1 129 LYS n 
1 130 ASN n 
1 131 CYS n 
1 132 LYS n 
1 133 LYS n 
1 134 GLU n 
1 135 VAL n 
1 136 HIS n 
1 137 ALA n 
1 138 CYS n 
1 139 ARG n 
1 140 LYS n 
1 141 SER n 
1 142 TYR n 
1 143 ASP n 
1 144 CYS n 
1 145 GLY n 
1 146 GLU n 
1 147 ARG n 
1 148 ASN n 
1 149 VAL n 
1 150 GLU n 
1 151 VAL n 
1 152 PRO n 
1 153 GLN n 
1 154 MET n 
1 155 GLU n 
1 156 ASP n 
1 157 MET n 
1 158 ILE n 
1 159 LEU n 
1 160 ASP n 
1 161 CYS n 
1 162 GLU n 
1 163 LEU n 
1 164 ASN n 
1 165 TRP n 
1 166 HIS n 
1 167 GLN n 
1 168 ALA n 
1 169 SER n 
1 170 GLU n 
1 171 GLY n 
1 172 LEU n 
1 173 THR n 
1 174 ASP n 
1 175 TYR n 
1 176 SER n 
1 177 PHE n 
1 178 TYR n 
1 179 ARG n 
1 180 VAL n 
1 181 TRP n 
1 182 GLY n 
1 183 ASN n 
1 184 ASN n 
1 185 THR n 
1 186 GLU n 
1 187 THR n 
1 188 LEU n 
1 189 VAL n 
1 190 SER n 
1 191 LYS n 
1 192 GLY n 
1 193 LYS n 
1 194 GLU n 
1 195 ALA n 
1 196 THR n 
1 197 LEU n 
1 198 THR n 
1 199 LYS n 
1 200 PRO n 
1 201 MET n 
1 202 VAL n 
1 203 GLY n 
1 204 PRO n 
1 205 GLU n 
1 206 ASP n 
1 207 ALA n 
1 208 GLY n 
1 209 SER n 
1 210 TYR n 
1 211 ARG n 
1 212 CYS n 
1 213 GLU n 
1 214 LEU n 
1 215 GLY n 
1 216 SER n 
1 217 VAL n 
1 218 ASN n 
1 219 SER n 
1 220 SER n 
1 221 PRO n 
1 222 ALA n 
1 223 THR n 
1 224 ILE n 
1 225 ILE n 
1 226 ASN n 
1 227 PHE n 
1 228 HIS n 
1 229 VAL n 
1 230 THR n 
1 231 VAL n 
1 232 LEU n 
1 233 PRO n 
1 234 GLY n 
1 235 ARG n 
1 236 VAL n 
1 237 LEU n 
1 238 PRO n 
1 239 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   239 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 IZUMO1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fruit fly' 
_entity_src_gen.pdbx_host_org_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7227 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.db_code                    IZUM1_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.details                    ? 
_struct_ref.entity_id                  1 
_struct_ref.id                         1 
_struct_ref.seq_align                  ? 
_struct_ref.seq_dif                    ? 
_struct_ref.pdbx_db_accession          Q8IYV9 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   
;CVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSD
VKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMILD
CELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLP
;
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_align_end             ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5F4T 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 233 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8IYV9 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  254 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       22 
_struct_ref_seq.pdbx_auth_seq_align_end       254 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5F4T GLY A 234 ? UNP Q8IYV9 ? ? 'expression tag' 255 1 
1 5F4T ARG A 235 ? UNP Q8IYV9 ? ? 'expression tag' 256 2 
1 5F4T VAL A 236 ? UNP Q8IYV9 ? ? 'expression tag' 257 3 
1 5F4T LEU A 237 ? UNP Q8IYV9 ? ? 'expression tag' 258 4 
1 5F4T PRO A 238 ? UNP Q8IYV9 ? ? 'expression tag' 259 5 
1 5F4T ARG A 239 ? UNP Q8IYV9 ? ? 'expression tag' 260 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ? 'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking' y PHENYLALANINE          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5F4T 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.49 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.76 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.07 M sodium acetate (pH 4.6), 5.6% (w/v) PEG 4000 and 30% (v/v) glycerol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-300' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-04-30 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97949 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97949 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_synchrotron_site       CLSI 
# 
_reflns.B_iso_Wilson_estimate            37.5 
_reflns.entry_id                         5F4T 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.080 
_reflns.d_resolution_low                 63.02 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       6484 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.400 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.900 
_reflns.pdbx_Rmerge_I_obs                0.115 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.080 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         18861 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.993 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.080 3.300  ? 3.100  2981 ? ? 1102 ? 91.300 ? ? ? ? 0.474 ? ? ? ? ? ? ? ? 2.700 ? ? ? ? ? 0.343 0 1 1 0.774 ? 
8.720 40.640 ? 15.900 831  ? ? 285  ? 96.000 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 2.900 ? ? ? ? ? 0.036 0 2 1 0.994 ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5F4T 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     6483 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.01 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.642 
_refine.ls_d_res_high                            3.083 
_refine.ls_percent_reflns_obs                    97.36 
_refine.ls_R_factor_obs                          0.2209 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2194 
_refine.ls_R_factor_R_free                       0.2484 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.17 
_refine.ls_number_reflns_R_free                  335 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      5F4E 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.40 
_refine.pdbx_overall_phase_error                 28.81 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1728 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             4 
_refine_hist.number_atoms_total               1746 
_refine_hist.d_res_high                       3.083 
_refine_hist.d_res_low                        40.642 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 1791 'X-RAY DIFFRACTION' ? 
f_angle_d          0.938  ? ? 2440 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.393 ? ? 604  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.038  ? ? 287  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 311  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 3.0829 3.8837  3058 0.2727 97.00 0.3303 . . 162 . . 
'X-RAY DIFFRACTION' . 3.8837 40.6458 3090 0.1962 98.00 0.2140 . . 173 . . 
# 
_struct.entry_id                     5F4T 
_struct.title                        'Crystal structure of the human sperm Izumo1 residues 22-254' 
_struct.pdbx_descriptor              'Izumo sperm-egg fusion protein 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5F4T 
_struct_keywords.text            'glycoprotein, membrane-bound, cysteine-rich, adhesion, fusion, CELL ADHESION' 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 CYS A 1   ? CYS A 4   ? CYS A 22  CYS A 25  5 ? 4  
HELX_P HELX_P2 AA2 ASP A 5   ? TYR A 19  ? ASP A 26  TYR A 40  1 ? 15 
HELX_P HELX_P3 AA3 TYR A 19  ? LEU A 24  ? TYR A 40  LEU A 45  1 ? 6  
HELX_P HELX_P4 AA4 ASP A 25  ? HIS A 28  ? ASP A 46  HIS A 49  5 ? 4  
HELX_P HELX_P5 AA5 HIS A 29  ? LYS A 41  ? HIS A 50  LYS A 62  1 ? 13 
HELX_P HELX_P6 AA6 ASP A 58  ? ASP A 80  ? ASP A 79  ASP A 101 1 ? 23 
HELX_P HELX_P7 AA7 LEU A 85  ? ALA A 112 ? LEU A 106 ALA A 133 1 ? 28 
HELX_P HELX_P8 AA8 TRP A 165 ? SER A 169 ? TRP A 186 SER A 190 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?   ? A CYS 1   SG  ? ? ? 1_555 A CYS 128 SG ? ? A CYS 22  A CYS 149 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf2 disulf ?   ? A CYS 4   SG  ? ? ? 1_555 A CYS 131 SG ? ? A CYS 25  A CYS 152 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3 disulf ?   ? A CYS 114 SG  ? ? ? 1_555 A CYS 138 SG ? ? A CYS 135 A CYS 159 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4 disulf ?   ? A CYS 118 SG  ? ? ? 1_555 A CYS 144 SG ? ? A CYS 139 A CYS 165 1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf5 disulf ?   ? A CYS 161 SG  ? ? ? 1_555 A CYS 212 SG ? ? A CYS 182 A CYS 233 1_555 ? ? ? ? ? ? ? 2.032 ? 
covale1 covale one ? A ASN 183 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 204 A NAG 301 1_555 ? ? ? ? ? ? ? 1.539 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 5 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 56  ? VAL A 57  ? VAL A 77  VAL A 78  
AA1 2 VAL A 120 ? TRP A 127 ? VAL A 141 TRP A 148 
AA1 3 LYS A 132 ? ARG A 139 ? LYS A 153 ARG A 160 
AA2 1 GLY A 145 ? PRO A 152 ? GLY A 166 PRO A 173 
AA2 2 SER A 219 ? LEU A 232 ? SER A 240 LEU A 253 
AA2 3 GLY A 208 ? SER A 216 ? GLY A 229 SER A 237 
AA2 4 LEU A 172 ? VAL A 180 ? LEU A 193 VAL A 201 
AA2 5 GLU A 186 ? GLY A 192 ? GLU A 207 GLY A 213 
AA3 1 MET A 157 ? ASP A 160 ? MET A 178 ASP A 181 
AA3 2 THR A 196 ? LYS A 199 ? THR A 217 LYS A 220 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 57  ? N VAL A 78  O ILE A 126 ? O ILE A 147 
AA1 2 3 N LEU A 125 ? N LEU A 146 O GLU A 134 ? O GLU A 155 
AA2 1 2 N ARG A 147 ? N ARG A 168 O ASN A 226 ? O ASN A 247 
AA2 2 3 O THR A 223 ? O THR A 244 N LEU A 214 ? N LEU A 235 
AA2 3 4 O GLY A 215 ? O GLY A 236 N ASP A 174 ? N ASP A 195 
AA2 4 5 N PHE A 177 ? N PHE A 198 O VAL A 189 ? O VAL A 210 
AA3 1 2 N MET A 157 ? N MET A 178 O LYS A 199 ? O LYS A 220 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    NAG 
_struct_site.pdbx_auth_seq_id     301 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'binding site for Mono-Saccharide NAG A 301 bound to ASN A 204' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 ASN A 183 ? ASN A 204 . ? 1_555 ? 
2 AC1 2 THR A 185 ? THR A 206 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5F4T 
_atom_sites.fract_transf_matrix[1][1]   0.007934 
_atom_sites.fract_transf_matrix[1][2]   0.004581 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009161 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016422 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 1   ? -25.484 -20.320 1.536   1.00 65.80  ?  22  CYS A N   1 
ATOM   2    C CA  . CYS A 1 1   ? -24.661 -20.400 2.736   1.00 70.72  ?  22  CYS A CA  1 
ATOM   3    C C   . CYS A 1 1   ? -23.191 -20.558 2.371   1.00 62.31  ?  22  CYS A C   1 
ATOM   4    O O   . CYS A 1 1   ? -22.338 -20.720 3.243   1.00 67.62  ?  22  CYS A O   1 
ATOM   5    C CB  . CYS A 1 1   ? -25.106 -21.570 3.612   1.00 81.81  ?  22  CYS A CB  1 
ATOM   6    S SG  . CYS A 1 1   ? -26.876 -21.894 3.538   1.00 107.42 ?  22  CYS A SG  1 
ATOM   7    N N   . VAL A 1 2   ? -22.912 -20.493 1.072   1.00 66.49  ?  23  VAL A N   1 
ATOM   8    C CA  . VAL A 1 2   ? -21.603 -20.833 0.517   1.00 60.84  ?  23  VAL A CA  1 
ATOM   9    C C   . VAL A 1 2   ? -20.426 -20.098 1.165   1.00 61.11  ?  23  VAL A C   1 
ATOM   10   O O   . VAL A 1 2   ? -19.356 -20.678 1.350   1.00 61.32  ?  23  VAL A O   1 
ATOM   11   C CB  . VAL A 1 2   ? -21.580 -20.566 -1.002  1.00 56.98  ?  23  VAL A CB  1 
ATOM   12   C CG1 . VAL A 1 2   ? -20.227 -20.916 -1.592  1.00 59.24  ?  23  VAL A CG1 1 
ATOM   13   C CG2 . VAL A 1 2   ? -22.671 -21.365 -1.686  1.00 57.68  ?  23  VAL A CG2 1 
ATOM   14   N N   . ILE A 1 3   ? -20.628 -18.837 1.538   1.00 62.02  ?  24  ILE A N   1 
ATOM   15   C CA  . ILE A 1 3   ? -19.547 -18.033 2.107   1.00 64.01  ?  24  ILE A CA  1 
ATOM   16   C C   . ILE A 1 3   ? -19.070 -18.577 3.459   1.00 65.73  ?  24  ILE A C   1 
ATOM   17   O O   . ILE A 1 3   ? -18.087 -18.092 4.022   1.00 69.27  ?  24  ILE A O   1 
ATOM   18   C CB  . ILE A 1 3   ? -19.969 -16.552 2.270   1.00 65.49  ?  24  ILE A CB  1 
ATOM   19   C CG1 . ILE A 1 3   ? -18.749 -15.630 2.170   1.00 65.76  ?  24  ILE A CG1 1 
ATOM   20   C CG2 . ILE A 1 3   ? -20.736 -16.341 3.570   1.00 63.17  ?  24  ILE A CG2 1 
ATOM   21   C CD1 . ILE A 1 3   ? -19.037 -14.300 1.511   1.00 66.21  ?  24  ILE A CD1 1 
ATOM   22   N N   . CYS A 1 4   ? -19.757 -19.597 3.967   1.00 64.34  ?  25  CYS A N   1 
ATOM   23   C CA  . CYS A 1 4   ? -19.336 -20.270 5.192   1.00 69.78  ?  25  CYS A CA  1 
ATOM   24   C C   . CYS A 1 4   ? -18.152 -21.208 4.945   1.00 72.05  ?  25  CYS A C   1 
ATOM   25   O O   . CYS A 1 4   ? -17.744 -21.950 5.839   1.00 72.29  ?  25  CYS A O   1 
ATOM   26   C CB  . CYS A 1 4   ? -20.499 -21.059 5.799   1.00 74.14  ?  25  CYS A CB  1 
ATOM   27   S SG  . CYS A 1 4   ? -21.912 -20.052 6.303   1.00 85.74  ?  25  CYS A SG  1 
ATOM   28   N N   . ASP A 1 5   ? -17.605 -21.175 3.732   1.00 70.77  ?  26  ASP A N   1 
ATOM   29   C CA  . ASP A 1 5   ? -16.483 -22.038 3.375   1.00 66.70  ?  26  ASP A CA  1 
ATOM   30   C C   . ASP A 1 5   ? -15.181 -21.252 3.227   1.00 65.95  ?  26  ASP A C   1 
ATOM   31   O O   . ASP A 1 5   ? -15.083 -20.357 2.388   1.00 64.44  ?  26  ASP A O   1 
ATOM   32   C CB  . ASP A 1 5   ? -16.779 -22.794 2.079   1.00 66.37  ?  26  ASP A CB  1 
ATOM   33   C CG  . ASP A 1 5   ? -15.664 -23.749 1.696   1.00 70.89  ?  26  ASP A CG  1 
ATOM   34   O OD1 . ASP A 1 5   ? -14.814 -24.051 2.560   1.00 75.21  -1 26  ASP A OD1 1 
ATOM   35   O OD2 . ASP A 1 5   ? -15.634 -24.196 0.531   1.00 68.07  ?  26  ASP A OD2 1 
ATOM   36   N N   . PRO A 1 6   ? -14.180 -21.589 4.056   1.00 64.22  ?  27  PRO A N   1 
ATOM   37   C CA  . PRO A 1 6   ? -12.839 -20.990 4.075   1.00 65.17  ?  27  PRO A CA  1 
ATOM   38   C C   . PRO A 1 6   ? -12.165 -20.882 2.706   1.00 63.69  ?  27  PRO A C   1 
ATOM   39   O O   . PRO A 1 6   ? -11.273 -20.055 2.547   1.00 64.75  ?  27  PRO A O   1 
ATOM   40   C CB  . PRO A 1 6   ? -12.040 -21.945 4.969   1.00 68.00  ?  27  PRO A CB  1 
ATOM   41   C CG  . PRO A 1 6   ? -13.047 -22.719 5.759   1.00 68.93  ?  27  PRO A CG  1 
ATOM   42   C CD  . PRO A 1 6   ? -14.423 -22.420 5.247   1.00 66.64  ?  27  PRO A CD  1 
ATOM   43   N N   . SER A 1 7   ? -12.568 -21.705 1.744   1.00 68.35  ?  28  SER A N   1 
ATOM   44   C CA  . SER A 1 7   ? -11.916 -21.718 0.437   1.00 69.58  ?  28  SER A CA  1 
ATOM   45   C C   . SER A 1 7   ? -12.497 -20.669 -0.508  1.00 66.61  ?  28  SER A C   1 
ATOM   46   O O   . SER A 1 7   ? -11.783 -20.111 -1.346  1.00 67.52  ?  28  SER A O   1 
ATOM   47   C CB  . SER A 1 7   ? -12.020 -23.108 -0.193  1.00 66.58  ?  28  SER A CB  1 
ATOM   48   O OG  . SER A 1 7   ? -11.469 -24.095 0.663   1.00 68.90  ?  28  SER A OG  1 
ATOM   49   N N   . VAL A 1 8   ? -13.793 -20.407 -0.370  1.00 61.73  ?  29  VAL A N   1 
ATOM   50   C CA  . VAL A 1 8   ? -14.461 -19.382 -1.164  1.00 59.81  ?  29  VAL A CA  1 
ATOM   51   C C   . VAL A 1 8   ? -13.831 -18.016 -0.922  1.00 62.08  ?  29  VAL A C   1 
ATOM   52   O O   . VAL A 1 8   ? -13.454 -17.317 -1.866  1.00 64.93  ?  29  VAL A O   1 
ATOM   53   C CB  . VAL A 1 8   ? -15.965 -19.306 -0.842  1.00 59.05  ?  29  VAL A CB  1 
ATOM   54   C CG1 . VAL A 1 8   ? -16.618 -18.167 -1.610  1.00 58.27  ?  29  VAL A CG1 1 
ATOM   55   C CG2 . VAL A 1 8   ? -16.641 -20.629 -1.157  1.00 58.86  ?  29  VAL A CG2 1 
ATOM   56   N N   . VAL A 1 9   ? -13.710 -17.650 0.350   1.00 62.67  ?  30  VAL A N   1 
ATOM   57   C CA  . VAL A 1 9   ? -13.136 -16.364 0.728   1.00 69.16  ?  30  VAL A CA  1 
ATOM   58   C C   . VAL A 1 9   ? -11.681 -16.256 0.266   1.00 74.04  ?  30  VAL A C   1 
ATOM   59   O O   . VAL A 1 9   ? -11.204 -15.164 -0.054  1.00 77.57  ?  30  VAL A O   1 
ATOM   60   C CB  . VAL A 1 9   ? -13.229 -16.129 2.256   1.00 69.12  ?  30  VAL A CB  1 
ATOM   61   C CG1 . VAL A 1 9   ? -14.682 -16.164 2.709   1.00 65.89  ?  30  VAL A CG1 1 
ATOM   62   C CG2 . VAL A 1 9   ? -12.416 -17.160 3.021   1.00 73.45  ?  30  VAL A CG2 1 
ATOM   63   N N   . LEU A 1 10  ? -10.986 -17.391 0.214   1.00 67.17  ?  31  LEU A N   1 
ATOM   64   C CA  . LEU A 1 10  ? -9.635  -17.431 -0.333  1.00 71.46  ?  31  LEU A CA  1 
ATOM   65   C C   . LEU A 1 10  ? -9.672  -17.096 -1.814  1.00 68.68  ?  31  LEU A C   1 
ATOM   66   O O   . LEU A 1 10  ? -8.886  -16.281 -2.298  1.00 80.17  ?  31  LEU A O   1 
ATOM   67   C CB  . LEU A 1 10  ? -8.990  -18.803 -0.126  1.00 74.49  ?  31  LEU A CB  1 
ATOM   68   C CG  . LEU A 1 10  ? -8.565  -19.212 1.285   1.00 84.69  ?  31  LEU A CG  1 
ATOM   69   C CD1 . LEU A 1 10  ? -7.409  -20.202 1.231   1.00 86.57  ?  31  LEU A CD1 1 
ATOM   70   C CD2 . LEU A 1 10  ? -8.202  -17.999 2.130   1.00 89.20  ?  31  LEU A CD2 1 
ATOM   71   N N   . ALA A 1 11  ? -10.598 -17.730 -2.526  1.00 69.19  ?  32  ALA A N   1 
ATOM   72   C CA  . ALA A 1 11  ? -10.760 -17.496 -3.955  1.00 68.98  ?  32  ALA A CA  1 
ATOM   73   C C   . ALA A 1 11  ? -11.136 -16.047 -4.239  1.00 72.59  ?  32  ALA A C   1 
ATOM   74   O O   . ALA A 1 11  ? -10.847 -15.528 -5.314  1.00 76.16  ?  32  ALA A O   1 
ATOM   75   C CB  . ALA A 1 11  ? -11.805 -18.436 -4.530  1.00 67.72  ?  32  ALA A CB  1 
ATOM   76   N N   . LEU A 1 12  ? -11.780 -15.399 -3.272  1.00 71.30  ?  33  LEU A N   1 
ATOM   77   C CA  . LEU A 1 12  ? -12.183 -14.004 -3.422  1.00 70.68  ?  33  LEU A CA  1 
ATOM   78   C C   . LEU A 1 12  ? -11.025 -13.046 -3.149  1.00 73.99  ?  33  LEU A C   1 
ATOM   79   O O   . LEU A 1 12  ? -10.846 -12.058 -3.866  1.00 74.20  ?  33  LEU A O   1 
ATOM   80   C CB  . LEU A 1 12  ? -13.359 -13.689 -2.497  1.00 70.04  ?  33  LEU A CB  1 
ATOM   81   C CG  . LEU A 1 12  ? -14.654 -14.427 -2.845  1.00 70.28  ?  33  LEU A CG  1 
ATOM   82   C CD1 . LEU A 1 12  ? -15.811 -13.938 -1.989  1.00 66.20  ?  33  LEU A CD1 1 
ATOM   83   C CD2 . LEU A 1 12  ? -14.974 -14.274 -4.325  1.00 72.60  ?  33  LEU A CD2 1 
ATOM   84   N N   . LYS A 1 13  ? -10.249 -13.338 -2.109  1.00 71.75  ?  34  LYS A N   1 
ATOM   85   C CA  . LYS A 1 13  ? -9.048  -12.561 -1.815  1.00 73.90  ?  34  LYS A CA  1 
ATOM   86   C C   . LYS A 1 13  ? -8.087  -12.628 -2.996  1.00 77.71  ?  34  LYS A C   1 
ATOM   87   O O   . LYS A 1 13  ? -7.552  -11.609 -3.443  1.00 77.70  ?  34  LYS A O   1 
ATOM   88   C CB  . LYS A 1 13  ? -8.368  -13.072 -0.543  1.00 73.39  ?  34  LYS A CB  1 
ATOM   89   N N   . SER A 1 14  ? -7.885  -13.840 -3.503  1.00 79.48  ?  35  SER A N   1 
ATOM   90   C CA  . SER A 1 14  ? -7.048  -14.053 -4.675  1.00 81.98  ?  35  SER A CA  1 
ATOM   91   C C   . SER A 1 14  ? -7.683  -13.433 -5.916  1.00 81.27  ?  35  SER A C   1 
ATOM   92   O O   . SER A 1 14  ? -6.980  -13.008 -6.828  1.00 91.33  ?  35  SER A O   1 
ATOM   93   C CB  . SER A 1 14  ? -6.799  -15.547 -4.896  1.00 79.73  ?  35  SER A CB  1 
ATOM   94   O OG  . SER A 1 14  ? -6.475  -16.197 -3.680  1.00 86.13  ?  35  SER A OG  1 
ATOM   95   N N   . LEU A 1 15  ? -9.012  -13.378 -5.950  1.00 78.41  ?  36  LEU A N   1 
ATOM   96   C CA  . LEU A 1 15  ? -9.703  -12.751 -7.073  1.00 77.92  ?  36  LEU A CA  1 
ATOM   97   C C   . LEU A 1 15  ? -9.377  -11.272 -7.145  1.00 83.13  ?  36  LEU A C   1 
ATOM   98   O O   . LEU A 1 15  ? -8.923  -10.779 -8.179  1.00 93.19  ?  36  LEU A O   1 
ATOM   99   C CB  . LEU A 1 15  ? -11.217 -12.932 -6.973  1.00 75.18  ?  36  LEU A CB  1 
ATOM   100  C CG  . LEU A 1 15  ? -11.963 -12.251 -8.122  1.00 69.77  ?  36  LEU A CG  1 
ATOM   101  C CD1 . LEU A 1 15  ? -11.604 -12.906 -9.448  1.00 72.08  ?  36  LEU A CD1 1 
ATOM   102  C CD2 . LEU A 1 15  ? -13.467 -12.267 -7.897  1.00 65.15  ?  36  LEU A CD2 1 
ATOM   103  N N   . GLU A 1 16  ? -9.622  -10.566 -6.046  1.00 80.96  ?  37  GLU A N   1 
ATOM   104  C CA  . GLU A 1 16  ? -9.265  -9.160  -5.962  1.00 80.76  ?  37  GLU A CA  1 
ATOM   105  C C   . GLU A 1 16  ? -7.786  -8.838  -6.124  1.00 85.79  ?  37  GLU A C   1 
ATOM   106  O O   . GLU A 1 16  ? -7.393  -8.166  -7.076  1.00 86.85  ?  37  GLU A O   1 
ATOM   107  C CB  . GLU A 1 16  ? -9.643  -8.577  -4.599  1.00 75.61  ?  37  GLU A CB  1 
ATOM   108  N N   . LYS A 1 17  ? -6.973  -9.377  -5.219  1.00 84.89  ?  38  LYS A N   1 
ATOM   109  C CA  . LYS A 1 17  ? -5.528  -9.146  -5.226  1.00 88.35  ?  38  LYS A CA  1 
ATOM   110  C C   . LYS A 1 17  ? -4.781  -9.611  -6.481  1.00 89.75  ?  38  LYS A C   1 
ATOM   111  O O   . LYS A 1 17  ? -3.823  -8.964  -6.901  1.00 90.23  ?  38  LYS A O   1 
ATOM   112  C CB  . LYS A 1 17  ? -4.899  -9.820  -4.004  1.00 88.41  ?  38  LYS A CB  1 
ATOM   113  N N   . ASP A 1 18  ? -5.200  -10.727 -7.073  1.00 93.68  ?  39  ASP A N   1 
ATOM   114  C CA  . ASP A 1 18  ? -4.432  -11.309 -8.173  1.00 93.78  ?  39  ASP A CA  1 
ATOM   115  C C   . ASP A 1 18  ? -5.092  -11.171 -9.548  1.00 88.84  ?  39  ASP A C   1 
ATOM   116  O O   . ASP A 1 18  ? -4.394  -11.074 -10.557 1.00 95.64  ?  39  ASP A O   1 
ATOM   117  C CB  . ASP A 1 18  ? -4.145  -12.790 -7.896  1.00 94.39  ?  39  ASP A CB  1 
ATOM   118  C CG  . ASP A 1 18  ? -3.393  -13.009 -6.594  1.00 103.49 ?  39  ASP A CG  1 
ATOM   119  O OD1 . ASP A 1 18  ? -3.180  -12.030 -5.849  1.00 115.84 ?  39  ASP A OD1 1 
ATOM   120  O OD2 . ASP A 1 18  ? -3.017  -14.166 -6.313  1.00 99.93  -1 39  ASP A OD2 1 
ATOM   121  N N   . TYR A 1 19  ? -6.422  -11.163 -9.604  1.00 92.29  ?  40  TYR A N   1 
ATOM   122  C CA  . TYR A 1 19  ? -7.090  -11.060 -10.901 1.00 91.16  ?  40  TYR A CA  1 
ATOM   123  C C   . TYR A 1 19  ? -7.650  -9.664  -11.166 1.00 91.05  ?  40  TYR A C   1 
ATOM   124  O O   . TYR A 1 19  ? -7.661  -9.215  -12.312 1.00 86.99  ?  40  TYR A O   1 
ATOM   125  C CB  . TYR A 1 19  ? -8.209  -12.102 -11.030 1.00 89.84  ?  40  TYR A CB  1 
ATOM   126  C CG  . TYR A 1 19  ? -8.835  -12.147 -12.413 1.00 88.53  ?  40  TYR A CG  1 
ATOM   127  C CD1 . TYR A 1 19  ? -9.919  -11.340 -12.739 1.00 88.39  ?  40  TYR A CD1 1 
ATOM   128  C CD2 . TYR A 1 19  ? -8.323  -12.982 -13.401 1.00 85.72  ?  40  TYR A CD2 1 
ATOM   129  C CE1 . TYR A 1 19  ? -10.484 -11.373 -14.001 1.00 85.46  ?  40  TYR A CE1 1 
ATOM   130  C CE2 . TYR A 1 19  ? -8.882  -13.020 -14.666 1.00 81.45  ?  40  TYR A CE2 1 
ATOM   131  C CZ  . TYR A 1 19  ? -9.962  -12.214 -14.960 1.00 83.33  ?  40  TYR A CZ  1 
ATOM   132  O OH  . TYR A 1 19  ? -10.522 -12.250 -16.217 1.00 79.36  ?  40  TYR A OH  1 
ATOM   133  N N   . LEU A 1 20  ? -8.112  -8.974  -10.125 1.00 89.44  ?  41  LEU A N   1 
ATOM   134  C CA  . LEU A 1 20  ? -8.651  -7.627  -10.328 1.00 92.27  ?  41  LEU A CA  1 
ATOM   135  C C   . LEU A 1 20  ? -7.644  -6.595  -10.881 1.00 96.34  ?  41  LEU A C   1 
ATOM   136  O O   . LEU A 1 20  ? -8.037  -5.757  -11.697 1.00 94.45  ?  41  LEU A O   1 
ATOM   137  C CB  . LEU A 1 20  ? -9.258  -7.091  -9.029  1.00 89.22  ?  41  LEU A CB  1 
ATOM   138  N N   . PRO A 1 21  ? -6.358  -6.639  -10.453 1.00 91.69  ?  42  PRO A N   1 
ATOM   139  C CA  . PRO A 1 21  ? -5.454  -5.596  -10.957 1.00 95.21  ?  42  PRO A CA  1 
ATOM   140  C C   . PRO A 1 21  ? -5.303  -5.591  -12.472 1.00 98.89  ?  42  PRO A C   1 
ATOM   141  O O   . PRO A 1 21  ? -5.555  -4.567  -13.106 1.00 104.06 ?  42  PRO A O   1 
ATOM   142  C CB  . PRO A 1 21  ? -4.115  -5.939  -10.294 1.00 98.04  ?  42  PRO A CB  1 
ATOM   143  C CG  . PRO A 1 21  ? -4.474  -6.717  -9.097  1.00 97.53  ?  42  PRO A CG  1 
ATOM   144  C CD  . PRO A 1 21  ? -5.655  -7.524  -9.506  1.00 95.97  ?  42  PRO A CD  1 
ATOM   145  N N   . GLY A 1 22  ? -4.903  -6.723  -13.038 1.00 99.21  ?  43  GLY A N   1 
ATOM   146  C CA  . GLY A 1 22  ? -4.636  -6.808  -14.460 1.00 100.67 ?  43  GLY A CA  1 
ATOM   147  C C   . GLY A 1 22  ? -5.835  -6.522  -15.345 1.00 100.67 ?  43  GLY A C   1 
ATOM   148  O O   . GLY A 1 22  ? -5.686  -5.970  -16.435 1.00 103.18 ?  43  GLY A O   1 
ATOM   149  N N   . HIS A 1 23  ? -7.027  -6.876  -14.872 1.00 107.12 ?  44  HIS A N   1 
ATOM   150  C CA  . HIS A 1 23  ? -8.209  -6.860  -15.729 1.00 97.96  ?  44  HIS A CA  1 
ATOM   151  C C   . HIS A 1 23  ? -9.281  -5.836  -15.353 1.00 95.92  ?  44  HIS A C   1 
ATOM   152  O O   . HIS A 1 23  ? -10.330 -5.786  -15.992 1.00 87.87  ?  44  HIS A O   1 
ATOM   153  C CB  . HIS A 1 23  ? -8.845  -8.252  -15.760 1.00 90.80  ?  44  HIS A CB  1 
ATOM   154  C CG  . HIS A 1 23  ? -7.860  -9.365  -15.942 1.00 92.64  ?  44  HIS A CG  1 
ATOM   155  N ND1 . HIS A 1 23  ? -7.053  -9.821  -14.922 1.00 98.52  ?  44  HIS A ND1 1 
ATOM   156  C CD2 . HIS A 1 23  ? -7.546  -10.106 -17.030 1.00 93.06  ?  44  HIS A CD2 1 
ATOM   157  C CE1 . HIS A 1 23  ? -6.289  -10.801 -15.373 1.00 97.82  ?  44  HIS A CE1 1 
ATOM   158  N NE2 . HIS A 1 23  ? -6.568  -10.993 -16.650 1.00 97.61  ?  44  HIS A NE2 1 
ATOM   159  N N   . LEU A 1 24  ? -9.041  -5.024  -14.329 1.00 96.50  ?  45  LEU A N   1 
ATOM   160  C CA  . LEU A 1 24  ? -10.017 -3.994  -13.983 1.00 99.91  ?  45  LEU A CA  1 
ATOM   161  C C   . LEU A 1 24  ? -9.358  -2.690  -13.547 1.00 105.99 ?  45  LEU A C   1 
ATOM   162  O O   . LEU A 1 24  ? -8.373  -2.696  -12.809 1.00 105.18 ?  45  LEU A O   1 
ATOM   163  C CB  . LEU A 1 24  ? -10.957 -4.489  -12.882 1.00 100.26 ?  45  LEU A CB  1 
ATOM   164  C CG  . LEU A 1 24  ? -12.260 -3.694  -12.756 1.00 97.85  ?  45  LEU A CG  1 
ATOM   165  C CD1 . LEU A 1 24  ? -13.360 -4.346  -13.583 1.00 90.31  ?  45  LEU A CD1 1 
ATOM   166  C CD2 . LEU A 1 24  ? -12.689 -3.540  -11.303 1.00 100.09 ?  45  LEU A CD2 1 
ATOM   167  N N   . ASP A 1 25  ? -9.911  -1.575  -14.016 1.00 106.04 ?  46  ASP A N   1 
ATOM   168  C CA  . ASP A 1 25  ? -9.444  -0.254  -13.616 1.00 107.50 ?  46  ASP A CA  1 
ATOM   169  C C   . ASP A 1 25  ? -9.613  -0.076  -12.112 1.00 105.78 ?  46  ASP A C   1 
ATOM   170  O O   . ASP A 1 25  ? -10.656 -0.415  -11.555 1.00 91.93  ?  46  ASP A O   1 
ATOM   171  C CB  . ASP A 1 25  ? -10.202 0.841   -14.371 1.00 107.24 ?  46  ASP A CB  1 
ATOM   172  N N   . ALA A 1 26  ? -8.581  0.455   -11.461 1.00 104.69 ?  47  ALA A N   1 
ATOM   173  C CA  . ALA A 1 26  ? -8.592  0.632   -10.012 1.00 102.84 ?  47  ALA A CA  1 
ATOM   174  C C   . ALA A 1 26  ? -9.577  1.716   -9.587  1.00 97.73  ?  47  ALA A C   1 
ATOM   175  O O   . ALA A 1 26  ? -9.845  1.893   -8.399  1.00 91.17  ?  47  ALA A O   1 
ATOM   176  C CB  . ALA A 1 26  ? -7.197  0.959   -9.508  1.00 107.98 ?  47  ALA A CB  1 
ATOM   177  N N   . LYS A 1 27  ? -10.112 2.440   -10.565 1.00 99.74  ?  48  LYS A N   1 
ATOM   178  C CA  . LYS A 1 27  ? -11.186 3.388   -10.314 1.00 99.92  ?  48  LYS A CA  1 
ATOM   179  C C   . LYS A 1 27  ? -12.427 2.640   -9.839  1.00 94.74  ?  48  LYS A C   1 
ATOM   180  O O   . LYS A 1 27  ? -13.311 3.217   -9.205  1.00 94.42  ?  48  LYS A O   1 
ATOM   181  C CB  . LYS A 1 27  ? -11.499 4.200   -11.574 1.00 101.03 ?  48  LYS A CB  1 
ATOM   182  N N   . HIS A 1 28  ? -12.468 1.343   -10.135 1.00 102.90 ?  49  HIS A N   1 
ATOM   183  C CA  . HIS A 1 28  ? -13.631 0.509   -9.858  1.00 101.25 ?  49  HIS A CA  1 
ATOM   184  C C   . HIS A 1 28  ? -13.314 -0.726  -9.008  1.00 94.60  ?  49  HIS A C   1 
ATOM   185  O O   . HIS A 1 28  ? -14.148 -1.619  -8.891  1.00 89.18  ?  49  HIS A O   1 
ATOM   186  C CB  . HIS A 1 28  ? -14.261 0.046   -11.175 1.00 100.48 ?  49  HIS A CB  1 
ATOM   187  C CG  . HIS A 1 28  ? -14.745 1.163   -12.039 1.00 103.86 ?  49  HIS A CG  1 
ATOM   188  N ND1 . HIS A 1 28  ? -14.809 1.063   -13.420 1.00 103.15 ?  49  HIS A ND1 1 
ATOM   189  C CD2 . HIS A 1 28  ? -15.196 2.402   -11.741 1.00 108.35 ?  49  HIS A CD2 1 
ATOM   190  C CE1 . HIS A 1 28  ? -15.268 2.189   -13.920 1.00 108.64 ?  49  HIS A CE1 1 
ATOM   191  N NE2 . HIS A 1 28  ? -15.514 3.025   -12.920 1.00 115.30 ?  49  HIS A NE2 1 
ATOM   192  N N   . HIS A 1 29  ? -12.121 -0.791  -8.423  1.00 93.73  ?  50  HIS A N   1 
ATOM   193  C CA  . HIS A 1 29  ? -11.675 -2.029  -7.779  1.00 90.14  ?  50  HIS A CA  1 
ATOM   194  C C   . HIS A 1 29  ? -12.192 -2.511  -6.426  1.00 88.81  ?  50  HIS A C   1 
ATOM   195  O O   . HIS A 1 29  ? -12.644 -3.648  -6.303  1.00 83.32  ?  50  HIS A O   1 
ATOM   196  C CB  . HIS A 1 29  ? -10.175 -1.969  -7.503  1.00 95.02  ?  50  HIS A CB  1 
ATOM   197  C CG  . HIS A 1 29  ? -9.346  -2.566  -8.594  1.00 98.01  ?  50  HIS A CG  1 
ATOM   198  N ND1 . HIS A 1 29  ? -8.093  -3.097  -8.375  1.00 101.61 ?  50  HIS A ND1 1 
ATOM   199  C CD2 . HIS A 1 29  ? -9.598  -2.729  -9.914  1.00 97.43  ?  50  HIS A CD2 1 
ATOM   200  C CE1 . HIS A 1 29  ? -7.607  -3.553  -9.514  1.00 104.89 ?  50  HIS A CE1 1 
ATOM   201  N NE2 . HIS A 1 29  ? -8.500  -3.343  -10.464 1.00 101.89 ?  50  HIS A NE2 1 
ATOM   202  N N   . LYS A 1 30  ? -12.116 -1.652  -5.413  1.00 90.95  ?  51  LYS A N   1 
ATOM   203  C CA  . LYS A 1 30  ? -12.745 -1.914  -4.119  1.00 90.67  ?  51  LYS A CA  1 
ATOM   204  C C   . LYS A 1 30  ? -14.260 -1.729  -4.179  1.00 91.60  ?  51  LYS A C   1 
ATOM   205  O O   . LYS A 1 30  ? -14.998 -2.283  -3.363  1.00 90.19  ?  51  LYS A O   1 
ATOM   206  C CB  . LYS A 1 30  ? -12.150 -1.004  -3.042  1.00 92.69  ?  51  LYS A CB  1 
ATOM   207  N N   . ALA A 1 31  ? -14.709 -0.951  -5.159  1.00 91.32  ?  52  ALA A N   1 
ATOM   208  C CA  . ALA A 1 31  ? -16.124 -0.645  -5.333  1.00 97.90  ?  52  ALA A CA  1 
ATOM   209  C C   . ALA A 1 31  ? -16.891 -1.812  -5.940  1.00 95.23  ?  52  ALA A C   1 
ATOM   210  O O   . ALA A 1 31  ? -18.121 -1.840  -5.904  1.00 92.93  ?  52  ALA A O   1 
ATOM   211  C CB  . ALA A 1 31  ? -16.287 0.595   -6.199  1.00 105.34 ?  52  ALA A CB  1 
ATOM   212  N N   . MET A 1 32  ? -16.168 -2.771  -6.507  1.00 101.06 ?  53  MET A N   1 
ATOM   213  C CA  . MET A 1 32  ? -16.823 -3.910  -7.134  1.00 96.67  ?  53  MET A CA  1 
ATOM   214  C C   . MET A 1 32  ? -16.859 -5.108  -6.196  1.00 91.29  ?  53  MET A C   1 
ATOM   215  O O   . MET A 1 32  ? -17.862 -5.816  -6.128  1.00 90.05  ?  53  MET A O   1 
ATOM   216  C CB  . MET A 1 32  ? -16.131 -4.290  -8.441  1.00 94.04  ?  53  MET A CB  1 
ATOM   217  C CG  . MET A 1 32  ? -16.744 -5.514  -9.098  1.00 91.57  ?  53  MET A CG  1 
ATOM   218  S SD  . MET A 1 32  ? -16.017 -5.947  -10.687 1.00 100.80 ?  53  MET A SD  1 
ATOM   219  C CE  . MET A 1 32  ? -14.429 -6.589  -10.170 1.00 94.30  ?  53  MET A CE  1 
ATOM   220  N N   . MET A 1 33  ? -15.767 -5.324  -5.468  1.00 85.56  ?  54  MET A N   1 
ATOM   221  C CA  . MET A 1 33  ? -15.690 -6.424  -4.510  1.00 84.92  ?  54  MET A CA  1 
ATOM   222  C C   . MET A 1 33  ? -16.792 -6.353  -3.455  1.00 87.07  ?  54  MET A C   1 
ATOM   223  O O   . MET A 1 33  ? -17.171 -7.372  -2.878  1.00 89.07  ?  54  MET A O   1 
ATOM   224  C CB  . MET A 1 33  ? -14.318 -6.445  -3.830  1.00 85.56  ?  54  MET A CB  1 
ATOM   225  C CG  . MET A 1 33  ? -13.165 -6.757  -4.767  1.00 87.49  ?  54  MET A CG  1 
ATOM   226  S SD  . MET A 1 33  ? -13.305 -8.390  -5.523  1.00 90.44  ?  54  MET A SD  1 
ATOM   227  C CE  . MET A 1 33  ? -13.580 -9.419  -4.081  1.00 91.76  ?  54  MET A CE  1 
ATOM   228  N N   . GLU A 1 34  ? -17.301 -5.151  -3.204  1.00 87.47  ?  55  GLU A N   1 
ATOM   229  C CA  . GLU A 1 34  ? -18.447 -4.977  -2.320  1.00 88.89  ?  55  GLU A CA  1 
ATOM   230  C C   . GLU A 1 34  ? -19.661 -5.695  -2.900  1.00 92.05  ?  55  GLU A C   1 
ATOM   231  O O   . GLU A 1 34  ? -20.211 -6.619  -2.287  1.00 93.48  ?  55  GLU A O   1 
ATOM   232  C CB  . GLU A 1 34  ? -18.754 -3.492  -2.116  1.00 91.65  ?  55  GLU A CB  1 
ATOM   233  N N   . ARG A 1 35  ? -20.057 -5.259  -4.094  1.00 88.82  ?  56  ARG A N   1 
ATOM   234  C CA  . ARG A 1 35  ? -21.174 -5.842  -4.827  1.00 89.29  ?  56  ARG A CA  1 
ATOM   235  C C   . ARG A 1 35  ? -21.024 -7.352  -4.955  1.00 86.31  ?  56  ARG A C   1 
ATOM   236  O O   . ARG A 1 35  ? -21.980 -8.100  -4.751  1.00 85.50  ?  56  ARG A O   1 
ATOM   237  C CB  . ARG A 1 35  ? -21.281 -5.211  -6.217  1.00 88.65  ?  56  ARG A CB  1 
ATOM   238  C CG  . ARG A 1 35  ? -22.346 -4.133  -6.342  1.00 94.51  ?  56  ARG A CG  1 
ATOM   239  C CD  . ARG A 1 35  ? -22.336 -3.193  -5.146  1.00 93.99  ?  56  ARG A CD  1 
ATOM   240  N N   . VAL A 1 36  ? -19.813 -7.792  -5.287  1.00 85.59  ?  57  VAL A N   1 
ATOM   241  C CA  . VAL A 1 36  ? -19.531 -9.215  -5.441  1.00 83.19  ?  57  VAL A CA  1 
ATOM   242  C C   . VAL A 1 36  ? -19.727 -9.991  -4.142  1.00 82.69  ?  57  VAL A C   1 
ATOM   243  O O   . VAL A 1 36  ? -20.548 -10.899 -4.083  1.00 87.80  ?  57  VAL A O   1 
ATOM   244  C CB  . VAL A 1 36  ? -18.097 -9.463  -5.940  1.00 80.56  ?  57  VAL A CB  1 
ATOM   245  C CG1 . VAL A 1 36  ? -17.851 -10.955 -6.090  1.00 74.40  ?  57  VAL A CG1 1 
ATOM   246  C CG2 . VAL A 1 36  ? -17.867 -8.761  -7.267  1.00 82.09  ?  57  VAL A CG2 1 
ATOM   247  N N   . GLU A 1 37  ? -18.966 -9.637  -3.109  1.00 89.24  ?  58  GLU A N   1 
ATOM   248  C CA  . GLU A 1 37  ? -19.022 -10.350 -1.832  1.00 84.26  ?  58  GLU A CA  1 
ATOM   249  C C   . GLU A 1 37  ? -20.414 -10.325 -1.207  1.00 85.19  ?  58  GLU A C   1 
ATOM   250  O O   . GLU A 1 37  ? -20.807 -11.264 -0.505  1.00 83.12  ?  58  GLU A O   1 
ATOM   251  C CB  . GLU A 1 37  ? -18.001 -9.777  -0.844  1.00 86.40  ?  58  GLU A CB  1 
ATOM   252  C CG  . GLU A 1 37  ? -16.663 -10.500 -0.851  1.00 86.95  ?  58  GLU A CG  1 
ATOM   253  C CD  . GLU A 1 37  ? -15.589 -9.769  -0.069  1.00 94.24  ?  58  GLU A CD  1 
ATOM   254  O OE1 . GLU A 1 37  ? -15.908 -9.196  0.996   1.00 99.39  ?  58  GLU A OE1 1 
ATOM   255  O OE2 . GLU A 1 37  ? -14.419 -9.785  -0.508  1.00 97.61  ?  58  GLU A OE2 1 
ATOM   256  N N   . ASN A 1 38  ? -21.161 -9.257  -1.465  1.00 83.16  ?  59  ASN A N   1 
ATOM   257  C CA  . ASN A 1 38  ? -22.548 -9.215  -1.027  1.00 84.54  ?  59  ASN A CA  1 
ATOM   258  C C   . ASN A 1 38  ? -23.465 -10.030 -1.937  1.00 83.79  ?  59  ASN A C   1 
ATOM   259  O O   . ASN A 1 38  ? -24.557 -10.421 -1.529  1.00 88.34  ?  59  ASN A O   1 
ATOM   260  C CB  . ASN A 1 38  ? -23.046 -7.771  -0.923  1.00 92.18  ?  59  ASN A CB  1 
ATOM   261  C CG  . ASN A 1 38  ? -22.181 -6.920  -0.014  1.00 96.86  ?  59  ASN A CG  1 
ATOM   262  O OD1 . ASN A 1 38  ? -21.200 -7.400  0.556   1.00 97.50  ?  59  ASN A OD1 1 
ATOM   263  N ND2 . ASN A 1 38  ? -22.557 -5.655  0.149   1.00 103.61 ?  59  ASN A ND2 1 
ATOM   264  N N   . ALA A 1 39  ? -23.023 -10.298 -3.162  1.00 84.35  ?  60  ALA A N   1 
ATOM   265  C CA  . ALA A 1 39  ? -23.776 -11.186 -4.044  1.00 78.99  ?  60  ALA A CA  1 
ATOM   266  C C   . ALA A 1 39  ? -23.556 -12.643 -3.639  1.00 73.71  ?  60  ALA A C   1 
ATOM   267  O O   . ALA A 1 39  ? -24.442 -13.483 -3.794  1.00 68.56  ?  60  ALA A O   1 
ATOM   268  C CB  . ALA A 1 39  ? -23.380 -10.968 -5.494  1.00 80.08  ?  60  ALA A CB  1 
ATOM   269  N N   . VAL A 1 40  ? -22.366 -12.931 -3.120  1.00 74.74  ?  61  VAL A N   1 
ATOM   270  C CA  . VAL A 1 40  ? -22.044 -14.254 -2.600  1.00 69.85  ?  61  VAL A CA  1 
ATOM   271  C C   . VAL A 1 40  ? -22.758 -14.472 -1.272  1.00 70.85  ?  61  VAL A C   1 
ATOM   272  O O   . VAL A 1 40  ? -23.290 -15.550 -1.006  1.00 71.62  ?  61  VAL A O   1 
ATOM   273  C CB  . VAL A 1 40  ? -20.524 -14.436 -2.402  1.00 67.85  ?  61  VAL A CB  1 
ATOM   274  C CG1 . VAL A 1 40  ? -20.216 -15.813 -1.833  1.00 64.54  ?  61  VAL A CG1 1 
ATOM   275  C CG2 . VAL A 1 40  ? -19.788 -14.226 -3.715  1.00 67.53  ?  61  VAL A CG2 1 
ATOM   276  N N   . LYS A 1 41  ? -22.776 -13.428 -0.448  1.00 73.48  ?  62  LYS A N   1 
ATOM   277  C CA  . LYS A 1 41  ? -23.393 -13.503 0.870   1.00 72.12  ?  62  LYS A CA  1 
ATOM   278  C C   . LYS A 1 41  ? -24.931 -13.537 0.808   1.00 73.45  ?  62  LYS A C   1 
ATOM   279  O O   . LYS A 1 41  ? -25.597 -13.629 1.844   1.00 79.97  ?  62  LYS A O   1 
ATOM   280  C CB  . LYS A 1 41  ? -22.919 -12.323 1.727   1.00 69.67  ?  62  LYS A CB  1 
ATOM   281  N N   . ASP A 1 42  ? -25.477 -13.487 -0.411  1.00 70.80  ?  63  ASP A N   1 
ATOM   282  C CA  . ASP A 1 42  ? -26.921 -13.389 -0.672  1.00 79.05  ?  63  ASP A CA  1 
ATOM   283  C C   . ASP A 1 42  ? -27.425 -14.795 -1.011  1.00 74.15  ?  63  ASP A C   1 
ATOM   284  O O   . ASP A 1 42  ? -28.637 -15.055 -1.017  1.00 79.20  ?  63  ASP A O   1 
ATOM   285  C CB  . ASP A 1 42  ? -27.200 -12.409 -1.834  1.00 89.39  ?  63  ASP A CB  1 
ATOM   286  C CG  . ASP A 1 42  ? -28.673 -12.406 -2.315  1.00 99.89  ?  63  ASP A CG  1 
ATOM   287  O OD1 . ASP A 1 42  ? -29.563 -12.572 -1.469  1.00 110.11 ?  63  ASP A OD1 1 
ATOM   288  O OD2 . ASP A 1 42  ? -28.933 -12.232 -3.535  1.00 99.89  ?  63  ASP A OD2 1 
ATOM   289  N N   . PHE A 1 43  ? -26.479 -15.700 -1.293  1.00 71.65  ?  64  PHE A N   1 
ATOM   290  C CA  . PHE A 1 43  ? -26.778 -17.128 -1.477  1.00 73.27  ?  64  PHE A CA  1 
ATOM   291  C C   . PHE A 1 43  ? -27.568 -17.628 -0.276  1.00 77.55  ?  64  PHE A C   1 
ATOM   292  O O   . PHE A 1 43  ? -28.435 -18.492 -0.397  1.00 80.70  ?  64  PHE A O   1 
ATOM   293  C CB  . PHE A 1 43  ? -25.499 -17.974 -1.655  1.00 68.68  ?  64  PHE A CB  1 
ATOM   294  C CG  . PHE A 1 43  ? -24.925 -17.962 -3.060  1.00 63.87  ?  64  PHE A CG  1 
ATOM   295  C CD1 . PHE A 1 43  ? -24.881 -16.799 -3.802  1.00 63.92  ?  64  PHE A CD1 1 
ATOM   296  C CD2 . PHE A 1 43  ? -24.455 -19.137 -3.643  1.00 60.98  ?  64  PHE A CD2 1 
ATOM   297  C CE1 . PHE A 1 43  ? -24.362 -16.792 -5.092  1.00 59.02  ?  64  PHE A CE1 1 
ATOM   298  C CE2 . PHE A 1 43  ? -23.939 -19.138 -4.932  1.00 60.00  ?  64  PHE A CE2 1 
ATOM   299  C CZ  . PHE A 1 43  ? -23.893 -17.963 -5.657  1.00 58.09  ?  64  PHE A CZ  1 
ATOM   300  N N   . GLN A 1 44  ? -27.245 -17.065 0.884   1.00 74.25  ?  65  GLN A N   1 
ATOM   301  C CA  . GLN A 1 44  ? -28.009 -17.273 2.105   1.00 77.27  ?  65  GLN A CA  1 
ATOM   302  C C   . GLN A 1 44  ? -29.497 -16.978 1.919   1.00 81.07  ?  65  GLN A C   1 
ATOM   303  O O   . GLN A 1 44  ? -30.347 -17.749 2.361   1.00 90.47  ?  65  GLN A O   1 
ATOM   304  C CB  . GLN A 1 44  ? -27.447 -16.397 3.226   1.00 80.81  ?  65  GLN A CB  1 
ATOM   305  C CG  . GLN A 1 44  ? -28.334 -16.320 4.457   1.00 87.82  ?  65  GLN A CG  1 
ATOM   306  C CD  . GLN A 1 44  ? -28.475 -14.907 4.989   1.00 93.37  ?  65  GLN A CD  1 
ATOM   307  O OE1 . GLN A 1 44  ? -27.501 -14.156 5.060   1.00 88.76  ?  65  GLN A OE1 1 
ATOM   308  N NE2 . GLN A 1 44  ? -29.692 -14.539 5.374   1.00 99.28  ?  65  GLN A NE2 1 
ATOM   309  N N   . GLU A 1 45  ? -29.810 -15.861 1.267   1.00 82.09  ?  66  GLU A N   1 
ATOM   310  C CA  . GLU A 1 45  ? -31.202 -15.457 1.088   1.00 83.35  ?  66  GLU A CA  1 
ATOM   311  C C   . GLU A 1 45  ? -31.807 -16.038 -0.185  1.00 84.07  ?  66  GLU A C   1 
ATOM   312  O O   . GLU A 1 45  ? -31.754 -15.414 -1.245  1.00 81.62  ?  66  GLU A O   1 
ATOM   313  C CB  . GLU A 1 45  ? -31.319 -13.930 1.067   1.00 81.20  ?  66  GLU A CB  1 
ATOM   314  N N   . LEU A 1 46  ? -32.380 -17.233 -0.079  1.00 85.69  ?  67  LEU A N   1 
ATOM   315  C CA  . LEU A 1 46  ? -33.069 -17.841 -1.211  1.00 88.80  ?  67  LEU A CA  1 
ATOM   316  C C   . LEU A 1 46  ? -34.423 -18.407 -0.802  1.00 95.16  ?  67  LEU A C   1 
ATOM   317  O O   . LEU A 1 46  ? -34.844 -18.289 0.350   1.00 97.58  ?  67  LEU A O   1 
ATOM   318  C CB  . LEU A 1 46  ? -32.218 -18.949 -1.848  1.00 83.43  ?  67  LEU A CB  1 
ATOM   319  C CG  . LEU A 1 46  ? -31.637 -20.078 -0.991  1.00 84.94  ?  67  LEU A CG  1 
ATOM   320  C CD1 . LEU A 1 46  ? -32.641 -21.207 -0.822  1.00 91.99  ?  67  LEU A CD1 1 
ATOM   321  C CD2 . LEU A 1 46  ? -30.364 -20.612 -1.623  1.00 83.39  ?  67  LEU A CD2 1 
ATOM   322  N N   . SER A 1 47  ? -35.090 -19.028 -1.769  1.00 102.19 ?  68  SER A N   1 
ATOM   323  C CA  . SER A 1 47  ? -36.373 -19.683 -1.557  1.00 107.35 ?  68  SER A CA  1 
ATOM   324  C C   . SER A 1 47  ? -36.729 -20.494 -2.792  1.00 110.71 ?  68  SER A C   1 
ATOM   325  O O   . SER A 1 47  ? -36.402 -20.107 -3.914  1.00 114.84 ?  68  SER A O   1 
ATOM   326  C CB  . SER A 1 47  ? -37.473 -18.662 -1.256  1.00 101.71 ?  68  SER A CB  1 
ATOM   327  N N   . LEU A 1 48  ? -37.389 -21.625 -2.583  1.00 113.38 ?  69  LEU A N   1 
ATOM   328  C CA  . LEU A 1 48  ? -37.866 -22.433 -3.691  1.00 119.29 ?  69  LEU A CA  1 
ATOM   329  C C   . LEU A 1 48  ? -39.213 -23.029 -3.330  1.00 124.35 ?  69  LEU A C   1 
ATOM   330  O O   . LEU A 1 48  ? -39.391 -23.549 -2.229  1.00 116.65 ?  69  LEU A O   1 
ATOM   331  C CB  . LEU A 1 48  ? -36.869 -23.538 -4.037  1.00 117.21 ?  69  LEU A CB  1 
ATOM   332  C CG  . LEU A 1 48  ? -36.623 -23.796 -5.526  1.00 115.33 ?  69  LEU A CG  1 
ATOM   333  C CD1 . LEU A 1 48  ? -35.789 -22.678 -6.140  1.00 110.39 ?  69  LEU A CD1 1 
ATOM   334  C CD2 . LEU A 1 48  ? -35.951 -25.144 -5.719  1.00 112.01 ?  69  LEU A CD2 1 
ATOM   335  N N   . ASN A 1 49  ? -40.161 -22.946 -4.256  1.00 119.38 ?  70  ASN A N   1 
ATOM   336  C CA  . ASN A 1 49  ? -41.492 -23.491 -4.027  1.00 126.51 ?  70  ASN A CA  1 
ATOM   337  C C   . ASN A 1 49  ? -41.449 -25.001 -3.803  1.00 131.32 ?  70  ASN A C   1 
ATOM   338  O O   . ASN A 1 49  ? -40.390 -25.623 -3.920  1.00 135.87 ?  70  ASN A O   1 
ATOM   339  C CB  . ASN A 1 49  ? -42.415 -23.153 -5.199  1.00 92.74  ?  70  ASN A CB  1 
ATOM   340  N N   . GLU A 1 50  ? -42.607 -25.568 -3.467  1.00 135.52 ?  71  GLU A N   1 
ATOM   341  C CA  . GLU A 1 50  ? -42.764 -26.986 -3.121  1.00 131.40 ?  71  GLU A CA  1 
ATOM   342  C C   . GLU A 1 50  ? -42.125 -27.325 -1.771  1.00 128.19 ?  71  GLU A C   1 
ATOM   343  O O   . GLU A 1 50  ? -42.105 -28.488 -1.366  1.00 124.47 ?  71  GLU A O   1 
ATOM   344  C CB  . GLU A 1 50  ? -42.191 -27.894 -4.217  1.00 125.23 ?  71  GLU A CB  1 
ATOM   345  N N   . ASP A 1 51  ? -41.620 -26.304 -1.080  1.00 133.34 ?  72  ASP A N   1 
ATOM   346  C CA  . ASP A 1 51  ? -41.059 -26.457 0.262   1.00 127.08 ?  72  ASP A CA  1 
ATOM   347  C C   . ASP A 1 51  ? -40.747 -25.097 0.877   1.00 119.79 ?  72  ASP A C   1 
ATOM   348  O O   . ASP A 1 51  ? -40.686 -24.088 0.175   1.00 111.21 ?  72  ASP A O   1 
ATOM   349  C CB  . ASP A 1 51  ? -39.788 -27.311 0.234   1.00 124.50 ?  72  ASP A CB  1 
ATOM   350  N N   . ALA A 1 52  ? -40.553 -25.074 2.191   1.00 111.38 ?  73  ALA A N   1 
ATOM   351  C CA  . ALA A 1 52  ? -40.074 -23.873 2.862   1.00 108.63 ?  73  ALA A CA  1 
ATOM   352  C C   . ALA A 1 52  ? -38.554 -23.828 2.778   1.00 108.38 ?  73  ALA A C   1 
ATOM   353  O O   . ALA A 1 52  ? -37.946 -24.593 2.029   1.00 112.06 ?  73  ALA A O   1 
ATOM   354  C CB  . ALA A 1 52  ? -40.537 -23.839 4.310   1.00 110.46 ?  73  ALA A CB  1 
ATOM   355  N N   . TYR A 1 53  ? -37.941 -22.936 3.546   1.00 106.03 ?  74  TYR A N   1 
ATOM   356  C CA  . TYR A 1 53  ? -36.489 -22.819 3.552   1.00 100.51 ?  74  TYR A CA  1 
ATOM   357  C C   . TYR A 1 53  ? -35.957 -22.845 4.978   1.00 99.45  ?  74  TYR A C   1 
ATOM   358  O O   . TYR A 1 53  ? -36.041 -21.851 5.701   1.00 100.80 ?  74  TYR A O   1 
ATOM   359  C CB  . TYR A 1 53  ? -36.052 -21.542 2.831   1.00 96.85  ?  74  TYR A CB  1 
ATOM   360  C CG  . TYR A 1 53  ? -34.575 -21.231 2.937   1.00 90.50  ?  74  TYR A CG  1 
ATOM   361  C CD1 . TYR A 1 53  ? -33.618 -22.148 2.521   1.00 90.08  ?  74  TYR A CD1 1 
ATOM   362  C CD2 . TYR A 1 53  ? -34.139 -20.008 3.429   1.00 82.89  ?  74  TYR A CD2 1 
ATOM   363  C CE1 . TYR A 1 53  ? -32.267 -21.862 2.611   1.00 83.08  ?  74  TYR A CE1 1 
ATOM   364  C CE2 . TYR A 1 53  ? -32.792 -19.712 3.519   1.00 78.72  ?  74  TYR A CE2 1 
ATOM   365  C CZ  . TYR A 1 53  ? -31.860 -20.641 3.107   1.00 77.76  ?  74  TYR A CZ  1 
ATOM   366  O OH  . TYR A 1 53  ? -30.519 -20.350 3.199   1.00 71.94  ?  74  TYR A OH  1 
ATOM   367  N N   . MET A 1 54  ? -35.414 -23.993 5.374   1.00 89.56  ?  75  MET A N   1 
ATOM   368  C CA  . MET A 1 54  ? -34.888 -24.183 6.721   1.00 84.61  ?  75  MET A CA  1 
ATOM   369  C C   . MET A 1 54  ? -33.787 -23.182 7.054   1.00 78.25  ?  75  MET A C   1 
ATOM   370  O O   . MET A 1 54  ? -33.598 -22.819 8.214   1.00 78.36  ?  75  MET A O   1 
ATOM   371  C CB  . MET A 1 54  ? -34.356 -25.609 6.889   1.00 88.81  ?  75  MET A CB  1 
ATOM   372  C CG  . MET A 1 54  ? -35.411 -26.697 6.768   1.00 97.34  ?  75  MET A CG  1 
ATOM   373  S SD  . MET A 1 54  ? -36.026 -27.225 8.378   1.00 104.77 ?  75  MET A SD  1 
ATOM   374  C CE  . MET A 1 54  ? -37.298 -28.392 7.898   1.00 113.23 ?  75  MET A CE  1 
ATOM   375  N N   . GLY A 1 55  ? -33.068 -22.732 6.031   1.00 77.28  ?  76  GLY A N   1 
ATOM   376  C CA  . GLY A 1 55  ? -31.953 -21.827 6.235   1.00 75.31  ?  76  GLY A CA  1 
ATOM   377  C C   . GLY A 1 55  ? -30.807 -22.565 6.889   1.00 73.47  ?  76  GLY A C   1 
ATOM   378  O O   . GLY A 1 55  ? -30.085 -22.015 7.721   1.00 72.87  ?  76  GLY A O   1 
ATOM   379  N N   . VAL A 1 56  ? -30.644 -23.825 6.502   1.00 70.12  ?  77  VAL A N   1 
ATOM   380  C CA  . VAL A 1 56  ? -29.656 -24.695 7.118   1.00 68.18  ?  77  VAL A CA  1 
ATOM   381  C C   . VAL A 1 56  ? -29.145 -25.696 6.081   1.00 66.47  ?  77  VAL A C   1 
ATOM   382  O O   . VAL A 1 56  ? -29.898 -26.129 5.206   1.00 67.40  ?  77  VAL A O   1 
ATOM   383  C CB  . VAL A 1 56  ? -30.256 -25.425 8.351   1.00 70.25  ?  77  VAL A CB  1 
ATOM   384  C CG1 . VAL A 1 56  ? -31.005 -26.695 7.947   1.00 71.49  ?  77  VAL A CG1 1 
ATOM   385  C CG2 . VAL A 1 56  ? -29.179 -25.727 9.366   1.00 69.66  ?  77  VAL A CG2 1 
ATOM   386  N N   . VAL A 1 57  ? -27.858 -26.032 6.138   1.00 64.09  ?  78  VAL A N   1 
ATOM   387  C CA  . VAL A 1 57  ? -27.329 -27.049 5.223   1.00 62.63  ?  78  VAL A CA  1 
ATOM   388  C C   . VAL A 1 57  ? -26.399 -28.019 5.937   1.00 61.36  ?  78  VAL A C   1 
ATOM   389  O O   . VAL A 1 57  ? -26.249 -27.958 7.149   1.00 61.75  ?  78  VAL A O   1 
ATOM   390  C CB  . VAL A 1 57  ? -26.570 -26.422 4.026   1.00 60.71  ?  78  VAL A CB  1 
ATOM   391  C CG1 . VAL A 1 57  ? -27.519 -25.640 3.127   1.00 61.96  ?  78  VAL A CG1 1 
ATOM   392  C CG2 . VAL A 1 57  ? -25.431 -25.539 4.512   1.00 59.04  ?  78  VAL A CG2 1 
ATOM   393  N N   . ASP A 1 58  ? -25.794 -28.932 5.186   1.00 60.00  ?  79  ASP A N   1 
ATOM   394  C CA  . ASP A 1 58  ? -24.760 -29.794 5.745   1.00 58.52  ?  79  ASP A CA  1 
ATOM   395  C C   . ASP A 1 58  ? -23.460 -29.564 4.986   1.00 55.98  ?  79  ASP A C   1 
ATOM   396  O O   . ASP A 1 58  ? -23.462 -28.930 3.930   1.00 55.58  ?  79  ASP A O   1 
ATOM   397  C CB  . ASP A 1 58  ? -25.176 -31.270 5.695   1.00 59.50  ?  79  ASP A CB  1 
ATOM   398  C CG  . ASP A 1 58  ? -25.472 -31.754 4.287   1.00 59.73  ?  79  ASP A CG  1 
ATOM   399  O OD1 . ASP A 1 58  ? -25.098 -31.058 3.322   1.00 61.55  -1 79  ASP A OD1 1 
ATOM   400  O OD2 . ASP A 1 58  ? -26.080 -32.837 4.148   1.00 61.12  ?  79  ASP A OD2 1 
ATOM   401  N N   . GLU A 1 59  ? -22.355 -30.060 5.536   1.00 60.92  ?  80  GLU A N   1 
ATOM   402  C CA  . GLU A 1 59  ? -21.049 -29.919 4.902   1.00 60.37  ?  80  GLU A CA  1 
ATOM   403  C C   . GLU A 1 59  ? -21.086 -30.449 3.474   1.00 59.25  ?  80  GLU A C   1 
ATOM   404  O O   . GLU A 1 59  ? -20.585 -29.809 2.549   1.00 55.80  ?  80  GLU A O   1 
ATOM   405  C CB  . GLU A 1 59  ? -19.976 -30.654 5.708   1.00 63.70  ?  80  GLU A CB  1 
ATOM   406  C CG  . GLU A 1 59  ? -18.556 -30.410 5.222   1.00 67.86  ?  80  GLU A CG  1 
ATOM   407  C CD  . GLU A 1 59  ? -18.072 -29.001 5.510   1.00 69.23  ?  80  GLU A CD  1 
ATOM   408  O OE1 . GLU A 1 59  ? -18.417 -28.460 6.582   1.00 71.89  ?  80  GLU A OE1 1 
ATOM   409  O OE2 . GLU A 1 59  ? -17.349 -28.434 4.663   1.00 75.27  -1 80  GLU A OE2 1 
ATOM   410  N N   . ALA A 1 60  ? -21.708 -31.612 3.311   1.00 55.89  ?  81  ALA A N   1 
ATOM   411  C CA  . ALA A 1 60  ? -21.834 -32.261 2.013   1.00 58.40  ?  81  ALA A CA  1 
ATOM   412  C C   . ALA A 1 60  ? -22.482 -31.354 0.971   1.00 55.33  ?  81  ALA A C   1 
ATOM   413  O O   . ALA A 1 60  ? -22.134 -31.412 -0.203  1.00 56.43  ?  81  ALA A O   1 
ATOM   414  C CB  . ALA A 1 60  ? -22.628 -33.551 2.150   1.00 62.22  ?  81  ALA A CB  1 
ATOM   415  N N   . THR A 1 61  ? -23.418 -30.515 1.407   1.00 53.12  ?  82  THR A N   1 
ATOM   416  C CA  . THR A 1 61  ? -24.129 -29.620 0.498   1.00 53.96  ?  82  THR A CA  1 
ATOM   417  C C   . THR A 1 61  ? -23.363 -28.315 0.296   1.00 51.45  ?  82  THR A C   1 
ATOM   418  O O   . THR A 1 61  ? -23.377 -27.738 -0.792  1.00 51.95  ?  82  THR A O   1 
ATOM   419  C CB  . THR A 1 61  ? -25.546 -29.304 1.016   1.00 55.74  ?  82  THR A CB  1 
ATOM   420  O OG1 . THR A 1 61  ? -26.241 -30.529 1.283   1.00 61.52  ?  82  THR A OG1 1 
ATOM   421  C CG2 . THR A 1 61  ? -26.331 -28.501 -0.010  1.00 56.40  ?  82  THR A CG2 1 
ATOM   422  N N   . LEU A 1 62  ? -22.695 -27.854 1.349   1.00 55.67  ?  83  LEU A N   1 
ATOM   423  C CA  . LEU A 1 62  ? -21.890 -26.638 1.277   1.00 56.43  ?  83  LEU A CA  1 
ATOM   424  C C   . LEU A 1 62  ? -20.736 -26.817 0.295   1.00 56.88  ?  83  LEU A C   1 
ATOM   425  O O   . LEU A 1 62  ? -20.397 -25.902 -0.464  1.00 56.27  ?  83  LEU A O   1 
ATOM   426  C CB  . LEU A 1 62  ? -21.354 -26.266 2.663   1.00 57.51  ?  83  LEU A CB  1 
ATOM   427  C CG  . LEU A 1 62  ? -20.451 -25.034 2.763   1.00 55.52  ?  83  LEU A CG  1 
ATOM   428  C CD1 . LEU A 1 62  ? -21.278 -23.759 2.757   1.00 56.07  ?  83  LEU A CD1 1 
ATOM   429  C CD2 . LEU A 1 62  ? -19.579 -25.100 4.007   1.00 54.19  ?  83  LEU A CD2 1 
ATOM   430  N N   . GLN A 1 63  ? -20.146 -28.009 0.309   1.00 54.13  ?  84  GLN A N   1 
ATOM   431  C CA  . GLN A 1 63  ? -19.018 -28.314 -0.562  1.00 51.33  ?  84  GLN A CA  1 
ATOM   432  C C   . GLN A 1 63  ? -19.421 -28.343 -2.035  1.00 52.97  ?  84  GLN A C   1 
ATOM   433  O O   . GLN A 1 63  ? -18.631 -27.964 -2.897  1.00 54.26  ?  84  GLN A O   1 
ATOM   434  C CB  . GLN A 1 63  ? -18.378 -29.646 -0.166  1.00 52.52  ?  84  GLN A CB  1 
ATOM   435  C CG  . GLN A 1 63  ? -17.793 -29.659 1.239   1.00 51.75  ?  84  GLN A CG  1 
ATOM   436  C CD  . GLN A 1 63  ? -16.602 -28.734 1.395   1.00 52.96  ?  84  GLN A CD  1 
ATOM   437  O OE1 . GLN A 1 63  ? -15.989 -28.316 0.413   1.00 54.05  ?  84  GLN A OE1 1 
ATOM   438  N NE2 . GLN A 1 63  ? -16.271 -28.405 2.638   1.00 54.42  ?  84  GLN A NE2 1 
ATOM   439  N N   . LYS A 1 64  ? -20.641 -28.791 -2.328  1.00 48.14  ?  85  LYS A N   1 
ATOM   440  C CA  . LYS A 1 64  ? -21.128 -28.739 -3.704  1.00 51.65  ?  85  LYS A CA  1 
ATOM   441  C C   . LYS A 1 64  ? -21.288 -27.305 -4.172  1.00 51.02  ?  85  LYS A C   1 
ATOM   442  O O   . LYS A 1 64  ? -20.826 -26.953 -5.249  1.00 55.27  ?  85  LYS A O   1 
ATOM   443  C CB  . LYS A 1 64  ? -22.461 -29.469 -3.875  1.00 56.47  ?  85  LYS A CB  1 
ATOM   444  C CG  . LYS A 1 64  ? -22.593 -30.776 -3.142  1.00 58.44  ?  85  LYS A CG  1 
ATOM   445  C CD  . LYS A 1 64  ? -23.770 -31.555 -3.700  1.00 60.03  ?  85  LYS A CD  1 
ATOM   446  C CE  . LYS A 1 64  ? -23.615 -31.739 -5.205  1.00 66.00  ?  85  LYS A CE  1 
ATOM   447  N NZ  . LYS A 1 64  ? -24.867 -32.203 -5.860  1.00 74.14  ?  85  LYS A NZ  1 
ATOM   448  N N   . GLY A 1 65  ? -21.959 -26.490 -3.365  1.00 51.66  ?  86  GLY A N   1 
ATOM   449  C CA  . GLY A 1 65  ? -22.154 -25.090 -3.692  1.00 49.76  ?  86  GLY A CA  1 
ATOM   450  C C   . GLY A 1 65  ? -20.828 -24.412 -3.959  1.00 49.12  ?  86  GLY A C   1 
ATOM   451  O O   . GLY A 1 65  ? -20.622 -23.820 -5.023  1.00 49.95  ?  86  GLY A O   1 
ATOM   452  N N   . SER A 1 66  ? -19.921 -24.526 -2.994  1.00 48.87  ?  87  SER A N   1 
ATOM   453  C CA  . SER A 1 66  ? -18.594 -23.936 -3.110  1.00 49.64  ?  87  SER A CA  1 
ATOM   454  C C   . SER A 1 66  ? -17.840 -24.429 -4.347  1.00 49.76  ?  87  SER A C   1 
ATOM   455  O O   . SER A 1 66  ? -17.266 -23.627 -5.081  1.00 51.36  ?  87  SER A O   1 
ATOM   456  C CB  . SER A 1 66  ? -17.787 -24.222 -1.845  1.00 48.73  ?  87  SER A CB  1 
ATOM   457  O OG  . SER A 1 66  ? -17.501 -25.603 -1.732  1.00 57.74  ?  87  SER A OG  1 
ATOM   458  N N   . TRP A 1 67  ? -17.848 -25.739 -4.582  1.00 47.71  ?  88  TRP A N   1 
ATOM   459  C CA  . TRP A 1 67  ? -17.190 -26.305 -5.760  1.00 49.49  ?  88  TRP A CA  1 
ATOM   460  C C   . TRP A 1 67  ? -17.749 -25.840 -7.098  1.00 50.91  ?  88  TRP A C   1 
ATOM   461  O O   . TRP A 1 67  ? -17.051 -25.197 -7.878  1.00 53.61  ?  88  TRP A O   1 
ATOM   462  C CB  . TRP A 1 67  ? -17.287 -27.831 -5.760  1.00 51.08  ?  88  TRP A CB  1 
ATOM   463  C CG  . TRP A 1 67  ? -16.101 -28.515 -5.156  1.00 52.09  ?  88  TRP A CG  1 
ATOM   464  C CD1 . TRP A 1 67  ? -16.086 -29.305 -4.044  1.00 54.13  ?  88  TRP A CD1 1 
ATOM   465  C CD2 . TRP A 1 67  ? -14.752 -28.470 -5.634  1.00 53.53  ?  88  TRP A CD2 1 
ATOM   466  N NE1 . TRP A 1 67  ? -14.811 -29.756 -3.800  1.00 54.53  ?  88  TRP A NE1 1 
ATOM   467  C CE2 . TRP A 1 67  ? -13.973 -29.257 -4.762  1.00 53.85  ?  88  TRP A CE2 1 
ATOM   468  C CE3 . TRP A 1 67  ? -14.127 -27.841 -6.715  1.00 55.92  ?  88  TRP A CE3 1 
ATOM   469  C CZ2 . TRP A 1 67  ? -12.602 -29.431 -4.937  1.00 55.58  ?  88  TRP A CZ2 1 
ATOM   470  C CZ3 . TRP A 1 67  ? -12.766 -28.014 -6.887  1.00 57.60  ?  88  TRP A CZ3 1 
ATOM   471  C CH2 . TRP A 1 67  ? -12.019 -28.803 -6.003  1.00 56.63  ?  88  TRP A CH2 1 
ATOM   472  N N   . SER A 1 68  ? -19.012 -26.179 -7.343  1.00 52.70  ?  89  SER A N   1 
ATOM   473  C CA  . SER A 1 68  ? -19.804 -25.705 -8.479  1.00 55.40  ?  89  SER A CA  1 
ATOM   474  C C   . SER A 1 68  ? -19.664 -24.208 -8.755  1.00 54.25  ?  89  SER A C   1 
ATOM   475  O O   . SER A 1 68  ? -19.690 -23.779 -9.909  1.00 62.49  ?  89  SER A O   1 
ATOM   476  C CB  . SER A 1 68  ? -21.279 -26.045 -8.248  1.00 58.80  ?  89  SER A CB  1 
ATOM   477  O OG  . SER A 1 68  ? -22.109 -25.463 -9.236  1.00 61.14  ?  89  SER A OG  1 
ATOM   478  N N   . LEU A 1 69  ? -19.514 -23.420 -7.695  1.00 53.59  ?  90  LEU A N   1 
ATOM   479  C CA  . LEU A 1 69  ? -19.306 -21.983 -7.836  1.00 52.77  ?  90  LEU A CA  1 
ATOM   480  C C   . LEU A 1 69  ? -17.878 -21.666 -8.292  1.00 53.72  ?  90  LEU A C   1 
ATOM   481  O O   . LEU A 1 69  ? -17.678 -20.979 -9.292  1.00 55.69  ?  90  LEU A O   1 
ATOM   482  C CB  . LEU A 1 69  ? -19.615 -21.278 -6.513  1.00 51.16  ?  90  LEU A CB  1 
ATOM   483  C CG  . LEU A 1 69  ? -19.097 -19.869 -6.214  1.00 51.91  ?  90  LEU A CG  1 
ATOM   484  C CD1 . LEU A 1 69  ? -19.516 -18.889 -7.284  1.00 53.91  ?  90  LEU A CD1 1 
ATOM   485  C CD2 . LEU A 1 69  ? -19.599 -19.404 -4.862  1.00 51.72  ?  90  LEU A CD2 1 
ATOM   486  N N   . LEU A 1 70  ? -16.890 -22.174 -7.560  1.00 51.51  ?  91  LEU A N   1 
ATOM   487  C CA  . LEU A 1 70  ? -15.488 -21.846 -7.821  1.00 52.61  ?  91  LEU A CA  1 
ATOM   488  C C   . LEU A 1 70  ? -14.959 -22.421 -9.135  1.00 58.09  ?  91  LEU A C   1 
ATOM   489  O O   . LEU A 1 70  ? -13.943 -21.959 -9.655  1.00 60.72  ?  91  LEU A O   1 
ATOM   490  C CB  . LEU A 1 70  ? -14.609 -22.320 -6.659  1.00 52.19  ?  91  LEU A CB  1 
ATOM   491  C CG  . LEU A 1 70  ? -14.348 -21.321 -5.525  1.00 51.07  ?  91  LEU A CG  1 
ATOM   492  C CD1 . LEU A 1 70  ? -15.619 -20.964 -4.772  1.00 55.99  ?  91  LEU A CD1 1 
ATOM   493  C CD2 . LEU A 1 70  ? -13.297 -21.868 -4.568  1.00 51.56  ?  91  LEU A CD2 1 
ATOM   494  N N   . LYS A 1 71  ? -15.646 -23.425 -9.670  1.00 59.31  ?  92  LYS A N   1 
ATOM   495  C CA  . LYS A 1 71  ? -15.278 -24.008 -10.956 1.00 62.66  ?  92  LYS A CA  1 
ATOM   496  C C   . LYS A 1 71  ? -15.537 -23.005 -12.081 1.00 62.25  ?  92  LYS A C   1 
ATOM   497  O O   . LYS A 1 71  ? -14.695 -22.796 -12.963 1.00 65.78  ?  92  LYS A O   1 
ATOM   498  C CB  . LYS A 1 71  ? -16.061 -25.303 -11.205 1.00 68.05  ?  92  LYS A CB  1 
ATOM   499  C CG  . LYS A 1 71  ? -15.315 -26.594 -10.868 1.00 68.43  ?  92  LYS A CG  1 
ATOM   500  C CD  . LYS A 1 71  ? -16.283 -27.676 -10.394 1.00 72.03  ?  92  LYS A CD  1 
ATOM   501  C CE  . LYS A 1 71  ? -15.768 -29.077 -10.702 1.00 83.38  ?  92  LYS A CE  1 
ATOM   502  N NZ  . LYS A 1 71  ? -16.839 -29.961 -11.247 1.00 88.42  ?  92  LYS A NZ  1 
ATOM   503  N N   . ASP A 1 72  ? -16.709 -22.379 -12.037 1.00 70.58  ?  93  ASP A N   1 
ATOM   504  C CA  . ASP A 1 72  ? -17.122 -21.440 -13.075 1.00 72.52  ?  93  ASP A CA  1 
ATOM   505  C C   . ASP A 1 72  ? -16.368 -20.122 -12.993 1.00 70.97  ?  93  ASP A C   1 
ATOM   506  O O   . ASP A 1 72  ? -16.133 -19.475 -14.010 1.00 75.63  ?  93  ASP A O   1 
ATOM   507  C CB  . ASP A 1 72  ? -18.627 -21.185 -12.991 1.00 75.03  ?  93  ASP A CB  1 
ATOM   508  C CG  . ASP A 1 72  ? -19.425 -22.153 -13.832 1.00 81.38  ?  93  ASP A CG  1 
ATOM   509  O OD1 . ASP A 1 72  ? -19.030 -23.337 -13.931 1.00 91.24  ?  93  ASP A OD1 1 
ATOM   510  O OD2 . ASP A 1 72  ? -20.451 -21.730 -14.408 1.00 87.32  -1 93  ASP A OD2 1 
ATOM   511  N N   . LEU A 1 73  ? -16.000 -19.730 -11.778 1.00 63.94  ?  94  LEU A N   1 
ATOM   512  C CA  . LEU A 1 73  ? -15.156 -18.560 -11.575 1.00 66.84  ?  94  LEU A CA  1 
ATOM   513  C C   . LEU A 1 73  ? -13.817 -18.825 -12.236 1.00 65.77  ?  94  LEU A C   1 
ATOM   514  O O   . LEU A 1 73  ? -13.231 -17.948 -12.879 1.00 69.59  ?  94  LEU A O   1 
ATOM   515  C CB  . LEU A 1 73  ? -14.978 -18.261 -10.084 1.00 66.36  ?  94  LEU A CB  1 
ATOM   516  C CG  . LEU A 1 73  ? -14.225 -16.982 -9.719  1.00 65.39  ?  94  LEU A CG  1 
ATOM   517  C CD1 . LEU A 1 73  ? -14.951 -15.759 -10.253 1.00 68.17  ?  94  LEU A CD1 1 
ATOM   518  C CD2 . LEU A 1 73  ? -14.032 -16.876 -8.212  1.00 64.57  ?  94  LEU A CD2 1 
ATOM   519  N N   . LYS A 1 74  ? -13.352 -20.060 -12.078 1.00 67.56  ?  95  LYS A N   1 
ATOM   520  C CA  . LYS A 1 74  ? -12.140 -20.514 -12.733 1.00 69.08  ?  95  LYS A CA  1 
ATOM   521  C C   . LYS A 1 74  ? -12.307 -20.462 -14.247 1.00 70.03  ?  95  LYS A C   1 
ATOM   522  O O   . LYS A 1 74  ? -11.375 -20.097 -14.949 1.00 70.09  ?  95  LYS A O   1 
ATOM   523  C CB  . LYS A 1 74  ? -11.775 -21.930 -12.281 1.00 67.11  ?  95  LYS A CB  1 
ATOM   524  N N   . ARG A 1 75  ? -13.487 -20.821 -14.751 1.00 67.52  ?  96  ARG A N   1 
ATOM   525  C CA  . ARG A 1 75  ? -13.772 -20.663 -16.181 1.00 71.01  ?  96  ARG A CA  1 
ATOM   526  C C   . ARG A 1 75  ? -13.580 -19.202 -16.604 1.00 73.37  ?  96  ARG A C   1 
ATOM   527  O O   . ARG A 1 75  ? -12.876 -18.904 -17.588 1.00 80.33  ?  96  ARG A O   1 
ATOM   528  C CB  . ARG A 1 75  ? -15.195 -21.138 -16.506 1.00 71.45  ?  96  ARG A CB  1 
ATOM   529  C CG  . ARG A 1 75  ? -15.921 -20.325 -17.579 1.00 77.46  ?  96  ARG A CG  1 
ATOM   530  C CD  . ARG A 1 75  ? -17.065 -21.107 -18.213 1.00 86.58  ?  96  ARG A CD  1 
ATOM   531  N NE  . ARG A 1 75  ? -17.780 -20.319 -19.215 1.00 86.31  ?  96  ARG A NE  1 
ATOM   532  C CZ  . ARG A 1 75  ? -17.551 -20.383 -20.522 1.00 91.39  ?  96  ARG A CZ  1 
ATOM   533  N NH1 . ARG A 1 75  ? -16.622 -21.201 -20.989 1.00 92.22  ?  96  ARG A NH1 1 
ATOM   534  N NH2 . ARG A 1 75  ? -18.249 -19.631 -21.362 1.00 97.01  ?  96  ARG A NH2 1 
ATOM   535  N N   . ILE A 1 76  ? -14.192 -18.303 -15.832 1.00 75.12  ?  97  ILE A N   1 
ATOM   536  C CA  . ILE A 1 76  ? -14.115 -16.865 -16.073 1.00 72.30  ?  97  ILE A CA  1 
ATOM   537  C C   . ILE A 1 76  ? -12.674 -16.381 -16.165 1.00 75.03  ?  97  ILE A C   1 
ATOM   538  O O   . ILE A 1 76  ? -12.269 -15.801 -17.174 1.00 79.57  ?  97  ILE A O   1 
ATOM   539  C CB  . ILE A 1 76  ? -14.830 -16.058 -14.962 1.00 71.40  ?  97  ILE A CB  1 
ATOM   540  C CG1 . ILE A 1 76  ? -16.263 -16.551 -14.756 1.00 72.86  ?  97  ILE A CG1 1 
ATOM   541  C CG2 . ILE A 1 76  ? -14.799 -14.567 -15.278 1.00 72.00  ?  97  ILE A CG2 1 
ATOM   542  C CD1 . ILE A 1 76  ? -17.227 -16.148 -15.850 1.00 76.33  ?  97  ILE A CD1 1 
ATOM   543  N N   . THR A 1 77  ? -11.900 -16.627 -15.111 1.00 74.88  ?  98  THR A N   1 
ATOM   544  C CA  . THR A 1 77  ? -10.513 -16.173 -15.071 1.00 77.15  ?  98  THR A CA  1 
ATOM   545  C C   . THR A 1 77  ? -9.666  -16.818 -16.169 1.00 85.56  ?  98  THR A C   1 
ATOM   546  O O   . THR A 1 77  ? -8.805  -16.163 -16.759 1.00 92.27  ?  98  THR A O   1 
ATOM   547  C CB  . THR A 1 77  ? -9.863  -16.459 -13.702 1.00 74.96  ?  98  THR A CB  1 
ATOM   548  O OG1 . THR A 1 77  ? -9.698  -17.872 -13.530 1.00 71.55  ?  98  THR A OG1 1 
ATOM   549  C CG2 . THR A 1 77  ? -10.720 -15.901 -12.575 1.00 72.90  ?  98  THR A CG2 1 
ATOM   550  N N   . ASP A 1 78  ? -9.917  -18.096 -16.441 1.00 78.64  ?  99  ASP A N   1 
ATOM   551  C CA  . ASP A 1 78  ? -9.197  -18.822 -17.486 1.00 84.54  ?  99  ASP A CA  1 
ATOM   552  C C   . ASP A 1 78  ? -9.411  -18.190 -18.855 1.00 88.69  ?  99  ASP A C   1 
ATOM   553  O O   . ASP A 1 78  ? -8.481  -18.111 -19.659 1.00 90.61  ?  99  ASP A O   1 
ATOM   554  C CB  . ASP A 1 78  ? -9.630  -20.290 -17.532 1.00 90.64  ?  99  ASP A CB  1 
ATOM   555  C CG  . ASP A 1 78  ? -9.049  -21.110 -16.396 1.00 91.18  ?  99  ASP A CG  1 
ATOM   556  O OD1 . ASP A 1 78  ? -8.161  -20.600 -15.680 1.00 86.36  ?  99  ASP A OD1 1 
ATOM   557  O OD2 . ASP A 1 78  ? -9.490  -22.265 -16.216 1.00 89.97  -1 99  ASP A OD2 1 
ATOM   558  N N   . SER A 1 79  ? -10.640 -17.750 -19.118 1.00 86.50  ?  100 SER A N   1 
ATOM   559  C CA  . SER A 1 79  ? -10.955 -17.103 -20.393 1.00 90.36  ?  100 SER A CA  1 
ATOM   560  C C   . SER A 1 79  ? -10.101 -15.858 -20.645 1.00 94.51  ?  100 SER A C   1 
ATOM   561  O O   . SER A 1 79  ? -9.834  -15.504 -21.796 1.00 106.98 ?  100 SER A O   1 
ATOM   562  C CB  . SER A 1 79  ? -12.434 -16.722 -20.444 1.00 86.94  ?  100 SER A CB  1 
ATOM   563  O OG  . SER A 1 79  ? -12.719 -15.690 -19.517 1.00 81.00  ?  100 SER A OG  1 
ATOM   564  N N   . ASP A 1 80  ? -9.692  -15.211 -19.554 1.00 95.12  ?  101 ASP A N   1 
ATOM   565  C CA  . ASP A 1 80  ? -8.904  -13.975 -19.567 1.00 91.15  ?  101 ASP A CA  1 
ATOM   566  C C   . ASP A 1 80  ? -9.695  -12.784 -20.106 1.00 90.38  ?  101 ASP A C   1 
ATOM   567  O O   . ASP A 1 80  ? -9.112  -11.819 -20.602 1.00 91.06  ?  101 ASP A O   1 
ATOM   568  C CB  . ASP A 1 80  ? -7.613  -14.151 -20.374 1.00 91.19  ?  101 ASP A CB  1 
ATOM   569  N N   . VAL A 1 81  ? -11.020 -12.849 -20.001 1.00 89.62  ?  102 VAL A N   1 
ATOM   570  C CA  . VAL A 1 81  ? -11.863 -11.709 -20.351 1.00 92.22  ?  102 VAL A CA  1 
ATOM   571  C C   . VAL A 1 81  ? -11.647 -10.600 -19.322 1.00 89.83  ?  102 VAL A C   1 
ATOM   572  O O   . VAL A 1 81  ? -11.458 -10.874 -18.135 1.00 84.18  ?  102 VAL A O   1 
ATOM   573  C CB  . VAL A 1 81  ? -13.356 -12.100 -20.437 1.00 94.20  ?  102 VAL A CB  1 
ATOM   574  C CG1 . VAL A 1 81  ? -13.554 -13.179 -21.490 1.00 103.54 ?  102 VAL A CG1 1 
ATOM   575  C CG2 . VAL A 1 81  ? -13.870 -12.583 -19.089 1.00 90.15  ?  102 VAL A CG2 1 
ATOM   576  N N   . LYS A 1 82  ? -11.658 -9.349  -19.775 1.00 96.25  ?  103 LYS A N   1 
ATOM   577  C CA  . LYS A 1 82  ? -11.146 -8.259  -18.948 1.00 100.04 ?  103 LYS A CA  1 
ATOM   578  C C   . LYS A 1 82  ? -11.836 -6.906  -19.122 1.00 100.51 ?  103 LYS A C   1 
ATOM   579  O O   . LYS A 1 82  ? -11.452 -5.932  -18.479 1.00 97.72  ?  103 LYS A O   1 
ATOM   580  C CB  . LYS A 1 82  ? -9.653  -8.082  -19.227 1.00 103.47 ?  103 LYS A CB  1 
ATOM   581  C CG  . LYS A 1 82  ? -9.356  -7.534  -20.613 1.00 104.38 ?  103 LYS A CG  1 
ATOM   582  C CD  . LYS A 1 82  ? -7.876  -7.254  -20.798 1.00 106.73 ?  103 LYS A CD  1 
ATOM   583  C CE  . LYS A 1 82  ? -7.038  -8.479  -20.475 1.00 108.13 ?  103 LYS A CE  1 
ATOM   584  N NZ  . LYS A 1 82  ? -5.610  -8.128  -20.249 1.00 115.66 ?  103 LYS A NZ  1 
ATOM   585  N N   . GLY A 1 83  ? -12.840 -6.831  -19.986 1.00 99.32  ?  104 GLY A N   1 
ATOM   586  C CA  . GLY A 1 83  ? -13.473 -5.555  -20.260 1.00 104.16 ?  104 GLY A CA  1 
ATOM   587  C C   . GLY A 1 83  ? -14.607 -5.219  -19.314 1.00 96.92  ?  104 GLY A C   1 
ATOM   588  O O   . GLY A 1 83  ? -14.641 -5.669  -18.167 1.00 85.65  ?  104 GLY A O   1 
ATOM   589  N N   . ASP A 1 84  ? -15.551 -4.426  -19.814 1.00 106.43 ?  105 ASP A N   1 
ATOM   590  C CA  . ASP A 1 84  ? -16.795 -4.142  -19.111 1.00 106.84 ?  105 ASP A CA  1 
ATOM   591  C C   . ASP A 1 84  ? -17.683 -5.379  -19.310 1.00 103.25 ?  105 ASP A C   1 
ATOM   592  O O   . ASP A 1 84  ? -18.850 -5.403  -18.933 1.00 101.19 ?  105 ASP A O   1 
ATOM   593  C CB  . ASP A 1 84  ? -17.444 -2.861  -19.661 1.00 113.61 ?  105 ASP A CB  1 
ATOM   594  C CG  . ASP A 1 84  ? -18.510 -2.270  -18.736 1.00 115.51 ?  105 ASP A CG  1 
ATOM   595  O OD1 . ASP A 1 84  ? -19.181 -3.008  -17.989 1.00 113.26 ?  105 ASP A OD1 1 
ATOM   596  O OD2 . ASP A 1 84  ? -18.671 -1.030  -18.758 1.00 117.94 ?  105 ASP A OD2 1 
ATOM   597  N N   . LEU A 1 85  ? -17.105 -6.406  -19.928 1.00 94.86  ?  106 LEU A N   1 
ATOM   598  C CA  . LEU A 1 85  ? -17.763 -7.693  -20.100 1.00 92.50  ?  106 LEU A CA  1 
ATOM   599  C C   . LEU A 1 85  ? -17.508 -8.590  -18.895 1.00 89.74  ?  106 LEU A C   1 
ATOM   600  O O   . LEU A 1 85  ? -18.388 -9.335  -18.483 1.00 89.80  ?  106 LEU A O   1 
ATOM   601  C CB  . LEU A 1 85  ? -17.279 -8.382  -21.378 1.00 93.57  ?  106 LEU A CB  1 
ATOM   602  N N   . PHE A 1 86  ? -16.299 -8.513  -18.344 1.00 87.44  ?  107 PHE A N   1 
ATOM   603  C CA  . PHE A 1 86  ? -15.915 -9.280  -17.158 1.00 83.18  ?  107 PHE A CA  1 
ATOM   604  C C   . PHE A 1 86  ? -16.937 -9.099  -16.035 1.00 78.08  ?  107 PHE A C   1 
ATOM   605  O O   . PHE A 1 86  ? -17.394 -10.072 -15.418 1.00 75.71  ?  107 PHE A O   1 
ATOM   606  C CB  . PHE A 1 86  ? -14.508 -8.856  -16.708 1.00 85.57  ?  107 PHE A CB  1 
ATOM   607  C CG  . PHE A 1 86  ? -14.151 -9.262  -15.302 1.00 86.43  ?  107 PHE A CG  1 
ATOM   608  C CD1 . PHE A 1 86  ? -14.215 -10.587 -14.902 1.00 89.11  ?  107 PHE A CD1 1 
ATOM   609  C CD2 . PHE A 1 86  ? -13.712 -8.315  -14.391 1.00 85.75  ?  107 PHE A CD2 1 
ATOM   610  C CE1 . PHE A 1 86  ? -13.874 -10.953 -13.611 1.00 85.18  ?  107 PHE A CE1 1 
ATOM   611  C CE2 . PHE A 1 86  ? -13.367 -8.675  -13.102 1.00 82.73  ?  107 PHE A CE2 1 
ATOM   612  C CZ  . PHE A 1 86  ? -13.447 -9.995  -12.712 1.00 81.05  ?  107 PHE A CZ  1 
ATOM   613  N N   . VAL A 1 87  ? -17.322 -7.846  -15.812 1.00 86.25  ?  108 VAL A N   1 
ATOM   614  C CA  . VAL A 1 87  ? -18.293 -7.496  -14.784 1.00 86.09  ?  108 VAL A CA  1 
ATOM   615  C C   . VAL A 1 87  ? -19.703 -7.979  -15.163 1.00 81.82  ?  108 VAL A C   1 
ATOM   616  O O   . VAL A 1 87  ? -20.566 -8.124  -14.306 1.00 79.71  ?  108 VAL A O   1 
ATOM   617  C CB  . VAL A 1 87  ? -18.282 -5.962  -14.528 1.00 89.22  ?  108 VAL A CB  1 
ATOM   618  C CG1 . VAL A 1 87  ? -18.565 -5.203  -15.807 1.00 96.62  ?  108 VAL A CG1 1 
ATOM   619  C CG2 . VAL A 1 87  ? -19.254 -5.565  -13.421 1.00 86.30  ?  108 VAL A CG2 1 
ATOM   620  N N   . LYS A 1 88  ? -19.934 -8.258  -16.441 1.00 83.07  ?  109 LYS A N   1 
ATOM   621  C CA  . LYS A 1 88  ? -21.231 -8.789  -16.864 1.00 82.87  ?  109 LYS A CA  1 
ATOM   622  C C   . LYS A 1 88  ? -21.315 -10.303 -16.641 1.00 79.88  ?  109 LYS A C   1 
ATOM   623  O O   . LYS A 1 88  ? -22.240 -10.806 -15.989 1.00 74.81  ?  109 LYS A O   1 
ATOM   624  C CB  . LYS A 1 88  ? -21.492 -8.458  -18.335 1.00 82.78  ?  109 LYS A CB  1 
ATOM   625  N N   . GLU A 1 89  ? -20.338 -11.018 -17.192 1.00 77.97  ?  110 GLU A N   1 
ATOM   626  C CA  . GLU A 1 89  ? -20.246 -12.467 -17.066 1.00 76.54  ?  110 GLU A CA  1 
ATOM   627  C C   . GLU A 1 89  ? -20.158 -12.900 -15.611 1.00 74.11  ?  110 GLU A C   1 
ATOM   628  O O   . GLU A 1 89  ? -20.810 -13.873 -15.206 1.00 75.82  ?  110 GLU A O   1 
ATOM   629  C CB  . GLU A 1 89  ? -19.032 -12.993 -17.836 1.00 78.40  ?  110 GLU A CB  1 
ATOM   630  N N   . LEU A 1 90  ? -19.353 -12.177 -14.833 1.00 72.65  ?  111 LEU A N   1 
ATOM   631  C CA  . LEU A 1 90  ? -19.187 -12.487 -13.417 1.00 70.38  ?  111 LEU A CA  1 
ATOM   632  C C   . LEU A 1 90  ? -20.530 -12.576 -12.702 1.00 68.48  ?  111 LEU A C   1 
ATOM   633  O O   . LEU A 1 90  ? -20.790 -13.530 -11.966 1.00 68.55  ?  111 LEU A O   1 
ATOM   634  C CB  . LEU A 1 90  ? -18.305 -11.440 -12.736 1.00 72.73  ?  111 LEU A CB  1 
ATOM   635  C CG  . LEU A 1 90  ? -17.933 -11.742 -11.284 1.00 72.41  ?  111 LEU A CG  1 
ATOM   636  C CD1 . LEU A 1 90  ? -17.359 -13.144 -11.152 1.00 73.29  ?  111 LEU A CD1 1 
ATOM   637  C CD2 . LEU A 1 90  ? -16.953 -10.710 -10.754 1.00 74.77  ?  111 LEU A CD2 1 
ATOM   638  N N   . PHE A 1 91  ? -21.391 -11.594 -12.943 1.00 71.76  ?  112 PHE A N   1 
ATOM   639  C CA  . PHE A 1 91  ? -22.674 -11.532 -12.252 1.00 71.58  ?  112 PHE A CA  1 
ATOM   640  C C   . PHE A 1 91  ? -23.764 -12.389 -12.893 1.00 75.28  ?  112 PHE A C   1 
ATOM   641  O O   . PHE A 1 91  ? -24.686 -12.830 -12.199 1.00 76.07  ?  112 PHE A O   1 
ATOM   642  C CB  . PHE A 1 91  ? -23.142 -10.083 -12.147 1.00 73.92  ?  112 PHE A CB  1 
ATOM   643  C CG  . PHE A 1 91  ? -22.349 -9.265  -11.167 1.00 74.52  ?  112 PHE A CG  1 
ATOM   644  C CD1 . PHE A 1 91  ? -21.172 -8.651  -11.551 1.00 75.72  ?  112 PHE A CD1 1 
ATOM   645  C CD2 . PHE A 1 91  ? -22.778 -9.117  -9.860  1.00 72.76  ?  112 PHE A CD2 1 
ATOM   646  C CE1 . PHE A 1 91  ? -20.440 -7.898  -10.661 1.00 76.97  ?  112 PHE A CE1 1 
ATOM   647  C CE2 . PHE A 1 91  ? -22.047 -8.365  -8.959  1.00 74.84  ?  112 PHE A CE2 1 
ATOM   648  C CZ  . PHE A 1 91  ? -20.876 -7.755  -9.363  1.00 78.32  ?  112 PHE A CZ  1 
ATOM   649  N N   . TRP A 1 92  ? -23.671 -12.629 -14.200 1.00 75.58  ?  113 TRP A N   1 
ATOM   650  C CA  . TRP A 1 92  ? -24.575 -13.596 -14.819 1.00 78.90  ?  113 TRP A CA  1 
ATOM   651  C C   . TRP A 1 92  ? -24.363 -14.955 -14.161 1.00 76.34  ?  113 TRP A C   1 
ATOM   652  O O   . TRP A 1 92  ? -25.311 -15.628 -13.724 1.00 79.62  ?  113 TRP A O   1 
ATOM   653  C CB  . TRP A 1 92  ? -24.351 -13.698 -16.324 1.00 92.46  ?  113 TRP A CB  1 
ATOM   654  C CG  . TRP A 1 92  ? -25.629 -13.877 -17.040 1.00 102.44 ?  113 TRP A CG  1 
ATOM   655  C CD1 . TRP A 1 92  ? -26.373 -15.017 -17.117 1.00 102.76 ?  113 TRP A CD1 1 
ATOM   656  C CD2 . TRP A 1 92  ? -26.354 -12.873 -17.747 1.00 108.47 ?  113 TRP A CD2 1 
ATOM   657  N NE1 . TRP A 1 92  ? -27.511 -14.788 -17.847 1.00 103.57 ?  113 TRP A NE1 1 
ATOM   658  C CE2 . TRP A 1 92  ? -27.523 -13.476 -18.246 1.00 108.20 ?  113 TRP A CE2 1 
ATOM   659  C CE3 . TRP A 1 92  ? -26.124 -11.520 -18.018 1.00 107.03 ?  113 TRP A CE3 1 
ATOM   660  C CZ2 . TRP A 1 92  ? -28.458 -12.779 -18.996 1.00 110.98 ?  113 TRP A CZ2 1 
ATOM   661  C CZ3 . TRP A 1 92  ? -27.055 -10.829 -18.764 1.00 104.51 ?  113 TRP A CZ3 1 
ATOM   662  C CH2 . TRP A 1 92  ? -28.207 -11.458 -19.246 1.00 108.87 ?  113 TRP A CH2 1 
ATOM   663  N N   . MET A 1 93  ? -23.089 -15.326 -14.088 1.00 78.60  ?  114 MET A N   1 
ATOM   664  C CA  . MET A 1 93  ? -22.637 -16.519 -13.390 1.00 76.69  ?  114 MET A CA  1 
ATOM   665  C C   . MET A 1 93  ? -23.101 -16.503 -11.933 1.00 73.72  ?  114 MET A C   1 
ATOM   666  O O   . MET A 1 93  ? -23.607 -17.511 -11.422 1.00 76.28  ?  114 MET A O   1 
ATOM   667  C CB  . MET A 1 93  ? -21.108 -16.626 -13.456 1.00 77.66  ?  114 MET A CB  1 
ATOM   668  C CG  . MET A 1 93  ? -20.474 -17.043 -12.123 1.00 78.82  ?  114 MET A CG  1 
ATOM   669  S SD  . MET A 1 93  ? -18.680 -17.128 -11.956 1.00 83.79  ?  114 MET A SD  1 
ATOM   670  C CE  . MET A 1 93  ? -18.562 -18.154 -10.495 1.00 75.70  ?  114 MET A CE  1 
ATOM   671  N N   . LEU A 1 94  ? -22.957 -15.345 -11.286 1.00 67.40  ?  115 LEU A N   1 
ATOM   672  C CA  . LEU A 1 94  ? -23.336 -15.185 -9.885  1.00 65.97  ?  115 LEU A CA  1 
ATOM   673  C C   . LEU A 1 94  ? -24.842 -15.394 -9.673  1.00 65.23  ?  115 LEU A C   1 
ATOM   674  O O   . LEU A 1 94  ? -25.274 -15.755 -8.579  1.00 67.71  ?  115 LEU A O   1 
ATOM   675  C CB  . LEU A 1 94  ? -22.907 -13.803 -9.392  1.00 68.80  ?  115 LEU A CB  1 
ATOM   676  C CG  . LEU A 1 94  ? -21.519 -13.780 -8.746  1.00 70.58  ?  115 LEU A CG  1 
ATOM   677  C CD1 . LEU A 1 94  ? -21.210 -12.443 -8.084  1.00 72.35  ?  115 LEU A CD1 1 
ATOM   678  C CD2 . LEU A 1 94  ? -21.393 -14.928 -7.757  1.00 72.57  ?  115 LEU A CD2 1 
ATOM   679  N N   . HIS A 1 95  ? -25.630 -15.160 -10.721 1.00 65.22  ?  116 HIS A N   1 
ATOM   680  C CA  . HIS A 1 95  ? -27.074 -15.425 -10.700 1.00 69.31  ?  116 HIS A CA  1 
ATOM   681  C C   . HIS A 1 95  ? -27.352 -16.926 -10.872 1.00 67.94  ?  116 HIS A C   1 
ATOM   682  O O   . HIS A 1 95  ? -28.052 -17.574 -10.056 1.00 67.45  ?  116 HIS A O   1 
ATOM   683  C CB  . HIS A 1 95  ? -27.761 -14.613 -11.810 1.00 76.48  ?  116 HIS A CB  1 
ATOM   684  C CG  . HIS A 1 95  ? -29.251 -14.782 -11.879 1.00 83.59  ?  116 HIS A CG  1 
ATOM   685  N ND1 . HIS A 1 95  ? -30.116 -14.171 -10.996 1.00 85.99  ?  116 HIS A ND1 1 
ATOM   686  C CD2 . HIS A 1 95  ? -30.028 -15.475 -12.746 1.00 85.58  ?  116 HIS A CD2 1 
ATOM   687  C CE1 . HIS A 1 95  ? -31.360 -14.488 -11.310 1.00 87.13  ?  116 HIS A CE1 1 
ATOM   688  N NE2 . HIS A 1 95  ? -31.335 -15.280 -12.367 1.00 86.73  ?  116 HIS A NE2 1 
ATOM   689  N N   . LEU A 1 96  ? -26.779 -17.477 -11.940 1.00 62.21  ?  117 LEU A N   1 
ATOM   690  C CA  . LEU A 1 96  ? -26.993 -18.885 -12.274 1.00 66.89  ?  117 LEU A CA  1 
ATOM   691  C C   . LEU A 1 96  ? -26.585 -19.835 -11.147 1.00 67.07  ?  117 LEU A C   1 
ATOM   692  O O   . LEU A 1 96  ? -27.292 -20.802 -10.847 1.00 70.99  ?  117 LEU A O   1 
ATOM   693  C CB  . LEU A 1 96  ? -26.232 -19.237 -13.550 1.00 75.25  ?  117 LEU A CB  1 
ATOM   694  C CG  . LEU A 1 96  ? -26.587 -18.356 -14.747 1.00 83.30  ?  117 LEU A CG  1 
ATOM   695  C CD1 . LEU A 1 96  ? -25.425 -18.291 -15.723 1.00 87.62  ?  117 LEU A CD1 1 
ATOM   696  C CD2 . LEU A 1 96  ? -27.854 -18.853 -15.428 1.00 85.11  ?  117 LEU A CD2 1 
ATOM   697  N N   . GLN A 1 97  ? -25.446 -19.556 -10.524 1.00 67.78  ?  118 GLN A N   1 
ATOM   698  C CA  . GLN A 1 97  ? -24.971 -20.372 -9.415  1.00 61.64  ?  118 GLN A CA  1 
ATOM   699  C C   . GLN A 1 97  ? -25.877 -20.238 -8.199  1.00 58.86  ?  118 GLN A C   1 
ATOM   700  O O   . GLN A 1 97  ? -25.967 -21.156 -7.383  1.00 64.85  ?  118 GLN A O   1 
ATOM   701  C CB  . GLN A 1 97  ? -23.533 -20.005 -9.047  1.00 59.20  ?  118 GLN A CB  1 
ATOM   702  C CG  . GLN A 1 97  ? -22.518 -20.427 -10.090 1.00 62.86  ?  118 GLN A CG  1 
ATOM   703  C CD  . GLN A 1 97  ? -22.253 -21.921 -10.056 1.00 64.32  ?  118 GLN A CD  1 
ATOM   704  O OE1 . GLN A 1 97  ? -22.371 -22.559 -9.009  1.00 69.09  ?  118 GLN A OE1 1 
ATOM   705  N NE2 . GLN A 1 97  ? -21.899 -22.487 -11.203 1.00 65.50  ?  118 GLN A NE2 1 
ATOM   706  N N   . LYS A 1 98  ? -26.550 -19.099 -8.077  1.00 58.69  ?  119 LYS A N   1 
ATOM   707  C CA  . LYS A 1 98  ? -27.571 -18.958 -7.051  1.00 59.23  ?  119 LYS A CA  1 
ATOM   708  C C   . LYS A 1 98  ? -28.709 -19.919 -7.365  1.00 62.73  ?  119 LYS A C   1 
ATOM   709  O O   . LYS A 1 98  ? -29.215 -20.599 -6.465  1.00 63.61  ?  119 LYS A O   1 
ATOM   710  C CB  . LYS A 1 98  ? -28.087 -17.521 -6.955  1.00 58.89  ?  119 LYS A CB  1 
ATOM   711  C CG  . LYS A 1 98  ? -29.207 -17.348 -5.942  1.00 59.46  ?  119 LYS A CG  1 
ATOM   712  C CD  . LYS A 1 98  ? -28.977 -16.140 -5.051  1.00 61.78  ?  119 LYS A CD  1 
ATOM   713  C CE  . LYS A 1 98  ? -30.099 -15.990 -4.037  1.00 60.75  ?  119 LYS A CE  1 
ATOM   714  N NZ  . LYS A 1 98  ? -30.577 -14.585 -3.933  1.00 63.73  ?  119 LYS A NZ  1 
ATOM   715  N N   . GLU A 1 99  ? -29.100 -19.992 -8.639  1.00 63.63  ?  120 GLU A N   1 
ATOM   716  C CA  . GLU A 1 99  ? -30.097 -21.005 -9.030  1.00 68.41  ?  120 GLU A CA  1 
ATOM   717  C C   . GLU A 1 99  ? -29.675 -22.434 -8.650  1.00 66.85  ?  120 GLU A C   1 
ATOM   718  O O   . GLU A 1 99  ? -30.384 -23.143 -7.917  1.00 64.03  ?  120 GLU A O   1 
ATOM   719  C CB  . GLU A 1 99  ? -30.370 -20.968 -10.535 1.00 77.97  ?  120 GLU A CB  1 
ATOM   720  C CG  . GLU A 1 99  ? -31.202 -19.805 -11.027 1.00 84.74  ?  120 GLU A CG  1 
ATOM   721  C CD  . GLU A 1 99  ? -31.430 -19.872 -12.526 1.00 90.65  ?  120 GLU A CD  1 
ATOM   722  O OE1 . GLU A 1 99  ? -31.116 -20.921 -13.128 1.00 90.90  ?  120 GLU A OE1 1 
ATOM   723  O OE2 . GLU A 1 99  ? -31.925 -18.882 -13.103 1.00 99.36  -1 120 GLU A OE2 1 
ATOM   724  N N   . THR A 1 100 ? -28.522 -22.845 -9.172  1.00 67.25  ?  121 THR A N   1 
ATOM   725  C CA  . THR A 1 100 ? -27.976 -24.185 -8.947  1.00 65.84  ?  121 THR A CA  1 
ATOM   726  C C   . THR A 1 100 ? -27.916 -24.536 -7.462  1.00 60.93  ?  121 THR A C   1 
ATOM   727  O O   . THR A 1 100 ? -28.420 -25.584 -7.018  1.00 61.75  ?  121 THR A O   1 
ATOM   728  C CB  . THR A 1 100 ? -26.559 -24.306 -9.547  1.00 66.27  ?  121 THR A CB  1 
ATOM   729  O OG1 . THR A 1 100 ? -26.590 -23.953 -10.935 1.00 68.95  ?  121 THR A OG1 1 
ATOM   730  C CG2 . THR A 1 100 ? -26.031 -25.722 -9.400  1.00 70.39  ?  121 THR A CG2 1 
ATOM   731  N N   . PHE A 1 101 ? -27.298 -23.644 -6.697  1.00 60.52  ?  122 PHE A N   1 
ATOM   732  C CA  . PHE A 1 101 ? -27.186 -23.824 -5.261  1.00 59.46  ?  122 PHE A CA  1 
ATOM   733  C C   . PHE A 1 101 ? -28.563 -23.951 -4.626  1.00 60.03  ?  122 PHE A C   1 
ATOM   734  O O   . PHE A 1 101 ? -28.752 -24.755 -3.718  1.00 58.21  ?  122 PHE A O   1 
ATOM   735  C CB  . PHE A 1 101 ? -26.415 -22.668 -4.629  1.00 57.67  ?  122 PHE A CB  1 
ATOM   736  C CG  . PHE A 1 101 ? -26.158 -22.848 -3.164  1.00 55.20  ?  122 PHE A CG  1 
ATOM   737  C CD1 . PHE A 1 101 ? -25.271 -23.814 -2.719  1.00 55.25  ?  122 PHE A CD1 1 
ATOM   738  C CD2 . PHE A 1 101 ? -26.798 -22.051 -2.232  1.00 54.00  ?  122 PHE A CD2 1 
ATOM   739  C CE1 . PHE A 1 101 ? -25.031 -23.986 -1.370  1.00 52.30  ?  122 PHE A CE1 1 
ATOM   740  C CE2 . PHE A 1 101 ? -26.561 -22.216 -0.881  1.00 52.66  ?  122 PHE A CE2 1 
ATOM   741  C CZ  . PHE A 1 101 ? -25.675 -23.185 -0.449  1.00 52.26  ?  122 PHE A CZ  1 
ATOM   742  N N   . ALA A 1 102 ? -29.525 -23.168 -5.111  1.00 62.78  ?  123 ALA A N   1 
ATOM   743  C CA  . ALA A 1 102 ? -30.895 -23.279 -4.618  1.00 65.96  ?  123 ALA A CA  1 
ATOM   744  C C   . ALA A 1 102 ? -31.429 -24.694 -4.835  1.00 65.80  ?  123 ALA A C   1 
ATOM   745  O O   . ALA A 1 102 ? -32.042 -25.279 -3.931  1.00 63.65  ?  123 ALA A O   1 
ATOM   746  C CB  . ALA A 1 102 ? -31.797 -22.257 -5.292  1.00 69.56  ?  123 ALA A CB  1 
ATOM   747  N N   . THR A 1 103 ? -31.182 -25.250 -6.021  1.00 61.39  ?  124 THR A N   1 
ATOM   748  C CA  . THR A 1 103 ? -31.571 -26.639 -6.284  1.00 63.81  ?  124 THR A CA  1 
ATOM   749  C C   . THR A 1 103 ? -30.920 -27.594 -5.280  1.00 64.16  ?  124 THR A C   1 
ATOM   750  O O   . THR A 1 103 ? -31.581 -28.500 -4.747  1.00 67.62  ?  124 THR A O   1 
ATOM   751  C CB  . THR A 1 103 ? -31.197 -27.093 -7.712  1.00 66.42  ?  124 THR A CB  1 
ATOM   752  O OG1 . THR A 1 103 ? -29.787 -27.337 -7.788  1.00 66.50  ?  124 THR A OG1 1 
ATOM   753  C CG2 . THR A 1 103 ? -31.596 -26.046 -8.740  1.00 66.84  ?  124 THR A CG2 1 
ATOM   754  N N   . TYR A 1 104 ? -29.628 -27.388 -5.024  1.00 64.14  ?  125 TYR A N   1 
ATOM   755  C CA  . TYR A 1 104 ? -28.915 -28.208 -4.038  1.00 60.87  ?  125 TYR A CA  1 
ATOM   756  C C   . TYR A 1 104 ? -29.600 -28.171 -2.673  1.00 61.18  ?  125 TYR A C   1 
ATOM   757  O O   . TYR A 1 104 ? -29.899 -29.214 -2.079  1.00 66.73  ?  125 TYR A O   1 
ATOM   758  C CB  . TYR A 1 104 ? -27.461 -27.749 -3.886  1.00 60.30  ?  125 TYR A CB  1 
ATOM   759  C CG  . TYR A 1 104 ? -26.599 -27.943 -5.113  1.00 60.63  ?  125 TYR A CG  1 
ATOM   760  C CD1 . TYR A 1 104 ? -27.055 -28.669 -6.205  1.00 63.86  ?  125 TYR A CD1 1 
ATOM   761  C CD2 . TYR A 1 104 ? -25.321 -27.401 -5.174  1.00 58.72  ?  125 TYR A CD2 1 
ATOM   762  C CE1 . TYR A 1 104 ? -26.266 -28.845 -7.326  1.00 64.00  ?  125 TYR A CE1 1 
ATOM   763  C CE2 . TYR A 1 104 ? -24.525 -27.572 -6.290  1.00 60.85  ?  125 TYR A CE2 1 
ATOM   764  C CZ  . TYR A 1 104 ? -25.001 -28.295 -7.361  1.00 61.55  ?  125 TYR A CZ  1 
ATOM   765  O OH  . TYR A 1 104 ? -24.212 -28.467 -8.474  1.00 60.75  ?  125 TYR A OH  1 
ATOM   766  N N   . VAL A 1 105 ? -29.852 -26.958 -2.188  1.00 60.88  ?  126 VAL A N   1 
ATOM   767  C CA  . VAL A 1 105 ? -30.489 -26.761 -0.893  1.00 62.91  ?  126 VAL A CA  1 
ATOM   768  C C   . VAL A 1 105 ? -31.893 -27.369 -0.884  1.00 66.83  ?  126 VAL A C   1 
ATOM   769  O O   . VAL A 1 105 ? -32.392 -27.763 0.167   1.00 67.27  ?  126 VAL A O   1 
ATOM   770  C CB  . VAL A 1 105 ? -30.552 -25.261 -0.518  1.00 63.77  ?  126 VAL A CB  1 
ATOM   771  C CG1 . VAL A 1 105 ? -31.057 -25.079 0.904   1.00 63.09  ?  126 VAL A CG1 1 
ATOM   772  C CG2 . VAL A 1 105 ? -29.178 -24.629 -0.652  1.00 64.08  ?  126 VAL A CG2 1 
ATOM   773  N N   . ALA A 1 106 ? -32.522 -27.468 -2.052  1.00 64.89  ?  127 ALA A N   1 
ATOM   774  C CA  . ALA A 1 106 ? -33.806 -28.163 -2.146  1.00 67.60  ?  127 ALA A CA  1 
ATOM   775  C C   . ALA A 1 106 ? -33.635 -29.671 -1.934  1.00 71.34  ?  127 ALA A C   1 
ATOM   776  O O   . ALA A 1 106 ? -34.311 -30.277 -1.083  1.00 72.80  ?  127 ALA A O   1 
ATOM   777  C CB  . ALA A 1 106 ? -34.466 -27.888 -3.487  1.00 68.84  ?  127 ALA A CB  1 
ATOM   778  N N   . ARG A 1 107 ? -32.729 -30.269 -2.709  1.00 72.95  ?  128 ARG A N   1 
ATOM   779  C CA  . ARG A 1 107 ? -32.450 -31.702 -2.587  1.00 75.64  ?  128 ARG A CA  1 
ATOM   780  C C   . ARG A 1 107 ? -32.086 -32.079 -1.153  1.00 73.46  ?  128 ARG A C   1 
ATOM   781  O O   . ARG A 1 107 ? -32.500 -33.131 -0.653  1.00 76.70  ?  128 ARG A O   1 
ATOM   782  C CB  . ARG A 1 107 ? -31.324 -32.123 -3.537  1.00 78.78  ?  128 ARG A CB  1 
ATOM   783  C CG  . ARG A 1 107 ? -31.798 -32.875 -4.775  1.00 85.92  ?  128 ARG A CG  1 
ATOM   784  C CD  . ARG A 1 107 ? -30.631 -33.297 -5.662  1.00 89.94  ?  128 ARG A CD  1 
ATOM   785  N NE  . ARG A 1 107 ? -30.125 -34.626 -5.323  1.00 99.31  ?  128 ARG A NE  1 
ATOM   786  C CZ  . ARG A 1 107 ? -29.347 -35.357 -6.117  1.00 110.25 ?  128 ARG A CZ  1 
ATOM   787  N NH1 . ARG A 1 107 ? -28.980 -34.890 -7.303  1.00 117.61 ?  128 ARG A NH1 1 
ATOM   788  N NH2 . ARG A 1 107 ? -28.934 -36.555 -5.726  1.00 112.16 ?  128 ARG A NH2 1 
ATOM   789  N N   . PHE A 1 108 ? -31.322 -31.211 -0.494  1.00 70.14  ?  129 PHE A N   1 
ATOM   790  C CA  . PHE A 1 108 ? -30.923 -31.445 0.892   1.00 66.67  ?  129 PHE A CA  1 
ATOM   791  C C   . PHE A 1 108 ? -32.111 -31.612 1.838   1.00 70.71  ?  129 PHE A C   1 
ATOM   792  O O   . PHE A 1 108 ? -32.152 -32.554 2.627   1.00 76.41  ?  129 PHE A O   1 
ATOM   793  C CB  . PHE A 1 108 ? -30.042 -30.306 1.398   1.00 61.26  ?  129 PHE A CB  1 
ATOM   794  C CG  . PHE A 1 108 ? -29.831 -30.332 2.883   1.00 58.26  ?  129 PHE A CG  1 
ATOM   795  C CD1 . PHE A 1 108 ? -29.168 -31.388 3.484   1.00 59.54  ?  129 PHE A CD1 1 
ATOM   796  C CD2 . PHE A 1 108 ? -30.321 -29.313 3.681   1.00 59.41  ?  129 PHE A CD2 1 
ATOM   797  C CE1 . PHE A 1 108 ? -28.981 -31.419 4.852   1.00 60.88  ?  129 PHE A CE1 1 
ATOM   798  C CE2 . PHE A 1 108 ? -30.139 -29.338 5.050   1.00 58.94  ?  129 PHE A CE2 1 
ATOM   799  C CZ  . PHE A 1 108 ? -29.468 -30.392 5.635   1.00 61.63  ?  129 PHE A CZ  1 
ATOM   800  N N   . GLN A 1 109 ? -33.064 -30.689 1.775   1.00 73.83  ?  130 GLN A N   1 
ATOM   801  C CA  . GLN A 1 109 ? -34.235 -30.762 2.643   1.00 74.83  ?  130 GLN A CA  1 
ATOM   802  C C   . GLN A 1 109 ? -35.134 -31.923 2.248   1.00 77.36  ?  130 GLN A C   1 
ATOM   803  O O   . GLN A 1 109 ? -35.753 -32.558 3.103   1.00 83.00  ?  130 GLN A O   1 
ATOM   804  C CB  . GLN A 1 109 ? -35.029 -29.455 2.603   1.00 75.70  ?  130 GLN A CB  1 
ATOM   805  C CG  . GLN A 1 109 ? -34.180 -28.202 2.629   1.00 74.05  ?  130 GLN A CG  1 
ATOM   806  C CD  . GLN A 1 109 ? -35.016 -26.940 2.670   1.00 74.12  ?  130 GLN A CD  1 
ATOM   807  O OE1 . GLN A 1 109 ? -34.640 -25.951 3.299   1.00 72.11  ?  130 GLN A OE1 1 
ATOM   808  N NE2 . GLN A 1 109 ? -36.164 -26.970 2.002   1.00 77.14  ?  130 GLN A NE2 1 
ATOM   809  N N   . LYS A 1 110 ? -35.205 -32.204 0.950   1.00 69.05  ?  131 LYS A N   1 
ATOM   810  C CA  . LYS A 1 110 ? -36.081 -33.272 0.481   1.00 73.30  ?  131 LYS A CA  1 
ATOM   811  C C   . LYS A 1 110 ? -35.562 -34.671 0.826   1.00 75.42  ?  131 LYS A C   1 
ATOM   812  O O   . LYS A 1 110 ? -36.352 -35.604 0.973   1.00 86.27  ?  131 LYS A O   1 
ATOM   813  C CB  . LYS A 1 110 ? -36.290 -33.160 -1.031  1.00 74.49  ?  131 LYS A CB  1 
ATOM   814  N N   . GLU A 1 111 ? -34.246 -34.823 0.958   1.00 75.05  ?  132 GLU A N   1 
ATOM   815  C CA  . GLU A 1 111 ? -33.671 -36.163 1.091   1.00 76.66  ?  132 GLU A CA  1 
ATOM   816  C C   . GLU A 1 111 ? -32.695 -36.353 2.257   1.00 75.43  ?  132 GLU A C   1 
ATOM   817  O O   . GLU A 1 111 ? -32.776 -37.346 2.981   1.00 80.62  ?  132 GLU A O   1 
ATOM   818  C CB  . GLU A 1 111 ? -32.972 -36.543 -0.218  1.00 74.83  ?  132 GLU A CB  1 
ATOM   819  C CG  . GLU A 1 111 ? -33.898 -36.540 -1.427  1.00 79.22  ?  132 GLU A CG  1 
ATOM   820  C CD  . GLU A 1 111 ? -33.158 -36.701 -2.739  1.00 84.97  ?  132 GLU A CD  1 
ATOM   821  O OE1 . GLU A 1 111 ? -31.993 -37.149 -2.717  1.00 87.75  ?  132 GLU A OE1 1 
ATOM   822  O OE2 . GLU A 1 111 ? -33.743 -36.373 -3.794  1.00 89.69  -1 132 GLU A OE2 1 
ATOM   823  N N   . ALA A 1 112 ? -31.774 -35.411 2.435   1.00 71.66  ?  133 ALA A N   1 
ATOM   824  C CA  . ALA A 1 112 ? -30.686 -35.582 3.396   1.00 68.46  ?  133 ALA A CA  1 
ATOM   825  C C   . ALA A 1 112 ? -30.963 -34.959 4.766   1.00 68.00  ?  133 ALA A C   1 
ATOM   826  O O   . ALA A 1 112 ? -30.216 -35.196 5.715   1.00 64.91  ?  133 ALA A O   1 
ATOM   827  C CB  . ALA A 1 112 ? -29.396 -35.013 2.822   1.00 65.04  ?  133 ALA A CB  1 
ATOM   828  N N   . TYR A 1 113 ? -32.023 -34.166 4.876   1.00 67.18  ?  134 TYR A N   1 
ATOM   829  C CA  . TYR A 1 113 ? -32.363 -33.559 6.160   1.00 69.05  ?  134 TYR A CA  1 
ATOM   830  C C   . TYR A 1 113 ? -33.111 -34.543 7.051   1.00 75.23  ?  134 TYR A C   1 
ATOM   831  O O   . TYR A 1 113 ? -34.293 -34.811 6.831   1.00 79.64  ?  134 TYR A O   1 
ATOM   832  C CB  . TYR A 1 113 ? -33.203 -32.295 5.972   1.00 70.70  ?  134 TYR A CB  1 
ATOM   833  C CG  . TYR A 1 113 ? -33.584 -31.644 7.284   1.00 72.77  ?  134 TYR A CG  1 
ATOM   834  C CD1 . TYR A 1 113 ? -32.673 -30.862 7.982   1.00 73.44  ?  134 TYR A CD1 1 
ATOM   835  C CD2 . TYR A 1 113 ? -34.847 -31.825 7.833   1.00 78.71  ?  134 TYR A CD2 1 
ATOM   836  C CE1 . TYR A 1 113 ? -33.011 -30.271 9.183   1.00 74.52  ?  134 TYR A CE1 1 
ATOM   837  C CE2 . TYR A 1 113 ? -35.194 -31.238 9.035   1.00 80.02  ?  134 TYR A CE2 1 
ATOM   838  C CZ  . TYR A 1 113 ? -34.272 -30.462 9.705   1.00 77.35  ?  134 TYR A CZ  1 
ATOM   839  O OH  . TYR A 1 113 ? -34.611 -29.874 10.902  1.00 82.94  ?  134 TYR A OH  1 
ATOM   840  N N   . CYS A 1 114 ? -32.415 -35.059 8.063   1.00 78.30  ?  135 CYS A N   1 
ATOM   841  C CA  . CYS A 1 114 ? -32.958 -36.076 8.964   1.00 74.82  ?  135 CYS A CA  1 
ATOM   842  C C   . CYS A 1 114 ? -33.577 -37.230 8.179   1.00 68.48  ?  135 CYS A C   1 
ATOM   843  O O   . CYS A 1 114 ? -34.797 -37.402 8.182   1.00 72.51  ?  135 CYS A O   1 
ATOM   844  C CB  . CYS A 1 114 ? -33.995 -35.461 9.909   1.00 78.44  ?  135 CYS A CB  1 
ATOM   845  S SG  . CYS A 1 114 ? -33.329 -34.230 11.055  1.00 86.05  ?  135 CYS A SG  1 
ATOM   846  N N   . PRO A 1 115 ? -32.734 -38.023 7.499   1.00 64.28  ?  136 PRO A N   1 
ATOM   847  C CA  . PRO A 1 115 ? -33.211 -39.062 6.583   1.00 67.07  ?  136 PRO A CA  1 
ATOM   848  C C   . PRO A 1 115 ? -33.512 -40.392 7.265   1.00 66.87  ?  136 PRO A C   1 
ATOM   849  O O   . PRO A 1 115 ? -33.786 -41.377 6.578   1.00 69.20  ?  136 PRO A O   1 
ATOM   850  C CB  . PRO A 1 115 ? -32.043 -39.210 5.612   1.00 64.74  ?  136 PRO A CB  1 
ATOM   851  C CG  . PRO A 1 115 ? -30.848 -38.971 6.472   1.00 61.18  ?  136 PRO A CG  1 
ATOM   852  C CD  . PRO A 1 115 ? -31.262 -37.947 7.510   1.00 61.50  ?  136 PRO A CD  1 
ATOM   853  N N   . ASN A 1 116 ? -33.457 -40.428 8.591   1.00 62.31  ?  137 ASN A N   1 
ATOM   854  C CA  . ASN A 1 116 ? -33.749 -41.660 9.308   1.00 67.07  ?  137 ASN A CA  1 
ATOM   855  C C   . ASN A 1 116 ? -35.246 -41.938 9.375   1.00 74.50  ?  137 ASN A C   1 
ATOM   856  O O   . ASN A 1 116 ? -36.045 -41.049 9.667   1.00 80.09  ?  137 ASN A O   1 
ATOM   857  C CB  . ASN A 1 116 ? -33.166 -41.623 10.725  1.00 65.06  ?  137 ASN A CB  1 
ATOM   858  C CG  . ASN A 1 116 ? -33.484 -40.334 11.461  1.00 64.52  ?  137 ASN A CG  1 
ATOM   859  O OD1 . ASN A 1 116 ? -34.225 -39.485 10.968  1.00 75.70  ?  137 ASN A OD1 1 
ATOM   860  N ND2 . ASN A 1 116 ? -32.938 -40.194 12.663  1.00 63.89  ?  137 ASN A ND2 1 
ATOM   861  N N   . LYS A 1 117 ? -35.623 -43.179 9.092   1.00 73.05  ?  138 LYS A N   1 
ATOM   862  C CA  . LYS A 1 117 ? -36.999 -43.606 9.282   1.00 72.13  ?  138 LYS A CA  1 
ATOM   863  C C   . LYS A 1 117 ? -37.198 -44.014 10.734  1.00 73.08  ?  138 LYS A C   1 
ATOM   864  O O   . LYS A 1 117 ? -38.324 -44.251 11.173  1.00 79.75  ?  138 LYS A O   1 
ATOM   865  C CB  . LYS A 1 117 ? -37.350 -44.763 8.342   1.00 69.16  ?  138 LYS A CB  1 
ATOM   866  N N   . CYS A 1 118 ? -36.099 -44.093 11.477  1.00 74.65  ?  139 CYS A N   1 
ATOM   867  C CA  . CYS A 1 118 ? -36.170 -44.514 12.867  1.00 78.00  ?  139 CYS A CA  1 
ATOM   868  C C   . CYS A 1 118 ? -34.942 -44.098 13.666  1.00 71.52  ?  139 CYS A C   1 
ATOM   869  O O   . CYS A 1 118 ? -33.889 -43.800 13.102  1.00 69.78  ?  139 CYS A O   1 
ATOM   870  C CB  . CYS A 1 118 ? -36.330 -46.023 12.953  1.00 85.83  ?  139 CYS A CB  1 
ATOM   871  S SG  . CYS A 1 118 ? -35.012 -46.965 12.148  1.00 102.66 ?  139 CYS A SG  1 
ATOM   872  N N   . GLY A 1 119 ? -35.086 -44.083 14.988  1.00 71.58  ?  140 GLY A N   1 
ATOM   873  C CA  . GLY A 1 119 ? -33.966 -43.846 15.880  1.00 68.37  ?  140 GLY A CA  1 
ATOM   874  C C   . GLY A 1 119 ? -33.596 -42.388 16.069  1.00 66.45  ?  140 GLY A C   1 
ATOM   875  O O   . GLY A 1 119 ? -34.425 -41.496 15.895  1.00 68.86  ?  140 GLY A O   1 
ATOM   876  N N   . VAL A 1 120 ? -32.341 -42.153 16.440  1.00 61.66  ?  141 VAL A N   1 
ATOM   877  C CA  . VAL A 1 120 ? -31.846 -40.804 16.686  1.00 59.81  ?  141 VAL A CA  1 
ATOM   878  C C   . VAL A 1 120 ? -30.572 -40.530 15.892  1.00 57.32  ?  141 VAL A C   1 
ATOM   879  O O   . VAL A 1 120 ? -29.545 -41.172 16.112  1.00 56.74  ?  141 VAL A O   1 
ATOM   880  C CB  . VAL A 1 120 ? -31.560 -40.569 18.184  1.00 60.30  ?  141 VAL A CB  1 
ATOM   881  C CG1 . VAL A 1 120 ? -31.220 -39.110 18.433  1.00 58.87  ?  141 VAL A CG1 1 
ATOM   882  C CG2 . VAL A 1 120 ? -32.754 -40.986 19.029  1.00 63.10  ?  141 VAL A CG2 1 
ATOM   883  N N   . MET A 1 121 ? -30.642 -39.576 14.969  1.00 58.84  ?  142 MET A N   1 
ATOM   884  C CA  . MET A 1 121 ? -29.483 -39.216 14.161  1.00 57.32  ?  142 MET A CA  1 
ATOM   885  C C   . MET A 1 121 ? -28.971 -37.827 14.515  1.00 56.56  ?  142 MET A C   1 
ATOM   886  O O   . MET A 1 121 ? -29.674 -36.833 14.335  1.00 56.77  ?  142 MET A O   1 
ATOM   887  C CB  . MET A 1 121 ? -29.821 -39.275 12.670  1.00 57.36  ?  142 MET A CB  1 
ATOM   888  C CG  . MET A 1 121 ? -28.807 -38.580 11.773  1.00 58.58  ?  142 MET A CG  1 
ATOM   889  S SD  . MET A 1 121 ? -28.999 -39.023 10.038  1.00 61.03  ?  142 MET A SD  1 
ATOM   890  C CE  . MET A 1 121 ? -27.845 -37.891 9.267   1.00 64.63  ?  142 MET A CE  1 
ATOM   891  N N   . LEU A 1 122 ? -27.745 -37.761 15.022  1.00 56.66  ?  143 LEU A N   1 
ATOM   892  C CA  . LEU A 1 122 ? -27.108 -36.479 15.288  1.00 59.56  ?  143 LEU A CA  1 
ATOM   893  C C   . LEU A 1 122 ? -26.462 -35.956 14.011  1.00 59.88  ?  143 LEU A C   1 
ATOM   894  O O   . LEU A 1 122 ? -25.412 -36.439 13.587  1.00 56.74  ?  143 LEU A O   1 
ATOM   895  C CB  . LEU A 1 122 ? -26.074 -36.603 16.409  1.00 61.06  ?  143 LEU A CB  1 
ATOM   896  C CG  . LEU A 1 122 ? -26.553 -37.274 17.699  1.00 64.37  ?  143 LEU A CG  1 
ATOM   897  C CD1 . LEU A 1 122 ? -25.492 -37.171 18.786  1.00 65.27  ?  143 LEU A CD1 1 
ATOM   898  C CD2 . LEU A 1 122 ? -27.868 -36.670 18.171  1.00 66.24  ?  143 LEU A CD2 1 
ATOM   899  N N   . GLN A 1 123 ? -27.108 -34.971 13.398  1.00 56.99  ?  144 GLN A N   1 
ATOM   900  C CA  . GLN A 1 123 ? -26.677 -34.446 12.109  1.00 58.60  ?  144 GLN A CA  1 
ATOM   901  C C   . GLN A 1 123 ? -26.085 -33.049 12.256  1.00 57.95  ?  144 GLN A C   1 
ATOM   902  O O   . GLN A 1 123 ? -26.763 -32.131 12.713  1.00 60.69  ?  144 GLN A O   1 
ATOM   903  C CB  . GLN A 1 123 ? -27.858 -34.417 11.136  1.00 61.58  ?  144 GLN A CB  1 
ATOM   904  C CG  . GLN A 1 123 ? -27.481 -34.277 9.673   1.00 60.85  ?  144 GLN A CG  1 
ATOM   905  C CD  . GLN A 1 123 ? -28.684 -34.400 8.757   1.00 63.82  ?  144 GLN A CD  1 
ATOM   906  O OE1 . GLN A 1 123 ? -29.801 -34.042 9.131   1.00 62.43  ?  144 GLN A OE1 1 
ATOM   907  N NE2 . GLN A 1 123 ? -28.463 -34.914 7.553   1.00 66.58  ?  144 GLN A NE2 1 
ATOM   908  N N   . THR A 1 124 ? -24.822 -32.885 11.872  1.00 60.24  ?  145 THR A N   1 
ATOM   909  C CA  . THR A 1 124 ? -24.198 -31.568 11.933  1.00 60.69  ?  145 THR A CA  1 
ATOM   910  C C   . THR A 1 124 ? -24.740 -30.659 10.842  1.00 62.26  ?  145 THR A C   1 
ATOM   911  O O   . THR A 1 124 ? -24.582 -30.925 9.649   1.00 59.01  ?  145 THR A O   1 
ATOM   912  C CB  . THR A 1 124 ? -22.667 -31.638 11.811  1.00 58.28  ?  145 THR A CB  1 
ATOM   913  O OG1 . THR A 1 124 ? -22.123 -32.244 12.987  1.00 61.34  ?  145 THR A OG1 1 
ATOM   914  C CG2 . THR A 1 124 ? -22.083 -30.239 11.667  1.00 57.55  ?  145 THR A CG2 1 
ATOM   915  N N   . LEU A 1 125 ? -25.385 -29.583 11.270  1.00 57.14  ?  146 LEU A N   1 
ATOM   916  C CA  . LEU A 1 125 ? -25.943 -28.606 10.356  1.00 58.23  ?  146 LEU A CA  1 
ATOM   917  C C   . LEU A 1 125 ? -25.250 -27.257 10.487  1.00 58.05  ?  146 LEU A C   1 
ATOM   918  O O   . LEU A 1 125 ? -24.718 -26.906 11.543  1.00 57.75  ?  146 LEU A O   1 
ATOM   919  C CB  . LEU A 1 125 ? -27.443 -28.448 10.594  1.00 60.44  ?  146 LEU A CB  1 
ATOM   920  C CG  . LEU A 1 125 ? -28.320 -29.675 10.345  1.00 63.11  ?  146 LEU A CG  1 
ATOM   921  C CD1 . LEU A 1 125 ? -29.779 -29.359 10.635  1.00 63.97  ?  146 LEU A CD1 1 
ATOM   922  C CD2 . LEU A 1 125 ? -28.147 -30.161 8.918   1.00 64.21  ?  146 LEU A CD2 1 
ATOM   923  N N   . ILE A 1 126 ? -25.265 -26.511 9.391   1.00 61.36  ?  147 ILE A N   1 
ATOM   924  C CA  . ILE A 1 126 ? -24.689 -25.185 9.335   1.00 63.90  ?  147 ILE A CA  1 
ATOM   925  C C   . ILE A 1 126 ? -25.791 -24.166 9.082   1.00 66.58  ?  147 ILE A C   1 
ATOM   926  O O   . ILE A 1 126 ? -26.472 -24.204 8.045   1.00 66.27  ?  147 ILE A O   1 
ATOM   927  C CB  . ILE A 1 126 ? -23.614 -25.080 8.237   1.00 63.34  ?  147 ILE A CB  1 
ATOM   928  C CG1 . ILE A 1 126 ? -22.614 -26.232 8.364   1.00 59.23  ?  147 ILE A CG1 1 
ATOM   929  C CG2 . ILE A 1 126 ? -22.904 -23.736 8.309   1.00 64.32  ?  147 ILE A CG2 1 
ATOM   930  C CD1 . ILE A 1 126 ? -21.537 -26.233 7.302   1.00 58.28  ?  147 ILE A CD1 1 
ATOM   931  N N   . TRP A 1 127 ? -25.982 -23.295 10.068  1.00 72.88  ?  148 TRP A N   1 
ATOM   932  C CA  . TRP A 1 127 ? -26.806 -22.106 9.937   1.00 79.02  ?  148 TRP A CA  1 
ATOM   933  C C   . TRP A 1 127 ? -26.145 -21.154 8.963   1.00 79.42  ?  148 TRP A C   1 
ATOM   934  O O   . TRP A 1 127 ? -25.003 -20.714 9.182   1.00 74.75  ?  148 TRP A O   1 
ATOM   935  C CB  . TRP A 1 127 ? -27.011 -21.423 11.288  1.00 84.99  ?  148 TRP A CB  1 
ATOM   936  C CG  . TRP A 1 127 ? -27.908 -22.176 12.203  1.00 88.36  ?  148 TRP A CG  1 
ATOM   937  C CD1 . TRP A 1 127 ? -27.538 -22.973 13.244  1.00 92.35  ?  148 TRP A CD1 1 
ATOM   938  C CD2 . TRP A 1 127 ? -29.340 -22.213 12.155  1.00 92.88  ?  148 TRP A CD2 1 
ATOM   939  N NE1 . TRP A 1 127 ? -28.651 -23.500 13.853  1.00 97.18  ?  148 TRP A NE1 1 
ATOM   940  C CE2 . TRP A 1 127 ? -29.766 -23.050 13.204  1.00 96.43  ?  148 TRP A CE2 1 
ATOM   941  C CE3 . TRP A 1 127 ? -30.295 -21.617 11.329  1.00 98.18  ?  148 TRP A CE3 1 
ATOM   942  C CZ2 . TRP A 1 127 ? -31.115 -23.306 13.445  1.00 98.98  ?  148 TRP A CZ2 1 
ATOM   943  C CZ3 . TRP A 1 127 ? -31.631 -21.873 11.572  1.00 101.78 ?  148 TRP A CZ3 1 
ATOM   944  C CH2 . TRP A 1 127 ? -32.029 -22.710 12.622  1.00 104.59 ?  148 TRP A CH2 1 
ATOM   945  N N   . CYS A 1 128 ? -26.892 -20.838 7.909   1.00 77.82  ?  149 CYS A N   1 
ATOM   946  C CA  . CYS A 1 128 ? -26.396 -20.127 6.739   1.00 77.98  ?  149 CYS A CA  1 
ATOM   947  C C   . CYS A 1 128 ? -26.251 -18.633 6.990   1.00 74.76  ?  149 CYS A C   1 
ATOM   948  O O   . CYS A 1 128 ? -25.380 -17.982 6.416   1.00 72.17  ?  149 CYS A O   1 
ATOM   949  C CB  . CYS A 1 128 ? -27.342 -20.359 5.560   1.00 87.65  ?  149 CYS A CB  1 
ATOM   950  S SG  . CYS A 1 128 ? -27.817 -22.088 5.323   1.00 87.85  ?  149 CYS A SG  1 
ATOM   951  N N   . LYS A 1 129 ? -27.122 -18.093 7.836   1.00 71.34  ?  150 LYS A N   1 
ATOM   952  C CA  . LYS A 1 129 ? -27.102 -16.670 8.150   1.00 73.31  ?  150 LYS A CA  1 
ATOM   953  C C   . LYS A 1 129 ? -25.797 -16.274 8.830   1.00 72.90  ?  150 LYS A C   1 
ATOM   954  O O   . LYS A 1 129 ? -25.163 -15.288 8.457   1.00 74.70  ?  150 LYS A O   1 
ATOM   955  C CB  . LYS A 1 129 ? -28.289 -16.302 9.042   1.00 74.73  ?  150 LYS A CB  1 
ATOM   956  N N   . ASN A 1 130 ? -25.397 -17.063 9.820   1.00 76.23  ?  151 ASN A N   1 
ATOM   957  C CA  . ASN A 1 130 ? -24.233 -16.749 10.638  1.00 77.26  ?  151 ASN A CA  1 
ATOM   958  C C   . ASN A 1 130 ? -23.058 -17.698 10.424  1.00 75.48  ?  151 ASN A C   1 
ATOM   959  O O   . ASN A 1 130 ? -22.055 -17.619 11.136  1.00 69.27  ?  151 ASN A O   1 
ATOM   960  C CB  . ASN A 1 130 ? -24.631 -16.751 12.113  1.00 79.92  ?  151 ASN A CB  1 
ATOM   961  C CG  . ASN A 1 130 ? -25.479 -17.952 12.480  1.00 83.88  ?  151 ASN A CG  1 
ATOM   962  O OD1 . ASN A 1 130 ? -25.055 -19.094 12.327  1.00 83.80  ?  151 ASN A OD1 1 
ATOM   963  N ND2 . ASN A 1 130 ? -26.687 -17.697 12.968  1.00 89.00  ?  151 ASN A ND2 1 
ATOM   964  N N   . CYS A 1 131 ? -23.192 -18.588 9.443   1.00 85.59  ?  152 CYS A N   1 
ATOM   965  C CA  . CYS A 1 131 ? -22.160 -19.574 9.119   1.00 84.08  ?  152 CYS A CA  1 
ATOM   966  C C   . CYS A 1 131 ? -21.751 -20.399 10.332  1.00 79.48  ?  152 CYS A C   1 
ATOM   967  O O   . CYS A 1 131 ? -20.569 -20.700 10.505  1.00 81.20  ?  152 CYS A O   1 
ATOM   968  C CB  . CYS A 1 131 ? -20.926 -18.889 8.523   1.00 84.13  ?  152 CYS A CB  1 
ATOM   969  S SG  . CYS A 1 131 ? -21.151 -18.250 6.850   1.00 97.29  ?  152 CYS A SG  1 
ATOM   970  N N   . LYS A 1 132 ? -22.711 -20.772 11.173  1.00 74.77  ?  153 LYS A N   1 
ATOM   971  C CA  . LYS A 1 132 ? -22.329 -21.429 12.430  1.00 71.69  ?  153 LYS A CA  1 
ATOM   972  C C   . LYS A 1 132 ? -22.871 -22.846 12.552  1.00 69.99  ?  153 LYS A C   1 
ATOM   973  O O   . LYS A 1 132 ? -23.931 -23.160 12.030  1.00 69.19  ?  153 LYS A O   1 
ATOM   974  C CB  . LYS A 1 132 ? -22.780 -20.602 13.636  1.00 70.27  ?  153 LYS A CB  1 
ATOM   975  N N   . LYS A 1 133 ? -22.141 -23.698 13.261  1.00 65.58  ?  154 LYS A N   1 
ATOM   976  C CA  . LYS A 1 133 ? -22.489 -25.111 13.333  1.00 65.71  ?  154 LYS A CA  1 
ATOM   977  C C   . LYS A 1 133 ? -23.314 -25.468 14.564  1.00 66.19  ?  154 LYS A C   1 
ATOM   978  O O   . LYS A 1 133 ? -23.101 -24.932 15.652  1.00 64.35  ?  154 LYS A O   1 
ATOM   979  C CB  . LYS A 1 133 ? -21.220 -25.963 13.303  1.00 63.11  ?  154 LYS A CB  1 
ATOM   980  C CG  . LYS A 1 133 ? -20.425 -25.829 12.020  1.00 60.96  ?  154 LYS A CG  1 
ATOM   981  C CD  . LYS A 1 133 ? -19.516 -27.023 11.805  1.00 60.03  ?  154 LYS A CD  1 
ATOM   982  C CE  . LYS A 1 133 ? -18.501 -26.743 10.710  1.00 62.02  ?  154 LYS A CE  1 
ATOM   983  N NZ  . LYS A 1 133 ? -18.162 -27.972 9.942   1.00 65.60  ?  154 LYS A NZ  1 
ATOM   984  N N   . GLU A 1 134 ? -24.264 -26.377 14.374  1.00 66.38  ?  155 GLU A N   1 
ATOM   985  C CA  . GLU A 1 134 ? -25.002 -26.963 15.485  1.00 68.54  ?  155 GLU A CA  1 
ATOM   986  C C   . GLU A 1 134 ? -25.265 -28.433 15.191  1.00 64.38  ?  155 GLU A C   1 
ATOM   987  O O   . GLU A 1 134 ? -25.426 -28.820 14.037  1.00 61.51  ?  155 GLU A O   1 
ATOM   988  C CB  . GLU A 1 134 ? -26.323 -26.226 15.732  1.00 75.65  ?  155 GLU A CB  1 
ATOM   989  C CG  . GLU A 1 134 ? -27.444 -26.597 14.769  1.00 82.76  ?  155 GLU A CG  1 
ATOM   990  C CD  . GLU A 1 134 ? -28.817 -26.225 15.296  1.00 89.78  ?  155 GLU A CD  1 
ATOM   991  O OE1 . GLU A 1 134 ? -29.060 -25.024 15.534  1.00 99.62  ?  155 GLU A OE1 1 
ATOM   992  O OE2 . GLU A 1 134 ? -29.654 -27.137 15.472  1.00 85.35  -1 155 GLU A OE2 1 
ATOM   993  N N   . VAL A 1 135 ? -25.291 -29.258 16.230  1.00 68.46  ?  156 VAL A N   1 
ATOM   994  C CA  . VAL A 1 135 ? -25.651 -30.657 16.048  1.00 66.49  ?  156 VAL A CA  1 
ATOM   995  C C   . VAL A 1 135 ? -27.145 -30.826 16.287  1.00 64.78  ?  156 VAL A C   1 
ATOM   996  O O   . VAL A 1 135 ? -27.649 -30.530 17.371  1.00 66.98  ?  156 VAL A O   1 
ATOM   997  C CB  . VAL A 1 135 ? -24.858 -31.584 16.980  1.00 63.74  ?  156 VAL A CB  1 
ATOM   998  C CG1 . VAL A 1 135 ? -25.091 -33.033 16.593  1.00 63.52  ?  156 VAL A CG1 1 
ATOM   999  C CG2 . VAL A 1 135 ? -23.375 -31.257 16.904  1.00 62.35  ?  156 VAL A CG2 1 
ATOM   1000 N N   . HIS A 1 136 ? -27.847 -31.295 15.262  1.00 63.22  ?  157 HIS A N   1 
ATOM   1001 C CA  . HIS A 1 136 ? -29.300 -31.400 15.302  1.00 67.10  ?  157 HIS A CA  1 
ATOM   1002 C C   . HIS A 1 136 ? -29.750 -32.839 15.522  1.00 66.59  ?  157 HIS A C   1 
ATOM   1003 O O   . HIS A 1 136 ? -29.351 -33.744 14.787  1.00 65.75  ?  157 HIS A O   1 
ATOM   1004 C CB  . HIS A 1 136 ? -29.902 -30.848 14.008  1.00 70.45  ?  157 HIS A CB  1 
ATOM   1005 C CG  . HIS A 1 136 ? -31.397 -30.895 13.964  1.00 75.28  ?  157 HIS A CG  1 
ATOM   1006 N ND1 . HIS A 1 136 ? -32.189 -30.340 14.947  1.00 82.31  ?  157 HIS A ND1 1 
ATOM   1007 C CD2 . HIS A 1 136 ? -32.246 -31.423 13.051  1.00 77.44  ?  157 HIS A CD2 1 
ATOM   1008 C CE1 . HIS A 1 136 ? -33.461 -30.529 14.642  1.00 85.24  ?  157 HIS A CE1 1 
ATOM   1009 N NE2 . HIS A 1 136 ? -33.522 -31.183 13.497  1.00 80.97  ?  157 HIS A NE2 1 
ATOM   1010 N N   . ALA A 1 137 ? -30.583 -33.043 16.538  1.00 68.11  ?  158 ALA A N   1 
ATOM   1011 C CA  . ALA A 1 137 ? -31.069 -34.375 16.875  1.00 66.40  ?  158 ALA A CA  1 
ATOM   1012 C C   . ALA A 1 137 ? -32.330 -34.725 16.091  1.00 68.63  ?  158 ALA A C   1 
ATOM   1013 O O   . ALA A 1 137 ? -33.409 -34.197 16.360  1.00 67.66  ?  158 ALA A O   1 
ATOM   1014 C CB  . ALA A 1 137 ? -31.331 -34.480 18.370  1.00 65.16  ?  158 ALA A CB  1 
ATOM   1015 N N   . CYS A 1 138 ? -32.181 -35.617 15.117  1.00 66.81  ?  159 CYS A N   1 
ATOM   1016 C CA  . CYS A 1 138 ? -33.314 -36.116 14.349  1.00 70.29  ?  159 CYS A CA  1 
ATOM   1017 C C   . CYS A 1 138 ? -33.920 -37.325 15.049  1.00 68.04  ?  159 CYS A C   1 
ATOM   1018 O O   . CYS A 1 138 ? -33.279 -38.368 15.169  1.00 66.05  ?  159 CYS A O   1 
ATOM   1019 C CB  . CYS A 1 138 ? -32.888 -36.480 12.926  1.00 73.39  ?  159 CYS A CB  1 
ATOM   1020 S SG  . CYS A 1 138 ? -31.893 -35.216 12.101  1.00 79.64  ?  159 CYS A SG  1 
ATOM   1021 N N   . ARG A 1 139 ? -35.157 -37.179 15.511  1.00 69.31  ?  160 ARG A N   1 
ATOM   1022 C CA  . ARG A 1 139 ? -35.800 -38.223 16.297  1.00 69.57  ?  160 ARG A CA  1 
ATOM   1023 C C   . ARG A 1 139 ? -36.996 -38.844 15.587  1.00 71.33  ?  160 ARG A C   1 
ATOM   1024 O O   . ARG A 1 139 ? -37.859 -38.139 15.065  1.00 73.20  ?  160 ARG A O   1 
ATOM   1025 C CB  . ARG A 1 139 ? -36.237 -37.666 17.651  1.00 71.38  ?  160 ARG A CB  1 
ATOM   1026 C CG  . ARG A 1 139 ? -35.084 -37.286 18.559  1.00 72.16  ?  160 ARG A CG  1 
ATOM   1027 C CD  . ARG A 1 139 ? -35.565 -37.021 19.974  1.00 74.14  ?  160 ARG A CD  1 
ATOM   1028 N NE  . ARG A 1 139 ? -34.544 -36.360 20.777  1.00 74.22  ?  160 ARG A NE  1 
ATOM   1029 C CZ  . ARG A 1 139 ? -34.311 -35.052 20.756  1.00 80.18  ?  160 ARG A CZ  1 
ATOM   1030 N NH1 . ARG A 1 139 ? -35.032 -34.261 19.972  1.00 82.31  ?  160 ARG A NH1 1 
ATOM   1031 N NH2 . ARG A 1 139 ? -33.360 -34.533 21.520  1.00 83.70  ?  160 ARG A NH2 1 
ATOM   1032 N N   . LYS A 1 140 ? -37.038 -40.172 15.577  1.00 73.41  ?  161 LYS A N   1 
ATOM   1033 C CA  . LYS A 1 140 ? -38.154 -40.905 14.996  1.00 77.10  ?  161 LYS A CA  1 
ATOM   1034 C C   . LYS A 1 140 ? -38.349 -42.151 15.858  1.00 83.81  ?  161 LYS A C   1 
ATOM   1035 O O   . LYS A 1 140 ? -37.953 -42.168 17.024  1.00 84.79  ?  161 LYS A O   1 
ATOM   1036 C CB  . LYS A 1 140 ? -37.809 -41.383 13.584  1.00 73.22  ?  161 LYS A CB  1 
ATOM   1037 N N   . SER A 1 141 ? -38.958 -43.185 15.280  1.00 87.36  ?  162 SER A N   1 
ATOM   1038 C CA  . SER A 1 141 ? -39.348 -44.393 16.007  1.00 90.04  ?  162 SER A CA  1 
ATOM   1039 C C   . SER A 1 141 ? -38.251 -44.851 16.967  1.00 88.76  ?  162 SER A C   1 
ATOM   1040 O O   . SER A 1 141 ? -37.066 -44.739 16.658  1.00 87.16  ?  162 SER A O   1 
ATOM   1041 C CB  . SER A 1 141 ? -39.681 -45.519 15.025  1.00 90.63  ?  162 SER A CB  1 
ATOM   1042 O OG  . SER A 1 141 ? -40.655 -45.106 14.083  1.00 92.49  ?  162 SER A OG  1 
ATOM   1043 N N   . TYR A 1 142 ? -38.647 -45.351 18.134  1.00 88.59  ?  163 TYR A N   1 
ATOM   1044 C CA  . TYR A 1 142 ? -37.687 -45.862 19.108  1.00 84.00  ?  163 TYR A CA  1 
ATOM   1045 C C   . TYR A 1 142 ? -36.942 -47.064 18.538  1.00 82.06  ?  163 TYR A C   1 
ATOM   1046 O O   . TYR A 1 142 ? -35.730 -47.015 18.323  1.00 84.43  ?  163 TYR A O   1 
ATOM   1047 C CB  . TYR A 1 142 ? -38.391 -46.242 20.412  1.00 87.45  ?  163 TYR A CB  1 
ATOM   1048 N N   . ASP A 1 143 ? -37.679 -48.142 18.294  1.00 89.09  ?  164 ASP A N   1 
ATOM   1049 C CA  . ASP A 1 143 ? -37.126 -49.324 17.643  1.00 92.63  ?  164 ASP A CA  1 
ATOM   1050 C C   . ASP A 1 143 ? -37.406 -49.263 16.146  1.00 93.34  ?  164 ASP A C   1 
ATOM   1051 O O   . ASP A 1 143 ? -38.552 -49.089 15.732  1.00 94.64  ?  164 ASP A O   1 
ATOM   1052 C CB  . ASP A 1 143 ? -37.710 -50.601 18.251  1.00 92.36  ?  164 ASP A CB  1 
ATOM   1053 N N   . CYS A 1 144 ? -36.357 -49.409 15.341  1.00 90.94  ?  165 CYS A N   1 
ATOM   1054 C CA  . CYS A 1 144 ? -36.470 -49.219 13.898  1.00 95.16  ?  165 CYS A CA  1 
ATOM   1055 C C   . CYS A 1 144 ? -37.398 -50.208 13.213  1.00 89.00  ?  165 CYS A C   1 
ATOM   1056 O O   . CYS A 1 144 ? -38.242 -49.821 12.406  1.00 94.12  ?  165 CYS A O   1 
ATOM   1057 C CB  . CYS A 1 144 ? -35.084 -49.277 13.245  1.00 97.19  ?  165 CYS A CB  1 
ATOM   1058 S SG  . CYS A 1 144 ? -33.998 -47.895 13.677  1.00 103.10 ?  165 CYS A SG  1 
ATOM   1059 N N   . GLY A 1 145 ? -37.236 -51.483 13.530  1.00 85.05  ?  166 GLY A N   1 
ATOM   1060 C CA  . GLY A 1 145 ? -38.062 -52.507 12.930  1.00 88.67  ?  166 GLY A CA  1 
ATOM   1061 C C   . GLY A 1 145 ? -37.652 -53.883 13.396  1.00 85.65  ?  166 GLY A C   1 
ATOM   1062 O O   . GLY A 1 145 ? -36.912 -54.026 14.370  1.00 79.92  ?  166 GLY A O   1 
ATOM   1063 N N   . GLU A 1 146 ? -38.137 -54.903 12.703  1.00 85.55  ?  167 GLU A N   1 
ATOM   1064 C CA  . GLU A 1 146 ? -37.764 -56.267 13.026  1.00 85.43  ?  167 GLU A CA  1 
ATOM   1065 C C   . GLU A 1 146 ? -37.300 -56.986 11.769  1.00 82.53  ?  167 GLU A C   1 
ATOM   1066 O O   . GLU A 1 146 ? -37.970 -56.954 10.738  1.00 86.47  ?  167 GLU A O   1 
ATOM   1067 C CB  . GLU A 1 146 ? -38.932 -57.008 13.677  1.00 89.41  ?  167 GLU A CB  1 
ATOM   1068 C CG  . GLU A 1 146 ? -38.592 -58.416 14.134  1.00 94.55  ?  167 GLU A CG  1 
ATOM   1069 C CD  . GLU A 1 146 ? -39.752 -59.096 14.832  1.00 104.58 ?  167 GLU A CD  1 
ATOM   1070 O OE1 . GLU A 1 146 ? -40.837 -58.482 14.922  1.00 110.33 ?  167 GLU A OE1 1 
ATOM   1071 O OE2 . GLU A 1 146 ? -39.577 -60.243 15.294  1.00 112.39 -1 167 GLU A OE2 1 
ATOM   1072 N N   . ARG A 1 147 ? -36.137 -57.619 11.860  1.00 81.37  ?  168 ARG A N   1 
ATOM   1073 C CA  . ARG A 1 147 ? -35.580 -58.363 10.742  1.00 83.47  ?  168 ARG A CA  1 
ATOM   1074 C C   . ARG A 1 147 ? -35.922 -59.837 10.876  1.00 85.31  ?  168 ARG A C   1 
ATOM   1075 O O   . ARG A 1 147 ? -35.828 -60.404 11.961  1.00 87.26  ?  168 ARG A O   1 
ATOM   1076 C CB  . ARG A 1 147 ? -34.062 -58.182 10.672  1.00 84.38  ?  168 ARG A CB  1 
ATOM   1077 C CG  . ARG A 1 147 ? -33.609 -56.735 10.668  1.00 84.41  ?  168 ARG A CG  1 
ATOM   1078 C CD  . ARG A 1 147 ? -33.893 -56.061 9.339   1.00 84.32  ?  168 ARG A CD  1 
ATOM   1079 N NE  . ARG A 1 147 ? -33.747 -54.611 9.424   1.00 86.52  ?  168 ARG A NE  1 
ATOM   1080 C CZ  . ARG A 1 147 ? -34.692 -53.788 9.870   1.00 86.24  ?  168 ARG A CZ  1 
ATOM   1081 N NH1 . ARG A 1 147 ? -35.861 -54.270 10.272  1.00 91.39  ?  168 ARG A NH1 1 
ATOM   1082 N NH2 . ARG A 1 147 ? -34.469 -52.481 9.912   1.00 81.51  ?  168 ARG A NH2 1 
ATOM   1083 N N   . ASN A 1 148 ? -36.331 -60.454 9.775   1.00 86.01  ?  169 ASN A N   1 
ATOM   1084 C CA  . ASN A 1 148 ? -36.535 -61.894 9.757   1.00 89.71  ?  169 ASN A CA  1 
ATOM   1085 C C   . ASN A 1 148 ? -35.417 -62.579 8.988   1.00 90.00  ?  169 ASN A C   1 
ATOM   1086 O O   . ASN A 1 148 ? -35.375 -62.535 7.759   1.00 92.41  ?  169 ASN A O   1 
ATOM   1087 C CB  . ASN A 1 148 ? -37.894 -62.250 9.154   1.00 89.54  ?  169 ASN A CB  1 
ATOM   1088 C CG  . ASN A 1 148 ? -38.997 -62.301 10.195  1.00 89.69  ?  169 ASN A CG  1 
ATOM   1089 O OD1 . ASN A 1 148 ? -39.266 -63.352 10.778  1.00 95.26  ?  169 ASN A OD1 1 
ATOM   1090 N ND2 . ASN A 1 148 ? -39.640 -61.164 10.434  1.00 86.53  ?  169 ASN A ND2 1 
ATOM   1091 N N   . VAL A 1 149 ? -34.503 -63.202 9.723   1.00 87.99  ?  170 VAL A N   1 
ATOM   1092 C CA  . VAL A 1 149 ? -33.371 -63.870 9.102   1.00 89.01  ?  170 VAL A CA  1 
ATOM   1093 C C   . VAL A 1 149 ? -33.604 -65.372 9.030   1.00 91.11  ?  170 VAL A C   1 
ATOM   1094 O O   . VAL A 1 149 ? -33.877 -66.018 10.038  1.00 91.65  ?  170 VAL A O   1 
ATOM   1095 C CB  . VAL A 1 149 ? -32.061 -63.590 9.863   1.00 88.35  ?  170 VAL A CB  1 
ATOM   1096 C CG1 . VAL A 1 149 ? -30.891 -64.282 9.182   1.00 86.29  ?  170 VAL A CG1 1 
ATOM   1097 C CG2 . VAL A 1 149 ? -31.813 -62.092 9.954   1.00 86.60  ?  170 VAL A CG2 1 
ATOM   1098 N N   . GLU A 1 150 ? -33.518 -65.917 7.823   1.00 90.78  ?  171 GLU A N   1 
ATOM   1099 C CA  . GLU A 1 150 ? -33.562 -67.358 7.634   1.00 96.21  ?  171 GLU A CA  1 
ATOM   1100 C C   . GLU A 1 150 ? -32.228 -67.799 7.058   1.00 97.63  ?  171 GLU A C   1 
ATOM   1101 O O   . GLU A 1 150 ? -31.726 -67.203 6.103   1.00 99.06  ?  171 GLU A O   1 
ATOM   1102 C CB  . GLU A 1 150 ? -34.717 -67.764 6.718   1.00 96.96  ?  171 GLU A CB  1 
ATOM   1103 N N   . VAL A 1 151 ? -31.652 -68.836 7.649   1.00 98.17  ?  172 VAL A N   1 
ATOM   1104 C CA  . VAL A 1 151 ? -30.308 -69.253 7.287   1.00 103.79 ?  172 VAL A CA  1 
ATOM   1105 C C   . VAL A 1 151 ? -30.225 -70.778 7.266   1.00 105.17 ?  172 VAL A C   1 
ATOM   1106 O O   . VAL A 1 151 ? -30.715 -71.442 8.174   1.00 106.41 ?  172 VAL A O   1 
ATOM   1107 C CB  . VAL A 1 151 ? -29.270 -68.644 8.274   1.00 104.99 ?  172 VAL A CB  1 
ATOM   1108 C CG1 . VAL A 1 151 ? -28.397 -69.699 8.893   1.00 110.81 ?  172 VAL A CG1 1 
ATOM   1109 C CG2 . VAL A 1 151 ? -28.424 -67.589 7.586   1.00 102.74 ?  172 VAL A CG2 1 
ATOM   1110 N N   . PRO A 1 152 ? -29.645 -71.350 6.203   1.00 104.48 ?  173 PRO A N   1 
ATOM   1111 C CA  . PRO A 1 152 ? -29.543 -72.810 6.250   1.00 109.49 ?  173 PRO A CA  1 
ATOM   1112 C C   . PRO A 1 152 ? -28.429 -73.252 7.190   1.00 110.24 ?  173 PRO A C   1 
ATOM   1113 O O   . PRO A 1 152 ? -27.460 -72.517 7.363   1.00 112.77 ?  173 PRO A O   1 
ATOM   1114 C CB  . PRO A 1 152 ? -29.236 -73.190 4.800   1.00 112.50 ?  173 PRO A CB  1 
ATOM   1115 C CG  . PRO A 1 152 ? -28.584 -71.984 4.221   1.00 110.11 ?  173 PRO A CG  1 
ATOM   1116 C CD  . PRO A 1 152 ? -29.189 -70.794 4.918   1.00 105.81 ?  173 PRO A CD  1 
ATOM   1117 N N   . GLN A 1 153 ? -28.577 -74.426 7.797   1.00 108.68 ?  174 GLN A N   1 
ATOM   1118 C CA  . GLN A 1 153 ? -27.548 -74.959 8.681   1.00 108.18 ?  174 GLN A CA  1 
ATOM   1119 C C   . GLN A 1 153 ? -26.236 -75.127 7.922   1.00 108.84 ?  174 GLN A C   1 
ATOM   1120 O O   . GLN A 1 153 ? -26.242 -75.359 6.712   1.00 119.36 ?  174 GLN A O   1 
ATOM   1121 C CB  . GLN A 1 153 ? -27.991 -76.293 9.285   1.00 113.08 ?  174 GLN A CB  1 
ATOM   1122 N N   . MET A 1 154 ? -25.127 -74.982 8.647   1.00 103.05 ?  175 MET A N   1 
ATOM   1123 C CA  . MET A 1 154 ? -23.766 -75.069 8.105   1.00 109.00 ?  175 MET A CA  1 
ATOM   1124 C C   . MET A 1 154 ? -23.400 -73.885 7.206   1.00 108.20 ?  175 MET A C   1 
ATOM   1125 O O   . MET A 1 154 ? -22.278 -73.807 6.705   1.00 107.66 ?  175 MET A O   1 
ATOM   1126 C CB  . MET A 1 154 ? -23.563 -76.385 7.347   1.00 113.19 ?  175 MET A CB  1 
ATOM   1127 C CG  . MET A 1 154 ? -23.765 -77.616 8.211   1.00 118.93 ?  175 MET A CG  1 
ATOM   1128 S SD  . MET A 1 154 ? -22.797 -77.538 9.730   1.00 123.92 ?  175 MET A SD  1 
ATOM   1129 C CE  . MET A 1 154 ? -24.006 -78.090 10.930  1.00 119.41 ?  175 MET A CE  1 
ATOM   1130 N N   . GLU A 1 155 ? -24.337 -72.965 7.004   1.00 110.31 ?  176 GLU A N   1 
ATOM   1131 C CA  . GLU A 1 155 ? -24.021 -71.705 6.345   1.00 105.77 ?  176 GLU A CA  1 
ATOM   1132 C C   . GLU A 1 155 ? -23.525 -70.726 7.400   1.00 110.61 ?  176 GLU A C   1 
ATOM   1133 O O   . GLU A 1 155 ? -23.545 -71.034 8.589   1.00 111.70 ?  176 GLU A O   1 
ATOM   1134 C CB  . GLU A 1 155 ? -25.238 -71.141 5.609   1.00 99.63  ?  176 GLU A CB  1 
ATOM   1135 N N   . ASP A 1 156 ? -23.069 -69.554 6.975   1.00 113.68 ?  177 ASP A N   1 
ATOM   1136 C CA  . ASP A 1 156 ? -22.664 -68.534 7.933   1.00 108.35 ?  177 ASP A CA  1 
ATOM   1137 C C   . ASP A 1 156 ? -23.805 -67.555 8.177   1.00 104.25 ?  177 ASP A C   1 
ATOM   1138 O O   . ASP A 1 156 ? -24.415 -67.049 7.235   1.00 109.20 ?  177 ASP A O   1 
ATOM   1139 C CB  . ASP A 1 156 ? -21.415 -67.791 7.454   1.00 107.24 ?  177 ASP A CB  1 
ATOM   1140 C CG  . ASP A 1 156 ? -20.364 -68.722 6.882   1.00 108.26 ?  177 ASP A CG  1 
ATOM   1141 O OD1 . ASP A 1 156 ? -20.465 -69.947 7.106   1.00 111.23 ?  177 ASP A OD1 1 
ATOM   1142 O OD2 . ASP A 1 156 ? -19.429 -68.227 6.216   1.00 100.59 -1 177 ASP A OD2 1 
ATOM   1143 N N   . MET A 1 157 ? -24.097 -67.303 9.448   1.00 98.42  ?  178 MET A N   1 
ATOM   1144 C CA  . MET A 1 157 ? -25.145 -66.363 9.815   1.00 93.08  ?  178 MET A CA  1 
ATOM   1145 C C   . MET A 1 157 ? -24.581 -64.953 9.916   1.00 88.82  ?  178 MET A C   1 
ATOM   1146 O O   . MET A 1 157 ? -23.588 -64.726 10.606  1.00 93.11  ?  178 MET A O   1 
ATOM   1147 C CB  . MET A 1 157 ? -25.795 -66.761 11.138  1.00 92.22  ?  178 MET A CB  1 
ATOM   1148 C CG  . MET A 1 157 ? -26.971 -65.883 11.524  1.00 89.89  ?  178 MET A CG  1 
ATOM   1149 S SD  . MET A 1 157 ? -27.507 -66.112 13.229  1.00 95.15  ?  178 MET A SD  1 
ATOM   1150 C CE  . MET A 1 157 ? -26.013 -65.687 14.119  1.00 94.68  ?  178 MET A CE  1 
ATOM   1151 N N   . ILE A 1 158 ? -25.219 -64.011 9.229   1.00 82.26  ?  179 ILE A N   1 
ATOM   1152 C CA  . ILE A 1 158 ? -24.768 -62.624 9.233   1.00 79.50  ?  179 ILE A CA  1 
ATOM   1153 C C   . ILE A 1 158 ? -25.893 -61.668 9.619   1.00 76.57  ?  179 ILE A C   1 
ATOM   1154 O O   . ILE A 1 158 ? -26.849 -61.481 8.866   1.00 77.58  ?  179 ILE A O   1 
ATOM   1155 C CB  . ILE A 1 158 ? -24.209 -62.209 7.858   1.00 80.75  ?  179 ILE A CB  1 
ATOM   1156 C CG1 . ILE A 1 158 ? -23.009 -63.082 7.482   1.00 87.31  ?  179 ILE A CG1 1 
ATOM   1157 C CG2 . ILE A 1 158 ? -23.823 -60.737 7.862   1.00 77.69  ?  179 ILE A CG2 1 
ATOM   1158 C CD1 . ILE A 1 158 ? -22.257 -62.600 6.260   1.00 88.77  ?  179 ILE A CD1 1 
ATOM   1159 N N   . LEU A 1 159 ? -25.771 -61.068 10.799  1.00 74.84  ?  180 LEU A N   1 
ATOM   1160 C CA  . LEU A 1 159 ? -26.737 -60.077 11.262  1.00 72.61  ?  180 LEU A CA  1 
ATOM   1161 C C   . LEU A 1 159 ? -26.197 -58.671 11.039  1.00 73.59  ?  180 LEU A C   1 
ATOM   1162 O O   . LEU A 1 159 ? -25.119 -58.336 11.521  1.00 73.31  ?  180 LEU A O   1 
ATOM   1163 C CB  . LEU A 1 159 ? -27.066 -60.285 12.744  1.00 70.05  ?  180 LEU A CB  1 
ATOM   1164 C CG  . LEU A 1 159 ? -28.168 -61.275 13.139  1.00 71.05  ?  180 LEU A CG  1 
ATOM   1165 C CD1 . LEU A 1 159 ? -28.090 -62.574 12.354  1.00 74.57  ?  180 LEU A CD1 1 
ATOM   1166 C CD2 . LEU A 1 159 ? -28.118 -61.552 14.635  1.00 69.67  ?  180 LEU A CD2 1 
ATOM   1167 N N   . ASP A 1 160 ? -26.945 -57.849 10.310  1.00 74.02  ?  181 ASP A N   1 
ATOM   1168 C CA  . ASP A 1 160 ? -26.496 -56.495 10.006  1.00 71.42  ?  181 ASP A CA  1 
ATOM   1169 C C   . ASP A 1 160 ? -27.365 -55.461 10.716  1.00 68.78  ?  181 ASP A C   1 
ATOM   1170 O O   . ASP A 1 160 ? -28.578 -55.407 10.514  1.00 70.54  ?  181 ASP A O   1 
ATOM   1171 C CB  . ASP A 1 160 ? -26.511 -56.253 8.494   1.00 72.31  ?  181 ASP A CB  1 
ATOM   1172 C CG  . ASP A 1 160 ? -25.703 -55.032 8.088   1.00 75.64  ?  181 ASP A CG  1 
ATOM   1173 O OD1 . ASP A 1 160 ? -25.438 -54.169 8.950   1.00 80.88  ?  181 ASP A OD1 1 
ATOM   1174 O OD2 . ASP A 1 160 ? -25.331 -54.936 6.900   1.00 72.22  -1 181 ASP A OD2 1 
ATOM   1175 N N   . CYS A 1 161 ? -26.730 -54.637 11.544  1.00 63.76  ?  182 CYS A N   1 
ATOM   1176 C CA  . CYS A 1 161 ? -27.430 -53.603 12.295  1.00 67.50  ?  182 CYS A CA  1 
ATOM   1177 C C   . CYS A 1 161 ? -27.128 -52.216 11.730  1.00 66.18  ?  182 CYS A C   1 
ATOM   1178 O O   . CYS A 1 161 ? -27.436 -51.201 12.354  1.00 69.24  ?  182 CYS A O   1 
ATOM   1179 C CB  . CYS A 1 161 ? -27.041 -53.668 13.775  1.00 71.06  ?  182 CYS A CB  1 
ATOM   1180 S SG  . CYS A 1 161 ? -28.195 -52.856 14.907  1.00 71.63  ?  182 CYS A SG  1 
ATOM   1181 N N   . GLU A 1 162 ? -26.528 -52.178 10.545  1.00 65.51  ?  183 GLU A N   1 
ATOM   1182 C CA  . GLU A 1 162 ? -26.132 -50.914 9.933   1.00 63.21  ?  183 GLU A CA  1 
ATOM   1183 C C   . GLU A 1 162 ? -27.209 -50.357 9.011   1.00 63.55  ?  183 GLU A C   1 
ATOM   1184 O O   . GLU A 1 162 ? -27.821 -51.091 8.236   1.00 64.64  ?  183 GLU A O   1 
ATOM   1185 C CB  . GLU A 1 162 ? -24.826 -51.079 9.153   1.00 60.57  ?  183 GLU A CB  1 
ATOM   1186 N N   . LEU A 1 163 ? -27.429 -49.050 9.103   1.00 65.35  ?  184 LEU A N   1 
ATOM   1187 C CA  . LEU A 1 163 ? -28.366 -48.361 8.227   1.00 66.49  ?  184 LEU A CA  1 
ATOM   1188 C C   . LEU A 1 163 ? -27.623 -47.320 7.392   1.00 66.83  ?  184 LEU A C   1 
ATOM   1189 O O   . LEU A 1 163 ? -26.513 -46.915 7.740   1.00 64.54  ?  184 LEU A O   1 
ATOM   1190 C CB  . LEU A 1 163 ? -29.488 -47.711 9.040   1.00 66.80  ?  184 LEU A CB  1 
ATOM   1191 C CG  . LEU A 1 163 ? -30.165 -48.605 10.085  1.00 65.01  ?  184 LEU A CG  1 
ATOM   1192 C CD1 . LEU A 1 163 ? -31.314 -47.875 10.764  1.00 60.19  ?  184 LEU A CD1 1 
ATOM   1193 C CD2 . LEU A 1 163 ? -30.654 -49.905 9.462   1.00 65.93  ?  184 LEU A CD2 1 
ATOM   1194 N N   . ASN A 1 164 ? -28.245 -46.888 6.299   1.00 68.07  ?  185 ASN A N   1 
ATOM   1195 C CA  A ASN A 1 164 ? -27.619 -45.961 5.358   0.54 67.86  ?  185 ASN A CA  1 
ATOM   1196 C CA  B ASN A 1 164 ? -27.618 -45.961 5.361   0.46 67.95  ?  185 ASN A CA  1 
ATOM   1197 C C   . ASN A 1 164 ? -27.162 -44.654 6.007   1.00 66.40  ?  185 ASN A C   1 
ATOM   1198 O O   . ASN A 1 164 ? -26.283 -43.968 5.485   1.00 67.07  ?  185 ASN A O   1 
ATOM   1199 C CB  A ASN A 1 164 ? -28.587 -45.658 4.208   0.54 68.76  ?  185 ASN A CB  1 
ATOM   1200 C CB  B ASN A 1 164 ? -28.575 -45.647 4.205   0.46 68.95  ?  185 ASN A CB  1 
ATOM   1201 C CG  A ASN A 1 164 ? -27.943 -44.859 3.088   0.54 68.44  ?  185 ASN A CG  1 
ATOM   1202 C CG  B ASN A 1 164 ? -29.897 -46.389 4.313   0.46 68.63  ?  185 ASN A CG  1 
ATOM   1203 O OD1 A ASN A 1 164 ? -26.726 -44.891 2.902   0.54 67.01  ?  185 ASN A OD1 1 
ATOM   1204 O OD1 B ASN A 1 164 ? -30.239 -46.932 5.364   0.46 67.76  ?  185 ASN A OD1 1 
ATOM   1205 N ND2 A ASN A 1 164 ? -28.762 -44.135 2.334   0.54 68.93  ?  185 ASN A ND2 1 
ATOM   1206 N ND2 B ASN A 1 164 ? -30.651 -46.410 3.220   0.46 68.74  ?  185 ASN A ND2 1 
ATOM   1207 N N   . TRP A 1 165 ? -27.750 -44.312 7.150   1.00 68.33  ?  186 TRP A N   1 
ATOM   1208 C CA  . TRP A 1 165 ? -27.460 -43.029 7.786   1.00 66.08  ?  186 TRP A CA  1 
ATOM   1209 C C   . TRP A 1 165 ? -26.543 -43.095 9.012   1.00 66.56  ?  186 TRP A C   1 
ATOM   1210 O O   . TRP A 1 165 ? -26.231 -42.061 9.602   1.00 65.15  ?  186 TRP A O   1 
ATOM   1211 C CB  . TRP A 1 165 ? -28.773 -42.343 8.174   1.00 64.37  ?  186 TRP A CB  1 
ATOM   1212 C CG  . TRP A 1 165 ? -29.609 -43.144 9.117   1.00 62.34  ?  186 TRP A CG  1 
ATOM   1213 C CD1 . TRP A 1 165 ? -30.600 -44.022 8.791   1.00 65.98  ?  186 TRP A CD1 1 
ATOM   1214 C CD2 . TRP A 1 165 ? -29.533 -43.138 10.550  1.00 61.04  ?  186 TRP A CD2 1 
ATOM   1215 N NE1 . TRP A 1 165 ? -31.144 -44.566 9.930   1.00 64.12  ?  186 TRP A NE1 1 
ATOM   1216 C CE2 . TRP A 1 165 ? -30.508 -44.041 11.017  1.00 59.66  ?  186 TRP A CE2 1 
ATOM   1217 C CE3 . TRP A 1 165 ? -28.735 -42.459 11.473  1.00 65.58  ?  186 TRP A CE3 1 
ATOM   1218 C CZ2 . TRP A 1 165 ? -30.703 -44.278 12.379  1.00 59.49  ?  186 TRP A CZ2 1 
ATOM   1219 C CZ3 . TRP A 1 165 ? -28.933 -42.699 12.821  1.00 61.94  ?  186 TRP A CZ3 1 
ATOM   1220 C CH2 . TRP A 1 165 ? -29.909 -43.600 13.261  1.00 59.00  ?  186 TRP A CH2 1 
ATOM   1221 N N   . HIS A 1 166 ? -26.111 -44.292 9.399   1.00 65.35  ?  187 HIS A N   1 
ATOM   1222 C CA  . HIS A 1 166 ? -25.203 -44.422 10.538  1.00 64.70  ?  187 HIS A CA  1 
ATOM   1223 C C   . HIS A 1 166 ? -23.835 -43.831 10.219  1.00 64.13  ?  187 HIS A C   1 
ATOM   1224 O O   . HIS A 1 166 ? -23.181 -43.246 11.083  1.00 66.69  ?  187 HIS A O   1 
ATOM   1225 C CB  . HIS A 1 166 ? -25.054 -45.884 10.959  1.00 63.37  ?  187 HIS A CB  1 
ATOM   1226 C CG  . HIS A 1 166 ? -26.249 -46.431 11.681  1.00 60.49  ?  187 HIS A CG  1 
ATOM   1227 N ND1 . HIS A 1 166 ? -26.399 -47.768 11.958  1.00 58.47  ?  187 HIS A ND1 1 
ATOM   1228 C CD2 . HIS A 1 166 ? -27.344 -45.810 12.179  1.00 61.18  ?  187 HIS A CD2 1 
ATOM   1229 C CE1 . HIS A 1 166 ? -27.543 -47.955 12.602  1.00 57.81  ?  187 HIS A CE1 1 
ATOM   1230 N NE2 . HIS A 1 166 ? -28.132 -46.785 12.746  1.00 59.97  ?  187 HIS A NE2 1 
ATOM   1231 N N   . GLN A 1 167 ? -23.416 -43.981 8.968   1.00 67.37  ?  188 GLN A N   1 
ATOM   1232 C CA  . GLN A 1 167 ? -22.149 -43.435 8.495   1.00 66.63  ?  188 GLN A CA  1 
ATOM   1233 C C   . GLN A 1 167 ? -22.146 -41.908 8.495   1.00 63.77  ?  188 GLN A C   1 
ATOM   1234 O O   . GLN A 1 167 ? -21.102 -41.281 8.314   1.00 67.69  ?  188 GLN A O   1 
ATOM   1235 C CB  . GLN A 1 167 ? -21.853 -43.948 7.088   1.00 67.73  ?  188 GLN A CB  1 
ATOM   1236 C CG  . GLN A 1 167 ? -22.914 -43.552 6.075   1.00 71.75  ?  188 GLN A CG  1 
ATOM   1237 C CD  . GLN A 1 167 ? -22.361 -43.395 4.677   1.00 73.04  ?  188 GLN A CD  1 
ATOM   1238 O OE1 . GLN A 1 167 ? -21.611 -44.244 4.194   1.00 74.78  ?  188 GLN A OE1 1 
ATOM   1239 N NE2 . GLN A 1 167 ? -22.727 -42.303 4.016   1.00 80.57  ?  188 GLN A NE2 1 
ATOM   1240 N N   . ALA A 1 168 ? -23.320 -41.317 8.689   1.00 63.01  ?  189 ALA A N   1 
ATOM   1241 C CA  . ALA A 1 168 ? -23.464 -39.867 8.652   1.00 65.13  ?  189 ALA A CA  1 
ATOM   1242 C C   . ALA A 1 168 ? -23.909 -39.304 10.000  1.00 65.94  ?  189 ALA A C   1 
ATOM   1243 O O   . ALA A 1 168 ? -23.956 -38.088 10.185  1.00 61.21  ?  189 ALA A O   1 
ATOM   1244 C CB  . ALA A 1 168 ? -24.446 -39.467 7.564   1.00 65.65  ?  189 ALA A CB  1 
ATOM   1245 N N   . SER A 1 169 ? -24.240 -40.188 10.936  1.00 65.92  ?  190 SER A N   1 
ATOM   1246 C CA  . SER A 1 169 ? -24.603 -39.759 12.282  1.00 64.80  ?  190 SER A CA  1 
ATOM   1247 C C   . SER A 1 169 ? -23.342 -39.423 13.069  1.00 59.92  ?  190 SER A C   1 
ATOM   1248 O O   . SER A 1 169 ? -22.229 -39.639 12.590  1.00 54.89  ?  190 SER A O   1 
ATOM   1249 C CB  . SER A 1 169 ? -25.415 -40.838 13.001  1.00 65.59  ?  190 SER A CB  1 
ATOM   1250 O OG  . SER A 1 169 ? -25.907 -40.362 14.242  1.00 66.19  ?  190 SER A OG  1 
ATOM   1251 N N   . GLU A 1 170 ? -23.515 -38.891 14.275  1.00 59.52  ?  191 GLU A N   1 
ATOM   1252 C CA  . GLU A 1 170 ? -22.378 -38.468 15.085  1.00 58.20  ?  191 GLU A CA  1 
ATOM   1253 C C   . GLU A 1 170 ? -22.551 -38.837 16.553  1.00 56.74  ?  191 GLU A C   1 
ATOM   1254 O O   . GLU A 1 170 ? -23.653 -39.160 16.995  1.00 58.68  ?  191 GLU A O   1 
ATOM   1255 C CB  . GLU A 1 170 ? -22.167 -36.963 14.946  1.00 61.54  ?  191 GLU A CB  1 
ATOM   1256 C CG  . GLU A 1 170 ? -21.645 -36.549 13.585  1.00 68.23  ?  191 GLU A CG  1 
ATOM   1257 C CD  . GLU A 1 170 ? -21.993 -35.121 13.247  1.00 73.51  ?  191 GLU A CD  1 
ATOM   1258 O OE1 . GLU A 1 170 ? -22.166 -34.315 14.185  1.00 71.56  ?  191 GLU A OE1 1 
ATOM   1259 O OE2 . GLU A 1 170 ? -22.102 -34.803 12.043  1.00 75.26  -1 191 GLU A OE2 1 
ATOM   1260 N N   . GLY A 1 171 ? -21.454 -38.782 17.302  1.00 60.20  ?  192 GLY A N   1 
ATOM   1261 C CA  . GLY A 1 171 ? -21.463 -39.162 18.702  1.00 60.43  ?  192 GLY A CA  1 
ATOM   1262 C C   . GLY A 1 171 ? -21.894 -40.604 18.875  1.00 57.69  ?  192 GLY A C   1 
ATOM   1263 O O   . GLY A 1 171 ? -22.657 -40.929 19.782  1.00 57.11  ?  192 GLY A O   1 
ATOM   1264 N N   . LEU A 1 172 ? -21.406 -41.469 17.992  1.00 54.93  ?  193 LEU A N   1 
ATOM   1265 C CA  . LEU A 1 172 ? -21.783 -42.876 18.009  1.00 53.83  ?  193 LEU A CA  1 
ATOM   1266 C C   . LEU A 1 172 ? -20.830 -43.711 18.854  1.00 55.01  ?  193 LEU A C   1 
ATOM   1267 O O   . LEU A 1 172 ? -19.611 -43.573 18.753  1.00 55.80  ?  193 LEU A O   1 
ATOM   1268 C CB  . LEU A 1 172 ? -21.827 -43.433 16.585  1.00 52.52  ?  193 LEU A CB  1 
ATOM   1269 C CG  . LEU A 1 172 ? -22.983 -42.973 15.696  1.00 54.15  ?  193 LEU A CG  1 
ATOM   1270 C CD1 . LEU A 1 172 ? -22.918 -43.667 14.346  1.00 52.96  ?  193 LEU A CD1 1 
ATOM   1271 C CD2 . LEU A 1 172 ? -24.318 -43.235 16.373  1.00 56.99  ?  193 LEU A CD2 1 
ATOM   1272 N N   . THR A 1 173 ? -21.394 -44.575 19.691  1.00 56.15  ?  194 THR A N   1 
ATOM   1273 C CA  . THR A 1 173 ? -20.600 -45.548 20.428  1.00 57.67  ?  194 THR A CA  1 
ATOM   1274 C C   . THR A 1 173 ? -20.648 -46.863 19.652  1.00 57.32  ?  194 THR A C   1 
ATOM   1275 O O   . THR A 1 173 ? -21.019 -46.879 18.480  1.00 63.16  ?  194 THR A O   1 
ATOM   1276 C CB  . THR A 1 173 ? -21.112 -45.738 21.872  1.00 61.02  ?  194 THR A CB  1 
ATOM   1277 O OG1 . THR A 1 173 ? -21.663 -44.506 22.348  1.00 61.30  ?  194 THR A OG1 1 
ATOM   1278 C CG2 . THR A 1 173 ? -19.977 -46.156 22.804  1.00 67.49  ?  194 THR A CG2 1 
ATOM   1279 N N   . ASP A 1 174 ? -20.285 -47.962 20.302  1.00 55.25  ?  195 ASP A N   1 
ATOM   1280 C CA  . ASP A 1 174 ? -20.167 -49.244 19.622  1.00 55.00  ?  195 ASP A CA  1 
ATOM   1281 C C   . ASP A 1 174 ? -21.513 -49.892 19.311  1.00 53.76  ?  195 ASP A C   1 
ATOM   1282 O O   . ASP A 1 174 ? -22.553 -49.513 19.858  1.00 53.50  ?  195 ASP A O   1 
ATOM   1283 C CB  . ASP A 1 174 ? -19.328 -50.205 20.467  1.00 57.39  ?  195 ASP A CB  1 
ATOM   1284 C CG  . ASP A 1 174 ? -18.194 -49.508 21.189  0.63 59.38  ?  195 ASP A CG  1 
ATOM   1285 O OD1 . ASP A 1 174 ? -17.135 -49.285 20.565  0.23 59.85  ?  195 ASP A OD1 1 
ATOM   1286 O OD2 . ASP A 1 174 ? -18.364 -49.176 22.381  0.96 60.77  -1 195 ASP A OD2 1 
ATOM   1287 N N   . TYR A 1 175 ? -21.471 -50.861 18.403  1.00 53.26  ?  196 TYR A N   1 
ATOM   1288 C CA  . TYR A 1 175 ? -22.558 -51.805 18.207  1.00 58.48  ?  196 TYR A CA  1 
ATOM   1289 C C   . TYR A 1 175 ? -22.478 -52.893 19.269  1.00 63.45  ?  196 TYR A C   1 
ATOM   1290 O O   . TYR A 1 175 ? -21.405 -53.470 19.510  1.00 59.09  ?  196 TYR A O   1 
ATOM   1291 C CB  . TYR A 1 175 ? -22.503 -52.440 16.815  1.00 58.41  ?  196 TYR A CB  1 
ATOM   1292 C CG  . TYR A 1 175 ? -22.768 -51.495 15.666  1.00 53.97  ?  196 TYR A CG  1 
ATOM   1293 C CD1 . TYR A 1 175 ? -21.743 -50.744 15.107  1.00 52.34  ?  196 TYR A CD1 1 
ATOM   1294 C CD2 . TYR A 1 175 ? -24.042 -51.369 15.127  1.00 54.62  ?  196 TYR A CD2 1 
ATOM   1295 C CE1 . TYR A 1 175 ? -21.982 -49.885 14.051  1.00 53.46  ?  196 TYR A CE1 1 
ATOM   1296 C CE2 . TYR A 1 175 ? -24.290 -50.514 14.071  1.00 53.59  ?  196 TYR A CE2 1 
ATOM   1297 C CZ  . TYR A 1 175 ? -23.257 -49.774 13.537  1.00 52.79  ?  196 TYR A CZ  1 
ATOM   1298 O OH  . TYR A 1 175 ? -23.497 -48.920 12.484  1.00 50.23  ?  196 TYR A OH  1 
ATOM   1299 N N   . SER A 1 176 ? -23.616 -53.159 19.902  1.00 62.35  ?  197 SER A N   1 
ATOM   1300 C CA  . SER A 1 176 ? -23.739 -54.247 20.860  1.00 63.63  ?  197 SER A CA  1 
ATOM   1301 C C   . SER A 1 176 ? -24.774 -55.256 20.377  1.00 65.81  ?  197 SER A C   1 
ATOM   1302 O O   . SER A 1 176 ? -25.905 -54.897 20.062  1.00 66.17  ?  197 SER A O   1 
ATOM   1303 C CB  . SER A 1 176 ? -24.123 -53.716 22.243  1.00 67.08  ?  197 SER A CB  1 
ATOM   1304 O OG  . SER A 1 176 ? -23.253 -52.679 22.657  1.00 71.52  ?  197 SER A OG  1 
ATOM   1305 N N   . PHE A 1 177 ? -24.371 -56.519 20.310  1.00 65.68  ?  198 PHE A N   1 
ATOM   1306 C CA  . PHE A 1 177 ? -25.263 -57.605 19.944  1.00 70.71  ?  198 PHE A CA  1 
ATOM   1307 C C   . PHE A 1 177 ? -25.553 -58.487 21.152  1.00 72.42  ?  198 PHE A C   1 
ATOM   1308 O O   . PHE A 1 177 ? -24.685 -59.243 21.612  1.00 72.34  ?  198 PHE A O   1 
ATOM   1309 C CB  . PHE A 1 177 ? -24.668 -58.436 18.805  1.00 71.15  ?  198 PHE A CB  1 
ATOM   1310 C CG  . PHE A 1 177 ? -24.647 -57.722 17.483  1.00 71.62  ?  198 PHE A CG  1 
ATOM   1311 C CD1 . PHE A 1 177 ? -23.599 -56.880 17.150  1.00 68.46  ?  198 PHE A CD1 1 
ATOM   1312 C CD2 . PHE A 1 177 ? -25.682 -57.888 16.576  1.00 73.83  ?  198 PHE A CD2 1 
ATOM   1313 C CE1 . PHE A 1 177 ? -23.580 -56.221 15.934  1.00 68.12  ?  198 PHE A CE1 1 
ATOM   1314 C CE2 . PHE A 1 177 ? -25.669 -57.231 15.359  1.00 70.98  ?  198 PHE A CE2 1 
ATOM   1315 C CZ  . PHE A 1 177 ? -24.617 -56.397 15.038  1.00 67.60  ?  198 PHE A CZ  1 
ATOM   1316 N N   . TYR A 1 178 ? -26.777 -58.349 21.661  1.00 73.51  ?  199 TYR A N   1 
ATOM   1317 C CA  . TYR A 1 178 ? -27.318 -59.171 22.738  1.00 74.39  ?  199 TYR A CA  1 
ATOM   1318 C C   . TYR A 1 178 ? -28.093 -60.373 22.203  1.00 77.60  ?  199 TYR A C   1 
ATOM   1319 O O   . TYR A 1 178 ? -28.541 -60.385 21.052  1.00 77.12  ?  199 TYR A O   1 
ATOM   1320 C CB  . TYR A 1 178 ? -28.256 -58.356 23.636  1.00 78.29  ?  199 TYR A CB  1 
ATOM   1321 C CG  . TYR A 1 178 ? -27.642 -57.177 24.354  1.00 79.71  ?  199 TYR A CG  1 
ATOM   1322 C CD1 . TYR A 1 178 ? -27.530 -55.938 23.734  1.00 77.66  ?  199 TYR A CD1 1 
ATOM   1323 C CD2 . TYR A 1 178 ? -27.212 -57.291 25.670  1.00 82.82  ?  199 TYR A CD2 1 
ATOM   1324 C CE1 . TYR A 1 178 ? -26.984 -54.854 24.397  1.00 81.46  ?  199 TYR A CE1 1 
ATOM   1325 C CE2 . TYR A 1 178 ? -26.665 -56.214 26.341  1.00 86.13  ?  199 TYR A CE2 1 
ATOM   1326 C CZ  . TYR A 1 178 ? -26.553 -54.998 25.700  1.00 87.06  ?  199 TYR A CZ  1 
ATOM   1327 O OH  . TYR A 1 178 ? -26.009 -53.923 26.366  1.00 90.58  ?  199 TYR A OH  1 
ATOM   1328 N N   . ARG A 1 179 ? -28.276 -61.358 23.076  1.00 80.47  ?  200 ARG A N   1 
ATOM   1329 C CA  . ARG A 1 179 ? -29.015 -62.580 22.773  1.00 80.77  ?  200 ARG A CA  1 
ATOM   1330 C C   . ARG A 1 179 ? -30.221 -62.716 23.698  1.00 83.45  ?  200 ARG A C   1 
ATOM   1331 O O   . ARG A 1 179 ? -30.053 -62.763 24.912  1.00 87.70  ?  200 ARG A O   1 
ATOM   1332 C CB  . ARG A 1 179 ? -28.103 -63.792 22.936  1.00 76.08  ?  200 ARG A CB  1 
ATOM   1333 C CG  . ARG A 1 179 ? -28.786 -65.126 22.763  1.00 79.03  ?  200 ARG A CG  1 
ATOM   1334 C CD  . ARG A 1 179 ? -28.668 -65.610 21.339  1.00 81.71  ?  200 ARG A CD  1 
ATOM   1335 N NE  . ARG A 1 179 ? -29.367 -66.873 21.139  1.00 79.28  ?  200 ARG A NE  1 
ATOM   1336 C CZ  . ARG A 1 179 ? -28.947 -67.831 20.320  1.00 84.35  ?  200 ARG A CZ  1 
ATOM   1337 N NH1 . ARG A 1 179 ? -29.643 -68.951 20.195  1.00 94.34  ?  200 ARG A NH1 1 
ATOM   1338 N NH2 . ARG A 1 179 ? -27.822 -67.673 19.637  1.00 86.24  ?  200 ARG A NH2 1 
ATOM   1339 N N   . VAL A 1 180 ? -31.429 -62.798 23.144  1.00 83.75  ?  201 VAL A N   1 
ATOM   1340 C CA  . VAL A 1 180 ? -32.626 -62.863 23.989  1.00 89.71  ?  201 VAL A CA  1 
ATOM   1341 C C   . VAL A 1 180 ? -33.191 -64.292 24.056  1.00 91.38  ?  201 VAL A C   1 
ATOM   1342 O O   . VAL A 1 180 ? -32.967 -65.088 23.147  1.00 88.45  ?  201 VAL A O   1 
ATOM   1343 C CB  . VAL A 1 180 ? -33.710 -61.886 23.485  1.00 90.50  ?  201 VAL A CB  1 
ATOM   1344 C CG1 . VAL A 1 180 ? -34.668 -61.529 24.610  1.00 94.70  ?  201 VAL A CG1 1 
ATOM   1345 C CG2 . VAL A 1 180 ? -33.061 -60.622 22.938  1.00 85.19  ?  201 VAL A CG2 1 
ATOM   1346 N N   . TRP A 1 181 ? -33.812 -64.630 25.174  1.00 106.95 ?  202 TRP A N   1 
ATOM   1347 C CA  . TRP A 1 181 ? -34.309 -65.971 25.400  1.00 112.72 ?  202 TRP A CA  1 
ATOM   1348 C C   . TRP A 1 181 ? -35.617 -65.964 26.165  1.00 119.09 ?  202 TRP A C   1 
ATOM   1349 O O   . TRP A 1 181 ? -36.229 -64.931 26.386  1.00 122.92 ?  202 TRP A O   1 
ATOM   1350 C CB  . TRP A 1 181 ? -33.350 -66.702 26.333  1.00 104.19 ?  202 TRP A CB  1 
ATOM   1351 C CG  . TRP A 1 181 ? -31.969 -66.967 25.930  1.00 94.64  ?  202 TRP A CG  1 
ATOM   1352 C CD1 . TRP A 1 181 ? -31.541 -67.828 24.992  1.00 94.63  ?  202 TRP A CD1 1 
ATOM   1353 C CD2 . TRP A 1 181 ? -30.816 -66.462 26.564  1.00 84.66  ?  202 TRP A CD2 1 
ATOM   1354 N NE1 . TRP A 1 181 ? -30.179 -67.858 24.962  1.00 89.29  ?  202 TRP A NE1 1 
ATOM   1355 C CE2 . TRP A 1 181 ? -29.712 -67.018 25.926  1.00 83.40  ?  202 TRP A CE2 1 
ATOM   1356 C CE3 . TRP A 1 181 ? -30.611 -65.565 27.596  1.00 82.31  ?  202 TRP A CE3 1 
ATOM   1357 C CZ2 . TRP A 1 181 ? -28.436 -66.713 26.278  1.00 83.05  ?  202 TRP A CZ2 1 
ATOM   1358 C CZ3 . TRP A 1 181 ? -29.350 -65.261 27.944  1.00 82.61  ?  202 TRP A CZ3 1 
ATOM   1359 C CH2 . TRP A 1 181 ? -28.271 -65.828 27.292  1.00 83.49  ?  202 TRP A CH2 1 
ATOM   1360 N N   . GLY A 1 182 ? -36.020 -67.148 26.598  1.00 117.29 ?  203 GLY A N   1 
ATOM   1361 C CA  . GLY A 1 182 ? -37.203 -67.294 27.406  1.00 121.94 ?  203 GLY A CA  1 
ATOM   1362 C C   . GLY A 1 182 ? -36.851 -66.950 28.836  1.00 124.49 ?  203 GLY A C   1 
ATOM   1363 O O   . GLY A 1 182 ? -37.698 -66.490 29.594  1.00 127.90 ?  203 GLY A O   1 
ATOM   1364 N N   . ASN A 1 183 ? -35.600 -67.128 29.210  1.00 123.64 ?  204 ASN A N   1 
ATOM   1365 C CA  . ASN A 1 183 ? -35.139 -66.822 30.563  1.00 121.61 ?  204 ASN A CA  1 
ATOM   1366 C C   . ASN A 1 183 ? -35.433 -65.379 30.956  1.00 125.85 ?  204 ASN A C   1 
ATOM   1367 O O   . ASN A 1 183 ? -35.235 -65.017 32.096  1.00 125.20 ?  204 ASN A O   1 
ATOM   1368 C CB  . ASN A 1 183 ? -33.636 -67.102 30.700  1.00 119.01 ?  204 ASN A CB  1 
ATOM   1369 C CG  . ASN A 1 183 ? -33.227 -68.438 30.138  1.00 115.35 ?  204 ASN A CG  1 
ATOM   1370 O OD1 . ASN A 1 183 ? -33.684 -68.832 29.079  1.00 112.22 ?  204 ASN A OD1 1 
ATOM   1371 N ND2 . ASN A 1 183 ? -32.347 -69.138 30.844  1.00 110.51 ?  204 ASN A ND2 1 
ATOM   1372 N N   . ASN A 1 184 ? -35.873 -64.551 30.036  1.00 123.96 ?  205 ASN A N   1 
ATOM   1373 C CA  . ASN A 1 184 ? -36.154 -63.170 30.362  1.00 128.49 ?  205 ASN A CA  1 
ATOM   1374 C C   . ASN A 1 184 ? -34.834 -62.442 30.440  1.00 125.16 ?  205 ASN A C   1 
ATOM   1375 O O   . ASN A 1 184 ? -34.791 -61.221 30.506  1.00 123.51 ?  205 ASN A O   1 
ATOM   1376 C CB  . ASN A 1 184 ? -36.877 -63.030 31.689  1.00 91.76  ?  205 ASN A CB  1 
ATOM   1377 N N   . THR A 1 185 ? -33.754 -63.204 30.434  1.00 118.34 ?  206 THR A N   1 
ATOM   1378 C CA  . THR A 1 185 ? -32.429 -62.633 30.510  1.00 111.29 ?  206 THR A CA  1 
ATOM   1379 C C   . THR A 1 185 ? -31.829 -62.621 29.131  1.00 104.85 ?  206 THR A C   1 
ATOM   1380 O O   . THR A 1 185 ? -32.269 -63.354 28.260  1.00 98.65  ?  206 THR A O   1 
ATOM   1381 C CB  . THR A 1 185 ? -31.532 -63.471 31.440  1.00 113.91 ?  206 THR A CB  1 
ATOM   1382 O OG1 . THR A 1 185 ? -30.301 -62.788 31.682  1.00 110.40 ?  206 THR A OG1 1 
ATOM   1383 C CG2 . THR A 1 185 ? -31.228 -64.830 30.831  1.00 110.15 ?  206 THR A CG2 1 
ATOM   1384 N N   . GLU A 1 186 ? -30.812 -61.794 28.949  1.00 101.42 ?  207 GLU A N   1 
ATOM   1385 C CA  . GLU A 1 186 ? -30.122 -61.683 27.682  1.00 94.10  ?  207 GLU A CA  1 
ATOM   1386 C C   . GLU A 1 186 ? -28.653 -61.466 27.941  1.00 85.88  ?  207 GLU A C   1 
ATOM   1387 O O   . GLU A 1 186 ? -28.286 -60.703 28.801  1.00 83.92  ?  207 GLU A O   1 
ATOM   1388 C CB  . GLU A 1 186 ? -30.656 -60.487 26.932  1.00 96.46  ?  207 GLU A CB  1 
ATOM   1389 C CG  . GLU A 1 186 ? -30.803 -59.298 27.844  1.00 101.35 ?  207 GLU A CG  1 
ATOM   1390 C CD  . GLU A 1 186 ? -31.296 -58.062 27.146  1.00 105.62 ?  207 GLU A CD  1 
ATOM   1391 O OE1 . GLU A 1 186 ? -31.817 -58.169 26.033  1.00 114.52 ?  207 GLU A OE1 1 
ATOM   1392 O OE2 . GLU A 1 186 ? -31.155 -56.972 27.718  1.00 112.15 -1 207 GLU A OE2 1 
ATOM   1393 N N   . THR A 1 187 ? -27.821 -62.146 27.180  1.00 85.12  ?  208 THR A N   1 
ATOM   1394 C CA  . THR A 1 187 ? -26.374 -62.034 27.257  1.00 83.89  ?  208 THR A CA  1 
ATOM   1395 C C   . THR A 1 187 ? -25.806 -61.338 26.034  1.00 79.63  ?  208 THR A C   1 
ATOM   1396 O O   . THR A 1 187 ? -26.095 -61.714 24.898  1.00 78.56  ?  208 THR A O   1 
ATOM   1397 C CB  . THR A 1 187 ? -25.699 -63.403 27.412  1.00 85.50  ?  208 THR A CB  1 
ATOM   1398 O OG1 . THR A 1 187 ? -26.189 -64.044 28.596  1.00 89.66  ?  208 THR A OG1 1 
ATOM   1399 C CG2 . THR A 1 187 ? -24.184 -63.244 27.507  1.00 84.94  ?  208 THR A CG2 1 
ATOM   1400 N N   . LEU A 1 188 ? -25.017 -60.301 26.285  1.00 75.11  ?  209 LEU A N   1 
ATOM   1401 C CA  . LEU A 1 188 ? -24.257 -59.629 25.243  1.00 74.91  ?  209 LEU A CA  1 
ATOM   1402 C C   . LEU A 1 188 ? -23.365 -60.644 24.530  1.00 70.30  ?  209 LEU A C   1 
ATOM   1403 O O   . LEU A 1 188 ? -22.569 -61.333 25.167  1.00 72.51  ?  209 LEU A O   1 
ATOM   1404 C CB  . LEU A 1 188 ? -23.433 -58.490 25.854  1.00 79.52  ?  209 LEU A CB  1 
ATOM   1405 C CG  . LEU A 1 188 ? -22.873 -57.371 24.976  1.00 84.92  ?  209 LEU A CG  1 
ATOM   1406 C CD1 . LEU A 1 188 ? -21.579 -57.809 24.318  1.00 91.16  ?  209 LEU A CD1 1 
ATOM   1407 C CD2 . LEU A 1 188 ? -23.898 -56.944 23.935  1.00 84.86  ?  209 LEU A CD2 1 
ATOM   1408 N N   . VAL A 1 189 ? -23.514 -60.743 23.211  1.00 74.06  ?  210 VAL A N   1 
ATOM   1409 C CA  . VAL A 1 189 ? -22.744 -61.701 22.421  1.00 69.13  ?  210 VAL A CA  1 
ATOM   1410 C C   . VAL A 1 189 ? -21.566 -61.017 21.738  1.00 66.93  ?  210 VAL A C   1 
ATOM   1411 O O   . VAL A 1 189 ? -20.489 -61.601 21.607  1.00 65.82  ?  210 VAL A O   1 
ATOM   1412 C CB  . VAL A 1 189 ? -23.624 -62.397 21.358  1.00 69.02  ?  210 VAL A CB  1 
ATOM   1413 C CG1 . VAL A 1 189 ? -22.794 -63.347 20.499  1.00 71.13  ?  210 VAL A CG1 1 
ATOM   1414 C CG2 . VAL A 1 189 ? -24.761 -63.142 22.025  1.00 72.64  ?  210 VAL A CG2 1 
ATOM   1415 N N   . SER A 1 190 ? -21.762 -59.775 21.307  1.00 73.22  ?  211 SER A N   1 
ATOM   1416 C CA  . SER A 1 190 ? -20.659 -59.037 20.688  1.00 68.97  ?  211 SER A CA  1 
ATOM   1417 C C   . SER A 1 190 ? -20.714 -57.553 21.025  1.00 66.47  ?  211 SER A C   1 
ATOM   1418 O O   . SER A 1 190 ? -21.775 -57.019 21.305  1.00 66.78  ?  211 SER A O   1 
ATOM   1419 C CB  . SER A 1 190 ? -20.671 -59.229 19.170  1.00 68.05  ?  211 SER A CB  1 
ATOM   1420 O OG  . SER A 1 190 ? -19.886 -58.242 18.523  1.00 71.07  ?  211 SER A OG  1 
ATOM   1421 N N   . LYS A 1 191 ? -19.566 -56.887 21.015  1.00 66.16  ?  212 LYS A N   1 
ATOM   1422 C CA  . LYS A 1 191 ? -19.550 -55.442 21.208  1.00 66.61  ?  212 LYS A CA  1 
ATOM   1423 C C   . LYS A 1 191 ? -18.297 -54.822 20.620  1.00 67.58  ?  212 LYS A C   1 
ATOM   1424 O O   . LYS A 1 191 ? -17.187 -55.059 21.099  1.00 72.44  ?  212 LYS A O   1 
ATOM   1425 C CB  . LYS A 1 191 ? -19.662 -55.080 22.689  1.00 68.00  ?  212 LYS A CB  1 
ATOM   1426 C CG  . LYS A 1 191 ? -19.829 -53.586 22.924  1.00 69.42  ?  212 LYS A CG  1 
ATOM   1427 C CD  . LYS A 1 191 ? -20.158 -53.274 24.372  1.00 70.75  ?  212 LYS A CD  1 
ATOM   1428 C CE  . LYS A 1 191 ? -20.744 -51.878 24.506  1.00 71.68  ?  212 LYS A CE  1 
ATOM   1429 N NZ  . LYS A 1 191 ? -20.242 -51.175 25.716  1.00 78.62  ?  212 LYS A NZ  1 
ATOM   1430 N N   . GLY A 1 192 ? -18.481 -54.019 19.581  1.00 68.48  ?  213 GLY A N   1 
ATOM   1431 C CA  . GLY A 1 192 ? -17.352 -53.398 18.914  1.00 65.93  ?  213 GLY A CA  1 
ATOM   1432 C C   . GLY A 1 192 ? -17.830 -52.428 17.862  1.00 60.06  ?  213 GLY A C   1 
ATOM   1433 O O   . GLY A 1 192 ? -19.021 -52.168 17.759  1.00 55.40  ?  213 GLY A O   1 
ATOM   1434 N N   . LYS A 1 193 ? -16.911 -51.893 17.069  1.00 60.95  ?  214 LYS A N   1 
ATOM   1435 C CA  . LYS A 1 193 ? -17.298 -50.951 16.030  1.00 60.13  ?  214 LYS A CA  1 
ATOM   1436 C C   . LYS A 1 193 ? -17.527 -51.672 14.707  1.00 60.92  ?  214 LYS A C   1 
ATOM   1437 O O   . LYS A 1 193 ? -17.425 -51.083 13.631  1.00 64.34  ?  214 LYS A O   1 
ATOM   1438 C CB  . LYS A 1 193 ? -16.246 -49.852 15.895  1.00 57.52  ?  214 LYS A CB  1 
ATOM   1439 C CG  . LYS A 1 193 ? -15.908 -49.227 17.236  1.00 56.79  ?  214 LYS A CG  1 
ATOM   1440 C CD  . LYS A 1 193 ? -15.558 -47.760 17.121  1.00 53.32  ?  214 LYS A CD  1 
ATOM   1441 C CE  . LYS A 1 193 ? -15.442 -47.140 18.501  1.00 53.89  ?  214 LYS A CE  1 
ATOM   1442 N NZ  . LYS A 1 193 ? -16.687 -47.317 19.300  1.00 59.87  ?  214 LYS A NZ  1 
ATOM   1443 N N   . GLU A 1 194 ? -17.843 -52.960 14.807  1.00 59.84  ?  215 GLU A N   1 
ATOM   1444 C CA  . GLU A 1 194 ? -18.297 -53.741 13.666  1.00 58.68  ?  215 GLU A CA  1 
ATOM   1445 C C   . GLU A 1 194 ? -19.820 -53.754 13.655  1.00 58.75  ?  215 GLU A C   1 
ATOM   1446 O O   . GLU A 1 194 ? -20.453 -54.102 14.652  1.00 60.75  ?  215 GLU A O   1 
ATOM   1447 C CB  . GLU A 1 194 ? -17.743 -55.165 13.720  1.00 58.97  ?  215 GLU A CB  1 
ATOM   1448 N N   . ALA A 1 195 ? -20.406 -53.371 12.527  1.00 58.06  ?  216 ALA A N   1 
ATOM   1449 C CA  . ALA A 1 195 ? -21.853 -53.229 12.430  1.00 57.81  ?  216 ALA A CA  1 
ATOM   1450 C C   . ALA A 1 195 ? -22.556 -54.562 12.200  1.00 58.04  ?  216 ALA A C   1 
ATOM   1451 O O   . ALA A 1 195 ? -23.780 -54.610 12.073  1.00 54.96  ?  216 ALA A O   1 
ATOM   1452 C CB  . ALA A 1 195 ? -22.205 -52.257 11.320  1.00 57.80  ?  216 ALA A CB  1 
ATOM   1453 N N   . THR A 1 196 ? -21.786 -55.643 12.150  1.00 63.30  ?  217 THR A N   1 
ATOM   1454 C CA  . THR A 1 196 ? -22.357 -56.949 11.850  1.00 64.91  ?  217 THR A CA  1 
ATOM   1455 C C   . THR A 1 196 ? -21.872 -58.053 12.787  1.00 66.27  ?  217 THR A C   1 
ATOM   1456 O O   . THR A 1 196 ? -20.724 -58.055 13.230  1.00 65.82  ?  217 THR A O   1 
ATOM   1457 C CB  . THR A 1 196 ? -22.054 -57.366 10.397  1.00 64.93  ?  217 THR A CB  1 
ATOM   1458 O OG1 . THR A 1 196 ? -22.474 -58.721 10.190  1.00 72.77  ?  217 THR A OG1 1 
ATOM   1459 C CG2 . THR A 1 196 ? -20.566 -57.251 10.105  1.00 63.78  ?  217 THR A CG2 1 
ATOM   1460 N N   . LEU A 1 197 ? -22.769 -58.988 13.086  1.00 71.08  ?  218 LEU A N   1 
ATOM   1461 C CA  . LEU A 1 197 ? -22.436 -60.162 13.883  1.00 72.50  ?  218 LEU A CA  1 
ATOM   1462 C C   . LEU A 1 197 ? -22.477 -61.410 13.012  1.00 71.13  ?  218 LEU A C   1 
ATOM   1463 O O   . LEU A 1 197 ? -23.535 -61.793 12.511  1.00 67.54  ?  218 LEU A O   1 
ATOM   1464 C CB  . LEU A 1 197 ? -23.396 -60.307 15.066  1.00 76.22  ?  218 LEU A CB  1 
ATOM   1465 C CG  . LEU A 1 197 ? -23.235 -61.563 15.926  1.00 79.23  ?  218 LEU A CG  1 
ATOM   1466 C CD1 . LEU A 1 197 ? -21.882 -61.574 16.620  1.00 81.25  ?  218 LEU A CD1 1 
ATOM   1467 C CD2 . LEU A 1 197 ? -24.364 -61.674 16.940  1.00 79.27  ?  218 LEU A CD2 1 
ATOM   1468 N N   . THR A 1 198 ? -21.321 -62.038 12.828  1.00 75.21  ?  219 THR A N   1 
ATOM   1469 C CA  . THR A 1 198 ? -21.230 -63.231 11.997  1.00 80.86  ?  219 THR A CA  1 
ATOM   1470 C C   . THR A 1 198 ? -20.908 -64.473 12.817  1.00 86.53  ?  219 THR A C   1 
ATOM   1471 O O   . THR A 1 198 ? -19.844 -64.567 13.428  1.00 98.46  ?  219 THR A O   1 
ATOM   1472 C CB  . THR A 1 198 ? -20.164 -63.077 10.897  1.00 80.83  ?  219 THR A CB  1 
ATOM   1473 O OG1 . THR A 1 198 ? -20.509 -61.979 10.043  1.00 82.95  ?  219 THR A OG1 1 
ATOM   1474 C CG2 . THR A 1 198 ? -20.068 -64.351 10.067  1.00 80.51  ?  219 THR A CG2 1 
ATOM   1475 N N   . LYS A 1 199 ? -21.835 -65.424 12.827  1.00 91.91  ?  220 LYS A N   1 
ATOM   1476 C CA  . LYS A 1 199 ? -21.603 -66.703 13.486  1.00 91.02  ?  220 LYS A CA  1 
ATOM   1477 C C   . LYS A 1 199 ? -21.540 -67.812 12.444  1.00 91.98  ?  220 LYS A C   1 
ATOM   1478 O O   . LYS A 1 199 ? -22.528 -68.086 11.762  1.00 92.45  ?  220 LYS A O   1 
ATOM   1479 C CB  . LYS A 1 199 ? -22.695 -66.995 14.516  1.00 89.91  ?  220 LYS A CB  1 
ATOM   1480 N N   . PRO A 1 200 ? -20.371 -68.455 12.318  1.00 91.98  ?  221 PRO A N   1 
ATOM   1481 C CA  . PRO A 1 200 ? -20.151 -69.482 11.298  1.00 101.28 ?  221 PRO A CA  1 
ATOM   1482 C C   . PRO A 1 200 ? -20.662 -70.853 11.726  1.00 106.58 ?  221 PRO A C   1 
ATOM   1483 O O   . PRO A 1 200 ? -20.750 -71.127 12.925  1.00 114.37 ?  221 PRO A O   1 
ATOM   1484 C CB  . PRO A 1 200 ? -18.629 -69.488 11.137  1.00 102.21 ?  221 PRO A CB  1 
ATOM   1485 C CG  . PRO A 1 200 ? -18.089 -68.961 12.451  1.00 99.55  ?  221 PRO A CG  1 
ATOM   1486 C CD  . PRO A 1 200 ? -19.223 -68.342 13.234  1.00 95.28  ?  221 PRO A CD  1 
ATOM   1487 N N   . MET A 1 201 ? -20.989 -71.693 10.747  1.00 104.96 ?  222 MET A N   1 
ATOM   1488 C CA  . MET A 1 201 ? -21.511 -73.034 10.996  1.00 103.90 ?  222 MET A CA  1 
ATOM   1489 C C   . MET A 1 201 ? -22.697 -72.997 11.955  1.00 101.41 ?  222 MET A C   1 
ATOM   1490 O O   . MET A 1 201 ? -22.703 -73.672 12.983  1.00 102.15 ?  222 MET A O   1 
ATOM   1491 C CB  . MET A 1 201 ? -20.411 -73.947 11.542  1.00 106.95 ?  222 MET A CB  1 
ATOM   1492 C CG  . MET A 1 201 ? -19.254 -74.160 10.577  1.00 110.16 ?  222 MET A CG  1 
ATOM   1493 S SD  . MET A 1 201 ? -19.756 -74.996 9.059   1.00 117.15 ?  222 MET A SD  1 
ATOM   1494 C CE  . MET A 1 201 ? -18.199 -75.076 8.178   1.00 116.74 ?  222 MET A CE  1 
ATOM   1495 N N   . VAL A 1 202 ? -23.685 -72.182 11.601  1.00 98.93  ?  223 VAL A N   1 
ATOM   1496 C CA  . VAL A 1 202 ? -24.924 -72.035 12.356  1.00 103.43 ?  223 VAL A CA  1 
ATOM   1497 C C   . VAL A 1 202 ? -25.561 -73.390 12.682  1.00 108.51 ?  223 VAL A C   1 
ATOM   1498 O O   . VAL A 1 202 ? -25.497 -74.325 11.884  1.00 109.30 ?  223 VAL A O   1 
ATOM   1499 C CB  . VAL A 1 202 ? -25.925 -71.179 11.560  1.00 103.49 ?  223 VAL A CB  1 
ATOM   1500 C CG1 . VAL A 1 202 ? -26.138 -71.799 10.195  1.00 107.46 ?  223 VAL A CG1 1 
ATOM   1501 C CG2 . VAL A 1 202 ? -27.242 -71.012 12.309  1.00 102.06 ?  223 VAL A CG2 1 
ATOM   1502 N N   . GLY A 1 203 ? -26.154 -73.498 13.866  1.00 106.74 ?  224 GLY A N   1 
ATOM   1503 C CA  . GLY A 1 203 ? -26.852 -74.707 14.255  1.00 108.55 ?  224 GLY A CA  1 
ATOM   1504 C C   . GLY A 1 203 ? -28.239 -74.404 14.784  1.00 110.60 ?  224 GLY A C   1 
ATOM   1505 O O   . GLY A 1 203 ? -28.598 -73.238 14.950  1.00 100.23 ?  224 GLY A O   1 
ATOM   1506 N N   . PRO A 1 204 ? -29.031 -75.456 15.045  1.00 116.17 ?  225 PRO A N   1 
ATOM   1507 C CA  . PRO A 1 204 ? -30.368 -75.348 15.643  1.00 115.40 ?  225 PRO A CA  1 
ATOM   1508 C C   . PRO A 1 204 ? -30.366 -74.544 16.943  1.00 108.62 ?  225 PRO A C   1 
ATOM   1509 O O   . PRO A 1 204 ? -31.387 -73.964 17.313  1.00 102.95 ?  225 PRO A O   1 
ATOM   1510 C CB  . PRO A 1 204 ? -30.748 -76.807 15.905  1.00 121.81 ?  225 PRO A CB  1 
ATOM   1511 C CG  . PRO A 1 204 ? -30.002 -77.572 14.871  1.00 123.99 ?  225 PRO A CG  1 
ATOM   1512 C CD  . PRO A 1 204 ? -28.701 -76.845 14.680  1.00 120.89 ?  225 PRO A CD  1 
ATOM   1513 N N   . GLU A 1 205 ? -29.222 -74.515 17.620  1.00 109.10 ?  226 GLU A N   1 
ATOM   1514 C CA  . GLU A 1 205 ? -29.071 -73.770 18.863  1.00 111.05 ?  226 GLU A CA  1 
ATOM   1515 C C   . GLU A 1 205 ? -28.760 -72.298 18.600  1.00 107.49 ?  226 GLU A C   1 
ATOM   1516 O O   . GLU A 1 205 ? -28.980 -71.445 19.461  1.00 99.34  ?  226 GLU A O   1 
ATOM   1517 C CB  . GLU A 1 205 ? -27.970 -74.391 19.731  1.00 113.65 ?  226 GLU A CB  1 
ATOM   1518 C CG  . GLU A 1 205 ? -26.578 -74.408 19.096  1.00 114.94 ?  226 GLU A CG  1 
ATOM   1519 C CD  . GLU A 1 205 ? -26.373 -75.545 18.104  1.00 121.20 ?  226 GLU A CD  1 
ATOM   1520 O OE1 . GLU A 1 205 ? -27.351 -75.965 17.452  1.00 135.57 ?  226 GLU A OE1 1 
ATOM   1521 O OE2 . GLU A 1 205 ? -25.225 -76.019 17.975  1.00 110.22 -1 226 GLU A OE2 1 
ATOM   1522 N N   . ASP A 1 206 ? -28.243 -72.006 17.410  1.00 112.53 ?  227 ASP A N   1 
ATOM   1523 C CA  . ASP A 1 206 ? -27.920 -70.633 17.036  1.00 101.57 ?  227 ASP A CA  1 
ATOM   1524 C C   . ASP A 1 206 ? -29.171 -69.879 16.594  1.00 97.09  ?  227 ASP A C   1 
ATOM   1525 O O   . ASP A 1 206 ? -29.201 -68.648 16.604  1.00 97.05  ?  227 ASP A O   1 
ATOM   1526 C CB  . ASP A 1 206 ? -26.865 -70.607 15.928  1.00 101.47 ?  227 ASP A CB  1 
ATOM   1527 C CG  . ASP A 1 206 ? -25.500 -71.066 16.410  1.00 102.18 ?  227 ASP A CG  1 
ATOM   1528 O OD1 . ASP A 1 206 ? -25.321 -71.224 17.636  1.00 100.98 ?  227 ASP A OD1 1 
ATOM   1529 O OD2 . ASP A 1 206 ? -24.604 -71.262 15.562  1.00 99.76  -1 227 ASP A OD2 1 
ATOM   1530 N N   . ALA A 1 207 ? -30.201 -70.623 16.205  1.00 96.21  ?  228 ALA A N   1 
ATOM   1531 C CA  . ALA A 1 207 ? -31.489 -70.027 15.870  1.00 94.85  ?  228 ALA A CA  1 
ATOM   1532 C C   . ALA A 1 207 ? -32.125 -69.429 17.121  1.00 94.52  ?  228 ALA A C   1 
ATOM   1533 O O   . ALA A 1 207 ? -31.823 -69.848 18.237  1.00 99.07  ?  228 ALA A O   1 
ATOM   1534 C CB  . ALA A 1 207 ? -32.410 -71.060 15.240  1.00 96.61  ?  228 ALA A CB  1 
ATOM   1535 N N   . GLY A 1 208 ? -33.002 -68.447 16.932  1.00 93.79  ?  229 GLY A N   1 
ATOM   1536 C CA  . GLY A 1 208 ? -33.648 -67.783 18.050  1.00 92.40  ?  229 GLY A CA  1 
ATOM   1537 C C   . GLY A 1 208 ? -33.933 -66.318 17.776  1.00 90.03  ?  229 GLY A C   1 
ATOM   1538 O O   . GLY A 1 208 ? -34.412 -65.964 16.699  1.00 95.16  ?  229 GLY A O   1 
ATOM   1539 N N   . SER A 1 209 ? -33.640 -65.462 18.752  1.00 87.61  ?  230 SER A N   1 
ATOM   1540 C CA  . SER A 1 209 ? -33.869 -64.029 18.595  1.00 86.55  ?  230 SER A CA  1 
ATOM   1541 C C   . SER A 1 209 ? -32.772 -63.185 19.249  1.00 84.13  ?  230 SER A C   1 
ATOM   1542 O O   . SER A 1 209 ? -32.474 -63.320 20.443  1.00 83.77  ?  230 SER A O   1 
ATOM   1543 C CB  . SER A 1 209 ? -35.239 -63.644 19.160  1.00 86.23  ?  230 SER A CB  1 
ATOM   1544 O OG  . SER A 1 209 ? -35.132 -63.147 20.481  1.00 85.99  ?  230 SER A OG  1 
ATOM   1545 N N   . TYR A 1 210 ? -32.185 -62.307 18.442  1.00 79.97  ?  231 TYR A N   1 
ATOM   1546 C CA  . TYR A 1 210 ? -31.076 -61.459 18.856  1.00 74.81  ?  231 TYR A CA  1 
ATOM   1547 C C   . TYR A 1 210 ? -31.505 -60.000 18.872  1.00 73.67  ?  231 TYR A C   1 
ATOM   1548 O O   . TYR A 1 210 ? -32.563 -59.653 18.344  1.00 78.11  ?  231 TYR A O   1 
ATOM   1549 C CB  . TYR A 1 210 ? -29.880 -61.625 17.914  1.00 72.81  ?  231 TYR A CB  1 
ATOM   1550 C CG  . TYR A 1 210 ? -29.379 -63.043 17.744  1.00 77.48  ?  231 TYR A CG  1 
ATOM   1551 C CD1 . TYR A 1 210 ? -30.125 -63.993 17.055  1.00 78.52  ?  231 TYR A CD1 1 
ATOM   1552 C CD2 . TYR A 1 210 ? -28.149 -63.426 18.258  1.00 81.23  ?  231 TYR A CD2 1 
ATOM   1553 C CE1 . TYR A 1 210 ? -29.666 -65.284 16.896  1.00 80.46  ?  231 TYR A CE1 1 
ATOM   1554 C CE2 . TYR A 1 210 ? -27.681 -64.714 18.101  1.00 81.85  ?  231 TYR A CE2 1 
ATOM   1555 C CZ  . TYR A 1 210 ? -28.443 -65.638 17.420  1.00 82.72  ?  231 TYR A CZ  1 
ATOM   1556 O OH  . TYR A 1 210 ? -27.975 -66.922 17.266  1.00 91.58  ?  231 TYR A OH  1 
ATOM   1557 N N   . ARG A 1 211 ? -30.679 -59.142 19.461  1.00 70.02  ?  232 ARG A N   1 
ATOM   1558 C CA  . ARG A 1 211 ? -30.938 -57.709 19.397  1.00 71.22  ?  232 ARG A CA  1 
ATOM   1559 C C   . ARG A 1 211 ? -29.652 -56.916 19.208  1.00 71.45  ?  232 ARG A C   1 
ATOM   1560 O O   . ARG A 1 211 ? -28.603 -57.283 19.726  1.00 71.61  ?  232 ARG A O   1 
ATOM   1561 C CB  . ARG A 1 211 ? -31.666 -57.228 20.652  1.00 72.50  ?  232 ARG A CB  1 
ATOM   1562 C CG  . ARG A 1 211 ? -32.424 -55.926 20.442  1.00 77.41  ?  232 ARG A CG  1 
ATOM   1563 C CD  . ARG A 1 211 ? -33.017 -55.404 21.735  1.00 79.59  ?  232 ARG A CD  1 
ATOM   1564 N NE  . ARG A 1 211 ? -31.989 -55.128 22.732  1.00 81.84  ?  232 ARG A NE  1 
ATOM   1565 C CZ  . ARG A 1 211 ? -31.892 -55.763 23.895  1.00 86.02  ?  232 ARG A CZ  1 
ATOM   1566 N NH1 . ARG A 1 211 ? -32.761 -56.714 24.207  1.00 88.33  ?  232 ARG A NH1 1 
ATOM   1567 N NH2 . ARG A 1 211 ? -30.924 -55.448 24.746  1.00 88.33  ?  232 ARG A NH2 1 
ATOM   1568 N N   . CYS A 1 212 ? -29.742 -55.827 18.456  1.00 73.63  ?  233 CYS A N   1 
ATOM   1569 C CA  . CYS A 1 212 ? -28.596 -54.964 18.217  1.00 72.56  ?  233 CYS A CA  1 
ATOM   1570 C C   . CYS A 1 212 ? -28.887 -53.538 18.659  1.00 65.32  ?  233 CYS A C   1 
ATOM   1571 O O   . CYS A 1 212 ? -29.832 -52.904 18.182  1.00 62.46  ?  233 CYS A O   1 
ATOM   1572 C CB  . CYS A 1 212 ? -28.201 -54.982 16.740  1.00 74.83  ?  233 CYS A CB  1 
ATOM   1573 S SG  . CYS A 1 212 ? -26.986 -53.722 16.291  1.00 77.45  ?  233 CYS A SG  1 
ATOM   1574 N N   . GLU A 1 213 ? -28.069 -53.047 19.583  1.00 60.03  ?  234 GLU A N   1 
ATOM   1575 C CA  . GLU A 1 213 ? -28.149 -51.670 20.039  1.00 59.52  ?  234 GLU A CA  1 
ATOM   1576 C C   . GLU A 1 213 ? -26.905 -50.899 19.618  1.00 56.60  ?  234 GLU A C   1 
ATOM   1577 O O   . GLU A 1 213 ? -25.790 -51.232 20.022  1.00 57.34  ?  234 GLU A O   1 
ATOM   1578 C CB  . GLU A 1 213 ? -28.310 -51.605 21.559  1.00 67.36  ?  234 GLU A CB  1 
ATOM   1579 C CG  . GLU A 1 213 ? -29.643 -52.106 22.079  1.00 74.26  ?  234 GLU A CG  1 
ATOM   1580 C CD  . GLU A 1 213 ? -29.563 -52.560 23.523  1.00 83.89  ?  234 GLU A CD  1 
ATOM   1581 O OE1 . GLU A 1 213 ? -28.803 -51.942 24.298  1.00 87.00  ?  234 GLU A OE1 1 
ATOM   1582 O OE2 . GLU A 1 213 ? -30.261 -53.529 23.886  1.00 96.11  -1 234 GLU A OE2 1 
ATOM   1583 N N   . LEU A 1 214 ? -27.099 -49.879 18.792  1.00 54.98  ?  235 LEU A N   1 
ATOM   1584 C CA  . LEU A 1 214 ? -26.019 -48.972 18.435  1.00 53.32  ?  235 LEU A CA  1 
ATOM   1585 C C   . LEU A 1 214 ? -25.959 -47.843 19.451  1.00 54.21  ?  235 LEU A C   1 
ATOM   1586 O O   . LEU A 1 214 ? -26.838 -46.983 19.486  1.00 54.97  ?  235 LEU A O   1 
ATOM   1587 C CB  . LEU A 1 214 ? -26.212 -48.412 17.026  1.00 51.87  ?  235 LEU A CB  1 
ATOM   1588 C CG  . LEU A 1 214 ? -25.258 -47.277 16.645  1.00 50.45  ?  235 LEU A CG  1 
ATOM   1589 C CD1 . LEU A 1 214 ? -23.842 -47.798 16.480  1.00 49.32  ?  235 LEU A CD1 1 
ATOM   1590 C CD2 . LEU A 1 214 ? -25.724 -46.581 15.377  1.00 49.67  ?  235 LEU A CD2 1 
ATOM   1591 N N   . GLY A 1 215 ? -24.923 -47.854 20.282  1.00 54.47  ?  236 GLY A N   1 
ATOM   1592 C CA  . GLY A 1 215 ? -24.797 -46.865 21.335  1.00 55.30  ?  236 GLY A CA  1 
ATOM   1593 C C   . GLY A 1 215 ? -24.560 -45.462 20.814  1.00 56.14  ?  236 GLY A C   1 
ATOM   1594 O O   . GLY A 1 215 ? -24.151 -45.272 19.669  1.00 57.06  ?  236 GLY A O   1 
ATOM   1595 N N   . SER A 1 216 ? -24.838 -44.476 21.659  1.00 59.40  ?  237 SER A N   1 
ATOM   1596 C CA  . SER A 1 216 ? -24.496 -43.088 21.373  1.00 59.71  ?  237 SER A CA  1 
ATOM   1597 C C   . SER A 1 216 ? -23.821 -42.490 22.600  1.00 62.13  ?  237 SER A C   1 
ATOM   1598 O O   . SER A 1 216 ? -23.990 -42.994 23.710  1.00 68.97  ?  237 SER A O   1 
ATOM   1599 C CB  . SER A 1 216 ? -25.735 -42.278 20.987  1.00 59.75  ?  237 SER A CB  1 
ATOM   1600 O OG  . SER A 1 216 ? -25.441 -40.893 20.938  1.00 61.63  ?  237 SER A OG  1 
ATOM   1601 N N   . VAL A 1 217 ? -23.046 -41.429 22.405  1.00 63.10  ?  238 VAL A N   1 
ATOM   1602 C CA  . VAL A 1 217 ? -22.313 -40.826 23.512  1.00 66.56  ?  238 VAL A CA  1 
ATOM   1603 C C   . VAL A 1 217 ? -23.246 -40.076 24.457  1.00 73.22  ?  238 VAL A C   1 
ATOM   1604 O O   . VAL A 1 217 ? -23.948 -39.150 24.047  1.00 68.31  ?  238 VAL A O   1 
ATOM   1605 C CB  . VAL A 1 217 ? -21.220 -39.863 23.014  1.00 62.86  ?  238 VAL A CB  1 
ATOM   1606 C CG1 . VAL A 1 217 ? -20.457 -39.281 24.192  1.00 65.74  ?  238 VAL A CG1 1 
ATOM   1607 C CG2 . VAL A 1 217 ? -20.272 -40.584 22.070  1.00 59.20  ?  238 VAL A CG2 1 
ATOM   1608 N N   . ASN A 1 218 ? -23.246 -40.498 25.719  1.00 72.51  ?  239 ASN A N   1 
ATOM   1609 C CA  . ASN A 1 218 ? -24.032 -39.863 26.774  1.00 77.98  ?  239 ASN A CA  1 
ATOM   1610 C C   . ASN A 1 218 ? -25.527 -39.796 26.469  1.00 79.10  ?  239 ASN A C   1 
ATOM   1611 O O   . ASN A 1 218 ? -26.192 -38.820 26.817  1.00 93.92  ?  239 ASN A O   1 
ATOM   1612 C CB  . ASN A 1 218 ? -23.502 -38.452 27.048  1.00 81.15  ?  239 ASN A CB  1 
ATOM   1613 N N   . SER A 1 219 ? -26.054 -40.833 25.824  1.00 73.65  ?  240 SER A N   1 
ATOM   1614 C CA  . SER A 1 219 ? -27.472 -40.865 25.480  1.00 72.86  ?  240 SER A CA  1 
ATOM   1615 C C   . SER A 1 219 ? -27.997 -42.282 25.282  1.00 72.36  ?  240 SER A C   1 
ATOM   1616 O O   . SER A 1 219 ? -27.261 -43.260 25.421  1.00 69.25  ?  240 SER A O   1 
ATOM   1617 C CB  . SER A 1 219 ? -27.732 -40.047 24.211  1.00 72.82  ?  240 SER A CB  1 
ATOM   1618 O OG  . SER A 1 219 ? -27.421 -38.679 24.404  1.00 75.56  ?  240 SER A OG  1 
ATOM   1619 N N   . SER A 1 220 ? -29.284 -42.375 24.962  1.00 81.79  ?  241 SER A N   1 
ATOM   1620 C CA  . SER A 1 220 ? -29.910 -43.637 24.591  1.00 81.13  ?  241 SER A CA  1 
ATOM   1621 C C   . SER A 1 220 ? -29.391 -44.062 23.217  1.00 74.54  ?  241 SER A C   1 
ATOM   1622 O O   . SER A 1 220 ? -28.871 -43.228 22.474  1.00 64.91  ?  241 SER A O   1 
ATOM   1623 C CB  . SER A 1 220 ? -31.436 -43.493 24.591  1.00 84.17  ?  241 SER A CB  1 
ATOM   1624 O OG  . SER A 1 220 ? -31.887 -42.801 23.440  1.00 93.17  ?  241 SER A OG  1 
ATOM   1625 N N   . PRO A 1 221 ? -29.514 -45.359 22.876  1.00 75.81  ?  242 PRO A N   1 
ATOM   1626 C CA  . PRO A 1 221 ? -28.995 -45.832 21.586  1.00 70.86  ?  242 PRO A CA  1 
ATOM   1627 C C   . PRO A 1 221 ? -29.583 -45.101 20.382  1.00 63.93  ?  242 PRO A C   1 
ATOM   1628 O O   . PRO A 1 221 ? -30.746 -44.700 20.401  1.00 64.80  ?  242 PRO A O   1 
ATOM   1629 C CB  . PRO A 1 221 ? -29.401 -47.313 21.564  1.00 71.62  ?  242 PRO A CB  1 
ATOM   1630 C CG  . PRO A 1 221 ? -30.476 -47.442 22.596  1.00 73.58  ?  242 PRO A CG  1 
ATOM   1631 C CD  . PRO A 1 221 ? -30.102 -46.461 23.656  1.00 76.99  ?  242 PRO A CD  1 
ATOM   1632 N N   . ALA A 1 222 ? -28.768 -44.927 19.347  1.00 62.20  ?  243 ALA A N   1 
ATOM   1633 C CA  . ALA A 1 222 ? -29.229 -44.317 18.111  1.00 60.22  ?  243 ALA A CA  1 
ATOM   1634 C C   . ALA A 1 222 ? -30.158 -45.270 17.373  1.00 58.11  ?  243 ALA A C   1 
ATOM   1635 O O   . ALA A 1 222 ? -31.144 -44.850 16.773  1.00 57.15  ?  243 ALA A O   1 
ATOM   1636 C CB  . ALA A 1 222 ? -28.048 -43.934 17.231  1.00 59.19  ?  243 ALA A CB  1 
ATOM   1637 N N   . THR A 1 223 ? -29.841 -46.559 17.433  1.00 58.51  ?  244 THR A N   1 
ATOM   1638 C CA  . THR A 1 223 ? -30.595 -47.568 16.699  1.00 63.67  ?  244 THR A CA  1 
ATOM   1639 C C   . THR A 1 223 ? -30.779 -48.840 17.521  1.00 63.26  ?  244 THR A C   1 
ATOM   1640 O O   . THR A 1 223 ? -29.858 -49.284 18.201  1.00 60.63  ?  244 THR A O   1 
ATOM   1641 C CB  . THR A 1 223 ? -29.893 -47.920 15.368  1.00 67.06  ?  244 THR A CB  1 
ATOM   1642 O OG1 . THR A 1 223 ? -29.809 -46.751 14.544  1.00 64.66  ?  244 THR A OG1 1 
ATOM   1643 C CG2 . THR A 1 223 ? -30.654 -49.000 14.618  1.00 73.02  ?  244 THR A CG2 1 
ATOM   1644 N N   . ILE A 1 224 ? -31.980 -49.409 17.474  1.00 67.65  ?  245 ILE A N   1 
ATOM   1645 C CA  . ILE A 1 224 ? -32.226 -50.731 18.042  1.00 69.51  ?  245 ILE A CA  1 
ATOM   1646 C C   . ILE A 1 224 ? -32.946 -51.606 17.025  1.00 69.61  ?  245 ILE A C   1 
ATOM   1647 O O   . ILE A 1 224 ? -34.004 -51.235 16.516  1.00 73.70  ?  245 ILE A O   1 
ATOM   1648 C CB  . ILE A 1 224 ? -33.066 -50.671 19.331  1.00 73.60  ?  245 ILE A CB  1 
ATOM   1649 C CG1 . ILE A 1 224 ? -32.580 -49.549 20.248  1.00 72.68  ?  245 ILE A CG1 1 
ATOM   1650 C CG2 . ILE A 1 224 ? -33.036 -52.016 20.049  1.00 77.81  ?  245 ILE A CG2 1 
ATOM   1651 C CD1 . ILE A 1 224 ? -33.377 -49.428 21.516  1.00 71.46  ?  245 ILE A CD1 1 
ATOM   1652 N N   . ILE A 1 225 ? -32.369 -52.764 16.721  1.00 68.06  ?  246 ILE A N   1 
ATOM   1653 C CA  . ILE A 1 225 ? -32.980 -53.678 15.761  1.00 69.07  ?  246 ILE A CA  1 
ATOM   1654 C C   . ILE A 1 225 ? -33.095 -55.088 16.327  1.00 73.69  ?  246 ILE A C   1 
ATOM   1655 O O   . ILE A 1 225 ? -32.142 -55.616 16.893  1.00 73.21  ?  246 ILE A O   1 
ATOM   1656 C CB  . ILE A 1 225 ? -32.182 -53.739 14.443  1.00 69.38  ?  246 ILE A CB  1 
ATOM   1657 C CG1 . ILE A 1 225 ? -31.870 -52.333 13.931  1.00 70.53  ?  246 ILE A CG1 1 
ATOM   1658 C CG2 . ILE A 1 225 ? -32.946 -54.523 13.395  1.00 72.97  ?  246 ILE A CG2 1 
ATOM   1659 C CD1 . ILE A 1 225 ? -31.011 -52.316 12.688  1.00 72.94  ?  246 ILE A CD1 1 
ATOM   1660 N N   . ASN A 1 226 ? -34.265 -55.700 16.171  1.00 72.80  ?  247 ASN A N   1 
ATOM   1661 C CA  . ASN A 1 226 ? -34.471 -57.061 16.648  1.00 73.16  ?  247 ASN A CA  1 
ATOM   1662 C C   . ASN A 1 226 ? -34.424 -58.083 15.524  1.00 73.91  ?  247 ASN A C   1 
ATOM   1663 O O   . ASN A 1 226 ? -35.174 -57.989 14.556  1.00 79.04  ?  247 ASN A O   1 
ATOM   1664 C CB  . ASN A 1 226 ? -35.801 -57.174 17.385  1.00 75.20  ?  247 ASN A CB  1 
ATOM   1665 C CG  . ASN A 1 226 ? -36.008 -56.057 18.377  1.00 81.40  ?  247 ASN A CG  1 
ATOM   1666 O OD1 . ASN A 1 226 ? -35.861 -54.879 18.049  1.00 89.07  ?  247 ASN A OD1 1 
ATOM   1667 N ND2 . ASN A 1 226 ? -36.323 -56.422 19.610  1.00 83.39  ?  247 ASN A ND2 1 
ATOM   1668 N N   . PHE A 1 227 ? -33.540 -59.063 15.662  1.00 74.40  ?  248 PHE A N   1 
ATOM   1669 C CA  . PHE A 1 227 ? -33.416 -60.108 14.658  1.00 79.66  ?  248 PHE A CA  1 
ATOM   1670 C C   . PHE A 1 227 ? -34.138 -61.371 15.109  1.00 87.78  ?  248 PHE A C   1 
ATOM   1671 O O   . PHE A 1 227 ? -33.993 -61.803 16.250  1.00 88.15  ?  248 PHE A O   1 
ATOM   1672 C CB  . PHE A 1 227 ? -31.943 -60.420 14.372  1.00 78.24  ?  248 PHE A CB  1 
ATOM   1673 C CG  . PHE A 1 227 ? -31.143 -59.233 13.906  1.00 74.70  ?  248 PHE A CG  1 
ATOM   1674 C CD1 . PHE A 1 227 ? -30.653 -58.307 14.813  1.00 71.47  ?  248 PHE A CD1 1 
ATOM   1675 C CD2 . PHE A 1 227 ? -30.880 -59.046 12.559  1.00 74.10  ?  248 PHE A CD2 1 
ATOM   1676 C CE1 . PHE A 1 227 ? -29.916 -57.219 14.386  1.00 70.02  ?  248 PHE A CE1 1 
ATOM   1677 C CE2 . PHE A 1 227 ? -30.143 -57.958 12.126  1.00 72.67  ?  248 PHE A CE2 1 
ATOM   1678 C CZ  . PHE A 1 227 ? -29.661 -57.044 13.041  1.00 70.32  ?  248 PHE A CZ  1 
ATOM   1679 N N   . HIS A 1 228 ? -34.928 -61.953 14.216  1.00 84.25  ?  249 HIS A N   1 
ATOM   1680 C CA  . HIS A 1 228 ? -35.513 -63.260 14.469  1.00 89.70  ?  249 HIS A CA  1 
ATOM   1681 C C   . HIS A 1 228 ? -34.928 -64.262 13.486  1.00 89.41  ?  249 HIS A C   1 
ATOM   1682 O O   . HIS A 1 228 ? -35.303 -64.297 12.310  1.00 83.73  ?  249 HIS A O   1 
ATOM   1683 C CB  . HIS A 1 228 ? -37.037 -63.227 14.360  1.00 98.82  ?  249 HIS A CB  1 
ATOM   1684 C CG  . HIS A 1 228 ? -37.692 -64.514 14.752  1.00 108.88 ?  249 HIS A CG  1 
ATOM   1685 N ND1 . HIS A 1 228 ? -37.566 -65.057 16.014  1.00 111.39 ?  249 HIS A ND1 1 
ATOM   1686 C CD2 . HIS A 1 228 ? -38.473 -65.371 14.053  1.00 113.05 ?  249 HIS A CD2 1 
ATOM   1687 C CE1 . HIS A 1 228 ? -38.242 -66.189 16.074  1.00 114.79 ?  249 HIS A CE1 1 
ATOM   1688 N NE2 . HIS A 1 228 ? -38.803 -66.403 14.897  1.00 118.33 ?  249 HIS A NE2 1 
ATOM   1689 N N   . VAL A 1 229 ? -33.992 -65.067 13.977  1.00 90.35  ?  250 VAL A N   1 
ATOM   1690 C CA  . VAL A 1 229 ? -33.289 -66.025 13.140  1.00 94.74  ?  250 VAL A CA  1 
ATOM   1691 C C   . VAL A 1 229 ? -33.893 -67.420 13.242  1.00 101.09 ?  250 VAL A C   1 
ATOM   1692 O O   . VAL A 1 229 ? -34.182 -67.908 14.336  1.00 110.86 ?  250 VAL A O   1 
ATOM   1693 C CB  . VAL A 1 229 ? -31.795 -66.098 13.507  1.00 94.52  ?  250 VAL A CB  1 
ATOM   1694 C CG1 . VAL A 1 229 ? -31.022 -66.845 12.432  1.00 98.77  ?  250 VAL A CG1 1 
ATOM   1695 C CG2 . VAL A 1 229 ? -31.229 -64.700 13.685  1.00 93.83  ?  250 VAL A CG2 1 
ATOM   1696 N N   . THR A 1 230 ? -34.089 -68.048 12.088  1.00 104.09 ?  251 THR A N   1 
ATOM   1697 C CA  . THR A 1 230 ? -34.519 -69.437 12.017  1.00 107.25 ?  251 THR A CA  1 
ATOM   1698 C C   . THR A 1 230 ? -33.624 -70.186 11.034  1.00 105.54 ?  251 THR A C   1 
ATOM   1699 O O   . THR A 1 230 ? -33.073 -69.591 10.100  1.00 98.16  ?  251 THR A O   1 
ATOM   1700 C CB  . THR A 1 230 ? -35.995 -69.561 11.595  1.00 110.32 ?  251 THR A CB  1 
ATOM   1701 O OG1 . THR A 1 230 ? -36.292 -68.577 10.597  1.00 114.26 ?  251 THR A OG1 1 
ATOM   1702 C CG2 . THR A 1 230 ? -36.911 -69.343 12.792  1.00 104.10 ?  251 THR A CG2 1 
ATOM   1703 N N   . VAL A 1 231 ? -33.474 -71.489 11.244  1.00 107.87 ?  252 VAL A N   1 
ATOM   1704 C CA  . VAL A 1 231 ? -32.503 -72.259 10.479  1.00 114.30 ?  252 VAL A CA  1 
ATOM   1705 C C   . VAL A 1 231 ? -33.143 -73.390 9.667   1.00 126.83 ?  252 VAL A C   1 
ATOM   1706 O O   . VAL A 1 231 ? -34.056 -74.073 10.131  1.00 133.62 ?  252 VAL A O   1 
ATOM   1707 C CB  . VAL A 1 231 ? -31.399 -72.829 11.411  1.00 111.10 ?  252 VAL A CB  1 
ATOM   1708 C CG1 . VAL A 1 231 ? -31.996 -73.738 12.478  1.00 110.16 ?  252 VAL A CG1 1 
ATOM   1709 C CG2 . VAL A 1 231 ? -30.320 -73.549 10.609  1.00 113.50 ?  252 VAL A CG2 1 
ATOM   1710 N N   . LEU A 1 232 ? -32.664 -73.555 8.436   1.00 123.84 ?  253 LEU A N   1 
ATOM   1711 C CA  . LEU A 1 232 ? -33.143 -74.595 7.531   1.00 125.84 ?  253 LEU A CA  1 
ATOM   1712 C C   . LEU A 1 232 ? -32.027 -75.624 7.329   1.00 127.81 ?  253 LEU A C   1 
ATOM   1713 O O   . LEU A 1 232 ? -30.858 -75.315 7.551   1.00 129.93 ?  253 LEU A O   1 
ATOM   1714 C CB  . LEU A 1 232 ? -33.572 -73.992 6.187   1.00 122.63 ?  253 LEU A CB  1 
ATOM   1715 C CG  . LEU A 1 232 ? -34.435 -72.722 6.116   1.00 118.81 ?  253 LEU A CG  1 
ATOM   1716 C CD1 . LEU A 1 232 ? -35.167 -72.654 4.782   1.00 118.81 ?  253 LEU A CD1 1 
ATOM   1717 C CD2 . LEU A 1 232 ? -35.435 -72.621 7.263   1.00 118.64 ?  253 LEU A CD2 1 
ATOM   1718 N N   . PRO A 1 233 ? -32.377 -76.855 6.920   1.00 137.84 ?  254 PRO A N   1 
ATOM   1719 C CA  . PRO A 1 233 ? -31.331 -77.869 6.744   1.00 132.41 ?  254 PRO A CA  1 
ATOM   1720 C C   . PRO A 1 233 ? -30.839 -78.033 5.303   1.00 132.37 ?  254 PRO A C   1 
ATOM   1721 O O   . PRO A 1 233 ? -29.981 -78.884 5.059   1.00 132.20 ?  254 PRO A O   1 
ATOM   1722 C CB  . PRO A 1 233 ? -32.014 -79.162 7.220   1.00 132.00 ?  254 PRO A CB  1 
ATOM   1723 C CG  . PRO A 1 233 ? -33.461 -78.784 7.548   1.00 133.54 ?  254 PRO A CG  1 
ATOM   1724 C CD  . PRO A 1 233 ? -33.714 -77.463 6.899   1.00 133.56 ?  254 PRO A CD  1 
ATOM   1725 N N   . GLY A 1 234 ? -31.373 -77.243 4.374   1.00 129.93 ?  255 GLY A N   1 
ATOM   1726 C CA  . GLY A 1 234 ? -30.977 -77.321 2.977   1.00 131.73 ?  255 GLY A CA  1 
ATOM   1727 C C   . GLY A 1 234 ? -29.483 -77.146 2.771   1.00 131.29 ?  255 GLY A C   1 
ATOM   1728 O O   . GLY A 1 234 ? -28.816 -76.497 3.577   1.00 135.74 ?  255 GLY A O   1 
ATOM   1729 N N   . ARG A 1 235 ? -28.966 -77.729 1.690   1.00 130.81 ?  256 ARG A N   1 
ATOM   1730 C CA  . ARG A 1 235 ? -27.533 -77.728 1.396   1.00 126.76 ?  256 ARG A CA  1 
ATOM   1731 C C   . ARG A 1 235 ? -26.729 -78.333 2.545   1.00 121.81 ?  256 ARG A C   1 
ATOM   1732 O O   . ARG A 1 235 ? -25.528 -78.569 2.420   1.00 121.06 ?  256 ARG A O   1 
ATOM   1733 C CB  . ARG A 1 235 ? -27.038 -76.309 1.096   1.00 118.03 ?  256 ARG A CB  1 
HETATM 1734 C C1  . NAG B 2 .   ? -31.020 -69.092 30.066  1.00 118.89 ?  301 NAG A C1  1 
HETATM 1735 C C2  . NAG B 2 .   ? -30.471 -69.256 31.452  1.00 111.02 ?  301 NAG A C2  1 
HETATM 1736 C C3  . NAG B 2 .   ? -28.950 -69.315 31.411  1.00 107.85 ?  301 NAG A C3  1 
HETATM 1737 C C4  . NAG B 2 .   ? -28.529 -70.464 30.494  1.00 107.25 ?  301 NAG A C4  1 
HETATM 1738 C C5  . NAG B 2 .   ? -29.197 -70.346 29.128  1.00 107.22 ?  301 NAG A C5  1 
HETATM 1739 C C6  . NAG B 2 .   ? -28.985 -71.576 28.281  1.00 102.12 ?  301 NAG A C6  1 
HETATM 1740 C C7  . NAG B 2 .   ? -31.644 -68.392 33.439  1.00 107.37 ?  301 NAG A C7  1 
HETATM 1741 C C8  . NAG B 2 .   ? -31.937 -69.811 33.756  1.00 105.67 ?  301 NAG A C8  1 
HETATM 1742 N N2  . NAG B 2 .   ? -30.925 -68.168 32.316  1.00 106.64 ?  301 NAG A N2  1 
HETATM 1743 O O3  . NAG B 2 .   ? -28.457 -69.535 32.720  1.00 106.55 ?  301 NAG A O3  1 
HETATM 1744 O O4  . NAG B 2 .   ? -27.117 -70.387 30.321  1.00 105.54 ?  301 NAG A O4  1 
HETATM 1745 O O5  . NAG B 2 .   ? -30.622 -70.206 29.270  1.00 117.58 ?  301 NAG A O5  1 
HETATM 1746 O O6  . NAG B 2 .   ? -30.123 -72.425 28.337  1.00 94.93  ?  301 NAG A O6  1 
HETATM 1747 O O7  . NAG B 2 .   ? -32.032 -67.461 34.139  1.00 106.46 ?  301 NAG A O7  1 
HETATM 1748 O O   . HOH C 3 .   ? -19.493 -38.899 11.114  1.00 59.76  ?  401 HOH A O   1 
HETATM 1749 O O   . HOH C 3 .   ? -12.321 -20.186 -20.829 1.00 68.15  ?  402 HOH A O   1 
HETATM 1750 O O   . HOH C 3 .   ? -22.093 -14.804 6.913   1.00 52.74  ?  403 HOH A O   1 
HETATM 1751 O O   . HOH C 3 .   ? -20.962 -46.867 10.969  1.00 52.43  ?  404 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . CYS A 1   ? 0.8246 1.0038 0.6716 -0.0472 0.1128  -0.0638 22  CYS A N   
2    C CA  . CYS A 1   ? 0.9110 1.0625 0.7136 -0.0437 0.1080  -0.0436 22  CYS A CA  
3    C C   . CYS A 1   ? 0.8122 0.9362 0.6192 -0.0477 0.0848  -0.0364 22  CYS A C   
4    O O   . CYS A 1   ? 0.8962 0.9979 0.6751 -0.0451 0.0740  -0.0197 22  CYS A O   
5    C CB  . CYS A 1   ? 1.0494 1.2038 0.8551 -0.0529 0.1338  -0.0203 22  CYS A CB  
6    S SG  . CYS A 1   ? 1.3455 1.5458 1.1902 -0.0595 0.1687  -0.0275 22  CYS A SG  
7    N N   . VAL A 2   ? 0.8521 0.9799 0.6943 -0.0524 0.0772  -0.0494 23  VAL A N   
8    C CA  . VAL A 2   ? 0.7799 0.8900 0.6418 -0.0574 0.0633  -0.0430 23  VAL A CA  
9    C C   . VAL A 2   ? 0.7999 0.8891 0.6330 -0.0511 0.0396  -0.0358 23  VAL A C   
10   O O   . VAL A 2   ? 0.8018 0.8791 0.6490 -0.0542 0.0302  -0.0213 23  VAL A O   
11   C CB  . VAL A 2   ? 0.7192 0.8369 0.6089 -0.0591 0.0610  -0.0609 23  VAL A CB  
12   C CG1 . VAL A 2   ? 0.7450 0.8486 0.6572 -0.0628 0.0527  -0.0543 23  VAL A CG1 
13   C CG2 . VAL A 2   ? 0.7106 0.8486 0.6322 -0.0662 0.0777  -0.0713 23  VAL A CG2 
14   N N   . ILE A 3   ? 0.8252 0.9099 0.6213 -0.0415 0.0282  -0.0471 24  ILE A N   
15   C CA  . ILE A 3   ? 0.8655 0.9289 0.6377 -0.0377 0.0014  -0.0451 24  ILE A CA  
16   C C   . ILE A 3   ? 0.9009 0.9518 0.6445 -0.0346 -0.0077 -0.0271 24  ILE A C   
17   O O   . ILE A 3   ? 0.9565 0.9913 0.6842 -0.0322 -0.0348 -0.0249 24  ILE A O   
18   C CB  . ILE A 3   ? 0.9000 0.9536 0.6347 -0.0272 -0.0095 -0.0638 24  ILE A CB  
19   C CG1 . ILE A 3   ? 0.9102 0.9421 0.6462 -0.0305 -0.0379 -0.0669 24  ILE A CG1 
20   C CG2 . ILE A 3   ? 0.8896 0.9397 0.5707 -0.0146 -0.0050 -0.0655 24  ILE A CG2 
21   C CD1 . ILE A 3   ? 0.9231 0.9429 0.6498 -0.0260 -0.0438 -0.0844 24  ILE A CD1 
22   N N   . CYS A 4   ? 0.8832 0.9405 0.6210 -0.0352 0.0139  -0.0135 25  CYS A N   
23   C CA  . CYS A 4   ? 0.9679 1.0095 0.6741 -0.0310 0.0081  0.0089  25  CYS A CA  
24   C C   . CYS A 4   ? 0.9856 1.0198 0.7324 -0.0368 -0.0039 0.0262  25  CYS A C   
25   O O   . CYS A 4   ? 0.9998 1.0194 0.7273 -0.0323 -0.0098 0.0484  25  CYS A O   
26   C CB  . CYS A 4   ? 1.0269 1.0753 0.7147 -0.0310 0.0403  0.0219  25  CYS A CB  
27   S SG  . CYS A 4   ? 1.1843 1.2475 0.8259 -0.0194 0.0590  0.0039  25  CYS A SG  
28   N N   . ASP A 5   ? 0.9484 0.9919 0.7488 -0.0442 -0.0066 0.0168  26  ASP A N   
29   C CA  . ASP A 5   ? 0.8823 0.9230 0.7289 -0.0470 -0.0145 0.0301  26  ASP A CA  
30   C C   . ASP A 5   ? 0.8660 0.9082 0.7316 -0.0461 -0.0441 0.0253  26  ASP A C   
31   O O   . ASP A 5   ? 0.8389 0.8890 0.7204 -0.0509 -0.0451 0.0086  26  ASP A O   
32   C CB  . ASP A 5   ? 0.8579 0.9087 0.7553 -0.0553 0.0091  0.0237  26  ASP A CB  
33   C CG  . ASP A 5   ? 0.9005 0.9471 0.8459 -0.0546 0.0051  0.0355  26  ASP A CG  
34   O OD1 . ASP A 5   ? 0.9599 0.9967 0.9012 -0.0475 -0.0142 0.0535  26  ASP A OD1 
35   O OD2 . ASP A 5   ? 0.8493 0.9021 0.8348 -0.0588 0.0200  0.0257  26  ASP A OD2 
36   N N   . PRO A 6   ? 0.8466 0.8811 0.7123 -0.0401 -0.0689 0.0413  27  PRO A N   
37   C CA  . PRO A 6   ? 0.8466 0.8874 0.7421 -0.0404 -0.1008 0.0393  27  PRO A CA  
38   C C   . PRO A 6   ? 0.7984 0.8584 0.7630 -0.0490 -0.0912 0.0315  27  PRO A C   
39   O O   . PRO A 6   ? 0.8000 0.8688 0.7915 -0.0540 -0.1112 0.0255  27  PRO A O   
40   C CB  . PRO A 6   ? 0.8833 0.9176 0.7829 -0.0303 -0.1209 0.0624  27  PRO A CB  
41   C CG  . PRO A 6   ? 0.9199 0.9347 0.7645 -0.0238 -0.1035 0.0773  27  PRO A CG  
42   C CD  . PRO A 6   ? 0.8965 0.9142 0.7211 -0.0313 -0.0702 0.0628  27  PRO A CD  
43   N N   . SER A 7   ? 0.8465 0.9119 0.8388 -0.0509 -0.0607 0.0313  28  SER A N   
44   C CA  . SER A 7   ? 0.8375 0.9191 0.8870 -0.0555 -0.0476 0.0247  28  SER A CA  
45   C C   . SER A 7   ? 0.8032 0.8875 0.8402 -0.0629 -0.0343 0.0064  28  SER A C   
46   O O   . SER A 7   ? 0.7999 0.8948 0.8706 -0.0679 -0.0316 0.0022  28  SER A O   
47   C CB  . SER A 7   ? 0.7896 0.8704 0.8697 -0.0516 -0.0234 0.0297  28  SER A CB  
48   O OG  . SER A 7   ? 0.8179 0.8907 0.9095 -0.0425 -0.0359 0.0494  28  SER A OG  
49   N N   . VAL A 8   ? 0.7602 0.8354 0.7500 -0.0626 -0.0250 -0.0027 29  VAL A N   
50   C CA  . VAL A 8   ? 0.7422 0.8170 0.7135 -0.0655 -0.0164 -0.0192 29  VAL A CA  
51   C C   . VAL A 8   ? 0.7754 0.8433 0.7399 -0.0693 -0.0384 -0.0228 29  VAL A C   
52   O O   . VAL A 8   ? 0.8050 0.8740 0.7880 -0.0747 -0.0331 -0.0274 29  VAL A O   
53   C CB  . VAL A 8   ? 0.7487 0.8196 0.6754 -0.0617 -0.0066 -0.0281 29  VAL A CB  
54   C CG1 . VAL A 8   ? 0.7456 0.8151 0.6532 -0.0606 -0.0029 -0.0446 29  VAL A CG1 
55   C CG2 . VAL A 8   ? 0.7391 0.8164 0.6809 -0.0625 0.0152  -0.0260 29  VAL A CG2 
56   N N   . VAL A 9   ? 0.7961 0.8535 0.7316 -0.0666 -0.0631 -0.0205 30  VAL A N   
57   C CA  . VAL A 9   ? 0.8850 0.9302 0.8124 -0.0712 -0.0893 -0.0273 30  VAL A CA  
58   C C   . VAL A 9   ? 0.9211 0.9795 0.9127 -0.0818 -0.0994 -0.0196 30  VAL A C   
59   O O   . VAL A 9   ? 0.9635 1.0149 0.9689 -0.0916 -0.1092 -0.0251 30  VAL A O   
60   C CB  . VAL A 9   ? 0.9060 0.9357 0.7846 -0.0640 -0.1170 -0.0286 30  VAL A CB  
61   C CG1 . VAL A 9   ? 0.8880 0.9091 0.7065 -0.0531 -0.1011 -0.0357 30  VAL A CG1 
62   C CG2 . VAL A 9   ? 0.9520 0.9903 0.8486 -0.0606 -0.1322 -0.0115 30  VAL A CG2 
63   N N   . LEU A 10  ? 0.8132 0.8907 0.8481 -0.0796 -0.0952 -0.0063 31  LEU A N   
64   C CA  . LEU A 10  ? 0.8362 0.9355 0.9433 -0.0873 -0.0979 0.0014  31  LEU A CA  
65   C C   . LEU A 10  ? 0.7918 0.8968 0.9211 -0.0936 -0.0662 -0.0022 31  LEU A C   
66   O O   . LEU A 10  ? 0.9230 1.0343 1.0888 -0.1052 -0.0677 -0.0007 31  LEU A O   
67   C CB  . LEU A 10  ? 0.8552 0.9725 1.0028 -0.0783 -0.0970 0.0155  31  LEU A CB  
68   C CG  . LEU A 10  ? 0.9886 1.1032 1.1258 -0.0702 -0.1324 0.0252  31  LEU A CG  
69   C CD1 . LEU A 10  ? 0.9811 1.1203 1.1877 -0.0631 -0.1374 0.0397  31  LEU A CD1 
70   C CD2 . LEU A 10  ? 1.0547 1.1607 1.1737 -0.0774 -0.1708 0.0169  31  LEU A CD2 
71   N N   . ALA A 11  ? 0.8071 0.9089 0.9129 -0.0864 -0.0380 -0.0064 32  ALA A N   
72   C CA  . ALA A 11  ? 0.8018 0.9055 0.9136 -0.0883 -0.0087 -0.0110 32  ALA A CA  
73   C C   . ALA A 11  ? 0.8645 0.9489 0.9447 -0.0951 -0.0129 -0.0175 32  ALA A C   
74   O O   . ALA A 11  ? 0.9061 0.9896 0.9979 -0.0998 0.0053  -0.0152 32  ALA A O   
75   C CB  . ALA A 11  ? 0.7951 0.8963 0.8815 -0.0788 0.0140  -0.0186 32  ALA A CB  
76   N N   . LEU A 12  ? 0.8689 0.9345 0.9058 -0.0938 -0.0354 -0.0247 33  LEU A N   
77   C CA  . LEU A 12  ? 0.8802 0.9206 0.8847 -0.0973 -0.0426 -0.0324 33  LEU A CA  
78   C C   . LEU A 12  ? 0.9128 0.9463 0.9521 -0.1127 -0.0630 -0.0274 33  LEU A C   
79   O O   . LEU A 12  ? 0.9197 0.9369 0.9627 -0.1213 -0.0564 -0.0255 33  LEU A O   
80   C CB  . LEU A 12  ? 0.8978 0.9205 0.8426 -0.0868 -0.0564 -0.0450 33  LEU A CB  
81   C CG  . LEU A 12  ? 0.9077 0.9388 0.8239 -0.0745 -0.0356 -0.0515 33  LEU A CG  
82   C CD1 . LEU A 12  ? 0.8778 0.8959 0.7414 -0.0637 -0.0448 -0.0637 33  LEU A CD1 
83   C CD2 . LEU A 12  ? 0.9363 0.9680 0.8543 -0.0729 -0.0129 -0.0535 33  LEU A CD2 
84   N N   . LYS A 13  ? 0.8720 0.9165 0.9375 -0.1166 -0.0893 -0.0246 34  LYS A N   
85   C CA  . LYS A 13  ? 0.8831 0.9285 0.9964 -0.1336 -0.1131 -0.0213 34  LYS A CA  
86   C C   . LYS A 13  ? 0.9004 0.9697 1.0824 -0.1455 -0.0868 -0.0072 34  LYS A C   
87   O O   . LYS A 13  ? 0.8950 0.9540 1.1034 -0.1620 -0.0859 -0.0034 34  LYS A O   
88   C CB  . LYS A 13  ? 0.8655 0.9254 0.9976 -0.1321 -0.1482 -0.0205 34  LYS A CB  
89   N N   . SER A 14  ? 0.9039 1.0026 1.1134 -0.1366 -0.0629 0.0007  35  SER A N   
90   C CA  . SER A 14  ? 0.9077 1.0315 1.1755 -0.1425 -0.0308 0.0127  35  SER A CA  
91   C C   . SER A 14  ? 0.9188 1.0207 1.1484 -0.1428 0.0011  0.0132  35  SER A C   
92   O O   . SER A 14  ? 1.0315 1.1411 1.2974 -0.1532 0.0247  0.0247  35  SER A O   
93   C CB  . SER A 14  ? 0.8599 1.0133 1.1563 -0.1281 -0.0133 0.0170  35  SER A CB  
94   O OG  . SER A 14  ? 0.9319 1.0965 1.2442 -0.1224 -0.0449 0.0177  35  SER A OG  
95   N N   . LEU A 15  ? 0.9156 0.9915 1.0723 -0.1305 0.0021  0.0019  36  LEU A N   
96   C CA  . LEU A 15  ? 0.9316 0.9844 1.0448 -0.1270 0.0255  0.0017  36  LEU A CA  
97   C C   . LEU A 15  ? 1.0068 1.0311 1.1209 -0.1425 0.0168  0.0079  36  LEU A C   
98   O O   . LEU A 15  ? 1.1315 1.1505 1.2589 -0.1502 0.0421  0.0214  36  LEU A O   
99   C CB  . LEU A 15  ? 0.9256 0.9612 0.9696 -0.1103 0.0221  -0.0133 36  LEU A CB  
100  C CG  . LEU A 15  ? 0.8806 0.8925 0.8778 -0.1033 0.0401  -0.0140 36  LEU A CG  
101  C CD1 . LEU A 15  ? 0.9011 0.9285 0.9093 -0.0990 0.0747  -0.0069 36  LEU A CD1 
102  C CD2 . LEU A 15  ? 0.8454 0.8453 0.7847 -0.0871 0.0306  -0.0303 36  LEU A CD2 
103  N N   . GLU A 16  ? 0.9926 0.9947 1.0887 -0.1465 -0.0178 -0.0019 37  GLU A N   
104  C CA  . GLU A 16  ? 0.9996 0.9681 1.1009 -0.1629 -0.0319 0.0011  37  GLU A CA  
105  C C   . GLU A 16  ? 1.0276 1.0191 1.2131 -0.1864 -0.0256 0.0174  37  GLU A C   
106  O O   . GLU A 16  ? 1.0358 1.0241 1.2401 -0.1955 0.0050  0.0340  37  GLU A O   
107  C CB  . GLU A 16  ? 0.9528 0.8958 1.0244 -0.1618 -0.0736 -0.0166 37  GLU A CB  
108  N N   . LYS A 17  ? 0.9903 1.0082 1.2269 -0.1945 -0.0535 0.0137  38  LYS A N   
109  C CA  . LYS A 17  ? 0.9939 1.0394 1.3235 -0.2184 -0.0573 0.0259  38  LYS A CA  
110  C C   . LYS A 17  ? 0.9814 1.0623 1.3663 -0.2227 -0.0102 0.0463  38  LYS A C   
111  O O   . LYS A 17  ? 0.9630 1.0528 1.4127 -0.2457 0.0011  0.0609  38  LYS A O   
112  C CB  . LYS A 17  ? 0.9702 1.0479 1.3412 -0.2177 -0.0951 0.0179  38  LYS A CB  
113  N N   . ASP A 18  ? 1.0325 1.1330 1.3939 -0.2013 0.0184  0.0468  39  ASP A N   
114  C CA  . ASP A 18  ? 1.0048 1.1415 1.4168 -0.2008 0.0627  0.0625  39  ASP A CA  
115  C C   . ASP A 18  ? 0.9701 1.0836 1.3218 -0.1905 0.1060  0.0693  39  ASP A C   
116  O O   . ASP A 18  ? 1.0400 1.1687 1.4250 -0.1967 0.1454  0.0864  39  ASP A O   
117  C CB  . ASP A 18  ? 0.9881 1.1669 1.4315 -0.1833 0.0641  0.0576  39  ASP A CB  
118  C CG  . ASP A 18  ? 1.0747 1.2794 1.5782 -0.1899 0.0207  0.0539  39  ASP A CG  
119  O OD1 . ASP A 18  ? 1.2328 1.4215 1.7470 -0.2080 -0.0138 0.0509  39  ASP A OD1 
120  O OD2 . ASP A 18  ? 1.0072 1.2450 1.5447 -0.1756 0.0190  0.0534  39  ASP A OD2 
121  N N   . TYR A 19  ? 1.0546 1.1336 1.3183 -0.1736 0.0994  0.0565  40  TYR A N   
122  C CA  . TYR A 19  ? 1.0681 1.1255 1.2700 -0.1608 0.1340  0.0612  40  TYR A CA  
123  C C   . TYR A 19  ? 1.1009 1.1068 1.2517 -0.1673 0.1286  0.0675  40  TYR A C   
124  O O   . TYR A 19  ? 1.0651 1.0524 1.1876 -0.1657 0.1603  0.0828  40  TYR A O   
125  C CB  . TYR A 19  ? 1.0704 1.1288 1.2144 -0.1354 0.1341  0.0426  40  TYR A CB  
126  C CG  . TYR A 19  ? 1.0800 1.1215 1.1623 -0.1199 0.1660  0.0441  40  TYR A CG  
127  C CD1 . TYR A 19  ? 1.1160 1.1174 1.1252 -0.1117 0.1576  0.0408  40  TYR A CD1 
128  C CD2 . TYR A 19  ? 1.0325 1.0972 1.1273 -0.1108 0.2031  0.0478  40  TYR A CD2 
129  C CE1 . TYR A 19  ? 1.1043 1.0899 1.0529 -0.0954 0.1816  0.0421  40  TYR A CE1 
130  C CE2 . TYR A 19  ? 1.0062 1.0528 1.0355 -0.0946 0.2294  0.0472  40  TYR A CE2 
131  C CZ  . TYR A 19  ? 1.0678 1.0751 1.0232 -0.0873 0.2167  0.0448  40  TYR A CZ  
132  O OH  . TYR A 19  ? 1.0469 1.0359 0.9327 -0.0690 0.2379  0.0440  40  TYR A OH  
133  N N   . LEU A 20  ? 1.0948 1.0742 1.2292 -0.1722 0.0893  0.0562  41  LEU A N   
134  C CA  . LEU A 20  ? 1.1647 1.0894 1.2519 -0.1758 0.0819  0.0608  41  LEU A CA  
135  C C   . LEU A 20  ? 1.2080 1.1147 1.3377 -0.2015 0.1000  0.0861  41  LEU A C   
136  O O   . LEU A 20  ? 1.2144 1.0777 1.2966 -0.1991 0.1160  0.0997  41  LEU A O   
137  C CB  . LEU A 20  ? 1.1420 1.0412 1.2068 -0.1748 0.0367  0.0408  41  LEU A CB  
138  N N   . PRO A 21  ? 1.1079 1.0471 1.3288 -0.2262 0.0974  0.0939  42  PRO A N   
139  C CA  . PRO A 21  ? 1.1429 1.0641 1.4106 -0.2545 0.1155  0.1188  42  PRO A CA  
140  C C   . PRO A 21  ? 1.1974 1.1158 1.4441 -0.2501 0.1713  0.1453  42  PRO A C   
141  O O   . PRO A 21  ? 1.2936 1.1603 1.4998 -0.2552 0.1847  0.1630  42  PRO A O   
142  C CB  . PRO A 21  ? 1.1237 1.0982 1.5033 -0.2780 0.1048  0.1201  42  PRO A CB  
143  C CG  . PRO A 21  ? 1.1124 1.1078 1.4856 -0.2638 0.0631  0.0930  42  PRO A CG  
144  C CD  . PRO A 21  ? 1.1223 1.1130 1.4111 -0.2309 0.0764  0.0828  42  PRO A CD  
145  N N   . GLY A 22  ? 1.1771 1.1465 1.4461 -0.2386 0.2034  0.1480  43  GLY A N   
146  C CA  . GLY A 22  ? 1.2016 1.1731 1.4505 -0.2327 0.2594  0.1716  43  GLY A CA  
147  C C   . GLY A 22  ? 1.2570 1.1779 1.3899 -0.2078 0.2702  0.1733  43  GLY A C   
148  O O   . GLY A 22  ? 1.3084 1.2032 1.4086 -0.2088 0.3083  0.1995  43  GLY A O   
149  N N   . HIS A 23  ? 1.3636 1.2713 1.4351 -0.1852 0.2365  0.1467  44  HIS A N   
150  C CA  . HIS A 23  ? 1.2932 1.1670 1.2617 -0.1569 0.2433  0.1432  44  HIS A CA  
151  C C   . HIS A 23  ? 1.3062 1.1238 1.2145 -0.1498 0.2085  0.1369  44  HIS A C   
152  O O   . HIS A 23  ? 1.2399 1.0320 1.0668 -0.1243 0.2076  0.1323  44  HIS A O   
153  C CB  . HIS A 23  ? 1.1989 1.1081 1.1429 -0.1315 0.2394  0.1165  44  HIS A CB  
154  C CG  . HIS A 23  ? 1.1836 1.1467 1.1896 -0.1341 0.2670  0.1166  44  HIS A CG  
155  N ND1 . HIS A 23  ? 1.2154 1.2185 1.3094 -0.1497 0.2516  0.1107  44  HIS A ND1 
156  C CD2 . HIS A 23  ? 1.1874 1.1698 1.1786 -0.1202 0.3084  0.1209  44  HIS A CD2 
157  C CE1 . HIS A 23  ? 1.1782 1.2241 1.3143 -0.1446 0.2825  0.1122  44  HIS A CE1 
158  N NE2 . HIS A 23  ? 1.2003 1.2339 1.2747 -0.1268 0.3188  0.1173  44  HIS A NE2 
159  N N   . LEU A 24  ? 1.3071 1.1051 1.2543 -0.1701 0.1782  0.1345  45  LEU A N   
160  C CA  . LEU A 24  ? 1.3883 1.1287 1.2792 -0.1610 0.1475  0.1277  45  LEU A CA  
161  C C   . LEU A 24  ? 1.4673 1.1638 1.3962 -0.1897 0.1360  0.1424  45  LEU A C   
162  O O   . LEU A 24  ? 1.4222 1.1426 1.4315 -0.2169 0.1264  0.1411  45  LEU A O   
163  C CB  . LEU A 24  ? 1.3929 1.1483 1.2680 -0.1445 0.1078  0.0930  45  LEU A CB  
164  C CG  . LEU A 24  ? 1.4026 1.1092 1.2059 -0.1222 0.0829  0.0816  45  LEU A CG  
165  C CD1 . LEU A 24  ? 1.3248 1.0432 1.0634 -0.0902 0.0919  0.0736  45  LEU A CD1 
166  C CD2 . LEU A 24  ? 1.4283 1.1330 1.2416 -0.1214 0.0422  0.0543  45  LEU A CD2 
167  N N   . ASP A 25  ? 1.5089 1.1392 1.3809 -0.1829 0.1346  0.1559  46  ASP A N   
168  C CA  . ASP A 25  ? 1.5369 1.1112 1.4363 -0.2085 0.1205  0.1679  46  ASP A CA  
169  C C   . ASP A 25  ? 1.5067 1.0794 1.4330 -0.2141 0.0709  0.1347  46  ASP A C   
170  O O   . ASP A 25  ? 1.3451 0.9227 1.2251 -0.1870 0.0455  0.1070  46  ASP A O   
171  C CB  . ASP A 25  ? 1.5856 1.0825 1.4064 -0.1923 0.1245  0.1864  46  ASP A CB  
172  N N   . ALA A 26  ? 1.4699 1.0367 1.4712 -0.2493 0.0575  0.1372  47  ALA A N   
173  C CA  . ALA A 26  ? 1.4392 1.0034 1.4649 -0.2561 0.0086  0.1049  47  ALA A CA  
174  C C   . ALA A 26  ? 1.4214 0.9100 1.3817 -0.2397 -0.0219 0.0891  47  ALA A C   
175  O O   . ALA A 26  ? 1.3429 0.8215 1.2995 -0.2361 -0.0623 0.0580  47  ALA A O   
176  C CB  . ALA A 26  ? 1.4666 1.0437 1.5924 -0.2988 -0.0011 0.1107  47  ALA A CB  
177  N N   . LYS A 27  ? 1.4834 0.9174 1.3888 -0.2270 -0.0023 0.1109  48  LYS A N   
178  C CA  . LYS A 27  ? 1.5319 0.8958 1.3688 -0.2025 -0.0277 0.0971  48  LYS A CA  
179  C C   . LYS A 27  ? 1.4733 0.8706 1.2559 -0.1627 -0.0441 0.0658  48  LYS A C   
180  O O   . LYS A 27  ? 1.4965 0.8551 1.2360 -0.1406 -0.0724 0.0422  48  LYS A O   
181  C CB  . LYS A 27  ? 1.5833 0.8855 1.3698 -0.1931 -0.0013 0.1315  48  LYS A CB  
182  N N   . HIS A 28  ? 1.5502 1.0199 1.3397 -0.1544 -0.0249 0.0653  49  HIS A N   
183  C CA  . HIS A 28  ? 1.5313 1.0387 1.2769 -0.1202 -0.0334 0.0406  49  HIS A CA  
184  C C   . HIS A 28  ? 1.4100 0.9877 1.1966 -0.1267 -0.0402 0.0217  49  HIS A C   
185  O O   . HIS A 28  ? 1.3368 0.9539 1.0977 -0.1037 -0.0397 0.0063  49  HIS A O   
186  C CB  . HIS A 28  ? 1.5326 1.0534 1.2319 -0.0969 -0.0047 0.0569  49  HIS A CB  
187  C CG  . HIS A 28  ? 1.6163 1.0684 1.2615 -0.0824 0.0000  0.0765  49  HIS A CG  
188  N ND1 . HIS A 28  ? 1.6214 1.0678 1.2299 -0.0725 0.0301  0.1041  49  HIS A ND1 
189  C CD2 . HIS A 28  ? 1.7062 1.0882 1.3224 -0.0733 -0.0220 0.0734  49  HIS A CD2 
190  C CE1 . HIS A 28  ? 1.7308 1.1069 1.2901 -0.0583 0.0256  0.1197  49  HIS A CE1 
191  N NE2 . HIS A 28  ? 1.8267 1.1615 1.3924 -0.0585 -0.0058 0.1013  49  HIS A NE2 
192  N N   . HIS A 29  ? 1.3719 0.9651 1.2244 -0.1579 -0.0477 0.0237  50  HIS A N   
193  C CA  . HIS A 29  ? 1.2902 0.9503 1.1845 -0.1635 -0.0510 0.0128  50  HIS A CA  
194  C C   . HIS A 29  ? 1.2788 0.9498 1.1457 -0.1460 -0.0822 -0.0188 50  HIS A C   
195  O O   . HIS A 29  ? 1.2073 0.9128 1.0455 -0.1237 -0.0749 -0.0283 50  HIS A O   
196  C CB  . HIS A 29  ? 1.3185 0.9955 1.2963 -0.1998 -0.0540 0.0239  50  HIS A CB  
197  C CG  . HIS A 29  ? 1.3285 1.0440 1.3514 -0.2125 -0.0132 0.0515  50  HIS A CG  
198  N ND1 . HIS A 29  ? 1.3303 1.0932 1.4373 -0.2365 -0.0094 0.0589  50  HIS A ND1 
199  C CD2 . HIS A 29  ? 1.3315 1.0460 1.3244 -0.2017 0.0258  0.0723  50  HIS A CD2 
200  C CE1 . HIS A 29  ? 1.3553 1.1455 1.4845 -0.2397 0.0340  0.0830  50  HIS A CE1 
201  N NE2 . HIS A 29  ? 1.3519 1.1114 1.4080 -0.2189 0.0560  0.0913  50  HIS A NE2 
202  N N   . LYS A 30  ? 1.5470 0.8601 1.0484 -0.2044 -0.0241 -0.0885 51  LYS A N   
203  C CA  . LYS A 30  ? 1.5978 0.8074 1.0398 -0.1648 0.0078  -0.1021 51  LYS A CA  
204  C C   . LYS A 30  ? 1.6060 0.7880 1.0864 -0.1338 0.0524  -0.0662 51  LYS A C   
205  O O   . LYS A 30  ? 1.6139 0.7456 1.0674 -0.0989 0.0820  -0.0709 51  LYS A O   
206  C CB  . LYS A 30  ? 1.6912 0.7840 1.0465 -0.1697 0.0050  -0.1249 51  LYS A CB  
207  N N   . ALA A 31  ? 1.5678 0.7885 1.1136 -0.1477 0.0562  -0.0273 52  ALA A N   
208  C CA  . ALA A 31  ? 1.6394 0.8466 1.2339 -0.1204 0.0968  0.0160  52  ALA A CA  
209  C C   . ALA A 31  ? 1.5539 0.8575 1.2070 -0.1134 0.1041  0.0355  52  ALA A C   
210  O O   . ALA A 31  ? 1.5150 0.8130 1.2028 -0.0869 0.1390  0.0698  52  ALA A O   
211  C CB  . ALA A 31  ? 1.7118 0.9318 1.3588 -0.1399 0.0951  0.0550  52  ALA A CB  
212  N N   . MET A 32  ? 1.5950 0.9868 1.2579 -0.1380 0.0722  0.0151  53  MET A N   
213  C CA  . MET A 32  ? 1.4953 0.9735 1.2041 -0.1382 0.0773  0.0304  53  MET A CA  
214  C C   . MET A 32  ? 1.4564 0.9007 1.1115 -0.1118 0.0862  -0.0023 53  MET A C   
215  O O   . MET A 32  ? 1.4309 0.8881 1.1026 -0.0937 0.1098  0.0153  53  MET A O   
216  C CB  . MET A 32  ? 1.4076 1.0037 1.1617 -0.1817 0.0425  0.0307  53  MET A CB  
217  C CG  . MET A 32  ? 1.3373 1.0153 1.1266 -0.1877 0.0473  0.0421  53  MET A CG  
218  S SD  . MET A 32  ? 1.3933 1.2053 1.2312 -0.2409 0.0129  0.0425  53  MET A SD  
219  C CE  . MET A 32  ? 1.3356 1.1359 1.1115 -0.2406 -0.0149 -0.0199 53  MET A CE  
220  N N   . MET A 33  ? 1.4190 0.8220 1.0100 -0.1114 0.0661  -0.0469 54  MET A N   
221  C CA  . MET A 33  ? 1.4417 0.8075 0.9775 -0.0869 0.0712  -0.0781 54  MET A CA  
222  C C   . MET A 33  ? 1.5089 0.7855 1.0138 -0.0482 0.1120  -0.0682 54  MET A C   
223  O O   . MET A 33  ? 1.5476 0.8104 1.0263 -0.0277 0.1237  -0.0793 54  MET A O   
224  C CB  . MET A 33  ? 1.4820 0.8139 0.9550 -0.0939 0.0422  -0.1208 54  MET A CB  
225  C CG  . MET A 33  ? 1.4655 0.8926 0.9661 -0.1268 0.0036  -0.1342 54  MET A CG  
226  S SD  . MET A 33  ? 1.4604 0.9807 0.9953 -0.1271 0.0006  -0.1389 54  MET A SD  
227  C CE  . MET A 33  ? 1.5275 0.9659 0.9931 -0.0865 0.0173  -0.1638 54  MET A CE  
228  N N   . GLU A 34  ? 1.5342 0.7485 1.0409 -0.0379 0.1349  -0.0470 55  GLU A N   
229  C CA  . GLU A 34  ? 1.5847 0.7207 1.0720 0.0005  0.1799  -0.0318 55  GLU A CA  
230  C C   . GLU A 34  ? 1.5800 0.7867 1.1308 0.0102  0.2008  0.0063  55  GLU A C   
231  O O   . GLU A 34  ? 1.6109 0.8034 1.1378 0.0314  0.2175  0.0004  55  GLU A O   
232  C CB  . GLU A 34  ? 1.6455 0.7058 1.1311 0.0097  0.2031  -0.0126 55  GLU A CB  
233  N N   . ARG A 35  ? 1.4865 0.7717 1.1166 -0.0095 0.1975  0.0473  56  ARG A N   
234  C CA  . ARG A 35  ? 1.4428 0.8101 1.1398 -0.0109 0.2121  0.0907  56  ARG A CA  
235  C C   . ARG A 35  ? 1.3928 0.8122 1.0744 -0.0219 0.1963  0.0692  56  ARG A C   
236  O O   . ARG A 35  ? 1.3763 0.8076 1.0646 -0.0075 0.2178  0.0869  56  ARG A O   
237  C CB  . ARG A 35  ? 1.3776 0.8343 1.1563 -0.0435 0.1977  0.1320  56  ARG A CB  
238  C CG  . ARG A 35  ? 1.4386 0.8809 1.2716 -0.0242 0.2307  0.1869  56  ARG A CG  
239  C CD  . ARG A 35  ? 1.4940 0.8050 1.2721 0.0134  0.2592  0.1714  56  ARG A CD  
240  N N   . VAL A 36  ? 1.3811 0.8300 1.0409 -0.0470 0.1597  0.0319  57  VAL A N   
241  C CA  . VAL A 36  ? 1.3428 0.8337 0.9842 -0.0564 0.1447  0.0079  57  VAL A CA  
242  C C   . VAL A 36  ? 1.3841 0.7987 0.9590 -0.0229 0.1608  -0.0177 57  VAL A C   
243  O O   . VAL A 36  ? 1.4429 0.8732 1.0201 -0.0157 0.1760  -0.0052 57  VAL A O   
244  C CB  . VAL A 36  ? 1.3006 0.8308 0.9297 -0.0831 0.1059  -0.0286 57  VAL A CB  
245  C CG1 . VAL A 36  ? 1.2174 0.7826 0.8270 -0.0877 0.0959  -0.0524 57  VAL A CG1 
246  C CG2 . VAL A 36  ? 1.2714 0.8833 0.9642 -0.1205 0.0884  -0.0043 57  VAL A CG2 
247  N N   . GLU A 37  ? 1.5150 0.8480 1.0277 -0.0064 0.1557  -0.0523 58  GLU A N   
248  C CA  . GLU A 37  ? 1.4996 0.7588 0.9431 0.0219  0.1670  -0.0787 58  GLU A CA  
249  C C   . GLU A 37  ? 1.5256 0.7428 0.9685 0.0507  0.2091  -0.0507 58  GLU A C   
250  O O   . GLU A 37  ? 1.5205 0.7112 0.9264 0.0678  0.2203  -0.0600 58  GLU A O   
251  C CB  . GLU A 37  ? 1.5758 0.7546 0.9523 0.0289  0.1543  -0.1149 58  GLU A CB  
252  C CG  . GLU A 37  ? 1.5837 0.7882 0.9316 0.0147  0.1159  -0.1524 58  GLU A CG  
253  C CD  . GLU A 37  ? 1.7154 0.8585 1.0069 0.0112  0.0975  -0.1804 58  GLU A CD  
254  O OE1 . GLU A 37  ? 1.8053 0.8964 1.0748 0.0270  0.1135  -0.1739 58  GLU A OE1 
255  O OE2 . GLU A 37  ? 1.7410 0.9301 1.0378 -0.0108 0.0630  -0.1975 58  GLU A OE2 
256  N N   . ASN A 38  ? 1.4869 0.7001 0.9727 0.0568  0.2332  -0.0141 59  ASN A N   
257  C CA  . ASN A 38  ? 1.5067 0.6982 1.0072 0.0848  0.2758  0.0206  59  ASN A CA  
258  C C   . ASN A 38  ? 1.4445 0.7326 1.0067 0.0703  0.2793  0.0591  59  ASN A C   
259  O O   . ASN A 38  ? 1.5019 0.7856 1.0689 0.0896  0.3089  0.0840  59  ASN A O   
260  C CB  . ASN A 38  ? 1.6100 0.7575 1.1351 0.1020  0.3049  0.0488  59  ASN A CB  
261  C CG  . ASN A 38  ? 1.7280 0.7700 1.1823 0.1112  0.3032  0.0109  59  ASN A CG  
262  O OD1 . ASN A 38  ? 1.7686 0.7776 1.1583 0.1036  0.2782  -0.0340 59  ASN A OD1 
263  N ND2 . ASN A 38  ? 1.8290 0.8150 1.2925 0.1271  0.3309  0.0305  59  ASN A ND2 
264  N N   . ALA A 39  ? 1.4078 0.7838 1.0135 0.0333  0.2492  0.0644  60  ALA A N   
265  C CA  . ALA A 39  ? 1.2952 0.7603 0.9459 0.0105  0.2480  0.0955  60  ALA A CA  
266  C C   . ALA A 39  ? 1.2500 0.7045 0.8462 0.0094  0.2382  0.0627  60  ALA A C   
267  O O   . ALA A 39  ? 1.1703 0.6584 0.7761 0.0035  0.2495  0.0855  60  ALA A O   
268  C CB  . ALA A 39  ? 1.2585 0.8168 0.9674 -0.0320 0.2211  0.1110  60  ALA A CB  
269  N N   . VAL A 40  ? 1.2975 0.7059 0.8366 0.0141  0.2164  0.0116  61  VAL A N   
270  C CA  . VAL A 40  ? 1.2621 0.6470 0.7450 0.0190  0.2072  -0.0215 61  VAL A CA  
271  C C   . VAL A 40  ? 1.3163 0.6240 0.7515 0.0538  0.2353  -0.0217 61  VAL A C   
272  O O   . VAL A 40  ? 1.3342 0.6404 0.7465 0.0563  0.2423  -0.0201 61  VAL A O   
273  C CB  . VAL A 40  ? 1.2577 0.6210 0.6994 0.0165  0.1755  -0.0710 61  VAL A CB  
274  C CG1 . VAL A 40  ? 1.2433 0.5793 0.6298 0.0259  0.1677  -0.1012 61  VAL A CG1 
275  C CG2 . VAL A 40  ? 1.2115 0.6547 0.6995 -0.0179 0.1494  -0.0718 61  VAL A CG2 
276  N N   . LYS A 41  ? 1.3782 0.6187 0.7950 0.0785  0.2526  -0.0236 62  LYS A N   
277  C CA  . LYS A 41  ? 1.4045 0.5651 0.7704 0.1117  0.2822  -0.0266 62  LYS A CA  
278  C C   . LYS A 41  ? 1.3990 0.5861 0.8055 0.1227  0.3191  0.0228  62  LYS A C   
279  O O   . LYS A 41  ? 1.5125 0.6428 0.8831 0.1503  0.3484  0.0259  62  LYS A O   
280  C CB  . LYS A 41  ? 1.4147 0.4900 0.7423 0.1311  0.2918  -0.0453 62  LYS A CB  
281  N N   . ASP A 42  ? 1.3104 0.5885 0.7912 0.0987  0.3167  0.0629  63  ASP A N   
282  C CA  . ASP A 42  ? 1.3810 0.7056 0.9168 0.1037  0.3483  0.1201  63  ASP A CA  
283  C C   . ASP A 42  ? 1.3031 0.6796 0.8345 0.0810  0.3400  0.1298  63  ASP A C   
284  O O   . ASP A 42  ? 1.3460 0.7576 0.9057 0.0830  0.3640  0.1735  63  ASP A O   
285  C CB  . ASP A 42  ? 1.4594 0.8562 1.0810 0.0865  0.3480  0.1637  63  ASP A CB  
286  C CG  . ASP A 42  ? 1.5446 1.0147 1.2360 0.0843  0.3746  0.2315  63  ASP A CG  
287  O OD1 . ASP A 42  ? 1.6888 1.1285 1.3665 0.1131  0.4077  0.2484  63  ASP A OD1 
288  O OD2 . ASP A 42  ? 1.4911 1.0529 1.2513 0.0521  0.3619  0.2698  63  ASP A OD2 
289  N N   . PHE A 43  ? 0.8693 0.7980 1.0550 0.0541  0.0604  0.1394  64  PHE A N   
290  C CA  . PHE A 43  ? 0.8832 0.8314 1.0694 0.0284  0.0531  0.1526  64  PHE A CA  
291  C C   . PHE A 43  ? 0.9244 0.9043 1.1177 0.0475  0.0647  0.1693  64  PHE A C   
292  O O   . PHE A 43  ? 0.9468 0.9616 1.1578 0.0325  0.0610  0.1972  64  PHE A O   
293  C CB  . PHE A 43  ? 0.8462 0.7584 1.0049 0.0080  0.0439  0.1245  64  PHE A CB  
294  C CG  . PHE A 43  ? 0.7932 0.6870 0.9465 -0.0184 0.0301  0.1186  64  PHE A CG  
295  C CD1 . PHE A 43  ? 0.7924 0.6800 0.9563 -0.0144 0.0302  0.1203  64  PHE A CD1 
296  C CD2 . PHE A 43  ? 0.7658 0.6491 0.9021 -0.0455 0.0166  0.1127  64  PHE A CD2 
297  C CE1 . PHE A 43  ? 0.7367 0.6107 0.8951 -0.0359 0.0191  0.1175  64  PHE A CE1 
298  C CE2 . PHE A 43  ? 0.7614 0.6294 0.8889 -0.0653 0.0046  0.1082  64  PHE A CE2 
299  C CZ  . PHE A 43  ? 0.7344 0.5995 0.8734 -0.0601 0.0067  0.1115  64  PHE A CZ  
300  N N   . GLN A 44  ? 0.8915 0.8586 1.0712 0.0817  0.0778  0.1527  65  GLN A N   
301  C CA  . GLN A 44  ? 0.9175 0.9163 1.1020 0.1102  0.0925  0.1692  65  GLN A CA  
302  C C   . GLN A 44  ? 0.9371 0.9884 1.1548 0.1177  0.0985  0.2109  65  GLN A C   
303  O O   . GLN A 44  ? 1.0367 1.1295 1.2715 0.1177  0.1039  0.2400  65  GLN A O   
304  C CB  . GLN A 44  ? 0.9790 0.9508 1.1407 0.1517  0.1034  0.1427  65  GLN A CB  
305  C CG  . GLN A 44  ? 1.0552 1.0618 1.2196 0.1911  0.1208  0.1616  65  GLN A CG  
306  C CD  . GLN A 44  ? 1.1324 1.1270 1.2884 0.2346  0.1286  0.1525  65  GLN A CD  
307  O OE1 . GLN A 44  ? 1.0969 1.0429 1.2328 0.2442  0.1221  0.1184  65  GLN A OE1 
308  N NE2 . GLN A 44  ? 1.1871 1.2259 1.3591 0.2620  0.1413  0.1839  65  GLN A NE2 
309  N N   . GLU A 45  ? 0.9466 0.9972 1.1753 0.1243  0.0975  0.2156  66  GLU A N   
310  C CA  . GLU A 45  ? 0.9359 1.0358 1.1953 0.1346  0.1038  0.2544  66  GLU A CA  
311  C C   . GLU A 45  ? 0.9281 1.0523 1.2139 0.0946  0.0890  0.2801  66  GLU A C   
312  O O   . GLU A 45  ? 0.8992 1.0118 1.1901 0.0816  0.0801  0.2783  66  GLU A O   
313  C CB  . GLU A 45  ? 0.9134 1.0011 1.1709 0.1649  0.1098  0.2479  66  GLU A CB  
314  N N   . LEU A 46  ? 0.9323 1.0890 1.2347 0.0756  0.0849  0.3044  67  LEU A N   
315  C CA  . LEU A 46  ? 0.9546 1.1356 1.2837 0.0394  0.0676  0.3310  67  LEU A CA  
316  C C   . LEU A 46  ? 1.0020 1.2445 1.3692 0.0408  0.0719  0.3770  67  LEU A C   
317  O O   . LEU A 46  ? 1.0219 1.2914 1.3942 0.0723  0.0909  0.3899  67  LEU A O   
318  C CB  . LEU A 46  ? 0.9035 1.0517 1.2148 0.0018  0.0478  0.3120  67  LEU A CB  
319  C CG  . LEU A 46  ? 0.9325 1.0683 1.2266 -0.0027 0.0483  0.2996  67  LEU A CG  
320  C CD1 . LEU A 46  ? 0.9968 1.1762 1.3220 -0.0199 0.0413  0.3375  67  LEU A CD1 
321  C CD2 . LEU A 46  ? 0.9407 1.0256 1.2021 -0.0273 0.0329  0.2648  67  LEU A CD2 
322  N N   . SER A 47  ? 1.0748 1.3394 1.4688 0.0071  0.0530  0.4024  68  SER A N   
323  C CA  . SER A 47  ? 1.1058 1.4296 1.5433 0.0001  0.0515  0.4497  68  SER A CA  
324  C C   . SER A 47  ? 1.1409 1.4678 1.5978 -0.0444 0.0217  0.4648  68  SER A C   
325  O O   . SER A 47  ? 1.2063 1.5061 1.6509 -0.0596 0.0077  0.4491  68  SER A O   
326  C CB  . SER A 47  ? 1.0091 1.3811 1.4741 0.0318  0.0695  0.4806  68  SER A CB  
327  N N   . LEU A 48  ? 1.1542 1.5129 1.6410 -0.0644 0.0108  0.4955  69  LEU A N   
328  C CA  . LEU A 48  ? 1.2200 1.5837 1.7288 -0.1053 -0.0212 0.5134  69  LEU A CA  
329  C C   . LEU A 48  ? 1.2439 1.6717 1.8092 -0.1126 -0.0245 0.5674  69  LEU A C   
330  O O   . LEU A 48  ? 1.1339 1.5864 1.7121 -0.1013 -0.0108 0.5837  69  LEU A O   
331  C CB  . LEU A 48  ? 1.2212 1.5340 1.6981 -0.1344 -0.0435 0.4841  69  LEU A CB  
332  C CG  . LEU A 48  ? 1.2129 1.4931 1.6760 -0.1658 -0.0751 0.4709  69  LEU A CG  
333  C CD1 . LEU A 48  ? 1.1746 1.4182 1.6016 -0.1517 -0.0663 0.4363  69  LEU A CD1 
334  C CD2 . LEU A 48  ? 1.1910 1.4333 1.6314 -0.1942 -0.0999 0.4538  69  LEU A CD2 
335  N N   . ASN A 49  ? 1.1595 1.6161 1.7602 -0.1310 -0.0426 0.5966  70  ASN A N   
336  C CA  . ASN A 49  ? 1.2081 1.7290 1.8696 -0.1412 -0.0490 0.6518  70  ASN A CA  
337  C C   . ASN A 49  ? 1.2658 1.7825 1.9413 -0.1725 -0.0712 0.6633  70  ASN A C   
338  O O   . ASN A 49  ? 1.3556 1.8168 1.9899 -0.1866 -0.0832 0.6262  70  ASN A O   
339  C CB  . ASN A 49  ? 0.7616 1.3067 1.4554 -0.1586 -0.0695 0.6766  70  ASN A CB  
340  N N   . GLU A 50  ? 1.2791 1.8557 2.0143 -0.1823 -0.0765 0.7164  71  GLU A N   
341  C CA  . GLU A 50  ? 1.2163 1.7993 1.9771 -0.2107 -0.0967 0.7378  71  GLU A CA  
342  C C   . GLU A 50  ? 1.1842 1.7623 1.9241 -0.1882 -0.0699 0.7270  71  GLU A C   
343  O O   . GLU A 50  ? 1.1320 1.7103 1.8869 -0.2084 -0.0832 0.7407  71  GLU A O   
344  C CB  . GLU A 50  ? 1.1656 1.6895 1.9030 -0.2527 -0.1403 0.7114  71  GLU A CB  
345  N N   . ASP A 51  ? 1.2628 1.8354 1.9682 -0.1457 -0.0340 0.7029  72  ASP A N   
346  C CA  . ASP A 51  ? 1.1914 1.7623 1.8746 -0.1168 -0.0058 0.6922  72  ASP A CA  
347  C C   . ASP A 51  ? 1.1100 1.6802 1.7613 -0.0668 0.0302  0.6706  72  ASP A C   
348  O O   . ASP A 51  ? 1.0111 1.5665 1.6479 -0.0591 0.0307  0.6534  72  ASP A O   
349  C CB  . ASP A 51  ? 1.1968 1.7006 1.8329 -0.1362 -0.0207 0.6480  72  ASP A CB  
350  N N   . ALA A 52  ? 1.0024 1.5873 1.6422 -0.0320 0.0588  0.6717  73  ALA A N   
351  C CA  . ALA A 52  ? 0.9853 1.5568 1.5856 0.0169  0.0891  0.6434  73  ALA A CA  
352  C C   . ALA A 52  ? 1.0287 1.5221 1.5672 0.0144  0.0845  0.5810  73  ALA A C   
353  O O   . ALA A 52  ? 1.0931 1.5455 1.6191 -0.0243 0.0584  0.5606  73  ALA A O   
354  C CB  . ALA A 52  ? 0.9884 1.6091 1.5996 0.0598  0.1209  0.6714  73  ALA A CB  
355  N N   . TYR A 53  ? 1.0187 1.4914 1.5183 0.0568  0.1086  0.5512  74  TYR A N   
356  C CA  . TYR A 53  ? 0.9909 1.3928 1.4352 0.0572  0.1055  0.4938  74  TYR A CA  
357  C C   . TYR A 53  ? 0.9891 1.3849 1.4046 0.0956  0.1290  0.4785  74  TYR A C   
358  O O   . TYR A 53  ? 1.0084 1.4122 1.4093 0.1412  0.1512  0.4732  74  TYR A O   
359  C CB  . TYR A 53  ? 0.9641 1.3311 1.3847 0.0668  0.1046  0.4629  74  TYR A CB  
360  C CG  . TYR A 53  ? 0.9238 1.2230 1.2918 0.0733  0.1044  0.4067  74  TYR A CG  
361  C CD1 . TYR A 53  ? 0.9401 1.1963 1.2864 0.0403  0.0862  0.3802  74  TYR A CD1 
362  C CD2 . TYR A 53  ? 0.8437 1.1212 1.1844 0.1128  0.1207  0.3810  74  TYR A CD2 
363  C CE1 . TYR A 53  ? 0.8856 1.0839 1.1872 0.0461  0.0863  0.3315  74  TYR A CE1 
364  C CE2 . TYR A 53  ? 0.8254 1.0423 1.1233 0.1171  0.1184  0.3320  74  TYR A CE2 
365  C CZ  . TYR A 53  ? 0.8315 1.0114 1.1115 0.0834  0.1021  0.3084  74  TYR A CZ  
366  O OH  . TYR A 53  ? 0.7896 0.9133 1.0304 0.0878  0.1003  0.2623  74  TYR A OH  
367  N N   . MET A 54  ? 0.8725 1.2525 1.2781 0.0783  0.1227  0.4710  75  MET A N   
368  C CA  . MET A 54  ? 0.8209 1.1949 1.1990 0.1120  0.1432  0.4573  75  MET A CA  
369  C C   . MET A 54  ? 0.7757 1.0962 1.1014 0.1430  0.1525  0.4047  75  MET A C   
370  O O   . MET A 54  ? 0.7838 1.1065 1.0870 0.1867  0.1736  0.3959  75  MET A O   
371  C CB  . MET A 54  ? 0.8818 1.2380 1.2548 0.0818  0.1302  0.4528  75  MET A CB  
372  C CG  . MET A 54  ? 0.9547 1.3625 1.3813 0.0532  0.1199  0.5066  75  MET A CG  
373  S SD  . MET A 54  ? 1.0228 1.4890 1.4691 0.0890  0.1484  0.5471  75  MET A SD  
374  C CE  . MET A 54  ? 1.0859 1.6105 1.6059 0.0452  0.1289  0.6130  75  MET A CE  
375  N N   . GLY A 55  ? 0.7855 1.0583 1.0927 0.1211  0.1358  0.3712  76  GLY A N   
376  C CA  . GLY A 55  ? 0.7931 1.0122 1.0561 0.1439  0.1402  0.3223  76  GLY A CA  
377  C C   . GLY A 55  ? 0.7947 0.9744 1.0223 0.1427  0.1395  0.2891  76  GLY A C   
378  O O   . GLY A 55  ? 0.8077 0.9593 1.0016 0.1765  0.1508  0.2583  76  GLY A O   
379  N N   . VAL A 56  ? 0.7511 0.9272 0.9859 0.1040  0.1242  0.2951  77  VAL A N   
380  C CA  . VAL A 56  ? 0.7474 0.8914 0.9517 0.1004  0.1230  0.2688  77  VAL A CA  
381  C C   . VAL A 56  ? 0.7362 0.8516 0.9377 0.0506  0.0970  0.2589  77  VAL A C   
382  O O   . VAL A 56  ? 0.7303 0.8678 0.9630 0.0199  0.0814  0.2876  77  VAL A O   
383  C CB  . VAL A 56  ? 0.7554 0.9415 0.9723 0.1211  0.1397  0.2989  77  VAL A CB  
384  C CG1 . VAL A 56  ? 0.7474 0.9664 1.0026 0.0826  0.1258  0.3390  77  VAL A CG1 
385  C CG2 . VAL A 56  ? 0.7736 0.9249 0.9484 0.1420  0.1484  0.2639  77  VAL A CG2 
386  N N   . VAL A 57  ? 0.7359 0.8008 0.8986 0.0440  0.0909  0.2178  78  VAL A N   
387  C CA  . VAL A 57  ? 0.7299 0.7661 0.8838 0.0014  0.0665  0.2073  78  VAL A CA  
388  C C   . VAL A 57  ? 0.7335 0.7414 0.8567 0.0003  0.0664  0.1841  78  VAL A C   
389  O O   . VAL A 57  ? 0.7399 0.7544 0.8520 0.0313  0.0852  0.1796  78  VAL A O   
390  C CB  . VAL A 57  ? 0.7248 0.7213 0.8604 -0.0147 0.0527  0.1778  78  VAL A CB  
391  C CG1 . VAL A 57  ? 0.7214 0.7447 0.8882 -0.0205 0.0485  0.2029  78  VAL A CG1 
392  C CG2 . VAL A 57  ? 0.7273 0.6866 0.8293 0.0120  0.0645  0.1365  78  VAL A CG2 
393  N N   . ASP A 58  ? 0.7320 0.7084 0.8396 -0.0337 0.0448  0.1700  79  ASP A N   
394  C CA  . ASP A 58  ? 0.7358 0.6786 0.8090 -0.0353 0.0433  0.1426  79  ASP A CA  
395  C C   . ASP A 58  ? 0.7332 0.6243 0.7695 -0.0459 0.0324  0.0997  79  ASP A C   
396  O O   . ASP A 58  ? 0.7291 0.6129 0.7697 -0.0572 0.0233  0.0964  79  ASP A O   
397  C CB  . ASP A 58  ? 0.7412 0.6929 0.8267 -0.0636 0.0271  0.1662  79  ASP A CB  
398  C CG  . ASP A 58  ? 0.7438 0.6861 0.8396 -0.1028 -0.0022 0.1760  79  ASP A CG  
399  O OD1 . ASP A 58  ? 0.7774 0.6995 0.8617 -0.1087 -0.0095 0.1578  79  ASP A OD1 
400  O OD2 . ASP A 58  ? 0.7506 0.7052 0.8663 -0.1270 -0.0192 0.2026  79  ASP A OD2 
401  N N   . GLU A 59  ? 0.6850 0.8956 0.7341 0.0980  0.0418  0.1955  80  GLU A N   
402  C CA  . GLU A 59  ? 0.6921 0.8649 0.7367 0.1019  0.0506  0.1786  80  GLU A CA  
403  C C   . GLU A 59  ? 0.7085 0.8079 0.7347 0.0869  0.0561  0.1705  80  GLU A C   
404  O O   . GLU A 59  ? 0.6824 0.7475 0.6903 0.0842  0.0608  0.1487  80  GLU A O   
405  C CB  . GLU A 59  ? 0.7197 0.9125 0.7882 0.1143  0.0575  0.1952  80  GLU A CB  
406  C CG  . GLU A 59  ? 0.7782 0.9475 0.8526 0.1215  0.0678  0.1804  80  GLU A CG  
407  C CD  . GLU A 59  ? 0.7864 0.9864 0.8577 0.1280  0.0615  0.1597  80  GLU A CD  
408  O OE1 . GLU A 59  ? 0.8022 1.0550 0.8742 0.1347  0.0502  0.1617  80  GLU A OE1 
409  O OE2 . GLU A 59  ? 0.8743 1.0444 0.9412 0.1259  0.0681  0.1415  80  GLU A OE2 
410  N N   . ALA A 60  ? 0.6731 0.7484 0.7020 0.0760  0.0546  0.1885  81  ALA A N   
411  C CA  . ALA A 60  ? 0.7376 0.7385 0.7430 0.0602  0.0575  0.1801  81  ALA A CA  
412  C C   . ALA A 60  ? 0.7180 0.6932 0.6910 0.0464  0.0485  0.1599  81  ALA A C   
413  O O   . ALA A 60  ? 0.7618 0.6777 0.7044 0.0379  0.0546  0.1428  81  ALA A O   
414  C CB  . ALA A 60  ? 0.7879 0.7724 0.8039 0.0476  0.0507  0.2041  81  ALA A CB  
415  N N   . THR A 61  ? 0.6728 0.6933 0.6521 0.0454  0.0346  0.1628  82  THR A N   
416  C CA  . THR A 61  ? 0.6976 0.6994 0.6532 0.0332  0.0226  0.1486  82  THR A CA  
417  C C   . THR A 61  ? 0.6673 0.6742 0.6135 0.0438  0.0273  0.1266  82  THR A C   
418  O O   . THR A 61  ? 0.6959 0.6637 0.6143 0.0335  0.0240  0.1123  82  THR A O   
419  C CB  . THR A 61  ? 0.6983 0.7469 0.6725 0.0290  0.0061  0.1634  82  THR A CB  
420  O OG1 . THR A 61  ? 0.7662 0.8155 0.7559 0.0172  0.0013  0.1882  82  THR A OG1 
421  C CG2 . THR A 61  ? 0.7211 0.7464 0.6755 0.0152  -0.0093 0.1530  82  THR A CG2 
422  N N   . LEU A 62  ? 0.6974 0.7520 0.6659 0.0626  0.0331  0.1256  83  LEU A N   
423  C CA  . LEU A 62  ? 0.7059 0.7666 0.6715 0.0714  0.0354  0.1061  83  LEU A CA  
424  C C   . LEU A 62  ? 0.7336 0.7445 0.6831 0.0673  0.0505  0.0955  83  LEU A C   
425  O O   . LEU A 62  ? 0.7383 0.7278 0.6720 0.0629  0.0508  0.0808  83  LEU A O   
426  C CB  . LEU A 62  ? 0.6915 0.8111 0.6824 0.0902  0.0361  0.1075  83  LEU A CB  
427  C CG  . LEU A 62  ? 0.6624 0.7911 0.6559 0.0982  0.0351  0.0880  83  LEU A CG  
428  C CD1 . LEU A 62  ? 0.6675 0.8075 0.6553 0.0992  0.0211  0.0745  83  LEU A CD1 
429  C CD2 . LEU A 62  ? 0.6230 0.7978 0.6383 0.1131  0.0368  0.0918  83  LEU A CD2 
430  N N   . GLN A 63  ? 0.7028 0.6957 0.6582 0.0695  0.0641  0.1045  84  GLN A N   
431  C CA  . GLN A 63  ? 0.6857 0.6347 0.6298 0.0696  0.0838  0.0952  84  GLN A CA  
432  C C   . GLN A 63  ? 0.7428 0.6285 0.6414 0.0517  0.0855  0.0835  84  GLN A C   
433  O O   . GLN A 63  ? 0.7751 0.6315 0.6550 0.0501  0.0998  0.0709  84  GLN A O   
434  C CB  . GLN A 63  ? 0.6959 0.6388 0.6611 0.0791  0.0981  0.1084  84  GLN A CB  
435  C CG  . GLN A 63  ? 0.6513 0.6559 0.6589 0.0963  0.0962  0.1225  84  GLN A CG  
436  C CD  . GLN A 63  ? 0.6527 0.6820 0.6776 0.1062  0.1022  0.1127  84  GLN A CD  
437  O OE1 . GLN A 63  ? 0.6815 0.6788 0.6933 0.1023  0.1147  0.0988  84  GLN A OE1 
438  N NE2 . GLN A 63  ? 0.6423 0.7296 0.6956 0.1175  0.0925  0.1210  84  GLN A NE2 
439  N N   . LYS A 64  ? 0.6941 0.5606 0.5744 0.0370  0.0704  0.0891  85  LYS A N   
440  C CA  . LYS A 64  ? 0.7740 0.5826 0.6059 0.0172  0.0657  0.0785  85  LYS A CA  
441  C C   . LYS A 64  ? 0.7679 0.5845 0.5861 0.0124  0.0559  0.0696  85  LYS A C   
442  O O   . LYS A 64  ? 0.8470 0.6235 0.6297 0.0044  0.0645  0.0581  85  LYS A O   
443  C CB  . LYS A 64  ? 0.8446 0.6357 0.6653 -0.0005 0.0457  0.0889  85  LYS A CB  
444  C CG  . LYS A 64  ? 0.8596 0.6552 0.7058 0.0027  0.0480  0.1046  85  LYS A CG  
445  C CD  . LYS A 64  ? 0.8989 0.6570 0.7249 -0.0212 0.0288  0.1117  85  LYS A CD  
446  C CE  . LYS A 64  ? 1.0207 0.7007 0.7863 -0.0378 0.0313  0.0912  85  LYS A CE  
447  N NZ  . LYS A 64  ? 1.1439 0.7892 0.8840 -0.0658 0.0045  0.0960  85  LYS A NZ  
448  N N   . GLY A 65  ? 0.7500 0.6171 0.5957 0.0179  0.0387  0.0756  86  GLY A N   
449  C CA  . GLY A 65  ? 0.7251 0.6000 0.5656 0.0159  0.0272  0.0683  86  GLY A CA  
450  C C   . GLY A 65  ? 0.7196 0.5878 0.5589 0.0223  0.0437  0.0571  86  GLY A C   
451  O O   . GLY A 65  ? 0.7518 0.5853 0.5609 0.0111  0.0451  0.0509  86  GLY A O   
452  N N   . SER A 66  ? 0.6935 0.5968 0.5667 0.0390  0.0555  0.0574  87  SER A N   
453  C CA  . SER A 66  ? 0.6989 0.6046 0.5826 0.0449  0.0703  0.0502  87  SER A CA  
454  C C   . SER A 66  ? 0.7278 0.5828 0.5801 0.0366  0.0933  0.0461  87  SER A C   
455  O O   . SER A 66  ? 0.7572 0.5971 0.5971 0.0305  0.1002  0.0410  87  SER A O   
456  C CB  . SER A 66  ? 0.6574 0.6101 0.5838 0.0627  0.0765  0.0547  87  SER A CB  
457  O OG  . SER A 66  ? 0.7736 0.7161 0.7042 0.0674  0.0913  0.0634  87  SER A OG  
458  N N   . TRP A 67  ? 0.7156 0.5430 0.5541 0.0365  0.1060  0.0484  88  TRP A N   
459  C CA  . TRP A 67  ? 0.7678 0.5424 0.5702 0.0311  0.1308  0.0408  88  TRP A CA  
460  C C   . TRP A 67  ? 0.8191 0.5498 0.5653 0.0107  0.1232  0.0341  88  TRP A C   
461  O O   . TRP A 67  ? 0.8614 0.5825 0.5928 0.0063  0.1341  0.0304  88  TRP A O   
462  C CB  . TRP A 67  ? 0.8005 0.5452 0.5953 0.0344  0.1415  0.0421  88  TRP A CB  
463  C CG  . TRP A 67  ? 0.7935 0.5562 0.6296 0.0548  0.1652  0.0465  88  TRP A CG  
464  C CD1 . TRP A 67  ? 0.7958 0.5879 0.6731 0.0677  0.1616  0.0595  88  TRP A CD1 
465  C CD2 . TRP A 67  ? 0.8112 0.5673 0.6554 0.0650  0.1961  0.0413  88  TRP A CD2 
466  N NE1 . TRP A 67  ? 0.7858 0.5885 0.6976 0.0857  0.1859  0.0629  88  TRP A NE1 
467  C CE2 . TRP A 67  ? 0.7895 0.5721 0.6845 0.0850  0.2084  0.0515  88  TRP A CE2 
468  C CE3 . TRP A 67  ? 0.8585 0.5919 0.6742 0.0591  0.2153  0.0317  88  TRP A CE3 
469  C CZ2 . TRP A 67  ? 0.7998 0.5888 0.7233 0.1004  0.2387  0.0519  88  TRP A CZ2 
470  C CZ3 . TRP A 67  ? 0.8687 0.6096 0.7104 0.0738  0.2481  0.0320  88  TRP A CZ3 
471  C CH2 . TRP A 67  ? 0.8282 0.5975 0.7260 0.0948  0.2594  0.0417  88  TRP A CH2 
472  N N   . SER A 68  ? 0.8596 0.5659 0.5768 -0.0032 0.1029  0.0356  89  SER A N   
473  C CA  . SER A 68  ? 0.9241 0.5923 0.5886 -0.0249 0.0869  0.0330  89  SER A CA  
474  C C   . SER A 68  ? 0.9032 0.5878 0.5701 -0.0286 0.0787  0.0351  89  SER A C   
475  O O   . SER A 68  ? 1.0359 0.6838 0.6548 -0.0441 0.0786  0.0331  89  SER A O   
476  C CB  . SER A 68  ? 0.9666 0.6371 0.6303 -0.0364 0.0558  0.0412  89  SER A CB  
477  O OG  . SER A 68  ? 1.0193 0.6625 0.6411 -0.0572 0.0342  0.0427  89  SER A OG  
478  N N   . LEU A 69  ? 0.8594 0.5968 0.5798 -0.0149 0.0708  0.0393  90  LEU A N   
479  C CA  . LEU A 69  ? 0.8411 0.5921 0.5719 -0.0169 0.0621  0.0406  90  LEU A CA  
480  C C   . LEU A 69  ? 0.8557 0.5997 0.5859 -0.0151 0.0895  0.0378  90  LEU A C   
481  O O   . LEU A 69  ? 0.8994 0.6176 0.5988 -0.0283 0.0922  0.0401  90  LEU A O   
482  C CB  . LEU A 69  ? 0.7847 0.5896 0.5696 -0.0022 0.0445  0.0420  90  LEU A CB  
483  C CG  . LEU A 69  ? 0.7774 0.6039 0.5909 0.0023  0.0378  0.0397  90  LEU A CG  
484  C CD1 . LEU A 69  ? 0.8226 0.6176 0.6080 -0.0138 0.0242  0.0442  90  LEU A CD1 
485  C CD2 . LEU A 69  ? 0.7450 0.6188 0.6012 0.0181  0.0202  0.0364  90  LEU A CD2 
486  N N   . LEU A 70  ? 0.8067 0.5767 0.5736 0.0008  0.1097  0.0360  91  LEU A N   
487  C CA  . LEU A 70  ? 0.8132 0.5896 0.5960 0.0045  0.1355  0.0366  91  LEU A CA  
488  C C   . LEU A 70  ? 0.9148 0.6446 0.6477 -0.0034 0.1656  0.0336  91  LEU A C   
489  O O   . LEU A 70  ? 0.9464 0.6776 0.6830 -0.0050 0.1876  0.0368  91  LEU A O   
490  C CB  . LEU A 70  ? 0.7745 0.5945 0.6141 0.0240  0.1464  0.0381  91  LEU A CB  
491  C CG  . LEU A 70  ? 0.7258 0.5966 0.6180 0.0311  0.1271  0.0398  91  LEU A CG  
492  C CD1 . LEU A 70  ? 0.7824 0.6687 0.6763 0.0325  0.0956  0.0371  91  LEU A CD1 
493  C CD2 . LEU A 70  ? 0.7021 0.6127 0.6443 0.0476  0.1396  0.0438  91  LEU A CD2 
494  N N   . LYS A 71  ? 0.9597 0.6484 0.6453 -0.0089 0.1669  0.0274  92  LYS A N   
495  C CA  . LYS A 71  ? 1.0398 0.6763 0.6646 -0.0167 0.1942  0.0198  92  LYS A CA  
496  C C   . LYS A 71  ? 1.0594 0.6711 0.6346 -0.0376 0.1867  0.0240  92  LYS A C   
497  O O   . LYS A 71  ? 1.1187 0.7142 0.6666 -0.0415 0.2150  0.0243  92  LYS A O   
498  C CB  . LYS A 71  ? 1.1362 0.7293 0.7200 -0.0202 0.1905  0.0100  92  LYS A CB  
499  C CG  . LYS A 71  ? 1.1375 0.7227 0.7400 -0.0012 0.2197  0.0028  92  LYS A CG  
500  C CD  . LYS A 71  ? 1.1898 0.7573 0.7897 -0.0023 0.2004  0.0007  92  LYS A CD  
501  C CE  . LYS A 71  ? 1.3542 0.8771 0.9367 0.0084  0.2292  -0.0116 92  LYS A CE  
502  N NZ  . LYS A 71  ? 1.4562 0.9200 0.9834 -0.0086 0.2116  -0.0212 92  LYS A NZ  
503  N N   . ASP A 72  ? 1.1678 0.7795 0.7342 -0.0503 0.1491  0.0298  93  ASP A N   
504  C CA  . ASP A 72  ? 1.2159 0.8030 0.7364 -0.0711 0.1351  0.0377  93  ASP A CA  
505  C C   . ASP A 72  ? 1.1744 0.7905 0.7315 -0.0710 0.1381  0.0494  93  ASP A C   
506  O O   . ASP A 72  ? 1.2535 0.8479 0.7723 -0.0863 0.1440  0.0581  93  ASP A O   
507  C CB  . ASP A 72  ? 1.2522 0.8349 0.7636 -0.0825 0.0923  0.0431  93  ASP A CB  
508  C CG  . ASP A 72  ? 1.3720 0.9047 0.8153 -0.0982 0.0847  0.0367  93  ASP A CG  
509  O OD1 . ASP A 72  ? 1.5120 1.0207 0.9341 -0.0927 0.1082  0.0233  93  ASP A OD1 
510  O OD2 . ASP A 72  ? 1.4636 0.9790 0.8753 -0.1164 0.0535  0.0453  93  ASP A OD2 
511  N N   . LEU A 73  ? 1.0454 0.7093 0.6747 -0.0554 0.1326  0.0503  94  LEU A N   
512  C CA  . LEU A 73  ? 1.0588 0.7501 0.7308 -0.0554 0.1350  0.0595  94  LEU A CA  
513  C C   . LEU A 73  ? 1.0495 0.7365 0.7131 -0.0554 0.1768  0.0623  94  LEU A C   
514  O O   . LEU A 73  ? 1.0994 0.7848 0.7599 -0.0672 0.1853  0.0748  94  LEU A O   
515  C CB  . LEU A 73  ? 1.0118 0.7527 0.7568 -0.0384 0.1210  0.0559  94  LEU A CB  
516  C CG  . LEU A 73  ? 0.9744 0.7420 0.7683 -0.0402 0.1144  0.0630  94  LEU A CG  
517  C CD1 . LEU A 73  ? 1.0216 0.7684 0.8001 -0.0553 0.0871  0.0715  94  LEU A CD1 
518  C CD2 . LEU A 73  ? 0.9282 0.7416 0.7838 -0.0231 0.1008  0.0552  94  LEU A CD2 
519  N N   . LYS A 74  ? 1.0730 0.7586 0.7355 -0.0416 0.2037  0.0523  95  LYS A N   
520  C CA  . LYS A 74  ? 1.0969 0.7772 0.7505 -0.0371 0.2487  0.0528  95  LYS A CA  
521  C C   . LYS A 74  ? 1.1534 0.7845 0.7232 -0.0552 0.2636  0.0540  95  LYS A C   
522  O O   . LYS A 74  ? 1.1556 0.7893 0.7182 -0.0596 0.2937  0.0630  95  LYS A O   
523  C CB  . LYS A 74  ? 1.0676 0.7482 0.7341 -0.0165 0.2719  0.0406  95  LYS A CB  
524  N N   . ARG A 75  ? 1.1568 0.7455 0.6632 -0.0669 0.2421  0.0465  96  ARG A N   
525  C CA  . ARG A 75  ? 1.2458 0.7870 0.6650 -0.0877 0.2479  0.0489  96  ARG A CA  
526  C C   . ARG A 75  ? 1.2688 0.8237 0.6954 -0.1039 0.2374  0.0714  96  ARG A C   
527  O O   . ARG A 75  ? 1.3733 0.9164 0.7626 -0.1136 0.2660  0.0807  96  ARG A O   
528  C CB  . ARG A 75  ? 1.2845 0.7847 0.6456 -0.1008 0.2144  0.0408  96  ARG A CB  
529  C CG  . ARG A 75  ? 1.3920 0.8621 0.6892 -0.1273 0.1905  0.0540  96  ARG A CG  
530  C CD  . ARG A 75  ? 1.5491 0.9693 0.7713 -0.1421 0.1682  0.0433  96  ARG A CD  
531  N NE  . ARG A 75  ? 1.5737 0.9686 0.7370 -0.1682 0.1409  0.0593  96  ARG A NE  
532  C CZ  . ARG A 75  ? 1.6819 1.0351 0.7553 -0.1852 0.1575  0.0596  96  ARG A CZ  
533  N NH1 . ARG A 75  ? 1.7133 1.0447 0.7459 -0.1767 0.2049  0.0420  96  ARG A NH1 
534  N NH2 . ARG A 75  ? 1.7763 1.1100 0.7997 -0.2096 0.1275  0.0782  96  ARG A NH2 
535  N N   . ILE A 76  ? 1.2658 0.8458 0.7425 -0.1058 0.1978  0.0804  97  ILE A N   
536  C CA  . ILE A 76  ? 1.2207 0.8109 0.7156 -0.1200 0.1806  0.1018  97  ILE A CA  
537  C C   . ILE A 76  ? 1.2336 0.8511 0.7663 -0.1187 0.2143  0.1137  97  ILE A C   
538  O O   . ILE A 76  ? 1.3070 0.9110 0.8054 -0.1354 0.2287  0.1311  97  ILE A O   
539  C CB  . ILE A 76  ? 1.1792 0.7962 0.7377 -0.1144 0.1378  0.1036  97  ILE A CB  
540  C CG1 . ILE A 76  ? 1.2110 0.8117 0.7457 -0.1137 0.1059  0.0946  97  ILE A CG1 
541  C CG2 . ILE A 76  ? 1.1809 0.7985 0.7565 -0.1293 0.1180  0.1251  97  ILE A CG2 
542  C CD1 . ILE A 76  ? 1.2887 0.8508 0.7605 -0.1356 0.0817  0.1073  97  ILE A CD1 
543  N N   . THR A 77  ? 1.1939 0.8527 0.7987 -0.1000 0.2261  0.1071  98  THR A N   
544  C CA  . THR A 77  ? 1.1943 0.8873 0.8499 -0.0989 0.2546  0.1205  98  THR A CA  
545  C C   . THR A 77  ? 1.3209 1.0002 0.9298 -0.0999 0.3063  0.1233  98  THR A C   
546  O O   . THR A 77  ? 1.3983 1.0909 1.0166 -0.1107 0.3287  0.1433  98  THR A O   
547  C CB  . THR A 77  ? 1.1223 0.8636 0.8624 -0.0783 0.2550  0.1125  98  THR A CB  
548  O OG1 . THR A 77  ? 1.0838 0.8223 0.8124 -0.0593 0.2807  0.0963  98  THR A OG1 
549  C CG2 . THR A 77  ? 1.0792 0.8336 0.8571 -0.0747 0.2075  0.1057  98  THR A CG2 
550  N N   . ASP A 78  ? 1.2591 0.9106 0.8181 -0.0885 0.3258  0.1033  99  ASP A N   
551  C CA  . ASP A 78  ? 1.3586 0.9897 0.8639 -0.0856 0.3773  0.0995  99  ASP A CA  
552  C C   . ASP A 78  ? 1.4491 1.0467 0.8740 -0.1105 0.3827  0.1138  99  ASP A C   
553  O O   . ASP A 78  ? 1.4779 1.0809 0.8839 -0.1133 0.4259  0.1246  99  ASP A O   
554  C CB  . ASP A 78  ? 1.4636 1.0580 0.9222 -0.0706 0.3892  0.0717  99  ASP A CB  
555  C CG  . ASP A 78  ? 1.4339 1.0622 0.9681 -0.0432 0.4012  0.0617  99  ASP A CG  
556  O OD1 . ASP A 78  ? 1.3271 1.0091 0.9452 -0.0355 0.4065  0.0757  99  ASP A OD1 
557  O OD2 . ASP A 78  ? 1.4360 1.0360 0.9463 -0.0309 0.4028  0.0413  99  ASP A OD2 
558  N N   . SER A 79  ? 1.4474 1.0131 0.8260 -0.1282 0.3392  0.1160  100 SER A N   
559  C CA  . SER A 79  ? 1.5333 1.0666 0.8334 -0.1540 0.3365  0.1334  100 SER A CA  
560  C C   . SER A 79  ? 1.5617 1.1268 0.9025 -0.1670 0.3467  0.1657  100 SER A C   
561  O O   . SER A 79  ? 1.7456 1.2940 1.0252 -0.1845 0.3674  0.1833  100 SER A O   
562  C CB  . SER A 79  ? 1.5112 1.0149 0.7774 -0.1695 0.2805  0.1352  100 SER A CB  
563  O OG  . SER A 79  ? 1.3987 0.9336 0.7455 -0.1696 0.2420  0.1484  100 SER A OG  
564  N N   . ASP A 80  ? 1.5207 1.1306 0.9627 -0.1598 0.3307  0.1737  101 ASP A N   
565  C CA  . ASP A 80  ? 1.4407 1.0826 0.9399 -0.1731 0.3319  0.2041  101 ASP A CA  
566  C C   . ASP A 80  ? 1.4485 1.0650 0.9203 -0.1987 0.2922  0.2278  101 ASP A C   
567  O O   . ASP A 80  ? 1.4487 1.0757 0.9355 -0.2167 0.2988  0.2583  101 ASP A O   
568  C CB  . ASP A 80  ? 1.4385 1.0987 0.9276 -0.1748 0.3910  0.2187  101 ASP A CB  
569  N N   . VAL A 81  ? 1.4610 1.0460 0.8980 -0.2005 0.2504  0.2167  102 VAL A N   
570  C CA  . VAL A 81  ? 1.5050 1.0685 0.9305 -0.2206 0.2066  0.2393  102 VAL A CA  
571  C C   . VAL A 81  ? 1.4315 1.0242 0.9575 -0.2182 0.1780  0.2485  102 VAL A C   
572  O O   . VAL A 81  ? 1.3288 0.9499 0.9196 -0.1986 0.1733  0.2280  102 VAL A O   
573  C CB  . VAL A 81  ? 1.5591 1.0875 0.9324 -0.2211 0.1682  0.2257  102 VAL A CB  
574  C CG1 . VAL A 81  ? 1.7242 1.2173 0.9927 -0.2269 0.1929  0.2148  102 VAL A CG1 
575  C CG2 . VAL A 81  ? 1.4821 1.0296 0.9135 -0.1979 0.1471  0.1984  102 VAL A CG2 
576  N N   . LYS A 82  ? 1.5122 1.0956 1.0490 -0.2388 0.1582  0.2795  103 LYS A N   
577  C CA  . LYS A 82  ? 1.5209 1.1286 1.1517 -0.2400 0.1392  0.2900  103 LYS A CA  
578  C C   . LYS A 82  ? 1.5303 1.1123 1.1764 -0.2560 0.0936  0.3139  103 LYS A C   
579  O O   . LYS A 82  ? 1.4661 1.0596 1.1873 -0.2587 0.0745  0.3215  103 LYS A O   
580  C CB  . LYS A 82  ? 1.5429 1.1819 1.2064 -0.2491 0.1808  0.3097  103 LYS A CB  
581  C CG  . LYS A 82  ? 1.5779 1.1997 1.1885 -0.2762 0.1985  0.3480  103 LYS A CG  
582  C CD  . LYS A 82  ? 1.5789 1.2395 1.2368 -0.2856 0.2388  0.3714  103 LYS A CD  
583  C CE  . LYS A 82  ? 1.5814 1.2769 1.2499 -0.2637 0.2864  0.3478  103 LYS A CE  
584  N NZ  . LYS A 82  ? 1.6333 1.3788 1.3824 -0.2685 0.3158  0.3682  103 LYS A NZ  
585  N N   . GLY A 83  ? 1.5503 1.0959 1.1277 -0.2670 0.0742  0.3261  104 GLY A N   
586  C CA  . GLY A 83  ? 1.6152 1.1350 1.2075 -0.2820 0.0320  0.3536  104 GLY A CA  
587  C C   . GLY A 83  ? 1.5120 1.0238 1.1467 -0.2643 -0.0147 0.3344  104 GLY A C   
588  O O   . GLY A 83  ? 1.3470 0.8817 1.0255 -0.2414 -0.0158 0.3016  104 GLY A O   
589  N N   . ASP A 84  ? 1.6472 1.1281 1.2684 -0.2745 -0.0526 0.3570  105 ASP A N   
590  C CA  . ASP A 84  ? 1.6449 1.1169 1.2978 -0.2570 -0.0955 0.3423  105 ASP A CA  
591  C C   . ASP A 84  ? 1.6204 1.0917 1.2108 -0.2488 -0.0934 0.3236  105 ASP A C   
592  O O   . ASP A 84  ? 1.5921 1.0594 1.1933 -0.2362 -0.1251 0.3143  105 ASP A O   
593  C CB  . ASP A 84  ? 1.7376 1.1768 1.4023 -0.2706 -0.1358 0.3775  105 ASP A CB  
594  C CG  . ASP A 84  ? 1.7432 1.1770 1.4686 -0.2481 -0.1780 0.3624  105 ASP A CG  
595  O OD1 . ASP A 84  ? 1.7069 1.1585 1.4380 -0.2255 -0.1813 0.3307  105 ASP A OD1 
596  O OD2 . ASP A 84  ? 1.7668 1.1778 1.5367 -0.2525 -0.2072 0.3836  105 ASP A OD2 
597  N N   . LEU A 85  ? 1.5344 1.0090 1.0608 -0.2564 -0.0549 0.3187  106 LEU A N   
598  C CA  . LEU A 85  ? 1.5259 0.9965 0.9922 -0.2503 -0.0486 0.2975  106 LEU A CA  
599  C C   . LEU A 85  ? 1.4669 0.9684 0.9743 -0.2246 -0.0308 0.2595  106 LEU A C   
600  O O   . LEU A 85  ? 1.4698 0.9736 0.9688 -0.2124 -0.0439 0.2399  106 LEU A O   
601  C CB  . LEU A 85  ? 1.5774 1.0294 0.9484 -0.2699 -0.0154 0.3077  106 LEU A CB  
602  N N   . PHE A 86  ? 1.4138 0.9409 0.9675 -0.2179 -0.0023 0.2525  107 PHE A N   
603  C CA  . PHE A 86  ? 1.3341 0.8939 0.9323 -0.1943 0.0138  0.2208  107 PHE A CA  
604  C C   . PHE A 86  ? 1.2499 0.8206 0.8962 -0.1748 -0.0222 0.2029  107 PHE A C   
605  O O   . PHE A 86  ? 1.2162 0.8005 0.8600 -0.1588 -0.0197 0.1798  107 PHE A O   
606  C CB  . PHE A 86  ? 1.3360 0.9235 0.9918 -0.1934 0.0379  0.2237  107 PHE A CB  
607  C CG  . PHE A 86  ? 1.3138 0.9377 1.0326 -0.1700 0.0413  0.1961  107 PHE A CG  
608  C CD1 . PHE A 86  ? 1.3489 0.9864 1.0504 -0.1537 0.0606  0.1728  107 PHE A CD1 
609  C CD2 . PHE A 86  ? 1.2740 0.9164 1.0677 -0.1658 0.0242  0.1944  107 PHE A CD2 
610  C CE1 . PHE A 86  ? 1.2688 0.9414 1.0263 -0.1333 0.0623  0.1514  107 PHE A CE1 
611  C CE2 . PHE A 86  ? 1.2074 0.8837 1.0524 -0.1460 0.0252  0.1698  107 PHE A CE2 
612  C CZ  . PHE A 86  ? 1.1865 0.8799 1.0133 -0.1296 0.0445  0.1500  107 PHE A CZ  
613  N N   . VAL A 87  ? 1.3416 0.9048 1.0306 -0.1763 -0.0548 0.2150  108 VAL A N   
614  C CA  . VAL A 87  ? 1.3204 0.8933 1.0572 -0.1562 -0.0873 0.1990  108 VAL A CA  
615  C C   . VAL A 87  ? 1.2834 0.8438 0.9816 -0.1550 -0.1091 0.2011  108 VAL A C   
616  O O   . VAL A 87  ? 1.2408 0.8179 0.9699 -0.1356 -0.1268 0.1849  108 VAL A O   
617  C CB  . VAL A 87  ? 1.3455 0.9063 1.1382 -0.1575 -0.1154 0.2110  108 VAL A CB  
618  C CG1 . VAL A 87  ? 1.4621 0.9870 1.2219 -0.1812 -0.1311 0.2478  108 VAL A CG1 
619  C CG2 . VAL A 87  ? 1.2886 0.8591 1.1311 -0.1327 -0.1450 0.1906  108 VAL A CG2 
620  N N   . LYS A 88  ? 1.3312 0.8645 0.9605 -0.1763 -0.1076 0.2217  109 LYS A N   
621  C CA  . LYS A 88  ? 1.3456 0.8674 0.9358 -0.1794 -0.1307 0.2252  109 LYS A CA  
622  C C   . LYS A 88  ? 1.3154 0.8479 0.8717 -0.1731 -0.1096 0.2014  109 LYS A C   
623  O O   . LYS A 88  ? 1.2393 0.7879 0.8151 -0.1596 -0.1253 0.1886  109 LYS A O   
624  C CB  . LYS A 88  ? 1.3784 0.8642 0.9027 -0.2072 -0.1431 0.2573  109 LYS A CB  
625  N N   . GLU A 89  ? 1.3103 0.8336 0.8186 -0.1824 -0.0729 0.1970  110 GLU A N   
626  C CA  . GLU A 89  ? 1.3028 0.8283 0.7772 -0.1768 -0.0491 0.1745  110 GLU A CA  
627  C C   . GLU A 89  ? 1.2374 0.8012 0.7773 -0.1506 -0.0431 0.1507  110 GLU A C   
628  O O   . GLU A 89  ? 1.2589 0.8291 0.7929 -0.1428 -0.0468 0.1367  110 GLU A O   
629  C CB  . GLU A 89  ? 1.3483 0.8594 0.7714 -0.1865 -0.0055 0.1733  110 GLU A CB  
630  N N   . LEU A 90  ? 1.1904 0.7789 0.7910 -0.1391 -0.0355 0.1476  111 LEU A N   
631  C CA  . LEU A 90  ? 1.1292 0.7557 0.7891 -0.1152 -0.0313 0.1261  111 LEU A CA  
632  C C   . LEU A 90  ? 1.0928 0.7333 0.7759 -0.1023 -0.0611 0.1192  111 LEU A C   
633  O O   . LEU A 90  ? 1.0837 0.7451 0.7759 -0.0891 -0.0545 0.1040  111 LEU A O   
634  C CB  . LEU A 90  ? 1.1323 0.7784 0.8528 -0.1086 -0.0305 0.1258  111 LEU A CB  
635  C CG  . LEU A 90  ? 1.0967 0.7826 0.8718 -0.0860 -0.0248 0.1037  111 LEU A CG  
636  C CD1 . LEU A 90  ? 1.1099 0.8083 0.8664 -0.0801 0.0070  0.0930  111 LEU A CD1 
637  C CD2 . LEU A 90  ? 1.1045 0.8043 0.9323 -0.0849 -0.0258 0.1038  111 LEU A CD2 
638  N N   . PHE A 91  ? 1.1339 0.7640 0.8288 -0.1059 -0.0930 0.1329  112 PHE A N   
639  C CA  . PHE A 91  ? 1.1144 0.7636 0.8416 -0.0913 -0.1200 0.1287  112 PHE A CA  
640  C C   . PHE A 91  ? 1.1793 0.8169 0.8640 -0.1024 -0.1333 0.1370  112 PHE A C   
641  O O   . PHE A 91  ? 1.1724 0.8353 0.8827 -0.0898 -0.1451 0.1308  112 PHE A O   
642  C CB  . PHE A 91  ? 1.1315 0.7763 0.9006 -0.0861 -0.1486 0.1392  112 PHE A CB  
643  C CG  . PHE A 91  ? 1.1160 0.7763 0.9389 -0.0707 -0.1433 0.1245  112 PHE A CG  
644  C CD1 . PHE A 91  ? 1.1367 0.7807 0.9596 -0.0833 -0.1316 0.1314  112 PHE A CD1 
645  C CD2 . PHE A 91  ? 1.0668 0.7588 0.9388 -0.0449 -0.1503 0.1040  112 PHE A CD2 
646  C CE1 . PHE A 91  ? 1.1317 0.7879 1.0048 -0.0726 -0.1312 0.1180  112 PHE A CE1 
647  C CE2 . PHE A 91  ? 1.0756 0.7777 0.9902 -0.0325 -0.1486 0.0877  112 PHE A CE2 
648  C CZ  . PHE A 91  ? 1.1255 0.8084 1.0418 -0.0474 -0.1410 0.0945  112 PHE A CZ  
649  N N   . TRP A 92  ? 1.2172 0.8180 0.8365 -0.1269 -0.1321 0.1514  113 TRP A N   
650  C CA  . TRP A 92  ? 1.2805 0.8659 0.8514 -0.1408 -0.1443 0.1556  113 TRP A CA  
651  C C   . TRP A 92  ? 1.2440 0.8440 0.8125 -0.1313 -0.1212 0.1340  113 TRP A C   
652  O O   . TRP A 92  ? 1.2758 0.8916 0.8577 -0.1273 -0.1354 0.1314  113 TRP A O   
653  C CB  . TRP A 92  ? 1.4947 1.0346 0.9836 -0.1692 -0.1430 0.1702  113 TRP A CB  
654  C CG  . TRP A 92  ? 1.6375 1.1611 1.0937 -0.1864 -0.1791 0.1861  113 TRP A CG  
655  C CD1 . TRP A 92  ? 1.6521 1.1711 1.0814 -0.1938 -0.1882 0.1791  113 TRP A CD1 
656  C CD2 . TRP A 92  ? 1.7188 1.2303 1.1724 -0.1991 -0.2150 0.2144  113 TRP A CD2 
657  N NE1 . TRP A 92  ? 1.6732 1.1799 1.0822 -0.2120 -0.2285 0.2011  113 TRP A NE1 
658  C CE2 . TRP A 92  ? 1.7281 1.2310 1.1519 -0.2146 -0.2455 0.2237  113 TRP A CE2 
659  C CE3 . TRP A 92  ? 1.6950 1.2007 1.1710 -0.2001 -0.2262 0.2347  113 TRP A CE3 
660  C CZ2 . TRP A 92  ? 1.7693 1.2618 1.1857 -0.2298 -0.2870 0.2535  113 TRP A CZ2 
661  C CZ3 . TRP A 92  ? 1.6702 1.1623 1.1384 -0.2140 -0.2661 0.2645  113 TRP A CZ3 
662  C CH2 . TRP A 92  ? 1.7368 1.2243 1.1757 -0.2282 -0.2962 0.2741  113 TRP A CH2 
663  N N   . MET A 93  ? 1.2778 0.8742 0.8345 -0.1278 -0.0854 0.1214  114 MET A N   
664  C CA  . MET A 93  ? 1.2467 0.8573 0.8100 -0.1155 -0.0598 0.1024  114 MET A CA  
665  C C   . MET A 93  ? 1.1700 0.8281 0.8029 -0.0923 -0.0689 0.0944  114 MET A C   
666  O O   . MET A 93  ? 1.1963 0.8672 0.8346 -0.0870 -0.0688 0.0881  114 MET A O   
667  C CB  . MET A 93  ? 1.2618 0.8695 0.8196 -0.1116 -0.0213 0.0942  114 MET A CB  
668  C CG  . MET A 93  ? 1.2441 0.8919 0.8587 -0.0881 -0.0033 0.0793  114 MET A CG  
669  S SD  . MET A 93  ? 1.2975 0.9567 0.9293 -0.0799 0.0382  0.0728  114 MET A SD  
670  C CE  . MET A 93  ? 1.1660 0.8647 0.8454 -0.0561 0.0470  0.0581  114 MET A CE  
671  N N   . LEU A 94  ? 1.0650 0.7470 0.7487 -0.0793 -0.0775 0.0951  115 LEU A N   
672  C CA  . LEU A 94  ? 1.0118 0.7387 0.7560 -0.0557 -0.0843 0.0852  115 LEU A CA  
673  C C   . LEU A 94  ? 0.9928 0.7352 0.7504 -0.0530 -0.1099 0.0924  115 LEU A C   
674  O O   . LEU A 94  ? 0.9991 0.7800 0.7937 -0.0356 -0.1094 0.0851  115 LEU A O   
675  C CB  . LEU A 94  ? 1.0295 0.7678 0.8168 -0.0448 -0.0912 0.0823  115 LEU A CB  
676  C CG  . LEU A 94  ? 1.0403 0.7936 0.8480 -0.0364 -0.0671 0.0694  115 LEU A CG  
677  C CD1 . LEU A 94  ? 1.0433 0.8080 0.8975 -0.0258 -0.0794 0.0632  115 LEU A CD1 
678  C CD2 . LEU A 94  ? 1.0506 0.8360 0.8707 -0.0220 -0.0514 0.0568  115 LEU A CD2 
679  N N   . HIS A 95  ? 1.0112 0.7268 0.7399 -0.0711 -0.1324 0.1091  116 HIS A N   
680  C CA  . HIS A 95  ? 1.0539 0.7841 0.7957 -0.0730 -0.1589 0.1207  116 HIS A CA  
681  C C   . HIS A 95  ? 1.0500 0.7728 0.7586 -0.0853 -0.1528 0.1191  116 HIS A C   
682  O O   . HIS A 95  ? 1.0216 0.7786 0.7627 -0.0760 -0.1559 0.1186  116 HIS A O   
683  C CB  . HIS A 95  ? 1.1596 0.8630 0.8831 -0.0900 -0.1890 0.1423  116 HIS A CB  
684  C CG  . HIS A 95  ? 1.2371 0.9582 0.9807 -0.0935 -0.2200 0.1586  116 HIS A CG  
685  N ND1 . HIS A 95  ? 1.2301 0.9945 1.0424 -0.0708 -0.2336 0.1620  116 HIS A ND1 
686  C CD2 . HIS A 95  ? 1.2813 0.9835 0.9868 -0.1177 -0.2407 0.1732  116 HIS A CD2 
687  C CE1 . HIS A 95  ? 1.2371 1.0137 1.0596 -0.0803 -0.2601 0.1807  116 HIS A CE1 
688  N NE2 . HIS A 95  ? 1.2662 1.0049 1.0244 -0.1103 -0.2673 0.1881  116 HIS A NE2 
689  N N   . LEU A 96  ? 1.0147 0.6912 0.6576 -0.1065 -0.1428 0.1181  117 LEU A N   
690  C CA  . LEU A 96  ? 1.0947 0.7498 0.6970 -0.1208 -0.1386 0.1140  117 LEU A CA  
691  C C   . LEU A 96  ? 1.0777 0.7600 0.7107 -0.1033 -0.1147 0.1002  117 LEU A C   
692  O O   . LEU A 96  ? 1.1225 0.8127 0.7620 -0.1074 -0.1223 0.1028  117 LEU A O   
693  C CB  . LEU A 96  ? 1.2461 0.8442 0.7687 -0.1415 -0.1244 0.1093  117 LEU A CB  
694  C CG  . LEU A 96  ? 1.3714 0.9402 0.8533 -0.1620 -0.1481 0.1262  117 LEU A CG  
695  C CD1 . LEU A 96  ? 1.4616 0.9888 0.8786 -0.1730 -0.1217 0.1207  117 LEU A CD1 
696  C CD2 . LEU A 96  ? 1.4109 0.9615 0.8614 -0.1851 -0.1838 0.1387  117 LEU A CD2 
697  N N   . GLN A 97  ? 1.0746 0.7719 0.7286 -0.0855 -0.0880 0.0884  118 GLN A N   
698  C CA  . GLN A 97  ? 0.9769 0.7030 0.6620 -0.0680 -0.0668 0.0783  118 GLN A CA  
699  C C   . GLN A 97  ? 0.9041 0.6845 0.6478 -0.0517 -0.0809 0.0835  118 GLN A C   
700  O O   . GLN A 97  ? 0.9654 0.7694 0.7290 -0.0435 -0.0721 0.0825  118 GLN A O   
701  C CB  . GLN A 97  ? 0.9393 0.6728 0.6370 -0.0542 -0.0392 0.0671  118 GLN A CB  
702  C CG  . GLN A 97  ? 1.0184 0.7064 0.6636 -0.0662 -0.0152 0.0616  118 GLN A CG  
703  C CD  . GLN A 97  ? 1.0494 0.7198 0.6749 -0.0659 0.0038  0.0539  118 GLN A CD  
704  O OE1 . GLN A 97  ? 1.0867 0.7880 0.7503 -0.0523 0.0065  0.0530  118 GLN A OE1 
705  N NE2 . GLN A 97  ? 1.1020 0.7208 0.6661 -0.0807 0.0174  0.0485  118 GLN A NE2 
706  N N   . LYS A 98  ? 0.8859 0.6864 0.6578 -0.0459 -0.1013 0.0900  119 LYS A N   
707  C CA  . LYS A 98  ? 0.8583 0.7101 0.6823 -0.0301 -0.1137 0.0957  119 LYS A CA  
708  C C   . LYS A 98  ? 0.9047 0.7561 0.7226 -0.0462 -0.1301 0.1108  119 LYS A C   
709  O O   . LYS A 98  ? 0.8926 0.7823 0.7421 -0.0378 -0.1271 0.1155  119 LYS A O   
710  C CB  . LYS A 98  ? 0.8378 0.7054 0.6941 -0.0190 -0.1317 0.0986  119 LYS A CB  
711  C CG  . LYS A 98  ? 0.8088 0.7312 0.7192 0.0001  -0.1413 0.1038  119 LYS A CG  
712  C CD  . LYS A 98  ? 0.8167 0.7654 0.7653 0.0269  -0.1380 0.0897  119 LYS A CD  
713  C CE  . LYS A 98  ? 0.7683 0.7730 0.7670 0.0488  -0.1424 0.0930  119 LYS A CE  
714  N NZ  . LYS A 98  ? 0.7928 0.8035 0.8253 0.0666  -0.1562 0.0892  119 LYS A NZ  
715  N N   . GLU A 99  ? 0.9446 0.7529 0.7203 -0.0713 -0.1485 0.1199  120 GLU A N   
716  C CA  . GLU A 99  ? 1.0116 0.8119 0.7757 -0.0920 -0.1671 0.1333  120 GLU A CA  
717  C C   . GLU A 99  ? 0.9992 0.7903 0.7504 -0.0951 -0.1478 0.1262  120 GLU A C   
718  O O   . GLU A 99  ? 0.9405 0.7653 0.7272 -0.0931 -0.1521 0.1365  120 GLU A O   
719  C CB  . GLU A 99  ? 1.1706 0.9162 0.8756 -0.1216 -0.1892 0.1405  120 GLU A CB  
720  C CG  . GLU A 99  ? 1.2477 1.0025 0.9695 -0.1252 -0.2196 0.1576  120 GLU A CG  
721  C CD  . GLU A 99  ? 1.3632 1.0631 1.0178 -0.1573 -0.2430 0.1665  120 GLU A CD  
722  O OE1 . GLU A 99  ? 1.4006 1.0569 0.9964 -0.1771 -0.2370 0.1575  120 GLU A OE1 
723  O OE2 . GLU A 99  ? 1.4727 1.1712 1.1313 -0.1625 -0.2680 0.1823  120 GLU A OE2 
724  N N   . THR A 100 ? 1.0356 0.7811 0.7384 -0.0996 -0.1258 0.1106  121 THR A N   
725  C CA  . THR A 100 ? 1.0295 0.7555 0.7168 -0.1011 -0.1057 0.1024  121 THR A CA  
726  C C   . THR A 100 ? 0.9290 0.7111 0.6750 -0.0784 -0.0922 0.1056  121 THR A C   
727  O O   . THR A 100 ? 0.9311 0.7223 0.6927 -0.0832 -0.0952 0.1148  121 THR A O   
728  C CB  . THR A 100 ? 1.0653 0.7466 0.7061 -0.0995 -0.0768 0.0841  121 THR A CB  
729  O OG1 . THR A 100 ? 1.1365 0.7673 0.7158 -0.1208 -0.0869 0.0821  121 THR A OG1 
730  C CG2 . THR A 100 ? 1.1310 0.7862 0.7574 -0.0995 -0.0565 0.0756  121 THR A CG2 
731  N N   . PHE A 101 ? 0.9014 0.7201 0.6781 -0.0551 -0.0789 0.0991  122 PHE A N   
732  C CA  . PHE A 101 ? 0.8530 0.7274 0.6786 -0.0328 -0.0669 0.1011  122 PHE A CA  
733  C C   . PHE A 101 ? 0.8316 0.7523 0.6971 -0.0321 -0.0849 0.1191  122 PHE A C   
734  O O   . PHE A 101 ? 0.7889 0.7419 0.6808 -0.0257 -0.0777 0.1282  122 PHE A O   
735  C CB  . PHE A 101 ? 0.8138 0.7165 0.6610 -0.0110 -0.0564 0.0893  122 PHE A CB  
736  C CG  . PHE A 101 ? 0.7515 0.7081 0.6380 0.0113  -0.0441 0.0888  122 PHE A CG  
737  C CD1 . PHE A 101 ? 0.7530 0.7080 0.6383 0.0159  -0.0247 0.0876  122 PHE A CD1 
738  C CD2 . PHE A 101 ? 0.7067 0.7153 0.6299 0.0285  -0.0516 0.0897  122 PHE A CD2 
739  C CE1 . PHE A 101 ? 0.6879 0.6938 0.6055 0.0349  -0.0159 0.0900  122 PHE A CE1 
740  C CE2 . PHE A 101 ? 0.6641 0.7222 0.6144 0.0482  -0.0403 0.0886  122 PHE A CE2 
741  C CZ  . PHE A 101 ? 0.6606 0.7182 0.6069 0.0501  -0.0238 0.0901  122 PHE A CZ  
742  N N   . ALA A 102 ? 0.8619 0.7883 0.7350 -0.0388 -0.1080 0.1271  123 ALA A N   
743  C CA  . ALA A 102 ? 0.8721 0.8456 0.7886 -0.0389 -0.1249 0.1470  123 ALA A CA  
744  C C   . ALA A 102 ? 0.8773 0.8358 0.7868 -0.0615 -0.1326 0.1621  123 ALA A C   
745  O O   . ALA A 102 ? 0.8211 0.8262 0.7710 -0.0567 -0.1308 0.1780  123 ALA A O   
746  C CB  . ALA A 102 ? 0.9139 0.8892 0.8400 -0.0442 -0.1507 0.1553  123 ALA A CB  
747  N N   . THR A 103 ? 0.8614 0.7533 0.7179 -0.0865 -0.1408 0.1569  124 THR A N   
748  C CA  . THR A 103 ? 0.9057 0.7698 0.7491 -0.1096 -0.1490 0.1665  124 THR A CA  
749  C C   . THR A 103 ? 0.8995 0.7778 0.7605 -0.0964 -0.1238 0.1660  124 THR A C   
750  O O   . THR A 103 ? 0.9262 0.8260 0.8171 -0.1042 -0.1297 0.1849  124 THR A O   
751  C CB  . THR A 103 ? 0.9906 0.7714 0.7617 -0.1356 -0.1569 0.1533  124 THR A CB  
752  O OG1 . THR A 103 ? 1.0151 0.7599 0.7516 -0.1241 -0.1260 0.1314  124 THR A OG1 
753  C CG2 . THR A 103 ? 1.0105 0.7741 0.7551 -0.1473 -0.1795 0.1537  124 THR A CG2 
754  N N   . TYR A 104 ? 0.9074 0.7759 0.7537 -0.0776 -0.0972 0.1475  125 TYR A N   
755  C CA  . TYR A 104 ? 0.8538 0.7391 0.7196 -0.0627 -0.0744 0.1489  125 TYR A CA  
756  C C   . TYR A 104 ? 0.8127 0.7758 0.7361 -0.0480 -0.0743 0.1688  125 TYR A C   
757  O O   . TYR A 104 ? 0.8709 0.8485 0.8162 -0.0523 -0.0727 0.1866  125 TYR A O   
758  C CB  . TYR A 104 ? 0.8539 0.7311 0.7062 -0.0427 -0.0488 0.1289  125 TYR A CB  
759  C CG  . TYR A 104 ? 0.9003 0.7058 0.6977 -0.0535 -0.0395 0.1104  125 TYR A CG  
760  C CD1 . TYR A 104 ? 0.9753 0.7210 0.7302 -0.0791 -0.0522 0.1089  125 TYR A CD1 
761  C CD2 . TYR A 104 ? 0.8819 0.6804 0.6689 -0.0385 -0.0175 0.0944  125 TYR A CD2 
762  C CE1 . TYR A 104 ? 1.0180 0.6981 0.7155 -0.0873 -0.0402 0.0899  125 TYR A CE1 
763  C CE2 . TYR A 104 ? 0.9453 0.6836 0.6831 -0.0468 -0.0043 0.0790  125 TYR A CE2 
764  C CZ  . TYR A 104 ? 0.9898 0.6686 0.6800 -0.0701 -0.0141 0.0757  125 TYR A CZ  
765  O OH  . TYR A 104 ? 1.0185 0.6372 0.6527 -0.0768 0.0022  0.0584  125 TYR A OH  
766  N N   . VAL A 105 ? 0.7851 0.7964 0.7318 -0.0304 -0.0754 0.1659  126 VAL A N   
767  C CA  . VAL A 105 ? 0.7691 0.8567 0.7645 -0.0127 -0.0716 0.1808  126 VAL A CA  
768  C C   . VAL A 105 ? 0.8003 0.9129 0.8260 -0.0298 -0.0893 0.2086  126 VAL A C   
769  O O   . VAL A 105 ? 0.7741 0.9440 0.8378 -0.0216 -0.0825 0.2282  126 VAL A O   
770  C CB  . VAL A 105 ? 0.7628 0.8873 0.7729 0.0098  -0.0707 0.1675  126 VAL A CB  
771  C CG1 . VAL A 105 ? 0.7145 0.9164 0.7661 0.0322  -0.0609 0.1775  126 VAL A CG1 
772  C CG2 . VAL A 105 ? 0.7855 0.8812 0.7681 0.0213  -0.0577 0.1419  126 VAL A CG2 
773  N N   . ALA A 106 ? 0.7951 0.8664 0.8038 -0.0553 -0.1126 0.2124  127 ALA A N   
774  C CA  . ALA A 106 ? 0.8133 0.9029 0.8521 -0.0772 -0.1335 0.2408  127 ALA A CA  
775  C C   . ALA A 106 ? 0.8692 0.9357 0.9058 -0.0932 -0.1296 0.2537  127 ALA A C   
776  O O   . ALA A 106 ? 0.8560 0.9728 0.9374 -0.0945 -0.1287 0.2809  127 ALA A O   
777  C CB  . ALA A 106 ? 0.8504 0.8980 0.8673 -0.1030 -0.1639 0.2413  127 ALA A CB  
778  N N   . ARG A 107 ? 0.9320 0.9220 0.9176 -0.1044 -0.1262 0.2351  128 ARG A N   
779  C CA  . ARG A 107 ? 0.9792 0.9344 0.9603 -0.1174 -0.1221 0.2436  128 ARG A CA  
780  C C   . ARG A 107 ? 0.9199 0.9313 0.9400 -0.0953 -0.0994 0.2587  128 ARG A C   
781  O O   . ARG A 107 ? 0.9481 0.9702 0.9959 -0.1064 -0.1023 0.2840  128 ARG A O   
782  C CB  . ARG A 107 ? 1.0685 0.9363 0.9884 -0.1229 -0.1132 0.2154  128 ARG A CB  
783  C CG  . ARG A 107 ? 1.1973 0.9901 1.0771 -0.1576 -0.1375 0.2116  128 ARG A CG  
784  C CD  . ARG A 107 ? 1.2979 1.0057 1.1138 -0.1583 -0.1222 0.1809  128 ARG A CD  
785  N NE  . ARG A 107 ? 1.4268 1.0996 1.2469 -0.1583 -0.1096 0.1832  128 ARG A NE  
786  C CZ  . ARG A 107 ? 1.6097 1.2000 1.3794 -0.1633 -0.0992 0.1597  128 ARG A CZ  
787  N NH1 . ARG A 107 ? 1.7419 1.2789 1.4479 -0.1699 -0.0986 0.1325  128 ARG A NH1 
788  N NH2 . ARG A 107 ? 1.6395 1.1999 1.4220 -0.1607 -0.0884 0.1642  128 ARG A NH2 
789  N N   . PHE A 108 ? 0.8656 0.9123 0.8872 -0.0657 -0.0789 0.2447  129 PHE A N   
790  C CA  . PHE A 108 ? 0.7929 0.8959 0.8443 -0.0438 -0.0590 0.2575  129 PHE A CA  
791  C C   . PHE A 108 ? 0.8022 0.9808 0.9037 -0.0444 -0.0632 0.2906  129 PHE A C   
792  O O   . PHE A 108 ? 0.8591 1.0604 0.9837 -0.0460 -0.0566 0.3155  129 PHE A O   
793  C CB  . PHE A 108 ? 0.7180 0.8486 0.7611 -0.0146 -0.0423 0.2349  129 PHE A CB  
794  C CG  . PHE A 108 ? 0.6479 0.8472 0.7185 0.0076  -0.0265 0.2480  129 PHE A CG  
795  C CD1 . PHE A 108 ? 0.6633 0.8594 0.7394 0.0098  -0.0158 0.2622  129 PHE A CD1 
796  C CD2 . PHE A 108 ? 0.6339 0.9001 0.7235 0.0268  -0.0228 0.2467  129 PHE A CD2 
797  C CE1 . PHE A 108 ? 0.6521 0.9128 0.7484 0.0286  -0.0034 0.2769  129 PHE A CE1 
798  C CE2 . PHE A 108 ? 0.6017 0.9303 0.7073 0.0466  -0.0083 0.2572  129 PHE A CE2 
799  C CZ  . PHE A 108 ? 0.6357 0.9630 0.7430 0.0464  0.0004  0.2735  129 PHE A CZ  
800  N N   . GLN A 109 ? 0.8215 1.0413 0.9426 -0.0420 -0.0729 0.2930  130 GLN A N   
801  C CA  . GLN A 109 ? 0.7907 1.0891 0.9634 -0.0402 -0.0734 0.3247  130 GLN A CA  
802  C C   . GLN A 109 ? 0.8199 1.1036 1.0160 -0.0738 -0.0929 0.3560  130 GLN A C   
803  O O   . GLN A 109 ? 0.8595 1.1972 1.0971 -0.0771 -0.0883 0.3897  130 GLN A O   
804  C CB  . GLN A 109 ? 0.7799 1.1236 0.9727 -0.0267 -0.0782 0.3184  130 GLN A CB  
805  C CG  . GLN A 109 ? 0.7711 1.1069 0.9357 -0.0002 -0.0673 0.2827  130 GLN A CG  
806  C CD  . GLN A 109 ? 0.7487 1.1282 0.9392 0.0157  -0.0717 0.2780  130 GLN A CD  
807  O OE1 . GLN A 109 ? 0.7152 1.1220 0.9027 0.0442  -0.0575 0.2577  130 GLN A OE1 
808  N NE2 . GLN A 109 ? 0.7760 1.1610 0.9941 -0.0028 -0.0931 0.2969  130 GLN A NE2 
809  N N   . LYS A 110 ? 0.7486 0.9587 0.9164 -0.1003 -0.1155 0.3454  131 LYS A N   
810  C CA  . LYS A 110 ? 0.8033 0.9913 0.9902 -0.1361 -0.1398 0.3720  131 LYS A CA  
811  C C   . LYS A 110 ? 0.8426 0.9959 1.0273 -0.1470 -0.1334 0.3853  131 LYS A C   
812  O O   . LYS A 110 ? 0.9654 1.1274 1.1852 -0.1715 -0.1476 0.4178  131 LYS A O   
813  C CB  . LYS A 110 ? 0.8560 0.9702 1.0039 -0.1625 -0.1684 0.3542  131 LYS A CB  
814  N N   . GLU A 111 ? 0.8625 0.9774 1.0116 -0.1292 -0.1131 0.3625  132 GLU A N   
815  C CA  . GLU A 111 ? 0.9006 0.9671 1.0450 -0.1390 -0.1091 0.3719  132 GLU A CA  
816  C C   . GLU A 111 ? 0.8708 0.9704 1.0246 -0.1105 -0.0813 0.3775  132 GLU A C   
817  O O   . GLU A 111 ? 0.9220 1.0359 1.1053 -0.1158 -0.0784 0.4084  132 GLU A O   
818  C CB  . GLU A 111 ? 0.9320 0.8920 1.0191 -0.1527 -0.1169 0.3391  132 GLU A CB  
819  C CG  . GLU A 111 ? 1.0081 0.9249 1.0770 -0.1858 -0.1490 0.3345  132 GLU A CG  
820  C CD  . GLU A 111 ? 1.1379 0.9533 1.1371 -0.1955 -0.1528 0.2967  132 GLU A CD  
821  O OE1 . GLU A 111 ? 1.1964 0.9674 1.1702 -0.1803 -0.1308 0.2786  132 GLU A OE1 
822  O OE2 . GLU A 111 ? 1.2186 1.0010 1.1884 -0.2177 -0.1774 0.2860  132 GLU A OE2 
823  N N   . ALA A 112 ? 0.8141 0.8541 1.0546 0.0495  -0.1820 0.0189  133 ALA A N   
824  C CA  . ALA A 112 ? 0.7852 0.8164 0.9995 0.0390  -0.1554 0.0252  133 ALA A CA  
825  C C   . ALA A 112 ? 0.7685 0.8122 1.0029 0.0372  -0.1286 0.0312  133 ALA A C   
826  O O   . ALA A 112 ? 0.7342 0.7778 0.9541 0.0287  -0.1068 0.0357  133 ALA A O   
827  C CB  . ALA A 112 ? 0.7724 0.7772 0.9214 0.0415  -0.1547 0.0269  133 ALA A CB  
828  N N   . TYR A 113 ? 0.7434 0.7993 1.0098 0.0471  -0.1306 0.0305  134 TYR A N   
829  C CA  . TYR A 113 ? 0.7561 0.8249 1.0428 0.0468  -0.1048 0.0342  134 TYR A CA  
830  C C   . TYR A 113 ? 0.8064 0.9050 1.1469 0.0356  -0.0929 0.0346  134 TYR A C   
831  O O   . TYR A 113 ? 0.8366 0.9597 1.2295 0.0375  -0.1037 0.0296  134 TYR A O   
832  C CB  . TYR A 113 ? 0.7726 0.8418 1.0720 0.0644  -0.1095 0.0328  134 TYR A CB  
833  C CG  . TYR A 113 ? 0.7875 0.8698 1.1077 0.0655  -0.0822 0.0343  134 TYR A CG  
834  C CD1 . TYR A 113 ? 0.8169 0.8786 1.0949 0.0626  -0.0602 0.0366  134 TYR A CD1 
835  C CD2 . TYR A 113 ? 0.8299 0.9480 1.2126 0.0683  -0.0777 0.0313  134 TYR A CD2 
836  C CE1 . TYR A 113 ? 0.8213 0.8946 1.1153 0.0638  -0.0354 0.0357  134 TYR A CE1 
837  C CE2 . TYR A 113 ? 0.8364 0.9677 1.2364 0.0701  -0.0513 0.0315  134 TYR A CE2 
838  C CZ  . TYR A 113 ? 0.8260 0.9332 1.1796 0.0685  -0.0307 0.0337  134 TYR A CZ  
839  O OH  . TYR A 113 ? 0.8878 1.0077 1.2557 0.0706  -0.0046 0.0318  134 TYR A OH  
840  N N   . CYS A 114 ? 0.8502 0.9479 1.1768 0.0242  -0.0701 0.0405  135 CYS A N   
841  C CA  . CYS A 114 ? 0.7862 0.9038 1.1528 0.0119  -0.0547 0.0442  135 CYS A CA  
842  C C   . CYS A 114 ? 0.6926 0.8156 1.0937 0.0042  -0.0745 0.0391  135 CYS A C   
843  O O   . CYS A 114 ? 0.7163 0.8654 1.1735 0.0013  -0.0780 0.0341  135 CYS A O   
844  C CB  . CYS A 114 ? 0.8089 0.9535 1.2180 0.0145  -0.0363 0.0444  135 CYS A CB  
845  S SG  . CYS A 114 ? 0.9197 1.0583 1.2913 0.0205  -0.0086 0.0477  135 CYS A SG  
846  N N   . PRO A 115 ? 0.6578 0.7581 1.0265 0.0005  -0.0872 0.0382  136 PRO A N   
847  C CA  . PRO A 115 ? 0.6852 0.7846 1.0787 -0.0064 -0.1090 0.0299  136 PRO A CA  
848  C C   . PRO A 115 ? 0.6727 0.7725 1.0957 -0.0237 -0.0947 0.0336  136 PRO A C   
849  O O   . PRO A 115 ? 0.6990 0.7917 1.1388 -0.0325 -0.1101 0.0256  136 PRO A O   
850  C CB  . PRO A 115 ? 0.6836 0.7549 1.0212 -0.0007 -0.1255 0.0270  136 PRO A CB  
851  C CG  . PRO A 115 ? 0.6575 0.7168 0.9503 0.0006  -0.1030 0.0370  136 PRO A CG  
852  C CD  . PRO A 115 ? 0.6511 0.7277 0.9580 0.0033  -0.0823 0.0426  136 PRO A CD  
853  N N   . ASN A 116 ? 0.6121 0.7170 1.0383 -0.0288 -0.0650 0.0453  137 ASN A N   
854  C CA  . ASN A 116 ? 0.6666 0.7662 1.1156 -0.0450 -0.0477 0.0522  137 ASN A CA  
855  C C   . ASN A 116 ? 0.7272 0.8559 1.2477 -0.0587 -0.0463 0.0455  137 ASN A C   
856  O O   . ASN A 116 ? 0.7761 0.9373 1.3294 -0.0541 -0.0416 0.0425  137 ASN A O   
857  C CB  . ASN A 116 ? 0.6513 0.7467 1.0739 -0.0445 -0.0159 0.0683  137 ASN A CB  
858  C CG  . ASN A 116 ? 0.6334 0.7552 1.0627 -0.0367 -0.0012 0.0697  137 ASN A CG  
859  O OD1 . ASN A 116 ? 0.7588 0.9010 1.2165 -0.0309 -0.0130 0.0600  137 ASN A OD1 
860  N ND2 . ASN A 116 ? 0.6348 0.7559 1.0369 -0.0350 0.0246  0.0812  137 ASN A ND2 
861  N N   . LYS A 117 ? 0.7042 0.8217 1.2498 -0.0757 -0.0501 0.0415  138 LYS A N   
862  C CA  . LYS A 117 ? 0.6591 0.8059 1.2756 -0.0944 -0.0441 0.0348  138 LYS A CA  
863  C C   . LYS A 117 ? 0.6679 0.8143 1.2945 -0.1071 -0.0053 0.0514  138 LYS A C   
864  O O   . LYS A 117 ? 0.7234 0.8984 1.4084 -0.1238 0.0089  0.0488  138 LYS A O   
865  C CB  . LYS A 117 ? 0.6179 0.7514 1.2584 -0.1109 -0.0638 0.0208  138 LYS A CB  
866  N N   . CYS A 118 ? 0.7168 0.8337 1.2858 -0.0989 0.0121  0.0683  139 CYS A N   
867  C CA  . CYS A 118 ? 0.7616 0.8735 1.3283 -0.1081 0.0486  0.0864  139 CYS A CA  
868  C C   . CYS A 118 ? 0.7072 0.8025 1.2078 -0.0907 0.0625  0.1015  139 CYS A C   
869  O O   . CYS A 118 ? 0.7059 0.7852 1.1601 -0.0753 0.0447  0.0986  139 CYS A O   
870  C CB  . CYS A 118 ? 0.8690 0.9471 1.4451 -0.1289 0.0584  0.0926  139 CYS A CB  
871  S SG  . CYS A 118 ? 1.1214 1.1417 1.6376 -0.1202 0.0384  0.0934  139 CYS A SG  
872  N N   . GLY A 119 ? 0.7067 0.8093 1.2036 -0.0938 0.0948  0.1165  140 GLY A N   
873  C CA  . GLY A 119 ? 0.6909 0.7807 1.1262 -0.0790 0.1096  0.1307  140 GLY A CA  
874  C C   . GLY A 119 ? 0.6642 0.7802 1.0804 -0.0627 0.1072  0.1238  140 GLY A C   
875  O O   . GLY A 119 ? 0.6718 0.8182 1.1264 -0.0624 0.1043  0.1126  140 GLY A O   
876  N N   . VAL A 120 ? 0.6273 0.7314 0.9841 -0.0486 0.1087  0.1297  141 VAL A N   
877  C CA  . VAL A 120 ? 0.6054 0.7292 0.9377 -0.0358 0.1087  0.1222  141 VAL A CA  
878  C C   . VAL A 120 ? 0.5943 0.7033 0.8805 -0.0243 0.0864  0.1153  141 VAL A C   
879  O O   . VAL A 120 ? 0.6064 0.6990 0.8506 -0.0184 0.0872  0.1231  141 VAL A O   
880  C CB  . VAL A 120 ? 0.6170 0.7525 0.9217 -0.0319 0.1382  0.1335  141 VAL A CB  
881  C CG1 . VAL A 120 ? 0.5979 0.7539 0.8849 -0.0220 0.1393  0.1217  141 VAL A CG1 
882  C CG2 . VAL A 120 ? 0.6346 0.7829 0.9800 -0.0444 0.1645  0.1428  141 VAL A CG2 
883  N N   . MET A 121 ? 0.6090 0.7243 0.9024 -0.0201 0.0673  0.1009  142 MET A N   
884  C CA  . MET A 121 ? 0.6079 0.7110 0.8591 -0.0116 0.0484  0.0934  142 MET A CA  
885  C C   . MET A 121 ? 0.6027 0.7183 0.8280 -0.0052 0.0547  0.0862  142 MET A C   
886  O O   . MET A 121 ? 0.5951 0.7194 0.8426 -0.0040 0.0536  0.0786  142 MET A O   
887  C CB  . MET A 121 ? 0.6059 0.6983 0.8753 -0.0123 0.0203  0.0831  142 MET A CB  
888  C CG  . MET A 121 ? 0.6379 0.7210 0.8669 -0.0043 0.0031  0.0742  142 MET A CG  
889  S SD  . MET A 121 ? 0.6718 0.7379 0.9092 -0.0039 -0.0297 0.0646  142 MET A SD  
890  C CE  . MET A 121 ? 0.7372 0.7955 0.9230 0.0044  -0.0403 0.0566  142 MET A CE  
891  N N   . LEU A 122 ? 0.6192 0.7359 0.7978 -0.0007 0.0612  0.0876  143 LEU A N   
892  C CA  . LEU A 122 ? 0.6620 0.7885 0.8126 0.0021  0.0665  0.0777  143 LEU A CA  
893  C C   . LEU A 122 ? 0.6772 0.7901 0.8080 0.0033  0.0455  0.0672  143 LEU A C   
894  O O   . LEU A 122 ? 0.6491 0.7574 0.7496 0.0052  0.0364  0.0662  143 LEU A O   
895  C CB  . LEU A 122 ? 0.6893 0.8301 0.8005 0.0052  0.0820  0.0809  143 LEU A CB  
896  C CG  . LEU A 122 ? 0.7254 0.8762 0.8443 0.0057  0.1037  0.0946  143 LEU A CG  
897  C CD1 . LEU A 122 ? 0.7455 0.9146 0.8200 0.0116  0.1165  0.0953  143 LEU A CD1 
898  C CD2 . LEU A 122 ? 0.7326 0.8930 0.8912 0.0011  0.1181  0.0937  143 LEU A CD2 
899  N N   . GLN A 123 ? 0.6373 0.7436 0.7844 0.0036  0.0386  0.0598  144 GLN A N   
900  C CA  . GLN A 123 ? 0.6699 0.7584 0.7981 0.0049  0.0194  0.0522  144 GLN A CA  
901  C C   . GLN A 123 ? 0.6732 0.7573 0.7714 0.0034  0.0280  0.0430  144 GLN A C   
902  O O   . GLN A 123 ? 0.7033 0.7871 0.8155 0.0051  0.0384  0.0400  144 GLN A O   
903  C CB  . GLN A 123 ? 0.6986 0.7777 0.8633 0.0086  0.0018  0.0516  144 GLN A CB  
904  C CG  . GLN A 123 ? 0.7029 0.7621 0.8471 0.0114  -0.0216 0.0469  144 GLN A CG  
905  C CD  . GLN A 123 ? 0.7293 0.7851 0.9105 0.0168  -0.0416 0.0458  144 GLN A CD  
906  O OE1 . GLN A 123 ? 0.6947 0.7625 0.9149 0.0202  -0.0374 0.0460  144 GLN A OE1 
907  N NE2 . GLN A 123 ? 0.7721 0.8155 0.9420 0.0183  -0.0639 0.0431  144 GLN A NE2 
908  N N   . THR A 124 ? 0.7170 0.7973 0.7746 -0.0005 0.0248  0.0373  145 THR A N   
909  C CA  . THR A 124 ? 0.7350 0.8077 0.7630 -0.0064 0.0340  0.0270  145 THR A CA  
910  C C   . THR A 124 ? 0.7652 0.8072 0.7932 -0.0035 0.0228  0.0252  145 THR A C   
911  O O   . THR A 124 ? 0.7322 0.7594 0.7504 -0.0015 0.0049  0.0269  145 THR A O   
912  C CB  . THR A 124 ? 0.7147 0.7975 0.7022 -0.0139 0.0351  0.0197  145 THR A CB  
913  O OG1 . THR A 124 ? 0.7449 0.8582 0.7274 -0.0137 0.0469  0.0203  145 THR A OG1 
914  C CG2 . THR A 124 ? 0.7195 0.7888 0.6783 -0.0242 0.0441  0.0078  145 THR A CG2 
915  N N   . LEU A 125 ? 0.7010 0.7326 0.7375 -0.0012 0.0336  0.0219  146 LEU A N   
916  C CA  . LEU A 125 ? 0.7269 0.7255 0.7601 0.0055  0.0248  0.0216  146 LEU A CA  
917  C C   . LEU A 125 ? 0.7454 0.7194 0.7409 -0.0029 0.0395  0.0124  146 LEU A C   
918  O O   . LEU A 125 ? 0.7408 0.7280 0.7255 -0.0123 0.0589  0.0038  146 LEU A O   
919  C CB  . LEU A 125 ? 0.7386 0.7405 0.8172 0.0191  0.0232  0.0253  146 LEU A CB  
920  C CG  . LEU A 125 ? 0.7506 0.7743 0.8729 0.0249  0.0084  0.0326  146 LEU A CG  
921  C CD1 . LEU A 125 ? 0.7423 0.7760 0.9123 0.0370  0.0095  0.0333  146 LEU A CD1 
922  C CD2 . LEU A 125 ? 0.7731 0.7825 0.8841 0.0275  -0.0172 0.0353  146 LEU A CD2 
923  N N   . ILE A 126 ? 0.8073 0.7437 0.7805 0.0003  0.0301  0.0139  147 ILE A N   
924  C CA  . ILE A 126 ? 0.8638 0.7653 0.7989 -0.0087 0.0442  0.0066  147 ILE A CA  
925  C C   . ILE A 126 ? 0.9072 0.7718 0.8507 0.0079  0.0429  0.0101  147 ILE A C   
926  O O   . ILE A 126 ? 0.9077 0.7540 0.8564 0.0235  0.0232  0.0196  147 ILE A O   
927  C CB  . ILE A 126 ? 0.8779 0.7592 0.7695 -0.0202 0.0382  0.0066  147 ILE A CB  
928  C CG1 . ILE A 126 ? 0.8133 0.7356 0.7018 -0.0308 0.0355  0.0035  147 ILE A CG1 
929  C CG2 . ILE A 126 ? 0.9156 0.7611 0.7672 -0.0356 0.0576  -0.0024 147 ILE A CG2 
930  C CD1 . ILE A 126 ? 0.8180 0.7290 0.6674 -0.0418 0.0308  0.0020  147 ILE A CD1 
931  N N   . TRP A 127 ? 0.9891 0.8457 0.9344 0.0066  0.0633  0.0014  148 TRP A N   
932  C CA  . TRP A 127 ? 1.0815 0.8956 1.0252 0.0218  0.0674  0.0017  148 TRP A CA  
933  C C   . TRP A 127 ? 1.1230 0.8801 1.0146 0.0152  0.0682  0.0034  148 TRP A C   
934  O O   . TRP A 127 ? 1.0797 0.8251 0.9355 -0.0085 0.0846  -0.0063 148 TRP A O   
935  C CB  . TRP A 127 ? 1.1526 0.9710 1.1057 0.0197  0.0918  -0.0111 148 TRP A CB  
936  C CG  . TRP A 127 ? 1.1622 1.0290 1.1660 0.0301  0.0934  -0.0106 148 TRP A CG  
937  C CD1 . TRP A 127 ? 1.1931 1.1061 1.2096 0.0185  0.1038  -0.0152 148 TRP A CD1 
938  C CD2 . TRP A 127 ? 1.2018 1.0769 1.2504 0.0546  0.0851  -0.0047 148 TRP A CD2 
939  N NE1 . TRP A 127 ? 1.2277 1.1731 1.2917 0.0320  0.1048  -0.0113 148 TRP A NE1 
940  C CE2 . TRP A 127 ? 1.2166 1.1430 1.3042 0.0531  0.0937  -0.0061 148 TRP A CE2 
941  C CE3 . TRP A 127 ? 1.2749 1.1214 1.3340 0.0784  0.0714  0.0016  148 TRP A CE3 
942  C CZ2 . TRP A 127 ? 1.2229 1.1748 1.3630 0.0714  0.0908  -0.0029 148 TRP A CZ2 
943  C CZ3 . TRP A 127 ? 1.2926 1.1688 1.4057 0.0992  0.0658  0.0037  148 TRP A CZ3 
944  C CH2 . TRP A 127 ? 1.2964 1.2261 1.4513 0.0939  0.0765  0.0008  148 TRP A CH2 
945  N N   . CYS A 128 ? 1.1150 0.8386 1.0030 0.0362  0.0508  0.0155  149 CYS A N   
946  C CA  . CYS A 128 ? 1.1530 0.8206 0.9894 0.0342  0.0469  0.0229  149 CYS A CA  
947  C C   . CYS A 128 ? 1.1445 0.7505 0.9457 0.0310  0.0689  0.0178  149 CYS A C   
948  O O   . CYS A 128 ? 1.1435 0.7044 0.8941 0.0144  0.0786  0.0186  149 CYS A O   
949  C CB  . CYS A 128 ? 1.2766 0.9327 1.1209 0.0619  0.0183  0.0382  149 CYS A CB  
950  S SG  . CYS A 128 ? 1.2394 0.9644 1.1342 0.0680  -0.0082 0.0414  149 CYS A SG  
951  N N   . LYS A 129 ? 1.0933 0.6960 0.9212 0.0466  0.0781  0.0121  150 LYS A N   
952  C CA  . LYS A 129 ? 1.1494 0.6896 0.9466 0.0466  0.0995  0.0055  150 LYS A CA  
953  C C   . LYS A 129 ? 1.1563 0.6907 0.9228 0.0092  0.1260  -0.0117 150 LYS A C   
954  O O   . LYS A 129 ? 1.2156 0.6890 0.9338 -0.0054 0.1407  -0.0139 150 LYS A O   
955  C CB  . LYS A 129 ? 1.1509 0.6997 0.9887 0.0715  0.1050  -0.0004 150 LYS A CB  
956  N N   . ASN A 130 ? 1.1679 0.7665 0.9618 -0.0064 0.1319  -0.0241 151 ASN A N   
957  C CA  . ASN A 130 ? 1.1852 0.7928 0.9576 -0.0396 0.1552  -0.0442 151 ASN A CA  
958  C C   . ASN A 130 ? 1.1495 0.8041 0.9142 -0.0637 0.1500  -0.0462 151 ASN A C   
959  O O   . ASN A 130 ? 1.0667 0.7453 0.8200 -0.0903 0.1659  -0.0641 151 ASN A O   
960  C CB  . ASN A 130 ? 1.1963 0.8402 1.0000 -0.0372 0.1691  -0.0599 151 ASN A CB  
961  C CG  . ASN A 130 ? 1.2087 0.9144 1.0640 -0.0173 0.1537  -0.0509 151 ASN A CG  
962  O OD1 . ASN A 130 ? 1.1883 0.9407 1.0550 -0.0241 0.1414  -0.0451 151 ASN A OD1 
963  N ND2 . ASN A 130 ? 1.2632 0.9682 1.1502 0.0072  0.1555  -0.0502 151 ASN A ND2 
964  N N   . CYS A 131 ? 1.2703 0.9400 1.0418 -0.0528 0.1271  -0.0296 152 CYS A N   
965  C CA  . CYS A 131 ? 1.2385 0.9518 1.0042 -0.0700 0.1199  -0.0302 152 CYS A CA  
966  C C   . CYS A 131 ? 1.1488 0.9298 0.9412 -0.0789 0.1253  -0.0425 152 CYS A C   
967  O O   . CYS A 131 ? 1.1653 0.9771 0.9429 -0.1008 0.1315  -0.0531 152 CYS A O   
968  C CB  . CYS A 131 ? 1.2661 0.9479 0.9827 -0.0982 0.1334  -0.0370 152 CYS A CB  
969  S SG  . CYS A 131 ? 1.4717 1.0789 1.1460 -0.0890 0.1243  -0.0172 152 CYS A SG  
970  N N   . LYS A 132 ? 1.0679 0.8741 0.8988 -0.0613 0.1234  -0.0410 153 LYS A N   
971  C CA  . LYS A 132 ? 1.0036 0.8678 0.8525 -0.0691 0.1319  -0.0518 153 LYS A CA  
972  C C   . LYS A 132 ? 0.9546 0.8643 0.8405 -0.0533 0.1156  -0.0390 153 LYS A C   
973  O O   . LYS A 132 ? 0.9393 0.8393 0.8505 -0.0338 0.1014  -0.0254 153 LYS A O   
974  C CB  . LYS A 132 ? 0.9852 0.8437 0.8410 -0.0684 0.1519  -0.0655 153 LYS A CB  
975  N N   . LYS A 133 ? 0.8814 0.8406 0.7699 -0.0618 0.1181  -0.0439 154 LYS A N   
976  C CA  . LYS A 133 ? 0.8613 0.8573 0.7783 -0.0494 0.1043  -0.0311 154 LYS A CA  
977  C C   . LYS A 133 ? 0.8482 0.8711 0.7958 -0.0393 0.1135  -0.0295 154 LYS A C   
978  O O   . LYS A 133 ? 0.8234 0.8584 0.7631 -0.0458 0.1316  -0.0422 154 LYS A O   
979  C CB  . LYS A 133 ? 0.8222 0.8538 0.7219 -0.0599 0.1000  -0.0343 154 LYS A CB  
980  C CG  . LYS A 133 ? 0.8104 0.8227 0.6832 -0.0691 0.0907  -0.0346 154 LYS A CG  
981  C CD  . LYS A 133 ? 0.7874 0.8377 0.6557 -0.0698 0.0805  -0.0330 154 LYS A CD  
982  C CE  . LYS A 133 ? 0.8267 0.8659 0.6639 -0.0830 0.0774  -0.0384 154 LYS A CE  
983  N NZ  . LYS A 133 ? 0.8656 0.9223 0.7048 -0.0741 0.0599  -0.0305 154 LYS A NZ  
984  N N   . GLU A 134 ? 0.8358 0.8684 0.8181 -0.0247 0.1018  -0.0149 155 GLU A N   
985  C CA  . GLU A 134 ? 0.8432 0.9055 0.8554 -0.0170 0.1112  -0.0105 155 GLU A CA  
986  C C   . GLU A 134 ? 0.7764 0.8582 0.8116 -0.0109 0.0971  0.0045  155 GLU A C   
987  O O   . GLU A 134 ? 0.7429 0.8096 0.7844 -0.0073 0.0781  0.0114  155 GLU A O   
988  C CB  . GLU A 134 ? 0.9286 0.9761 0.9698 -0.0052 0.1186  -0.0109 155 GLU A CB  
989  C CG  . GLU A 134 ? 1.0101 1.0472 1.0871 0.0088  0.1002  0.0012  155 GLU A CG  
990  C CD  . GLU A 134 ? 1.0836 1.1266 1.2009 0.0226  0.1089  0.0012  155 GLU A CD  
991  O OE1 . GLU A 134 ? 1.2183 1.2393 1.3275 0.0277  0.1201  -0.0084 155 GLU A OE1 
992  O OE2 . GLU A 134 ? 1.0052 1.0747 1.1630 0.0280  0.1057  0.0100  155 GLU A OE2 
993  N N   . VAL A 135 ? 0.8149 0.9273 0.8591 -0.0099 0.1069  0.0094  156 VAL A N   
994  C CA  . VAL A 135 ? 0.7785 0.9024 0.8453 -0.0048 0.0969  0.0243  156 VAL A CA  
995  C C   . VAL A 135 ? 0.7403 0.8671 0.8540 0.0023  0.1011  0.0316  156 VAL A C   
996  O O   . VAL A 135 ? 0.7596 0.9012 0.8843 0.0038  0.1204  0.0300  156 VAL A O   
997  C CB  . VAL A 135 ? 0.7410 0.8920 0.7891 -0.0060 0.1050  0.0288  156 VAL A CB  
998  C CG1 . VAL A 135 ? 0.7325 0.8834 0.7975 -0.0014 0.0934  0.0440  156 VAL A CG1 
999  C CG2 . VAL A 135 ? 0.7348 0.8939 0.7403 -0.0127 0.1031  0.0174  156 VAL A CG2 
1000 N N   . HIS A 136 ? 0.7147 0.8307 0.8566 0.0064  0.0829  0.0379  157 HIS A N   
1001 C CA  . HIS A 136 ? 0.7445 0.8679 0.9369 0.0124  0.0838  0.0420  157 HIS A CA  
1002 C C   . HIS A 136 ? 0.7236 0.8624 0.9442 0.0088  0.0835  0.0539  157 HIS A C   
1003 O O   . HIS A 136 ? 0.7178 0.8479 0.9324 0.0062  0.0674  0.0587  157 HIS A O   
1004 C CB  . HIS A 136 ? 0.7883 0.8922 0.9963 0.0201  0.0627  0.0388  157 HIS A CB  
1005 C CG  . HIS A 136 ? 0.8258 0.9446 1.0898 0.0280  0.0606  0.0401  157 HIS A CG  
1006 N ND1 . HIS A 136 ? 0.9007 1.0367 1.1900 0.0327  0.0810  0.0368  157 HIS A ND1 
1007 C CD2 . HIS A 136 ? 0.8392 0.9626 1.1405 0.0319  0.0403  0.0423  157 HIS A CD2 
1008 C CE1 . HIS A 136 ? 0.9144 1.0677 1.2568 0.0395  0.0740  0.0372  157 HIS A CE1 
1009 N NE2 . HIS A 136 ? 0.8594 1.0064 1.2106 0.0386  0.0486  0.0401  157 HIS A NE2 
1010 N N   . ALA A 137 ? 0.7261 0.8855 0.9762 0.0081  0.1031  0.0581  158 ALA A N   
1011 C CA  . ALA A 137 ? 0.6921 0.8623 0.9683 0.0019  0.1083  0.0704  158 ALA A CA  
1012 C C   . ALA A 137 ? 0.6998 0.8755 1.0323 0.0009  0.0952  0.0700  158 ALA A C   
1013 O O   . ALA A 137 ? 0.6679 0.8623 1.0405 0.0042  0.1036  0.0656  158 ALA A O   
1014 C CB  . ALA A 137 ? 0.6692 0.8596 0.9468 -0.0003 0.1382  0.0762  158 ALA A CB  
1015 N N   . CYS A 138 ? 0.6799 0.8423 1.0162 -0.0031 0.0743  0.0726  159 CYS A N   
1016 C CA  . CYS A 138 ? 0.7035 0.8742 1.0930 -0.0066 0.0596  0.0702  159 CYS A CA  
1017 C C   . CYS A 138 ? 0.6608 0.8424 1.0821 -0.0200 0.0762  0.0800  159 CYS A C   
1018 O O   . CYS A 138 ? 0.6493 0.8128 1.0474 -0.0266 0.0781  0.0892  159 CYS A O   
1019 C CB  . CYS A 138 ? 0.7540 0.9039 1.1305 -0.0052 0.0289  0.0658  159 CYS A CB  
1020 S SG  . CYS A 138 ? 0.8577 0.9860 1.1823 0.0071  0.0132  0.0581  159 CYS A SG  
1021 N N   . ARG A 139 ? 0.6498 0.8598 1.1238 -0.0236 0.0895  0.0780  160 ARG A N   
1022 C CA  . ARG A 139 ? 0.6390 0.8603 1.1439 -0.0391 0.1113  0.0878  160 ARG A CA  
1023 C C   . ARG A 139 ? 0.6336 0.8724 1.2041 -0.0508 0.0995  0.0809  160 ARG A C   
1024 O O   . ARG A 139 ? 0.6345 0.8999 1.2468 -0.0440 0.0873  0.0682  160 ARG A O   
1025 C CB  . ARG A 139 ? 0.6513 0.8971 1.1638 -0.0378 0.1441  0.0913  160 ARG A CB  
1026 C CG  . ARG A 139 ? 0.6870 0.9192 1.1355 -0.0302 0.1593  0.0981  160 ARG A CG  
1027 C CD  . ARG A 139 ? 0.7021 0.9580 1.1568 -0.0315 0.1941  0.1029  160 ARG A CD  
1028 N NE  . ARG A 139 ? 0.7245 0.9746 1.1208 -0.0219 0.2052  0.1032  160 ARG A NE  
1029 C CZ  . ARG A 139 ? 0.8036 1.0577 1.1852 -0.0104 0.2020  0.0891  160 ARG A CZ  
1030 N NH1 . ARG A 139 ? 0.8161 1.0770 1.2343 -0.0038 0.1880  0.0762  160 ARG A NH1 
1031 N NH2 . ARG A 139 ? 0.8667 1.1173 1.1962 -0.0051 0.2126  0.0873  160 ARG A NH2 
1032 N N   . LYS A 140 ? 0.8019 0.7749 1.2126 0.0544  0.1936  0.3272  161 LYS A N   
1033 C CA  . LYS A 140 ? 0.8120 0.8341 1.2835 0.0505  0.1739  0.3570  161 LYS A CA  
1034 C C   . LYS A 140 ? 0.9119 0.9186 1.3538 0.0398  0.1818  0.3433  161 LYS A C   
1035 O O   . LYS A 140 ? 0.9526 0.9113 1.3576 0.0405  0.2191  0.3218  161 LYS A O   
1036 C CB  . LYS A 140 ? 0.7516 0.8142 1.2164 0.0396  0.1193  0.3694  161 LYS A CB  
1037 N N   . SER A 141 ? 0.9416 0.9842 1.3934 0.0269  0.1471  0.3557  162 SER A N   
1038 C CA  . SER A 141 ? 0.9902 1.0181 1.4128 0.0140  0.1510  0.3454  162 SER A CA  
1039 C C   . SER A 141 ? 1.0283 0.9954 1.3487 0.0097  0.1553  0.3077  162 SER A C   
1040 O O   . SER A 141 ? 1.0292 0.9841 1.2985 0.0111  0.1326  0.2894  162 SER A O   
1041 C CB  . SER A 141 ? 0.9808 1.0508 1.4120 -0.0025 0.1054  0.3598  162 SER A CB  
1042 O OG  . SER A 141 ? 0.9543 1.0828 1.4770 -0.0015 0.0930  0.3971  162 SER A OG  
1043 N N   . TYR A 142 ? 1.0482 0.9774 1.3403 0.0034  0.1841  0.2968  163 TYR A N   
1044 C CA  . TYR A 142 ? 1.0439 0.9121 1.2358 -0.0027 0.1834  0.2652  163 TYR A CA  
1045 C C   . TYR A 142 ? 1.0342 0.9075 1.1760 -0.0109 0.1327  0.2556  163 TYR A C   
1046 O O   . TYR A 142 ? 1.0832 0.9454 1.1793 -0.0069 0.1082  0.2369  163 TYR A O   
1047 C CB  . TYR A 142 ? 1.1108 0.9341 1.2779 -0.0123 0.2237  0.2594  163 TYR A CB  
1048 N N   . ASP A 143 ? 1.1136 1.0034 1.2679 -0.0229 0.1196  0.2675  164 ASP A N   
1049 C CA  . ASP A 143 ? 1.1699 1.0645 1.2850 -0.0315 0.0750  0.2604  164 ASP A CA  
1050 C C   . ASP A 143 ? 1.1395 1.0958 1.3114 -0.0348 0.0464  0.2802  164 ASP A C   
1051 O O   . ASP A 143 ? 1.1189 1.1160 1.3610 -0.0398 0.0535  0.3069  164 ASP A O   
1052 C CB  . ASP A 143 ? 1.1864 1.0534 1.2693 -0.0468 0.0766  0.2599  164 ASP A CB  
1053 N N   . CYS A 144 ? 1.1171 1.0794 1.2587 -0.0336 0.0141  0.2674  165 CYS A N   
1054 C CA  . CYS A 144 ? 1.1410 1.1531 1.3216 -0.0397 -0.0121 0.2838  165 CYS A CA  
1055 C C   . CYS A 144 ? 1.0461 1.0869 1.2486 -0.0596 -0.0327 0.3022  165 CYS A C   
1056 O O   . CYS A 144 ? 1.0749 1.1626 1.3386 -0.0665 -0.0407 0.3305  165 CYS A O   
1057 C CB  . CYS A 144 ? 1.1842 1.1894 1.3191 -0.0377 -0.0369 0.2607  165 CYS A CB  
1058 S SG  . CYS A 144 ? 1.2687 1.2565 1.3924 -0.0194 -0.0181 0.2431  165 CYS A SG  
1059 N N   . GLY A 145 ? 1.0229 1.0340 1.1748 -0.0699 -0.0434 0.2872  166 GLY A N   
1060 C CA  . GLY A 145 ? 1.0582 1.0894 1.2214 -0.0926 -0.0621 0.3010  166 GLY A CA  
1061 C C   . GLY A 145 ? 1.0588 1.0420 1.1535 -0.1006 -0.0708 0.2794  166 GLY A C   
1062 O O   . GLY A 145 ? 1.0188 0.9537 1.0641 -0.0875 -0.0603 0.2585  166 GLY A O   
1063 N N   . GLU A 146 ? 1.0558 1.0492 1.1454 -0.1236 -0.0915 0.2855  167 GLU A N   
1064 C CA  . GLU A 146 ? 1.0924 1.0364 1.1170 -0.1320 -0.1008 0.2662  167 GLU A CA  
1065 C C   . GLU A 146 ? 1.0624 1.0122 1.0611 -0.1476 -0.1314 0.2572  167 GLU A C   
1066 O O   . GLU A 146 ? 1.0875 1.0798 1.1183 -0.1688 -0.1465 0.2752  167 GLU A O   
1067 C CB  . GLU A 146 ? 1.1438 1.0771 1.1764 -0.1495 -0.0863 0.2789  167 GLU A CB  
1068 C CG  . GLU A 146 ? 1.2534 1.1252 1.2137 -0.1579 -0.0932 0.2609  167 GLU A CG  
1069 C CD  . GLU A 146 ? 1.3839 1.2411 1.3486 -0.1779 -0.0747 0.2730  167 GLU A CD  
1070 O OE1 . GLU A 146 ? 1.4195 1.3209 1.4517 -0.1852 -0.0559 0.2947  167 GLU A OE1 
1071 O OE2 . GLU A 146 ? 1.5222 1.3226 1.4253 -0.1862 -0.0776 0.2610  167 GLU A OE2 
1072 N N   . ARG A 147 ? 1.0815 0.9874 1.0226 -0.1377 -0.1404 0.2293  168 ARG A N   
1073 C CA  . ARG A 147 ? 1.1199 1.0208 1.0309 -0.1515 -0.1624 0.2147  168 ARG A CA  
1074 C C   . ARG A 147 ? 1.1704 1.0302 1.0406 -0.1695 -0.1682 0.2087  168 ARG A C   
1075 O O   . ARG A 147 ? 1.2207 1.0337 1.0609 -0.1592 -0.1591 0.2018  168 ARG A O   
1076 C CB  . ARG A 147 ? 1.1475 1.0279 1.0308 -0.1290 -0.1662 0.1861  168 ARG A CB  
1077 C CG  . ARG A 147 ? 1.1261 1.0385 1.0424 -0.1115 -0.1579 0.1887  168 ARG A CG  
1078 C CD  . ARG A 147 ? 1.0994 1.0596 1.0446 -0.1284 -0.1669 0.2026  168 ARG A CD  
1079 N NE  . ARG A 147 ? 1.1055 1.0944 1.0874 -0.1134 -0.1559 0.2123  168 ARG A NE  
1080 C CZ  . ARG A 147 ? 1.0783 1.0916 1.1070 -0.1095 -0.1429 0.2387  168 ARG A CZ  
1081 N NH1 . ARG A 147 ? 1.1353 1.1531 1.1840 -0.1204 -0.1389 0.2579  168 ARG A NH1 
1082 N NH2 . ARG A 147 ? 1.0023 1.0342 1.0604 -0.0952 -0.1312 0.2452  168 ARG A NH2 
1083 N N   . ASN A 148 ? 1.1772 1.0498 1.0409 -0.1990 -0.1836 0.2119  169 ASN A N   
1084 C CA  . ASN A 148 ? 1.2543 1.0817 1.0726 -0.2186 -0.1889 0.2022  169 ASN A CA  
1085 C C   . ASN A 148 ? 1.2846 1.0784 1.0565 -0.2182 -0.1990 0.1728  169 ASN A C   
1086 O O   . ASN A 148 ? 1.3087 1.1247 1.0776 -0.2397 -0.2098 0.1703  169 ASN A O   
1087 C CB  . ASN A 148 ? 1.2342 1.0934 1.0743 -0.2578 -0.1970 0.2253  169 ASN A CB  
1088 C CG  . ASN A 148 ? 1.2252 1.0883 1.0942 -0.2617 -0.1808 0.2454  169 ASN A CG  
1089 O OD1 . ASN A 148 ? 1.3236 1.1397 1.1562 -0.2721 -0.1744 0.2396  169 ASN A OD1 
1090 N ND2 . ASN A 148 ? 1.1456 1.0616 1.0804 -0.2539 -0.1712 0.2686  169 ASN A ND2 
1091 N N   . VAL A 149 ? 1.2896 1.0279 1.0257 -0.1940 -0.1949 0.1508  170 VAL A N   
1092 C CA  . VAL A 149 ? 1.3251 1.0294 1.0275 -0.1879 -0.2001 0.1207  170 VAL A CA  
1093 C C   . VAL A 149 ? 1.3867 1.0331 1.0420 -0.2062 -0.2020 0.1111  170 VAL A C   
1094 O O   . VAL A 149 ? 1.4150 1.0181 1.0493 -0.1997 -0.1988 0.1158  170 VAL A O   
1095 C CB  . VAL A 149 ? 1.3239 1.0068 1.0261 -0.1465 -0.1979 0.1015  170 VAL A CB  
1096 C CG1 . VAL A 149 ? 1.3147 0.9678 0.9961 -0.1386 -0.2002 0.0696  170 VAL A CG1 
1097 C CG2 . VAL A 149 ? 1.2701 1.0055 1.0147 -0.1310 -0.1938 0.1093  170 VAL A CG2 
1098 N N   . GLU A 150 ? 1.3918 1.0326 1.0250 -0.2323 -0.2057 0.0976  171 GLU A N   
1099 C CA  . GLU A 150 ? 1.4979 1.0758 1.0817 -0.2496 -0.2046 0.0826  171 GLU A CA  
1100 C C   . GLU A 150 ? 1.5341 1.0774 1.0979 -0.2335 -0.1994 0.0476  171 GLU A C   
1101 O O   . GLU A 150 ? 1.5379 1.1133 1.1125 -0.2389 -0.1974 0.0361  171 GLU A O   
1102 C CB  . GLU A 150 ? 1.5074 1.1002 1.0765 -0.3012 -0.2106 0.0951  171 GLU A CB  
1103 N N   . VAL A 151 ? 1.5726 1.0484 1.1090 -0.2136 -0.1959 0.0312  172 VAL A N   
1104 C CA  . VAL A 151 ? 1.6559 1.0991 1.1883 -0.1896 -0.1890 -0.0020 172 VAL A CA  
1105 C C   . VAL A 151 ? 1.7160 1.0775 1.2024 -0.1959 -0.1831 -0.0184 172 VAL A C   
1106 O O   . VAL A 151 ? 1.7538 1.0718 1.2176 -0.1929 -0.1879 -0.0047 172 VAL A O   
1107 C CB  . VAL A 151 ? 1.6562 1.1082 1.2247 -0.1392 -0.1940 -0.0055 172 VAL A CB  
1108 C CG1 . VAL A 151 ? 1.7575 1.1407 1.3121 -0.1078 -0.1959 -0.0227 172 VAL A CG1 
1109 C CG2 . VAL A 151 ? 1.5967 1.1032 1.2035 -0.1290 -0.1889 -0.0200 172 VAL A CG2 
1110 N N   . PRO A 152 ? 1.7223 1.0574 1.1902 -0.2078 -0.1697 -0.0481 173 PRO A N   
1111 C CA  . PRO A 152 ? 1.8284 1.0782 1.2535 -0.2109 -0.1614 -0.0642 173 PRO A CA  
1112 C C   . PRO A 152 ? 1.8464 1.0514 1.2909 -0.1568 -0.1639 -0.0754 173 PRO A C   
1113 O O   . PRO A 152 ? 1.8507 1.0918 1.3422 -0.1220 -0.1666 -0.0838 173 PRO A O   
1114 C CB  . PRO A 152 ? 1.8798 1.1150 1.2797 -0.2414 -0.1421 -0.0947 173 PRO A CB  
1115 C CG  . PRO A 152 ? 1.8136 1.1163 1.2537 -0.2326 -0.1390 -0.1026 173 PRO A CG  
1116 C CD  . PRO A 152 ? 1.7247 1.0960 1.1998 -0.2252 -0.1587 -0.0676 173 PRO A CD  
1117 N N   . GLN A 153 ? 1.8644 0.9916 1.2735 -0.1511 -0.1652 -0.0737 174 GLN A N   
1118 C CA  . GLN A 153 ? 1.8696 0.9464 1.2943 -0.1003 -0.1726 -0.0808 174 GLN A CA  
1119 C C   . GLN A 153 ? 1.8679 0.9395 1.3280 -0.0758 -0.1572 -0.1173 174 GLN A C   
1120 O O   . GLN A 153 ? 2.0072 1.0756 1.4523 -0.1053 -0.1343 -0.1412 174 GLN A O   
1121 C CB  . GLN A 153 ? 1.9804 0.9640 1.3520 -0.1044 -0.1743 -0.0733 174 GLN A CB  
1122 N N   . MET A 154 ? 1.7786 0.8507 1.2861 -0.0241 -0.1696 -0.1213 175 MET A N   
1123 C CA  . MET A 154 ? 1.8351 0.9108 1.3955 0.0071  -0.1558 -0.1551 175 MET A CA  
1124 C C   . MET A 154 ? 1.7845 0.9433 1.3833 -0.0045 -0.1420 -0.1706 175 MET A C   
1125 O O   . MET A 154 ? 1.7569 0.9292 1.4046 0.0175  -0.1264 -0.2002 175 MET A O   
1126 C CB  . MET A 154 ? 1.9231 0.9206 1.4570 -0.0018 -0.1292 -0.1836 175 MET A CB  
1127 C CG  . MET A 154 ? 2.0383 0.9438 1.5366 0.0141  -0.1411 -0.1704 175 MET A CG  
1128 S SD  . MET A 154 ? 2.0868 0.9851 1.6364 0.0812  -0.1791 -0.1511 175 MET A SD  
1129 C CE  . MET A 154 ? 2.0769 0.9126 1.5476 0.0651  -0.2030 -0.1099 175 MET A CE  
1130 N N   . GLU A 155 ? 1.7994 1.0127 1.3791 -0.0388 -0.1468 -0.1503 176 GLU A N   
1131 C CA  . GLU A 155 ? 1.7042 0.9958 1.3187 -0.0467 -0.1394 -0.1576 176 GLU A CA  
1132 C C   . GLU A 155 ? 1.7331 1.0730 1.3968 -0.0095 -0.1620 -0.1413 176 GLU A C   
1133 O O   . GLU A 155 ? 1.7569 1.0686 1.4186 0.0164  -0.1839 -0.1229 176 GLU A O   
1134 C CB  . GLU A 155 ? 1.6276 0.9545 1.2032 -0.0993 -0.1366 -0.1410 176 GLU A CB  
1135 N N   . ASP A 156 ? 1.7366 1.1441 1.4384 -0.0092 -0.1564 -0.1482 177 ASP A N   
1136 C CA  . ASP A 156 ? 1.6399 1.0941 1.3828 0.0196  -0.1763 -0.1333 177 ASP A CA  
1137 C C   . ASP A 156 ? 1.5814 1.0762 1.3035 -0.0055 -0.1848 -0.1013 177 ASP A C   
1138 O O   . ASP A 156 ? 1.6385 1.1644 1.3464 -0.0405 -0.1726 -0.0987 177 ASP A O   
1139 C CB  . ASP A 156 ? 1.5894 1.0927 1.3927 0.0377  -0.1648 -0.1600 177 ASP A CB  
1140 C CG  . ASP A 156 ? 1.6040 1.0740 1.4354 0.0552  -0.1457 -0.1967 177 ASP A CG  
1141 O OD1 . ASP A 156 ? 1.6708 1.0753 1.4802 0.0637  -0.1474 -0.1989 177 ASP A OD1 
1142 O OD2 . ASP A 156 ? 1.4792 0.9865 1.3563 0.0604  -0.1265 -0.2239 177 ASP A OD2 
1143 N N   . MET A 157 ? 1.5096 1.0008 1.2291 0.0117  -0.2055 -0.0764 178 MET A N   
1144 C CA  . MET A 157 ? 1.4338 0.9610 1.1419 -0.0074 -0.2098 -0.0468 178 MET A CA  
1145 C C   . MET A 157 ? 1.3449 0.9341 1.0957 0.0052  -0.2103 -0.0476 178 MET A C   
1146 O O   . MET A 157 ? 1.3885 0.9813 1.1681 0.0371  -0.2213 -0.0563 178 MET A O   
1147 C CB  . MET A 157 ? 1.4467 0.9335 1.1238 0.0000  -0.2252 -0.0214 178 MET A CB  
1148 C CG  . MET A 157 ? 1.4089 0.9285 1.0779 -0.0209 -0.2231 0.0076  178 MET A CG  
1149 S SD  . MET A 157 ? 1.5025 0.9761 1.1365 -0.0099 -0.2356 0.0331  178 MET A SD  
1150 C CE  . MET A 157 ? 1.4891 0.9615 1.1469 0.0336  -0.2549 0.0213  178 MET A CE  
1151 N N   . ILE A 158 ? 1.2448 0.8813 0.9995 -0.0210 -0.2001 -0.0374 179 ILE A N   
1152 C CA  . ILE A 158 ? 1.1794 0.8710 0.9703 -0.0132 -0.1974 -0.0372 179 ILE A CA  
1153 C C   . ILE A 158 ? 1.1338 0.8542 0.9212 -0.0279 -0.1978 -0.0054 179 ILE A C   
1154 O O   . ILE A 158 ? 1.1438 0.8824 0.9215 -0.0576 -0.1919 0.0092  179 ILE A O   
1155 C CB  . ILE A 158 ? 1.1790 0.9027 0.9863 -0.0284 -0.1804 -0.0592 179 ILE A CB  
1156 C CG1 . ILE A 158 ? 1.2657 0.9640 1.0877 -0.0116 -0.1732 -0.0947 179 ILE A CG1 
1157 C CG2 . ILE A 158 ? 1.1115 0.8884 0.9518 -0.0236 -0.1764 -0.0568 179 ILE A CG2 
1158 C CD1 . ILE A 158 ? 1.2677 0.9961 1.1089 -0.0240 -0.1514 -0.1213 179 ILE A CD1 
1159 N N   . LEU A 159 ? 1.1081 0.8312 0.9045 -0.0077 -0.2050 0.0053  180 LEU A N   
1160 C CA  . LEU A 159 ? 1.0703 0.8183 0.8701 -0.0174 -0.1998 0.0324  180 LEU A CA  
1161 C C   . LEU A 159 ? 1.0557 0.8512 0.8893 -0.0119 -0.1923 0.0283  180 LEU A C   
1162 O O   . LEU A 159 ? 1.0461 0.8444 0.8948 0.0098  -0.1972 0.0119  180 LEU A O   
1163 C CB  . LEU A 159 ? 1.0577 0.7692 0.8346 -0.0046 -0.2068 0.0468  180 LEU A CB  
1164 C CG  . LEU A 159 ? 1.0960 0.7666 0.8370 -0.0196 -0.2071 0.0642  180 LEU A CG  
1165 C CD1 . LEU A 159 ? 1.1567 0.7976 0.8789 -0.0293 -0.2116 0.0514  180 LEU A CD1 
1166 C CD2 . LEU A 159 ? 1.1050 0.7281 0.8142 -0.0042 -0.2149 0.0717  180 LEU A CD2 
1167 N N   . ASP A 160 ? 1.0446 0.8767 0.8910 -0.0323 -0.1821 0.0443  181 ASP A N   
1168 C CA  . ASP A 160 ? 0.9890 0.8610 0.8636 -0.0298 -0.1732 0.0422  181 ASP A CA  
1169 C C   . ASP A 160 ? 0.9466 0.8331 0.8334 -0.0297 -0.1651 0.0690  181 ASP A C   
1170 O O   . ASP A 160 ? 0.9648 0.8606 0.8549 -0.0460 -0.1617 0.0943  181 ASP A O   
1171 C CB  . ASP A 160 ? 0.9898 0.8889 0.8687 -0.0531 -0.1674 0.0386  181 ASP A CB  
1172 C CG  . ASP A 160 ? 1.0136 0.9447 0.9158 -0.0497 -0.1574 0.0281  181 ASP A CG  
1173 O OD1 . ASP A 160 ? 1.0716 1.0108 0.9907 -0.0331 -0.1540 0.0309  181 ASP A OD1 
1174 O OD2 . ASP A 160 ? 0.9671 0.9113 0.8659 -0.0665 -0.1513 0.0160  181 ASP A OD2 
1175 N N   . CYS A 161 ? 0.8792 0.7677 0.7756 -0.0120 -0.1611 0.0625  182 CYS A N   
1176 C CA  . CYS A 161 ? 0.9212 0.8161 0.8273 -0.0105 -0.1477 0.0831  182 CYS A CA  
1177 C C   . CYS A 161 ? 0.8834 0.8137 0.8175 -0.0126 -0.1354 0.0836  182 CYS A C   
1178 O O   . CYS A 161 ? 0.9176 0.8508 0.8625 -0.0081 -0.1212 0.0949  182 CYS A O   
1179 C CB  . CYS A 161 ? 0.9854 0.8453 0.8691 0.0062  -0.1504 0.0769  182 CYS A CB  
1180 S SG  . CYS A 161 ? 0.9985 0.8450 0.8782 0.0036  -0.1280 0.1019  182 CYS A SG  
1181 N N   . GLU A 162 ? 0.8651 0.8169 0.8071 -0.0211 -0.1382 0.0705  183 GLU A N   
1182 C CA  . GLU A 162 ? 0.8199 0.7998 0.7818 -0.0255 -0.1266 0.0693  183 GLU A CA  
1183 C C   . GLU A 162 ? 0.8127 0.8149 0.7870 -0.0441 -0.1222 0.0987  183 GLU A C   
1184 O O   . GLU A 162 ? 0.8286 0.8338 0.7938 -0.0609 -0.1322 0.1086  183 GLU A O   
1185 C CB  . GLU A 162 ? 0.7830 0.7726 0.7456 -0.0269 -0.1284 0.0378  183 GLU A CB  
1186 N N   . LEU A 163 ? 0.8240 0.8397 0.8192 -0.0419 -0.1087 0.1133  184 LEU A N   
1187 C CA  . LEU A 163 ? 0.8248 0.8628 0.8388 -0.0565 -0.1073 0.1442  184 LEU A CA  
1188 C C   . LEU A 163 ? 0.8244 0.8751 0.8397 -0.0636 -0.0998 0.1374  184 LEU A C   
1189 O O   . LEU A 163 ? 0.7985 0.8437 0.8098 -0.0546 -0.0902 0.1110  184 LEU A O   
1190 C CB  . LEU A 163 ? 0.8183 0.8575 0.8622 -0.0472 -0.0951 0.1735  184 LEU A CB  
1191 C CG  . LEU A 163 ? 0.8032 0.8239 0.8431 -0.0405 -0.0950 0.1776  184 LEU A CG  
1192 C CD1 . LEU A 163 ? 0.7287 0.7532 0.8049 -0.0339 -0.0761 0.2058  184 LEU A CD1 
1193 C CD2 . LEU A 163 ? 0.8187 0.8419 0.8445 -0.0567 -0.1149 0.1819  184 LEU A CD2 
1194 N N   . ASN A 164 ? 0.8330 0.9001 0.8531 -0.0817 -0.1056 0.1625  185 ASN A N   
1195 C CA  A ASN A 164 ? 0.8311 0.9045 0.8428 -0.0939 -0.0994 0.1592  185 ASN A CA  
1196 C CA  B ASN A 164 ? 0.8322 0.9055 0.8439 -0.0938 -0.0994 0.1592  185 ASN A CA  
1197 C C   . ASN A 164 ? 0.8081 0.8768 0.8379 -0.0786 -0.0783 0.1560  185 ASN A C   
1198 O O   . ASN A 164 ? 0.8205 0.8886 0.8392 -0.0863 -0.0686 0.1409  185 ASN A O   
1199 C CB  A ASN A 164 ? 0.8377 0.9249 0.8501 -0.1157 -0.1139 0.1960  185 ASN A CB  
1200 C CB  B ASN A 164 ? 0.8402 0.9273 0.8524 -0.1157 -0.1137 0.1958  185 ASN A CB  
1201 C CG  A ASN A 164 ? 0.8421 0.9278 0.8307 -0.1347 -0.1100 0.1933  185 ASN A CG  
1202 C CG  B ASN A 164 ? 0.8268 0.9247 0.8560 -0.1194 -0.1314 0.2243  185 ASN A CG  
1203 O OD1 A ASN A 164 ? 0.8343 0.9115 0.8003 -0.1384 -0.0975 0.1576  185 ASN A OD1 
1204 O OD1 B ASN A 164 ? 0.8123 0.9051 0.8571 -0.1033 -0.1273 0.2211  185 ASN A OD1 
1205 N ND2 A ASN A 164 ? 0.8432 0.9370 0.8387 -0.1476 -0.1209 0.2320  185 ASN A ND2 
1206 N ND2 B ASN A 164 ? 0.8253 0.9371 0.8494 -0.1436 -0.1519 0.2531  185 ASN A ND2 
1207 N N   . TRP A 165 ? 0.8266 0.8885 0.8810 -0.0597 -0.0684 0.1683  186 TRP A N   
1208 C CA  . TRP A 165 ? 0.7970 0.8485 0.8654 -0.0478 -0.0456 0.1673  186 TRP A CA  
1209 C C   . TRP A 165 ? 0.8128 0.8467 0.8696 -0.0338 -0.0352 0.1344  186 TRP A C   
1210 O O   . TRP A 165 ? 0.7975 0.8187 0.8591 -0.0273 -0.0157 0.1295  186 TRP A O   
1211 C CB  . TRP A 165 ? 0.7627 0.8144 0.8685 -0.0382 -0.0353 0.2051  186 TRP A CB  
1212 C CG  . TRP A 165 ? 0.7344 0.7819 0.8522 -0.0282 -0.0359 0.2124  186 TRP A CG  
1213 C CD1 . TRP A 165 ? 0.7710 0.8344 0.9016 -0.0352 -0.0529 0.2335  186 TRP A CD1 
1214 C CD2 . TRP A 165 ? 0.7279 0.7506 0.8407 -0.0133 -0.0175 0.1982  186 TRP A CD2 
1215 N NE1 . TRP A 165 ? 0.7498 0.8002 0.8863 -0.0248 -0.0439 0.2328  186 TRP A NE1 
1216 C CE2 . TRP A 165 ? 0.7071 0.7303 0.8295 -0.0117 -0.0223 0.2117  186 TRP A CE2 
1217 C CE3 . TRP A 165 ? 0.7992 0.7970 0.8956 -0.0048 0.0019  0.1752  186 TRP A CE3 
1218 C CZ2 . TRP A 165 ? 0.7177 0.7132 0.8292 -0.0018 -0.0061 0.2031  186 TRP A CZ2 
1219 C CZ3 . TRP A 165 ? 0.7663 0.7370 0.8499 0.0042  0.0149  0.1671  186 TRP A CZ3 
1220 C CH2 . TRP A 165 ? 0.7282 0.6960 0.8173 0.0056  0.0118  0.1812  186 TRP A CH2 
1221 N N   . HIS A 166 ? 0.8044 0.8346 0.8441 -0.0304 -0.0494 0.1130  187 HIS A N   
1222 C CA  . HIS A 166 ? 0.8058 0.8198 0.8329 -0.0184 -0.0471 0.0843  187 HIS A CA  
1223 C C   . HIS A 166 ? 0.7961 0.8190 0.8216 -0.0231 -0.0422 0.0553  187 HIS A C   
1224 O O   . HIS A 166 ? 0.8330 0.8454 0.8555 -0.0173 -0.0340 0.0389  187 HIS A O   
1225 C CB  . HIS A 166 ? 0.7970 0.8026 0.8081 -0.0125 -0.0671 0.0714  187 HIS A CB  
1226 C CG  . HIS A 166 ? 0.7673 0.7563 0.7750 -0.0075 -0.0678 0.0939  187 HIS A CG  
1227 N ND1 . HIS A 166 ? 0.7516 0.7279 0.7422 -0.0053 -0.0846 0.0899  187 HIS A ND1 
1228 C CD2 . HIS A 166 ? 0.7736 0.7553 0.7955 -0.0052 -0.0507 0.1197  187 HIS A CD2 
1229 C CE1 . HIS A 166 ? 0.7477 0.7101 0.7387 -0.0040 -0.0779 0.1121  187 HIS A CE1 
1230 N NE2 . HIS A 166 ? 0.7660 0.7335 0.7792 -0.0034 -0.0565 0.1298  187 HIS A NE2 
1231 N N   . GLN A 167 ? 0.8312 0.8723 0.8564 -0.0369 -0.0461 0.0483  188 GLN A N   
1232 C CA  . GLN A 167 ? 0.8173 0.8699 0.8446 -0.0454 -0.0374 0.0202  188 GLN A CA  
1233 C C   . GLN A 167 ? 0.7815 0.8283 0.8131 -0.0508 -0.0159 0.0295  188 GLN A C   
1234 O O   . GLN A 167 ? 0.8285 0.8816 0.8620 -0.0588 -0.0049 0.0060  188 GLN A O   
1235 C CB  . GLN A 167 ? 0.8292 0.8959 0.8482 -0.0632 -0.0408 0.0124  188 GLN A CB  
1236 C CG  . GLN A 167 ? 0.8841 0.9498 0.8924 -0.0792 -0.0403 0.0474  188 GLN A CG  
1237 C CD  . GLN A 167 ? 0.9047 0.9765 0.8939 -0.1043 -0.0342 0.0373  188 GLN A CD  
1238 O OE1 . GLN A 167 ? 0.9279 1.0048 0.9084 -0.1119 -0.0353 0.0088  188 GLN A OE1 
1239 N NE2 . GLN A 167 ? 1.0044 1.0713 0.9854 -0.1181 -0.0257 0.0607  188 GLN A NE2 
1240 N N   . ALA A 168 ? 0.7744 0.8086 0.8112 -0.0467 -0.0084 0.0636  189 ALA A N   
1241 C CA  . ALA A 168 ? 0.8033 0.8253 0.8460 -0.0499 0.0137  0.0770  189 ALA A CA  
1242 C C   . ALA A 168 ? 0.8197 0.8176 0.8681 -0.0352 0.0292  0.0830  189 ALA A C   
1243 O O   . ALA A 168 ? 0.7644 0.7446 0.8167 -0.0360 0.0519  0.0894  189 ALA A O   
1244 C CB  . ALA A 168 ? 0.8065 0.8319 0.8560 -0.0587 0.0124  0.1145  189 ALA A CB  
1245 N N   . SER A 169 ? 0.8232 0.8144 0.8672 -0.0237 0.0195  0.0803  190 SER A N   
1246 C CA  . SER A 169 ? 0.8206 0.7824 0.8590 -0.0137 0.0364  0.0817  190 SER A CA  
1247 C C   . SER A 169 ? 0.7699 0.7201 0.7868 -0.0172 0.0388  0.0469  190 SER A C   
1248 O O   . SER A 169 ? 0.6993 0.6705 0.7156 -0.0243 0.0259  0.0224  190 SER A O   
1249 C CB  . SER A 169 ? 0.8349 0.7886 0.8686 -0.0043 0.0261  0.0918  190 SER A CB  
1250 O OG  . SER A 169 ? 0.8569 0.7769 0.8811 0.0019  0.0484  0.0954  190 SER A OG  
1251 N N   . GLU A 170 ? 0.7814 0.6984 0.7816 -0.0140 0.0563  0.0439  191 GLU A N   
1252 C CA  . GLU A 170 ? 0.7774 0.6807 0.7532 -0.0214 0.0569  0.0129  191 GLU A CA  
1253 C C   . GLU A 170 ? 0.7823 0.6505 0.7231 -0.0183 0.0553  0.0068  191 GLU A C   
1254 O O   . GLU A 170 ? 0.8150 0.6632 0.7514 -0.0109 0.0651  0.0271  191 GLU A O   
1255 C CB  . GLU A 170 ? 0.8243 0.7119 0.8021 -0.0312 0.0873  0.0109  191 GLU A CB  
1256 C CG  . GLU A 170 ? 0.8922 0.8088 0.8913 -0.0403 0.0869  0.0096  191 GLU A CG  
1257 C CD  . GLU A 170 ? 0.9649 0.8586 0.9697 -0.0458 0.1196  0.0243  191 GLU A CD  
1258 O OE1 . GLU A 170 ? 0.9578 0.8137 0.9475 -0.0463 0.1444  0.0216  191 GLU A OE1 
1259 O OE2 . GLU A 170 ? 0.9768 0.8854 0.9973 -0.0508 0.1212  0.0390  191 GLU A OE2 
1260 N N   . GLY A 171 ? 0.8373 0.6977 0.7524 -0.0263 0.0425  -0.0212 192 GLY A N   
1261 C CA  . GLY A 171 ? 0.8678 0.6906 0.7376 -0.0279 0.0349  -0.0284 192 GLY A CA  
1262 C C   . GLY A 171 ? 0.8345 0.6595 0.6978 -0.0161 0.0087  -0.0183 192 GLY A C   
1263 O O   . GLY A 171 ? 0.8508 0.6378 0.6812 -0.0151 0.0163  -0.0077 192 GLY A O   
1264 N N   . LEU A 172 ? 0.7763 0.6418 0.6690 -0.0090 -0.0188 -0.0227 193 LEU A N   
1265 C CA  . LEU A 172 ? 0.7633 0.6298 0.6520 0.0018  -0.0430 -0.0137 193 LEU A CA  
1266 C C   . LEU A 172 ? 0.7900 0.6468 0.6533 0.0048  -0.0792 -0.0321 193 LEU A C   
1267 O O   . LEU A 172 ? 0.7867 0.6676 0.6657 0.0028  -0.0973 -0.0546 193 LEU A O   
1268 C CB  . LEU A 172 ? 0.7193 0.6274 0.6489 0.0067  -0.0514 -0.0086 193 LEU A CB  
1269 C CG  . LEU A 172 ? 0.7291 0.6465 0.6818 0.0048  -0.0272 0.0180  193 LEU A CG  
1270 C CD1 . LEU A 172 ? 0.6937 0.6462 0.6721 0.0043  -0.0413 0.0203  193 LEU A CD1 
1271 C CD2 . LEU A 172 ? 0.7793 0.6677 0.7184 0.0086  -0.0143 0.0424  193 LEU A CD2 
1272 N N   . THR A 173 ? 0.8286 0.6499 0.6548 0.0090  -0.0902 -0.0212 194 THR A N   
1273 C CA  . THR A 173 ? 0.8605 0.6686 0.6620 0.0143  -0.1302 -0.0323 194 THR A CA  
1274 C C   . THR A 173 ? 0.8402 0.6690 0.6687 0.0287  -0.1516 -0.0278 194 THR A C   
1275 O O   . THR A 173 ? 0.8911 0.7512 0.7576 0.0306  -0.1378 -0.0224 194 THR A O   
1276 C CB  . THR A 173 ? 0.9469 0.6929 0.6787 0.0069  -0.1306 -0.0235 194 THR A CB  
1277 O OG1 . THR A 173 ? 0.9669 0.6866 0.6756 -0.0075 -0.0912 -0.0209 194 THR A OG1 
1278 C CG2 . THR A 173 ? 1.0450 0.7749 0.7444 0.0056  -0.1733 -0.0382 194 THR A CG2 
1279 N N   . ASP A 174 ? 0.8294 0.6360 0.6339 0.0372  -0.1854 -0.0294 195 ASP A N   
1280 C CA  . ASP A 174 ? 0.8134 0.6339 0.6426 0.0515  -0.2063 -0.0290 195 ASP A CA  
1281 C C   . ASP A 174 ? 0.8084 0.6100 0.6241 0.0504  -0.1900 -0.0067 195 ASP A C   
1282 O O   . ASP A 174 ? 0.8253 0.5978 0.6097 0.0408  -0.1665 0.0101  195 ASP A O   
1283 C CB  . ASP A 174 ? 0.8578 0.6556 0.6674 0.0628  -0.2497 -0.0356 195 ASP A CB  
1284 C CG  . ASP A 174 ? 0.8810 0.6863 0.6889 0.0587  -0.2698 -0.0522 195 ASP A CG  
1285 O OD1 . ASP A 174 ? 0.8517 0.7060 0.7163 0.0641  -0.2795 -0.0723 195 ASP A OD1 
1286 O OD2 . ASP A 174 ? 0.9331 0.6945 0.6814 0.0472  -0.2744 -0.0459 195 ASP A OD2 
1287 N N   . TYR A 175 ? 0.6782 0.7717 0.5739 -0.0290 -0.1326 0.1587  196 TYR A N   
1288 C CA  . TYR A 175 ? 0.7330 0.8427 0.6464 -0.0431 -0.1215 0.1686  196 TYR A CA  
1289 C C   . TYR A 175 ? 0.7889 0.9056 0.7161 -0.0432 -0.1139 0.1922  196 TYR A C   
1290 O O   . TYR A 175 ? 0.7371 0.8311 0.6771 -0.0431 -0.1136 0.1988  196 TYR A O   
1291 C CB  . TYR A 175 ? 0.7348 0.8187 0.6658 -0.0660 -0.1150 0.1578  196 TYR A CB  
1292 C CG  . TYR A 175 ? 0.6865 0.7624 0.6019 -0.0708 -0.1224 0.1364  196 TYR A CG  
1293 C CD1 . TYR A 175 ? 0.6794 0.7272 0.5822 -0.0679 -0.1292 0.1193  196 TYR A CD1 
1294 C CD2 . TYR A 175 ? 0.6883 0.7849 0.6021 -0.0794 -0.1233 0.1342  196 TYR A CD2 
1295 C CE1 . TYR A 175 ? 0.7035 0.7400 0.5879 -0.0738 -0.1367 0.1007  196 TYR A CE1 
1296 C CE2 . TYR A 175 ? 0.6836 0.7708 0.5817 -0.0842 -0.1325 0.1164  196 TYR A CE2 
1297 C CZ  . TYR A 175 ? 0.6898 0.7448 0.5710 -0.0815 -0.1391 0.0996  196 TYR A CZ  
1298 O OH  . TYR A 175 ? 0.6684 0.7103 0.5299 -0.0876 -0.1490 0.0827  196 TYR A OH  
1299 N N   . SER A 176 ? 0.7649 0.9137 0.6904 -0.0433 -0.1079 0.2054  197 SER A N   
1300 C CA  . SER A 176 ? 0.7754 0.9312 0.7110 -0.0472 -0.0997 0.2290  197 SER A CA  
1301 C C   . SER A 176 ? 0.7930 0.9589 0.7485 -0.0687 -0.0875 0.2362  197 SER A C   
1302 O O   . SER A 176 ? 0.7884 0.9831 0.7425 -0.0725 -0.0856 0.2316  197 SER A O   
1303 C CB  . SER A 176 ? 0.8176 1.0021 0.7290 -0.0300 -0.1017 0.2407  197 SER A CB  
1304 O OG  . SER A 176 ? 0.8849 1.0596 0.7729 -0.0118 -0.1142 0.2325  197 SER A OG  
1305 N N   . PHE A 177 ? 0.7930 0.9346 0.7678 -0.0828 -0.0798 0.2478  198 PHE A N   
1306 C CA  . PHE A 177 ? 0.8501 0.9955 0.8412 -0.1058 -0.0680 0.2568  198 PHE A CA  
1307 C C   . PHE A 177 ? 0.8678 1.0243 0.8594 -0.1075 -0.0609 0.2829  198 PHE A C   
1308 O O   . PHE A 177 ? 0.8742 1.0026 0.8720 -0.1063 -0.0602 0.2956  198 PHE A O   
1309 C CB  . PHE A 177 ? 0.8640 0.9660 0.8732 -0.1241 -0.0625 0.2486  198 PHE A CB  
1310 C CG  . PHE A 177 ? 0.8748 0.9660 0.8806 -0.1302 -0.0670 0.2237  198 PHE A CG  
1311 C CD1 . PHE A 177 ? 0.8436 0.9155 0.8420 -0.1169 -0.0752 0.2077  198 PHE A CD1 
1312 C CD2 . PHE A 177 ? 0.8987 0.9990 0.9073 -0.1509 -0.0640 0.2172  198 PHE A CD2 
1313 C CE1 . PHE A 177 ? 0.8461 0.9050 0.8372 -0.1243 -0.0793 0.1854  198 PHE A CE1 
1314 C CE2 . PHE A 177 ? 0.8693 0.9568 0.8706 -0.1580 -0.0699 0.1956  198 PHE A CE2 
1315 C CZ  . PHE A 177 ? 0.8373 0.9029 0.8285 -0.1447 -0.0770 0.1795  198 PHE A CZ  
1316 N N   . TYR A 178 ? 0.8699 1.0679 0.8553 -0.1097 -0.0558 0.2909  199 TYR A N   
1317 C CA  . TYR A 178 ? 0.8765 1.0902 0.8597 -0.1160 -0.0466 0.3152  199 TYR A CA  
1318 C C   . TYR A 178 ? 0.9118 1.1227 0.9141 -0.1448 -0.0351 0.3237  199 TYR A C   
1319 O O   . TYR A 178 ? 0.9018 1.1118 0.9165 -0.1597 -0.0344 0.3102  199 TYR A O   
1320 C CB  . TYR A 178 ? 0.9152 1.1783 0.8811 -0.1034 -0.0443 0.3190  199 TYR A CB  
1321 C CG  . TYR A 178 ? 0.9407 1.2074 0.8805 -0.0763 -0.0542 0.3125  199 TYR A CG  
1322 C CD1 . TYR A 178 ? 0.9155 1.1869 0.8483 -0.0621 -0.0634 0.2901  199 TYR A CD1 
1323 C CD2 . TYR A 178 ? 0.9882 1.2519 0.9065 -0.0664 -0.0549 0.3293  199 TYR A CD2 
1324 C CE1 . TYR A 178 ? 0.9727 1.2441 0.8782 -0.0389 -0.0724 0.2839  199 TYR A CE1 
1325 C CE2 . TYR A 178 ? 1.0392 1.3038 0.9294 -0.0440 -0.0645 0.3232  199 TYR A CE2 
1326 C CZ  . TYR A 178 ? 1.0519 1.3201 0.9359 -0.0304 -0.0728 0.3002  199 TYR A CZ  
1327 O OH  . TYR A 178 ? 1.1078 1.3734 0.9606 -0.0098 -0.0823 0.2938  199 TYR A OH  
1328 N N   . ARG A 179 ? 0.9493 1.1580 0.9502 -0.1539 -0.0269 0.3470  200 ARG A N   
1329 C CA  . ARG A 179 ? 0.9501 1.1542 0.9647 -0.1828 -0.0154 0.3587  200 ARG A CA  
1330 C C   . ARG A 179 ? 0.9705 1.2215 0.9788 -0.1898 -0.0057 0.3755  200 ARG A C   
1331 O O   . ARG A 179 ? 1.0282 1.2849 1.0191 -0.1796 -0.0041 0.3917  200 ARG A O   
1332 C CB  . ARG A 179 ? 0.9067 1.0581 0.9258 -0.1903 -0.0129 0.3728  200 ARG A CB  
1333 C CG  . ARG A 179 ? 0.9453 1.0842 0.9732 -0.2205 -0.0007 0.3872  200 ARG A CG  
1334 C CD  . ARG A 179 ? 0.9857 1.0901 1.0289 -0.2396 0.0020  0.3716  200 ARG A CD  
1335 N NE  . ARG A 179 ? 0.9580 1.0479 1.0062 -0.2709 0.0133  0.3844  200 ARG A NE  
1336 C CZ  . ARG A 179 ? 1.0375 1.0744 1.0932 -0.2885 0.0189  0.3810  200 ARG A CZ  
1337 N NH1 . ARG A 179 ? 1.1684 1.1917 1.2245 -0.3185 0.0290  0.3932  200 ARG A NH1 
1338 N NH2 . ARG A 179 ? 1.0730 1.0692 1.1347 -0.2768 0.0156  0.3650  200 ARG A NH2 
1339 N N   . VAL A 180 ? 0.9583 1.2433 0.9805 -0.2085 0.0007  0.3724  201 VAL A N   
1340 C CA  . VAL A 180 ? 1.0172 1.3536 1.0379 -0.2151 0.0118  0.3871  201 VAL A CA  
1341 C C   . VAL A 180 ? 1.0387 1.3656 1.0676 -0.2479 0.0236  0.4065  201 VAL A C   
1342 O O   . VAL A 180 ? 1.0106 1.2998 1.0503 -0.2681 0.0229  0.4035  201 VAL A O   
1343 C CB  . VAL A 180 ? 1.0040 1.3962 1.0384 -0.2117 0.0111  0.3727  201 VAL A CB  
1344 C CG1 . VAL A 180 ? 1.0400 1.4886 1.0694 -0.2044 0.0226  0.3842  201 VAL A CG1 
1345 C CG2 . VAL A 180 ? 0.9412 1.3259 0.9696 -0.1860 -0.0030 0.3497  201 VAL A CG2 
1346 N N   . TRP A 181 ? 1.2282 1.5865 1.2490 -0.2541 0.0352  0.4258  202 TRP A N   
1347 C CA  . TRP A 181 ? 1.3048 1.6505 1.3275 -0.2852 0.0465  0.4471  202 TRP A CA  
1348 C C   . TRP A 181 ? 1.3614 1.7711 1.3924 -0.3011 0.0607  0.4573  202 TRP A C   
1349 O O   . TRP A 181 ? 1.3890 1.8532 1.4283 -0.2866 0.0618  0.4469  202 TRP A O   
1350 C CB  . TRP A 181 ? 1.2196 1.5209 1.2182 -0.2795 0.0467  0.4670  202 TRP A CB  
1351 C CG  . TRP A 181 ? 1.1195 1.3590 1.1174 -0.2665 0.0342  0.4597  202 TRP A CG  
1352 C CD1 . TRP A 181 ? 1.1280 1.3253 1.1422 -0.2792 0.0315  0.4492  202 TRP A CD1 
1353 C CD2 . TRP A 181 ? 1.0070 1.2217 0.9881 -0.2388 0.0236  0.4620  202 TRP A CD2 
1354 N NE1 . TRP A 181 ? 1.0768 1.2269 1.0888 -0.2600 0.0218  0.4447  202 TRP A NE1 
1355 C CE2 . TRP A 181 ? 1.0046 1.1660 0.9981 -0.2353 0.0155  0.4530  202 TRP A CE2 
1356 C CE3 . TRP A 181 ? 0.9798 1.2119 0.9357 -0.2180 0.0204  0.4707  202 TRP A CE3 
1357 C CZ2 . TRP A 181 ? 1.0128 1.1429 0.9999 -0.2113 0.0034  0.4534  202 TRP A CZ2 
1358 C CZ3 . TRP A 181 ? 0.9987 1.1965 0.9437 -0.1957 0.0065  0.4714  202 TRP A CZ3 
1359 C CH2 . TRP A 181 ? 1.0197 1.1695 0.9830 -0.1923 -0.0023 0.4632  202 TRP A CH2 
1360 N N   . GLY A 182 ? 1.3411 1.7439 1.3714 -0.3311 0.0719  0.4776  203 GLY A N   
1361 C CA  . GLY A 182 ? 1.3785 1.8406 1.4143 -0.3470 0.0877  0.4908  203 GLY A CA  
1362 C C   . GLY A 182 ? 1.4139 1.8938 1.4223 -0.3265 0.0953  0.5021  203 GLY A C   
1363 O O   . GLY A 182 ? 1.4353 1.9757 1.4484 -0.3180 0.1052  0.4997  203 GLY A O   
1364 N N   . ASN A 183 ? 1.4310 1.8557 1.4109 -0.3213 0.0911  0.5157  204 ASN A N   
1365 C CA  . ASN A 183 ? 1.4192 1.8363 1.3650 -0.2955 0.0892  0.5226  204 ASN A CA  
1366 C C   . ASN A 183 ? 1.4641 1.9045 1.4132 -0.2622 0.0798  0.4981  204 ASN A C   
1367 O O   . ASN A 183 ? 1.4617 1.8729 1.4224 -0.2510 0.0649  0.4815  204 ASN A O   
1368 C CB  . ASN A 183 ? 1.4169 1.7611 1.3437 -0.2917 0.0768  0.5343  204 ASN A CB  
1369 C CG  . ASN A 183 ? 1.3853 1.7141 1.2832 -0.2595 0.0653  0.5334  204 ASN A CG  
1370 O OD1 . ASN A 183 ? 1.3405 1.7056 1.2179 -0.2459 0.0711  0.5329  204 ASN A OD1 
1371 N ND2 . ASN A 183 ? 1.3405 1.6178 1.2406 -0.2461 0.0485  0.5289  204 ASN A ND2 
1372 N N   . ASN A 184 ? 1.4279 1.9171 1.3650 -0.2463 0.0890  0.4951  205 ASN A N   
1373 C CA  . ASN A 184 ? 1.4760 1.9900 1.4160 -0.2154 0.0816  0.4711  205 ASN A CA  
1374 C C   . ASN A 184 ? 1.4558 1.9251 1.3748 -0.1879 0.0626  0.4602  205 ASN A C   
1375 O O   . ASN A 184 ? 1.4288 1.9140 1.3500 -0.1646 0.0555  0.4394  205 ASN A O   
1376 C CB  . ASN A 184 ? 0.9969 1.5665 0.9232 -0.2035 0.0985  0.4718  205 ASN A CB  
1377 N N   . THR A 185 ? 1.3939 1.8091 1.2934 -0.1895 0.0535  0.4740  206 THR A N   
1378 C CA  . THR A 185 ? 1.3208 1.7024 1.2054 -0.1636 0.0353  0.4628  206 THR A CA  
1379 C C   . THR A 185 ? 1.2374 1.5943 1.1523 -0.1643 0.0234  0.4451  206 THR A C   
1380 O O   . THR A 185 ? 1.1488 1.5086 1.0908 -0.1857 0.0286  0.4436  206 THR A O   
1381 C CB  . THR A 185 ? 1.3795 1.7139 1.2345 -0.1604 0.0260  0.4829  206 THR A CB  
1382 O OG1 . THR A 185 ? 1.3460 1.6603 1.1884 -0.1345 0.0086  0.4699  206 THR A OG1 
1383 C CG2 . THR A 185 ? 1.3416 1.6286 1.2149 -0.1781 0.0209  0.4948  206 THR A CG2 
1384 N N   . GLU A 186 ? 1.2047 1.5363 1.1126 -0.1423 0.0077  0.4315  207 GLU A N   
1385 C CA  . GLU A 186 ? 1.1132 1.4169 1.0453 -0.1422 -0.0029 0.4141  207 GLU A CA  
1386 C C   . GLU A 186 ? 1.0274 1.2866 0.9490 -0.1255 -0.0186 0.4136  207 GLU A C   
1387 O O   . GLU A 186 ? 1.0104 1.2731 0.9051 -0.1065 -0.0255 0.4154  207 GLU A O   
1388 C CB  . GLU A 186 ? 1.1282 1.4653 1.0715 -0.1323 -0.0049 0.3892  207 GLU A CB  
1389 C CG  . GLU A 186 ? 1.1930 1.5472 1.1107 -0.1040 -0.0109 0.3787  207 GLU A CG  
1390 C CD  . GLU A 186 ? 1.2326 1.6196 1.1608 -0.0937 -0.0124 0.3562  207 GLU A CD  
1391 O OE1 . GLU A 186 ? 1.3361 1.7239 1.2912 -0.1075 -0.0137 0.3466  207 GLU A OE1 
1392 O OE2 . GLU A 186 ? 1.3149 1.7239 1.2224 -0.0721 -0.0128 0.3482  207 GLU A OE2 
1393 N N   . THR A 187 ? 1.0248 1.2421 0.9674 -0.1333 -0.0236 0.4116  208 THR A N   
1394 C CA  . THR A 187 ? 1.0226 1.2011 0.9637 -0.1175 -0.0381 0.4106  208 THR A CA  
1395 C C   . THR A 187 ? 0.9669 1.1338 0.9248 -0.1097 -0.0455 0.3839  208 THR A C   
1396 O O   . THR A 187 ? 0.9492 1.1070 0.9286 -0.1247 -0.0398 0.3727  208 THR A O   
1397 C CB  . THR A 187 ? 1.0539 1.1879 1.0066 -0.1284 -0.0382 0.4307  208 THR A CB  
1398 O OG1 . THR A 187 ? 1.1111 1.2522 1.0434 -0.1368 -0.0325 0.4571  208 THR A OG1 
1399 C CG2 . THR A 187 ? 1.0567 1.1565 1.0143 -0.1101 -0.0539 0.4302  208 THR A CG2 
1400 N N   . LEU A 188 ? 0.9144 1.0807 0.8587 -0.0879 -0.0584 0.3739  209 LEU A N   
1401 C CA  . LEU A 188 ? 0.9133 1.0630 0.8698 -0.0798 -0.0668 0.3503  209 LEU A CA  
1402 C C   . LEU A 188 ? 0.8602 0.9659 0.8450 -0.0891 -0.0658 0.3519  209 LEU A C   
1403 O O   . LEU A 188 ? 0.8947 0.9763 0.8840 -0.0854 -0.0700 0.3696  209 LEU A O   
1404 C CB  . LEU A 188 ? 0.9783 1.1304 0.9127 -0.0566 -0.0815 0.3443  209 LEU A CB  
1405 C CG  . LEU A 188 ? 1.0481 1.1950 0.9834 -0.0458 -0.0907 0.3179  209 LEU A CG  
1406 C CD1 . LEU A 188 ? 1.1317 1.2400 1.0919 -0.0467 -0.0961 0.3134  209 LEU A CD1 
1407 C CD2 . LEU A 188 ? 1.0392 1.2052 0.9800 -0.0542 -0.0834 0.2994  209 LEU A CD2 
1408 N N   . VAL A 189 ? 0.9057 0.9995 0.9087 -0.1011 -0.0601 0.3337  210 VAL A N   
1409 C CA  . VAL A 189 ? 0.8495 0.8991 0.8782 -0.1110 -0.0553 0.3319  210 VAL A CA  
1410 C C   . VAL A 189 ? 0.8252 0.8547 0.8633 -0.0984 -0.0632 0.3121  210 VAL A C   
1411 O O   . VAL A 189 ? 0.8154 0.8115 0.8739 -0.0949 -0.0634 0.3152  210 VAL A O   
1412 C CB  . VAL A 189 ? 0.8469 0.8889 0.8868 -0.1369 -0.0420 0.3247  210 VAL A CB  
1413 C CG1 . VAL A 189 ? 0.8829 0.8739 0.9457 -0.1467 -0.0348 0.3200  210 VAL A CG1 
1414 C CG2 . VAL A 189 ? 0.8880 0.9503 0.9215 -0.1521 -0.0335 0.3453  210 VAL A CG2 
1415 N N   . SER A 190 ? 1.1789 0.8038 0.7994 -0.1117 -0.1463 0.2091  211 SER A N   
1416 C CA  . SER A 190 ? 1.1051 0.7499 0.7656 -0.0807 -0.1564 0.1990  211 SER A CA  
1417 C C   . SER A 190 ? 1.0474 0.7447 0.7334 -0.0752 -0.1476 0.1868  211 SER A C   
1418 O O   . SER A 190 ? 1.0405 0.7679 0.7290 -0.0930 -0.1285 0.1808  211 SER A O   
1419 C CB  . SER A 190 ? 1.0783 0.7315 0.7756 -0.0712 -0.1533 0.1890  211 SER A CB  
1420 O OG  . SER A 190 ? 1.0896 0.7791 0.8316 -0.0462 -0.1565 0.1782  211 SER A OG  
1421 N N   . LYS A 191 ? 1.0326 0.7406 0.7408 -0.0507 -0.1610 0.1829  212 LYS A N   
1422 C CA  . LYS A 191 ? 1.0121 0.7674 0.7514 -0.0442 -0.1534 0.1694  212 LYS A CA  
1423 C C   . LYS A 191 ? 1.0058 0.7759 0.7860 -0.0154 -0.1680 0.1650  212 LYS A C   
1424 O O   . LYS A 191 ? 1.0793 0.8265 0.8464 -0.0022 -0.1880 0.1728  212 LYS A O   
1425 C CB  . LYS A 191 ? 1.0437 0.7963 0.7436 -0.0575 -0.1522 0.1698  212 LYS A CB  
1426 C CG  . LYS A 191 ? 1.0356 0.8344 0.7677 -0.0540 -0.1401 0.1516  212 LYS A CG  
1427 C CD  . LYS A 191 ? 1.0681 0.8648 0.7552 -0.0723 -0.1330 0.1473  212 LYS A CD  
1428 C CE  . LYS A 191 ? 1.0528 0.8947 0.7759 -0.0736 -0.1116 0.1252  212 LYS A CE  
1429 N NZ  . LYS A 191 ? 1.1500 0.9921 0.8451 -0.0766 -0.1158 0.1143  212 LYS A NZ  
1430 N N   . GLY A 192 ? 0.9864 0.7973 0.8183 -0.0066 -0.1585 0.1548  213 GLY A N   
1431 C CA  . GLY A 192 ? 0.9335 0.7634 0.8082 0.0189  -0.1700 0.1517  213 GLY A CA  
1432 C C   . GLY A 192 ? 0.8244 0.7039 0.7535 0.0221  -0.1568 0.1431  213 GLY A C   
1433 O O   . GLY A 192 ? 0.7563 0.6564 0.6921 0.0055  -0.1398 0.1395  213 GLY A O   
1434 N N   . LYS A 193 ? 0.8147 0.7155 0.7854 0.0429  -0.1647 0.1421  214 LYS A N   
1435 C CA  . LYS A 193 ? 0.7705 0.7198 0.7944 0.0456  -0.1545 0.1380  214 LYS A CA  
1436 C C   . LYS A 193 ? 0.7780 0.7295 0.8070 0.0441  -0.1508 0.1408  214 LYS A C   
1437 O O   . LYS A 193 ? 0.7952 0.7837 0.8658 0.0509  -0.1483 0.1410  214 LYS A O   
1438 C CB  . LYS A 193 ? 0.7136 0.6900 0.7818 0.0655  -0.1639 0.1365  214 LYS A CB  
1439 C CG  . LYS A 193 ? 0.7109 0.6796 0.7675 0.0654  -0.1702 0.1314  214 LYS A CG  
1440 C CD  . LYS A 193 ? 0.6358 0.6432 0.7468 0.0750  -0.1705 0.1256  214 LYS A CD  
1441 C CE  . LYS A 193 ? 0.6521 0.6503 0.7454 0.0695  -0.1735 0.1157  214 LYS A CE  
1442 N NZ  . LYS A 193 ? 0.7427 0.7312 0.8010 0.0484  -0.1563 0.1083  214 LYS A NZ  
1443 N N   . GLU A 194 ? 0.7927 0.7035 0.7773 0.0334  -0.1508 0.1429  215 GLU A N   
1444 C CA  . GLU A 194 ? 0.7807 0.6882 0.7608 0.0253  -0.1453 0.1420  215 GLU A CA  
1445 C C   . GLU A 194 ? 0.7784 0.7008 0.7529 -0.0012 -0.1315 0.1425  215 GLU A C   
1446 O O   . GLU A 194 ? 0.8212 0.7222 0.7647 -0.0163 -0.1273 0.1446  215 GLU A O   
1447 C CB  . GLU A 194 ? 0.8165 0.6676 0.7566 0.0288  -0.1532 0.1430  215 GLU A CB  
1448 N N   . ALA A 195 ? 0.7461 0.7082 0.7517 -0.0080 -0.1249 0.1423  216 ALA A N   
1449 C CA  . ALA A 195 ? 0.7321 0.7192 0.7453 -0.0321 -0.1130 0.1450  216 ALA A CA  
1450 C C   . ALA A 195 ? 0.7599 0.7135 0.7318 -0.0539 -0.1109 0.1450  216 ALA A C   
1451 O O   . ALA A 195 ? 0.7131 0.6858 0.6893 -0.0766 -0.1021 0.1484  216 ALA A O   
1452 C CB  . ALA A 195 ? 0.6947 0.7406 0.7611 -0.0319 -0.1099 0.1487  216 ALA A CB  
1453 N N   . THR A 196 ? 0.8553 0.7589 0.7910 -0.0471 -0.1191 0.1416  217 THR A N   
1454 C CA  . THR A 196 ? 0.9007 0.7667 0.7988 -0.0673 -0.1181 0.1399  217 THR A CA  
1455 C C   . THR A 196 ? 0.9553 0.7551 0.8076 -0.0652 -0.1247 0.1421  217 THR A C   
1456 O O   . THR A 196 ? 0.9578 0.7360 0.8072 -0.0424 -0.1339 0.1428  217 THR A O   
1457 C CB  . THR A 196 ? 0.8982 0.7682 0.8007 -0.0655 -0.1202 0.1314  217 THR A CB  
1458 O OG1 . THR A 196 ? 1.0265 0.8493 0.8890 -0.0841 -0.1202 0.1266  217 THR A OG1 
1459 C CG2 . THR A 196 ? 0.8832 0.7441 0.7959 -0.0349 -0.1272 0.1260  217 THR A CG2 
1460 N N   . LEU A 197 ? 1.0372 0.8066 0.8568 -0.0905 -0.1210 0.1456  218 LEU A N   
1461 C CA  . LEU A 197 ? 1.0918 0.7953 0.8678 -0.0928 -0.1281 0.1512  218 LEU A CA  
1462 C C   . LEU A 197 ? 1.0950 0.7565 0.8511 -0.1017 -0.1302 0.1438  218 LEU A C   
1463 O O   . LEU A 197 ? 1.0498 0.7169 0.7993 -0.1283 -0.1238 0.1415  218 LEU A O   
1464 C CB  . LEU A 197 ? 1.1499 0.8457 0.9004 -0.1165 -0.1219 0.1627  218 LEU A CB  
1465 C CG  . LEU A 197 ? 1.2263 0.8548 0.9294 -0.1250 -0.1295 0.1737  218 LEU A CG  
1466 C CD1 . LEU A 197 ? 1.2641 0.8644 0.9588 -0.0981 -0.1440 0.1793  218 LEU A CD1 
1467 C CD2 . LEU A 197 ? 1.2343 0.8647 0.9130 -0.1539 -0.1198 0.1853  218 LEU A CD2 
1468 N N   . THR A 198 ? 1.1628 0.7827 0.9121 -0.0796 -0.1391 0.1392  219 THR A N   
1469 C CA  . THR A 198 ? 1.2552 0.8297 0.9874 -0.0848 -0.1396 0.1279  219 THR A CA  
1470 C C   . THR A 198 ? 1.3628 0.8626 1.0624 -0.0852 -0.1480 0.1370  219 THR A C   
1471 O O   . THR A 198 ? 1.5214 0.9966 1.2229 -0.0606 -0.1580 0.1444  219 THR A O   
1472 C CB  . THR A 198 ? 1.2435 0.8283 0.9992 -0.0587 -0.1396 0.1118  219 THR A CB  
1473 O OG1 . THR A 198 ? 1.2377 0.8915 1.0226 -0.0614 -0.1328 0.1062  219 THR A OG1 
1474 C CG2 . THR A 198 ? 1.2633 0.7968 0.9988 -0.0643 -0.1375 0.0957  219 THR A CG2 
1475 N N   . LYS A 199 ? 1.4518 0.9164 1.1238 -0.1142 -0.1454 0.1384  220 LYS A N   
1476 C CA  . LYS A 199 ? 1.4756 0.8645 1.1183 -0.1176 -0.1538 0.1484  220 LYS A CA  
1477 C C   . LYS A 199 ? 1.5059 0.8477 1.1412 -0.1223 -0.1518 0.1295  220 LYS A C   
1478 O O   . LYS A 199 ? 1.5126 0.8611 1.1388 -0.1506 -0.1447 0.1193  220 LYS A O   
1479 C CB  . LYS A 199 ? 1.4747 0.8527 1.0889 -0.1494 -0.1527 0.1680  220 LYS A CB  
1480 N N   . PRO A 200 ? 1.5198 0.8140 1.1610 -0.0947 -0.1580 0.1241  221 PRO A N   
1481 C CA  . PRO A 200 ? 1.6547 0.9014 1.2921 -0.0943 -0.1537 0.1010  221 PRO A CA  
1482 C C   . PRO A 200 ? 1.7569 0.9271 1.3657 -0.1168 -0.1583 0.1084  221 PRO A C   
1483 O O   . PRO A 200 ? 1.8691 1.0125 1.4639 -0.1217 -0.1681 0.1355  221 PRO A O   
1484 C CB  . PRO A 200 ? 1.6624 0.8950 1.3263 -0.0517 -0.1571 0.0947  221 PRO A CB  
1485 C CG  . PRO A 200 ? 1.6233 0.8654 1.2939 -0.0353 -0.1704 0.1234  221 PRO A CG  
1486 C CD  . PRO A 200 ? 1.5637 0.8415 1.2149 -0.0643 -0.1702 0.1408  221 PRO A CD  
1487 N N   . MET A 201 ? 1.7512 0.8868 1.3499 -0.1317 -0.1516 0.0845  222 MET A N   
1488 C CA  . MET A 201 ? 1.7714 0.8307 1.3455 -0.1556 -0.1553 0.0880  222 MET A CA  
1489 C C   . MET A 201 ? 1.7441 0.8128 1.2961 -0.1908 -0.1592 0.1153  222 MET A C   
1490 O O   . MET A 201 ? 1.7749 0.7939 1.3124 -0.1963 -0.1686 0.1402  222 MET A O   
1491 C CB  . MET A 201 ? 1.8323 0.8170 1.4142 -0.1275 -0.1647 0.0969  222 MET A CB  
1492 C CG  . MET A 201 ? 1.8701 0.8383 1.4773 -0.0930 -0.1578 0.0677  222 MET A CG  
1493 S SD  . MET A 201 ? 1.9742 0.9103 1.5666 -0.1151 -0.1426 0.0232  222 MET A SD  
1494 C CE  . MET A 201 ? 1.9615 0.8868 1.5873 -0.0673 -0.1320 -0.0071 222 MET A CE  
1495 N N   . VAL A 202 ? 1.6905 0.8262 1.2423 -0.2143 -0.1516 0.1118  223 VAL A N   
1496 C CA  . VAL A 202 ? 1.7451 0.9029 1.2818 -0.2493 -0.1509 0.1338  223 VAL A CA  
1497 C C   . VAL A 202 ? 1.8424 0.9280 1.3525 -0.2803 -0.1552 0.1427  223 VAL A C   
1498 O O   . VAL A 202 ? 1.8717 0.9058 1.3756 -0.2872 -0.1553 0.1220  223 VAL A O   
1499 C CB  . VAL A 202 ? 1.7169 0.9506 1.2648 -0.2714 -0.1415 0.1224  223 VAL A CB  
1500 C CG1 . VAL A 202 ? 1.7748 0.9906 1.3175 -0.2860 -0.1387 0.0930  223 VAL A CG1 
1501 C CG2 . VAL A 202 ? 1.6923 0.9539 1.2316 -0.3070 -0.1381 0.1442  223 VAL A CG2 
1502 N N   . GLY A 203 ? 1.8270 0.9076 1.3209 -0.2996 -0.1580 0.1729  224 GLY A N   
1503 C CA  . GLY A 203 ? 1.8788 0.8968 1.3487 -0.3329 -0.1621 0.1864  224 GLY A CA  
1504 C C   . GLY A 203 ? 1.8935 0.9555 1.3534 -0.3726 -0.1550 0.2046  224 GLY A C   
1505 O O   . GLY A 203 ? 1.7322 0.8708 1.2054 -0.3707 -0.1468 0.2074  224 GLY A O   
1506 N N   . PRO A 204 ? 1.9814 1.0058 1.4269 -0.4045 -0.1561 0.2144  225 PRO A N   
1507 C CA  . PRO A 204 ? 1.9563 1.0288 1.3994 -0.4386 -0.1473 0.2313  225 PRO A CA  
1508 C C   . PRO A 204 ? 1.8570 0.9740 1.2960 -0.4299 -0.1424 0.2567  225 PRO A C   
1509 O O   . PRO A 204 ? 1.7637 0.9406 1.2075 -0.4516 -0.1306 0.2652  225 PRO A O   
1510 C CB  . PRO A 204 ? 2.0586 1.0765 1.4931 -0.4562 -0.1515 0.2377  225 PRO A CB  
1511 C CG  . PRO A 204 ? 2.1068 1.0605 1.5439 -0.4432 -0.1586 0.2116  225 PRO A CG  
1512 C CD  . PRO A 204 ? 2.0671 1.0163 1.5099 -0.4031 -0.1625 0.2033  225 PRO A CD  
1513 N N   . GLU A 205 ? 1.8743 0.9645 1.3067 -0.3979 -0.1511 0.2669  226 GLU A N   
1514 C CA  . GLU A 205 ? 1.8891 1.0174 1.3129 -0.3884 -0.1483 0.2879  226 GLU A CA  
1515 C C   . GLU A 205 ? 1.8222 1.0041 1.2577 -0.3719 -0.1430 0.2794  226 GLU A C   
1516 O O   . GLU A 205 ? 1.7044 0.9343 1.1357 -0.3723 -0.1350 0.2909  226 GLU A O   
1517 C CB  . GLU A 205 ? 1.9409 1.0225 1.3547 -0.3627 -0.1624 0.3041  226 GLU A CB  
1518 C CG  . GLU A 205 ? 1.9648 1.0094 1.3931 -0.3242 -0.1747 0.2907  226 GLU A CG  
1519 C CD  . GLU A 205 ? 2.0616 1.0434 1.4998 -0.3234 -0.1793 0.2733  226 GLU A CD  
1520 O OE1 . GLU A 205 ? 2.2457 1.2238 1.6817 -0.3536 -0.1722 0.2618  226 GLU A OE1 
1521 O OE2 . GLU A 205 ? 1.9328 0.8713 1.3838 -0.2922 -0.1894 0.2697  226 GLU A OE2 
1522 N N   . ASP A 206 ? 1.8772 1.0634 1.3350 -0.3525 -0.1451 0.2539  227 ASP A N   
1523 C CA  . ASP A 206 ? 1.7050 0.9629 1.1915 -0.3275 -0.1384 0.2384  227 ASP A CA  
1524 C C   . ASP A 206 ? 1.6174 0.9473 1.1241 -0.3519 -0.1233 0.2312  227 ASP A C   
1525 O O   . ASP A 206 ? 1.5869 0.9830 1.1176 -0.3385 -0.1151 0.2261  227 ASP A O   
1526 C CB  . ASP A 206 ? 1.7010 0.9463 1.2082 -0.2951 -0.1449 0.2135  227 ASP A CB  
1527 C CG  . ASP A 206 ? 1.7306 0.9207 1.2309 -0.2630 -0.1589 0.2211  227 ASP A CG  
1528 O OD1 . ASP A 206 ? 1.7291 0.8992 1.2086 -0.2640 -0.1656 0.2470  227 ASP A OD1 
1529 O OD2 . ASP A 206 ? 1.7014 0.8709 1.2182 -0.2372 -0.1631 0.2018  227 ASP A OD2 
1530 N N   . ALA A 207 ? 1.6129 0.9294 1.1133 -0.3880 -0.1204 0.2318  228 ALA A N   
1531 C CA  . ALA A 207 ? 1.5659 0.9500 1.0880 -0.4152 -0.1075 0.2302  228 ALA A CA  
1532 C C   . ALA A 207 ? 1.5496 0.9735 1.0684 -0.4267 -0.0944 0.2512  228 ALA A C   
1533 O O   . ALA A 207 ? 1.6302 1.0164 1.1178 -0.4273 -0.0967 0.2701  228 ALA A O   
1534 C CB  . ALA A 207 ? 1.6000 0.9562 1.1144 -0.4539 -0.1097 0.2278  228 ALA A CB  
1535 N N   . GLY A 208 ? 1.5037 1.0047 1.0554 -0.4359 -0.0804 0.2481  229 GLY A N   
1536 C CA  . GLY A 208 ? 1.4706 1.0159 1.0244 -0.4456 -0.0635 0.2630  229 GLY A CA  
1537 C C   . GLY A 208 ? 1.3972 1.0258 0.9978 -0.4308 -0.0507 0.2522  229 GLY A C   
1538 O O   . GLY A 208 ? 1.4363 1.1054 1.0738 -0.4354 -0.0507 0.2417  229 GLY A O   
1539 N N   . SER A 209 ? 1.3586 1.0122 0.9580 -0.4140 -0.0404 0.2553  230 SER A N   
1540 C CA  . SER A 209 ? 1.3045 1.0327 0.9514 -0.3981 -0.0272 0.2448  230 SER A CA  
1541 C C   . SER A 209 ? 1.2755 1.0048 0.9163 -0.3637 -0.0285 0.2384  230 SER A C   
1542 O O   . SER A 209 ? 1.2915 0.9971 0.8943 -0.3642 -0.0254 0.2475  230 SER A O   
1543 C CB  . SER A 209 ? 1.2754 1.0575 0.9434 -0.4251 -0.0035 0.2535  230 SER A CB  
1544 O OG  . SER A 209 ? 1.2763 1.0666 0.9245 -0.4200 0.0114  0.2575  230 SER A OG  
1545 N N   . TYR A 210 ? 1.2005 0.9595 0.8786 -0.3359 -0.0339 0.2238  231 TYR A N   
1546 C CA  . TYR A 210 ? 1.1335 0.8957 0.8133 -0.3025 -0.0380 0.2159  231 TYR A CA  
1547 C C   . TYR A 210 ? 1.0783 0.9118 0.8089 -0.2926 -0.0216 0.2069  231 TYR A C   
1548 O O   . TYR A 210 ? 1.1051 0.9864 0.8763 -0.3074 -0.0100 0.2071  231 TYR A O   
1549 C CB  . TYR A 210 ? 1.1158 0.8507 0.7997 -0.2757 -0.0582 0.2067  231 TYR A CB  
1550 C CG  . TYR A 210 ? 1.2126 0.8753 0.8559 -0.2810 -0.0740 0.2121  231 TYR A CG  
1551 C CD1 . TYR A 210 ? 1.2339 0.8778 0.8715 -0.3073 -0.0753 0.2137  231 TYR A CD1 
1552 C CD2 . TYR A 210 ? 1.2864 0.8992 0.9009 -0.2596 -0.0884 0.2155  231 TYR A CD2 
1553 C CE1 . TYR A 210 ? 1.2932 0.8667 0.8971 -0.3116 -0.0888 0.2165  231 TYR A CE1 
1554 C CE2 . TYR A 210 ? 1.3267 0.8718 0.9114 -0.2621 -0.1023 0.2208  231 TYR A CE2 
1555 C CZ  . TYR A 210 ? 1.3466 0.8703 0.9261 -0.2877 -0.1016 0.2202  231 TYR A CZ  
1556 O OH  . TYR A 210 ? 1.4918 0.9435 1.0445 -0.2897 -0.1144 0.2235  231 TYR A OH  
1557 N N   . ARG A 211 ? 1.0294 0.8696 0.7613 -0.2676 -0.0216 0.1996  232 ARG A N   
1558 C CA  . ARG A 211 ? 1.0062 0.9083 0.7915 -0.2541 -0.0077 0.1887  232 ARG A CA  
1559 C C   . ARG A 211 ? 1.0046 0.9063 0.8040 -0.2200 -0.0205 0.1784  232 ARG A C   
1560 O O   . ARG A 211 ? 1.0342 0.8925 0.7943 -0.2076 -0.0343 0.1795  232 ARG A O   
1561 C CB  . ARG A 211 ? 1.0171 0.9423 0.7953 -0.2672 0.0164  0.1879  232 ARG A CB  
1562 C CG  . ARG A 211 ? 1.0340 1.0276 0.8795 -0.2620 0.0365  0.1782  232 ARG A CG  
1563 C CD  . ARG A 211 ? 1.0577 1.0716 0.8948 -0.2716 0.0633  0.1722  232 ARG A CD  
1564 N NE  . ARG A 211 ? 1.1104 1.0951 0.9041 -0.2574 0.0587  0.1638  232 ARG A NE  
1565 C CZ  . ARG A 211 ? 1.1967 1.1473 0.9244 -0.2730 0.0620  0.1695  232 ARG A CZ  
1566 N NH1 . ARG A 211 ? 1.2388 1.1791 0.9380 -0.3029 0.0713  0.1840  232 ARG A NH1 
1567 N NH2 . ARG A 211 ? 1.2460 1.1742 0.9361 -0.2605 0.0547  0.1624  232 ARG A NH2 
1568 N N   . CYS A 212 ? 0.9955 0.9472 0.8546 -0.2056 -0.0169 0.1706  233 CYS A N   
1569 C CA  . CYS A 212 ? 0.9727 0.9309 0.8535 -0.1749 -0.0277 0.1617  233 CYS A CA  
1570 C C   . CYS A 212 ? 0.8498 0.8560 0.7761 -0.1653 -0.0114 0.1520  233 CYS A C   
1571 O O   . CYS A 212 ? 0.7797 0.8346 0.7590 -0.1712 0.0018  0.1523  233 CYS A O   
1572 C CB  . CYS A 212 ? 0.9877 0.9565 0.8991 -0.1636 -0.0421 0.1622  233 CYS A CB  
1573 S SG  . CYS A 212 ? 0.9985 0.9915 0.9528 -0.1285 -0.0519 0.1538  233 CYS A SG  
1574 N N   . GLU A 213 ? 0.7942 0.7854 0.7011 -0.1511 -0.0130 0.1435  234 GLU A N   
1575 C CA  . GLU A 213 ? 0.7618 0.7903 0.7093 -0.1397 0.0010  0.1300  234 GLU A CA  
1576 C C   . GLU A 213 ? 0.7159 0.7460 0.6887 -0.1114 -0.0159 0.1240  234 GLU A C   
1577 O O   . GLU A 213 ? 0.7506 0.7438 0.6843 -0.1011 -0.0327 0.1237  234 GLU A O   
1578 C CB  . GLU A 213 ? 0.8806 0.8949 0.7840 -0.1504 0.0158  0.1218  234 GLU A CB  
1579 C CG  . GLU A 213 ? 0.9697 0.9941 0.8578 -0.1787 0.0388  0.1262  234 GLU A CG  
1580 C CD  . GLU A 213 ? 1.1254 1.1189 0.9432 -0.1938 0.0460  0.1246  234 GLU A CD  
1581 O OE1 . GLU A 213 ? 1.1738 1.1588 0.9730 -0.1826 0.0436  0.1121  234 GLU A OE1 
1582 O OE2 . GLU A 213 ? 1.2978 1.2761 1.0778 -0.2187 0.0532  0.1368  234 GLU A OE2 
1583 N N   . LEU A 214 ? 0.6577 0.7323 0.6991 -0.0997 -0.0123 0.1216  235 LEU A N   
1584 C CA  . LEU A 214 ? 0.6229 0.7060 0.6969 -0.0747 -0.0253 0.1163  235 LEU A CA  
1585 C C   . LEU A 214 ? 0.6250 0.7197 0.7148 -0.0681 -0.0124 0.0995  235 LEU A C   
1586 O O   . LEU A 214 ? 0.6055 0.7375 0.7454 -0.0703 0.0072  0.0932  235 LEU A O   
1587 C CB  . LEU A 214 ? 0.5688 0.6934 0.7086 -0.0665 -0.0294 0.1246  235 LEU A CB  
1588 C CG  . LEU A 214 ? 0.5294 0.6721 0.7154 -0.0425 -0.0393 0.1209  235 LEU A CG  
1589 C CD1 . LEU A 214 ? 0.5384 0.6464 0.6891 -0.0285 -0.0612 0.1226  235 LEU A CD1 
1590 C CD2 . LEU A 214 ? 0.4797 0.6715 0.7360 -0.0390 -0.0393 0.1321  235 LEU A CD2 
1591 N N   . GLY A 215 ? 0.6528 0.7155 0.7013 -0.0604 -0.0235 0.0919  236 GLY A N   
1592 C CA  . GLY A 215 ? 0.6605 0.7282 0.7124 -0.0573 -0.0125 0.0727  236 GLY A CA  
1593 C C   . GLY A 215 ? 0.6348 0.7366 0.7618 -0.0388 -0.0112 0.0643  236 GLY A C   
1594 O O   . GLY A 215 ? 0.6273 0.7448 0.7961 -0.0257 -0.0249 0.0758  236 GLY A O   
1595 N N   . SER A 216 ? 0.6666 0.7796 0.8106 -0.0390 0.0065  0.0438  237 SER A N   
1596 C CA  . SER A 216 ? 0.6397 0.7769 0.8523 -0.0216 0.0070  0.0333  237 SER A CA  
1597 C C   . SER A 216 ? 0.6875 0.8034 0.8697 -0.0206 0.0075  0.0095  237 SER A C   
1598 O O   . SER A 216 ? 0.8034 0.8968 0.9201 -0.0360 0.0158  -0.0006 237 SER A O   
1599 C CB  . SER A 216 ? 0.6012 0.7810 0.8881 -0.0223 0.0319  0.0305  237 SER A CB  
1600 O OG  . SER A 216 ? 0.5977 0.7947 0.9492 -0.0067 0.0349  0.0176  237 SER A OG  
1601 N N   . VAL A 217 ? 0.6822 0.8055 0.9098 -0.0044 -0.0023 0.0014  238 VAL A N   
1602 C CA  . VAL A 217 ? 0.7423 0.8450 0.9418 -0.0047 -0.0055 -0.0222 238 VAL A CA  
1603 C C   . VAL A 217 ? 0.8209 0.9324 1.0288 -0.0144 0.0272  -0.0511 238 VAL A C   
1604 O O   . VAL A 217 ? 0.7241 0.8644 1.0072 -0.0069 0.0460  -0.0583 238 VAL A O   
1605 C CB  . VAL A 217 ? 0.6763 0.7849 0.9270 0.0138  -0.0255 -0.0229 238 VAL A CB  
1606 C CG1 . VAL A 217 ? 0.7313 0.8175 0.9490 0.0104  -0.0309 -0.0482 238 VAL A CG1 
1607 C CG2 . VAL A 217 ? 0.6337 0.7370 0.8787 0.0242  -0.0546 0.0039  238 VAL A CG2 
1608 N N   . ASN A 218 ? 0.8458 0.9328 0.9764 -0.0313 0.0341  -0.0667 239 ASN A N   
1609 C CA  . ASN A 218 ? 0.9158 1.0076 1.0393 -0.0429 0.0671  -0.0985 239 ASN A CA  
1610 C C   . ASN A 218 ? 0.9038 1.0273 1.0742 -0.0469 0.1009  -0.0985 239 ASN A C   
1611 O O   . ASN A 218 ? 1.0703 1.2115 1.2869 -0.0449 0.1297  -0.1238 239 ASN A O   
1612 C CB  . ASN A 218 ? 0.9407 1.0337 1.1089 -0.0320 0.0685  -0.1264 239 ASN A CB  
1613 N N   . SER A 219 ? 0.8355 0.9661 0.9969 -0.0527 0.0977  -0.0707 240 SER A N   
1614 C CA  . SER A 219 ? 0.7990 0.9631 1.0062 -0.0584 0.1264  -0.0663 240 SER A CA  
1615 C C   . SER A 219 ? 0.8107 0.9694 0.9693 -0.0753 0.1234  -0.0413 240 SER A C   
1616 O O   . SER A 219 ? 0.8052 0.9313 0.8948 -0.0816 0.0997  -0.0276 240 SER A O   
1617 C CB  . SER A 219 ? 0.7519 0.9510 1.0638 -0.0393 0.1240  -0.0544 240 SER A CB  
1618 O OG  . SER A 219 ? 0.7662 0.9713 1.1335 -0.0247 0.1309  -0.0775 240 SER A OG  
1619 N N   . SER A 220 ? 0.9057 1.0968 1.1053 -0.0829 0.1473  -0.0351 241 SER A N   
1620 C CA  . SER A 220 ? 0.9072 1.0985 1.0767 -0.0995 0.1448  -0.0102 241 SER A CA  
1621 C C   . SER A 220 ? 0.8160 1.0070 1.0091 -0.0887 0.1131  0.0170  241 SER A C   
1622 O O   . SER A 220 ? 0.6702 0.8750 0.9212 -0.0689 0.1007  0.0180  241 SER A O   
1623 C CB  . SER A 220 ? 0.9159 1.1482 1.1338 -0.1104 0.1789  -0.0113 241 SER A CB  
1624 O OG  . SER A 220 ? 0.9842 1.2563 1.2994 -0.0958 0.1780  -0.0002 241 SER A OG  
1625 N N   . PRO A 221 ? 0.8529 1.0274 1.0004 -0.1026 0.1007  0.0383  242 PRO A N   
1626 C CA  . PRO A 221 ? 0.7861 0.9577 0.9484 -0.0939 0.0725  0.0604  242 PRO A CA  
1627 C C   . PRO A 221 ? 0.6523 0.8714 0.9055 -0.0844 0.0747  0.0703  242 PRO A C   
1628 O O   . PRO A 221 ? 0.6351 0.8906 0.9365 -0.0914 0.0980  0.0690  242 PRO A O   
1629 C CB  . PRO A 221 ? 0.8229 0.9719 0.9266 -0.1154 0.0681  0.0771  242 PRO A CB  
1630 C CG  . PRO A 221 ? 0.8513 1.0091 0.9354 -0.1361 0.0982  0.0685  242 PRO A CG  
1631 C CD  . PRO A 221 ? 0.8969 1.0525 0.9760 -0.1279 0.1119  0.0428  242 PRO A CD  
1632 N N   . ALA A 222 ? 0.6215 0.8424 0.8992 -0.0690 0.0503  0.0817  243 ALA A N   
1633 C CA  . ALA A 222 ? 0.5549 0.8206 0.9126 -0.0619 0.0473  0.0963  243 ALA A CA  
1634 C C   . ALA A 222 ? 0.5243 0.8050 0.8784 -0.0810 0.0464  0.1156  243 ALA A C   
1635 O O   . ALA A 222 ? 0.4760 0.8016 0.8939 -0.0854 0.0553  0.1262  243 ALA A O   
1636 C CB  . ALA A 222 ? 0.5363 0.7996 0.9128 -0.0428 0.0219  0.1040  243 ALA A CB  
1637 N N   . THR A 223 ? 0.5732 0.9205 0.7294 -0.0369 0.1364  0.2663  244 THR A N   
1638 C CA  . THR A 223 ? 0.6292 1.0090 0.7809 -0.0545 0.1256  0.2863  244 THR A CA  
1639 C C   . THR A 223 ? 0.6471 0.9881 0.7686 -0.0923 0.1154  0.2937  244 THR A C   
1640 O O   . THR A 223 ? 0.6387 0.9338 0.7310 -0.0936 0.1138  0.2924  244 THR A O   
1641 C CB  . THR A 223 ? 0.6641 1.0793 0.8045 -0.0292 0.1222  0.3006  244 THR A CB  
1642 O OG1 . THR A 223 ? 0.6173 1.0593 0.7803 0.0043  0.1302  0.2934  244 THR A OG1 
1643 C CG2 . THR A 223 ? 0.7420 1.1710 0.8615 -0.0474 0.0977  0.3066  244 THR A CG2 
1644 N N   . ILE A 224 ? 0.6969 1.0504 0.8231 -0.1242 0.1064  0.3006  245 ILE A N   
1645 C CA  . ILE A 224 ? 0.7488 1.0549 0.8373 -0.1639 0.0894  0.3047  245 ILE A CA  
1646 C C   . ILE A 224 ? 0.7510 1.0664 0.8276 -0.1719 0.0594  0.2931  245 ILE A C   
1647 O O   . ILE A 224 ? 0.7702 1.1436 0.8866 -0.1806 0.0628  0.3003  245 ILE A O   
1648 C CB  . ILE A 224 ? 0.8116 1.0788 0.9059 -0.1895 0.0998  0.2910  245 ILE A CB  
1649 C CG1 . ILE A 224 ? 0.8055 1.0482 0.9079 -0.1646 0.1206  0.2715  245 ILE A CG1 
1650 C CG2 . ILE A 224 ? 0.9046 1.1031 0.9485 -0.2269 0.0839  0.2930  245 ILE A CG2 
1651 C CD1 . ILE A 224 ? 0.8055 1.0056 0.9041 -0.1837 0.1340  0.2547  245 ILE A CD1 
1652 N N   . ILE A 225 ? 0.7681 1.0271 0.7908 -0.1681 0.0291  0.2742  246 ILE A N   
1653 C CA  . ILE A 225 ? 0.7855 1.0471 0.7918 -0.1760 -0.0013 0.2606  246 ILE A CA  
1654 C C   . ILE A 225 ? 0.8865 1.0704 0.8430 -0.2068 -0.0243 0.2447  246 ILE A C   
1655 O O   . ILE A 225 ? 0.9173 1.0353 0.8290 -0.2010 -0.0308 0.2371  246 ILE A O   
1656 C CB  . ILE A 225 ? 0.7917 1.0661 0.7782 -0.1353 -0.0180 0.2510  246 ILE A CB  
1657 C CG1 . ILE A 225 ? 0.7708 1.1104 0.7984 -0.1011 0.0085  0.2666  246 ILE A CG1 
1658 C CG2 . ILE A 225 ? 0.8365 1.1242 0.8119 -0.1430 -0.0479 0.2383  246 ILE A CG2 
1659 C CD1 . ILE A 225 ? 0.8063 1.1530 0.8120 -0.0598 -0.0020 0.2581  246 ILE A CD1 
1660 N N   . ASN A 226 ? 0.8701 1.0611 0.8350 -0.2391 -0.0364 0.2389  247 ASN A N   
1661 C CA  . ASN A 226 ? 0.9150 1.0317 0.8330 -0.2705 -0.0561 0.2233  247 ASN A CA  
1662 C C   . ASN A 226 ? 0.9402 1.0431 0.8248 -0.2636 -0.0913 0.2030  247 ASN A C   
1663 O O   . ASN A 226 ? 0.9771 1.1360 0.8902 -0.2630 -0.1022 0.1996  247 ASN A O   
1664 C CB  . ASN A 226 ? 0.9293 1.0512 0.8769 -0.3171 -0.0429 0.2276  247 ASN A CB  
1665 C CG  . ASN A 226 ? 0.9862 1.1326 0.9739 -0.3245 -0.0060 0.2486  247 ASN A CG  
1666 O OD1 . ASN A 226 ? 1.0480 1.2583 1.0778 -0.2992 0.0112  0.2628  247 ASN A OD1 
1667 N ND2 . ASN A 226 ? 1.0355 1.1266 1.0065 -0.3586 0.0079  0.2508  247 ASN A ND2 
1668 N N   . PHE A 227 ? 0.9921 1.0193 0.8153 -0.2575 -0.1100 0.1890  248 PHE A N   
1669 C CA  . PHE A 227 ? 1.0788 1.0835 0.8643 -0.2514 -0.1429 0.1687  248 PHE A CA  
1670 C C   . PHE A 227 ? 1.2112 1.1575 0.9667 -0.2940 -0.1572 0.1547  248 PHE A C   
1671 O O   . PHE A 227 ? 1.2474 1.1281 0.9738 -0.3147 -0.1488 0.1560  248 PHE A O   
1672 C CB  . PHE A 227 ? 1.0919 1.0516 0.8294 -0.2144 -0.1552 0.1601  248 PHE A CB  
1673 C CG  . PHE A 227 ? 1.0207 1.0317 0.7859 -0.1722 -0.1391 0.1712  248 PHE A CG  
1674 C CD1 . PHE A 227 ? 0.9705 0.9875 0.7575 -0.1639 -0.1117 0.1864  248 PHE A CD1 
1675 C CD2 . PHE A 227 ? 0.9993 1.0496 0.7665 -0.1411 -0.1500 0.1657  248 PHE A CD2 
1676 C CE1 . PHE A 227 ? 0.9278 0.9906 0.7421 -0.1264 -0.0943 0.1953  248 PHE A CE1 
1677 C CE2 . PHE A 227 ? 0.9592 1.0520 0.7500 -0.1028 -0.1316 0.1756  248 PHE A CE2 
1678 C CZ  . PHE A 227 ? 0.9186 1.0184 0.7348 -0.0960 -0.1031 0.1901  248 PHE A CZ  
1679 N N   . HIS A 228 ? 1.1569 1.1255 0.9185 -0.3071 -0.1781 0.1409  249 HIS A N   
1680 C CA  . HIS A 228 ? 1.2564 1.1660 0.9856 -0.3450 -0.1939 0.1235  249 HIS A CA  
1681 C C   . HIS A 228 ? 1.2815 1.1559 0.9596 -0.3277 -0.2267 0.1027  249 HIS A C   
1682 O O   . HIS A 228 ? 1.1888 1.1110 0.8817 -0.3181 -0.2451 0.0933  249 HIS A O   
1683 C CB  . HIS A 228 ? 1.3376 1.2975 1.1197 -0.3822 -0.1907 0.1209  249 HIS A CB  
1684 C CG  . HIS A 228 ? 1.4948 1.3927 1.2494 -0.4256 -0.2005 0.1031  249 HIS A CG  
1685 N ND1 . HIS A 228 ? 1.5661 1.3825 1.2839 -0.4516 -0.1856 0.1051  249 HIS A ND1 
1686 C CD2 . HIS A 228 ? 1.5454 1.4479 1.3020 -0.4476 -0.2229 0.0821  249 HIS A CD2 
1687 C CE1 . HIS A 228 ? 1.6305 1.4024 1.3286 -0.4881 -0.1959 0.0869  249 HIS A CE1 
1688 N NE2 . HIS A 228 ? 1.6493 1.4738 1.3729 -0.4873 -0.2188 0.0719  249 HIS A NE2 
1689 N N   . VAL A 229 ? 1.3426 1.1316 0.9588 -0.3224 -0.2343 0.0955  250 VAL A N   
1690 C CA  . VAL A 229 ? 1.4297 1.1767 0.9932 -0.3037 -0.2632 0.0762  250 VAL A CA  
1691 C C   . VAL A 229 ? 1.5434 1.2282 1.0694 -0.3410 -0.2805 0.0568  250 VAL A C   
1692 O O   . VAL A 229 ? 1.6928 1.3193 1.1998 -0.3724 -0.2696 0.0580  250 VAL A O   
1693 C CB  . VAL A 229 ? 1.4607 1.1516 0.9790 -0.2703 -0.2637 0.0776  250 VAL A CB  
1694 C CG1 . VAL A 229 ? 1.5372 1.2030 1.0126 -0.2432 -0.2908 0.0593  250 VAL A CG1 
1695 C CG2 . VAL A 229 ? 1.4206 1.1655 0.9792 -0.2400 -0.2405 0.0971  250 VAL A CG2 
1696 N N   . THR A 230 ? 1.5817 1.2775 1.0957 -0.3372 -0.3064 0.0385  251 THR A N   
1697 C CA  . THR A 230 ? 1.6557 1.2900 1.1295 -0.3680 -0.3253 0.0168  251 THR A CA  
1698 C C   . THR A 230 ? 1.6628 1.2630 1.0842 -0.3388 -0.3527 -0.0003 251 THR A C   
1699 O O   . THR A 230 ? 1.5507 1.1978 0.9813 -0.3007 -0.3593 0.0018  251 THR A O   
1700 C CB  . THR A 230 ? 1.6616 1.3479 1.1822 -0.4041 -0.3302 0.0070  251 THR A CB  
1701 O OG1 . THR A 230 ? 1.6623 1.4455 1.2338 -0.3804 -0.3345 0.0127  251 THR A OG1 
1702 C CG2 . THR A 230 ? 1.5724 1.2557 1.1272 -0.4456 -0.3034 0.0172  251 THR A CG2 
1703 N N   . VAL A 231 ? 1.7394 1.2550 1.1040 -0.3566 -0.3666 -0.0172 252 VAL A N   
1704 C CA  . VAL A 231 ? 1.8546 1.3247 1.1635 -0.3287 -0.3900 -0.0329 252 VAL A CA  
1705 C C   . VAL A 231 ? 2.0273 1.4782 1.3136 -0.3513 -0.4146 -0.0581 252 VAL A C   
1706 O O   . VAL A 231 ? 2.1228 1.5454 1.4089 -0.3946 -0.4132 -0.0670 252 VAL A O   
1707 C CB  . VAL A 231 ? 1.8653 1.2406 1.1153 -0.3179 -0.3873 -0.0313 252 VAL A CB  
1708 C CG1 . VAL A 231 ? 1.8887 1.1882 1.1088 -0.3621 -0.3811 -0.0355 252 VAL A CG1 
1709 C CG2 . VAL A 231 ? 1.9276 1.2598 1.1251 -0.2852 -0.4100 -0.0471 252 VAL A CG2 
1710 N N   . LEU A 232 ? 1.9899 1.4571 1.2584 -0.3218 -0.4357 -0.0702 253 LEU A N   
1711 C CA  . LEU A 232 ? 2.0292 1.4797 1.2726 -0.3374 -0.4615 -0.0957 253 LEU A CA  
1712 C C   . LEU A 232 ? 2.1073 1.4716 1.2775 -0.3179 -0.4766 -0.1095 253 LEU A C   
1713 O O   . LEU A 232 ? 2.1485 1.4900 1.2982 -0.2829 -0.4702 -0.0999 253 LEU A O   
1714 C CB  . LEU A 232 ? 1.9481 1.4857 1.2258 -0.3193 -0.4757 -0.1003 253 LEU A CB  
1715 C CG  . LEU A 232 ? 1.8419 1.4786 1.1937 -0.3216 -0.4629 -0.0842 253 LEU A CG  
1716 C CD1 . LEU A 232 ? 1.8139 1.5147 1.1856 -0.3177 -0.4864 -0.0985 253 LEU A CD1 
1717 C CD2 . LEU A 232 ? 1.8246 1.4659 1.2173 -0.3662 -0.4437 -0.0766 253 LEU A CD2 
1718 N N   . PRO A 233 ? 2.2629 1.5788 1.3954 -0.3405 -0.4961 -0.1332 254 PRO A N   
1719 C CA  . PRO A 233 ? 2.2461 1.4768 1.3081 -0.3223 -0.5098 -0.1466 254 PRO A CA  
1720 C C   . PRO A 233 ? 2.2462 1.4957 1.2874 -0.2902 -0.5315 -0.1614 254 PRO A C   
1721 O O   . PRO A 233 ? 2.2856 1.4671 1.2701 -0.2741 -0.5432 -0.1740 254 PRO A O   
1722 C CB  . PRO A 233 ? 2.2760 1.4342 1.3052 -0.3683 -0.5152 -0.1639 254 PRO A CB  
1723 C CG  . PRO A 233 ? 2.2571 1.4708 1.3461 -0.4110 -0.5044 -0.1612 254 PRO A CG  
1724 C CD  . PRO A 233 ? 2.2006 1.5226 1.3515 -0.3887 -0.5022 -0.1485 254 PRO A CD  
1725 N N   . GLY A 234 ? 2.1721 1.5089 1.2556 -0.2803 -0.5365 -0.1600 255 GLY A N   
1726 C CA  . GLY A 234 ? 2.1958 1.5519 1.2575 -0.2495 -0.5557 -0.1731 255 GLY A CA  
1727 C C   . GLY A 234 ? 2.2116 1.5371 1.2396 -0.2020 -0.5509 -0.1679 255 GLY A C   
1728 O O   . GLY A 234 ? 2.2641 1.5872 1.3064 -0.1856 -0.5309 -0.1493 255 GLY A O   
1729 N N   . ARG A 235 ? 2.2227 1.5306 1.2169 -0.1788 -0.5635 -0.1837 256 ARG A N   
1730 C CA  . ARG A 235 ? 2.1895 1.4676 1.1593 -0.1339 -0.5547 -0.1816 256 ARG A CA  
1731 C C   . ARG A 235 ? 2.1604 1.3614 1.1065 -0.1349 -0.5450 -0.1779 256 ARG A C   
1732 O O   . ARG A 235 ? 2.1698 1.3347 1.0953 -0.1018 -0.5396 -0.1793 256 ARG A O   
1733 C CB  . ARG A 235 ? 2.0512 1.3887 1.0449 -0.0979 -0.5444 -0.1654 256 ARG A CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   CYS 1   22  22  CYS CYS A . n 
A 1 2   VAL 2   23  23  VAL VAL A . n 
A 1 3   ILE 3   24  24  ILE ILE A . n 
A 1 4   CYS 4   25  25  CYS CYS A . n 
A 1 5   ASP 5   26  26  ASP ASP A . n 
A 1 6   PRO 6   27  27  PRO PRO A . n 
A 1 7   SER 7   28  28  SER SER A . n 
A 1 8   VAL 8   29  29  VAL VAL A . n 
A 1 9   VAL 9   30  30  VAL VAL A . n 
A 1 10  LEU 10  31  31  LEU LEU A . n 
A 1 11  ALA 11  32  32  ALA ALA A . n 
A 1 12  LEU 12  33  33  LEU LEU A . n 
A 1 13  LYS 13  34  34  LYS LYS A . n 
A 1 14  SER 14  35  35  SER SER A . n 
A 1 15  LEU 15  36  36  LEU LEU A . n 
A 1 16  GLU 16  37  37  GLU GLU A . n 
A 1 17  LYS 17  38  38  LYS LYS A . n 
A 1 18  ASP 18  39  39  ASP ASP A . n 
A 1 19  TYR 19  40  40  TYR TYR A . n 
A 1 20  LEU 20  41  41  LEU LEU A . n 
A 1 21  PRO 21  42  42  PRO PRO A . n 
A 1 22  GLY 22  43  43  GLY GLY A . n 
A 1 23  HIS 23  44  44  HIS HIS A . n 
A 1 24  LEU 24  45  45  LEU LEU A . n 
A 1 25  ASP 25  46  46  ASP ASP A . n 
A 1 26  ALA 26  47  47  ALA ALA A . n 
A 1 27  LYS 27  48  48  LYS LYS A . n 
A 1 28  HIS 28  49  49  HIS HIS A . n 
A 1 29  HIS 29  50  50  HIS HIS A . n 
A 1 30  LYS 30  51  51  LYS LYS A . n 
A 1 31  ALA 31  52  52  ALA ALA A . n 
A 1 32  MET 32  53  53  MET MET A . n 
A 1 33  MET 33  54  54  MET MET A . n 
A 1 34  GLU 34  55  55  GLU GLU A . n 
A 1 35  ARG 35  56  56  ARG ARG A . n 
A 1 36  VAL 36  57  57  VAL VAL A . n 
A 1 37  GLU 37  58  58  GLU GLU A . n 
A 1 38  ASN 38  59  59  ASN ASN A . n 
A 1 39  ALA 39  60  60  ALA ALA A . n 
A 1 40  VAL 40  61  61  VAL VAL A . n 
A 1 41  LYS 41  62  62  LYS LYS A . n 
A 1 42  ASP 42  63  63  ASP ASP A . n 
A 1 43  PHE 43  64  64  PHE PHE A . n 
A 1 44  GLN 44  65  65  GLN GLN A . n 
A 1 45  GLU 45  66  66  GLU GLU A . n 
A 1 46  LEU 46  67  67  LEU LEU A . n 
A 1 47  SER 47  68  68  SER SER A . n 
A 1 48  LEU 48  69  69  LEU LEU A . n 
A 1 49  ASN 49  70  70  ASN ASN A . n 
A 1 50  GLU 50  71  71  GLU GLU A . n 
A 1 51  ASP 51  72  72  ASP ASP A . n 
A 1 52  ALA 52  73  73  ALA ALA A . n 
A 1 53  TYR 53  74  74  TYR TYR A . n 
A 1 54  MET 54  75  75  MET MET A . n 
A 1 55  GLY 55  76  76  GLY GLY A . n 
A 1 56  VAL 56  77  77  VAL VAL A . n 
A 1 57  VAL 57  78  78  VAL VAL A . n 
A 1 58  ASP 58  79  79  ASP ASP A . n 
A 1 59  GLU 59  80  80  GLU GLU A . n 
A 1 60  ALA 60  81  81  ALA ALA A . n 
A 1 61  THR 61  82  82  THR THR A . n 
A 1 62  LEU 62  83  83  LEU LEU A . n 
A 1 63  GLN 63  84  84  GLN GLN A . n 
A 1 64  LYS 64  85  85  LYS LYS A . n 
A 1 65  GLY 65  86  86  GLY GLY A . n 
A 1 66  SER 66  87  87  SER SER A . n 
A 1 67  TRP 67  88  88  TRP TRP A . n 
A 1 68  SER 68  89  89  SER SER A . n 
A 1 69  LEU 69  90  90  LEU LEU A . n 
A 1 70  LEU 70  91  91  LEU LEU A . n 
A 1 71  LYS 71  92  92  LYS LYS A . n 
A 1 72  ASP 72  93  93  ASP ASP A . n 
A 1 73  LEU 73  94  94  LEU LEU A . n 
A 1 74  LYS 74  95  95  LYS LYS A . n 
A 1 75  ARG 75  96  96  ARG ARG A . n 
A 1 76  ILE 76  97  97  ILE ILE A . n 
A 1 77  THR 77  98  98  THR THR A . n 
A 1 78  ASP 78  99  99  ASP ASP A . n 
A 1 79  SER 79  100 100 SER SER A . n 
A 1 80  ASP 80  101 101 ASP ASP A . n 
A 1 81  VAL 81  102 102 VAL VAL A . n 
A 1 82  LYS 82  103 103 LYS LYS A . n 
A 1 83  GLY 83  104 104 GLY GLY A . n 
A 1 84  ASP 84  105 105 ASP ASP A . n 
A 1 85  LEU 85  106 106 LEU LEU A . n 
A 1 86  PHE 86  107 107 PHE PHE A . n 
A 1 87  VAL 87  108 108 VAL VAL A . n 
A 1 88  LYS 88  109 109 LYS LYS A . n 
A 1 89  GLU 89  110 110 GLU GLU A . n 
A 1 90  LEU 90  111 111 LEU LEU A . n 
A 1 91  PHE 91  112 112 PHE PHE A . n 
A 1 92  TRP 92  113 113 TRP TRP A . n 
A 1 93  MET 93  114 114 MET MET A . n 
A 1 94  LEU 94  115 115 LEU LEU A . n 
A 1 95  HIS 95  116 116 HIS HIS A . n 
A 1 96  LEU 96  117 117 LEU LEU A . n 
A 1 97  GLN 97  118 118 GLN GLN A . n 
A 1 98  LYS 98  119 119 LYS LYS A . n 
A 1 99  GLU 99  120 120 GLU GLU A . n 
A 1 100 THR 100 121 121 THR THR A . n 
A 1 101 PHE 101 122 122 PHE PHE A . n 
A 1 102 ALA 102 123 123 ALA ALA A . n 
A 1 103 THR 103 124 124 THR THR A . n 
A 1 104 TYR 104 125 125 TYR TYR A . n 
A 1 105 VAL 105 126 126 VAL VAL A . n 
A 1 106 ALA 106 127 127 ALA ALA A . n 
A 1 107 ARG 107 128 128 ARG ARG A . n 
A 1 108 PHE 108 129 129 PHE PHE A . n 
A 1 109 GLN 109 130 130 GLN GLN A . n 
A 1 110 LYS 110 131 131 LYS LYS A . n 
A 1 111 GLU 111 132 132 GLU GLU A . n 
A 1 112 ALA 112 133 133 ALA ALA A . n 
A 1 113 TYR 113 134 134 TYR TYR A . n 
A 1 114 CYS 114 135 135 CYS CYS A . n 
A 1 115 PRO 115 136 136 PRO PRO A . n 
A 1 116 ASN 116 137 137 ASN ASN A . n 
A 1 117 LYS 117 138 138 LYS LYS A . n 
A 1 118 CYS 118 139 139 CYS CYS A . n 
A 1 119 GLY 119 140 140 GLY GLY A . n 
A 1 120 VAL 120 141 141 VAL VAL A . n 
A 1 121 MET 121 142 142 MET MET A . n 
A 1 122 LEU 122 143 143 LEU LEU A . n 
A 1 123 GLN 123 144 144 GLN GLN A . n 
A 1 124 THR 124 145 145 THR THR A . n 
A 1 125 LEU 125 146 146 LEU LEU A . n 
A 1 126 ILE 126 147 147 ILE ILE A . n 
A 1 127 TRP 127 148 148 TRP TRP A . n 
A 1 128 CYS 128 149 149 CYS CYS A . n 
A 1 129 LYS 129 150 150 LYS LYS A . n 
A 1 130 ASN 130 151 151 ASN ASN A . n 
A 1 131 CYS 131 152 152 CYS CYS A . n 
A 1 132 LYS 132 153 153 LYS LYS A . n 
A 1 133 LYS 133 154 154 LYS LYS A . n 
A 1 134 GLU 134 155 155 GLU GLU A . n 
A 1 135 VAL 135 156 156 VAL VAL A . n 
A 1 136 HIS 136 157 157 HIS HIS A . n 
A 1 137 ALA 137 158 158 ALA ALA A . n 
A 1 138 CYS 138 159 159 CYS CYS A . n 
A 1 139 ARG 139 160 160 ARG ARG A . n 
A 1 140 LYS 140 161 161 LYS LYS A . n 
A 1 141 SER 141 162 162 SER SER A . n 
A 1 142 TYR 142 163 163 TYR TYR A . n 
A 1 143 ASP 143 164 164 ASP ASP A . n 
A 1 144 CYS 144 165 165 CYS CYS A . n 
A 1 145 GLY 145 166 166 GLY GLY A . n 
A 1 146 GLU 146 167 167 GLU GLU A . n 
A 1 147 ARG 147 168 168 ARG ARG A . n 
A 1 148 ASN 148 169 169 ASN ASN A . n 
A 1 149 VAL 149 170 170 VAL VAL A . n 
A 1 150 GLU 150 171 171 GLU GLU A . n 
A 1 151 VAL 151 172 172 VAL VAL A . n 
A 1 152 PRO 152 173 173 PRO PRO A . n 
A 1 153 GLN 153 174 174 GLN GLN A . n 
A 1 154 MET 154 175 175 MET MET A . n 
A 1 155 GLU 155 176 176 GLU GLU A . n 
A 1 156 ASP 156 177 177 ASP ASP A . n 
A 1 157 MET 157 178 178 MET MET A . n 
A 1 158 ILE 158 179 179 ILE ILE A . n 
A 1 159 LEU 159 180 180 LEU LEU A . n 
A 1 160 ASP 160 181 181 ASP ASP A . n 
A 1 161 CYS 161 182 182 CYS CYS A . n 
A 1 162 GLU 162 183 183 GLU GLU A . n 
A 1 163 LEU 163 184 184 LEU LEU A . n 
A 1 164 ASN 164 185 185 ASN ASN A . n 
A 1 165 TRP 165 186 186 TRP TRP A . n 
A 1 166 HIS 166 187 187 HIS HIS A . n 
A 1 167 GLN 167 188 188 GLN GLN A . n 
A 1 168 ALA 168 189 189 ALA ALA A . n 
A 1 169 SER 169 190 190 SER SER A . n 
A 1 170 GLU 170 191 191 GLU GLU A . n 
A 1 171 GLY 171 192 192 GLY GLY A . n 
A 1 172 LEU 172 193 193 LEU LEU A . n 
A 1 173 THR 173 194 194 THR THR A . n 
A 1 174 ASP 174 195 195 ASP ASP A . n 
A 1 175 TYR 175 196 196 TYR TYR A . n 
A 1 176 SER 176 197 197 SER SER A . n 
A 1 177 PHE 177 198 198 PHE PHE A . n 
A 1 178 TYR 178 199 199 TYR TYR A . n 
A 1 179 ARG 179 200 200 ARG ARG A . n 
A 1 180 VAL 180 201 201 VAL VAL A . n 
A 1 181 TRP 181 202 202 TRP TRP A . n 
A 1 182 GLY 182 203 203 GLY GLY A . n 
A 1 183 ASN 183 204 204 ASN ASN A . n 
A 1 184 ASN 184 205 205 ASN ASN A . n 
A 1 185 THR 185 206 206 THR THR A . n 
A 1 186 GLU 186 207 207 GLU GLU A . n 
A 1 187 THR 187 208 208 THR THR A . n 
A 1 188 LEU 188 209 209 LEU LEU A . n 
A 1 189 VAL 189 210 210 VAL VAL A . n 
A 1 190 SER 190 211 211 SER SER A . n 
A 1 191 LYS 191 212 212 LYS LYS A . n 
A 1 192 GLY 192 213 213 GLY GLY A . n 
A 1 193 LYS 193 214 214 LYS LYS A . n 
A 1 194 GLU 194 215 215 GLU GLU A . n 
A 1 195 ALA 195 216 216 ALA ALA A . n 
A 1 196 THR 196 217 217 THR THR A . n 
A 1 197 LEU 197 218 218 LEU LEU A . n 
A 1 198 THR 198 219 219 THR THR A . n 
A 1 199 LYS 199 220 220 LYS LYS A . n 
A 1 200 PRO 200 221 221 PRO PRO A . n 
A 1 201 MET 201 222 222 MET MET A . n 
A 1 202 VAL 202 223 223 VAL VAL A . n 
A 1 203 GLY 203 224 224 GLY GLY A . n 
A 1 204 PRO 204 225 225 PRO PRO A . n 
A 1 205 GLU 205 226 226 GLU GLU A . n 
A 1 206 ASP 206 227 227 ASP ASP A . n 
A 1 207 ALA 207 228 228 ALA ALA A . n 
A 1 208 GLY 208 229 229 GLY GLY A . n 
A 1 209 SER 209 230 230 SER SER A . n 
A 1 210 TYR 210 231 231 TYR TYR A . n 
A 1 211 ARG 211 232 232 ARG ARG A . n 
A 1 212 CYS 212 233 233 CYS CYS A . n 
A 1 213 GLU 213 234 234 GLU GLU A . n 
A 1 214 LEU 214 235 235 LEU LEU A . n 
A 1 215 GLY 215 236 236 GLY GLY A . n 
A 1 216 SER 216 237 237 SER SER A . n 
A 1 217 VAL 217 238 238 VAL VAL A . n 
A 1 218 ASN 218 239 239 ASN ASN A . n 
A 1 219 SER 219 240 240 SER SER A . n 
A 1 220 SER 220 241 241 SER SER A . n 
A 1 221 PRO 221 242 242 PRO PRO A . n 
A 1 222 ALA 222 243 243 ALA ALA A . n 
A 1 223 THR 223 244 244 THR THR A . n 
A 1 224 ILE 224 245 245 ILE ILE A . n 
A 1 225 ILE 225 246 246 ILE ILE A . n 
A 1 226 ASN 226 247 247 ASN ASN A . n 
A 1 227 PHE 227 248 248 PHE PHE A . n 
A 1 228 HIS 228 249 249 HIS HIS A . n 
A 1 229 VAL 229 250 250 VAL VAL A . n 
A 1 230 THR 230 251 251 THR THR A . n 
A 1 231 VAL 231 252 252 VAL VAL A . n 
A 1 232 LEU 232 253 253 LEU LEU A . n 
A 1 233 PRO 233 254 254 PRO PRO A . n 
A 1 234 GLY 234 255 255 GLY GLY A . n 
A 1 235 ARG 235 256 256 ARG ARG A . n 
A 1 236 VAL 236 257 ?   ?   ?   A . n 
A 1 237 LEU 237 258 ?   ?   ?   A . n 
A 1 238 PRO 238 259 ?   ?   ?   A . n 
A 1 239 ARG 239 260 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1 301 301 NAG NAG A . 
C 3 HOH 1 401 401 HOH HOH A . 
C 3 HOH 2 402 402 HOH HOH A . 
C 3 HOH 3 403 403 HOH HOH A . 
C 3 HOH 4 404 404 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-15 
2 'Structure model' 1 1 2016-06-29 
3 'Structure model' 1 2 2016-07-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -11.7127 -11.9379 -5.3897 0.6795 0.6872 0.6900 -0.1124 -0.0208 -0.0250 4.3294 5.8911 3.9986 
-1.3886 0.3015  0.2078  -0.1506 -0.0377 0.3028  0.0723  -0.1812 -1.2482 -0.6523 0.2991  0.2213  
'X-RAY DIFFRACTION' 2 ? refined -19.7932 -8.4226  -3.4518 1.1770 0.5070 0.7387 -0.0035 0.1789  -0.0096 2.6086 2.5532 4.9600 2.1806 
-0.6990 -2.4311 -0.3304 0.6473  1.0251  1.4401  0.9997  0.7083  -0.7273 -0.0781 0.1687  
'X-RAY DIFFRACTION' 3 ? refined -32.8308 -22.5716 1.7284  0.7194 0.9347 1.0468 0.0105  0.0673  0.3552  1.8624 1.8203 1.9227 
-1.8380 1.2629  -1.3423 -0.2665 -0.4291 -0.0770 0.1257  1.1079  0.9143  -0.0670 -1.2017 -0.8283 
'X-RAY DIFFRACTION' 4 ? refined -21.7143 -20.8917 -9.0330 0.7933 0.5124 0.4773 -0.0467 0.0060  0.0536  4.4832 4.3683 3.1764 0.3721 
0.7389  -1.6366 -0.4513 0.1579  0.0754  -1.1870 0.3786  -0.0402 0.3028  -0.0487 -0.0247 
'X-RAY DIFFRACTION' 5 ? refined -29.1204 -31.4795 11.8721 0.5240 0.5989 0.7053 0.0195  0.0233  0.0409  2.7521 2.4456 4.1653 
-0.5600 -0.7477 1.1139  0.1365  -0.2731 -0.0235 -0.1200 -0.0327 1.0035  -0.3031 -0.2025 -0.0033 
'X-RAY DIFFRACTION' 6 ? refined -28.4206 -53.8714 11.3037 0.6822 0.5950 0.5963 -0.0311 -0.1473 0.1013  2.4857 6.0884 3.4251 2.4794 
-0.9998 0.0134  -0.0416 0.3394  -0.0230 0.2204  0.6175  0.1461  0.5594  -0.1215 -0.4901 
'X-RAY DIFFRACTION' 7 ? refined -28.4925 -60.7477 24.2005 0.7379 0.9761 0.7195 -0.1376 -0.0278 0.3550  1.1900 2.9048 2.5820 1.1630 
-0.0300 -0.3359 -0.2537 -0.6878 -0.7464 0.4062  0.1795  0.0784  0.5035  -0.8843 0.1530  
'X-RAY DIFFRACTION' 8 ? refined -25.4415 -58.0724 17.7859 0.7984 0.5851 0.5590 -0.1476 -0.0876 0.1735  4.1705 3.0493 2.1048 1.4450 
0.0610  -0.7518 0.1868  -0.3348 -0.2417 0.6806  -0.0501 0.1296  1.0989  -0.5245 -0.0572 
'X-RAY DIFFRACTION' 9 ? refined -32.8013 -64.0907 12.3339 1.1244 0.9848 0.7515 -0.2515 -0.2444 0.0979  0.7548 3.2814 1.4290 
-0.5297 -0.8952 1.1582  0.6287  0.8094  -0.3867 0.0673  -0.3044 0.7681  1.4648  -0.7875 0.2585  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 22 through 50 )
;
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 51 through 63 )
;
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 64 through 79 )
;
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 80 through 132 )
;
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 133 through 160 )
;
'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 161 through 195 )
;
'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 196 through 210 )
;
'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 211 through 243 )
;
'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 244 through 256 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.5.8    2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .        5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   ND2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASN 
_pdbx_validate_close_contact.auth_seq_id_1    204 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   C2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   NAG 
_pdbx_validate_close_contact.auth_seq_id_2    301 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.98 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 132 ? ? -130.08 -45.64  
2 1 LYS A 161 ? ? -144.85 -156.66 
3 1 MET A 175 ? ? 70.14   -1.49   
4 1 ASN A 204 ? ? -55.97  -8.90   
5 1 ASN A 205 ? ? 77.40   -11.00  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 34  ? CG  ? A LYS 13  CG  
2   1 Y 1 A LYS 34  ? CD  ? A LYS 13  CD  
3   1 Y 1 A LYS 34  ? CE  ? A LYS 13  CE  
4   1 Y 1 A LYS 34  ? NZ  ? A LYS 13  NZ  
5   1 Y 1 A GLU 37  ? CG  ? A GLU 16  CG  
6   1 Y 1 A GLU 37  ? CD  ? A GLU 16  CD  
7   1 Y 1 A GLU 37  ? OE1 ? A GLU 16  OE1 
8   1 Y 1 A GLU 37  ? OE2 ? A GLU 16  OE2 
9   1 Y 1 A LYS 38  ? CG  ? A LYS 17  CG  
10  1 Y 1 A LYS 38  ? CD  ? A LYS 17  CD  
11  1 Y 1 A LYS 38  ? CE  ? A LYS 17  CE  
12  1 Y 1 A LYS 38  ? NZ  ? A LYS 17  NZ  
13  1 Y 1 A LEU 41  ? CG  ? A LEU 20  CG  
14  1 Y 1 A LEU 41  ? CD1 ? A LEU 20  CD1 
15  1 Y 1 A LEU 41  ? CD2 ? A LEU 20  CD2 
16  1 Y 1 A ASP 46  ? CG  ? A ASP 25  CG  
17  1 Y 1 A ASP 46  ? OD1 ? A ASP 25  OD1 
18  1 Y 1 A ASP 46  ? OD2 ? A ASP 25  OD2 
19  1 Y 1 A LYS 48  ? CG  ? A LYS 27  CG  
20  1 Y 1 A LYS 48  ? CD  ? A LYS 27  CD  
21  1 Y 1 A LYS 48  ? CE  ? A LYS 27  CE  
22  1 Y 1 A LYS 48  ? NZ  ? A LYS 27  NZ  
23  1 Y 1 A LYS 51  ? CG  ? A LYS 30  CG  
24  1 Y 1 A LYS 51  ? CD  ? A LYS 30  CD  
25  1 Y 1 A LYS 51  ? CE  ? A LYS 30  CE  
26  1 Y 1 A LYS 51  ? NZ  ? A LYS 30  NZ  
27  1 Y 1 A GLU 55  ? CG  ? A GLU 34  CG  
28  1 Y 1 A GLU 55  ? CD  ? A GLU 34  CD  
29  1 Y 1 A GLU 55  ? OE1 ? A GLU 34  OE1 
30  1 Y 1 A GLU 55  ? OE2 ? A GLU 34  OE2 
31  1 Y 1 A ARG 56  ? NE  ? A ARG 35  NE  
32  1 Y 1 A ARG 56  ? CZ  ? A ARG 35  CZ  
33  1 Y 1 A ARG 56  ? NH1 ? A ARG 35  NH1 
34  1 Y 1 A ARG 56  ? NH2 ? A ARG 35  NH2 
35  1 Y 1 A LYS 62  ? CG  ? A LYS 41  CG  
36  1 Y 1 A LYS 62  ? CD  ? A LYS 41  CD  
37  1 Y 1 A LYS 62  ? CE  ? A LYS 41  CE  
38  1 Y 1 A LYS 62  ? NZ  ? A LYS 41  NZ  
39  1 Y 1 A GLU 66  ? CG  ? A GLU 45  CG  
40  1 Y 1 A GLU 66  ? CD  ? A GLU 45  CD  
41  1 Y 1 A GLU 66  ? OE1 ? A GLU 45  OE1 
42  1 Y 1 A GLU 66  ? OE2 ? A GLU 45  OE2 
43  1 Y 1 A SER 68  ? OG  ? A SER 47  OG  
44  1 Y 1 A ASN 70  ? CG  ? A ASN 49  CG  
45  1 Y 1 A ASN 70  ? OD1 ? A ASN 49  OD1 
46  1 Y 1 A ASN 70  ? ND2 ? A ASN 49  ND2 
47  1 Y 1 A GLU 71  ? CG  ? A GLU 50  CG  
48  1 Y 1 A GLU 71  ? CD  ? A GLU 50  CD  
49  1 Y 1 A GLU 71  ? OE1 ? A GLU 50  OE1 
50  1 Y 1 A GLU 71  ? OE2 ? A GLU 50  OE2 
51  1 Y 1 A ASP 72  ? CG  ? A ASP 51  CG  
52  1 Y 1 A ASP 72  ? OD1 ? A ASP 51  OD1 
53  1 Y 1 A ASP 72  ? OD2 ? A ASP 51  OD2 
54  1 Y 1 A LYS 95  ? CG  ? A LYS 74  CG  
55  1 Y 1 A LYS 95  ? CD  ? A LYS 74  CD  
56  1 Y 1 A LYS 95  ? CE  ? A LYS 74  CE  
57  1 Y 1 A LYS 95  ? NZ  ? A LYS 74  NZ  
58  1 Y 1 A ASP 101 ? CG  ? A ASP 80  CG  
59  1 Y 1 A ASP 101 ? OD1 ? A ASP 80  OD1 
60  1 Y 1 A ASP 101 ? OD2 ? A ASP 80  OD2 
61  1 Y 1 A LEU 106 ? CG  ? A LEU 85  CG  
62  1 Y 1 A LEU 106 ? CD1 ? A LEU 85  CD1 
63  1 Y 1 A LEU 106 ? CD2 ? A LEU 85  CD2 
64  1 Y 1 A LYS 109 ? CG  ? A LYS 88  CG  
65  1 Y 1 A LYS 109 ? CD  ? A LYS 88  CD  
66  1 Y 1 A LYS 109 ? CE  ? A LYS 88  CE  
67  1 Y 1 A LYS 109 ? NZ  ? A LYS 88  NZ  
68  1 Y 1 A GLU 110 ? CG  ? A GLU 89  CG  
69  1 Y 1 A GLU 110 ? CD  ? A GLU 89  CD  
70  1 Y 1 A GLU 110 ? OE1 ? A GLU 89  OE1 
71  1 Y 1 A GLU 110 ? OE2 ? A GLU 89  OE2 
72  1 Y 1 A LYS 131 ? CG  ? A LYS 110 CG  
73  1 Y 1 A LYS 131 ? CD  ? A LYS 110 CD  
74  1 Y 1 A LYS 131 ? CE  ? A LYS 110 CE  
75  1 Y 1 A LYS 131 ? NZ  ? A LYS 110 NZ  
76  1 Y 1 A LYS 138 ? CG  ? A LYS 117 CG  
77  1 Y 1 A LYS 138 ? CD  ? A LYS 117 CD  
78  1 Y 1 A LYS 138 ? CE  ? A LYS 117 CE  
79  1 Y 1 A LYS 138 ? NZ  ? A LYS 117 NZ  
80  1 Y 1 A LYS 150 ? CG  ? A LYS 129 CG  
81  1 Y 1 A LYS 150 ? CD  ? A LYS 129 CD  
82  1 Y 1 A LYS 150 ? CE  ? A LYS 129 CE  
83  1 Y 1 A LYS 150 ? NZ  ? A LYS 129 NZ  
84  1 Y 1 A LYS 153 ? CG  ? A LYS 132 CG  
85  1 Y 1 A LYS 153 ? CD  ? A LYS 132 CD  
86  1 Y 1 A LYS 153 ? CE  ? A LYS 132 CE  
87  1 Y 1 A LYS 153 ? NZ  ? A LYS 132 NZ  
88  1 Y 1 A LYS 161 ? CG  ? A LYS 140 CG  
89  1 Y 1 A LYS 161 ? CD  ? A LYS 140 CD  
90  1 Y 1 A LYS 161 ? CE  ? A LYS 140 CE  
91  1 Y 1 A LYS 161 ? NZ  ? A LYS 140 NZ  
92  1 Y 1 A TYR 163 ? CG  ? A TYR 142 CG  
93  1 Y 1 A TYR 163 ? CD1 ? A TYR 142 CD1 
94  1 Y 1 A TYR 163 ? CD2 ? A TYR 142 CD2 
95  1 Y 1 A TYR 163 ? CE1 ? A TYR 142 CE1 
96  1 Y 1 A TYR 163 ? CE2 ? A TYR 142 CE2 
97  1 Y 1 A TYR 163 ? CZ  ? A TYR 142 CZ  
98  1 Y 1 A TYR 163 ? OH  ? A TYR 142 OH  
99  1 Y 1 A ASP 164 ? CG  ? A ASP 143 CG  
100 1 Y 1 A ASP 164 ? OD1 ? A ASP 143 OD1 
101 1 Y 1 A ASP 164 ? OD2 ? A ASP 143 OD2 
102 1 Y 1 A GLU 171 ? CG  ? A GLU 150 CG  
103 1 Y 1 A GLU 171 ? CD  ? A GLU 150 CD  
104 1 Y 1 A GLU 171 ? OE1 ? A GLU 150 OE1 
105 1 Y 1 A GLU 171 ? OE2 ? A GLU 150 OE2 
106 1 Y 1 A GLN 174 ? CG  ? A GLN 153 CG  
107 1 Y 1 A GLN 174 ? CD  ? A GLN 153 CD  
108 1 Y 1 A GLN 174 ? OE1 ? A GLN 153 OE1 
109 1 Y 1 A GLN 174 ? NE2 ? A GLN 153 NE2 
110 1 Y 1 A GLU 176 ? CG  ? A GLU 155 CG  
111 1 Y 1 A GLU 176 ? CD  ? A GLU 155 CD  
112 1 Y 1 A GLU 176 ? OE1 ? A GLU 155 OE1 
113 1 Y 1 A GLU 176 ? OE2 ? A GLU 155 OE2 
114 1 Y 1 A GLU 183 ? CG  ? A GLU 162 CG  
115 1 Y 1 A GLU 183 ? CD  ? A GLU 162 CD  
116 1 Y 1 A GLU 183 ? OE1 ? A GLU 162 OE1 
117 1 Y 1 A GLU 183 ? OE2 ? A GLU 162 OE2 
118 1 Y 1 A ASN 205 ? CG  ? A ASN 184 CG  
119 1 Y 1 A ASN 205 ? OD1 ? A ASN 184 OD1 
120 1 Y 1 A ASN 205 ? ND2 ? A ASN 184 ND2 
121 1 Y 1 A GLU 215 ? CG  ? A GLU 194 CG  
122 1 Y 1 A GLU 215 ? CD  ? A GLU 194 CD  
123 1 Y 1 A GLU 215 ? OE1 ? A GLU 194 OE1 
124 1 Y 1 A GLU 215 ? OE2 ? A GLU 194 OE2 
125 1 Y 1 A LYS 220 ? CG  ? A LYS 199 CG  
126 1 Y 1 A LYS 220 ? CD  ? A LYS 199 CD  
127 1 Y 1 A LYS 220 ? CE  ? A LYS 199 CE  
128 1 Y 1 A LYS 220 ? NZ  ? A LYS 199 NZ  
129 1 Y 1 A ASN 239 ? CG  ? A ASN 218 CG  
130 1 Y 1 A ASN 239 ? OD1 ? A ASN 218 OD1 
131 1 Y 1 A ASN 239 ? ND2 ? A ASN 218 ND2 
132 1 Y 1 A ARG 256 ? CG  ? A ARG 235 CG  
133 1 Y 1 A ARG 256 ? CD  ? A ARG 235 CD  
134 1 Y 1 A ARG 256 ? NE  ? A ARG 235 NE  
135 1 Y 1 A ARG 256 ? CZ  ? A ARG 235 CZ  
136 1 Y 1 A ARG 256 ? NH1 ? A ARG 235 NH1 
137 1 Y 1 A ARG 256 ? NH2 ? A ARG 235 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A VAL 257 ? A VAL 236 
2 1 Y 1 A LEU 258 ? A LEU 237 
3 1 Y 1 A PRO 259 ? A PRO 238 
4 1 Y 1 A ARG 260 ? A ARG 239 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-ACETYL-D-GLUCOSAMINE NAG 
3 water                  HOH 
#