data_5FD3
# 
_entry.id   5FD3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FD3         
WWPDB D_1000216360 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5FD3 
_pdbx_database_status.recvd_initial_deposition_date   2015-12-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Marceau, A.H.'    1 ? 
'Felthousen, J.G.' 2 ? 
'Goetsch, P.D.'    3 ? 
'Lee, H.'          4 ? 
'Tripathi, S.M.'   5 ? 
'Strome, S.'       6 ? 
'Litovchick, L.'   7 ? 
'Rubin, S.M.'      8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                12301 
_citation.page_last                 12301 
_citation.title                     'Structural basis for LIN54 recognition of CHR elements in cell cycle-regulated promoters.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/ncomms12301 
_citation.pdbx_database_id_PubMed   27465258 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Marceau, A.H.'    1 
primary 'Felthousen, J.G.' 2 
primary 'Goetsch, P.D.'    3 
primary 'Iness, A.N.'      4 
primary 'Lee, H.W.'        5 
primary 'Tripathi, S.M.'   6 
primary 'Strome, S.'       7 
primary 'Litovchick, L.'   8 
primary 'Rubin, S.M.'      9 
# 
_cell.angle_alpha                  98.400 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   102.530 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  106.570 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5FD3 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     39.320 
_cell.length_a_esd                 ? 
_cell.length_b                     53.880 
_cell.length_b_esd                 ? 
_cell.length_c                     67.120 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5FD3 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein lin-54 homolog'                                15331.646 2  ? ? 'tesmin domain (UNP residues 515-646)' 
? 
2 polymer     syn 
;DNA (5'-D(*GP*AP*GP*TP*TP*TP*GP*AP*AP*AP*CP*T)-3')
;
3701.440  2  ? ? ?                                      ? 
3 polymer     syn 
;DNA (5'-D(*CP*AP*GP*TP*TP*TP*CP*AP*AP*AP*CP*TP*C)-3')
;
3910.573  2  ? ? ?                                      ? 
4 non-polymer syn 'ZINC ION'                                              65.409    12 ? ? ?                                      
? 
5 water       nat water                                                   18.015    56 ? ? ?                                      
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CXC domain-containing protein 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GEFSESASRPRKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGES
DRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLAD
;
;GEFSESASRPRKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGES
DRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLAD
;
A,B ? 
2 polydeoxyribonucleotide no no '(DG)(DA)(DG)(DT)(DT)(DT)(DG)(DA)(DA)(DA)(DC)(DT)' GAGTTTGAAACT C,H ? 
3 polydeoxyribonucleotide no no '(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DA)(DA)(DA)(DC)(DT)(DC)' CAGTTTCAAACTC D,I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLU n 
1 3   PHE n 
1 4   SER n 
1 5   GLU n 
1 6   SER n 
1 7   ALA n 
1 8   SER n 
1 9   ARG n 
1 10  PRO n 
1 11  ARG n 
1 12  LYS n 
1 13  PRO n 
1 14  CYS n 
1 15  ASN n 
1 16  CYS n 
1 17  THR n 
1 18  LYS n 
1 19  SER n 
1 20  LEU n 
1 21  CYS n 
1 22  LEU n 
1 23  LYS n 
1 24  LEU n 
1 25  TYR n 
1 26  CYS n 
1 27  ASP n 
1 28  CYS n 
1 29  PHE n 
1 30  ALA n 
1 31  ASN n 
1 32  GLY n 
1 33  GLU n 
1 34  PHE n 
1 35  CYS n 
1 36  ASN n 
1 37  ASN n 
1 38  CYS n 
1 39  ASN n 
1 40  CYS n 
1 41  THR n 
1 42  ASN n 
1 43  CYS n 
1 44  TYR n 
1 45  ASN n 
1 46  ASN n 
1 47  LEU n 
1 48  GLU n 
1 49  HIS n 
1 50  GLU n 
1 51  ASN n 
1 52  GLU n 
1 53  ARG n 
1 54  GLN n 
1 55  LYS n 
1 56  ALA n 
1 57  ILE n 
1 58  LYS n 
1 59  ALA n 
1 60  CYS n 
1 61  LEU n 
1 62  ASP n 
1 63  ARG n 
1 64  ASN n 
1 65  PRO n 
1 66  GLU n 
1 67  ALA n 
1 68  PHE n 
1 69  LYS n 
1 70  PRO n 
1 71  LYS n 
1 72  ILE n 
1 73  GLY n 
1 74  LYS n 
1 75  GLY n 
1 76  LYS n 
1 77  GLU n 
1 78  GLY n 
1 79  GLU n 
1 80  SER n 
1 81  ASP n 
1 82  ARG n 
1 83  ARG n 
1 84  HIS n 
1 85  SER n 
1 86  LYS n 
1 87  GLY n 
1 88  CYS n 
1 89  ASN n 
1 90  CYS n 
1 91  LYS n 
1 92  ARG n 
1 93  SER n 
1 94  GLY n 
1 95  CYS n 
1 96  LEU n 
1 97  LYS n 
1 98  ASN n 
1 99  TYR n 
1 100 CYS n 
1 101 GLU n 
1 102 CYS n 
1 103 TYR n 
1 104 GLU n 
1 105 ALA n 
1 106 LYS n 
1 107 ILE n 
1 108 MET n 
1 109 CYS n 
1 110 SER n 
1 111 SER n 
1 112 ILE n 
1 113 CYS n 
1 114 LYS n 
1 115 CYS n 
1 116 ILE n 
1 117 GLY n 
1 118 CYS n 
1 119 LYS n 
1 120 ASN n 
1 121 PHE n 
1 122 GLU n 
1 123 GLU n 
1 124 SER n 
1 125 PRO n 
1 126 GLU n 
1 127 ARG n 
1 128 LYS n 
1 129 THR n 
1 130 LEU n 
1 131 MET n 
1 132 HIS n 
1 133 LEU n 
1 134 ALA n 
1 135 ASP n 
2 1   DG  n 
2 2   DA  n 
2 3   DG  n 
2 4   DT  n 
2 5   DT  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DA  n 
2 10  DA  n 
2 11  DC  n 
2 12  DT  n 
3 1   DC  n 
3 2   DA  n 
3 3   DG  n 
3 4   DT  n 
3 5   DT  n 
3 6   DT  n 
3 7   DC  n 
3 8   DA  n 
3 9   DA  n 
3 10  DA  n 
3 11  DC  n 
3 12  DT  n 
3 13  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   135 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'LIN54, CXCDC1, KIAA2037' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEV 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'Homo sapiens' Human 9606 ? 
3 1 sample 1 13 'Homo sapiens' Human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP LIN54_HUMAN Q6MZP7 ? 1 
;SESASRPRKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRR
HSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLAD
;
515 
2 PDB 5FD3        5FD3   ? 2 ? 1   
3 PDB 5FD3        5FD3   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5FD3 A 4 ? 135 ? Q6MZP7 515 ? 646 ? 515 646 
2 1 5FD3 B 4 ? 135 ? Q6MZP7 515 ? 646 ? 515 646 
3 2 5FD3 C 1 ? 12  ? 5FD3   1   ? 12  ? 1   12  
4 3 5FD3 D 1 ? 13  ? 5FD3   1   ? 13  ? 1   13  
5 2 5FD3 H 1 ? 12  ? 5FD3   1   ? 12  ? 1   12  
6 3 5FD3 I 1 ? 13  ? 5FD3   1   ? 13  ? 1   13  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5FD3 GLY A 1 ? UNP Q6MZP7 ? ? 'expression tag' 512 1 
1 5FD3 GLU A 2 ? UNP Q6MZP7 ? ? 'expression tag' 513 2 
1 5FD3 PHE A 3 ? UNP Q6MZP7 ? ? 'expression tag' 514 3 
2 5FD3 GLY B 1 ? UNP Q6MZP7 ? ? 'expression tag' 512 4 
2 5FD3 GLU B 2 ? UNP Q6MZP7 ? ? 'expression tag' 513 5 
2 5FD3 PHE B 3 ? UNP Q6MZP7 ? ? 'expression tag' 514 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5FD3 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.83 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.54 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '21% PEG 3350, 310 mM Magnesium Chloride Hexahydrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           75 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-06-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03318 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.03318 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5FD3 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.42 
_reflns.d_resolution_low                 63.88 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       18229 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.6 
_reflns.pdbx_Rmerge_I_obs                0.060 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.86 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.Rmerge_I_obs                0.405 
_reflns_shell.d_res_high                  2.42 
_reflns_shell.d_res_low                   2.55 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_sigI_obs         2.2 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_redundancy             2.6 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.percent_possible_all        94.4 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.percent_possible_obs        ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                153.380 
_refine.B_iso_mean                               61.4305 
_refine.B_iso_min                                20.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5FD3 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.4200 
_refine.ls_d_res_low                             36 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18145 
_refine.ls_number_reflns_R_free                  908 
_refine.ls_number_reflns_R_work                  17237 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    94.7200 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1836 
_refine.ls_R_factor_R_free                       0.2381 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1806 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.980 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4RKH 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.2300 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3800 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.4200 
_refine_hist.d_res_low                        36 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             56 
_refine_hist.number_atoms_total               2704 
_refine_hist.pdbx_number_residues_total       266 
_refine_hist.pdbx_B_iso_mean_ligand           49.82 
_refine_hist.pdbx_B_iso_mean_solvent          48.70 
_refine_hist.pdbx_number_atoms_protein        1657 
_refine_hist.pdbx_number_atoms_nucleic_acid   979 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  ? 2773 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.210  ? 3925 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.050  ? 424  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 345  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 23.320 ? 1110 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 916 7.179 ? ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 TORSIONAL B 916 7.179 ? ? ? ? ? 
3 'X-RAY DIFFRACTION' 2 1 TORSIONAL C 232 7.179 ? ? ? ? ? 
4 'X-RAY DIFFRACTION' 2 2 TORSIONAL H 232 7.179 ? ? ? ? ? 
5 'X-RAY DIFFRACTION' 3 1 TORSIONAL D 212 7.179 ? ? ? ? ? 
6 'X-RAY DIFFRACTION' 3 2 TORSIONAL I 212 7.179 ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.4201 2.5717 . . 156 2859 94.0000 . . . 0.3540 . 0.2739 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5717 2.7702 . . 137 2863 95.0000 . . . 0.3125 . 0.2485 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7702 3.0488 . . 142 2912 95.0000 . . . 0.3252 . 0.2510 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0488 3.4897 . . 152 2814 94.0000 . . . 0.3052 . 0.2012 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4897 4.3954 . . 169 2918 96.0000 . . . 0.2018 . 0.1519 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3954 36     . . 152 2871 95.0000 . . . 0.1862 . 0.1417 . . . . . . . . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 'chain A' 
1 2 'chain B' 
2 1 'chain C' 
2 2 'chain H' 
3 1 'chain D' 
3 2 'chain I' 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? A 522 A 643 'chain A' ? ? ? ? ? ? ? ? 
1 2 1 ? B 522 B 706 'chain B' ? ? ? ? ? ? ? ? 
2 1 1 ? C 1   C 12  'chain C' ? ? ? ? ? ? ? ? 
2 2 1 ? H 1   H 12  'chain H' ? ? ? ? ? ? ? ? 
3 1 1 ? D 1   D 13  'chain D' ? ? ? ? ? ? ? ? 
3 2 1 ? I 1   I 13  'chain I' ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                     5FD3 
_struct.title                        'Structure of Lin54 tesmin domain bound to DNA' 
_struct.pdbx_descriptor              'Protein lin-54 homolog/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5FD3 
_struct_keywords.text            'transcription factor, tesmin domain, TRANSCRIPTION-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
V N N 5 ? 
W N N 5 ? 
X N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 26  ? ASN A 31  ? CYS A 537 ASN A 542 1 ? 6  
HELX_P HELX_P2  AA2 ASN A 46  ? GLU A 48  ? ASN A 557 GLU A 559 5 ? 3  
HELX_P HELX_P3  AA3 HIS A 49  ? ASN A 64  ? HIS A 560 ASN A 575 1 ? 16 
HELX_P HELX_P4  AA4 CYS A 100 ? ALA A 105 ? CYS A 611 ALA A 616 1 ? 6  
HELX_P HELX_P5  AA5 SER A 124 ? HIS A 132 ? SER A 635 HIS A 643 1 ? 9  
HELX_P HELX_P6  AA6 CYS B 26  ? ASN B 31  ? CYS B 537 ASN B 542 1 ? 6  
HELX_P HELX_P7  AA7 ASN B 46  ? GLU B 48  ? ASN B 557 GLU B 559 5 ? 3  
HELX_P HELX_P8  AA8 HIS B 49  ? ASN B 64  ? HIS B 560 ASN B 575 1 ? 16 
HELX_P HELX_P9  AA9 CYS B 100 ? ALA B 105 ? CYS B 611 ALA B 616 1 ? 6  
HELX_P HELX_P10 AB1 SER B 124 ? HIS B 132 ? SER B 635 HIS B 643 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 14  SG ? ? ? 1_555 G ZN .  ZN ? ? A CYS 525 A ZN 701 1_555 ? ? ? ? ? ? ?            2.498 ? 
metalc2  metalc ? ? A CYS 14  SG ? ? ? 1_555 I ZN .  ZN ? ? A CYS 525 A ZN 703 1_555 ? ? ? ? ? ? ?            2.325 ? 
metalc3  metalc ? ? A CYS 16  SG ? ? ? 1_555 G ZN .  ZN ? ? A CYS 527 A ZN 701 1_555 ? ? ? ? ? ? ?            2.085 ? 
metalc4  metalc ? ? A CYS 21  SG ? ? ? 1_555 G ZN .  ZN ? ? A CYS 532 A ZN 701 1_555 ? ? ? ? ? ? ?            2.421 ? 
metalc5  metalc ? ? A CYS 21  SG ? ? ? 1_555 H ZN .  ZN ? ? A CYS 532 A ZN 702 1_555 ? ? ? ? ? ? ?            2.397 ? 
metalc6  metalc ? ? A CYS 26  SG ? ? ? 1_555 G ZN .  ZN ? ? A CYS 537 A ZN 701 1_555 ? ? ? ? ? ? ?            2.330 ? 
metalc7  metalc ? ? A CYS 28  SG ? ? ? 1_555 I ZN .  ZN ? ? A CYS 539 A ZN 703 1_555 ? ? ? ? ? ? ?            2.303 ? 
metalc8  metalc ? ? A CYS 35  SG ? ? ? 1_555 H ZN .  ZN ? ? A CYS 546 A ZN 702 1_555 ? ? ? ? ? ? ?            2.601 ? 
metalc9  metalc ? ? A CYS 35  SG ? ? ? 1_555 I ZN .  ZN ? ? A CYS 546 A ZN 703 1_555 ? ? ? ? ? ? ?            2.360 ? 
metalc10 metalc ? ? A CYS 38  SG ? ? ? 1_555 I ZN .  ZN ? ? A CYS 549 A ZN 703 1_555 ? ? ? ? ? ? ?            2.314 ? 
metalc11 metalc ? ? A CYS 40  SG ? ? ? 1_555 H ZN .  ZN ? ? A CYS 551 A ZN 702 1_555 ? ? ? ? ? ? ?            2.227 ? 
metalc12 metalc ? ? A CYS 43  SG ? ? ? 1_555 H ZN .  ZN ? ? A CYS 554 A ZN 702 1_555 ? ? ? ? ? ? ?            2.422 ? 
metalc13 metalc ? ? A CYS 88  SG ? ? ? 1_555 J ZN .  ZN ? ? A CYS 599 A ZN 704 1_555 ? ? ? ? ? ? ?            2.280 ? 
metalc14 metalc ? ? A CYS 88  SG ? ? ? 1_555 L ZN .  ZN ? ? A CYS 599 A ZN 706 1_555 ? ? ? ? ? ? ?            2.522 ? 
metalc15 metalc ? ? A CYS 90  SG ? ? ? 1_555 J ZN .  ZN ? ? A CYS 601 A ZN 704 1_555 ? ? ? ? ? ? ?            2.382 ? 
metalc16 metalc ? ? A CYS 95  SG ? ? ? 1_555 J ZN .  ZN ? ? A CYS 606 A ZN 704 1_555 ? ? ? ? ? ? ?            2.416 ? 
metalc17 metalc ? ? A CYS 95  SG ? ? ? 1_555 K ZN .  ZN ? ? A CYS 606 A ZN 705 1_555 ? ? ? ? ? ? ?            2.488 ? 
metalc18 metalc ? ? A CYS 100 SG ? ? ? 1_555 J ZN .  ZN ? ? A CYS 611 A ZN 704 1_555 ? ? ? ? ? ? ?            2.248 ? 
metalc19 metalc ? ? A CYS 102 SG ? ? ? 1_555 L ZN .  ZN ? ? A CYS 613 A ZN 706 1_555 ? ? ? ? ? ? ?            2.178 ? 
metalc20 metalc ? ? A CYS 109 SG ? ? ? 1_555 K ZN .  ZN ? ? A CYS 620 A ZN 705 1_555 ? ? ? ? ? ? ?            2.222 ? 
metalc21 metalc ? ? A CYS 109 SG ? ? ? 1_555 L ZN .  ZN ? ? A CYS 620 A ZN 706 1_555 ? ? ? ? ? ? ?            2.367 ? 
metalc22 metalc ? ? A CYS 113 SG ? ? ? 1_555 L ZN .  ZN ? ? A CYS 624 A ZN 706 1_555 ? ? ? ? ? ? ?            2.406 ? 
metalc23 metalc ? ? A CYS 115 SG ? ? ? 1_555 K ZN .  ZN ? ? A CYS 626 A ZN 705 1_555 ? ? ? ? ? ? ?            2.064 ? 
metalc24 metalc ? ? A CYS 118 SG ? ? ? 1_555 K ZN .  ZN ? ? A CYS 629 A ZN 705 1_555 ? ? ? ? ? ? ?            2.371 ? 
metalc25 metalc ? ? B CYS 14  SG ? ? ? 1_555 O ZN .  ZN ? ? B CYS 525 B ZN 703 1_555 ? ? ? ? ? ? ?            2.444 ? 
metalc26 metalc ? ? B CYS 14  SG ? ? ? 1_555 M ZN .  ZN ? ? B CYS 525 B ZN 701 1_555 ? ? ? ? ? ? ?            2.381 ? 
metalc27 metalc ? ? B CYS 16  SG ? ? ? 1_555 M ZN .  ZN ? ? B CYS 527 B ZN 701 1_555 ? ? ? ? ? ? ?            2.334 ? 
metalc28 metalc ? ? B CYS 21  SG ? ? ? 1_555 N ZN .  ZN ? ? B CYS 532 B ZN 702 1_555 ? ? ? ? ? ? ?            2.338 ? 
metalc29 metalc ? ? B CYS 21  SG ? ? ? 1_555 M ZN .  ZN ? ? B CYS 532 B ZN 701 1_555 ? ? ? ? ? ? ?            2.510 ? 
metalc30 metalc ? ? B CYS 26  SG ? ? ? 1_555 M ZN .  ZN ? ? B CYS 537 B ZN 701 1_555 ? ? ? ? ? ? ?            2.370 ? 
metalc31 metalc ? ? B CYS 28  SG ? ? ? 1_555 O ZN .  ZN ? ? B CYS 539 B ZN 703 1_555 ? ? ? ? ? ? ?            2.330 ? 
metalc32 metalc ? ? B CYS 35  SG ? ? ? 1_555 O ZN .  ZN ? ? B CYS 546 B ZN 703 1_555 ? ? ? ? ? ? ?            2.478 ? 
metalc33 metalc ? ? B CYS 35  SG ? ? ? 1_555 N ZN .  ZN ? ? B CYS 546 B ZN 702 1_555 ? ? ? ? ? ? ?            2.354 ? 
metalc34 metalc ? ? B CYS 38  SG ? ? ? 1_555 O ZN .  ZN ? ? B CYS 549 B ZN 703 1_555 ? ? ? ? ? ? ?            2.236 ? 
metalc35 metalc ? ? B CYS 40  SG ? ? ? 1_555 N ZN .  ZN ? ? B CYS 551 B ZN 702 1_555 ? ? ? ? ? ? ?            2.040 ? 
metalc36 metalc ? ? B CYS 43  SG ? ? ? 1_555 N ZN .  ZN ? ? B CYS 554 B ZN 702 1_555 ? ? ? ? ? ? ?            2.534 ? 
metalc37 metalc ? ? B CYS 88  SG ? ? ? 1_555 R ZN .  ZN ? ? B CYS 599 B ZN 706 1_555 ? ? ? ? ? ? ?            2.285 ? 
metalc38 metalc ? ? B CYS 88  SG ? ? ? 1_555 P ZN .  ZN ? ? B CYS 599 B ZN 704 1_555 ? ? ? ? ? ? ?            2.382 ? 
metalc39 metalc ? ? B CYS 90  SG ? ? ? 1_555 P ZN .  ZN ? ? B CYS 601 B ZN 704 1_555 ? ? ? ? ? ? ?            2.236 ? 
metalc40 metalc ? ? B CYS 95  SG ? ? ? 1_555 P ZN .  ZN ? ? B CYS 606 B ZN 704 1_555 ? ? ? ? ? ? ?            2.709 ? 
metalc41 metalc ? ? B CYS 95  SG ? ? ? 1_555 Q ZN .  ZN ? ? B CYS 606 B ZN 705 1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc42 metalc ? ? B CYS 100 SG ? ? ? 1_555 P ZN .  ZN ? ? B CYS 611 B ZN 704 1_555 ? ? ? ? ? ? ?            2.159 ? 
metalc43 metalc ? ? B CYS 102 SG ? ? ? 1_555 R ZN .  ZN ? ? B CYS 613 B ZN 706 1_555 ? ? ? ? ? ? ?            2.218 ? 
metalc44 metalc ? ? B CYS 109 SG ? ? ? 1_555 R ZN .  ZN ? ? B CYS 620 B ZN 706 1_555 ? ? ? ? ? ? ?            2.573 ? 
metalc45 metalc ? ? B CYS 109 SG ? ? ? 1_555 Q ZN .  ZN ? ? B CYS 620 B ZN 705 1_555 ? ? ? ? ? ? ?            2.212 ? 
metalc46 metalc ? ? B CYS 113 SG ? ? ? 1_555 R ZN .  ZN ? ? B CYS 624 B ZN 706 1_555 ? ? ? ? ? ? ?            2.337 ? 
metalc47 metalc ? ? B CYS 115 SG ? ? ? 1_555 Q ZN .  ZN ? ? B CYS 626 B ZN 705 1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc48 metalc ? ? B CYS 118 SG ? ? ? 1_555 Q ZN .  ZN ? ? B CYS 629 B ZN 705 1_555 ? ? ? ? ? ? ?            2.562 ? 
hydrog1  hydrog ? ? C DG  1   N1 ? ? ? 1_555 D DC 13 N3 ? ? C DG  1   D DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  1   N2 ? ? ? 1_555 D DC 13 O2 ? ? C DG  1   D DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  1   O6 ? ? ? 1_555 D DC 13 N4 ? ? C DG  1   D DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DA  2   N1 ? ? ? 1_555 D DT 12 N3 ? ? C DA  2   D DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DA  2   N6 ? ? ? 1_555 D DT 12 O4 ? ? C DA  2   D DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DG  3   N1 ? ? ? 1_555 D DC 11 N3 ? ? C DG  3   D DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DG  3   N2 ? ? ? 1_555 D DC 11 O2 ? ? C DG  3   D DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DG  3   O6 ? ? ? 1_555 D DC 11 N4 ? ? C DG  3   D DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DT  4   N3 ? ? ? 1_555 D DA 10 N1 ? ? C DT  4   D DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DT  4   O4 ? ? ? 1_555 D DA 10 N6 ? ? C DT  4   D DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DT  5   N3 ? ? ? 1_555 D DA 9  N1 ? ? C DT  5   D DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DT  5   O4 ? ? ? 1_555 D DA 9  N6 ? ? C DT  5   D DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DT  6   N3 ? ? ? 1_555 D DA 8  N1 ? ? C DT  6   D DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DT  6   O4 ? ? ? 1_555 D DA 8  N6 ? ? C DT  6   D DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DG  7   N1 ? ? ? 1_555 D DC 7  N3 ? ? C DG  7   D DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DG  7   N2 ? ? ? 1_555 D DC 7  O2 ? ? C DG  7   D DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DG  7   O6 ? ? ? 1_555 D DC 7  N4 ? ? C DG  7   D DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DA  8   N1 ? ? ? 1_555 D DT 6  N3 ? ? C DA  8   D DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DA  8   N6 ? ? ? 1_555 D DT 6  O4 ? ? C DA  8   D DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DA  9   N1 ? ? ? 1_555 D DT 5  N3 ? ? C DA  9   D DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DA  9   N6 ? ? ? 1_555 D DT 5  O4 ? ? C DA  9   D DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DA  10  N1 ? ? ? 1_555 D DT 4  N3 ? ? C DA  10  D DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DA  10  N6 ? ? ? 1_555 D DT 4  O4 ? ? C DA  10  D DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DC  11  N3 ? ? ? 1_555 D DG 3  N1 ? ? C DC  11  D DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DC  11  N4 ? ? ? 1_555 D DG 3  O6 ? ? C DC  11  D DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DC  11  O2 ? ? ? 1_555 D DG 3  N2 ? ? C DC  11  D DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DT  12  N3 ? ? ? 1_555 D DA 2  N1 ? ? C DT  12  D DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DT  12  O4 ? ? ? 1_555 D DA 2  N6 ? ? C DT  12  D DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? E DG  1   N1 ? ? ? 1_555 F DC 13 N3 ? ? H DG  1   I DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? E DG  1   N2 ? ? ? 1_555 F DC 13 O2 ? ? H DG  1   I DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? E DG  1   O6 ? ? ? 1_555 F DC 13 N4 ? ? H DG  1   I DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? E DA  2   N1 ? ? ? 1_555 F DT 12 N3 ? ? H DA  2   I DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DA  2   N6 ? ? ? 1_555 F DT 12 O4 ? ? H DA  2   I DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DG  3   N1 ? ? ? 1_555 F DC 11 N3 ? ? H DG  3   I DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E DG  3   N2 ? ? ? 1_555 F DC 11 O2 ? ? H DG  3   I DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DG  3   O6 ? ? ? 1_555 F DC 11 N4 ? ? H DG  3   I DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DT  4   N3 ? ? ? 1_555 F DA 10 N1 ? ? H DT  4   I DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DT  4   O4 ? ? ? 1_555 F DA 10 N6 ? ? H DT  4   I DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DT  5   N3 ? ? ? 1_555 F DA 9  N1 ? ? H DT  5   I DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DT  5   O4 ? ? ? 1_555 F DA 9  N6 ? ? H DT  5   I DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DT  6   N3 ? ? ? 1_555 F DA 8  N1 ? ? H DT  6   I DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DT  6   O4 ? ? ? 1_555 F DA 8  N6 ? ? H DT  6   I DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DG  7   N1 ? ? ? 1_555 F DC 7  N3 ? ? H DG  7   I DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? E DG  7   N2 ? ? ? 1_555 F DC 7  O2 ? ? H DG  7   I DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? E DG  7   O6 ? ? ? 1_555 F DC 7  N4 ? ? H DG  7   I DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? E DA  8   N1 ? ? ? 1_555 F DT 6  N3 ? ? H DA  8   I DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DA  8   N6 ? ? ? 1_555 F DT 6  O4 ? ? H DA  8   I DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DA  9   N1 ? ? ? 1_555 F DT 5  N3 ? ? H DA  9   I DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E DA  9   N6 ? ? ? 1_555 F DT 5  O4 ? ? H DA  9   I DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? E DA  10  N1 ? ? ? 1_555 F DT 4  N3 ? ? H DA  10  I DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? E DA  10  N6 ? ? ? 1_555 F DT 4  O4 ? ? H DA  10  I DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? E DC  11  N3 ? ? ? 1_555 F DG 3  N1 ? ? H DC  11  I DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? E DC  11  N4 ? ? ? 1_555 F DG 3  O6 ? ? H DC  11  I DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? E DC  11  O2 ? ? ? 1_555 F DG 3  N2 ? ? H DC  11  I DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? E DT  12  N3 ? ? ? 1_555 F DA 2  N1 ? ? H DT  12  I DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? E DT  12  O4 ? ? ? 1_555 F DA 2  N6 ? ? H DT  12  I DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 701 ? 5 'binding site for residue ZN A 701' 
AC2 Software A ZN 702 ? 7 'binding site for residue ZN A 702' 
AC3 Software A ZN 703 ? 5 'binding site for residue ZN A 703' 
AC4 Software A ZN 704 ? 6 'binding site for residue ZN A 704' 
AC5 Software A ZN 705 ? 6 'binding site for residue ZN A 705' 
AC6 Software A ZN 706 ? 5 'binding site for residue ZN A 706' 
AC7 Software B ZN 701 ? 5 'binding site for residue ZN B 701' 
AC8 Software B ZN 702 ? 6 'binding site for residue ZN B 702' 
AC9 Software B ZN 703 ? 4 'binding site for residue ZN B 703' 
AD1 Software B ZN 704 ? 6 'binding site for residue ZN B 704' 
AD2 Software B ZN 705 ? 6 'binding site for residue ZN B 705' 
AD3 Software B ZN 706 ? 5 'binding site for residue ZN B 706' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS A 14  ? CYS A 525 . ? 1_555 ? 
2  AC1 5 CYS A 16  ? CYS A 527 . ? 1_555 ? 
3  AC1 5 CYS A 21  ? CYS A 532 . ? 1_555 ? 
4  AC1 5 CYS A 26  ? CYS A 537 . ? 1_555 ? 
5  AC1 5 ZN  H .   ? ZN  A 702 . ? 1_555 ? 
6  AC2 7 CYS A 14  ? CYS A 525 . ? 1_555 ? 
7  AC2 7 CYS A 21  ? CYS A 532 . ? 1_555 ? 
8  AC2 7 CYS A 35  ? CYS A 546 . ? 1_555 ? 
9  AC2 7 CYS A 40  ? CYS A 551 . ? 1_555 ? 
10 AC2 7 CYS A 43  ? CYS A 554 . ? 1_555 ? 
11 AC2 7 ZN  G .   ? ZN  A 701 . ? 1_555 ? 
12 AC2 7 ZN  I .   ? ZN  A 703 . ? 1_555 ? 
13 AC3 5 CYS A 14  ? CYS A 525 . ? 1_555 ? 
14 AC3 5 CYS A 28  ? CYS A 539 . ? 1_555 ? 
15 AC3 5 CYS A 35  ? CYS A 546 . ? 1_555 ? 
16 AC3 5 CYS A 38  ? CYS A 549 . ? 1_555 ? 
17 AC3 5 ZN  H .   ? ZN  A 702 . ? 1_555 ? 
18 AC4 6 CYS A 88  ? CYS A 599 . ? 1_555 ? 
19 AC4 6 CYS A 90  ? CYS A 601 . ? 1_555 ? 
20 AC4 6 CYS A 95  ? CYS A 606 . ? 1_555 ? 
21 AC4 6 CYS A 100 ? CYS A 611 . ? 1_555 ? 
22 AC4 6 ZN  K .   ? ZN  A 705 . ? 1_555 ? 
23 AC4 6 ZN  L .   ? ZN  A 706 . ? 1_555 ? 
24 AC5 6 CYS A 88  ? CYS A 599 . ? 1_555 ? 
25 AC5 6 CYS A 95  ? CYS A 606 . ? 1_555 ? 
26 AC5 6 CYS A 109 ? CYS A 620 . ? 1_555 ? 
27 AC5 6 CYS A 115 ? CYS A 626 . ? 1_555 ? 
28 AC5 6 CYS A 118 ? CYS A 629 . ? 1_555 ? 
29 AC5 6 ZN  J .   ? ZN  A 704 . ? 1_555 ? 
30 AC6 5 CYS A 88  ? CYS A 599 . ? 1_555 ? 
31 AC6 5 CYS A 102 ? CYS A 613 . ? 1_555 ? 
32 AC6 5 CYS A 109 ? CYS A 620 . ? 1_555 ? 
33 AC6 5 CYS A 113 ? CYS A 624 . ? 1_555 ? 
34 AC6 5 ZN  J .   ? ZN  A 704 . ? 1_555 ? 
35 AC7 5 CYS B 14  ? CYS B 525 . ? 1_555 ? 
36 AC7 5 CYS B 16  ? CYS B 527 . ? 1_555 ? 
37 AC7 5 CYS B 21  ? CYS B 532 . ? 1_555 ? 
38 AC7 5 CYS B 26  ? CYS B 537 . ? 1_555 ? 
39 AC7 5 ZN  N .   ? ZN  B 702 . ? 1_555 ? 
40 AC8 6 CYS B 14  ? CYS B 525 . ? 1_555 ? 
41 AC8 6 CYS B 21  ? CYS B 532 . ? 1_555 ? 
42 AC8 6 CYS B 35  ? CYS B 546 . ? 1_555 ? 
43 AC8 6 CYS B 40  ? CYS B 551 . ? 1_555 ? 
44 AC8 6 CYS B 43  ? CYS B 554 . ? 1_555 ? 
45 AC8 6 ZN  M .   ? ZN  B 701 . ? 1_555 ? 
46 AC9 4 CYS B 14  ? CYS B 525 . ? 1_555 ? 
47 AC9 4 CYS B 28  ? CYS B 539 . ? 1_555 ? 
48 AC9 4 CYS B 35  ? CYS B 546 . ? 1_555 ? 
49 AC9 4 CYS B 38  ? CYS B 549 . ? 1_555 ? 
50 AD1 6 CYS B 88  ? CYS B 599 . ? 1_555 ? 
51 AD1 6 CYS B 90  ? CYS B 601 . ? 1_555 ? 
52 AD1 6 CYS B 95  ? CYS B 606 . ? 1_555 ? 
53 AD1 6 CYS B 100 ? CYS B 611 . ? 1_555 ? 
54 AD1 6 ZN  Q .   ? ZN  B 705 . ? 1_555 ? 
55 AD1 6 ZN  R .   ? ZN  B 706 . ? 1_555 ? 
56 AD2 6 CYS B 88  ? CYS B 599 . ? 1_555 ? 
57 AD2 6 CYS B 95  ? CYS B 606 . ? 1_555 ? 
58 AD2 6 CYS B 109 ? CYS B 620 . ? 1_555 ? 
59 AD2 6 CYS B 115 ? CYS B 626 . ? 1_555 ? 
60 AD2 6 CYS B 118 ? CYS B 629 . ? 1_555 ? 
61 AD2 6 ZN  P .   ? ZN  B 704 . ? 1_555 ? 
62 AD3 5 CYS B 88  ? CYS B 599 . ? 1_555 ? 
63 AD3 5 CYS B 102 ? CYS B 613 . ? 1_555 ? 
64 AD3 5 CYS B 109 ? CYS B 620 . ? 1_555 ? 
65 AD3 5 CYS B 113 ? CYS B 624 . ? 1_555 ? 
66 AD3 5 ZN  P .   ? ZN  B 704 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5FD3 
_atom_sites.fract_transf_matrix[1][1]   0.025432 
_atom_sites.fract_transf_matrix[1][2]   0.007567 
_atom_sites.fract_transf_matrix[1][3]   0.007522 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019364 
_atom_sites.fract_transf_matrix[2][3]   0.004414 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015654 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 11  ? 6.877   43.107 3.695   1.00 81.06  ? 522 ARG A N     1 
ATOM   2    C  CA    . ARG A 1 11  ? 8.219   42.740 4.119   1.00 81.98  ? 522 ARG A CA    1 
ATOM   3    C  C     . ARG A 1 11  ? 9.020   42.157 2.952   1.00 74.55  ? 522 ARG A C     1 
ATOM   4    O  O     . ARG A 1 11  ? 9.946   42.798 2.463   1.00 91.41  ? 522 ARG A O     1 
ATOM   5    C  CB    . ARG A 1 11  ? 8.171   41.749 5.285   1.00 89.31  ? 522 ARG A CB    1 
ATOM   6    N  N     . LYS A 1 12  ? 8.657   40.969 2.477   1.00 82.31  ? 523 LYS A N     1 
ATOM   7    C  CA    . LYS A 1 12  ? 9.397   40.354 1.378   1.00 69.83  ? 523 LYS A CA    1 
ATOM   8    C  C     . LYS A 1 12  ? 8.759   40.771 0.052   1.00 79.10  ? 523 LYS A C     1 
ATOM   9    O  O     . LYS A 1 12  ? 7.532   40.846 -0.054  1.00 86.95  ? 523 LYS A O     1 
ATOM   10   C  CB    . LYS A 1 12  ? 9.440   38.821 1.499   1.00 67.67  ? 523 LYS A CB    1 
ATOM   11   C  CG    . LYS A 1 12  ? 9.789   38.260 2.890   1.00 79.93  ? 523 LYS A CG    1 
ATOM   12   C  CD    . LYS A 1 12  ? 8.687   38.410 3.934   1.00 83.14  ? 523 LYS A CD    1 
ATOM   13   C  CE    . LYS A 1 12  ? 9.156   38.057 5.314   1.00 84.77  ? 523 LYS A CE    1 
ATOM   14   N  NZ    . LYS A 1 12  ? 8.222   38.611 6.341   1.00 90.80  ? 523 LYS A NZ    1 
ATOM   15   N  N     . PRO A 1 13  ? 9.592   41.069 -0.960  1.00 75.85  ? 524 PRO A N     1 
ATOM   16   C  CA    . PRO A 1 13  ? 9.120   41.597 -2.250  1.00 70.93  ? 524 PRO A CA    1 
ATOM   17   C  C     . PRO A 1 13  ? 8.338   40.586 -3.075  1.00 65.53  ? 524 PRO A C     1 
ATOM   18   O  O     . PRO A 1 13  ? 8.787   39.452 -3.197  1.00 67.80  ? 524 PRO A O     1 
ATOM   19   C  CB    . PRO A 1 13  ? 10.418  41.970 -2.971  1.00 72.94  ? 524 PRO A CB    1 
ATOM   20   C  CG    . PRO A 1 13  ? 11.444  41.057 -2.366  1.00 72.47  ? 524 PRO A CG    1 
ATOM   21   C  CD    . PRO A 1 13  ? 11.062  40.956 -0.920  1.00 74.06  ? 524 PRO A CD    1 
ATOM   22   N  N     . CYS A 1 14  ? 7.193   40.994 -3.620  1.00 60.74  ? 525 CYS A N     1 
ATOM   23   C  CA    . CYS A 1 14  ? 6.419   40.163 -4.538  1.00 47.70  ? 525 CYS A CA    1 
ATOM   24   C  C     . CYS A 1 14  ? 7.018   40.308 -5.928  1.00 57.53  ? 525 CYS A C     1 
ATOM   25   O  O     . CYS A 1 14  ? 7.695   41.295 -6.197  1.00 63.97  ? 525 CYS A O     1 
ATOM   26   C  CB    . CYS A 1 14  ? 4.950   40.571 -4.538  1.00 35.21  ? 525 CYS A CB    1 
ATOM   27   S  SG    . CYS A 1 14  ? 4.654   42.140 -5.427  1.00 42.79  ? 525 CYS A SG    1 
ATOM   28   N  N     . ASN A 1 15  ? 6.781   39.344 -6.814  1.00 57.31  ? 526 ASN A N     1 
ATOM   29   C  CA    . ASN A 1 15  ? 7.259   39.456 -8.197  1.00 50.49  ? 526 ASN A CA    1 
ATOM   30   C  C     . ASN A 1 15  ? 6.142   39.241 -9.210  1.00 55.03  ? 526 ASN A C     1 
ATOM   31   O  O     . ASN A 1 15  ? 6.371   38.685 -10.281 1.00 59.75  ? 526 ASN A O     1 
ATOM   32   C  CB    . ASN A 1 15  ? 8.381   38.467 -8.470  1.00 54.56  ? 526 ASN A CB    1 
ATOM   33   C  CG    . ASN A 1 15  ? 9.477   38.535 -7.431  1.00 69.91  ? 526 ASN A CG    1 
ATOM   34   O  OD1   . ASN A 1 15  ? 10.469  39.242 -7.608  1.00 78.20  ? 526 ASN A OD1   1 
ATOM   35   N  ND2   . ASN A 1 15  ? 9.307   37.788 -6.334  1.00 69.28  ? 526 ASN A ND2   1 
ATOM   36   N  N     . CYS A 1 16  ? 4.925   39.631 -8.839  1.00 52.32  ? 527 CYS A N     1 
ATOM   37   C  CA    . CYS A 1 16  ? 3.754   39.505 -9.702  1.00 55.39  ? 527 CYS A CA    1 
ATOM   38   C  C     . CYS A 1 16  ? 3.916   40.209 -11.066 1.00 60.47  ? 527 CYS A C     1 
ATOM   39   O  O     . CYS A 1 16  ? 4.579   41.234 -11.172 1.00 60.55  ? 527 CYS A O     1 
ATOM   40   C  CB    . CYS A 1 16  ? 2.528   40.083 -8.986  1.00 59.53  ? 527 CYS A CB    1 
ATOM   41   S  SG    . CYS A 1 16  ? 2.426   39.814 -7.191  1.00 44.77  ? 527 CYS A SG    1 
ATOM   42   N  N     . THR A 1 17  ? 3.295   39.671 -12.108 1.00 56.91  ? 528 THR A N     1 
ATOM   43   C  CA    . THR A 1 17  ? 3.249   40.372 -13.382 1.00 58.96  ? 528 THR A CA    1 
ATOM   44   C  C     . THR A 1 17  ? 1.798   40.441 -13.864 1.00 55.03  ? 528 THR A C     1 
ATOM   45   O  O     . THR A 1 17  ? 1.275   41.484 -14.273 1.00 49.17  ? 528 THR A O     1 
ATOM   46   C  CB    . THR A 1 17  ? 4.116   39.685 -14.440 1.00 59.30  ? 528 THR A CB    1 
ATOM   47   O  OG1   . THR A 1 17  ? 3.679   38.334 -14.613 1.00 51.54  ? 528 THR A OG1   1 
ATOM   48   C  CG2   . THR A 1 17  ? 5.584   39.678 -14.014 1.00 65.41  ? 528 THR A CG2   1 
ATOM   49   N  N     . LYS A 1 18  ? 1.146   39.301 -13.761 1.00 39.20  ? 529 LYS A N     1 
ATOM   50   C  CA    . LYS A 1 18  ? -0.084  39.056 -14.453 1.00 35.92  ? 529 LYS A CA    1 
ATOM   51   C  C     . LYS A 1 18  ? -1.291  39.543 -13.643 1.00 44.70  ? 529 LYS A C     1 
ATOM   52   O  O     . LYS A 1 18  ? -2.336  39.863 -14.210 1.00 54.90  ? 529 LYS A O     1 
ATOM   53   C  CB    . LYS A 1 18  ? -0.183  37.560 -14.752 1.00 43.07  ? 529 LYS A CB    1 
ATOM   54   C  CG    . LYS A 1 18  ? -0.887  37.221 -16.033 1.00 52.95  ? 529 LYS A CG    1 
ATOM   55   C  CD    . LYS A 1 18  ? 0.043   37.174 -17.217 1.00 56.08  ? 529 LYS A CD    1 
ATOM   56   C  CE    . LYS A 1 18  ? -0.772  37.030 -18.499 1.00 70.64  ? 529 LYS A CE    1 
ATOM   57   N  NZ    . LYS A 1 18  ? 0.055   36.710 -19.698 1.00 84.04  ? 529 LYS A NZ    1 
ATOM   58   N  N     . SER A 1 19  ? -1.136  39.644 -12.326 1.00 46.47  ? 530 SER A N     1 
ATOM   59   C  CA    . SER A 1 19  ? -2.281  39.877 -11.441 1.00 47.90  ? 530 SER A CA    1 
ATOM   60   C  C     . SER A 1 19  ? -2.460  41.331 -11.100 1.00 44.27  ? 530 SER A C     1 
ATOM   61   O  O     . SER A 1 19  ? -3.489  41.698 -10.539 1.00 46.20  ? 530 SER A O     1 
ATOM   62   C  CB    . SER A 1 19  ? -2.135  39.113 -10.116 1.00 42.75  ? 530 SER A CB    1 
ATOM   63   O  OG    . SER A 1 19  ? -1.068  39.657 -9.351  1.00 35.91  ? 530 SER A OG    1 
ATOM   64   N  N     . LEU A 1 20  ? -1.457  42.144 -11.429 1.00 40.03  ? 531 LEU A N     1 
ATOM   65   C  CA    . LEU A 1 20  ? -1.439  43.567 -11.091 1.00 45.51  ? 531 LEU A CA    1 
ATOM   66   C  C     . LEU A 1 20  ? -1.259  43.824 -9.593  1.00 50.63  ? 531 LEU A C     1 
ATOM   67   O  O     . LEU A 1 20  ? -1.182  44.983 -9.177  1.00 49.65  ? 531 LEU A O     1 
ATOM   68   C  CB    . LEU A 1 20  ? -2.728  44.265 -11.575 1.00 47.13  ? 531 LEU A CB    1 
ATOM   69   C  CG    . LEU A 1 20  ? -3.183  44.063 -13.021 1.00 48.58  ? 531 LEU A CG    1 
ATOM   70   C  CD1   . LEU A 1 20  ? -4.576  44.669 -13.234 1.00 48.87  ? 531 LEU A CD1   1 
ATOM   71   C  CD2   . LEU A 1 20  ? -2.152  44.673 -13.998 1.00 39.36  ? 531 LEU A CD2   1 
ATOM   72   N  N     . CYS A 1 21  ? -1.155  42.743 -8.807  1.00 46.26  ? 532 CYS A N     1 
ATOM   73   C  CA    . CYS A 1 21  ? -1.066  42.781 -7.341  1.00 41.27  ? 532 CYS A CA    1 
ATOM   74   C  C     . CYS A 1 21  ? -2.394  43.224 -6.757  1.00 36.71  ? 532 CYS A C     1 
ATOM   75   O  O     . CYS A 1 21  ? -2.435  43.880 -5.723  1.00 35.75  ? 532 CYS A O     1 
ATOM   76   C  CB    . CYS A 1 21  ? 0.073   43.699 -6.857  1.00 32.41  ? 532 CYS A CB    1 
ATOM   77   S  SG    . CYS A 1 21  ? 1.649   43.324 -7.683  1.00 39.56  ? 532 CYS A SG    1 
ATOM   78   N  N     . LEU A 1 22  ? -3.467  42.866 -7.456  1.00 40.78  ? 533 LEU A N     1 
ATOM   79   C  CA    . LEU A 1 22  ? -4.844  43.186 -7.067  1.00 51.44  ? 533 LEU A CA    1 
ATOM   80   C  C     . LEU A 1 22  ? -5.660  41.919 -6.818  1.00 51.63  ? 533 LEU A C     1 
ATOM   81   O  O     . LEU A 1 22  ? -6.892  41.928 -6.788  1.00 45.47  ? 533 LEU A O     1 
ATOM   82   C  CB    . LEU A 1 22  ? -5.515  44.039 -8.143  1.00 44.76  ? 533 LEU A CB    1 
ATOM   83   C  CG    . LEU A 1 22  ? -5.081  45.498 -8.191  1.00 43.16  ? 533 LEU A CG    1 
ATOM   84   C  CD1   . LEU A 1 22  ? -6.007  46.269 -9.102  1.00 35.15  ? 533 LEU A CD1   1 
ATOM   85   C  CD2   . LEU A 1 22  ? -5.108  46.068 -6.789  1.00 40.57  ? 533 LEU A CD2   1 
ATOM   86   N  N     . LYS A 1 23  ? -4.941  40.823 -6.676  1.00 49.24  ? 534 LYS A N     1 
ATOM   87   C  CA    . LYS A 1 23  ? -5.528  39.551 -6.351  1.00 44.27  ? 534 LYS A CA    1 
ATOM   88   C  C     . LYS A 1 23  ? -4.733  38.911 -5.214  1.00 42.64  ? 534 LYS A C     1 
ATOM   89   O  O     . LYS A 1 23  ? -3.668  39.391 -4.853  1.00 44.90  ? 534 LYS A O     1 
ATOM   90   C  CB    . LYS A 1 23  ? -5.582  38.671 -7.590  1.00 45.16  ? 534 LYS A CB    1 
ATOM   91   C  CG    . LYS A 1 23  ? -6.739  39.039 -8.481  1.00 42.41  ? 534 LYS A CG    1 
ATOM   92   C  CD    . LYS A 1 23  ? -6.790  38.210 -9.754  1.00 56.20  ? 534 LYS A CD    1 
ATOM   93   C  CE    . LYS A 1 23  ? -7.879  38.719 -10.707 1.00 57.32  ? 534 LYS A CE    1 
ATOM   94   N  NZ    . LYS A 1 23  ? -7.998  37.875 -11.934 1.00 60.44  ? 534 LYS A NZ    1 
ATOM   95   N  N     . LEU A 1 24  ? -5.305  37.896 -4.584  1.00 54.26  ? 535 LEU A N     1 
ATOM   96   C  CA    . LEU A 1 24  ? -4.723  37.288 -3.388  1.00 51.36  ? 535 LEU A CA    1 
ATOM   97   C  C     . LEU A 1 24  ? -3.524  36.420 -3.733  1.00 51.57  ? 535 LEU A C     1 
ATOM   98   O  O     . LEU A 1 24  ? -2.831  35.937 -2.832  1.00 57.07  ? 535 LEU A O     1 
ATOM   99   C  CB    . LEU A 1 24  ? -5.774  36.462 -2.641  1.00 49.61  ? 535 LEU A CB    1 
ATOM   100  C  CG    . LEU A 1 24  ? -6.953  37.262 -2.075  1.00 49.09  ? 535 LEU A CG    1 
ATOM   101  C  CD1   . LEU A 1 24  ? -8.033  36.327 -1.531  1.00 53.26  ? 535 LEU A CD1   1 
ATOM   102  C  CD2   . LEU A 1 24  ? -6.503  38.275 -1.012  1.00 36.39  ? 535 LEU A CD2   1 
ATOM   103  N  N     . TYR A 1 25  ? -3.304  36.191 -5.031  1.00 41.06  ? 536 TYR A N     1 
ATOM   104  C  CA    . TYR A 1 25  ? -2.071  35.564 -5.490  1.00 38.04  ? 536 TYR A CA    1 
ATOM   105  C  C     . TYR A 1 25  ? -0.888  36.450 -5.092  1.00 45.58  ? 536 TYR A C     1 
ATOM   106  O  O     . TYR A 1 25  ? 0.247   35.992 -5.034  1.00 43.86  ? 536 TYR A O     1 
ATOM   107  C  CB    . TYR A 1 25  ? -2.043  35.352 -7.008  1.00 42.68  ? 536 TYR A CB    1 
ATOM   108  C  CG    . TYR A 1 25  ? -3.193  34.592 -7.660  1.00 41.23  ? 536 TYR A CG    1 
ATOM   109  C  CD1   . TYR A 1 25  ? -3.413  33.232 -7.416  1.00 36.44  ? 536 TYR A CD1   1 
ATOM   110  C  CD2   . TYR A 1 25  ? -4.005  35.226 -8.598  1.00 41.06  ? 536 TYR A CD2   1 
ATOM   111  C  CE1   . TYR A 1 25  ? -4.440  32.550 -8.061  1.00 51.04  ? 536 TYR A CE1   1 
ATOM   112  C  CE2   . TYR A 1 25  ? -5.033  34.557 -9.236  1.00 36.30  ? 536 TYR A CE2   1 
ATOM   113  C  CZ    . TYR A 1 25  ? -5.247  33.227 -8.976  1.00 48.18  ? 536 TYR A CZ    1 
ATOM   114  O  OH    . TYR A 1 25  ? -6.278  32.593 -9.635  1.00 49.82  ? 536 TYR A OH    1 
ATOM   115  N  N     . CYS A 1 26  ? -1.160  37.736 -4.885  1.00 50.18  ? 537 CYS A N     1 
ATOM   116  C  CA    . CYS A 1 26  ? -0.139  38.692 -4.464  1.00 49.63  ? 537 CYS A CA    1 
ATOM   117  C  C     . CYS A 1 26  ? -0.100  38.827 -2.943  1.00 55.62  ? 537 CYS A C     1 
ATOM   118  O  O     . CYS A 1 26  ? -1.016  39.402 -2.338  1.00 51.80  ? 537 CYS A O     1 
ATOM   119  C  CB    . CYS A 1 26  ? -0.380  40.062 -5.097  1.00 37.27  ? 537 CYS A CB    1 
ATOM   120  S  SG    . CYS A 1 26  ? 0.712   41.337 -4.450  1.00 47.29  ? 537 CYS A SG    1 
ATOM   121  N  N     . ASP A 1 27  ? 0.962   38.310 -2.333  1.00 50.90  ? 538 ASP A N     1 
ATOM   122  C  CA    . ASP A 1 27  ? 1.064   38.292 -0.884  1.00 50.58  ? 538 ASP A CA    1 
ATOM   123  C  C     . ASP A 1 27  ? 1.061   39.684 -0.254  1.00 56.23  ? 538 ASP A C     1 
ATOM   124  O  O     . ASP A 1 27  ? 0.589   39.854 0.876   1.00 50.11  ? 538 ASP A O     1 
ATOM   125  C  CB    . ASP A 1 27  ? 2.309   37.517 -0.480  1.00 54.73  ? 538 ASP A CB    1 
ATOM   126  C  CG    . ASP A 1 27  ? 2.174   36.035 -0.777  1.00 70.28  ? 538 ASP A CG    1 
ATOM   127  O  OD1   . ASP A 1 27  ? 1.070   35.485 -0.556  1.00 78.78  ? 538 ASP A OD1   1 
ATOM   128  O  OD2   . ASP A 1 27  ? 3.157   35.413 -1.227  1.00 71.00  ? 538 ASP A OD2   1 
ATOM   129  N  N     . CYS A 1 28  ? 1.564   40.680 -0.985  1.00 54.57  ? 539 CYS A N     1 
ATOM   130  C  CA    . CYS A 1 28  ? 1.544   42.060 -0.497  1.00 50.70  ? 539 CYS A CA    1 
ATOM   131  C  C     . CYS A 1 28  ? 0.110   42.512 -0.326  1.00 53.71  ? 539 CYS A C     1 
ATOM   132  O  O     . CYS A 1 28  ? -0.255  43.089 0.692   1.00 61.98  ? 539 CYS A O     1 
ATOM   133  C  CB    . CYS A 1 28  ? 2.272   43.009 -1.446  1.00 52.66  ? 539 CYS A CB    1 
ATOM   134  S  SG    . CYS A 1 28  ? 4.017   42.733 -1.640  1.00 65.28  ? 539 CYS A SG    1 
ATOM   135  N  N     . PHE A 1 29  ? -0.684  42.274 -1.362  1.00 56.59  ? 540 PHE A N     1 
ATOM   136  C  CA    . PHE A 1 29  ? -2.098  42.657 -1.402  1.00 57.25  ? 540 PHE A CA    1 
ATOM   137  C  C     . PHE A 1 29  ? -2.947  41.817 -0.434  1.00 51.76  ? 540 PHE A C     1 
ATOM   138  O  O     . PHE A 1 29  ? -3.919  42.303 0.149   1.00 42.62  ? 540 PHE A O     1 
ATOM   139  C  CB    . PHE A 1 29  ? -2.608  42.520 -2.842  1.00 48.17  ? 540 PHE A CB    1 
ATOM   140  C  CG    . PHE A 1 29  ? -4.056  42.855 -3.024  1.00 44.10  ? 540 PHE A CG    1 
ATOM   141  C  CD1   . PHE A 1 29  ? -4.463  44.171 -3.163  1.00 39.89  ? 540 PHE A CD1   1 
ATOM   142  C  CD2   . PHE A 1 29  ? -5.002  41.854 -3.108  1.00 37.19  ? 540 PHE A CD2   1 
ATOM   143  C  CE1   . PHE A 1 29  ? -5.785  44.481 -3.343  1.00 36.10  ? 540 PHE A CE1   1 
ATOM   144  C  CE2   . PHE A 1 29  ? -6.317  42.156 -3.285  1.00 36.53  ? 540 PHE A CE2   1 
ATOM   145  C  CZ    . PHE A 1 29  ? -6.714  43.473 -3.412  1.00 40.40  ? 540 PHE A CZ    1 
ATOM   146  N  N     . ALA A 1 30  ? -2.567  40.554 -0.279  1.00 51.22  ? 541 ALA A N     1 
ATOM   147  C  CA    . ALA A 1 30  ? -3.259  39.640 0.621   1.00 56.03  ? 541 ALA A CA    1 
ATOM   148  C  C     . ALA A 1 30  ? -3.084  40.056 2.083   1.00 59.20  ? 541 ALA A C     1 
ATOM   149  O  O     . ALA A 1 30  ? -3.950  39.794 2.920   1.00 63.05  ? 541 ALA A O     1 
ATOM   150  C  CB    . ALA A 1 30  ? -2.764  38.224 0.414   1.00 52.44  ? 541 ALA A CB    1 
ATOM   151  N  N     . ASN A 1 31  ? -1.960  40.699 2.386   1.00 56.74  ? 542 ASN A N     1 
ATOM   152  C  CA    . ASN A 1 31  ? -1.687  41.180 3.738   1.00 64.20  ? 542 ASN A CA    1 
ATOM   153  C  C     . ASN A 1 31  ? -2.176  42.604 3.959   1.00 61.86  ? 542 ASN A C     1 
ATOM   154  O  O     . ASN A 1 31  ? -1.836  43.239 4.958   1.00 58.11  ? 542 ASN A O     1 
ATOM   155  C  CB    . ASN A 1 31  ? -0.191  41.096 4.052   1.00 71.17  ? 542 ASN A CB    1 
ATOM   156  C  CG    . ASN A 1 31  ? 0.286   39.665 4.197   1.00 78.38  ? 542 ASN A CG    1 
ATOM   157  O  OD1   . ASN A 1 31  ? -0.495  38.780 4.558   1.00 80.83  ? 542 ASN A OD1   1 
ATOM   158  N  ND2   . ASN A 1 31  ? 1.576   39.433 3.949   1.00 74.16  ? 542 ASN A ND2   1 
ATOM   159  N  N     . GLY A 1 32  ? -2.954  43.108 3.007   1.00 69.47  ? 543 GLY A N     1 
ATOM   160  C  CA    . GLY A 1 32  ? -3.530  44.436 3.108   1.00 66.57  ? 543 GLY A CA    1 
ATOM   161  C  C     . GLY A 1 32  ? -2.492  45.539 3.081   1.00 60.72  ? 543 GLY A C     1 
ATOM   162  O  O     . GLY A 1 32  ? -2.681  46.584 3.695   1.00 65.23  ? 543 GLY A O     1 
ATOM   163  N  N     . GLU A 1 33  ? -1.387  45.310 2.380   1.00 54.92  ? 544 GLU A N     1 
ATOM   164  C  CA    . GLU A 1 33  ? -0.378  46.343 2.235   1.00 62.70  ? 544 GLU A CA    1 
ATOM   165  C  C     . GLU A 1 33  ? -0.265  46.894 0.814   1.00 63.20  ? 544 GLU A C     1 
ATOM   166  O  O     . GLU A 1 33  ? -0.572  46.216 -0.168  1.00 67.27  ? 544 GLU A O     1 
ATOM   167  C  CB    . GLU A 1 33  ? 0.986   45.815 2.658   1.00 67.66  ? 544 GLU A CB    1 
ATOM   168  C  CG    . GLU A 1 33  ? 1.007   45.171 4.014   1.00 86.25  ? 544 GLU A CG    1 
ATOM   169  C  CD    . GLU A 1 33  ? 2.353   44.559 4.327   1.00 102.14 ? 544 GLU A CD    1 
ATOM   170  O  OE1   . GLU A 1 33  ? 3.377   45.171 3.952   1.00 105.24 ? 544 GLU A OE1   1 
ATOM   171  O  OE2   . GLU A 1 33  ? 2.384   43.464 4.930   1.00 109.95 ? 544 GLU A OE2   1 
ATOM   172  N  N     . PHE A 1 34  ? 0.150   48.148 0.716   1.00 53.20  ? 545 PHE A N     1 
ATOM   173  C  CA    . PHE A 1 34  ? 0.711   48.619 -0.527  1.00 57.00  ? 545 PHE A CA    1 
ATOM   174  C  C     . PHE A 1 34  ? 2.029   47.881 -0.758  1.00 58.60  ? 545 PHE A C     1 
ATOM   175  O  O     . PHE A 1 34  ? 2.727   47.541 0.192   1.00 66.14  ? 545 PHE A O     1 
ATOM   176  C  CB    . PHE A 1 34  ? 0.957   50.125 -0.504  1.00 59.86  ? 545 PHE A CB    1 
ATOM   177  C  CG    . PHE A 1 34  ? -0.285  50.943 -0.501  1.00 60.87  ? 545 PHE A CG    1 
ATOM   178  C  CD1   . PHE A 1 34  ? -1.075  51.008 -1.626  1.00 60.89  ? 545 PHE A CD1   1 
ATOM   179  C  CD2   . PHE A 1 34  ? -0.635  51.691 0.602   1.00 68.71  ? 545 PHE A CD2   1 
ATOM   180  C  CE1   . PHE A 1 34  ? -2.207  51.774 -1.654  1.00 65.25  ? 545 PHE A CE1   1 
ATOM   181  C  CE2   . PHE A 1 34  ? -1.770  52.462 0.585   1.00 70.60  ? 545 PHE A CE2   1 
ATOM   182  C  CZ    . PHE A 1 34  ? -2.557  52.501 -0.551  1.00 70.94  ? 545 PHE A CZ    1 
ATOM   183  N  N     . CYS A 1 35  ? 2.362   47.627 -2.014  1.00 54.80  ? 546 CYS A N     1 
ATOM   184  C  CA    . CYS A 1 35  ? 3.679   47.121 -2.362  1.00 62.68  ? 546 CYS A CA    1 
ATOM   185  C  C     . CYS A 1 35  ? 4.772   48.170 -2.081  1.00 70.01  ? 546 CYS A C     1 
ATOM   186  O  O     . CYS A 1 35  ? 4.576   49.352 -2.342  1.00 75.55  ? 546 CYS A O     1 
ATOM   187  C  CB    . CYS A 1 35  ? 3.704   46.706 -3.828  1.00 66.78  ? 546 CYS A CB    1 
ATOM   188  S  SG    . CYS A 1 35  ? 2.684   45.292 -4.190  1.00 60.17  ? 546 CYS A SG    1 
ATOM   189  N  N     . ASN A 1 36  ? 5.914   47.744 -1.542  1.00 75.92  ? 547 ASN A N     1 
ATOM   190  C  CA    . ASN A 1 36  ? 7.021   48.664 -1.284  1.00 81.29  ? 547 ASN A CA    1 
ATOM   191  C  C     . ASN A 1 36  ? 8.356   48.053 -1.668  1.00 80.89  ? 547 ASN A C     1 
ATOM   192  O  O     . ASN A 1 36  ? 8.837   47.135 -1.005  1.00 77.83  ? 547 ASN A O     1 
ATOM   193  C  CB    . ASN A 1 36  ? 7.061   49.070 0.191   1.00 90.80  ? 547 ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 36  ? 6.186   50.272 0.494   1.00 103.76 ? 547 ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 36  ? 5.968   51.130 -0.365  1.00 107.42 ? 547 ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 36  ? 5.691   50.349 1.729   1.00 107.60 ? 547 ASN A ND2   1 
ATOM   197  N  N     . ASN A 1 37  ? 8.952   48.588 -2.730  1.00 82.95  ? 548 ASN A N     1 
ATOM   198  C  CA    . ASN A 1 37  ? 10.256  48.148 -3.202  1.00 90.28  ? 548 ASN A CA    1 
ATOM   199  C  C     . ASN A 1 37  ? 10.144  46.744 -3.794  1.00 85.94  ? 548 ASN A C     1 
ATOM   200  O  O     . ASN A 1 37  ? 11.086  45.952 -3.718  1.00 88.30  ? 548 ASN A O     1 
ATOM   201  C  CB    . ASN A 1 37  ? 11.325  48.206 -2.106  1.00 100.78 ? 548 ASN A CB    1 
ATOM   202  C  CG    . ASN A 1 37  ? 12.720  48.431 -2.673  1.00 109.25 ? 548 ASN A CG    1 
ATOM   203  O  OD1   . ASN A 1 37  ? 12.874  48.898 -3.805  1.00 109.98 ? 548 ASN A OD1   1 
ATOM   204  N  ND2   . ASN A 1 37  ? 13.741  48.102 -1.890  1.00 113.72 ? 548 ASN A ND2   1 
ATOM   205  N  N     . CYS A 1 38  ? 8.959   46.417 -4.305  1.00 76.15  ? 549 CYS A N     1 
ATOM   206  C  CA    . CYS A 1 38  ? 8.713   45.102 -4.896  1.00 62.87  ? 549 CYS A CA    1 
ATOM   207  C  C     . CYS A 1 38  ? 9.263   44.962 -6.315  1.00 58.67  ? 549 CYS A C     1 
ATOM   208  O  O     . CYS A 1 38  ? 9.761   45.920 -6.902  1.00 65.13  ? 549 CYS A O     1 
ATOM   209  C  CB    . CYS A 1 38  ? 7.217   44.795 -4.918  1.00 55.90  ? 549 CYS A CB    1 
ATOM   210  S  SG    . CYS A 1 38  ? 6.470   44.496 -3.327  1.00 59.45  ? 549 CYS A SG    1 
ATOM   211  N  N     . ASN A 1 39  ? 9.134   43.758 -6.862  1.00 49.75  ? 550 ASN A N     1 
ATOM   212  C  CA    . ASN A 1 39  ? 9.605   43.443 -8.198  1.00 44.74  ? 550 ASN A CA    1 
ATOM   213  C  C     . ASN A 1 39  ? 8.443   43.106 -9.120  1.00 50.86  ? 550 ASN A C     1 
ATOM   214  O  O     . ASN A 1 39  ? 8.623   42.497 -10.185 1.00 55.58  ? 550 ASN A O     1 
ATOM   215  C  CB    . ASN A 1 39  ? 10.595  42.285 -8.153  1.00 48.09  ? 550 ASN A CB    1 
ATOM   216  C  CG    . ASN A 1 39  ? 11.751  42.549 -7.207  1.00 59.88  ? 550 ASN A CG    1 
ATOM   217  O  OD1   . ASN A 1 39  ? 12.251  43.676 -7.129  1.00 72.11  ? 550 ASN A OD1   1 
ATOM   218  N  ND2   . ASN A 1 39  ? 12.193  41.513 -6.491  1.00 53.44  ? 550 ASN A ND2   1 
ATOM   219  N  N     . CYS A 1 40  ? 7.245   43.511 -8.706  1.00 39.83  ? 551 CYS A N     1 
ATOM   220  C  CA    . CYS A 1 40  ? 6.060   43.297 -9.517  1.00 41.46  ? 551 CYS A CA    1 
ATOM   221  C  C     . CYS A 1 40  ? 6.060   44.124 -10.799 1.00 51.39  ? 551 CYS A C     1 
ATOM   222  O  O     . CYS A 1 40  ? 6.740   45.149 -10.885 1.00 51.09  ? 551 CYS A O     1 
ATOM   223  C  CB    . CYS A 1 40  ? 4.812   43.610 -8.700  1.00 41.69  ? 551 CYS A CB    1 
ATOM   224  S  SG    . CYS A 1 40  ? 5.009   45.028 -7.619  1.00 54.54  ? 551 CYS A SG    1 
ATOM   225  N  N     . THR A 1 41  ? 5.297   43.672 -11.793 1.00 60.16  ? 552 THR A N     1 
ATOM   226  C  CA    . THR A 1 41  ? 5.095   44.439 -13.022 1.00 64.33  ? 552 THR A CA    1 
ATOM   227  C  C     . THR A 1 41  ? 3.640   44.901 -13.161 1.00 59.31  ? 552 THR A C     1 
ATOM   228  O  O     . THR A 1 41  ? 2.717   44.145 -12.863 1.00 64.69  ? 552 THR A O     1 
ATOM   229  C  CB    . THR A 1 41  ? 5.471   43.605 -14.251 1.00 71.76  ? 552 THR A CB    1 
ATOM   230  O  OG1   . THR A 1 41  ? 6.856   43.257 -14.182 1.00 81.12  ? 552 THR A OG1   1 
ATOM   231  C  CG2   . THR A 1 41  ? 5.221   44.378 -15.521 1.00 69.34  ? 552 THR A CG2   1 
ATOM   232  N  N     . ASN A 1 42  ? 3.449   46.123 -13.650 1.00 43.78  ? 553 ASN A N     1 
ATOM   233  C  CA    . ASN A 1 42  ? 2.121   46.705 -13.808 1.00 47.31  ? 553 ASN A CA    1 
ATOM   234  C  C     . ASN A 1 42  ? 1.363   46.701 -12.504 1.00 50.84  ? 553 ASN A C     1 
ATOM   235  O  O     . ASN A 1 42  ? 0.202   46.312 -12.439 1.00 51.63  ? 553 ASN A O     1 
ATOM   236  C  CB    . ASN A 1 42  ? 1.329   45.967 -14.880 1.00 52.83  ? 553 ASN A CB    1 
ATOM   237  C  CG    . ASN A 1 42  ? 1.801   46.309 -16.270 1.00 67.07  ? 553 ASN A CG    1 
ATOM   238  O  OD1   . ASN A 1 42  ? 2.123   45.420 -17.052 1.00 80.75  ? 553 ASN A OD1   1 
ATOM   239  N  ND2   . ASN A 1 42  ? 1.880   47.608 -16.578 1.00 60.66  ? 553 ASN A ND2   1 
ATOM   240  N  N     . CYS A 1 43  ? 2.046   47.132 -11.458 1.00 54.04  ? 554 CYS A N     1 
ATOM   241  C  CA    . CYS A 1 43  ? 1.484   47.128 -10.128 1.00 55.25  ? 554 CYS A CA    1 
ATOM   242  C  C     . CYS A 1 43  ? 0.390   48.165 -10.013 1.00 50.43  ? 554 CYS A C     1 
ATOM   243  O  O     . CYS A 1 43  ? 0.591   49.317 -10.375 1.00 52.15  ? 554 CYS A O     1 
ATOM   244  C  CB    . CYS A 1 43  ? 2.581   47.391 -9.097  1.00 59.98  ? 554 CYS A CB    1 
ATOM   245  S  SG    . CYS A 1 43  ? 2.045   47.277 -7.386  1.00 53.11  ? 554 CYS A SG    1 
ATOM   246  N  N     . TYR A 1 44  ? -0.765  47.750 -9.503  1.00 46.46  ? 555 TYR A N     1 
ATOM   247  C  CA    . TYR A 1 44  ? -1.832  48.687 -9.180  1.00 52.99  ? 555 TYR A CA    1 
ATOM   248  C  C     . TYR A 1 44  ? -1.996  48.787 -7.679  1.00 52.47  ? 555 TYR A C     1 
ATOM   249  O  O     . TYR A 1 44  ? -2.871  49.494 -7.189  1.00 59.98  ? 555 TYR A O     1 
ATOM   250  C  CB    . TYR A 1 44  ? -3.168  48.266 -9.821  1.00 60.00  ? 555 TYR A CB    1 
ATOM   251  C  CG    . TYR A 1 44  ? -3.343  48.714 -11.253 1.00 57.29  ? 555 TYR A CG    1 
ATOM   252  C  CD1   . TYR A 1 44  ? -2.236  49.008 -12.043 1.00 64.59  ? 555 TYR A CD1   1 
ATOM   253  C  CD2   . TYR A 1 44  ? -4.604  48.861 -11.814 1.00 55.03  ? 555 TYR A CD2   1 
ATOM   254  C  CE1   . TYR A 1 44  ? -2.373  49.422 -13.364 1.00 61.46  ? 555 TYR A CE1   1 
ATOM   255  C  CE2   . TYR A 1 44  ? -4.754  49.274 -13.143 1.00 56.79  ? 555 TYR A CE2   1 
ATOM   256  C  CZ    . TYR A 1 44  ? -3.624  49.559 -13.908 1.00 56.34  ? 555 TYR A CZ    1 
ATOM   257  O  OH    . TYR A 1 44  ? -3.722  49.971 -15.221 1.00 47.62  ? 555 TYR A OH    1 
ATOM   258  N  N     . ASN A 1 45  ? -1.147  48.084 -6.942  1.00 51.12  ? 556 ASN A N     1 
ATOM   259  C  CA    . ASN A 1 45  ? -1.286  48.034 -5.489  1.00 46.19  ? 556 ASN A CA    1 
ATOM   260  C  C     . ASN A 1 45  ? -0.591  49.214 -4.825  1.00 47.04  ? 556 ASN A C     1 
ATOM   261  O  O     . ASN A 1 45  ? 0.318   49.040 -4.016  1.00 48.29  ? 556 ASN A O     1 
ATOM   262  C  CB    . ASN A 1 45  ? -0.717  46.714 -4.964  1.00 51.34  ? 556 ASN A CB    1 
ATOM   263  C  CG    . ASN A 1 45  ? -1.002  46.498 -3.497  1.00 56.14  ? 556 ASN A CG    1 
ATOM   264  O  OD1   . ASN A 1 45  ? -2.020  46.953 -2.976  1.00 58.21  ? 556 ASN A OD1   1 
ATOM   265  N  ND2   . ASN A 1 45  ? -0.090  45.814 -2.813  1.00 59.96  ? 556 ASN A ND2   1 
ATOM   266  N  N     . ASN A 1 46  ? -1.031  50.420 -5.162  1.00 53.13  ? 557 ASN A N     1 
ATOM   267  C  CA    . ASN A 1 46  ? -0.317  51.633 -4.771  1.00 54.34  ? 557 ASN A CA    1 
ATOM   268  C  C     . ASN A 1 46  ? -1.213  52.870 -4.836  1.00 58.92  ? 557 ASN A C     1 
ATOM   269  O  O     . ASN A 1 46  ? -2.365  52.789 -5.258  1.00 53.70  ? 557 ASN A O     1 
ATOM   270  C  CB    . ASN A 1 46  ? 0.921   51.826 -5.649  1.00 49.19  ? 557 ASN A CB    1 
ATOM   271  C  CG    . ASN A 1 46  ? 0.602   51.739 -7.131  1.00 58.47  ? 557 ASN A CG    1 
ATOM   272  O  OD1   . ASN A 1 46  ? -0.159  52.547 -7.660  1.00 68.58  ? 557 ASN A OD1   1 
ATOM   273  N  ND2   . ASN A 1 46  ? 1.188   50.761 -7.809  1.00 60.36  ? 557 ASN A ND2   1 
ATOM   274  N  N     . LEU A 1 47  ? -0.688  54.008 -4.397  1.00 63.73  ? 558 LEU A N     1 
ATOM   275  C  CA    . LEU A 1 47  ? -1.482  55.233 -4.334  1.00 73.90  ? 558 LEU A CA    1 
ATOM   276  C  C     . LEU A 1 47  ? -1.974  55.686 -5.705  1.00 77.57  ? 558 LEU A C     1 
ATOM   277  O  O     . LEU A 1 47  ? -3.083  56.202 -5.829  1.00 81.28  ? 558 LEU A O     1 
ATOM   278  C  CB    . LEU A 1 47  ? -0.672  56.343 -3.664  1.00 74.81  ? 558 LEU A CB    1 
ATOM   279  C  CG    . LEU A 1 47  ? -0.311  55.988 -2.218  1.00 74.89  ? 558 LEU A CG    1 
ATOM   280  C  CD1   . LEU A 1 47  ? 0.999   56.620 -1.778  1.00 74.85  ? 558 LEU A CD1   1 
ATOM   281  C  CD2   . LEU A 1 47  ? -1.442  56.382 -1.280  1.00 69.72  ? 558 LEU A CD2   1 
ATOM   282  N  N     . GLU A 1 48  ? -1.172  55.446 -6.735  1.00 74.09  ? 559 GLU A N     1 
ATOM   283  C  CA    . GLU A 1 48  ? -1.477  55.920 -8.082  1.00 72.24  ? 559 GLU A CA    1 
ATOM   284  C  C     . GLU A 1 48  ? -2.629  55.184 -8.764  1.00 70.51  ? 559 GLU A C     1 
ATOM   285  O  O     . GLU A 1 48  ? -3.093  55.603 -9.825  1.00 71.39  ? 559 GLU A O     1 
ATOM   286  C  CB    . GLU A 1 48  ? -0.228  55.864 -8.969  1.00 80.22  ? 559 GLU A CB    1 
ATOM   287  C  CG    . GLU A 1 48  ? 0.976   56.626 -8.423  1.00 86.82  ? 559 GLU A CG    1 
ATOM   288  C  CD    . GLU A 1 48  ? 1.712   55.901 -7.321  1.00 93.63  ? 559 GLU A CD    1 
ATOM   289  O  OE1   . GLU A 1 48  ? 1.282   54.798 -6.940  1.00 90.22  ? 559 GLU A OE1   1 
ATOM   290  O  OE2   . GLU A 1 48  ? 2.720   56.444 -6.825  1.00 101.92 ? 559 GLU A OE2   1 
ATOM   291  N  N     . HIS A 1 49  ? -3.094  54.090 -8.179  1.00 70.22  ? 560 HIS A N     1 
ATOM   292  C  CA    . HIS A 1 49  ? -4.220  53.381 -8.774  1.00 67.05  ? 560 HIS A CA    1 
ATOM   293  C  C     . HIS A 1 49  ? -5.363  53.150 -7.839  1.00 62.49  ? 560 HIS A C     1 
ATOM   294  O  O     . HIS A 1 49  ? -6.031  52.129 -7.945  1.00 58.81  ? 560 HIS A O     1 
ATOM   295  C  CB    . HIS A 1 49  ? -3.771  52.049 -9.326  1.00 59.76  ? 560 HIS A CB    1 
ATOM   296  C  CG    . HIS A 1 49  ? -2.683  52.176 -10.339 1.00 56.33  ? 560 HIS A CG    1 
ATOM   297  N  ND1   . HIS A 1 49  ? -1.371  52.391 -9.993  1.00 52.27  ? 560 HIS A ND1   1 
ATOM   298  C  CD2   . HIS A 1 49  ? -2.731  52.154 -11.692 1.00 50.09  ? 560 HIS A CD2   1 
ATOM   299  C  CE1   . HIS A 1 49  ? -0.639  52.458 -11.097 1.00 54.16  ? 560 HIS A CE1   1 
ATOM   300  N  NE2   . HIS A 1 49  ? -1.440  52.324 -12.134 1.00 55.62  ? 560 HIS A NE2   1 
ATOM   301  N  N     . GLU A 1 50  ? -5.605  54.137 -6.979  1.00 65.40  ? 561 GLU A N     1 
ATOM   302  C  CA    . GLU A 1 50  ? -6.577  54.053 -5.891  1.00 72.16  ? 561 GLU A CA    1 
ATOM   303  C  C     . GLU A 1 50  ? -7.984  53.615 -6.295  1.00 70.57  ? 561 GLU A C     1 
ATOM   304  O  O     . GLU A 1 50  ? -8.594  52.805 -5.586  1.00 74.75  ? 561 GLU A O     1 
ATOM   305  C  CB    . GLU A 1 50  ? -6.662  55.410 -5.177  1.00 66.73  ? 561 GLU A CB    1 
ATOM   306  N  N     . ASN A 1 51  ? -8.508  54.126 -7.408  1.00 73.45  ? 562 ASN A N     1 
ATOM   307  C  CA    . ASN A 1 51  ? -9.845  53.710 -7.836  1.00 71.33  ? 562 ASN A CA    1 
ATOM   308  C  C     . ASN A 1 51  ? -9.931  52.243 -8.199  1.00 69.81  ? 562 ASN A C     1 
ATOM   309  O  O     . ASN A 1 51  ? -10.808 51.523 -7.714  1.00 73.72  ? 562 ASN A O     1 
ATOM   310  C  CB    . ASN A 1 51  ? -10.355 54.552 -9.003  1.00 73.96  ? 562 ASN A CB    1 
ATOM   311  C  CG    . ASN A 1 51  ? -11.177 55.735 -8.537  1.00 89.22  ? 562 ASN A CG    1 
ATOM   312  O  OD1   . ASN A 1 51  ? -12.384 55.610 -8.303  1.00 91.38  ? 562 ASN A OD1   1 
ATOM   313  N  ND2   . ASN A 1 51  ? -10.531 56.882 -8.375  1.00 97.95  ? 562 ASN A ND2   1 
ATOM   314  N  N     . GLU A 1 52  ? -9.013  51.806 -9.048  1.00 59.58  ? 563 GLU A N     1 
ATOM   315  C  CA    . GLU A 1 52  ? -8.993  50.428 -9.501  1.00 62.78  ? 563 GLU A CA    1 
ATOM   316  C  C     . GLU A 1 52  ? -8.638  49.460 -8.363  1.00 63.82  ? 563 GLU A C     1 
ATOM   317  O  O     . GLU A 1 52  ? -9.098  48.309 -8.338  1.00 63.63  ? 563 GLU A O     1 
ATOM   318  C  CB    . GLU A 1 52  ? -7.994  50.281 -10.650 1.00 58.80  ? 563 GLU A CB    1 
ATOM   319  C  CG    . GLU A 1 52  ? -8.412  49.285 -11.693 1.00 64.67  ? 563 GLU A CG    1 
ATOM   320  C  CD    . GLU A 1 52  ? -9.742  49.646 -12.314 1.00 78.87  ? 563 GLU A CD    1 
ATOM   321  O  OE1   . GLU A 1 52  ? -9.878  50.792 -12.786 1.00 89.70  ? 563 GLU A OE1   1 
ATOM   322  O  OE2   . GLU A 1 52  ? -10.651 48.789 -12.329 1.00 79.15  ? 563 GLU A OE2   1 
ATOM   323  N  N     . ARG A 1 53  ? -7.820  49.938 -7.427  1.00 61.28  ? 564 ARG A N     1 
ATOM   324  C  CA    . ARG A 1 53  ? -7.398  49.127 -6.300  1.00 63.46  ? 564 ARG A CA    1 
ATOM   325  C  C     . ARG A 1 53  ? -8.587  48.901 -5.390  1.00 59.69  ? 564 ARG A C     1 
ATOM   326  O  O     . ARG A 1 53  ? -8.758  47.814 -4.875  1.00 50.73  ? 564 ARG A O     1 
ATOM   327  C  CB    . ARG A 1 53  ? -6.220  49.752 -5.542  1.00 64.47  ? 564 ARG A CB    1 
ATOM   328  C  CG    . ARG A 1 53  ? -5.805  48.936 -4.314  1.00 61.15  ? 564 ARG A CG    1 
ATOM   329  C  CD    . ARG A 1 53  ? -4.464  49.397 -3.739  1.00 63.45  ? 564 ARG A CD    1 
ATOM   330  N  NE    . ARG A 1 53  ? -3.989  48.550 -2.637  1.00 60.07  ? 564 ARG A NE    1 
ATOM   331  C  CZ    . ARG A 1 53  ? -4.180  48.804 -1.340  1.00 49.57  ? 564 ARG A CZ    1 
ATOM   332  N  NH1   . ARG A 1 53  ? -4.815  49.892 -0.949  1.00 47.79  ? 564 ARG A NH1   1 
ATOM   333  N  NH2   . ARG A 1 53  ? -3.707  47.979 -0.432  1.00 47.46  ? 564 ARG A NH2   1 
ATOM   334  N  N     . GLN A 1 54  ? -9.389  49.941 -5.179  1.00 57.68  ? 565 GLN A N     1 
ATOM   335  C  CA    . GLN A 1 54  ? -10.570 49.835 -4.322  1.00 64.24  ? 565 GLN A CA    1 
ATOM   336  C  C     . GLN A 1 54  ? -11.564 48.826 -4.888  1.00 70.59  ? 565 GLN A C     1 
ATOM   337  O  O     . GLN A 1 54  ? -12.185 48.071 -4.138  1.00 70.20  ? 565 GLN A O     1 
ATOM   338  C  CB    . GLN A 1 54  ? -11.249 51.201 -4.153  1.00 62.18  ? 565 GLN A CB    1 
ATOM   339  C  CG    . GLN A 1 54  ? -10.668 52.077 -3.042  1.00 62.30  ? 565 GLN A CG    1 
ATOM   340  C  CD    . GLN A 1 54  ? -10.804 51.461 -1.649  1.00 66.59  ? 565 GLN A CD    1 
ATOM   341  O  OE1   . GLN A 1 54  ? -9.830  50.970 -1.090  1.00 69.80  ? 565 GLN A OE1   1 
ATOM   342  N  NE2   . GLN A 1 54  ? -12.008 51.519 -1.075  1.00 55.68  ? 565 GLN A NE2   1 
ATOM   343  N  N     . LYS A 1 55  ? -11.714 48.829 -6.211  1.00 71.94  ? 566 LYS A N     1 
ATOM   344  C  CA    . LYS A 1 55  ? -12.560 47.863 -6.914  1.00 66.92  ? 566 LYS A CA    1 
ATOM   345  C  C     . LYS A 1 55  ? -12.136 46.428 -6.656  1.00 59.96  ? 566 LYS A C     1 
ATOM   346  O  O     . LYS A 1 55  ? -12.959 45.561 -6.407  1.00 53.88  ? 566 LYS A O     1 
ATOM   347  C  CB    . LYS A 1 55  ? -12.570 48.147 -8.419  1.00 67.51  ? 566 LYS A CB    1 
ATOM   348  C  CG    . LYS A 1 55  ? -13.623 49.170 -8.827  1.00 70.38  ? 566 LYS A CG    1 
ATOM   349  C  CD    . LYS A 1 55  ? -13.534 49.551 -10.293 1.00 71.69  ? 566 LYS A CD    1 
ATOM   350  C  CE    . LYS A 1 55  ? -14.107 48.474 -11.192 1.00 74.16  ? 566 LYS A CE    1 
ATOM   351  N  NZ    . LYS A 1 55  ? -14.238 48.978 -12.598 1.00 77.13  ? 566 LYS A NZ    1 
ATOM   352  N  N     . ALA A 1 56  ? -10.841 46.179 -6.758  1.00 59.19  ? 567 ALA A N     1 
ATOM   353  C  CA    . ALA A 1 56  ? -10.313 44.844 -6.533  1.00 50.95  ? 567 ALA A CA    1 
ATOM   354  C  C     . ALA A 1 56  ? -10.552 44.412 -5.102  1.00 52.69  ? 567 ALA A C     1 
ATOM   355  O  O     . ALA A 1 56  ? -10.806 43.248 -4.839  1.00 50.67  ? 567 ALA A O     1 
ATOM   356  C  CB    . ALA A 1 56  ? -8.833  44.800 -6.849  1.00 50.36  ? 567 ALA A CB    1 
ATOM   357  N  N     . ILE A 1 57  ? -10.461 45.357 -4.179  1.00 52.43  ? 568 ILE A N     1 
ATOM   358  C  CA    . ILE A 1 57  ? -10.632 45.042 -2.778  1.00 59.12  ? 568 ILE A CA    1 
ATOM   359  C  C     . ILE A 1 57  ? -12.050 44.539 -2.493  1.00 58.64  ? 568 ILE A C     1 
ATOM   360  O  O     . ILE A 1 57  ? -12.223 43.561 -1.779  1.00 53.49  ? 568 ILE A O     1 
ATOM   361  C  CB    . ILE A 1 57  ? -10.312 46.258 -1.903  1.00 56.23  ? 568 ILE A CB    1 
ATOM   362  C  CG1   . ILE A 1 57  ? -8.829  46.609 -2.050  1.00 54.68  ? 568 ILE A CG1   1 
ATOM   363  C  CG2   . ILE A 1 57  ? -10.654 45.959 -0.457  1.00 51.68  ? 568 ILE A CG2   1 
ATOM   364  C  CD1   . ILE A 1 57  ? -8.342  47.671 -1.128  1.00 52.29  ? 568 ILE A CD1   1 
ATOM   365  N  N     . LYS A 1 58  ? -13.058 45.119 -3.136  1.00 55.52  ? 569 LYS A N     1 
ATOM   366  C  CA    . LYS A 1 58  ? -14.410 44.756 -2.775  1.00 54.89  ? 569 LYS A CA    1 
ATOM   367  C  C     . LYS A 1 58  ? -14.834 43.489 -3.496  1.00 65.41  ? 569 LYS A C     1 
ATOM   368  O  O     . LYS A 1 58  ? -15.525 42.648 -2.913  1.00 69.07  ? 569 LYS A O     1 
ATOM   369  C  CB    . LYS A 1 58  ? -15.365 45.907 -3.087  1.00 57.83  ? 569 LYS A CB    1 
ATOM   370  C  CG    . LYS A 1 58  ? -16.824 45.502 -3.228  1.00 69.09  ? 569 LYS A CG    1 
ATOM   371  C  CD    . LYS A 1 58  ? -17.668 46.657 -3.748  1.00 74.43  ? 569 LYS A CD    1 
ATOM   372  C  CE    . LYS A 1 58  ? -19.145 46.277 -3.861  1.00 80.48  ? 569 LYS A CE    1 
ATOM   373  N  NZ    . LYS A 1 58  ? -19.333 45.020 -4.653  1.00 84.78  ? 569 LYS A NZ    1 
ATOM   374  N  N     . ALA A 1 59  ? -14.315 43.296 -4.704  1.00 54.18  ? 570 ALA A N     1 
ATOM   375  C  CA    . ALA A 1 59  ? -14.518 42.062 -5.462  1.00 53.86  ? 570 ALA A CA    1 
ATOM   376  C  C     . ALA A 1 59  ? -13.868 40.910 -4.729  1.00 69.85  ? 570 ALA A C     1 
ATOM   377  O  O     . ALA A 1 59  ? -14.355 39.787 -4.725  1.00 72.82  ? 570 ALA A O     1 
ATOM   378  C  CB    . ALA A 1 59  ? -13.938 42.186 -6.871  1.00 53.38  ? 570 ALA A CB    1 
ATOM   379  N  N     . CYS A 1 60  ? -12.722 41.201 -4.143  1.00 68.05  ? 571 CYS A N     1 
ATOM   380  C  CA    . CYS A 1 60  ? -11.982 40.224 -3.382  1.00 70.60  ? 571 CYS A CA    1 
ATOM   381  C  C     . CYS A 1 60  ? -12.807 39.859 -2.136  1.00 71.48  ? 571 CYS A C     1 
ATOM   382  O  O     . CYS A 1 60  ? -12.904 38.691 -1.737  1.00 62.55  ? 571 CYS A O     1 
ATOM   383  C  CB    . CYS A 1 60  ? -10.615 40.811 -3.034  1.00 71.85  ? 571 CYS A CB    1 
ATOM   384  S  SG    . CYS A 1 60  ? -9.368  39.688 -2.508  1.00 93.09  ? 571 CYS A SG    1 
ATOM   385  N  N     . LEU A 1 61  ? -13.431 40.876 -1.550  1.00 72.88  ? 572 LEU A N     1 
ATOM   386  C  CA    . LEU A 1 61  ? -14.139 40.726 -0.290  1.00 66.40  ? 572 LEU A CA    1 
ATOM   387  C  C     . LEU A 1 61  ? -15.518 40.071 -0.401  1.00 81.11  ? 572 LEU A C     1 
ATOM   388  O  O     . LEU A 1 61  ? -15.927 39.366 0.509   1.00 83.76  ? 572 LEU A O     1 
ATOM   389  C  CB    . LEU A 1 61  ? -14.278 42.082 0.382   1.00 62.45  ? 572 LEU A CB    1 
ATOM   390  C  CG    . LEU A 1 61  ? -14.242 42.061 1.906   1.00 72.12  ? 572 LEU A CG    1 
ATOM   391  C  CD1   . LEU A 1 61  ? -13.073 41.244 2.434   1.00 72.23  ? 572 LEU A CD1   1 
ATOM   392  C  CD2   . LEU A 1 61  ? -14.174 43.477 2.413   1.00 81.60  ? 572 LEU A CD2   1 
ATOM   393  N  N     . ASP A 1 62  ? -16.262 40.312 -1.476  1.00 91.53  ? 573 ASP A N     1 
ATOM   394  C  CA    . ASP A 1 62  ? -17.581 39.685 -1.580  1.00 102.97 ? 573 ASP A CA    1 
ATOM   395  C  C     . ASP A 1 62  ? -17.436 38.228 -2.047  1.00 95.90  ? 573 ASP A C     1 
ATOM   396  O  O     . ASP A 1 62  ? -18.393 37.460 -2.010  1.00 95.06  ? 573 ASP A O     1 
ATOM   397  C  CB    . ASP A 1 62  ? -18.522 40.487 -2.487  1.00 115.66 ? 573 ASP A CB    1 
ATOM   398  C  CG    . ASP A 1 62  ? -18.005 40.624 -3.888  1.00 122.59 ? 573 ASP A CG    1 
ATOM   399  O  OD1   . ASP A 1 62  ? -16.810 40.360 -4.088  1.00 124.39 ? 573 ASP A OD1   1 
ATOM   400  O  OD2   . ASP A 1 62  ? -18.784 41.013 -4.784  1.00 125.05 ? 573 ASP A OD2   1 
ATOM   401  N  N     . ARG A 1 63  ? -16.239 37.866 -2.508  1.00 90.50  ? 574 ARG A N     1 
ATOM   402  C  CA    . ARG A 1 63  ? -15.891 36.464 -2.743  1.00 83.29  ? 574 ARG A CA    1 
ATOM   403  C  C     . ARG A 1 63  ? -15.736 35.755 -1.403  1.00 82.89  ? 574 ARG A C     1 
ATOM   404  O  O     . ARG A 1 63  ? -16.135 34.606 -1.250  1.00 85.98  ? 574 ARG A O     1 
ATOM   405  C  CB    . ARG A 1 63  ? -14.590 36.316 -3.541  1.00 80.38  ? 574 ARG A CB    1 
ATOM   406  C  CG    . ARG A 1 63  ? -14.660 36.674 -5.012  1.00 86.34  ? 574 ARG A CG    1 
ATOM   407  C  CD    . ARG A 1 63  ? -13.307 36.415 -5.681  1.00 92.31  ? 574 ARG A CD    1 
ATOM   408  N  NE    . ARG A 1 63  ? -13.045 37.314 -6.805  1.00 96.10  ? 574 ARG A NE    1 
ATOM   409  C  CZ    . ARG A 1 63  ? -11.896 37.963 -7.000  1.00 97.13  ? 574 ARG A CZ    1 
ATOM   410  N  NH1   . ARG A 1 63  ? -10.882 37.812 -6.153  1.00 95.97  ? 574 ARG A NH1   1 
ATOM   411  N  NH2   . ARG A 1 63  ? -11.755 38.760 -8.050  1.00 95.51  ? 574 ARG A NH2   1 
ATOM   412  N  N     . ASN A 1 64  ? -15.124 36.448 -0.447  1.00 79.72  ? 575 ASN A N     1 
ATOM   413  C  CA    . ASN A 1 64  ? -14.951 35.946 0.915   1.00 81.00  ? 575 ASN A CA    1 
ATOM   414  C  C     . ASN A 1 64  ? -14.778 37.102 1.896   1.00 75.79  ? 575 ASN A C     1 
ATOM   415  O  O     . ASN A 1 64  ? -13.727 37.742 1.939   1.00 75.99  ? 575 ASN A O     1 
ATOM   416  C  CB    . ASN A 1 64  ? -13.744 34.997 0.967   1.00 81.62  ? 575 ASN A CB    1 
ATOM   417  C  CG    . ASN A 1 64  ? -13.173 34.816 2.370   1.00 77.74  ? 575 ASN A CG    1 
ATOM   418  O  OD1   . ASN A 1 64  ? -13.869 34.954 3.383   1.00 77.20  ? 575 ASN A OD1   1 
ATOM   419  N  ND2   . ASN A 1 64  ? -11.885 34.502 2.428   1.00 74.47  ? 575 ASN A ND2   1 
ATOM   420  N  N     . PRO A 1 65  ? -15.811 37.349 2.715   1.00 73.30  ? 576 PRO A N     1 
ATOM   421  C  CA    . PRO A 1 65  ? -15.863 38.506 3.618   1.00 70.13  ? 576 PRO A CA    1 
ATOM   422  C  C     . PRO A 1 65  ? -14.737 38.507 4.655   1.00 71.19  ? 576 PRO A C     1 
ATOM   423  O  O     . PRO A 1 65  ? -14.484 39.520 5.320   1.00 61.14  ? 576 PRO A O     1 
ATOM   424  C  CB    . PRO A 1 65  ? -17.233 38.358 4.289   1.00 63.51  ? 576 PRO A CB    1 
ATOM   425  C  CG    . PRO A 1 65  ? -17.565 36.909 4.162   1.00 63.85  ? 576 PRO A CG    1 
ATOM   426  C  CD    . PRO A 1 65  ? -17.007 36.498 2.844   1.00 67.28  ? 576 PRO A CD    1 
ATOM   427  N  N     . GLU A 1 66  ? -14.071 37.368 4.793   1.00 71.35  ? 577 GLU A N     1 
ATOM   428  C  CA    . GLU A 1 66  ? -12.973 37.253 5.730   1.00 77.82  ? 577 GLU A CA    1 
ATOM   429  C  C     . GLU A 1 66  ? -11.600 37.398 5.078   1.00 70.05  ? 577 GLU A C     1 
ATOM   430  O  O     . GLU A 1 66  ? -10.581 37.065 5.685   1.00 63.99  ? 577 GLU A O     1 
ATOM   431  C  CB    . GLU A 1 66  ? -13.089 35.908 6.443   1.00 85.77  ? 577 GLU A CB    1 
ATOM   432  C  CG    . GLU A 1 66  ? -14.514 35.619 6.874   1.00 91.73  ? 577 GLU A CG    1 
ATOM   433  C  CD    . GLU A 1 66  ? -14.815 34.142 6.956   1.00 100.47 ? 577 GLU A CD    1 
ATOM   434  O  OE1   . GLU A 1 66  ? -14.261 33.473 7.855   1.00 101.49 ? 577 GLU A OE1   1 
ATOM   435  O  OE2   . GLU A 1 66  ? -15.600 33.651 6.111   1.00 104.18 ? 577 GLU A OE2   1 
ATOM   436  N  N     . ALA A 1 67  ? -11.568 37.945 3.869   1.00 59.16  ? 578 ALA A N     1 
ATOM   437  C  CA    . ALA A 1 67  ? -10.324 38.018 3.114   1.00 64.31  ? 578 ALA A CA    1 
ATOM   438  C  C     . ALA A 1 67  ? -9.267  38.850 3.834   1.00 65.70  ? 578 ALA A C     1 
ATOM   439  O  O     . ALA A 1 67  ? -8.112  38.436 3.947   1.00 65.66  ? 578 ALA A O     1 
ATOM   440  C  CB    . ALA A 1 67  ? -10.587 38.587 1.724   1.00 64.92  ? 578 ALA A CB    1 
ATOM   441  N  N     . PHE A 1 68  ? -9.674  40.010 4.343   1.00 61.39  ? 579 PHE A N     1 
ATOM   442  C  CA    . PHE A 1 68  ? -8.751  40.898 5.033   1.00 66.57  ? 579 PHE A CA    1 
ATOM   443  C  C     . PHE A 1 68  ? -9.065  40.992 6.517   1.00 67.91  ? 579 PHE A C     1 
ATOM   444  O  O     . PHE A 1 68  ? -8.965  42.064 7.118   1.00 57.53  ? 579 PHE A O     1 
ATOM   445  C  CB    . PHE A 1 68  ? -8.777  42.292 4.407   1.00 75.41  ? 579 PHE A CB    1 
ATOM   446  C  CG    . PHE A 1 68  ? -8.616  42.282 2.916   1.00 76.16  ? 579 PHE A CG    1 
ATOM   447  C  CD1   . PHE A 1 68  ? -7.369  42.093 2.344   1.00 69.57  ? 579 PHE A CD1   1 
ATOM   448  C  CD2   . PHE A 1 68  ? -9.711  42.493 2.087   1.00 80.05  ? 579 PHE A CD2   1 
ATOM   449  C  CE1   . PHE A 1 68  ? -7.216  42.085 0.973   1.00 77.33  ? 579 PHE A CE1   1 
ATOM   450  C  CE2   . PHE A 1 68  ? -9.567  42.494 0.711   1.00 81.40  ? 579 PHE A CE2   1 
ATOM   451  C  CZ    . PHE A 1 68  ? -8.317  42.290 0.150   1.00 80.54  ? 579 PHE A CZ    1 
ATOM   452  N  N     . LYS A 1 69  ? -9.414  39.856 7.110   1.00 80.33  ? 580 LYS A N     1 
ATOM   453  C  CA    . LYS A 1 69  ? -9.678  39.793 8.540   1.00 90.21  ? 580 LYS A CA    1 
ATOM   454  C  C     . LYS A 1 69  ? -8.319  39.700 9.211   1.00 90.98  ? 580 LYS A C     1 
ATOM   455  O  O     . LYS A 1 69  ? -7.439  39.009 8.699   1.00 98.87  ? 580 LYS A O     1 
ATOM   456  C  CB    . LYS A 1 69  ? -10.577 38.606 8.907   1.00 92.00  ? 580 LYS A CB    1 
ATOM   457  C  CG    . LYS A 1 69  ? -11.386 38.843 10.177  1.00 100.70 ? 580 LYS A CG    1 
ATOM   458  C  CD    . LYS A 1 69  ? -12.232 37.659 10.616  1.00 108.51 ? 580 LYS A CD    1 
ATOM   459  C  CE    . LYS A 1 69  ? -13.291 37.308 9.584   1.00 109.73 ? 580 LYS A CE    1 
ATOM   460  N  NZ    . LYS A 1 69  ? -14.197 38.427 9.183   1.00 106.60 ? 580 LYS A NZ    1 
ATOM   461  N  N     . PRO A 1 70  ? -8.130  40.434 10.326  1.00 82.15  ? 581 PRO A N     1 
ATOM   462  C  CA    . PRO A 1 70  ? -6.864  40.521 11.059  1.00 83.20  ? 581 PRO A CA    1 
ATOM   463  C  C     . PRO A 1 70  ? -6.090  39.210 11.165  1.00 86.52  ? 581 PRO A C     1 
ATOM   464  O  O     . PRO A 1 70  ? -6.540  38.244 11.788  1.00 78.06  ? 581 PRO A O     1 
ATOM   465  C  CB    . PRO A 1 70  ? -7.318  40.980 12.445  1.00 80.35  ? 581 PRO A CB    1 
ATOM   466  C  CG    . PRO A 1 70  ? -8.463  41.860 12.158  1.00 77.06  ? 581 PRO A CG    1 
ATOM   467  C  CD    . PRO A 1 70  ? -9.173  41.247 10.976  1.00 77.39  ? 581 PRO A CD    1 
ATOM   468  N  N     . LYS A 1 71  ? -4.923  39.202 10.520  1.00 92.75  ? 582 LYS A N     1 
ATOM   469  C  CA    . LYS A 1 71  ? -4.051  38.034 10.447  1.00 95.79  ? 582 LYS A CA    1 
ATOM   470  C  C     . LYS A 1 71  ? -2.644  38.444 9.999   1.00 87.77  ? 582 LYS A C     1 
ATOM   471  O  O     . LYS A 1 71  ? -2.053  37.827 9.109   1.00 82.30  ? 582 LYS A O     1 
ATOM   472  C  CB    . LYS A 1 71  ? -4.632  36.985 9.491   1.00 99.85  ? 582 LYS A CB    1 
ATOM   473  N  N     . LYS A 1 86  ? -8.503  28.413 6.260   1.00 85.54  ? 597 LYS A N     1 
ATOM   474  C  CA    . LYS A 1 86  ? -8.461  27.321 7.222   1.00 85.97  ? 597 LYS A CA    1 
ATOM   475  C  C     . LYS A 1 86  ? -8.196  25.978 6.532   1.00 83.56  ? 597 LYS A C     1 
ATOM   476  O  O     . LYS A 1 86  ? -9.027  25.480 5.771   1.00 83.23  ? 597 LYS A O     1 
ATOM   477  C  CB    . LYS A 1 86  ? -9.767  27.263 8.022   1.00 86.18  ? 597 LYS A CB    1 
ATOM   478  N  N     . GLY A 1 87  ? -7.016  25.424 6.799   1.00 80.35  ? 598 GLY A N     1 
ATOM   479  C  CA    . GLY A 1 87  ? -6.562  24.151 6.256   1.00 76.05  ? 598 GLY A CA    1 
ATOM   480  C  C     . GLY A 1 87  ? -6.100  24.096 4.804   1.00 65.89  ? 598 GLY A C     1 
ATOM   481  O  O     . GLY A 1 87  ? -6.618  24.811 3.950   1.00 62.62  ? 598 GLY A O     1 
ATOM   482  N  N     . CYS A 1 88  ? -5.157  23.189 4.539   1.00 55.41  ? 599 CYS A N     1 
ATOM   483  C  CA    . CYS A 1 88  ? -4.552  22.980 3.224   1.00 50.92  ? 599 CYS A CA    1 
ATOM   484  C  C     . CYS A 1 88  ? -5.296  21.912 2.424   1.00 49.45  ? 599 CYS A C     1 
ATOM   485  O  O     . CYS A 1 88  ? -6.127  21.206 2.958   1.00 53.62  ? 599 CYS A O     1 
ATOM   486  C  CB    . CYS A 1 88  ? -3.079  22.560 3.364   1.00 38.44  ? 599 CYS A CB    1 
ATOM   487  S  SG    . CYS A 1 88  ? -2.877  20.847 4.021   1.00 46.01  ? 599 CYS A SG    1 
ATOM   488  N  N     . ASN A 1 89  ? -4.965  21.767 1.148   1.00 46.55  ? 600 ASN A N     1 
ATOM   489  C  CA    . ASN A 1 89  ? -5.550  20.704 0.331   1.00 52.52  ? 600 ASN A CA    1 
ATOM   490  C  C     . ASN A 1 89  ? -4.469  19.996 -0.479  1.00 49.05  ? 600 ASN A C     1 
ATOM   491  O  O     . ASN A 1 89  ? -4.713  19.503 -1.582  1.00 48.85  ? 600 ASN A O     1 
ATOM   492  C  CB    . ASN A 1 89  ? -6.619  21.279 -0.598  1.00 60.38  ? 600 ASN A CB    1 
ATOM   493  C  CG    . ASN A 1 89  ? -7.692  22.023 0.159   1.00 60.06  ? 600 ASN A CG    1 
ATOM   494  O  OD1   . ASN A 1 89  ? -8.491  21.418 0.878   1.00 66.11  ? 600 ASN A OD1   1 
ATOM   495  N  ND2   . ASN A 1 89  ? -7.705  23.345 0.020   1.00 56.77  ? 600 ASN A ND2   1 
ATOM   496  N  N     . CYS A 1 90  ? -3.275  19.947 0.099   1.00 45.19  ? 601 CYS A N     1 
ATOM   497  C  CA    . CYS A 1 90  ? -2.085  19.440 -0.566  1.00 37.84  ? 601 CYS A CA    1 
ATOM   498  C  C     . CYS A 1 90  ? -2.320  18.043 -1.066  1.00 48.51  ? 601 CYS A C     1 
ATOM   499  O  O     . CYS A 1 90  ? -3.026  17.262 -0.436  1.00 53.99  ? 601 CYS A O     1 
ATOM   500  C  CB    . CYS A 1 90  ? -0.910  19.478 0.393   1.00 30.37  ? 601 CYS A CB    1 
ATOM   501  S  SG    . CYS A 1 90  ? -0.779  21.094 1.158   1.00 49.42  ? 601 CYS A SG    1 
ATOM   502  N  N     . LYS A 1 91  ? -1.745  17.735 -2.215  1.00 53.12  ? 602 LYS A N     1 
ATOM   503  C  CA    . LYS A 1 91  ? -1.862  16.402 -2.764  1.00 57.80  ? 602 LYS A CA    1 
ATOM   504  C  C     . LYS A 1 91  ? -0.505  15.720 -2.829  1.00 64.20  ? 602 LYS A C     1 
ATOM   505  O  O     . LYS A 1 91  ? -0.369  14.548 -2.483  1.00 73.62  ? 602 LYS A O     1 
ATOM   506  C  CB    . LYS A 1 91  ? -2.504  16.469 -4.141  1.00 60.33  ? 602 LYS A CB    1 
ATOM   507  C  CG    . LYS A 1 91  ? -3.993  16.777 -4.097  1.00 68.96  ? 602 LYS A CG    1 
ATOM   508  C  CD    . LYS A 1 91  ? -4.553  16.878 -5.497  1.00 73.28  ? 602 LYS A CD    1 
ATOM   509  C  CE    . LYS A 1 91  ? -6.057  16.951 -5.496  1.00 74.96  ? 602 LYS A CE    1 
ATOM   510  N  NZ    . LYS A 1 91  ? -6.551  16.964 -6.900  1.00 79.51  ? 602 LYS A NZ    1 
ATOM   511  N  N     . ARG A 1 92  ? 0.495   16.471 -3.269  1.00 56.80  ? 603 ARG A N     1 
ATOM   512  C  CA    . ARG A 1 92  ? 1.776   15.905 -3.648  1.00 53.27  ? 603 ARG A CA    1 
ATOM   513  C  C     . ARG A 1 92  ? 2.935   16.256 -2.705  1.00 47.26  ? 603 ARG A C     1 
ATOM   514  O  O     . ARG A 1 92  ? 3.932   15.548 -2.666  1.00 48.21  ? 603 ARG A O     1 
ATOM   515  C  CB    . ARG A 1 92  ? 2.103   16.348 -5.091  1.00 63.84  ? 603 ARG A CB    1 
ATOM   516  C  CG    . ARG A 1 92  ? 0.972   16.025 -6.090  1.00 62.74  ? 603 ARG A CG    1 
ATOM   517  C  CD    . ARG A 1 92  ? 1.475   15.634 -7.476  1.00 61.85  ? 603 ARG A CD    1 
ATOM   518  N  NE    . ARG A 1 92  ? 2.747   14.911 -7.420  1.00 79.58  ? 603 ARG A NE    1 
ATOM   519  C  CZ    . ARG A 1 92  ? 2.906   13.678 -6.938  1.00 90.61  ? 603 ARG A CZ    1 
ATOM   520  N  NH1   . ARG A 1 92  ? 1.867   13.005 -6.450  1.00 97.66  ? 603 ARG A NH1   1 
ATOM   521  N  NH2   . ARG A 1 92  ? 4.113   13.120 -6.930  1.00 85.90  ? 603 ARG A NH2   1 
ATOM   522  N  N     . SER A 1 93  ? 2.823   17.339 -1.945  1.00 48.26  ? 604 SER A N     1 
ATOM   523  C  CA    . SER A 1 93  ? 3.932   17.726 -1.063  1.00 48.30  ? 604 SER A CA    1 
ATOM   524  C  C     . SER A 1 93  ? 4.081   16.886 0.213   1.00 43.31  ? 604 SER A C     1 
ATOM   525  O  O     . SER A 1 93  ? 5.156   16.863 0.811   1.00 46.44  ? 604 SER A O     1 
ATOM   526  C  CB    . SER A 1 93  ? 3.802   19.195 -0.639  1.00 49.23  ? 604 SER A CB    1 
ATOM   527  O  OG    . SER A 1 93  ? 2.923   19.327 0.474   1.00 53.61  ? 604 SER A OG    1 
ATOM   528  N  N     . GLY A 1 94  ? 3.009   16.233 0.650   1.00 39.08  ? 605 GLY A N     1 
ATOM   529  C  CA    . GLY A 1 94  ? 3.044   15.449 1.879   1.00 53.08  ? 605 GLY A CA    1 
ATOM   530  C  C     . GLY A 1 94  ? 2.896   16.357 3.089   1.00 46.39  ? 605 GLY A C     1 
ATOM   531  O  O     . GLY A 1 94  ? 2.926   15.920 4.246   1.00 44.11  ? 605 GLY A O     1 
ATOM   532  N  N     . CYS A 1 95  ? 2.746   17.634 2.780   1.00 32.25  ? 606 CYS A N     1 
ATOM   533  C  CA    . CYS A 1 95  ? 2.711   18.739 3.728   1.00 33.15  ? 606 CYS A CA    1 
ATOM   534  C  C     . CYS A 1 95  ? 4.008   18.932 4.505   1.00 39.52  ? 606 CYS A C     1 
ATOM   535  O  O     . CYS A 1 95  ? 3.999   19.466 5.606   1.00 40.65  ? 606 CYS A O     1 
ATOM   536  C  CB    . CYS A 1 95  ? 1.515   18.570 4.664   1.00 35.58  ? 606 CYS A CB    1 
ATOM   537  S  SG    . CYS A 1 95  ? -0.046  18.343 3.759   1.00 41.70  ? 606 CYS A SG    1 
ATOM   538  N  N     . LEU A 1 96  ? 5.134   18.570 3.885   1.00 48.11  ? 607 LEU A N     1 
ATOM   539  C  CA    . LEU A 1 96  ? 6.474   18.838 4.446   1.00 40.54  ? 607 LEU A CA    1 
ATOM   540  C  C     . LEU A 1 96  ? 7.324   19.691 3.501   1.00 53.26  ? 607 LEU A C     1 
ATOM   541  O  O     . LEU A 1 96  ? 8.554   19.643 3.506   1.00 60.62  ? 607 LEU A O     1 
ATOM   542  C  CB    . LEU A 1 96  ? 7.182   17.529 4.788   1.00 34.50  ? 607 LEU A CB    1 
ATOM   543  C  CG    . LEU A 1 96  ? 6.464   16.771 5.909   1.00 37.41  ? 607 LEU A CG    1 
ATOM   544  C  CD1   . LEU A 1 96  ? 7.194   15.483 6.272   1.00 40.59  ? 607 LEU A CD1   1 
ATOM   545  C  CD2   . LEU A 1 96  ? 6.312   17.668 7.135   1.00 34.66  ? 607 LEU A CD2   1 
ATOM   546  N  N     . LYS A 1 97  ? 6.628   20.458 2.672   1.00 57.00  ? 608 LYS A N     1 
ATOM   547  C  CA    . LYS A 1 97  ? 7.235   21.409 1.767   1.00 50.97  ? 608 LYS A CA    1 
ATOM   548  C  C     . LYS A 1 97  ? 6.459   22.710 1.893   1.00 49.49  ? 608 LYS A C     1 
ATOM   549  O  O     . LYS A 1 97  ? 5.279   22.709 2.229   1.00 55.60  ? 608 LYS A O     1 
ATOM   550  C  CB    . LYS A 1 97  ? 7.210   20.886 0.324   1.00 42.90  ? 608 LYS A CB    1 
ATOM   551  C  CG    . LYS A 1 97  ? 8.071   19.664 0.124   1.00 44.85  ? 608 LYS A CG    1 
ATOM   552  C  CD    . LYS A 1 97  ? 7.828   18.933 -1.189  1.00 47.35  ? 608 LYS A CD    1 
ATOM   553  C  CE    . LYS A 1 97  ? 9.013   17.994 -1.448  1.00 56.51  ? 608 LYS A CE    1 
ATOM   554  N  NZ    . LYS A 1 97  ? 8.950   17.197 -2.704  1.00 61.20  ? 608 LYS A NZ    1 
ATOM   555  N  N     . ASN A 1 98  ? 7.113   23.826 1.622   1.00 46.02  ? 609 ASN A N     1 
ATOM   556  C  CA    . ASN A 1 98  ? 6.467   25.110 1.825   1.00 52.71  ? 609 ASN A CA    1 
ATOM   557  C  C     . ASN A 1 98  ? 5.368   25.454 0.798   1.00 50.16  ? 609 ASN A C     1 
ATOM   558  O  O     . ASN A 1 98  ? 4.730   26.501 0.896   1.00 47.67  ? 609 ASN A O     1 
ATOM   559  C  CB    . ASN A 1 98  ? 7.533   26.196 1.893   1.00 50.59  ? 609 ASN A CB    1 
ATOM   560  C  CG    . ASN A 1 98  ? 8.331   26.130 3.182   1.00 53.71  ? 609 ASN A CG    1 
ATOM   561  O  OD1   . ASN A 1 98  ? 7.804   26.400 4.264   1.00 50.59  ? 609 ASN A OD1   1 
ATOM   562  N  ND2   . ASN A 1 98  ? 9.588   25.721 3.082   1.00 58.29  ? 609 ASN A ND2   1 
ATOM   563  N  N     . TYR A 1 99  ? 5.117   24.566 -0.160  1.00 39.32  ? 610 TYR A N     1 
ATOM   564  C  CA    . TYR A 1 99  ? 3.818   24.591 -0.843  1.00 34.65  ? 610 TYR A CA    1 
ATOM   565  C  C     . TYR A 1 99  ? 2.629   24.390 0.111   1.00 37.66  ? 610 TYR A C     1 
ATOM   566  O  O     . TYR A 1 99  ? 1.526   24.845 -0.172  1.00 40.83  ? 610 TYR A O     1 
ATOM   567  C  CB    . TYR A 1 99  ? 3.745   23.508 -1.915  1.00 36.02  ? 610 TYR A CB    1 
ATOM   568  C  CG    . TYR A 1 99  ? 4.899   23.516 -2.879  1.00 37.63  ? 610 TYR A CG    1 
ATOM   569  C  CD1   . TYR A 1 99  ? 4.935   24.445 -3.911  1.00 37.51  ? 610 TYR A CD1   1 
ATOM   570  C  CD2   . TYR A 1 99  ? 5.940   22.584 -2.779  1.00 32.47  ? 610 TYR A CD2   1 
ATOM   571  C  CE1   . TYR A 1 99  ? 5.986   24.478 -4.829  1.00 37.25  ? 610 TYR A CE1   1 
ATOM   572  C  CE2   . TYR A 1 99  ? 6.997   22.603 -3.700  1.00 44.37  ? 610 TYR A CE2   1 
ATOM   573  C  CZ    . TYR A 1 99  ? 7.002   23.574 -4.725  1.00 44.95  ? 610 TYR A CZ    1 
ATOM   574  O  OH    . TYR A 1 99  ? 7.991   23.658 -5.654  1.00 30.11  ? 610 TYR A OH    1 
ATOM   575  N  N     . CYS A 1 100 ? 2.833   23.660 1.217   1.00 41.02  ? 611 CYS A N     1 
ATOM   576  C  CA    . CYS A 1 100 ? 1.784   23.525 2.222   1.00 41.78  ? 611 CYS A CA    1 
ATOM   577  C  C     . CYS A 1 100 ? 1.752   24.758 3.101   1.00 35.06  ? 611 CYS A C     1 
ATOM   578  O  O     . CYS A 1 100 ? 2.768   25.148 3.665   1.00 43.64  ? 611 CYS A O     1 
ATOM   579  C  CB    . CYS A 1 100 ? 1.986   22.268 3.075   1.00 53.38  ? 611 CYS A CB    1 
ATOM   580  S  SG    . CYS A 1 100 ? 0.794   22.094 4.436   1.00 58.96  ? 611 CYS A SG    1 
ATOM   581  N  N     . GLU A 1 101 ? 0.590   25.381 3.196   1.00 35.83  ? 612 GLU A N     1 
ATOM   582  C  CA    . GLU A 1 101 ? 0.459   26.591 3.987   1.00 42.69  ? 612 GLU A CA    1 
ATOM   583  C  C     . GLU A 1 101 ? 0.593   26.260 5.486   1.00 42.90  ? 612 GLU A C     1 
ATOM   584  O  O     . GLU A 1 101 ? 1.047   27.071 6.297   1.00 35.95  ? 612 GLU A O     1 
ATOM   585  C  CB    . GLU A 1 101 ? -0.869  27.298 3.655   1.00 41.41  ? 612 GLU A CB    1 
ATOM   586  C  CG    . GLU A 1 101 ? -0.635  28.601 2.830   1.00 53.59  ? 612 GLU A CG    1 
ATOM   587  C  CD    . GLU A 1 101 ? -1.880  29.207 2.158   1.00 56.93  ? 612 GLU A CD    1 
ATOM   588  O  OE1   . GLU A 1 101 ? -3.024  29.006 2.616   1.00 52.83  ? 612 GLU A OE1   1 
ATOM   589  O  OE2   . GLU A 1 101 ? -1.694  29.920 1.148   1.00 70.47  ? 612 GLU A OE2   1 
ATOM   590  N  N     . CYS A 1 102 ? 0.213   25.048 5.846   1.00 48.36  ? 613 CYS A N     1 
ATOM   591  C  CA    . CYS A 1 102 ? 0.396   24.596 7.213   1.00 40.83  ? 613 CYS A CA    1 
ATOM   592  C  C     . CYS A 1 102 ? 1.887   24.517 7.516   1.00 39.57  ? 613 CYS A C     1 
ATOM   593  O  O     . CYS A 1 102 ? 2.382   25.193 8.416   1.00 49.58  ? 613 CYS A O     1 
ATOM   594  C  CB    . CYS A 1 102 ? -0.305  23.256 7.417   1.00 41.41  ? 613 CYS A CB    1 
ATOM   595  S  SG    . CYS A 1 102 ? -2.125  23.384 7.282   1.00 49.45  ? 613 CYS A SG    1 
ATOM   596  N  N     . TYR A 1 103 ? 2.623   23.769 6.710   1.00 42.45  ? 614 TYR A N     1 
ATOM   597  C  CA    . TYR A 1 103 ? 4.058   23.616 6.947   1.00 47.04  ? 614 TYR A CA    1 
ATOM   598  C  C     . TYR A 1 103 ? 4.801   24.952 6.899   1.00 51.07  ? 614 TYR A C     1 
ATOM   599  O  O     . TYR A 1 103 ? 5.690   25.196 7.721   1.00 58.83  ? 614 TYR A O     1 
ATOM   600  C  CB    . TYR A 1 103 ? 4.667   22.660 5.933   1.00 52.59  ? 614 TYR A CB    1 
ATOM   601  C  CG    . TYR A 1 103 ? 6.072   22.250 6.294   1.00 59.71  ? 614 TYR A CG    1 
ATOM   602  C  CD1   . TYR A 1 103 ? 6.291   21.223 7.200   1.00 49.84  ? 614 TYR A CD1   1 
ATOM   603  C  CD2   . TYR A 1 103 ? 7.182   22.901 5.744   1.00 62.91  ? 614 TYR A CD2   1 
ATOM   604  C  CE1   . TYR A 1 103 ? 7.572   20.839 7.547   1.00 54.51  ? 614 TYR A CE1   1 
ATOM   605  C  CE2   . TYR A 1 103 ? 8.467   22.526 6.086   1.00 64.78  ? 614 TYR A CE2   1 
ATOM   606  C  CZ    . TYR A 1 103 ? 8.653   21.485 6.990   1.00 66.68  ? 614 TYR A CZ    1 
ATOM   607  O  OH    . TYR A 1 103 ? 9.919   21.083 7.346   1.00 74.94  ? 614 TYR A OH    1 
ATOM   608  N  N     . GLU A 1 104 ? 4.435   25.813 5.946   1.00 40.24  ? 615 GLU A N     1 
ATOM   609  C  CA    . GLU A 1 104 ? 5.062   27.128 5.843   1.00 45.91  ? 615 GLU A CA    1 
ATOM   610  C  C     . GLU A 1 104 ? 4.808   27.961 7.099   1.00 45.79  ? 615 GLU A C     1 
ATOM   611  O  O     . GLU A 1 104 ? 5.658   28.733 7.525   1.00 51.76  ? 615 GLU A O     1 
ATOM   612  C  CB    . GLU A 1 104 ? 4.551   27.878 4.604   1.00 56.59  ? 615 GLU A CB    1 
ATOM   613  C  CG    . GLU A 1 104 ? 4.864   29.373 4.593   1.00 73.80  ? 615 GLU A CG    1 
ATOM   614  C  CD    . GLU A 1 104 ? 4.444   30.071 3.297   1.00 91.47  ? 615 GLU A CD    1 
ATOM   615  O  OE1   . GLU A 1 104 ? 3.813   29.418 2.435   1.00 96.88  ? 615 GLU A OE1   1 
ATOM   616  O  OE2   . GLU A 1 104 ? 4.741   31.280 3.144   1.00 97.19  ? 615 GLU A OE2   1 
ATOM   617  N  N     . ALA A 1 105 ? 3.651   27.780 7.720   1.00 56.90  ? 616 ALA A N     1 
ATOM   618  C  CA    . ALA A 1 105 ? 3.350   28.516 8.942   1.00 60.09  ? 616 ALA A CA    1 
ATOM   619  C  C     . ALA A 1 105 ? 3.972   27.812 10.147  1.00 65.22  ? 616 ALA A C     1 
ATOM   620  O  O     . ALA A 1 105 ? 3.791   28.240 11.289  1.00 64.95  ? 616 ALA A O     1 
ATOM   621  C  CB    . ALA A 1 105 ? 1.845   28.676 9.116   1.00 55.48  ? 616 ALA A CB    1 
ATOM   622  N  N     . LYS A 1 106 ? 4.705   26.734 9.870   1.00 66.17  ? 617 LYS A N     1 
ATOM   623  C  CA    . LYS A 1 106 ? 5.429   25.978 10.886  1.00 74.40  ? 617 LYS A CA    1 
ATOM   624  C  C     . LYS A 1 106 ? 4.466   25.414 11.942  1.00 75.34  ? 617 LYS A C     1 
ATOM   625  O  O     . LYS A 1 106 ? 4.764   25.388 13.133  1.00 71.96  ? 617 LYS A O     1 
ATOM   626  C  CB    . LYS A 1 106 ? 6.510   26.850 11.535  1.00 74.08  ? 617 LYS A CB    1 
ATOM   627  N  N     . ILE A 1 107 ? 3.312   24.946 11.484  1.00 69.66  ? 618 ILE A N     1 
ATOM   628  C  CA    . ILE A 1 107 ? 2.335   24.339 12.364  1.00 67.69  ? 618 ILE A CA    1 
ATOM   629  C  C     . ILE A 1 107 ? 1.864   23.012 11.781  1.00 70.04  ? 618 ILE A C     1 
ATOM   630  O  O     . ILE A 1 107 ? 2.076   22.734 10.598  1.00 74.80  ? 618 ILE A O     1 
ATOM   631  C  CB    . ILE A 1 107 ? 1.131   25.251 12.573  1.00 72.59  ? 618 ILE A CB    1 
ATOM   632  C  CG1   . ILE A 1 107 ? 0.339   25.384 11.275  1.00 72.50  ? 618 ILE A CG1   1 
ATOM   633  C  CG2   . ILE A 1 107 ? 1.576   26.617 13.054  1.00 77.73  ? 618 ILE A CG2   1 
ATOM   634  C  CD1   . ILE A 1 107 ? -1.131  25.660 11.499  1.00 71.05  ? 618 ILE A CD1   1 
ATOM   635  N  N     . MET A 1 108 ? 1.217   22.204 12.618  1.00 55.05  ? 619 MET A N     1 
ATOM   636  C  CA    . MET A 1 108 ? 0.687   20.909 12.211  1.00 47.15  ? 619 MET A CA    1 
ATOM   637  C  C     . MET A 1 108 ? -0.608  21.055 11.419  1.00 53.34  ? 619 MET A C     1 
ATOM   638  O  O     . MET A 1 108 ? -1.358  22.001 11.633  1.00 58.91  ? 619 MET A O     1 
ATOM   639  C  CB    . MET A 1 108 ? 0.430   20.035 13.453  1.00 52.04  ? 619 MET A CB    1 
ATOM   640  C  CG    . MET A 1 108 ? 1.242   18.766 13.529  1.00 39.53  ? 619 MET A CG    1 
ATOM   641  S  SD    . MET A 1 108 ? 3.008   19.073 13.653  1.00 70.95  ? 619 MET A SD    1 
ATOM   642  C  CE    . MET A 1 108 ? 3.078   19.898 15.241  1.00 79.61  ? 619 MET A CE    1 
ATOM   643  N  N     . CYS A 1 109 ? -0.867  20.125 10.501  1.00 55.24  ? 620 CYS A N     1 
ATOM   644  C  CA    . CYS A 1 109 ? -2.178  20.048 9.866   1.00 55.05  ? 620 CYS A CA    1 
ATOM   645  C  C     . CYS A 1 109 ? -3.234  19.678 10.907  1.00 58.92  ? 620 CYS A C     1 
ATOM   646  O  O     . CYS A 1 109 ? -2.923  19.057 11.915  1.00 62.43  ? 620 CYS A O     1 
ATOM   647  C  CB    . CYS A 1 109 ? -2.178  19.053 8.692   1.00 48.96  ? 620 CYS A CB    1 
ATOM   648  S  SG    . CYS A 1 109 ? -1.345  19.638 7.147   1.00 44.08  ? 620 CYS A SG    1 
ATOM   649  N  N     . SER A 1 110 ? -4.476  20.087 10.680  1.00 65.89  ? 621 SER A N     1 
ATOM   650  C  CA    . SER A 1 110 ? -5.554  19.725 11.592  1.00 74.59  ? 621 SER A CA    1 
ATOM   651  C  C     . SER A 1 110 ? -6.693  19.050 10.848  1.00 73.07  ? 621 SER A C     1 
ATOM   652  O  O     . SER A 1 110 ? -6.600  18.794 9.641   1.00 63.11  ? 621 SER A O     1 
ATOM   653  C  CB    . SER A 1 110 ? -6.081  20.942 12.341  1.00 78.52  ? 621 SER A CB    1 
ATOM   654  O  OG    . SER A 1 110 ? -6.948  21.691 11.525  1.00 77.14  ? 621 SER A OG    1 
ATOM   655  N  N     . SER A 1 111 ? -7.766  18.780 11.585  1.00 74.84  ? 622 SER A N     1 
ATOM   656  C  CA    . SER A 1 111 ? -8.919  18.047 11.072  1.00 74.75  ? 622 SER A CA    1 
ATOM   657  C  C     . SER A 1 111 ? -9.541  18.724 9.872   1.00 61.38  ? 622 SER A C     1 
ATOM   658  O  O     . SER A 1 111 ? -10.032 18.051 8.974   1.00 62.33  ? 622 SER A O     1 
ATOM   659  C  CB    . SER A 1 111 ? -9.987  17.880 12.166  1.00 83.48  ? 622 SER A CB    1 
ATOM   660  O  OG    . SER A 1 111 ? -10.514 19.136 12.575  1.00 84.33  ? 622 SER A OG    1 
ATOM   661  N  N     . ILE A 1 112 ? -9.517  20.052 9.864   1.00 66.45  ? 623 ILE A N     1 
ATOM   662  C  CA    . ILE A 1 112 ? -10.079 20.840 8.762   1.00 73.03  ? 623 ILE A CA    1 
ATOM   663  C  C     . ILE A 1 112 ? -9.290  20.726 7.444   1.00 76.77  ? 623 ILE A C     1 
ATOM   664  O  O     . ILE A 1 112 ? -9.862  20.911 6.365   1.00 84.13  ? 623 ILE A O     1 
ATOM   665  C  CB    . ILE A 1 112 ? -10.172 22.327 9.160   1.00 73.76  ? 623 ILE A CB    1 
ATOM   666  C  CG1   . ILE A 1 112 ? -8.773  22.883 9.411   1.00 78.37  ? 623 ILE A CG1   1 
ATOM   667  C  CG2   . ILE A 1 112 ? -10.989 22.483 10.425  1.00 81.36  ? 623 ILE A CG2   1 
ATOM   668  C  CD1   . ILE A 1 112 ? -8.708  24.373 9.644   1.00 82.88  ? 623 ILE A CD1   1 
ATOM   669  N  N     . CYS A 1 113 ? -7.998  20.393 7.527   1.00 68.85  ? 624 CYS A N     1 
ATOM   670  C  CA    . CYS A 1 113 ? -7.175  20.201 6.328   1.00 60.65  ? 624 CYS A CA    1 
ATOM   671  C  C     . CYS A 1 113 ? -7.715  19.021 5.541   1.00 59.50  ? 624 CYS A C     1 
ATOM   672  O  O     . CYS A 1 113 ? -8.116  18.005 6.114   1.00 61.88  ? 624 CYS A O     1 
ATOM   673  C  CB    . CYS A 1 113 ? -5.701  19.949 6.675   1.00 46.11  ? 624 CYS A CB    1 
ATOM   674  S  SG    . CYS A 1 113 ? -4.888  21.324 7.467   1.00 54.45  ? 624 CYS A SG    1 
ATOM   675  N  N     . LYS A 1 114 ? -7.680  19.133 4.226   1.00 50.84  ? 625 LYS A N     1 
ATOM   676  C  CA    . LYS A 1 114 ? -8.158  18.064 3.384   1.00 47.52  ? 625 LYS A CA    1 
ATOM   677  C  C     . LYS A 1 114 ? -6.995  17.456 2.612   1.00 52.95  ? 625 LYS A C     1 
ATOM   678  O  O     . LYS A 1 114 ? -7.172  16.994 1.485   1.00 50.10  ? 625 LYS A O     1 
ATOM   679  C  CB    . LYS A 1 114 ? -9.227  18.604 2.451   1.00 56.03  ? 625 LYS A CB    1 
ATOM   680  C  CG    . LYS A 1 114 ? -10.447 19.129 3.192   1.00 54.83  ? 625 LYS A CG    1 
ATOM   681  C  CD    . LYS A 1 114 ? -11.242 20.126 2.334   1.00 62.95  ? 625 LYS A CD    1 
ATOM   682  C  CE    . LYS A 1 114 ? -12.391 20.760 3.126   1.00 67.40  ? 625 LYS A CE    1 
ATOM   683  N  NZ    . LYS A 1 114 ? -13.476 21.349 2.262   1.00 64.93  ? 625 LYS A NZ    1 
ATOM   684  N  N     . CYS A 1 115 ? -5.817  17.452 3.252   1.00 62.74  ? 626 CYS A N     1 
ATOM   685  C  CA    . CYS A 1 115 ? -4.592  16.810 2.745   1.00 61.94  ? 626 CYS A CA    1 
ATOM   686  C  C     . CYS A 1 115 ? -4.814  15.405 2.211   1.00 60.41  ? 626 CYS A C     1 
ATOM   687  O  O     . CYS A 1 115 ? -5.711  14.688 2.651   1.00 60.86  ? 626 CYS A O     1 
ATOM   688  C  CB    . CYS A 1 115 ? -3.528  16.643 3.832   1.00 57.24  ? 626 CYS A CB    1 
ATOM   689  S  SG    . CYS A 1 115 ? -3.451  17.785 5.160   1.00 52.14  ? 626 CYS A SG    1 
ATOM   690  N  N     . ILE A 1 116 ? -3.945  15.006 1.297   1.00 54.60  ? 627 ILE A N     1 
ATOM   691  C  CA    . ILE A 1 116 ? -3.774  13.615 0.929   1.00 54.30  ? 627 ILE A CA    1 
ATOM   692  C  C     . ILE A 1 116 ? -2.309  13.218 1.124   1.00 55.25  ? 627 ILE A C     1 
ATOM   693  O  O     . ILE A 1 116 ? -1.417  13.911 0.677   1.00 61.16  ? 627 ILE A O     1 
ATOM   694  C  CB    . ILE A 1 116 ? -4.207  13.365 -0.509  1.00 65.09  ? 627 ILE A CB    1 
ATOM   695  C  CG1   . ILE A 1 116 ? -5.723  13.522 -0.613  1.00 76.68  ? 627 ILE A CG1   1 
ATOM   696  C  CG2   . ILE A 1 116 ? -3.810  11.976 -0.947  1.00 64.89  ? 627 ILE A CG2   1 
ATOM   697  C  CD1   . ILE A 1 116 ? -6.272  13.268 -2.000  1.00 79.91  ? 627 ILE A CD1   1 
ATOM   698  N  N     . GLY A 1 117 ? -2.069  12.133 1.849   1.00 56.18  ? 628 GLY A N     1 
ATOM   699  C  CA    . GLY A 1 117 ? -0.717  11.681 2.099   1.00 53.26  ? 628 GLY A CA    1 
ATOM   700  C  C     . GLY A 1 117 ? -0.026  12.564 3.117   1.00 51.54  ? 628 GLY A C     1 
ATOM   701  O  O     . GLY A 1 117 ? 1.182   12.759 3.035   1.00 51.58  ? 628 GLY A O     1 
ATOM   702  N  N     . CYS A 1 118 ? -0.785  13.130 4.055   1.00 47.27  ? 629 CYS A N     1 
ATOM   703  C  CA    . CYS A 1 118 ? -0.193  14.060 5.015   1.00 46.79  ? 629 CYS A CA    1 
ATOM   704  C  C     . CYS A 1 118 ? 0.782   13.391 6.005   1.00 53.89  ? 629 CYS A C     1 
ATOM   705  O  O     . CYS A 1 118 ? 0.460   12.435 6.743   1.00 52.98  ? 629 CYS A O     1 
ATOM   706  C  CB    . CYS A 1 118 ? -1.274  14.809 5.790   1.00 39.01  ? 629 CYS A CB    1 
ATOM   707  S  SG    . CYS A 1 118 ? -0.611  16.051 6.930   1.00 44.77  ? 629 CYS A SG    1 
ATOM   708  N  N     . LYS A 1 119 ? 1.986   13.938 6.001   1.00 45.77  ? 630 LYS A N     1 
ATOM   709  C  CA    . LYS A 1 119 ? 3.048   13.513 6.874   1.00 38.83  ? 630 LYS A CA    1 
ATOM   710  C  C     . LYS A 1 119 ? 3.349   14.637 7.843   1.00 38.70  ? 630 LYS A C     1 
ATOM   711  O  O     . LYS A 1 119 ? 4.362   14.614 8.522   1.00 37.10  ? 630 LYS A O     1 
ATOM   712  C  CB    . LYS A 1 119 ? 4.297   13.165 6.065   1.00 33.66  ? 630 LYS A CB    1 
ATOM   713  C  CG    . LYS A 1 119 ? 4.098   12.011 5.114   1.00 49.19  ? 630 LYS A CG    1 
ATOM   714  C  CD    . LYS A 1 119 ? 5.311   11.817 4.217   1.00 62.74  ? 630 LYS A CD    1 
ATOM   715  C  CE    . LYS A 1 119 ? 5.025   10.750 3.165   1.00 71.91  ? 630 LYS A CE    1 
ATOM   716  N  NZ    . LYS A 1 119 ? 6.249   10.297 2.445   1.00 75.72  ? 630 LYS A NZ    1 
ATOM   717  N  N     . ASN A 1 120 ? 2.474   15.633 7.903   1.00 38.36  ? 631 ASN A N     1 
ATOM   718  C  CA    . ASN A 1 120 ? 2.739   16.785 8.766   1.00 55.85  ? 631 ASN A CA    1 
ATOM   719  C  C     . ASN A 1 120 ? 1.800   16.718 9.965   1.00 55.38  ? 631 ASN A C     1 
ATOM   720  O  O     . ASN A 1 120 ? 0.839   17.484 10.087  1.00 56.38  ? 631 ASN A O     1 
ATOM   721  C  CB    . ASN A 1 120 ? 2.585   18.097 7.974   1.00 35.05  ? 631 ASN A CB    1 
ATOM   722  C  CG    . ASN A 1 120 ? 2.841   19.376 8.811   1.00 53.74  ? 631 ASN A CG    1 
ATOM   723  O  OD1   . ASN A 1 120 ? 3.829   19.489 9.553   1.00 42.70  ? 631 ASN A OD1   1 
ATOM   724  N  ND2   . ASN A 1 120 ? 1.961   20.378 8.630   1.00 45.13  ? 631 ASN A ND2   1 
ATOM   725  N  N     . PHE A 1 121 ? 2.092   15.749 10.821  1.00 55.10  ? 632 PHE A N     1 
ATOM   726  C  CA    . PHE A 1 121 ? 1.423   15.580 12.112  1.00 59.43  ? 632 PHE A CA    1 
ATOM   727  C  C     . PHE A 1 121 ? 2.484   15.294 13.160  1.00 59.15  ? 632 PHE A C     1 
ATOM   728  O  O     . PHE A 1 121 ? 3.640   15.003 12.822  1.00 54.05  ? 632 PHE A O     1 
ATOM   729  C  CB    . PHE A 1 121 ? 0.370   14.463 12.090  1.00 50.07  ? 632 PHE A CB    1 
ATOM   730  C  CG    . PHE A 1 121 ? 0.873   13.154 11.548  1.00 48.96  ? 632 PHE A CG    1 
ATOM   731  C  CD1   . PHE A 1 121 ? 0.813   12.882 10.189  1.00 48.23  ? 632 PHE A CD1   1 
ATOM   732  C  CD2   . PHE A 1 121 ? 1.397   12.192 12.394  1.00 54.04  ? 632 PHE A CD2   1 
ATOM   733  C  CE1   . PHE A 1 121 ? 1.265   11.685 9.692   1.00 47.62  ? 632 PHE A CE1   1 
ATOM   734  C  CE2   . PHE A 1 121 ? 1.855   10.986 11.901  1.00 48.45  ? 632 PHE A CE2   1 
ATOM   735  C  CZ    . PHE A 1 121 ? 1.795   10.735 10.550  1.00 46.77  ? 632 PHE A CZ    1 
ATOM   736  N  N     . GLU A 1 122 ? 2.075   15.390 14.422  1.00 59.43  ? 633 GLU A N     1 
ATOM   737  C  CA    . GLU A 1 122 ? 2.978   15.346 15.571  1.00 64.33  ? 633 GLU A CA    1 
ATOM   738  C  C     . GLU A 1 122 ? 3.891   14.107 15.596  1.00 54.82  ? 633 GLU A C     1 
ATOM   739  O  O     . GLU A 1 122 ? 5.102   14.213 15.822  1.00 50.98  ? 633 GLU A O     1 
ATOM   740  C  CB    . GLU A 1 122 ? 2.152   15.412 16.853  1.00 76.64  ? 633 GLU A CB    1 
ATOM   741  C  CG    . GLU A 1 122 ? 2.964   15.374 18.123  1.00 91.68  ? 633 GLU A CG    1 
ATOM   742  C  CD    . GLU A 1 122 ? 3.794   16.619 18.307  1.00 103.77 ? 633 GLU A CD    1 
ATOM   743  O  OE1   . GLU A 1 122 ? 3.215   17.728 18.273  1.00 109.19 ? 633 GLU A OE1   1 
ATOM   744  O  OE2   . GLU A 1 122 ? 5.024   16.488 18.484  1.00 107.73 ? 633 GLU A OE2   1 
ATOM   745  N  N     . GLU A 1 123 ? 3.310   12.937 15.364  1.00 41.35  ? 634 GLU A N     1 
ATOM   746  C  CA    . GLU A 1 123 ? 4.040   11.688 15.525  1.00 57.75  ? 634 GLU A CA    1 
ATOM   747  C  C     . GLU A 1 123 ? 4.714   11.243 14.212  1.00 65.50  ? 634 GLU A C     1 
ATOM   748  O  O     . GLU A 1 123 ? 5.214   10.116 14.108  1.00 67.90  ? 634 GLU A O     1 
ATOM   749  C  CB    . GLU A 1 123 ? 3.098   10.589 16.061  1.00 61.24  ? 634 GLU A CB    1 
ATOM   750  C  CG    . GLU A 1 123 ? 2.255   11.015 17.289  1.00 68.05  ? 634 GLU A CG    1 
ATOM   751  C  CD    . GLU A 1 123 ? 1.015   11.866 16.931  1.00 72.86  ? 634 GLU A CD    1 
ATOM   752  O  OE1   . GLU A 1 123 ? 0.944   12.403 15.806  1.00 66.55  ? 634 GLU A OE1   1 
ATOM   753  O  OE2   . GLU A 1 123 ? 0.121   12.031 17.790  1.00 78.10  ? 634 GLU A OE2   1 
ATOM   754  N  N     . SER A 1 124 ? 4.736   12.124 13.214  1.00 65.12  ? 635 SER A N     1 
ATOM   755  C  CA    . SER A 1 124 ? 5.313   11.778 11.912  1.00 58.43  ? 635 SER A CA    1 
ATOM   756  C  C     . SER A 1 124 ? 6.829   11.682 11.996  1.00 59.84  ? 635 SER A C     1 
ATOM   757  O  O     . SER A 1 124 ? 7.483   12.619 12.452  1.00 60.76  ? 635 SER A O     1 
ATOM   758  C  CB    . SER A 1 124 ? 4.908   12.798 10.838  1.00 56.63  ? 635 SER A CB    1 
ATOM   759  O  OG    . SER A 1 124 ? 5.578   12.563 9.597   1.00 53.19  ? 635 SER A OG    1 
ATOM   760  N  N     . PRO A 1 125 ? 7.387   10.542 11.556  1.00 58.76  ? 636 PRO A N     1 
ATOM   761  C  CA    . PRO A 1 125 ? 8.837   10.348 11.477  1.00 64.41  ? 636 PRO A CA    1 
ATOM   762  C  C     . PRO A 1 125 ? 9.473   11.320 10.472  1.00 65.11  ? 636 PRO A C     1 
ATOM   763  O  O     . PRO A 1 125 ? 10.386  12.072 10.831  1.00 65.40  ? 636 PRO A O     1 
ATOM   764  C  CB    . PRO A 1 125 ? 8.979   8.902  10.992  1.00 60.31  ? 636 PRO A CB    1 
ATOM   765  C  CG    . PRO A 1 125 ? 7.644   8.280  11.178  1.00 59.09  ? 636 PRO A CG    1 
ATOM   766  C  CD    . PRO A 1 125 ? 6.650   9.373  11.049  1.00 53.10  ? 636 PRO A CD    1 
ATOM   767  N  N     . GLU A 1 126 ? 8.973   11.302 9.236   1.00 58.97  ? 637 GLU A N     1 
ATOM   768  C  CA    . GLU A 1 126 ? 9.517   12.128 8.164   1.00 57.03  ? 637 GLU A CA    1 
ATOM   769  C  C     . GLU A 1 126 ? 9.524   13.578 8.588   1.00 57.60  ? 637 GLU A C     1 
ATOM   770  O  O     . GLU A 1 126 ? 10.455  14.309 8.277   1.00 63.23  ? 637 GLU A O     1 
ATOM   771  C  CB    . GLU A 1 126 ? 8.723   11.966 6.864   1.00 57.32  ? 637 GLU A CB    1 
ATOM   772  C  CG    . GLU A 1 126 ? 8.604   10.530 6.374   1.00 66.36  ? 637 GLU A CG    1 
ATOM   773  C  CD    . GLU A 1 126 ? 7.362   9.811  6.920   1.00 76.43  ? 637 GLU A CD    1 
ATOM   774  O  OE1   . GLU A 1 126 ? 6.787   10.279 7.939   1.00 69.13  ? 637 GLU A OE1   1 
ATOM   775  O  OE2   . GLU A 1 126 ? 6.966   8.775  6.326   1.00 76.39  ? 637 GLU A OE2   1 
ATOM   776  N  N     . ARG A 1 127 ? 8.495   13.995 9.314   1.00 58.60  ? 638 ARG A N     1 
ATOM   777  C  CA    . ARG A 1 127 ? 8.461   15.374 9.765   1.00 60.66  ? 638 ARG A CA    1 
ATOM   778  C  C     . ARG A 1 127 ? 9.592   15.598 10.749  1.00 71.53  ? 638 ARG A C     1 
ATOM   779  O  O     . ARG A 1 127 ? 10.340  16.569 10.623  1.00 78.28  ? 638 ARG A O     1 
ATOM   780  C  CB    . ARG A 1 127 ? 7.121   15.727 10.406  1.00 52.82  ? 638 ARG A CB    1 
ATOM   781  C  CG    . ARG A 1 127 ? 7.044   17.173 10.840  1.00 47.59  ? 638 ARG A CG    1 
ATOM   782  C  CD    . ARG A 1 127 ? 5.834   17.489 11.700  1.00 56.34  ? 638 ARG A CD    1 
ATOM   783  N  NE    . ARG A 1 127 ? 5.870   16.794 12.983  1.00 74.34  ? 638 ARG A NE    1 
ATOM   784  C  CZ    . ARG A 1 127 ? 6.680   17.116 13.989  1.00 79.13  ? 638 ARG A CZ    1 
ATOM   785  N  NH1   . ARG A 1 127 ? 7.541   18.120 13.855  1.00 78.63  ? 638 ARG A NH1   1 
ATOM   786  N  NH2   . ARG A 1 127 ? 6.635   16.426 15.127  1.00 71.76  ? 638 ARG A NH2   1 
ATOM   787  N  N     . LYS A 1 128 ? 9.733   14.678 11.705  1.00 75.91  ? 639 LYS A N     1 
ATOM   788  C  CA    . LYS A 1 128 ? 10.798  14.756 12.706  1.00 70.90  ? 639 LYS A CA    1 
ATOM   789  C  C     . LYS A 1 128 ? 12.191  14.719 12.078  1.00 67.82  ? 639 LYS A C     1 
ATOM   790  O  O     . LYS A 1 128 ? 13.071  15.469 12.487  1.00 79.33  ? 639 LYS A O     1 
ATOM   791  C  CB    . LYS A 1 128 ? 10.655  13.633 13.727  1.00 76.68  ? 639 LYS A CB    1 
ATOM   792  C  CG    . LYS A 1 128 ? 9.833   14.021 14.950  1.00 76.89  ? 639 LYS A CG    1 
ATOM   793  C  CD    . LYS A 1 128 ? 9.314   12.813 15.723  1.00 65.38  ? 639 LYS A CD    1 
ATOM   794  C  CE    . LYS A 1 128 ? 8.614   13.296 16.985  1.00 68.96  ? 639 LYS A CE    1 
ATOM   795  N  NZ    . LYS A 1 128 ? 7.894   12.250 17.766  1.00 64.45  ? 639 LYS A NZ    1 
ATOM   796  N  N     . THR A 1 129 ? 12.388  13.854 11.086  1.00 55.66  ? 640 THR A N     1 
ATOM   797  C  CA    . THR A 1 129 ? 13.660  13.790 10.368  1.00 59.56  ? 640 THR A CA    1 
ATOM   798  C  C     . THR A 1 129 ? 13.951  15.118 9.652   1.00 68.41  ? 640 THR A C     1 
ATOM   799  O  O     . THR A 1 129 ? 15.053  15.653 9.760   1.00 80.48  ? 640 THR A O     1 
ATOM   800  C  CB    . THR A 1 129 ? 13.679  12.666 9.317   1.00 61.37  ? 640 THR A CB    1 
ATOM   801  O  OG1   . THR A 1 129 ? 13.233  11.438 9.896   1.00 70.60  ? 640 THR A OG1   1 
ATOM   802  C  CG2   . THR A 1 129 ? 15.079  12.490 8.750   1.00 59.57  ? 640 THR A CG2   1 
ATOM   803  N  N     . LEU A 1 130 ? 12.960  15.640 8.923   1.00 57.62  ? 641 LEU A N     1 
ATOM   804  C  CA    . LEU A 1 130 ? 13.084  16.933 8.252   1.00 63.41  ? 641 LEU A CA    1 
ATOM   805  C  C     . LEU A 1 130 ? 13.153  18.102 9.236   1.00 73.43  ? 641 LEU A C     1 
ATOM   806  O  O     . LEU A 1 130 ? 13.421  19.233 8.837   1.00 79.93  ? 641 LEU A O     1 
ATOM   807  C  CB    . LEU A 1 130 ? 11.921  17.157 7.273   1.00 56.52  ? 641 LEU A CB    1 
ATOM   808  N  N     . MET A 1 131 ? 12.910  17.840 10.514  1.00 77.40  ? 642 MET A N     1 
ATOM   809  C  CA    . MET A 1 131 ? 13.050  18.882 11.518  1.00 87.57  ? 642 MET A CA    1 
ATOM   810  C  C     . MET A 1 131 ? 14.517  19.015 11.946  1.00 104.03 ? 642 MET A C     1 
ATOM   811  O  O     . MET A 1 131 ? 14.939  20.061 12.444  1.00 108.37 ? 642 MET A O     1 
ATOM   812  C  CB    . MET A 1 131 ? 12.153  18.584 12.715  1.00 86.26  ? 642 MET A CB    1 
ATOM   813  C  CG    . MET A 1 131 ? 11.841  19.791 13.573  1.00 89.46  ? 642 MET A CG    1 
ATOM   814  S  SD    . MET A 1 131 ? 10.691  19.381 14.894  1.00 109.47 ? 642 MET A SD    1 
ATOM   815  C  CE    . MET A 1 131 ? 10.722  20.880 15.876  1.00 76.38  ? 642 MET A CE    1 
ATOM   816  N  N     . HIS A 1 132 ? 15.290  17.951 11.738  1.00 112.00 ? 643 HIS A N     1 
ATOM   817  C  CA    . HIS A 1 132 ? 16.734  17.967 11.991  1.00 114.57 ? 643 HIS A CA    1 
ATOM   818  C  C     . HIS A 1 132 ? 17.535  17.631 10.726  1.00 105.81 ? 643 HIS A C     1 
ATOM   819  O  O     . HIS A 1 132 ? 17.842  18.506 9.908   1.00 94.81  ? 643 HIS A O     1 
ATOM   820  C  CB    . HIS A 1 132 ? 17.097  16.991 13.120  1.00 118.79 ? 643 HIS A CB    1 
ATOM   821  C  CG    . HIS A 1 132 ? 16.301  17.188 14.376  1.00 124.10 ? 643 HIS A CG    1 
ATOM   822  N  ND1   . HIS A 1 132 ? 15.854  16.139 15.147  1.00 125.33 ? 643 HIS A ND1   1 
ATOM   823  C  CD2   . HIS A 1 132 ? 15.880  18.318 14.996  1.00 126.36 ? 643 HIS A CD2   1 
ATOM   824  C  CE1   . HIS A 1 132 ? 15.186  16.611 16.189  1.00 125.26 ? 643 HIS A CE1   1 
ATOM   825  N  NE2   . HIS A 1 132 ? 15.189  17.931 16.117  1.00 126.08 ? 643 HIS A NE2   1 
ATOM   826  N  N     . ARG B 1 11  ? -22.895 39.804 16.827  1.00 111.09 ? 522 ARG B N     1 
ATOM   827  C  CA    . ARG B 1 11  ? -22.519 41.007 16.086  1.00 110.81 ? 522 ARG B CA    1 
ATOM   828  C  C     . ARG B 1 11  ? -23.555 42.118 16.246  1.00 108.30 ? 522 ARG B C     1 
ATOM   829  O  O     . ARG B 1 11  ? -24.370 42.354 15.353  1.00 108.84 ? 522 ARG B O     1 
ATOM   830  C  CB    . ARG B 1 11  ? -22.327 40.690 14.598  1.00 108.46 ? 522 ARG B CB    1 
ATOM   831  N  N     . LYS B 1 12  ? -23.505 42.800 17.387  1.00 98.98  ? 523 LYS B N     1 
ATOM   832  C  CA    . LYS B 1 12  ? -24.409 43.906 17.691  1.00 87.15  ? 523 LYS B CA    1 
ATOM   833  C  C     . LYS B 1 12  ? -23.783 45.245 17.270  1.00 84.04  ? 523 LYS B C     1 
ATOM   834  O  O     . LYS B 1 12  ? -22.569 45.421 17.372  1.00 92.61  ? 523 LYS B O     1 
ATOM   835  C  CB    . LYS B 1 12  ? -24.752 43.900 19.187  1.00 78.18  ? 523 LYS B CB    1 
ATOM   836  C  CG    . LYS B 1 12  ? -25.297 45.214 19.729  1.00 77.82  ? 523 LYS B CG    1 
ATOM   837  C  CD    . LYS B 1 12  ? -26.081 45.020 21.012  1.00 78.83  ? 523 LYS B CD    1 
ATOM   838  C  CE    . LYS B 1 12  ? -25.241 44.371 22.091  1.00 75.75  ? 523 LYS B CE    1 
ATOM   839  N  NZ    . LYS B 1 12  ? -26.044 44.217 23.326  1.00 79.36  ? 523 LYS B NZ    1 
ATOM   840  N  N     . PRO B 1 13  ? -24.601 46.185 16.767  1.00 70.24  ? 524 PRO B N     1 
ATOM   841  C  CA    . PRO B 1 13  ? -24.058 47.453 16.260  1.00 65.95  ? 524 PRO B CA    1 
ATOM   842  C  C     . PRO B 1 13  ? -23.415 48.360 17.326  1.00 60.62  ? 524 PRO B C     1 
ATOM   843  O  O     . PRO B 1 13  ? -23.983 48.597 18.381  1.00 64.75  ? 524 PRO B O     1 
ATOM   844  C  CB    . PRO B 1 13  ? -25.290 48.132 15.653  1.00 66.10  ? 524 PRO B CB    1 
ATOM   845  C  CG    . PRO B 1 13  ? -26.459 47.520 16.378  1.00 64.65  ? 524 PRO B CG    1 
ATOM   846  C  CD    . PRO B 1 13  ? -26.060 46.096 16.574  1.00 64.63  ? 524 PRO B CD    1 
ATOM   847  N  N     . CYS B 1 14  ? -22.232 48.878 17.010  1.00 50.80  ? 525 CYS B N     1 
ATOM   848  C  CA    . CYS B 1 14  ? -21.503 49.807 17.864  1.00 44.11  ? 525 CYS B CA    1 
ATOM   849  C  C     . CYS B 1 14  ? -22.075 51.226 17.755  1.00 49.47  ? 525 CYS B C     1 
ATOM   850  O  O     . CYS B 1 14  ? -22.725 51.558 16.763  1.00 55.77  ? 525 CYS B O     1 
ATOM   851  C  CB    . CYS B 1 14  ? -20.015 49.805 17.466  1.00 37.77  ? 525 CYS B CB    1 
ATOM   852  S  SG    . CYS B 1 14  ? -19.644 50.672 15.863  1.00 42.95  ? 525 CYS B SG    1 
ATOM   853  N  N     . ASN B 1 15  ? -21.828 52.064 18.761  1.00 40.42  ? 526 ASN B N     1 
ATOM   854  C  CA    . ASN B 1 15  ? -22.257 53.468 18.724  1.00 40.03  ? 526 ASN B CA    1 
ATOM   855  C  C     . ASN B 1 15  ? -21.098 54.439 18.939  1.00 45.70  ? 526 ASN B C     1 
ATOM   856  O  O     . ASN B 1 15  ? -21.268 55.529 19.482  1.00 48.48  ? 526 ASN B O     1 
ATOM   857  C  CB    . ASN B 1 15  ? -23.335 53.740 19.773  1.00 44.20  ? 526 ASN B CB    1 
ATOM   858  C  CG    . ASN B 1 15  ? -24.507 52.805 19.648  1.00 53.46  ? 526 ASN B CG    1 
ATOM   859  O  OD1   . ASN B 1 15  ? -24.336 51.592 19.587  1.00 59.25  ? 526 ASN B OD1   1 
ATOM   860  N  ND2   . ASN B 1 15  ? -25.707 53.366 19.555  1.00 49.99  ? 526 ASN B ND2   1 
ATOM   861  N  N     . CYS B 1 16  ? -19.917 54.021 18.519  1.00 42.81  ? 527 CYS B N     1 
ATOM   862  C  CA    . CYS B 1 16  ? -18.708 54.810 18.677  1.00 47.56  ? 527 CYS B CA    1 
ATOM   863  C  C     . CYS B 1 16  ? -18.816 56.200 18.043  1.00 49.06  ? 527 CYS B C     1 
ATOM   864  O  O     . CYS B 1 16  ? -19.527 56.411 17.062  1.00 56.63  ? 527 CYS B O     1 
ATOM   865  C  CB    . CYS B 1 16  ? -17.540 54.042 18.083  1.00 53.36  ? 527 CYS B CB    1 
ATOM   866  S  SG    . CYS B 1 16  ? -17.683 52.275 18.326  1.00 45.46  ? 527 CYS B SG    1 
ATOM   867  N  N     . THR B 1 17  ? -18.100 57.141 18.627  1.00 47.88  ? 528 THR B N     1 
ATOM   868  C  CA    . THR B 1 17  ? -18.014 58.487 18.106  1.00 49.84  ? 528 THR B CA    1 
ATOM   869  C  C     . THR B 1 17  ? -16.573 58.912 17.912  1.00 52.93  ? 528 THR B C     1 
ATOM   870  O  O     . THR B 1 17  ? -16.191 59.446 16.879  1.00 63.03  ? 528 THR B O     1 
ATOM   871  C  CB    . THR B 1 17  ? -18.658 59.453 19.058  1.00 52.96  ? 528 THR B CB    1 
ATOM   872  O  OG1   . THR B 1 17  ? -19.985 59.008 19.316  1.00 59.34  ? 528 THR B OG1   1 
ATOM   873  C  CG2   . THR B 1 17  ? -18.694 60.837 18.448  1.00 69.27  ? 528 THR B CG2   1 
ATOM   874  N  N     . LYS B 1 18  ? -15.790 58.638 18.941  1.00 41.11  ? 529 LYS B N     1 
ATOM   875  C  CA    . LYS B 1 18  ? -14.504 59.243 19.153  1.00 39.83  ? 529 LYS B CA    1 
ATOM   876  C  C     . LYS B 1 18  ? -13.349 58.458 18.523  1.00 48.20  ? 529 LYS B C     1 
ATOM   877  O  O     . LYS B 1 18  ? -12.299 59.033 18.198  1.00 48.89  ? 529 LYS B O     1 
ATOM   878  C  CB    . LYS B 1 18  ? -14.305 59.420 20.663  1.00 45.15  ? 529 LYS B CB    1 
ATOM   879  C  CG    . LYS B 1 18  ? -15.111 60.590 21.253  1.00 45.21  ? 529 LYS B CG    1 
ATOM   880  C  CD    . LYS B 1 18  ? -14.481 61.915 20.773  1.00 53.88  ? 529 LYS B CD    1 
ATOM   881  C  CE    . LYS B 1 18  ? -15.338 63.143 21.053  1.00 62.45  ? 529 LYS B CE    1 
ATOM   882  N  NZ    . LYS B 1 18  ? -15.525 63.451 22.498  1.00 67.00  ? 529 LYS B NZ    1 
ATOM   883  N  N     . SER B 1 19  ? -13.546 57.156 18.338  1.00 48.05  ? 530 SER B N     1 
ATOM   884  C  CA    . SER B 1 19  ? -12.457 56.257 17.945  1.00 42.64  ? 530 SER B CA    1 
ATOM   885  C  C     . SER B 1 19  ? -12.379 55.937 16.443  1.00 44.31  ? 530 SER B C     1 
ATOM   886  O  O     . SER B 1 19  ? -11.412 55.316 15.985  1.00 45.92  ? 530 SER B O     1 
ATOM   887  C  CB    . SER B 1 19  ? -12.577 54.957 18.714  1.00 32.36  ? 530 SER B CB    1 
ATOM   888  O  OG    . SER B 1 19  ? -13.769 54.318 18.326  1.00 36.69  ? 530 SER B OG    1 
ATOM   889  N  N     . LEU B 1 20  ? -13.407 56.327 15.696  1.00 41.71  ? 531 LEU B N     1 
ATOM   890  C  CA    . LEU B 1 20  ? -13.506 56.058 14.258  1.00 42.76  ? 531 LEU B CA    1 
ATOM   891  C  C     . LEU B 1 20  ? -13.754 54.579 14.021  1.00 48.11  ? 531 LEU B C     1 
ATOM   892  O  O     . LEU B 1 20  ? -13.850 54.126 12.870  1.00 45.37  ? 531 LEU B O     1 
ATOM   893  C  CB    . LEU B 1 20  ? -12.240 56.507 13.508  1.00 39.36  ? 531 LEU B CB    1 
ATOM   894  C  CG    . LEU B 1 20  ? -11.691 57.901 13.813  1.00 47.01  ? 531 LEU B CG    1 
ATOM   895  C  CD1   . LEU B 1 20  ? -10.351 58.104 13.127  1.00 46.36  ? 531 LEU B CD1   1 
ATOM   896  C  CD2   . LEU B 1 20  ? -12.680 58.967 13.384  1.00 47.12  ? 531 LEU B CD2   1 
ATOM   897  N  N     . CYS B 1 21  ? -13.861 53.841 15.129  1.00 46.82  ? 532 CYS B N     1 
ATOM   898  C  CA    . CYS B 1 21  ? -14.010 52.390 15.132  1.00 37.07  ? 532 CYS B CA    1 
ATOM   899  C  C     . CYS B 1 21  ? -12.695 51.762 14.664  1.00 38.50  ? 532 CYS B C     1 
ATOM   900  O  O     . CYS B 1 21  ? -12.666 50.678 14.079  1.00 34.58  ? 532 CYS B O     1 
ATOM   901  C  CB    . CYS B 1 21  ? -15.202 51.937 14.279  1.00 34.96  ? 532 CYS B CB    1 
ATOM   902  S  SG    . CYS B 1 21  ? -16.718 52.821 14.688  1.00 39.18  ? 532 CYS B SG    1 
ATOM   903  N  N     . LEU B 1 22  ? -11.606 52.451 14.982  1.00 39.17  ? 533 LEU B N     1 
ATOM   904  C  CA    . LEU B 1 22  ? -10.255 51.999 14.653  1.00 46.00  ? 533 LEU B CA    1 
ATOM   905  C  C     . LEU B 1 22  ? -9.415  51.710 15.907  1.00 49.99  ? 533 LEU B C     1 
ATOM   906  O  O     . LEU B 1 22  ? -8.198  51.531 15.839  1.00 48.46  ? 533 LEU B O     1 
ATOM   907  C  CB    . LEU B 1 22  ? -9.567  53.040 13.784  1.00 33.99  ? 533 LEU B CB    1 
ATOM   908  C  CG    . LEU B 1 22  ? -10.067 53.033 12.332  1.00 37.14  ? 533 LEU B CG    1 
ATOM   909  C  CD1   . LEU B 1 22  ? -9.168  53.867 11.454  1.00 38.04  ? 533 LEU B CD1   1 
ATOM   910  C  CD2   . LEU B 1 22  ? -10.126 51.611 11.797  1.00 34.83  ? 533 LEU B CD2   1 
ATOM   911  N  N     . LYS B 1 23  ? -10.097 51.625 17.044  1.00 42.38  ? 534 LYS B N     1 
ATOM   912  C  CA    . LYS B 1 23  ? -9.472  51.279 18.300  1.00 46.33  ? 534 LYS B CA    1 
ATOM   913  C  C     . LYS B 1 23  ? -10.288 50.154 18.938  1.00 46.29  ? 534 LYS B C     1 
ATOM   914  O  O     . LYS B 1 23  ? -11.462 49.969 18.596  1.00 44.55  ? 534 LYS B O     1 
ATOM   915  C  CB    . LYS B 1 23  ? -9.390  52.498 19.211  1.00 45.54  ? 534 LYS B CB    1 
ATOM   916  C  CG    . LYS B 1 23  ? -8.261  53.454 18.867  1.00 35.41  ? 534 LYS B CG    1 
ATOM   917  C  CD    . LYS B 1 23  ? -8.281  54.665 19.790  1.00 42.49  ? 534 LYS B CD    1 
ATOM   918  C  CE    . LYS B 1 23  ? -7.265  55.731 19.368  1.00 50.26  ? 534 LYS B CE    1 
ATOM   919  N  NZ    . LYS B 1 23  ? -7.255  56.886 20.326  1.00 54.32  ? 534 LYS B NZ    1 
ATOM   920  N  N     . LEU B 1 24  ? -9.678  49.425 19.874  1.00 48.63  ? 535 LEU B N     1 
ATOM   921  C  CA    . LEU B 1 24  ? -10.270 48.185 20.392  1.00 51.47  ? 535 LEU B CA    1 
ATOM   922  C  C     . LEU B 1 24  ? -11.473 48.442 21.281  1.00 50.29  ? 535 LEU B C     1 
ATOM   923  O  O     . LEU B 1 24  ? -12.196 47.505 21.617  1.00 56.08  ? 535 LEU B O     1 
ATOM   924  C  CB    . LEU B 1 24  ? -9.237  47.345 21.161  1.00 56.21  ? 535 LEU B CB    1 
ATOM   925  C  CG    . LEU B 1 24  ? -8.040  46.778 20.387  1.00 56.79  ? 535 LEU B CG    1 
ATOM   926  C  CD1   . LEU B 1 24  ? -7.073  46.122 21.354  1.00 63.32  ? 535 LEU B CD1   1 
ATOM   927  C  CD2   . LEU B 1 24  ? -8.444  45.806 19.269  1.00 40.88  ? 535 LEU B CD2   1 
ATOM   928  N  N     . TYR B 1 25  ? -11.712 49.708 21.619  1.00 33.97  ? 536 TYR B N     1 
ATOM   929  C  CA    . TYR B 1 25  ? -12.963 50.113 22.257  1.00 34.21  ? 536 TYR B CA    1 
ATOM   930  C  C     . TYR B 1 25  ? -14.152 49.715 21.377  1.00 38.78  ? 536 TYR B C     1 
ATOM   931  O  O     . TYR B 1 25  ? -15.280 49.642 21.832  1.00 35.68  ? 536 TYR B O     1 
ATOM   932  C  CB    . TYR B 1 25  ? -13.021 51.633 22.486  1.00 42.27  ? 536 TYR B CB    1 
ATOM   933  C  CG    . TYR B 1 25  ? -11.889 52.279 23.266  1.00 49.42  ? 536 TYR B CG    1 
ATOM   934  C  CD1   . TYR B 1 25  ? -11.737 52.088 24.645  1.00 46.32  ? 536 TYR B CD1   1 
ATOM   935  C  CD2   . TYR B 1 25  ? -10.963 53.088 22.612  1.00 43.45  ? 536 TYR B CD2   1 
ATOM   936  C  CE1   . TYR B 1 25  ? -10.696 52.706 25.337  1.00 52.43  ? 536 TYR B CE1   1 
ATOM   937  C  CE2   . TYR B 1 25  ? -9.921  53.690 23.288  1.00 36.98  ? 536 TYR B CE2   1 
ATOM   938  C  CZ    . TYR B 1 25  ? -9.781  53.505 24.642  1.00 52.56  ? 536 TYR B CZ    1 
ATOM   939  O  OH    . TYR B 1 25  ? -8.733  54.136 25.279  1.00 30.96  ? 536 TYR B OH    1 
ATOM   940  N  N     . CYS B 1 26  ? -13.895 49.528 20.089  1.00 47.16  ? 537 CYS B N     1 
ATOM   941  C  CA    . CYS B 1 26  ? -14.937 49.171 19.150  1.00 47.45  ? 537 CYS B CA    1 
ATOM   942  C  C     . CYS B 1 26  ? -15.039 47.676 19.006  1.00 41.31  ? 537 CYS B C     1 
ATOM   943  O  O     . CYS B 1 26  ? -14.180 47.056 18.379  1.00 41.90  ? 537 CYS B O     1 
ATOM   944  C  CB    . CYS B 1 26  ? -14.674 49.819 17.780  1.00 55.65  ? 537 CYS B CB    1 
ATOM   945  S  SG    . CYS B 1 26  ? -15.812 49.260 16.487  1.00 50.59  ? 537 CYS B SG    1 
ATOM   946  N  N     . ASP B 1 27  ? -16.117 47.107 19.536  1.00 41.27  ? 538 ASP B N     1 
ATOM   947  C  CA    . ASP B 1 27  ? -16.278 45.661 19.535  1.00 49.52  ? 538 ASP B CA    1 
ATOM   948  C  C     . ASP B 1 27  ? -16.284 45.090 18.121  1.00 54.44  ? 538 ASP B C     1 
ATOM   949  O  O     . ASP B 1 27  ? -15.879 43.934 17.925  1.00 55.16  ? 538 ASP B O     1 
ATOM   950  C  CB    . ASP B 1 27  ? -17.553 45.268 20.281  1.00 60.72  ? 538 ASP B CB    1 
ATOM   951  C  CG    . ASP B 1 27  ? -17.432 45.462 21.785  1.00 65.90  ? 538 ASP B CG    1 
ATOM   952  O  OD1   . ASP B 1 27  ? -16.359 45.115 22.347  1.00 66.70  ? 538 ASP B OD1   1 
ATOM   953  O  OD2   . ASP B 1 27  ? -18.399 45.968 22.400  1.00 65.16  ? 538 ASP B OD2   1 
ATOM   954  N  N     . CYS B 1 28  ? -16.739 45.886 17.147  1.00 37.95  ? 539 CYS B N     1 
ATOM   955  C  CA    . CYS B 1 28  ? -16.687 45.472 15.742  1.00 41.48  ? 539 CYS B CA    1 
ATOM   956  C  C     . CYS B 1 28  ? -15.232 45.317 15.329  1.00 45.64  ? 539 CYS B C     1 
ATOM   957  O  O     . CYS B 1 28  ? -14.794 44.271 14.837  1.00 48.44  ? 539 CYS B O     1 
ATOM   958  C  CB    . CYS B 1 28  ? -17.361 46.495 14.831  1.00 40.04  ? 539 CYS B CB    1 
ATOM   959  S  SG    . CYS B 1 28  ? -19.110 46.755 15.090  1.00 61.84  ? 539 CYS B SG    1 
ATOM   960  N  N     . PHE B 1 29  ? -14.470 46.365 15.578  1.00 45.81  ? 540 PHE B N     1 
ATOM   961  C  CA    . PHE B 1 29  ? -13.065 46.362 15.215  1.00 50.89  ? 540 PHE B CA    1 
ATOM   962  C  C     . PHE B 1 29  ? -12.317 45.360 16.085  1.00 47.07  ? 540 PHE B C     1 
ATOM   963  O  O     . PHE B 1 29  ? -11.381 44.711 15.640  1.00 47.43  ? 540 PHE B O     1 
ATOM   964  C  CB    . PHE B 1 29  ? -12.492 47.769 15.367  1.00 44.67  ? 540 PHE B CB    1 
ATOM   965  C  CG    . PHE B 1 29  ? -11.028 47.892 15.053  1.00 44.16  ? 540 PHE B CG    1 
ATOM   966  C  CD1   . PHE B 1 29  ? -10.590 48.025 13.742  1.00 44.50  ? 540 PHE B CD1   1 
ATOM   967  C  CD2   . PHE B 1 29  ? -10.098 47.968 16.067  1.00 46.73  ? 540 PHE B CD2   1 
ATOM   968  C  CE1   . PHE B 1 29  ? -9.243  48.179 13.449  1.00 41.27  ? 540 PHE B CE1   1 
ATOM   969  C  CE2   . PHE B 1 29  ? -8.750  48.112 15.781  1.00 49.61  ? 540 PHE B CE2   1 
ATOM   970  C  CZ    . PHE B 1 29  ? -8.322  48.226 14.462  1.00 44.87  ? 540 PHE B CZ    1 
ATOM   971  N  N     . ALA B 1 30  ? -12.753 45.207 17.324  1.00 44.80  ? 541 ALA B N     1 
ATOM   972  C  CA    . ALA B 1 30  ? -12.054 44.287 18.210  1.00 49.65  ? 541 ALA B CA    1 
ATOM   973  C  C     . ALA B 1 30  ? -12.203 42.845 17.733  1.00 47.74  ? 541 ALA B C     1 
ATOM   974  O  O     . ALA B 1 30  ? -11.308 42.031 17.927  1.00 61.15  ? 541 ALA B O     1 
ATOM   975  C  CB    . ALA B 1 30  ? -12.546 44.442 19.650  1.00 44.95  ? 541 ALA B CB    1 
ATOM   976  N  N     . ASN B 1 31  ? -13.320 42.541 17.087  1.00 46.36  ? 542 ASN B N     1 
ATOM   977  C  CA    . ASN B 1 31  ? -13.550 41.204 16.559  1.00 55.15  ? 542 ASN B CA    1 
ATOM   978  C  C     . ASN B 1 31  ? -13.072 41.069 15.129  1.00 58.07  ? 542 ASN B C     1 
ATOM   979  O  O     . ASN B 1 31  ? -13.318 40.059 14.459  1.00 54.45  ? 542 ASN B O     1 
ATOM   980  C  CB    . ASN B 1 31  ? -15.033 40.861 16.661  1.00 66.82  ? 542 ASN B CB    1 
ATOM   981  C  CG    . ASN B 1 31  ? -15.464 40.642 18.093  1.00 74.65  ? 542 ASN B CG    1 
ATOM   982  O  OD1   . ASN B 1 31  ? -14.665 40.214 18.932  1.00 70.12  ? 542 ASN B OD1   1 
ATOM   983  N  ND2   . ASN B 1 31  ? -16.719 40.961 18.391  1.00 80.69  ? 542 ASN B ND2   1 
ATOM   984  N  N     . GLY B 1 32  ? -12.378 42.105 14.673  1.00 61.65  ? 543 GLY B N     1 
ATOM   985  C  CA    . GLY B 1 32  ? -11.780 42.118 13.361  1.00 53.72  ? 543 GLY B CA    1 
ATOM   986  C  C     . GLY B 1 32  ? -12.763 42.114 12.215  1.00 55.29  ? 543 GLY B C     1 
ATOM   987  O  O     . GLY B 1 32  ? -12.442 41.611 11.141  1.00 60.46  ? 543 GLY B O     1 
ATOM   988  N  N     . GLU B 1 33  ? -13.945 42.689 12.431  1.00 47.28  ? 544 GLU B N     1 
ATOM   989  C  CA    . GLU B 1 33  ? -14.928 42.833 11.372  1.00 45.76  ? 544 GLU B CA    1 
ATOM   990  C  C     . GLU B 1 33  ? -15.061 44.303 11.006  1.00 60.59  ? 544 GLU B C     1 
ATOM   991  O  O     . GLU B 1 33  ? -14.823 45.181 11.839  1.00 62.37  ? 544 GLU B O     1 
ATOM   992  C  CB    . GLU B 1 33  ? -16.298 42.282 11.783  1.00 57.80  ? 544 GLU B CB    1 
ATOM   993  C  CG    . GLU B 1 33  ? -16.302 40.853 12.332  1.00 73.51  ? 544 GLU B CG    1 
ATOM   994  C  CD    . GLU B 1 33  ? -16.179 39.770 11.255  1.00 80.74  ? 544 GLU B CD    1 
ATOM   995  O  OE1   . GLU B 1 33  ? -16.274 40.088 10.044  1.00 81.23  ? 544 GLU B OE1   1 
ATOM   996  O  OE2   . GLU B 1 33  ? -15.989 38.587 11.631  1.00 81.85  ? 544 GLU B OE2   1 
ATOM   997  N  N     . PHE B 1 34  ? -15.442 44.556 9.754   1.00 65.13  ? 545 PHE B N     1 
ATOM   998  C  CA    . PHE B 1 34  ? -15.921 45.860 9.331   1.00 64.06  ? 545 PHE B CA    1 
ATOM   999  C  C     . PHE B 1 34  ? -17.210 46.184 10.066  1.00 60.71  ? 545 PHE B C     1 
ATOM   1000 O  O     . PHE B 1 34  ? -17.989 45.291 10.365  1.00 59.96  ? 545 PHE B O     1 
ATOM   1001 C  CB    . PHE B 1 34  ? -16.180 45.876 7.819   1.00 66.48  ? 545 PHE B CB    1 
ATOM   1002 C  CG    . PHE B 1 34  ? -14.941 45.756 6.983   1.00 69.32  ? 545 PHE B CG    1 
ATOM   1003 C  CD1   . PHE B 1 34  ? -14.062 46.818 6.847   1.00 64.74  ? 545 PHE B CD1   1 
ATOM   1004 C  CD2   . PHE B 1 34  ? -14.642 44.563 6.345   1.00 76.50  ? 545 PHE B CD2   1 
ATOM   1005 C  CE1   . PHE B 1 34  ? -12.917 46.695 6.069   1.00 70.34  ? 545 PHE B CE1   1 
ATOM   1006 C  CE2   . PHE B 1 34  ? -13.492 44.433 5.577   1.00 79.32  ? 545 PHE B CE2   1 
ATOM   1007 C  CZ    . PHE B 1 34  ? -12.629 45.502 5.440   1.00 74.12  ? 545 PHE B CZ    1 
ATOM   1008 N  N     . CYS B 1 35  ? -17.439 47.455 10.364  1.00 57.14  ? 546 CYS B N     1 
ATOM   1009 C  CA    . CYS B 1 35  ? -18.743 47.846 10.862  1.00 58.18  ? 546 CYS B CA    1 
ATOM   1010 C  C     . CYS B 1 35  ? -19.769 47.644 9.747   1.00 65.28  ? 546 CYS B C     1 
ATOM   1011 O  O     . CYS B 1 35  ? -19.522 47.992 8.595   1.00 70.71  ? 546 CYS B O     1 
ATOM   1012 C  CB    . CYS B 1 35  ? -18.759 49.305 11.313  1.00 61.74  ? 546 CYS B CB    1 
ATOM   1013 S  SG    . CYS B 1 35  ? -17.801 49.715 12.758  1.00 55.26  ? 546 CYS B SG    1 
ATOM   1014 N  N     . ASN B 1 36  ? -20.914 47.075 10.099  1.00 63.58  ? 547 ASN B N     1 
ATOM   1015 C  CA    . ASN B 1 36  ? -22.011 46.854 9.168   1.00 67.76  ? 547 ASN B CA    1 
ATOM   1016 C  C     . ASN B 1 36  ? -23.339 47.082 9.871   1.00 69.92  ? 547 ASN B C     1 
ATOM   1017 O  O     . ASN B 1 36  ? -23.613 46.421 10.864  1.00 78.49  ? 547 ASN B O     1 
ATOM   1018 C  CB    . ASN B 1 36  ? -21.963 45.445 8.578   1.00 76.78  ? 547 ASN B CB    1 
ATOM   1019 N  N     . ASN B 1 37  ? -24.115 48.059 9.425   1.00 68.00  ? 548 ASN B N     1 
ATOM   1020 C  CA    . ASN B 1 37  ? -25.435 48.287 9.994   1.00 72.34  ? 548 ASN B CA    1 
ATOM   1021 C  C     . ASN B 1 37  ? -25.335 48.873 11.392  1.00 72.76  ? 548 ASN B C     1 
ATOM   1022 O  O     . ASN B 1 37  ? -26.297 48.820 12.159  1.00 71.25  ? 548 ASN B O     1 
ATOM   1023 C  CB    . ASN B 1 37  ? -26.238 46.981 10.026  1.00 79.65  ? 548 ASN B CB    1 
ATOM   1024 C  CG    . ASN B 1 37  ? -27.716 47.203 9.970   1.00 94.59  ? 548 ASN B CG    1 
ATOM   1025 O  OD1   . ASN B 1 37  ? -28.178 48.318 9.708   1.00 92.20  ? 548 ASN B OD1   1 
ATOM   1026 N  ND2   . ASN B 1 37  ? -28.483 46.134 10.195  1.00 103.41 ? 548 ASN B ND2   1 
ATOM   1027 N  N     . CYS B 1 38  ? -24.171 49.447 11.702  1.00 68.69  ? 549 CYS B N     1 
ATOM   1028 C  CA    . CYS B 1 38  ? -23.885 50.031 13.016  1.00 53.60  ? 549 CYS B CA    1 
ATOM   1029 C  C     . CYS B 1 38  ? -24.425 51.451 13.201  1.00 52.23  ? 549 CYS B C     1 
ATOM   1030 O  O     . CYS B 1 38  ? -24.988 52.043 12.289  1.00 60.51  ? 549 CYS B O     1 
ATOM   1031 C  CB    . CYS B 1 38  ? -22.383 50.049 13.278  1.00 38.71  ? 549 CYS B CB    1 
ATOM   1032 S  SG    . CYS B 1 38  ? -21.659 48.451 13.438  1.00 53.09  ? 549 CYS B SG    1 
ATOM   1033 N  N     . ASN B 1 39  ? -24.231 51.996 14.399  1.00 50.81  ? 550 ASN B N     1 
ATOM   1034 C  CA    . ASN B 1 39  ? -24.696 53.338 14.718  1.00 48.10  ? 550 ASN B CA    1 
ATOM   1035 C  C     . ASN B 1 39  ? -23.549 54.323 15.065  1.00 55.34  ? 550 ASN B C     1 
ATOM   1036 O  O     . ASN B 1 39  ? -23.771 55.379 15.670  1.00 50.62  ? 550 ASN B O     1 
ATOM   1037 C  CB    . ASN B 1 39  ? -25.712 53.224 15.854  1.00 49.98  ? 550 ASN B CB    1 
ATOM   1038 C  CG    . ASN B 1 39  ? -26.844 52.238 15.521  1.00 58.14  ? 550 ASN B CG    1 
ATOM   1039 O  OD1   . ASN B 1 39  ? -27.347 52.204 14.391  1.00 67.43  ? 550 ASN B OD1   1 
ATOM   1040 N  ND2   . ASN B 1 39  ? -27.195 51.393 16.482  1.00 56.42  ? 550 ASN B ND2   1 
ATOM   1041 N  N     . CYS B 1 40  ? -22.326 53.961 14.681  1.00 46.21  ? 551 CYS B N     1 
ATOM   1042 C  CA    . CYS B 1 40  ? -21.161 54.813 14.891  1.00 46.58  ? 551 CYS B CA    1 
ATOM   1043 C  C     . CYS B 1 40  ? -21.203 56.074 14.027  1.00 49.97  ? 551 CYS B C     1 
ATOM   1044 O  O     . CYS B 1 40  ? -21.819 56.093 12.968  1.00 47.29  ? 551 CYS B O     1 
ATOM   1045 C  CB    . CYS B 1 40  ? -19.871 54.038 14.584  1.00 39.70  ? 551 CYS B CB    1 
ATOM   1046 S  SG    . CYS B 1 40  ? -19.953 52.895 13.136  1.00 45.18  ? 551 CYS B SG    1 
ATOM   1047 N  N     . THR B 1 41  ? -20.520 57.118 14.472  1.00 48.64  ? 552 THR B N     1 
ATOM   1048 C  CA    . THR B 1 41  ? -20.346 58.308 13.653  1.00 52.44  ? 552 THR B CA    1 
ATOM   1049 C  C     . THR B 1 41  ? -18.864 58.402 13.282  1.00 56.65  ? 552 THR B C     1 
ATOM   1050 O  O     . THR B 1 41  ? -17.990 57.907 14.007  1.00 48.44  ? 552 THR B O     1 
ATOM   1051 C  CB    . THR B 1 41  ? -20.814 59.601 14.350  1.00 55.02  ? 552 THR B CB    1 
ATOM   1052 O  OG1   . THR B 1 41  ? -19.867 59.983 15.351  1.00 66.37  ? 552 THR B OG1   1 
ATOM   1053 C  CG2   . THR B 1 41  ? -22.180 59.410 14.974  1.00 55.36  ? 552 THR B CG2   1 
ATOM   1054 N  N     . ASN B 1 42  ? -18.605 58.944 12.103  1.00 56.36  ? 553 ASN B N     1 
ATOM   1055 C  CA    . ASN B 1 42  ? -17.252 59.084 11.593  1.00 54.63  ? 553 ASN B CA    1 
ATOM   1056 C  C     . ASN B 1 42  ? -16.513 57.759 11.560  1.00 47.06  ? 553 ASN B C     1 
ATOM   1057 O  O     . ASN B 1 42  ? -15.341 57.675 11.933  1.00 36.76  ? 553 ASN B O     1 
ATOM   1058 C  CB    . ASN B 1 42  ? -16.491 60.126 12.414  1.00 52.92  ? 553 ASN B CB    1 
ATOM   1059 C  CG    . ASN B 1 42  ? -16.925 61.542 12.062  1.00 62.93  ? 553 ASN B CG    1 
ATOM   1060 O  OD1   . ASN B 1 42  ? -17.312 62.320 12.927  1.00 75.76  ? 553 ASN B OD1   1 
ATOM   1061 N  ND2   . ASN B 1 42  ? -16.893 61.865 10.772  1.00 53.96  ? 553 ASN B ND2   1 
ATOM   1062 N  N     . CYS B 1 43  ? -17.209 56.735 11.071  1.00 45.76  ? 554 CYS B N     1 
ATOM   1063 C  CA    . CYS B 1 43  ? -16.652 55.386 10.978  1.00 49.40  ? 554 CYS B CA    1 
ATOM   1064 C  C     . CYS B 1 43  ? -15.569 55.279 9.897   1.00 53.97  ? 554 CYS B C     1 
ATOM   1065 O  O     . CYS B 1 43  ? -15.776 55.669 8.744   1.00 58.44  ? 554 CYS B O     1 
ATOM   1066 C  CB    . CYS B 1 43  ? -17.763 54.359 10.708  1.00 35.59  ? 554 CYS B CB    1 
ATOM   1067 S  SG    . CYS B 1 43  ? -17.245 52.597 10.663  1.00 49.11  ? 554 CYS B SG    1 
ATOM   1068 N  N     . TYR B 1 44  ? -14.418 54.733 10.280  1.00 46.77  ? 555 TYR B N     1 
ATOM   1069 C  CA    . TYR B 1 44  ? -13.387 54.397 9.320   1.00 45.31  ? 555 TYR B CA    1 
ATOM   1070 C  C     . TYR B 1 44  ? -13.273 52.877 9.195   1.00 44.37  ? 555 TYR B C     1 
ATOM   1071 O  O     . TYR B 1 44  ? -12.376 52.377 8.521   1.00 47.39  ? 555 TYR B O     1 
ATOM   1072 C  CB    . TYR B 1 44  ? -12.040 55.014 9.720   1.00 53.53  ? 555 TYR B CB    1 
ATOM   1073 C  CG    . TYR B 1 44  ? -11.842 56.472 9.295   1.00 62.38  ? 555 TYR B CG    1 
ATOM   1074 C  CD1   . TYR B 1 44  ? -12.928 57.290 9.014   1.00 64.41  ? 555 TYR B CD1   1 
ATOM   1075 C  CD2   . TYR B 1 44  ? -10.573 57.032 9.207   1.00 63.14  ? 555 TYR B CD2   1 
ATOM   1076 C  CE1   . TYR B 1 44  ? -12.760 58.604 8.653   1.00 58.03  ? 555 TYR B CE1   1 
ATOM   1077 C  CE2   . TYR B 1 44  ? -10.398 58.361 8.839   1.00 61.79  ? 555 TYR B CE2   1 
ATOM   1078 C  CZ    . TYR B 1 44  ? -11.503 59.137 8.567   1.00 57.86  ? 555 TYR B CZ    1 
ATOM   1079 O  OH    . TYR B 1 44  ? -11.367 60.453 8.200   1.00 56.10  ? 555 TYR B OH    1 
ATOM   1080 N  N     . ASN B 1 45  ? -14.141 52.139 9.885   1.00 43.44  ? 556 ASN B N     1 
ATOM   1081 C  CA    . ASN B 1 45  ? -14.062 50.660 9.887   1.00 50.42  ? 556 ASN B CA    1 
ATOM   1082 C  C     . ASN B 1 45  ? -14.856 50.073 8.724   1.00 54.35  ? 556 ASN B C     1 
ATOM   1083 O  O     . ASN B 1 45  ? -15.839 49.356 8.914   1.00 63.91  ? 556 ASN B O     1 
ATOM   1084 C  CB    . ASN B 1 45  ? -14.550 50.090 11.238  1.00 52.69  ? 556 ASN B CB    1 
ATOM   1085 C  CG    . ASN B 1 45  ? -14.328 48.579 11.386  1.00 52.44  ? 556 ASN B CG    1 
ATOM   1086 O  OD1   . ASN B 1 45  ? -13.396 47.993 10.833  1.00 51.36  ? 556 ASN B OD1   1 
ATOM   1087 N  ND2   . ASN B 1 45  ? -15.188 47.951 12.166  1.00 60.98  ? 556 ASN B ND2   1 
ATOM   1088 N  N     . ASN B 1 46  ? -14.435 50.414 7.516   1.00 58.66  ? 557 ASN B N     1 
ATOM   1089 C  CA    . ASN B 1 46  ? -15.176 50.088 6.301   1.00 52.98  ? 557 ASN B CA    1 
ATOM   1090 C  C     . ASN B 1 46  ? -14.267 50.175 5.086   1.00 52.75  ? 557 ASN B C     1 
ATOM   1091 O  O     . ASN B 1 46  ? -13.122 50.600 5.203   1.00 57.06  ? 557 ASN B O     1 
ATOM   1092 C  CB    . ASN B 1 46  ? -16.362 51.027 6.148   1.00 43.54  ? 557 ASN B CB    1 
ATOM   1093 C  CG    . ASN B 1 46  ? -15.963 52.469 6.308   1.00 52.33  ? 557 ASN B CG    1 
ATOM   1094 O  OD1   . ASN B 1 46  ? -15.154 52.988 5.538   1.00 62.08  ? 557 ASN B OD1   1 
ATOM   1095 N  ND2   . ASN B 1 46  ? -16.521 53.129 7.313   1.00 53.74  ? 557 ASN B ND2   1 
ATOM   1096 N  N     . LEU B 1 47  ? -14.774 49.778 3.924   1.00 62.91  ? 558 LEU B N     1 
ATOM   1097 C  CA    . LEU B 1 47  ? -13.980 49.768 2.690   1.00 69.86  ? 558 LEU B CA    1 
ATOM   1098 C  C     . LEU B 1 47  ? -13.517 51.155 2.317   1.00 68.71  ? 558 LEU B C     1 
ATOM   1099 O  O     . LEU B 1 47  ? -12.447 51.331 1.751   1.00 72.27  ? 558 LEU B O     1 
ATOM   1100 C  CB    . LEU B 1 47  ? -14.775 49.195 1.523   1.00 75.14  ? 558 LEU B CB    1 
ATOM   1101 C  CG    . LEU B 1 47  ? -15.267 47.755 1.619   1.00 84.67  ? 558 LEU B CG    1 
ATOM   1102 C  CD1   . LEU B 1 47  ? -16.540 47.629 2.473   1.00 85.68  ? 558 LEU B CD1   1 
ATOM   1103 C  CD2   . LEU B 1 47  ? -15.494 47.223 0.220   1.00 87.07  ? 558 LEU B CD2   1 
ATOM   1104 N  N     . GLU B 1 48  ? -14.318 52.148 2.672   1.00 70.87  ? 559 GLU B N     1 
ATOM   1105 C  CA    . GLU B 1 48  ? -14.083 53.499 2.196   1.00 75.37  ? 559 GLU B CA    1 
ATOM   1106 C  C     . GLU B 1 48  ? -12.837 54.024 2.864   1.00 72.58  ? 559 GLU B C     1 
ATOM   1107 O  O     . GLU B 1 48  ? -12.233 54.989 2.410   1.00 75.49  ? 559 GLU B O     1 
ATOM   1108 C  CB    . GLU B 1 48  ? -15.251 54.427 2.546   1.00 86.18  ? 559 GLU B CB    1 
ATOM   1109 C  CG    . GLU B 1 48  ? -16.632 53.769 2.700   1.00 95.97  ? 559 GLU B CG    1 
ATOM   1110 C  CD    . GLU B 1 48  ? -16.916 52.662 1.707   1.00 101.07 ? 559 GLU B CD    1 
ATOM   1111 O  OE1   . GLU B 1 48  ? -17.016 52.946 0.493   1.00 105.83 ? 559 GLU B OE1   1 
ATOM   1112 O  OE2   . GLU B 1 48  ? -17.012 51.499 2.156   1.00 97.02  ? 559 GLU B OE2   1 
ATOM   1113 N  N     . HIS B 1 49  ? -12.459 53.371 3.957   1.00 71.45  ? 560 HIS B N     1 
ATOM   1114 C  CA    . HIS B 1 49  ? -11.254 53.729 4.672   1.00 63.91  ? 560 HIS B CA    1 
ATOM   1115 C  C     . HIS B 1 49  ? -10.420 52.511 4.955   1.00 59.68  ? 560 HIS B C     1 
ATOM   1116 O  O     . HIS B 1 49  ? -9.739  52.460 5.974   1.00 60.56  ? 560 HIS B O     1 
ATOM   1117 C  CB    . HIS B 1 49  ? -11.599 54.415 5.979   1.00 58.94  ? 560 HIS B CB    1 
ATOM   1118 C  CG    . HIS B 1 49  ? -12.504 55.590 5.816   1.00 52.58  ? 560 HIS B CG    1 
ATOM   1119 N  ND1   . HIS B 1 49  ? -13.861 55.457 5.608   1.00 48.43  ? 560 HIS B ND1   1 
ATOM   1120 C  CD2   . HIS B 1 49  ? -12.259 56.920 5.852   1.00 46.60  ? 560 HIS B CD2   1 
ATOM   1121 C  CE1   . HIS B 1 49  ? -14.409 56.653 5.521   1.00 52.78  ? 560 HIS B CE1   1 
ATOM   1122 N  NE2   . HIS B 1 49  ? -13.460 57.559 5.669   1.00 48.47  ? 560 HIS B NE2   1 
ATOM   1123 N  N     . GLU B 1 50  ? -10.469 51.542 4.046   1.00 59.68  ? 561 GLU B N     1 
ATOM   1124 C  CA    . GLU B 1 50  ? -9.777  50.269 4.220   1.00 57.21  ? 561 GLU B CA    1 
ATOM   1125 C  C     . GLU B 1 50  ? -8.312  50.516 4.531   1.00 63.70  ? 561 GLU B C     1 
ATOM   1126 O  O     . GLU B 1 50  ? -7.698  49.807 5.326   1.00 71.51  ? 561 GLU B O     1 
ATOM   1127 C  CB    . GLU B 1 50  ? -9.934  49.380 2.975   1.00 57.71  ? 561 GLU B CB    1 
ATOM   1128 C  CG    . GLU B 1 50  ? -8.974  48.179 2.891   1.00 64.79  ? 561 GLU B CG    1 
ATOM   1129 C  CD    . GLU B 1 50  ? -9.187  47.119 3.985   1.00 74.24  ? 561 GLU B CD    1 
ATOM   1130 O  OE1   . GLU B 1 50  ? -9.447  45.944 3.644   1.00 71.54  ? 561 GLU B OE1   1 
ATOM   1131 O  OE2   . GLU B 1 50  ? -9.078  47.443 5.187   1.00 80.90  ? 561 GLU B OE2   1 
ATOM   1132 N  N     . ASN B 1 51  ? -7.760  51.548 3.911   1.00 66.98  ? 562 ASN B N     1 
ATOM   1133 C  CA    . ASN B 1 51  ? -6.355  51.872 4.088   1.00 71.67  ? 562 ASN B CA    1 
ATOM   1134 C  C     . ASN B 1 51  ? -5.997  52.207 5.523   1.00 69.35  ? 562 ASN B C     1 
ATOM   1135 O  O     . ASN B 1 51  ? -5.083  51.620 6.095   1.00 58.36  ? 562 ASN B O     1 
ATOM   1136 C  CB    . ASN B 1 51  ? -5.997  53.046 3.203   1.00 71.58  ? 562 ASN B CB    1 
ATOM   1137 C  CG    . ASN B 1 51  ? -5.720  52.617 1.812   1.00 82.72  ? 562 ASN B CG    1 
ATOM   1138 O  OD1   . ASN B 1 51  ? -4.618  52.196 1.492   1.00 86.17  ? 562 ASN B OD1   1 
ATOM   1139 N  ND2   . ASN B 1 51  ? -6.735  52.697 0.962   1.00 90.05  ? 562 ASN B ND2   1 
ATOM   1140 N  N     . GLU B 1 52  ? -6.748  53.144 6.091   1.00 77.13  ? 563 GLU B N     1 
ATOM   1141 C  CA    . GLU B 1 52  ? -6.544  53.595 7.454   1.00 71.34  ? 563 GLU B CA    1 
ATOM   1142 C  C     . GLU B 1 52  ? -6.901  52.463 8.401   1.00 69.09  ? 563 GLU B C     1 
ATOM   1143 O  O     . GLU B 1 52  ? -6.341  52.340 9.474   1.00 70.27  ? 563 GLU B O     1 
ATOM   1144 C  CB    . GLU B 1 52  ? -7.383  54.837 7.745   1.00 74.21  ? 563 GLU B CB    1 
ATOM   1145 C  CG    . GLU B 1 52  ? -7.037  56.047 6.877   1.00 83.48  ? 563 GLU B CG    1 
ATOM   1146 C  CD    . GLU B 1 52  ? -7.653  55.991 5.469   1.00 93.05  ? 563 GLU B CD    1 
ATOM   1147 O  OE1   . GLU B 1 52  ? -8.396  55.036 5.159   1.00 90.14  ? 563 GLU B OE1   1 
ATOM   1148 O  OE2   . GLU B 1 52  ? -7.389  56.913 4.665   1.00 100.52 ? 563 GLU B OE2   1 
ATOM   1149 N  N     . ARG B 1 53  ? -7.822  51.608 7.982   1.00 68.85  ? 564 ARG B N     1 
ATOM   1150 C  CA    . ARG B 1 53  ? -8.197  50.479 8.805   1.00 70.28  ? 564 ARG B CA    1 
ATOM   1151 C  C     . ARG B 1 53  ? -7.073  49.484 9.000   1.00 73.25  ? 564 ARG B C     1 
ATOM   1152 O  O     . ARG B 1 53  ? -6.759  49.113 10.127  1.00 71.35  ? 564 ARG B O     1 
ATOM   1153 C  CB    . ARG B 1 53  ? -9.372  49.746 8.179   1.00 68.43  ? 564 ARG B CB    1 
ATOM   1154 C  CG    . ARG B 1 53  ? -9.623  48.420 8.841   1.00 61.91  ? 564 ARG B CG    1 
ATOM   1155 C  CD    . ARG B 1 53  ? -10.876 47.777 8.346   1.00 57.74  ? 564 ARG B CD    1 
ATOM   1156 N  NE    . ARG B 1 53  ? -11.121 46.522 9.037   1.00 62.98  ? 564 ARG B NE    1 
ATOM   1157 C  CZ    . ARG B 1 53  ? -10.723 45.337 8.590   1.00 68.70  ? 564 ARG B CZ    1 
ATOM   1158 N  NH1   . ARG B 1 53  ? -10.058 45.248 7.447   1.00 70.54  ? 564 ARG B NH1   1 
ATOM   1159 N  NH2   . ARG B 1 53  ? -10.985 44.239 9.290   1.00 73.03  ? 564 ARG B NH2   1 
ATOM   1160 N  N     . GLN B 1 54  ? -6.449  49.081 7.900   1.00 76.91  ? 565 GLN B N     1 
ATOM   1161 C  CA    . GLN B 1 54  ? -5.353  48.121 7.943   1.00 76.97  ? 565 GLN B CA    1 
ATOM   1162 C  C     . GLN B 1 54  ? -4.192  48.730 8.713   1.00 67.58  ? 565 GLN B C     1 
ATOM   1163 O  O     . GLN B 1 54  ? -3.496  48.032 9.459   1.00 65.70  ? 565 GLN B O     1 
ATOM   1164 C  CB    . GLN B 1 54  ? -4.926  47.713 6.533   1.00 83.82  ? 565 GLN B CB    1 
ATOM   1165 C  CG    . GLN B 1 54  ? -4.422  46.278 6.415   1.00 89.29  ? 565 GLN B CG    1 
ATOM   1166 C  CD    . GLN B 1 54  ? -5.547  45.246 6.412   1.00 88.19  ? 565 GLN B CD    1 
ATOM   1167 O  OE1   . GLN B 1 54  ? -6.648  45.505 5.922   1.00 82.79  ? 565 GLN B OE1   1 
ATOM   1168 N  NE2   . GLN B 1 54  ? -5.267  44.065 6.957   1.00 87.96  ? 565 GLN B NE2   1 
ATOM   1169 N  N     . LYS B 1 55  ? -3.995  50.034 8.506   1.00 60.99  ? 566 LYS B N     1 
ATOM   1170 C  CA    . LYS B 1 55  ? -3.013  50.823 9.241   1.00 60.07  ? 566 LYS B CA    1 
ATOM   1171 C  C     . LYS B 1 55  ? -3.264  50.701 10.747  1.00 69.51  ? 566 LYS B C     1 
ATOM   1172 O  O     . LYS B 1 55  ? -2.359  50.397 11.524  1.00 69.35  ? 566 LYS B O     1 
ATOM   1173 C  CB    . LYS B 1 55  ? -3.075  52.293 8.802   1.00 58.95  ? 566 LYS B CB    1 
ATOM   1174 C  CG    . LYS B 1 55  ? -2.709  53.306 9.891   1.00 72.48  ? 566 LYS B CG    1 
ATOM   1175 C  CD    . LYS B 1 55  ? -3.446  54.654 9.725   1.00 83.27  ? 566 LYS B CD    1 
ATOM   1176 C  CE    . LYS B 1 55  ? -4.829  54.707 10.441  1.00 63.94  ? 566 LYS B CE    1 
ATOM   1177 N  NZ    . LYS B 1 55  ? -4.859  54.380 11.904  1.00 55.71  ? 566 LYS B NZ    1 
ATOM   1178 N  N     . ALA B 1 56  ? -4.512  50.911 11.149  1.00 66.30  ? 567 ALA B N     1 
ATOM   1179 C  CA    . ALA B 1 56  ? -4.874  50.796 12.549  1.00 59.68  ? 567 ALA B CA    1 
ATOM   1180 C  C     . ALA B 1 56  ? -4.673  49.360 12.993  1.00 61.64  ? 567 ALA B C     1 
ATOM   1181 O  O     . ALA B 1 56  ? -4.205  49.099 14.103  1.00 69.85  ? 567 ALA B O     1 
ATOM   1182 C  CB    . ALA B 1 56  ? -6.308  51.228 12.767  1.00 49.59  ? 567 ALA B CB    1 
ATOM   1183 N  N     . ILE B 1 57  ? -4.978  48.429 12.098  1.00 52.04  ? 568 ILE B N     1 
ATOM   1184 C  CA    . ILE B 1 57  ? -4.871  47.021 12.422  1.00 55.23  ? 568 ILE B CA    1 
ATOM   1185 C  C     . ILE B 1 57  ? -3.434  46.644 12.750  1.00 65.37  ? 568 ILE B C     1 
ATOM   1186 O  O     . ILE B 1 57  ? -3.211  45.828 13.645  1.00 70.45  ? 568 ILE B O     1 
ATOM   1187 C  CB    . ILE B 1 57  ? -5.440  46.136 11.286  1.00 58.27  ? 568 ILE B CB    1 
ATOM   1188 C  CG1   . ILE B 1 57  ? -6.970  46.323 11.227  1.00 51.79  ? 568 ILE B CG1   1 
ATOM   1189 C  CG2   . ILE B 1 57  ? -5.132  44.658 11.542  1.00 57.41  ? 568 ILE B CG2   1 
ATOM   1190 C  CD1   . ILE B 1 57  ? -7.714  45.390 10.271  1.00 44.41  ? 568 ILE B CD1   1 
ATOM   1191 N  N     . LYS B 1 58  ? -2.453  47.258 12.089  1.00 64.72  ? 569 LYS B N     1 
ATOM   1192 C  CA    . LYS B 1 58  ? -1.090  46.799 12.312  1.00 68.88  ? 569 LYS B CA    1 
ATOM   1193 C  C     . LYS B 1 58  ? -0.515  47.492 13.536  1.00 68.63  ? 569 LYS B C     1 
ATOM   1194 O  O     . LYS B 1 58  ? 0.270   46.900 14.285  1.00 82.35  ? 569 LYS B O     1 
ATOM   1195 C  CB    . LYS B 1 58  ? -0.189  47.051 11.090  1.00 83.51  ? 569 LYS B CB    1 
ATOM   1196 C  CG    . LYS B 1 58  ? 1.323   46.887 11.396  1.00 109.20 ? 569 LYS B CG    1 
ATOM   1197 C  CD    . LYS B 1 58  ? 2.293   47.561 10.417  1.00 104.53 ? 569 LYS B CD    1 
ATOM   1198 C  CE    . LYS B 1 58  ? 3.751   47.285 10.824  1.00 100.82 ? 569 LYS B CE    1 
ATOM   1199 N  NZ    . LYS B 1 58  ? 3.918   45.926 11.434  1.00 97.29  ? 569 LYS B NZ    1 
ATOM   1200 N  N     . ALA B 1 59  ? -0.955  48.711 13.806  1.00 49.34  ? 570 ALA B N     1 
ATOM   1201 C  CA    . ALA B 1 59  ? -0.493  49.354 15.029  1.00 57.47  ? 570 ALA B CA    1 
ATOM   1202 C  C     . ALA B 1 59  ? -0.977  48.602 16.281  1.00 75.02  ? 570 ALA B C     1 
ATOM   1203 O  O     . ALA B 1 59  ? -0.218  48.438 17.237  1.00 84.71  ? 570 ALA B O     1 
ATOM   1204 C  CB    . ALA B 1 59  ? -0.940  50.797 15.075  1.00 54.04  ? 570 ALA B CB    1 
ATOM   1205 N  N     . CYS B 1 60  ? -2.224  48.134 16.266  1.00 76.96  ? 571 CYS B N     1 
ATOM   1206 C  CA    . CYS B 1 60  ? -2.787  47.399 17.399  1.00 84.20  ? 571 CYS B CA    1 
ATOM   1207 C  C     . CYS B 1 60  ? -2.060  46.089 17.605  1.00 86.77  ? 571 CYS B C     1 
ATOM   1208 O  O     . CYS B 1 60  ? -1.855  45.638 18.732  1.00 88.95  ? 571 CYS B O     1 
ATOM   1209 C  CB    . CYS B 1 60  ? -4.277  47.129 17.190  1.00 81.89  ? 571 CYS B CB    1 
ATOM   1210 S  SG    . CYS B 1 60  ? -5.269  48.607 17.189  1.00 98.73  ? 571 CYS B SG    1 
ATOM   1211 N  N     . LEU B 1 61  ? -1.698  45.472 16.492  1.00 86.28  ? 572 LEU B N     1 
ATOM   1212 C  CA    . LEU B 1 61  ? -1.131  44.143 16.503  1.00 82.26  ? 572 LEU B CA    1 
ATOM   1213 C  C     . LEU B 1 61  ? 0.316   44.213 16.972  1.00 93.96  ? 572 LEU B C     1 
ATOM   1214 O  O     . LEU B 1 61  ? 0.817   43.290 17.609  1.00 101.41 ? 572 LEU B O     1 
ATOM   1215 C  CB    . LEU B 1 61  ? -1.237  43.518 15.116  1.00 68.49  ? 572 LEU B CB    1 
ATOM   1216 C  CG    . LEU B 1 61  ? -1.481  42.016 15.043  1.00 68.77  ? 572 LEU B CG    1 
ATOM   1217 C  CD1   . LEU B 1 61  ? -2.604  41.626 15.952  1.00 72.85  ? 572 LEU B CD1   1 
ATOM   1218 C  CD2   . LEU B 1 61  ? -1.806  41.606 13.630  1.00 67.21  ? 572 LEU B CD2   1 
ATOM   1219 N  N     . ASP B 1 62  ? 0.987   45.318 16.667  1.00 93.65  ? 573 ASP B N     1 
ATOM   1220 C  CA    . ASP B 1 62  ? 2.393   45.445 17.017  1.00 94.31  ? 573 ASP B CA    1 
ATOM   1221 C  C     . ASP B 1 62  ? 2.634   45.782 18.485  1.00 93.87  ? 573 ASP B C     1 
ATOM   1222 O  O     . ASP B 1 62  ? 3.746   45.607 18.973  1.00 95.85  ? 573 ASP B O     1 
ATOM   1223 C  CB    . ASP B 1 62  ? 3.055   46.504 16.139  1.00 97.48  ? 573 ASP B CB    1 
ATOM   1224 C  CG    . ASP B 1 62  ? 4.510   46.201 15.875  1.00 104.51 ? 573 ASP B CG    1 
ATOM   1225 O  OD1   . ASP B 1 62  ? 5.348   46.494 16.755  1.00 111.15 ? 573 ASP B OD1   1 
ATOM   1226 O  OD2   . ASP B 1 62  ? 4.812   45.657 14.791  1.00 103.13 ? 573 ASP B OD2   1 
ATOM   1227 N  N     . ARG B 1 63  ? 1.606   46.245 19.193  1.00 94.61  ? 574 ARG B N     1 
ATOM   1228 C  CA    . ARG B 1 63  ? 1.705   46.392 20.646  1.00 95.67  ? 574 ARG B CA    1 
ATOM   1229 C  C     . ARG B 1 63  ? 1.685   45.021 21.312  1.00 105.96 ? 574 ARG B C     1 
ATOM   1230 O  O     . ARG B 1 63  ? 2.469   44.748 22.220  1.00 108.52 ? 574 ARG B O     1 
ATOM   1231 C  CB    . ARG B 1 63  ? 0.571   47.266 21.197  1.00 84.25  ? 574 ARG B CB    1 
ATOM   1232 C  CG    . ARG B 1 63  ? 0.728   48.737 20.882  1.00 78.94  ? 574 ARG B CG    1 
ATOM   1233 C  CD    . ARG B 1 63  ? -0.374  49.594 21.486  1.00 79.77  ? 574 ARG B CD    1 
ATOM   1234 N  NE    . ARG B 1 63  ? -1.360  49.999 20.482  1.00 89.90  ? 574 ARG B NE    1 
ATOM   1235 C  CZ    . ARG B 1 63  ? -2.180  51.044 20.602  1.00 88.54  ? 574 ARG B CZ    1 
ATOM   1236 N  NH1   . ARG B 1 63  ? -2.134  51.815 21.687  1.00 81.86  ? 574 ARG B NH1   1 
ATOM   1237 N  NH2   . ARG B 1 63  ? -3.041  51.325 19.627  1.00 84.35  ? 574 ARG B NH2   1 
ATOM   1238 N  N     . ASN B 1 64  ? 0.781   44.167 20.844  1.00 110.09 ? 575 ASN B N     1 
ATOM   1239 C  CA    . ASN B 1 64  ? 0.692   42.776 21.281  1.00 111.10 ? 575 ASN B CA    1 
ATOM   1240 C  C     . ASN B 1 64  ? -0.048  41.974 20.207  1.00 109.70 ? 575 ASN B C     1 
ATOM   1241 O  O     . ASN B 1 64  ? -1.222  42.219 19.934  1.00 106.45 ? 575 ASN B O     1 
ATOM   1242 C  CB    . ASN B 1 64  ? 0.031   42.649 22.674  1.00 107.55 ? 575 ASN B CB    1 
ATOM   1243 C  CG    . ASN B 1 64  ? -1.481  42.842 22.653  1.00 99.40  ? 575 ASN B CG    1 
ATOM   1244 O  OD1   . ASN B 1 64  ? -2.240  41.870 22.610  1.00 95.06  ? 575 ASN B OD1   1 
ATOM   1245 N  ND2   . ASN B 1 64  ? -1.923  44.095 22.709  1.00 94.56  ? 575 ASN B ND2   1 
ATOM   1246 N  N     . PRO B 1 65  ? 0.666   41.050 19.545  1.00 113.74 ? 576 PRO B N     1 
ATOM   1247 C  CA    . PRO B 1 65  ? 0.165   40.279 18.395  1.00 115.63 ? 576 PRO B CA    1 
ATOM   1248 C  C     . PRO B 1 65  ? -1.082  39.444 18.713  1.00 113.77 ? 576 PRO B C     1 
ATOM   1249 O  O     . PRO B 1 65  ? -1.722  38.916 17.801  1.00 110.96 ? 576 PRO B O     1 
ATOM   1250 C  CB    . PRO B 1 65  ? 1.356   39.386 18.027  1.00 117.61 ? 576 PRO B CB    1 
ATOM   1251 C  CG    . PRO B 1 65  ? 2.180   39.312 19.268  1.00 118.36 ? 576 PRO B CG    1 
ATOM   1252 C  CD    . PRO B 1 65  ? 2.040   40.662 19.904  1.00 116.82 ? 576 PRO B CD    1 
ATOM   1253 N  N     . GLU B 1 66  ? -1.421  39.339 19.994  1.00 112.82 ? 577 GLU B N     1 
ATOM   1254 C  CA    . GLU B 1 66  ? -2.604  38.610 20.429  1.00 105.28 ? 577 GLU B CA    1 
ATOM   1255 C  C     . GLU B 1 66  ? -3.774  39.583 20.553  1.00 100.54 ? 577 GLU B C     1 
ATOM   1256 O  O     . GLU B 1 66  ? -4.735  39.330 21.281  1.00 102.57 ? 577 GLU B O     1 
ATOM   1257 C  CB    . GLU B 1 66  ? -2.341  37.900 21.756  1.00 103.04 ? 577 GLU B CB    1 
ATOM   1258 N  N     . ALA B 1 67  ? -3.663  40.701 19.833  1.00 95.00  ? 578 ALA B N     1 
ATOM   1259 C  CA    . ALA B 1 67  ? -4.629  41.804 19.875  1.00 77.87  ? 578 ALA B CA    1 
ATOM   1260 C  C     . ALA B 1 67  ? -6.018  41.353 19.448  1.00 67.07  ? 578 ALA B C     1 
ATOM   1261 O  O     . ALA B 1 67  ? -7.028  41.777 20.018  1.00 55.02  ? 578 ALA B O     1 
ATOM   1262 C  CB    . ALA B 1 67  ? -4.164  42.952 19.008  1.00 67.86  ? 578 ALA B CB    1 
ATOM   1263 N  N     . PHE B 1 68  ? -6.074  40.504 18.432  1.00 65.28  ? 579 PHE B N     1 
ATOM   1264 C  CA    . PHE B 1 68  ? -7.365  40.035 17.965  1.00 71.38  ? 579 PHE B CA    1 
ATOM   1265 C  C     . PHE B 1 68  ? -7.598  38.574 18.367  1.00 83.88  ? 579 PHE B C     1 
ATOM   1266 O  O     . PHE B 1 68  ? -8.159  37.778 17.607  1.00 80.51  ? 579 PHE B O     1 
ATOM   1267 C  CB    . PHE B 1 68  ? -7.468  40.233 16.449  1.00 65.83  ? 579 PHE B CB    1 
ATOM   1268 C  CG    . PHE B 1 68  ? -7.183  41.648 16.014  1.00 65.75  ? 579 PHE B CG    1 
ATOM   1269 C  CD1   . PHE B 1 68  ? -8.168  42.625 16.097  1.00 63.25  ? 579 PHE B CD1   1 
ATOM   1270 C  CD2   . PHE B 1 68  ? -5.920  42.013 15.577  1.00 71.10  ? 579 PHE B CD2   1 
ATOM   1271 C  CE1   . PHE B 1 68  ? -7.906  43.927 15.734  1.00 70.51  ? 579 PHE B CE1   1 
ATOM   1272 C  CE2   . PHE B 1 68  ? -5.642  43.312 15.204  1.00 76.41  ? 579 PHE B CE2   1 
ATOM   1273 C  CZ    . PHE B 1 68  ? -6.638  44.276 15.279  1.00 79.24  ? 579 PHE B CZ    1 
ATOM   1274 N  N     . LYS B 1 69  ? -7.150  38.228 19.574  1.00 93.70  ? 580 LYS B N     1 
ATOM   1275 C  CA    . LYS B 1 69  ? -7.467  36.929 20.142  1.00 99.52  ? 580 LYS B CA    1 
ATOM   1276 C  C     . LYS B 1 69  ? -8.776  37.034 20.912  1.00 111.99 ? 580 LYS B C     1 
ATOM   1277 O  O     . LYS B 1 69  ? -8.908  37.891 21.789  1.00 116.46 ? 580 LYS B O     1 
ATOM   1278 C  CB    . LYS B 1 69  ? -6.350  36.451 21.066  1.00 98.80  ? 580 LYS B CB    1 
ATOM   1279 N  N     . PRO B 1 70  ? -9.749  36.169 20.584  1.00 116.77 ? 581 PRO B N     1 
ATOM   1280 C  CA    . PRO B 1 70  ? -11.057 36.093 21.249  1.00 120.03 ? 581 PRO B CA    1 
ATOM   1281 C  C     . PRO B 1 70  ? -10.964 36.040 22.783  1.00 119.14 ? 581 PRO B C     1 
ATOM   1282 O  O     . PRO B 1 70  ? -11.033 37.070 23.460  1.00 115.19 ? 581 PRO B O     1 
ATOM   1283 C  CB    . PRO B 1 70  ? -11.649 34.803 20.680  1.00 119.32 ? 581 PRO B CB    1 
ATOM   1284 C  CG    . PRO B 1 70  ? -11.107 34.755 19.292  1.00 115.33 ? 581 PRO B CG    1 
ATOM   1285 C  CD    . PRO B 1 70  ? -9.702  35.317 19.381  1.00 115.64 ? 581 PRO B CD    1 
ATOM   1286 N  N     . LYS B 1 86  ? -4.876  37.667 30.307  1.00 100.71 ? 597 LYS B N     1 
ATOM   1287 C  CA    . LYS B 1 86  ? -6.230  37.357 29.875  1.00 103.54 ? 597 LYS B CA    1 
ATOM   1288 C  C     . LYS B 1 86  ? -7.202  37.711 31.007  1.00 105.92 ? 597 LYS B C     1 
ATOM   1289 O  O     . LYS B 1 86  ? -8.406  37.864 30.801  1.00 109.27 ? 597 LYS B O     1 
ATOM   1290 C  CB    . LYS B 1 86  ? -6.318  35.874 29.466  1.00 107.56 ? 597 LYS B CB    1 
ATOM   1291 C  CG    . LYS B 1 86  ? -7.673  35.190 29.649  1.00 110.25 ? 597 LYS B CG    1 
ATOM   1292 C  CD    . LYS B 1 86  ? -7.674  33.787 29.046  1.00 110.04 ? 597 LYS B CD    1 
ATOM   1293 C  CE    . LYS B 1 86  ? -8.998  33.077 29.297  1.00 106.07 ? 597 LYS B CE    1 
ATOM   1294 N  NZ    . LYS B 1 86  ? -9.174  31.893 28.411  1.00 104.32 ? 597 LYS B NZ    1 
ATOM   1295 N  N     . GLY B 1 87  ? -6.648  37.886 32.201  1.00 100.29 ? 598 GLY B N     1 
ATOM   1296 C  CA    . GLY B 1 87  ? -7.419  38.183 33.399  1.00 91.57  ? 598 GLY B CA    1 
ATOM   1297 C  C     . GLY B 1 87  ? -8.097  39.540 33.481  1.00 77.66  ? 598 GLY B C     1 
ATOM   1298 O  O     . GLY B 1 87  ? -7.673  40.491 32.826  1.00 74.15  ? 598 GLY B O     1 
ATOM   1299 N  N     . CYS B 1 88  ? -9.150  39.619 34.300  1.00 60.68  ? 599 CYS B N     1 
ATOM   1300 C  CA    . CYS B 1 88  ? -9.906  40.854 34.520  1.00 49.35  ? 599 CYS B CA    1 
ATOM   1301 C  C     . CYS B 1 88  ? -9.221  41.663 35.621  1.00 52.09  ? 599 CYS B C     1 
ATOM   1302 O  O     . CYS B 1 88  ? -8.303  41.176 36.269  1.00 62.56  ? 599 CYS B O     1 
ATOM   1303 C  CB    . CYS B 1 88  ? -11.374 40.547 34.898  1.00 42.13  ? 599 CYS B CB    1 
ATOM   1304 S  SG    . CYS B 1 88  ? -11.677 39.699 36.581  1.00 43.21  ? 599 CYS B SG    1 
ATOM   1305 N  N     . ASN B 1 89  ? -9.637  42.905 35.813  1.00 45.81  ? 600 ASN B N     1 
ATOM   1306 C  CA    . ASN B 1 89  ? -9.106  43.731 36.892  1.00 55.02  ? 600 ASN B CA    1 
ATOM   1307 C  C     . ASN B 1 89  ? -10.215 44.454 37.608  1.00 58.08  ? 600 ASN B C     1 
ATOM   1308 O  O     . ASN B 1 89  ? -10.030 45.578 38.073  1.00 62.44  ? 600 ASN B O     1 
ATOM   1309 C  CB    . ASN B 1 89  ? -8.098  44.761 36.378  1.00 63.60  ? 600 ASN B CB    1 
ATOM   1310 C  CG    . ASN B 1 89  ? -6.930  44.132 35.675  1.00 67.89  ? 600 ASN B CG    1 
ATOM   1311 O  OD1   . ASN B 1 89  ? -5.830  44.044 36.224  1.00 67.26  ? 600 ASN B OD1   1 
ATOM   1312 N  ND2   . ASN B 1 89  ? -7.166  43.663 34.452  1.00 72.66  ? 600 ASN B ND2   1 
ATOM   1313 N  N     . CYS B 1 90  ? -11.369 43.812 37.680  1.00 52.17  ? 601 CYS B N     1 
ATOM   1314 C  CA    . CYS B 1 90  ? -12.550 44.448 38.234  1.00 48.18  ? 601 CYS B CA    1 
ATOM   1315 C  C     . CYS B 1 90  ? -12.320 44.951 39.642  1.00 46.75  ? 601 CYS B C     1 
ATOM   1316 O  O     . CYS B 1 90  ? -11.615 44.320 40.435  1.00 47.23  ? 601 CYS B O     1 
ATOM   1317 C  CB    . CYS B 1 90  ? -13.706 43.470 38.220  1.00 41.88  ? 601 CYS B CB    1 
ATOM   1318 S  SG    . CYS B 1 90  ? -13.899 42.708 36.625  1.00 52.50  ? 601 CYS B SG    1 
ATOM   1319 N  N     . LYS B 1 91  ? -12.908 46.102 39.946  1.00 56.35  ? 602 LYS B N     1 
ATOM   1320 C  CA    . LYS B 1 91  ? -12.848 46.655 41.294  1.00 58.27  ? 602 LYS B CA    1 
ATOM   1321 C  C     . LYS B 1 91  ? -14.214 46.790 41.958  1.00 60.65  ? 602 LYS B C     1 
ATOM   1322 O  O     . LYS B 1 91  ? -14.377 46.434 43.115  1.00 63.28  ? 602 LYS B O     1 
ATOM   1323 C  CB    . LYS B 1 91  ? -12.160 48.016 41.266  1.00 59.29  ? 602 LYS B CB    1 
ATOM   1324 C  CG    . LYS B 1 91  ? -10.661 47.936 41.070  1.00 65.09  ? 602 LYS B CG    1 
ATOM   1325 C  CD    . LYS B 1 91  ? -10.073 49.327 40.991  1.00 71.99  ? 602 LYS B CD    1 
ATOM   1326 C  CE    . LYS B 1 91  ? -8.564  49.276 41.031  1.00 76.59  ? 602 LYS B CE    1 
ATOM   1327 N  NZ    . LYS B 1 91  ? -8.022  50.658 41.025  1.00 78.65  ? 602 LYS B NZ    1 
ATOM   1328 N  N     . ARG B 1 92  ? -15.200 47.305 41.234  1.00 62.59  ? 603 ARG B N     1 
ATOM   1329 C  CA    . ARG B 1 92  ? -16.437 47.723 41.882  1.00 61.07  ? 603 ARG B CA    1 
ATOM   1330 C  C     . ARG B 1 92  ? -17.574 46.757 41.583  1.00 49.55  ? 603 ARG B C     1 
ATOM   1331 O  O     . ARG B 1 92  ? -18.551 46.669 42.328  1.00 40.02  ? 603 ARG B O     1 
ATOM   1332 C  CB    . ARG B 1 92  ? -16.826 49.145 41.450  1.00 66.48  ? 603 ARG B CB    1 
ATOM   1333 C  CG    . ARG B 1 92  ? -15.746 50.202 41.668  1.00 69.61  ? 603 ARG B CG    1 
ATOM   1334 C  CD    . ARG B 1 92  ? -15.433 50.420 43.135  1.00 78.57  ? 603 ARG B CD    1 
ATOM   1335 N  NE    . ARG B 1 92  ? -16.533 51.044 43.870  1.00 87.41  ? 603 ARG B NE    1 
ATOM   1336 C  CZ    . ARG B 1 92  ? -16.644 51.038 45.199  1.00 94.59  ? 603 ARG B CZ    1 
ATOM   1337 N  NH1   . ARG B 1 92  ? -15.725 50.431 45.953  1.00 94.09  ? 603 ARG B NH1   1 
ATOM   1338 N  NH2   . ARG B 1 92  ? -17.680 51.635 45.779  1.00 92.28  ? 603 ARG B NH2   1 
ATOM   1339 N  N     . SER B 1 93  ? -17.463 46.030 40.484  1.00 43.62  ? 604 SER B N     1 
ATOM   1340 C  CA    . SER B 1 93  ? -18.487 45.046 40.191  1.00 58.09  ? 604 SER B CA    1 
ATOM   1341 C  C     . SER B 1 93  ? -18.168 43.884 41.120  1.00 56.74  ? 604 SER B C     1 
ATOM   1342 O  O     . SER B 1 93  ? -17.338 44.008 42.025  1.00 67.68  ? 604 SER B O     1 
ATOM   1343 C  CB    . SER B 1 93  ? -18.495 44.655 38.698  1.00 58.06  ? 604 SER B CB    1 
ATOM   1344 O  OG    . SER B 1 93  ? -17.499 43.697 38.382  1.00 54.05  ? 604 SER B OG    1 
ATOM   1345 N  N     . GLY B 1 94  ? -18.802 42.750 40.948  1.00 53.08  ? 605 GLY B N     1 
ATOM   1346 C  CA    . GLY B 1 94  ? -18.448 41.664 41.858  1.00 65.38  ? 605 GLY B CA    1 
ATOM   1347 C  C     . GLY B 1 94  ? -17.715 40.647 41.028  1.00 58.34  ? 605 GLY B C     1 
ATOM   1348 O  O     . GLY B 1 94  ? -17.353 39.564 41.488  1.00 52.40  ? 605 GLY B O     1 
ATOM   1349 N  N     . CYS B 1 95  ? -17.497 41.058 39.783  1.00 50.81  ? 606 CYS B N     1 
ATOM   1350 C  CA    . CYS B 1 95  ? -17.204 40.180 38.669  1.00 47.70  ? 606 CYS B CA    1 
ATOM   1351 C  C     . CYS B 1 95  ? -18.501 39.384 38.510  1.00 47.63  ? 606 CYS B C     1 
ATOM   1352 O  O     . CYS B 1 95  ? -18.494 38.244 38.062  1.00 57.69  ? 606 CYS B O     1 
ATOM   1353 C  CB    . CYS B 1 95  ? -15.979 39.289 38.877  1.00 38.65  ? 606 CYS B CB    1 
ATOM   1354 S  SG    . CYS B 1 95  ? -14.459 40.164 39.349  1.00 53.46  ? 606 CYS B SG    1 
ATOM   1355 N  N     . LEU B 1 96  ? -19.614 40.023 38.880  1.00 42.12  ? 607 LEU B N     1 
ATOM   1356 C  CA    . LEU B 1 96  ? -20.975 39.502 38.657  1.00 51.96  ? 607 LEU B CA    1 
ATOM   1357 C  C     . LEU B 1 96  ? -21.867 40.458 37.842  1.00 66.92  ? 607 LEU B C     1 
ATOM   1358 O  O     . LEU B 1 96  ? -23.100 40.398 37.917  1.00 72.46  ? 607 LEU B O     1 
ATOM   1359 C  CB    . LEU B 1 96  ? -21.651 39.202 39.989  1.00 38.21  ? 607 LEU B CB    1 
ATOM   1360 C  CG    . LEU B 1 96  ? -20.863 38.107 40.701  1.00 39.76  ? 607 LEU B CG    1 
ATOM   1361 C  CD1   . LEU B 1 96  ? -21.498 37.732 42.029  1.00 50.03  ? 607 LEU B CD1   1 
ATOM   1362 C  CD2   . LEU B 1 96  ? -20.762 36.904 39.784  1.00 39.95  ? 607 LEU B CD2   1 
ATOM   1363 N  N     . LYS B 1 97  ? -21.238 41.342 37.075  1.00 62.43  ? 608 LYS B N     1 
ATOM   1364 C  CA    . LYS B 1 97  ? -21.953 42.232 36.184  1.00 60.95  ? 608 LYS B CA    1 
ATOM   1365 C  C     . LYS B 1 97  ? -21.217 42.178 34.875  1.00 56.42  ? 608 LYS B C     1 
ATOM   1366 O  O     . LYS B 1 97  ? -20.033 41.866 34.855  1.00 61.79  ? 608 LYS B O     1 
ATOM   1367 C  CB    . LYS B 1 97  ? -22.007 43.651 36.731  1.00 58.43  ? 608 LYS B CB    1 
ATOM   1368 C  CG    . LYS B 1 97  ? -22.818 43.772 38.004  1.00 58.48  ? 608 LYS B CG    1 
ATOM   1369 C  CD    . LYS B 1 97  ? -22.616 45.119 38.657  1.00 57.45  ? 608 LYS B CD    1 
ATOM   1370 C  CE    . LYS B 1 97  ? -23.746 45.414 39.618  1.00 61.91  ? 608 LYS B CE    1 
ATOM   1371 N  NZ    . LYS B 1 97  ? -23.616 46.762 40.215  1.00 67.53  ? 608 LYS B NZ    1 
ATOM   1372 N  N     . ASN B 1 98  ? -21.889 42.458 33.773  1.00 50.75  ? 609 ASN B N     1 
ATOM   1373 C  CA    . ASN B 1 98  ? -21.213 42.284 32.492  1.00 52.11  ? 609 ASN B CA    1 
ATOM   1374 C  C     . ASN B 1 98  ? -20.105 43.315 32.172  1.00 46.03  ? 609 ASN B C     1 
ATOM   1375 O  O     . ASN B 1 98  ? -19.426 43.157 31.176  1.00 40.77  ? 609 ASN B O     1 
ATOM   1376 C  CB    . ASN B 1 98  ? -22.245 42.230 31.373  1.00 50.81  ? 609 ASN B CB    1 
ATOM   1377 C  CG    . ASN B 1 98  ? -23.071 40.947 31.413  1.00 54.92  ? 609 ASN B CG    1 
ATOM   1378 O  OD1   . ASN B 1 98  ? -22.552 39.861 31.181  1.00 57.57  ? 609 ASN B OD1   1 
ATOM   1379 N  ND2   . ASN B 1 98  ? -24.358 41.069 31.731  1.00 51.44  ? 609 ASN B ND2   1 
ATOM   1380 N  N     . TYR B 1 99  ? -19.844 44.293 33.044  1.00 50.30  ? 610 TYR B N     1 
ATOM   1381 C  CA    . TYR B 1 99  ? -18.544 45.003 33.024  1.00 37.57  ? 610 TYR B CA    1 
ATOM   1382 C  C     . TYR B 1 99  ? -17.340 44.081 33.262  1.00 46.82  ? 610 TYR B C     1 
ATOM   1383 O  O     . TYR B 1 99  ? -16.206 44.420 32.862  1.00 37.71  ? 610 TYR B O     1 
ATOM   1384 C  CB    . TYR B 1 99  ? -18.483 46.094 34.076  1.00 37.73  ? 610 TYR B CB    1 
ATOM   1385 C  CG    . TYR B 1 99  ? -19.664 47.026 34.121  1.00 37.73  ? 610 TYR B CG    1 
ATOM   1386 C  CD1   . TYR B 1 99  ? -19.807 48.036 33.192  1.00 53.94  ? 610 TYR B CD1   1 
ATOM   1387 C  CD2   . TYR B 1 99  ? -20.606 46.931 35.140  1.00 39.95  ? 610 TYR B CD2   1 
ATOM   1388 C  CE1   . TYR B 1 99  ? -20.873 48.914 33.244  1.00 59.72  ? 610 TYR B CE1   1 
ATOM   1389 C  CE2   . TYR B 1 99  ? -21.671 47.796 35.200  1.00 39.52  ? 610 TYR B CE2   1 
ATOM   1390 C  CZ    . TYR B 1 99  ? -21.802 48.790 34.250  1.00 55.37  ? 610 TYR B CZ    1 
ATOM   1391 O  OH    . TYR B 1 99  ? -22.854 49.666 34.288  1.00 56.58  ? 610 TYR B OH    1 
ATOM   1392 N  N     . CYS B 1 100 ? -17.548 42.969 34.003  1.00 37.73  ? 611 CYS B N     1 
ATOM   1393 C  CA    . CYS B 1 100 ? -16.506 41.944 34.111  1.00 43.10  ? 611 CYS B CA    1 
ATOM   1394 C  C     . CYS B 1 100 ? -16.495 41.064 32.864  1.00 45.63  ? 611 CYS B C     1 
ATOM   1395 O  O     . CYS B 1 100 ? -17.516 40.497 32.476  1.00 46.91  ? 611 CYS B O     1 
ATOM   1396 C  CB    . CYS B 1 100 ? -16.680 41.057 35.352  1.00 47.20  ? 611 CYS B CB    1 
ATOM   1397 S  SG    . CYS B 1 100 ? -15.466 39.685 35.419  1.00 52.97  ? 611 CYS B SG    1 
ATOM   1398 N  N     . GLU B 1 101 ? -15.338 40.963 32.226  1.00 54.34  ? 612 GLU B N     1 
ATOM   1399 C  CA    . GLU B 1 101 ? -15.221 40.183 31.002  1.00 54.39  ? 612 GLU B CA    1 
ATOM   1400 C  C     . GLU B 1 101 ? -15.310 38.680 31.294  1.00 49.86  ? 612 GLU B C     1 
ATOM   1401 O  O     . GLU B 1 101 ? -15.785 37.899 30.466  1.00 45.69  ? 612 GLU B O     1 
ATOM   1402 C  CB    . GLU B 1 101 ? -13.920 40.535 30.272  1.00 55.92  ? 612 GLU B CB    1 
ATOM   1403 C  CG    . GLU B 1 101 ? -14.148 41.391 29.016  1.00 62.43  ? 612 GLU B CG    1 
ATOM   1404 C  CD    . GLU B 1 101 ? -12.872 42.012 28.483  1.00 63.45  ? 612 GLU B CD    1 
ATOM   1405 O  OE1   . GLU B 1 101 ? -11.775 41.454 28.708  1.00 57.22  ? 612 GLU B OE1   1 
ATOM   1406 O  OE2   . GLU B 1 101 ? -12.969 43.082 27.857  1.00 70.33  ? 612 GLU B OE2   1 
ATOM   1407 N  N     . CYS B 1 102 ? -14.873 38.272 32.479  1.00 55.77  ? 613 CYS B N     1 
ATOM   1408 C  CA    . CYS B 1 102 ? -15.039 36.875 32.878  1.00 55.01  ? 613 CYS B CA    1 
ATOM   1409 C  C     . CYS B 1 102 ? -16.522 36.581 32.975  1.00 47.87  ? 613 CYS B C     1 
ATOM   1410 O  O     . CYS B 1 102 ? -17.025 35.659 32.339  1.00 53.64  ? 613 CYS B O     1 
ATOM   1411 C  CB    . CYS B 1 102 ? -14.305 36.574 34.183  1.00 63.56  ? 613 CYS B CB    1 
ATOM   1412 S  SG    . CYS B 1 102 ? -12.486 36.620 34.024  1.00 62.68  ? 613 CYS B SG    1 
ATOM   1413 N  N     . TYR B 1 103 ? -17.236 37.399 33.731  1.00 52.50  ? 614 TYR B N     1 
ATOM   1414 C  CA    . TYR B 1 103 ? -18.670 37.186 33.881  1.00 57.10  ? 614 TYR B CA    1 
ATOM   1415 C  C     . TYR B 1 103 ? -19.437 37.254 32.546  1.00 58.44  ? 614 TYR B C     1 
ATOM   1416 O  O     . TYR B 1 103 ? -20.337 36.441 32.307  1.00 51.85  ? 614 TYR B O     1 
ATOM   1417 C  CB    . TYR B 1 103 ? -19.259 38.195 34.872  1.00 54.96  ? 614 TYR B CB    1 
ATOM   1418 C  CG    . TYR B 1 103 ? -20.697 37.876 35.235  1.00 57.24  ? 614 TYR B CG    1 
ATOM   1419 C  CD1   . TYR B 1 103 ? -20.996 36.912 36.198  1.00 47.27  ? 614 TYR B CD1   1 
ATOM   1420 C  CD2   . TYR B 1 103 ? -21.752 38.538 34.617  1.00 59.69  ? 614 TYR B CD2   1 
ATOM   1421 C  CE1   . TYR B 1 103 ? -22.282 36.609 36.511  1.00 48.27  ? 614 TYR B CE1   1 
ATOM   1422 C  CE2   . TYR B 1 103 ? -23.054 38.244 34.930  1.00 62.70  ? 614 TYR B CE2   1 
ATOM   1423 C  CZ    . TYR B 1 103 ? -23.315 37.278 35.884  1.00 60.69  ? 614 TYR B CZ    1 
ATOM   1424 O  OH    . TYR B 1 103 ? -24.619 36.977 36.202  1.00 61.75  ? 614 TYR B OH    1 
ATOM   1425 N  N     . GLU B 1 104 ? -19.087 38.202 31.674  1.00 58.39  ? 615 GLU B N     1 
ATOM   1426 C  CA    . GLU B 1 104 ? -19.795 38.330 30.396  1.00 57.51  ? 615 GLU B CA    1 
ATOM   1427 C  C     . GLU B 1 104 ? -19.602 37.085 29.524  1.00 55.32  ? 615 GLU B C     1 
ATOM   1428 O  O     . GLU B 1 104 ? -20.498 36.697 28.769  1.00 56.37  ? 615 GLU B O     1 
ATOM   1429 C  CB    . GLU B 1 104 ? -19.364 39.602 29.646  1.00 57.69  ? 615 GLU B CB    1 
ATOM   1430 C  CG    . GLU B 1 104 ? -19.796 39.642 28.189  1.00 68.64  ? 615 GLU B CG    1 
ATOM   1431 C  CD    . GLU B 1 104 ? -19.498 40.973 27.516  1.00 85.88  ? 615 GLU B CD    1 
ATOM   1432 O  OE1   . GLU B 1 104 ? -19.897 41.148 26.342  1.00 91.98  ? 615 GLU B OE1   1 
ATOM   1433 O  OE2   . GLU B 1 104 ? -18.870 41.846 28.154  1.00 91.48  ? 615 GLU B OE2   1 
ATOM   1434 N  N     . ALA B 1 105 ? -18.447 36.442 29.653  1.00 54.69  ? 616 ALA B N     1 
ATOM   1435 C  CA    . ALA B 1 105 ? -18.178 35.227 28.895  1.00 55.70  ? 616 ALA B CA    1 
ATOM   1436 C  C     . ALA B 1 105 ? -18.755 33.997 29.569  1.00 61.24  ? 616 ALA B C     1 
ATOM   1437 O  O     . ALA B 1 105 ? -18.583 32.882 29.079  1.00 58.21  ? 616 ALA B O     1 
ATOM   1438 C  CB    . ALA B 1 105 ? -16.688 35.063 28.687  1.00 54.89  ? 616 ALA B CB    1 
ATOM   1439 N  N     . LYS B 1 106 ? -19.435 34.222 30.694  1.00 75.50  ? 617 LYS B N     1 
ATOM   1440 C  CA    . LYS B 1 106 ? -20.135 33.185 31.470  1.00 80.57  ? 617 LYS B CA    1 
ATOM   1441 C  C     . LYS B 1 106 ? -19.223 32.077 32.012  1.00 78.60  ? 617 LYS B C     1 
ATOM   1442 O  O     . LYS B 1 106 ? -19.578 30.894 31.987  1.00 80.71  ? 617 LYS B O     1 
ATOM   1443 C  CB    . LYS B 1 106 ? -21.262 32.568 30.638  1.00 85.97  ? 617 LYS B CB    1 
ATOM   1444 C  CG    . LYS B 1 106 ? -22.348 33.558 30.228  1.00 90.24  ? 617 LYS B CG    1 
ATOM   1445 C  CD    . LYS B 1 106 ? -22.953 34.267 31.439  1.00 95.30  ? 617 LYS B CD    1 
ATOM   1446 C  CE    . LYS B 1 106 ? -24.107 35.205 31.046  1.00 96.17  ? 617 LYS B CE    1 
ATOM   1447 N  NZ    . LYS B 1 106 ? -23.667 36.501 30.453  1.00 91.11  ? 617 LYS B NZ    1 
ATOM   1448 N  N     . ILE B 1 107 ? -18.049 32.473 32.498  1.00 69.64  ? 618 ILE B N     1 
ATOM   1449 C  CA    . ILE B 1 107 ? -17.103 31.559 33.128  1.00 63.38  ? 618 ILE B CA    1 
ATOM   1450 C  C     . ILE B 1 107 ? -16.597 32.165 34.437  1.00 63.82  ? 618 ILE B C     1 
ATOM   1451 O  O     . ILE B 1 107 ? -16.777 33.371 34.646  1.00 69.77  ? 618 ILE B O     1 
ATOM   1452 C  CB    . ILE B 1 107 ? -15.897 31.277 32.224  1.00 64.33  ? 618 ILE B CB    1 
ATOM   1453 C  CG1   . ILE B 1 107 ? -15.016 32.526 32.124  1.00 52.50  ? 618 ILE B CG1   1 
ATOM   1454 C  CG2   . ILE B 1 107 ? -16.347 30.774 30.855  1.00 57.01  ? 618 ILE B CG2   1 
ATOM   1455 C  CD1   . ILE B 1 107 ? -13.580 32.211 31.907  1.00 52.39  ? 618 ILE B CD1   1 
ATOM   1456 N  N     . MET B 1 108 ? -15.942 31.359 35.290  1.00 52.07  ? 619 MET B N     1 
ATOM   1457 C  CA    . MET B 1 108 ? -15.360 31.844 36.560  1.00 44.71  ? 619 MET B CA    1 
ATOM   1458 C  C     . MET B 1 108 ? -14.057 32.595 36.352  1.00 48.03  ? 619 MET B C     1 
ATOM   1459 O  O     . MET B 1 108 ? -13.297 32.284 35.440  1.00 48.78  ? 619 MET B O     1 
ATOM   1460 C  CB    . MET B 1 108 ? -15.041 30.695 37.557  1.00 50.85  ? 619 MET B CB    1 
ATOM   1461 C  CG    . MET B 1 108 ? -16.077 29.641 37.732  1.00 46.93  ? 619 MET B CG    1 
ATOM   1462 S  SD    . MET B 1 108 ? -17.590 30.333 38.372  1.00 66.45  ? 619 MET B SD    1 
ATOM   1463 C  CE    . MET B 1 108 ? -18.684 28.943 38.075  1.00 69.80  ? 619 MET B CE    1 
ATOM   1464 N  N     . CYS B 1 109 ? -13.770 33.536 37.250  1.00 59.73  ? 620 CYS B N     1 
ATOM   1465 C  CA    . CYS B 1 109 ? -12.450 34.164 37.315  1.00 62.24  ? 620 CYS B CA    1 
ATOM   1466 C  C     . CYS B 1 109 ? -11.406 33.116 37.648  1.00 62.91  ? 620 CYS B C     1 
ATOM   1467 O  O     . CYS B 1 109 ? -11.702 32.141 38.343  1.00 53.61  ? 620 CYS B O     1 
ATOM   1468 C  CB    . CYS B 1 109 ? -12.406 35.250 38.388  1.00 57.00  ? 620 CYS B CB    1 
ATOM   1469 S  SG    . CYS B 1 109 ? -13.326 36.723 38.006  1.00 51.05  ? 620 CYS B SG    1 
ATOM   1470 N  N     . SER B 1 110 ? -10.174 33.337 37.207  1.00 66.08  ? 621 SER B N     1 
ATOM   1471 C  CA    . SER B 1 110 ? -9.105  32.401 37.519  1.00 71.31  ? 621 SER B CA    1 
ATOM   1472 C  C     . SER B 1 110 ? -7.952  33.094 38.229  1.00 77.16  ? 621 SER B C     1 
ATOM   1473 O  O     . SER B 1 110 ? -8.014  34.292 38.533  1.00 77.53  ? 621 SER B O     1 
ATOM   1474 C  CB    . SER B 1 110 ? -8.592  31.721 36.249  1.00 71.66  ? 621 SER B CB    1 
ATOM   1475 O  OG    . SER B 1 110 ? -7.731  32.587 35.517  1.00 66.75  ? 621 SER B OG    1 
ATOM   1476 N  N     . SER B 1 111 ? -6.902  32.318 38.479  1.00 79.53  ? 622 SER B N     1 
ATOM   1477 C  CA    . SER B 1 111 ? -5.719  32.776 39.194  1.00 78.94  ? 622 SER B CA    1 
ATOM   1478 C  C     . SER B 1 111 ? -5.044  33.966 38.514  1.00 70.73  ? 622 SER B C     1 
ATOM   1479 O  O     . SER B 1 111 ? -4.483  34.829 39.185  1.00 75.01  ? 622 SER B O     1 
ATOM   1480 C  CB    . SER B 1 111 ? -4.722  31.628 39.326  1.00 84.62  ? 622 SER B CB    1 
ATOM   1481 O  OG    . SER B 1 111 ? -4.282  31.214 38.042  1.00 91.70  ? 622 SER B OG    1 
ATOM   1482 N  N     . ILE B 1 112 ? -5.087  34.002 37.187  1.00 66.98  ? 623 ILE B N     1 
ATOM   1483 C  CA    . ILE B 1 112 ? -4.492  35.117 36.438  1.00 74.72  ? 623 ILE B CA    1 
ATOM   1484 C  C     . ILE B 1 112 ? -5.241  36.457 36.596  1.00 77.50  ? 623 ILE B C     1 
ATOM   1485 O  O     . ILE B 1 112 ? -4.668  37.510 36.343  1.00 76.20  ? 623 ILE B O     1 
ATOM   1486 C  CB    . ILE B 1 112 ? -4.391  34.795 34.946  1.00 72.72  ? 623 ILE B CB    1 
ATOM   1487 C  CG1   . ILE B 1 112 ? -5.783  34.725 34.323  1.00 78.61  ? 623 ILE B CG1   1 
ATOM   1488 C  CG2   . ILE B 1 112 ? -3.619  33.492 34.740  1.00 71.19  ? 623 ILE B CG2   1 
ATOM   1489 C  CD1   . ILE B 1 112 ? -5.773  34.620 32.822  1.00 81.70  ? 623 ILE B CD1   1 
ATOM   1490 N  N     . CYS B 1 113 ? -6.517  36.421 36.987  1.00 78.86  ? 624 CYS B N     1 
ATOM   1491 C  CA    . CYS B 1 113 ? -7.280  37.651 37.241  1.00 73.08  ? 624 CYS B CA    1 
ATOM   1492 C  C     . CYS B 1 113 ? -6.726  38.457 38.409  1.00 67.89  ? 624 CYS B C     1 
ATOM   1493 O  O     . CYS B 1 113 ? -6.278  37.889 39.403  1.00 81.86  ? 624 CYS B O     1 
ATOM   1494 C  CB    . CYS B 1 113 ? -8.757  37.345 37.539  1.00 77.67  ? 624 CYS B CB    1 
ATOM   1495 S  SG    . CYS B 1 113 ? -9.773  36.680 36.204  1.00 66.86  ? 624 CYS B SG    1 
ATOM   1496 N  N     . LYS B 1 114 ? -6.787  39.780 38.304  1.00 47.03  ? 625 LYS B N     1 
ATOM   1497 C  CA    . LYS B 1 114 ? -6.393  40.643 39.411  1.00 44.13  ? 625 LYS B CA    1 
ATOM   1498 C  C     . LYS B 1 114 ? -7.591  41.387 40.023  1.00 55.34  ? 625 LYS B C     1 
ATOM   1499 O  O     . LYS B 1 114 ? -7.441  42.511 40.526  1.00 51.46  ? 625 LYS B O     1 
ATOM   1500 C  CB    . LYS B 1 114 ? -5.308  41.630 38.971  1.00 55.02  ? 625 LYS B CB    1 
ATOM   1501 C  CG    . LYS B 1 114 ? -3.930  41.012 38.677  1.00 60.61  ? 625 LYS B CG    1 
ATOM   1502 C  CD    . LYS B 1 114 ? -3.719  40.502 37.248  1.00 60.91  ? 625 LYS B CD    1 
ATOM   1503 C  CE    . LYS B 1 114 ? -2.276  39.949 37.099  1.00 61.20  ? 625 LYS B CE    1 
ATOM   1504 N  NZ    . LYS B 1 114 ? -1.954  39.248 35.805  1.00 53.96  ? 625 LYS B NZ    1 
ATOM   1505 N  N     . CYS B 1 115 ? -8.758  40.723 40.007  1.00 58.63  ? 626 CYS B N     1 
ATOM   1506 C  CA    . CYS B 1 115 ? -9.988  41.202 40.663  1.00 57.45  ? 626 CYS B CA    1 
ATOM   1507 C  C     . CYS B 1 115 ? -9.729  41.669 42.080  1.00 62.81  ? 626 CYS B C     1 
ATOM   1508 O  O     . CYS B 1 115 ? -8.901  41.096 42.784  1.00 50.64  ? 626 CYS B O     1 
ATOM   1509 C  CB    . CYS B 1 115 ? -11.035 40.113 40.841  1.00 45.48  ? 626 CYS B CB    1 
ATOM   1510 S  SG    . CYS B 1 115 ? -11.057 38.816 39.723  1.00 57.17  ? 626 CYS B SG    1 
ATOM   1511 N  N     . ILE B 1 116 ? -10.534 42.612 42.542  1.00 73.64  ? 627 ILE B N     1 
ATOM   1512 C  CA    . ILE B 1 116 ? -10.609 42.895 43.962  1.00 71.67  ? 627 ILE B CA    1 
ATOM   1513 C  C     . ILE B 1 116 ? -12.073 42.714 44.340  1.00 68.64  ? 627 ILE B C     1 
ATOM   1514 O  O     . ILE B 1 116 ? -12.952 43.282 43.703  1.00 78.80  ? 627 ILE B O     1 
ATOM   1515 C  CB    . ILE B 1 116 ? -10.140 44.311 44.314  1.00 74.79  ? 627 ILE B CB    1 
ATOM   1516 C  CG1   . ILE B 1 116 ? -8.674  44.517 43.917  1.00 82.71  ? 627 ILE B CG1   1 
ATOM   1517 C  CG2   . ILE B 1 116 ? -10.372 44.596 45.785  1.00 72.50  ? 627 ILE B CG2   1 
ATOM   1518 C  CD1   . ILE B 1 116 ? -7.715  43.559 44.570  1.00 86.59  ? 627 ILE B CD1   1 
ATOM   1519 N  N     . GLY B 1 117 ? -12.325 41.908 45.361  1.00 49.40  ? 628 GLY B N     1 
ATOM   1520 C  CA    . GLY B 1 117 ? -13.666 41.626 45.819  1.00 47.05  ? 628 GLY B CA    1 
ATOM   1521 C  C     . GLY B 1 117 ? -14.395 40.624 44.950  1.00 50.94  ? 628 GLY B C     1 
ATOM   1522 O  O     . GLY B 1 117 ? -15.620 40.628 44.900  1.00 54.78  ? 628 GLY B O     1 
ATOM   1523 N  N     . CYS B 1 118 ? -13.658 39.717 44.316  1.00 48.97  ? 629 CYS B N     1 
ATOM   1524 C  CA    . CYS B 1 118 ? -14.289 38.770 43.404  1.00 50.53  ? 629 CYS B CA    1 
ATOM   1525 C  C     . CYS B 1 118 ? -15.234 37.753 44.071  1.00 56.38  ? 629 CYS B C     1 
ATOM   1526 O  O     . CYS B 1 118 ? -14.858 36.982 44.966  1.00 61.61  ? 629 CYS B O     1 
ATOM   1527 C  CB    . CYS B 1 118 ? -13.240 38.011 42.614  1.00 39.82  ? 629 CYS B CB    1 
ATOM   1528 S  SG    . CYS B 1 118 ? -13.940 36.871 41.399  1.00 43.43  ? 629 CYS B SG    1 
ATOM   1529 N  N     . LYS B 1 119 ? -16.457 37.757 43.554  1.00 53.06  ? 630 LYS B N     1 
ATOM   1530 C  CA    . LYS B 1 119 ? -17.547 36.872 43.929  1.00 45.19  ? 630 LYS B CA    1 
ATOM   1531 C  C     . LYS B 1 119 ? -17.907 35.925 42.797  1.00 46.69  ? 630 LYS B C     1 
ATOM   1532 O  O     . LYS B 1 119 ? -18.989 35.359 42.785  1.00 39.08  ? 630 LYS B O     1 
ATOM   1533 C  CB    . LYS B 1 119 ? -18.760 37.702 44.328  1.00 39.18  ? 630 LYS B CB    1 
ATOM   1534 C  CG    . LYS B 1 119 ? -18.500 38.530 45.577  1.00 61.38  ? 630 LYS B CG    1 
ATOM   1535 C  CD    . LYS B 1 119 ? -19.620 39.489 45.920  1.00 65.81  ? 630 LYS B CD    1 
ATOM   1536 C  CE    . LYS B 1 119 ? -19.219 40.351 47.112  1.00 76.29  ? 630 LYS B CE    1 
ATOM   1537 N  NZ    . LYS B 1 119 ? -20.374 41.093 47.699  1.00 83.06  ? 630 LYS B NZ    1 
ATOM   1538 N  N     . ASN B 1 120 ? -17.035 35.837 41.794  1.00 49.00  ? 631 ASN B N     1 
ATOM   1539 C  CA    . ASN B 1 120 ? -17.256 34.969 40.632  1.00 55.19  ? 631 ASN B CA    1 
ATOM   1540 C  C     . ASN B 1 120 ? -16.247 33.851 40.673  1.00 61.02  ? 631 ASN B C     1 
ATOM   1541 O  O     . ASN B 1 120 ? -15.241 33.858 39.945  1.00 55.65  ? 631 ASN B O     1 
ATOM   1542 C  CB    . ASN B 1 120 ? -17.177 35.753 39.310  1.00 53.67  ? 631 ASN B CB    1 
ATOM   1543 C  CG    . ASN B 1 120 ? -17.314 34.859 38.054  1.00 64.91  ? 631 ASN B CG    1 
ATOM   1544 O  OD1   . ASN B 1 120 ? -16.359 34.731 37.290  1.00 75.24  ? 631 ASN B OD1   1 
ATOM   1545 N  ND2   . ASN B 1 120 ? -18.493 34.278 37.824  1.00 38.61  ? 631 ASN B ND2   1 
ATOM   1546 N  N     . PHE B 1 121 ? -16.489 32.949 41.615  1.00 63.22  ? 632 PHE B N     1 
ATOM   1547 C  CA    . PHE B 1 121 ? -15.748 31.709 41.754  1.00 52.00  ? 632 PHE B CA    1 
ATOM   1548 C  C     . PHE B 1 121 ? -16.808 30.657 42.033  1.00 46.29  ? 632 PHE B C     1 
ATOM   1549 O  O     . PHE B 1 121 ? -17.954 31.011 42.311  1.00 42.13  ? 632 PHE B O     1 
ATOM   1550 C  CB    . PHE B 1 121 ? -14.700 31.801 42.858  1.00 44.54  ? 632 PHE B CB    1 
ATOM   1551 C  CG    . PHE B 1 121 ? -15.242 32.267 44.165  1.00 58.90  ? 632 PHE B CG    1 
ATOM   1552 C  CD1   . PHE B 1 121 ? -15.345 33.615 44.451  1.00 55.73  ? 632 PHE B CD1   1 
ATOM   1553 C  CD2   . PHE B 1 121 ? -15.641 31.343 45.129  1.00 60.57  ? 632 PHE B CD2   1 
ATOM   1554 C  CE1   . PHE B 1 121 ? -15.855 34.031 45.661  1.00 46.93  ? 632 PHE B CE1   1 
ATOM   1555 C  CE2   . PHE B 1 121 ? -16.137 31.753 46.330  1.00 42.24  ? 632 PHE B CE2   1 
ATOM   1556 C  CZ    . PHE B 1 121 ? -16.240 33.094 46.603  1.00 41.39  ? 632 PHE B CZ    1 
ATOM   1557 N  N     . GLU B 1 122 ? -16.448 29.381 41.920  1.00 51.63  ? 633 GLU B N     1 
ATOM   1558 C  CA    . GLU B 1 122 ? -17.428 28.296 41.974  1.00 54.79  ? 633 GLU B CA    1 
ATOM   1559 C  C     . GLU B 1 122 ? -18.293 28.294 43.239  1.00 52.46  ? 633 GLU B C     1 
ATOM   1560 O  O     . GLU B 1 122 ? -19.529 28.168 43.167  1.00 46.96  ? 633 GLU B O     1 
ATOM   1561 C  CB    . GLU B 1 122 ? -16.732 26.942 41.843  1.00 66.28  ? 633 GLU B CB    1 
ATOM   1562 C  CG    . GLU B 1 122 ? -17.698 25.771 41.919  1.00 78.54  ? 633 GLU B CG    1 
ATOM   1563 C  CD    . GLU B 1 122 ? -18.622 25.710 40.724  1.00 87.33  ? 633 GLU B CD    1 
ATOM   1564 O  OE1   . GLU B 1 122 ? -18.110 25.661 39.586  1.00 94.57  ? 633 GLU B OE1   1 
ATOM   1565 O  OE2   . GLU B 1 122 ? -19.855 25.744 40.920  1.00 85.21  ? 633 GLU B OE2   1 
ATOM   1566 N  N     . GLU B 1 123 ? -17.655 28.450 44.395  1.00 49.06  ? 634 GLU B N     1 
ATOM   1567 C  CA    . GLU B 1 123 ? -18.369 28.236 45.658  1.00 61.48  ? 634 GLU B CA    1 
ATOM   1568 C  C     . GLU B 1 123 ? -19.021 29.513 46.163  1.00 62.79  ? 634 GLU B C     1 
ATOM   1569 O  O     . GLU B 1 123 ? -19.499 29.555 47.302  1.00 58.64  ? 634 GLU B O     1 
ATOM   1570 C  CB    . GLU B 1 123 ? -17.431 27.654 46.727  1.00 57.96  ? 634 GLU B CB    1 
ATOM   1571 C  CG    . GLU B 1 123 ? -16.646 26.407 46.304  1.00 60.23  ? 634 GLU B CG    1 
ATOM   1572 C  CD    . GLU B 1 123 ? -15.435 26.696 45.396  1.00 68.01  ? 634 GLU B CD    1 
ATOM   1573 O  OE1   . GLU B 1 123 ? -15.358 27.787 44.768  1.00 57.80  ? 634 GLU B OE1   1 
ATOM   1574 O  OE2   . GLU B 1 123 ? -14.553 25.811 45.314  1.00 77.30  ? 634 GLU B OE2   1 
ATOM   1575 N  N     . SER B 1 124 ? -19.064 30.543 45.315  1.00 49.63  ? 635 SER B N     1 
ATOM   1576 C  CA    . SER B 1 124 ? -19.662 31.812 45.726  1.00 54.32  ? 635 SER B CA    1 
ATOM   1577 C  C     . SER B 1 124 ? -21.165 31.738 45.881  1.00 60.22  ? 635 SER B C     1 
ATOM   1578 O  O     . SER B 1 124 ? -21.868 31.384 44.941  1.00 66.27  ? 635 SER B O     1 
ATOM   1579 C  CB    . SER B 1 124 ? -19.354 32.928 44.730  1.00 57.64  ? 635 SER B CB    1 
ATOM   1580 O  OG    . SER B 1 124 ? -20.119 34.087 45.049  1.00 51.24  ? 635 SER B OG    1 
ATOM   1581 N  N     . PRO B 1 125 ? -21.663 32.129 47.058  1.00 59.74  ? 636 PRO B N     1 
ATOM   1582 C  CA    . PRO B 1 125 ? -23.107 32.212 47.268  1.00 58.16  ? 636 PRO B CA    1 
ATOM   1583 C  C     . PRO B 1 125 ? -23.719 33.228 46.324  1.00 64.01  ? 636 PRO B C     1 
ATOM   1584 O  O     . PRO B 1 125 ? -24.633 32.897 45.571  1.00 65.72  ? 636 PRO B O     1 
ATOM   1585 C  CB    . PRO B 1 125 ? -23.231 32.676 48.720  1.00 52.26  ? 636 PRO B CB    1 
ATOM   1586 C  CG    . PRO B 1 125 ? -21.880 32.407 49.335  1.00 59.49  ? 636 PRO B CG    1 
ATOM   1587 C  CD    . PRO B 1 125 ? -20.896 32.528 48.249  1.00 57.55  ? 636 PRO B CD    1 
ATOM   1588 N  N     . GLU B 1 126 ? -23.190 34.446 46.354  1.00 62.22  ? 637 GLU B N     1 
ATOM   1589 C  CA    . GLU B 1 126 ? -23.722 35.530 45.556  1.00 60.63  ? 637 GLU B CA    1 
ATOM   1590 C  C     . GLU B 1 126 ? -23.785 35.135 44.083  1.00 60.84  ? 637 GLU B C     1 
ATOM   1591 O  O     . GLU B 1 126 ? -24.748 35.467 43.397  1.00 68.65  ? 637 GLU B O     1 
ATOM   1592 C  CB    . GLU B 1 126 ? -22.874 36.793 45.727  1.00 64.79  ? 637 GLU B CB    1 
ATOM   1593 C  CG    . GLU B 1 126 ? -22.705 37.251 47.168  1.00 68.50  ? 637 GLU B CG    1 
ATOM   1594 C  CD    . GLU B 1 126 ? -21.481 36.644 47.849  1.00 70.36  ? 637 GLU B CD    1 
ATOM   1595 O  OE1   . GLU B 1 126 ? -20.975 35.601 47.377  1.00 65.62  ? 637 GLU B OE1   1 
ATOM   1596 O  OE2   . GLU B 1 126 ? -21.014 37.225 48.852  1.00 72.00  ? 637 GLU B OE2   1 
ATOM   1597 N  N     . ARG B 1 127 ? -22.777 34.415 43.594  1.00 54.71  ? 638 ARG B N     1 
ATOM   1598 C  CA    . ARG B 1 127 ? -22.822 33.968 42.206  1.00 59.76  ? 638 ARG B CA    1 
ATOM   1599 C  C     . ARG B 1 127 ? -23.946 32.959 42.041  1.00 64.37  ? 638 ARG B C     1 
ATOM   1600 O  O     . ARG B 1 127 ? -24.725 33.028 41.091  1.00 67.64  ? 638 ARG B O     1 
ATOM   1601 C  CB    . ARG B 1 127 ? -21.492 33.364 41.738  1.00 56.18  ? 638 ARG B CB    1 
ATOM   1602 C  CG    . ARG B 1 127 ? -21.539 32.900 40.267  1.00 52.36  ? 638 ARG B CG    1 
ATOM   1603 C  CD    . ARG B 1 127 ? -20.312 32.100 39.854  1.00 55.49  ? 638 ARG B CD    1 
ATOM   1604 N  NE    . ARG B 1 127 ? -20.170 30.848 40.604  1.00 67.72  ? 638 ARG B NE    1 
ATOM   1605 C  CZ    . ARG B 1 127 ? -20.912 29.757 40.419  1.00 69.42  ? 638 ARG B CZ    1 
ATOM   1606 N  NH1   . ARG B 1 127 ? -21.866 29.743 39.494  1.00 71.69  ? 638 ARG B NH1   1 
ATOM   1607 N  NH2   . ARG B 1 127 ? -20.693 28.675 41.157  1.00 65.24  ? 638 ARG B NH2   1 
ATOM   1608 N  N     . LYS B 1 128 ? -24.032 32.032 42.984  1.00 66.11  ? 639 LYS B N     1 
ATOM   1609 C  CA    . LYS B 1 128 ? -25.065 31.017 42.955  1.00 64.77  ? 639 LYS B CA    1 
ATOM   1610 C  C     . LYS B 1 128 ? -26.448 31.661 42.967  1.00 66.91  ? 639 LYS B C     1 
ATOM   1611 O  O     . LYS B 1 128 ? -27.342 31.217 42.250  1.00 69.67  ? 639 LYS B O     1 
ATOM   1612 C  CB    . LYS B 1 128 ? -24.899 30.066 44.140  1.00 66.51  ? 639 LYS B CB    1 
ATOM   1613 C  CG    . LYS B 1 128 ? -24.007 28.855 43.847  1.00 65.72  ? 639 LYS B CG    1 
ATOM   1614 C  CD    . LYS B 1 128 ? -23.465 28.276 45.129  1.00 57.55  ? 639 LYS B CD    1 
ATOM   1615 C  CE    . LYS B 1 128 ? -22.647 27.017 44.908  1.00 59.52  ? 639 LYS B CE    1 
ATOM   1616 N  NZ    . LYS B 1 128 ? -21.992 26.611 46.206  1.00 59.24  ? 639 LYS B NZ    1 
ATOM   1617 N  N     . THR B 1 129 ? -26.618 32.719 43.759  1.00 65.78  ? 640 THR B N     1 
ATOM   1618 C  CA    . THR B 1 129 ? -27.912 33.405 43.834  1.00 69.03  ? 640 THR B CA    1 
ATOM   1619 C  C     . THR B 1 129 ? -28.310 33.977 42.471  1.00 69.46  ? 640 THR B C     1 
ATOM   1620 O  O     . THR B 1 129 ? -29.347 33.607 41.926  1.00 72.41  ? 640 THR B O     1 
ATOM   1621 C  CB    . THR B 1 129 ? -27.915 34.549 44.890  1.00 68.37  ? 640 THR B CB    1 
ATOM   1622 O  OG1   . THR B 1 129 ? -27.449 34.062 46.151  1.00 69.17  ? 640 THR B OG1   1 
ATOM   1623 C  CG2   . THR B 1 129 ? -29.322 35.108 45.084  1.00 64.40  ? 640 THR B CG2   1 
ATOM   1624 N  N     . LEU B 1 130 ? -27.482 34.826 41.906  1.00 73.94  ? 641 LEU B N     1 
ATOM   1625 C  CA    . LEU B 1 130 ? -27.754 35.424 40.618  1.00 77.20  ? 641 LEU B CA    1 
ATOM   1626 C  C     . LEU B 1 130 ? -27.941 34.437 39.513  1.00 72.82  ? 641 LEU B C     1 
ATOM   1627 O  O     . LEU B 1 130 ? -28.274 34.810 38.421  1.00 77.01  ? 641 LEU B O     1 
ATOM   1628 C  CB    . LEU B 1 130 ? -26.557 36.264 40.207  1.00 20.00  ? 641 LEU B CB    1 
ATOM   1629 C  CG    . LEU B 1 130 ? -26.531 37.781 40.345  1.00 20.00  ? 641 LEU B CG    1 
ATOM   1630 C  CD1   . LEU B 1 130 ? -25.090 38.225 40.370  1.00 20.00  ? 641 LEU B CD1   1 
ATOM   1631 C  CD2   . LEU B 1 130 ? -27.247 38.448 39.190  1.00 20.00  ? 641 LEU B CD2   1 
ATOM   1632 N  N     . MET B 1 131 ? -27.699 33.180 39.784  1.00 69.72  ? 642 MET B N     1 
ATOM   1633 C  CA    . MET B 1 131 ? -27.759 32.152 38.757  1.00 76.45  ? 642 MET B CA    1 
ATOM   1634 C  C     . MET B 1 131 ? -29.165 31.551 38.656  1.00 93.58  ? 642 MET B C     1 
ATOM   1635 O  O     . MET B 1 131 ? -29.527 30.965 37.635  1.00 95.94  ? 642 MET B O     1 
ATOM   1636 C  CB    . MET B 1 131 ? -26.734 31.059 39.039  1.00 69.15  ? 642 MET B CB    1 
ATOM   1637 C  CG    . MET B 1 131 ? -26.362 30.255 37.821  1.00 62.80  ? 642 MET B CG    1 
ATOM   1638 S  SD    . MET B 1 131 ? -25.106 29.027 38.178  1.00 104.57 ? 642 MET B SD    1 
ATOM   1639 C  CE    . MET B 1 131 ? -25.055 28.131 36.622  1.00 75.14  ? 642 MET B CE    1 
ATOM   1640 N  N     . HIS B 1 132 ? -29.949 31.691 39.722  1.00 104.29 ? 643 HIS B N     1 
ATOM   1641 C  CA    . HIS B 1 132 ? -31.344 31.254 39.717  1.00 111.76 ? 643 HIS B CA    1 
ATOM   1642 C  C     . HIS B 1 132 ? -32.254 32.437 40.005  1.00 121.14 ? 643 HIS B C     1 
ATOM   1643 O  O     . HIS B 1 132 ? -32.886 32.487 41.063  1.00 124.40 ? 643 HIS B O     1 
ATOM   1644 C  CB    . HIS B 1 132 ? -31.597 30.161 40.760  1.00 105.36 ? 643 HIS B CB    1 
ATOM   1645 C  CG    . HIS B 1 132 ? -30.634 29.024 40.701  1.00 99.92  ? 643 HIS B CG    1 
ATOM   1646 N  ND1   . HIS B 1 132 ? -29.643 28.837 41.648  1.00 97.20  ? 643 HIS B ND1   1 
ATOM   1647 C  CD2   . HIS B 1 132 ? -30.504 28.000 39.825  1.00 100.76 ? 643 HIS B CD2   1 
ATOM   1648 C  CE1   . HIS B 1 132 ? -28.953 27.756 41.355  1.00 97.81  ? 643 HIS B CE1   1 
ATOM   1649 N  NE2   . HIS B 1 132 ? -29.451 27.227 40.248  1.00 99.87  ? 643 HIS B NE2   1 
ATOM   1650 N  N     . LEU B 1 133 ? -32.319 33.379 39.065  1.00 84.23  ? 644 LEU B N     1 
ATOM   1651 C  CA    . LEU B 1 133 ? -33.064 34.622 39.255  1.00 85.92  ? 644 LEU B CA    1 
ATOM   1652 C  C     . LEU B 1 133 ? -32.540 35.374 40.480  1.00 80.46  ? 644 LEU B C     1 
ATOM   1653 O  O     . LEU B 1 133 ? -32.086 36.515 40.383  1.00 79.51  ? 644 LEU B O     1 
ATOM   1654 C  CB    . LEU B 1 133 ? -34.577 34.357 39.401  1.00 90.32  ? 644 LEU B CB    1 
ATOM   1655 C  CG    . LEU B 1 133 ? -35.426 33.785 38.253  1.00 89.08  ? 644 LEU B CG    1 
ATOM   1656 C  CD1   . LEU B 1 133 ? -35.264 32.274 38.109  1.00 88.18  ? 644 LEU B CD1   1 
ATOM   1657 C  CD2   . LEU B 1 133 ? -36.894 34.151 38.451  1.00 87.83  ? 644 LEU B CD2   1 
ATOM   1658 O  "O5'" . DG  C 2 1   ? -34.721 57.658 23.005  1.00 77.94  ? 1   DG  C "O5'" 1 
ATOM   1659 C  "C5'" . DG  C 2 1   ? -35.592 58.747 23.299  1.00 80.79  ? 1   DG  C "C5'" 1 
ATOM   1660 C  "C4'" . DG  C 2 1   ? -35.024 59.641 24.400  1.00 82.33  ? 1   DG  C "C4'" 1 
ATOM   1661 O  "O4'" . DG  C 2 1   ? -35.139 58.976 25.683  1.00 80.22  ? 1   DG  C "O4'" 1 
ATOM   1662 C  "C3'" . DG  C 2 1   ? -33.552 60.033 24.244  1.00 86.57  ? 1   DG  C "C3'" 1 
ATOM   1663 O  "O3'" . DG  C 2 1   ? -33.360 61.409 24.615  1.00 94.46  ? 1   DG  C "O3'" 1 
ATOM   1664 C  "C2'" . DG  C 2 1   ? -32.823 59.075 25.185  1.00 81.78  ? 1   DG  C "C2'" 1 
ATOM   1665 C  "C1'" . DG  C 2 1   ? -33.861 58.828 26.281  1.00 83.66  ? 1   DG  C "C1'" 1 
ATOM   1666 N  N9    . DG  C 2 1   ? -33.780 57.482 26.870  1.00 79.73  ? 1   DG  C N9    1 
ATOM   1667 C  C8    . DG  C 2 1   ? -33.638 56.293 26.191  1.00 74.56  ? 1   DG  C C8    1 
ATOM   1668 N  N7    . DG  C 2 1   ? -33.596 55.252 26.968  1.00 71.97  ? 1   DG  C N7    1 
ATOM   1669 C  C5    . DG  C 2 1   ? -33.714 55.775 28.250  1.00 68.76  ? 1   DG  C C5    1 
ATOM   1670 C  C6    . DG  C 2 1   ? -33.728 55.117 29.505  1.00 61.06  ? 1   DG  C C6    1 
ATOM   1671 O  O6    . DG  C 2 1   ? -33.640 53.904 29.732  1.00 56.12  ? 1   DG  C O6    1 
ATOM   1672 N  N1    . DG  C 2 1   ? -33.860 56.019 30.560  1.00 61.36  ? 1   DG  C N1    1 
ATOM   1673 C  C2    . DG  C 2 1   ? -33.965 57.383 30.418  1.00 66.84  ? 1   DG  C C2    1 
ATOM   1674 N  N2    . DG  C 2 1   ? -34.086 58.094 31.549  1.00 73.50  ? 1   DG  C N2    1 
ATOM   1675 N  N3    . DG  C 2 1   ? -33.958 58.009 29.249  1.00 68.90  ? 1   DG  C N3    1 
ATOM   1676 C  C4    . DG  C 2 1   ? -33.826 57.146 28.211  1.00 71.91  ? 1   DG  C C4    1 
ATOM   1677 P  P     . DA  C 2 2   ? -31.881 62.032 24.744  1.00 97.68  ? 2   DA  C P     1 
ATOM   1678 O  OP1   . DA  C 2 2   ? -31.947 63.453 24.348  1.00 97.17  ? 2   DA  C OP1   1 
ATOM   1679 O  "O5'" . DA  C 2 2   ? -31.599 61.983 26.310  1.00 95.46  ? 2   DA  C "O5'" 1 
ATOM   1680 C  "C5'" . DA  C 2 2   ? -32.346 62.811 27.176  1.00 90.48  ? 2   DA  C "C5'" 1 
ATOM   1681 C  "C4'" . DA  C 2 2   ? -31.895 62.623 28.608  1.00 85.98  ? 2   DA  C "C4'" 1 
ATOM   1682 O  "O4'" . DA  C 2 2   ? -32.036 61.225 28.973  1.00 81.09  ? 2   DA  C "O4'" 1 
ATOM   1683 C  "C3'" . DA  C 2 2   ? -30.443 63.011 28.901  1.00 85.26  ? 2   DA  C "C3'" 1 
ATOM   1684 O  "O3'" . DA  C 2 2   ? -30.392 63.776 30.107  1.00 82.90  ? 2   DA  C "O3'" 1 
ATOM   1685 C  "C2'" . DA  C 2 2   ? -29.726 61.663 29.038  1.00 85.06  ? 2   DA  C "C2'" 1 
ATOM   1686 C  "C1'" . DA  C 2 2   ? -30.840 60.755 29.553  1.00 79.98  ? 2   DA  C "C1'" 1 
ATOM   1687 N  N9    . DA  C 2 2   ? -30.682 59.345 29.187  1.00 68.59  ? 2   DA  C N9    1 
ATOM   1688 C  C8    . DA  C 2 2   ? -30.549 58.830 27.925  1.00 65.46  ? 2   DA  C C8    1 
ATOM   1689 N  N7    . DA  C 2 2   ? -30.430 57.522 27.894  1.00 63.55  ? 2   DA  C N7    1 
ATOM   1690 C  C5    . DA  C 2 2   ? -30.486 57.150 29.232  1.00 57.08  ? 2   DA  C C5    1 
ATOM   1691 C  C6    . DA  C 2 2   ? -30.404 55.892 29.879  1.00 52.07  ? 2   DA  C C6    1 
ATOM   1692 N  N6    . DA  C 2 2   ? -30.262 54.730 29.223  1.00 39.31  ? 2   DA  C N6    1 
ATOM   1693 N  N1    . DA  C 2 2   ? -30.478 55.879 31.227  1.00 43.22  ? 2   DA  C N1    1 
ATOM   1694 C  C2    . DA  C 2 2   ? -30.631 57.038 31.880  1.00 47.94  ? 2   DA  C C2    1 
ATOM   1695 N  N3    . DA  C 2 2   ? -30.719 58.274 31.386  1.00 57.53  ? 2   DA  C N3    1 
ATOM   1696 C  C4    . DA  C 2 2   ? -30.639 58.261 30.043  1.00 60.84  ? 2   DA  C C4    1 
ATOM   1697 P  P     . DG  C 2 3   ? -29.003 64.381 30.638  1.00 96.63  ? 3   DG  C P     1 
ATOM   1698 O  OP1   . DG  C 2 3   ? -29.326 65.587 31.431  1.00 95.56  ? 3   DG  C OP1   1 
ATOM   1699 O  OP2   . DG  C 2 3   ? -28.057 64.455 29.508  1.00 98.42  ? 3   DG  C OP2   1 
ATOM   1700 O  "O5'" . DG  C 2 3   ? -28.451 63.275 31.640  1.00 84.98  ? 3   DG  C "O5'" 1 
ATOM   1701 C  "C5'" . DG  C 2 3   ? -29.180 62.966 32.805  1.00 81.14  ? 3   DG  C "C5'" 1 
ATOM   1702 C  "C4'" . DG  C 2 3   ? -28.433 61.960 33.662  1.00 81.99  ? 3   DG  C "C4'" 1 
ATOM   1703 O  "O4'" . DG  C 2 3   ? -28.510 60.655 33.052  1.00 82.07  ? 3   DG  C "O4'" 1 
ATOM   1704 C  "C3'" . DG  C 2 3   ? -26.948 62.262 33.893  1.00 79.61  ? 3   DG  C "C3'" 1 
ATOM   1705 O  "O3'" . DG  C 2 3   ? -26.689 62.281 35.308  1.00 76.34  ? 3   DG  C "O3'" 1 
ATOM   1706 C  "C2'" . DG  C 2 3   ? -26.206 61.127 33.161  1.00 74.50  ? 3   DG  C "C2'" 1 
ATOM   1707 C  "C1'" . DG  C 2 3   ? -27.255 60.021 33.088  1.00 76.35  ? 3   DG  C "C1'" 1 
ATOM   1708 N  N9    . DG  C 2 3   ? -27.167 59.202 31.889  1.00 67.20  ? 3   DG  C N9    1 
ATOM   1709 C  C8    . DG  C 2 3   ? -27.157 59.645 30.589  1.00 66.29  ? 3   DG  C C8    1 
ATOM   1710 N  N7    . DG  C 2 3   ? -27.112 58.683 29.711  1.00 59.19  ? 3   DG  C N7    1 
ATOM   1711 C  C5    . DG  C 2 3   ? -27.106 57.528 30.475  1.00 55.22  ? 3   DG  C C5    1 
ATOM   1712 C  C6    . DG  C 2 3   ? -27.053 56.180 30.071  1.00 64.44  ? 3   DG  C C6    1 
ATOM   1713 O  O6    . DG  C 2 3   ? -27.005 55.732 28.920  1.00 66.63  ? 3   DG  C O6    1 
ATOM   1714 N  N1    . DG  C 2 3   ? -27.061 55.306 31.169  1.00 66.59  ? 3   DG  C N1    1 
ATOM   1715 C  C2    . DG  C 2 3   ? -27.107 55.700 32.491  1.00 58.80  ? 3   DG  C C2    1 
ATOM   1716 N  N2    . DG  C 2 3   ? -27.102 54.712 33.407  1.00 52.46  ? 3   DG  C N2    1 
ATOM   1717 N  N3    . DG  C 2 3   ? -27.157 56.977 32.885  1.00 50.44  ? 3   DG  C N3    1 
ATOM   1718 C  C4    . DG  C 2 3   ? -27.154 57.829 31.824  1.00 57.19  ? 3   DG  C C4    1 
ATOM   1719 P  P     . DT  C 2 4   ? -25.196 62.343 35.894  1.00 81.49  ? 4   DT  C P     1 
ATOM   1720 O  OP1   . DT  C 2 4   ? -25.309 63.032 37.201  1.00 80.04  ? 4   DT  C OP1   1 
ATOM   1721 O  OP2   . DT  C 2 4   ? -24.277 62.850 34.847  1.00 85.84  ? 4   DT  C OP2   1 
ATOM   1722 O  "O5'" . DT  C 2 4   ? -24.864 60.824 36.207  1.00 66.37  ? 4   DT  C "O5'" 1 
ATOM   1723 C  "C5'" . DT  C 2 4   ? -25.757 60.093 37.012  1.00 54.28  ? 4   DT  C "C5'" 1 
ATOM   1724 C  "C4'" . DT  C 2 4   ? -25.239 58.707 37.268  1.00 46.97  ? 4   DT  C "C4'" 1 
ATOM   1725 O  "O4'" . DT  C 2 4   ? -25.313 57.907 36.070  1.00 49.03  ? 4   DT  C "O4'" 1 
ATOM   1726 C  "C3'" . DT  C 2 4   ? -23.804 58.619 37.751  1.00 55.80  ? 4   DT  C "C3'" 1 
ATOM   1727 O  "O3'" . DT  C 2 4   ? -23.782 57.705 38.825  1.00 57.04  ? 4   DT  C "O3'" 1 
ATOM   1728 C  "C2'" . DT  C 2 4   ? -23.050 58.086 36.525  1.00 57.34  ? 4   DT  C "C2'" 1 
ATOM   1729 C  "C1'" . DT  C 2 4   ? -24.116 57.197 35.913  1.00 55.27  ? 4   DT  C "C1'" 1 
ATOM   1730 N  N1    . DT  C 2 4   ? -23.944 56.900 34.465  1.00 56.72  ? 4   DT  C N1    1 
ATOM   1731 C  C2    . DT  C 2 4   ? -23.923 55.593 34.053  1.00 56.57  ? 4   DT  C C2    1 
ATOM   1732 O  O2    . DT  C 2 4   ? -24.006 54.651 34.820  1.00 60.50  ? 4   DT  C O2    1 
ATOM   1733 N  N3    . DT  C 2 4   ? -23.797 55.420 32.704  1.00 50.40  ? 4   DT  C N3    1 
ATOM   1734 C  C4    . DT  C 2 4   ? -23.702 56.402 31.747  1.00 52.68  ? 4   DT  C C4    1 
ATOM   1735 O  O4    . DT  C 2 4   ? -23.589 56.144 30.563  1.00 58.88  ? 4   DT  C O4    1 
ATOM   1736 C  C5    . DT  C 2 4   ? -23.740 57.754 32.239  1.00 57.96  ? 4   DT  C C5    1 
ATOM   1737 C  C7    . DT  C 2 4   ? -23.635 58.906 31.284  1.00 52.39  ? 4   DT  C C7    1 
ATOM   1738 C  C6    . DT  C 2 4   ? -23.869 57.936 33.561  1.00 61.41  ? 4   DT  C C6    1 
ATOM   1739 P  P     . DT  C 2 5   ? -22.412 57.286 39.522  1.00 65.33  ? 5   DT  C P     1 
ATOM   1740 O  OP1   . DT  C 2 5   ? -22.766 56.939 40.918  1.00 70.27  ? 5   DT  C OP1   1 
ATOM   1741 O  OP2   . DT  C 2 5   ? -21.385 58.312 39.200  1.00 60.66  ? 5   DT  C OP2   1 
ATOM   1742 O  "O5'" . DT  C 2 5   ? -22.058 55.914 38.808  1.00 55.01  ? 5   DT  C "O5'" 1 
ATOM   1743 C  "C5'" . DT  C 2 5   ? -22.895 54.811 38.991  1.00 47.11  ? 5   DT  C "C5'" 1 
ATOM   1744 C  "C4'" . DT  C 2 5   ? -22.283 53.584 38.356  1.00 49.81  ? 5   DT  C "C4'" 1 
ATOM   1745 O  "O4'" . DT  C 2 5   ? -22.180 53.757 36.921  1.00 52.11  ? 5   DT  C "O4'" 1 
ATOM   1746 C  "C3'" . DT  C 2 5   ? -20.889 53.244 38.852  1.00 54.20  ? 5   DT  C "C3'" 1 
ATOM   1747 O  "O3'" . DT  C 2 5   ? -20.908 51.896 39.294  1.00 34.84  ? 5   DT  C "O3'" 1 
ATOM   1748 C  "C2'" . DT  C 2 5   ? -19.965 53.474 37.615  1.00 40.18  ? 5   DT  C "C2'" 1 
ATOM   1749 C  "C1'" . DT  C 2 5   ? -20.935 53.284 36.454  1.00 48.62  ? 5   DT  C "C1'" 1 
ATOM   1750 N  N1    . DT  C 2 5   ? -20.654 54.067 35.215  1.00 47.45  ? 5   DT  C N1    1 
ATOM   1751 C  C2    . DT  C 2 5   ? -20.637 53.416 34.000  1.00 49.52  ? 5   DT  C C2    1 
ATOM   1752 O  O2    . DT  C 2 5   ? -20.754 52.206 33.885  1.00 53.80  ? 5   DT  C O2    1 
ATOM   1753 N  N3    . DT  C 2 5   ? -20.471 54.232 32.917  1.00 41.27  ? 5   DT  C N3    1 
ATOM   1754 C  C4    . DT  C 2 5   ? -20.323 55.606 32.924  1.00 51.01  ? 5   DT  C C4    1 
ATOM   1755 O  O4    . DT  C 2 5   ? -20.164 56.256 31.895  1.00 55.77  ? 5   DT  C O4    1 
ATOM   1756 C  C5    . DT  C 2 5   ? -20.377 56.224 34.220  1.00 48.06  ? 5   DT  C C5    1 
ATOM   1757 C  C7    . DT  C 2 5   ? -20.237 57.704 34.347  1.00 41.62  ? 5   DT  C C7    1 
ATOM   1758 C  C6    . DT  C 2 5   ? -20.555 55.434 35.292  1.00 47.81  ? 5   DT  C C6    1 
ATOM   1759 P  P     . DT  C 2 6   ? -19.601 51.251 39.927  1.00 44.84  ? 6   DT  C P     1 
ATOM   1760 O  OP1   . DT  C 2 6   ? -20.012 50.051 40.684  1.00 53.64  ? 6   DT  C OP1   1 
ATOM   1761 O  OP2   . DT  C 2 6   ? -18.824 52.369 40.494  1.00 43.82  ? 6   DT  C OP2   1 
ATOM   1762 O  "O5'" . DT  C 2 6   ? -18.810 50.700 38.683  1.00 44.83  ? 6   DT  C "O5'" 1 
ATOM   1763 C  "C5'" . DT  C 2 6   ? -19.406 49.735 37.889  1.00 47.93  ? 6   DT  C "C5'" 1 
ATOM   1764 C  "C4'" . DT  C 2 6   ? -18.540 49.455 36.694  1.00 48.60  ? 6   DT  C "C4'" 1 
ATOM   1765 O  "O4'" . DT  C 2 6   ? -18.589 50.554 35.784  1.00 43.97  ? 6   DT  C "O4'" 1 
ATOM   1766 C  "C3'" . DT  C 2 6   ? -17.072 49.263 37.031  1.00 43.80  ? 6   DT  C "C3'" 1 
ATOM   1767 O  "O3'" . DT  C 2 6   ? -16.793 47.886 36.950  1.00 43.46  ? 6   DT  C "O3'" 1 
ATOM   1768 C  "C2'" . DT  C 2 6   ? -16.316 50.095 35.953  1.00 36.76  ? 6   DT  C "C2'" 1 
ATOM   1769 C  "C1'" . DT  C 2 6   ? -17.425 50.514 35.006  1.00 40.54  ? 6   DT  C "C1'" 1 
ATOM   1770 N  N1    . DT  C 2 6   ? -17.265 51.873 34.389  1.00 44.12  ? 6   DT  C N1    1 
ATOM   1771 C  C2    . DT  C 2 6   ? -17.283 51.988 33.017  1.00 36.09  ? 6   DT  C C2    1 
ATOM   1772 O  O2    . DT  C 2 6   ? -17.360 51.030 32.275  1.00 35.93  ? 6   DT  C O2    1 
ATOM   1773 N  N3    . DT  C 2 6   ? -17.177 53.265 32.544  1.00 37.02  ? 6   DT  C N3    1 
ATOM   1774 C  C4    . DT  C 2 6   ? -17.060 54.418 33.287  1.00 48.32  ? 6   DT  C C4    1 
ATOM   1775 O  O4    . DT  C 2 6   ? -16.965 55.528 32.768  1.00 45.52  ? 6   DT  C O4    1 
ATOM   1776 C  C5    . DT  C 2 6   ? -17.050 54.226 34.727  1.00 54.55  ? 6   DT  C C5    1 
ATOM   1777 C  C7    . DT  C 2 6   ? -16.929 55.406 35.646  1.00 63.73  ? 6   DT  C C7    1 
ATOM   1778 C  C6    . DT  C 2 6   ? -17.167 52.978 35.200  1.00 40.61  ? 6   DT  C C6    1 
ATOM   1779 P  P     . DG  C 2 7   ? -15.464 47.267 37.594  1.00 45.06  ? 7   DG  C P     1 
ATOM   1780 O  OP1   . DG  C 2 7   ? -15.793 45.871 37.952  1.00 44.96  ? 7   DG  C OP1   1 
ATOM   1781 O  OP2   . DG  C 2 7   ? -14.902 48.220 38.572  1.00 41.53  ? 7   DG  C OP2   1 
ATOM   1782 O  "O5'" . DG  C 2 7   ? -14.461 47.191 36.356  1.00 43.46  ? 7   DG  C "O5'" 1 
ATOM   1783 C  "C5'" . DG  C 2 7   ? -14.745 46.304 35.294  1.00 45.43  ? 7   DG  C "C5'" 1 
ATOM   1784 C  "C4'" . DG  C 2 7   ? -13.881 46.595 34.076  1.00 48.12  ? 7   DG  C "C4'" 1 
ATOM   1785 O  "O4'" . DG  C 2 7   ? -14.180 47.924 33.564  1.00 53.98  ? 7   DG  C "O4'" 1 
ATOM   1786 C  "C3'" . DG  C 2 7   ? -12.358 46.585 34.310  1.00 35.90  ? 7   DG  C "C3'" 1 
ATOM   1787 O  "O3'" . DG  C 2 7   ? -11.757 46.238 33.115  1.00 44.26  ? 7   DG  C "O3'" 1 
ATOM   1788 C  "C2'" . DG  C 2 7   ? -12.098 48.050 34.587  1.00 39.97  ? 7   DG  C "C2'" 1 
ATOM   1789 C  "C1'" . DG  C 2 7   ? -12.978 48.633 33.486  1.00 43.29  ? 7   DG  C "C1'" 1 
ATOM   1790 N  N9    . DG  C 2 7   ? -13.229 50.052 33.586  1.00 37.66  ? 7   DG  C N9    1 
ATOM   1791 C  C8    . DG  C 2 7   ? -13.143 50.831 34.703  1.00 35.43  ? 7   DG  C C8    1 
ATOM   1792 N  N7    . DG  C 2 7   ? -13.396 52.093 34.478  1.00 36.22  ? 7   DG  C N7    1 
ATOM   1793 C  C5    . DG  C 2 7   ? -13.653 52.149 33.115  1.00 36.50  ? 7   DG  C C5    1 
ATOM   1794 C  C6    . DG  C 2 7   ? -13.969 53.256 32.293  1.00 37.44  ? 7   DG  C C6    1 
ATOM   1795 O  O6    . DG  C 2 7   ? -14.120 54.445 32.623  1.00 38.02  ? 7   DG  C O6    1 
ATOM   1796 N  N1    . DG  C 2 7   ? -14.145 52.874 30.977  1.00 37.39  ? 7   DG  C N1    1 
ATOM   1797 C  C2    . DG  C 2 7   ? -14.008 51.592 30.504  1.00 48.42  ? 7   DG  C C2    1 
ATOM   1798 N  N2    . DG  C 2 7   ? -14.207 51.419 29.188  1.00 54.30  ? 7   DG  C N2    1 
ATOM   1799 N  N3    . DG  C 2 7   ? -13.700 50.548 31.266  1.00 35.93  ? 7   DG  C N3    1 
ATOM   1800 C  C4    . DG  C 2 7   ? -13.542 50.902 32.551  1.00 35.87  ? 7   DG  C C4    1 
ATOM   1801 P  P     . DA  C 2 8   ? -10.500 45.261 33.036  1.00 59.41  ? 8   DA  C P     1 
ATOM   1802 O  OP1   . DA  C 2 8   ? -10.899 43.951 33.597  1.00 54.94  ? 8   DA  C OP1   1 
ATOM   1803 O  OP2   . DA  C 2 8   ? -9.304  45.981 33.545  1.00 64.61  ? 8   DA  C OP2   1 
ATOM   1804 O  "O5'" . DA  C 2 8   ? -10.312 45.098 31.458  1.00 49.80  ? 8   DA  C "O5'" 1 
ATOM   1805 C  "C5'" . DA  C 2 8   ? -11.435 44.845 30.616  1.00 43.75  ? 8   DA  C "C5'" 1 
ATOM   1806 C  "C4'" . DA  C 2 8   ? -11.297 45.572 29.257  1.00 54.65  ? 8   DA  C "C4'" 1 
ATOM   1807 O  "O4'" . DA  C 2 8   ? -11.548 46.989 29.406  1.00 41.39  ? 8   DA  C "O4'" 1 
ATOM   1808 C  "C3'" . DA  C 2 8   ? -9.934  45.472 28.570  1.00 58.90  ? 8   DA  C "C3'" 1 
ATOM   1809 O  "O3'" . DA  C 2 8   ? -10.116 45.433 27.163  1.00 65.98  ? 8   DA  C "O3'" 1 
ATOM   1810 C  "C2'" . DA  C 2 8   ? -9.227  46.746 29.022  1.00 44.42  ? 8   DA  C "C2'" 1 
ATOM   1811 C  "C1'" . DA  C 2 8   ? -10.383 47.730 29.081  1.00 42.01  ? 8   DA  C "C1'" 1 
ATOM   1812 N  N9    . DA  C 2 8   ? -10.237 48.785 30.075  1.00 52.37  ? 8   DA  C N9    1 
ATOM   1813 C  C8    . DA  C 2 8   ? -9.889  48.642 31.386  1.00 45.92  ? 8   DA  C C8    1 
ATOM   1814 N  N7    . DA  C 2 8   ? -9.874  49.775 32.054  1.00 43.72  ? 8   DA  C N7    1 
ATOM   1815 C  C5    . DA  C 2 8   ? -10.238 50.717 31.112  1.00 39.21  ? 8   DA  C C5    1 
ATOM   1816 C  C6    . DA  C 2 8   ? -10.410 52.103 31.189  1.00 49.73  ? 8   DA  C C6    1 
ATOM   1817 N  N6    . DA  C 2 8   ? -10.211 52.795 32.313  1.00 50.85  ? 8   DA  C N6    1 
ATOM   1818 N  N1    . DA  C 2 8   ? -10.810 52.758 30.066  1.00 45.38  ? 8   DA  C N1    1 
ATOM   1819 C  C2    . DA  C 2 8   ? -11.009 52.054 28.948  1.00 43.19  ? 8   DA  C C2    1 
ATOM   1820 N  N3    . DA  C 2 8   ? -10.873 50.742 28.755  1.00 50.81  ? 8   DA  C N3    1 
ATOM   1821 C  C4    . DA  C 2 8   ? -10.472 50.127 29.891  1.00 39.49  ? 8   DA  C C4    1 
ATOM   1822 P  P     . DA  C 2 9   ? -8.849  45.378 26.173  1.00 53.98  ? 9   DA  C P     1 
ATOM   1823 O  OP1   . DA  C 2 9   ? -9.322  44.663 24.973  1.00 62.89  ? 9   DA  C OP1   1 
ATOM   1824 O  OP2   . DA  C 2 9   ? -7.608  45.004 26.885  1.00 48.99  ? 9   DA  C OP2   1 
ATOM   1825 O  "O5'" . DA  C 2 9   ? -8.617  46.892 25.785  1.00 45.07  ? 9   DA  C "O5'" 1 
ATOM   1826 C  "C5'" . DA  C 2 9   ? -9.613  47.605 25.114  1.00 43.15  ? 9   DA  C "C5'" 1 
ATOM   1827 C  "C4'" . DA  C 2 9   ? -9.093  48.951 24.750  1.00 51.68  ? 9   DA  C "C4'" 1 
ATOM   1828 O  "O4'" . DA  C 2 9   ? -9.016  49.766 25.935  1.00 50.37  ? 9   DA  C "O4'" 1 
ATOM   1829 C  "C3'" . DA  C 2 9   ? -7.688  48.946 24.127  1.00 55.81  ? 9   DA  C "C3'" 1 
ATOM   1830 O  "O3'" . DA  C 2 9   ? -7.698  49.811 23.007  1.00 61.19  ? 9   DA  C "O3'" 1 
ATOM   1831 C  "C2'" . DA  C 2 9   ? -6.809  49.487 25.253  1.00 56.14  ? 9   DA  C "C2'" 1 
ATOM   1832 C  "C1'" . DA  C 2 9   ? -7.775  50.428 25.959  1.00 57.76  ? 9   DA  C "C1'" 1 
ATOM   1833 N  N9    . DA  C 2 9   ? -7.472  50.664 27.366  1.00 53.97  ? 9   DA  C N9    1 
ATOM   1834 C  C8    . DA  C 2 9   ? -7.020  49.745 28.277  1.00 44.04  ? 9   DA  C C8    1 
ATOM   1835 N  N7    . DA  C 2 9   ? -6.871  50.233 29.487  1.00 48.16  ? 9   DA  C N7    1 
ATOM   1836 C  C5    . DA  C 2 9   ? -7.264  51.557 29.369  1.00 50.41  ? 9   DA  C C5    1 
ATOM   1837 C  C6    . DA  C 2 9   ? -7.338  52.616 30.303  1.00 52.85  ? 9   DA  C C6    1 
ATOM   1838 N  N6    . DA  C 2 9   ? -7.010  52.483 31.604  1.00 41.45  ? 9   DA  C N6    1 
ATOM   1839 N  N1    . DA  C 2 9   ? -7.777  53.821 29.847  1.00 46.58  ? 9   DA  C N1    1 
ATOM   1840 C  C2    . DA  C 2 9   ? -8.104  53.948 28.545  1.00 43.43  ? 9   DA  C C2    1 
ATOM   1841 N  N3    . DA  C 2 9   ? -8.074  53.027 27.579  1.00 39.52  ? 9   DA  C N3    1 
ATOM   1842 C  C4    . DA  C 2 9   ? -7.640  51.843 28.063  1.00 49.05  ? 9   DA  C C4    1 
ATOM   1843 P  P     . DA  C 2 10  ? -6.427  49.980 22.048  1.00 44.66  ? 10  DA  C P     1 
ATOM   1844 O  OP1   . DA  C 2 10  ? -7.062  49.994 20.722  1.00 51.80  ? 10  DA  C OP1   1 
ATOM   1845 O  OP2   . DA  C 2 10  ? -5.398  48.945 22.304  1.00 46.99  ? 10  DA  C OP2   1 
ATOM   1846 O  "O5'" . DA  C 2 10  ? -5.843  51.404 22.462  1.00 43.90  ? 10  DA  C "O5'" 1 
ATOM   1847 C  "C5'" . DA  C 2 10  ? -6.704  52.481 22.506  1.00 41.76  ? 10  DA  C "C5'" 1 
ATOM   1848 C  "C4'" . DA  C 2 10  ? -6.134  53.661 23.287  1.00 41.28  ? 10  DA  C "C4'" 1 
ATOM   1849 O  "O4'" . DA  C 2 10  ? -6.051  53.340 24.679  1.00 43.53  ? 10  DA  C "O4'" 1 
ATOM   1850 C  "C3'" . DA  C 2 10  ? -4.746  54.157 22.886  1.00 43.51  ? 10  DA  C "C3'" 1 
ATOM   1851 O  "O3'" . DA  C 2 10  ? -4.886  55.450 22.367  1.00 53.01  ? 10  DA  C "O3'" 1 
ATOM   1852 C  "C2'" . DA  C 2 10  ? -3.952  54.174 24.209  1.00 49.85  ? 10  DA  C "C2'" 1 
ATOM   1853 C  "C1'" . DA  C 2 10  ? -5.073  54.156 25.245  1.00 48.49  ? 10  DA  C "C1'" 1 
ATOM   1854 N  N9    . DA  C 2 10  ? -4.713  53.584 26.546  1.00 44.53  ? 10  DA  C N9    1 
ATOM   1855 C  C8    . DA  C 2 10  ? -4.335  52.299 26.804  1.00 52.67  ? 10  DA  C C8    1 
ATOM   1856 N  N7    . DA  C 2 10  ? -4.102  52.056 28.072  1.00 63.11  ? 10  DA  C N7    1 
ATOM   1857 C  C5    . DA  C 2 10  ? -4.370  53.259 28.699  1.00 59.45  ? 10  DA  C C5    1 
ATOM   1858 C  C6    . DA  C 2 10  ? -4.314  53.656 30.055  1.00 65.14  ? 10  DA  C C6    1 
ATOM   1859 N  N6    . DA  C 2 10  ? -3.946  52.825 31.070  1.00 44.93  ? 10  DA  C N6    1 
ATOM   1860 N  N1    . DA  C 2 10  ? -4.642  54.942 30.334  1.00 54.08  ? 10  DA  C N1    1 
ATOM   1861 C  C2    . DA  C 2 10  ? -4.977  55.759 29.322  1.00 57.17  ? 10  DA  C C2    1 
ATOM   1862 N  N3    . DA  C 2 10  ? -5.074  55.494 28.014  1.00 46.99  ? 10  DA  C N3    1 
ATOM   1863 C  C4    . DA  C 2 10  ? -4.753  54.216 27.770  1.00 50.06  ? 10  DA  C C4    1 
ATOM   1864 P  P     . DC  C 2 11  ? -3.640  56.191 21.690  1.00 64.73  ? 11  DC  C P     1 
ATOM   1865 O  OP1   . DC  C 2 11  ? -4.159  57.041 20.604  1.00 68.37  ? 11  DC  C OP1   1 
ATOM   1866 O  OP2   . DC  C 2 11  ? -2.603  55.164 21.445  1.00 68.35  ? 11  DC  C OP2   1 
ATOM   1867 O  "O5'" . DC  C 2 11  ? -3.068  57.100 22.857  1.00 63.99  ? 11  DC  C "O5'" 1 
ATOM   1868 C  "C5'" . DC  C 2 11  ? -3.922  57.926 23.588  1.00 58.46  ? 11  DC  C "C5'" 1 
ATOM   1869 C  "C4'" . DC  C 2 11  ? -3.208  58.382 24.826  1.00 60.13  ? 11  DC  C "C4'" 1 
ATOM   1870 O  "O4'" . DC  C 2 11  ? -3.096  57.274 25.742  1.00 61.49  ? 11  DC  C "O4'" 1 
ATOM   1871 C  "C3'" . DC  C 2 11  ? -1.773  58.845 24.579  1.00 62.68  ? 11  DC  C "C3'" 1 
ATOM   1872 O  "O3'" . DC  C 2 11  ? -1.651  60.225 24.879  1.00 69.19  ? 11  DC  C "O3'" 1 
ATOM   1873 C  "C2'" . DC  C 2 11  ? -0.909  57.966 25.512  1.00 56.48  ? 11  DC  C "C2'" 1 
ATOM   1874 C  "C1'" . DC  C 2 11  ? -1.940  57.466 26.502  1.00 55.85  ? 11  DC  C "C1'" 1 
ATOM   1875 N  N1    . DC  C 2 11  ? -1.587  56.190 27.200  1.00 55.92  ? 11  DC  C N1    1 
ATOM   1876 C  C2    . DC  C 2 11  ? -1.529  56.187 28.589  1.00 57.01  ? 11  DC  C C2    1 
ATOM   1877 O  O2    . DC  C 2 11  ? -1.777  57.231 29.196  1.00 57.05  ? 11  DC  C O2    1 
ATOM   1878 N  N3    . DC  C 2 11  ? -1.226  55.037 29.234  1.00 52.98  ? 11  DC  C N3    1 
ATOM   1879 C  C4    . DC  C 2 11  ? -0.965  53.924 28.541  1.00 54.68  ? 11  DC  C C4    1 
ATOM   1880 N  N4    . DC  C 2 11  ? -0.658  52.808 29.237  1.00 54.36  ? 11  DC  C N4    1 
ATOM   1881 C  C5    . DC  C 2 11  ? -0.992  53.907 27.112  1.00 47.54  ? 11  DC  C C5    1 
ATOM   1882 C  C6    . DC  C 2 11  ? -1.323  55.051 26.488  1.00 54.03  ? 11  DC  C C6    1 
ATOM   1883 P  P     . DT  C 2 12  ? -0.331  61.020 24.425  1.00 83.03  ? 12  DT  C P     1 
ATOM   1884 O  OP1   . DT  C 2 12  ? -0.735  62.376 23.977  1.00 80.25  ? 12  DT  C OP1   1 
ATOM   1885 O  OP2   . DT  C 2 12  ? 0.378   60.139 23.467  1.00 76.44  ? 12  DT  C OP2   1 
ATOM   1886 O  "O5'" . DT  C 2 12  ? 0.531   61.101 25.780  1.00 68.73  ? 12  DT  C "O5'" 1 
ATOM   1887 C  "C5'" . DT  C 2 12  ? -0.000  61.812 26.905  1.00 73.96  ? 12  DT  C "C5'" 1 
ATOM   1888 C  "C4'" . DT  C 2 12  ? 0.751   61.487 28.195  1.00 79.16  ? 12  DT  C "C4'" 1 
ATOM   1889 O  "O4'" . DT  C 2 12  ? 0.605   60.078 28.508  1.00 73.72  ? 12  DT  C "O4'" 1 
ATOM   1890 C  "C3'" . DT  C 2 12  ? 2.263   61.764 28.170  1.00 79.34  ? 12  DT  C "C3'" 1 
ATOM   1891 O  "O3'" . DT  C 2 12  ? 2.584   62.874 29.019  1.00 73.65  ? 12  DT  C "O3'" 1 
ATOM   1892 C  "C2'" . DT  C 2 12  ? 2.904   60.462 28.680  1.00 83.80  ? 12  DT  C "C2'" 1 
ATOM   1893 C  "C1'" . DT  C 2 12  ? 1.720   59.677 29.254  1.00 78.49  ? 12  DT  C "C1'" 1 
ATOM   1894 N  N1    . DT  C 2 12  ? 1.887   58.196 29.108  1.00 73.95  ? 12  DT  C N1    1 
ATOM   1895 C  C2    . DT  C 2 12  ? 1.993   57.395 30.238  1.00 72.53  ? 12  DT  C C2    1 
ATOM   1896 O  O2    . DT  C 2 12  ? 1.944   57.826 31.377  1.00 71.48  ? 12  DT  C O2    1 
ATOM   1897 N  N3    . DT  C 2 12  ? 2.156   56.056 29.976  1.00 69.49  ? 12  DT  C N3    1 
ATOM   1898 C  C4    . DT  C 2 12  ? 2.228   55.455 28.722  1.00 70.08  ? 12  DT  C C4    1 
ATOM   1899 O  O4    . DT  C 2 12  ? 2.385   54.245 28.576  1.00 68.19  ? 12  DT  C O4    1 
ATOM   1900 C  C5    . DT  C 2 12  ? 2.108   56.352 27.593  1.00 63.95  ? 12  DT  C C5    1 
ATOM   1901 C  C7    . DT  C 2 12  ? 2.167   55.814 26.199  1.00 69.24  ? 12  DT  C C7    1 
ATOM   1902 C  C6    . DT  C 2 12  ? 1.949   57.658 27.837  1.00 60.75  ? 12  DT  C C6    1 
ATOM   1903 O  "O3'" . DC  D 3 1   ? 3.017   46.877 38.641  1.00 153.38 ? 1   DC  D "O3'" 1 
ATOM   1904 P  P     . DA  D 3 2   ? 3.098   47.833 37.351  1.00 130.16 ? 2   DA  D P     1 
ATOM   1905 O  OP1   . DA  D 3 2   ? 2.003   47.448 36.429  1.00 130.23 ? 2   DA  D OP1   1 
ATOM   1906 O  OP2   . DA  D 3 2   ? 4.499   47.806 36.877  1.00 123.77 ? 2   DA  D OP2   1 
ATOM   1907 O  "O5'" . DA  D 3 2   ? 2.785   49.295 37.933  1.00 99.89  ? 2   DA  D "O5'" 1 
ATOM   1908 C  "C5'" . DA  D 3 2   ? 3.824   50.067 38.538  1.00 94.15  ? 2   DA  D "C5'" 1 
ATOM   1909 C  "C4'" . DA  D 3 2   ? 3.350   51.475 38.884  1.00 87.82  ? 2   DA  D "C4'" 1 
ATOM   1910 O  "O4'" . DA  D 3 2   ? 3.470   52.340 37.731  1.00 85.13  ? 2   DA  D "O4'" 1 
ATOM   1911 C  "C3'" . DA  D 3 2   ? 1.907   51.602 39.332  1.00 89.92  ? 2   DA  D "C3'" 1 
ATOM   1912 O  "O3'" . DA  D 3 2   ? 1.797   52.709 40.209  1.00 91.49  ? 2   DA  D "O3'" 1 
ATOM   1913 C  "C2'" . DA  D 3 2   ? 1.170   51.847 38.014  1.00 87.45  ? 2   DA  D "C2'" 1 
ATOM   1914 C  "C1'" . DA  D 3 2   ? 2.185   52.676 37.236  1.00 80.94  ? 2   DA  D "C1'" 1 
ATOM   1915 N  N9    . DA  D 3 2   ? 2.182   52.405 35.809  1.00 69.93  ? 2   DA  D N9    1 
ATOM   1916 C  C8    . DA  D 3 2   ? 2.082   51.184 35.203  1.00 63.79  ? 2   DA  D C8    1 
ATOM   1917 N  N7    . DA  D 3 2   ? 2.105   51.243 33.891  1.00 58.96  ? 2   DA  D N7    1 
ATOM   1918 C  C5    . DA  D 3 2   ? 2.223   52.596 33.622  1.00 62.25  ? 2   DA  D C5    1 
ATOM   1919 C  C6    . DA  D 3 2   ? 2.311   53.321 32.418  1.00 46.83  ? 2   DA  D C6    1 
ATOM   1920 N  N6    . DA  D 3 2   ? 2.293   52.746 31.207  1.00 45.21  ? 2   DA  D N6    1 
ATOM   1921 N  N1    . DA  D 3 2   ? 2.414   54.666 32.505  1.00 47.23  ? 2   DA  D N1    1 
ATOM   1922 C  C2    . DA  D 3 2   ? 2.447   55.239 33.711  1.00 61.51  ? 2   DA  D C2    1 
ATOM   1923 N  N3    . DA  D 3 2   ? 2.392   54.660 34.914  1.00 68.85  ? 2   DA  D N3    1 
ATOM   1924 C  C4    . DA  D 3 2   ? 2.273   53.326 34.795  1.00 67.62  ? 2   DA  D C4    1 
ATOM   1925 P  P     . DG  D 3 3   ? 0.363   53.206 40.725  1.00 107.45 ? 3   DG  D P     1 
ATOM   1926 O  OP1   . DG  D 3 3   ? 0.589   53.712 42.094  1.00 107.90 ? 3   DG  D OP1   1 
ATOM   1927 O  OP2   . DG  D 3 3   ? -0.654  52.166 40.443  1.00 107.07 ? 3   DG  D OP2   1 
ATOM   1928 O  "O5'" . DG  D 3 3   ? 0.028   54.454 39.795  1.00 77.42  ? 3   DG  D "O5'" 1 
ATOM   1929 C  "C5'" . DG  D 3 3   ? 0.901   55.565 39.789  1.00 81.84  ? 3   DG  D "C5'" 1 
ATOM   1930 C  "C4'" . DG  D 3 3   ? 0.321   56.713 38.980  1.00 81.26  ? 3   DG  D "C4'" 1 
ATOM   1931 O  "O4'" . DG  D 3 3   ? 0.394   56.421 37.563  1.00 75.02  ? 3   DG  D "O4'" 1 
ATOM   1932 C  "C3'" . DG  D 3 3   ? -1.136  57.047 39.275  1.00 79.31  ? 3   DG  D "C3'" 1 
ATOM   1933 O  "O3'" . DG  D 3 3   ? -1.295  58.454 39.250  1.00 76.23  ? 3   DG  D "O3'" 1 
ATOM   1934 C  "C2'" . DG  D 3 3   ? -1.899  56.345 38.145  1.00 72.63  ? 3   DG  D "C2'" 1 
ATOM   1935 C  "C1'" . DG  D 3 3   ? -0.900  56.411 36.996  1.00 71.23  ? 3   DG  D "C1'" 1 
ATOM   1936 N  N9    . DG  D 3 3   ? -0.970  55.281 36.083  1.00 60.29  ? 3   DG  D N9    1 
ATOM   1937 C  C8    . DG  D 3 3   ? -0.982  53.948 36.407  1.00 62.10  ? 3   DG  D C8    1 
ATOM   1938 N  N7    . DG  D 3 3   ? -1.034  53.160 35.367  1.00 57.21  ? 3   DG  D N7    1 
ATOM   1939 C  C5    . DG  D 3 3   ? -1.050  54.032 34.288  1.00 56.46  ? 3   DG  D C5    1 
ATOM   1940 C  C6    . DG  D 3 3   ? -1.109  53.765 32.896  1.00 54.73  ? 3   DG  D C6    1 
ATOM   1941 O  O6    . DG  D 3 3   ? -1.153  52.671 32.324  1.00 55.97  ? 3   DG  D O6    1 
ATOM   1942 N  N1    . DG  D 3 3   ? -1.117  54.934 32.149  1.00 49.31  ? 3   DG  D N1    1 
ATOM   1943 C  C2    . DG  D 3 3   ? -1.075  56.199 32.671  1.00 56.38  ? 3   DG  D C2    1 
ATOM   1944 N  N2    . DG  D 3 3   ? -1.096  57.197 31.785  1.00 65.77  ? 3   DG  D N2    1 
ATOM   1945 N  N3    . DG  D 3 3   ? -1.016  56.470 33.970  1.00 53.75  ? 3   DG  D N3    1 
ATOM   1946 C  C4    . DG  D 3 3   ? -1.012  55.339 34.716  1.00 53.63  ? 3   DG  D C4    1 
ATOM   1947 P  P     . DT  D 3 4   ? -2.712  59.136 39.569  1.00 100.88 ? 4   DT  D P     1 
ATOM   1948 O  OP1   . DT  D 3 4   ? -2.404  60.416 40.245  1.00 102.46 ? 4   DT  D OP1   1 
ATOM   1949 O  OP2   . DT  D 3 4   ? -3.631  58.149 40.188  1.00 95.92  ? 4   DT  D OP2   1 
ATOM   1950 O  "O5'" . DT  D 3 4   ? -3.255  59.488 38.121  1.00 83.80  ? 4   DT  D "O5'" 1 
ATOM   1951 C  "C5'" . DT  D 3 4   ? -2.393  60.138 37.227  1.00 79.56  ? 4   DT  D "C5'" 1 
ATOM   1952 C  "C4'" . DT  D 3 4   ? -3.051  60.305 35.885  1.00 68.23  ? 4   DT  D "C4'" 1 
ATOM   1953 O  "O4'" . DT  D 3 4   ? -2.977  59.075 35.139  1.00 61.06  ? 4   DT  D "O4'" 1 
ATOM   1954 C  "C3'" . DT  D 3 4   ? -4.517  60.693 35.938  1.00 65.43  ? 4   DT  D "C3'" 1 
ATOM   1955 O  "O3'" . DT  D 3 4   ? -4.669  61.854 35.143  1.00 69.36  ? 4   DT  D "O3'" 1 
ATOM   1956 C  "C2'" . DT  D 3 4   ? -5.239  59.458 35.365  1.00 58.78  ? 4   DT  D "C2'" 1 
ATOM   1957 C  "C1'" . DT  D 3 4   ? -4.172  58.893 34.446  1.00 63.18  ? 4   DT  D "C1'" 1 
ATOM   1958 N  N1    . DT  D 3 4   ? -4.288  57.436 34.132  1.00 61.64  ? 4   DT  D N1    1 
ATOM   1959 C  C2    . DT  D 3 4   ? -4.224  57.026 32.811  1.00 60.98  ? 4   DT  D C2    1 
ATOM   1960 O  O2    . DT  D 3 4   ? -4.109  57.787 31.877  1.00 64.57  ? 4   DT  D O2    1 
ATOM   1961 N  N3    . DT  D 3 4   ? -4.306  55.683 32.624  1.00 56.73  ? 4   DT  D N3    1 
ATOM   1962 C  C4    . DT  D 3 4   ? -4.428  54.715 33.594  1.00 52.10  ? 4   DT  D C4    1 
ATOM   1963 O  O4    . DT  D 3 4   ? -4.487  53.530 33.314  1.00 49.44  ? 4   DT  D O4    1 
ATOM   1964 C  C5    . DT  D 3 4   ? -4.488  55.200 34.956  1.00 54.66  ? 4   DT  D C5    1 
ATOM   1965 C  C7    . DT  D 3 4   ? -4.630  54.229 36.095  1.00 60.92  ? 4   DT  D C7    1 
ATOM   1966 C  C6    . DT  D 3 4   ? -4.414  56.527 35.158  1.00 52.18  ? 4   DT  D C6    1 
ATOM   1967 P  P     . DT  D 3 5   ? -6.093  62.557 34.936  1.00 85.30  ? 5   DT  D P     1 
ATOM   1968 O  OP1   . DT  D 3 5   ? -5.881  64.019 34.947  1.00 79.90  ? 5   DT  D OP1   1 
ATOM   1969 O  OP2   . DT  D 3 5   ? -7.071  61.939 35.859  1.00 88.41  ? 5   DT  D OP2   1 
ATOM   1970 O  "O5'" . DT  D 3 5   ? -6.469  62.160 33.444  1.00 65.18  ? 5   DT  D "O5'" 1 
ATOM   1971 C  "C5'" . DT  D 3 5   ? -5.488  62.188 32.443  1.00 44.73  ? 5   DT  D "C5'" 1 
ATOM   1972 C  "C4'" . DT  D 3 5   ? -6.067  61.672 31.150  1.00 50.34  ? 5   DT  D "C4'" 1 
ATOM   1973 O  "O4'" . DT  D 3 5   ? -6.078  60.229 31.145  1.00 47.50  ? 5   DT  D "O4'" 1 
ATOM   1974 C  "C3'" . DT  D 3 5   ? -7.503  62.109 30.861  1.00 61.88  ? 5   DT  D "C3'" 1 
ATOM   1975 O  "O3'" . DT  D 3 5   ? -7.589  62.557 29.500  1.00 64.82  ? 5   DT  D "O3'" 1 
ATOM   1976 C  "C2'" . DT  D 3 5   ? -8.334  60.837 31.117  1.00 57.04  ? 5   DT  D "C2'" 1 
ATOM   1977 C  "C1'" . DT  D 3 5   ? -7.346  59.759 30.724  1.00 55.74  ? 5   DT  D "C1'" 1 
ATOM   1978 N  N1    . DT  D 3 5   ? -7.562  58.454 31.375  1.00 54.05  ? 5   DT  D N1    1 
ATOM   1979 C  C2    . DT  D 3 5   ? -7.586  57.319 30.604  1.00 54.62  ? 5   DT  D C2    1 
ATOM   1980 O  O2    . DT  D 3 5   ? -7.490  57.330 29.396  1.00 55.69  ? 5   DT  D O2    1 
ATOM   1981 N  N3    . DT  D 3 5   ? -7.735  56.158 31.305  1.00 52.30  ? 5   DT  D N3    1 
ATOM   1982 C  C4    . DT  D 3 5   ? -7.854  56.026 32.668  1.00 46.04  ? 5   DT  D C4    1 
ATOM   1983 O  O4    . DT  D 3 5   ? -7.989  54.943 33.200  1.00 48.05  ? 5   DT  D O4    1 
ATOM   1984 C  C5    . DT  D 3 5   ? -7.809  57.254 33.418  1.00 42.86  ? 5   DT  D C5    1 
ATOM   1985 C  C7    . DT  D 3 5   ? -7.940  57.233 34.904  1.00 44.71  ? 5   DT  D C7    1 
ATOM   1986 C  C6    . DT  D 3 5   ? -7.659  58.393 32.746  1.00 42.91  ? 5   DT  D C6    1 
ATOM   1987 P  P     . DT  D 3 6   ? -9.009  62.887 28.838  1.00 62.72  ? 6   DT  D P     1 
ATOM   1988 O  OP1   . DT  D 3 6   ? -8.759  63.930 27.831  1.00 67.93  ? 6   DT  D OP1   1 
ATOM   1989 O  OP2   . DT  D 3 6   ? -10.024 63.085 29.902  1.00 61.45  ? 6   DT  D OP2   1 
ATOM   1990 O  "O5'" . DT  D 3 6   ? -9.354  61.547 28.059  1.00 58.47  ? 6   DT  D "O5'" 1 
ATOM   1991 C  "C5'" . DT  D 3 6   ? -8.430  61.037 27.143  1.00 40.94  ? 6   DT  D "C5'" 1 
ATOM   1992 C  "C4'" . DT  D 3 6   ? -8.964  59.787 26.495  1.00 43.22  ? 6   DT  D "C4'" 1 
ATOM   1993 O  "O4'" . DT  D 3 6   ? -9.111  58.753 27.491  1.00 43.11  ? 6   DT  D "O4'" 1 
ATOM   1994 C  "C3'" . DT  D 3 6   ? -10.335 59.931 25.813  1.00 47.94  ? 6   DT  D "C3'" 1 
ATOM   1995 O  "O3'" . DT  D 3 6   ? -10.230 59.402 24.499  1.00 52.95  ? 6   DT  D "O3'" 1 
ATOM   1996 C  "C2'" . DT  D 3 6   ? -11.276 59.091 26.697  1.00 46.10  ? 6   DT  D "C2'" 1 
ATOM   1997 C  "C1'" . DT  D 3 6   ? -10.301 58.048 27.250  1.00 46.51  ? 6   DT  D "C1'" 1 
ATOM   1998 N  N1    . DT  D 3 6   ? -10.702 57.420 28.539  1.00 37.47  ? 6   DT  D N1    1 
ATOM   1999 C  C2    . DT  D 3 6   ? -10.752 56.054 28.634  1.00 40.18  ? 6   DT  D C2    1 
ATOM   2000 O  O2    . DT  D 3 6   ? -10.541 55.315 27.701  1.00 48.93  ? 6   DT  D O2    1 
ATOM   2001 N  N3    . DT  D 3 6   ? -11.095 55.580 29.867  1.00 40.50  ? 6   DT  D N3    1 
ATOM   2002 C  C4    . DT  D 3 6   ? -11.349 56.321 31.004  1.00 43.97  ? 6   DT  D C4    1 
ATOM   2003 O  O4    . DT  D 3 6   ? -11.651 55.803 32.071  1.00 57.27  ? 6   DT  D O4    1 
ATOM   2004 C  C5    . DT  D 3 6   ? -11.263 57.746 30.839  1.00 37.92  ? 6   DT  D C5    1 
ATOM   2005 C  C7    . DT  D 3 6   ? -11.533 58.655 31.997  1.00 39.32  ? 6   DT  D C7    1 
ATOM   2006 C  C6    . DT  D 3 6   ? -10.943 58.221 29.629  1.00 37.95  ? 6   DT  D C6    1 
ATOM   2007 P  P     . DC  D 3 7   ? -11.341 59.705 23.385  1.00 48.68  ? 7   DC  D P     1 
ATOM   2008 O  OP1   . DC  D 3 7   ? -10.674 59.541 22.083  1.00 50.33  ? 7   DC  D OP1   1 
ATOM   2009 O  OP2   . DC  D 3 7   ? -12.056 60.937 23.747  1.00 46.80  ? 7   DC  D OP2   1 
ATOM   2010 O  "O5'" . DC  D 3 7   ? -12.333 58.482 23.494  1.00 52.49  ? 7   DC  D "O5'" 1 
ATOM   2011 C  "C5'" . DC  D 3 7   ? -11.843 57.203 23.266  1.00 43.80  ? 7   DC  D "C5'" 1 
ATOM   2012 C  "C4'" . DC  D 3 7   ? -12.841 56.182 23.740  1.00 45.83  ? 7   DC  D "C4'" 1 
ATOM   2013 O  "O4'" . DC  D 3 7   ? -12.839 56.093 25.180  1.00 44.14  ? 7   DC  D "O4'" 1 
ATOM   2014 C  "C3'" . DC  D 3 7   ? -14.270 56.479 23.341  1.00 44.65  ? 7   DC  D "C3'" 1 
ATOM   2015 O  "O3'" . DC  D 3 7   ? -14.510 55.765 22.127  1.00 48.13  ? 7   DC  D "O3'" 1 
ATOM   2016 C  "C2'" . DC  D 3 7   ? -15.116 55.954 24.551  1.00 47.29  ? 7   DC  D "C2'" 1 
ATOM   2017 C  "C1'" . DC  D 3 7   ? -14.050 55.507 25.583  1.00 41.88  ? 7   DC  D "C1'" 1 
ATOM   2018 N  N1    . DC  D 3 7   ? -14.270 55.896 27.026  1.00 33.14  ? 7   DC  D N1    1 
ATOM   2019 C  C2    . DC  D 3 7   ? -14.245 54.900 28.012  1.00 38.86  ? 7   DC  D C2    1 
ATOM   2020 O  O2    . DC  D 3 7   ? -14.101 53.721 27.670  1.00 38.64  ? 7   DC  D O2    1 
ATOM   2021 N  N3    . DC  D 3 7   ? -14.382 55.259 29.319  1.00 32.30  ? 7   DC  D N3    1 
ATOM   2022 C  C4    . DC  D 3 7   ? -14.530 56.541 29.641  1.00 44.73  ? 7   DC  D C4    1 
ATOM   2023 N  N4    . DC  D 3 7   ? -14.665 56.839 30.928  1.00 45.63  ? 7   DC  D N4    1 
ATOM   2024 C  C5    . DC  D 3 7   ? -14.557 57.577 28.650  1.00 33.38  ? 7   DC  D C5    1 
ATOM   2025 C  C6    . DC  D 3 7   ? -14.400 57.208 27.373  1.00 35.27  ? 7   DC  D C6    1 
ATOM   2026 P  P     . DA  D 3 8   ? -15.870 55.908 21.296  1.00 48.27  ? 8   DA  D P     1 
ATOM   2027 O  OP1   . DA  D 3 8   ? -15.562 55.434 19.926  1.00 36.42  ? 8   DA  D OP1   1 
ATOM   2028 O  OP2   . DA  D 3 8   ? -16.457 57.233 21.561  1.00 41.25  ? 8   DA  D OP2   1 
ATOM   2029 O  "O5'" . DA  D 3 8   ? -16.801 54.779 21.954  1.00 38.51  ? 8   DA  D "O5'" 1 
ATOM   2030 C  "C5'" . DA  D 3 8   ? -16.374 53.438 21.891  1.00 38.69  ? 8   DA  D "C5'" 1 
ATOM   2031 C  "C4'" . DA  D 3 8   ? -17.273 52.489 22.690  1.00 44.25  ? 8   DA  D "C4'" 1 
ATOM   2032 O  "O4'" . DA  D 3 8   ? -17.152 52.737 24.118  1.00 41.02  ? 8   DA  D "O4'" 1 
ATOM   2033 C  "C3'" . DA  D 3 8   ? -18.764 52.570 22.403  1.00 43.28  ? 8   DA  D "C3'" 1 
ATOM   2034 O  "O3'" . DA  D 3 8   ? -19.286 51.307 22.632  1.00 37.01  ? 8   DA  D "O3'" 1 
ATOM   2035 C  "C2'" . DA  D 3 8   ? -19.226 53.551 23.463  1.00 37.35  ? 8   DA  D "C2'" 1 
ATOM   2036 C  "C1'" . DA  D 3 8   ? -18.417 53.038 24.631  1.00 36.18  ? 8   DA  D "C1'" 1 
ATOM   2037 N  N9    . DA  D 3 8   ? -18.281 53.973 25.717  1.00 36.01  ? 8   DA  D N9    1 
ATOM   2038 C  C8    . DA  D 3 8   ? -18.478 55.323 25.691  1.00 41.16  ? 8   DA  D C8    1 
ATOM   2039 N  N7    . DA  D 3 8   ? -18.291 55.907 26.852  1.00 36.26  ? 8   DA  D N7    1 
ATOM   2040 C  C5    . DA  D 3 8   ? -17.932 54.856 27.689  1.00 50.86  ? 8   DA  D C5    1 
ATOM   2041 C  C6    . DA  D 3 8   ? -17.605 54.799 29.049  1.00 46.41  ? 8   DA  D C6    1 
ATOM   2042 N  N6    . DA  D 3 8   ? -17.570 55.879 29.836  1.00 45.02  ? 8   DA  D N6    1 
ATOM   2043 N  N1    . DA  D 3 8   ? -17.309 53.595 29.572  1.00 40.88  ? 8   DA  D N1    1 
ATOM   2044 C  C2    . DA  D 3 8   ? -17.343 52.522 28.786  1.00 39.10  ? 8   DA  D C2    1 
ATOM   2045 N  N3    . DA  D 3 8   ? -17.636 52.448 27.495  1.00 35.36  ? 8   DA  D N3    1 
ATOM   2046 C  C4    . DA  D 3 8   ? -17.924 53.663 27.004  1.00 48.84  ? 8   DA  D C4    1 
ATOM   2047 P  P     . DA  D 3 9   ? -20.788 50.920 22.213  1.00 48.15  ? 9   DA  D P     1 
ATOM   2048 O  OP1   . DA  D 3 9   ? -20.750 50.426 20.821  1.00 38.50  ? 9   DA  D OP1   1 
ATOM   2049 O  OP2   . DA  D 3 9   ? -21.717 51.980 22.637  1.00 51.13  ? 9   DA  D OP2   1 
ATOM   2050 O  "O5'" . DA  D 3 9   ? -21.076 49.644 23.122  1.00 47.64  ? 9   DA  D "O5'" 1 
ATOM   2051 C  "C5'" . DA  D 3 9   ? -20.005 48.782 23.485  1.00 36.56  ? 9   DA  D "C5'" 1 
ATOM   2052 C  "C4'" . DA  D 3 9   ? -20.163 48.347 24.911  1.00 36.62  ? 9   DA  D "C4'" 1 
ATOM   2053 O  "O4'" . DA  D 3 9   ? -19.871 49.471 25.775  1.00 45.90  ? 9   DA  D "O4'" 1 
ATOM   2054 C  "C3'" . DA  D 3 9   ? -21.571 47.877 25.269  1.00 50.66  ? 9   DA  D "C3'" 1 
ATOM   2055 O  "O3'" . DA  D 3 9   ? -21.492 46.666 26.005  1.00 55.23  ? 9   DA  D "O3'" 1 
ATOM   2056 C  "C2'" . DA  D 3 9   ? -22.142 49.031 26.101  1.00 37.50  ? 9   DA  D "C2'" 1 
ATOM   2057 C  "C1'" . DA  D 3 9   ? -20.889 49.607 26.734  1.00 39.81  ? 9   DA  D "C1'" 1 
ATOM   2058 N  N9    . DA  D 3 9   ? -21.020 51.023 27.055  1.00 43.78  ? 9   DA  D N9    1 
ATOM   2059 C  C8    . DA  D 3 9   ? -21.443 52.026 26.218  1.00 44.43  ? 9   DA  D C8    1 
ATOM   2060 N  N7    . DA  D 3 9   ? -21.467 53.209 26.788  1.00 46.07  ? 9   DA  D N7    1 
ATOM   2061 C  C5    . DA  D 3 9   ? -21.034 52.960 28.090  1.00 43.26  ? 9   DA  D C5    1 
ATOM   2062 C  C6    . DA  D 3 9   ? -20.842 53.791 29.204  1.00 45.18  ? 9   DA  D C6    1 
ATOM   2063 N  N6    . DA  D 3 9   ? -21.081 55.092 29.193  1.00 37.51  ? 9   DA  D N6    1 
ATOM   2064 N  N1    . DA  D 3 9   ? -20.400 53.221 30.351  1.00 53.34  ? 9   DA  D N1    1 
ATOM   2065 C  C2    . DA  D 3 9   ? -20.170 51.907 30.379  1.00 36.98  ? 9   DA  D C2    1 
ATOM   2066 N  N3    . DA  D 3 9   ? -20.308 51.024 29.402  1.00 42.40  ? 9   DA  D N3    1 
ATOM   2067 C  C4    . DA  D 3 9   ? -20.751 51.622 28.267  1.00 43.21  ? 9   DA  D C4    1 
ATOM   2068 P  P     . DA  D 3 10  ? -22.819 45.851 26.374  1.00 55.96  ? 10  DA  D P     1 
ATOM   2069 O  OP1   . DA  D 3 10  ? -22.519 44.439 26.050  1.00 55.28  ? 10  DA  D OP1   1 
ATOM   2070 O  OP2   . DA  D 3 10  ? -24.003 46.518 25.782  1.00 54.13  ? 10  DA  D OP2   1 
ATOM   2071 O  "O5'" . DA  D 3 10  ? -22.951 46.075 27.938  1.00 51.51  ? 10  DA  D "O5'" 1 
ATOM   2072 C  "C5'" . DA  D 3 10  ? -21.931 45.638 28.798  1.00 46.63  ? 10  DA  D "C5'" 1 
ATOM   2073 C  "C4'" . DA  D 3 10  ? -22.250 46.052 30.207  1.00 44.55  ? 10  DA  D "C4'" 1 
ATOM   2074 O  "O4'" . DA  D 3 10  ? -22.204 47.504 30.322  1.00 45.80  ? 10  DA  D "O4'" 1 
ATOM   2075 C  "C3'" . DA  D 3 10  ? -23.629 45.632 30.692  1.00 36.53  ? 10  DA  D "C3'" 1 
ATOM   2076 O  "O3'" . DA  D 3 10  ? -23.525 45.157 32.019  1.00 49.15  ? 10  DA  D "O3'" 1 
ATOM   2077 C  "C2'" . DA  D 3 10  ? -24.440 46.917 30.630  1.00 41.03  ? 10  DA  D "C2'" 1 
ATOM   2078 C  "C1'" . DA  D 3 10  ? -23.390 47.977 30.927  1.00 37.48  ? 10  DA  D "C1'" 1 
ATOM   2079 N  N9    . DA  D 3 10  ? -23.695 49.266 30.325  1.00 41.65  ? 10  DA  D N9    1 
ATOM   2080 C  C8    . DA  D 3 10  ? -24.072 49.480 29.029  1.00 48.06  ? 10  DA  D C8    1 
ATOM   2081 N  N7    . DA  D 3 10  ? -24.265 50.736 28.735  1.00 48.03  ? 10  DA  D N7    1 
ATOM   2082 C  C5    . DA  D 3 10  ? -23.981 51.403 29.913  1.00 49.03  ? 10  DA  D C5    1 
ATOM   2083 C  C6    . DA  D 3 10  ? -23.996 52.774 30.252  1.00 45.69  ? 10  DA  D C6    1 
ATOM   2084 N  N6    . DA  D 3 10  ? -24.334 53.736 29.393  1.00 39.71  ? 10  DA  D N6    1 
ATOM   2085 N  N1    . DA  D 3 10  ? -23.662 53.107 31.519  1.00 38.40  ? 10  DA  D N1    1 
ATOM   2086 C  C2    . DA  D 3 10  ? -23.356 52.122 32.378  1.00 41.81  ? 10  DA  D C2    1 
ATOM   2087 N  N3    . DA  D 3 10  ? -23.301 50.806 32.165  1.00 37.27  ? 10  DA  D N3    1 
ATOM   2088 C  C4    . DA  D 3 10  ? -23.628 50.511 30.908  1.00 37.78  ? 10  DA  D C4    1 
ATOM   2089 P  P     . DC  D 3 11  ? -24.792 44.484 32.724  1.00 44.66  ? 11  DC  D P     1 
ATOM   2090 O  OP1   . DC  D 3 11  ? -24.273 43.520 33.711  1.00 56.18  ? 11  DC  D OP1   1 
ATOM   2091 O  OP2   . DC  D 3 11  ? -25.705 44.064 31.649  1.00 45.78  ? 11  DC  D OP2   1 
ATOM   2092 O  "O5'" . DC  D 3 11  ? -25.474 45.694 33.488  1.00 42.28  ? 11  DC  D "O5'" 1 
ATOM   2093 C  "C5'" . DC  D 3 11  ? -24.695 46.471 34.360  1.00 41.17  ? 11  DC  D "C5'" 1 
ATOM   2094 C  "C4'" . DC  D 3 11  ? -25.396 47.769 34.725  1.00 49.63  ? 11  DC  D "C4'" 1 
ATOM   2095 O  "O4'" . DC  D 3 11  ? -25.450 48.677 33.604  1.00 45.06  ? 11  DC  D "O4'" 1 
ATOM   2096 C  "C3'" . DC  D 3 11  ? -26.832 47.632 35.196  1.00 51.95  ? 11  DC  D "C3'" 1 
ATOM   2097 O  "O3'" . DC  D 3 11  ? -26.845 47.769 36.595  1.00 50.27  ? 11  DC  D "O3'" 1 
ATOM   2098 C  "C2'" . DC  D 3 11  ? -27.586 48.796 34.477  1.00 46.58  ? 11  DC  D "C2'" 1 
ATOM   2099 C  "C1'" . DC  D 3 11  ? -26.436 49.622 33.904  1.00 44.62  ? 11  DC  D "C1'" 1 
ATOM   2100 N  N1    . DC  D 3 11  ? -26.746 50.403 32.646  1.00 48.72  ? 11  DC  D N1    1 
ATOM   2101 C  C2    . DC  D 3 11  ? -26.783 51.803 32.696  1.00 53.37  ? 11  DC  D C2    1 
ATOM   2102 O  O2    . DC  D 3 11  ? -26.622 52.374 33.776  1.00 58.57  ? 11  DC  D O2    1 
ATOM   2103 N  N3    . DC  D 3 11  ? -27.023 52.497 31.564  1.00 56.01  ? 11  DC  D N3    1 
ATOM   2104 C  C4    . DC  D 3 11  ? -27.209 51.851 30.418  1.00 63.76  ? 11  DC  D C4    1 
ATOM   2105 N  N4    . DC  D 3 11  ? -27.449 52.586 29.317  1.00 63.49  ? 11  DC  D N4    1 
ATOM   2106 C  C5    . DC  D 3 11  ? -27.152 50.424 30.342  1.00 61.12  ? 11  DC  D C5    1 
ATOM   2107 C  C6    . DC  D 3 11  ? -26.911 49.752 31.466  1.00 40.20  ? 11  DC  D C6    1 
ATOM   2108 P  P     . DT  D 3 12  ? -28.188 47.451 37.411  1.00 64.70  ? 12  DT  D P     1 
ATOM   2109 O  OP1   . DT  D 3 12  ? -27.788 46.814 38.683  1.00 65.52  ? 12  DT  D OP1   1 
ATOM   2110 O  OP2   . DT  D 3 12  ? -29.115 46.754 36.487  1.00 51.57  ? 12  DT  D OP2   1 
ATOM   2111 O  "O5'" . DT  D 3 12  ? -28.778 48.911 37.701  1.00 59.37  ? 12  DT  D "O5'" 1 
ATOM   2112 C  "C5'" . DT  D 3 12  ? -27.889 49.963 38.070  1.00 60.35  ? 12  DT  D "C5'" 1 
ATOM   2113 C  "C4'" . DT  D 3 12  ? -28.571 51.314 37.949  1.00 65.52  ? 12  DT  D "C4'" 1 
ATOM   2114 O  "O4'" . DT  D 3 12  ? -28.583 51.756 36.564  1.00 63.97  ? 12  DT  D "O4'" 1 
ATOM   2115 C  "C3'" . DT  D 3 12  ? -30.026 51.333 38.407  1.00 65.99  ? 12  DT  D "C3'" 1 
ATOM   2116 O  "O3'" . DT  D 3 12  ? -30.205 52.327 39.395  1.00 75.75  ? 12  DT  D "O3'" 1 
ATOM   2117 C  "C2'" . DT  D 3 12  ? -30.820 51.654 37.131  1.00 56.77  ? 12  DT  D "C2'" 1 
ATOM   2118 C  "C1'" . DT  D 3 12  ? -29.802 52.415 36.320  1.00 52.66  ? 12  DT  D "C1'" 1 
ATOM   2119 N  N1    . DT  D 3 12  ? -30.051 52.390 34.872  1.00 49.51  ? 12  DT  D N1    1 
ATOM   2120 C  C2    . DT  D 3 12  ? -30.115 53.578 34.178  1.00 53.63  ? 12  DT  D C2    1 
ATOM   2121 O  O2    . DT  D 3 12  ? -30.000 54.669 34.702  1.00 64.89  ? 12  DT  D O2    1 
ATOM   2122 N  N3    . DT  D 3 12  ? -30.319 53.448 32.839  1.00 49.32  ? 12  DT  D N3    1 
ATOM   2123 C  C4    . DT  D 3 12  ? -30.458 52.278 32.120  1.00 52.72  ? 12  DT  D C4    1 
ATOM   2124 O  O4    . DT  D 3 12  ? -30.645 52.272 30.896  1.00 46.72  ? 12  DT  D O4    1 
ATOM   2125 C  C5    . DT  D 3 12  ? -30.381 51.063 32.909  1.00 50.80  ? 12  DT  D C5    1 
ATOM   2126 C  C7    . DT  D 3 12  ? -30.525 49.727 32.249  1.00 54.59  ? 12  DT  D C7    1 
ATOM   2127 C  C6    . DT  D 3 12  ? -30.172 51.180 34.231  1.00 44.84  ? 12  DT  D C6    1 
ATOM   2128 P  P     . DC  D 3 13  ? -31.626 52.463 40.137  1.00 100.00 ? 13  DC  D P     1 
ATOM   2129 O  OP1   . DC  D 3 13  ? -31.366 52.820 41.546  1.00 107.35 ? 13  DC  D OP1   1 
ATOM   2130 O  OP2   . DC  D 3 13  ? -32.415 51.250 39.821  1.00 89.83  ? 13  DC  D OP2   1 
ATOM   2131 O  "O5'" . DC  D 3 13  ? -32.331 53.703 39.407  1.00 93.80  ? 13  DC  D "O5'" 1 
ATOM   2132 C  "C5'" . DC  D 3 13  ? -31.647 54.958 39.296  1.00 90.94  ? 13  DC  D "C5'" 1 
ATOM   2133 C  "C4'" . DC  D 3 13  ? -32.405 55.896 38.374  1.00 86.99  ? 13  DC  D "C4'" 1 
ATOM   2134 O  "O4'" . DC  D 3 13  ? -32.222 55.476 36.989  1.00 87.12  ? 13  DC  D "O4'" 1 
ATOM   2135 C  "C3'" . DC  D 3 13  ? -33.922 55.932 38.629  1.00 90.93  ? 13  DC  D "C3'" 1 
ATOM   2136 O  "O3'" . DC  D 3 13  ? -34.357 57.258 38.956  1.00 93.09  ? 13  DC  D "O3'" 1 
ATOM   2137 C  "C2'" . DC  D 3 13  ? -34.549 55.433 37.320  1.00 95.72  ? 13  DC  D "C2'" 1 
ATOM   2138 C  "C1'" . DC  D 3 13  ? -33.440 55.662 36.294  1.00 90.53  ? 13  DC  D "C1'" 1 
ATOM   2139 N  N1    . DC  D 3 13  ? -33.514 54.711 35.099  1.00 76.02  ? 13  DC  D N1    1 
ATOM   2140 C  C2    . DC  D 3 13  ? -33.605 55.227 33.801  1.00 65.01  ? 13  DC  D C2    1 
ATOM   2141 O  O2    . DC  D 3 13  ? -33.624 56.452 33.642  1.00 66.69  ? 13  DC  D O2    1 
ATOM   2142 N  N3    . DC  D 3 13  ? -33.681 54.361 32.750  1.00 54.89  ? 13  DC  D N3    1 
ATOM   2143 C  C4    . DC  D 3 13  ? -33.667 53.037 32.967  1.00 56.82  ? 13  DC  D C4    1 
ATOM   2144 N  N4    . DC  D 3 13  ? -33.738 52.220 31.908  1.00 47.07  ? 13  DC  D N4    1 
ATOM   2145 C  C5    . DC  D 3 13  ? -33.569 52.494 34.284  1.00 60.19  ? 13  DC  D C5    1 
ATOM   2146 C  C6    . DC  D 3 13  ? -33.495 53.356 35.305  1.00 68.91  ? 13  DC  D C6    1 
ATOM   2147 O  "O5'" . DG  E 2 1   ? 19.863  34.928 -13.278 1.00 92.42  ? 1   DG  H "O5'" 1 
ATOM   2148 C  "C5'" . DG  E 2 1   ? 20.749  34.751 -14.385 1.00 92.60  ? 1   DG  H "C5'" 1 
ATOM   2149 C  "C4'" . DG  E 2 1   ? 20.237  33.686 -15.350 1.00 92.07  ? 1   DG  H "C4'" 1 
ATOM   2150 O  "O4'" . DG  E 2 1   ? 20.382  32.370 -14.759 1.00 88.51  ? 1   DG  H "O4'" 1 
ATOM   2151 C  "C3'" . DG  E 2 1   ? 18.769  33.809 -15.762 1.00 97.95  ? 1   DG  H "C3'" 1 
ATOM   2152 O  "O3'" . DG  E 2 1   ? 18.620  33.466 -17.142 1.00 109.56 ? 1   DG  H "O3'" 1 
ATOM   2153 C  "C2'" . DG  E 2 1   ? 18.061  32.807 -14.862 1.00 89.14  ? 1   DG  H "C2'" 1 
ATOM   2154 C  "C1'" . DG  E 2 1   ? 19.119  31.728 -14.671 1.00 87.02  ? 1   DG  H "C1'" 1 
ATOM   2155 N  N9    . DG  E 2 1   ? 19.013  31.064 -13.369 1.00 80.00  ? 1   DG  H N9    1 
ATOM   2156 C  C8    . DG  E 2 1   ? 18.800  31.671 -12.155 1.00 72.29  ? 1   DG  H C8    1 
ATOM   2157 N  N7    . DG  E 2 1   ? 18.740  30.838 -11.161 1.00 67.34  ? 1   DG  H N7    1 
ATOM   2158 C  C5    . DG  E 2 1   ? 18.914  29.594 -11.747 1.00 68.30  ? 1   DG  H C5    1 
ATOM   2159 C  C6    . DG  E 2 1   ? 18.943  28.311 -11.155 1.00 65.20  ? 1   DG  H C6    1 
ATOM   2160 O  O6    . DG  E 2 1   ? 18.819  28.025 -9.963  1.00 59.01  ? 1   DG  H O6    1 
ATOM   2161 N  N1    . DG  E 2 1   ? 19.143  27.305 -12.101 1.00 71.13  ? 1   DG  H N1    1 
ATOM   2162 C  C2    . DG  E 2 1   ? 19.298  27.521 -13.452 1.00 81.54  ? 1   DG  H C2    1 
ATOM   2163 N  N2    . DG  E 2 1   ? 19.485  26.433 -14.211 1.00 92.40  ? 1   DG  H N2    1 
ATOM   2164 N  N3    . DG  E 2 1   ? 19.283  28.722 -14.018 1.00 76.94  ? 1   DG  H N3    1 
ATOM   2165 C  C4    . DG  E 2 1   ? 19.081  29.709 -13.106 1.00 75.41  ? 1   DG  H C4    1 
ATOM   2166 P  P     . DA  E 2 2   ? 17.160  33.291 -17.807 1.00 94.84  ? 2   DA  H P     1 
ATOM   2167 O  OP1   . DA  E 2 2   ? 17.303  33.650 -19.234 1.00 92.41  ? 2   DA  H OP1   1 
ATOM   2168 O  OP2   . DA  E 2 2   ? 16.115  33.966 -16.994 1.00 88.64  ? 2   DA  H OP2   1 
ATOM   2169 O  "O5'" . DA  E 2 2   ? 16.915  31.712 -17.740 1.00 100.35 ? 2   DA  H "O5'" 1 
ATOM   2170 C  "C5'" . DA  E 2 2   ? 17.714  30.833 -18.524 1.00 94.73  ? 2   DA  H "C5'" 1 
ATOM   2171 C  "C4'" . DA  E 2 2   ? 17.233  29.401 -18.382 1.00 87.21  ? 2   DA  H "C4'" 1 
ATOM   2172 O  "O4'" . DA  E 2 2   ? 17.328  28.979 -16.997 1.00 81.23  ? 2   DA  H "O4'" 1 
ATOM   2173 C  "C3'" . DA  E 2 2   ? 15.781  29.176 -18.814 1.00 85.36  ? 2   DA  H "C3'" 1 
ATOM   2174 O  "O3'" . DA  E 2 2   ? 15.687  28.037 -19.648 1.00 82.49  ? 2   DA  H "O3'" 1 
ATOM   2175 C  "C2'" . DA  E 2 2   ? 15.026  28.986 -17.494 1.00 80.62  ? 2   DA  H "C2'" 1 
ATOM   2176 C  "C1'" . DA  E 2 2   ? 16.100  28.404 -16.578 1.00 78.01  ? 2   DA  H "C1'" 1 
ATOM   2177 N  N9    . DA  E 2 2   ? 15.903  28.752 -15.166 1.00 67.19  ? 2   DA  H N9    1 
ATOM   2178 C  C8    . DA  E 2 2   ? 15.739  30.009 -14.650 1.00 61.93  ? 2   DA  H C8    1 
ATOM   2179 N  N7    . DA  E 2 2   ? 15.611  30.037 -13.350 1.00 55.10  ? 2   DA  H N7    1 
ATOM   2180 C  C5    . DA  E 2 2   ? 15.710  28.709 -12.978 1.00 56.24  ? 2   DA  H C5    1 
ATOM   2181 C  C6    . DA  E 2 2   ? 15.646  28.072 -11.724 1.00 52.45  ? 2   DA  H C6    1 
ATOM   2182 N  N6    . DA  E 2 2   ? 15.482  28.732 -10.580 1.00 51.77  ? 2   DA  H N6    1 
ATOM   2183 N  N1    . DA  E 2 2   ? 15.772  26.732 -11.695 1.00 53.27  ? 2   DA  H N1    1 
ATOM   2184 C  C2    . DA  E 2 2   ? 15.947  26.074 -12.847 1.00 56.07  ? 2   DA  H C2    1 
ATOM   2185 N  N3    . DA  E 2 2   ? 16.022  26.562 -14.085 1.00 65.72  ? 2   DA  H N3    1 
ATOM   2186 C  C4    . DA  E 2 2   ? 15.892  27.901 -14.082 1.00 61.61  ? 2   DA  H C4    1 
ATOM   2187 P  P     . DG  E 2 3   ? 14.269  27.595 -20.253 1.00 96.85  ? 3   DG  H P     1 
ATOM   2188 O  OP1   . DG  E 2 3   ? 14.515  26.852 -21.505 1.00 97.29  ? 3   DG  H OP1   1 
ATOM   2189 O  OP2   . DG  E 2 3   ? 13.335  28.745 -20.199 1.00 94.46  ? 3   DG  H OP2   1 
ATOM   2190 O  "O5'" . DG  E 2 3   ? 13.736  26.555 -19.183 1.00 96.51  ? 3   DG  H "O5'" 1 
ATOM   2191 C  "C5'" . DG  E 2 3   ? 14.469  25.385 -18.941 1.00 92.90  ? 3   DG  H "C5'" 1 
ATOM   2192 C  "C4'" . DG  E 2 3   ? 13.728  24.511 -17.966 1.00 82.61  ? 3   DG  H "C4'" 1 
ATOM   2193 O  "O4'" . DG  E 2 3   ? 13.804  25.096 -16.648 1.00 73.30  ? 3   DG  H "O4'" 1 
ATOM   2194 C  "C3'" . DG  E 2 3   ? 12.247  24.326 -18.289 1.00 75.56  ? 3   DG  H "C3'" 1 
ATOM   2195 O  "O3'" . DG  E 2 3   ? 11.971  22.954 -18.369 1.00 70.65  ? 3   DG  H "O3'" 1 
ATOM   2196 C  "C2'" . DG  E 2 3   ? 11.503  25.005 -17.128 1.00 70.40  ? 3   DG  H "C2'" 1 
ATOM   2197 C  "C1'" . DG  E 2 3   ? 12.546  25.043 -16.022 1.00 71.27  ? 3   DG  H "C1'" 1 
ATOM   2198 N  N9    . DG  E 2 3   ? 12.448  26.221 -15.181 1.00 63.19  ? 3   DG  H N9    1 
ATOM   2199 C  C8    . DG  E 2 3   ? 12.450  27.525 -15.596 1.00 59.82  ? 3   DG  H C8    1 
ATOM   2200 N  N7    . DG  E 2 3   ? 12.373  28.382 -14.623 1.00 51.56  ? 3   DG  H N7    1 
ATOM   2201 C  C5    . DG  E 2 3   ? 12.326  27.594 -13.486 1.00 53.53  ? 3   DG  H C5    1 
ATOM   2202 C  C6    . DG  E 2 3   ? 12.250  27.973 -12.139 1.00 57.17  ? 3   DG  H C6    1 
ATOM   2203 O  O6    . DG  E 2 3   ? 12.192  29.118 -11.672 1.00 55.32  ? 3   DG  H O6    1 
ATOM   2204 N  N1    . DG  E 2 3   ? 12.235  26.865 -11.294 1.00 70.05  ? 3   DG  H N1    1 
ATOM   2205 C  C2    . DG  E 2 3   ? 12.291  25.552 -11.714 1.00 66.05  ? 3   DG  H C2    1 
ATOM   2206 N  N2    . DG  E 2 3   ? 12.256  24.614 -10.747 1.00 54.89  ? 3   DG  H N2    1 
ATOM   2207 N  N3    . DG  E 2 3   ? 12.374  25.185 -12.993 1.00 51.49  ? 3   DG  H N3    1 
ATOM   2208 C  C4    . DG  E 2 3   ? 12.380  26.258 -13.813 1.00 52.77  ? 3   DG  H C4    1 
ATOM   2209 P  P     . DT  E 2 4   ? 10.461  22.422 -18.415 1.00 74.02  ? 4   DT  H P     1 
ATOM   2210 O  OP1   . DT  E 2 4   ? 10.473  21.114 -19.107 1.00 79.13  ? 4   DT  H OP1   1 
ATOM   2211 O  OP2   . DT  E 2 4   ? 9.564   23.497 -18.884 1.00 61.75  ? 4   DT  H OP2   1 
ATOM   2212 O  "O5'" . DT  E 2 4   ? 10.174  22.104 -16.886 1.00 71.61  ? 4   DT  H "O5'" 1 
ATOM   2213 C  "C5'" . DT  E 2 4   ? 11.086  21.296 -16.188 1.00 60.76  ? 4   DT  H "C5'" 1 
ATOM   2214 C  "C4'" . DT  E 2 4   ? 10.591  20.998 -14.793 1.00 58.73  ? 4   DT  H "C4'" 1 
ATOM   2215 O  "O4'" . DT  E 2 4   ? 10.640  22.186 -13.971 1.00 55.46  ? 4   DT  H "O4'" 1 
ATOM   2216 C  "C3'" . DT  E 2 4   ? 9.160   20.475 -14.711 1.00 61.73  ? 4   DT  H "C3'" 1 
ATOM   2217 O  "O3'" . DT  E 2 4   ? 9.156   19.379 -13.858 1.00 70.74  ? 4   DT  H "O3'" 1 
ATOM   2218 C  "C2'" . DT  E 2 4   ? 8.386   21.651 -14.117 1.00 55.07  ? 4   DT  H "C2'" 1 
ATOM   2219 C  "C1'" . DT  E 2 4   ? 9.445   22.286 -13.237 1.00 58.08  ? 4   DT  H "C1'" 1 
ATOM   2220 N  N1    . DT  E 2 4   ? 9.215   23.732 -12.948 1.00 64.38  ? 4   DT  H N1    1 
ATOM   2221 C  C2    . DT  E 2 4   ? 9.194   24.169 -11.643 1.00 59.68  ? 4   DT  H C2    1 
ATOM   2222 O  O2    . DT  E 2 4   ? 9.334   23.430 -10.685 1.00 56.88  ? 4   DT  H O2    1 
ATOM   2223 N  N3    . DT  E 2 4   ? 9.000   25.516 -11.502 1.00 54.30  ? 4   DT  H N3    1 
ATOM   2224 C  C4    . DT  E 2 4   ? 8.839   26.451 -12.510 1.00 49.78  ? 4   DT  H C4    1 
ATOM   2225 O  O4    . DT  E 2 4   ? 8.674   27.640 -12.283 1.00 49.07  ? 4   DT  H O4    1 
ATOM   2226 C  C5    . DT  E 2 4   ? 8.871   25.928 -13.847 1.00 54.74  ? 4   DT  H C5    1 
ATOM   2227 C  C7    . DT  E 2 4   ? 8.703   26.849 -15.017 1.00 55.64  ? 4   DT  H C7    1 
ATOM   2228 C  C6    . DT  E 2 4   ? 9.067   24.613 -14.004 1.00 62.14  ? 4   DT  H C6    1 
ATOM   2229 P  P     . DT  E 2 5   ? 7.795   18.631 -13.478 1.00 68.19  ? 5   DT  H P     1 
ATOM   2230 O  OP1   . DT  E 2 5   ? 8.234   17.250 -13.183 1.00 59.13  ? 5   DT  H OP1   1 
ATOM   2231 O  OP2   . DT  E 2 5   ? 6.733   18.946 -14.460 1.00 70.44  ? 5   DT  H OP2   1 
ATOM   2232 O  "O5'" . DT  E 2 5   ? 7.396   19.284 -12.089 1.00 49.17  ? 5   DT  H "O5'" 1 
ATOM   2233 C  "C5'" . DT  E 2 5   ? 8.224   19.070 -10.992 1.00 44.50  ? 5   DT  H "C5'" 1 
ATOM   2234 C  "C4'" . DT  E 2 5   ? 7.601   19.659 -9.758  1.00 42.96  ? 5   DT  H "C4'" 1 
ATOM   2235 O  "O4'" . DT  E 2 5   ? 7.496   21.094 -9.891  1.00 42.98  ? 5   DT  H "O4'" 1 
ATOM   2236 C  "C3'" . DT  E 2 5   ? 6.198   19.143 -9.453  1.00 46.33  ? 5   DT  H "C3'" 1 
ATOM   2237 O  "O3'" . DT  E 2 5   ? 6.210   18.630 -8.139  1.00 46.42  ? 5   DT  H "O3'" 1 
ATOM   2238 C  "C2'" . DT  E 2 5   ? 5.272   20.388 -9.619  1.00 37.33  ? 5   DT  H "C2'" 1 
ATOM   2239 C  "C1'" . DT  E 2 5   ? 6.241   21.538 -9.401  1.00 46.84  ? 5   DT  H "C1'" 1 
ATOM   2240 N  N1    . DT  E 2 5   ? 5.933   22.808 -10.134 1.00 44.81  ? 5   DT  H N1    1 
ATOM   2241 C  C2    . DT  E 2 5   ? 5.856   23.990 -9.427  1.00 50.67  ? 5   DT  H C2    1 
ATOM   2242 O  O2    . DT  E 2 5   ? 5.926   24.045 -8.216  1.00 57.59  ? 5   DT  H O2    1 
ATOM   2243 N  N3    . DT  E 2 5   ? 5.667   25.115 -10.193 1.00 46.35  ? 5   DT  H N3    1 
ATOM   2244 C  C4    . DT  E 2 5   ? 5.569   25.168 -11.566 1.00 47.99  ? 5   DT  H C4    1 
ATOM   2245 O  O4    . DT  E 2 5   ? 5.387   26.217 -12.164 1.00 55.78  ? 5   DT  H O4    1 
ATOM   2246 C  C5    . DT  E 2 5   ? 5.695   23.900 -12.248 1.00 48.79  ? 5   DT  H C5    1 
ATOM   2247 C  C7    . DT  E 2 5   ? 5.604   23.841 -13.737 1.00 47.55  ? 5   DT  H C7    1 
ATOM   2248 C  C6    . DT  E 2 5   ? 5.887   22.797 -11.509 1.00 44.64  ? 5   DT  H C6    1 
ATOM   2249 P  P     . DT  E 2 6   ? 4.908   17.970 -7.496  1.00 52.19  ? 6   DT  H P     1 
ATOM   2250 O  OP1   . DT  E 2 6   ? 5.409   17.138 -6.384  1.00 64.99  ? 6   DT  H OP1   1 
ATOM   2251 O  OP2   . DT  E 2 6   ? 4.014   17.421 -8.552  1.00 45.07  ? 6   DT  H OP2   1 
ATOM   2252 O  "O5'" . DT  E 2 6   ? 4.130   19.210 -6.870  1.00 44.39  ? 6   DT  H "O5'" 1 
ATOM   2253 C  "C5'" . DT  E 2 6   ? 4.714   19.975 -5.866  1.00 29.65  ? 6   DT  H "C5'" 1 
ATOM   2254 C  "C4'" . DT  E 2 6   ? 3.829   21.156 -5.532  1.00 38.73  ? 6   DT  H "C4'" 1 
ATOM   2255 O  "O4'" . DT  E 2 6   ? 3.854   22.114 -6.604  1.00 36.09  ? 6   DT  H "O4'" 1 
ATOM   2256 C  "C3'" . DT  E 2 6   ? 2.347   20.819 -5.322  1.00 44.30  ? 6   DT  H "C3'" 1 
ATOM   2257 O  "O3'" . DT  E 2 6   ? 2.076   20.842 -3.909  1.00 44.41  ? 6   DT  H "O3'" 1 
ATOM   2258 C  "C2'" . DT  E 2 6   ? 1.569   21.931 -6.109  1.00 30.99  ? 6   DT  H "C2'" 1 
ATOM   2259 C  "C1'" . DT  E 2 6   ? 2.693   22.904 -6.510  1.00 39.29  ? 6   DT  H "C1'" 1 
ATOM   2260 N  N1    . DT  E 2 6   ? 2.529   23.631 -7.834  1.00 40.85  ? 6   DT  H N1    1 
ATOM   2261 C  C2    . DT  E 2 6   ? 2.587   25.007 -7.856  1.00 38.52  ? 6   DT  H C2    1 
ATOM   2262 O  O2    . DT  E 2 6   ? 2.739   25.682 -6.866  1.00 45.31  ? 6   DT  H O2    1 
ATOM   2263 N  N3    . DT  E 2 6   ? 2.480   25.570 -9.085  1.00 37.26  ? 6   DT  H N3    1 
ATOM   2264 C  C4    . DT  E 2 6   ? 2.321   24.919 -10.287 1.00 49.78  ? 6   DT  H C4    1 
ATOM   2265 O  O4    . DT  E 2 6   ? 2.227   25.526 -11.362 1.00 42.14  ? 6   DT  H O4    1 
ATOM   2266 C  C5    . DT  E 2 6   ? 2.257   23.478 -10.197 1.00 50.34  ? 6   DT  H C5    1 
ATOM   2267 C  C7    . DT  E 2 6   ? 2.076   22.656 -11.437 1.00 54.69  ? 6   DT  H C7    1 
ATOM   2268 C  C6    . DT  E 2 6   ? 2.370   22.911 -8.985  1.00 42.82  ? 6   DT  H C6    1 
ATOM   2269 P  P     . DG  E 2 7   ? 0.739   20.198 -3.288  1.00 39.47  ? 7   DG  H P     1 
ATOM   2270 O  OP1   . DG  E 2 7   ? 1.096   19.806 -1.917  1.00 41.42  ? 7   DG  H OP1   1 
ATOM   2271 O  OP2   . DG  E 2 7   ? 0.118   19.228 -4.231  1.00 39.32  ? 7   DG  H OP2   1 
ATOM   2272 O  "O5'" . DG  E 2 7   ? -0.236  21.432 -3.160  1.00 32.66  ? 7   DG  H "O5'" 1 
ATOM   2273 C  "C5'" . DG  E 2 7   ? 0.061   22.493 -2.252  1.00 38.99  ? 7   DG  H "C5'" 1 
ATOM   2274 C  "C4'" . DG  E 2 7   ? -0.839  23.694 -2.514  1.00 35.18  ? 7   DG  H "C4'" 1 
ATOM   2275 O  "O4'" . DG  E 2 7   ? -0.612  24.196 -3.861  1.00 35.71  ? 7   DG  H "O4'" 1 
ATOM   2276 C  "C3'" . DG  E 2 7   ? -2.348  23.431 -2.452  1.00 41.96  ? 7   DG  H "C3'" 1 
ATOM   2277 O  "O3'" . DG  E 2 7   ? -2.984  24.653 -2.086  1.00 46.95  ? 7   DG  H "O3'" 1 
ATOM   2278 C  "C2'" . DG  E 2 7   ? -2.642  23.111 -3.902  1.00 33.85  ? 7   DG  H "C2'" 1 
ATOM   2279 C  "C1'" . DG  E 2 7   ? -1.828  24.215 -4.536  1.00 32.22  ? 7   DG  H "C1'" 1 
ATOM   2280 N  N9    . DG  E 2 7   ? -1.587  24.061 -5.961  1.00 34.89  ? 7   DG  H N9    1 
ATOM   2281 C  C8    . DG  E 2 7   ? -1.683  22.923 -6.711  1.00 36.30  ? 7   DG  H C8    1 
ATOM   2282 N  N7    . DG  E 2 7   ? -1.438  23.122 -7.983  1.00 43.12  ? 7   DG  H N7    1 
ATOM   2283 C  C5    . DG  E 2 7   ? -1.157  24.478 -8.069  1.00 43.11  ? 7   DG  H C5    1 
ATOM   2284 C  C6    . DG  E 2 7   ? -0.798  25.266 -9.186  1.00 49.30  ? 7   DG  H C6    1 
ATOM   2285 O  O6    . DG  E 2 7   ? -0.658  24.909 -10.364 1.00 53.57  ? 7   DG  H O6    1 
ATOM   2286 N  N1    . DG  E 2 7   ? -0.596  26.594 -8.833  1.00 46.34  ? 7   DG  H N1    1 
ATOM   2287 C  C2    . DG  E 2 7   ? -0.732  27.093 -7.555  1.00 53.63  ? 7   DG  H C2    1 
ATOM   2288 N  N2    . DG  E 2 7   ? -0.497  28.403 -7.402  1.00 54.16  ? 7   DG  H N2    1 
ATOM   2289 N  N3    . DG  E 2 7   ? -1.061  26.357 -6.499  1.00 30.15  ? 7   DG  H N3    1 
ATOM   2290 C  C4    . DG  E 2 7   ? -1.246  25.067 -6.832  1.00 31.42  ? 7   DG  H C4    1 
ATOM   2291 P  P     . DA  E 2 8   ? -4.200  24.670 -1.054  1.00 50.64  ? 8   DA  H P     1 
ATOM   2292 O  OP1   . DA  E 2 8   ? -3.674  24.128 0.213   1.00 45.71  ? 8   DA  H OP1   1 
ATOM   2293 O  OP2   . DA  E 2 8   ? -5.397  24.128 -1.741  1.00 64.42  ? 8   DA  H OP2   1 
ATOM   2294 O  "O5'" . DA  E 2 8   ? -4.457  26.219 -0.809  1.00 33.15  ? 8   DA  H "O5'" 1 
ATOM   2295 C  "C5'" . DA  E 2 8   ? -3.345  27.061 -0.516  1.00 35.98  ? 8   DA  H "C5'" 1 
ATOM   2296 C  "C4'" . DA  E 2 8   ? -3.502  28.434 -1.174  1.00 47.15  ? 8   DA  H "C4'" 1 
ATOM   2297 O  "O4'" . DA  E 2 8   ? -3.272  28.340 -2.608  1.00 31.63  ? 8   DA  H "O4'" 1 
ATOM   2298 C  "C3'" . DA  E 2 8   ? -4.867  29.073 -1.012  1.00 49.39  ? 8   DA  H "C3'" 1 
ATOM   2299 O  "O3'" . DA  E 2 8   ? -4.715  30.479 -0.876  1.00 45.92  ? 8   DA  H "O3'" 1 
ATOM   2300 C  "C2'" . DA  E 2 8   ? -5.585  28.679 -2.309  1.00 41.05  ? 8   DA  H "C2'" 1 
ATOM   2301 C  "C1'" . DA  E 2 8   ? -4.440  28.665 -3.312  1.00 34.56  ? 8   DA  H "C1'" 1 
ATOM   2302 N  N9    . DA  E 2 8   ? -4.582  27.699 -4.405  1.00 44.12  ? 8   DA  H N9    1 
ATOM   2303 C  C8    . DA  E 2 8   ? -4.922  26.371 -4.324  1.00 39.02  ? 8   DA  H C8    1 
ATOM   2304 N  N7    . DA  E 2 8   ? -4.923  25.752 -5.499  1.00 36.11  ? 8   DA  H N7    1 
ATOM   2305 C  C5    . DA  E 2 8   ? -4.545  26.749 -6.398  1.00 38.50  ? 8   DA  H C5    1 
ATOM   2306 C  C6    . DA  E 2 8   ? -4.359  26.761 -7.805  1.00 41.88  ? 8   DA  H C6    1 
ATOM   2307 N  N6    . DA  E 2 8   ? -4.535  25.693 -8.582  1.00 34.84  ? 8   DA  H N6    1 
ATOM   2308 N  N1    . DA  E 2 8   ? -3.993  27.928 -8.382  1.00 40.12  ? 8   DA  H N1    1 
ATOM   2309 C  C2    . DA  E 2 8   ? -3.811  29.000 -7.606  1.00 49.10  ? 8   DA  H C2    1 
ATOM   2310 N  N3    . DA  E 2 8   ? -3.956  29.113 -6.281  1.00 48.77  ? 8   DA  H N3    1 
ATOM   2311 C  C4    . DA  E 2 8   ? -4.333  27.946 -5.737  1.00 42.65  ? 8   DA  H C4    1 
ATOM   2312 P  P     . DA  E 2 9   ? -6.003  31.409 -0.669  1.00 64.09  ? 9   DA  H P     1 
ATOM   2313 O  OP1   . DA  E 2 9   ? -5.572  32.633 0.043   1.00 67.14  ? 9   DA  H OP1   1 
ATOM   2314 O  OP2   . DA  E 2 9   ? -7.123  30.586 -0.187  1.00 59.29  ? 9   DA  H OP2   1 
ATOM   2315 O  "O5'" . DA  E 2 9   ? -6.331  31.851 -2.142  1.00 56.80  ? 9   DA  H "O5'" 1 
ATOM   2316 C  "C5'" . DA  E 2 9   ? -5.358  32.580 -2.851  1.00 49.34  ? 9   DA  H "C5'" 1 
ATOM   2317 C  "C4'" . DA  E 2 9   ? -5.894  32.989 -4.187  1.00 38.51  ? 9   DA  H "C4'" 1 
ATOM   2318 O  "O4'" . DA  E 2 9   ? -5.946  31.832 -5.047  1.00 38.98  ? 9   DA  H "O4'" 1 
ATOM   2319 C  "C3'" . DA  E 2 9   ? -7.309  33.569 -4.172  1.00 40.33  ? 9   DA  H "C3'" 1 
ATOM   2320 O  "O3'" . DA  E 2 9   ? -7.313  34.712 -5.032  1.00 41.84  ? 9   DA  H "O3'" 1 
ATOM   2321 C  "C2'" . DA  E 2 9   ? -8.158  32.418 -4.726  1.00 36.13  ? 9   DA  H "C2'" 1 
ATOM   2322 C  "C1'" . DA  E 2 9   ? -7.183  31.802 -5.708  1.00 45.00  ? 9   DA  H "C1'" 1 
ATOM   2323 N  N9    . DA  E 2 9   ? -7.449  30.422 -6.067  1.00 44.87  ? 9   DA  H N9    1 
ATOM   2324 C  C8    . DA  E 2 9   ? -7.901  29.435 -5.254  1.00 45.13  ? 9   DA  H C8    1 
ATOM   2325 N  N7    . DA  E 2 9   ? -7.997  28.265 -5.841  1.00 49.75  ? 9   DA  H N7    1 
ATOM   2326 C  C5    . DA  E 2 9   ? -7.547  28.494 -7.119  1.00 46.66  ? 9   DA  H C5    1 
ATOM   2327 C  C6    . DA  E 2 9   ? -7.395  27.650 -8.230  1.00 46.44  ? 9   DA  H C6    1 
ATOM   2328 N  N6    . DA  E 2 9   ? -7.708  26.343 -8.209  1.00 43.39  ? 9   DA  H N6    1 
ATOM   2329 N  N1    . DA  E 2 9   ? -6.914  28.202 -9.371  1.00 47.59  ? 9   DA  H N1    1 
ATOM   2330 C  C2    . DA  E 2 9   ? -6.612  29.506 -9.383  1.00 45.38  ? 9   DA  H C2    1 
ATOM   2331 N  N3    . DA  E 2 9   ? -6.705  30.397 -8.394  1.00 46.09  ? 9   DA  H N3    1 
ATOM   2332 C  C4    . DA  E 2 9   ? -7.197  29.822 -7.282  1.00 49.18  ? 9   DA  H C4    1 
ATOM   2333 P  P     . DA  E 2 10  ? -8.626  35.584 -5.283  1.00 43.13  ? 10  DA  H P     1 
ATOM   2334 O  OP1   . DA  E 2 10  ? -8.222  36.983 -5.314  1.00 44.44  ? 10  DA  H OP1   1 
ATOM   2335 O  OP2   . DA  E 2 10  ? -9.684  35.157 -4.337  1.00 60.13  ? 10  DA  H OP2   1 
ATOM   2336 O  "O5'" . DA  E 2 10  ? -9.082  35.157 -6.736  1.00 45.54  ? 10  DA  H "O5'" 1 
ATOM   2337 C  "C5'" . DA  E 2 10  ? -8.173  35.162 -7.753  1.00 43.10  ? 10  DA  H "C5'" 1 
ATOM   2338 C  "C4'" . DA  E 2 10  ? -8.713  34.432 -8.958  1.00 42.20  ? 10  DA  H "C4'" 1 
ATOM   2339 O  "O4'" . DA  E 2 10  ? -8.777  33.023 -8.718  1.00 44.43  ? 10  DA  H "O4'" 1 
ATOM   2340 C  "C3'" . DA  E 2 10  ? -10.092 34.851 -9.408  1.00 47.46  ? 10  DA  H "C3'" 1 
ATOM   2341 O  "O3'" . DA  E 2 10  ? -9.973  35.471 -10.693 1.00 55.36  ? 10  DA  H "O3'" 1 
ATOM   2342 C  "C2'" . DA  E 2 10  ? -10.879 33.520 -9.475  1.00 47.69  ? 10  DA  H "C2'" 1 
ATOM   2343 C  "C1'" . DA  E 2 10  ? -9.767  32.497 -9.550  1.00 37.61  ? 10  DA  H "C1'" 1 
ATOM   2344 N  N9    . DA  E 2 10  ? -10.122 31.160 -9.054  1.00 51.67  ? 10  DA  H N9    1 
ATOM   2345 C  C8    . DA  E 2 10  ? -10.476 30.819 -7.765  1.00 59.45  ? 10  DA  H C8    1 
ATOM   2346 N  N7    . DA  E 2 10  ? -10.716 29.535 -7.593  1.00 55.95  ? 10  DA  H N7    1 
ATOM   2347 C  C5    . DA  E 2 10  ? -10.500 28.988 -8.850  1.00 62.09  ? 10  DA  H C5    1 
ATOM   2348 C  C6    . DA  E 2 10  ? -10.596 27.665 -9.333  1.00 64.61  ? 10  DA  H C6    1 
ATOM   2349 N  N6    . DA  E 2 10  ? -10.936 26.621 -8.553  1.00 58.51  ? 10  DA  H N6    1 
ATOM   2350 N  N1    . DA  E 2 10  ? -10.328 27.456 -10.649 1.00 62.22  ? 10  DA  H N1    1 
ATOM   2351 C  C2    . DA  E 2 10  ? -9.981  28.510 -11.418 1.00 58.15  ? 10  DA  H C2    1 
ATOM   2352 N  N3    . DA  E 2 10  ? -9.848  29.797 -11.074 1.00 50.81  ? 10  DA  H N3    1 
ATOM   2353 C  C4    . DA  E 2 10  ? -10.123 29.973 -9.765  1.00 54.28  ? 10  DA  H C4    1 
ATOM   2354 P  P     . DC  E 2 11  ? -11.224 36.197 -11.382 1.00 59.25  ? 11  DC  H P     1 
ATOM   2355 O  OP1   . DC  E 2 11  ? -10.706 37.316 -12.196 1.00 70.49  ? 11  DC  H OP1   1 
ATOM   2356 O  OP2   . DC  E 2 11  ? -12.237 36.430 -10.330 1.00 57.71  ? 11  DC  H OP2   1 
ATOM   2357 O  "O5'" . DC  E 2 11  ? -11.804 35.075 -12.346 1.00 61.00  ? 11  DC  H "O5'" 1 
ATOM   2358 C  "C5'" . DC  E 2 11  ? -10.924 34.386 -13.194 1.00 56.35  ? 11  DC  H "C5'" 1 
ATOM   2359 C  "C4'" . DC  E 2 11  ? -11.607 33.169 -13.765 1.00 56.34  ? 11  DC  H "C4'" 1 
ATOM   2360 O  "O4'" . DC  E 2 11  ? -11.736 32.156 -12.753 1.00 55.18  ? 11  DC  H "O4'" 1 
ATOM   2361 C  "C3'" . DC  E 2 11  ? -13.017 33.421 -14.292 1.00 51.66  ? 11  DC  H "C3'" 1 
ATOM   2362 O  "O3'" . DC  E 2 11  ? -13.045 33.168 -15.694 1.00 61.30  ? 11  DC  H "O3'" 1 
ATOM   2363 C  "C2'" . DC  E 2 11  ? -13.893 32.423 -13.514 1.00 56.20  ? 11  DC  H "C2'" 1 
ATOM   2364 C  "C1'" . DC  E 2 11  ? -12.869 31.406 -13.042 1.00 48.62  ? 11  DC  H "C1'" 1 
ATOM   2365 N  N1    . DC  E 2 11  ? -13.244 30.656 -11.828 1.00 48.66  ? 11  DC  H N1    1 
ATOM   2366 C  C2    . DC  E 2 11  ? -13.336 29.268 -11.898 1.00 53.86  ? 11  DC  H C2    1 
ATOM   2367 O  O2    . DC  E 2 11  ? -13.153 28.717 -12.991 1.00 48.40  ? 11  DC  H O2    1 
ATOM   2368 N  N3    . DC  E 2 11  ? -13.650 28.565 -10.769 1.00 54.31  ? 11  DC  H N3    1 
ATOM   2369 C  C4    . DC  E 2 11  ? -13.857 29.207 -9.608  1.00 51.72  ? 11  DC  H C4    1 
ATOM   2370 N  N4    . DC  E 2 11  ? -14.179 28.472 -8.529  1.00 48.20  ? 11  DC  H N4    1 
ATOM   2371 C  C5    . DC  E 2 11  ? -13.746 30.630 -9.511  1.00 47.56  ? 11  DC  H C5    1 
ATOM   2372 C  C6    . DC  E 2 11  ? -13.425 31.307 -10.639 1.00 50.27  ? 11  DC  H C6    1 
ATOM   2373 P  P     . DT  E 2 12  ? -14.281 33.665 -16.596 1.00 77.58  ? 12  DT  H P     1 
ATOM   2374 O  OP1   . DT  E 2 12  ? -13.696 33.979 -17.914 1.00 82.61  ? 12  DT  H OP1   1 
ATOM   2375 O  OP2   . DT  E 2 12  ? -15.026 34.721 -15.866 1.00 66.66  ? 12  DT  H OP2   1 
ATOM   2376 O  "O5'" . DT  E 2 12  ? -15.185 32.344 -16.751 1.00 86.21  ? 12  DT  H "O5'" 1 
ATOM   2377 C  "C5'" . DT  E 2 12  ? -14.663 31.207 -17.461 1.00 86.78  ? 12  DT  H "C5'" 1 
ATOM   2378 C  "C4'" . DT  E 2 12  ? -15.472 29.944 -17.188 1.00 87.09  ? 12  DT  H "C4'" 1 
ATOM   2379 O  "O4'" . DT  E 2 12  ? -15.350 29.561 -15.797 1.00 79.75  ? 12  DT  H "O4'" 1 
ATOM   2380 C  "C3'" . DT  E 2 12  ? -16.977 30.043 -17.476 1.00 90.96  ? 12  DT  H "C3'" 1 
ATOM   2381 O  "O3'" . DT  E 2 12  ? -17.321 29.239 -18.606 1.00 92.87  ? 12  DT  H "O3'" 1 
ATOM   2382 C  "C2'" . DT  E 2 12  ? -17.647 29.523 -16.191 1.00 90.25  ? 12  DT  H "C2'" 1 
ATOM   2383 C  "C1'" . DT  E 2 12  ? -16.495 28.853 -15.438 1.00 79.30  ? 12  DT  H "C1'" 1 
ATOM   2384 N  N1    . DT  E 2 12  ? -16.645 28.906 -13.959 1.00 70.92  ? 12  DT  H N1    1 
ATOM   2385 C  C2    . DT  E 2 12  ? -16.816 27.730 -13.248 1.00 68.74  ? 12  DT  H C2    1 
ATOM   2386 O  O2    . DT  E 2 12  ? -16.849 26.627 -13.768 1.00 70.75  ? 12  DT  H O2    1 
ATOM   2387 N  N3    . DT  E 2 12  ? -16.959 27.896 -11.895 1.00 62.46  ? 12  DT  H N3    1 
ATOM   2388 C  C4    . DT  E 2 12  ? -16.946 29.092 -11.193 1.00 63.21  ? 12  DT  H C4    1 
ATOM   2389 O  O4    . DT  E 2 12  ? -17.084 29.139 -9.969  1.00 56.96  ? 12  DT  H O4    1 
ATOM   2390 C  C5    . DT  E 2 12  ? -16.764 30.285 -12.002 1.00 61.81  ? 12  DT  H C5    1 
ATOM   2391 C  C7    . DT  E 2 12  ? -16.739 31.636 -11.357 1.00 64.43  ? 12  DT  H C7    1 
ATOM   2392 C  C6    . DT  E 2 12  ? -16.625 30.134 -13.327 1.00 60.74  ? 12  DT  H C6    1 
ATOM   2393 O  "O3'" . DC  F 3 1   ? -19.074 21.327 -4.193  1.00 121.62 ? 1   DC  I "O3'" 1 
ATOM   2394 P  P     . DA  F 3 2   ? -18.046 20.102 -4.021  1.00 117.61 ? 2   DA  I P     1 
ATOM   2395 O  OP1   . DA  F 3 2   ? -18.760 19.018 -3.309  1.00 116.46 ? 2   DA  I OP1   1 
ATOM   2396 O  OP2   . DA  F 3 2   ? -16.782 20.647 -3.464  1.00 116.66 ? 2   DA  I OP2   1 
ATOM   2397 O  "O5'" . DA  F 3 2   ? -17.741 19.636 -5.523  1.00 97.79  ? 2   DA  I "O5'" 1 
ATOM   2398 C  "C5'" . DA  F 3 2   ? -18.797 19.178 -6.368  1.00 95.06  ? 2   DA  I "C5'" 1 
ATOM   2399 C  "C4'" . DA  F 3 2   ? -18.303 18.931 -7.792  1.00 92.96  ? 2   DA  I "C4'" 1 
ATOM   2400 O  "O4'" . DA  F 3 2   ? -18.339 20.165 -8.556  1.00 87.74  ? 2   DA  I "O4'" 1 
ATOM   2401 C  "C3'" . DA  F 3 2   ? -16.877 18.418 -7.915  1.00 91.80  ? 2   DA  I "C3'" 1 
ATOM   2402 O  "O3'" . DA  F 3 2   ? -16.769 17.586 -9.070  1.00 88.74  ? 2   DA  I "O3'" 1 
ATOM   2403 C  "C2'" . DA  F 3 2   ? -16.067 19.710 -8.059  1.00 91.51  ? 2   DA  I "C2'" 1 
ATOM   2404 C  "C1'" . DA  F 3 2   ? -17.023 20.611 -8.842  1.00 83.33  ? 2   DA  I "C1'" 1 
ATOM   2405 N  N9    . DA  F 3 2   ? -16.937 22.026 -8.481  1.00 66.98  ? 2   DA  I N9    1 
ATOM   2406 C  C8    . DA  F 3 2   ? -16.766 22.556 -7.228  1.00 58.93  ? 2   DA  I C8    1 
ATOM   2407 N  N7    . DA  F 3 2   ? -16.754 23.872 -7.203  1.00 55.00  ? 2   DA  I N7    1 
ATOM   2408 C  C5    . DA  F 3 2   ? -16.953 24.230 -8.535  1.00 58.14  ? 2   DA  I C5    1 
ATOM   2409 C  C6    . DA  F 3 2   ? -17.049 25.485 -9.189  1.00 53.77  ? 2   DA  I C6    1 
ATOM   2410 N  N6    . DA  F 3 2   ? -16.950 26.666 -8.555  1.00 48.01  ? 2   DA  I N6    1 
ATOM   2411 N  N1    . DA  F 3 2   ? -17.243 25.478 -10.529 1.00 58.20  ? 2   DA  I N1    1 
ATOM   2412 C  C2    . DA  F 3 2   ? -17.334 24.305 -11.165 1.00 62.81  ? 2   DA  I C2    1 
ATOM   2413 N  N3    . DA  F 3 2   ? -17.269 23.071 -10.662 1.00 67.15  ? 2   DA  I N3    1 
ATOM   2414 C  C4    . DA  F 3 2   ? -17.070 23.103 -9.332  1.00 65.57  ? 2   DA  I C4    1 
ATOM   2415 P  P     . DG  F 3 3   ? -15.346 17.001 -9.529  1.00 113.41 ? 3   DG  I P     1 
ATOM   2416 O  OP1   . DG  F 3 3   ? -15.651 15.637 -10.020 1.00 110.10 ? 3   DG  I OP1   1 
ATOM   2417 O  OP2   . DG  F 3 3   ? -14.357 17.203 -8.442  1.00 113.54 ? 3   DG  I OP2   1 
ATOM   2418 O  "O5'" . DG  F 3 3   ? -14.904 17.943 -10.750 1.00 89.71  ? 3   DG  I "O5'" 1 
ATOM   2419 C  "C5'" . DG  F 3 3   ? -15.709 17.997 -11.929 1.00 87.22  ? 3   DG  I "C5'" 1 
ATOM   2420 C  "C4'" . DG  F 3 3   ? -15.072 18.862 -13.012 1.00 81.32  ? 3   DG  I "C4'" 1 
ATOM   2421 O  "O4'" . DG  F 3 3   ? -15.124 20.254 -12.620 1.00 76.78  ? 3   DG  I "O4'" 1 
ATOM   2422 C  "C3'" . DG  F 3 3   ? -13.606 18.569 -13.352 1.00 80.15  ? 3   DG  I "C3'" 1 
ATOM   2423 O  "O3'" . DG  F 3 3   ? -13.423 18.699 -14.770 1.00 80.11  ? 3   DG  I "O3'" 1 
ATOM   2424 C  "C2'" . DG  F 3 3   ? -12.846 19.644 -12.566 1.00 75.40  ? 3   DG  I "C2'" 1 
ATOM   2425 C  "C1'" . DG  F 3 3   ? -13.824 20.814 -12.615 1.00 75.15  ? 3   DG  I "C1'" 1 
ATOM   2426 N  N9    . DG  F 3 3   ? -13.738 21.730 -11.478 1.00 67.29  ? 3   DG  I N9    1 
ATOM   2427 C  C8    . DG  F 3 3   ? -13.699 21.405 -10.144 1.00 61.06  ? 3   DG  I C8    1 
ATOM   2428 N  N7    . DG  F 3 3   ? -13.662 22.447 -9.354  1.00 54.10  ? 3   DG  I N7    1 
ATOM   2429 C  C5    . DG  F 3 3   ? -13.695 23.533 -10.220 1.00 56.23  ? 3   DG  I C5    1 
ATOM   2430 C  C6    . DG  F 3 3   ? -13.668 24.930 -9.956  1.00 49.23  ? 3   DG  I C6    1 
ATOM   2431 O  O6    . DG  F 3 3   ? -13.614 25.518 -8.871  1.00 51.49  ? 3   DG  I O6    1 
ATOM   2432 N  N1    . DG  F 3 3   ? -13.713 25.672 -11.121 1.00 46.67  ? 3   DG  I N1    1 
ATOM   2433 C  C2    . DG  F 3 3   ? -13.766 25.156 -12.380 1.00 55.36  ? 3   DG  I C2    1 
ATOM   2434 N  N2    . DG  F 3 3   ? -13.801 26.051 -13.368 1.00 68.74  ? 3   DG  I N2    1 
ATOM   2435 N  N3    . DG  F 3 3   ? -13.788 23.860 -12.658 1.00 59.67  ? 3   DG  I N3    1 
ATOM   2436 C  C4    . DG  F 3 3   ? -13.748 23.106 -11.530 1.00 65.51  ? 3   DG  I C4    1 
ATOM   2437 P  P     . DT  F 3 4   ? -11.993 18.453 -15.462 1.00 83.88  ? 4   DT  I P     1 
ATOM   2438 O  OP1   . DT  F 3 4   ? -12.248 17.835 -16.783 1.00 85.60  ? 4   DT  I OP1   1 
ATOM   2439 O  OP2   . DT  F 3 4   ? -11.071 17.808 -14.498 1.00 82.60  ? 4   DT  I OP2   1 
ATOM   2440 O  "O5'" . DT  F 3 4   ? -11.460 19.934 -15.688 1.00 66.14  ? 4   DT  I "O5'" 1 
ATOM   2441 C  "C5'" . DT  F 3 4   ? -12.307 20.884 -16.268 1.00 63.53  ? 4   DT  I "C5'" 1 
ATOM   2442 C  "C4'" . DT  F 3 4   ? -11.645 22.244 -16.311 1.00 67.44  ? 4   DT  I "C4'" 1 
ATOM   2443 O  "O4'" . DT  F 3 4   ? -11.770 22.903 -15.026 1.00 67.46  ? 4   DT  I "O4'" 1 
ATOM   2444 C  "C3'" . DT  F 3 4   ? -10.149 22.237 -16.659 1.00 65.90  ? 4   DT  I "C3'" 1 
ATOM   2445 O  "O3'" . DT  F 3 4   ? -9.935  23.103 -17.785 1.00 65.84  ? 4   DT  I "O3'" 1 
ATOM   2446 C  "C2'" . DT  F 3 4   ? -9.477  22.754 -15.370 1.00 61.31  ? 4   DT  I "C2'" 1 
ATOM   2447 C  "C1'" . DT  F 3 4   ? -10.585 23.606 -14.766 1.00 61.48  ? 4   DT  I "C1'" 1 
ATOM   2448 N  N1    . DT  F 3 4   ? -10.497 23.833 -13.281 1.00 53.77  ? 4   DT  I N1    1 
ATOM   2449 C  C2    . DT  F 3 4   ? -10.542 25.135 -12.779 1.00 50.45  ? 4   DT  I C2    1 
ATOM   2450 O  O2    . DT  F 3 4   ? -10.600 26.134 -13.466 1.00 49.52  ? 4   DT  I O2    1 
ATOM   2451 N  N3    . DT  F 3 4   ? -10.491 25.227 -11.434 1.00 47.47  ? 4   DT  I N3    1 
ATOM   2452 C  C4    . DT  F 3 4   ? -10.424 24.201 -10.532 1.00 46.05  ? 4   DT  I C4    1 
ATOM   2453 O  O4    . DT  F 3 4   ? -10.397 24.417 -9.328  1.00 46.90  ? 4   DT  I O4    1 
ATOM   2454 C  C5    . DT  F 3 4   ? -10.400 22.861 -11.102 1.00 51.67  ? 4   DT  I C5    1 
ATOM   2455 C  C7    . DT  F 3 4   ? -10.330 21.649 -10.202 1.00 59.00  ? 4   DT  I C7    1 
ATOM   2456 C  C6    . DT  F 3 4   ? -10.449 22.745 -12.437 1.00 43.27  ? 4   DT  I C6    1 
ATOM   2457 P  P     . DT  F 3 5   ? -8.477  23.344 -18.420 1.00 67.92  ? 5   DT  I P     1 
ATOM   2458 O  OP1   . DT  F 3 5   ? -8.625  23.416 -19.883 1.00 77.98  ? 5   DT  I OP1   1 
ATOM   2459 O  OP2   . DT  F 3 5   ? -7.500  22.380 -17.877 1.00 65.67  ? 5   DT  I OP2   1 
ATOM   2460 O  "O5'" . DT  F 3 5   ? -8.146  24.805 -17.910 1.00 53.14  ? 5   DT  I "O5'" 1 
ATOM   2461 C  "C5'" . DT  F 3 5   ? -9.171  25.776 -17.895 1.00 49.58  ? 5   DT  I "C5'" 1 
ATOM   2462 C  "C4'" . DT  F 3 5   ? -8.658  27.080 -17.317 1.00 57.69  ? 5   DT  I "C4'" 1 
ATOM   2463 O  "O4'" . DT  F 3 5   ? -8.654  26.998 -15.869 1.00 46.22  ? 5   DT  I "O4'" 1 
ATOM   2464 C  "C3'" . DT  F 3 5   ? -7.227  27.467 -17.746 1.00 61.70  ? 5   DT  I "C3'" 1 
ATOM   2465 O  "O3'" . DT  F 3 5   ? -7.204  28.864 -18.171 1.00 57.35  ? 5   DT  I "O3'" 1 
ATOM   2466 C  "C2'" . DT  F 3 5   ? -6.381  27.198 -16.474 1.00 40.19  ? 5   DT  I "C2'" 1 
ATOM   2467 C  "C1'" . DT  F 3 5   ? -7.409  27.457 -15.369 1.00 49.48  ? 5   DT  I "C1'" 1 
ATOM   2468 N  N1    . DT  F 3 5   ? -7.183  26.739 -14.089 1.00 50.35  ? 5   DT  I N1    1 
ATOM   2469 C  C2    . DT  F 3 5   ? -7.205  27.452 -12.916 1.00 49.01  ? 5   DT  I C2    1 
ATOM   2470 O  O2    . DT  F 3 5   ? -7.333  28.668 -12.872 1.00 48.46  ? 5   DT  I O2    1 
ATOM   2471 N  N3    . DT  F 3 5   ? -7.064  26.692 -11.784 1.00 45.61  ? 5   DT  I N3    1 
ATOM   2472 C  C4    . DT  F 3 5   ? -6.910  25.321 -11.709 1.00 51.57  ? 5   DT  I C4    1 
ATOM   2473 O  O4    . DT  F 3 5   ? -6.776  24.727 -10.641 1.00 58.90  ? 5   DT  I O4    1 
ATOM   2474 C  C5    . DT  F 3 5   ? -6.918  24.633 -12.970 1.00 47.78  ? 5   DT  I C5    1 
ATOM   2475 C  C7    . DT  F 3 5   ? -6.756  23.146 -13.004 1.00 48.95  ? 5   DT  I C7    1 
ATOM   2476 C  C6    . DT  F 3 5   ? -7.065  25.363 -14.089 1.00 50.14  ? 5   DT  I C6    1 
ATOM   2477 P  P     . DT  F 3 6   ? -5.825  29.619 -18.547 1.00 61.91  ? 6   DT  I P     1 
ATOM   2478 O  OP1   . DT  F 3 6   ? -6.117  30.702 -19.498 1.00 70.10  ? 6   DT  I OP1   1 
ATOM   2479 O  OP2   . DT  F 3 6   ? -4.747  28.651 -18.866 1.00 53.01  ? 6   DT  I OP2   1 
ATOM   2480 O  "O5'" . DT  F 3 6   ? -5.471  30.360 -17.202 1.00 58.60  ? 6   DT  I "O5'" 1 
ATOM   2481 C  "C5'" . DT  F 3 6   ? -6.408  31.215 -16.619 1.00 38.92  ? 6   DT  I "C5'" 1 
ATOM   2482 C  "C4'" . DT  F 3 6   ? -5.825  31.796 -15.363 1.00 40.81  ? 6   DT  I "C4'" 1 
ATOM   2483 O  "O4'" . DT  F 3 6   ? -5.627  30.740 -14.396 1.00 34.34  ? 6   DT  I "O4'" 1 
ATOM   2484 C  "C3'" . DT  F 3 6   ? -4.451  32.469 -15.537 1.00 47.90  ? 6   DT  I "C3'" 1 
ATOM   2485 O  "O3'" . DT  F 3 6   ? -4.540  33.732 -14.978 1.00 43.84  ? 6   DT  I "O3'" 1 
ATOM   2486 C  "C2'" . DT  F 3 6   ? -3.471  31.551 -14.755 1.00 31.50  ? 6   DT  I "C2'" 1 
ATOM   2487 C  "C1'" . DT  F 3 6   ? -4.418  30.949 -13.716 1.00 36.04  ? 6   DT  I "C1'" 1 
ATOM   2488 N  N1    . DT  F 3 6   ? -4.041  29.640 -13.126 1.00 37.96  ? 6   DT  I N1    1 
ATOM   2489 C  C2    . DT  F 3 6   ? -3.994  29.521 -11.752 1.00 40.97  ? 6   DT  I C2    1 
ATOM   2490 O  O2    . DT  F 3 6   ? -4.162  30.452 -11.000 1.00 44.63  ? 6   DT  I O2    1 
ATOM   2491 N  N3    . DT  F 3 6   ? -3.714  28.274 -11.293 1.00 33.60  ? 6   DT  I N3    1 
ATOM   2492 C  C4    . DT  F 3 6   ? -3.508  27.141 -12.045 1.00 42.24  ? 6   DT  I C4    1 
ATOM   2493 O  O4    . DT  F 3 6   ? -3.252  26.055 -11.532 1.00 41.89  ? 6   DT  I O4    1 
ATOM   2494 C  C5    . DT  F 3 6   ? -3.592  27.324 -13.487 1.00 41.97  ? 6   DT  I C5    1 
ATOM   2495 C  C7    . DT  F 3 6   ? -3.359  26.164 -14.416 1.00 38.45  ? 6   DT  I C7    1 
ATOM   2496 C  C6    . DT  F 3 6   ? -3.868  28.549 -13.947 1.00 35.13  ? 6   DT  I C6    1 
ATOM   2497 P  P     . DC  F 3 7   ? -3.406  34.820 -15.200 1.00 50.38  ? 7   DC  I P     1 
ATOM   2498 O  OP1   . DC  F 3 7   ? -4.069  36.121 -14.997 1.00 46.75  ? 7   DC  I OP1   1 
ATOM   2499 O  OP2   . DC  F 3 7   ? -2.653  34.467 -16.422 1.00 53.10  ? 7   DC  I OP2   1 
ATOM   2500 O  "O5'" . DC  F 3 7   ? -2.465  34.646 -13.919 1.00 46.60  ? 7   DC  I "O5'" 1 
ATOM   2501 C  "C5'" . DC  F 3 7   ? -3.016  34.842 -12.631 1.00 42.81  ? 7   DC  I "C5'" 1 
ATOM   2502 C  "C4'" . DC  F 3 7   ? -2.077  34.318 -11.568 1.00 47.80  ? 7   DC  I "C4'" 1 
ATOM   2503 O  "O4'" . DC  F 3 7   ? -2.079  32.869 -11.553 1.00 39.11  ? 7   DC  I "O4'" 1 
ATOM   2504 C  "C3'" . DC  F 3 7   ? -0.643  34.722 -11.760 1.00 36.45  ? 7   DC  I "C3'" 1 
ATOM   2505 O  "O3'" . DC  F 3 7   ? -0.433  35.899 -10.997 1.00 44.90  ? 7   DC  I "O3'" 1 
ATOM   2506 C  "C2'" . DC  F 3 7   ? 0.168   33.495 -11.254 1.00 44.32  ? 7   DC  I "C2'" 1 
ATOM   2507 C  "C1'" . DC  F 3 7   ? -0.904  32.439 -10.948 1.00 32.24  ? 7   DC  I "C1'" 1 
ATOM   2508 N  N1    . DC  F 3 7   ? -0.642  31.023 -11.433 1.00 32.74  ? 7   DC  I N1    1 
ATOM   2509 C  C2    . DC  F 3 7   ? -0.648  29.993 -10.498 1.00 33.46  ? 7   DC  I C2    1 
ATOM   2510 O  O2    . DC  F 3 7   ? -0.786  30.283 -9.313  1.00 33.16  ? 7   DC  I O2    1 
ATOM   2511 N  N3    . DC  F 3 7   ? -0.463  28.723 -10.912 1.00 34.51  ? 7   DC  I N3    1 
ATOM   2512 C  C4    . DC  F 3 7   ? -0.328  28.461 -12.206 1.00 40.21  ? 7   DC  I C4    1 
ATOM   2513 N  N4    . DC  F 3 7   ? -0.168  27.184 -12.564 1.00 44.74  ? 7   DC  I N4    1 
ATOM   2514 C  C5    . DC  F 3 7   ? -0.341  29.490 -13.191 1.00 34.12  ? 7   DC  I C5    1 
ATOM   2515 C  C6    . DC  F 3 7   ? -0.518  30.744 -12.761 1.00 38.84  ? 7   DC  I C6    1 
ATOM   2516 P  P     . DA  F 3 8   ? 0.949   36.712 -11.039 1.00 47.16  ? 8   DA  I P     1 
ATOM   2517 O  OP1   . DA  F 3 8   ? 0.610   38.083 -10.612 1.00 33.50  ? 8   DA  I OP1   1 
ATOM   2518 O  OP2   . DA  F 3 8   ? 1.687   36.424 -12.301 1.00 46.94  ? 8   DA  I OP2   1 
ATOM   2519 O  "O5'" . DA  F 3 8   ? 1.777   36.075 -9.856  1.00 41.92  ? 8   DA  I "O5'" 1 
ATOM   2520 C  "C5'" . DA  F 3 8   ? 1.284   36.179 -8.516  1.00 40.21  ? 8   DA  I "C5'" 1 
ATOM   2521 C  "C4'" . DA  F 3 8   ? 2.162   35.399 -7.572  1.00 37.42  ? 8   DA  I "C4'" 1 
ATOM   2522 O  "O4'" . DA  F 3 8   ? 2.052   33.996 -7.886  1.00 35.85  ? 8   DA  I "O4'" 1 
ATOM   2523 C  "C3'" . DA  F 3 8   ? 3.660   35.712 -7.653  1.00 47.64  ? 8   DA  I "C3'" 1 
ATOM   2524 O  "O3'" . DA  F 3 8   ? 4.220   35.442 -6.415  1.00 52.46  ? 8   DA  I "O3'" 1 
ATOM   2525 C  "C2'" . DA  F 3 8   ? 4.133   34.698 -8.671  1.00 32.54  ? 8   DA  I "C2'" 1 
ATOM   2526 C  "C1'" . DA  F 3 8   ? 3.319   33.504 -8.220  1.00 37.30  ? 8   DA  I "C1'" 1 
ATOM   2527 N  N9    . DA  F 3 8   ? 3.184   32.469 -9.222  1.00 34.09  ? 8   DA  I N9    1 
ATOM   2528 C  C8    . DA  F 3 8   ? 3.314   32.598 -10.572 1.00 34.10  ? 8   DA  I C8    1 
ATOM   2529 N  N7    . DA  F 3 8   ? 3.178   31.466 -11.225 1.00 34.24  ? 8   DA  I N7    1 
ATOM   2530 C  C5    . DA  F 3 8   ? 2.977   30.533 -10.221 1.00 34.78  ? 8   DA  I C5    1 
ATOM   2531 C  C6    . DA  F 3 8   ? 2.787   29.137 -10.244 1.00 38.00  ? 8   DA  I C6    1 
ATOM   2532 N  N6    . DA  F 3 8   ? 2.755   28.424 -11.371 1.00 36.57  ? 8   DA  I N6    1 
ATOM   2533 N  N1    . DA  F 3 8   ? 2.615   28.505 -9.058  1.00 36.18  ? 8   DA  I N1    1 
ATOM   2534 C  C2    . DA  F 3 8   ? 2.640   29.232 -7.938  1.00 43.48  ? 8   DA  I C2    1 
ATOM   2535 N  N3    . DA  F 3 8   ? 2.816   30.551 -7.794  1.00 34.71  ? 8   DA  I N3    1 
ATOM   2536 C  C4    . DA  F 3 8   ? 2.981   31.140 -8.984  1.00 34.35  ? 8   DA  I C4    1 
ATOM   2537 P  P     . DA  F 3 9   ? 5.710   35.891 -6.052  1.00 55.44  ? 9   DA  I P     1 
ATOM   2538 O  OP1   . DA  F 3 9   ? 5.663   37.248 -5.470  1.00 54.53  ? 9   DA  I OP1   1 
ATOM   2539 O  OP2   . DA  F 3 9   ? 6.643   35.570 -7.155  1.00 64.71  ? 9   DA  I OP2   1 
ATOM   2540 O  "O5'" . DA  F 3 9   ? 6.061   34.887 -4.888  1.00 54.55  ? 9   DA  I "O5'" 1 
ATOM   2541 C  "C5'" . DA  F 3 9   ? 5.030   34.377 -4.077  1.00 48.50  ? 9   DA  I "C5'" 1 
ATOM   2542 C  "C4'" . DA  F 3 9   ? 5.261   32.910 -3.810  1.00 44.93  ? 9   DA  I "C4'" 1 
ATOM   2543 O  "O4'" . DA  F 3 9   ? 5.001   32.159 -5.027  1.00 45.82  ? 9   DA  I "O4'" 1 
ATOM   2544 C  "C3'" . DA  F 3 9   ? 6.696   32.554 -3.386  1.00 47.70  ? 9   DA  I "C3'" 1 
ATOM   2545 O  "O3'" . DA  F 3 9   ? 6.667   31.705 -2.266  1.00 55.70  ? 9   DA  I "O3'" 1 
ATOM   2546 C  "C2'" . DA  F 3 9   ? 7.275   31.841 -4.613  1.00 50.28  ? 9   DA  I "C2'" 1 
ATOM   2547 C  "C1'" . DA  F 3 9   ? 6.027   31.223 -5.223  1.00 49.28  ? 9   DA  I "C1'" 1 
ATOM   2548 N  N9    . DA  F 3 9   ? 6.159   30.918 -6.640  1.00 50.35  ? 9   DA  I N9    1 
ATOM   2549 C  C8    . DA  F 3 9   ? 6.561   31.764 -7.636  1.00 50.57  ? 9   DA  I C8    1 
ATOM   2550 N  N7    . DA  F 3 9   ? 6.603   31.200 -8.820  1.00 36.35  ? 9   DA  I N7    1 
ATOM   2551 C  C5    . DA  F 3 9   ? 6.214   29.894 -8.587  1.00 37.05  ? 9   DA  I C5    1 
ATOM   2552 C  C6    . DA  F 3 9   ? 6.076   28.783 -9.438  1.00 43.64  ? 9   DA  I C6    1 
ATOM   2553 N  N6    . DA  F 3 9   ? 6.322   28.838 -10.758 1.00 38.39  ? 9   DA  I N6    1 
ATOM   2554 N  N1    . DA  F 3 9   ? 5.674   27.602 -8.880  1.00 40.26  ? 9   DA  I N1    1 
ATOM   2555 C  C2    . DA  F 3 9   ? 5.442   27.566 -7.558  1.00 45.97  ? 9   DA  I C2    1 
ATOM   2556 N  N3    . DA  F 3 9   ? 5.534   28.556 -6.658  1.00 44.89  ? 9   DA  I N3    1 
ATOM   2557 C  C4    . DA  F 3 9   ? 5.939   29.698 -7.245  1.00 46.64  ? 9   DA  I C4    1 
ATOM   2558 P  P     . DA  F 3 10  ? 8.021   31.290 -1.513  1.00 52.51  ? 10  DA  I P     1 
ATOM   2559 O  OP1   . DA  F 3 10  ? 7.715   31.485 -0.088  1.00 58.14  ? 10  DA  I OP1   1 
ATOM   2560 O  OP2   . DA  F 3 10  ? 9.197   31.959 -2.103  1.00 51.95  ? 10  DA  I OP2   1 
ATOM   2561 O  "O5'" . DA  F 3 10  ? 8.196   29.755 -1.861  1.00 50.87  ? 10  DA  I "O5'" 1 
ATOM   2562 C  "C5'" . DA  F 3 10  ? 7.215   28.827 -1.452  1.00 47.70  ? 10  DA  I "C5'" 1 
ATOM   2563 C  "C4'" . DA  F 3 10  ? 7.587   27.439 -1.928  1.00 47.21  ? 10  DA  I "C4'" 1 
ATOM   2564 O  "O4'" . DA  F 3 10  ? 7.548   27.404 -3.381  1.00 43.84  ? 10  DA  I "O4'" 1 
ATOM   2565 C  "C3'" . DA  F 3 10  ? 8.987   26.988 -1.529  1.00 51.51  ? 10  DA  I "C3'" 1 
ATOM   2566 O  "O3'" . DA  F 3 10  ? 8.929   25.647 -1.074  1.00 38.81  ? 10  DA  I "O3'" 1 
ATOM   2567 C  "C2'" . DA  F 3 10  ? 9.804   27.130 -2.828  1.00 39.26  ? 10  DA  I "C2'" 1 
ATOM   2568 C  "C1'" . DA  F 3 10  ? 8.743   26.879 -3.893  1.00 38.49  ? 10  DA  I "C1'" 1 
ATOM   2569 N  N9    . DA  F 3 10  ? 8.993   27.560 -5.158  1.00 36.51  ? 10  DA  I N9    1 
ATOM   2570 C  C8    . DA  F 3 10  ? 9.289   28.874 -5.322  1.00 41.60  ? 10  DA  I C8    1 
ATOM   2571 N  N7    . DA  F 3 10  ? 9.439   29.227 -6.572  1.00 47.27  ? 10  DA  I N7    1 
ATOM   2572 C  C5    . DA  F 3 10  ? 9.217   28.058 -7.280  1.00 43.19  ? 10  DA  I C5    1 
ATOM   2573 C  C6    . DA  F 3 10  ? 9.236   27.767 -8.659  1.00 41.59  ? 10  DA  I C6    1 
ATOM   2574 N  N6    . DA  F 3 10  ? 9.502   28.677 -9.583  1.00 34.78  ? 10  DA  I N6    1 
ATOM   2575 N  N1    . DA  F 3 10  ? 8.966   26.490 -9.039  1.00 35.76  ? 10  DA  I N1    1 
ATOM   2576 C  C2    . DA  F 3 10  ? 8.713   25.579 -8.089  1.00 34.11  ? 10  DA  I C2    1 
ATOM   2577 N  N3    . DA  F 3 10  ? 8.663   25.750 -6.772  1.00 39.50  ? 10  DA  I N3    1 
ATOM   2578 C  C4    . DA  F 3 10  ? 8.930   27.021 -6.429  1.00 37.81  ? 10  DA  I C4    1 
ATOM   2579 P  P     . DC  F 3 11  ? 10.216  24.973 -0.422  1.00 44.20  ? 11  DC  I P     1 
ATOM   2580 O  OP1   . DC  F 3 11  ? 9.795   23.902 0.513   1.00 67.23  ? 11  DC  I OP1   1 
ATOM   2581 O  OP2   . DC  F 3 11  ? 11.049  26.058 0.111   1.00 53.58  ? 11  DC  I OP2   1 
ATOM   2582 O  "O5'" . DC  F 3 11  ? 10.895  24.262 -1.667  1.00 45.02  ? 11  DC  I "O5'" 1 
ATOM   2583 C  "C5'" . DC  F 3 11  ? 10.105  23.421 -2.428  1.00 39.72  ? 11  DC  I "C5'" 1 
ATOM   2584 C  "C4'" . DC  F 3 11  ? 10.756  23.082 -3.740  1.00 49.68  ? 11  DC  I "C4'" 1 
ATOM   2585 O  "O4'" . DC  F 3 11  ? 10.814  24.244 -4.600  1.00 52.37  ? 11  DC  I "O4'" 1 
ATOM   2586 C  "C3'" . DC  F 3 11  ? 12.182  22.575 -3.658  1.00 42.31  ? 11  DC  I "C3'" 1 
ATOM   2587 O  "O3'" . DC  F 3 11  ? 12.163  21.166 -3.837  1.00 52.14  ? 11  DC  I "O3'" 1 
ATOM   2588 C  "C2'" . DC  F 3 11  ? 12.911  23.310 -4.832  1.00 67.37  ? 11  DC  I "C2'" 1 
ATOM   2589 C  "C1'" . DC  F 3 11  ? 11.745  23.942 -5.593  1.00 55.51  ? 11  DC  I "C1'" 1 
ATOM   2590 N  N1    . DC  F 3 11  ? 12.053  25.193 -6.376  1.00 48.61  ? 11  DC  I N1    1 
ATOM   2591 C  C2    . DC  F 3 11  ? 11.999  25.155 -7.779  1.00 51.99  ? 11  DC  I C2    1 
ATOM   2592 O  O2    . DC  F 3 11  ? 11.745  24.086 -8.342  1.00 50.88  ? 11  DC  I O2    1 
ATOM   2593 N  N3    . DC  F 3 11  ? 12.237  26.290 -8.487  1.00 53.27  ? 11  DC  I N3    1 
ATOM   2594 C  C4    . DC  F 3 11  ? 12.520  27.421 -7.850  1.00 57.23  ? 11  DC  I C4    1 
ATOM   2595 N  N4    . DC  F 3 11  ? 12.760  28.513 -8.595  1.00 56.82  ? 11  DC  I N4    1 
ATOM   2596 C  C5    . DC  F 3 11  ? 12.560  27.486 -6.417  1.00 50.73  ? 11  DC  I C5    1 
ATOM   2597 C  C6    . DC  F 3 11  ? 12.314  26.359 -5.730  1.00 46.80  ? 11  DC  I C6    1 
ATOM   2598 P  P     . DT  F 3 12  ? 13.501  20.311 -3.585  1.00 67.53  ? 12  DT  I P     1 
ATOM   2599 O  OP1   . DT  F 3 12  ? 13.136  19.011 -2.966  1.00 68.05  ? 12  DT  I OP1   1 
ATOM   2600 O  OP2   . DT  F 3 12  ? 14.425  21.238 -2.887  1.00 58.85  ? 12  DT  I OP2   1 
ATOM   2601 O  "O5'" . DT  F 3 12  ? 14.048  20.026 -5.063  1.00 71.67  ? 12  DT  I "O5'" 1 
ATOM   2602 C  "C5'" . DT  F 3 12  ? 13.139  19.654 -6.086  1.00 65.81  ? 12  DT  I "C5'" 1 
ATOM   2603 C  "C4'" . DT  F 3 12  ? 13.777  19.788 -7.452  1.00 65.24  ? 12  DT  I "C4'" 1 
ATOM   2604 O  "O4'" . DT  F 3 12  ? 13.759  21.175 -7.864  1.00 65.46  ? 12  DT  I "O4'" 1 
ATOM   2605 C  "C3'" . DT  F 3 12  ? 15.237  19.334 -7.532  1.00 65.31  ? 12  DT  I "C3'" 1 
ATOM   2606 O  "O3'" . DT  F 3 12  ? 15.382  18.347 -8.558  1.00 66.09  ? 12  DT  I "O3'" 1 
ATOM   2607 C  "C2'" . DT  F 3 12  ? 16.011  20.624 -7.858  1.00 64.26  ? 12  DT  I "C2'" 1 
ATOM   2608 C  "C1'" . DT  F 3 12  ? 14.946  21.457 -8.551  1.00 55.07  ? 12  DT  I "C1'" 1 
ATOM   2609 N  N1    . DT  F 3 12  ? 15.182  22.927 -8.503  1.00 50.83  ? 12  DT  I N1    1 
ATOM   2610 C  C2    . DT  F 3 12  ? 15.200  23.639 -9.683  1.00 61.37  ? 12  DT  I C2    1 
ATOM   2611 O  O2    . DT  F 3 12  ? 15.041  23.122 -10.773 1.00 71.71  ? 12  DT  I O2    1 
ATOM   2612 N  N3    . DT  F 3 12  ? 15.428  24.987 -9.547  1.00 54.66  ? 12  DT  I N3    1 
ATOM   2613 C  C4    . DT  F 3 12  ? 15.612  25.689 -8.370  1.00 53.51  ? 12  DT  I C4    1 
ATOM   2614 O  O4    . DT  F 3 12  ? 15.784  26.908 -8.347  1.00 45.97  ? 12  DT  I O4    1 
ATOM   2615 C  C5    . DT  F 3 12  ? 15.568  24.887 -7.163  1.00 54.29  ? 12  DT  I C5    1 
ATOM   2616 C  C7    . DT  F 3 12  ? 15.755  25.542 -5.824  1.00 53.29  ? 12  DT  I C7    1 
ATOM   2617 C  C6    . DT  F 3 12  ? 15.358  23.557 -7.288  1.00 48.19  ? 12  DT  I C6    1 
ATOM   2618 P  P     . DC  F 3 13  ? 16.741  17.500 -8.682  1.00 82.05  ? 13  DC  I P     1 
ATOM   2619 O  OP1   . DC  F 3 13  ? 16.388  16.141 -9.140  1.00 85.73  ? 13  DC  I OP1   1 
ATOM   2620 O  OP2   . DC  F 3 13  ? 17.492  17.690 -7.423  1.00 84.76  ? 13  DC  I OP2   1 
ATOM   2621 O  "O5'" . DC  F 3 13  ? 17.532  18.210 -9.884  1.00 89.11  ? 13  DC  I "O5'" 1 
ATOM   2622 C  "C5'" . DC  F 3 13  ? 16.898  18.350 -11.143 1.00 85.04  ? 13  DC  I "C5'" 1 
ATOM   2623 C  "C4'" . DC  F 3 13  ? 17.683  19.264 -12.052 1.00 81.95  ? 13  DC  I "C4'" 1 
ATOM   2624 O  "O4'" . DC  F 3 13  ? 17.507  20.630 -11.612 1.00 79.84  ? 13  DC  I "O4'" 1 
ATOM   2625 C  "C3'" . DC  F 3 13  ? 19.191  19.001 -12.079 1.00 92.49  ? 13  DC  I "C3'" 1 
ATOM   2626 O  "O3'" . DC  F 3 13  ? 19.618  18.708 -13.413 1.00 96.08  ? 13  DC  I "O3'" 1 
ATOM   2627 C  "C2'" . DC  F 3 13  ? 19.817  20.300 -11.551 1.00 94.00  ? 13  DC  I "C2'" 1 
ATOM   2628 C  "C1'" . DC  F 3 13  ? 18.713  21.329 -11.778 1.00 88.15  ? 13  DC  I "C1'" 1 
ATOM   2629 N  N1    . DC  F 3 13  ? 18.752  22.479 -10.796 1.00 82.64  ? 13  DC  I N1    1 
ATOM   2630 C  C2    . DC  F 3 13  ? 18.740  23.798 -11.270 1.00 71.04  ? 13  DC  I C2    1 
ATOM   2631 O  O2    . DC  F 3 13  ? 18.662  24.002 -12.489 1.00 70.88  ? 13  DC  I O2    1 
ATOM   2632 N  N3    . DC  F 3 13  ? 18.781  24.819 -10.376 1.00 62.42  ? 13  DC  I N3    1 
ATOM   2633 C  C4    . DC  F 3 13  ? 18.863  24.565 -9.069  1.00 63.67  ? 13  DC  I C4    1 
ATOM   2634 N  N4    . DC  F 3 13  ? 18.905  25.608 -8.230  1.00 55.83  ? 13  DC  I N4    1 
ATOM   2635 C  C5    . DC  F 3 13  ? 18.885  23.229 -8.563  1.00 73.24  ? 13  DC  I C5    1 
ATOM   2636 C  C6    . DC  F 3 13  ? 18.835  22.227 -9.453  1.00 80.20  ? 13  DC  I C6    1 
HETATM 2637 ZN ZN    . ZN  G 4 .   ? 2.316   41.600 -6.120  1.00 48.37  ? 701 ZN  A ZN    1 
HETATM 2638 ZN ZN    . ZN  H 4 .   ? 2.952   45.117 -6.771  1.00 51.73  ? 702 ZN  A ZN    1 
HETATM 2639 ZN ZN    . ZN  I 4 .   ? 4.340   43.680 -3.714  1.00 54.89  ? 703 ZN  A ZN    1 
HETATM 2640 ZN ZN    . ZN  J 4 .   ? -0.665  20.664 3.498   1.00 45.81  ? 704 ZN  A ZN    1 
HETATM 2641 ZN ZN    . ZN  K 4 .   ? -1.477  17.916 5.749   1.00 46.83  ? 705 ZN  A ZN    1 
HETATM 2642 ZN ZN    . ZN  L 4 .   ? -2.705  21.451 6.464   1.00 55.40  ? 706 ZN  A ZN    1 
HETATM 2643 ZN ZN    . ZN  M 4 .   ? -17.348 51.060 16.362  1.00 42.40  ? 701 ZN  B ZN    1 
HETATM 2644 ZN ZN    . ZN  N 4 .   ? -18.108 52.038 12.979  1.00 45.40  ? 702 ZN  B ZN    1 
HETATM 2645 ZN ZN    . ZN  O 4 .   ? -19.606 48.860 14.224  1.00 53.65  ? 703 ZN  B ZN    1 
HETATM 2646 ZN ZN    . ZN  P 4 .   ? -13.926 40.474 36.711  1.00 49.31  ? 704 ZN  B ZN    1 
HETATM 2647 ZN ZN    . ZN  Q 4 .   ? -13.015 38.323 39.502  1.00 50.85  ? 705 ZN  B ZN    1 
HETATM 2648 ZN ZN    . ZN  R 4 .   ? -11.946 37.510 35.982  1.00 53.16  ? 706 ZN  B ZN    1 
HETATM 2649 O  O     . HOH S 5 .   ? -15.408 45.593 -7.180  1.00 42.72  ? 801 HOH A O     1 
HETATM 2650 O  O     . HOH S 5 .   ? 10.999  20.427 3.361   1.00 53.82  ? 802 HOH A O     1 
HETATM 2651 O  O     . HOH S 5 .   ? 0.583   27.231 -1.462  1.00 37.75  ? 803 HOH A O     1 
HETATM 2652 O  O     . HOH S 5 .   ? 1.029   33.297 -3.988  1.00 45.32  ? 804 HOH A O     1 
HETATM 2653 O  O     . HOH S 5 .   ? 0.957   50.355 -15.042 1.00 53.20  ? 805 HOH A O     1 
HETATM 2654 O  O     . HOH S 5 .   ? -7.443  35.944 6.014   1.00 68.47  ? 806 HOH A O     1 
HETATM 2655 O  O     . HOH S 5 .   ? 1.425   23.614 15.716  1.00 50.60  ? 807 HOH A O     1 
HETATM 2656 O  O     . HOH S 5 .   ? -4.781  20.246 -6.453  1.00 56.54  ? 808 HOH A O     1 
HETATM 2657 O  O     . HOH S 5 .   ? 2.691   28.655 -1.530  1.00 38.89  ? 809 HOH A O     1 
HETATM 2658 O  O     . HOH T 5 .   ? -9.086  47.855 37.235  1.00 47.80  ? 801 HOH B O     1 
HETATM 2659 O  O     . HOH T 5 .   ? -21.260 55.928 22.081  1.00 58.90  ? 802 HOH B O     1 
HETATM 2660 O  O     . HOH T 5 .   ? -25.624 40.651 37.110  1.00 49.18  ? 803 HOH B O     1 
HETATM 2661 O  O     . HOH T 5 .   ? -13.274 42.773 32.505  1.00 36.27  ? 804 HOH B O     1 
HETATM 2662 O  O     . HOH T 5 .   ? -2.748  50.518 24.127  1.00 45.26  ? 805 HOH B O     1 
HETATM 2663 O  O     . HOH T 5 .   ? -20.576 60.086 10.327  1.00 43.38  ? 806 HOH B O     1 
HETATM 2664 O  O     . HOH T 5 .   ? -7.917  45.564 40.139  1.00 57.34  ? 807 HOH B O     1 
HETATM 2665 O  O     . HOH T 5 .   ? -9.353  59.464 17.986  1.00 67.05  ? 808 HOH B O     1 
HETATM 2666 O  O     . HOH T 5 .   ? -15.190 45.787 30.356  1.00 39.21  ? 809 HOH B O     1 
HETATM 2667 O  O     . HOH T 5 .   ? -2.672  37.338 39.161  1.00 53.23  ? 810 HOH B O     1 
HETATM 2668 O  O     . HOH T 5 .   ? -16.150 60.681 8.006   1.00 47.19  ? 811 HOH B O     1 
HETATM 2669 O  O     . HOH T 5 .   ? -20.062 24.481 43.822  1.00 75.79  ? 812 HOH B O     1 
HETATM 2670 O  O     . HOH T 5 .   ? -17.707 45.879 29.589  1.00 40.04  ? 813 HOH B O     1 
HETATM 2671 O  O     . HOH T 5 .   ? -5.240  48.278 41.014  1.00 58.27  ? 814 HOH B O     1 
HETATM 2672 O  O     . HOH T 5 .   ? -10.514 50.409 37.494  1.00 35.53  ? 815 HOH B O     1 
HETATM 2673 O  O     . HOH U 5 .   ? -13.713 48.249 30.036  1.00 31.65  ? 101 HOH C O     1 
HETATM 2674 O  O     . HOH U 5 .   ? -12.002 43.901 25.261  1.00 58.53  ? 102 HOH C O     1 
HETATM 2675 O  O     . HOH U 5 .   ? -16.705 48.147 31.765  1.00 38.78  ? 103 HOH C O     1 
HETATM 2676 O  O     . HOH U 5 .   ? -28.304 57.873 25.464  1.00 58.07  ? 104 HOH C O     1 
HETATM 2677 O  O     . HOH V 5 .   ? -20.073 44.303 26.223  1.00 56.31  ? 101 HOH D O     1 
HETATM 2678 O  O     . HOH V 5 .   ? -12.285 56.571 34.394  1.00 43.95  ? 102 HOH D O     1 
HETATM 2679 O  O     . HOH V 5 .   ? -23.445 53.631 23.539  1.00 54.98  ? 103 HOH D O     1 
HETATM 2680 O  O     . HOH V 5 .   ? -6.126  58.110 27.264  1.00 50.09  ? 104 HOH D O     1 
HETATM 2681 O  O     . HOH V 5 .   ? -14.663 52.108 25.608  1.00 39.84  ? 105 HOH D O     1 
HETATM 2682 O  O     . HOH V 5 .   ? -15.261 59.427 31.456  1.00 42.55  ? 106 HOH D O     1 
HETATM 2683 O  O     . HOH V 5 .   ? -18.794 58.203 30.553  1.00 65.30  ? 107 HOH D O     1 
HETATM 2684 O  O     . HOH V 5 .   ? -21.609 55.912 26.027  1.00 51.46  ? 108 HOH D O     1 
HETATM 2685 O  O     . HOH V 5 .   ? -18.421 58.627 27.606  1.00 44.55  ? 109 HOH D O     1 
HETATM 2686 O  O     . HOH V 5 .   ? -17.144 49.745 26.578  1.00 42.01  ? 110 HOH D O     1 
HETATM 2687 O  O     . HOH V 5 .   ? -1.405  50.460 34.254  1.00 56.09  ? 111 HOH D O     1 
HETATM 2688 O  O     . HOH V 5 .   ? -5.990  51.010 34.235  1.00 50.63  ? 112 HOH D O     1 
HETATM 2689 O  O     . HOH W 5 .   ? 10.483  21.729 -9.027  1.00 55.96  ? 101 HOH H O     1 
HETATM 2690 O  O     . HOH W 5 .   ? 1.411   24.790 -13.840 1.00 39.88  ? 102 HOH H O     1 
HETATM 2691 O  O     . HOH W 5 .   ? -5.112  23.383 -6.895  1.00 42.47  ? 103 HOH H O     1 
HETATM 2692 O  O     . HOH W 5 .   ? -0.922  27.646 -3.990  1.00 29.13  ? 104 HOH H O     1 
HETATM 2693 O  O     . HOH W 5 .   ? -2.978  33.414 0.921   1.00 57.23  ? 105 HOH H O     1 
HETATM 2694 O  O     . HOH W 5 .   ? -9.438  38.875 -14.355 1.00 53.88  ? 106 HOH H O     1 
HETATM 2695 O  O     . HOH W 5 .   ? 2.005   25.617 -3.951  1.00 34.60  ? 107 HOH H O     1 
HETATM 2696 O  O     . HOH W 5 .   ? -6.161  22.071 -3.883  1.00 55.36  ? 108 HOH H O     1 
HETATM 2697 O  O     . HOH W 5 .   ? -12.172 33.277 -4.856  1.00 51.09  ? 109 HOH H O     1 
HETATM 2698 O  O     . HOH W 5 .   ? 1.506   29.511 -3.871  1.00 40.09  ? 110 HOH H O     1 
HETATM 2699 O  O     . HOH X 5 .   ? 0.569   26.868 -14.879 1.00 46.14  ? 101 HOH I O     1 
HETATM 2700 O  O     . HOH X 5 .   ? -2.571  23.499 -11.934 1.00 46.82  ? 102 HOH I O     1 
HETATM 2701 O  O     . HOH X 5 .   ? 2.146   31.455 -5.280  1.00 39.66  ? 103 HOH I O     1 
HETATM 2702 O  O     . HOH X 5 .   ? -5.553  22.384 -9.430  1.00 44.17  ? 104 HOH I O     1 
HETATM 2703 O  O     . HOH X 5 .   ? 6.934   31.914 -11.768 1.00 48.71  ? 105 HOH I O     1 
HETATM 2704 O  O     . HOH X 5 .   ? 10.458  31.864 -9.100  1.00 55.51  ? 106 HOH I O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
6    N N     . LYS A 12  ? 1.0538 0.9491 1.1247 -0.0832 -0.0613 0.0244  523 LYS A N     
7    C CA    . LYS A 12  ? 0.8933 0.7756 0.9844 -0.0889 -0.0526 0.0228  523 LYS A CA    
8    C C     . LYS A 12  ? 1.0182 0.8929 1.0944 -0.0861 -0.0439 0.0139  523 LYS A C     
9    O O     . LYS A 12  ? 1.1206 1.0046 1.1786 -0.0826 -0.0432 0.0116  523 LYS A O     
10   C CB    . LYS A 12  ? 0.8546 0.7460 0.9703 -0.0958 -0.0509 0.0303  523 LYS A CB    
11   C CG    . LYS A 12  ? 1.0012 0.9051 1.1306 -0.0985 -0.0598 0.0407  523 LYS A CG    
12   C CD    . LYS A 12  ? 1.0414 0.9648 1.1526 -0.0940 -0.0670 0.0448  523 LYS A CD    
13   C CE    . LYS A 12  ? 1.0543 0.9895 1.1771 -0.0959 -0.0761 0.0546  523 LYS A CE    
14   N NZ    . LYS A 12  ? 1.1326 1.0849 1.2325 -0.0895 -0.0837 0.0565  523 LYS A NZ    
15   N N     . PRO A 13  ? 0.9801 0.8382 1.0638 -0.0876 -0.0374 0.0090  524 PRO A N     
16   C CA    . PRO A 13  ? 0.9252 0.7752 0.9945 -0.0847 -0.0292 0.0005  524 PRO A CA    
17   C C     . PRO A 13  ? 0.8537 0.7096 0.9266 -0.0871 -0.0218 -0.0011 524 PRO A C     
18   O O     . PRO A 13  ? 0.8742 0.7314 0.9704 -0.0928 -0.0192 0.0025  524 PRO A O     
19   C CB    . PRO A 13  ? 0.9520 0.7849 1.0346 -0.0869 -0.0247 -0.0019 524 PRO A CB    
20   C CG    . PRO A 13  ? 0.9367 0.7700 1.0470 -0.0930 -0.0273 0.0054  524 PRO A CG    
21   C CD    . PRO A 13  ? 0.9536 0.8004 1.0599 -0.0920 -0.0375 0.0117  524 PRO A CD    
22   N N     . CYS A 14  ? 0.7993 0.6586 0.8501 -0.0827 -0.0188 -0.0065 525 CYS A N     
23   C CA    . CYS A 14  ? 0.6322 0.4957 0.6843 -0.0843 -0.0115 -0.0094 525 CYS A CA    
24   C C     . CYS A 14  ? 0.7596 0.6092 0.8169 -0.0853 -0.0020 -0.0161 525 CYS A C     
25   O O     . CYS A 14  ? 0.8467 0.6850 0.8989 -0.0832 -0.0012 -0.0189 525 CYS A O     
26   C CB    . CYS A 14  ? 0.4794 0.3527 0.5055 -0.0791 -0.0124 -0.0122 525 CYS A CB    
27   S SG    . CYS A 14  ? 0.5883 0.4504 0.5872 -0.0724 -0.0087 -0.0216 525 CYS A SG    
28   N N     . ASN A 15  ? 0.7530 0.6038 0.8207 -0.0882 0.0051  -0.0186 526 ASN A N     
29   C CA    . ASN A 15  ? 0.6693 0.5088 0.7404 -0.0885 0.0146  -0.0255 526 ASN A CA    
30   C C     . ASN A 15  ? 0.7298 0.5733 0.7878 -0.0864 0.0210  -0.0319 526 ASN A C     
31   O O     . ASN A 15  ? 0.7876 0.6271 0.8555 -0.0883 0.0288  -0.0366 526 ASN A O     
32   C CB    . ASN A 15  ? 0.7124 0.5471 0.8135 -0.0943 0.0181  -0.0237 526 ASN A CB    
33   C CG    . ASN A 15  ? 0.9027 0.7344 1.0192 -0.0970 0.0115  -0.0166 526 ASN A CG    
34   O OD1   . ASN A 15  ? 1.0103 0.8310 1.1299 -0.0966 0.0125  -0.0172 526 ASN A OD1   
35   N ND2   . ASN A 15  ? 0.8879 0.7297 1.0147 -0.0998 0.0045  -0.0092 526 ASN A ND2   
36   N N     . CYS A 16  ? 0.6998 0.5520 0.7360 -0.0826 0.0175  -0.0321 527 CYS A N     
37   C CA    . CYS A 16  ? 0.7421 0.5989 0.7636 -0.0802 0.0225  -0.0378 527 CYS A CA    
38   C C     . CYS A 16  ? 0.8132 0.6597 0.8245 -0.0776 0.0311  -0.0460 527 CYS A C     
39   O O     . CYS A 16  ? 0.8193 0.6566 0.8247 -0.0755 0.0314  -0.0470 527 CYS A O     
40   C CB    . CYS A 16  ? 0.7992 0.6660 0.7968 -0.0757 0.0166  -0.0363 527 CYS A CB    
41   S SG    . CYS A 16  ? 0.6065 0.4858 0.6088 -0.0765 0.0051  -0.0262 527 CYS A SG    
42   N N     . THR A 17  ? 0.7681 0.6167 0.7775 -0.0777 0.0379  -0.0516 528 THR A N     
43   C CA    . THR A 17  ? 0.8007 0.6422 0.7971 -0.0745 0.0458  -0.0591 528 THR A CA    
44   C C     . THR A 17  ? 0.7556 0.6044 0.7311 -0.0712 0.0476  -0.0634 528 THR A C     
45   O O     . THR A 17  ? 0.6894 0.5362 0.6426 -0.0667 0.0491  -0.0669 528 THR A O     
46   C CB    . THR A 17  ? 0.8006 0.6361 0.8163 -0.0776 0.0540  -0.0631 528 THR A CB    
47   O OG1   . THR A 17  ? 0.6953 0.5380 0.7250 -0.0807 0.0552  -0.0641 528 THR A OG1   
48   C CG2   . THR A 17  ? 0.8737 0.7015 0.9100 -0.0807 0.0526  -0.0587 528 THR A CG2   
49   N N     . LYS A 18  ? 0.5492 0.4070 0.5333 -0.0737 0.0469  -0.0626 529 LYS A N     
50   C CA    . LYS A 18  ? 0.5101 0.3741 0.4808 -0.0717 0.0501  -0.0675 529 LYS A CA    
51   C C     . LYS A 18  ? 0.6250 0.4983 0.5749 -0.0683 0.0437  -0.0643 529 LYS A C     
52   O O     . LYS A 18  ? 0.7595 0.6361 0.6904 -0.0650 0.0462  -0.0686 529 LYS A O     
53   C CB    . LYS A 18  ? 0.5917 0.4607 0.5839 -0.0761 0.0519  -0.0682 529 LYS A CB    
54   C CG    . LYS A 18  ? 0.7187 0.5887 0.7046 -0.0747 0.0589  -0.0765 529 LYS A CG    
55   C CD    . LYS A 18  ? 0.7582 0.6193 0.7533 -0.0751 0.0674  -0.0833 529 LYS A CD    
56   C CE    . LYS A 18  ? 0.9458 0.8089 0.9295 -0.0727 0.0741  -0.0921 529 LYS A CE    
57   N NZ    . LYS A 18  ? 1.1135 0.9707 1.1090 -0.0731 0.0825  -0.0992 529 LYS A NZ    
58   N N     . SER A 19  ? 0.6451 0.5228 0.5977 -0.0688 0.0356  -0.0568 530 SER A N     
59   C CA    . SER A 19  ? 0.6649 0.5542 0.6011 -0.0659 0.0291  -0.0529 530 SER A CA    
60   C C     . SER A 19  ? 0.6277 0.5140 0.5403 -0.0603 0.0261  -0.0540 530 SER A C     
61   O O     . SER A 19  ? 0.6549 0.5504 0.5501 -0.0567 0.0217  -0.0525 530 SER A O     
62   C CB    . SER A 19  ? 0.5912 0.4901 0.5432 -0.0692 0.0213  -0.0436 530 SER A CB    
63   O OG    . SER A 19  ? 0.5045 0.3976 0.4621 -0.0694 0.0170  -0.0400 530 SER A OG    
64   N N     . LEU A 20  ? 0.5779 0.4519 0.4910 -0.0595 0.0282  -0.0565 531 LEU A N     
65   C CA    . LEU A 20  ? 0.6552 0.5246 0.5493 -0.0544 0.0246  -0.0575 531 LEU A CA    
66   C C     . LEU A 20  ? 0.7182 0.5928 0.6126 -0.0535 0.0147  -0.0512 531 LEU A C     
67   O O     . LEU A 20  ? 0.7116 0.5827 0.5921 -0.0491 0.0103  -0.0521 531 LEU A O     
68   C CB    . LEU A 20  ? 0.6833 0.5564 0.5510 -0.0492 0.0261  -0.0622 531 LEU A CB    
69   C CG    . LEU A 20  ? 0.7041 0.5747 0.5670 -0.0493 0.0353  -0.0687 531 LEU A CG    
70   C CD1   . LEU A 20  ? 0.7144 0.5911 0.5514 -0.0442 0.0351  -0.0719 531 LEU A CD1   
71   C CD2   . LEU A 20  ? 0.5905 0.4476 0.4574 -0.0495 0.0415  -0.0727 531 LEU A CD2   
72   N N     . CYS A 21  ? 0.6543 0.5376 0.5656 -0.0575 0.0110  -0.0448 532 CYS A N     
73   C CA    . CYS A 21  ? 0.5878 0.4795 0.5008 -0.0569 0.0015  -0.0379 532 CYS A CA    
74   C C     . CYS A 21  ? 0.5336 0.4377 0.4237 -0.0516 -0.0031 -0.0374 532 CYS A C     
75   O O     . CYS A 21  ? 0.5229 0.4317 0.4037 -0.0480 -0.0106 -0.0350 532 CYS A O     
76   C CB    . CYS A 21  ? 0.4783 0.3597 0.3936 -0.0557 -0.0025 -0.0375 532 CYS A CB    
77   S SG    . CYS A 21  ? 0.5654 0.4313 0.5062 -0.0614 0.0039  -0.0385 532 CYS A SG    
78   N N     . LEU A 22  ? 0.5861 0.4958 0.4674 -0.0509 0.0014  -0.0402 533 LEU A N     
79   C CA    . LEU A 22  ? 0.7242 0.6464 0.5840 -0.0460 -0.0018 -0.0400 533 LEU A CA    
80   C C     . LEU A 22  ? 0.7186 0.6555 0.5874 -0.0492 -0.0023 -0.0345 533 LEU A C     
81   O O     . LEU A 22  ? 0.6422 0.5896 0.4960 -0.0462 -0.0029 -0.0344 533 LEU A O     
82   C CB    . LEU A 22  ? 0.6488 0.5646 0.4875 -0.0418 0.0036  -0.0481 533 LEU A CB    
83   C CG    . LEU A 22  ? 0.6368 0.5418 0.4611 -0.0370 0.0021  -0.0527 533 LEU A CG    
84   C CD1   . LEU A 22  ? 0.5436 0.4462 0.3458 -0.0325 0.0063  -0.0593 533 LEU A CD1   
85   C CD2   . LEU A 22  ? 0.6041 0.5163 0.4211 -0.0332 -0.0077 -0.0489 533 LEU A CD2   
86   N N     . LYS A 23  ? 0.6798 0.6170 0.5743 -0.0553 -0.0021 -0.0297 534 LYS A N     
87   C CA    . LYS A 23  ? 0.6077 0.5584 0.5159 -0.0591 -0.0036 -0.0233 534 LYS A CA    
88   C C     . LYS A 23  ? 0.5781 0.5346 0.5073 -0.0631 -0.0098 -0.0141 534 LYS A C     
89   O O     . LYS A 23  ? 0.6079 0.5560 0.5422 -0.0633 -0.0118 -0.0140 534 LYS A O     
90   C CB    . LYS A 23  ? 0.6166 0.5617 0.5374 -0.0632 0.0040  -0.0276 534 LYS A CB    
91   C CG    . LYS A 23  ? 0.5884 0.5344 0.4885 -0.0594 0.0085  -0.0341 534 LYS A CG    
92   C CD    . LYS A 23  ? 0.7610 0.7016 0.6727 -0.0629 0.0158  -0.0395 534 LYS A CD    
93   C CE    . LYS A 23  ? 0.7828 0.7230 0.6720 -0.0588 0.0205  -0.0467 534 LYS A CE    
94   N NZ    . LYS A 23  ? 0.8201 0.7564 0.7200 -0.0618 0.0272  -0.0524 534 LYS A NZ    
95   N N     . LEU A 24  ? 0.7165 0.6883 0.6568 -0.0658 -0.0134 -0.0059 535 LEU A N     
96   C CA    . LEU A 24  ? 0.6707 0.6514 0.6294 -0.0692 -0.0201 0.0042  535 LEU A CA    
97   C C     . LEU A 24  ? 0.6667 0.6376 0.6549 -0.0761 -0.0176 0.0052  535 LEU A C     
98   O O     . LEU A 24  ? 0.7290 0.7045 0.7348 -0.0795 -0.0226 0.0131  535 LEU A O     
99   C CB    . LEU A 24  ? 0.6405 0.6421 0.6024 -0.0700 -0.0248 0.0136  535 LEU A CB    
100  C CG    . LEU A 24  ? 0.6388 0.6535 0.5729 -0.0630 -0.0284 0.0143  535 LEU A CG    
101  C CD1   . LEU A 24  ? 0.6828 0.7184 0.6224 -0.0643 -0.0318 0.0238  535 LEU A CD1   
102  C CD2   . LEU A 24  ? 0.4814 0.4983 0.4029 -0.0583 -0.0347 0.0156  535 LEU A CD2   
103  N N     . TYR A 25  ? 0.5360 0.4943 0.5297 -0.0780 -0.0098 -0.0027 536 TYR A N     
104  C CA    . TYR A 25  ? 0.4932 0.4399 0.5124 -0.0834 -0.0065 -0.0038 536 TYR A CA    
105  C C     . TYR A 25  ? 0.5925 0.5287 0.6105 -0.0823 -0.0082 -0.0044 536 TYR A C     
106  O O     . TYR A 25  ? 0.5657 0.4951 0.6058 -0.0868 -0.0079 -0.0024 536 TYR A O     
107  C CB    . TYR A 25  ? 0.5550 0.4902 0.5764 -0.0843 0.0026  -0.0136 536 TYR A CB    
108  C CG    . TYR A 25  ? 0.5344 0.4770 0.5552 -0.0848 0.0052  -0.0155 536 TYR A CG    
109  C CD1   . TYR A 25  ? 0.4629 0.4146 0.5072 -0.0899 0.0027  -0.0094 536 TYR A CD1   
110  C CD2   . TYR A 25  ? 0.5408 0.4801 0.5390 -0.0804 0.0104  -0.0239 536 TYR A CD2   
111  C CE1   . TYR A 25  ? 0.6457 0.6032 0.6905 -0.0904 0.0049  -0.0117 536 TYR A CE1   
112  C CE2   . TYR A 25  ? 0.4788 0.4241 0.4763 -0.0808 0.0128  -0.0262 536 TYR A CE2   
113  C CZ    . TYR A 25  ? 0.6186 0.5727 0.6393 -0.0857 0.0099  -0.0204 536 TYR A CZ    
114  O OH    . TYR A 25  ? 0.6376 0.5972 0.6580 -0.0860 0.0119  -0.0230 536 TYR A OH    
115  N N     . CYS A 26  ? 0.6599 0.5942 0.6525 -0.0763 -0.0099 -0.0078 537 CYS A N     
116  C CA    . CYS A 26  ? 0.6571 0.5818 0.6467 -0.0745 -0.0126 -0.0086 537 CYS A CA    
117  C C     . CYS A 26  ? 0.7294 0.6659 0.7181 -0.0734 -0.0222 -0.0002 537 CYS A C     
118  O O     . CYS A 26  ? 0.6844 0.6315 0.6523 -0.0682 -0.0266 0.0007  537 CYS A O     
119  C CB    . CYS A 26  ? 0.5124 0.4275 0.4764 -0.0685 -0.0097 -0.0172 537 CYS A CB    
120  S SG    . CYS A 26  ? 0.6445 0.5493 0.6032 -0.0655 -0.0149 -0.0178 537 CYS A SG    
121  N N     . ASP A 27  ? 0.6627 0.5978 0.6736 -0.0779 -0.0254 0.0058  538 ASP A N     
122  C CA    . ASP A 27  ? 0.6538 0.6013 0.6668 -0.0774 -0.0346 0.0144  538 ASP A CA    
123  C C     . ASP A 27  ? 0.7334 0.6797 0.7233 -0.0706 -0.0399 0.0115  538 ASP A C     
124  O O     . ASP A 27  ? 0.6539 0.6149 0.6349 -0.0675 -0.0473 0.0167  538 ASP A O     
125  C CB    . ASP A 27  ? 0.6978 0.6419 0.7400 -0.0839 -0.0364 0.0207  538 ASP A CB    
126  C CG    . ASP A 27  ? 0.8846 0.8346 0.9512 -0.0904 -0.0337 0.0256  538 ASP A CG    
127  O OD1   . ASP A 27  ? 0.9886 0.9533 1.0514 -0.0900 -0.0351 0.0296  538 ASP A OD1   
128  O OD2   . ASP A 27  ? 0.8892 0.8292 0.9792 -0.0957 -0.0304 0.0254  538 ASP A OD2   
129  N N     . CYS A 28  ? 0.7211 0.6507 0.7015 -0.0681 -0.0364 0.0031  539 CYS A N     
130  C CA    . CYS A 28  ? 0.6802 0.6071 0.6391 -0.0613 -0.0416 -0.0008 539 CYS A CA    
131  C C     . CYS A 28  ? 0.7227 0.6619 0.6561 -0.0551 -0.0433 -0.0029 539 CYS A C     
132  O O     . CYS A 28  ? 0.8287 0.7779 0.7483 -0.0501 -0.0508 -0.0012 539 CYS A O     
133  C CB    . CYS A 28  ? 0.7131 0.6200 0.6679 -0.0600 -0.0371 -0.0090 539 CYS A CB    
134  S SG    . CYS A 28  ? 0.8688 0.7603 0.8511 -0.0661 -0.0354 -0.0072 539 CYS A SG    
135  N N     . PHE A 29  ? 0.7617 0.6997 0.6886 -0.0552 -0.0361 -0.0071 540 PHE A N     
136  C CA    . PHE A 29  ? 0.7745 0.7230 0.6776 -0.0497 -0.0363 -0.0096 540 PHE A CA    
137  C C     . PHE A 29  ? 0.6971 0.6675 0.6022 -0.0501 -0.0412 -0.0008 540 PHE A C     
138  O O     . PHE A 29  ? 0.5837 0.5667 0.4689 -0.0444 -0.0453 -0.0004 540 PHE A O     
139  C CB    . PHE A 29  ? 0.6635 0.6042 0.5623 -0.0506 -0.0270 -0.0161 540 PHE A CB    
140  C CG    . PHE A 29  ? 0.6165 0.5668 0.4921 -0.0455 -0.0264 -0.0188 540 PHE A CG    
141  C CD1   . PHE A 29  ? 0.5729 0.5187 0.4242 -0.0387 -0.0274 -0.0255 540 PHE A CD1   
142  C CD2   . PHE A 29  ? 0.5235 0.4867 0.4027 -0.0477 -0.0247 -0.0148 540 PHE A CD2   
143  C CE1   . PHE A 29  ? 0.5289 0.4834 0.3593 -0.0340 -0.0267 -0.0281 540 PHE A CE1   
144  C CE2   . PHE A 29  ? 0.5191 0.4911 0.3777 -0.0431 -0.0240 -0.0170 540 PHE A CE2   
145  C CZ    . PHE A 29  ? 0.5779 0.5455 0.4116 -0.0363 -0.0248 -0.0238 540 PHE A CZ    
146  N N     . ALA A 30  ? 0.6803 0.6555 0.6102 -0.0569 -0.0406 0.0066  541 ALA A N     
147  C CA    . ALA A 30  ? 0.7320 0.7283 0.6686 -0.0584 -0.0452 0.0166  541 ALA A CA    
148  C C     . ALA A 30  ? 0.7699 0.7784 0.7011 -0.0550 -0.0546 0.0225  541 ALA A C     
149  O O     . ALA A 30  ? 0.8141 0.8425 0.7389 -0.0527 -0.0592 0.0292  541 ALA A O     
150  C CB    . ALA A 30  ? 0.6762 0.6730 0.6432 -0.0668 -0.0428 0.0229  541 ALA A CB    
151  N N     . ASN A 31  ? 0.7415 0.7386 0.6758 -0.0545 -0.0575 0.0202  542 ASN A N     
152  C CA    . ASN A 31  ? 0.8344 0.8416 0.7635 -0.0509 -0.0667 0.0244  542 ASN A CA    
153  C C     . ASN A 31  ? 0.8147 0.8211 0.7146 -0.0418 -0.0702 0.0166  542 ASN A C     
154  O O     . ASN A 31  ? 0.7679 0.7788 0.6613 -0.0377 -0.0780 0.0172  542 ASN A O     
155  C CB    . ASN A 31  ? 0.9196 0.9157 0.8688 -0.0552 -0.0692 0.0266  542 ASN A CB    
156  C CG    . ASN A 31  ? 0.9993 1.0006 0.9782 -0.0636 -0.0682 0.0362  542 ASN A CG    
157  O OD1   . ASN A 31  ? 1.0229 1.0415 1.0069 -0.0654 -0.0692 0.0439  542 ASN A OD1   
158  N ND2   . ASN A 31  ? 0.9438 0.9306 0.9432 -0.0688 -0.0667 0.0362  542 ASN A ND2   
159  N N     . GLY A 32  ? 0.9187 0.9189 0.8018 -0.0386 -0.0648 0.0089  543 GLY A N     
160  C CA    . GLY A 32  ? 0.8915 0.8908 0.7472 -0.0299 -0.0677 0.0011  543 GLY A CA    
161  C C     . GLY A 32  ? 0.8241 0.8059 0.6772 -0.0275 -0.0704 -0.0056 543 GLY A C     
162  O O     . GLY A 32  ? 0.8863 0.8705 0.7217 -0.0204 -0.0768 -0.0098 543 GLY A O     
163  N N     . GLU A 33  ? 0.7503 0.7148 0.6217 -0.0334 -0.0659 -0.0067 544 GLU A N     
164  C CA    . GLU A 33  ? 0.8549 0.8017 0.7257 -0.0316 -0.0679 -0.0126 544 GLU A CA    
165  C C     . GLU A 33  ? 0.8689 0.7972 0.7353 -0.0319 -0.0599 -0.0206 544 GLU A C     
166  O O     . GLU A 33  ? 0.9193 0.8454 0.7914 -0.0358 -0.0515 -0.0209 544 GLU A O     
167  C CB    . GLU A 33  ? 0.9114 0.8524 0.8071 -0.0376 -0.0702 -0.0071 544 GLU A CB    
168  C CG    . GLU A 33  ? 1.1383 1.0973 1.0416 -0.0383 -0.0777 0.0018  544 GLU A CG    
169  C CD    . GLU A 33  ? 1.3328 1.2856 1.2625 -0.0450 -0.0791 0.0076  544 GLU A CD    
170  O OE1   . GLU A 33  ? 1.3761 1.3109 1.3116 -0.0457 -0.0787 0.0033  544 GLU A OE1   
171  O OE2   . GLU A 33  ? 1.4221 1.3880 1.3675 -0.0495 -0.0807 0.0168  544 GLU A OE2   
172  N N     . PHE A 34  ? 0.7496 0.6656 0.6060 -0.0274 -0.0628 -0.0271 545 PHE A N     
173  C CA    . PHE A 34  ? 0.8031 0.6999 0.6627 -0.0291 -0.0560 -0.0326 545 PHE A CA    
174  C C     . PHE A 34  ? 0.8174 0.7048 0.7042 -0.0367 -0.0529 -0.0283 545 PHE A C     
175  O O     . PHE A 34  ? 0.9073 0.7984 0.8071 -0.0388 -0.0588 -0.0229 545 PHE A O     
176  C CB    . PHE A 34  ? 0.8476 0.7334 0.6934 -0.0229 -0.0608 -0.0394 545 PHE A CB    
177  C CG    . PHE A 34  ? 0.8670 0.7593 0.6866 -0.0154 -0.0628 -0.0450 545 PHE A CG    
178  C CD1   . PHE A 34  ? 0.8715 0.7612 0.6808 -0.0149 -0.0548 -0.0489 545 PHE A CD1   
179  C CD2   . PHE A 34  ? 0.9682 0.8688 0.7736 -0.0084 -0.0728 -0.0467 545 PHE A CD2   
180  C CE1   . PHE A 34  ? 0.9328 0.8280 0.7186 -0.0081 -0.0565 -0.0539 545 PHE A CE1   
181  C CE2   . PHE A 34  ? 0.9982 0.9045 0.7798 -0.0012 -0.0745 -0.0522 545 PHE A CE2   
182  C CZ    . PHE A 34  ? 1.0067 0.9101 0.7788 -0.0012 -0.0663 -0.0556 545 PHE A CZ    
183  N N     . CYS A 35  ? 0.7704 0.6462 0.6658 -0.0407 -0.0436 -0.0307 546 CYS A N     
184  C CA    . CYS A 35  ? 0.8656 0.7303 0.7857 -0.0470 -0.0402 -0.0280 546 CYS A CA    
185  C C     . CYS A 35  ? 0.9618 0.8133 0.8848 -0.0453 -0.0454 -0.0296 546 CYS A C     
186  O O     . CYS A 35  ? 1.0396 0.8841 0.9468 -0.0401 -0.0471 -0.0352 546 CYS A O     
187  C CB    . CYS A 35  ? 0.9182 0.7747 0.8442 -0.0505 -0.0289 -0.0312 546 CYS A CB    
188  S SG    . CYS A 35  ? 0.8288 0.6988 0.7584 -0.0539 -0.0230 -0.0289 546 CYS A SG    
189  N N     . ASN A 36  ? 1.0309 0.8789 0.9747 -0.0497 -0.0484 -0.0245 547 ASN A N     
190  C CA    . ASN A 36  ? 1.1014 0.9364 1.0507 -0.0487 -0.0536 -0.0254 547 ASN A CA    
191  C C     . ASN A 36  ? 1.0909 0.9157 1.0669 -0.0556 -0.0493 -0.0215 547 ASN A C     
192  O O     . ASN A 36  ? 1.0445 0.8751 1.0376 -0.0601 -0.0516 -0.0153 547 ASN A O     
193  C CB    . ASN A 36  ? 1.2210 1.0640 1.1650 -0.0449 -0.0657 -0.0232 547 ASN A CB    
194  C CG    . ASN A 36  ? 1.3930 1.2387 1.3108 -0.0364 -0.0716 -0.0295 547 ASN A CG    
195  O OD1   . ASN A 36  ? 1.4463 1.2822 1.3532 -0.0334 -0.0683 -0.0354 547 ASN A OD1   
196  N ND2   . ASN A 36  ? 1.4402 1.2999 1.3483 -0.0323 -0.0806 -0.0280 547 ASN A ND2   
197  N N     . ASN A 37  ? 1.1206 0.9308 1.1003 -0.0563 -0.0434 -0.0249 548 ASN A N     
198  C CA    . ASN A 37  ? 1.2088 1.0083 1.2130 -0.0622 -0.0388 -0.0218 548 ASN A CA    
199  C C     . ASN A 37  ? 1.1474 0.9523 1.1657 -0.0678 -0.0301 -0.0196 548 ASN A C     
200  O O     . ASN A 37  ? 1.1704 0.9728 1.2119 -0.0734 -0.0286 -0.0151 548 ASN A O     
201  C CB    . ASN A 37  ? 1.3377 1.1347 1.3568 -0.0640 -0.0476 -0.0167 548 ASN A CB    
202  C CG    . ASN A 37  ? 1.4437 1.2252 1.4821 -0.0676 -0.0445 -0.0154 548 ASN A CG    
203  O OD1   . ASN A 37  ? 1.4567 1.2288 1.4934 -0.0671 -0.0373 -0.0189 548 ASN A OD1   
204  N ND2   . ASN A 37  ? 1.4947 1.2742 1.5518 -0.0711 -0.0497 -0.0099 548 ASN A ND2   
205  N N     . CYS A 38  ? 1.0252 0.8383 1.0299 -0.0662 -0.0253 -0.0227 549 CYS A N     
206  C CA    . CYS A 38  ? 0.8510 0.6697 0.8679 -0.0710 -0.0177 -0.0215 549 CYS A CA    
207  C C     . CYS A 38  ? 0.7982 0.6064 0.8246 -0.0735 -0.0070 -0.0251 549 CYS A C     
208  O O     . CYS A 38  ? 0.8851 0.6822 0.9073 -0.0714 -0.0049 -0.0281 549 CYS A O     
209  C CB    . CYS A 38  ? 0.7643 0.5960 0.7635 -0.0683 -0.0169 -0.0234 549 CYS A CB    
210  S SG    . CYS A 38  ? 0.8058 0.6549 0.7982 -0.0666 -0.0275 -0.0177 549 CYS A SG    
211  N N     . ASN A 39  ? 0.6796 0.4921 0.7188 -0.0776 -0.0005 -0.0248 550 ASN A N     
212  C CA    . ASN A 39  ? 0.6153 0.4202 0.6645 -0.0799 0.0099  -0.0286 550 ASN A CA    
213  C C     . ASN A 39  ? 0.6952 0.5061 0.7313 -0.0782 0.0167  -0.0340 550 ASN A C     
214  O O     . ASN A 39  ? 0.7526 0.5611 0.7981 -0.0804 0.0254  -0.0374 550 ASN A O     
215  C CB    . ASN A 39  ? 0.6483 0.4520 0.7268 -0.0862 0.0121  -0.0245 550 ASN A CB    
216  C CG    . ASN A 39  ? 0.7948 0.5930 0.8873 -0.0882 0.0052  -0.0187 550 ASN A CG    
217  O OD1   . ASN A 39  ? 0.9548 0.7445 1.0405 -0.0855 0.0024  -0.0192 550 ASN A OD1   
218  N ND2   . ASN A 39  ? 0.7048 0.5079 0.8180 -0.0930 0.0020  -0.0129 550 ASN A ND2   
219  N N     . CYS A 40  ? 0.5601 0.3790 0.5744 -0.0741 0.0126  -0.0352 551 CYS A N     
220  C CA    . CYS A 40  ? 0.5836 0.4084 0.5834 -0.0721 0.0181  -0.0402 551 CYS A CA    
221  C C     . CYS A 40  ? 0.7162 0.5324 0.7042 -0.0692 0.0257  -0.0466 551 CYS A C     
222  O O     . CYS A 40  ? 0.7164 0.5232 0.7016 -0.0673 0.0247  -0.0469 551 CYS A O     
223  C CB    . CYS A 40  ? 0.5897 0.4255 0.5688 -0.0681 0.0114  -0.0394 551 CYS A CB    
224  S SG    . CYS A 40  ? 0.7584 0.5912 0.7228 -0.0631 0.0014  -0.0378 551 CYS A SG    
225  N N     . THR A 41  ? 0.8279 0.6478 0.8099 -0.0688 0.0329  -0.0515 552 THR A N     
226  C CA    . THR A 41  ? 0.8873 0.7016 0.8555 -0.0656 0.0401  -0.0575 552 THR A CA    
227  C C     . THR A 41  ? 0.8300 0.6512 0.7724 -0.0610 0.0394  -0.0610 552 THR A C     
228  O O     . THR A 41  ? 0.8958 0.7270 0.8352 -0.0615 0.0380  -0.0607 552 THR A O     
229  C CB    . THR A 41  ? 0.9774 0.7899 0.9593 -0.0685 0.0502  -0.0613 552 THR A CB    
230  O OG1   . THR A 41  ? 1.0903 0.8960 1.0959 -0.0724 0.0513  -0.0582 552 THR A OG1   
231  C CG2   . THR A 41  ? 0.9530 0.7615 0.9200 -0.0650 0.0577  -0.0670 552 THR A CG2   
232  N N     . ASN A 42  ? 0.6409 0.4567 0.5658 -0.0567 0.0406  -0.0641 553 ASN A N     
233  C CA    . ASN A 42  ? 0.6921 0.5134 0.5919 -0.0520 0.0398  -0.0675 553 ASN A CA    
234  C C     . ASN A 42  ? 0.7369 0.5671 0.6278 -0.0501 0.0305  -0.0644 553 ASN A C     
235  O O     . ASN A 42  ? 0.7473 0.5872 0.6270 -0.0488 0.0303  -0.0655 553 ASN A O     
236  C CB    . ASN A 42  ? 0.7615 0.5881 0.6575 -0.0525 0.0479  -0.0723 553 ASN A CB    
237  C CG    . ASN A 42  ? 0.9441 0.7636 0.8407 -0.0522 0.0572  -0.0766 553 ASN A CG    
238  O OD1   . ASN A 42  ? 1.1128 0.9328 1.0226 -0.0552 0.0641  -0.0789 553 ASN A OD1   
239  N ND2   . ASN A 42  ? 0.8695 0.6828 0.7527 -0.0485 0.0571  -0.0775 553 ASN A ND2   
240  N N     . CYS A 43  ? 0.7767 0.6039 0.6728 -0.0499 0.0228  -0.0602 554 CYS A N     
241  C CA    . CYS A 43  ? 0.7911 0.6277 0.6806 -0.0481 0.0135  -0.0568 554 CYS A CA    
242  C C     . CYS A 43  ? 0.7378 0.5777 0.6007 -0.0416 0.0102  -0.0602 554 CYS A C     
243  O O     . CYS A 43  ? 0.7657 0.5969 0.6188 -0.0382 0.0100  -0.0632 554 CYS A O     
244  C CB    . CYS A 43  ? 0.8483 0.6803 0.7504 -0.0492 0.0061  -0.0521 554 CYS A CB    
245  S SG    . CYS A 43  ? 0.7588 0.6039 0.6552 -0.0471 -0.0055 -0.0472 554 CYS A SG    
246  N N     . TYR A 44  ? 0.6868 0.5396 0.5389 -0.0399 0.0074  -0.0594 555 TYR A N     
247  C CA    . TYR A 44  ? 0.7760 0.6339 0.6033 -0.0335 0.0030  -0.0620 555 TYR A CA    
248  C C     . TYR A 44  ? 0.7675 0.6345 0.5917 -0.0311 -0.0073 -0.0579 555 TYR A C     
249  O O     . TYR A 44  ? 0.8670 0.7404 0.6717 -0.0254 -0.0123 -0.0597 555 TYR A O     
250  C CB    . TYR A 44  ? 0.8663 0.7331 0.6805 -0.0324 0.0079  -0.0647 555 TYR A CB    
251  C CG    . TYR A 44  ? 0.8373 0.6960 0.6434 -0.0315 0.0164  -0.0705 555 TYR A CG    
252  C CD1   . TYR A 44  ? 0.9304 0.7763 0.7475 -0.0337 0.0213  -0.0720 555 TYR A CD1   
253  C CD2   . TYR A 44  ? 0.8128 0.6774 0.6005 -0.0285 0.0194  -0.0742 555 TYR A CD2   
254  C CE1   . TYR A 44  ? 0.8951 0.7351 0.7051 -0.0328 0.0292  -0.0767 555 TYR A CE1   
255  C CE2   . TYR A 44  ? 0.8399 0.6978 0.6202 -0.0277 0.0271  -0.0792 555 TYR A CE2   
256  C CZ    . TYR A 44  ? 0.8344 0.6804 0.6259 -0.0298 0.0320  -0.0803 555 TYR A CZ    
257  O OH    . TYR A 44  ? 0.7280 0.5686 0.5128 -0.0290 0.0398  -0.0847 555 TYR A OH    
258  N N     . ASN A 45  ? 0.7434 0.6118 0.5870 -0.0353 -0.0106 -0.0525 556 ASN A N     
259  C CA    . ASN A 45  ? 0.6778 0.5571 0.5200 -0.0334 -0.0202 -0.0478 556 ASN A CA    
260  C C     . ASN A 45  ? 0.6926 0.5643 0.5305 -0.0295 -0.0278 -0.0492 556 ASN A C     
261  O O     . ASN A 45  ? 0.7041 0.5748 0.5560 -0.0316 -0.0330 -0.0450 556 ASN A O     
262  C CB    . ASN A 45  ? 0.7332 0.6185 0.5990 -0.0398 -0.0207 -0.0407 556 ASN A CB    
263  C CG    . ASN A 45  ? 0.7896 0.6895 0.6541 -0.0382 -0.0300 -0.0348 556 ASN A CG    
264  O OD1   . ASN A 45  ? 0.8187 0.7292 0.6637 -0.0327 -0.0343 -0.0357 556 ASN A OD1   
265  N ND2   . ASN A 45  ? 0.8306 0.7317 0.7158 -0.0428 -0.0332 -0.0286 556 ASN A ND2   
266  N N     . ASN A 46  ? 0.7778 0.6442 0.5967 -0.0238 -0.0288 -0.0550 557 ASN A N     
267  C CA    . ASN A 46  ? 0.7975 0.6537 0.6135 -0.0201 -0.0354 -0.0574 557 ASN A CA    
268  C C     . ASN A 46  ? 0.8637 0.7199 0.6553 -0.0124 -0.0387 -0.0635 557 ASN A C     
269  O O     . ASN A 46  ? 0.8000 0.6635 0.5768 -0.0102 -0.0351 -0.0658 557 ASN A O     
270  C CB    . ASN A 46  ? 0.7325 0.5719 0.5646 -0.0242 -0.0303 -0.0578 557 ASN A CB    
271  C CG    . ASN A 46  ? 0.8528 0.6868 0.6818 -0.0258 -0.0195 -0.0611 557 ASN A CG    
272  O OD1   . ASN A 46  ? 0.9873 0.8201 0.7983 -0.0213 -0.0182 -0.0658 557 ASN A OD1   
273  N ND2   . ASN A 46  ? 0.8717 0.7030 0.7187 -0.0320 -0.0118 -0.0589 557 ASN A ND2   
274  N N     . LEU A 47  ? 0.9285 0.7764 0.7167 -0.0083 -0.0461 -0.0662 558 LEU A N     
275  C CA    . LEU A 47  ? 1.0646 0.9124 0.8310 -0.0006 -0.0507 -0.0722 558 LEU A CA    
276  C C     . LEU A 47  ? 1.1165 0.9570 0.8737 -0.0001 -0.0425 -0.0763 558 LEU A C     
277  O O     . LEU A 47  ? 1.1682 1.0141 0.9058 0.0051  -0.0431 -0.0802 558 LEU A O     
278  C CB    . LEU A 47  ? 1.0786 0.9171 0.8468 0.0031  -0.0605 -0.0744 558 LEU A CB    
279  C CG    . LEU A 47  ? 1.0746 0.9222 0.8487 0.0038  -0.0697 -0.0710 558 LEU A CG    
280  C CD1   . LEU A 47  ? 1.0738 0.9089 0.8613 0.0035  -0.0766 -0.0709 558 LEU A CD1   
281  C CD2   . LEU A 47  ? 1.0111 0.8734 0.7644 0.0115  -0.0771 -0.0741 558 LEU A CD2   
282  N N     . GLU A 48  ? 1.0714 0.9009 0.8428 -0.0054 -0.0347 -0.0750 559 GLU A N     
283  C CA    . GLU A 48  ? 1.0528 0.8749 0.8172 -0.0051 -0.0268 -0.0784 559 GLU A CA    
284  C C     . GLU A 48  ? 1.0310 0.8629 0.7853 -0.0060 -0.0189 -0.0794 559 GLU A C     
285  O O     . GLU A 48  ? 1.0465 0.8746 0.7915 -0.0048 -0.0129 -0.0826 559 GLU A O     
286  C CB    . GLU A 48  ? 1.1520 0.9609 0.9352 -0.0104 -0.0206 -0.0764 559 GLU A CB    
287  C CG    . GLU A 48  ? 1.2354 1.0331 1.0303 -0.0100 -0.0280 -0.0750 559 GLU A CG    
288  C CD    . GLU A 48  ? 1.3155 1.1167 1.1255 -0.0130 -0.0334 -0.0706 559 GLU A CD    
289  O OE1   . GLU A 48  ? 1.2679 1.0805 1.0798 -0.0154 -0.0317 -0.0682 559 GLU A OE1   
290  O OE2   . GLU A 48  ? 1.4198 1.2123 1.2404 -0.0130 -0.0397 -0.0693 559 GLU A OE2   
291  N N     . HIS A 49  ? 1.0223 0.8668 0.7789 -0.0080 -0.0191 -0.0763 560 HIS A N     
292  C CA    . HIS A 49  ? 0.9819 0.8359 0.7296 -0.0086 -0.0125 -0.0771 560 HIS A CA    
293  C C     . HIS A 49  ? 0.9235 0.7933 0.6576 -0.0049 -0.0179 -0.0763 560 HIS A C     
294  O O     . HIS A 49  ? 0.8730 0.7532 0.6082 -0.0074 -0.0140 -0.0740 560 HIS A O     
295  C CB    . HIS A 49  ? 0.8832 0.7379 0.6496 -0.0158 -0.0048 -0.0738 560 HIS A CB    
296  C CG    . HIS A 49  ? 0.8399 0.6807 0.6198 -0.0195 0.0017  -0.0746 560 HIS A CG    
297  N ND1   . HIS A 49  ? 0.7861 0.6177 0.5821 -0.0217 -0.0013 -0.0721 560 HIS A ND1   
298  C CD2   . HIS A 49  ? 0.7628 0.5984 0.5421 -0.0210 0.0110  -0.0775 560 HIS A CD2   
299  C CE1   . HIS A 49  ? 0.8103 0.6317 0.6158 -0.0246 0.0062  -0.0730 560 HIS A CE1   
300  N NE2   . HIS A 49  ? 0.8313 0.6553 0.6267 -0.0241 0.0137  -0.0763 560 HIS A NE2   
301  N N     . GLU A 50  ? 0.9639 0.8357 0.6853 0.0014  -0.0267 -0.0784 561 GLU A N     
302  C CA    . GLU A 50  ? 1.0485 0.9363 0.7569 0.0060  -0.0334 -0.0774 561 GLU A CA    
303  C C     . GLU A 50  ? 1.0291 0.9287 0.7234 0.0073  -0.0288 -0.0780 561 GLU A C     
304  O O     . GLU A 50  ? 1.0772 0.9920 0.7711 0.0070  -0.0307 -0.0737 561 GLU A O     
305  C CB    . GLU A 50  ? 0.9851 0.8708 0.6795 0.0138  -0.0428 -0.0819 561 GLU A CB    
306  N N     . ASN A 51  ? 1.0841 0.8244 0.8822 0.2106  0.1552  -0.0622 562 ASN A N     
307  C CA    . ASN A 51  ? 1.0349 0.8238 0.8515 0.2121  0.1551  -0.0494 562 ASN A CA    
308  C C     . ASN A 51  ? 1.0070 0.8193 0.8262 0.1943  0.1351  -0.0559 562 ASN A C     
309  O O     . ASN A 51  ? 1.0494 0.8795 0.8720 0.1874  0.1335  -0.0540 562 ASN A O     
310  C CB    . ASN A 51  ? 1.0504 0.8728 0.8869 0.2284  0.1621  -0.0330 562 ASN A CB    
311  C CG    . ASN A 51  ? 1.2417 1.0641 1.0840 0.2461  0.1839  -0.0199 562 ASN A CG    
312  O OD1   . ASN A 51  ? 1.2566 1.1061 1.1091 0.2492  0.1903  -0.0100 562 ASN A OD1   
313  N ND2   . ASN A 51  ? 1.3647 1.1564 1.2007 0.2578  0.1953  -0.0200 562 ASN A ND2   
314  N N     . GLU A 52  ? 0.8778 0.6901 0.6958 0.1870  0.1200  -0.0634 563 GLU A N     
315  C CA    . GLU A 52  ? 0.9101 0.7444 0.7310 0.1703  0.0999  -0.0702 563 GLU A CA    
316  C C     . GLU A 52  ? 0.9382 0.7448 0.7418 0.1530  0.0918  -0.0854 563 GLU A C     
317  O O     . GLU A 52  ? 0.9275 0.7552 0.7348 0.1400  0.0797  -0.0882 563 GLU A O     
318  C CB    . GLU A 52  ? 0.8582 0.6954 0.6805 0.1675  0.0863  -0.0755 563 GLU A CB    
319  C CG    . GLU A 52  ? 0.9129 0.7943 0.7498 0.1595  0.0701  -0.0729 563 GLU A CG    
320  C CD    . GLU A 52  ? 1.0702 0.9978 0.9288 0.1716  0.0785  -0.0544 563 GLU A CD    
321  O OE1   . GLU A 52  ? 1.2029 1.1358 1.0695 0.1883  0.0914  -0.0431 563 GLU A OE1   
322  O OE2   . GLU A 52  ? 1.0603 1.0188 0.9282 0.1644  0.0722  -0.0510 563 GLU A OE2   
323  N N     . ARG A 53  ? 0.9281 0.6873 0.7131 0.1531  0.0986  -0.0950 564 ARG A N     
324  C CA    . ARG A 53  ? 0.9717 0.7006 0.7389 0.1376  0.0921  -0.1097 564 ARG A CA    
325  C C     . ARG A 53  ? 0.9189 0.6598 0.6891 0.1373  0.1007  -0.1035 564 ARG A C     
326  O O     . ARG A 53  ? 0.8063 0.5494 0.5720 0.1224  0.0906  -0.1107 564 ARG A O     
327  C CB    . ARG A 53  ? 1.0092 0.6844 0.7559 0.1386  0.0978  -0.1212 564 ARG A CB    
328  C CG    . ARG A 53  ? 0.9841 0.6272 0.7120 0.1228  0.0919  -0.1362 564 ARG A CG    
329  C CD    . ARG A 53  ? 1.0375 0.6282 0.7450 0.1214  0.0935  -0.1496 564 ARG A CD    
330  N NE    . ARG A 53  ? 1.0108 0.5713 0.7003 0.1053  0.0862  -0.1647 564 ARG A NE    
331  C CZ    . ARG A 53  ? 0.8907 0.4246 0.5682 0.1060  0.0975  -0.1675 564 ARG A CZ    
332  N NH1   . ARG A 53  ? 0.8676 0.3998 0.5486 0.1222  0.1168  -0.1568 564 ARG A NH1   
333  N NH2   . ARG A 53  ? 0.8771 0.3865 0.5397 0.0905  0.0892  -0.1810 564 ARG A NH2   
334  N N     . GLN A 54  ? 0.8886 0.6367 0.6662 0.1538  0.1195  -0.0902 565 GLN A N     
335  C CA    . GLN A 54  ? 0.9664 0.7269 0.7475 0.1554  0.1294  -0.0830 565 GLN A CA    
336  C C     . GLN A 54  ? 1.0254 0.8337 0.8229 0.1479  0.1188  -0.0762 565 GLN A C     
337  O O     . GLN A 54  ? 1.0191 0.8334 0.8149 0.1387  0.1167  -0.0777 565 GLN A O     
338  C CB    . GLN A 54  ? 0.9373 0.6999 0.7252 0.1759  0.1513  -0.0690 565 GLN A CB    
339  C CG    . GLN A 54  ? 0.9608 0.6753 0.7310 0.1821  0.1652  -0.0753 565 GLN A CG    
340  C CD    . GLN A 54  ? 1.0274 0.7198 0.7829 0.1712  0.1658  -0.0843 565 GLN A CD    
341  O OE1   . GLN A 54  ? 1.0852 0.7436 0.8234 0.1590  0.1573  -0.0997 565 GLN A OE1   
342  N NE2   . GLN A 54  ? 0.8807 0.5917 0.6430 0.1760  0.1764  -0.0746 565 GLN A NE2   
343  N N     . LYS A 55  ? 1.0258 0.8681 0.8394 0.1521  0.1123  -0.0685 566 LYS A N     
344  C CA    . LYS A 55  ? 0.9412 0.8302 0.7713 0.1450  0.1006  -0.0625 566 LYS A CA    
345  C C     . LYS A 55  ? 0.8573 0.7415 0.6793 0.1236  0.0811  -0.0766 566 LYS A C     
346  O O     . LYS A 55  ? 0.7704 0.6779 0.5989 0.1151  0.0756  -0.0744 566 LYS A O     
347  C CB    . LYS A 55  ? 0.9323 0.8538 0.7790 0.1529  0.0959  -0.0538 566 LYS A CB    
348  C CG    . LYS A 55  ? 0.9537 0.9034 0.8172 0.1719  0.1126  -0.0349 566 LYS A CG    
349  C CD    . LYS A 55  ? 0.9557 0.9340 0.8343 0.1805  0.1089  -0.0266 566 LYS A CD    
350  C CE    . LYS A 55  ? 0.9668 0.9904 0.8607 0.1715  0.0929  -0.0235 566 LYS A CE    
351  N NZ    . LYS A 55  ? 0.9879 1.0439 0.8987 0.1827  0.0924  -0.0125 566 LYS A NZ    
352  N N     . ALA A 56  ? 0.8619 0.7167 0.6705 0.1151  0.0703  -0.0909 567 ALA A N     
353  C CA    . ALA A 56  ? 0.7629 0.6100 0.5630 0.0948  0.0513  -0.1054 567 ALA A CA    
354  C C     . ALA A 56  ? 0.7967 0.6213 0.5841 0.0861  0.0549  -0.1116 567 ALA A C     
355  O O     . ALA A 56  ? 0.7675 0.6027 0.5552 0.0711  0.0425  -0.1170 567 ALA A O     
356  C CB    . ALA A 56  ? 0.7702 0.5863 0.5570 0.0888  0.0410  -0.1194 567 ALA A CB    
357  N N     . ILE A 57  ? 0.8075 0.6008 0.5839 0.0956  0.0720  -0.1109 568 ILE A N     
358  C CA    . ILE A 57  ? 0.9046 0.6738 0.6678 0.0883  0.0767  -0.1170 568 ILE A CA    
359  C C     . ILE A 57  ? 0.8823 0.6871 0.6585 0.0871  0.0794  -0.1064 568 ILE A C     
360  O O     . ILE A 57  ? 0.8198 0.6219 0.5905 0.0730  0.0716  -0.1130 568 ILE A O     
361  C CB    . ILE A 57  ? 0.8852 0.6159 0.6353 0.1007  0.0956  -0.1173 568 ILE A CB    
362  C CG1   . ILE A 57  ? 0.8835 0.5752 0.6187 0.0993  0.0912  -0.1298 568 ILE A CG1   
363  C CG2   . ILE A 57  ? 0.8383 0.5490 0.5764 0.0946  0.1017  -0.1217 568 ILE A CG2   
364  C CD1   . ILE A 57  ? 0.8726 0.5216 0.5926 0.1088  0.1072  -0.1330 568 ILE A CD1   
365  N N     . LYS A 58  ? 0.8249 0.6655 0.6193 0.1008  0.0888  -0.0899 569 LYS A N     
366  C CA    . LYS A 58  ? 0.8026 0.6743 0.6085 0.1009  0.0934  -0.0793 569 LYS A CA    
367  C C     . LYS A 58  ? 0.9188 0.8285 0.7379 0.0878  0.0749  -0.0790 569 LYS A C     
368  O O     . LYS A 58  ? 0.9602 0.8826 0.7814 0.0781  0.0709  -0.0787 569 LYS A O     
369  C CB    . LYS A 58  ? 0.8278 0.7217 0.6476 0.1211  0.1119  -0.0616 569 LYS A CB    
370  C CG    . LYS A 58  ? 0.9492 0.8885 0.7873 0.1224  0.1137  -0.0479 569 LYS A CG    
371  C CD    . LYS A 58  ? 1.0040 0.9671 0.8570 0.1427  0.1304  -0.0304 569 LYS A CD    
372  C CE    . LYS A 58  ? 1.0595 1.0676 0.9306 0.1443  0.1328  -0.0165 569 LYS A CE    
373  N NZ    . LYS A 58  ? 1.0992 1.1406 0.9815 0.1305  0.1128  -0.0181 569 LYS A NZ    
374  N N     . ALA A 59  ? 0.7693 0.6936 0.5955 0.0863  0.0627  -0.0807 570 ALA A N     
375  C CA    . ALA A 59  ? 0.7508 0.7078 0.5881 0.0730  0.0430  -0.0827 570 ALA A CA    
376  C C     . ALA A 59  ? 0.9660 0.8993 0.7889 0.0530  0.0284  -0.0990 570 ALA A C     
377  O O     . ALA A 59  ? 0.9939 0.9494 0.8235 0.0402  0.0159  -0.1004 570 ALA A O     
378  C CB    . ALA A 59  ? 0.7368 0.7091 0.5824 0.0762  0.0335  -0.0825 570 ALA A CB    
379  N N     . CYS A 60  ? 0.9649 0.8525 0.7681 0.0503  0.0296  -0.1117 571 CYS A N     
380  C CA    . CYS A 60  ? 1.0118 0.8713 0.7993 0.0321  0.0170  -0.1279 571 CYS A CA    
381  C C     . CYS A 60  ? 1.0248 0.8820 0.8090 0.0273  0.0236  -0.1259 571 CYS A C     
382  O O     . CYS A 60  ? 0.9111 0.7721 0.6935 0.0111  0.0108  -0.1328 571 CYS A O     
383  C CB    . CYS A 60  ? 1.0506 0.8613 0.8182 0.0331  0.0195  -0.1403 571 CYS A CB    
384  S SG    . CYS A 60  ? 1.3375 1.1132 1.0862 0.0114  0.0009  -0.1617 571 CYS A SG    
385  N N     . LEU A 61  ? 1.0442 0.8965 0.8282 0.0419  0.0439  -0.1159 572 LEU A N     
386  C CA    . LEU A 61  ? 0.9662 0.8116 0.7450 0.0395  0.0530  -0.1139 572 LEU A CA    
387  C C     . LEU A 61  ? 1.1315 1.0218 0.9283 0.0370  0.0510  -0.1022 572 LEU A C     
388  O O     . LEU A 61  ? 1.1672 1.0553 0.9600 0.0270  0.0490  -0.1048 572 LEU A O     
389  C CB    . LEU A 61  ? 0.9260 0.7491 0.6979 0.0565  0.0756  -0.1079 572 LEU A CB    
390  C CG    . LEU A 61  ? 1.0651 0.8551 0.8200 0.0523  0.0839  -0.1143 572 LEU A CG    
391  C CD1   . LEU A 61  ? 1.0843 0.8390 0.8209 0.0349  0.0698  -0.1330 572 LEU A CD1   
392  C CD2   . LEU A 61  ? 1.1960 0.9611 0.9434 0.0698  0.1050  -0.1099 572 LEU A CD2   
393  N N     . ASP A 62  ? 1.2433 1.1744 1.0599 0.0463  0.0520  -0.0890 573 ASP A N     
394  C CA    . ASP A 62  ? 1.3682 1.3421 1.2021 0.0438  0.0500  -0.0778 573 ASP A CA    
395  C C     . ASP A 62  ? 1.2707 1.2630 1.1100 0.0250  0.0267  -0.0855 573 ASP A C     
396  O O     . ASP A 62  ? 1.2455 1.2691 1.0971 0.0187  0.0216  -0.0793 573 ASP A O     
397  C CB    . ASP A 62  ? 1.5098 1.5213 1.3633 0.0610  0.0605  -0.0600 573 ASP A CB    
398  C CG    . ASP A 62  ? 1.5897 1.6165 1.4519 0.0644  0.0514  -0.0597 573 ASP A CG    
399  O OD1   . ASP A 62  ? 1.6247 1.6264 1.4754 0.0564  0.0403  -0.0733 573 ASP A OD1   
400  O OD2   . ASP A 62  ? 1.6024 1.6662 1.4828 0.0753  0.0556  -0.0459 573 ASP A OD2   
401  N N     . ARG A 63  ? 1.2114 1.1848 1.0422 0.0164  0.0128  -0.0988 574 ARG A N     
402  C CA    . ARG A 63  ? 1.1173 1.0983 0.9489 -0.0031 -0.0096 -0.1095 574 ARG A CA    
403  C C     . ARG A 63  ? 1.1261 1.0803 0.9431 -0.0170 -0.0122 -0.1194 574 ARG A C     
404  O O     . ARG A 63  ? 1.1577 1.1290 0.9802 -0.0310 -0.0250 -0.1217 574 ARG A O     
405  C CB    . ARG A 63  ? 1.0881 1.0531 0.9130 -0.0082 -0.0231 -0.1217 574 ARG A CB    
406  C CG    . ARG A 63  ? 1.1480 1.1440 0.9884 0.0012  -0.0265 -0.1141 574 ARG A CG    
407  C CD    . ARG A 63  ? 1.2328 1.2100 1.0647 -0.0058 -0.0410 -0.1278 574 ARG A CD    
408  N NE    . ARG A 63  ? 1.2747 1.2627 1.1139 0.0084  -0.0366 -0.1214 574 ARG A NE    
409  C CZ    . ARG A 63  ? 1.3021 1.2590 1.1292 0.0127  -0.0349 -0.1290 574 ARG A CZ    
410  N NH1   . ARG A 63  ? 1.3091 1.2216 1.1158 0.0040  -0.0374 -0.1435 574 ARG A NH1   
411  N NH2   . ARG A 63  ? 1.2743 1.2447 1.1098 0.0259  -0.0309 -0.1218 574 ARG A NH2   
412  N N     . ASN A 64  ? 1.1063 1.0180 0.9047 -0.0130 -0.0003 -0.1255 575 ASN A N     
413  C CA    . ASN A 64  ? 1.1374 1.0201 0.9202 -0.0242 0.0000  -0.1345 575 ASN A CA    
414  C C     . ASN A 64  ? 1.0879 0.9356 0.8561 -0.0120 0.0205  -0.1337 575 ASN A C     
415  O O     . ASN A 64  ? 1.1067 0.9197 0.8610 -0.0081 0.0238  -0.1420 575 ASN A O     
416  C CB    . ASN A 64  ? 1.1579 1.0153 0.9280 -0.0422 -0.0190 -0.1527 575 ASN A CB    
417  C CG    . ASN A 64  ? 1.1302 0.9445 0.8791 -0.0509 -0.0162 -0.1643 575 ASN A CG    
418  O OD1   . ASN A 64  ? 1.1255 0.9364 0.8715 -0.0488 -0.0047 -0.1593 575 ASN A OD1   
419  N ND2   . ASN A 64  ? 1.1048 0.8860 0.8386 -0.0608 -0.0270 -0.1801 575 ASN A ND2   
420  N N     . PRO A 65  ? 1.0525 0.9089 0.8237 -0.0064 0.0342  -0.1240 576 PRO A N     
421  C CA    . PRO A 65  ? 1.0252 0.8544 0.7852 0.0072  0.0553  -0.1208 576 PRO A CA    
422  C C     . PRO A 65  ? 1.0639 0.8415 0.7996 -0.0003 0.0553  -0.1367 576 PRO A C     
423  O O     . PRO A 65  ? 0.9503 0.6986 0.6742 0.0107  0.0713  -0.1370 576 PRO A O     
424  C CB    . PRO A 65  ? 0.9300 0.7840 0.6991 0.0095  0.0646  -0.1089 576 PRO A CB    
425  C CG    . PRO A 65  ? 0.9236 0.8017 0.7008 -0.0084 0.0461  -0.1117 576 PRO A CG    
426  C CD    . PRO A 65  ? 0.9591 0.8525 0.7447 -0.0130 0.0298  -0.1155 576 PRO A CD    
427  N N     . GLU A 66  ? 1.0719 0.8387 0.8004 -0.0190 0.0373  -0.1499 577 GLU A N     
428  C CA    . GLU A 66  ? 1.1773 0.8963 0.8831 -0.0277 0.0353  -0.1657 577 GLU A CA    
429  C C     . GLU A 66  ? 1.0904 0.7842 0.7869 -0.0301 0.0261  -0.1776 577 GLU A C     
430  O O     . GLU A 66  ? 1.0319 0.6887 0.7106 -0.0406 0.0197  -0.1924 577 GLU A O     
431  C CB    . GLU A 66  ? 1.2791 0.9986 0.9812 -0.0472 0.0221  -0.1731 577 GLU A CB    
432  C CG    . GLU A 66  ? 1.3394 1.0916 1.0543 -0.0459 0.0284  -0.1602 577 GLU A CG    
433  C CD    . GLU A 66  ? 1.4416 1.2132 1.1628 -0.0649 0.0104  -0.1639 577 GLU A CD    
434  O OE1   . GLU A 66  ? 1.4682 1.2128 1.1750 -0.0787 0.0037  -0.1758 577 GLU A OE1   
435  O OE2   . GLU A 66  ? 1.4679 1.2819 1.2087 -0.0661 0.0029  -0.1548 577 GLU A OE2   
436  N N     . ALA A 67  ? 0.8883 0.5155 0.8440 -0.0132 0.1626  -0.0716 578 ALA A N     
437  C CA    . ALA A 67  ? 0.9491 0.5886 0.9060 -0.0190 0.1444  -0.0607 578 ALA A CA    
438  C C     . ALA A 67  ? 0.9833 0.6059 0.9073 -0.0292 0.1331  -0.0584 578 ALA A C     
439  O O     . ALA A 67  ? 0.9840 0.6145 0.8961 -0.0363 0.1231  -0.0484 578 ALA A O     
440  C CB    . ALA A 67  ? 0.9441 0.5932 0.9294 -0.0143 0.1366  -0.0607 578 ALA A CB    
441  N N     . PHE A 68  ? 0.9414 0.5403 0.8508 -0.0296 0.1343  -0.0681 579 PHE A N     
442  C CA    . PHE A 68  ? 1.0238 0.6036 0.9020 -0.0388 0.1224  -0.0669 579 PHE A CA    
443  C C     . PHE A 68  ? 1.0590 0.6155 0.9057 -0.0396 0.1332  -0.0752 579 PHE A C     
444  O O     . PHE A 68  ? 0.9430 0.4758 0.7672 -0.0423 0.1282  -0.0816 579 PHE A O     
445  C CB    . PHE A 68  ? 1.1378 0.7066 1.0210 -0.0395 0.1105  -0.0705 579 PHE A CB    
446  C CG    . PHE A 68  ? 1.1296 0.7202 1.0438 -0.0380 0.1012  -0.0632 579 PHE A CG    
447  C CD1   . PHE A 68  ? 1.0403 0.6475 0.9557 -0.0455 0.0863  -0.0495 579 PHE A CD1   
448  C CD2   . PHE A 68  ? 1.1684 0.7629 1.1104 -0.0290 0.1070  -0.0702 579 PHE A CD2   
449  C CE1   . PHE A 68  ? 1.1224 0.7507 1.0650 -0.0438 0.0783  -0.0428 579 PHE A CE1   
450  C CE2   . PHE A 68  ? 1.1702 0.7837 1.1391 -0.0275 0.0982  -0.0635 579 PHE A CE2   
451  C CZ    . PHE A 68  ? 1.1537 0.7844 1.1222 -0.0349 0.0840  -0.0497 579 PHE A CZ    
452  N N     . LYS A 69  ? 1.2149 0.7781 1.0591 -0.0374 0.1472  -0.0748 580 LYS A N     
453  C CA    . LYS A 69  ? 1.3570 0.9006 1.1701 -0.0386 0.1585  -0.0813 580 LYS A CA    
454  C C     . LYS A 69  ? 1.3793 0.9154 1.1621 -0.0492 0.1458  -0.0727 580 LYS A C     
455  O O     . LYS A 69  ? 1.4704 1.0246 1.2617 -0.0537 0.1362  -0.0610 580 LYS A O     
456  C CB    . LYS A 69  ? 1.3730 0.9272 1.1955 -0.0331 0.1779  -0.0830 580 LYS A CB    
457  C CG    . LYS A 69  ? 1.4978 1.0320 1.2964 -0.0306 0.1942  -0.0941 580 LYS A CG    
458  C CD    . LYS A 69  ? 1.5905 1.1355 1.3968 -0.0268 0.2133  -0.0942 580 LYS A CD    
459  C CE    . LYS A 69  ? 1.5856 1.1496 1.4340 -0.0177 0.2216  -0.0963 580 LYS A CE    
460  N NZ    . LYS A 69  ? 1.5441 1.0998 1.4064 -0.0100 0.2251  -0.1087 580 LYS A NZ    
461  N N     . PRO A 70  ? 1.2881 0.7973 1.0360 -0.0529 0.1448  -0.0788 581 PRO A N     
462  C CA    . PRO A 70  ? 1.3161 0.8130 1.0321 -0.0631 0.1316  -0.0719 581 PRO A CA    
463  C C     . PRO A 70  ? 1.3528 0.8665 1.0679 -0.0683 0.1297  -0.0600 581 PRO A C     
464  O O     . PRO A 70  ? 1.2466 0.7629 0.9563 -0.0665 0.1435  -0.0607 581 PRO A O     
465  C CB    . PRO A 70  ? 1.3013 0.7696 0.9822 -0.0621 0.1413  -0.0830 581 PRO A CB    
466  C CG    . PRO A 70  ? 1.2578 0.7186 0.9515 -0.0531 0.1492  -0.0959 581 PRO A CG    
467  C CD    . PRO A 70  ? 1.2387 0.7267 0.9750 -0.0465 0.1565  -0.0938 581 PRO A CD    
468  N N     . LYS A 71  ? 1.4256 0.9514 1.1471 -0.0748 0.1120  -0.0489 582 LYS A N     
469  C CA    . LYS A 71  ? 1.4571 1.0012 1.1811 -0.0794 0.1066  -0.0373 582 LYS A CA    
470  C C     . LYS A 71  ? 1.3544 0.9042 1.0763 -0.0880 0.0850  -0.0269 582 LYS A C     
471  O O     . LYS A 71  ? 1.2691 0.8449 1.0130 -0.0886 0.0775  -0.0174 582 LYS A O     
472  C CB    . LYS A 71  ? 1.4871 1.0598 1.2468 -0.0721 0.1147  -0.0343 582 LYS A CB    
473  N N     . LYS A 86  ? 1.2040 0.9101 1.1362 -0.0283 0.1602  -0.0149 597 LYS A N     
474  C CA    . LYS A 86  ? 1.2157 0.9180 1.1328 -0.0326 0.1641  -0.0108 597 LYS A CA    
475  C C     . LYS A 86  ? 1.1707 0.8943 1.1099 -0.0283 0.1551  -0.0032 597 LYS A C     
476  O O     . LYS A 86  ? 1.1523 0.8884 1.1216 -0.0199 0.1590  -0.0040 597 LYS A O     
477  C CB    . LYS A 86  ? 1.2235 0.9135 1.1375 -0.0315 0.1839  -0.0168 597 LYS A CB    
478  N N     . GLY A 87  ? 1.1339 0.8609 1.0580 -0.0339 0.1419  0.0037  598 GLY A N     
479  C CA    . GLY A 87  ? 1.0678 0.8137 1.0081 -0.0303 0.1306  0.0106  598 GLY A CA    
480  C C     . GLY A 87  ? 0.9220 0.6916 0.8900 -0.0223 0.1179  0.0129  598 GLY A C     
481  O O     . GLY A 87  ? 0.8725 0.6473 0.8595 -0.0162 0.1211  0.0087  598 GLY A O     
482  N N     . CYS A 88  ? 0.7836 0.5677 0.7540 -0.0217 0.1034  0.0192  599 CYS A N     
483  C CA    . CYS A 88  ? 0.7108 0.5196 0.7045 -0.0139 0.0900  0.0221  599 CYS A CA    
484  C C     . CYS A 88  ? 0.6769 0.5005 0.7013 -0.0027 0.0896  0.0224  599 CYS A C     
485  O O     . CYS A 88  ? 0.7318 0.5473 0.7583 -0.0023 0.0976  0.0219  599 CYS A O     
486  C CB    . CYS A 88  ? 0.5542 0.3721 0.5344 -0.0185 0.0737  0.0282  599 CYS A CB    
487  S SG    . CYS A 88  ? 0.6512 0.4701 0.6269 -0.0189 0.0671  0.0329  599 CYS A SG    
488  N N     . ASN A 89  ? 0.6252 0.4708 0.6727 0.0064  0.0794  0.0235  600 ASN A N     
489  C CA    . ASN A 89  ? 0.6866 0.5464 0.7626 0.0180  0.0760  0.0239  600 ASN A CA    
490  C C     . ASN A 89  ? 0.6317 0.5151 0.7168 0.0242  0.0581  0.0282  600 ASN A C     
491  O O     . ASN A 89  ? 0.6150 0.5153 0.7259 0.0360  0.0523  0.0277  600 ASN A O     
492  C CB    . ASN A 89  ? 0.7769 0.6394 0.8779 0.0264  0.0841  0.0190  600 ASN A CB    
493  C CG    . ASN A 89  ? 0.7826 0.6235 0.8761 0.0214  0.1017  0.0138  600 ASN A CG    
494  O OD1   . ASN A 89  ? 0.8629 0.6934 0.9557 0.0200  0.1108  0.0134  600 ASN A OD1   
495  N ND2   . ASN A 89  ? 0.7451 0.5794 0.8327 0.0184  0.1063  0.0100  600 ASN A ND2   
496  N N     . CYS A 90  ? 0.5898 0.4739 0.6534 0.0165  0.0493  0.0320  601 CYS A N     
497  C CA    . CYS A 90  ? 0.4872 0.3942 0.5561 0.0211  0.0325  0.0357  601 CYS A CA    
498  C C     . CYS A 90  ? 0.6117 0.5312 0.7003 0.0321  0.0241  0.0363  601 CYS A C     
499  O O     . CYS A 90  ? 0.6855 0.5924 0.7736 0.0313  0.0282  0.0364  601 CYS A O     
500  C CB    . CYS A 90  ? 0.4039 0.3050 0.4451 0.0099  0.0254  0.0395  601 CYS A CB    
501  S SG    . CYS A 90  ? 0.6606 0.5409 0.6761 -0.0035 0.0353  0.0383  601 CYS A SG    
502  N N     . LYS A 91  ? 0.6558 0.6004 0.7621 0.0426  0.0121  0.0370  602 LYS A N     
503  C CA    . LYS A 91  ? 0.7045 0.6620 0.8294 0.0544  0.0015  0.0371  602 LYS A CA    
504  C C     . LYS A 91  ? 0.7817 0.7566 0.9009 0.0561  -0.0156 0.0401  602 LYS A C     
505  O O     . LYS A 91  ? 0.9013 0.8755 1.0205 0.0587  -0.0249 0.0412  602 LYS A O     
506  C CB    . LYS A 91  ? 0.7222 0.6944 0.8755 0.0683  0.0015  0.0341  602 LYS A CB    
507  C CG    . LYS A 91  ? 0.8335 0.7889 0.9979 0.0691  0.0162  0.0307  602 LYS A CG    
508  C CD    . LYS A 91  ? 0.8744 0.8438 1.0662 0.0828  0.0147  0.0277  602 LYS A CD    
509  C CE    . LYS A 91  ? 0.8957 0.8498 1.1025 0.0852  0.0271  0.0244  602 LYS A CE    
510  N NZ    . LYS A 91  ? 0.9400 0.9074 1.1737 0.0994  0.0234  0.0216  602 LYS A NZ    
511  N N     . ARG A 92  ? 0.6843 0.6748 0.7991 0.0545  -0.0201 0.0416  603 ARG A N     
512  C CA    . ARG A 92  ? 0.6315 0.6454 0.7473 0.0592  -0.0365 0.0437  603 ARG A CA    
513  C C     . ARG A 92  ? 0.5652 0.5745 0.6558 0.0459  -0.0408 0.0475  603 ARG A C     
514  O O     . ARG A 92  ? 0.5735 0.5966 0.6618 0.0481  -0.0546 0.0492  603 ARG A O     
515  C CB    . ARG A 92  ? 0.7496 0.7916 0.8844 0.0699  -0.0404 0.0432  603 ARG A CB    
516  C CG    . ARG A 92  ? 0.7260 0.7719 0.8858 0.0837  -0.0373 0.0392  603 ARG A CG    
517  C CD    . ARG A 92  ? 0.6977 0.7752 0.8770 0.0993  -0.0488 0.0382  603 ARG A CD    
518  N NE    . ARG A 92  ? 0.9174 1.0141 1.0919 0.1019  -0.0637 0.0400  603 ARG A NE    
519  C CZ    . ARG A 92  ? 1.0586 1.1522 1.2319 0.1055  -0.0740 0.0391  603 ARG A CZ    
520  N NH1   . ARG A 92  ? 1.1541 1.2263 1.3304 0.1061  -0.0708 0.0375  603 ARG A NH1   
521  N NH2   . ARG A 92  ? 0.9941 1.1062 1.1634 0.1080  -0.0880 0.0402  603 ARG A NH2   
522  N N     . SER A 93  ? 0.5907 0.5805 0.6625 0.0327  -0.0300 0.0485  604 SER A N     
523  C CA    . SER A 93  ? 0.6012 0.5852 0.6487 0.0201  -0.0350 0.0523  604 SER A CA    
524  C C     . SER A 93  ? 0.5511 0.5155 0.5791 0.0128  -0.0387 0.0533  604 SER A C     
525  O O     . SER A 93  ? 0.5962 0.5604 0.6077 0.0052  -0.0476 0.0563  604 SER A O     
526  C CB    . SER A 93  ? 0.6236 0.5912 0.6556 0.0084  -0.0238 0.0528  604 SER A CB    
527  O OG    . SER A 93  ? 0.6952 0.6315 0.7102 0.0003  -0.0118 0.0507  604 SER A OG    
528  N N     . GLY A 94  ? 0.5027 0.4500 0.5320 0.0142  -0.0319 0.0512  605 GLY A N     
529  C CA    . GLY A 94  ? 0.6932 0.6203 0.7031 0.0064  -0.0345 0.0528  605 GLY A CA    
530  C C     . GLY A 94  ? 0.6275 0.5267 0.6085 -0.0087 -0.0228 0.0535  605 GLY A C     
531  O O     . GLY A 94  ? 0.6126 0.4914 0.5720 -0.0175 -0.0229 0.0551  605 GLY A O     
532  N N     . CYS A 95  ? 0.4487 0.3472 0.4292 -0.0112 -0.0136 0.0521  606 CYS A N     
533  C CA    . CYS A 95  ? 0.4767 0.3515 0.4313 -0.0240 -0.0037 0.0519  606 CYS A CA    
534  C C     . CYS A 95  ? 0.5674 0.4367 0.4974 -0.0346 -0.0142 0.0557  606 CYS A C     
535  O O     . CYS A 95  ? 0.5990 0.4432 0.5021 -0.0458 -0.0085 0.0557  606 CYS A O     
536  C CB    . CYS A 95  ? 0.5201 0.3685 0.4632 -0.0283 0.0108  0.0495  606 CYS A CB    
537  S SG    . CYS A 95  ? 0.5850 0.4399 0.5594 -0.0161 0.0228  0.0454  606 CYS A SG    
538  N N     . LEU A 96  ? 0.6648 0.5584 0.6047 -0.0305 -0.0297 0.0586  607 LEU A N     
539  C CA    . LEU A 96  ? 0.5754 0.4684 0.4965 -0.0398 -0.0412 0.0626  607 LEU A CA    
540  C C     . LEU A 96  ? 0.7243 0.6417 0.6575 -0.0383 -0.0471 0.0651  607 LEU A C     
541  O O     . LEU A 96  ? 0.8143 0.7448 0.7441 -0.0413 -0.0602 0.0690  607 LEU A O     
542  C CB    . LEU A 96  ? 0.4979 0.3964 0.4167 -0.0382 -0.0559 0.0644  607 LEU A CB    
543  C CG    . LEU A 96  ? 0.5497 0.4205 0.4511 -0.0431 -0.0510 0.0636  607 LEU A CG    
544  C CD1   . LEU A 96  ? 0.5898 0.4642 0.4880 -0.0423 -0.0674 0.0656  607 LEU A CD1   
545  C CD2   . LEU A 96  ? 0.5361 0.3753 0.4055 -0.0572 -0.0411 0.0638  607 LEU A CD2   
546  N N     . LYS A 97  ? 0.7645 0.6885 0.7127 -0.0336 -0.0376 0.0632  608 LYS A N     
547  C CA    . LYS A 97  ? 0.6776 0.6222 0.6368 -0.0332 -0.0409 0.0660  608 LYS A CA    
548  C C     . LYS A 97  ? 0.6677 0.5930 0.6196 -0.0389 -0.0278 0.0639  608 LYS A C     
549  O O     . LYS A 97  ? 0.7523 0.6582 0.7019 -0.0376 -0.0153 0.0592  608 LYS A O     
550  C CB    . LYS A 97  ? 0.5537 0.5321 0.5440 -0.0184 -0.0452 0.0655  608 LYS A CB    
551  C CG    . LYS A 97  ? 0.5687 0.5684 0.5669 -0.0116 -0.0597 0.0669  608 LYS A CG    
552  C CD    . LYS A 97  ? 0.5810 0.6098 0.6084 0.0051  -0.0634 0.0647  608 LYS A CD    
553  C CE    . LYS A 97  ? 0.6862 0.7407 0.7201 0.0110  -0.0801 0.0665  608 LYS A CE    
554  N NZ    . LYS A 97  ? 0.7268 0.8113 0.7872 0.0283  -0.0862 0.0639  608 LYS A NZ    
555  N N     . ASN A 98  ? 0.6229 0.5538 0.5719 -0.0452 -0.0311 0.0676  609 ASN A N     
556  C CA    . ASN A 98  ? 0.7176 0.6278 0.6575 -0.0514 -0.0209 0.0655  609 ASN A CA    
557  C C     . ASN A 98  ? 0.6754 0.5927 0.6376 -0.0421 -0.0111 0.0616  609 ASN A C     
558  O O     . ASN A 98  ? 0.6513 0.5516 0.6082 -0.0460 -0.0027 0.0588  609 ASN A O     
559  C CB    . ASN A 98  ? 0.6935 0.6058 0.6229 -0.0619 -0.0295 0.0714  609 ASN A CB    
560  C CG    . ASN A 98  ? 0.7489 0.6416 0.6502 -0.0732 -0.0363 0.0738  609 ASN A CG    
561  O OD1   . ASN A 98  ? 0.7278 0.5885 0.6059 -0.0796 -0.0290 0.0701  609 ASN A OD1   
562  N ND2   . ASN A 98  ? 0.7997 0.7119 0.7030 -0.0752 -0.0502 0.0797  609 ASN A ND2   
563  N N     . TYR A 99  ? 0.5222 0.4629 0.5089 -0.0295 -0.0127 0.0607  610 TYR A N     
564  C CA    . TYR A 99  ? 0.4573 0.3968 0.4624 -0.0201 -0.0019 0.0553  610 TYR A CA    
565  C C     . TYR A 99  ? 0.5089 0.4187 0.5031 -0.0217 0.0112  0.0494  610 TYR A C     
566  O O     . TYR A 99  ? 0.5492 0.4499 0.5524 -0.0181 0.0222  0.0447  610 TYR A O     
567  C CB    . TYR A 99  ? 0.4568 0.4238 0.4880 -0.0058 -0.0070 0.0550  610 TYR A CB    
568  C CG    . TYR A 99  ? 0.4622 0.4622 0.5053 -0.0023 -0.0194 0.0605  610 TYR A CG    
569  C CD1   . TYR A 99  ? 0.4516 0.4663 0.5073 -0.0006 -0.0190 0.0625  610 TYR A CD1   
570  C CD2   . TYR A 99  ? 0.3913 0.4087 0.4336 -0.0003 -0.0317 0.0636  610 TYR A CD2   
571  C CE1   . TYR A 99  ? 0.4337 0.4811 0.5005 0.0025  -0.0295 0.0681  610 TYR A CE1   
572  C CE2   . TYR A 99  ? 0.5270 0.5776 0.5814 0.0037  -0.0423 0.0683  610 TYR A CE2   
573  C CZ    . TYR A 99  ? 0.5252 0.5911 0.5916 0.0048  -0.0405 0.0709  610 TYR A CZ    
574  O OH    . TYR A 99  ? 0.3219 0.4217 0.4003 0.0083  -0.0495 0.0762  610 TYR A OH    
575  N N     . CYS A 100 ? 0.5624 0.4580 0.5382 -0.0268 0.0100  0.0498  611 CYS A N     
576  C CA    . CYS A 100 ? 0.5857 0.4535 0.5481 -0.0299 0.0229  0.0451  611 CYS A CA    
577  C C     . CYS A 100 ? 0.5175 0.3597 0.4547 -0.0411 0.0294  0.0435  611 CYS A C     
578  O O     . CYS A 100 ? 0.6347 0.4715 0.5521 -0.0503 0.0212  0.0472  611 CYS A O     
579  C CB    . CYS A 100 ? 0.7385 0.6000 0.6897 -0.0315 0.0189  0.0466  611 CYS A CB    
580  S SG    . CYS A 100 ? 0.8270 0.6549 0.7581 -0.0372 0.0350  0.0425  611 CYS A SG    
581  N N     . GLU A 101 ? 0.5322 0.3586 0.4708 -0.0399 0.0433  0.0377  612 GLU A N     
582  C CA    . GLU A 101 ? 0.6351 0.4365 0.5504 -0.0490 0.0495  0.0348  612 GLU A CA    
583  C C     . GLU A 101 ? 0.6563 0.4334 0.5402 -0.0577 0.0523  0.0345  612 GLU A C     
584  O O     . GLU A 101 ? 0.5834 0.3413 0.4412 -0.0671 0.0508  0.0344  612 GLU A O     
585  C CB    . GLU A 101 ? 0.6181 0.4103 0.5451 -0.0440 0.0634  0.0277  612 GLU A CB    
586  C CG    . GLU A 101 ? 0.7680 0.5653 0.7027 -0.0448 0.0592  0.0278  612 GLU A CG    
587  C CD    . GLU A 101 ? 0.8050 0.5995 0.7588 -0.0376 0.0699  0.0212  612 GLU A CD    
588  O OE1   . GLU A 101 ? 0.7573 0.5381 0.7119 -0.0343 0.0834  0.0148  612 GLU A OE1   
589  O OE2   . GLU A 101 ? 0.9674 0.7740 0.9360 -0.0356 0.0643  0.0226  612 GLU A OE2   
590  N N     . CYS A 102 ? 0.7248 0.5022 0.6106 -0.0547 0.0553  0.0348  613 CYS A N     
591  C CA    . CYS A 102 ? 0.6462 0.4026 0.5026 -0.0630 0.0566  0.0356  613 CYS A CA    
592  C C     . CYS A 102 ? 0.6344 0.3940 0.4751 -0.0703 0.0401  0.0416  613 CYS A C     
593  O O     . CYS A 102 ? 0.7773 0.5167 0.5899 -0.0799 0.0384  0.0418  613 CYS A O     
594  C CB    . CYS A 102 ? 0.6500 0.4085 0.5149 -0.0584 0.0616  0.0358  613 CYS A CB    
595  S SG    . CYS A 102 ? 0.7488 0.5003 0.6298 -0.0514 0.0825  0.0289  613 CYS A SG    
596  N N     . TYR A 103 ? 0.6559 0.4415 0.5156 -0.0652 0.0274  0.0462  614 TYR A N     
597  C CA    . TYR A 103 ? 0.7159 0.5075 0.5638 -0.0714 0.0112  0.0519  614 TYR A CA    
598  C C     . TYR A 103 ? 0.7714 0.5597 0.6092 -0.0786 0.0060  0.0537  614 TYR A C     
599  O O     . TYR A 103 ? 0.8821 0.6574 0.6959 -0.0883 -0.0021 0.0566  614 TYR A O     
600  C CB    . TYR A 103 ? 0.7669 0.5906 0.6406 -0.0627 -0.0011 0.0555  614 TYR A CB    
601  C CG    . TYR A 103 ? 0.8588 0.6889 0.7212 -0.0683 -0.0175 0.0608  614 TYR A CG    
602  C CD1   . TYR A 103 ? 0.7427 0.5612 0.5897 -0.0716 -0.0224 0.0619  614 TYR A CD1   
603  C CD2   . TYR A 103 ? 0.8918 0.7393 0.7590 -0.0707 -0.0286 0.0651  614 TYR A CD2   
604  C CE1   . TYR A 103 ? 0.8035 0.6269 0.6406 -0.0766 -0.0382 0.0663  614 TYR A CE1   
605  C CE2   . TYR A 103 ? 0.9164 0.7703 0.7746 -0.0758 -0.0437 0.0699  614 TYR A CE2   
606  C CZ    . TYR A 103 ? 0.9496 0.7911 0.7929 -0.0784 -0.0486 0.0701  614 TYR A CZ    
607  O OH    . TYR A 103 ? 1.0551 0.9022 0.8900 -0.0831 -0.0644 0.0743  614 TYR A OH    
608  N N     . GLU A 104 ? 0.6247 0.4236 0.4805 -0.0743 0.0099  0.0522  615 GLU A N     
609  C CA    . GLU A 104 ? 0.7004 0.4957 0.5483 -0.0814 0.0045  0.0544  615 GLU A CA    
610  C C     . GLU A 104 ? 0.7217 0.4811 0.5370 -0.0909 0.0105  0.0508  615 GLU A C     
611  O O     . GLU A 104 ? 0.8064 0.5560 0.6042 -0.1000 0.0017  0.0540  615 GLU A O     
612  C CB    . GLU A 104 ? 0.8222 0.6330 0.6951 -0.0750 0.0084  0.0531  615 GLU A CB    
613  C CG    . GLU A 104 ? 1.0468 0.8471 0.9101 -0.0828 0.0054  0.0542  615 GLU A CG    
614  C CD    . GLU A 104 ? 1.2566 1.0736 1.1453 -0.0768 0.0072  0.0539  615 GLU A CD    
615  O OE1   . GLU A 104 ? 1.3109 1.1459 1.2241 -0.0661 0.0121  0.0520  615 GLU A OE1   
616  O OE2   . GLU A 104 ? 1.3325 1.1438 1.2164 -0.0831 0.0028  0.0558  615 GLU A OE2   
617  N N     . ALA A 105 ? 0.8717 0.6117 0.6786 -0.0888 0.0252  0.0442  616 ALA A N     
618  C CA    . ALA A 105 ? 0.9340 0.6402 0.7087 -0.0965 0.0320  0.0398  616 ALA A CA    
619  C C     . ALA A 105 ? 1.0136 0.7042 0.7602 -0.1039 0.0268  0.0424  616 ALA A C     
620  O O     . ALA A 105 ? 1.0300 0.6916 0.7462 -0.1103 0.0318  0.0391  616 ALA A O     
621  C CB    . ALA A 105 ? 0.8793 0.5724 0.6565 -0.0909 0.0507  0.0315  616 ALA A CB    
622  N N     . LYS A 106 ? 1.0158 0.7257 0.7727 -0.1025 0.0163  0.0481  617 LYS A N     
623  C CA    . LYS A 106 ? 1.1318 0.8299 0.8652 -0.1094 0.0083  0.0514  617 LYS A CA    
624  C C     . LYS A 106 ? 1.1579 0.8327 0.8718 -0.1104 0.0217  0.0472  617 LYS A C     
625  O O     . LYS A 106 ? 1.1340 0.7843 0.8159 -0.1187 0.0203  0.0474  617 LYS A O     
626  C CB    . LYS A 106 ? 1.1414 0.8237 0.8495 -0.1201 -0.0032 0.0544  617 LYS A CB    
627  N N     . ILE A 107 ? 1.0766 0.7597 0.8105 -0.1021 0.0345  0.0437  618 ILE A N     
628  C CA    . ILE A 107 ? 1.0620 0.7277 0.7823 -0.1026 0.0479  0.0408  618 ILE A CA    
629  C C     . ILE A 107 ? 1.0763 0.7619 0.8228 -0.0948 0.0486  0.0428  618 ILE A C     
630  O O     . ILE A 107 ? 1.1177 0.8298 0.8944 -0.0871 0.0416  0.0446  618 ILE A O     
631  C CB    . ILE A 107 ? 1.1305 0.7811 0.8465 -0.1007 0.0661  0.0332  618 ILE A CB    
632  C CG1   . ILE A 107 ? 1.1095 0.7822 0.8630 -0.0899 0.0724  0.0306  618 ILE A CG1   
633  C CG2   . ILE A 107 ? 1.2101 0.8411 0.9022 -0.1072 0.0638  0.0305  618 ILE A CG2   
634  C CD1   . ILE A 107 ? 1.0938 0.7558 0.8501 -0.0858 0.0924  0.0235  618 ILE A CD1   
635  N N     . MET A 108 ? 0.8951 0.5674 0.6291 -0.0970 0.0568  0.0428  619 MET A N     
636  C CA    . MET A 108 ? 0.7826 0.4698 0.5390 -0.0906 0.0572  0.0452  619 MET A CA    
637  C C     . MET A 108 ? 0.8481 0.5458 0.6328 -0.0811 0.0714  0.0409  619 MET A C     
638  O O     . MET A 108 ? 0.9245 0.6104 0.7033 -0.0814 0.0855  0.0354  619 MET A O     
639  C CB    . MET A 108 ? 0.8593 0.5270 0.5909 -0.0977 0.0608  0.0476  619 MET A CB    
640  C CG    . MET A 108 ? 0.6981 0.3732 0.4306 -0.0992 0.0439  0.0539  619 MET A CG    
641  S SD    . MET A 108 ? 1.1012 0.7768 0.8177 -0.1053 0.0227  0.0571  619 MET A SD    
642  C CE    . MET A 108 ? 1.2396 0.8775 0.9079 -0.1184 0.0303  0.0555  619 MET A CE    
643  N N     . CYS A 109 ? 0.8546 0.5741 0.6702 -0.0723 0.0670  0.0429  620 CYS A N     
644  C CA    . CYS A 109 ? 0.8407 0.5680 0.6828 -0.0636 0.0801  0.0394  620 CYS A CA    
645  C C     . CYS A 109 ? 0.9006 0.6095 0.7288 -0.0680 0.0957  0.0387  620 CYS A C     
646  O O     . CYS A 109 ? 0.9575 0.6529 0.7617 -0.0759 0.0930  0.0425  620 CYS A O     
647  C CB    . CYS A 109 ? 0.7434 0.4966 0.6202 -0.0530 0.0700  0.0420  620 CYS A CB    
648  S SG    . CYS A 109 ? 0.6641 0.4446 0.5661 -0.0443 0.0572  0.0415  620 CYS A SG    
649  N N     . SER A 110 ? 0.9844 0.6925 0.8268 -0.0632 0.1121  0.0339  621 SER A N     
650  C CA    . SER A 110 ? 1.1023 0.7966 0.9352 -0.0666 0.1283  0.0335  621 SER A CA    
651  C C     . SER A 110 ? 1.0665 0.7753 0.9346 -0.0577 0.1350  0.0337  621 SER A C     
652  O O     . SER A 110 ? 0.9237 0.6522 0.8222 -0.0485 0.1259  0.0340  621 SER A O     
653  C CB    . SER A 110 ? 1.1658 0.8409 0.9766 -0.0706 0.1447  0.0268  621 SER A CB    
654  O OG    . SER A 110 ? 1.1375 0.8204 0.9729 -0.0623 0.1546  0.0204  621 SER A OG    
655  N N     . SER A 111 ? 1.0936 0.7927 0.9572 -0.0604 0.1510  0.0335  622 SER A N     
656  C CA    . SER A 111 ? 1.0781 0.7886 0.9734 -0.0537 0.1581  0.0349  622 SER A CA    
657  C C     . SER A 111 ? 0.8936 0.6173 0.8211 -0.0427 0.1624  0.0288  622 SER A C     
658  O O     . SER A 111 ? 0.8897 0.6287 0.8498 -0.0344 0.1586  0.0306  622 SER A O     
659  C CB    . SER A 111 ? 1.1974 0.8949 1.0797 -0.0596 0.1773  0.0354  622 SER A CB    
660  O OG    . SER A 111 ? 1.2161 0.9025 1.0855 -0.0603 0.1940  0.0272  622 SER A OG    
661  N N     . ILE A 112 ? 0.9634 0.6800 0.8814 -0.0427 0.1693  0.0217  623 ILE A N     
662  C CA    . ILE A 112 ? 1.0341 0.7607 0.9799 -0.0331 0.1730  0.0154  623 ILE A CA    
663  C C     . ILE A 112 ? 1.0680 0.8134 1.0356 -0.0258 0.1551  0.0172  623 ILE A C     
664  O O     . ILE A 112 ? 1.1470 0.9047 1.1449 -0.0163 0.1559  0.0143  623 ILE A O     
665  C CB    . ILE A 112 ? 1.0546 0.7666 0.9814 -0.0357 0.1830  0.0074  623 ILE A CB    
666  C CG1   . ILE A 112 ? 1.1242 0.8295 1.0240 -0.0422 0.1698  0.0087  623 ILE A CG1   
667  C CG2   . ILE A 112 ? 1.1638 0.8586 1.0690 -0.0414 0.2017  0.0045  623 ILE A CG2   
668  C CD1   . ILE A 112 ? 1.1915 0.8829 1.0745 -0.0443 0.1750  0.0013  623 ILE A CD1   
669  N N     . CYS A 113 ? 0.9716 0.7199 0.9244 -0.0299 0.1391  0.0221  624 CYS A N     
670  C CA    . CYS A 113 ? 0.8546 0.6230 0.8267 -0.0230 0.1220  0.0242  624 CYS A CA    
671  C C     . CYS A 113 ? 0.8243 0.6085 0.8279 -0.0136 0.1172  0.0271  624 CYS A C     
672  O O     . CYS A 113 ? 0.8561 0.6363 0.8587 -0.0159 0.1188  0.0310  624 CYS A O     
673  C CB    . CYS A 113 ? 0.6775 0.4467 0.6278 -0.0293 0.1060  0.0291  624 CYS A CB    
674  S SG    . CYS A 113 ? 0.8008 0.5523 0.7157 -0.0398 0.1073  0.0267  624 CYS A SG    
675  N N     . LYS A 114 ? 0.6997 0.5016 0.7305 -0.0034 0.1100  0.0256  625 LYS A N     
676  C CA    . LYS A 114 ? 0.6426 0.4593 0.7038 0.0068  0.1036  0.0277  625 LYS A CA    
677  C C     . LYS A 114 ? 0.7030 0.5381 0.7708 0.0121  0.0833  0.0312  625 LYS A C     
678  O O     . LYS A 114 ? 0.6523 0.5039 0.7476 0.0236  0.0756  0.0309  625 LYS A O     
679  C CB    . LYS A 114 ? 0.7392 0.5611 0.8286 0.0160  0.1123  0.0225  625 LYS A CB    
680  C CG    . LYS A 114 ? 0.7305 0.5362 0.8166 0.0120  0.1326  0.0185  625 LYS A CG    
681  C CD    . LYS A 114 ? 0.8256 0.6336 0.9326 0.0192  0.1407  0.0116  625 LYS A CD    
682  C CE    . LYS A 114 ? 0.8889 0.6810 0.9909 0.0154  0.1611  0.0064  625 LYS A CE    
683  N NZ    . LYS A 114 ? 0.8470 0.6424 0.9778 0.0243  0.1689  0.0002  625 LYS A NZ    
684  N N     . CYS A 115 ? 0.8366 0.6685 0.8786 0.0041  0.0747  0.0342  626 CYS A N     
685  C CA    . CYS A 115 ? 0.8201 0.6690 0.8642 0.0077  0.0553  0.0378  626 CYS A CA    
686  C C     . CYS A 115 ? 0.7894 0.6503 0.8556 0.0171  0.0444  0.0402  626 CYS A C     
687  O O     . CYS A 115 ? 0.7965 0.6481 0.8678 0.0165  0.0499  0.0416  626 CYS A O     
688  C CB    . CYS A 115 ? 0.7746 0.6134 0.7871 -0.0036 0.0484  0.0415  626 CYS A CB    
689  S SG    . CYS A 115 ? 0.7306 0.5437 0.7068 -0.0183 0.0613  0.0401  626 CYS A SG    
690  N N     . ILE A 116 ? 0.7049 0.5865 0.7830 0.0255  0.0282  0.0410  627 ILE A N     
691  C CA    . ILE A 116 ? 0.6928 0.5853 0.7852 0.0337  0.0131  0.0434  627 ILE A CA    
692  C C     . ILE A 116 ? 0.7068 0.6082 0.7844 0.0313  -0.0036 0.0460  627 ILE A C     
693  O O     . ILE A 116 ? 0.7786 0.6925 0.8527 0.0318  -0.0080 0.0453  627 ILE A O     
694  C CB    . ILE A 116 ? 0.8121 0.7237 0.9374 0.0495  0.0078  0.0407  627 ILE A CB    
695  C CG1   . ILE A 116 ? 0.9568 0.8581 1.0987 0.0519  0.0226  0.0386  627 ILE A CG1   
696  C CG2   . ILE A 116 ? 0.8010 0.7253 0.9391 0.0591  -0.0110 0.0425  627 ILE A CG2   
697  C CD1   . ILE A 116 ? 0.9817 0.8985 1.1560 0.0675  0.0176  0.0358  627 ILE A CD1   
698  N N     . GLY A 117 ? 0.7241 0.6182 0.7924 0.0277  -0.0128 0.0495  628 GLY A N     
699  C CA    . GLY A 117 ? 0.6893 0.5903 0.7440 0.0255  -0.0293 0.0516  628 GLY A CA    
700  C C     . GLY A 117 ? 0.6826 0.5695 0.7060 0.0109  -0.0238 0.0530  628 GLY A C     
701  O O     . GLY A 117 ? 0.6825 0.5798 0.6974 0.0096  -0.0346 0.0538  628 GLY A O     
702  N N     . CYS A 118 ? 0.6419 0.5057 0.6484 0.0005  -0.0072 0.0532  629 CYS A N     
703  C CA    . CYS A 118 ? 0.6513 0.4996 0.6270 -0.0127 -0.0017 0.0538  629 CYS A CA    
704  C C     . CYS A 118 ? 0.7525 0.5911 0.7038 -0.0215 -0.0142 0.0578  629 CYS A C     
705  O O     . CYS A 118 ? 0.7479 0.5736 0.6913 -0.0254 -0.0164 0.0607  629 CYS A O     
706  C CB    . CYS A 118 ? 0.5645 0.3904 0.5273 -0.0204 0.0192  0.0521  629 CYS A CB    
707  S SG    . CYS A 118 ? 0.6574 0.4622 0.5816 -0.0353 0.0258  0.0518  629 CYS A SG    
708  N N     . LYS A 119 ? 0.6515 0.4964 0.5912 -0.0250 -0.0228 0.0583  630 LYS A N     
709  C CA    . LYS A 119 ? 0.5742 0.4106 0.4906 -0.0335 -0.0354 0.0615  630 LYS A CA    
710  C C     . LYS A 119 ? 0.5898 0.4053 0.4754 -0.0468 -0.0268 0.0618  630 LYS A C     
711  O O     . LYS A 119 ? 0.5790 0.3872 0.4436 -0.0547 -0.0368 0.0642  630 LYS A O     
712  C CB    . LYS A 119 ? 0.4957 0.3582 0.4250 -0.0262 -0.0545 0.0620  630 LYS A CB    
713  C CG    . LYS A 119 ? 0.6761 0.5590 0.6340 -0.0119 -0.0653 0.0610  630 LYS A CG    
714  C CD    . LYS A 119 ? 0.8334 0.7452 0.8051 -0.0032 -0.0822 0.0604  630 LYS A CD    
715  C CE    . LYS A 119 ? 0.9328 0.8654 0.9338 0.0131  -0.0923 0.0582  630 LYS A CE    
716  N NZ    . LYS A 119 ? 0.9681 0.9284 0.9804 0.0222  -0.1109 0.0573  630 LYS A NZ    
717  N N     . ASN A 120 ? 0.5897 0.3951 0.4729 -0.0488 -0.0090 0.0589  631 ASN A N     
718  C CA    . ASN A 120 ? 0.8275 0.6127 0.6820 -0.0602 -0.0015 0.0583  631 ASN A CA    
719  C C     . ASN A 120 ? 0.8383 0.5954 0.6703 -0.0682 0.0130  0.0578  631 ASN A C     
720  O O     . ASN A 120 ? 0.8548 0.6020 0.6853 -0.0687 0.0300  0.0542  631 ASN A O     
721  C CB    . ASN A 120 ? 0.5574 0.3514 0.4231 -0.0569 0.0062  0.0550  631 ASN A CB    
722  C CG    . ASN A 120 ? 0.8111 0.5833 0.6477 -0.0680 0.0128  0.0539  631 ASN A CG    
723  O OD1   . ASN A 120 ? 0.6825 0.4445 0.4954 -0.0768 0.0036  0.0566  631 ASN A OD1   
724  N ND2   . ASN A 120 ? 0.7032 0.4687 0.5430 -0.0669 0.0277  0.0495  631 ASN A ND2   
725  N N     . PHE A 121 ? 0.8442 0.5898 0.6596 -0.0741 0.0055  0.0616  632 PHE A N     
726  C CA    . PHE A 121 ? 0.9170 0.6354 0.7056 -0.0836 0.0168  0.0626  632 PHE A CA    
727  C C     . PHE A 121 ? 0.9296 0.6315 0.6864 -0.0944 0.0045  0.0662  632 PHE A C     
728  O O     . PHE A 121 ? 0.8598 0.5737 0.6204 -0.0931 -0.0135 0.0681  632 PHE A O     
729  C CB    . PHE A 121 ? 0.7929 0.5128 0.5967 -0.0798 0.0217  0.0646  632 PHE A CB    
730  C CG    . PHE A 121 ? 0.7673 0.5032 0.5897 -0.0737 0.0027  0.0681  632 PHE A CG    
731  C CD1   . PHE A 121 ? 0.7374 0.4998 0.5954 -0.0603 -0.0039 0.0664  632 PHE A CD1   
732  C CD2   . PHE A 121 ? 0.8418 0.5658 0.6455 -0.0809 -0.0094 0.0729  632 PHE A CD2   
733  C CE1   . PHE A 121 ? 0.7194 0.4961 0.5937 -0.0536 -0.0219 0.0687  632 PHE A CE1   
734  C CE2   . PHE A 121 ? 0.7606 0.4986 0.5815 -0.0747 -0.0281 0.0754  632 PHE A CE2   
735  C CZ    . PHE A 121 ? 0.7188 0.4834 0.5750 -0.0606 -0.0345 0.0731  632 PHE A CZ    
736  N N     . GLU A 122 ? 0.9525 0.6274 0.6781 -0.1045 0.0145  0.0670  633 GLU A N     
737  C CA    . GLU A 122 ? 1.0338 0.6872 0.7233 -0.1161 0.0056  0.0697  633 GLU A CA    
738  C C     . GLU A 122 ? 0.9106 0.5701 0.6023 -0.1167 -0.0160 0.0746  633 GLU A C     
739  O O     . GLU A 122 ? 0.8671 0.5243 0.5458 -0.1210 -0.0311 0.0759  633 GLU A O     
740  C CB    . GLU A 122 ? 1.2092 0.8346 0.8680 -0.1252 0.0213  0.0701  633 GLU A CB    
741  C CG    . GLU A 122 ? 1.4218 1.0214 1.0400 -0.1374 0.0135  0.0728  633 GLU A CG    
742  C CD    . GLU A 122 ? 1.5840 1.1747 1.1841 -0.1412 0.0104  0.0697  633 GLU A CD    
743  O OE1   . GLU A 122 ? 1.6554 1.2410 1.2523 -0.1399 0.0254  0.0647  633 GLU A OE1   
744  O OE2   . GLU A 122 ? 1.6383 1.2269 1.2280 -0.1454 -0.0077 0.0723  633 GLU A OE2   
745  N N     . GLU A 123 ? 0.7318 0.3988 0.4407 -0.1123 -0.0184 0.0773  634 GLU A N     
746  C CA    . GLU A 123 ? 0.9390 0.6077 0.6475 -0.1134 -0.0387 0.0816  634 GLU A CA    
747  C C     . GLU A 123 ? 1.0153 0.7152 0.7581 -0.1010 -0.0554 0.0804  634 GLU A C     
748  O O     . GLU A 123 ? 1.0412 0.7474 0.7913 -0.0985 -0.0731 0.0829  634 GLU A O     
749  C CB    . GLU A 123 ? 0.9873 0.6454 0.6940 -0.1164 -0.0348 0.0859  634 GLU A CB    
750  C CG    . GLU A 123 ? 1.0931 0.7239 0.7684 -0.1275 -0.0151 0.0871  634 GLU A CG    
751  C CD    . GLU A 123 ? 1.1484 0.7835 0.8365 -0.1228 0.0088  0.0829  634 GLU A CD    
752  O OE1   . GLU A 123 ? 1.0523 0.7081 0.7682 -0.1125 0.0105  0.0786  634 GLU A OE1   
753  O OE2   . GLU A 123 ? 1.2266 0.8445 0.8962 -0.1295 0.0260  0.0838  634 GLU A OE2   
754  N N     . SER A 124 ? 0.9973 0.7164 0.7603 -0.0930 -0.0502 0.0765  635 SER A N     
755  C CA    . SER A 124 ? 0.8914 0.6418 0.6868 -0.0804 -0.0639 0.0750  635 SER A CA    
756  C C     . SER A 124 ? 0.9100 0.6666 0.6971 -0.0828 -0.0836 0.0763  635 SER A C     
757  O O     . SER A 124 ? 0.9313 0.6788 0.6987 -0.0906 -0.0826 0.0763  635 SER A O     
758  C CB    . SER A 124 ? 0.8551 0.6237 0.6727 -0.0721 -0.0524 0.0711  635 SER A CB    
759  O OG    . SER A 124 ? 0.7919 0.5914 0.6377 -0.0603 -0.0656 0.0699  635 SER A OG    
760  N N     . PRO A 125 ? 0.8859 0.6580 0.6887 -0.0757 -0.1023 0.0771  636 PRO A N     
761  C CA    . PRO A 125 ? 0.9544 0.7377 0.7553 -0.0757 -0.1223 0.0777  636 PRO A CA    
762  C C     . PRO A 125 ? 0.9488 0.7581 0.7668 -0.0695 -0.1221 0.0755  636 PRO A C     
763  O O     . PRO A 125 ? 0.9588 0.7646 0.7615 -0.0769 -0.1259 0.0767  636 PRO A O     
764  C CB    . PRO A 125 ? 0.8909 0.6887 0.7120 -0.0659 -0.1397 0.0776  636 PRO A CB    
765  C CG    . PRO A 125 ? 0.8783 0.6638 0.7032 -0.0651 -0.1298 0.0787  636 PRO A CG    
766  C CD    . PRO A 125 ? 0.8037 0.5847 0.6291 -0.0664 -0.1061 0.0772  636 PRO A CD    
767  N N     . GLU A 126 ? 0.8524 0.6868 0.7014 -0.0563 -0.1180 0.0729  637 GLU A N     
768  C CA    . GLU A 126 ? 0.8125 0.6744 0.6802 -0.0495 -0.1182 0.0714  637 GLU A CA    
769  C C     . GLU A 126 ? 0.8303 0.6784 0.6799 -0.0599 -0.1052 0.0722  637 GLU A C     
770  O O     . GLU A 126 ? 0.8968 0.7581 0.7474 -0.0615 -0.1105 0.0734  637 GLU A O     
771  C CB    . GLU A 126 ? 0.7974 0.6826 0.6978 -0.0347 -0.1124 0.0684  637 GLU A CB    
772  C CG    . GLU A 126 ? 0.9012 0.7993 0.8210 -0.0230 -0.1256 0.0670  637 GLU A CG    
773  C CD    . GLU A 126 ? 1.0372 0.9132 0.9535 -0.0247 -0.1183 0.0676  637 GLU A CD    
774  O OE1   . GLU A 126 ? 0.9617 0.8102 0.8546 -0.0369 -0.1050 0.0695  637 GLU A OE1   
775  O OE2   . GLU A 126 ? 1.0262 0.9131 0.9633 -0.0135 -0.1262 0.0663  637 GLU A OE2   
776  N N     . ARG A 127 ? 0.8573 0.6790 0.6901 -0.0668 -0.0887 0.0717  638 ARG A N     
777  C CA    . ARG A 127 ? 0.8948 0.7011 0.7089 -0.0761 -0.0772 0.0716  638 ARG A CA    
778  C C     . ARG A 127 ? 1.0471 0.8377 0.8331 -0.0879 -0.0880 0.0745  638 ARG A C     
779  O O     . ARG A 127 ? 1.1323 0.9275 0.9143 -0.0920 -0.0908 0.0757  638 ARG A O     
780  C CB    . ARG A 127 ? 0.8083 0.5894 0.6091 -0.0804 -0.0574 0.0696  638 ARG A CB    
781  C CG    . ARG A 127 ? 0.7539 0.5185 0.5357 -0.0886 -0.0460 0.0683  638 ARG A CG    
782  C CD    . ARG A 127 ? 0.8802 0.6173 0.6432 -0.0938 -0.0274 0.0659  638 ARG A CD    
783  N NE    . ARG A 127 ? 1.1259 0.8381 0.8604 -0.1028 -0.0295 0.0681  638 ARG A NE    
784  C CZ    . ARG A 127 ? 1.2039 0.8956 0.9069 -0.1137 -0.0360 0.0699  638 ARG A CZ    
785  N NH1   . ARG A 127 ? 1.1989 0.8926 0.8962 -0.1170 -0.0417 0.0700  638 ARG A NH1   
786  N NH2   . ARG A 127 ? 1.1270 0.7957 0.8039 -0.1216 -0.0377 0.0721  638 ARG A NH2   
787  N N     . LYS A 128 ? 1.1149 0.8870 0.8822 -0.0936 -0.0954 0.0762  639 LYS A N     
788  C CA    . LYS A 128 ? 1.0665 0.8212 0.8060 -0.1048 -0.1073 0.0789  639 LYS A CA    
789  C C     . LYS A 128 ? 1.0142 0.7946 0.7680 -0.1016 -0.1257 0.0806  639 LYS A C     
790  O O     . LYS A 128 ? 1.1672 0.9410 0.9059 -0.1098 -0.1314 0.0827  639 LYS A O     
791  C CB    . LYS A 128 ? 1.1538 0.8862 0.8736 -0.1103 -0.1133 0.0806  639 LYS A CB    
792  C CG    . LYS A 128 ? 1.1794 0.8758 0.8662 -0.1212 -0.0981 0.0808  639 LYS A CG    
793  C CD    . LYS A 128 ? 1.0435 0.7226 0.7181 -0.1246 -0.0999 0.0829  639 LYS A CD    
794  C CE    . LYS A 128 ? 1.1124 0.7568 0.7511 -0.1360 -0.0846 0.0833  639 LYS A CE    
795  N NZ    . LYS A 128 ? 1.0655 0.6923 0.6912 -0.1404 -0.0820 0.0862  639 LYS A NZ    
796  N N     . THR A 129 ? 0.8405 0.6506 0.6238 -0.0893 -0.1353 0.0796  640 THR A N     
797  C CA    . THR A 129 ? 0.8742 0.7139 0.6748 -0.0843 -0.1515 0.0807  640 THR A CA    
798  C C     . THR A 129 ? 0.9774 0.8339 0.7880 -0.0843 -0.1450 0.0817  640 THR A C     
799  O O     . THR A 129 ? 1.1300 0.9924 0.9355 -0.0900 -0.1544 0.0847  640 THR A O     
800  C CB    . THR A 129 ? 0.8764 0.7468 0.7085 -0.0688 -0.1612 0.0783  640 THR A CB    
801  O OG1   . THR A 129 ? 1.0009 0.8553 0.8262 -0.0683 -0.1667 0.0776  640 THR A OG1   
802  C CG2   . THR A 129 ? 0.8390 0.7388 0.6856 -0.0641 -0.1791 0.0791  640 THR A CG2   
803  N N     . LEU A 130 ? 0.8334 0.6972 0.6586 -0.0782 -0.1295 0.0796  641 LEU A N     
804  C CA    . LEU A 130 ? 0.8996 0.7763 0.7335 -0.0788 -0.1224 0.0807  641 LEU A CA    
805  C C     . LEU A 130 ? 1.0463 0.8931 0.8506 -0.0932 -0.1161 0.0825  641 LEU A C     
806  O O     . LEU A 130 ? 1.1251 0.9791 0.9327 -0.0960 -0.1132 0.0843  641 LEU A O     
807  C CB    . LEU A 130 ? 0.8011 0.6897 0.6569 -0.0688 -0.1079 0.0775  641 LEU A CB    
808  N N     . MET A 131 ? 1.1177 0.9307 0.8925 -0.1021 -0.1146 0.0821  642 MET A N     
809  C CA    . MET A 131 ? 1.2668 1.0498 1.0109 -0.1151 -0.1105 0.0832  642 MET A CA    
810  C C     . MET A 131 ? 1.4788 1.2621 1.2117 -0.1231 -0.1284 0.0876  642 MET A C     
811  O O     . MET A 131 ? 1.5450 1.3127 1.2599 -0.1326 -0.1291 0.0896  642 MET A O     
812  C CB    . MET A 131 ? 1.2718 1.0185 0.9874 -0.1212 -0.1004 0.0809  642 MET A CB    
813  C CG    . MET A 131 ? 1.3322 1.0481 1.0187 -0.1313 -0.0901 0.0798  642 MET A CG    
814  S SD    . MET A 131 ? 1.6089 1.2867 1.2638 -0.1368 -0.0760 0.0768  642 MET A SD    
815  C CE    . MET A 131 ? 1.2129 0.8571 0.8321 -0.1480 -0.0692 0.0753  642 MET A CE    
816  N N     . HIS A 132 ? 1.5699 1.3711 1.3145 -0.1187 -0.1438 0.0889  643 HIS A N     
817  C CA    . HIS A 132 ? 1.6018 1.4093 1.3420 -0.1244 -0.1621 0.0929  643 HIS A CA    
818  C C     . HIS A 132 ? 1.4640 1.3168 1.2393 -0.1140 -0.1728 0.0943  643 HIS A C     
819  O O     . HIS A 132 ? 1.3119 1.1868 1.1034 -0.1126 -0.1707 0.0968  643 HIS A O     
820  C CB    . HIS A 132 ? 1.6708 1.4546 1.3880 -0.1303 -0.1735 0.0930  643 HIS A CB    
821  C CG    . HIS A 132 ? 1.7642 1.5050 1.4460 -0.1399 -0.1630 0.0916  643 HIS A CG    
822  N ND1   . HIS A 132 ? 1.7918 1.5123 1.4580 -0.1414 -0.1640 0.0904  643 HIS A ND1   
823  C CD2   . HIS A 132 ? 1.8094 1.5239 1.4677 -0.1483 -0.1515 0.0914  643 HIS A CD2   
824  C CE1   . HIS A 132 ? 1.8133 1.4982 1.4478 -0.1503 -0.1524 0.0897  643 HIS A CE1   
825  N NE2   . HIS A 132 ? 1.8271 1.5075 1.4561 -0.1541 -0.1448 0.0897  643 HIS A NE2   
826  N N     . ARG B 11  ? 1.4720 1.3133 1.4354 -0.0862 -0.1339 0.0789  522 ARG B N     
827  C CA    . ARG B 11  ? 1.4699 1.3148 1.4256 -0.0802 -0.1267 0.0698  522 ARG B CA    
828  C C     . ARG B 11  ? 1.4277 1.2939 1.3932 -0.0817 -0.1214 0.0773  522 ARG B C     
829  O O     . ARG B 11  ? 1.4342 1.3006 1.4005 -0.0859 -0.1261 0.0790  522 ARG B O     
830  C CB    . ARG B 11  ? 1.4503 1.2762 1.3944 -0.0815 -0.1343 0.0606  522 ARG B CB    
831  N N     . LYS B 12  ? 1.3010 1.1858 1.2742 -0.0780 -0.1116 0.0816  523 LYS B N     
832  C CA    . LYS B 12  ? 1.1403 1.0470 1.1240 -0.0784 -0.1054 0.0882  523 LYS B CA    
833  C C     . LYS B 12  ? 1.1016 1.0128 1.0787 -0.0703 -0.0953 0.0788  523 LYS B C     
834  O O     . LYS B 12  ? 1.2153 1.1202 1.1831 -0.0634 -0.0895 0.0693  523 LYS B O     
835  C CB    . LYS B 12  ? 1.0161 0.9416 1.0127 -0.0793 -0.1004 0.0979  523 LYS B CB    
836  C CG    . LYS B 12  ? 1.0002 0.9499 1.0066 -0.0766 -0.0903 0.1016  523 LYS B CG    
837  C CD    . LYS B 12  ? 1.0015 0.9708 1.0229 -0.0808 -0.0890 0.1139  523 LYS B CD    
838  C CE    . LYS B 12  ? 0.9629 0.9317 0.9837 -0.0788 -0.0865 0.1141  523 LYS B CE    
839  N NZ    . LYS B 12  ? 0.9967 0.9863 1.0323 -0.0833 -0.0852 0.1263  523 LYS B NZ    
840  N N     . PRO B 13  ? 0.9218 0.8435 0.9036 -0.0711 -0.0935 0.0814  524 PRO B N     
841  C CA    . PRO B 13  ? 0.8685 0.7932 0.8441 -0.0640 -0.0848 0.0729  524 PRO B CA    
842  C C     . PRO B 13  ? 0.7950 0.7343 0.7739 -0.0567 -0.0716 0.0705  524 PRO B C     
843  O O     . PRO B 13  ? 0.8371 0.7943 0.8286 -0.0576 -0.0673 0.0784  524 PRO B O     
844  C CB    . PRO B 13  ? 0.8645 0.7992 0.8477 -0.0677 -0.0869 0.0793  524 PRO B CB    
845  C CG    . PRO B 13  ? 0.8380 0.7835 0.8351 -0.0751 -0.0920 0.0922  524 PRO B CG    
846  C CD    . PRO B 13  ? 0.8442 0.7746 0.8369 -0.0789 -0.0999 0.0923  524 PRO B CD    
847  N N     . CYS B 14  ? 0.6768 0.6090 0.6442 -0.0495 -0.0652 0.0590  525 CYS B N     
848  C CA    . CYS B 14  ? 0.5876 0.5320 0.5563 -0.0421 -0.0524 0.0547  525 CYS B CA    
849  C C     . CYS B 14  ? 0.6480 0.6078 0.6238 -0.0397 -0.0449 0.0562  525 CYS B C     
850  O O     . CYS B 14  ? 0.7289 0.6859 0.7043 -0.0422 -0.0492 0.0575  525 CYS B O     
851  C CB    . CYS B 14  ? 0.5175 0.4473 0.4704 -0.0358 -0.0490 0.0415  525 CYS B CB    
852  S SG    . CYS B 14  ? 0.5910 0.5099 0.5311 -0.0328 -0.0486 0.0315  525 CYS B SG    
853  N N     . ASN B 15  ? 0.5257 0.5019 0.5082 -0.0348 -0.0336 0.0557  526 ASN B N     
854  C CA    . ASN B 15  ? 0.5136 0.5043 0.5032 -0.0315 -0.0255 0.0560  526 ASN B CA    
855  C C     . ASN B 15  ? 0.5869 0.5794 0.5700 -0.0232 -0.0137 0.0456  526 ASN B C     
856  O O     . ASN B 15  ? 0.6140 0.6224 0.6057 -0.0196 -0.0042 0.0459  526 ASN B O     
857  C CB    . ASN B 15  ? 0.5530 0.5659 0.5604 -0.0341 -0.0226 0.0666  526 ASN B CB    
858  C CG    . ASN B 15  ? 0.6679 0.6808 0.6826 -0.0427 -0.0338 0.0774  526 ASN B CG    
859  O OD1   . ASN B 15  ? 0.7471 0.7475 0.7565 -0.0467 -0.0420 0.0787  526 ASN B OD1   
860  N ND2   . ASN B 15  ? 0.6157 0.6417 0.6421 -0.0454 -0.0345 0.0850  526 ASN B ND2   
861  N N     . CYS B 16  ? 0.5606 0.5370 0.5290 -0.0203 -0.0144 0.0361  527 CYS B N     
862  C CA    . CYS B 16  ? 0.6233 0.5998 0.5839 -0.0128 -0.0039 0.0255  527 CYS B CA    
863  C C     . CYS B 16  ? 0.6408 0.6216 0.6016 -0.0093 0.0024  0.0221  527 CYS B C     
864  O O     . CYS B 16  ? 0.7381 0.7146 0.6991 -0.0122 -0.0032 0.0251  527 CYS B O     
865  C CB    . CYS B 16  ? 0.7091 0.6656 0.6529 -0.0111 -0.0078 0.0162  527 CYS B CB    
866  S SG    . CYS B 16  ? 0.6130 0.5585 0.5559 -0.0169 -0.0196 0.0214  527 CYS B SG    
867  N N     . THR B 17  ? 0.6228 0.6125 0.5839 -0.0031 0.0141  0.0160  528 THR B N     
868  C CA    . THR B 17  ? 0.6467 0.6396 0.6074 0.0009  0.0212  0.0117  528 THR B CA    
869  C C     . THR B 17  ? 0.6930 0.6780 0.6401 0.0069  0.0283  -0.0007 528 THR B C     
870  O O     . THR B 17  ? 0.8272 0.8027 0.7649 0.0086  0.0284  -0.0065 528 THR B O     
871  C CB    . THR B 17  ? 0.6737 0.6879 0.6506 0.0027  0.0300  0.0164  528 THR B CB    
872  O OG1   . THR B 17  ? 0.7473 0.7702 0.7371 -0.0030 0.0234  0.0280  528 THR B OG1   
873  C CG2   . THR B 17  ? 0.8792 0.8958 0.8570 0.0064  0.0362  0.0130  528 THR B CG2   
874  N N     . LYS B 18  ? 0.5420 0.5319 0.4882 0.0099  0.0341  -0.0044 529 LYS B N     
875  C CA    . LYS B 18  ? 0.5290 0.5181 0.4664 0.0161  0.0439  -0.0153 529 LYS B CA    
876  C C     . LYS B 18  ? 0.6470 0.6177 0.5667 0.0174  0.0397  -0.0241 529 LYS B C     
877  O O     . LYS B 18  ? 0.6609 0.6268 0.5701 0.0221  0.0459  -0.0342 529 LYS B O     
878  C CB    . LYS B 18  ? 0.5873 0.5940 0.5343 0.0187  0.0530  -0.0145 529 LYS B CB    
879  C CG    . LYS B 18  ? 0.5763 0.6023 0.5390 0.0198  0.0609  -0.0101 529 LYS B CG    
880  C CD    . LYS B 18  ? 0.6881 0.7132 0.6460 0.0250  0.0700  -0.0189 529 LYS B CD    
881  C CE    . LYS B 18  ? 0.7864 0.8270 0.7593 0.0261  0.0766  -0.0149 529 LYS B CE    
882  N NZ    . LYS B 18  ? 0.8325 0.8941 0.8189 0.0277  0.0851  -0.0130 529 LYS B NZ    
883  N N     . SER B 19  ? 0.6494 0.6099 0.5661 0.0131  0.0291  -0.0206 530 SER B N     
884  C CA    . SER B 19  ? 0.5914 0.5356 0.4931 0.0145  0.0249  -0.0286 530 SER B CA    
885  C C     . SER B 19  ? 0.6226 0.5487 0.5122 0.0123  0.0161  -0.0326 530 SER B C     
886  O O     . SER B 19  ? 0.6521 0.5645 0.5282 0.0140  0.0132  -0.0409 530 SER B O     
887  C CB    . SER B 19  ? 0.4604 0.4035 0.3657 0.0116  0.0189  -0.0232 530 SER B CB    
888  O OG    . SER B 19  ? 0.5140 0.4540 0.4261 0.0049  0.0085  -0.0136 530 SER B OG    
889  N N     . LEU B 20  ? 0.5879 0.5146 0.4824 0.0086  0.0117  -0.0268 531 LEU B N     
890  C CA    . LEU B 20  ? 0.6094 0.5213 0.4940 0.0057  0.0029  -0.0293 531 LEU B CA    
891  C C     . LEU B 20  ? 0.6821 0.5818 0.5641 0.0007  -0.0091 -0.0266 531 LEU B C     
892  O O     . LEU B 20  ? 0.6544 0.5411 0.5282 -0.0024 -0.0178 -0.0288 531 LEU B O     
893  C CB    . LEU B 20  ? 0.5748 0.4772 0.4434 0.0104  0.0070  -0.0419 531 LEU B CB    
894  C CG    . LEU B 20  ? 0.6683 0.5807 0.5373 0.0159  0.0198  -0.0468 531 LEU B CG    
895  C CD1   . LEU B 20  ? 0.6691 0.5711 0.5211 0.0200  0.0228  -0.0595 531 LEU B CD1   
896  C CD2   . LEU B 20  ? 0.6640 0.5845 0.5419 0.0144  0.0214  -0.0405 531 LEU B CD2   
897  N N     . CYS B 21  ? 0.6617 0.5663 0.5510 -0.0002 -0.0096 -0.0217 532 CYS B N     
898  C CA    . CYS B 21  ? 0.5423 0.4359 0.4304 -0.0045 -0.0202 -0.0188 532 CYS B CA    
899  C C     . CYS B 21  ? 0.5710 0.4485 0.4432 -0.0011 -0.0220 -0.0305 532 CYS B C     
900  O O     . CYS B 21  ? 0.5282 0.3910 0.3947 -0.0043 -0.0321 -0.0318 532 CYS B O     
901  C CB    . CYS B 21  ? 0.5160 0.4043 0.4080 -0.0117 -0.0313 -0.0114 532 CYS B CB    
902  S SG    . CYS B 21  ? 0.5570 0.4649 0.4670 -0.0150 -0.0287 0.0013  532 CYS B SG    
903  N N     . LEU B 22  ? 0.5804 0.4614 0.4463 0.0055  -0.0120 -0.0390 533 LEU B N     
904  C CA    . LEU B 22  ? 0.6761 0.5445 0.5271 0.0097  -0.0119 -0.0509 533 LEU B CA    
905  C C     . LEU B 22  ? 0.7245 0.5985 0.5765 0.0142  -0.0054 -0.0530 533 LEU B C     
906  O O     . LEU B 22  ? 0.7111 0.5782 0.5518 0.0189  -0.0028 -0.0631 533 LEU B O     
907  C CB    . LEU B 22  ? 0.5283 0.3948 0.3684 0.0135  -0.0060 -0.0606 533 LEU B CB    
908  C CG    . LEU B 22  ? 0.5735 0.4299 0.4079 0.0094  -0.0143 -0.0612 533 LEU B CG    
909  C CD1   . LEU B 22  ? 0.5905 0.4431 0.4118 0.0133  -0.0093 -0.0720 533 LEU B CD1   
910  C CD2   . LEU B 22  ? 0.5512 0.3919 0.3805 0.0055  -0.0267 -0.0620 533 LEU B CD2   
911  N N     . LYS B 23  ? 0.6191 0.5062 0.4850 0.0124  -0.0034 -0.0431 534 LYS B N     
912  C CA    . LYS B 23  ? 0.6658 0.5601 0.5345 0.0156  0.0018  -0.0430 534 LYS B CA    
913  C C     . LYS B 23  ? 0.6617 0.5563 0.5407 0.0102  -0.0064 -0.0318 534 LYS B C     
914  O O     . LYS B 23  ? 0.6372 0.5318 0.5238 0.0042  -0.0133 -0.0233 534 LYS B O     
915  C CB    . LYS B 23  ? 0.6467 0.5608 0.5226 0.0194  0.0148  -0.0426 534 LYS B CB    
916  C CG    . LYS B 23  ? 0.5223 0.4360 0.3871 0.0257  0.0241  -0.0548 534 LYS B CG    
917  C CD    . LYS B 23  ? 0.6025 0.5361 0.4759 0.0288  0.0369  -0.0540 534 LYS B CD    
918  C CE    . LYS B 23  ? 0.7044 0.6377 0.5676 0.0344  0.0461  -0.0656 534 LYS B CE    
919  N NZ    . LYS B 23  ? 0.7463 0.6990 0.6185 0.0375  0.0588  -0.0654 534 LYS B NZ    
920  N N     . LEU B 24  ? 0.6908 0.5864 0.5703 0.0122  -0.0056 -0.0315 535 LEU B N     
921  C CA    . LEU B 24  ? 0.7254 0.6178 0.6125 0.0071  -0.0146 -0.0219 535 LEU B CA    
922  C C     . LEU B 24  ? 0.6988 0.6094 0.6025 0.0026  -0.0130 -0.0089 535 LEU B C     
923  O O     . LEU B 24  ? 0.7702 0.6792 0.6815 -0.0029 -0.0210 0.0007  535 LEU B O     
924  C CB    . LEU B 24  ? 0.7880 0.6766 0.6711 0.0108  -0.0141 -0.0249 535 LEU B CB    
925  C CG    . LEU B 24  ? 0.8069 0.6763 0.6745 0.0150  -0.0175 -0.0370 535 LEU B CG    
926  C CD1   . LEU B 24  ? 0.8899 0.7600 0.7559 0.0192  -0.0151 -0.0388 535 LEU B CD1   
927  C CD2   . LEU B 24  ? 0.6136 0.4628 0.4768 0.0102  -0.0308 -0.0372 535 LEU B CD2   
928  N N     . TYR B 25  ? 0.4846 0.4121 0.3939 0.0048  -0.0030 -0.0087 536 TYR B N     
929  C CA    . TYR B 25  ? 0.4765 0.4216 0.4016 0.0005  -0.0016 0.0028  536 TYR B CA    
930  C C     . TYR B 25  ? 0.5358 0.4730 0.4646 -0.0065 -0.0124 0.0098  536 TYR B C     
931  O O     . TYR B 25  ? 0.4886 0.4369 0.4302 -0.0116 -0.0149 0.0207  536 TYR B O     
932  C CB    . TYR B 25  ? 0.5716 0.5334 0.5010 0.0043  0.0104  0.0000  536 TYR B CB    
933  C CG    . TYR B 25  ? 0.6602 0.6315 0.5860 0.0112  0.0225  -0.0080 536 TYR B CG    
934  C CD1   . TYR B 25  ? 0.6132 0.6000 0.5470 0.0121  0.0277  -0.0039 536 TYR B CD1   
935  C CD2   . TYR B 25  ? 0.5903 0.5558 0.5048 0.0167  0.0287  -0.0198 536 TYR B CD2   
936  C CE1   . TYR B 25  ? 0.6885 0.6848 0.6189 0.0184  0.0390  -0.0116 536 TYR B CE1   
937  C CE2   . TYR B 25  ? 0.5067 0.4809 0.4177 0.0228  0.0398  -0.0275 536 TYR B CE2   
938  C CZ    . TYR B 25  ? 0.6963 0.6858 0.6151 0.0237  0.0449  -0.0237 536 TYR B CZ    
939  O OH    . TYR B 25  ? 0.4209 0.4195 0.3359 0.0297  0.0561  -0.0319 536 TYR B OH    
940  N N     . CYS B 26  ? 0.6518 0.5709 0.5692 -0.0067 -0.0185 0.0032  537 CYS B N     
941  C CA    . CYS B 26  ? 0.6574 0.5684 0.5769 -0.0132 -0.0287 0.0086  537 CYS B CA    
942  C C     . CYS B 26  ? 0.5853 0.4813 0.5031 -0.0179 -0.0405 0.0118  537 CYS B C     
943  O O     . CYS B 26  ? 0.6025 0.4812 0.5082 -0.0160 -0.0448 0.0033  537 CYS B O     
944  C CB    . CYS B 26  ? 0.7683 0.6692 0.6769 -0.0114 -0.0290 -0.0002 537 CYS B CB    
945  S SG    . CYS B 26  ? 0.7081 0.5971 0.6169 -0.0193 -0.0426 0.0049  537 CYS B SG    
946  N N     . ASP B 27  ? 0.5786 0.4810 0.5085 -0.0244 -0.0461 0.0240  538 ASP B N     
947  C CA    . ASP B 27  ? 0.6874 0.5765 0.6175 -0.0294 -0.0573 0.0284  538 ASP B CA    
948  C C     . ASP B 27  ? 0.7600 0.6281 0.6802 -0.0321 -0.0674 0.0228  538 ASP B C     
949  O O     . ASP B 27  ? 0.7764 0.6282 0.6914 -0.0335 -0.0754 0.0207  538 ASP B O     
950  C CB    . ASP B 27  ? 0.8201 0.7213 0.7656 -0.0366 -0.0615 0.0430  538 ASP B CB    
951  C CG    . ASP B 27  ? 0.8764 0.7965 0.8312 -0.0346 -0.0533 0.0486  538 ASP B CG    
952  O OD1   . ASP B 27  ? 0.8893 0.8061 0.8387 -0.0299 -0.0500 0.0437  538 ASP B OD1   
953  O OD2   . ASP B 27  ? 0.8565 0.7953 0.8239 -0.0376 -0.0502 0.0577  538 ASP B OD2   
954  N N     . CYS B 28  ? 0.5518 0.4205 0.4696 -0.0329 -0.0672 0.0205  539 CYS B N     
955  C CA    . CYS B 28  ? 0.6060 0.4565 0.5135 -0.0351 -0.0759 0.0142  539 CYS B CA    
956  C C     . CYS B 28  ? 0.6682 0.5052 0.5608 -0.0286 -0.0738 0.0005  539 CYS B C     
957  O O     . CYS B 28  ? 0.7119 0.5314 0.5972 -0.0297 -0.0819 -0.0044 539 CYS B O     
958  C CB    . CYS B 28  ? 0.5858 0.4419 0.4935 -0.0363 -0.0747 0.0143  539 CYS B CB    
959  S SG    . CYS B 28  ? 0.8511 0.7230 0.7756 -0.0438 -0.0777 0.0294  539 CYS B SG    
960  N N     . PHE B 29  ? 0.6689 0.5144 0.5573 -0.0218 -0.0626 -0.0060 540 PHE B N     
961  C CA    . PHE B 29  ? 0.7414 0.5764 0.6156 -0.0153 -0.0593 -0.0193 540 PHE B CA    
962  C C     . PHE B 29  ? 0.6951 0.5246 0.5686 -0.0131 -0.0604 -0.0201 540 PHE B C     
963  O O     . PHE B 29  ? 0.7084 0.5228 0.5711 -0.0103 -0.0638 -0.0293 540 PHE B O     
964  C CB    . PHE B 29  ? 0.6596 0.5068 0.5308 -0.0090 -0.0466 -0.0250 540 PHE B CB    
965  C CG    . PHE B 29  ? 0.6609 0.4996 0.5176 -0.0021 -0.0420 -0.0387 540 PHE B CG    
966  C CD1   . PHE B 29  ? 0.6734 0.5000 0.5175 -0.0014 -0.0451 -0.0482 540 PHE B CD1   
967  C CD2   . PHE B 29  ? 0.6916 0.5364 0.5474 0.0036  -0.0339 -0.0420 540 PHE B CD2   
968  C CE1   . PHE B 29  ? 0.6391 0.4592 0.4697 0.0048  -0.0406 -0.0610 540 PHE B CE1   
969  C CE2   . PHE B 29  ? 0.7349 0.5728 0.5774 0.0099  -0.0295 -0.0547 540 PHE B CE2   
970  C CZ    . PHE B 29  ? 0.6832 0.5088 0.5130 0.0105  -0.0328 -0.0643 540 PHE B CZ    
971  N N     . ALA B 30  ? 0.6582 0.5004 0.5437 -0.0145 -0.0579 -0.0101 541 ALA B N     
972  C CA    . ALA B 30  ? 0.7208 0.5591 0.6064 -0.0124 -0.0587 -0.0099 541 ALA B CA    
973  C C     . ALA B 30  ? 0.7038 0.5227 0.5875 -0.0170 -0.0719 -0.0087 541 ALA B C     
974  O O     . ALA B 30  ? 0.8791 0.6870 0.7572 -0.0140 -0.0742 -0.0137 541 ALA B O     
975  C CB    . ALA B 30  ? 0.6503 0.5079 0.5497 -0.0135 -0.0533 0.0012  541 ALA B CB    
976  N N     . ASN B 31  ? 0.6861 0.5008 0.5745 -0.0243 -0.0805 -0.0025 542 ASN B N     
977  C CA    . ASN B 31  ? 0.8040 0.6002 0.6912 -0.0294 -0.0934 -0.0015 542 ASN B CA    
978  C C     . ASN B 31  ? 0.8512 0.6303 0.7251 -0.0284 -0.0985 -0.0136 542 ASN B C     
979  O O     . ASN B 31  ? 0.8113 0.5743 0.6832 -0.0330 -0.1095 -0.0144 542 ASN B O     
980  C CB    . ASN B 31  ? 0.9460 0.7472 0.8458 -0.0385 -0.1005 0.0119  542 ASN B CB    
981  C CG    . ASN B 31  ? 1.0361 0.8515 0.9489 -0.0404 -0.0979 0.0241  542 ASN B CG    
982  O OD1   . ASN B 31  ? 0.9791 0.7940 0.8913 -0.0366 -0.0952 0.0233  542 ASN B OD1   
983  N ND2   . ASN B 31  ? 1.1039 0.9333 1.0286 -0.0464 -0.0985 0.0355  542 ASN B ND2   
984  N N     . GLY B 32  ? 0.8983 0.6813 0.7631 -0.0226 -0.0903 -0.0232 543 GLY B N     
985  C CA    . GLY B 32  ? 0.8069 0.5761 0.6581 -0.0208 -0.0934 -0.0356 543 GLY B CA    
986  C C     . GLY B 32  ? 0.8282 0.5928 0.6795 -0.0275 -0.1014 -0.0337 543 GLY B C     
987  O O     . GLY B 32  ? 0.9020 0.6516 0.7437 -0.0283 -0.1082 -0.0423 543 GLY B O     
988  N N     . GLU B 33  ? 0.7187 0.4969 0.5808 -0.0321 -0.1003 -0.0228 544 GLU B N     
989  C CA    . GLU B 33  ? 0.6997 0.4763 0.5626 -0.0383 -0.1069 -0.0202 544 GLU B CA    
990  C C     . GLU B 33  ? 0.8836 0.6734 0.7450 -0.0356 -0.0984 -0.0215 544 GLU B C     
991  O O     . GLU B 33  ? 0.9003 0.7040 0.7656 -0.0310 -0.0879 -0.0197 544 GLU B O     
992  C CB    . GLU B 33  ? 0.8461 0.6273 0.7228 -0.0465 -0.1138 -0.0062 544 GLU B CB    
993  C CG    . GLU B 33  ? 1.0473 0.8174 0.9282 -0.0499 -0.1220 -0.0023 544 GLU B CG    
994  C CD    . GLU B 33  ? 1.1486 0.8976 1.0218 -0.0535 -0.1337 -0.0091 544 GLU B CD    
995  O OE1   . GLU B 33  ? 1.1588 0.9032 1.0245 -0.0547 -0.1365 -0.0156 544 GLU B OE1   
996  O OE2   . GLU B 33  ? 1.1658 0.9031 1.0409 -0.0552 -0.1403 -0.0080 544 GLU B OE2   
997  N N     . PHE B 34  ? 0.9444 0.7298 0.8004 -0.0386 -0.1030 -0.0245 545 PHE B N     
998  C CA    . PHE B 34  ? 0.9262 0.7242 0.7837 -0.0382 -0.0973 -0.0225 545 PHE B CA    
999  C C     . PHE B 34  ? 0.8733 0.6867 0.7468 -0.0424 -0.0964 -0.0082 545 PHE B C     
1000 O O     . PHE B 34  ? 0.8617 0.6731 0.7433 -0.0484 -0.1041 -0.0002 545 PHE B O     
1001 C CB    . PHE B 34  ? 0.9623 0.7521 0.8115 -0.0418 -0.1044 -0.0273 545 PHE B CB    
1002 C CG    . PHE B 34  ? 1.0079 0.7851 0.8410 -0.0375 -0.1044 -0.0419 545 PHE B CG    
1003 C CD1   . PHE B 34  ? 0.9508 0.7330 0.7759 -0.0309 -0.0947 -0.0494 545 PHE B CD1   
1004 C CD2   . PHE B 34  ? 1.1067 0.8671 0.9327 -0.0401 -0.1143 -0.0483 545 PHE B CD2   
1005 C CE1   . PHE B 34  ? 1.0304 0.8018 0.8404 -0.0272 -0.0948 -0.0630 545 PHE B CE1   
1006 C CE2   . PHE B 34  ? 1.1510 0.9005 0.9623 -0.0360 -0.1144 -0.0623 545 PHE B CE2   
1007 C CZ    . PHE B 34  ? 1.0859 0.8413 0.8890 -0.0296 -0.1046 -0.0695 545 PHE B CZ    
1008 N N     . CYS B 35  ? 0.8213 0.6502 0.6997 -0.0394 -0.0871 -0.0052 546 CYS B N     
1009 C CA    . CYS B 35  ? 0.8243 0.6684 0.7177 -0.0437 -0.0868 0.0076  546 CYS B CA    
1010 C C     . CYS B 35  ? 0.9153 0.7557 0.8095 -0.0507 -0.0965 0.0116  546 CYS B C     
1011 O O     . CYS B 35  ? 0.9894 0.8235 0.8739 -0.0502 -0.0982 0.0049  546 CYS B O     
1012 C CB    . CYS B 35  ? 0.8622 0.7232 0.7606 -0.0386 -0.0749 0.0090  546 CYS B CB    
1013 S SG    . CYS B 35  ? 0.7761 0.6467 0.6769 -0.0312 -0.0624 0.0063  546 CYS B SG    
1014 N N     . ASN B 36  ? 0.8883 0.7333 0.7941 -0.0574 -0.1029 0.0227  547 ASN B N     
1015 C CA    . ASN B 36  ? 0.9409 0.7846 0.8493 -0.0647 -0.1122 0.0279  547 ASN B CA    
1016 C C     . ASN B 36  ? 0.9572 0.8174 0.8821 -0.0691 -0.1122 0.0417  547 ASN B C     
1017 O O     . ASN B 36  ? 1.0619 0.9253 0.9952 -0.0715 -0.1135 0.0483  547 ASN B O     
1018 C CB    . ASN B 36  ? 1.0629 0.8887 0.9655 -0.0701 -0.1241 0.0249  547 ASN B CB    
1019 N N     . ASN B 37  ? 0.9274 0.7992 0.8572 -0.0698 -0.1102 0.0461  548 ASN B N     
1020 C CA    . ASN B 37  ? 0.9716 0.8597 0.9172 -0.0742 -0.1108 0.0590  548 ASN B CA    
1021 C C     . ASN B 37  ? 0.9685 0.8720 0.9239 -0.0697 -0.1004 0.0631  548 ASN B C     
1022 O O     . ASN B 37  ? 0.9404 0.8574 0.9095 -0.0733 -0.1007 0.0736  548 ASN B O     
1023 C CB    . ASN B 37  ? 1.0644 0.9468 1.0150 -0.0830 -0.1222 0.0661  548 ASN B CB    
1024 C CG    . ASN B 37  ? 1.2449 1.1410 1.2082 -0.0892 -0.1261 0.0777  548 ASN B CG    
1025 O OD1   . ASN B 37  ? 1.2092 1.1175 1.1766 -0.0871 -0.1213 0.0802  548 ASN B OD1   
1026 N ND2   . ASN B 37  ? 1.3551 1.2491 1.3247 -0.0971 -0.1350 0.0852  548 ASN B ND2   
1027 N N     . CYS B 38  ? 0.9196 0.8220 0.8681 -0.0618 -0.0911 0.0545  549 CYS B N     
1028 C CA    . CYS B 38  ? 0.7213 0.6378 0.6775 -0.0568 -0.0803 0.0563  549 CYS B CA    
1029 C C     . CYS B 38  ? 0.6948 0.6294 0.6602 -0.0535 -0.0717 0.0600  549 CYS B C     
1030 O O     . CYS B 38  ? 0.7993 0.7351 0.7647 -0.0548 -0.0738 0.0612  549 CYS B O     
1031 C CB    . CYS B 38  ? 0.5393 0.4473 0.4843 -0.0498 -0.0738 0.0452  549 CYS B CB    
1032 S SG    . CYS B 38  ? 0.7301 0.6200 0.6672 -0.0519 -0.0817 0.0414  549 CYS B SG    
1033 N N     . ASN B 39  ? 0.6695 0.6182 0.6428 -0.0493 -0.0620 0.0615  550 ASN B N     
1034 C CA    . ASN B 39  ? 0.6260 0.5923 0.6092 -0.0457 -0.0531 0.0644  550 ASN B CA    
1035 C C     . ASN B 39  ? 0.7186 0.6874 0.6965 -0.0370 -0.0408 0.0550  550 ASN B C     
1036 O O     . ASN B 39  ? 0.6505 0.6350 0.6378 -0.0332 -0.0317 0.0567  550 ASN B O     
1037 C CB    . ASN B 39  ? 0.6381 0.6227 0.6382 -0.0491 -0.0523 0.0755  550 ASN B CB    
1038 C CG    . ASN B 39  ? 0.7405 0.7228 0.7457 -0.0581 -0.0645 0.0849  550 ASN B CG    
1039 O OD1   . ASN B 39  ? 0.8617 0.8369 0.8634 -0.0615 -0.0716 0.0857  550 ASN B OD1   
1040 N ND2   . ASN B 39  ? 0.7143 0.7021 0.7271 -0.0622 -0.0672 0.0918  550 ASN B ND2   
1041 N N     . CYS B 40  ? 0.6132 0.5665 0.5763 -0.0339 -0.0407 0.0448  551 CYS B N     
1042 C CA    . CYS B 40  ? 0.6200 0.5737 0.5762 -0.0262 -0.0298 0.0351  551 CYS B CA    
1043 C C     . CYS B 40  ? 0.6631 0.6185 0.6170 -0.0230 -0.0255 0.0319  551 CYS B C     
1044 O O     . CYS B 40  ? 0.6314 0.5817 0.5836 -0.0266 -0.0325 0.0345  551 CYS B O     
1045 C CB    . CYS B 40  ? 0.5440 0.4801 0.4842 -0.0241 -0.0319 0.0250  551 CYS B CB    
1046 S SG    . CYS B 40  ? 0.6247 0.5391 0.5529 -0.0299 -0.0465 0.0226  551 CYS B SG    
1047 N N     . THR B 41  ? 0.6439 0.6065 0.5978 -0.0164 -0.0140 0.0263  552 THR B N     
1048 C CA    . THR B 41  ? 0.6935 0.6555 0.6436 -0.0129 -0.0094 0.0221  552 THR B CA    
1049 C C     . THR B 41  ? 0.7562 0.7060 0.6900 -0.0081 -0.0052 0.0096  552 THR B C     
1050 O O     . THR B 41  ? 0.6545 0.6021 0.5838 -0.0056 -0.0019 0.0045  552 THR B O     
1051 C CB    . THR B 41  ? 0.7155 0.6958 0.6794 -0.0092 0.0007  0.0256  552 THR B CB    
1052 O OG1   . THR B 41  ? 0.8574 0.8435 0.8209 -0.0036 0.0115  0.0192  552 THR B OG1   
1053 C CG2   . THR B 41  ? 0.7093 0.7039 0.6901 -0.0136 -0.0025 0.0375  552 THR B CG2   
1054 N N     . ASN B 42  ? 0.7584 0.7001 0.6829 -0.0072 -0.0062 0.0050  553 ASN B N     
1055 C CA    . ASN B 42  ? 0.7457 0.6759 0.6541 -0.0031 -0.0029 -0.0068 553 ASN B CA    
1056 C C     . ASN B 42  ? 0.6580 0.5748 0.5554 -0.0045 -0.0090 -0.0123 553 ASN B C     
1057 O O     . ASN B 42  ? 0.5317 0.4445 0.4206 -0.0001 -0.0036 -0.0210 553 ASN B O     
1058 C CB    . ASN B 42  ? 0.7203 0.6598 0.6308 0.0036  0.0106  -0.0122 553 ASN B CB    
1059 C CG    . ASN B 42  ? 0.8421 0.7898 0.7589 0.0057  0.0165  -0.0100 553 ASN B CG    
1060 O OD1   . ASN B 42  ? 0.9957 0.9576 0.9254 0.0082  0.0243  -0.0064 553 ASN B OD1   
1061 N ND2   . ASN B 42  ? 0.7344 0.6733 0.6426 0.0046  0.0124  -0.0119 553 ASN B ND2   
1062 N N     . CYS B 43  ? 0.6438 0.5535 0.5414 -0.0106 -0.0205 -0.0073 554 CYS B N     
1063 C CA    . CYS B 43  ? 0.6975 0.5935 0.5860 -0.0126 -0.0279 -0.0116 554 CYS B CA    
1064 C C     . CYS B 43  ? 0.7663 0.6474 0.6369 -0.0105 -0.0297 -0.0233 554 CYS B C     
1065 O O     . CYS B 43  ? 0.8261 0.7031 0.6912 -0.0122 -0.0331 -0.0246 554 CYS B O     
1066 C CB    . CYS B 43  ? 0.5218 0.4142 0.4161 -0.0201 -0.0399 -0.0029 554 CYS B CB    
1067 S SG    . CYS B 43  ? 0.7016 0.5768 0.5875 -0.0233 -0.0500 -0.0069 554 CYS B SG    
1068 N N     . TYR B 44  ? 0.6805 0.5543 0.5422 -0.0070 -0.0274 -0.0318 555 TYR B N     
1069 C CA    . TYR B 44  ? 0.6725 0.5318 0.5174 -0.0055 -0.0303 -0.0431 555 TYR B CA    
1070 C C     . TYR B 44  ? 0.6665 0.5125 0.5069 -0.0089 -0.0407 -0.0447 555 TYR B C     
1071 O O     . TYR B 44  ? 0.7134 0.5468 0.5404 -0.0076 -0.0438 -0.0546 555 TYR B O     
1072 C CB    . TYR B 44  ? 0.7789 0.6395 0.6155 0.0017  -0.0196 -0.0532 555 TYR B CB    
1073 C CG    . TYR B 44  ? 0.8893 0.7568 0.7240 0.0049  -0.0112 -0.0559 555 TYR B CG    
1074 C CD1   . TYR B 44  ? 0.9088 0.7850 0.7533 0.0024  -0.0110 -0.0474 555 TYR B CD1   
1075 C CD2   . TYR B 44  ? 0.9034 0.7688 0.7269 0.0105  -0.0033 -0.0667 555 TYR B CD2   
1076 C CE1   . TYR B 44  ? 0.8265 0.7084 0.6700 0.0054  -0.0035 -0.0492 555 TYR B CE1   
1077 C CE2   . TYR B 44  ? 0.8847 0.7561 0.7068 0.0131  0.0043  -0.0687 555 TYR B CE2   
1078 C CZ    . TYR B 44  ? 0.8289 0.7082 0.6613 0.0105  0.0041  -0.0598 555 TYR B CZ    
1079 O OH    . TYR B 44  ? 0.8051 0.6897 0.6370 0.0130  0.0113  -0.0611 555 TYR B OH    
1080 N N     . ASN B 45  ? 0.6498 0.4989 0.5018 -0.0130 -0.0456 -0.0351 556 ASN B N     
1081 C CA    . ASN B 45  ? 0.7435 0.5797 0.5928 -0.0164 -0.0554 -0.0358 556 ASN B CA    
1082 C C     . ASN B 45  ? 0.7968 0.6240 0.6442 -0.0232 -0.0672 -0.0335 556 ASN B C     
1083 O O     . ASN B 45  ? 0.9149 0.7422 0.7714 -0.0291 -0.0747 -0.0246 556 ASN B O     
1084 C CB    . ASN B 45  ? 0.7653 0.6090 0.6277 -0.0179 -0.0551 -0.0265 556 ASN B CB    
1085 C CG    . ASN B 45  ? 0.7675 0.5976 0.6274 -0.0205 -0.0642 -0.0273 556 ASN B CG    
1086 O OD1   . ASN B 45  ? 0.7626 0.5786 0.6103 -0.0185 -0.0674 -0.0373 556 ASN B OD1   
1087 N ND2   . ASN B 45  ? 0.8699 0.7049 0.7421 -0.0250 -0.0682 -0.0165 556 ASN B ND2   
1088 N N     . ASN B 46  ? 0.8577 0.6780 0.6933 -0.0226 -0.0687 -0.0415 557 ASN B N     
1089 C CA    . ASN B 46  ? 0.7886 0.6028 0.6218 -0.0288 -0.0788 -0.0399 557 ASN B CA    
1090 C C     . ASN B 46  ? 0.7945 0.5984 0.6112 -0.0270 -0.0803 -0.0522 557 ASN B C     
1091 O O     . ASN B 46  ? 0.8524 0.6552 0.6604 -0.0209 -0.0729 -0.0613 557 ASN B O     
1092 C CB    . ASN B 46  ? 0.6611 0.4886 0.5047 -0.0317 -0.0774 -0.0297 557 ASN B CB    
1093 C CG    . ASN B 46  ? 0.7689 0.6070 0.6122 -0.0259 -0.0658 -0.0315 557 ASN B CG    
1094 O OD1   . ASN B 46  ? 0.8979 0.7317 0.7293 -0.0228 -0.0629 -0.0404 557 ASN B OD1   
1095 N ND2   . ASN B 46  ? 0.7776 0.6300 0.6342 -0.0245 -0.0589 -0.0232 557 ASN B ND2   
1096 N N     . LEU B 47  ? 0.9267 0.7242 0.7393 -0.0325 -0.0898 -0.0528 558 LEU B N     
1097 C CA    . LEU B 47  ? 1.0231 0.8113 0.8201 -0.0317 -0.0924 -0.0645 558 LEU B CA    
1098 C C     . LEU B 47  ? 1.0075 0.8039 0.7991 -0.0274 -0.0833 -0.0677 558 LEU B C     
1099 O O     . LEU B 47  ? 1.0588 0.8498 0.8372 -0.0239 -0.0808 -0.0789 558 LEU B O     
1100 C CB    . LEU B 47  ? 1.0923 0.8750 0.8875 -0.0391 -0.1040 -0.0631 558 LEU B CB    
1101 C CG    . LEU B 47  ? 1.2151 0.9877 1.0143 -0.0445 -0.1147 -0.0608 558 LEU B CG    
1102 C CD1   . LEU B 47  ? 1.2195 1.0006 1.0354 -0.0488 -0.1164 -0.0463 558 LEU B CD1   
1103 C CD2   . LEU B 47  ? 1.2510 1.0153 1.0421 -0.0500 -0.1249 -0.0659 558 LEU B CD2   
1104 N N     . GLU B 48  ? 1.0269 0.8365 0.8293 -0.0276 -0.0782 -0.0580 559 GLU B N     
1105 C CA    . GLU B 48  ? 1.0826 0.8997 0.8813 -0.0245 -0.0708 -0.0594 559 GLU B CA    
1106 C C     . GLU B 48  ? 1.0488 0.8670 0.8419 -0.0171 -0.0599 -0.0673 559 GLU B C     
1107 O O     . GLU B 48  ? 1.0872 0.9081 0.8730 -0.0138 -0.0536 -0.0724 559 GLU B O     
1108 C CB    . GLU B 48  ? 1.2099 1.0411 1.0232 -0.0259 -0.0675 -0.0468 559 GLU B CB    
1109 C CG    . GLU B 48  ? 1.3289 1.1628 1.1546 -0.0325 -0.0759 -0.0355 559 GLU B CG    
1110 C CD    . GLU B 48  ? 1.3994 1.2222 1.2186 -0.0387 -0.0884 -0.0378 559 GLU B CD    
1111 O OE1   . GLU B 48  ? 1.4626 1.2839 1.2745 -0.0412 -0.0924 -0.0402 559 GLU B OE1   
1112 O OE2   . GLU B 48  ? 1.3496 1.1655 1.1713 -0.0412 -0.0942 -0.0374 559 GLU B OE2   
1113 N N     . HIS B 49  ? 1.0340 0.8504 0.8306 -0.0146 -0.0579 -0.0681 560 HIS B N     
1114 C CA    . HIS B 49  ? 0.9398 0.7572 0.7312 -0.0077 -0.0480 -0.0758 560 HIS B CA    
1115 C C     . HIS B 49  ? 0.8924 0.6983 0.6769 -0.0063 -0.0518 -0.0835 560 HIS B C     
1116 O O     . HIS B 49  ? 0.9024 0.7106 0.6881 -0.0015 -0.0452 -0.0859 560 HIS B O     
1117 C CB    . HIS B 49  ? 0.8679 0.6987 0.6728 -0.0049 -0.0389 -0.0682 560 HIS B CB    
1118 C CG    . HIS B 49  ? 0.7804 0.6229 0.5944 -0.0061 -0.0353 -0.0599 560 HIS B CG    
1119 N ND1   . HIS B 49  ? 0.7230 0.5696 0.5476 -0.0117 -0.0420 -0.0490 560 HIS B ND1   
1120 C CD2   . HIS B 49  ? 0.7017 0.5528 0.5163 -0.0022 -0.0256 -0.0607 560 HIS B CD2   
1121 C CE1   . HIS B 49  ? 0.7722 0.6296 0.6037 -0.0110 -0.0366 -0.0435 560 HIS B CE1   
1122 N NE2   . HIS B 49  ? 0.7186 0.5785 0.5444 -0.0053 -0.0267 -0.0504 560 HIS B NE2   
1123 N N     . GLU B 50  ? 0.8987 0.6928 0.6762 -0.0103 -0.0624 -0.0875 561 GLU B N     
1124 C CA    . GLU B 50  ? 0.8735 0.6551 0.6453 -0.0094 -0.0676 -0.0945 561 GLU B CA    
1125 C C     . GLU B 50  ? 0.9596 0.7395 0.7210 -0.0021 -0.0594 -0.1059 561 GLU B C     
1126 O O     . GLU B 50  ? 1.0601 0.8357 0.8215 0.0010  -0.0586 -0.1089 561 GLU B O     
1127 C CB    . GLU B 50  ? 0.8865 0.6557 0.6504 -0.0144 -0.0794 -0.0995 561 GLU B CB    
1128 C CG    . GLU B 50  ? 0.9841 0.7389 0.7388 -0.0124 -0.0844 -0.1102 561 GLU B CG    
1129 C CD    . GLU B 50  ? 1.1020 0.8524 0.8663 -0.0129 -0.0877 -0.1049 561 GLU B CD    
1130 O OE1   . GLU B 50  ? 1.0717 0.8105 0.8359 -0.0170 -0.0980 -0.1058 561 GLU B OE1   
1131 O OE2   . GLU B 50  ? 1.1813 0.9397 0.9530 -0.0094 -0.0801 -0.0999 561 GLU B OE2   
1132 N N     . ASN B 51  ? 1.0027 0.7867 0.7555 0.0006  -0.0533 -0.1118 562 ASN B N     
1133 C CA    . ASN B 51  ? 1.0660 0.8492 0.8080 0.0072  -0.0454 -0.1231 562 ASN B CA    
1134 C C     . ASN B 51  ? 1.0315 0.8230 0.7807 0.0122  -0.0356 -0.1205 562 ASN B C     
1135 O O     . ASN B 51  ? 0.8951 0.6823 0.6401 0.0163  -0.0338 -0.1269 562 ASN B O     
1136 C CB    . ASN B 51  ? 1.0662 0.8541 0.7996 0.0083  -0.0402 -0.1277 562 ASN B CB    
1137 C CG    . ASN B 51  ? 1.2147 0.9932 0.9353 0.0055  -0.0482 -0.1359 562 ASN B CG    
1138 O OD1   . ASN B 51  ? 1.2647 1.0361 0.9731 0.0086  -0.0484 -0.1478 562 ASN B OD1   
1139 N ND2   . ASN B 51  ? 1.3063 1.0855 1.0299 -0.0005 -0.0551 -0.1297 562 ASN B ND2   
1140 N N     . GLU B 52  ? 1.2163 0.8981 0.8160 0.0241  0.0616  -0.1572 563 GLU B N     
1141 C CA    . GLU B 52  ? 1.1443 0.8297 0.7366 0.0228  0.0579  -0.1529 563 GLU B CA    
1142 C C     . GLU B 52  ? 1.1042 0.8055 0.7153 0.0286  0.0551  -0.1540 563 GLU B C     
1143 O O     . GLU B 52  ? 1.1140 0.8269 0.7288 0.0272  0.0534  -0.1549 563 GLU B O     
1144 C CB    . GLU B 52  ? 1.1946 0.8631 0.7619 0.0224  0.0544  -0.1429 563 GLU B CB    
1145 C CG    . GLU B 52  ? 1.3241 0.9753 0.8724 0.0165  0.0575  -0.1414 563 GLU B CG    
1146 C CD    . GLU B 52  ? 1.4495 1.0906 0.9954 0.0183  0.0600  -0.1415 563 GLU B CD    
1147 O OE1   . GLU B 52  ? 1.4064 1.0535 0.9649 0.0242  0.0592  -0.1426 563 GLU B OE1   
1148 O OE2   . GLU B 52  ? 1.5535 1.1810 1.0847 0.0136  0.0629  -0.1405 563 GLU B OE2   
1149 N N     . ARG B 53  ? 1.0966 0.7994 0.7200 0.0349  0.0550  -0.1542 564 ARG B N     
1150 C CA    . ARG B 53  ? 1.1035 0.8201 0.7466 0.0407  0.0531  -0.1553 564 ARG B CA    
1151 C C     . ARG B 53  ? 1.1272 0.8596 0.7962 0.0405  0.0568  -0.1656 564 ARG B C     
1152 O O     . ARG B 53  ? 1.1095 0.8337 0.7677 0.0425  0.0574  -0.1629 564 ARG B O     
1153 C CB    . ARG B 53  ? 1.0779 0.7919 0.7302 0.0472  0.0529  -0.1541 564 ARG B CB    
1154 C CG    . ARG B 53  ? 0.9818 0.7101 0.6603 0.0531  0.0528  -0.1570 564 ARG B CG    
1155 C CD    . ARG B 53  ? 0.9277 0.6531 0.6130 0.0594  0.0519  -0.1544 564 ARG B CD    
1156 N NE    . ARG B 53  ? 0.9810 0.7188 0.6930 0.0652  0.0523  -0.1565 564 ARG B NE    
1157 C CZ    . ARG B 53  ? 1.0417 0.7855 0.7831 0.0682  0.0578  -0.1658 564 ARG B CZ    
1158 N NH1   . ARG B 53  ? 1.0591 0.8076 0.8135 0.0644  0.0618  -0.1756 564 ARG B NH1   
1159 N NH2   . ARG B 53  ? 1.0942 0.8332 0.8475 0.0776  0.0593  -0.1638 564 ARG B NH2   
1160 N N     . GLN B 54  ? 1.1686 0.9019 0.8517 0.0396  0.0616  -0.1740 565 GLN B N     
1161 C CA    . GLN B 54  ? 1.1686 0.8945 0.8613 0.0408  0.0688  -0.1812 565 GLN B CA    
1162 C C     . GLN B 54  ? 1.0602 0.7765 0.7309 0.0342  0.0711  -0.1797 565 GLN B C     
1163 O O     . GLN B 54  ? 1.0410 0.7462 0.7093 0.0349  0.0773  -0.1811 565 GLN B O     
1164 C CB    . GLN B 54  ? 1.2472 0.9777 0.9597 0.0407  0.0722  -0.1902 565 GLN B CB    
1165 C CG    . GLN B 54  ? 1.3109 1.0352 1.0464 0.0462  0.0799  -0.1968 565 GLN B CG    
1166 C CD    . GLN B 54  ? 1.2875 1.0183 1.0452 0.0551  0.0782  -0.1971 565 GLN B CD    
1167 O OE1   . GLN B 54  ? 1.2141 0.9568 0.9746 0.0556  0.0720  -0.1957 565 GLN B OE1   
1168 N NE2   . GLN B 54  ? 1.2811 1.0039 1.0572 0.0618  0.0852  -0.1982 565 GLN B NE2   
1169 N N     . LYS B 55  ? 0.9804 0.7006 0.6363 0.0275  0.0671  -0.1769 566 LYS B N     
1170 C CA    . LYS B 55  ? 0.9780 0.6923 0.6121 0.0199  0.0677  -0.1746 566 LYS B CA    
1171 C C     . LYS B 55  ? 1.1043 0.8148 0.7220 0.0208  0.0651  -0.1683 566 LYS B C     
1172 O O     . LYS B 55  ? 1.1092 0.8113 0.7143 0.0168  0.0694  -0.1691 566 LYS B O     
1173 C CB    . LYS B 55  ? 0.9645 0.6853 0.5899 0.0150  0.0630  -0.1714 566 LYS B CB    
1174 C CG    . LYS B 55  ? 1.1435 0.8632 0.7472 0.0090  0.0599  -0.1657 566 LYS B CG    
1175 C CD    . LYS B 55  ? 1.2913 0.9981 0.8744 0.0068  0.0573  -0.1581 566 LYS B CD    
1176 C CE    . LYS B 55  ? 1.0493 0.7537 0.6265 0.0122  0.0522  -0.1504 566 LYS B CE    
1177 N NZ    . LYS B 55  ? 0.9384 0.6594 0.5190 0.0130  0.0477  -0.1486 566 LYS B NZ    
1178 N N     . ALA B 56  ? 1.0617 0.7784 0.6788 0.0257  0.0583  -0.1619 567 ALA B N     
1179 C CA    . ALA B 56  ? 0.9839 0.6986 0.5852 0.0277  0.0543  -0.1552 567 ALA B CA    
1180 C C     . ALA B 56  ? 1.0108 0.7154 0.6160 0.0348  0.0594  -0.1575 567 ALA B C     
1181 O O     . ALA B 56  ? 1.1228 0.8215 0.7095 0.0342  0.0597  -0.1546 567 ALA B O     
1182 C CB    . ALA B 56  ? 0.8528 0.5751 0.4564 0.0320  0.0472  -0.1480 567 ALA B CB    
1183 N N     . ILE B 57  ? 0.8812 0.5845 0.5116 0.0415  0.0640  -0.1629 568 ILE B N     
1184 C CA    . ILE B 57  ? 0.9206 0.6138 0.5641 0.0513  0.0708  -0.1653 568 ILE B CA    
1185 C C     . ILE B 57  ? 1.0549 0.7352 0.6936 0.0467  0.0821  -0.1701 568 ILE B C     
1186 O O     . ILE B 57  ? 1.1010 0.8032 0.7726 0.0500  0.0801  -0.1566 568 ILE B O     
1187 C CB    . ILE B 57  ? 0.9454 0.6441 0.6245 0.0578  0.0742  -0.1709 568 ILE B CB    
1188 C CG1   . ILE B 57  ? 0.8591 0.5681 0.5404 0.0620  0.0651  -0.1647 568 ILE B CG1   
1189 C CG2   . ILE B 57  ? 0.9290 0.6181 0.6344 0.0689  0.0847  -0.1736 568 ILE B CG2   
1190 C CD1   . ILE B 57  ? 0.7522 0.4691 0.4662 0.0677  0.0671  -0.1692 568 ILE B CD1   
1191 N N     . LYS B 58  ? 1.0470 0.7283 0.6838 0.0349  0.0862  -0.1754 569 LYS B N     
1192 C CA    . LYS B 58  ? 1.0940 0.7768 0.7464 0.0273  0.0969  -0.1758 569 LYS B CA    
1193 C C     . LYS B 58  ? 1.0887 0.7910 0.7280 0.0169  0.0881  -0.1621 569 LYS B C     
1194 O O     . LYS B 58  ? 1.2357 0.9737 0.9196 0.0125  0.0856  -0.1453 569 LYS B O     
1195 C CB    . LYS B 58  ? 1.2821 0.9545 0.9365 0.0189  0.1070  -0.1888 569 LYS B CB    
1196 C CG    . LYS B 58  ? 1.5926 1.2832 1.2735 0.0066  0.1131  -0.1828 569 LYS B CG    
1197 C CD    . LYS B 58  ? 1.5473 1.2181 1.2063 -0.0049 0.1234  -0.1981 569 LYS B CD    
1198 C CE    . LYS B 58  ? 1.4771 1.1777 1.1760 -0.0161 0.1261  -0.1865 569 LYS B CE    
1199 N NZ    . LYS B 58  ? 1.3963 1.1345 1.1657 -0.0100 0.1248  -0.1683 569 LYS B NZ    
1200 N N     . ALA B 59  ? 0.8711 0.5523 0.4513 0.0132  0.0830  -0.1682 570 ALA B N     
1201 C CA    . ALA B 59  ? 0.9718 0.6727 0.5391 0.0030  0.0746  -0.1558 570 ALA B CA    
1202 C C     . ALA B 59  ? 1.1711 0.9072 0.7720 0.0092  0.0638  -0.1352 570 ALA B C     
1203 O O     . ALA B 59  ? 1.2740 1.0445 0.9001 0.0009  0.0588  -0.1189 570 ALA B O     
1204 C CB    . ALA B 59  ? 0.9386 0.6377 0.4768 -0.0010 0.0662  -0.1565 570 ALA B CB    
1205 N N     . CYS B 60  ? 1.1978 0.9266 0.8000 0.0234  0.0602  -0.1353 571 CYS B N     
1206 C CA    . CYS B 60  ? 1.2685 1.0290 0.9018 0.0305  0.0501  -0.1162 571 CYS B CA    
1207 C C     . CYS B 60  ? 1.2645 1.0625 0.9699 0.0316  0.0519  -0.1002 571 CYS B C     
1208 O O     . CYS B 60  ? 1.2691 1.1047 1.0059 0.0298  0.0438  -0.0797 571 CYS B O     
1209 C CB    . CYS B 60  ? 1.2494 0.9917 0.8703 0.0461  0.0472  -0.1211 571 CYS B CB    
1210 S SG    . CYS B 60  ? 1.5012 1.2058 1.0444 0.0460  0.0433  -0.1350 571 CYS B SG    
1211 N N     . LEU B 61  ? 1.2526 1.0406 0.9849 0.0347  0.0628  -0.1096 572 LEU B N     
1212 C CA    . LEU B 61  ? 1.1676 0.9863 0.9716 0.0380  0.0668  -0.0968 572 LEU B CA    
1213 C C     . LEU B 61  ? 1.2982 1.1451 1.1268 0.0239  0.0676  -0.0849 572 LEU B C     
1214 O O     . LEU B 61  ? 1.3607 1.2456 1.2469 0.0241  0.0655  -0.0652 572 LEU B O     
1215 C CB    . LEU B 61  ? 0.9946 0.7914 0.8165 0.0449  0.0794  -0.1131 572 LEU B CB    
1216 C CG    . LEU B 61  ? 0.9687 0.7867 0.8578 0.0562  0.0827  -0.1039 572 LEU B CG    
1217 C CD1   . LEU B 61  ? 1.0138 0.8453 0.9088 0.0671  0.0714  -0.0907 572 LEU B CD1   
1218 C CD2   . LEU B 61  ? 0.9571 0.7472 0.8494 0.0624  0.0950  -0.1244 572 LEU B CD2   
1219 N N     . ASP B 62  ? 1.3147 1.1435 1.1002 0.0115  0.0707  -0.0963 573 ASP B N     
1220 C CA    . ASP B 62  ? 1.3082 1.1613 1.1140 -0.0026 0.0722  -0.0867 573 ASP B CA    
1221 C C     . ASP B 62  ? 1.2922 1.1788 1.0957 -0.0110 0.0600  -0.0669 573 ASP B C     
1222 O O     . ASP B 62  ? 1.2968 1.2142 1.1308 -0.0214 0.0595  -0.0531 573 ASP B O     
1223 C CB    . ASP B 62  ? 1.3735 1.1956 1.1347 -0.0133 0.0803  -0.1061 573 ASP B CB    
1224 C CG    . ASP B 62  ? 1.4440 1.2843 1.2426 -0.0237 0.0880  -0.1017 573 ASP B CG    
1225 O OD1   . ASP B 62  ? 1.5168 1.3844 1.3218 -0.0353 0.0827  -0.0877 573 ASP B OD1   
1226 O OD2   . ASP B 62  ? 1.4226 1.2508 1.2449 -0.0205 0.0995  -0.1123 573 ASP B OD2   
1227 N N     . ARG B 63  ? 1.3148 1.1968 1.0833 -0.0070 0.0503  -0.0653 574 ARG B N     
1228 C CA    . ARG B 63  ? 1.3149 1.2330 1.0870 -0.0140 0.0383  -0.0453 574 ARG B CA    
1229 C C     . ARG B 63  ? 1.4079 1.3687 1.2492 -0.0066 0.0337  -0.0215 574 ARG B C     
1230 O O     . ARG B 63  ? 1.4160 1.4179 1.2895 -0.0154 0.0284  -0.0011 574 ARG B O     
1231 C CB    . ARG B 63  ? 1.1950 1.0954 0.9106 -0.0117 0.0300  -0.0513 574 ARG B CB    
1232 C CG    . ARG B 63  ? 1.1613 1.0280 0.8101 -0.0222 0.0328  -0.0699 574 ARG B CG    
1233 C CD    . ARG B 63  ? 1.1946 1.0453 0.7910 -0.0202 0.0254  -0.0751 574 ARG B CD    
1234 N NE    . ARG B 63  ? 1.3512 1.1553 0.9094 -0.0095 0.0305  -0.0953 574 ARG B NE    
1235 C CZ    . ARG B 63  ? 1.3622 1.1382 0.8637 -0.0092 0.0282  -0.1066 574 ARG B CZ    
1236 N NH1   . ARG B 63  ? 1.2823 1.0710 0.7571 -0.0195 0.0213  -0.1014 574 ARG B NH1   
1237 N NH2   . ARG B 63  ? 1.3257 1.0690 0.8101 0.0010  0.0323  -0.1210 574 ARG B NH2   
1238 N N     . ASN B 64  ? 1.4559 1.4070 1.3200 0.0094  0.0359  -0.0240 575 ASN B N     
1239 C CA    . ASN B 64  ? 1.4336 1.4204 1.3672 0.0185  0.0336  -0.0034 575 ASN B CA    
1240 C C     . ASN B 64  ? 1.4175 1.3799 1.3707 0.0340  0.0420  -0.0159 575 ASN B C     
1241 O O     . ASN B 64  ? 1.3971 1.3321 1.3155 0.0435  0.0401  -0.0279 575 ASN B O     
1242 C CB    . ASN B 64  ? 1.3773 1.3950 1.3141 0.0204  0.0194  0.0166  575 ASN B CB    
1243 C CG    . ASN B 64  ? 1.2947 1.2868 1.1954 0.0329  0.0147  0.0069  575 ASN B CG    
1244 O OD1   . ASN B 64  ? 1.2263 1.2243 1.1613 0.0467  0.0139  0.0129  575 ASN B OD1   
1245 N ND2   . ASN B 64  ? 1.2652 1.2296 1.0980 0.0279  0.0118  -0.0075 575 ASN B ND2   
1246 N N     . PRO B 65  ? 1.4476 1.4187 1.4554 0.0357  0.0523  -0.0144 576 PRO B N     
1247 C CA    . PRO B 65  ? 1.4719 1.4202 1.5014 0.0479  0.0629  -0.0286 576 PRO B CA    
1248 C C     . PRO B 65  ? 1.4392 1.3935 1.4903 0.0635  0.0576  -0.0215 576 PRO B C     
1249 O O     . PRO B 65  ? 1.4081 1.3404 1.4674 0.0739  0.0652  -0.0351 576 PRO B O     
1250 C CB    . PRO B 65  ? 1.4679 1.4380 1.5626 0.0443  0.0732  -0.0212 576 PRO B CB    
1251 C CG    . PRO B 65  ? 1.4530 1.4677 1.5763 0.0352  0.0646  0.0052  576 PRO B CG    
1252 C CD    . PRO B 65  ? 1.4590 1.4653 1.5145 0.0254  0.0546  0.0022  576 PRO B CD    
1253 N N     . GLU B 66  ? 1.4142 1.3987 1.4736 0.0644  0.0448  -0.0005 577 GLU B N     
1254 C CA    . GLU B 66  ? 1.3100 1.3025 1.3878 0.0785  0.0384  0.0081  577 GLU B CA    
1255 C C     . GLU B 66  ? 1.2829 1.2463 1.2909 0.0819  0.0309  -0.0044 577 GLU B C     
1256 O O     . GLU B 66  ? 1.3049 1.2789 1.3134 0.0902  0.0216  0.0056  577 GLU B O     
1257 C CB    . GLU B 66  ? 1.2476 1.2914 1.3762 0.0777  0.0287  0.0391  577 GLU B CB    
1258 N N     . ALA B 67  ? 1.2444 1.1714 1.1938 0.0753  0.0355  -0.0258 578 ALA B N     
1259 C CA    . ALA B 67  ? 1.0611 0.9573 0.9403 0.0765  0.0299  -0.0391 578 ALA B CA    
1260 C C     . ALA B 67  ? 0.9327 0.8087 0.8069 0.0926  0.0296  -0.0469 578 ALA B C     
1261 O O     . ALA B 67  ? 0.7934 0.6630 0.6342 0.0976  0.0207  -0.0457 578 ALA B O     
1262 C CB    . ALA B 67  ? 0.9638 0.8244 0.7901 0.0671  0.0371  -0.0606 578 ALA B CB    
1263 N N     . PHE B 68  ? 0.9025 0.7683 0.8095 0.1002  0.0396  -0.0557 579 PHE B N     
1264 C CA    . PHE B 68  ? 0.9869 0.8343 0.8910 0.1148  0.0400  -0.0637 579 PHE B CA    
1265 C C     . PHE B 68  ? 1.1114 0.9902 1.0856 0.1251  0.0389  -0.0466 579 PHE B C     
1266 O O     . PHE B 68  ? 1.0644 0.9323 1.0622 0.1353  0.0456  -0.0548 579 PHE B O     
1267 C CB    . PHE B 68  ? 0.9370 0.7456 0.8185 0.1161  0.0522  -0.0891 579 PHE B CB    
1268 C CG    . PHE B 68  ? 0.9679 0.7463 0.7840 0.1059  0.0538  -0.1049 579 PHE B CG    
1269 C CD1   . PHE B 68  ? 0.9653 0.7175 0.7204 0.1087  0.0477  -0.1133 579 PHE B CD1   
1270 C CD2   . PHE B 68  ? 1.0358 0.8131 0.8526 0.0935  0.0614  -0.1103 579 PHE B CD2   
1271 C CE1   . PHE B 68  ? 1.0855 0.8106 0.7830 0.0995  0.0495  -0.1267 579 PHE B CE1   
1272 C CE2   . PHE B 68  ? 1.1316 0.8819 0.8898 0.0839  0.0630  -0.1240 579 PHE B CE2   
1273 C CZ    . PHE B 68  ? 1.1962 0.9200 0.8947 0.0870  0.0571  -0.1322 579 PHE B CZ    
1274 N N     . LYS B 69  ? 1.2110 1.1301 1.2193 0.1216  0.0307  -0.0225 580 LYS B N     
1275 C CA    . LYS B 69  ? 1.2527 1.2039 1.3246 0.1315  0.0276  -0.0031 580 LYS B CA    
1276 C C     . LYS B 69  ? 1.4182 1.3703 1.4667 0.1407  0.0156  0.0034  580 LYS B C     
1277 O O     . LYS B 69  ? 1.4858 1.4436 1.4954 0.1347  0.0055  0.0094  580 LYS B O     
1278 C CB    . LYS B 69  ? 1.2111 1.2081 1.3348 0.1234  0.0245  0.0218  580 LYS B CB    
1279 N N     . PRO B 70  ? 1.4726 1.4193 1.5448 0.1549  0.0171  0.0015  581 PRO B N     
1280 C CA    . PRO B 70  ? 1.5183 1.4667 1.5757 0.1655  0.0065  0.0081  581 PRO B CA    
1281 C C     . PRO B 70  ? 1.4882 1.4774 1.5610 0.1622  -0.0068 0.0344  581 PRO B C     
1282 O O     . PRO B 70  ? 1.4547 1.4427 1.4793 0.1546  -0.0150 0.0354  581 PRO B O     
1283 C CB    . PRO B 70  ? 1.4923 1.4412 1.6000 0.1791  0.0127  0.0072  581 PRO B CB    
1284 C CG    . PRO B 70  ? 1.4500 1.3728 1.5592 0.1762  0.0276  -0.0140 581 PRO B CG    
1285 C CD    . PRO B 70  ? 1.4514 1.3837 1.5585 0.1612  0.0306  -0.0115 581 PRO B CD    
1286 N N     . LYS B 86  ? 1.1384 1.4026 1.2854 0.0685  -0.0585 0.1739  597 LYS B N     
1287 C CA    . LYS B 86  ? 1.1876 1.4229 1.3235 0.0857  -0.0580 0.1625  597 LYS B CA    
1288 C C     . LYS B 86  ? 1.2230 1.4727 1.3290 0.0862  -0.0712 0.1710  597 LYS B C     
1289 O O     . LYS B 86  ? 1.2848 1.5066 1.3603 0.0973  -0.0727 0.1586  597 LYS B O     
1290 C CB    . LYS B 86  ? 1.2095 1.4578 1.4195 0.0997  -0.0527 0.1740  597 LYS B CB    
1291 C CG    . LYS B 86  ? 1.2403 1.4863 1.4623 0.1164  -0.0574 0.1778  597 LYS B CG    
1292 C CD    . LYS B 86  ? 1.2117 1.4641 1.5052 0.1294  -0.0493 0.1846  597 LYS B CD    
1293 C CE    . LYS B 86  ? 1.1562 1.4095 1.4643 0.1455  -0.0545 0.1900  597 LYS B CE    
1294 N NZ    . LYS B 86  ? 1.1187 1.3629 1.4821 0.1590  -0.0439 0.1870  597 LYS B NZ    
1295 N N     . GLY B 87  ? 1.1345 1.4282 1.2477 0.0730  -0.0806 0.1918  598 GLY B N     
1296 C CA    . GLY B 87  ? 1.0246 1.3401 1.1146 0.0708  -0.0933 0.2025  598 GLY B CA    
1297 C C     . GLY B 87  ? 0.8868 1.1681 0.8958 0.0660  -0.0955 0.1804  598 GLY B C     
1298 O O     . GLY B 87  ? 0.8680 1.1160 0.8333 0.0584  -0.0885 0.1593  598 GLY B O     
1299 N N     . CYS B 88  ? 0.6750 0.9650 0.6657 0.0703  -0.1049 0.1857  599 CYS B N     
1300 C CA    . CYS B 88  ? 0.5656 0.8266 0.4830 0.0664  -0.1074 0.1669  599 CYS B CA    
1301 C C     . CYS B 88  ? 0.5976 0.8905 0.4910 0.0454  -0.1141 0.1751  599 CYS B C     
1302 O O     . CYS B 88  ? 0.7006 1.0406 0.6359 0.0355  -0.1183 0.1976  599 CYS B O     
1303 C CB    . CYS B 88  ? 0.4782 0.7344 0.3883 0.0808  -0.1140 0.1686  599 CYS B CB    
1304 S SG    . CYS B 88  ? 0.4544 0.7790 0.4084 0.0790  -0.1294 0.2043  599 CYS B SG    
1305 N N     . ASN B 89  ? 0.5486 0.8162 0.3756 0.0380  -0.1145 0.1569  600 ASN B N     
1306 C CA    . ASN B 89  ? 0.6649 0.9613 0.4645 0.0175  -0.1205 0.1623  600 ASN B CA    
1307 C C     . ASN B 89  ? 0.7240 1.0034 0.4795 0.0169  -0.1235 0.1505  600 ASN B C     
1308 O O     . ASN B 89  ? 0.7977 1.0606 0.5142 0.0024  -0.1200 0.1350  600 ASN B O     
1309 C CB    . ASN B 89  ? 0.7926 1.0670 0.5569 0.0026  -0.1126 0.1453  600 ASN B CB    
1310 C CG    . ASN B 89  ? 0.8288 1.1116 0.6392 0.0014  -0.1063 0.1521  600 ASN B CG    
1311 O OD1   . ASN B 89  ? 0.8261 1.0775 0.6519 0.0148  -0.0981 0.1421  600 ASN B OD1   
1312 N ND2   . ASN B 89  ? 0.8675 1.1934 0.6998 -0.0154 -0.1097 0.1688  600 ASN B ND2   
1313 N N     . CYS B 90  ? 0.6469 0.9171 0.4183 0.0327  -0.1256 0.1521  601 CYS B N     
1314 C CA    . CYS B 90  ? 0.6183 0.8555 0.3568 0.0334  -0.1243 0.1351  601 CYS B CA    
1315 C C     . CYS B 90  ? 0.5934 0.8533 0.3294 0.0165  -0.1260 0.1378  601 CYS B C     
1316 O O     . CYS B 90  ? 0.5690 0.8798 0.3459 0.0082  -0.1302 0.1591  601 CYS B O     
1317 C CB    . CYS B 90  ? 0.5300 0.7642 0.2969 0.0507  -0.1272 0.1412  601 CYS B CB    
1318 S SG    . CYS B 90  ? 0.6659 0.8817 0.4473 0.0730  -0.1246 0.1409  601 CYS B SG    
1319 N N     . LYS B 91  ? 0.8198 0.7803 0.5409 0.0056  0.0927  0.0842  602 LYS B N     
1320 C CA    . LYS B 91  ? 0.8540 0.8004 0.5597 -0.0036 0.0991  0.0864  602 LYS B CA    
1321 C C     . LYS B 91  ? 0.8914 0.8163 0.5969 -0.0042 0.1071  0.0901  602 LYS B C     
1322 O O     . LYS B 91  ? 0.9304 0.8444 0.6297 -0.0074 0.1081  0.0919  602 LYS B O     
1323 C CB    . LYS B 91  ? 0.8711 0.8186 0.5630 -0.0128 0.1053  0.0855  602 LYS B CB    
1324 C CG    . LYS B 91  ? 0.9395 0.9067 0.6269 -0.0154 0.0981  0.0823  602 LYS B CG    
1325 C CD    . LYS B 91  ? 1.0316 0.9989 0.7049 -0.0250 0.1050  0.0813  602 LYS B CD    
1326 C CE    . LYS B 91  ? 1.0858 1.0719 0.7524 -0.0293 0.0984  0.0785  602 LYS B CE    
1327 N NZ    . LYS B 91  ? 1.1175 1.1023 0.7686 -0.0400 0.1057  0.0774  602 LYS B NZ    
1328 N N     . ARG B 92  ? 0.9156 0.8346 0.6278 -0.0010 0.1130  0.0915  603 ARG B N     
1329 C CA    . ARG B 92  ? 0.9040 0.8025 0.6138 -0.0029 0.1226  0.0955  603 ARG B CA    
1330 C C     . ARG B 92  ? 0.7540 0.6497 0.4792 0.0058  0.1199  0.0969  603 ARG B C     
1331 O O     . ARG B 92  ? 0.6387 0.5186 0.3634 0.0052  0.1252  0.1000  603 ARG B O     
1332 C CB    . ARG B 92  ? 0.9768 0.8680 0.6812 -0.0066 0.1332  0.0970  603 ARG B CB    
1333 C CG    . ARG B 92  ? 1.0213 0.9143 0.7094 -0.0160 0.1369  0.0954  603 ARG B CG    
1334 C CD    . ARG B 92  ? 1.1445 1.0247 0.8163 -0.0254 0.1411  0.0964  603 ARG B CD    
1335 N NE    . ARG B 92  ? 1.2660 1.1235 0.9318 -0.0287 0.1528  0.1002  603 ARG B NE    
1336 C CZ    . ARG B 92  ? 1.3655 1.2083 1.0202 -0.0355 0.1570  0.1018  603 ARG B CZ    
1337 N NH1   . ARG B 92  ? 1.3594 1.2083 1.0075 -0.0396 0.1501  0.1002  603 ARG B NH1   
1338 N NH2   . ARG B 92  ? 1.3448 1.1669 0.9947 -0.0380 0.1681  0.1053  603 ARG B NH2   
1339 N N     . SER B 93  ? 0.6693 0.5803 0.4079 0.0136  0.1118  0.0947  604 SER B N     
1340 C CA    . SER B 93  ? 0.8485 0.7576 0.6009 0.0212  0.1088  0.0958  604 SER B CA    
1341 C C     . SER B 93  ? 0.8328 0.7398 0.5835 0.0217  0.1024  0.0951  604 SER B C     
1342 O O     . SER B 93  ? 0.9759 0.8810 0.7147 0.0159  0.1020  0.0946  604 SER B O     
1343 C CB    . SER B 93  ? 0.8381 0.7635 0.6046 0.0287  0.1027  0.0936  604 SER B CB    
1344 O OG    . SER B 93  ? 0.7812 0.7213 0.5511 0.0321  0.0923  0.0899  604 SER B OG    
1345 N N     . GLY B 94  ? 0.7828 0.6897 0.5443 0.0283  0.0975  0.0950  605 GLY B N     
1346 C CA    . GLY B 94  ? 0.9405 0.8444 0.6991 0.0288  0.0917  0.0944  605 GLY B CA    
1347 C C     . GLY B 94  ? 0.8429 0.7637 0.6100 0.0357  0.0813  0.0910  605 GLY B C     
1348 O O     . GLY B 94  ? 0.7672 0.6889 0.5346 0.0385  0.0749  0.0901  605 GLY B O     
1349 N N     . CYS B 95  ? 0.7412 0.6748 0.5148 0.0383  0.0801  0.0891  606 CYS B N     
1350 C CA    . CYS B 95  ? 0.6930 0.6414 0.4780 0.0457  0.0720  0.0861  606 CYS B CA    
1351 C C     . CYS B 95  ? 0.6915 0.6317 0.4864 0.0506  0.0722  0.0874  606 CYS B C     
1352 O O     . CYS B 95  ? 0.8146 0.7602 0.6172 0.0565  0.0655  0.0855  606 CYS B O     
1353 C CB    . CYS B 95  ? 0.5757 0.5344 0.3585 0.0481  0.0633  0.0834  606 CYS B CB    
1354 S SG    . CYS B 95  ? 0.7647 0.7324 0.5341 0.0411  0.0631  0.0824  606 CYS B SG    
1355 N N     . LEU B 96  ? 0.6264 0.5534 0.4205 0.0476  0.0804  0.0909  607 LEU B N     
1356 C CA    . LEU B 96  ? 0.7502 0.6702 0.5540 0.0513  0.0821  0.0928  607 LEU B CA    
1357 C C     . LEU B 96  ? 0.9373 0.8581 0.7472 0.0513  0.0887  0.0952  607 LEU B C     
1358 O O     . LEU B 96  ? 1.0083 0.9209 0.8238 0.0523  0.0930  0.0982  607 LEU B O     
1359 C CB    . LEU B 96  ? 0.5838 0.4861 0.3819 0.0484  0.0859  0.0955  607 LEU B CB    
1360 C CG    . LEU B 96  ? 0.6051 0.5072 0.3987 0.0496  0.0787  0.0935  607 LEU B CG    
1361 C CD1   . LEU B 96  ? 0.7429 0.6274 0.5306 0.0467  0.0819  0.0959  607 LEU B CD1   
1362 C CD2   . LEU B 96  ? 0.6005 0.5131 0.4044 0.0569  0.0704  0.0905  607 LEU B CD2   
1363 N N     . LYS B 97  ? 0.8774 0.8085 0.6863 0.0503  0.0895  0.0941  608 LYS B N     
1364 C CA    . LYS B 97  ? 0.8557 0.7895 0.6705 0.0510  0.0950  0.0964  608 LYS B CA    
1365 C C     . LYS B 97  ? 0.7902 0.7422 0.6111 0.0541  0.0889  0.0929  608 LYS B C     
1366 O O     . LYS B 97  ? 0.8569 0.8173 0.6737 0.0539  0.0829  0.0892  608 LYS B O     
1367 C CB    . LYS B 97  ? 0.8306 0.7546 0.6350 0.0450  0.1049  0.0993  608 LYS B CB    
1368 C CG    . LYS B 97  ? 0.8394 0.7446 0.6380 0.0416  0.1119  0.1030  608 LYS B CG    
1369 C CD    . LYS B 97  ? 0.8343 0.7289 0.6197 0.0348  0.1215  0.1051  608 LYS B CD    
1370 C CE    . LYS B 97  ? 0.8979 0.7739 0.6803 0.0325  0.1305  0.1095  608 LYS B CE    
1371 N NZ    . LYS B 97  ? 0.9775 0.8418 0.7466 0.0259  0.1408  0.1117  608 LYS B NZ    
1372 N N     . ASN B 98  ? 0.7129 0.6717 0.5436 0.0571  0.0901  0.0940  609 ASN B N     
1373 C CA    . ASN B 98  ? 0.7223 0.6984 0.5592 0.0602  0.0837  0.0904  609 ASN B CA    
1374 C C     . ASN B 98  ? 0.6455 0.6290 0.4745 0.0568  0.0848  0.0885  609 ASN B C     
1375 O O     . ASN B 98  ? 0.5726 0.5706 0.4058 0.0590  0.0792  0.0851  609 ASN B O     
1376 C CB    . ASN B 98  ? 0.6996 0.6817 0.5492 0.0641  0.0841  0.0922  609 ASN B CB    
1377 C CG    . ASN B 98  ? 0.7495 0.7294 0.6077 0.0678  0.0802  0.0923  609 ASN B CG    
1378 O OD1   . ASN B 98  ? 0.7802 0.7661 0.6409 0.0705  0.0725  0.0884  609 ASN B OD1   
1379 N ND2   . ASN B 98  ? 0.7073 0.6780 0.5693 0.0677  0.0858  0.0968  609 ASN B ND2   
1380 N N     . TYR B 99  ? 0.7069 0.6806 0.5238 0.0510  0.0916  0.0903  610 TYR B N     
1381 C CA    . TYR B 99  ? 0.5468 0.5271 0.3535 0.0466  0.0911  0.0875  610 TYR B CA    
1382 C C     . TYR B 99  ? 0.6616 0.6512 0.4660 0.0474  0.0821  0.0832  610 TYR B C     
1383 O O     . TYR B 99  ? 0.5438 0.5450 0.3439 0.0456  0.0791  0.0801  610 TYR B O     
1384 C CB    . TYR B 99  ? 0.5582 0.5246 0.3507 0.0394  0.1001  0.0901  610 TYR B CB    
1385 C CG    . TYR B 99  ? 0.5624 0.5163 0.3549 0.0384  0.1103  0.0950  610 TYR B CG    
1386 C CD1   . TYR B 99  ? 0.7658 0.7240 0.5596 0.0385  0.1149  0.0961  610 TYR B CD1   
1387 C CD2   . TYR B 99  ? 0.5966 0.5341 0.3873 0.0374  0.1160  0.0987  610 TYR B CD2   
1388 C CE1   . TYR B 99  ? 0.8429 0.7896 0.6366 0.0381  0.1248  0.1011  610 TYR B CE1   
1389 C CE2   . TYR B 99  ? 0.5949 0.5212 0.3857 0.0369  0.1259  0.1035  610 TYR B CE2   
1390 C CZ    . TYR B 99  ? 0.7935 0.7246 0.5859 0.0375  0.1303  0.1049  610 TYR B CZ    
1391 O OH    . TYR B 99  ? 0.8123 0.7326 0.6050 0.0377  0.1405  0.1102  610 TYR B OH    
1392 N N     . CYS B 100 ? 0.5478 0.5317 0.3539 0.0497  0.0783  0.0833  611 CYS B N     
1393 C CA    . CYS B 100 ? 0.6127 0.6060 0.4187 0.0522  0.0694  0.0797  611 CYS B CA    
1394 C C     . CYS B 100 ? 0.6362 0.6427 0.4549 0.0591  0.0623  0.0767  611 CYS B C     
1395 O O     . CYS B 100 ? 0.6505 0.6536 0.4785 0.0630  0.0621  0.0778  611 CYS B O     
1396 C CB    . CYS B 100 ? 0.6696 0.6517 0.4720 0.0523  0.0680  0.0809  611 CYS B CB    
1397 S SG    . CYS B 100 ? 0.7384 0.7322 0.5420 0.0570  0.0570  0.0771  611 CYS B SG    
1398 N N     . GLU B 101 ? 0.7414 0.7631 0.5602 0.0604  0.0566  0.0729  612 GLU B N     
1399 C CA    . GLU B 101 ? 0.7341 0.7685 0.5639 0.0665  0.0502  0.0697  612 GLU B CA    
1400 C C     . GLU B 101 ? 0.6759 0.7081 0.5104 0.0719  0.0442  0.0686  612 GLU B C     
1401 O O     . GLU B 101 ? 0.6187 0.6545 0.4628 0.0767  0.0409  0.0672  612 GLU B O     
1402 C CB    . GLU B 101 ? 0.7484 0.7996 0.5765 0.0660  0.0463  0.0659  612 GLU B CB    
1403 C CG    . GLU B 101 ? 0.8268 0.8858 0.6596 0.0655  0.0486  0.0653  612 GLU B CG    
1404 C CD    . GLU B 101 ? 0.8364 0.9097 0.6647 0.0631  0.0465  0.0619  612 GLU B CD    
1405 O OE1   . GLU B 101 ? 0.7555 0.8374 0.5812 0.0643  0.0409  0.0591  612 GLU B OE1   
1406 O OE2   . GLU B 101 ? 0.9231 0.9990 0.7501 0.0601  0.0507  0.0623  612 GLU B OE2   
1407 N N     . CYS B 102 ? 0.7555 0.7811 0.5824 0.0707  0.0432  0.0693  613 CYS B N     
1408 C CA    . CYS B 102 ? 0.7464 0.7673 0.5765 0.0757  0.0384  0.0688  613 CYS B CA    
1409 C C     . CYS B 102 ? 0.6585 0.6664 0.4939 0.0764  0.0421  0.0714  613 CYS B C     
1410 O O     . CYS B 102 ? 0.7285 0.7375 0.5722 0.0811  0.0389  0.0701  613 CYS B O     
1411 C CB    . CYS B 102 ? 0.8595 0.8756 0.6799 0.0740  0.0369  0.0697  613 CYS B CB    
1412 S SG    . CYS B 102 ? 0.8438 0.8783 0.6595 0.0744  0.0310  0.0666  613 CYS B SG    
1413 N N     . TYR B 103 ? 0.7229 0.7186 0.5533 0.0714  0.0492  0.0751  614 TYR B N     
1414 C CA    . TYR B 103 ? 0.7835 0.7673 0.6188 0.0718  0.0532  0.0780  614 TYR B CA    
1415 C C     . TYR B 103 ? 0.7943 0.7853 0.6409 0.0745  0.0534  0.0777  614 TYR B C     
1416 O O     . TYR B 103 ? 0.7096 0.6970 0.5633 0.0774  0.0523  0.0781  614 TYR B O     
1417 C CB    . TYR B 103 ? 0.7634 0.7336 0.5913 0.0659  0.0617  0.0822  614 TYR B CB    
1418 C CG    . TYR B 103 ? 0.7952 0.7523 0.6275 0.0664  0.0657  0.0854  614 TYR B CG    
1419 C CD1   . TYR B 103 ? 0.6735 0.6194 0.5033 0.0671  0.0641  0.0859  614 TYR B CD1   
1420 C CD2   . TYR B 103 ? 0.8242 0.7806 0.6630 0.0661  0.0711  0.0880  614 TYR B CD2   
1421 C CE1   . TYR B 103 ? 0.6886 0.6234 0.5223 0.0672  0.0677  0.0885  614 TYR B CE1   
1422 C CE2   . TYR B 103 ? 0.8643 0.8104 0.7075 0.0665  0.0747  0.0911  614 TYR B CE2   
1423 C CZ    . TYR B 103 ? 0.8434 0.7786 0.6840 0.0668  0.0730  0.0912  614 TYR B CZ    
1424 O OH    . TYR B 103 ? 0.8587 0.7840 0.7036 0.0669  0.0767  0.0941  614 TYR B OH    
1425 N N     . GLU B 104 ? 0.7897 0.7913 0.6377 0.0733  0.0548  0.0771  615 GLU B N     
1426 C CA    . GLU B 104 ? 0.7724 0.7817 0.6308 0.0755  0.0550  0.0772  615 GLU B CA    
1427 C C     . GLU B 104 ? 0.7391 0.7575 0.6054 0.0807  0.0474  0.0733  615 GLU B C     
1428 O O     . GLU B 104 ? 0.7487 0.7691 0.6239 0.0826  0.0470  0.0738  615 GLU B O     
1429 C CB    . GLU B 104 ? 0.7721 0.7905 0.6293 0.0730  0.0578  0.0771  615 GLU B CB    
1430 C CG    . GLU B 104 ? 0.9034 0.9333 0.7712 0.0757  0.0563  0.0764  615 GLU B CG    
1431 C CD    . GLU B 104 ? 1.1200 1.1571 0.9860 0.0730  0.0600  0.0770  615 GLU B CD    
1432 O OE1   . GLU B 104 ? 1.1915 1.2377 1.0658 0.0747  0.0594  0.0771  615 GLU B OE1   
1433 O OE2   . GLU B 104 ? 1.1955 1.2289 1.0514 0.0690  0.0637  0.0775  615 GLU B OE2   
1434 N N     . ALA B 105 ? 0.7305 0.7543 0.5933 0.0828  0.0416  0.0697  616 ALA B N     
1435 C CA    . ALA B 105 ? 0.7387 0.7698 0.6078 0.0879  0.0349  0.0659  616 ALA B CA    
1436 C C     . ALA B 105 ? 0.8126 0.8321 0.6820 0.0903  0.0333  0.0663  616 ALA B C     
1437 O O     . ALA B 105 ? 0.7719 0.7945 0.6451 0.0946  0.0283  0.0633  616 ALA B O     
1438 C CB    . ALA B 105 ? 0.7257 0.7683 0.5915 0.0898  0.0297  0.0621  616 ALA B CB    
1439 N N     . LYS B 106 ? 0.9995 1.0050 0.8643 0.0874  0.0379  0.0700  617 LYS B N     
1440 C CA    . LYS B 106 ? 1.0683 1.0606 0.9324 0.0887  0.0376  0.0710  617 LYS B CA    
1441 C C     . LYS B 106 ? 1.0456 1.0361 0.9049 0.0923  0.0320  0.0685  617 LYS B C     
1442 O O     . LYS B 106 ? 1.0732 1.0585 0.9348 0.0957  0.0292  0.0672  617 LYS B O     
1443 C CB    . LYS B 106 ? 1.1336 1.1259 1.0070 0.0904  0.0373  0.0709  617 LYS B CB    
1444 C CG    . LYS B 106 ? 1.1857 1.1786 1.0644 0.0872  0.0432  0.0745  617 LYS B CG    
1445 C CD    . LYS B 106 ? 1.2561 1.2357 1.1292 0.0834  0.0498  0.0790  617 LYS B CD    
1446 C CE    . LYS B 106 ? 1.2652 1.2448 1.1439 0.0811  0.0562  0.0832  617 LYS B CE    
1447 N NZ    . LYS B 106 ? 1.1982 1.1868 1.0766 0.0795  0.0590  0.0840  617 LYS B NZ    
1448 N N     . ILE B 107 ? 0.9328 0.9279 0.7853 0.0916  0.0306  0.0679  618 ILE B N     
1449 C CA    . ILE B 107 ? 0.8554 0.8499 0.7027 0.0950  0.0257  0.0664  618 ILE B CA    
1450 C C     . ILE B 107 ? 0.8663 0.8551 0.7034 0.0908  0.0280  0.0690  618 ILE B C     
1451 O O     . ILE B 107 ? 0.9430 0.9309 0.7770 0.0853  0.0331  0.0711  618 ILE B O     
1452 C CB    . ILE B 107 ? 0.8613 0.8719 0.7111 0.0993  0.0201  0.0625  618 ILE B CB    
1453 C CG1   . ILE B 107 ? 0.7090 0.7307 0.5551 0.0955  0.0213  0.0625  618 ILE B CG1   
1454 C CG2   . ILE B 107 ? 0.7633 0.7802 0.6226 0.1026  0.0182  0.0597  618 ILE B CG2   
1455 C CD1   . ILE B 107 ? 0.7036 0.7388 0.5480 0.0989  0.0158  0.0597  618 ILE B CD1   
1456 N N     . MET B 108 ? 0.7206 0.7058 0.5521 0.0932  0.0244  0.0690  619 MET B N     
1457 C CA    . MET B 108 ? 0.6322 0.6132 0.4534 0.0889  0.0258  0.0715  619 MET B CA    
1458 C C     . MET B 108 ? 0.6704 0.6667 0.4880 0.0872  0.0240  0.0703  619 MET B C     
1459 O O     . MET B 108 ? 0.6736 0.6839 0.4958 0.0917  0.0194  0.0673  619 MET B O     
1460 C CB    . MET B 108 ? 0.7143 0.6873 0.5305 0.0922  0.0222  0.0723  619 MET B CB    
1461 C CG    . MET B 108 ? 0.6683 0.6275 0.4874 0.0951  0.0223  0.0726  619 MET B CG    
1462 S SD    . MET B 108 ? 0.9215 0.8641 0.7393 0.0885  0.0301  0.0760  619 MET B SD    
1463 C CE    . MET B 108 ? 0.9654 0.8975 0.7892 0.0932  0.0287  0.0749  619 MET B CE    
1464 N N     . CYS B 109 ? 0.8225 0.8159 0.6310 0.0806  0.0276  0.0727  620 CYS B N     
1465 C CA    . CYS B 109 ? 0.8517 0.8588 0.6544 0.0780  0.0257  0.0719  620 CYS B CA    
1466 C C     . CYS B 109 ? 0.8583 0.8725 0.6596 0.0834  0.0188  0.0711  620 CYS B C     
1467 O O     . CYS B 109 ? 0.7441 0.7482 0.5444 0.0865  0.0171  0.0725  620 CYS B O     
1468 C CB    . CYS B 109 ? 0.7914 0.7913 0.5829 0.0691  0.0313  0.0748  620 CYS B CB    
1469 S SG    . CYS B 109 ? 0.7183 0.7120 0.5094 0.0625  0.0402  0.0759  620 CYS B SG    
1470 N N     . SER B 110 ? 0.8927 0.9244 0.6935 0.0843  0.0150  0.0693  621 SER B N     
1471 C CA    . SER B 110 ? 0.9564 0.9968 0.7561 0.0898  0.0086  0.0690  621 SER B CA    
1472 C C     . SER B 110 ? 1.0302 1.0810 0.8207 0.0844  0.0079  0.0704  621 SER B C     
1473 O O     . SER B 110 ? 1.0375 1.0868 0.8214 0.0759  0.0127  0.0714  621 SER B O     
1474 C CB    . SER B 110 ? 0.9532 1.0072 0.7622 0.0978  0.0036  0.0653  621 SER B CB    
1475 O OG    . SER B 110 ? 0.8852 0.9564 0.6946 0.0954  0.0030  0.0632  621 SER B OG    
1476 N N     . SER B 111 ? 1.0569 1.1183 0.8467 0.0895  0.0019  0.0707  622 SER B N     
1477 C CA    . SER B 111 ? 1.0483 1.1216 0.8296 0.0852  0.0001  0.0724  622 SER B CA    
1478 C C     . SER B 111 ? 0.9397 1.0283 0.7196 0.0796  0.0014  0.0702  622 SER B C     
1479 O O     . SER B 111 ? 0.9956 1.0885 0.7659 0.0715  0.0032  0.0717  622 SER B O     
1480 C CB    . SER B 111 ? 1.1157 1.2000 0.8992 0.0937  -0.0069 0.0730  622 SER B CB    
1481 O OG    . SER B 111 ? 1.1978 1.2954 0.9908 0.1011  -0.0104 0.0693  622 SER B OG    
1482 N N     . ILE B 112 ? 0.8866 0.9832 0.6753 0.0836  0.0006  0.0665  623 ILE B N     
1483 C CA    . ILE B 112 ? 0.9803 1.0909 0.7679 0.0786  0.0019  0.0641  623 ILE B CA    
1484 C C     . ILE B 112 ? 1.0212 1.1211 0.8025 0.0687  0.0096  0.0648  623 ILE B C     
1485 O O     . ILE B 112 ? 1.0032 1.1126 0.7796 0.0624  0.0116  0.0637  623 ILE B O     
1486 C CB    . ILE B 112 ? 0.9477 1.0689 0.7463 0.0853  -0.0008 0.0600  623 ILE B CB    
1487 C CG1   . ILE B 112 ? 1.0249 1.1317 0.8303 0.0867  0.0028  0.0592  623 ILE B CG1   
1488 C CG2   . ILE B 112 ? 0.9231 1.0544 0.7275 0.0953  -0.0077 0.0592  623 ILE B CG2   
1489 C CD1   . ILE B 112 ? 1.0575 1.1741 0.8727 0.0913  0.0011  0.0551  623 ILE B CD1   
1490 N N     . CYS B 113 ? 1.0448 1.1252 0.8264 0.0676  0.0142  0.0667  624 CYS B N     
1491 C CA    . CYS B 113 ? 0.9776 1.0462 0.7530 0.0589  0.0222  0.0681  624 CYS B CA    
1492 C C     . CYS B 113 ? 0.9171 0.9841 0.6785 0.0494  0.0252  0.0704  624 CYS B C     
1493 O O     . CYS B 113 ? 1.0959 1.1622 0.8523 0.0494  0.0223  0.0725  624 CYS B O     
1494 C CB    . CYS B 113 ? 1.0415 1.0897 0.8201 0.0601  0.0264  0.0701  624 CYS B CB    
1495 S SG    . CYS B 113 ? 0.9002 0.9466 0.6937 0.0683  0.0253  0.0679  624 CYS B SG    
1496 N N     . LYS B 114 ? 0.6557 0.7210 0.4102 0.0412  0.0314  0.0702  625 LYS B N     
1497 C CA    . LYS B 114 ? 0.6253 0.6864 0.3652 0.0308  0.0357  0.0724  625 LYS B CA    
1498 C C     . LYS B 114 ? 0.7766 0.8156 0.5104 0.0246  0.0449  0.0749  625 LYS B C     
1499 O O     . LYS B 114 ? 0.7330 0.7673 0.4548 0.0148  0.0511  0.0758  625 LYS B O     
1500 C CB    . LYS B 114 ? 0.7600 0.8371 0.4934 0.0246  0.0360  0.0702  625 LYS B CB    
1501 C CG    . LYS B 114 ? 0.8222 0.9223 0.5584 0.0287  0.0274  0.0684  625 LYS B CG    
1502 C CD    . LYS B 114 ? 0.8171 0.9307 0.5666 0.0378  0.0224  0.0648  625 LYS B CD    
1503 C CE    . LYS B 114 ? 0.8126 0.9491 0.5636 0.0413  0.0145  0.0634  625 LYS B CE    
1504 N NZ    . LYS B 114 ? 0.7120 0.8623 0.4760 0.0510  0.0089  0.0600  625 LYS B NZ    
1505 N N     . CYS B 115 ? 0.8201 0.8457 0.5619 0.0302  0.0458  0.0762  626 CYS B N     
1506 C CA    . CYS B 115 ? 0.8136 0.8177 0.5514 0.0258  0.0541  0.0790  626 CYS B CA    
1507 C C     . CYS B 115 ? 0.8896 0.8844 0.6125 0.0166  0.0580  0.0816  626 CYS B C     
1508 O O     . CYS B 115 ? 0.7348 0.7360 0.4533 0.0161  0.0527  0.0822  626 CYS B O     
1509 C CB    . CYS B 115 ? 0.6630 0.6554 0.4095 0.0327  0.0526  0.0804  626 CYS B CB    
1510 S SG    . CYS B 115 ? 0.8024 0.8055 0.5645 0.0446  0.0444  0.0777  626 CYS B SG    
1511 N N     . ILE B 116 ? 1.0346 1.0129 0.7504 0.0098  0.0673  0.0836  627 ILE B N     
1512 C CA    . ILE B 116 ? 1.0186 0.9832 0.7211 0.0016  0.0718  0.0864  627 ILE B CA    
1513 C C     . ILE B 116 ? 0.9859 0.9300 0.6921 0.0033  0.0775  0.0889  627 ILE B C     
1514 O O     . ILE B 116 ? 1.1152 1.0526 0.8262 0.0044  0.0833  0.0891  627 ILE B O     
1515 C CB    . ILE B 116 ? 1.0639 1.0265 0.7514 -0.0100 0.0792  0.0866  627 ILE B CB    
1516 C CG1   . ILE B 116 ? 1.1583 1.1425 0.8420 -0.0123 0.0736  0.0840  627 ILE B CG1   
1517 C CG2   . ILE B 116 ? 1.0450 0.9910 0.7188 -0.0188 0.0848  0.0895  627 ILE B CG2   
1518 C CD1   . ILE B 116 ? 1.2039 1.1997 0.8863 -0.0108 0.0649  0.0845  627 ILE B CD1   
1519 N N     . GLY B 117 ? 0.7460 0.6808 0.4501 0.0037  0.0756  0.0908  628 GLY B N     
1520 C CA    . GLY B 117 ? 0.7216 0.6373 0.4288 0.0051  0.0804  0.0931  628 GLY B CA    
1521 C C     . GLY B 117 ? 0.7648 0.6826 0.4880 0.0158  0.0758  0.0922  628 GLY B C     
1522 O O     . GLY B 117 ? 0.8160 0.7210 0.5443 0.0175  0.0807  0.0936  628 GLY B O     
1523 N N     . CYS B 118 ? 0.7321 0.6658 0.4629 0.0229  0.0666  0.0898  629 CYS B N     
1524 C CA    . CYS B 118 ? 0.7462 0.6824 0.4914 0.0325  0.0624  0.0885  629 CYS B CA    
1525 C C     . CYS B 118 ? 0.8242 0.7457 0.5724 0.0358  0.0620  0.0902  629 CYS B C     
1526 O O     . CYS B 118 ? 0.8930 0.8114 0.6364 0.0361  0.0581  0.0911  629 CYS B O     
1527 C CB    . CYS B 118 ? 0.6021 0.5575 0.3535 0.0392  0.0532  0.0855  629 CYS B CB    
1528 S SG    . CYS B 118 ? 0.6410 0.5999 0.4091 0.0503  0.0483  0.0834  629 CYS B SG    
1529 N N     . LYS B 119 ? 0.7820 0.6956 0.5384 0.0385  0.0658  0.0907  630 LYS B N     
1530 C CA    . LYS B 119 ? 0.6852 0.5855 0.4463 0.0418  0.0661  0.0920  630 LYS B CA    
1531 C C     . LYS B 119 ? 0.6973 0.6050 0.4718 0.0505  0.0608  0.0898  630 LYS B C     
1532 O O     . LYS B 119 ? 0.6021 0.5003 0.3824 0.0531  0.0621  0.0906  630 LYS B O     
1533 C CB    . LYS B 119 ? 0.6149 0.4996 0.3741 0.0369  0.0759  0.0949  630 LYS B CB    
1534 C CG    . LYS B 119 ? 0.9044 0.7785 0.6492 0.0278  0.0818  0.0971  630 LYS B CG    
1535 C CD    . LYS B 119 ? 0.9665 0.8252 0.7086 0.0229  0.0924  0.1000  630 LYS B CD    
1536 C CE    . LYS B 119 ? 1.1079 0.9566 0.8342 0.0132  0.0984  0.1017  630 LYS B CE    
1537 N NZ    . LYS B 119 ? 1.2010 1.0313 0.9236 0.0085  0.1092  0.1048  630 LYS B NZ    
1538 N N     . ASN B 120 ? 0.7192 0.6441 0.4984 0.0544  0.0555  0.0870  631 ASN B N     
1539 C CA    . ASN B 120 ? 0.7908 0.7239 0.5821 0.0622  0.0504  0.0844  631 ASN B CA    
1540 C C     . ASN B 120 ? 0.8620 0.8032 0.6532 0.0676  0.0421  0.0824  631 ASN B C     
1541 O O     . ASN B 120 ? 0.7880 0.7451 0.5813 0.0703  0.0375  0.0799  631 ASN B O     
1542 C CB    . ASN B 120 ? 0.7651 0.7110 0.5630 0.0629  0.0514  0.0827  631 ASN B CB    
1543 C CG    . ASN B 120 ? 0.9004 0.8559 0.7101 0.0704  0.0459  0.0798  631 ASN B CG    
1544 O OD1   . ASN B 120 ? 1.0254 0.9957 0.8376 0.0735  0.0410  0.0769  631 ASN B OD1   
1545 N ND2   . ASN B 120 ? 0.5677 0.5150 0.3843 0.0729  0.0471  0.0805  631 ASN B ND2   
1546 N N     . PHE B 121 ? 0.8948 0.8246 0.6826 0.0688  0.0406  0.0837  632 PHE B N     
1547 C CA    . PHE B 121 ? 0.7513 0.6852 0.5392 0.0749  0.0333  0.0825  632 PHE B CA    
1548 C C     . PHE B 121 ? 0.6829 0.6021 0.4737 0.0781  0.0334  0.0830  632 PHE B C     
1549 O O     . PHE B 121 ? 0.6341 0.5411 0.4254 0.0744  0.0390  0.0847  632 PHE B O     
1550 C CB    . PHE B 121 ? 0.6598 0.5955 0.4370 0.0718  0.0313  0.0842  632 PHE B CB    
1551 C CG    . PHE B 121 ? 0.8500 0.7698 0.6179 0.0644  0.0368  0.0875  632 PHE B CG    
1552 C CD1   . PHE B 121 ? 0.8126 0.7303 0.5746 0.0562  0.0433  0.0889  632 PHE B CD1   
1553 C CD2   . PHE B 121 ? 0.8769 0.7831 0.6413 0.0656  0.0358  0.0892  632 PHE B CD2   
1554 C CE1   . PHE B 121 ? 0.7094 0.6116 0.4623 0.0492  0.0488  0.0918  632 PHE B CE1   
1555 C CE2   . PHE B 121 ? 0.6527 0.5441 0.4083 0.0586  0.0408  0.0921  632 PHE B CE2   
1556 C CZ    . PHE B 121 ? 0.6444 0.5338 0.3943 0.0504  0.0474  0.0934  632 PHE B CZ    
1557 N N     . GLU B 122 ? 0.7495 0.6699 0.5423 0.0850  0.0275  0.0816  633 GLU B N     
1558 C CA    . GLU B 122 ? 0.7927 0.7002 0.5888 0.0884  0.0272  0.0813  633 GLU B CA    
1559 C C     . GLU B 122 ? 0.7717 0.6605 0.5612 0.0835  0.0316  0.0844  633 GLU B C     
1560 O O     . GLU B 122 ? 0.7043 0.5825 0.4974 0.0822  0.0354  0.0847  633 GLU B O     
1561 C CB    . GLU B 122 ? 0.9372 0.8474 0.7337 0.0963  0.0206  0.0796  633 GLU B CB    
1562 C CG    . GLU B 122 ? 1.0967 0.9925 0.8950 0.0996  0.0205  0.0791  633 GLU B CG    
1563 C CD    . GLU B 122 ? 1.2044 1.1018 1.0121 0.1006  0.0221  0.0768  633 GLU B CD    
1564 O OE1   . GLU B 122 ? 1.2895 1.2005 1.1034 0.1044  0.0193  0.0740  633 GLU B OE1   
1565 O OE2   . GLU B 122 ? 1.1810 1.0668 0.9900 0.0972  0.0263  0.0778  633 GLU B OE2   
1566 N N     . GLU B 123 ? 0.7330 0.6183 0.5128 0.0802  0.0313  0.0866  634 GLU B N     
1567 C CA    . GLU B 123 ? 0.8987 0.7658 0.6715 0.0762  0.0346  0.0893  634 GLU B CA    
1568 C C     . GLU B 123 ? 0.9189 0.7788 0.6880 0.0676  0.0423  0.0915  634 GLU B C     
1569 O O     . GLU B 123 ? 0.8735 0.7189 0.6355 0.0629  0.0457  0.0939  634 GLU B O     
1570 C CB    . GLU B 123 ? 0.8578 0.7231 0.6214 0.0769  0.0304  0.0910  634 GLU B CB    
1571 C CG    . GLU B 123 ? 0.8833 0.7558 0.6496 0.0860  0.0230  0.0893  634 GLU B CG    
1572 C CD    . GLU B 123 ? 0.9734 0.8672 0.7436 0.0897  0.0188  0.0875  634 GLU B CD    
1573 O OE1   . GLU B 123 ? 0.8398 0.7432 0.6130 0.0860  0.0214  0.0866  634 GLU B OE1   
1574 O OE2   . GLU B 123 ? 1.0888 0.9893 0.8589 0.0965  0.0131  0.0870  634 GLU B OE2   
1575 N N     . SER B 124 ? 0.7475 0.6168 0.5212 0.0657  0.0453  0.0908  635 SER B N     
1576 C CA    . SER B 124 ? 0.8105 0.6729 0.5806 0.0581  0.0534  0.0930  635 SER B CA    
1577 C C     . SER B 124 ? 0.8888 0.7367 0.6626 0.0568  0.0589  0.0944  635 SER B C     
1578 O O     . SER B 124 ? 0.9612 0.8119 0.7448 0.0608  0.0585  0.0931  635 SER B O     
1579 C CB    . SER B 124 ? 0.8469 0.7225 0.6208 0.0568  0.0556  0.0920  635 SER B CB    
1580 O OG    . SER B 124 ? 0.7696 0.6365 0.5407 0.0503  0.0643  0.0944  635 SER B OG    
1581 N N     . PRO B 125 ? 0.8904 0.7234 0.6561 0.0506  0.0645  0.0971  636 PRO B N     
1582 C CA    . PRO B 125 ? 0.8738 0.6932 0.6427 0.0487  0.0708  0.0989  636 PRO B CA    
1583 C C     . PRO B 125 ? 0.9435 0.7688 0.7199 0.0480  0.0762  0.0994  636 PRO B C     
1584 O O     . PRO B 125 ? 0.9615 0.7878 0.7477 0.0514  0.0767  0.0991  636 PRO B O     
1585 C CB    . PRO B 125 ? 0.8080 0.6124 0.5652 0.0412  0.0761  0.1016  636 PRO B CB    
1586 C CG    . PRO B 125 ? 0.9010 0.7104 0.6491 0.0404  0.0705  0.1012  636 PRO B CG    
1587 C CD    . PRO B 125 ? 0.8683 0.6969 0.6214 0.0447  0.0654  0.0988  636 PRO B CD    
1588 N N     . GLU B 126 ? 0.9211 0.7505 0.6924 0.0435  0.0802  0.1003  637 GLU B N     
1589 C CA    . GLU B 126 ? 0.8977 0.7314 0.6745 0.0425  0.0862  0.1013  637 GLU B CA    
1590 C C     . GLU B 126 ? 0.8913 0.7398 0.6807 0.0492  0.0814  0.0990  637 GLU B C     
1591 O O     . GLU B 126 ? 0.9871 0.8364 0.7848 0.0504  0.0853  0.1002  637 GLU B O     
1592 C CB    . GLU B 126 ? 0.9520 0.7896 0.7202 0.0371  0.0899  0.1018  637 GLU B CB    
1593 C CG    . GLU B 126 ? 1.0082 0.8318 0.7626 0.0294  0.0948  0.1039  637 GLU B CG    
1594 C CD    . GLU B 126 ? 1.0334 0.8607 0.7794 0.0284  0.0879  0.1025  637 GLU B CD    
1595 O OE1   . GLU B 126 ? 0.9683 0.8053 0.7197 0.0347  0.0794  0.1003  637 GLU B OE1   
1596 O OE2   . GLU B 126 ? 1.0605 0.8812 0.7941 0.0212  0.0912  0.1039  637 GLU B OE2   
1597 N N     . ARG B 127 ? 0.8092 0.6694 0.6000 0.0535  0.0732  0.0959  638 ARG B N     
1598 C CA    . ARG B 127 ? 0.8650 0.7385 0.6671 0.0595  0.0686  0.0934  638 ARG B CA    
1599 C C     . ARG B 127 ? 0.9233 0.7900 0.7326 0.0628  0.0678  0.0934  638 ARG B C     
1600 O O     . ARG B 127 ? 0.9598 0.8315 0.7787 0.0648  0.0690  0.0934  638 ARG B O     
1601 C CB    . ARG B 127 ? 0.8152 0.7022 0.6171 0.0637  0.0603  0.0900  638 ARG B CB    
1602 C CG    . ARG B 127 ? 0.7587 0.6589 0.5719 0.0696  0.0559  0.0872  638 ARG B CG    
1603 C CD    . ARG B 127 ? 0.7945 0.7062 0.6078 0.0746  0.0477  0.0838  638 ARG B CD    
1604 N NE    . ARG B 127 ? 0.9534 0.8567 0.7630 0.0775  0.0436  0.0834  638 ARG B NE    
1605 C CZ    . ARG B 127 ? 0.9755 0.8723 0.7897 0.0812  0.0418  0.0825  638 ARG B CZ    
1606 N NH1   . ARG B 127 ? 1.0008 0.8993 0.8238 0.0821  0.0436  0.0820  638 ARG B NH1   
1607 N NH2   . ARG B 127 ? 0.9270 0.8154 0.7363 0.0837  0.0384  0.0823  638 ARG B NH2   
1608 N N     . LYS B 128 ? 0.9508 0.8062 0.7550 0.0629  0.0657  0.0935  639 LYS B N     
1609 C CA    . LYS B 128 ? 0.9347 0.7822 0.7440 0.0653  0.0650  0.0933  639 LYS B CA    
1610 C C     . LYS B 128 ? 0.9627 0.8033 0.7764 0.0621  0.0727  0.0964  639 LYS B C     
1611 O O     . LYS B 128 ? 0.9939 0.8366 0.8165 0.0644  0.0726  0.0961  639 LYS B O     
1612 C CB    . LYS B 128 ? 0.9639 0.7984 0.7648 0.0650  0.0626  0.0934  639 LYS B CB    
1613 C CG    . LYS B 128 ? 0.9522 0.7922 0.7528 0.0709  0.0542  0.0902  639 LYS B CG    
1614 C CD    . LYS B 128 ? 0.8556 0.6852 0.6458 0.0700  0.0521  0.0911  639 LYS B CD    
1615 C CE    . LYS B 128 ? 0.8794 0.7130 0.6690 0.0766  0.0444  0.0886  639 LYS B CE    
1616 N NZ    . LYS B 128 ? 0.8823 0.7074 0.6611 0.0756  0.0424  0.0901  639 LYS B NZ    
1617 N N     . THR B 129 ? 0.9530 0.7858 0.7607 0.0568  0.0796  0.0994  640 THR B N     
1618 C CA    . THR B 129 ? 0.9950 0.8210 0.8067 0.0541  0.0878  0.1028  640 THR B CA    
1619 C C     . THR B 129 ? 0.9924 0.8319 0.8150 0.0567  0.0890  0.1031  640 THR B C     
1620 O O     . THR B 129 ? 1.0262 0.8671 0.8578 0.0585  0.0898  0.1040  640 THR B O     
1621 C CB    . THR B 129 ? 0.9936 0.8086 0.7957 0.0478  0.0958  0.1059  640 THR B CB    
1622 O OG1   . THR B 129 ? 1.0111 0.8146 0.8024 0.0449  0.0943  0.1056  640 THR B OG1   
1623 C CG2   . THR B 129 ? 0.9449 0.7510 0.7510 0.0457  0.1045  0.1097  640 THR B CG2   
1624 N N     . LEU B 130 ? 1.0458 0.8959 0.8676 0.0566  0.0890  0.1025  641 LEU B N     
1625 C CA    . LEU B 130 ? 1.0796 0.9428 0.9109 0.0588  0.0902  0.1030  641 LEU B CA    
1626 C C     . LEU B 130 ? 1.0170 0.8915 0.8584 0.0639  0.0832  0.1002  641 LEU B C     
1627 O O     . LEU B 130 ? 1.0633 0.9496 0.9133 0.0659  0.0833  0.1005  641 LEU B O     
1632 N N     . MET B 131 ? 0.9795 0.8501 0.8193 0.0659  0.0773  0.0976  642 MET B N     
1633 C CA    . MET B 131 ? 1.0591 0.9390 0.9068 0.0704  0.0710  0.0945  642 MET B CA    
1634 C C     . MET B 131 ? 1.2757 1.1502 1.1299 0.0703  0.0729  0.0960  642 MET B C     
1635 O O     . MET B 131 ? 1.3000 1.1831 1.1622 0.0728  0.0696  0.0944  642 MET B O     
1636 C CB    . MET B 131 ? 0.9687 0.8477 0.8108 0.0732  0.0637  0.0908  642 MET B CB    
1637 C CG    . MET B 131 ? 0.8821 0.7733 0.7308 0.0779  0.0571  0.0870  642 MET B CG    
1638 S SD    . MET B 131 ? 1.4138 1.3037 1.2556 0.0821  0.0494  0.0831  642 MET B SD    
1639 C CE    . MET B 131 ? 1.0340 0.9362 0.8848 0.0871  0.0438  0.0790  642 MET B CE    
1640 N N     . HIS B 132 ? 1.4172 1.2777 1.2676 0.0670  0.0783  0.0990  643 HIS B N     
1641 C CA    . HIS B 132 ? 1.5114 1.3670 1.3679 0.0662  0.0812  0.1010  643 HIS B CA    
1642 C C     . HIS B 132 ? 1.6305 1.4827 1.4894 0.0633  0.0901  0.1061  643 HIS B C     
1643 O O     . HIS B 132 ? 1.6778 1.5163 1.5323 0.0603  0.0950  0.1084  643 HIS B O     
1644 C CB    . HIS B 132 ? 1.4375 1.2780 1.2875 0.0652  0.0797  0.1000  643 HIS B CB    
1645 C CG    . HIS B 132 ? 1.3700 1.2108 1.2156 0.0683  0.0718  0.0955  643 HIS B CG    
1646 N ND1   . HIS B 132 ? 1.3415 1.1748 1.1768 0.0681  0.0696  0.0945  643 HIS B ND1   
1647 C CD2   . HIS B 132 ? 1.3772 1.2245 1.2268 0.0718  0.0659  0.0920  643 HIS B CD2   
1648 C CE1   . HIS B 132 ? 1.3491 1.1846 1.1828 0.0720  0.0628  0.0909  643 HIS B CE1   
1649 N NE2   . HIS B 132 ? 1.3697 1.2131 1.2117 0.0743  0.0606  0.0891  643 HIS B NE2   
1658 O "O5'" . DG  C 1   ? 0.8529 1.0311 1.0774 -0.2168 -0.1387 0.3110  1   DG  C "O5'" 
1659 C "C5'" . DG  C 1   ? 0.8722 1.0548 1.1427 -0.2112 -0.1492 0.3196  1   DG  C "C5'" 
1660 C "C4'" . DG  C 1   ? 0.8717 1.0630 1.1935 -0.2026 -0.1503 0.3117  1   DG  C "C4'" 
1661 O "O4'" . DG  C 1   ? 0.8396 1.0403 1.1682 -0.1950 -0.1428 0.3031  1   DG  C "O4'" 
1662 C "C3'" . DG  C 1   ? 0.9226 1.1158 1.2510 -0.2052 -0.1484 0.3012  1   DG  C "C3'" 
1663 O "O3'" . DG  C 1   ? 1.0030 1.2013 1.3846 -0.1973 -0.1565 0.2969  1   DG  C "O3'" 
1664 C "C2'" . DG  C 1   ? 0.8653 1.0651 1.1771 -0.1990 -0.1369 0.2847  1   DG  C "C2'" 
1665 C "C1'" . DG  C 1   ? 0.8868 1.0876 1.2041 -0.1798 -0.1347 0.2772  1   DG  C "C1'" 
1666 N N9    . DG  C 1   ? 0.8558 1.0507 1.1228 -0.1680 -0.1213 0.2626  1   DG  C N9    
1667 C C8    . DG  C 1   ? 0.8108 0.9977 1.0245 -0.1812 -0.1135 0.2697  1   DG  C C8    
1668 N N7    . DG  C 1   ? 0.7915 0.9741 0.9690 -0.1657 -0.1022 0.2533  1   DG  C N7    
1669 C C5    . DG  C 1   ? 0.7388 0.9271 0.9467 -0.1407 -0.1025 0.2341  1   DG  C C5    
1670 C C6    . DG  C 1   ? 0.6477 0.8348 0.8376 -0.1163 -0.0931 0.2115  1   DG  C C6    
1671 O O6    . DG  C 1   ? 0.6030 0.7835 0.7457 -0.1117 -0.0825 0.2041  1   DG  C O6    
1672 N N1    . DG  C 1   ? 0.6349 0.8289 0.8677 -0.0962 -0.0970 0.1968  1   DG  C N1    
1673 C C2    . DG  C 1   ? 0.6839 0.8849 0.9707 -0.0991 -0.1085 0.2032  1   DG  C C2    
1674 N N2    . DG  C 1   ? 0.7546 0.9612 1.0768 -0.0777 -0.1103 0.1863  1   DG  C N2    
1675 N N3    . DG  C 1   ? 0.7036 0.9059 1.0084 -0.1216 -0.1176 0.2247  1   DG  C N3    
1676 C C4    . DG  C 1   ? 0.7579 0.9537 1.0208 -0.1416 -0.1140 0.2392  1   DG  C C4    
1677 P P     . DA  C 2   ? 1.0352 1.2389 1.4372 -0.1953 -0.1561 0.2820  2   DA  C P     
1678 O OP1   . DA  C 2   ? 1.0191 1.2180 1.4548 -0.1929 -0.1655 0.2866  2   DA  C OP1   
1679 O "O5'" . DA  C 2   ? 0.9943 1.2108 1.4221 -0.1737 -0.1525 0.2581  2   DA  C "O5'" 
1680 C "C5'" . DA  C 2   ? 0.9145 1.1363 1.3868 -0.1583 -0.1586 0.2535  2   DA  C "C5'" 
1681 C "C4'" . DA  C 2   ? 0.8576 1.0810 1.3281 -0.1292 -0.1504 0.2223  2   DA  C "C4'" 
1682 O "O4'" . DA  C 2   ? 0.8151 1.0328 1.2329 -0.1223 -0.1383 0.2144  2   DA  C "O4'" 
1683 C "C3'" . DA  C 2   ? 0.8453 1.0713 1.3228 -0.1203 -0.1481 0.2014  2   DA  C "C3'" 
1684 O "O3'" . DA  C 2   ? 0.8014 1.0326 1.3159 -0.0971 -0.1499 0.1810  2   DA  C "O3'" 
1685 C "C2'" . DA  C 2   ? 0.8638 1.0843 1.2838 -0.1157 -0.1347 0.1879  2   DA  C "C2'" 
1686 C "C1'" . DA  C 2   ? 0.8093 1.0260 1.2037 -0.1082 -0.1291 0.1896  2   DA  C "C1'" 
1687 N N9    . DA  C 2   ? 0.6872 0.8965 1.0225 -0.1146 -0.1185 0.1911  2   DA  C N9    
1688 C C8    . DA  C 2   ? 0.6589 0.8633 0.9651 -0.1388 -0.1179 0.2102  2   DA  C C8    
1689 N N7    . DA  C 2   ? 0.6544 0.8520 0.9082 -0.1388 -0.1070 0.2063  2   DA  C N7    
1690 C C5    . DA  C 2   ? 0.5742 0.7724 0.8222 -0.1128 -0.1002 0.1834  2   DA  C C5    
1691 C C6    . DA  C 2   ? 0.5278 0.7204 0.7300 -0.0998 -0.0881 0.1689  2   DA  C C6    
1692 N N6    . DA  C 2   ? 0.3855 0.5704 0.5376 -0.1118 -0.0801 0.1759  2   DA  C N6    
1693 N N1    . DA  C 2   ? 0.4125 0.6074 0.6223 -0.0742 -0.0844 0.1471  2   DA  C N1    
1694 C C2    . DA  C 2   ? 0.4534 0.6554 0.7128 -0.0625 -0.0920 0.1399  2   DA  C C2    
1695 N N3    . DA  C 2   ? 0.5574 0.7650 0.8633 -0.0723 -0.1033 0.1516  2   DA  C N3    
1696 C C4    . DA  C 2   ? 0.6029 0.8083 0.9003 -0.0978 -0.1071 0.1737  2   DA  C C4    
1697 P P     . DG  C 3   ? 0.9681 1.2032 1.5001 -0.0843 -0.1491 0.1571  3   DG  C P     
1698 O OP1   . DG  C 3   ? 0.9348 1.1754 1.5208 -0.0702 -0.1567 0.1488  3   DG  C OP1   
1699 O OP2   . DG  C 3   ? 0.9941 1.2286 1.5167 -0.1040 -0.1507 0.1667  3   DG  C OP2   
1700 O "O5'" . DG  C 3   ? 0.8356 1.0678 1.3254 -0.0638 -0.1358 0.1312  3   DG  C "O5'" 
1701 C "C5'" . DG  C 3   ? 0.7878 1.0197 1.2755 -0.0433 -0.1315 0.1182  3   DG  C "C5'" 
1702 C "C4'" . DG  C 3   ? 0.8128 1.0421 1.2603 -0.0254 -0.1195 0.0934  3   DG  C "C4'" 
1703 O "O4'" . DG  C 3   ? 0.8338 1.0564 1.2280 -0.0364 -0.1114 0.1027  3   DG  C "O4'" 
1704 C "C3'" . DG  C 3   ? 0.7803 1.0124 1.2321 -0.0181 -0.1180 0.0737  3   DG  C "C3'" 
1705 O "O3'" . DG  C 3   ? 0.7366 0.9706 1.1933 0.0083  -0.1139 0.0465  3   DG  C "O3'" 
1706 C "C2'" . DG  C 3   ? 0.7343 0.9614 1.1350 -0.0294 -0.1096 0.0766  3   DG  C "C2'" 
1707 C "C1'" . DG  C 3   ? 0.7723 0.9932 1.1352 -0.0326 -0.1036 0.0874  3   DG  C "C1'" 
1708 N N9    . DG  C 3   ? 0.6710 0.8864 0.9960 -0.0544 -0.1000 0.1054  3   DG  C N9    
1709 C C8    . DG  C 3   ? 0.6560 0.8715 0.9911 -0.0792 -0.1068 0.1282  3   DG  C C8    
1710 N N7    . DG  C 3   ? 0.5823 0.7916 0.8749 -0.0954 -0.1011 0.1406  3   DG  C N7    
1711 C C5    . DG  C 3   ? 0.5470 0.7517 0.7993 -0.0802 -0.0900 0.1254  3   DG  C C5    
1712 C C6    . DG  C 3   ? 0.6846 0.8815 0.8824 -0.0871 -0.0800 0.1289  3   DG  C C6    
1713 O O6    . DG  C 3   ? 0.7220 0.9143 0.8952 -0.1089 -0.0787 0.1464  3   DG  C O6    
1714 N N1    . DG  C 3   ? 0.7219 0.9160 0.8923 -0.0658 -0.0706 0.1092  3   DG  C N1    
1715 C C2    . DG  C 3   ? 0.6143 0.8128 0.8070 -0.0412 -0.0710 0.0886  3   DG  C C2    
1716 N N2    . DG  C 3   ? 0.5464 0.7409 0.7058 -0.0236 -0.0613 0.0719  3   DG  C N2    
1717 N N3    . DG  C 3   ? 0.4889 0.6947 0.7328 -0.0346 -0.0802 0.0848  3   DG  C N3    
1718 C C4    . DG  C 3   ? 0.5643 0.7728 0.8358 -0.0549 -0.0893 0.1039  3   DG  C C4    
1719 P P     . DT  C 4   ? 0.8020 1.0386 1.2555 0.0220  -0.1102 0.0207  4   DT  C P     
1720 O OP1   . DT  C 4   ? 0.7720 1.0123 1.2567 0.0447  -0.1123 0.0001  4   DT  C OP1   
1721 O OP2   . DT  C 4   ? 0.8526 1.0916 1.3175 0.0045  -0.1148 0.0297  4   DT  C OP2   
1722 O "O5'" . DT  C 4   ? 0.6320 0.8630 1.0268 0.0294  -0.0975 0.0100  4   DT  C "O5'" 
1723 C "C5'" . DT  C 4   ? 0.4872 0.7145 0.8607 0.0423  -0.0916 0.0049  4   DT  C "C5'" 
1724 C "C4'" . DT  C 4   ? 0.4145 0.6365 0.7336 0.0490  -0.0799 -0.0063 4   DT  C "C4'" 
1725 O "O4'" . DT  C 4   ? 0.4537 0.6705 0.7386 0.0279  -0.0765 0.0135  4   DT  C "O4'" 
1726 C "C3'" . DT  C 4   ? 0.5282 0.7524 0.8398 0.0610  -0.0761 -0.0293 4   DT  C "C3'" 
1727 O "O3'" . DT  C 4   ? 0.5554 0.7763 0.8354 0.0807  -0.0674 -0.0481 4   DT  C "O3'" 
1728 C "C2'" . DT  C 4   ? 0.5574 0.7790 0.8423 0.0413  -0.0731 -0.0174 4   DT  C "C2'" 
1729 C "C1'" . DT  C 4   ? 0.5441 0.7589 0.7969 0.0285  -0.0693 0.0027  4   DT  C "C1'" 
1730 N N1    . DT  C 4   ? 0.5694 0.7811 0.8046 0.0028  -0.0692 0.0242  4   DT  C N1    
1731 C C2    . DT  C 4   ? 0.5870 0.7914 0.7710 -0.0036 -0.0596 0.0288  4   DT  C C2    
1732 O O2    . DT  C 4   ? 0.6487 0.8490 0.8009 0.0109  -0.0513 0.0159  4   DT  C O2    
1733 N N3    . DT  C 4   ? 0.5142 0.7157 0.6849 -0.0281 -0.0601 0.0490  4   DT  C N3    
1734 C C4    . DT  C 4   ? 0.5312 0.7366 0.7339 -0.0465 -0.0692 0.0652  4   DT  C C4    
1735 O O4    . DT  C 4   ? 0.6164 0.8184 0.8024 -0.0683 -0.0687 0.0827  4   DT  C O4    
1736 C C5    . DT  C 4   ? 0.5775 0.7906 0.8341 -0.0384 -0.0792 0.0599  4   DT  C C5    
1737 C C7    . DT  C 4   ? 0.4926 0.7101 0.7878 -0.0570 -0.0898 0.0766  4   DT  C C7    
1738 C C6    . DT  C 4   ? 0.6158 0.8316 0.8861 -0.0144 -0.0786 0.0398  4   DT  C C6    
1739 P P     . DT  C 5   ? 0.6663 0.8882 0.9279 0.0964  -0.0615 -0.0737 5   DT  C P     
1740 O OP1   . DT  C 5   ? 0.7322 0.9529 0.9849 0.1200  -0.0573 -0.0931 5   DT  C OP1   
1741 O OP2   . DT  C 5   ? 0.5934 0.8218 0.8896 0.0922  -0.0683 -0.0779 5   DT  C OP2   
1742 O "O5'" . DT  C 5   ? 0.5557 0.7709 0.7635 0.0861  -0.0519 -0.0668 5   DT  C "O5'" 
1743 C "C5'" . DT  C 5   ? 0.4707 0.6790 0.6402 0.0882  -0.0446 -0.0622 5   DT  C "C5'" 
1744 C "C4'" . DT  C 5   ? 0.5233 0.7254 0.6439 0.0798  -0.0354 -0.0594 5   DT  C "C4'" 
1745 O "O4'" . DT  C 5   ? 0.5522 0.7536 0.6742 0.0545  -0.0381 -0.0376 5   DT  C "O4'" 
1746 C "C3'" . DT  C 5   ? 0.5830 0.7866 0.6898 0.0926  -0.0303 -0.0815 5   DT  C "C3'" 
1747 O "O3'" . DT  C 5   ? 0.3562 0.5528 0.4149 0.1017  -0.0200 -0.0892 5   DT  C "O3'" 
1748 C "C2'" . DT  C 5   ? 0.4037 0.6091 0.5138 0.0732  -0.0316 -0.0712 5   DT  C "C2'" 
1749 C "C1'" . DT  C 5   ? 0.5154 0.7161 0.6159 0.0501  -0.0327 -0.0435 5   DT  C "C1'" 
1750 N N1    . DT  C 5   ? 0.4917 0.6955 0.6157 0.0278  -0.0393 -0.0260 5   DT  C N1    
1751 C C2    . DT  C 5   ? 0.5296 0.7278 0.6242 0.0064  -0.0352 -0.0080 5   DT  C C2    
1752 O O2    . DT  C 5   ? 0.6013 0.7921 0.6509 0.0052  -0.0260 -0.0068 5   DT  C O2    
1753 N N3    . DT  C 5   ? 0.4158 0.6172 0.5352 -0.0139 -0.0422 0.0085  5   DT  C N3    
1754 C C4    . DT  C 5   ? 0.5196 0.7289 0.6897 -0.0148 -0.0528 0.0090  5   DT  C C4    
1755 O O4    . DT  C 5   ? 0.5730 0.7844 0.7618 -0.0342 -0.0586 0.0248  5   DT  C O4    
1756 C C5    . DT  C 5   ? 0.4708 0.6853 0.6700 0.0082  -0.0565 -0.0101 5   DT  C C5    
1757 C C7    . DT  C 5   ? 0.3681 0.5906 0.6226 0.0093  -0.0677 -0.0115 5   DT  C C7    
1758 C C6    . DT  C 5   ? 0.4767 0.6882 0.6515 0.0280  -0.0497 -0.0264 5   DT  C C6    
1759 P P     . DT  C 6   ? 0.4907 0.6872 0.5260 0.1171  -0.0131 -0.1123 6   DT  C P     
1760 O OP1   . DT  C 6   ? 0.6181 0.8076 0.6122 0.1302  -0.0044 -0.1206 6   DT  C OP1   
1761 O OP2   . DT  C 6   ? 0.4610 0.6663 0.5376 0.1277  -0.0202 -0.1279 6   DT  C OP2   
1762 O "O5'" . DT  C 6   ? 0.4995 0.6931 0.5109 0.0985  -0.0082 -0.1017 6   DT  C "O5'" 
1763 C "C5'" . DT  C 6   ? 0.5538 0.7391 0.5281 0.0839  -0.0021 -0.0847 6   DT  C "C5'" 
1764 C "C4'" . DT  C 6   ? 0.5677 0.7516 0.5273 0.0658  0.0014  -0.0757 6   DT  C "C4'" 
1765 O "O4'" . DT  C 6   ? 0.4954 0.6843 0.4910 0.0480  -0.0073 -0.0603 6   DT  C "O4'" 
1766 C "C3'" . DT  C 6   ? 0.5077 0.6946 0.4618 0.0766  0.0057  -0.0956 6   DT  C "C3'" 
1767 O "O3'" . DT  C 6   ? 0.5225 0.7014 0.4274 0.0779  0.0169  -0.0986 6   DT  C "O3'" 
1768 C "C2'" . DT  C 6   ? 0.4080 0.6005 0.3881 0.0586  0.0009  -0.0862 6   DT  C "C2'" 
1769 C "C1'" . DT  C 6   ? 0.4531 0.6435 0.4438 0.0376  -0.0046 -0.0604 6   DT  C "C1'" 
1770 N N1    . DT  C 6   ? 0.4804 0.6784 0.5175 0.0251  -0.0151 -0.0509 6   DT  C N1    
1771 C C2    . DT  C 6   ? 0.3801 0.5763 0.4148 -0.0001 -0.0161 -0.0298 6   DT  C C2    
1772 O O2    . DT  C 6   ? 0.3934 0.5821 0.3895 -0.0128 -0.0086 -0.0194 6   DT  C O2    
1773 N N3    . DT  C 6   ? 0.3750 0.5781 0.4537 -0.0102 -0.0263 -0.0216 6   DT  C N3    
1774 C C4    . DT  C 6   ? 0.5001 0.7114 0.6244 0.0022  -0.0351 -0.0324 6   DT  C C4    
1775 O O4    . DT  C 6   ? 0.4502 0.6669 0.6124 -0.0085 -0.0440 -0.0236 6   DT  C O4    
1776 C C5    . DT  C 6   ? 0.5787 0.7913 0.7026 0.0287  -0.0332 -0.0550 6   DT  C C5    
1777 C C7    . DT  C 6   ? 0.6768 0.8974 0.8472 0.0440  -0.0420 -0.0689 6   DT  C C7    
1778 C C6    . DT  C 6   ? 0.4188 0.6248 0.4994 0.0386  -0.0235 -0.0627 6   DT  C C6    
1779 P P     . DG  C 7   ? 0.5486 0.7283 0.4353 0.0944  0.0239  -0.1217 7   DG  C P     
1780 O OP1   . DG  C 7   ? 0.5666 0.7367 0.4049 0.1017  0.0339  -0.1249 7   DG  C OP1   
1781 O OP2   . DG  C 7   ? 0.4882 0.6773 0.4125 0.1119  0.0168  -0.1404 7   DG  C OP2   
1782 O "O5'" . DG  C 7   ? 0.5300 0.7102 0.4108 0.0760  0.0273  -0.1139 7   DG  C "O5'" 
1783 C "C5'" . DG  C 7   ? 0.5701 0.7414 0.4146 0.0575  0.0347  -0.0970 7   DG  C "C5'" 
1784 C "C4'" . DG  C 7   ? 0.6014 0.7750 0.4521 0.0380  0.0356  -0.0880 7   DG  C "C4'" 
1785 O "O4'" . DG  C 7   ? 0.6586 0.8392 0.5530 0.0256  0.0245  -0.0757 7   DG  C "O4'" 
1786 C "C3'" . DG  C 7   ? 0.4432 0.6224 0.2982 0.0474  0.0391  -0.1064 7   DG  C "C3'" 
1787 O "O3'" . DG  C 7   ? 0.5557 0.7320 0.3942 0.0285  0.0451  -0.0962 7   DG  C "O3'" 
1788 C "C2'" . DG  C 7   ? 0.4735 0.6638 0.3815 0.0507  0.0275  -0.1109 7   DG  C "C2'" 
1789 C "C1'" . DG  C 7   ? 0.5116 0.7006 0.4327 0.0270  0.0218  -0.0856 7   DG  C "C1'" 
1790 N N9    . DG  C 7   ? 0.4207 0.6181 0.3920 0.0256  0.0095  -0.0824 7   DG  C N9    
1791 C C8    . DG  C 7   ? 0.3791 0.5837 0.3833 0.0448  0.0025  -0.0984 7   DG  C C8    
1792 N N7    . DG  C 7   ? 0.3725 0.5835 0.4201 0.0379  -0.0081 -0.0909 7   DG  C N7    
1793 C C5    . DG  C 7   ? 0.3787 0.5867 0.4215 0.0123  -0.0084 -0.0680 7   DG  C C5    
1794 C C6    . DG  C 7   ? 0.3776 0.5895 0.4555 -0.0055 -0.0178 -0.0507 7   DG  C C6    
1795 O O6    . DG  C 7   ? 0.3679 0.5867 0.4900 -0.0018 -0.0281 -0.0522 7   DG  C O6    
1796 N N1    . DG  C 7   ? 0.3858 0.5924 0.4426 -0.0298 -0.0146 -0.0299 7   DG  C N1    
1797 C C2    . DG  C 7   ? 0.5445 0.7427 0.5527 -0.0362 -0.0032 -0.0266 7   DG  C C2    
1798 N N2    . DG  C 7   ? 0.6253 0.8189 0.6189 -0.0614 -0.0017 -0.0054 7   DG  C N2    
1799 N N3    . DG  C 7   ? 0.3984 0.5927 0.3742 -0.0194 0.0059  -0.0430 7   DG  C N3    
1800 C C4    . DG  C 7   ? 0.3891 0.5888 0.3848 0.0043  0.0025  -0.0628 7   DG  C C4    
1801 P P     . DA  C 8   ? 0.5355 0.8580 0.8639 0.1742  0.0112  0.2631  8   DA  C P     
1802 O OP1   . DA  C 8   ? 0.4865 0.7906 0.8106 0.1872  0.0271  0.2741  8   DA  C OP1   
1803 O OP2   . DA  C 8   ? 0.5749 0.9659 0.9140 0.1685  0.0148  0.2614  8   DA  C OP2   
1804 O "O5'" . DA  C 8   ? 0.4521 0.6928 0.7471 0.1763  0.0237  0.2619  8   DA  C "O5'" 
1805 C "C5'" . DA  C 8   ? 0.4205 0.5643 0.6776 0.1629  0.0152  0.2450  8   DA  C "C5'" 
1806 C "C4'" . DA  C 8   ? 0.5923 0.6733 0.8109 0.1420  0.0106  0.2229  8   DA  C "C4'" 
1807 O "O4'" . DA  C 8   ? 0.4121 0.5235 0.6370 0.1155  -0.0199 0.2000  8   DA  C "O4'" 
1808 C "C3'" . DA  C 8   ? 0.6476 0.7324 0.8581 0.1537  0.0371  0.2336  8   DA  C "C3'" 
1809 O "O3'" . DA  C 8   ? 0.7836 0.7749 0.9484 0.1425  0.0420  0.2190  8   DA  C "O3'" 
1810 C "C2'" . DA  C 8   ? 0.4290 0.5941 0.6645 0.1417  0.0221  0.2267  8   DA  C "C2'" 
1811 C "C1'" . DA  C 8   ? 0.4065 0.5547 0.6350 0.1124  -0.0141 0.1990  8   DA  C "C1'" 
1812 N N9    . DA  C 8   ? 0.4972 0.7327 0.7599 0.1020  -0.0361 0.1936  8   DA  C N9    
1813 C C8    . DA  C 8   ? 0.3715 0.6964 0.6770 0.1170  -0.0347 0.2116  8   DA  C C8    
1814 N N7    . DA  C 8   ? 0.3150 0.7034 0.6428 0.1013  -0.0584 0.2002  8   DA  C N7    
1815 C C5    . DA  C 8   ? 0.2851 0.6218 0.5830 0.0747  -0.0763 0.1732  8   DA  C C5    
1816 C C6    . DA  C 8   ? 0.4089 0.7707 0.7098 0.0489  -0.1043 0.1507  8   DA  C C6    
1817 N N6    . DA  C 8   ? 0.4066 0.8134 0.7122 0.0422  -0.1088 0.1360  8   DA  C N6    
1818 N N1    . DA  C 8   ? 0.3890 0.6815 0.6539 0.0260  -0.1166 0.1264  8   DA  C N1    
1819 C C2    . DA  C 8   ? 0.4025 0.6075 0.6311 0.0288  -0.1015 0.1253  8   DA  C C2    
1820 N N3    . DA  C 8   ? 0.5123 0.6848 0.7336 0.0520  -0.0748 0.1449  8   DA  C N3    
1821 C C4    . DA  C 8   ? 0.3332 0.5761 0.5911 0.0746  -0.0632 0.1688  8   DA  C C4    
1822 P P     . DA  C 9   ? 0.6433 0.6179 0.7897 0.1506  0.0679  0.2254  9   DA  C P     
1823 O OP1   . DA  C 9   ? 0.8067 0.6749 0.9078 0.1496  0.0799  0.2192  9   DA  C OP1   
1824 O OP2   . DA  C 9   ? 0.5422 0.5969 0.7223 0.1761  0.0907  0.2524  9   DA  C OP2   
1825 O "O5'" . DA  C 9   ? 0.5260 0.5186 0.6679 0.1233  0.0451  0.2019  9   DA  C "O5'" 
1826 C "C5'" . DA  C 9   ? 0.5314 0.4632 0.6449 0.0951  0.0198  0.1736  9   DA  C "C5'" 
1827 C "C4'" . DA  C 9   ? 0.6315 0.5886 0.7434 0.0743  0.0047  0.1564  9   DA  C "C4'" 
1828 O "O4'" . DA  C 9   ? 0.5712 0.6198 0.7229 0.0687  -0.0150 0.1558  9   DA  C "O4'" 
1829 C "C3'" . DA  C 9   ? 0.6814 0.6511 0.7882 0.0850  0.0296  0.1673  9   DA  C "C3'" 
1830 O "O3'" . DA  C 9   ? 0.7765 0.6968 0.8516 0.0616  0.0190  0.1444  9   DA  C "O3'" 
1831 C "C2'" . DA  C 9   ? 0.6333 0.7145 0.7854 0.0922  0.0273  0.1799  9   DA  C "C2'" 
1832 C "C1'" . DA  C 9   ? 0.6400 0.7482 0.8066 0.0698  -0.0085 0.1606  9   DA  C "C1'" 
1833 N N9    . DA  C 9   ? 0.5430 0.7518 0.7559 0.0780  -0.0153 0.1732  9   DA  C N9    
1834 C C8    . DA  C 9   ? 0.3895 0.6514 0.6323 0.1053  0.0039  0.2006  9   DA  C C8    
1835 N N7    . DA  C 9   ? 0.3992 0.7497 0.6810 0.1058  -0.0091 0.2058  9   DA  C N7    
1836 C C5    . DA  C 9   ? 0.4277 0.7828 0.7047 0.0769  -0.0388 0.1798  9   DA  C C5    
1837 C C6    . DA  C 9   ? 0.4245 0.8533 0.7302 0.0628  -0.0640 0.1708  9   DA  C C6    
1838 N N6    . DA  C 9   ? 0.2496 0.7443 0.5810 0.0731  -0.0601 0.1808  9   DA  C N6    
1839 N N1    . DA  C 9   ? 0.3573 0.7654 0.6471 0.0338  -0.0902 0.1432  9   DA  C N1    
1840 C C2    . DA  C 9   ? 0.3604 0.6810 0.6089 0.0200  -0.0909 0.1263  9   DA  C C2    
1841 N N3    . DA  C 9   ? 0.3455 0.5919 0.5640 0.0306  -0.0689 0.1323  9   DA  C N3    
1842 C C4    . DA  C 9   ? 0.4536 0.7217 0.6883 0.0595  -0.0431 0.1595  9   DA  C C4    
1843 P P     . DA  C 10  ? 0.5752 0.4875 0.6341 0.0656  0.0403  0.1484  10  DA  C P     
1844 O OP1   . DA  C 10  ? 0.7156 0.5255 0.7271 0.0494  0.0370  0.1288  10  DA  C OP1   
1845 O OP2   . DA  C 10  ? 0.5896 0.5326 0.6634 0.0974  0.0744  0.1783  10  DA  C OP2   
1846 O "O5'" . DA  C 10  ? 0.5324 0.5209 0.6148 0.0486  0.0205  0.1383  10  DA  C "O5'" 
1847 C "C5'" . DA  C 10  ? 0.5088 0.4908 0.5871 0.0203  -0.0130 0.1126  10  DA  C "C5'" 
1848 C "C4'" . DA  C 10  ? 0.4613 0.5345 0.5724 0.0098  -0.0302 0.1088  10  DA  C "C4'" 
1849 O "O4'" . DA  C 10  ? 0.4494 0.6022 0.6023 0.0256  -0.0300 0.1265  10  DA  C "O4'" 
1850 C "C3'" . DA  C 10  ? 0.4762 0.5864 0.5906 0.0118  -0.0165 0.1148  10  DA  C "C3'" 
1851 O "O3'" . DA  C 10  ? 0.6047 0.7042 0.7054 -0.0168 -0.0400 0.0896  10  DA  C "O3'" 
1852 C "C2'" . DA  C 10  ? 0.5043 0.7232 0.6665 0.0278  -0.0117 0.1357  10  DA  C "C2'" 
1853 C "C1'" . DA  C 10  ? 0.4741 0.7126 0.6556 0.0238  -0.0334 0.1311  10  DA  C "C1'" 
1854 N N9    . DA  C 10  ? 0.3834 0.7022 0.6062 0.0461  -0.0241 0.1553  10  DA  C N9    
1855 C C8    . DA  C 10  ? 0.4821 0.8053 0.7137 0.0754  0.0042  0.1816  10  DA  C C8    
1856 N N7    . DA  C 10  ? 0.5742 0.9779 0.8457 0.0902  0.0057  0.1994  10  DA  C N7    
1857 C C5    . DA  C 10  ? 0.5050 0.9595 0.7944 0.0689  -0.0240 0.1831  10  DA  C C5    
1858 C C6    . DA  C 10  ? 0.5330 1.0787 0.8635 0.0703  -0.0375 0.1895  10  DA  C C6    
1859 N N6    . DA  C 10  ? 0.2640 0.8380 0.6052 0.0902  -0.0197 0.2070  10  DA  C N6    
1860 N N1    . DA  C 10  ? 0.3943 0.9444 0.7162 0.0428  -0.0643 0.1618  10  DA  C N1    
1861 C C2    . DA  C 10  ? 0.4506 0.9659 0.7555 0.0204  -0.0822 0.1427  10  DA  C C2    
1862 N N3    . DA  C 10  ? 0.3637 0.7925 0.6292 0.0163  -0.0722 0.1345  10  DA  C N3    
1863 C C4    . DA  C 10  ? 0.4134 0.8159 0.6730 0.0416  -0.0426 0.1558  10  DA  C C4    
1864 P P     . DC  C 11  ? 0.7481 0.8683 0.8432 -0.0228 -0.0318 0.0883  11  DC  C P     
1865 O OP1   . DC  C 11  ? 0.8282 0.8815 0.8879 -0.0506 -0.0498 0.0604  11  DC  C OP1   
1866 O OP2   . DC  C 11  ? 0.7922 0.9168 0.8881 0.0050  0.0042  0.1141  11  DC  C OP2   
1867 O "O5'" . DC  C 11  ? 0.6887 0.9165 0.8263 -0.0271 -0.0463 0.0917  11  DC  C "O5'" 
1868 C "C5'" . DC  C 11  ? 0.6050 0.8593 0.7569 -0.0460 -0.0779 0.0750  11  DC  C "C5'" 
1869 C "C4'" . DC  C 11  ? 0.5756 0.9377 0.7715 -0.0404 -0.0822 0.0873  11  DC  C "C4'" 
1870 O "O4'" . DC  C 11  ? 0.5713 0.9718 0.7933 -0.0129 -0.0647 0.1129  11  DC  C "O4'" 
1871 C "C3'" . DC  C 11  ? 0.5890 0.9993 0.7931 -0.0379 -0.0688 0.0963  11  DC  C "C3'" 
1872 O "O3'" . DC  C 11  ? 0.6521 1.1090 0.8678 -0.0614 -0.0942 0.0796  11  DC  C "O3'" 
1873 C "C2'" . DC  C 11  ? 0.4747 0.9576 0.7136 -0.0078 -0.0447 0.1283  11  DC  C "C2'" 
1874 C "C1'" . DC  C 11  ? 0.4577 0.9506 0.7139 -0.0016 -0.0554 0.1309  11  DC  C "C1'" 
1875 N N1    . DC  C 11  ? 0.4404 0.9653 0.7189 0.0301  -0.0301 0.1607  11  DC  C N1    
1876 C C2    . DC  C 11  ? 0.4122 1.0222 0.7317 0.0388  -0.0365 0.1733  11  DC  C C2    
1877 O O2    . DC  C 11  ? 0.4148 1.0275 0.7252 0.0184  -0.0578 0.1503  11  DC  C O2    
1878 N N3    . DC  C 11  ? 0.3465 0.9822 0.6842 0.0671  -0.0137 0.1995  11  DC  C N3    
1879 C C4    . DC  C 11  ? 0.3896 0.9770 0.7110 0.0874  0.0146  0.2150  11  DC  C C4    
1880 N N4    . DC  C 11  ? 0.3672 0.9874 0.7109 0.1160  0.0365  0.2423  11  DC  C N4    
1881 C C5    . DC  C 11  ? 0.3425 0.8425 0.6214 0.0791  0.0221  0.2025  11  DC  C C5    
1882 C C6    . DC  C 11  ? 0.4408 0.9123 0.6996 0.0503  -0.0011 0.1753  11  DC  C C6    
1883 P P     . DT  C 12  ? 0.8143 1.3090 1.0315 -0.0680 -0.0878 0.0808  12  DT  C P     
1884 O OP1   . DT  C 12  ? 0.7906 1.2664 0.9921 -0.1002 -0.1164 0.0517  12  DT  C OP1   
1885 O OP2   . DT  C 12  ? 0.7525 1.2032 0.9486 -0.0503 -0.0561 0.0954  12  DT  C OP2   
1886 O "O5'" . DT  C 12  ? 0.5793 1.1882 0.8440 -0.0546 -0.0841 0.1017  12  DT  C "O5'" 
1887 C "C5'" . DT  C 12  ? 0.6584 1.2417 0.9102 -0.0587 -0.0958 0.0825  12  DT  C "C5'" 
1888 C "C4'" . DT  C 12  ? 0.7060 1.3309 0.9706 -0.0392 -0.0797 0.0992  12  DT  C "C4'" 
1889 O "O4'" . DT  C 12  ? 0.6236 1.2702 0.9075 -0.0169 -0.0648 0.1234  12  DT  C "O4'" 
1890 C "C3'" . DT  C 12  ? 0.6921 1.3619 0.9605 -0.0338 -0.0651 0.1127  12  DT  C "C3'" 
1891 O "O3'" . DT  C 12  ? 0.6268 1.2897 0.8820 -0.0420 -0.0718 0.0987  12  DT  C "O3'" 
1892 C "C2'" . DT  C 12  ? 0.7287 1.4392 1.0159 -0.0064 -0.0414 0.1437  12  DT  C "C2'" 
1893 C "C1'" . DT  C 12  ? 0.6675 1.3553 0.9595 0.0009  -0.0454 0.1436  12  DT  C "C1'" 
1894 N N1    . DT  C 12  ? 0.5981 1.3033 0.9083 0.0275  -0.0224 0.1728  12  DT  C N1    
1895 C C2    . DT  C 12  ? 0.5757 1.2910 0.8891 0.0448  -0.0117 0.1865  12  DT  C C2    
1896 O O2    . DT  C 12  ? 0.5651 1.2810 0.8699 0.0385  -0.0205 0.1767  12  DT  C O2    
1897 N N3    . DT  C 12  ? 0.5317 1.2512 0.8576 0.0704  0.0118  0.2126  12  DT  C N3    
1898 C C4    . DT  C 12  ? 0.5382 1.2497 0.8747 0.0832  0.0299  0.2269  12  DT  C C4    
1899 O O4    . DT  C 12  ? 0.5150 1.2181 0.8578 0.1091  0.0557  0.2498  12  DT  C O4    
1900 C C5    . DT  C 12  ? 0.4682 1.1639 0.7977 0.0627  0.0185  0.2104  12  DT  C C5    
1901 C C7    . DT  C 12  ? 0.5790 1.1839 0.8679 0.0663  0.0372  0.2075  12  DT  C C7    
1902 C C6    . DT  C 12  ? 0.4269 1.1320 0.7493 0.0355  -0.0093 0.1859  12  DT  C C6    
1903 O "O3'" . DC  D 1   ? 1.7297 2.2588 1.8392 0.2153  0.1628  0.1355  1   DC  D "O3'" 
1904 P P     . DA  D 2   ? 1.4502 1.9413 1.5541 0.1681  0.1323  0.1097  2   DA  D P     
1905 O OP1   . DA  D 2   ? 1.4538 1.9143 1.5801 0.1532  0.1565  0.1052  2   DA  D OP1   
1906 O OP2   . DA  D 2   ? 1.3587 1.8663 1.4777 0.1434  0.1224  0.1135  2   DA  D OP2   
1907 O "O5'" . DA  D 2   ? 1.0905 1.5639 1.1411 0.1745  0.0843  0.0858  2   DA  D "O5'" 
1908 C "C5'" . DA  D 2   ? 1.0208 1.5121 1.0444 0.1772  0.0477  0.0799  2   DA  D "C5'" 
1909 C "C4'" . DA  D 2   ? 0.9643 1.4313 0.9411 0.1785  0.0034  0.0540  2   DA  D "C4'" 
1910 O "O4'" . DA  D 2   ? 0.9421 1.3755 0.9168 0.1359  -0.0236 0.0326  2   DA  D "O4'" 
1911 C "C3'" . DA  D 2   ? 1.0036 1.4513 0.9615 0.2021  0.0107  0.0481  2   DA  D "C3'" 
1912 O "O3'" . DA  D 2   ? 1.0398 1.4848 0.9517 0.2192  -0.0281 0.0318  2   DA  D "O3'" 
1913 C "C2'" . DA  D 2   ? 0.9821 1.3876 0.9528 0.1669  0.0121  0.0332  2   DA  D "C2'" 
1914 C "C1'" . DA  D 2   ? 0.9041 1.3000 0.8712 0.1287  -0.0223 0.0185  2   DA  D "C1'" 
1915 N N9    . DA  D 2   ? 0.7614 1.1356 0.7599 0.0901  -0.0094 0.0157  2   DA  D N9    
1916 C C8    . DA  D 2   ? 0.6674 1.0483 0.7082 0.0843  0.0335  0.0330  2   DA  D C8    
1917 N N7    . DA  D 2   ? 0.6074 0.9648 0.6681 0.0465  0.0347  0.0246  2   DA  D N7    
1918 C C5    . DA  D 2   ? 0.6675 1.0008 0.6970 0.0262  -0.0101 0.0012  2   DA  D C5    
1919 C C6    . DA  D 2   ? 0.4820 0.7850 0.5122 -0.0143 -0.0312 -0.0164 2   DA  D C6    
1920 N N6    . DA  D 2   ? 0.4542 0.7458 0.5179 -0.0423 -0.0089 -0.0135 2   DA  D N6    
1921 N N1    . DA  D 2   ? 0.5048 0.7896 0.5000 -0.0244 -0.0761 -0.0374 2   DA  D N1    
1922 C C2    . DA  D 2   ? 0.6928 0.9895 0.6548 0.0037  -0.0987 -0.0413 2   DA  D C2    
1923 N N3    . DA  D 2   ? 0.7779 1.1038 0.7343 0.0430  -0.0831 -0.0265 2   DA  D N3    
1924 C C4    . DA  D 2   ? 0.7449 1.0879 0.7365 0.0524  -0.0378 -0.0049 2   DA  D C4    
1925 P P     . DG  D 3   ? 1.2598 1.6810 1.1416 0.2417  -0.0332 0.0197  3   DG  D P     
1926 O OP1   . DG  D 3   ? 1.2704 1.7147 1.1147 0.2767  -0.0560 0.0179  3   DG  D OP1   
1927 O OP2   . DG  D 3   ? 1.2478 1.6620 1.1582 0.2507  0.0119  0.0338  3   DG  D OP2   
1928 O "O5'" . DG  D 3   ? 0.9002 1.2772 0.7642 0.2054  -0.0698 -0.0098 3   DG  D "O5'" 
1929 C "C5'" . DG  D 3   ? 0.9648 1.3394 0.8055 0.1882  -0.1149 -0.0271 3   DG  D "C5'" 
1930 C "C4'" . DG  D 3   ? 0.9780 1.3083 0.8012 0.1587  -0.1456 -0.0540 3   DG  D "C4'" 
1931 O "O4'" . DG  D 3   ? 0.8950 1.2049 0.7507 0.1194  -0.1323 -0.0544 3   DG  D "O4'" 
1932 C "C3'" . DG  D 3   ? 0.9693 1.2738 0.7704 0.1763  -0.1446 -0.0644 3   DG  D "C3'" 
1933 O "O3'" . DG  D 3   ? 0.9506 1.2288 0.7170 0.1643  -0.1898 -0.0910 3   DG  D "O3'" 
1934 C "C2'" . DG  D 3   ? 0.8813 1.1625 0.7157 0.1555  -0.1114 -0.0596 3   DG  D "C2'" 
1935 C "C1'" . DG  D 3   ? 0.8571 1.1340 0.7153 0.1135  -0.1191 -0.0619 3   DG  D "C1'" 
1936 N N9    . DG  D 3   ? 0.7037 0.9812 0.6057 0.0978  -0.0788 -0.0467 3   DG  D N9    
1937 C C8    . DG  D 3   ? 0.7079 1.0124 0.6391 0.1189  -0.0355 -0.0220 3   DG  D C8    
1938 N N7    . DG  D 3   ? 0.6355 0.9332 0.6049 0.0964  -0.0065 -0.0143 3   DG  D N7    
1939 C C5    . DG  D 3   ? 0.6389 0.9037 0.6028 0.0584  -0.0325 -0.0349 3   DG  D C5    
1940 C C6    . DG  D 3   ? 0.6140 0.8586 0.6070 0.0223  -0.0200 -0.0381 3   DG  D C6    
1941 O O6    . DG  D 3   ? 0.6145 0.8662 0.6457 0.0162  0.0174  -0.0238 3   DG  D O6    
1942 N N1    . DG  D 3   ? 0.5620 0.7755 0.5361 -0.0084 -0.0560 -0.0608 3   DG  D N1    
1943 C C2    . DG  D 3   ? 0.6686 0.8712 0.6025 -0.0052 -0.0987 -0.0785 3   DG  D C2    
1944 N N2    . DG  D 3   ? 0.8014 0.9732 0.7244 -0.0379 -0.1282 -0.0984 3   DG  D N2    
1945 N N3    . DG  D 3   ? 0.6382 0.8592 0.5449 0.0280  -0.1116 -0.0768 3   DG  D N3    
1946 C C4    . DG  D 3   ? 0.6209 0.8728 0.5439 0.0588  -0.0767 -0.0545 3   DG  D C4    
1947 P P     . DT  D 4   ? 1.2832 1.5310 1.0190 0.1792  -0.2006 -0.1074 4   DT  D P     
1948 O OP1   . DT  D 4   ? 1.3174 1.5614 1.0141 0.1846  -0.2467 -0.1271 4   DT  D OP1   
1949 O OP2   . DT  D 4   ? 1.2139 1.4733 0.9574 0.2138  -0.1613 -0.0900 4   DT  D OP2   
1950 O "O5'" . DT  D 4   ? 1.0760 1.2819 0.8260 0.1381  -0.2031 -0.1212 4   DT  D "O5'" 
1951 C "C5'" . DT  D 4   ? 1.0244 1.2186 0.7800 0.0995  -0.2292 -0.1327 4   DT  D "C5'" 
1952 C "C4'" . DT  D 4   ? 0.8884 1.0448 0.6591 0.0651  -0.2249 -0.1428 4   DT  D "C4'" 
1953 O "O4'" . DT  D 4   ? 0.7808 0.9456 0.5934 0.0541  -0.1834 -0.1243 4   DT  D "O4'" 
1954 C "C3'" . DT  D 4   ? 0.8695 0.9950 0.6215 0.0752  -0.2251 -0.1552 4   DT  D "C3'" 
1955 O "O3'" . DT  D 4   ? 0.9334 1.0195 0.6822 0.0391  -0.2463 -0.1684 4   DT  D "O3'" 
1956 C "C2'" . DT  D 4   ? 0.7744 0.8977 0.5615 0.0755  -0.1775 -0.1393 4   DT  D "C2'" 
1957 C "C1'" . DT  D 4   ? 0.8144 0.9498 0.6362 0.0459  -0.1656 -0.1291 4   DT  D "C1'" 
1958 N N1    . DT  D 4   ? 0.7759 0.9276 0.6385 0.0505  -0.1167 -0.1068 4   DT  D N1    
1959 C C2    . DT  D 4   ? 0.7616 0.8992 0.6562 0.0168  -0.1007 -0.1060 4   DT  D C2    
1960 O O2    . DT  D 4   ? 0.8167 0.9291 0.7074 -0.0162 -0.1238 -0.1218 4   DT  D O2    
1961 N N3    . DT  D 4   ? 0.6896 0.8443 0.6215 0.0238  -0.0563 -0.0857 4   DT  D N3    
1962 C C4    . DT  D 4   ? 0.6179 0.8019 0.5597 0.0600  -0.0259 -0.0655 4   DT  D C4    
1963 O O4    . DT  D 4   ? 0.5676 0.7648 0.5460 0.0628  0.0137  -0.0481 4   DT  D O4    
1964 C C5    . DT  D 4   ? 0.6576 0.8556 0.5638 0.0946  -0.0441 -0.0664 4   DT  D C5    
1965 C C7    . DT  D 4   ? 0.7237 0.9545 0.6367 0.1366  -0.0133 -0.0442 4   DT  D C7    
1966 C C6    . DT  D 4   ? 0.6443 0.8258 0.5126 0.0883  -0.0885 -0.0873 4   DT  D C6    
1967 P P     . DT  D 5   ? 1.1505 1.1975 0.8929 0.0340  -0.2411 -0.1747 5   DT  D P     
1968 O OP1   . DT  D 5   ? 1.0874 1.1187 0.8297 0.0102  -0.2510 -0.1718 5   DT  D OP1   
1969 O OP2   . DT  D 5   ? 1.1933 1.2504 0.9154 0.0784  -0.2327 -0.1781 5   DT  D OP2   
1970 O "O5'" . DT  D 5   ? 0.8950 0.9208 0.6608 0.0026  -0.2273 -0.1786 5   DT  D "O5'" 
1971 C "C5'" . DT  D 5   ? 0.6280 0.6558 0.4158 -0.0330 -0.2267 -0.1735 5   DT  D "C5'" 
1972 C "C4'" . DT  D 5   ? 0.6981 0.7063 0.5083 -0.0563 -0.2087 -0.1770 5   DT  D "C4'" 
1973 O "O4'" . DT  D 5   ? 0.6481 0.6763 0.4803 -0.0409 -0.1844 -0.1723 5   DT  D "O4'" 
1974 C "C3'" . DT  D 5   ? 0.8549 0.8349 0.6615 -0.0573 -0.1970 -0.1803 5   DT  D "C3'" 
1975 O "O3'" . DT  D 5   ? 0.8865 0.8598 0.7165 -0.0926 -0.1798 -0.1767 5   DT  D "O3'" 
1976 C "C2'" . DT  D 5   ? 0.7934 0.7735 0.6002 -0.0285 -0.1861 -0.1922 5   DT  D "C2'" 
1977 C "C1'" . DT  D 5   ? 0.7554 0.7635 0.5992 -0.0381 -0.1587 -0.1728 5   DT  D "C1'" 
1978 N N1    . DT  D 5   ? 0.7176 0.7530 0.5832 -0.0078 -0.1170 -0.1508 5   DT  D N1    
1979 C C2    . DT  D 5   ? 0.7090 0.7505 0.6157 -0.0190 -0.0791 -0.1373 5   DT  D C2    
1980 O O2    . DT  D 5   ? 0.7220 0.7469 0.6470 -0.0522 -0.0778 -0.1432 5   DT  D O2    
1981 N N3    . DT  D 5   ? 0.6642 0.7325 0.5906 0.0109  -0.0422 -0.1166 5   DT  D N3    
1982 C C4    . DT  D 5   ? 0.5837 0.6735 0.4920 0.0505  -0.0393 -0.1075 5   DT  D C4    
1983 O O4    . DT  D 5   ? 0.5944 0.7077 0.5236 0.0755  -0.0041 -0.0878 5   DT  D O4    
1984 C C5    . DT  D 5   ? 0.5608 0.6436 0.4243 0.0605  -0.0807 -0.1229 5   DT  D C5    
1985 C C7    . DT  D 5   ? 0.5847 0.6900 0.4240 0.1035  -0.0817 -0.1154 5   DT  D C7    
1986 C C6    . DT  D 5   ? 0.5764 0.6326 0.4216 0.0310  -0.1172 -0.1438 5   DT  D C6    
1987 P P     . DT  D 6   ? 0.8640 0.8182 0.7011 -0.0983 -0.1616 -0.1790 6   DT  D P     
1988 O OP1   . DT  D 6   ? 0.9152 0.8880 0.7776 -0.1166 -0.1486 -0.1778 6   DT  D OP1   
1989 O OP2   . DT  D 6   ? 0.8612 0.7998 0.6739 -0.0703 -0.1708 -0.1823 6   DT  D OP2   
1990 O "O5'" . DT  D 6   ? 0.8090 0.7489 0.6635 -0.1055 -0.1442 -0.1811 6   DT  D "O5'" 
1991 C "C5'" . DT  D 6   ? 0.5715 0.5269 0.4573 -0.1231 -0.1328 -0.1767 6   DT  D "C5'" 
1992 C "C4'" . DT  D 6   ? 0.6105 0.5220 0.5097 -0.1191 -0.1303 -0.1692 6   DT  D "C4'" 
1993 O "O4'" . DT  D 6   ? 0.5934 0.5416 0.5031 -0.1012 -0.1071 -0.1815 6   DT  D "O4'" 
1994 C "C3'" . DT  D 6   ? 0.6791 0.5605 0.5821 -0.1118 -0.1210 -0.1611 6   DT  D "C3'" 
1995 O "O3'" . DT  D 6   ? 0.7245 0.6123 0.6751 -0.1181 -0.1087 -0.1542 6   DT  D "O3'" 
1996 C "C2'" . DT  D 6   ? 0.6522 0.5457 0.5535 -0.1025 -0.0976 -0.1868 6   DT  D "C2'" 
1997 C "C1'" . DT  D 6   ? 0.6343 0.5711 0.5617 -0.0922 -0.0761 -0.1791 6   DT  D "C1'" 
1998 N N1    . DT  D 6   ? 0.5138 0.4719 0.4381 -0.0500 -0.0555 -0.1653 6   DT  D N1    
1999 C C2    . DT  D 6   ? 0.5286 0.5091 0.4889 -0.0360 -0.0122 -0.1453 6   DT  D C2    
2000 O O2    . DT  D 6   ? 0.6272 0.6098 0.6223 -0.0562 0.0108  -0.1394 6   DT  D O2    
2001 N N3    . DT  D 6   ? 0.5281 0.5282 0.4827 0.0036  0.0039  -0.1326 6   DT  D N3    
2002 C C4    . DT  D 6   ? 0.5847 0.5856 0.5005 0.0303  -0.0191 -0.1380 6   DT  D C4    
2003 O O4    . DT  D 6   ? 0.7475 0.7679 0.6607 0.0662  -0.0014 -0.1249 6   DT  D O4    
2004 C C5    . DT  D 6   ? 0.5281 0.5052 0.4075 0.0133  -0.0650 -0.1601 6   DT  D C5    
2005 C C7    . DT  D 6   ? 0.5607 0.5361 0.3969 0.0395  -0.0936 -0.1690 6   DT  D C7    
2006 C C6    . DT  D 6   ? 0.5330 0.4900 0.4189 -0.0257 -0.0806 -0.1722 6   DT  D C6    
2007 P P     . DC  D 7   ? 0.6090 0.6038 0.6367 -0.0118 0.0105  -0.0557 7   DC  D P     
2008 O OP1   . DC  D 7   ? 0.6513 0.6153 0.6455 -0.0247 0.0063  -0.0500 7   DC  D OP1   
2009 O OP2   . DC  D 7   ? 0.5635 0.5793 0.6353 -0.0021 0.0058  -0.0535 7   DC  D OP2   
2010 O "O5'" . DC  D 7   ? 0.6586 0.6614 0.6745 -0.0208 0.0054  -0.0468 7   DC  D "O5'" 
2011 C "C5'" . DC  D 7   ? 0.5674 0.5535 0.5432 -0.0298 0.0091  -0.0483 7   DC  D "C5'" 
2012 C "C4'" . DC  D 7   ? 0.5886 0.5898 0.5630 -0.0341 0.0062  -0.0425 7   DC  D "C4'" 
2013 O "O4'" . DC  D 7   ? 0.5529 0.5776 0.5468 -0.0199 0.0170  -0.0551 7   DC  D "O4'" 
2014 C "C3'" . DC  D 7   ? 0.5620 0.5761 0.5586 -0.0401 -0.0079 -0.0262 7   DC  D "C3'" 
2015 O "O3'" . DC  D 7   ? 0.6236 0.6163 0.5890 -0.0577 -0.0182 -0.0128 7   DC  D "O3'" 
2016 C "C2'" . DC  D 7   ? 0.5794 0.6221 0.5951 -0.0334 -0.0045 -0.0286 7   DC  D "C2'" 
2017 C "C1'" . DC  D 7   ? 0.5144 0.5581 0.5189 -0.0229 0.0117  -0.0470 7   DC  D "C1'" 
2018 N N1    . DC  D 7   ? 0.3828 0.4556 0.4206 -0.0062 0.0207  -0.0579 7   DC  D N1    
2019 C C2    . DC  D 7   ? 0.4549 0.5382 0.4835 -0.0027 0.0293  -0.0657 7   DC  D C2    
2020 O O2    . DC  D 7   ? 0.4683 0.5372 0.4627 -0.0135 0.0288  -0.0627 7   DC  D O2    
2021 N N3    . DC  D 7   ? 0.3538 0.4624 0.4112 0.0126  0.0379  -0.0762 7   DC  D N3    
2022 C C4    . DC  D 7   ? 0.4943 0.6173 0.5880 0.0241  0.0380  -0.0793 7   DC  D C4    
2023 N N4    . DC  D 7   ? 0.4885 0.6361 0.6090 0.0389  0.0465  -0.0897 7   DC  D N4    
2024 C C5    . DC  D 7   ? 0.3504 0.4631 0.4545 0.0208  0.0290  -0.0715 7   DC  D C5    
2025 C C6    . DC  D 7   ? 0.3926 0.4800 0.4675 0.0056  0.0209  -0.0613 7   DC  D C6    
2026 P P     . DA  D 8   ? 0.6203 0.6167 0.5970 -0.0689 -0.0352 0.0067  8   DA  D P     
2027 O OP1   . DA  D 8   ? 0.4926 0.4588 0.4323 -0.0850 -0.0429 0.0163  8   DA  D OP1   
2028 O OP2   . DA  D 8   ? 0.5105 0.5260 0.5307 -0.0593 -0.0392 0.0085  8   DA  D OP2   
2029 O "O5'" . DA  D 8   ? 0.4914 0.5049 0.4669 -0.0720 -0.0361 0.0105  8   DA  D "O5'" 
2030 C "C5'" . DA  D 8   ? 0.5111 0.5105 0.4483 -0.0800 -0.0321 0.0084  8   DA  D "C5'" 
2031 C "C4'" . DA  D 8   ? 0.5734 0.5928 0.5151 -0.0807 -0.0320 0.0108  8   DA  D "C4'" 
2032 O "O4'" . DA  D 8   ? 0.5160 0.5597 0.4829 -0.0645 -0.0201 -0.0028 8   DA  D "O4'" 
2033 C "C3'" . DA  D 8   ? 0.5492 0.5835 0.5120 -0.0874 -0.0457 0.0270  8   DA  D "C3'" 
2034 O "O3'" . DA  D 8   ? 0.4742 0.5120 0.4199 -0.0950 -0.0470 0.0313  8   DA  D "O3'" 
2035 C "C2'" . DA  D 8   ? 0.4486 0.5131 0.4573 -0.0717 -0.0415 0.0210  8   DA  D "C2'" 
2036 C "C1'" . DA  D 8   ? 0.4341 0.5051 0.4355 -0.0611 -0.0257 0.0041  8   DA  D "C1'" 
2037 N N9    . DA  D 8   ? 0.4127 0.5060 0.4495 -0.0435 -0.0168 -0.0077 8   DA  D N9    
2038 C C8    . DA  D 8   ? 0.4634 0.5665 0.5340 -0.0353 -0.0197 -0.0073 8   DA  D C8    
2039 N N7    . DA  D 8   ? 0.3853 0.5090 0.4833 -0.0190 -0.0098 -0.0199 8   DA  D N7    
2040 C C5    . DA  D 8   ? 0.5750 0.7022 0.6552 -0.0167 0.0006  -0.0291 8   DA  D C5    
2041 C C6    . DA  D 8   ? 0.5084 0.6537 0.6013 -0.0024 0.0137  -0.0438 8   DA  D C6    
2042 N N6    . DA  D 8   ? 0.4727 0.6369 0.6010 0.0131  0.0190  -0.0525 8   DA  D N6    
2043 N N1    . DA  D 8   ? 0.4475 0.5905 0.5152 -0.0046 0.0210  -0.0494 8   DA  D N1    
2044 C C2    . DA  D 8   ? 0.4431 0.5671 0.4756 -0.0200 0.0154  -0.0408 8   DA  D C2    
2045 N N3    . DA  D 8   ? 0.4067 0.5127 0.4239 -0.0342 0.0032  -0.0269 8   DA  D N3    
2046 C C4    . DA  D 8   ? 0.5681 0.6768 0.6108 -0.0317 -0.0037 -0.0217 8   DA  D C4    
2047 P P     . DA  D 9   ? 0.6088 0.6569 0.5636 -0.1062 -0.0616 0.0492  9   DA  D P     
2048 O OP1   . DA  D 9   ? 0.5072 0.5272 0.4287 -0.1230 -0.0724 0.0612  9   DA  D OP1   
2049 O OP2   . DA  D 9   ? 0.6225 0.6968 0.6234 -0.0976 -0.0658 0.0528  9   DA  D OP2   
2050 O "O5'" . DA  D 9   ? 0.6019 0.6621 0.5459 -0.1067 -0.0556 0.0458  9   DA  D "O5'" 
2051 C "C5'" . DA  D 9   ? 0.4767 0.5236 0.3888 -0.1056 -0.0443 0.0338  9   DA  D "C5'" 
2052 C "C4'" . DA  D 9   ? 0.4649 0.5359 0.3906 -0.0952 -0.0338 0.0239  9   DA  D "C4'" 
2053 O "O4'" . DA  D 9   ? 0.5652 0.6542 0.5247 -0.0782 -0.0250 0.0124  9   DA  D "O4'" 
2054 C "C3'" . DA  D 9   ? 0.6294 0.7229 0.5726 -0.0995 -0.0410 0.0348  9   DA  D "C3'" 
2055 O "O3'" . DA  D 9   ? 0.6922 0.7895 0.6168 -0.1005 -0.0342 0.0297  9   DA  D "O3'" 
2056 C "C2'" . DA  D 9   ? 0.4368 0.5600 0.4281 -0.0852 -0.0386 0.0315  9   DA  D "C2'" 
2057 C "C1'" . DA  D 9   ? 0.4664 0.5868 0.4595 -0.0711 -0.0246 0.0137  9   DA  D "C1'" 
2058 N N9    . DA  D 9   ? 0.4982 0.6346 0.5307 -0.0585 -0.0236 0.0101  9   DA  D N9    
2059 C C8    . DA  D 9   ? 0.5013 0.6351 0.5518 -0.0611 -0.0342 0.0197  9   DA  D C8    
2060 N N7    . DA  D 9   ? 0.5044 0.6554 0.5908 -0.0473 -0.0306 0.0132  9   DA  D N7    
2061 C C5    . DA  D 9   ? 0.4619 0.6280 0.5540 -0.0348 -0.0166 -0.0015 9   DA  D C5    
2062 C C6    . DA  D 9   ? 0.4684 0.6558 0.5923 -0.0172 -0.0068 -0.0142 9   DA  D C6    
2063 N N6    . DA  D 9   ? 0.3565 0.5546 0.5142 -0.0088 -0.0098 -0.0140 9   DA  D N6    
2064 N N1    . DA  D 9   ? 0.5700 0.7673 0.6894 -0.0085 0.0062  -0.0272 9   DA  D N1    
2065 C C2    . DA  D 9   ? 0.3776 0.5642 0.4632 -0.0169 0.0090  -0.0274 9   DA  D C2    
2066 N N3    . DA  D 9   ? 0.4635 0.6302 0.5175 -0.0332 0.0006  -0.0164 9   DA  D N3    
2067 C C4    . DA  D 9   ? 0.4752 0.6324 0.5344 -0.0416 -0.0121 -0.0036 9   DA  D C4    
2068 P P     . DA  D 10  ? 0.6920 0.8089 0.6252 -0.1071 -0.0406 0.0405  10  DA  D P     
2069 O OP1   . DA  D 10  ? 0.7040 0.8015 0.5949 -0.1190 -0.0412 0.0424  10  DA  D OP1   
2070 O OP2   . DA  D 10  ? 0.6563 0.7839 0.6164 -0.1119 -0.0541 0.0555  10  DA  D OP2   
2071 O "O5'" . DA  D 10  ? 0.6157 0.7630 0.5784 -0.0910 -0.0284 0.0285  10  DA  D "O5'" 
2072 C "C5'" . DA  D 10  ? 0.5599 0.7046 0.5074 -0.0825 -0.0141 0.0124  10  DA  D "C5'" 
2073 C "C4'" . DA  D 10  ? 0.5116 0.6876 0.4933 -0.0672 -0.0046 0.0032  10  DA  D "C4'" 
2074 O "O4'" . DA  D 10  ? 0.5123 0.6994 0.5286 -0.0555 -0.0035 -0.0007 10  DA  D "O4'" 
2075 C "C3'" . DA  D 10  ? 0.3949 0.5964 0.3966 -0.0703 -0.0098 0.0130  10  DA  D "C3'" 
2076 O "O3'" . DA  D 10  ? 0.5470 0.7665 0.5538 -0.0609 0.0021  0.0020  10  DA  D "O3'" 
2077 C "C2'" . DA  D 10  ? 0.4311 0.6521 0.4756 -0.0642 -0.0160 0.0188  10  DA  D "C2'" 
2078 C "C1'" . DA  D 10  ? 0.3837 0.6014 0.4391 -0.0501 -0.0066 0.0046  10  DA  D "C1'" 
2079 N N9    . DA  D 10  ? 0.4267 0.6468 0.5089 -0.0475 -0.0142 0.0101  10  DA  D N9    
2080 C C8    . DA  D 10  ? 0.5153 0.7198 0.5910 -0.0597 -0.0278 0.0241  10  DA  D C8    
2081 N N7    . DA  D 10  ? 0.5036 0.7136 0.6076 -0.0540 -0.0323 0.0262  10  DA  D N7    
2082 C C5    . DA  D 10  ? 0.5005 0.7310 0.6314 -0.0368 -0.0208 0.0124  10  DA  D C5    
2083 C C6    . DA  D 10  ? 0.4412 0.6861 0.6088 -0.0234 -0.0190 0.0072  10  DA  D C6    
2084 N N6    . DA  D 10  ? 0.3615 0.6021 0.5452 -0.0259 -0.0295 0.0159  10  DA  D N6    
2085 N N1    . DA  D 10  ? 0.3360 0.6000 0.5229 -0.0074 -0.0063 -0.0074 10  DA  D N1    
2086 C C2    . DA  D 10  ? 0.3833 0.6516 0.5538 -0.0053 0.0038  -0.0157 10  DA  D C2    
2087 N N3    . DA  D 10  ? 0.3414 0.5970 0.4775 -0.0170 0.0033  -0.0119 10  DA  D N3    
2088 C C4    . DA  D 10  ? 0.3601 0.5972 0.4780 -0.0325 -0.0094 0.0023  10  DA  D C4    
2089 P P     . DC  D 11  ? 0.4765 0.7221 0.4984 -0.0636 -0.0003 0.0096  11  DC  D P     
2090 O OP1   . DC  D 11  ? 0.6278 0.8756 0.6311 -0.0598 0.0113  -0.0014 11  DC  D OP1   
2091 O OP2   . DC  D 11  ? 0.4959 0.7339 0.5096 -0.0801 -0.0157 0.0279  11  DC  D OP2   
2092 O "O5'" . DC  D 11  ? 0.4192 0.6965 0.4909 -0.0496 0.0018  0.0074  11  DC  D "O5'" 
2093 C "C5'" . DC  D 11  ? 0.3970 0.6827 0.4847 -0.0328 0.0143  -0.0087 11  DC  D "C5'" 
2094 C "C4'" . DC  D 11  ? 0.4799 0.7912 0.6146 -0.0217 0.0127  -0.0079 11  DC  D "C4'" 
2095 O "O4'" . DC  D 11  ? 0.4236 0.7226 0.5659 -0.0258 0.0024  0.0000  11  DC  D "O4'" 
2096 C "C3'" . DC  D 11  ? 0.4902 0.8309 0.6527 -0.0231 0.0077  0.0018  11  DC  D "C3'" 
2097 O "O3'" . DC  D 11  ? 0.4536 0.8193 0.6371 -0.0087 0.0198  -0.0100 11  DC  D "O3'" 
2098 C "C2'" . DC  D 11  ? 0.4095 0.7571 0.6032 -0.0234 -0.0038 0.0122  11  DC  D "C2'" 
2099 C "C1'" . DC  D 11  ? 0.3950 0.7203 0.5803 -0.0189 -0.0018 0.0046  11  DC  D "C1'" 
2100 N N1    . DC  D 11  ? 0.4485 0.7617 0.6409 -0.0261 -0.0153 0.0164  11  DC  D N1    
2101 C C2    . DC  D 11  ? 0.4928 0.8161 0.7190 -0.0150 -0.0160 0.0134  11  DC  D C2    
2102 O O2    . DC  D 11  ? 0.5438 0.8870 0.7947 0.0004  -0.0059 0.0015  11  DC  D O2    
2103 N N3    . DC  D 11  ? 0.5285 0.8398 0.7599 -0.0216 -0.0281 0.0238  11  DC  D N3    
2104 C C4    . DC  D 11  ? 0.6428 0.9328 0.8469 -0.0383 -0.0389 0.0366  11  DC  D C4    
2105 N N4    . DC  D 11  ? 0.6412 0.9196 0.8513 -0.0443 -0.0509 0.0467  11  DC  D N4    
2106 C C5    . DC  D 11  ? 0.6248 0.9038 0.7938 -0.0496 -0.0382 0.0396  11  DC  D C5    
2107 C C6    . DC  D 11  ? 0.3574 0.6483 0.5218 -0.0430 -0.0263 0.0293  11  DC  D C6    
2108 P P     . DT  D 12  ? 0.6166 1.0154 0.8265 -0.0079 0.0188  -0.0036 12  DT  D P     
2109 O OP1   . DT  D 12  ? 0.6254 1.0351 0.8287 0.0005  0.0327  -0.0163 12  DT  D OP1   
2110 O OP2   . DT  D 12  ? 0.4560 0.8489 0.6547 -0.0254 0.0050  0.0144  12  DT  D OP2   
2111 O "O5'" . DT  D 12  ? 0.5250 0.9479 0.7830 0.0046  0.0173  -0.0041 12  DT  D "O5'" 
2112 C "C5'" . DT  D 12  ? 0.5333 0.9552 0.8046 0.0195  0.0255  -0.0179 12  DT  D "C5'" 
2113 C "C4'" . DT  D 12  ? 0.5789 1.0183 0.8924 0.0270  0.0194  -0.0140 12  DT  D "C4'" 
2114 O "O4'" . DT  D 12  ? 0.5685 0.9869 0.8753 0.0169  0.0066  -0.0032 12  DT  D "O4'" 
2115 C "C3'" . DT  D 12  ? 0.5636 1.0345 0.9093 0.0270  0.0146  -0.0049 12  DT  D "C3'" 
2116 O "O3'" . DT  D 12  ? 0.6656 1.1628 1.0497 0.0442  0.0217  -0.0143 12  DT  D "O3'" 
2117 C "C2'" . DT  D 12  ? 0.4471 0.9107 0.7991 0.0146  -0.0022 0.0123  12  DT  D "C2'" 
2118 C "C1'" . DT  D 12  ? 0.4074 0.8450 0.7484 0.0160  -0.0038 0.0082  12  DT  D "C1'" 
2119 N N1    . DT  D 12  ? 0.3796 0.7956 0.7061 0.0009  -0.0185 0.0229  12  DT  D N1    
2120 C C2    . DT  D 12  ? 0.4265 0.8384 0.7728 0.0032  -0.0263 0.0266  12  DT  D C2    
2121 O O2    . DT  D 12  ? 0.5544 0.9802 0.9308 0.0174  -0.0219 0.0185  12  DT  D O2    
2122 N N3    . DT  D 12  ? 0.3848 0.7752 0.7141 -0.0116 -0.0396 0.0403  12  DT  D N3    
2123 C C4    . DT  D 12  ? 0.4451 0.8177 0.7402 -0.0282 -0.0460 0.0504  12  DT  D C4    
2124 O O4    . DT  D 12  ? 0.3799 0.7333 0.6618 -0.0408 -0.0584 0.0625  12  DT  D O4    
2125 C C5    . DT  D 12  ? 0.4254 0.8035 0.7015 -0.0298 -0.0374 0.0457  12  DT  D C5    
2126 C C7    . DT  D 12  ? 0.4917 0.8519 0.7306 -0.0471 -0.0435 0.0557  12  DT  D C7    
2127 C C6    . DT  D 12  ? 0.3374 0.7365 0.6297 -0.0154 -0.0241 0.0324  12  DT  D C6    
2128 P P     . DC  D 13  ? 0.9476 1.4821 1.3698 0.0482  0.0198  -0.0083 13  DC  D P     
2129 O OP1   . DC  D 13  ? 1.0266 1.5834 1.4689 0.0658  0.0340  -0.0237 13  DC  D OP1   
2130 O OP2   . DC  D 13  ? 0.8247 1.3592 1.2294 0.0325  0.0132  0.0048  13  DC  D OP2   
2131 O "O5'" . DC  D 13  ? 0.8558 1.3969 1.3113 0.0491  0.0077  0.0008  13  DC  D "O5'" 
2132 C "C5'" . DC  D 13  ? 0.8164 1.3518 1.2872 0.0605  0.0094  -0.0077 13  DC  D "C5'" 
2133 C "C4'" . DC  D 13  ? 0.7576 1.2947 1.2530 0.0569  -0.0049 0.0044  13  DC  D "C4'" 
2134 O "O4'" . DC  D 13  ? 0.7794 1.2864 1.2444 0.0402  -0.0161 0.0160  13  DC  D "O4'" 
2135 C "C3'" . DC  D 13  ? 0.7867 1.3538 1.3144 0.0553  -0.0119 0.0152  13  DC  D "C3'" 
2136 O "O3'" . DC  D 13  ? 0.7927 1.3806 1.3636 0.0685  -0.0133 0.0123  13  DC  D "O3'" 
2137 C "C2'" . DC  D 13  ? 0.8580 1.4092 1.3698 0.0363  -0.0275 0.0334  13  DC  D "C2'" 
2138 C "C1'" . DC  D 13  ? 0.8136 1.3292 1.2969 0.0312  -0.0305 0.0322  13  DC  D "C1'" 
2139 N N1    . DC  D 13  ? 0.6505 1.1402 1.0978 0.0114  -0.0410 0.0457  13  DC  D N1    
2140 C C2    . DC  D 13  ? 0.5185 0.9890 0.9626 0.0024  -0.0544 0.0565  13  DC  D C2    
2141 O O2    . DC  D 13  ? 0.5294 1.0043 1.0002 0.0107  -0.0576 0.0549  13  DC  D O2    
2142 N N3    . DC  D 13  ? 0.4089 0.8564 0.8204 -0.0152 -0.0638 0.0685  13  DC  D N3    
2143 C C4    . DC  D 13  ? 0.4440 0.8874 0.8274 -0.0236 -0.0603 0.0698  13  DC  D C4    
2144 N N4    . DC  D 13  ? 0.3389 0.7591 0.6906 -0.0407 -0.0699 0.0815  13  DC  D N4    
2145 C C5    . DC  D 13  ? 0.4793 0.9419 0.8656 -0.0148 -0.0467 0.0590  13  DC  D C5    
2146 C C6    . DC  D 13  ? 0.5717 1.0568 0.9898 0.0024  -0.0375 0.0473  13  DC  D C6    
2147 O "O5'" . DG  E 1   ? 0.9257 1.4513 1.1346 -0.1587 -0.1614 0.4637  1   DG  H "O5'" 
2148 C "C5'" . DG  E 1   ? 0.9027 1.5023 1.1134 -0.1680 -0.1479 0.4914  1   DG  H "C5'" 
2149 C "C4'" . DG  E 1   ? 0.8957 1.5037 1.0990 -0.1596 -0.1059 0.4502  1   DG  H "C4'" 
2150 O "O4'" . DG  E 1   ? 0.8410 1.4397 1.0824 -0.1298 -0.0685 0.4314  1   DG  H "O4'" 
2151 C "C3'" . DG  E 1   ? 0.9983 1.5652 1.1582 -0.1657 -0.1166 0.4167  1   DG  H "C3'" 
2152 O "O3'" . DG  E 1   ? 1.1412 1.7391 1.2823 -0.1750 -0.0902 0.3937  1   DG  H "O3'" 
2153 C "C2'" . DG  E 1   ? 0.8971 1.4164 1.0734 -0.1379 -0.0997 0.3885  1   DG  H "C2'" 
2154 C "C1'" . DG  E 1   ? 0.8431 1.3953 1.0680 -0.1172 -0.0582 0.3911  1   DG  H "C1'" 
2155 N N9    . DG  E 1   ? 0.7566 1.2714 1.0117 -0.0915 -0.0529 0.3871  1   DG  H N9    
2156 C C8    . DG  E 1   ? 0.6713 1.1469 0.9284 -0.0893 -0.0889 0.4062  1   DG  H C8    
2157 N N7    . DG  E 1   ? 0.6080 1.0561 0.8946 -0.0644 -0.0741 0.3970  1   DG  H N7    
2158 C C5    . DG  E 1   ? 0.6066 1.0763 0.9123 -0.0487 -0.0252 0.3699  1   DG  H C5    
2159 C C6    . DG  E 1   ? 0.5606 1.0162 0.9005 -0.0201 0.0094  0.3498  1   DG  H C6    
2160 O O6    . DG  E 1   ? 0.4871 0.9075 0.8474 -0.0030 0.0032  0.3526  1   DG  H O6    
2161 N N1    . DG  E 1   ? 0.6218 1.1090 0.9717 -0.0122 0.0551  0.3244  1   DG  H N1    
2162 C C2    . DG  E 1   ? 0.7471 1.2750 1.0761 -0.0301 0.0659  0.3193  1   DG  H C2    
2163 N N2    . DG  E 1   ? 0.8711 1.4255 1.2143 -0.0190 0.1120  0.2934  1   DG  H N2    
2164 N N3    . DG  E 1   ? 0.6949 1.2369 0.9916 -0.0572 0.0336  0.3384  1   DG  H N3    
2165 C C4    . DG  E 1   ? 0.6892 1.2000 0.9759 -0.0649 -0.0113 0.3631  1   DG  H C4    
2166 P P     . DA  E 2   ? 0.9801 1.5440 1.0795 -0.1788 -0.0881 0.3521  2   DA  H P     
2167 O OP1   . DA  E 2   ? 0.9440 1.5500 1.0172 -0.2015 -0.0822 0.3499  2   DA  H OP1   
2168 O OP2   . DA  E 2   ? 0.9291 1.4346 1.0044 -0.1811 -0.1284 0.3506  2   DA  H OP2   
2169 O "O5'" . DA  E 2   ? 1.0445 1.5992 1.1690 -0.1502 -0.0385 0.3141  2   DA  H "O5'" 
2170 C "C5'" . DA  E 2   ? 0.9492 1.5531 1.0969 -0.1438 0.0063  0.3058  2   DA  H "C5'" 
2171 C "C4'" . DA  E 2   ? 0.8546 1.4385 1.0205 -0.1168 0.0481  0.2665  2   DA  H "C4'" 
2172 O "O4'" . DA  E 2   ? 0.7791 1.3302 0.9772 -0.0939 0.0461  0.2727  2   DA  H "O4'" 
2173 C "C3'" . DA  E 2   ? 0.8568 1.4011 0.9853 -0.1174 0.0492  0.2261  2   DA  H "C3'" 
2174 O "O3'" . DA  E 2   ? 0.8121 1.3754 0.9467 -0.1068 0.0961  0.1923  2   DA  H "O3'" 
2175 C "C2'" . DA  E 2   ? 0.8149 1.2982 0.9499 -0.0991 0.0337  0.2179  2   DA  H "C2'" 
2176 C "C1'" . DA  E 2   ? 0.7603 1.2575 0.9464 -0.0790 0.0503  0.2377  2   DA  H "C1'" 
2177 N N9    . DA  E 2   ? 0.6342 1.0876 0.8310 -0.0697 0.0204  0.2539  2   DA  H N9    
2178 C C8    . DA  E 2   ? 0.5807 1.0145 0.7578 -0.0861 -0.0283 0.2811  2   DA  H C8    
2179 N N7    . DA  E 2   ? 0.5014 0.8971 0.6950 -0.0727 -0.0457 0.2908  2   DA  H N7    
2180 C C5    . DA  E 2   ? 0.5069 0.8967 0.7334 -0.0457 -0.0060 0.2691  2   DA  H C5    
2181 C C6    . DA  E 2   ? 0.4605 0.8159 0.7166 -0.0216 -0.0008 0.2663  2   DA  H C6    
2182 N N6    . DA  E 2   ? 0.4633 0.7834 0.7203 -0.0214 -0.0372 0.2868  2   DA  H N6    
2183 N N1    . DA  E 2   ? 0.4601 0.8191 0.7448 0.0019  0.0433  0.2420  2   DA  H N1    
2184 C C2    . DA  E 2   ? 0.4839 0.8787 0.7679 0.0015  0.0800  0.2214  2   DA  H C2    
2185 N N3    . DA  E 2   ? 0.6033 1.0329 0.8610 -0.0199 0.0798  0.2213  2   DA  H N3    
2186 C C4    . DA  E 2   ? 0.5622 0.9872 0.7915 -0.0432 0.0351  0.2461  2   DA  H C4    
2187 P P     . DG  E 3   ? 1.0170 1.5465 1.1162 -0.1058 0.1066  0.1466  3   DG  H P     
2188 O OP1   . DG  E 3   ? 1.0086 1.5801 1.1078 -0.1072 0.1483  0.1245  3   DG  H OP1   
2189 O OP2   . DG  E 3   ? 1.0125 1.5076 1.0688 -0.1251 0.0604  0.1512  3   DG  H OP2   
2190 O "O5'" . DG  E 3   ? 1.0203 1.5033 1.1434 -0.0753 0.1239  0.1231  3   DG  H "O5'" 
2191 C "C5'" . DG  E 3   ? 0.9534 1.4559 1.1203 -0.0522 0.1653  0.1167  3   DG  H "C5'" 
2192 C "C4'" . DG  E 3   ? 0.8357 1.2866 1.0164 -0.0261 0.1763  0.0915  3   DG  H "C4'" 
2193 O "O4'" . DG  E 3   ? 0.7246 1.1437 0.9167 -0.0218 0.1417  0.1179  3   DG  H "O4'" 
2194 C "C3'" . DG  E 3   ? 0.7733 1.1811 0.9165 -0.0265 0.1747  0.0523  3   DG  H "C3'" 
2195 O "O3'" . DG  E 3   ? 0.7077 1.1078 0.8687 -0.0035 0.2185  0.0169  3   DG  H "O3'" 
2196 C "C2'" . DG  E 3   ? 0.7308 1.0825 0.8614 -0.0255 0.1326  0.0612  3   DG  H "C2'" 
2197 C "C1'" . DG  E 3   ? 0.7255 1.0845 0.8978 -0.0142 0.1261  0.0951  3   DG  H "C1'" 
2198 N N9    . DG  E 3   ? 0.6353 0.9692 0.7963 -0.0256 0.0767  0.1252  3   DG  H N9    
2199 C C8    . DG  E 3   ? 0.5992 0.9439 0.7296 -0.0526 0.0390  0.1484  3   DG  H C8    
2200 N N7    . DG  E 3   ? 0.5048 0.8215 0.6327 -0.0570 -0.0013 0.1733  3   DG  H N7    
2201 C C5    . DG  E 3   ? 0.5297 0.8156 0.6884 -0.0315 0.0107  0.1664  3   DG  H C5    
2202 C C6    . DG  E 3   ? 0.5844 0.8330 0.7548 -0.0241 -0.0183 0.1848  3   DG  H C6    
2203 O O6    . DG  E 3   ? 0.5707 0.8052 0.7260 -0.0390 -0.0616 0.2111  3   DG  H O6    
2204 N N1    . DG  E 3   ? 0.7440 0.9705 0.9471 0.0036  0.0075  0.1697  3   DG  H N1    
2205 C C2    . DG  E 3   ? 0.6828 0.9218 0.9051 0.0219  0.0556  0.1403  3   DG  H C2    
2206 N N2    . DG  E 3   ? 0.5399 0.7526 0.7932 0.0477  0.0740  0.1295  3   DG  H N2    
2207 N N3    . DG  E 3   ? 0.4900 0.7646 0.7018 0.0152  0.0835  0.1227  3   DG  H N3    
2208 C C4    . DG  E 3   ? 0.5097 0.8059 0.6894 -0.0118 0.0586  0.1372  3   DG  H C4    
2209 P P     . DT  E 4   ? 0.7767 1.1255 0.9102 0.0050  0.2246  -0.0275 4   DT  H P     
2210 O OP1   . DT  E 4   ? 0.8308 1.1977 0.9782 0.0200  0.2760  -0.0612 4   DT  H OP1   
2211 O OP2   . DT  E 4   ? 0.6438 0.9741 0.7282 -0.0188 0.1881  -0.0290 4   DT  H OP2   
2212 O "O5'" . DT  E 4   ? 0.7553 1.0542 0.9114 0.0271  0.2142  -0.0259 4   DT  H "O5'" 
2213 C "C5'" . DT  E 4   ? 0.5975 0.9093 0.8018 0.0486  0.2389  -0.0161 4   DT  H "C5'" 
2214 C "C4'" . DT  E 4   ? 0.5847 0.8431 0.8037 0.0683  0.2277  -0.0197 4   DT  H "C4'" 
2215 O "O4'" . DT  E 4   ? 0.5524 0.7918 0.7630 0.0564  0.1795  0.0137  4   DT  H "O4'" 
2216 C "C3'" . DT  E 4   ? 0.6480 0.8548 0.8428 0.0778  0.2327  -0.0611 4   DT  H "C3'" 
2217 O "O3'" . DT  E 4   ? 0.7586 0.9425 0.9866 0.1053  0.2577  -0.0755 4   DT  H "O3'" 
2218 C "C2'" . DT  E 4   ? 0.5878 0.7535 0.7512 0.0636  0.1815  -0.0485 4   DT  H "C2'" 
2219 C "C1'" . DT  E 4   ? 0.6122 0.7917 0.8030 0.0620  0.1583  -0.0038 4   DT  H "C1'" 
2220 N N1    . DT  E 4   ? 0.7060 0.8708 0.8692 0.0402  0.1063  0.0233  4   DT  H N1    
2221 C C2    . DT  E 4   ? 0.6541 0.7849 0.8284 0.0459  0.0763  0.0438  4   DT  H C2    
2222 O O2    . DT  E 4   ? 0.6150 0.7258 0.8204 0.0680  0.0897  0.0408  4   DT  H O2    
2223 N N3    . DT  E 4   ? 0.5983 0.7192 0.7457 0.0244  0.0295  0.0680  4   DT  H N3    
2224 C C4    . DT  E 4   ? 0.5462 0.6874 0.6578 -0.0018 0.0098  0.0742  4   DT  H C4    
2225 O O4    . DT  E 4   ? 0.5482 0.6781 0.6382 -0.0197 -0.0328 0.0967  4   DT  H O4    
2226 C C5    . DT  E 4   ? 0.6006 0.7771 0.7021 -0.0066 0.0429  0.0522  4   DT  H C5    
2227 C C7    . DT  E 4   ? 0.6168 0.8175 0.6798 -0.0346 0.0253  0.0568  4   DT  H C7    
2228 C C6    . DT  E 4   ? 0.6822 0.8693 0.8097 0.0143  0.0891  0.0283  4   DT  H C6    
2229 P P     . DT  E 5   ? 0.7500 0.8771 0.9639 0.1214  0.2669  -0.1171 5   DT  H P     
2230 O OP1   . DT  E 5   ? 0.6306 0.7592 0.8568 0.1378  0.2777  -0.1208 5   DT  H OP1   
2231 O OP2   . DT  E 5   ? 0.7975 0.9141 0.9648 0.1056  0.2608  -0.1435 5   DT  H OP2   
2232 O "O5'" . DT  E 5   ? 0.5257 0.6041 0.7386 0.1240  0.2258  -0.0994 5   DT  H "O5'" 
2233 C "C5'" . DT  E 5   ? 0.4531 0.5313 0.7065 0.1388  0.2253  -0.0748 5   DT  H "C5'" 
2234 C "C4'" . DT  E 5   ? 0.4537 0.4797 0.6991 0.1405  0.1868  -0.0651 5   DT  H "C4'" 
2235 O "O4'" . DT  E 5   ? 0.4638 0.4907 0.6787 0.1149  0.1416  -0.0400 5   DT  H "O4'" 
2236 C "C3'" . DT  E 5   ? 0.5245 0.4973 0.7385 0.1463  0.1803  -0.1001 5   DT  H "C3'" 
2237 O "O3'" . DT  E 5   ? 0.5348 0.4842 0.7447 0.1511  0.1575  -0.0884 5   DT  H "O3'" 
2238 C "C2'" . DT  E 5   ? 0.4319 0.3765 0.6097 0.1286  0.1447  -0.1016 5   DT  H "C2'" 
2239 C "C1'" . DT  E 5   ? 0.5411 0.5136 0.7250 0.1117  0.1123  -0.0547 5   DT  H "C1'" 
2240 N N1    . DT  E 5   ? 0.5260 0.5074 0.6691 0.0831  0.0779  -0.0430 5   DT  H N1    
2241 C C2    . DT  E 5   ? 0.6110 0.5725 0.7419 0.0701  0.0309  -0.0147 5   DT  H C2    
2242 O O2    . DT  E 5   ? 0.7017 0.6351 0.8511 0.0807  0.0153  -0.0011 5   DT  H O2    
2243 N N3    . DT  E 5   ? 0.5636 0.5385 0.6590 0.0437  0.0022  -0.0033 5   DT  H N3    
2244 C C4    . DT  E 5   ? 0.5818 0.5881 0.6535 0.0292  0.0158  -0.0166 5   DT  H C4    
2245 O O4    . DT  E 5   ? 0.6879 0.7033 0.7281 0.0056  -0.0127 -0.0049 5   DT  H O4    
2246 C C5    . DT  E 5   ? 0.5799 0.6073 0.6666 0.0438  0.0659  -0.0455 5   DT  H C5    
2247 C C7    . DT  E 5   ? 0.5604 0.6227 0.6236 0.0297  0.0848  -0.0621 5   DT  H C7    
2248 C C6    . DT  E 5   ? 0.5198 0.5345 0.6417 0.0699  0.0943  -0.0568 5   DT  H C6    
2249 P P     . DT  E 6   ? 0.5071 0.7174 0.7584 -0.0505 -0.0146 -0.2089 6   DT  H P     
2250 O OP1   . DT  E 6   ? 0.6989 0.8423 0.9282 -0.0344 0.0036  -0.2089 6   DT  H OP1   
2251 O OP2   . DT  E 6   ? 0.3781 0.6449 0.6895 -0.0694 -0.0134 -0.2258 6   DT  H OP2   
2252 O "O5'" . DT  E 6   ? 0.4231 0.6097 0.6538 -0.0395 -0.0090 -0.1776 6   DT  H "O5'" 
2253 C "C5'" . DT  E 6   ? 0.2736 0.4066 0.4464 -0.0209 -0.0091 -0.1552 6   DT  H "C5'" 
2254 C "C4'" . DT  E 6   ? 0.3943 0.5193 0.5577 -0.0146 -0.0058 -0.1283 6   DT  H "C4'" 
2255 O "O4'" . DT  E 6   ? 0.3402 0.5261 0.5051 -0.0280 -0.0314 -0.1286 6   DT  H "O4'" 
2256 C "C3'" . DT  E 6   ? 0.4509 0.5716 0.6608 -0.0156 0.0182  -0.1235 6   DT  H "C3'" 
2257 O "O3'" . DT  E 6   ? 0.4859 0.5318 0.6696 0.0048  0.0423  -0.1026 6   DT  H "O3'" 
2258 C "C2'" . DT  E 6   ? 0.2598 0.4321 0.4857 -0.0255 0.0039  -0.1139 6   DT  H "C2'" 
2259 C "C1'" . DT  E 6   ? 0.3748 0.5651 0.5530 -0.0264 -0.0249 -0.1097 6   DT  H "C1'" 
2260 N N1    . DT  E 6   ? 0.3647 0.6278 0.5596 -0.0443 -0.0503 -0.1161 6   DT  H N1    
2261 C C2    . DT  E 6   ? 0.3455 0.6130 0.5051 -0.0404 -0.0654 -0.0958 6   DT  H C2    
2262 O O2    . DT  E 6   ? 0.4626 0.6795 0.5796 -0.0234 -0.0591 -0.0727 6   DT  H O2    
2263 N N3    . DT  E 6   ? 0.3137 0.6246 0.4775 -0.0538 -0.0833 -0.0965 6   DT  H N3    
2264 C C4    . DT  E 6   ? 0.4651 0.7817 0.6445 -0.0632 -0.0809 -0.1028 6   DT  H C4    
2265 O O4    . DT  E 6   ? 0.3741 0.6875 0.5393 -0.0661 -0.0885 -0.0913 6   DT  H O4    
2266 C C5    . DT  E 6   ? 0.4583 0.7811 0.6733 -0.0674 -0.0681 -0.1247 6   DT  H C5    
2267 C C7    . DT  E 6   ? 0.5067 0.8372 0.7342 -0.0752 -0.0662 -0.1309 6   DT  H C7    
2268 C C6    . DT  E 6   ? 0.3575 0.6741 0.5956 -0.0628 -0.0574 -0.1398 6   DT  H C6    
2269 P P     . DG  E 7   ? 0.4198 0.4368 0.6432 0.0085  0.0748  -0.0982 7   DG  H P     
2270 O OP1   . DG  E 7   ? 0.4835 0.4200 0.6701 0.0282  0.0954  -0.0869 7   DG  H OP1   
2271 O OP2   . DG  E 7   ? 0.3797 0.4475 0.6668 -0.0100 0.0783  -0.1233 7   DG  H OP2   
2272 O "O5'" . DG  E 7   ? 0.3319 0.3544 0.5547 0.0120  0.0758  -0.0739 7   DG  H "O5'" 
2273 C "C5'" . DG  E 7   ? 0.4462 0.4218 0.6136 0.0294  0.0750  -0.0466 7   DG  H "C5'" 
2274 C "C4'" . DG  E 7   ? 0.3868 0.3883 0.5614 0.0277  0.0693  -0.0285 7   DG  H "C4'" 
2275 O "O4'" . DG  E 7   ? 0.3646 0.4396 0.5525 0.0106  0.0401  -0.0400 7   DG  H "O4'" 
2276 C "C3'" . DG  E 7   ? 0.4531 0.4609 0.6803 0.0244  0.0914  -0.0264 7   DG  H "C3'" 
2277 O "O3'" . DG  E 7   ? 0.5251 0.5229 0.7360 0.0328  0.0917  -0.0008 7   DG  H "O3'" 
2278 C "C2'" . DG  E 7   ? 0.3066 0.3941 0.5853 0.0021  0.0750  -0.0500 7   DG  H "C2'" 
2279 C "C1'" . DG  E 7   ? 0.2875 0.4074 0.5292 -0.0012 0.0433  -0.0445 7   DG  H "C1'" 
2280 N N9    . DG  E 7   ? 0.2874 0.4808 0.5575 -0.0217 0.0195  -0.0671 7   DG  H N9    
2281 C C8    . DG  E 7   ? 0.2773 0.5073 0.5945 -0.0368 0.0209  -0.0942 7   DG  H C8    
2282 N N7    . DG  E 7   ? 0.3367 0.6324 0.6694 -0.0540 -0.0041 -0.1093 7   DG  H N7    
2283 C C5    . DG  E 7   ? 0.3479 0.6497 0.6404 -0.0499 -0.0231 -0.0909 7   DG  H C5    
2284 C C6    . DG  E 7   ? 0.4099 0.7683 0.6949 -0.0629 -0.0530 -0.0955 7   DG  H C6    
2285 O O6    . DG  E 7   ? 0.4656 0.8284 0.7415 -0.0716 -0.0618 -0.0997 7   DG  H O6    
2286 N N1    . DG  E 7   ? 0.3938 0.7353 0.6315 -0.0529 -0.0637 -0.0713 7   DG  H N1    
2287 C C2    . DG  E 7   ? 0.5189 0.7970 0.7218 -0.0327 -0.0474 -0.0458 7   DG  H C2    
2288 N N2    . DG  E 7   ? 0.5428 0.8135 0.7017 -0.0257 -0.0613 -0.0247 7   DG  H N2    
2289 N N3    . DG  E 7   ? 0.2373 0.4615 0.4466 -0.0204 -0.0194 -0.0414 7   DG  H N3    
2290 C C4    . DG  E 7   ? 0.2333 0.4730 0.4875 -0.0301 -0.0089 -0.0648 7   DG  H C4    
2291 P P     . DA  E 8   ? 0.5827 0.5334 0.8079 0.0446  0.1233  0.0170  8   DA  H P     
2292 O OP1   . DA  E 8   ? 0.5581 0.4320 0.7465 0.0611  0.1435  0.0244  8   DA  H OP1   
2293 O OP2   . DA  E 8   ? 0.7192 0.7151 1.0134 0.0304  0.1325  0.0026  8   DA  H OP2   
2294 O "O5'" . DA  E 8   ? 0.3739 0.3196 0.5661 0.0536  0.1135  0.0446  8   DA  H "O5'" 
2295 C "C5'" . DA  E 8   ? 0.4381 0.3622 0.5669 0.0631  0.0956  0.0582  8   DA  H "C5'" 
2296 C "C4'" . DA  E 8   ? 0.5695 0.5352 0.6867 0.0590  0.0718  0.0706  8   DA  H "C4'" 
2297 O "O4'" . DA  E 8   ? 0.3387 0.3793 0.4839 0.0391  0.0466  0.0491  8   DA  H "O4'" 
2298 C "C3'" . DA  E 8   ? 0.5878 0.5577 0.7313 0.0617  0.0836  0.0864  8   DA  H "C3'" 
2299 O "O3'" . DA  E 8   ? 0.5595 0.5246 0.6605 0.0695  0.0687  0.1093  8   DA  H "O3'" 
2300 C "C2'" . DA  E 8   ? 0.4361 0.4804 0.6433 0.0414  0.0744  0.0647  8   DA  H "C2'" 
2301 C "C1'" . DA  E 8   ? 0.3444 0.4326 0.5363 0.0291  0.0447  0.0480  8   DA  H "C1'" 
2302 N N9    . DA  E 8   ? 0.4290 0.5737 0.6738 0.0100  0.0387  0.0189  8   DA  H N9    
2303 C C8    . DA  E 8   ? 0.3521 0.4917 0.6387 0.0051  0.0586  0.0007  8   DA  H C8    
2304 N N7    . DA  E 8   ? 0.2814 0.4814 0.6093 -0.0136 0.0458  -0.0246 8   DA  H N7    
2305 C C5    . DA  E 8   ? 0.3019 0.5484 0.6125 -0.0215 0.0156  -0.0226 8   DA  H C5    
2306 C C6    . DA  E 8   ? 0.3131 0.6309 0.6471 -0.0409 -0.0099 -0.0420 8   DA  H C6    
2307 N N6    . DA  E 8   ? 0.1946 0.5517 0.5774 -0.0564 -0.0091 -0.0683 8   DA  H N6    
2308 N N1    . DA  E 8   ? 0.2914 0.6376 0.5955 -0.0440 -0.0362 -0.0331 8   DA  H N1    
2309 C C2    . DA  E 8   ? 0.4348 0.7415 0.6895 -0.0286 -0.0370 -0.0068 8   DA  H C2    
2310 N N3    . DA  E 8   ? 0.4612 0.7014 0.6903 -0.0097 -0.0148 0.0133  8   DA  H N3    
2311 C C4    . DA  E 8   ? 0.3826 0.5956 0.6422 -0.0072 0.0111  0.0040  8   DA  H C4    
2312 P P     . DA  E 9   ? 0.7837 0.7507 0.9008 0.0746  0.0769  0.1295  9   DA  H P     
2313 O OP1   . DA  E 9   ? 0.8557 0.7837 0.9114 0.0898  0.0706  0.1567  9   DA  H OP1   
2314 O OP2   . DA  E 9   ? 0.7131 0.6619 0.8777 0.0761  0.1074  0.1259  9   DA  H OP2   
2315 O "O5'" . DA  E 9   ? 0.6529 0.7018 0.8034 0.0564  0.0505  0.1172  9   DA  H "O5'" 
2316 C "C5'" . DA  E 9   ? 0.5604 0.6394 0.6748 0.0507  0.0196  0.1163  9   DA  H "C5'" 
2317 C "C4'" . DA  E 9   ? 0.3865 0.5397 0.5371 0.0340  -0.0019 0.1059  9   DA  H "C4'" 
2318 O "O4'" . DA  E 9   ? 0.3613 0.5581 0.5617 0.0173  -0.0033 0.0768  9   DA  H "O4'" 
2319 C "C3'" . DA  E 9   ? 0.3944 0.5597 0.5783 0.0362  0.0066  0.1183  9   DA  H "C3'" 
2320 O "O3'" . DA  E 9   ? 0.4029 0.6125 0.5743 0.0299  -0.0212 0.1242  9   DA  H "O3'" 
2321 C "C2'" . DA  E 9   ? 0.3056 0.5063 0.5609 0.0232  0.0188  0.0950  9   DA  H "C2'" 
2322 C "C1'" . DA  E 9   ? 0.4036 0.6451 0.6611 0.0077  -0.0015 0.0704  9   DA  H "C1'" 
2323 N N9    . DA  E 9   ? 0.3780 0.6390 0.6879 -0.0036 0.0106  0.0450  9   DA  H N9    
2324 C C8    . DA  E 9   ? 0.3865 0.6082 0.7201 0.0025  0.0409  0.0418  9   DA  H C8    
2325 N N7    . DA  E 9   ? 0.4202 0.6711 0.7990 -0.0109 0.0450  0.0162  9   DA  H N7    
2326 C C5    . DA  E 9   ? 0.3584 0.6717 0.7428 -0.0266 0.0154  0.0016  9   DA  H C5    
2327 C C6    . DA  E 9   ? 0.3246 0.6920 0.7480 -0.0455 0.0042  -0.0265 9   DA  H C6    
2328 N N6    . DA  E 9   ? 0.2716 0.6386 0.7384 -0.0515 0.0229  -0.0456 9   DA  H N6    
2329 N N1    . DA  E 9   ? 0.3237 0.7453 0.7393 -0.0582 -0.0267 -0.0345 9   DA  H N1    
2330 C C2    . DA  E 9   ? 0.3108 0.7313 0.6821 -0.0524 -0.0447 -0.0154 9   DA  H C2    
2331 N N3    . DA  E 9   ? 0.3491 0.7214 0.6808 -0.0349 -0.0369 0.0117  9   DA  H N3    
2332 C C4    . DA  E 9   ? 0.4024 0.7224 0.7439 -0.0226 -0.0062 0.0190  9   DA  H C4    
2333 P P     . DA  E 10  ? 0.4016 0.6361 0.6009 0.0306  -0.0224 0.1368  10  DA  H P     
2334 O OP1   . DA  E 10  ? 0.4366 0.6681 0.5840 0.0367  -0.0428 0.1570  10  DA  H OP1   
2335 O OP2   . DA  E 10  ? 0.6194 0.8161 0.8490 0.0410  0.0100  0.1447  10  DA  H OP2   
2336 O "O5'" . DA  E 10  ? 0.3877 0.6994 0.6431 0.0095  -0.0390 0.1116  10  DA  H "O5'" 
2337 C "C5'" . DA  E 10  ? 0.3473 0.7007 0.5895 -0.0043 -0.0657 0.0963  10  DA  H "C5'" 
2338 C "C4'" . DA  E 10  ? 0.2938 0.7121 0.5976 -0.0237 -0.0738 0.0701  10  DA  H "C4'" 
2339 O "O4'" . DA  E 10  ? 0.3132 0.7212 0.6535 -0.0272 -0.0527 0.0518  10  DA  H "O4'" 
2340 C "C3'" . DA  E 10  ? 0.3401 0.7812 0.6817 -0.0260 -0.0724 0.0698  10  DA  H "C3'" 
2341 O "O3'" . DA  E 10  ? 0.4513 0.8914 0.7606 -0.0338 -0.0929 0.0508  10  DA  H "O3'" 
2342 C "C2'" . DA  E 10  ? 0.3142 0.7727 0.7251 -0.0335 -0.0518 0.0506  10  DA  H "C2'" 
2343 C "C1'" . DA  E 10  ? 0.1902 0.6455 0.5933 -0.0403 -0.0518 0.0334  10  DA  H "C1'" 
2344 N N9    . DA  E 10  ? 0.3600 0.7981 0.8050 -0.0408 -0.0242 0.0210  10  DA  H N9    
2345 C C8    . DA  E 10  ? 0.4801 0.8570 0.9217 -0.0256 0.0066  0.0335  10  DA  H C8    
2346 N N7    . DA  E 10  ? 0.4253 0.7948 0.9055 -0.0299 0.0273  0.0164  10  DA  H N7    
2347 C C5    . DA  E 10  ? 0.4724 0.9029 0.9840 -0.0492 0.0089  -0.0090 10  DA  H C5    
2348 C C6    . DA  E 10  ? 0.4958 0.9337 1.0253 -0.0600 0.0156  -0.0310 10  DA  H C6    
2349 N N6    . DA  E 10  ? 0.4198 0.8245 0.9790 -0.0558 0.0449  -0.0381 10  DA  H N6    
2350 N N1    . DA  E 10  ? 0.4638 0.9283 0.9717 -0.0728 -0.0082 -0.0372 10  DA  H N1    
2351 C C2    . DA  E 10  ? 0.4188 0.8926 0.8980 -0.0749 -0.0350 -0.0243 10  DA  H C2    
2352 N N3    . DA  E 10  ? 0.3323 0.8007 0.7976 -0.0664 -0.0449 -0.0116 10  DA  H N3    
2353 C C4    . DA  E 10  ? 0.3715 0.8392 0.8519 -0.0556 -0.0227 -0.0052 10  DA  H C4    
2354 P P     . DC  E 11  ? 0.4900 0.9433 0.8180 -0.0347 -0.0979 0.0483  11  DC  H P     
2355 O OP1   . DC  E 11  ? 0.6578 1.0908 0.9298 -0.0346 -0.1152 0.0472  11  DC  H OP1   
2356 O OP2   . DC  E 11  ? 0.4569 0.9175 0.8182 -0.0249 -0.0819 0.0729  11  DC  H OP2   
2357 O "O5'" . DC  E 11  ? 0.4882 0.9595 0.8700 -0.0459 -0.0953 0.0182  11  DC  H "O5'" 
2358 C "C5'" . DC  E 11  ? 0.4370 0.8963 0.8076 -0.0538 -0.1039 0.0016  11  DC  H "C5'" 
2359 C "C4'" . DC  E 11  ? 0.4130 0.8845 0.8432 -0.0631 -0.0976 -0.0114 11  DC  H "C4'" 
2360 O "O4'" . DC  E 11  ? 0.3829 0.8618 0.8518 -0.0633 -0.0764 -0.0099 11  DC  H "O4'" 
2361 C "C3'" . DC  E 11  ? 0.3344 0.8220 0.8065 -0.0646 -0.0984 -0.0126 11  DC  H "C3'" 
2362 O "O3'" . DC  E 11  ? 0.4581 0.9422 0.9289 -0.0732 -0.1126 -0.0165 11  DC  H "O3'" 
2363 C "C2'" . DC  E 11  ? 0.3725 0.8679 0.8948 -0.0656 -0.0735 -0.0078 11  DC  H "C2'" 
2364 C "C1'" . DC  E 11  ? 0.2819 0.7720 0.7935 -0.0697 -0.0655 -0.0034 11  DC  H "C1'" 
2365 N N1    . DC  E 11  ? 0.2713 0.7889 0.7884 -0.0694 -0.0364 0.0067  11  DC  H N1    
2366 C C2    . DC  E 11  ? 0.3275 0.8508 0.8682 -0.0765 -0.0227 -0.0101 11  DC  H C2    
2367 O O2    . DC  E 11  ? 0.2585 0.7833 0.7970 -0.0860 -0.0362 -0.0145 11  DC  H O2    
2368 N N3    . DC  E 11  ? 0.3324 0.8313 0.8997 -0.0690 0.0062  -0.0213 11  DC  H N3    
2369 C C4    . DC  E 11  ? 0.3054 0.7766 0.8832 -0.0551 0.0223  -0.0093 11  DC  H C4    
2370 N N4    . DC  E 11  ? 0.2660 0.6946 0.8709 -0.0468 0.0533  -0.0081 11  DC  H N4    
2371 C C5    . DC  E 11  ? 0.2574 0.7346 0.8149 -0.0477 0.0079  0.0081  11  DC  H C5    
2372 C C6    . DC  E 11  ? 0.2901 0.8057 0.8143 -0.0563 -0.0207 -0.0015 11  DC  H C6    
2373 P P     . DT  E 12  ? 0.6538 1.1484 1.1456 -0.0748 -0.1199 -0.0165 12  DT  H P     
2374 O OP1   . DT  E 12  ? 0.7258 1.2325 1.1805 -0.0817 -0.1365 -0.0241 12  DT  H OP1   
2375 O OP2   . DT  E 12  ? 0.5106 1.0143 1.0077 -0.0648 -0.1161 -0.0154 12  DT  H OP2   
2376 O "O5'" . DT  E 12  ? 0.7430 1.2539 1.2786 -0.0845 -0.1067 -0.0072 12  DT  H "O5'" 
2377 C "C5'" . DT  E 12  ? 0.7451 1.2730 1.2792 -0.0962 -0.1083 -0.0142 12  DT  H "C5'" 
2378 C "C4'" . DT  E 12  ? 0.7312 1.2826 1.2951 -0.1033 -0.0901 -0.0081 12  DT  H "C4'" 
2379 O "O4'" . DT  E 12  ? 0.6367 1.1906 1.2030 -0.0987 -0.0695 -0.0036 12  DT  H "O4'" 
2380 C "C3'" . DT  E 12  ? 0.7613 1.3401 1.3545 -0.1058 -0.0860 -0.0024 12  DT  H "C3'" 
2381 O "O3'" . DT  E 12  ? 0.7696 1.3757 1.3834 -0.1168 -0.0912 -0.0183 12  DT  H "O3'" 
2382 C "C2'" . DT  E 12  ? 0.7398 1.3398 1.3496 -0.1031 -0.0598 -0.0004 12  DT  H "C2'" 
2383 C "C1'" . DT  E 12  ? 0.6096 1.1953 1.2081 -0.1018 -0.0506 -0.0081 12  DT  H "C1'" 
2384 N N1    . DT  E 12  ? 0.5027 1.0852 1.1066 -0.0923 -0.0273 -0.0124 12  DT  H N1    
2385 C C2    . DT  E 12  ? 0.4732 1.0392 1.0993 -0.0905 -0.0036 -0.0306 12  DT  H C2    
2386 O O2    . DT  E 12  ? 0.4953 1.0607 1.1320 -0.0975 -0.0014 -0.0432 12  DT  H O2    
2387 N N3    . DT  E 12  ? 0.3982 0.9383 1.0369 -0.0792 0.0182  -0.0312 12  DT  H N3    
2388 C C4    . DT  E 12  ? 0.4129 0.9459 1.0429 -0.0688 0.0189  -0.0182 12  DT  H C4    
2389 O O4    . DT  E 12  ? 0.3413 0.8361 0.9869 -0.0571 0.0413  -0.0121 12  DT  H O4    
2390 C C5    . DT  E 12  ? 0.3942 0.9600 0.9941 -0.0718 -0.0074 -0.0074 12  DT  H C5    
2391 C C7    . DT  E 12  ? 0.4342 0.9921 1.0217 -0.0597 -0.0096 -0.0003 12  DT  H C7    
2392 C C6    . DT  E 12  ? 0.3792 0.9614 0.9671 -0.0833 -0.0289 -0.0009 12  DT  H C6    
2393 O "O3'" . DC  F 1   ? 1.6113 1.3974 1.6124 -0.0414 0.1242  -0.0585 1   DC  I "O3'" 
2394 P P     . DA  F 2   ? 1.5634 1.3279 1.5772 -0.0341 0.1354  -0.0581 2   DA  I P     
2395 O OP1   . DA  F 2   ? 1.5569 1.2963 1.5717 -0.0335 0.1508  -0.0570 2   DA  I OP1   
2396 O OP2   . DA  F 2   ? 1.5537 1.3149 1.5638 -0.0198 0.1225  -0.0454 2   DA  I OP2   
2397 O "O5'" . DA  F 2   ? 1.3019 1.0824 1.3314 -0.0460 0.1429  -0.0755 2   DA  I "O5'" 
2398 C "C5'" . DA  F 2   ? 1.2625 1.0517 1.2978 -0.0615 0.1537  -0.0908 2   DA  I "C5'" 
2399 C "C4'" . DA  F 2   ? 1.2264 1.0317 1.2739 -0.0707 0.1576  -0.1059 2   DA  I "C4'" 
2400 O "O4'" . DA  F 2   ? 1.1527 0.9865 1.1943 -0.0757 0.1437  -0.1092 2   DA  I "O4'" 
2401 C "C3'" . DA  F 2   ? 1.2115 1.0076 1.2689 -0.0620 0.1602  -0.1038 2   DA  I "C3'" 
2402 O "O3'" . DA  F 2   ? 1.1672 0.9669 1.2375 -0.0720 0.1727  -0.1198 2   DA  I "O3'" 
2403 C "C2'" . DA  F 2   ? 1.2035 1.0184 1.2551 -0.0561 0.1420  -0.0967 2   DA  I "C2'" 
2404 C "C1'" . DA  F 2   ? 1.0936 0.9342 1.1382 -0.0683 0.1353  -0.1052 2   DA  I "C1'" 
2405 N N9    . DA  F 2   ? 0.8862 0.7408 0.9177 -0.0631 0.1172  -0.0948 2   DA  I N9    
2406 C C8    . DA  F 2   ? 0.7917 0.6351 0.8123 -0.0510 0.1074  -0.0784 2   DA  I C8    
2407 N N7    . DA  F 2   ? 0.7401 0.6001 0.7495 -0.0494 0.0917  -0.0726 2   DA  I N7    
2408 C C5    . DA  F 2   ? 0.7706 0.6547 0.7836 -0.0610 0.0914  -0.0860 2   DA  I C5    
2409 C C6    . DA  F 2   ? 0.7096 0.6187 0.7147 -0.0652 0.0790  -0.0879 2   DA  I C6    
2410 N N6    . DA  F 2   ? 0.6394 0.5536 0.6310 -0.0583 0.0638  -0.0758 2   DA  I N6    
2411 N N1    . DA  F 2   ? 0.7575 0.6855 0.7683 -0.0766 0.0829  -0.1028 2   DA  I N1    
2412 C C2    . DA  F 2   ? 0.8136 0.7357 0.8370 -0.0837 0.0979  -0.1152 2   DA  I C2    
2413 N N3    . DA  F 2   ? 0.8734 0.7727 0.9055 -0.0812 0.1107  -0.1151 2   DA  I N3    
2414 C C4    . DA  F 2   ? 0.8613 0.7424 0.8877 -0.0695 0.1068  -0.0999 2   DA  I C4    
2415 P P     . DG  F 3   ? 1.4774 1.2714 1.5601 -0.0659 0.1776  -0.1212 3   DG  I P     
2416 O OP1   . DG  F 3   ? 1.4366 1.2169 1.5298 -0.0738 0.1969  -0.1339 3   DG  I OP1   
2417 O OP2   . DG  F 3   ? 1.4843 1.2651 1.5646 -0.0491 0.1699  -0.1041 3   DG  I OP2   
2418 O "O5'" . DG  F 3   ? 1.1673 0.9904 1.2508 -0.0717 0.1675  -0.1287 3   DG  I "O5'" 
2419 C "C5'" . DG  F 3   ? 1.1297 0.9705 1.2138 -0.0870 0.1711  -0.1450 3   DG  I "C5'" 
2420 C "C4'" . DG  F 3   ? 1.0467 0.9120 1.1312 -0.0896 0.1619  -0.1502 3   DG  I "C4'" 
2421 O "O4'" . DG  F 3   ? 0.9880 0.8685 1.0607 -0.0853 0.1443  -0.1399 3   DG  I "O4'" 
2422 C "C3'" . DG  F 3   ? 1.0295 0.8911 1.1248 -0.0818 0.1641  -0.1484 3   DG  I "C3'" 
2423 O "O3'" . DG  F 3   ? 1.0217 0.9011 1.1209 -0.0909 0.1662  -0.1623 3   DG  I "O3'" 
2424 C "C2'" . DG  F 3   ? 0.9696 0.8361 1.0593 -0.0694 0.1475  -0.1319 3   DG  I "C2'" 
2425 C "C1'" . DG  F 3   ? 0.9649 0.8502 1.0404 -0.0755 0.1354  -0.1317 3   DG  I "C1'" 
2426 N N9    . DG  F 3   ? 0.8694 0.7531 0.9344 -0.0655 0.1210  -0.1154 3   DG  I N9    
2427 C C8    . DG  F 3   ? 0.7986 0.6609 0.8605 -0.0552 0.1208  -0.1025 3   DG  I C8    
2428 N N7    . DG  F 3   ? 0.7131 0.5790 0.7634 -0.0479 0.1059  -0.0897 3   DG  I N7    
2429 C C5    . DG  F 3   ? 0.7330 0.6246 0.7789 -0.0541 0.0959  -0.0945 3   DG  I C5    
2430 C C6    . DG  F 3   ? 0.6437 0.5495 0.6772 -0.0508 0.0790  -0.0859 3   DG  I C6    
2431 O O6    . DG  F 3   ? 0.6781 0.5767 0.7016 -0.0417 0.0685  -0.0721 3   DG  I O6    
2432 N N1    . DG  F 3   ? 0.6035 0.5336 0.6360 -0.0591 0.0747  -0.0949 3   DG  I N1    
2433 C C2    . DG  F 3   ? 0.7075 0.6471 0.7489 -0.0690 0.0847  -0.1103 3   DG  I C2    
2434 N N2    . DG  F 3   ? 0.8706 0.8333 0.9079 -0.0752 0.0782  -0.1167 3   DG  I N2    
2435 N N3    . DG  F 3   ? 0.7626 0.6892 0.8153 -0.0725 0.1002  -0.1188 3   DG  I N3    
2436 C C4    . DG  F 3   ? 0.8439 0.7467 0.8985 -0.0647 0.1051  -0.1101 3   DG  I C4    
2437 P P     . DT  F 4   ? 1.0653 0.9457 1.1761 -0.0856 0.1697  -0.1639 4   DT  I P     
2438 O OP1   . DT  F 4   ? 1.0837 0.9695 1.1992 -0.0975 0.1814  -0.1821 4   DT  I OP1   
2439 O OP2   . DT  F 4   ? 1.0536 0.9124 1.1724 -0.0723 0.1734  -0.1519 4   DT  I OP2   
2440 O "O5'" . DT  F 4   ? 0.8349 0.7383 0.9399 -0.0819 0.1523  -0.1572 4   DT  I "O5'" 
2441 C "C5'" . DT  F 4   ? 0.7984 0.7231 0.8923 -0.0909 0.1439  -0.1631 4   DT  I "C5'" 
2442 C "C4'" . DT  F 4   ? 0.8437 0.7861 0.9325 -0.0852 0.1280  -0.1544 4   DT  I "C4'" 
2443 O "O4'" . DT  F 4   ? 0.8483 0.7860 0.9289 -0.0768 0.1161  -0.1388 4   DT  I "O4'" 
2444 C "C3'" . DT  F 4   ? 0.8200 0.7633 0.9207 -0.0774 0.1282  -0.1510 4   DT  I "C3'" 
2445 O "O3'" . DT  F 4   ? 0.8127 0.7785 0.9105 -0.0825 0.1228  -0.1577 4   DT  I "O3'" 
2446 C "C2'" . DT  F 4   ? 0.7644 0.7005 0.8646 -0.0640 0.1165  -0.1326 4   DT  I "C2'" 
2447 C "C1'" . DT  F 4   ? 0.7701 0.7122 0.8538 -0.0667 0.1057  -0.1279 4   DT  I "C1'" 
2448 N N1    . DT  F 4   ? 0.6787 0.6071 0.7573 -0.0557 0.0972  -0.1116 4   DT  I N1    
2449 C C2    . DT  F 4   ? 0.6368 0.5761 0.7038 -0.0518 0.0806  -0.1014 4   DT  I C2    
2450 O O2    . DT  F 4   ? 0.6203 0.5799 0.6815 -0.0563 0.0726  -0.1044 4   DT  I O2    
2451 N N3    . DT  F 4   ? 0.6058 0.5303 0.6673 -0.0418 0.0740  -0.0874 4   DT  I N3    
2452 C C4    . DT  F 4   ? 0.5945 0.4950 0.6603 -0.0351 0.0818  -0.0821 4   DT  I C4    
2453 O O4    . DT  F 4   ? 0.6117 0.4999 0.6703 -0.0257 0.0744  -0.0690 4   DT  I O4    
2454 C C5    . DT  F 4   ? 0.6650 0.5551 0.7432 -0.0396 0.0995  -0.0930 4   DT  I C5    
2455 C C7    . DT  F 4   ? 0.7652 0.6281 0.8485 -0.0326 0.1102  -0.0882 4   DT  I C7    
2456 C C6    . DT  F 4   ? 0.5519 0.4563 0.6359 -0.0499 0.1062  -0.1072 4   DT  I C6    
2457 P P     . DT  F 5   ? 0.8329 0.8059 0.9420 -0.0766 0.1223  -0.1560 5   DT  I P     
2458 O OP1   . DT  F 5   ? 0.9558 0.9433 1.0637 -0.0863 0.1280  -0.1710 5   DT  I OP1   
2459 O OP2   . DT  F 5   ? 0.8059 0.7598 0.9297 -0.0672 0.1301  -0.1499 5   DT  I OP2   
2460 O "O5'" . DT  F 5   ? 0.6435 0.6303 0.7453 -0.0704 0.1039  -0.1431 5   DT  I "O5'" 
2461 C "C5'" . DT  F 5   ? 0.5994 0.5995 0.6849 -0.0762 0.0940  -0.1435 5   DT  I "C5'" 
2462 C "C4'" . DT  F 5   ? 0.7007 0.7105 0.7808 -0.0687 0.0774  -0.1300 5   DT  I "C4'" 
2463 O "O4'" . DT  F 5   ? 0.5612 0.5553 0.6394 -0.0598 0.0714  -0.1163 5   DT  I "O4'" 
2464 C "C3'" . DT  F 5   ? 0.7452 0.7622 0.8370 -0.0625 0.0746  -0.1262 5   DT  I "C3'" 
2465 O "O3'" . DT  F 5   ? 0.6864 0.7238 0.7688 -0.0643 0.0626  -0.1243 5   DT  I "O3'" 
2466 C "C2'" . DT  F 5   ? 0.4751 0.4763 0.5758 -0.0499 0.0702  -0.1115 5   DT  I "C2'" 
2467 C "C1'" . DT  F 5   ? 0.6002 0.5938 0.6861 -0.0491 0.0628  -0.1043 5   DT  I "C1'" 
2468 N N1    . DT  F 5   ? 0.6171 0.5887 0.7071 -0.0397 0.0637  -0.0940 5   DT  I N1    
2469 C C2    . DT  F 5   ? 0.6046 0.5720 0.6855 -0.0320 0.0501  -0.0801 5   DT  I C2    
2470 O O2    . DT  F 5   ? 0.5967 0.5776 0.6671 -0.0324 0.0371  -0.0756 5   DT  I O2    
2471 N N3    . DT  F 5   ? 0.5679 0.5136 0.6515 -0.0233 0.0523  -0.0716 5   DT  I N3    
2472 C C4    . DT  F 5   ? 0.6456 0.5738 0.7401 -0.0216 0.0668  -0.0753 5   DT  I C4    
2473 O O4    . DT  F 5   ? 0.7446 0.6532 0.8400 -0.0128 0.0680  -0.0665 5   DT  I O4    
2474 C C5    . DT  F 5   ? 0.5926 0.5262 0.6965 -0.0304 0.0808  -0.0901 5   DT  I C5    
2475 C C7    . DT  F 5   ? 0.6099 0.5247 0.7253 -0.0295 0.0977  -0.0953 5   DT  I C7    
2476 C C6    . DT  F 5   ? 0.6165 0.5712 0.7174 -0.0390 0.0785  -0.0988 5   DT  I C6    
2477 P P     . DT  F 6   ? 0.7373 0.7857 0.8294 -0.0583 0.0565  -0.1186 6   DT  I P     
2478 O OP1   . DT  F 6   ? 0.8377 0.9067 0.9192 -0.0647 0.0514  -0.1242 6   DT  I OP1   
2479 O OP2   . DT  F 6   ? 0.6208 0.6607 0.7324 -0.0541 0.0675  -0.1207 6   DT  I OP2   
2480 O "O5'" . DT  F 6   ? 0.6978 0.7419 0.7870 -0.0487 0.0413  -0.1018 6   DT  I "O5'" 
2481 C "C5'" . DT  F 6   ? 0.4533 0.5012 0.5243 -0.0503 0.0303  -0.0969 6   DT  I "C5'" 
2482 C "C4'" . DT  F 6   ? 0.4796 0.5210 0.5502 -0.0400 0.0168  -0.0809 6   DT  I "C4'" 
2483 O "O4'" . DT  F 6   ? 0.4020 0.4223 0.4803 -0.0330 0.0214  -0.0753 6   DT  I "O4'" 
2484 C "C3'" . DT  F 6   ? 0.5624 0.6128 0.6448 -0.0340 0.0096  -0.0745 6   DT  I "C3'" 
2485 O "O3'" . DT  F 6   ? 0.5128 0.5701 0.5829 -0.0316 -0.0058 -0.0652 6   DT  I "O3'" 
2486 C "C2'" . DT  F 6   ? 0.3545 0.3884 0.4540 -0.0240 0.0124  -0.0671 6   DT  I "C2'" 
2487 C "C1'" . DT  F 6   ? 0.4213 0.4375 0.5104 -0.0224 0.0134  -0.0637 6   DT  I "C1'" 
2488 N N1    . DT  F 6   ? 0.4483 0.4445 0.5495 -0.0160 0.0226  -0.0615 6   DT  I N1    
2489 C C2    . DT  F 6   ? 0.4929 0.4733 0.5903 -0.0066 0.0154  -0.0493 6   DT  I C2    
2490 O O2    . DT  F 6   ? 0.5428 0.5247 0.6282 -0.0031 0.0014  -0.0400 6   DT  I O2    
2491 N N3    . DT  F 6   ? 0.4025 0.3642 0.5101 -0.0010 0.0253  -0.0482 6   DT  I N3    
2492 C C4    . DT  F 6   ? 0.5091 0.4660 0.6299 -0.0042 0.0418  -0.0581 6   DT  I C4    
2493 O O4    . DT  F 6   ? 0.5079 0.4468 0.6368 0.0018  0.0502  -0.0560 6   DT  I O4    
2494 C C5    . DT  F 6   ? 0.4989 0.4730 0.6226 -0.0145 0.0485  -0.0711 6   DT  I C5    
2495 C C7    . DT  F 6   ? 0.4515 0.4213 0.5883 -0.0185 0.0663  -0.0828 6   DT  I C7    
2496 C C6    . DT  F 6   ? 0.4095 0.4022 0.5231 -0.0197 0.0387  -0.0722 6   DT  I C6    
2497 P P     . DC  F 7   ? 0.5888 0.6597 0.6657 -0.0278 -0.0161 -0.0590 7   DC  I P     
2498 O OP1   . DC  F 7   ? 0.5463 0.6265 0.6034 -0.0303 -0.0285 -0.0549 7   DC  I OP1   
2499 O OP2   . DC  F 7   ? 0.6150 0.6949 0.7076 -0.0308 -0.0055 -0.0679 7   DC  I OP2   
2500 O "O5'" . DC  F 7   ? 0.5420 0.5995 0.6292 -0.0160 -0.0246 -0.0452 7   DC  I "O5'" 
2501 C "C5'" . DC  F 7   ? 0.5026 0.5478 0.5762 -0.0110 -0.0343 -0.0355 7   DC  I "C5'" 
2502 C "C4'" . DC  F 7   ? 0.5665 0.5970 0.6527 0.0004  -0.0385 -0.0249 7   DC  I "C4'" 
2503 O "O4'" . DC  F 7   ? 0.4576 0.4739 0.5546 0.0019  -0.0243 -0.0294 7   DC  I "O4'" 
2504 C "C3'" . DC  F 7   ? 0.4136 0.4532 0.5182 0.0055  -0.0441 -0.0202 7   DC  I "C3'" 
2505 O "O3'" . DC  F 7   ? 0.5226 0.5653 0.6180 0.0097  -0.0616 -0.0096 7   DC  I "O3'" 
2506 C "C2'" . DC  F 7   ? 0.5121 0.5368 0.6353 0.0141  -0.0376 -0.0169 7   DC  I "C2'" 
2507 C "C1'" . DC  F 7   ? 0.3677 0.3759 0.4815 0.0122  -0.0268 -0.0213 7   DC  I "C1'" 
2508 N N1    . DC  F 7   ? 0.3717 0.3712 0.5012 0.0121  -0.0095 -0.0289 7   DC  I N1    
2509 C C2    . DC  F 7   ? 0.3870 0.3655 0.5190 0.0197  -0.0052 -0.0239 7   DC  I C2    
2510 O O2    . DC  F 7   ? 0.3898 0.3581 0.5121 0.0268  -0.0161 -0.0132 7   DC  I O2    
2511 N N3    . DC  F 7   ? 0.3991 0.3685 0.5439 0.0196  0.0109  -0.0307 7   DC  I N3    
2512 C C4    . DC  F 7   ? 0.4646 0.4448 0.6184 0.0119  0.0223  -0.0423 7   DC  I C4    
2513 N N4    . DC  F 7   ? 0.5218 0.4911 0.6869 0.0120  0.0383  -0.0488 7   DC  I N4    
2514 C C5    . DC  F 7   ? 0.3815 0.3829 0.5321 0.0042  0.0182  -0.0478 7   DC  I C5    
2515 C C6    . DC  F 7   ? 0.4424 0.4528 0.5808 0.0045  0.0025  -0.0408 7   DC  I C6    
2516 P P     . DA  F 8   ? 0.5423 0.5965 0.6531 0.0143  -0.0722 -0.0030 8   DA  I P     
2517 O OP1   . DA  F 8   ? 0.3733 0.4334 0.4661 0.0134  -0.0875 0.0033  8   DA  I OP1   
2518 O OP2   . DA  F 8   ? 0.5288 0.5957 0.6590 0.0104  -0.0610 -0.0115 8   DA  I OP2   
2519 O "O5'" . DA  F 8   ? 0.4771 0.5159 0.5999 0.0264  -0.0776 0.0075  8   DA  I "O5'" 
2520 C "C5'" . DA  F 8   ? 0.4660 0.4892 0.5727 0.0328  -0.0880 0.0170  8   DA  I "C5'" 
2521 C "C4'" . DA  F 8   ? 0.4307 0.4398 0.5514 0.0445  -0.0906 0.0253  8   DA  I "C4'" 
2522 O "O4'" . DA  F 8   ? 0.4107 0.4100 0.5415 0.0447  -0.0736 0.0188  8   DA  I "O4'" 
2523 C "C3'" . DA  F 8   ? 0.5490 0.5683 0.6928 0.0500  -0.0977 0.0301  8   DA  I "C3'" 
2524 O "O3'" . DA  F 8   ? 0.6135 0.6191 0.7606 0.0617  -0.1075 0.0410  8   DA  I "O3'" 
2525 C "C2'" . DA  F 8   ? 0.3494 0.3727 0.5143 0.0476  -0.0804 0.0211  8   DA  I "C2'" 
2526 C "C1'" . DA  F 8   ? 0.4191 0.4226 0.5756 0.0495  -0.0697 0.0191  8   DA  I "C1'" 
2527 N N9    . DA  F 8   ? 0.3749 0.3785 0.5417 0.0441  -0.0505 0.0078  8   DA  I N9    
2528 C C8    . DA  F 8   ? 0.3671 0.3865 0.5421 0.0355  -0.0412 -0.0024 8   DA  I C8    
2529 N N7    . DA  F 8   ? 0.3680 0.3819 0.5510 0.0327  -0.0240 -0.0113 8   DA  I N7    
2530 C C5    . DA  F 8   ? 0.3825 0.3758 0.5633 0.0402  -0.0217 -0.0063 8   DA  I C5    
2531 C C6    . DA  F 8   ? 0.4266 0.4042 0.6130 0.0417  -0.0061 -0.0109 8   DA  I C6    
2532 N N6    . DA  F 8   ? 0.4045 0.3852 0.5996 0.0351  0.0104  -0.0226 8   DA  I N6    
2533 N N1    . DA  F 8   ? 0.4119 0.3694 0.5932 0.0503  -0.0078 -0.0032 8   DA  I N1    
2534 C C2    . DA  F 8   ? 0.5092 0.4628 0.6803 0.0571  -0.0244 0.0083  8   DA  I C2    
2535 N N3    . DA  F 8   ? 0.3957 0.3626 0.5605 0.0563  -0.0404 0.0135  8   DA  I N3    
2536 C C4    . DA  F 8   ? 0.3826 0.3693 0.5533 0.0475  -0.0379 0.0057  8   DA  I C4    
2537 P P     . DA  F 9   ? 0.6419 0.6551 0.8096 0.0696  -0.1204 0.0493  9   DA  I P     
2538 O OP1   . DA  F 9   ? 0.6336 0.6515 0.7870 0.0697  -0.1390 0.0565  9   DA  I OP1   
2539 O OP2   . DA  F 9   ? 0.7455 0.7733 0.9398 0.0670  -0.1103 0.0431  9   DA  I OP2   
2540 O "O5'" . DA  F 9   ? 0.6359 0.6289 0.8079 0.0824  -0.1219 0.0574  9   DA  I "O5'" 
2541 C "C5'" . DA  F 9   ? 0.5730 0.5459 0.7238 0.0852  -0.1197 0.0596  9   DA  I "C5'" 
2542 C "C4'" . DA  F 9   ? 0.5293 0.4864 0.6913 0.0925  -0.1073 0.0595  9   DA  I "C4'" 
2543 O "O4'" . DA  F 9   ? 0.5355 0.4982 0.7073 0.0840  -0.0878 0.0474  9   DA  I "O4'" 
2544 C "C3'" . DA  F 9   ? 0.5564 0.5137 0.7424 0.1038  -0.1130 0.0667  9   DA  I "C3'" 
2545 O "O3'" . DA  F 9   ? 0.6667 0.6019 0.8476 0.1153  -0.1135 0.0739  9   DA  I "O3'" 
2546 C "C2'" . DA  F 9   ? 0.5773 0.5455 0.7877 0.0995  -0.0965 0.0576  9   DA  I "C2'" 
2547 C "C1'" . DA  F 9   ? 0.5716 0.5329 0.7680 0.0903  -0.0797 0.0473  9   DA  I "C1'" 
2548 N N9    . DA  F 9   ? 0.5760 0.5506 0.7864 0.0813  -0.0646 0.0358  9   DA  I N9    
2549 C C8    . DA  F 9   ? 0.5687 0.5649 0.7877 0.0738  -0.0663 0.0310  9   DA  I C8    
2550 N N7    . DA  F 9   ? 0.3829 0.3856 0.6127 0.0673  -0.0499 0.0205  9   DA  I N7    
2551 C C5    . DA  F 9   ? 0.3980 0.3825 0.6270 0.0703  -0.0368 0.0180  9   DA  I C5    
2552 C C6    . DA  F 9   ? 0.4803 0.4604 0.7175 0.0664  -0.0170 0.0079  9   DA  I C6    
2553 N N6    . DA  F 9   ? 0.4055 0.4002 0.6531 0.0585  -0.0070 -0.0018 9   DA  I N6    
2554 N N1    . DA  F 9   ? 0.4456 0.4047 0.6793 0.0711  -0.0074 0.0082  9   DA  I N1    
2555 C C2    . DA  F 9   ? 0.5268 0.4706 0.7493 0.0796  -0.0172 0.0183  9   DA  I C2    
2556 N N3    . DA  F 9   ? 0.5156 0.4615 0.7286 0.0843  -0.0361 0.0283  9   DA  I N3    
2557 C C4    . DA  F 9   ? 0.5292 0.4962 0.7466 0.0790  -0.0453 0.0274  9   DA  I C4    
2558 P P     . DA  F 10  ? 0.6226 0.7142 0.6585 -0.0479 -0.1142 0.1287  10  DA  I P     
2559 O OP1   . DA  F 10  ? 0.7074 0.7933 0.7083 -0.0440 -0.1482 0.1305  10  DA  I OP1   
2560 O OP2   . DA  F 10  ? 0.5893 0.6916 0.6929 -0.0550 -0.1010 0.1125  10  DA  I OP2   
2561 O "O5'" . DA  F 10  ? 0.5933 0.6923 0.6472 -0.0414 -0.1178 0.1356  10  DA  I "O5'" 
2562 C "C5'" . DA  F 10  ? 0.5737 0.6652 0.5737 -0.0338 -0.1293 0.1512  10  DA  I "C5'" 
2563 C "C4'" . DA  F 10  ? 0.5545 0.6550 0.5844 -0.0289 -0.1296 0.1552  10  DA  I "C4'" 
2564 O "O4'" . DA  F 10  ? 0.5057 0.6079 0.5520 -0.0331 -0.0916 0.1558  10  DA  I "O4'" 
2565 C "C3'" . DA  F 10  ? 0.5806 0.6962 0.6803 -0.0276 -0.1524 0.1429  10  DA  I "C3'" 
2566 O "O3'" . DA  F 10  ? 0.4202 0.5388 0.5154 -0.0192 -0.1739 0.1511  10  DA  I "O3'" 
2567 C "C2'" . DA  F 10  ? 0.4026 0.5279 0.5614 -0.0337 -0.1224 0.1334  10  DA  I "C2'" 
2568 C "C1'" . DA  F 10  ? 0.4095 0.5262 0.5266 -0.0340 -0.0896 0.1461  10  DA  I "C1'" 
2569 N N9    . DA  F 10  ? 0.3748 0.4937 0.5188 -0.0416 -0.0528 0.1397  10  DA  I N9    
2570 C C8    . DA  F 10  ? 0.4351 0.5530 0.5927 -0.0492 -0.0404 0.1294  10  DA  I C8    
2571 N N7    . DA  F 10  ? 0.4988 0.6188 0.6786 -0.0548 -0.0056 0.1261  10  DA  I N7    
2572 C C5    . DA  F 10  ? 0.4461 0.5687 0.6264 -0.0507 0.0054  0.1348  10  DA  I C5    
2573 C C6    . DA  F 10  ? 0.4185 0.5444 0.6175 -0.0532 0.0394  0.1363  10  DA  I C6    
2574 N N6    . DA  F 10  ? 0.3244 0.4514 0.5458 -0.0607 0.0690  0.1288  10  DA  I N6    
2575 N N1    . DA  F 10  ? 0.3459 0.4737 0.5392 -0.0476 0.0412  0.1459  10  DA  I N1    
2576 C C2    . DA  F 10  ? 0.3326 0.4593 0.5041 -0.0400 0.0109  0.1534  10  DA  I C2    
2577 N N3    . DA  F 10  ? 0.4083 0.5320 0.5605 -0.0369 -0.0220 0.1530  10  DA  I N3    
2578 C C4    . DA  F 10  ? 0.3856 0.5074 0.5436 -0.0426 -0.0231 0.1434  10  DA  I C4    
2579 P P     . DC  F 11  ? 0.4632 0.5963 0.6198 -0.0156 -0.2042 0.1414  11  DC  I P     
2580 O OP1   . DC  F 11  ? 0.7658 0.8967 0.8918 -0.0064 -0.2339 0.1522  11  DC  I OP1   
2581 O OP2   . DC  F 11  ? 0.5694 0.7070 0.7595 -0.0208 -0.2156 0.1263  11  DC  I OP2   
2582 O "O5'" . DC  F 11  ? 0.4521 0.5960 0.6626 -0.0170 -0.1810 0.1383  11  DC  I "O5'" 
2583 C "C5'" . DC  F 11  ? 0.3960 0.5354 0.5776 -0.0140 -0.1622 0.1513  11  DC  I "C5'" 
2584 C "C4'" . DC  F 11  ? 0.5018 0.6506 0.7352 -0.0174 -0.1343 0.1461  11  DC  I "C4'" 
2585 O "O4'" . DC  F 11  ? 0.5332 0.6802 0.7765 -0.0261 -0.1035 0.1389  11  DC  I "O4'" 
2586 C "C3'" . DC  F 11  ? 0.3780 0.5427 0.6871 -0.0167 -0.1491 0.1341  11  DC  I "C3'" 
2587 O "O3'" . DC  F 11  ? 0.4990 0.6680 0.8141 -0.0101 -0.1544 0.1422  11  DC  I "O3'" 
2588 C "C2'" . DC  F 11  ? 0.6762 0.8476 1.0359 -0.0253 -0.1173 0.1222  11  DC  I "C2'" 
2589 C "C1'" . DC  F 11  ? 0.5483 0.7069 0.8539 -0.0290 -0.0854 0.1308  11  DC  I "C1'" 
2590 N N1    . DC  F 11  ? 0.4535 0.6123 0.7810 -0.0382 -0.0574 0.1206  11  DC  I N1    
2591 C C2    . DC  F 11  ? 0.4911 0.6514 0.8330 -0.0421 -0.0203 0.1214  11  DC  I C2    
2592 O O2    . DC  F 11  ? 0.4776 0.6394 0.8163 -0.0380 -0.0119 0.1297  11  DC  I O2    
2593 N N3    . DC  F 11  ? 0.5015 0.6616 0.8610 -0.0501 0.0054  0.1128  11  DC  I N3    
2594 C C4    . DC  F 11  ? 0.5509 0.7094 0.9143 -0.0544 -0.0045 0.1037  11  DC  I C4    
2595 N N4    . DC  F 11  ? 0.5395 0.6979 0.9215 -0.0624 0.0220  0.0954  11  DC  I N4    
2596 C C5    . DC  F 11  ? 0.4743 0.6310 0.8220 -0.0507 -0.0422 0.1027  11  DC  I C5    
2597 C C6    . DC  F 11  ? 0.4305 0.5874 0.7601 -0.0425 -0.0673 0.1115  11  DC  I C6    
2598 P P     . DT  F 12  ? 0.6651 0.8501 1.0506 -0.0069 -0.1756 0.1332  12  DT  I P     
2599 O OP1   . DT  F 12  ? 0.6793 0.8637 1.0424 0.0023  -0.1989 0.1446  12  DT  I OP1   
2600 O OP2   . DT  F 12  ? 0.5409 0.7319 0.9631 -0.0108 -0.1932 0.1185  12  DT  I OP2   
2601 O "O5'" . DT  F 12  ? 0.6987 0.8919 1.1324 -0.0110 -0.1421 0.1288  12  DT  I "O5'" 
2602 C "C5'" . DT  F 12  ? 0.6382 0.8244 1.0379 -0.0110 -0.1122 0.1399  12  DT  I "C5'" 
2603 C "C4'" . DT  F 12  ? 0.6118 0.8057 1.0613 -0.0168 -0.0792 0.1322  12  DT  I "C4'" 
2604 O "O4'" . DT  F 12  ? 0.6161 0.8062 1.0648 -0.0250 -0.0582 0.1247  12  DT  I "O4'" 
2605 C "C3'" . DT  F 12  ? 0.5808 0.7909 1.1099 -0.0169 -0.0892 0.1197  12  DT  I "C3'" 
2606 O "O3'" . DT  F 12  ? 0.5810 0.7966 1.1336 -0.0153 -0.0701 0.1233  12  DT  I "O3'" 
2607 C "C2'" . DT  F 12  ? 0.5525 0.7671 1.1221 -0.0256 -0.0760 0.1045  12  DT  I "C2'" 
2608 C "C1'" . DT  F 12  ? 0.4572 0.6593 0.9760 -0.0303 -0.0451 0.1108  12  DT  I "C1'" 
2609 N N1    . DT  F 12  ? 0.4019 0.6019 0.9278 -0.0379 -0.0370 0.1004  12  DT  I N1    
2610 C C2    . DT  F 12  ? 0.5312 0.7306 1.0700 -0.0449 -0.0006 0.0963  12  DT  I C2    
2611 O O2    . DT  F 12  ? 0.6596 0.8604 1.2046 -0.0452 0.0253  0.1006  12  DT  I O2    
2612 N N3    . DT  F 12  ? 0.4447 0.6422 0.9899 -0.0516 0.0045  0.0867  12  DT  I N3    
2613 C C4    . DT  F 12  ? 0.4329 0.6286 0.9715 -0.0521 -0.0226 0.0809  12  DT  I C4    
2614 O O4    . DT  F 12  ? 0.3364 0.5299 0.8803 -0.0584 -0.0150 0.0725  12  DT  I O4    
2615 C C5    . DT  F 12  ? 0.4475 0.6439 0.9715 -0.0444 -0.0604 0.0857  12  DT  I C5    
2616 C C7    . DT  F 12  ? 0.4381 0.6328 0.9537 -0.0441 -0.0922 0.0800  12  DT  I C7    
2617 C C6    . DT  F 12  ? 0.3713 0.5698 0.8898 -0.0377 -0.0656 0.0952  12  DT  I C6    
2618 P P     . DC  F 13  ? 0.7522 0.9842 1.3812 -0.0133 -0.0811 0.1140  13  DC  I P     
2619 O OP1   . DC  F 13  ? 0.8012 1.0340 1.4220 -0.0074 -0.0765 0.1248  13  DC  I OP1   
2620 O OP2   . DC  F 13  ? 0.7767 1.0144 1.4295 -0.0115 -0.1176 0.1057  13  DC  I OP2   
2621 O "O5'" . DC  F 13  ? 0.8213 1.0606 1.5041 -0.0217 -0.0489 0.1016  13  DC  I "O5'" 
2622 C "C5'" . DC  F 13  ? 0.7779 1.0117 1.4414 -0.0252 -0.0108 0.1069  13  DC  I "C5'" 
2623 C "C4'" . DC  F 13  ? 0.7203 0.9604 1.4330 -0.0335 0.0153  0.0939  13  DC  I "C4'" 
2624 O "O4'" . DC  F 13  ? 0.7020 0.9359 1.3957 -0.0388 0.0146  0.0885  13  DC  I "O4'" 
2625 C "C3'" . DC  F 13  ? 0.8272 1.0774 1.6097 -0.0337 0.0051  0.0791  13  DC  I "C3'" 
2626 O "O3'" . DC  F 13  ? 0.8768 1.1144 1.6596 -0.0337 0.0337  0.0734  13  DC  I "O3'" 
2627 C "C2'" . DC  F 13  ? 0.8369 1.0903 1.6444 -0.0397 -0.0030 0.0662  13  DC  I "C2'" 
2628 C "C1'" . DC  F 13  ? 0.7826 1.0266 1.5400 -0.0446 0.0171  0.0725  13  DC  I "C1'" 
2629 N N1    . DC  F 13  ? 0.7186 0.9585 1.4629 -0.0476 -0.0008 0.0660  13  DC  I N1    
2630 C C2    . DC  F 13  ? 0.5726 0.8089 1.3179 -0.0556 0.0217  0.0590  13  DC  I C2    
2631 O O2    . DC  F 13  ? 0.5711 0.8039 1.3183 -0.0589 0.0556  0.0583  13  DC  I O2    
2632 N N3    . DC  F 13  ? 0.4684 0.7010 1.2023 -0.0583 0.0053  0.0530  13  DC  I N3    
2633 C C4    . DC  F 13  ? 0.4877 0.7205 1.2110 -0.0534 -0.0320 0.0534  13  DC  I C4    
2634 N N4    . DC  F 13  ? 0.3932 0.6224 1.1057 -0.0564 -0.0468 0.0472  13  DC  I N4    
2635 C C5    . DC  F 13  ? 0.6078 0.8445 1.3303 -0.0452 -0.0556 0.0605  13  DC  I C5    
2636 C C6    . DC  F 13  ? 0.6912 0.9313 1.4247 -0.0426 -0.0389 0.0666  13  DC  I C6    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   512 ?   ?   ?   A . n 
A 1 2   GLU 2   513 ?   ?   ?   A . n 
A 1 3   PHE 3   514 ?   ?   ?   A . n 
A 1 4   SER 4   515 ?   ?   ?   A . n 
A 1 5   GLU 5   516 ?   ?   ?   A . n 
A 1 6   SER 6   517 ?   ?   ?   A . n 
A 1 7   ALA 7   518 ?   ?   ?   A . n 
A 1 8   SER 8   519 ?   ?   ?   A . n 
A 1 9   ARG 9   520 ?   ?   ?   A . n 
A 1 10  PRO 10  521 ?   ?   ?   A . n 
A 1 11  ARG 11  522 522 ARG ARG A . n 
A 1 12  LYS 12  523 523 LYS LYS A . n 
A 1 13  PRO 13  524 524 PRO PRO A . n 
A 1 14  CYS 14  525 525 CYS CYS A . n 
A 1 15  ASN 15  526 526 ASN ASN A . n 
A 1 16  CYS 16  527 527 CYS CYS A . n 
A 1 17  THR 17  528 528 THR THR A . n 
A 1 18  LYS 18  529 529 LYS LYS A . n 
A 1 19  SER 19  530 530 SER SER A . n 
A 1 20  LEU 20  531 531 LEU LEU A . n 
A 1 21  CYS 21  532 532 CYS CYS A . n 
A 1 22  LEU 22  533 533 LEU LEU A . n 
A 1 23  LYS 23  534 534 LYS LYS A . n 
A 1 24  LEU 24  535 535 LEU LEU A . n 
A 1 25  TYR 25  536 536 TYR TYR A . n 
A 1 26  CYS 26  537 537 CYS CYS A . n 
A 1 27  ASP 27  538 538 ASP ASP A . n 
A 1 28  CYS 28  539 539 CYS CYS A . n 
A 1 29  PHE 29  540 540 PHE PHE A . n 
A 1 30  ALA 30  541 541 ALA ALA A . n 
A 1 31  ASN 31  542 542 ASN ASN A . n 
A 1 32  GLY 32  543 543 GLY GLY A . n 
A 1 33  GLU 33  544 544 GLU GLU A . n 
A 1 34  PHE 34  545 545 PHE PHE A . n 
A 1 35  CYS 35  546 546 CYS CYS A . n 
A 1 36  ASN 36  547 547 ASN ASN A . n 
A 1 37  ASN 37  548 548 ASN ASN A . n 
A 1 38  CYS 38  549 549 CYS CYS A . n 
A 1 39  ASN 39  550 550 ASN ASN A . n 
A 1 40  CYS 40  551 551 CYS CYS A . n 
A 1 41  THR 41  552 552 THR THR A . n 
A 1 42  ASN 42  553 553 ASN ASN A . n 
A 1 43  CYS 43  554 554 CYS CYS A . n 
A 1 44  TYR 44  555 555 TYR TYR A . n 
A 1 45  ASN 45  556 556 ASN ASN A . n 
A 1 46  ASN 46  557 557 ASN ASN A . n 
A 1 47  LEU 47  558 558 LEU LEU A . n 
A 1 48  GLU 48  559 559 GLU GLU A . n 
A 1 49  HIS 49  560 560 HIS HIS A . n 
A 1 50  GLU 50  561 561 GLU GLU A . n 
A 1 51  ASN 51  562 562 ASN ASN A . n 
A 1 52  GLU 52  563 563 GLU GLU A . n 
A 1 53  ARG 53  564 564 ARG ARG A . n 
A 1 54  GLN 54  565 565 GLN GLN A . n 
A 1 55  LYS 55  566 566 LYS LYS A . n 
A 1 56  ALA 56  567 567 ALA ALA A . n 
A 1 57  ILE 57  568 568 ILE ILE A . n 
A 1 58  LYS 58  569 569 LYS LYS A . n 
A 1 59  ALA 59  570 570 ALA ALA A . n 
A 1 60  CYS 60  571 571 CYS CYS A . n 
A 1 61  LEU 61  572 572 LEU LEU A . n 
A 1 62  ASP 62  573 573 ASP ASP A . n 
A 1 63  ARG 63  574 574 ARG ARG A . n 
A 1 64  ASN 64  575 575 ASN ASN A . n 
A 1 65  PRO 65  576 576 PRO PRO A . n 
A 1 66  GLU 66  577 577 GLU GLU A . n 
A 1 67  ALA 67  578 578 ALA ALA A . n 
A 1 68  PHE 68  579 579 PHE PHE A . n 
A 1 69  LYS 69  580 580 LYS LYS A . n 
A 1 70  PRO 70  581 581 PRO PRO A . n 
A 1 71  LYS 71  582 582 LYS LYS A . n 
A 1 72  ILE 72  583 ?   ?   ?   A . n 
A 1 73  GLY 73  584 ?   ?   ?   A . n 
A 1 74  LYS 74  585 ?   ?   ?   A . n 
A 1 75  GLY 75  586 ?   ?   ?   A . n 
A 1 76  LYS 76  587 ?   ?   ?   A . n 
A 1 77  GLU 77  588 ?   ?   ?   A . n 
A 1 78  GLY 78  589 ?   ?   ?   A . n 
A 1 79  GLU 79  590 ?   ?   ?   A . n 
A 1 80  SER 80  591 ?   ?   ?   A . n 
A 1 81  ASP 81  592 ?   ?   ?   A . n 
A 1 82  ARG 82  593 ?   ?   ?   A . n 
A 1 83  ARG 83  594 ?   ?   ?   A . n 
A 1 84  HIS 84  595 ?   ?   ?   A . n 
A 1 85  SER 85  596 ?   ?   ?   A . n 
A 1 86  LYS 86  597 597 LYS LYS A . n 
A 1 87  GLY 87  598 598 GLY GLY A . n 
A 1 88  CYS 88  599 599 CYS CYS A . n 
A 1 89  ASN 89  600 600 ASN ASN A . n 
A 1 90  CYS 90  601 601 CYS CYS A . n 
A 1 91  LYS 91  602 602 LYS LYS A . n 
A 1 92  ARG 92  603 603 ARG ARG A . n 
A 1 93  SER 93  604 604 SER SER A . n 
A 1 94  GLY 94  605 605 GLY GLY A . n 
A 1 95  CYS 95  606 606 CYS CYS A . n 
A 1 96  LEU 96  607 607 LEU LEU A . n 
A 1 97  LYS 97  608 608 LYS LYS A . n 
A 1 98  ASN 98  609 609 ASN ASN A . n 
A 1 99  TYR 99  610 610 TYR TYR A . n 
A 1 100 CYS 100 611 611 CYS CYS A . n 
A 1 101 GLU 101 612 612 GLU GLU A . n 
A 1 102 CYS 102 613 613 CYS CYS A . n 
A 1 103 TYR 103 614 614 TYR TYR A . n 
A 1 104 GLU 104 615 615 GLU GLU A . n 
A 1 105 ALA 105 616 616 ALA ALA A . n 
A 1 106 LYS 106 617 617 LYS LYS A . n 
A 1 107 ILE 107 618 618 ILE ILE A . n 
A 1 108 MET 108 619 619 MET MET A . n 
A 1 109 CYS 109 620 620 CYS CYS A . n 
A 1 110 SER 110 621 621 SER SER A . n 
A 1 111 SER 111 622 622 SER SER A . n 
A 1 112 ILE 112 623 623 ILE ILE A . n 
A 1 113 CYS 113 624 624 CYS CYS A . n 
A 1 114 LYS 114 625 625 LYS LYS A . n 
A 1 115 CYS 115 626 626 CYS CYS A . n 
A 1 116 ILE 116 627 627 ILE ILE A . n 
A 1 117 GLY 117 628 628 GLY GLY A . n 
A 1 118 CYS 118 629 629 CYS CYS A . n 
A 1 119 LYS 119 630 630 LYS LYS A . n 
A 1 120 ASN 120 631 631 ASN ASN A . n 
A 1 121 PHE 121 632 632 PHE PHE A . n 
A 1 122 GLU 122 633 633 GLU GLU A . n 
A 1 123 GLU 123 634 634 GLU GLU A . n 
A 1 124 SER 124 635 635 SER SER A . n 
A 1 125 PRO 125 636 636 PRO PRO A . n 
A 1 126 GLU 126 637 637 GLU GLU A . n 
A 1 127 ARG 127 638 638 ARG ARG A . n 
A 1 128 LYS 128 639 639 LYS LYS A . n 
A 1 129 THR 129 640 640 THR THR A . n 
A 1 130 LEU 130 641 641 LEU LEU A . n 
A 1 131 MET 131 642 642 MET MET A . n 
A 1 132 HIS 132 643 643 HIS HIS A . n 
A 1 133 LEU 133 644 ?   ?   ?   A . n 
A 1 134 ALA 134 645 ?   ?   ?   A . n 
A 1 135 ASP 135 646 ?   ?   ?   A . n 
B 1 1   GLY 1   512 ?   ?   ?   B . n 
B 1 2   GLU 2   513 ?   ?   ?   B . n 
B 1 3   PHE 3   514 ?   ?   ?   B . n 
B 1 4   SER 4   515 ?   ?   ?   B . n 
B 1 5   GLU 5   516 ?   ?   ?   B . n 
B 1 6   SER 6   517 ?   ?   ?   B . n 
B 1 7   ALA 7   518 ?   ?   ?   B . n 
B 1 8   SER 8   519 ?   ?   ?   B . n 
B 1 9   ARG 9   520 ?   ?   ?   B . n 
B 1 10  PRO 10  521 ?   ?   ?   B . n 
B 1 11  ARG 11  522 522 ARG ARG B . n 
B 1 12  LYS 12  523 523 LYS LYS B . n 
B 1 13  PRO 13  524 524 PRO PRO B . n 
B 1 14  CYS 14  525 525 CYS CYS B . n 
B 1 15  ASN 15  526 526 ASN ASN B . n 
B 1 16  CYS 16  527 527 CYS CYS B . n 
B 1 17  THR 17  528 528 THR THR B . n 
B 1 18  LYS 18  529 529 LYS LYS B . n 
B 1 19  SER 19  530 530 SER SER B . n 
B 1 20  LEU 20  531 531 LEU LEU B . n 
B 1 21  CYS 21  532 532 CYS CYS B . n 
B 1 22  LEU 22  533 533 LEU LEU B . n 
B 1 23  LYS 23  534 534 LYS LYS B . n 
B 1 24  LEU 24  535 535 LEU LEU B . n 
B 1 25  TYR 25  536 536 TYR TYR B . n 
B 1 26  CYS 26  537 537 CYS CYS B . n 
B 1 27  ASP 27  538 538 ASP ASP B . n 
B 1 28  CYS 28  539 539 CYS CYS B . n 
B 1 29  PHE 29  540 540 PHE PHE B . n 
B 1 30  ALA 30  541 541 ALA ALA B . n 
B 1 31  ASN 31  542 542 ASN ASN B . n 
B 1 32  GLY 32  543 543 GLY GLY B . n 
B 1 33  GLU 33  544 544 GLU GLU B . n 
B 1 34  PHE 34  545 545 PHE PHE B . n 
B 1 35  CYS 35  546 546 CYS CYS B . n 
B 1 36  ASN 36  547 547 ASN ASN B . n 
B 1 37  ASN 37  548 548 ASN ASN B . n 
B 1 38  CYS 38  549 549 CYS CYS B . n 
B 1 39  ASN 39  550 550 ASN ASN B . n 
B 1 40  CYS 40  551 551 CYS CYS B . n 
B 1 41  THR 41  552 552 THR THR B . n 
B 1 42  ASN 42  553 553 ASN ASN B . n 
B 1 43  CYS 43  554 554 CYS CYS B . n 
B 1 44  TYR 44  555 555 TYR TYR B . n 
B 1 45  ASN 45  556 556 ASN ASN B . n 
B 1 46  ASN 46  557 557 ASN ASN B . n 
B 1 47  LEU 47  558 558 LEU LEU B . n 
B 1 48  GLU 48  559 559 GLU GLU B . n 
B 1 49  HIS 49  560 560 HIS HIS B . n 
B 1 50  GLU 50  561 561 GLU GLU B . n 
B 1 51  ASN 51  562 562 ASN ASN B . n 
B 1 52  GLU 52  563 563 GLU GLU B . n 
B 1 53  ARG 53  564 564 ARG ARG B . n 
B 1 54  GLN 54  565 565 GLN GLN B . n 
B 1 55  LYS 55  566 566 LYS LYS B . n 
B 1 56  ALA 56  567 567 ALA ALA B . n 
B 1 57  ILE 57  568 568 ILE ILE B . n 
B 1 58  LYS 58  569 569 LYS LYS B . n 
B 1 59  ALA 59  570 570 ALA ALA B . n 
B 1 60  CYS 60  571 571 CYS CYS B . n 
B 1 61  LEU 61  572 572 LEU LEU B . n 
B 1 62  ASP 62  573 573 ASP ASP B . n 
B 1 63  ARG 63  574 574 ARG ARG B . n 
B 1 64  ASN 64  575 575 ASN ASN B . n 
B 1 65  PRO 65  576 576 PRO PRO B . n 
B 1 66  GLU 66  577 577 GLU GLU B . n 
B 1 67  ALA 67  578 578 ALA ALA B . n 
B 1 68  PHE 68  579 579 PHE PHE B . n 
B 1 69  LYS 69  580 580 LYS LYS B . n 
B 1 70  PRO 70  581 581 PRO PRO B . n 
B 1 71  LYS 71  582 ?   ?   ?   B . n 
B 1 72  ILE 72  583 ?   ?   ?   B . n 
B 1 73  GLY 73  584 ?   ?   ?   B . n 
B 1 74  LYS 74  585 ?   ?   ?   B . n 
B 1 75  GLY 75  586 ?   ?   ?   B . n 
B 1 76  LYS 76  587 ?   ?   ?   B . n 
B 1 77  GLU 77  588 ?   ?   ?   B . n 
B 1 78  GLY 78  589 ?   ?   ?   B . n 
B 1 79  GLU 79  590 ?   ?   ?   B . n 
B 1 80  SER 80  591 ?   ?   ?   B . n 
B 1 81  ASP 81  592 ?   ?   ?   B . n 
B 1 82  ARG 82  593 ?   ?   ?   B . n 
B 1 83  ARG 83  594 ?   ?   ?   B . n 
B 1 84  HIS 84  595 ?   ?   ?   B . n 
B 1 85  SER 85  596 ?   ?   ?   B . n 
B 1 86  LYS 86  597 597 LYS LYS B . n 
B 1 87  GLY 87  598 598 GLY GLY B . n 
B 1 88  CYS 88  599 599 CYS CYS B . n 
B 1 89  ASN 89  600 600 ASN ASN B . n 
B 1 90  CYS 90  601 601 CYS CYS B . n 
B 1 91  LYS 91  602 602 LYS LYS B . n 
B 1 92  ARG 92  603 603 ARG ARG B . n 
B 1 93  SER 93  604 604 SER SER B . n 
B 1 94  GLY 94  605 605 GLY GLY B . n 
B 1 95  CYS 95  606 606 CYS CYS B . n 
B 1 96  LEU 96  607 607 LEU LEU B . n 
B 1 97  LYS 97  608 608 LYS LYS B . n 
B 1 98  ASN 98  609 609 ASN ASN B . n 
B 1 99  TYR 99  610 610 TYR TYR B . n 
B 1 100 CYS 100 611 611 CYS CYS B . n 
B 1 101 GLU 101 612 612 GLU GLU B . n 
B 1 102 CYS 102 613 613 CYS CYS B . n 
B 1 103 TYR 103 614 614 TYR TYR B . n 
B 1 104 GLU 104 615 615 GLU GLU B . n 
B 1 105 ALA 105 616 616 ALA ALA B . n 
B 1 106 LYS 106 617 617 LYS LYS B . n 
B 1 107 ILE 107 618 618 ILE ILE B . n 
B 1 108 MET 108 619 619 MET MET B . n 
B 1 109 CYS 109 620 620 CYS CYS B . n 
B 1 110 SER 110 621 621 SER SER B . n 
B 1 111 SER 111 622 622 SER SER B . n 
B 1 112 ILE 112 623 623 ILE ILE B . n 
B 1 113 CYS 113 624 624 CYS CYS B . n 
B 1 114 LYS 114 625 625 LYS LYS B . n 
B 1 115 CYS 115 626 626 CYS CYS B . n 
B 1 116 ILE 116 627 627 ILE ILE B . n 
B 1 117 GLY 117 628 628 GLY GLY B . n 
B 1 118 CYS 118 629 629 CYS CYS B . n 
B 1 119 LYS 119 630 630 LYS LYS B . n 
B 1 120 ASN 120 631 631 ASN ASN B . n 
B 1 121 PHE 121 632 632 PHE PHE B . n 
B 1 122 GLU 122 633 633 GLU GLU B . n 
B 1 123 GLU 123 634 634 GLU GLU B . n 
B 1 124 SER 124 635 635 SER SER B . n 
B 1 125 PRO 125 636 636 PRO PRO B . n 
B 1 126 GLU 126 637 637 GLU GLU B . n 
B 1 127 ARG 127 638 638 ARG ARG B . n 
B 1 128 LYS 128 639 639 LYS LYS B . n 
B 1 129 THR 129 640 640 THR THR B . n 
B 1 130 LEU 130 641 641 LEU LEU B . n 
B 1 131 MET 131 642 642 MET MET B . n 
B 1 132 HIS 132 643 643 HIS HIS B . n 
B 1 133 LEU 133 644 644 LEU LEU B . n 
B 1 134 ALA 134 645 ?   ?   ?   B . n 
B 1 135 ASP 135 646 ?   ?   ?   B . n 
C 2 1   DG  1   1   1   DG  DG  C . n 
C 2 2   DA  2   2   2   DA  DA  C . n 
C 2 3   DG  3   3   3   DG  DG  C . n 
C 2 4   DT  4   4   4   DT  DT  C . n 
C 2 5   DT  5   5   5   DT  DT  C . n 
C 2 6   DT  6   6   6   DT  DT  C . n 
C 2 7   DG  7   7   7   DG  DG  C . n 
C 2 8   DA  8   8   8   DA  DA  C . n 
C 2 9   DA  9   9   9   DA  DA  C . n 
C 2 10  DA  10  10  10  DA  DA  C . n 
C 2 11  DC  11  11  11  DC  DC  C . n 
C 2 12  DT  12  12  12  DT  DT  C . n 
D 3 1   DC  1   1   1   DC  DC  D . n 
D 3 2   DA  2   2   2   DA  DA  D . n 
D 3 3   DG  3   3   3   DG  DG  D . n 
D 3 4   DT  4   4   4   DT  DT  D . n 
D 3 5   DT  5   5   5   DT  DT  D . n 
D 3 6   DT  6   6   6   DT  DT  D . n 
D 3 7   DC  7   7   7   DC  DC  D . n 
D 3 8   DA  8   8   8   DA  DA  D . n 
D 3 9   DA  9   9   9   DA  DA  D . n 
D 3 10  DA  10  10  10  DA  DA  D . n 
D 3 11  DC  11  11  11  DC  DC  D . n 
D 3 12  DT  12  12  12  DT  DT  D . n 
D 3 13  DC  13  13  13  DC  DC  D . n 
E 2 1   DG  1   1   1   DG  DG  H . n 
E 2 2   DA  2   2   2   DA  DA  H . n 
E 2 3   DG  3   3   3   DG  DG  H . n 
E 2 4   DT  4   4   4   DT  DT  H . n 
E 2 5   DT  5   5   5   DT  DT  H . n 
E 2 6   DT  6   6   6   DT  DT  H . n 
E 2 7   DG  7   7   7   DG  DG  H . n 
E 2 8   DA  8   8   8   DA  DA  H . n 
E 2 9   DA  9   9   9   DA  DA  H . n 
E 2 10  DA  10  10  10  DA  DA  H . n 
E 2 11  DC  11  11  11  DC  DC  H . n 
E 2 12  DT  12  12  12  DT  DT  H . n 
F 3 1   DC  1   1   1   DC  DC  I . n 
F 3 2   DA  2   2   2   DA  DA  I . n 
F 3 3   DG  3   3   3   DG  DG  I . n 
F 3 4   DT  4   4   4   DT  DT  I . n 
F 3 5   DT  5   5   5   DT  DT  I . n 
F 3 6   DT  6   6   6   DT  DT  I . n 
F 3 7   DC  7   7   7   DC  DC  I . n 
F 3 8   DA  8   8   8   DA  DA  I . n 
F 3 9   DA  9   9   9   DA  DA  I . n 
F 3 10  DA  10  10  10  DA  DA  I . n 
F 3 11  DC  11  11  11  DC  DC  I . n 
F 3 12  DT  12  12  12  DT  DT  I . n 
F 3 13  DC  13  13  13  DC  DC  I . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 ZN  1  701 701 ZN  ZN  A . 
H 4 ZN  1  702 702 ZN  ZN  A . 
I 4 ZN  1  703 703 ZN  ZN  A . 
J 4 ZN  1  704 704 ZN  ZN  A . 
K 4 ZN  1  705 705 ZN  ZN  A . 
L 4 ZN  1  706 706 ZN  ZN  A . 
M 4 ZN  1  701 701 ZN  ZN  B . 
N 4 ZN  1  702 702 ZN  ZN  B . 
O 4 ZN  1  703 703 ZN  ZN  B . 
P 4 ZN  1  704 704 ZN  ZN  B . 
Q 4 ZN  1  705 705 ZN  ZN  B . 
R 4 ZN  1  706 706 ZN  ZN  B . 
S 5 HOH 1  801 9   HOH HOH A . 
S 5 HOH 2  802 30  HOH HOH A . 
S 5 HOH 3  803 46  HOH HOH A . 
S 5 HOH 4  804 45  HOH HOH A . 
S 5 HOH 5  805 23  HOH HOH A . 
S 5 HOH 6  806 15  HOH HOH A . 
S 5 HOH 7  807 52  HOH HOH A . 
S 5 HOH 8  808 43  HOH HOH A . 
S 5 HOH 9  809 11  HOH HOH A . 
T 5 HOH 1  801 5   HOH HOH B . 
T 5 HOH 2  802 56  HOH HOH B . 
T 5 HOH 3  803 20  HOH HOH B . 
T 5 HOH 4  804 27  HOH HOH B . 
T 5 HOH 5  805 37  HOH HOH B . 
T 5 HOH 6  806 33  HOH HOH B . 
T 5 HOH 7  807 36  HOH HOH B . 
T 5 HOH 8  808 38  HOH HOH B . 
T 5 HOH 9  809 51  HOH HOH B . 
T 5 HOH 10 810 55  HOH HOH B . 
T 5 HOH 11 811 4   HOH HOH B . 
T 5 HOH 12 812 39  HOH HOH B . 
T 5 HOH 13 813 41  HOH HOH B . 
T 5 HOH 14 814 54  HOH HOH B . 
T 5 HOH 15 815 44  HOH HOH B . 
U 5 HOH 1  101 2   HOH HOH C . 
U 5 HOH 2  102 29  HOH HOH C . 
U 5 HOH 3  103 17  HOH HOH C . 
U 5 HOH 4  104 31  HOH HOH C . 
V 5 HOH 1  101 47  HOH HOH D . 
V 5 HOH 2  102 13  HOH HOH D . 
V 5 HOH 3  103 34  HOH HOH D . 
V 5 HOH 4  104 6   HOH HOH D . 
V 5 HOH 5  105 25  HOH HOH D . 
V 5 HOH 6  106 18  HOH HOH D . 
V 5 HOH 7  107 53  HOH HOH D . 
V 5 HOH 8  108 22  HOH HOH D . 
V 5 HOH 9  109 35  HOH HOH D . 
V 5 HOH 10 110 8   HOH HOH D . 
V 5 HOH 11 111 40  HOH HOH D . 
V 5 HOH 12 112 50  HOH HOH D . 
W 5 HOH 1  101 24  HOH HOH H . 
W 5 HOH 2  102 21  HOH HOH H . 
W 5 HOH 3  103 7   HOH HOH H . 
W 5 HOH 4  104 10  HOH HOH H . 
W 5 HOH 5  105 12  HOH HOH H . 
W 5 HOH 6  106 28  HOH HOH H . 
W 5 HOH 7  107 48  HOH HOH H . 
W 5 HOH 8  108 32  HOH HOH H . 
W 5 HOH 9  109 3   HOH HOH H . 
W 5 HOH 10 110 1   HOH HOH H . 
X 5 HOH 1  101 14  HOH HOH I . 
X 5 HOH 2  102 16  HOH HOH I . 
X 5 HOH 3  103 42  HOH HOH I . 
X 5 HOH 4  104 26  HOH HOH I . 
X 5 HOH 5  105 19  HOH HOH I . 
X 5 HOH 6  106 49  HOH HOH I . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E,F,G,H,I,J,K,L,S,W,X 
2 1 B,C,D,M,N,O,P,Q,R,T,U,V 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3100  ? 
1 MORE         -28   ? 
1 'SSA (A^2)'  10740 ? 
2 'ABSA (A^2)' 3170  ? 
2 MORE         -28   ? 
2 'SSA (A^2)'  10700 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 14  ? A CYS 525 ? 1_555 ZN ? G ZN . ? A ZN 701 ? 1_555 SG ? A CYS 16  ? A CYS 527 ? 1_555 106.2 ? 
2  SG ? A CYS 14  ? A CYS 525 ? 1_555 ZN ? G ZN . ? A ZN 701 ? 1_555 SG ? A CYS 21  ? A CYS 532 ? 1_555 106.4 ? 
3  SG ? A CYS 16  ? A CYS 527 ? 1_555 ZN ? G ZN . ? A ZN 701 ? 1_555 SG ? A CYS 21  ? A CYS 532 ? 1_555 107.0 ? 
4  SG ? A CYS 14  ? A CYS 525 ? 1_555 ZN ? G ZN . ? A ZN 701 ? 1_555 SG ? A CYS 26  ? A CYS 537 ? 1_555 118.0 ? 
5  SG ? A CYS 16  ? A CYS 527 ? 1_555 ZN ? G ZN . ? A ZN 701 ? 1_555 SG ? A CYS 26  ? A CYS 537 ? 1_555 107.9 ? 
6  SG ? A CYS 21  ? A CYS 532 ? 1_555 ZN ? G ZN . ? A ZN 701 ? 1_555 SG ? A CYS 26  ? A CYS 537 ? 1_555 110.7 ? 
7  SG ? A CYS 14  ? A CYS 525 ? 1_555 ZN ? I ZN . ? A ZN 703 ? 1_555 SG ? A CYS 28  ? A CYS 539 ? 1_555 114.2 ? 
8  SG ? A CYS 14  ? A CYS 525 ? 1_555 ZN ? I ZN . ? A ZN 703 ? 1_555 SG ? A CYS 35  ? A CYS 546 ? 1_555 113.5 ? 
9  SG ? A CYS 28  ? A CYS 539 ? 1_555 ZN ? I ZN . ? A ZN 703 ? 1_555 SG ? A CYS 35  ? A CYS 546 ? 1_555 111.4 ? 
10 SG ? A CYS 14  ? A CYS 525 ? 1_555 ZN ? I ZN . ? A ZN 703 ? 1_555 SG ? A CYS 38  ? A CYS 549 ? 1_555 103.4 ? 
11 SG ? A CYS 28  ? A CYS 539 ? 1_555 ZN ? I ZN . ? A ZN 703 ? 1_555 SG ? A CYS 38  ? A CYS 549 ? 1_555 97.1  ? 
12 SG ? A CYS 35  ? A CYS 546 ? 1_555 ZN ? I ZN . ? A ZN 703 ? 1_555 SG ? A CYS 38  ? A CYS 549 ? 1_555 116.0 ? 
13 SG ? A CYS 21  ? A CYS 532 ? 1_555 ZN ? H ZN . ? A ZN 702 ? 1_555 SG ? A CYS 35  ? A CYS 546 ? 1_555 111.8 ? 
14 SG ? A CYS 21  ? A CYS 532 ? 1_555 ZN ? H ZN . ? A ZN 702 ? 1_555 SG ? A CYS 40  ? A CYS 551 ? 1_555 109.1 ? 
15 SG ? A CYS 35  ? A CYS 546 ? 1_555 ZN ? H ZN . ? A ZN 702 ? 1_555 SG ? A CYS 40  ? A CYS 551 ? 1_555 118.4 ? 
16 SG ? A CYS 21  ? A CYS 532 ? 1_555 ZN ? H ZN . ? A ZN 702 ? 1_555 SG ? A CYS 43  ? A CYS 554 ? 1_555 111.5 ? 
17 SG ? A CYS 35  ? A CYS 546 ? 1_555 ZN ? H ZN . ? A ZN 702 ? 1_555 SG ? A CYS 43  ? A CYS 554 ? 1_555 98.8  ? 
18 SG ? A CYS 40  ? A CYS 551 ? 1_555 ZN ? H ZN . ? A ZN 702 ? 1_555 SG ? A CYS 43  ? A CYS 554 ? 1_555 106.6 ? 
19 SG ? A CYS 88  ? A CYS 599 ? 1_555 ZN ? J ZN . ? A ZN 704 ? 1_555 SG ? A CYS 90  ? A CYS 601 ? 1_555 99.5  ? 
20 SG ? A CYS 88  ? A CYS 599 ? 1_555 ZN ? J ZN . ? A ZN 704 ? 1_555 SG ? A CYS 95  ? A CYS 606 ? 1_555 107.5 ? 
21 SG ? A CYS 90  ? A CYS 601 ? 1_555 ZN ? J ZN . ? A ZN 704 ? 1_555 SG ? A CYS 95  ? A CYS 606 ? 1_555 107.0 ? 
22 SG ? A CYS 88  ? A CYS 599 ? 1_555 ZN ? J ZN . ? A ZN 704 ? 1_555 SG ? A CYS 100 ? A CYS 611 ? 1_555 118.9 ? 
23 SG ? A CYS 90  ? A CYS 601 ? 1_555 ZN ? J ZN . ? A ZN 704 ? 1_555 SG ? A CYS 100 ? A CYS 611 ? 1_555 109.0 ? 
24 SG ? A CYS 95  ? A CYS 606 ? 1_555 ZN ? J ZN . ? A ZN 704 ? 1_555 SG ? A CYS 100 ? A CYS 611 ? 1_555 113.6 ? 
25 SG ? A CYS 88  ? A CYS 599 ? 1_555 ZN ? L ZN . ? A ZN 706 ? 1_555 SG ? A CYS 102 ? A CYS 613 ? 1_555 126.5 ? 
26 SG ? A CYS 88  ? A CYS 599 ? 1_555 ZN ? L ZN . ? A ZN 706 ? 1_555 SG ? A CYS 109 ? A CYS 620 ? 1_555 97.8  ? 
27 SG ? A CYS 102 ? A CYS 613 ? 1_555 ZN ? L ZN . ? A ZN 706 ? 1_555 SG ? A CYS 109 ? A CYS 620 ? 1_555 114.7 ? 
28 SG ? A CYS 88  ? A CYS 599 ? 1_555 ZN ? L ZN . ? A ZN 706 ? 1_555 SG ? A CYS 113 ? A CYS 624 ? 1_555 109.2 ? 
29 SG ? A CYS 102 ? A CYS 613 ? 1_555 ZN ? L ZN . ? A ZN 706 ? 1_555 SG ? A CYS 113 ? A CYS 624 ? 1_555 97.6  ? 
30 SG ? A CYS 109 ? A CYS 620 ? 1_555 ZN ? L ZN . ? A ZN 706 ? 1_555 SG ? A CYS 113 ? A CYS 624 ? 1_555 111.1 ? 
31 SG ? A CYS 95  ? A CYS 606 ? 1_555 ZN ? K ZN . ? A ZN 705 ? 1_555 SG ? A CYS 109 ? A CYS 620 ? 1_555 109.6 ? 
32 SG ? A CYS 95  ? A CYS 606 ? 1_555 ZN ? K ZN . ? A ZN 705 ? 1_555 SG ? A CYS 115 ? A CYS 626 ? 1_555 109.4 ? 
33 SG ? A CYS 109 ? A CYS 620 ? 1_555 ZN ? K ZN . ? A ZN 705 ? 1_555 SG ? A CYS 115 ? A CYS 626 ? 1_555 106.6 ? 
34 SG ? A CYS 95  ? A CYS 606 ? 1_555 ZN ? K ZN . ? A ZN 705 ? 1_555 SG ? A CYS 118 ? A CYS 629 ? 1_555 108.9 ? 
35 SG ? A CYS 109 ? A CYS 620 ? 1_555 ZN ? K ZN . ? A ZN 705 ? 1_555 SG ? A CYS 118 ? A CYS 629 ? 1_555 105.9 ? 
36 SG ? A CYS 115 ? A CYS 626 ? 1_555 ZN ? K ZN . ? A ZN 705 ? 1_555 SG ? A CYS 118 ? A CYS 629 ? 1_555 116.2 ? 
37 SG ? B CYS 14  ? B CYS 525 ? 1_555 ZN ? O ZN . ? B ZN 703 ? 1_555 SG ? B CYS 28  ? B CYS 539 ? 1_555 115.1 ? 
38 SG ? B CYS 14  ? B CYS 525 ? 1_555 ZN ? O ZN . ? B ZN 703 ? 1_555 SG ? B CYS 35  ? B CYS 546 ? 1_555 98.8  ? 
39 SG ? B CYS 28  ? B CYS 539 ? 1_555 ZN ? O ZN . ? B ZN 703 ? 1_555 SG ? B CYS 35  ? B CYS 546 ? 1_555 112.1 ? 
40 SG ? B CYS 14  ? B CYS 525 ? 1_555 ZN ? O ZN . ? B ZN 703 ? 1_555 SG ? B CYS 38  ? B CYS 549 ? 1_555 110.9 ? 
41 SG ? B CYS 28  ? B CYS 539 ? 1_555 ZN ? O ZN . ? B ZN 703 ? 1_555 SG ? B CYS 38  ? B CYS 549 ? 1_555 99.3  ? 
42 SG ? B CYS 35  ? B CYS 546 ? 1_555 ZN ? O ZN . ? B ZN 703 ? 1_555 SG ? B CYS 38  ? B CYS 549 ? 1_555 121.6 ? 
43 SG ? B CYS 14  ? B CYS 525 ? 1_555 ZN ? M ZN . ? B ZN 701 ? 1_555 SG ? B CYS 16  ? B CYS 527 ? 1_555 97.1  ? 
44 SG ? B CYS 14  ? B CYS 525 ? 1_555 ZN ? M ZN . ? B ZN 701 ? 1_555 SG ? B CYS 21  ? B CYS 532 ? 1_555 102.5 ? 
45 SG ? B CYS 16  ? B CYS 527 ? 1_555 ZN ? M ZN . ? B ZN 701 ? 1_555 SG ? B CYS 21  ? B CYS 532 ? 1_555 103.4 ? 
46 SG ? B CYS 14  ? B CYS 525 ? 1_555 ZN ? M ZN . ? B ZN 701 ? 1_555 SG ? B CYS 26  ? B CYS 537 ? 1_555 120.8 ? 
47 SG ? B CYS 16  ? B CYS 527 ? 1_555 ZN ? M ZN . ? B ZN 701 ? 1_555 SG ? B CYS 26  ? B CYS 537 ? 1_555 116.4 ? 
48 SG ? B CYS 21  ? B CYS 532 ? 1_555 ZN ? M ZN . ? B ZN 701 ? 1_555 SG ? B CYS 26  ? B CYS 537 ? 1_555 113.9 ? 
49 SG ? B CYS 21  ? B CYS 532 ? 1_555 ZN ? N ZN . ? B ZN 702 ? 1_555 SG ? B CYS 35  ? B CYS 546 ? 1_555 108.8 ? 
50 SG ? B CYS 21  ? B CYS 532 ? 1_555 ZN ? N ZN . ? B ZN 702 ? 1_555 SG ? B CYS 40  ? B CYS 551 ? 1_555 109.9 ? 
51 SG ? B CYS 35  ? B CYS 546 ? 1_555 ZN ? N ZN . ? B ZN 702 ? 1_555 SG ? B CYS 40  ? B CYS 551 ? 1_555 122.7 ? 
52 SG ? B CYS 21  ? B CYS 532 ? 1_555 ZN ? N ZN . ? B ZN 702 ? 1_555 SG ? B CYS 43  ? B CYS 554 ? 1_555 113.1 ? 
53 SG ? B CYS 35  ? B CYS 546 ? 1_555 ZN ? N ZN . ? B ZN 702 ? 1_555 SG ? B CYS 43  ? B CYS 554 ? 1_555 95.0  ? 
54 SG ? B CYS 40  ? B CYS 551 ? 1_555 ZN ? N ZN . ? B ZN 702 ? 1_555 SG ? B CYS 43  ? B CYS 554 ? 1_555 106.6 ? 
55 SG ? B CYS 88  ? B CYS 599 ? 1_555 ZN ? R ZN . ? B ZN 706 ? 1_555 SG ? B CYS 102 ? B CYS 613 ? 1_555 130.1 ? 
56 SG ? B CYS 88  ? B CYS 599 ? 1_555 ZN ? R ZN . ? B ZN 706 ? 1_555 SG ? B CYS 109 ? B CYS 620 ? 1_555 98.6  ? 
57 SG ? B CYS 102 ? B CYS 613 ? 1_555 ZN ? R ZN . ? B ZN 706 ? 1_555 SG ? B CYS 109 ? B CYS 620 ? 1_555 116.2 ? 
58 SG ? B CYS 88  ? B CYS 599 ? 1_555 ZN ? R ZN . ? B ZN 706 ? 1_555 SG ? B CYS 113 ? B CYS 624 ? 1_555 101.9 ? 
59 SG ? B CYS 102 ? B CYS 613 ? 1_555 ZN ? R ZN . ? B ZN 706 ? 1_555 SG ? B CYS 113 ? B CYS 624 ? 1_555 99.7  ? 
60 SG ? B CYS 109 ? B CYS 620 ? 1_555 ZN ? R ZN . ? B ZN 706 ? 1_555 SG ? B CYS 113 ? B CYS 624 ? 1_555 108.4 ? 
61 SG ? B CYS 88  ? B CYS 599 ? 1_555 ZN ? P ZN . ? B ZN 704 ? 1_555 SG ? B CYS 90  ? B CYS 601 ? 1_555 108.2 ? 
62 SG ? B CYS 88  ? B CYS 599 ? 1_555 ZN ? P ZN . ? B ZN 704 ? 1_555 SG ? B CYS 95  ? B CYS 606 ? 1_555 101.6 ? 
63 SG ? B CYS 90  ? B CYS 601 ? 1_555 ZN ? P ZN . ? B ZN 704 ? 1_555 SG ? B CYS 95  ? B CYS 606 ? 1_555 98.9  ? 
64 SG ? B CYS 88  ? B CYS 599 ? 1_555 ZN ? P ZN . ? B ZN 704 ? 1_555 SG ? B CYS 100 ? B CYS 611 ? 1_555 121.4 ? 
65 SG ? B CYS 90  ? B CYS 601 ? 1_555 ZN ? P ZN . ? B ZN 704 ? 1_555 SG ? B CYS 100 ? B CYS 611 ? 1_555 110.5 ? 
66 SG ? B CYS 95  ? B CYS 606 ? 1_555 ZN ? P ZN . ? B ZN 704 ? 1_555 SG ? B CYS 100 ? B CYS 611 ? 1_555 113.6 ? 
67 SG ? B CYS 95  ? B CYS 606 ? 1_555 ZN ? Q ZN . ? B ZN 705 ? 1_555 SG ? B CYS 109 ? B CYS 620 ? 1_555 115.9 ? 
68 SG ? B CYS 95  ? B CYS 606 ? 1_555 ZN ? Q ZN . ? B ZN 705 ? 1_555 SG ? B CYS 115 ? B CYS 626 ? 1_555 114.2 ? 
69 SG ? B CYS 109 ? B CYS 620 ? 1_555 ZN ? Q ZN . ? B ZN 705 ? 1_555 SG ? B CYS 115 ? B CYS 626 ? 1_555 112.6 ? 
70 SG ? B CYS 95  ? B CYS 606 ? 1_555 ZN ? Q ZN . ? B ZN 705 ? 1_555 SG ? B CYS 118 ? B CYS 629 ? 1_555 105.7 ? 
71 SG ? B CYS 109 ? B CYS 620 ? 1_555 ZN ? Q ZN . ? B ZN 705 ? 1_555 SG ? B CYS 118 ? B CYS 629 ? 1_555 92.3  ? 
72 SG ? B CYS 115 ? B CYS 626 ? 1_555 ZN ? Q ZN . ? B ZN 705 ? 1_555 SG ? B CYS 118 ? B CYS 629 ? 1_555 113.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-08-03 
2 'Structure model' 1 1 2016-08-10 
3 'Structure model' 1 2 2017-09-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_audit_support    
2 3 'Structure model' pdbx_struct_oper_list 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1  'X-RAY DIFFRACTION' ? refined 1.1342   44.2688 -5.7180  0.4807 ? -0.0554 ? -0.0108 ? 0.3583 ? -0.0333 ? 0.4028 ? 0.9520 ? 
-0.1770 ? 0.3307  ? 0.2319 ? -0.1785 ? 0.1249 ? -0.0473 ? -0.1839 ? -0.2397 ? -0.0074 ? -0.0060 ? -0.3818 ? -0.1445 ? -0.2310 ? 
-0.0000 ? 
2  'X-RAY DIFFRACTION' ? refined -12.4870 43.6079 -3.0799  0.7894 ? 0.0782  ? 0.0663  ? 0.6268 ? -0.1046 ? 0.5772 ? 0.3318 ? 
-0.0782 ? 0.1134  ? 0.0463 ? -0.0650 ? 0.0482 ? 0.3026  ? 0.3240  ? 0.2346  ? 0.3085  ? 0.1479  ? 0.3255  ? -0.2463 ? -0.7583 ? 
0.0004  ? 
3  'X-RAY DIFFRACTION' ? refined 1.3217   20.7394 6.6599   0.5414 ? -0.0510 ? 0.0306  ? 0.3392 ? 0.0465  ? 0.4285 ? 0.6829 ? 
-0.1218 ? 0.8932  ? 0.8953 ? -0.0731 ? 0.6670 ? 0.2335  ? -0.1013 ? -0.0104 ? 0.6469  ? -0.2039 ? 0.1826  ? -0.1675 ? 0.1752  ? 
-0.0000 ? 
4  'X-RAY DIFFRACTION' ? refined -15.9990 50.7269 13.4203  0.5324 ? -0.0195 ? -0.0463 ? 0.4071 ? -0.0068 ? 0.4235 ? 0.7065 ? 
0.1360  ? 0.0650  ? 0.0163 ? 0.0470  ? 0.4007 ? 0.1082  ? -0.0472 ? -0.2066 ? -0.2002 ? 0.1810  ? 0.2510  ? 0.2485  ? -0.1594 ? 
-0.0001 ? 
5  'X-RAY DIFFRACTION' ? refined -4.8103  44.6084 18.9173  0.6406 ? 0.0626  ? 0.0338  ? 0.4613 ? -0.0785 ? 0.3781 ? 1.3659 ? 
0.5413  ? -0.4360 ? 0.2895 ? -0.2446 ? 0.2477 ? 0.0279  ? -0.4916 ? -0.8066 ? -0.1856 ? -0.1105 ? -0.4630 ? -0.5143 ? 0.3610  ? 
-0.0542 ? 
6  'X-RAY DIFFRACTION' ? refined -17.6004 36.8686 38.9310  0.5743 ? 0.0593  ? 0.0574  ? 0.5199 ? 0.0838  ? 0.3725 ? 0.1694 ? 
0.2481  ? -0.3197 ? 0.1961 ? -0.1407 ? 0.7195 ? 0.1490  ? 0.0589  ? -0.0951 ? 0.2027  ? -0.0293 ? 0.1026  ? -0.0065 ? 0.2438  ? 
-0.0001 ? 
7  'X-RAY DIFFRACTION' ? refined -24.0163 55.9885 32.8997  0.3581 ? -0.0255 ? -0.0648 ? 0.5626 ? 0.0491  ? 0.5520 ? 0.4293 ? 
0.2846  ? -0.0137 ? 0.5969 ? -0.0869 ? 0.2735 ? -0.5050 ? 0.0936  ? 0.9311  ? -0.1393 ? 0.5584  ? 0.0942  ? 0.1525  ? 0.0435  ? 
-0.0015 ? 
8  'X-RAY DIFFRACTION' ? refined -5.0039  53.1102 27.2071  0.3550 ? 0.0563  ? -0.0229 ? 0.6933 ? 0.1646  ? 0.5934 ? 0.3134 ? 
0.0780  ? -0.1029 ? 0.1837 ? -0.3223 ? 0.5803 ? -0.4756 ? -0.8677 ? -0.4979 ? -0.8517 ? -0.1139 ? -0.2928 ? 0.5534  ? 1.0660  ? 
-0.0758 ? 
9  'X-RAY DIFFRACTION' ? refined -3.6527  56.5603 34.1054  0.5608 ? 0.0522  ? -0.0934 ? 0.7370 ? -0.0896 ? 0.4491 ? 1.0908 ? 
-0.4870 ? -0.1429 ? 0.4986 ? -0.0462 ? 0.0849 ? -1.1556 ? -0.9469 ? -0.2738 ? 0.4669  ? 0.4495  ? -0.1389 ? -0.4606 ? 0.4934  ? 
-0.0800 ? 
10 'X-RAY DIFFRACTION' ? refined -23.3299 51.9515 30.1016  0.3623 ? -0.0289 ? -0.0151 ? 0.5899 ? 0.0039  ? 0.4975 ? 0.1695 ? 
-0.0003 ? 0.1896  ? 0.3085 ? 0.0411  ? 0.1876 ? -0.2022 ? -0.1013 ? 0.4895  ? -0.3943 ? 0.3629  ? 0.4832  ? 0.1734  ? -0.4169 ? 
0.0003  ? 
11 'X-RAY DIFFRACTION' ? refined 12.7736  26.2130 -14.3467 0.5004 ? -0.0166 ? 0.0694  ? 0.8240 ? 0.1400  ? 0.6821 ? 0.2851 ? 
0.2413  ? 0.0942  ? 0.1728 ? 0.0550  ? 0.1642 ? -0.8240 ? 1.1802  ? -0.5333 ? -0.4390 ? -0.2208 ? -0.6888 ? 0.0008  ? 0.9909  ? 
-0.0086 ? 
12 'X-RAY DIFFRACTION' ? refined -6.6208  28.3019 -7.9822  0.2025 ? -0.0386 ? -0.0069 ? 0.5513 ? -0.0150 ? 0.5776 ? 0.0109 ? 
0.0667  ? -0.0420 ? 0.7658 ? 0.4342  ? 0.5211 ? -0.4784 ? 0.8754  ? -0.7715 ? 0.5847  ? 0.3056  ? 0.9841  ? 0.0384  ? -0.2553 ? 
-0.0921 ? 
13 'X-RAY DIFFRACTION' ? refined -6.1403  27.1365 -11.3535 0.4154 ? -0.0149 ? 0.0433  ? 0.3619 ? -0.0622 ? 0.5037 ? 0.2565 ? 
-0.2957 ? -0.2902 ? 0.7937 ? -0.0505 ? 0.5390 ? -0.3436 ? 0.2038  ? -0.5417 ? 0.1218  ? 0.0591  ? -0.3058 ? 0.3376  ? 0.0199  ? 
0.0006  ? 
14 'X-RAY DIFFRACTION' ? refined 13.1797  23.9976 -6.4222  0.3481 ? -0.0340 ? -0.0719 ? 0.5220 ? 0.1155  ? 0.7393 ? 0.1921 ? 
-0.0694 ? -0.0787 ? 0.1542 ? -0.0086 ? 0.0506 ? 0.0838  ? -0.3157 ? -0.0035 ? 0.3516  ? 0.2563  ? -1.5128 ? -0.0882 ? 0.2897  ? 
-0.0013 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1  'X-RAY DIFFRACTION' 1  ? ? A 523 ? ? A 561 ? '(chain A and resid 523:561)' 
2  'X-RAY DIFFRACTION' 2  ? ? A 562 ? ? A 577 ? '(chain A and resid 562:577)' 
3  'X-RAY DIFFRACTION' 3  ? ? A 578 ? ? A 643 ? '(chain A and resid 578:643)' 
4  'X-RAY DIFFRACTION' 4  ? ? B 522 ? ? B 562 ? '(chain B and resid 522:562)' 
5  'X-RAY DIFFRACTION' 5  ? ? B 563 ? ? B 601 ? '(chain B and resid 563:601)' 
6  'X-RAY DIFFRACTION' 6  ? ? B 602 ? ? B 643 ? '(chain B and resid 602:643)' 
7  'X-RAY DIFFRACTION' 7  ? ? C 1   ? ? C 7   ? '(chain C and resid 1:7)'     
8  'X-RAY DIFFRACTION' 8  ? ? C 8   ? ? C 12  ? '(chain C and resid 8:12)'    
9  'X-RAY DIFFRACTION' 9  ? ? D 1   ? ? D 6   ? '(chain D and resid 1:6)'     
10 'X-RAY DIFFRACTION' 10 ? ? D 7   ? ? D 13  ? '(chain D and resid 7:13)'    
11 'X-RAY DIFFRACTION' 11 ? ? H 1   ? ? H 5   ? '(chain H and resid 1:5)'     
12 'X-RAY DIFFRACTION' 12 ? ? H 6   ? ? H 12  ? '(chain H and resid 6:12)'    
13 'X-RAY DIFFRACTION' 13 ? ? I 1   ? ? I 9   ? '(chain I and resid 1:9)'     
14 'X-RAY DIFFRACTION' 14 ? ? I 10  ? ? I 13  ? '(chain I and resid 10:13)'   
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15     2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? iMOSFLM     ? ? ? .        3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .        5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB    B CYS 626 ? ? SG    B CYS 626 ? ? 1.712 1.812 -0.100 0.016 N 
2 1 "O3'" C DG  7   ? ? "C3'" C DG  7   ? ? 1.382 1.419 -0.037 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DG 7  ? ? "C1'" C DG 7  ? ? N9 C DG 7  ? ? 110.18 108.30 1.88 0.30 N 
2 1 "O4'" D DC 13 ? ? "C1'" D DC 13 ? ? N1 D DC 13 ? ? 110.11 108.30 1.81 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 531 ? ? 69.97   -0.50   
2 1 PRO A 581 ? ? -39.24  114.23  
3 1 CYS A 626 ? ? -46.17  153.96  
4 1 ASN A 631 ? ? -107.74 70.94   
5 1 SER B 604 ? ? -77.15  -169.79 
6 1 CYS B 626 ? ? -47.30  151.25  
7 1 ASN B 631 ? ? -111.79 72.59   
8 1 LEU B 641 ? ? -58.34  -7.26   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 522 ? CG    ? A ARG 11  CG    
2  1 Y 1 A ARG 522 ? CD    ? A ARG 11  CD    
3  1 Y 1 A ARG 522 ? NE    ? A ARG 11  NE    
4  1 Y 1 A ARG 522 ? CZ    ? A ARG 11  CZ    
5  1 Y 1 A ARG 522 ? NH1   ? A ARG 11  NH1   
6  1 Y 1 A ARG 522 ? NH2   ? A ARG 11  NH2   
7  1 Y 1 A GLU 561 ? CG    ? A GLU 50  CG    
8  1 Y 1 A GLU 561 ? CD    ? A GLU 50  CD    
9  1 Y 1 A GLU 561 ? OE1   ? A GLU 50  OE1   
10 1 Y 1 A GLU 561 ? OE2   ? A GLU 50  OE2   
11 1 Y 1 A LYS 582 ? CG    ? A LYS 71  CG    
12 1 Y 1 A LYS 582 ? CD    ? A LYS 71  CD    
13 1 Y 1 A LYS 582 ? CE    ? A LYS 71  CE    
14 1 Y 1 A LYS 582 ? NZ    ? A LYS 71  NZ    
15 1 Y 1 A LYS 597 ? CG    ? A LYS 86  CG    
16 1 Y 1 A LYS 597 ? CD    ? A LYS 86  CD    
17 1 Y 1 A LYS 597 ? CE    ? A LYS 86  CE    
18 1 Y 1 A LYS 597 ? NZ    ? A LYS 86  NZ    
19 1 Y 1 A LYS 617 ? CG    ? A LYS 106 CG    
20 1 Y 1 A LYS 617 ? CD    ? A LYS 106 CD    
21 1 Y 1 A LYS 617 ? CE    ? A LYS 106 CE    
22 1 Y 1 A LYS 617 ? NZ    ? A LYS 106 NZ    
23 1 Y 1 A LEU 641 ? CG    ? A LEU 130 CG    
24 1 Y 1 A LEU 641 ? CD1   ? A LEU 130 CD1   
25 1 Y 1 A LEU 641 ? CD2   ? A LEU 130 CD2   
26 1 Y 1 B ARG 522 ? CG    ? B ARG 11  CG    
27 1 Y 1 B ARG 522 ? CD    ? B ARG 11  CD    
28 1 Y 1 B ARG 522 ? NE    ? B ARG 11  NE    
29 1 Y 1 B ARG 522 ? CZ    ? B ARG 11  CZ    
30 1 Y 1 B ARG 522 ? NH1   ? B ARG 11  NH1   
31 1 Y 1 B ARG 522 ? NH2   ? B ARG 11  NH2   
32 1 Y 1 B ASN 547 ? CG    ? B ASN 36  CG    
33 1 Y 1 B ASN 547 ? OD1   ? B ASN 36  OD1   
34 1 Y 1 B ASN 547 ? ND2   ? B ASN 36  ND2   
35 1 Y 1 B GLU 577 ? CG    ? B GLU 66  CG    
36 1 Y 1 B GLU 577 ? CD    ? B GLU 66  CD    
37 1 Y 1 B GLU 577 ? OE1   ? B GLU 66  OE1   
38 1 Y 1 B GLU 577 ? OE2   ? B GLU 66  OE2   
39 1 Y 1 B LYS 580 ? CG    ? B LYS 69  CG    
40 1 Y 1 B LYS 580 ? CD    ? B LYS 69  CD    
41 1 Y 1 B LYS 580 ? CE    ? B LYS 69  CE    
42 1 Y 1 B LYS 580 ? NZ    ? B LYS 69  NZ    
43 1 Y 1 C DA  2   ? OP2   ? C DA  2   OP2   
44 1 Y 1 D DC  1   ? "O5'" ? D DC  1   "O5'" 
45 1 Y 1 D DC  1   ? "C5'" ? D DC  1   "C5'" 
46 1 Y 1 D DC  1   ? "C4'" ? D DC  1   "C4'" 
47 1 Y 1 D DC  1   ? "O4'" ? D DC  1   "O4'" 
48 1 Y 1 D DC  1   ? "C3'" ? D DC  1   "C3'" 
49 1 Y 1 D DC  1   ? "C2'" ? D DC  1   "C2'" 
50 1 Y 1 D DC  1   ? "C1'" ? D DC  1   "C1'" 
51 1 Y 1 D DC  1   ? N1    ? D DC  1   N1    
52 1 Y 1 D DC  1   ? C2    ? D DC  1   C2    
53 1 Y 1 D DC  1   ? O2    ? D DC  1   O2    
54 1 Y 1 D DC  1   ? N3    ? D DC  1   N3    
55 1 Y 1 D DC  1   ? C4    ? D DC  1   C4    
56 1 Y 1 D DC  1   ? N4    ? D DC  1   N4    
57 1 Y 1 D DC  1   ? C5    ? D DC  1   C5    
58 1 Y 1 D DC  1   ? C6    ? D DC  1   C6    
59 1 Y 1 I DC  1   ? "O5'" ? F DC  1   "O5'" 
60 1 Y 1 I DC  1   ? "C5'" ? F DC  1   "C5'" 
61 1 Y 1 I DC  1   ? "C4'" ? F DC  1   "C4'" 
62 1 Y 1 I DC  1   ? "O4'" ? F DC  1   "O4'" 
63 1 Y 1 I DC  1   ? "C3'" ? F DC  1   "C3'" 
64 1 Y 1 I DC  1   ? "C2'" ? F DC  1   "C2'" 
65 1 Y 1 I DC  1   ? "C1'" ? F DC  1   "C1'" 
66 1 Y 1 I DC  1   ? N1    ? F DC  1   N1    
67 1 Y 1 I DC  1   ? C2    ? F DC  1   C2    
68 1 Y 1 I DC  1   ? O2    ? F DC  1   O2    
69 1 Y 1 I DC  1   ? N3    ? F DC  1   N3    
70 1 Y 1 I DC  1   ? C4    ? F DC  1   C4    
71 1 Y 1 I DC  1   ? N4    ? F DC  1   N4    
72 1 Y 1 I DC  1   ? C5    ? F DC  1   C5    
73 1 Y 1 I DC  1   ? C6    ? F DC  1   C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 512 ? A GLY 1   
2  1 Y 1 A GLU 513 ? A GLU 2   
3  1 Y 1 A PHE 514 ? A PHE 3   
4  1 Y 1 A SER 515 ? A SER 4   
5  1 Y 1 A GLU 516 ? A GLU 5   
6  1 Y 1 A SER 517 ? A SER 6   
7  1 Y 1 A ALA 518 ? A ALA 7   
8  1 Y 1 A SER 519 ? A SER 8   
9  1 Y 1 A ARG 520 ? A ARG 9   
10 1 Y 1 A PRO 521 ? A PRO 10  
11 1 Y 1 A ILE 583 ? A ILE 72  
12 1 Y 1 A GLY 584 ? A GLY 73  
13 1 Y 1 A LYS 585 ? A LYS 74  
14 1 Y 1 A GLY 586 ? A GLY 75  
15 1 Y 1 A LYS 587 ? A LYS 76  
16 1 Y 1 A GLU 588 ? A GLU 77  
17 1 Y 1 A GLY 589 ? A GLY 78  
18 1 Y 1 A GLU 590 ? A GLU 79  
19 1 Y 1 A SER 591 ? A SER 80  
20 1 Y 1 A ASP 592 ? A ASP 81  
21 1 Y 1 A ARG 593 ? A ARG 82  
22 1 Y 1 A ARG 594 ? A ARG 83  
23 1 Y 1 A HIS 595 ? A HIS 84  
24 1 Y 1 A SER 596 ? A SER 85  
25 1 Y 1 A LEU 644 ? A LEU 133 
26 1 Y 1 A ALA 645 ? A ALA 134 
27 1 Y 1 A ASP 646 ? A ASP 135 
28 1 Y 1 B GLY 512 ? B GLY 1   
29 1 Y 1 B GLU 513 ? B GLU 2   
30 1 Y 1 B PHE 514 ? B PHE 3   
31 1 Y 1 B SER 515 ? B SER 4   
32 1 Y 1 B GLU 516 ? B GLU 5   
33 1 Y 1 B SER 517 ? B SER 6   
34 1 Y 1 B ALA 518 ? B ALA 7   
35 1 Y 1 B SER 519 ? B SER 8   
36 1 Y 1 B ARG 520 ? B ARG 9   
37 1 Y 1 B PRO 521 ? B PRO 10  
38 1 Y 1 B LYS 582 ? B LYS 71  
39 1 Y 1 B ILE 583 ? B ILE 72  
40 1 Y 1 B GLY 584 ? B GLY 73  
41 1 Y 1 B LYS 585 ? B LYS 74  
42 1 Y 1 B GLY 586 ? B GLY 75  
43 1 Y 1 B LYS 587 ? B LYS 76  
44 1 Y 1 B GLU 588 ? B GLU 77  
45 1 Y 1 B GLY 589 ? B GLY 78  
46 1 Y 1 B GLU 590 ? B GLU 79  
47 1 Y 1 B SER 591 ? B SER 80  
48 1 Y 1 B ASP 592 ? B ASP 81  
49 1 Y 1 B ARG 593 ? B ARG 82  
50 1 Y 1 B ARG 594 ? B ARG 83  
51 1 Y 1 B HIS 595 ? B HIS 84  
52 1 Y 1 B SER 596 ? B SER 85  
53 1 Y 1 B ALA 645 ? B ALA 134 
54 1 Y 1 B ASP 646 ? B ASP 135 
# 
_ndb_struct_conf_na.entry_id   5FD3 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 1  1_555 D DC 13 1_555 -0.787 -0.465 0.058  6.015   -6.352  -0.899 1  C_DG1:DC13_D C 1  ? D 13 ? 19 1 
1 C DA 2  1_555 D DT 12 1_555 0.152  -0.042 0.126  1.986   -13.728 -1.851 2  C_DA2:DT12_D C 2  ? D 12 ? 20 1 
1 C DG 3  1_555 D DC 11 1_555 0.491  -0.082 0.242  1.550   -11.728 7.560  3  C_DG3:DC11_D C 3  ? D 11 ? 19 1 
1 C DT 4  1_555 D DA 10 1_555 -0.457 -0.354 0.093  -4.703  -20.904 -1.633 4  C_DT4:DA10_D C 4  ? D 10 ? 20 1 
1 C DT 5  1_555 D DA 9  1_555 -0.376 -0.154 0.130  -14.066 -21.841 3.209  5  C_DT5:DA9_D  C 5  ? D 9  ? 20 1 
1 C DT 6  1_555 D DA 8  1_555 -0.052 0.014  0.077  -15.137 -9.841  -2.564 6  C_DT6:DA8_D  C 6  ? D 8  ? 20 1 
1 C DG 7  1_555 D DC 7  1_555 -0.575 -0.167 0.121  13.722  -5.771  1.826  7  C_DG7:DC7_D  C 7  ? D 7  ? 19 1 
1 C DA 8  1_555 D DT 6  1_555 0.034  -0.085 0.604  14.791  -26.474 2.304  8  C_DA8:DT6_D  C 8  ? D 6  ? 20 1 
1 C DA 9  1_555 D DT 5  1_555 0.139  -0.169 0.224  9.631   -24.104 1.917  9  C_DA9:DT5_D  C 9  ? D 5  ? 20 1 
1 C DA 10 1_555 D DT 4  1_555 0.030  -0.593 -0.200 -0.855  -21.857 -3.950 10 C_DA10:DT4_D C 10 ? D 4  ? 20 1 
1 C DC 11 1_555 D DG 3  1_555 -0.050 -0.033 0.187  -1.403  -15.384 4.417  11 C_DC11:DG3_D C 11 ? D 3  ? 19 1 
1 C DT 12 1_555 D DA 2  1_555 0.336  -0.128 -0.031 -8.947  -8.060  -0.206 12 C_DT12:DA2_D C 12 ? D 2  ? 20 1 
1 E DG 1  1_555 F DC 13 1_555 -0.899 -0.240 -0.249 2.544   -11.362 -1.926 13 H_DG1:DC13_I H 1  ? I 13 ? 19 1 
1 E DA 2  1_555 F DT 12 1_555 0.411  -0.171 -0.108 1.631   -16.945 -0.992 14 H_DA2:DT12_I H 2  ? I 12 ? 20 1 
1 E DG 3  1_555 F DC 11 1_555 0.650  -0.092 0.207  -3.666  -14.402 6.273  15 H_DG3:DC11_I H 3  ? I 11 ? 19 1 
1 E DT 4  1_555 F DA 10 1_555 -0.183 -0.276 0.223  -4.481  -21.009 1.816  16 H_DT4:DA10_I H 4  ? I 10 ? 20 1 
1 E DT 5  1_555 F DA 9  1_555 -0.198 -0.093 0.326  -14.586 -20.448 0.587  17 H_DT5:DA9_I  H 5  ? I 9  ? 20 1 
1 E DT 6  1_555 F DA 8  1_555 0.090  -0.071 0.042  -7.084  -9.131  -3.066 18 H_DT6:DA8_I  H 6  ? I 8  ? 20 1 
1 E DG 7  1_555 F DC 7  1_555 -0.139 0.046  0.079  16.065  -6.431  5.997  19 H_DG7:DC7_I  H 7  ? I 7  ? 19 1 
1 E DA 8  1_555 F DT 6  1_555 0.111  0.015  0.549  14.724  -23.078 -0.377 20 H_DA8:DT6_I  H 8  ? I 6  ? 20 1 
1 E DA 9  1_555 F DT 5  1_555 -0.039 -0.138 0.040  11.150  -24.862 0.176  21 H_DA9:DT5_I  H 9  ? I 5  ? 20 1 
1 E DA 10 1_555 F DT 4  1_555 -0.031 -0.637 -0.002 -1.757  -18.450 -3.851 22 H_DA10:DT4_I H 10 ? I 4  ? 20 1 
1 E DC 11 1_555 F DG 3  1_555 0.278  -0.106 0.271  -5.892  -14.247 1.806  23 H_DC11:DG3_I H 11 ? I 3  ? 19 1 
1 E DT 12 1_555 F DA 2  1_555 0.079  -0.180 0.063  -12.739 -8.729  -1.291 24 H_DT12:DA2_I H 12 ? I 2  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 1  1_555 D DC 13 1_555 C DA 2  1_555 D DT 12 1_555 -0.353 -0.335 3.373 -1.367 1.535  38.248 -0.709 0.362  3.368 2.341  
2.084  38.301 1  CC_DG1DA2:DT12DC13_DD C 1  ? D 13 ? C 2  ? D 12 ? 
1 C DA 2  1_555 D DT 12 1_555 C DG 3  1_555 D DC 11 1_555 0.345  -0.391 3.326 -0.774 1.736  36.505 -0.865 -0.659 3.297 2.769  
1.234  36.552 2  CC_DA2DG3:DC11DT12_DD C 2  ? D 12 ? C 3  ? D 11 ? 
1 C DG 3  1_555 D DC 11 1_555 C DT 4  1_555 D DA 10 1_555 -1.111 -1.041 3.274 0.062  0.836  27.478 -2.396 2.352  3.239 1.759  
-0.130 27.491 3  CC_DG3DT4:DA10DC11_DD C 3  ? D 11 ? C 4  ? D 10 ? 
1 C DT 4  1_555 D DA 10 1_555 C DT 5  1_555 D DA 9  1_555 0.361  -0.209 3.419 0.718  0.399  42.270 -0.333 -0.423 3.422 0.553  
-0.996 42.277 4  CC_DT4DT5:DA9DA10_DD  C 4  ? D 10 ? C 5  ? D 9  ? 
1 C DT 5  1_555 D DA 9  1_555 C DT 6  1_555 D DA 8  1_555 0.135  0.065  3.241 1.160  -0.376 35.917 0.158  -0.055 3.243 -0.610 
-1.881 35.937 5  CC_DT5DT6:DA8DA9_DD   C 5  ? D 9  ? C 6  ? D 8  ? 
1 C DT 6  1_555 D DA 8  1_555 C DG 7  1_555 D DC 7  1_555 0.207  1.165  2.700 -1.456 7.242  23.929 0.804  -0.857 2.904 16.957 
3.408  25.028 6  CC_DT6DG7:DC7DA8_DD   C 6  ? D 8  ? C 7  ? D 7  ? 
1 C DG 7  1_555 D DC 7  1_555 C DA 8  1_555 D DT 6  1_555 -0.878 0.556  3.268 -4.871 -0.150 41.215 0.801  0.713  3.344 -0.213 
6.891  41.490 7  CC_DG7DA8:DT6DC7_DD   C 7  ? D 7  ? C 8  ? D 6  ? 
1 C DA 8  1_555 D DT 6  1_555 C DA 9  1_555 D DT 5  1_555 0.030  -0.355 3.336 1.530  -4.138 38.487 -0.015 0.147  3.354 -6.252 
-2.312 38.730 8  CC_DA8DA9:DT5DT6_DD   C 8  ? D 6  ? C 9  ? D 5  ? 
1 C DA 9  1_555 D DT 5  1_555 C DA 10 1_555 D DT 4  1_555 0.102  -0.487 3.417 2.324  1.379  35.835 -0.994 0.180  3.396 2.237  
-3.771 35.934 9  CC_DA9DA10:DT4DT5_DD  C 9  ? D 5  ? C 10 ? D 4  ? 
1 C DA 10 1_555 D DT 4  1_555 C DC 11 1_555 D DG 3  1_555 0.695  -0.635 3.230 -0.352 -0.844 32.291 -0.994 -1.311 3.237 -1.517 
0.633  32.303 10 CC_DA10DC11:DG3DT4_DD C 10 ? D 4  ? C 11 ? D 3  ? 
1 C DC 11 1_555 D DG 3  1_555 C DT 12 1_555 D DA 2  1_555 0.084  -0.214 3.461 4.302  4.127  37.285 -0.894 0.457  3.408 6.405  
-6.676 37.742 11 CC_DC11DT12:DA2DG3_DD C 11 ? D 3  ? C 12 ? D 2  ? 
1 E DG 1  1_555 F DC 13 1_555 E DA 2  1_555 F DT 12 1_555 -0.160 -0.107 3.313 -2.585 3.077  40.472 -0.499 -0.060 3.300 4.435  
3.725  40.663 12 HH_DG1DA2:DT12DC13_II H 1  ? I 13 ? H 2  ? I 12 ? 
1 E DA 2  1_555 F DT 12 1_555 E DG 3  1_555 F DC 11 1_555 0.341  -0.292 3.384 -1.484 3.729  36.091 -1.004 -0.760 3.322 5.996  
2.386  36.306 13 HH_DA2DG3:DC11DT12_II H 2  ? I 12 ? H 3  ? I 11 ? 
1 E DG 3  1_555 F DC 11 1_555 E DT 4  1_555 F DA 10 1_555 -0.811 -0.997 3.223 -0.632 -3.351 27.589 -1.266 1.536  3.336 -6.992 
1.319  27.794 14 HH_DG3DT4:DA10DC11_II H 3  ? I 11 ? H 4  ? I 10 ? 
1 E DT 4  1_555 F DA 10 1_555 E DT 5  1_555 F DA 9  1_555 0.157  -0.369 3.416 -0.487 2.726  40.987 -0.835 -0.278 3.384 3.887  
0.695  41.077 15 HH_DT4DT5:DA9DA10_II  H 4  ? I 10 ? H 5  ? I 9  ? 
1 E DT 5  1_555 F DA 9  1_555 E DT 6  1_555 F DA 8  1_555 0.042  -0.232 3.077 2.131  -4.050 33.732 0.213  0.249  3.080 -6.939 
-3.651 34.032 16 HH_DT5DT6:DA8DA9_II   H 5  ? I 9  ? H 6  ? I 8  ? 
1 E DT 6  1_555 F DA 8  1_555 E DG 7  1_555 F DC 7  1_555 0.595  1.361  2.837 0.841  9.002  27.196 0.843  -1.026 3.135 18.506 
-1.729 28.632 17 HH_DT6DG7:DC7DA8_II   H 6  ? I 8  ? H 7  ? I 7  ? 
1 E DG 7  1_555 F DC 7  1_555 E DA 8  1_555 F DT 6  1_555 -1.204 0.531  3.309 -4.521 -1.461 40.100 0.938  1.221  3.399 -2.121 
6.566  40.369 18 HH_DG7DA8:DT6DC7_II   H 7  ? I 7  ? H 8  ? I 6  ? 
1 E DA 8  1_555 F DT 6  1_555 E DA 9  1_555 F DT 5  1_555 0.155  -0.245 3.282 3.873  -2.352 36.593 -0.066 0.284  3.289 -3.729 
-6.140 36.863 19 HH_DA8DA9:DT5DT6_II   H 8  ? I 6  ? H 9  ? I 5  ? 
1 E DA 9  1_555 F DT 5  1_555 E DA 10 1_555 F DT 4  1_555 0.297  -0.658 3.518 -1.043 0.804  36.222 -1.178 -0.634 3.493 1.292  
1.677  36.245 20 HH_DA9DA10:DT4DT5_II  H 9  ? I 5  ? H 10 ? I 4  ? 
1 E DA 10 1_555 F DT 4  1_555 E DC 11 1_555 F DG 3  1_555 0.360  -0.737 3.284 0.604  0.697  34.284 -1.359 -0.516 3.274 1.182  
-1.024 34.296 21 HH_DA10DC11:DG3DT4_II H 10 ? I 4  ? H 11 ? I 3  ? 
1 E DC 11 1_555 F DG 3  1_555 E DT 12 1_555 F DA 2  1_555 0.105  -0.253 3.405 2.687  5.371  35.047 -1.227 0.235  3.330 8.838  
-4.422 35.541 22 HH_DC11DT12:DA2DG3_II H 11 ? I 3  ? H 12 ? I 2  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
#