data_5FFO
# 
_entry.id   5FFO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FFO         
WWPDB D_1000216498 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          5FFG 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5FFO 
_pdbx_database_status.recvd_initial_deposition_date   2015-12-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dong, X.'       1 
'Zhao, B.'       2 
'Springer, T.A.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            542 
_citation.language                  ? 
_citation.page_first                55 
_citation.page_last                 59 
_citation.title                     'Force interacts with macromolecular structure in activation of TGF-beta.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature21035 
_citation.pdbx_database_id_PubMed   28117447 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Dong, X.'       1 ? 
primary 'Zhao, B.'       2 ? 
primary 'Iacob, R.E.'    3 ? 
primary 'Zhu, J.'        4 ? 
primary 'Koksal, A.C.'   5 ? 
primary 'Lu, C.'         6 ? 
primary 'Engen, J.R.'    7 ? 
primary 'Springer, T.A.' 8 ? 
# 
_cell.entry_id           5FFO 
_cell.length_a           81.440 
_cell.length_b           91.440 
_cell.length_c           131.030 
_cell.angle_alpha        89.98 
_cell.angle_beta         86.25 
_cell.angle_gamma        89.85 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FFO 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Integrin alpha-V' 65982.922 2 ? ? 'UNP residues 31-627'  ? 
2  polymer     man 'Integrin beta-6' 28851.707 2 ? ? 'Unp residues 128-378' ? 
3  polymer     man 'Transforming growth factor beta-1' 41489.371 4 ? ? 'UNP residues 34-390'  ? 
4  branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   2 ? 
? ?                      ? 
5  branched    man 
;alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
1072.964  2 ? ? ?                      ? 
6  branched    man 
;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
1235.105  2 ? ? ?                      ? 
7  branched    man 
;alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682   2 ? ? ?                      ? 
8  branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2 ? ? ? ? 
9  branched    man 
;alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682   3 ? ? ?                      ? 
10 branched    man 
;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
1072.964  1 ? ? ?                      ? 
11 non-polymer syn 'CALCIUM ION' 40.078    8 ? ? ?                      ? 
12 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   4 ? ? ?                      ? 
13 non-polymer syn 'MANGANESE (II) ION' 54.938    6 ? ? ?                      ? 
14 water       nat water 18.015    5 ? ? ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Vitronectin receptor subunit alpha' 
3 TGF-beta-1                           
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;FNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDY
AKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFS
IDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFV
SGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQ
RASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSG
CPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCL
KADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFM
EYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDTGGLE
;
;FNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDY
AKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFS
IDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFV
SGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQ
RASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSG
CPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCL
KADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFM
EYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDTGGLE
;
A,E     ? 
2 'polypeptide(L)' no no 
;TEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPT
FGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVC
PNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISA
YEELRSEVELEHHHHHH
;
;TEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPT
FGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVC
PNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISA
YEELRSEVELEHHHHHH
;
B,F     ? 
3 'polypeptide(L)' no no 
;GPLSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKE
VTRVLMVETHNEIYDKFKQSTHSIYMFFQTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSQNSWRYLSNRLL
APSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLER
AQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHN
PGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
;
;GPLSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKE
VTRVLMVETHNEIYDKFKQSTHSIYMFFQTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSQNSWRYLSNRLL
APSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLER
AQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHN
PGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
;
C,D,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   ASN n 
1 3   LEU n 
1 4   ASP n 
1 5   VAL n 
1 6   ASP n 
1 7   SER n 
1 8   PRO n 
1 9   ALA n 
1 10  GLU n 
1 11  TYR n 
1 12  SER n 
1 13  GLY n 
1 14  PRO n 
1 15  GLU n 
1 16  GLY n 
1 17  SER n 
1 18  TYR n 
1 19  PHE n 
1 20  GLY n 
1 21  PHE n 
1 22  ALA n 
1 23  VAL n 
1 24  ASP n 
1 25  PHE n 
1 26  PHE n 
1 27  VAL n 
1 28  PRO n 
1 29  SER n 
1 30  ALA n 
1 31  SER n 
1 32  SER n 
1 33  ARG n 
1 34  MET n 
1 35  PHE n 
1 36  LEU n 
1 37  LEU n 
1 38  VAL n 
1 39  GLY n 
1 40  ALA n 
1 41  PRO n 
1 42  LYS n 
1 43  ALA n 
1 44  ASN n 
1 45  THR n 
1 46  THR n 
1 47  GLN n 
1 48  PRO n 
1 49  GLY n 
1 50  ILE n 
1 51  VAL n 
1 52  GLU n 
1 53  GLY n 
1 54  GLY n 
1 55  GLN n 
1 56  VAL n 
1 57  LEU n 
1 58  LYS n 
1 59  CYS n 
1 60  ASP n 
1 61  TRP n 
1 62  SER n 
1 63  SER n 
1 64  THR n 
1 65  ARG n 
1 66  ARG n 
1 67  CYS n 
1 68  GLN n 
1 69  PRO n 
1 70  ILE n 
1 71  GLU n 
1 72  PHE n 
1 73  ASP n 
1 74  ALA n 
1 75  THR n 
1 76  GLY n 
1 77  ASN n 
1 78  ARG n 
1 79  ASP n 
1 80  TYR n 
1 81  ALA n 
1 82  LYS n 
1 83  ASP n 
1 84  ASP n 
1 85  PRO n 
1 86  LEU n 
1 87  GLU n 
1 88  PHE n 
1 89  LYS n 
1 90  SER n 
1 91  HIS n 
1 92  GLN n 
1 93  TRP n 
1 94  PHE n 
1 95  GLY n 
1 96  ALA n 
1 97  SER n 
1 98  VAL n 
1 99  ARG n 
1 100 SER n 
1 101 LYS n 
1 102 GLN n 
1 103 ASP n 
1 104 LYS n 
1 105 ILE n 
1 106 LEU n 
1 107 ALA n 
1 108 CYS n 
1 109 ALA n 
1 110 PRO n 
1 111 LEU n 
1 112 TYR n 
1 113 HIS n 
1 114 TRP n 
1 115 ARG n 
1 116 THR n 
1 117 GLU n 
1 118 MET n 
1 119 LYS n 
1 120 GLN n 
1 121 GLU n 
1 122 ARG n 
1 123 GLU n 
1 124 PRO n 
1 125 VAL n 
1 126 GLY n 
1 127 THR n 
1 128 CYS n 
1 129 PHE n 
1 130 LEU n 
1 131 GLN n 
1 132 ASP n 
1 133 GLY n 
1 134 THR n 
1 135 LYS n 
1 136 THR n 
1 137 VAL n 
1 138 GLU n 
1 139 TYR n 
1 140 ALA n 
1 141 PRO n 
1 142 CYS n 
1 143 ARG n 
1 144 SER n 
1 145 GLN n 
1 146 ASP n 
1 147 ILE n 
1 148 ASP n 
1 149 ALA n 
1 150 ASP n 
1 151 GLY n 
1 152 GLN n 
1 153 GLY n 
1 154 PHE n 
1 155 CYS n 
1 156 GLN n 
1 157 GLY n 
1 158 GLY n 
1 159 PHE n 
1 160 SER n 
1 161 ILE n 
1 162 ASP n 
1 163 PHE n 
1 164 THR n 
1 165 LYS n 
1 166 ALA n 
1 167 ASP n 
1 168 ARG n 
1 169 VAL n 
1 170 LEU n 
1 171 LEU n 
1 172 GLY n 
1 173 GLY n 
1 174 PRO n 
1 175 GLY n 
1 176 SER n 
1 177 PHE n 
1 178 TYR n 
1 179 TRP n 
1 180 GLN n 
1 181 GLY n 
1 182 GLN n 
1 183 LEU n 
1 184 ILE n 
1 185 SER n 
1 186 ASP n 
1 187 GLN n 
1 188 VAL n 
1 189 ALA n 
1 190 GLU n 
1 191 ILE n 
1 192 VAL n 
1 193 SER n 
1 194 LYS n 
1 195 TYR n 
1 196 ASP n 
1 197 PRO n 
1 198 ASN n 
1 199 VAL n 
1 200 TYR n 
1 201 SER n 
1 202 ILE n 
1 203 LYS n 
1 204 TYR n 
1 205 ASN n 
1 206 ASN n 
1 207 GLN n 
1 208 LEU n 
1 209 ALA n 
1 210 THR n 
1 211 ARG n 
1 212 THR n 
1 213 ALA n 
1 214 GLN n 
1 215 ALA n 
1 216 ILE n 
1 217 PHE n 
1 218 ASP n 
1 219 ASP n 
1 220 SER n 
1 221 TYR n 
1 222 LEU n 
1 223 GLY n 
1 224 TYR n 
1 225 SER n 
1 226 VAL n 
1 227 ALA n 
1 228 VAL n 
1 229 GLY n 
1 230 ASP n 
1 231 PHE n 
1 232 ASN n 
1 233 GLY n 
1 234 ASP n 
1 235 GLY n 
1 236 ILE n 
1 237 ASP n 
1 238 ASP n 
1 239 PHE n 
1 240 VAL n 
1 241 SER n 
1 242 GLY n 
1 243 VAL n 
1 244 PRO n 
1 245 ARG n 
1 246 ALA n 
1 247 ALA n 
1 248 ARG n 
1 249 THR n 
1 250 LEU n 
1 251 GLY n 
1 252 MET n 
1 253 VAL n 
1 254 TYR n 
1 255 ILE n 
1 256 TYR n 
1 257 ASP n 
1 258 GLY n 
1 259 LYS n 
1 260 ASN n 
1 261 MET n 
1 262 SER n 
1 263 SER n 
1 264 LEU n 
1 265 TYR n 
1 266 ASN n 
1 267 PHE n 
1 268 THR n 
1 269 GLY n 
1 270 GLU n 
1 271 GLN n 
1 272 MET n 
1 273 ALA n 
1 274 ALA n 
1 275 TYR n 
1 276 PHE n 
1 277 GLY n 
1 278 PHE n 
1 279 SER n 
1 280 VAL n 
1 281 ALA n 
1 282 ALA n 
1 283 THR n 
1 284 ASP n 
1 285 ILE n 
1 286 ASN n 
1 287 GLY n 
1 288 ASP n 
1 289 ASP n 
1 290 TYR n 
1 291 ALA n 
1 292 ASP n 
1 293 VAL n 
1 294 PHE n 
1 295 ILE n 
1 296 GLY n 
1 297 ALA n 
1 298 PRO n 
1 299 LEU n 
1 300 PHE n 
1 301 MET n 
1 302 ASP n 
1 303 ARG n 
1 304 GLY n 
1 305 SER n 
1 306 ASP n 
1 307 GLY n 
1 308 LYS n 
1 309 LEU n 
1 310 GLN n 
1 311 GLU n 
1 312 VAL n 
1 313 GLY n 
1 314 GLN n 
1 315 VAL n 
1 316 SER n 
1 317 VAL n 
1 318 SER n 
1 319 LEU n 
1 320 GLN n 
1 321 ARG n 
1 322 ALA n 
1 323 SER n 
1 324 GLY n 
1 325 ASP n 
1 326 PHE n 
1 327 GLN n 
1 328 THR n 
1 329 THR n 
1 330 LYS n 
1 331 LEU n 
1 332 ASN n 
1 333 GLY n 
1 334 PHE n 
1 335 GLU n 
1 336 VAL n 
1 337 PHE n 
1 338 ALA n 
1 339 ARG n 
1 340 PHE n 
1 341 GLY n 
1 342 SER n 
1 343 ALA n 
1 344 ILE n 
1 345 ALA n 
1 346 PRO n 
1 347 LEU n 
1 348 GLY n 
1 349 ASP n 
1 350 LEU n 
1 351 ASP n 
1 352 GLN n 
1 353 ASP n 
1 354 GLY n 
1 355 PHE n 
1 356 ASN n 
1 357 ASP n 
1 358 ILE n 
1 359 ALA n 
1 360 ILE n 
1 361 ALA n 
1 362 ALA n 
1 363 PRO n 
1 364 TYR n 
1 365 GLY n 
1 366 GLY n 
1 367 GLU n 
1 368 ASP n 
1 369 LYS n 
1 370 LYS n 
1 371 GLY n 
1 372 ILE n 
1 373 VAL n 
1 374 TYR n 
1 375 ILE n 
1 376 PHE n 
1 377 ASN n 
1 378 GLY n 
1 379 ARG n 
1 380 SER n 
1 381 THR n 
1 382 GLY n 
1 383 LEU n 
1 384 ASN n 
1 385 ALA n 
1 386 VAL n 
1 387 PRO n 
1 388 SER n 
1 389 GLN n 
1 390 ILE n 
1 391 LEU n 
1 392 GLU n 
1 393 GLY n 
1 394 GLN n 
1 395 TRP n 
1 396 ALA n 
1 397 ALA n 
1 398 ARG n 
1 399 SER n 
1 400 GLY n 
1 401 CYS n 
1 402 PRO n 
1 403 PRO n 
1 404 SER n 
1 405 PHE n 
1 406 GLY n 
1 407 TYR n 
1 408 SER n 
1 409 MET n 
1 410 LYS n 
1 411 GLY n 
1 412 ALA n 
1 413 THR n 
1 414 ASP n 
1 415 ILE n 
1 416 ASP n 
1 417 LYS n 
1 418 ASN n 
1 419 GLY n 
1 420 TYR n 
1 421 PRO n 
1 422 ASP n 
1 423 LEU n 
1 424 ILE n 
1 425 VAL n 
1 426 GLY n 
1 427 ALA n 
1 428 PHE n 
1 429 GLY n 
1 430 VAL n 
1 431 ASP n 
1 432 ARG n 
1 433 ALA n 
1 434 ILE n 
1 435 LEU n 
1 436 TYR n 
1 437 ARG n 
1 438 ALA n 
1 439 ARG n 
1 440 PRO n 
1 441 VAL n 
1 442 ILE n 
1 443 THR n 
1 444 VAL n 
1 445 ASN n 
1 446 ALA n 
1 447 GLY n 
1 448 LEU n 
1 449 GLU n 
1 450 VAL n 
1 451 TYR n 
1 452 PRO n 
1 453 SER n 
1 454 ILE n 
1 455 LEU n 
1 456 ASN n 
1 457 GLN n 
1 458 ASP n 
1 459 ASN n 
1 460 LYS n 
1 461 THR n 
1 462 CYS n 
1 463 SER n 
1 464 LEU n 
1 465 PRO n 
1 466 GLY n 
1 467 THR n 
1 468 ALA n 
1 469 LEU n 
1 470 LYS n 
1 471 VAL n 
1 472 SER n 
1 473 CYS n 
1 474 PHE n 
1 475 ASN n 
1 476 VAL n 
1 477 ARG n 
1 478 PHE n 
1 479 CYS n 
1 480 LEU n 
1 481 LYS n 
1 482 ALA n 
1 483 ASP n 
1 484 GLY n 
1 485 LYS n 
1 486 GLY n 
1 487 VAL n 
1 488 LEU n 
1 489 PRO n 
1 490 ARG n 
1 491 LYS n 
1 492 LEU n 
1 493 ASN n 
1 494 PHE n 
1 495 GLN n 
1 496 VAL n 
1 497 GLU n 
1 498 LEU n 
1 499 LEU n 
1 500 LEU n 
1 501 ASP n 
1 502 LYS n 
1 503 LEU n 
1 504 LYS n 
1 505 GLN n 
1 506 LYS n 
1 507 GLY n 
1 508 ALA n 
1 509 ILE n 
1 510 ARG n 
1 511 ARG n 
1 512 ALA n 
1 513 LEU n 
1 514 PHE n 
1 515 LEU n 
1 516 TYR n 
1 517 SER n 
1 518 ARG n 
1 519 SER n 
1 520 PRO n 
1 521 SER n 
1 522 HIS n 
1 523 SER n 
1 524 LYS n 
1 525 ASN n 
1 526 MET n 
1 527 THR n 
1 528 ILE n 
1 529 SER n 
1 530 ARG n 
1 531 GLY n 
1 532 GLY n 
1 533 LEU n 
1 534 MET n 
1 535 GLN n 
1 536 CYS n 
1 537 GLU n 
1 538 GLU n 
1 539 LEU n 
1 540 ILE n 
1 541 ALA n 
1 542 TYR n 
1 543 LEU n 
1 544 ARG n 
1 545 ASP n 
1 546 GLU n 
1 547 SER n 
1 548 GLU n 
1 549 PHE n 
1 550 ARG n 
1 551 ASP n 
1 552 LYS n 
1 553 LEU n 
1 554 THR n 
1 555 PRO n 
1 556 ILE n 
1 557 THR n 
1 558 ILE n 
1 559 PHE n 
1 560 MET n 
1 561 GLU n 
1 562 TYR n 
1 563 ARG n 
1 564 LEU n 
1 565 ASP n 
1 566 TYR n 
1 567 ARG n 
1 568 THR n 
1 569 ALA n 
1 570 ALA n 
1 571 ASP n 
1 572 THR n 
1 573 THR n 
1 574 GLY n 
1 575 LEU n 
1 576 GLN n 
1 577 PRO n 
1 578 ILE n 
1 579 LEU n 
1 580 ASN n 
1 581 GLN n 
1 582 PHE n 
1 583 THR n 
1 584 PRO n 
1 585 ALA n 
1 586 ASN n 
1 587 ILE n 
1 588 SER n 
1 589 ARG n 
1 590 GLN n 
1 591 ALA n 
1 592 HIS n 
1 593 ILE n 
1 594 LEU n 
1 595 LEU n 
1 596 ASP n 
1 597 THR n 
1 598 GLY n 
1 599 GLY n 
1 600 LEU n 
1 601 GLU n 
2 1   THR n 
2 2   GLU n 
2 3   ASP n 
2 4   TYR n 
2 5   PRO n 
2 6   VAL n 
2 7   ASP n 
2 8   LEU n 
2 9   TYR n 
2 10  TYR n 
2 11  LEU n 
2 12  MET n 
2 13  ASP n 
2 14  LEU n 
2 15  SER n 
2 16  ALA n 
2 17  SER n 
2 18  MET n 
2 19  ASP n 
2 20  ASP n 
2 21  ASP n 
2 22  LEU n 
2 23  ASN n 
2 24  THR n 
2 25  ILE n 
2 26  LYS n 
2 27  GLU n 
2 28  LEU n 
2 29  GLY n 
2 30  SER n 
2 31  ARG n 
2 32  LEU n 
2 33  SER n 
2 34  LYS n 
2 35  GLU n 
2 36  MET n 
2 37  SER n 
2 38  LYS n 
2 39  LEU n 
2 40  THR n 
2 41  SER n 
2 42  ASN n 
2 43  PHE n 
2 44  ARG n 
2 45  LEU n 
2 46  GLY n 
2 47  PHE n 
2 48  GLY n 
2 49  SER n 
2 50  PHE n 
2 51  VAL n 
2 52  GLU n 
2 53  LYS n 
2 54  PRO n 
2 55  VAL n 
2 56  SER n 
2 57  PRO n 
2 58  PHE n 
2 59  VAL n 
2 60  LYS n 
2 61  THR n 
2 62  THR n 
2 63  PRO n 
2 64  GLU n 
2 65  GLU n 
2 66  ILE n 
2 67  ALA n 
2 68  ASN n 
2 69  PRO n 
2 70  CYS n 
2 71  SER n 
2 72  SER n 
2 73  ILE n 
2 74  PRO n 
2 75  TYR n 
2 76  PHE n 
2 77  CYS n 
2 78  LEU n 
2 79  PRO n 
2 80  THR n 
2 81  PHE n 
2 82  GLY n 
2 83  PHE n 
2 84  LYS n 
2 85  HIS n 
2 86  ILE n 
2 87  LEU n 
2 88  PRO n 
2 89  LEU n 
2 90  THR n 
2 91  ASN n 
2 92  ASP n 
2 93  ALA n 
2 94  GLU n 
2 95  ARG n 
2 96  PHE n 
2 97  ASN n 
2 98  GLU n 
2 99  ILE n 
2 100 VAL n 
2 101 LYS n 
2 102 ASN n 
2 103 GLN n 
2 104 LYS n 
2 105 ILE n 
2 106 SER n 
2 107 ALA n 
2 108 ASN n 
2 109 ILE n 
2 110 ASP n 
2 111 THR n 
2 112 PRO n 
2 113 GLU n 
2 114 GLY n 
2 115 GLY n 
2 116 PHE n 
2 117 ASP n 
2 118 ALA n 
2 119 ILE n 
2 120 MET n 
2 121 GLN n 
2 122 ALA n 
2 123 ALA n 
2 124 VAL n 
2 125 CYS n 
2 126 LYS n 
2 127 GLU n 
2 128 LYS n 
2 129 ILE n 
2 130 GLY n 
2 131 TRP n 
2 132 ARG n 
2 133 ASN n 
2 134 ASP n 
2 135 SER n 
2 136 LEU n 
2 137 HIS n 
2 138 LEU n 
2 139 LEU n 
2 140 VAL n 
2 141 PHE n 
2 142 VAL n 
2 143 SER n 
2 144 ASP n 
2 145 ALA n 
2 146 ASP n 
2 147 SER n 
2 148 HIS n 
2 149 PHE n 
2 150 GLY n 
2 151 MET n 
2 152 ASP n 
2 153 SER n 
2 154 LYS n 
2 155 LEU n 
2 156 ALA n 
2 157 GLY n 
2 158 ILE n 
2 159 VAL n 
2 160 CYS n 
2 161 PRO n 
2 162 ASN n 
2 163 ASP n 
2 164 GLY n 
2 165 LEU n 
2 166 CYS n 
2 167 HIS n 
2 168 LEU n 
2 169 ASP n 
2 170 SER n 
2 171 LYS n 
2 172 ASN n 
2 173 GLU n 
2 174 TYR n 
2 175 SER n 
2 176 MET n 
2 177 SER n 
2 178 THR n 
2 179 VAL n 
2 180 LEU n 
2 181 GLU n 
2 182 TYR n 
2 183 PRO n 
2 184 THR n 
2 185 ILE n 
2 186 GLY n 
2 187 GLN n 
2 188 LEU n 
2 189 ILE n 
2 190 ASP n 
2 191 LYS n 
2 192 LEU n 
2 193 VAL n 
2 194 GLN n 
2 195 ASN n 
2 196 ASN n 
2 197 VAL n 
2 198 LEU n 
2 199 LEU n 
2 200 ILE n 
2 201 PHE n 
2 202 ALA n 
2 203 VAL n 
2 204 THR n 
2 205 GLN n 
2 206 GLU n 
2 207 GLN n 
2 208 VAL n 
2 209 HIS n 
2 210 LEU n 
2 211 TYR n 
2 212 GLU n 
2 213 ASN n 
2 214 TYR n 
2 215 ALA n 
2 216 LYS n 
2 217 LEU n 
2 218 ILE n 
2 219 PRO n 
2 220 GLY n 
2 221 ALA n 
2 222 THR n 
2 223 VAL n 
2 224 GLY n 
2 225 LEU n 
2 226 LEU n 
2 227 GLN n 
2 228 LYS n 
2 229 ASP n 
2 230 SER n 
2 231 GLY n 
2 232 ASN n 
2 233 ILE n 
2 234 LEU n 
2 235 GLN n 
2 236 LEU n 
2 237 ILE n 
2 238 ILE n 
2 239 SER n 
2 240 ALA n 
2 241 TYR n 
2 242 GLU n 
2 243 GLU n 
2 244 LEU n 
2 245 ARG n 
2 246 SER n 
2 247 GLU n 
2 248 VAL n 
2 249 GLU n 
2 250 LEU n 
2 251 GLU n 
2 252 HIS n 
2 253 HIS n 
2 254 HIS n 
2 255 HIS n 
2 256 HIS n 
2 257 HIS n 
3 1   GLY n 
3 2   PRO n 
3 3   LEU n 
3 4   SER n 
3 5   THR n 
3 6   SER n 
3 7   LYS n 
3 8   THR n 
3 9   ILE n 
3 10  ASP n 
3 11  MET n 
3 12  GLU n 
3 13  LEU n 
3 14  VAL n 
3 15  LYS n 
3 16  ARG n 
3 17  LYS n 
3 18  ARG n 
3 19  ILE n 
3 20  GLU n 
3 21  ALA n 
3 22  ILE n 
3 23  ARG n 
3 24  GLY n 
3 25  GLN n 
3 26  ILE n 
3 27  LEU n 
3 28  SER n 
3 29  LYS n 
3 30  LEU n 
3 31  ARG n 
3 32  LEU n 
3 33  ALA n 
3 34  SER n 
3 35  PRO n 
3 36  PRO n 
3 37  SER n 
3 38  GLN n 
3 39  GLY n 
3 40  GLU n 
3 41  VAL n 
3 42  PRO n 
3 43  PRO n 
3 44  GLY n 
3 45  PRO n 
3 46  LEU n 
3 47  PRO n 
3 48  GLU n 
3 49  ALA n 
3 50  VAL n 
3 51  LEU n 
3 52  ALA n 
3 53  LEU n 
3 54  TYR n 
3 55  ASN n 
3 56  SER n 
3 57  THR n 
3 58  ARG n 
3 59  ASP n 
3 60  ARG n 
3 61  VAL n 
3 62  ALA n 
3 63  GLY n 
3 64  GLU n 
3 65  SER n 
3 66  ALA n 
3 67  GLU n 
3 68  PRO n 
3 69  GLU n 
3 70  PRO n 
3 71  GLU n 
3 72  PRO n 
3 73  GLU n 
3 74  ALA n 
3 75  ASP n 
3 76  TYR n 
3 77  TYR n 
3 78  ALA n 
3 79  LYS n 
3 80  GLU n 
3 81  VAL n 
3 82  THR n 
3 83  ARG n 
3 84  VAL n 
3 85  LEU n 
3 86  MET n 
3 87  VAL n 
3 88  GLU n 
3 89  THR n 
3 90  HIS n 
3 91  ASN n 
3 92  GLU n 
3 93  ILE n 
3 94  TYR n 
3 95  ASP n 
3 96  LYS n 
3 97  PHE n 
3 98  LYS n 
3 99  GLN n 
3 100 SER n 
3 101 THR n 
3 102 HIS n 
3 103 SER n 
3 104 ILE n 
3 105 TYR n 
3 106 MET n 
3 107 PHE n 
3 108 PHE n 
3 109 GLN n 
3 110 THR n 
3 111 SER n 
3 112 GLU n 
3 113 LEU n 
3 114 ARG n 
3 115 GLU n 
3 116 ALA n 
3 117 VAL n 
3 118 PRO n 
3 119 GLU n 
3 120 PRO n 
3 121 VAL n 
3 122 LEU n 
3 123 LEU n 
3 124 SER n 
3 125 ARG n 
3 126 ALA n 
3 127 GLU n 
3 128 LEU n 
3 129 ARG n 
3 130 LEU n 
3 131 LEU n 
3 132 ARG n 
3 133 LEU n 
3 134 LYS n 
3 135 LEU n 
3 136 LYS n 
3 137 VAL n 
3 138 GLU n 
3 139 GLN n 
3 140 HIS n 
3 141 VAL n 
3 142 GLU n 
3 143 LEU n 
3 144 TYR n 
3 145 GLN n 
3 146 LYS n 
3 147 TYR n 
3 148 SER n 
3 149 GLN n 
3 150 ASN n 
3 151 SER n 
3 152 TRP n 
3 153 ARG n 
3 154 TYR n 
3 155 LEU n 
3 156 SER n 
3 157 ASN n 
3 158 ARG n 
3 159 LEU n 
3 160 LEU n 
3 161 ALA n 
3 162 PRO n 
3 163 SER n 
3 164 ASP n 
3 165 SER n 
3 166 PRO n 
3 167 GLU n 
3 168 TRP n 
3 169 LEU n 
3 170 SER n 
3 171 PHE n 
3 172 ASP n 
3 173 VAL n 
3 174 THR n 
3 175 GLY n 
3 176 VAL n 
3 177 VAL n 
3 178 ARG n 
3 179 GLN n 
3 180 TRP n 
3 181 LEU n 
3 182 SER n 
3 183 ARG n 
3 184 GLY n 
3 185 GLY n 
3 186 GLU n 
3 187 ILE n 
3 188 GLU n 
3 189 GLY n 
3 190 PHE n 
3 191 ARG n 
3 192 LEU n 
3 193 SER n 
3 194 ALA n 
3 195 HIS n 
3 196 CYS n 
3 197 SER n 
3 198 CYS n 
3 199 ASP n 
3 200 SER n 
3 201 ARG n 
3 202 ASP n 
3 203 ASN n 
3 204 THR n 
3 205 LEU n 
3 206 GLN n 
3 207 VAL n 
3 208 ASP n 
3 209 ILE n 
3 210 ASN n 
3 211 GLY n 
3 212 PHE n 
3 213 THR n 
3 214 THR n 
3 215 GLY n 
3 216 ARG n 
3 217 ARG n 
3 218 GLY n 
3 219 ASP n 
3 220 LEU n 
3 221 ALA n 
3 222 THR n 
3 223 ILE n 
3 224 HIS n 
3 225 GLY n 
3 226 MET n 
3 227 ASN n 
3 228 ARG n 
3 229 PRO n 
3 230 PHE n 
3 231 LEU n 
3 232 LEU n 
3 233 LEU n 
3 234 MET n 
3 235 ALA n 
3 236 THR n 
3 237 PRO n 
3 238 LEU n 
3 239 GLU n 
3 240 ARG n 
3 241 ALA n 
3 242 GLN n 
3 243 HIS n 
3 244 LEU n 
3 245 GLN n 
3 246 SER n 
3 247 SER n 
3 248 ARG n 
3 249 HIS n 
3 250 ARG n 
3 251 ARG n 
3 252 ALA n 
3 253 LEU n 
3 254 ASP n 
3 255 THR n 
3 256 ASN n 
3 257 TYR n 
3 258 CYS n 
3 259 PHE n 
3 260 SER n 
3 261 SER n 
3 262 THR n 
3 263 GLU n 
3 264 LYS n 
3 265 ASN n 
3 266 CYS n 
3 267 CYS n 
3 268 VAL n 
3 269 ARG n 
3 270 GLN n 
3 271 LEU n 
3 272 TYR n 
3 273 ILE n 
3 274 ASP n 
3 275 PHE n 
3 276 ARG n 
3 277 LYS n 
3 278 ASP n 
3 279 LEU n 
3 280 GLY n 
3 281 TRP n 
3 282 LYS n 
3 283 TRP n 
3 284 ILE n 
3 285 HIS n 
3 286 GLU n 
3 287 PRO n 
3 288 LYS n 
3 289 GLY n 
3 290 TYR n 
3 291 HIS n 
3 292 ALA n 
3 293 ASN n 
3 294 PHE n 
3 295 CYS n 
3 296 LEU n 
3 297 GLY n 
3 298 PRO n 
3 299 CYS n 
3 300 PRO n 
3 301 TYR n 
3 302 ILE n 
3 303 TRP n 
3 304 SER n 
3 305 LEU n 
3 306 ASP n 
3 307 THR n 
3 308 GLN n 
3 309 TYR n 
3 310 SER n 
3 311 LYS n 
3 312 VAL n 
3 313 LEU n 
3 314 ALA n 
3 315 LEU n 
3 316 TYR n 
3 317 ASN n 
3 318 GLN n 
3 319 HIS n 
3 320 ASN n 
3 321 PRO n 
3 322 GLY n 
3 323 ALA n 
3 324 SER n 
3 325 ALA n 
3 326 ALA n 
3 327 PRO n 
3 328 CYS n 
3 329 CYS n 
3 330 VAL n 
3 331 PRO n 
3 332 GLN n 
3 333 ALA n 
3 334 LEU n 
3 335 GLU n 
3 336 PRO n 
3 337 LEU n 
3 338 PRO n 
3 339 ILE n 
3 340 VAL n 
3 341 TYR n 
3 342 TYR n 
3 343 VAL n 
3 344 GLY n 
3 345 ARG n 
3 346 LYS n 
3 347 PRO n 
3 348 LYS n 
3 349 VAL n 
3 350 GLU n 
3 351 GLN n 
3 352 LEU n 
3 353 SER n 
3 354 ASN n 
3 355 MET n 
3 356 ILE n 
3 357 VAL n 
3 358 ARG n 
3 359 SER n 
3 360 CYS n 
3 361 LYS n 
3 362 CYS n 
3 363 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 601 Human ? 'ITGAV, MSK8, VNRA' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Homo sapiens' 
9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 257 Human ? ITGB6               ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Homo sapiens' 
9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 363 Human ? 'TGFB1, TGFB'       ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Homo sapiens' 
9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ITAV_HUMAN  P06756 ? 1 
;FNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDY
AKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFS
IDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFV
SGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQ
RASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSM
PPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLK
ADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFME
YRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCG
;
31  
2 UNP ITB6_HUMAN  P18564 ? 2 
;TEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPT
FGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVI
PNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISA
YEELRSEVELE
;
128 
3 UNP TGFB1_HUMAN P01137 ? 3 
;KTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLM
VETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSP
EWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQS
SRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAA
PCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
;
34  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5FFO A 1 ? 598 ? P06756 31  ? 627 ? 1   598 
2 2 5FFO B 1 ? 251 ? P18564 128 ? 378 ? 111 361 
3 3 5FFO C 7 ? 363 ? P01137 34  ? 390 ? 5   361 
4 3 5FFO D 7 ? 363 ? P01137 34  ? 390 ? 5   361 
5 1 5FFO E 1 ? 598 ? P06756 31  ? 627 ? 1   598 
6 2 5FFO F 1 ? 251 ? P18564 128 ? 378 ? 111 361 
7 3 5FFO G 7 ? 363 ? P01137 34  ? 390 ? 5   361 
8 3 5FFO H 7 ? 363 ? P01137 34  ? 390 ? 5   361 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5FFO GLY A 400 ? UNP P06756 ?   ?   insertion        400 1  
1 5FFO CYS A 401 ? UNP P06756 MET 430 conflict         401 2  
1 5FFO THR A 597 ? UNP P06756 CYS 626 conflict         597 3  
1 5FFO GLY A 599 ? UNP P06756 ?   ?   'expression tag' 599 4  
1 5FFO LEU A 600 ? UNP P06756 ?   ?   'expression tag' 600 5  
1 5FFO GLU A 601 ? UNP P06756 ?   ?   'expression tag' 601 6  
2 5FFO CYS B 160 ? UNP P18564 ILE 287 conflict         270 7  
2 5FFO HIS B 252 ? UNP P18564 ?   ?   'expression tag' 362 8  
2 5FFO HIS B 253 ? UNP P18564 ?   ?   'expression tag' 363 9  
2 5FFO HIS B 254 ? UNP P18564 ?   ?   'expression tag' 364 10 
2 5FFO HIS B 255 ? UNP P18564 ?   ?   'expression tag' 365 11 
2 5FFO HIS B 256 ? UNP P18564 ?   ?   'expression tag' 366 12 
2 5FFO HIS B 257 ? UNP P18564 ?   ?   'expression tag' 367 13 
3 5FFO GLY C 1   ? UNP P01137 ?   ?   'expression tag' -1  14 
3 5FFO PRO C 2   ? UNP P01137 ?   ?   'expression tag' 0   15 
3 5FFO LEU C 3   ? UNP P01137 ?   ?   'expression tag' 1   16 
3 5FFO SER C 4   ? UNP P01137 ?   ?   'expression tag' 2   17 
3 5FFO THR C 5   ? UNP P01137 ?   ?   'expression tag' 3   18 
3 5FFO SER C 6   ? UNP P01137 ?   ?   'expression tag' 4   19 
3 5FFO GLN C 109 ? UNP P01137 ASN 136 conflict         107 20 
3 5FFO GLN C 149 ? UNP P01137 ASN 176 conflict         147 21 
4 5FFO GLY D 1   ? UNP P01137 ?   ?   'expression tag' -1  22 
4 5FFO PRO D 2   ? UNP P01137 ?   ?   'expression tag' 0   23 
4 5FFO LEU D 3   ? UNP P01137 ?   ?   'expression tag' 1   24 
4 5FFO SER D 4   ? UNP P01137 ?   ?   'expression tag' 2   25 
4 5FFO THR D 5   ? UNP P01137 ?   ?   'expression tag' 3   26 
4 5FFO SER D 6   ? UNP P01137 ?   ?   'expression tag' 4   27 
4 5FFO GLN D 109 ? UNP P01137 ASN 136 conflict         107 28 
4 5FFO GLN D 149 ? UNP P01137 ASN 176 conflict         147 29 
5 5FFO GLY E 400 ? UNP P06756 ?   ?   insertion        400 30 
5 5FFO CYS E 401 ? UNP P06756 MET 430 conflict         401 31 
5 5FFO THR E 597 ? UNP P06756 CYS 626 conflict         597 32 
5 5FFO GLY E 599 ? UNP P06756 ?   ?   'expression tag' 599 33 
5 5FFO LEU E 600 ? UNP P06756 ?   ?   'expression tag' 600 34 
5 5FFO GLU E 601 ? UNP P06756 ?   ?   'expression tag' 601 35 
6 5FFO CYS F 160 ? UNP P18564 ILE 287 conflict         270 36 
6 5FFO HIS F 252 ? UNP P18564 ?   ?   'expression tag' 362 37 
6 5FFO HIS F 253 ? UNP P18564 ?   ?   'expression tag' 363 38 
6 5FFO HIS F 254 ? UNP P18564 ?   ?   'expression tag' 364 39 
6 5FFO HIS F 255 ? UNP P18564 ?   ?   'expression tag' 365 40 
6 5FFO HIS F 256 ? UNP P18564 ?   ?   'expression tag' 366 41 
6 5FFO HIS F 257 ? UNP P18564 ?   ?   'expression tag' 367 42 
7 5FFO GLY G 1   ? UNP P01137 ?   ?   'expression tag' -1  43 
7 5FFO PRO G 2   ? UNP P01137 ?   ?   'expression tag' 0   44 
7 5FFO LEU G 3   ? UNP P01137 ?   ?   'expression tag' 1   45 
7 5FFO SER G 4   ? UNP P01137 ?   ?   'expression tag' 2   46 
7 5FFO THR G 5   ? UNP P01137 ?   ?   'expression tag' 3   47 
7 5FFO SER G 6   ? UNP P01137 ?   ?   'expression tag' 4   48 
7 5FFO GLN G 109 ? UNP P01137 ASN 136 conflict         107 49 
7 5FFO GLN G 149 ? UNP P01137 ASN 176 conflict         147 50 
8 5FFO GLY H 1   ? UNP P01137 ?   ?   'expression tag' -1  51 
8 5FFO PRO H 2   ? UNP P01137 ?   ?   'expression tag' 0   52 
8 5FFO LEU H 3   ? UNP P01137 ?   ?   'expression tag' 1   53 
8 5FFO SER H 4   ? UNP P01137 ?   ?   'expression tag' 2   54 
8 5FFO THR H 5   ? UNP P01137 ?   ?   'expression tag' 3   55 
8 5FFO SER H 6   ? UNP P01137 ?   ?   'expression tag' 4   56 
8 5FFO GLN H 109 ? UNP P01137 ASN 136 conflict         107 57 
8 5FFO GLN H 149 ? UNP P01137 ASN 176 conflict         147 58 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
CA  non-polymer                   . 'CALCIUM ION'                            ? 'Ca 2'           40.078  
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer                   . 'MANGANESE (II) ION'                     ? 'Mn 2'           54.938  
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5FFO 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.74 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.13 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;8% PEG8000
0.1M Immidazole
;
_exptl_crystal_grow.pdbx_pH_range   7.5-8.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MAR CCD 165 mm' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-07-27 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03318 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.03318 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5FFO 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.49 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       45279 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  1.8 
_reflns.pdbx_Rmerge_I_obs                0.168 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.988 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.5 
_reflns_shell.d_res_low                   3.64 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.4 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        97.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5FFO 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     45279 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.91 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.720 
_refine.ls_d_res_high                            3.490 
_refine.ls_percent_reflns_obs                    94.40 
_refine.ls_R_factor_obs                          0.2257 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2236 
_refine.ls_R_factor_R_free                       0.2774 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.46 
_refine.ls_number_reflns_R_free                  1116 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       TWIN_LSQ_F 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            . 
_refine.pdbx_overall_phase_error                 27.95 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        22945 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         836 
_refine_hist.number_atoms_solvent             5 
_refine_hist.number_atoms_total               23786 
_refine_hist.d_res_high                       3.490 
_refine_hist.d_res_low                        45.720 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 24469 'X-RAY DIFFRACTION' ? 
f_angle_d          0.798  ? ? 33145 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 11.435 ? ? 14775 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.045  ? ? 3786  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 4184  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.4948 3.6535  5647 0.2814 95.00 0.3078 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.6535 3.8456  5610 0.2832 94.00 0.2944 . . 129 . . . . 
'X-RAY DIFFRACTION' . 3.8456 4.0859  5609 0.2889 94.00 0.2905 . . 135 . . . . 
'X-RAY DIFFRACTION' . 4.0859 4.4002  5430 0.2809 92.00 0.3565 . . 147 . . . . 
'X-RAY DIFFRACTION' . 4.4002 4.8408  5551 0.2504 93.00 0.3077 . . 120 . . . . 
'X-RAY DIFFRACTION' . 4.8408 5.5364  5496 0.2258 93.00 0.2611 . . 138 . . . . 
'X-RAY DIFFRACTION' . 5.5364 6.9568  5485 0.2132 92.00 0.3155 . . 124 . . . . 
'X-RAY DIFFRACTION' . 6.9568 27.6276 5273 0.1668 89.00 0.2328 . . 126 . . . . 
# 
_struct.entry_id                     5FFO 
_struct.title                        'Integrin alpha V beta 6 in complex with pro-TGF-beta' 
_struct.pdbx_descriptor              'Integrin alpha-V, Integrin beta-6, Transforming growth factor beta-1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5FFO 
_struct_keywords.text            'Integrin, TGF-beta, CELL ADHESION' 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 3  ? 
E  N N 1  ? 
F  N N 2  ? 
G  N N 3  ? 
H  N N 3  ? 
I  N N 4  ? 
J  N N 5  ? 
K  N N 6  ? 
L  N N 7  ? 
M  N N 8  ? 
N  N N 9  ? 
O  N N 9  ? 
P  N N 4  ? 
Q  N N 5  ? 
R  N N 6  ? 
S  N N 7  ? 
T  N N 8  ? 
U  N N 9  ? 
V  N N 10 ? 
W  N N 11 ? 
X  N N 11 ? 
Y  N N 11 ? 
Z  N N 11 ? 
AA N N 12 ? 
BA N N 13 ? 
CA N N 13 ? 
DA N N 13 ? 
EA N N 12 ? 
FA N N 11 ? 
GA N N 11 ? 
HA N N 11 ? 
IA N N 11 ? 
JA N N 12 ? 
KA N N 13 ? 
LA N N 13 ? 
MA N N 13 ? 
NA N N 12 ? 
OA N N 14 ? 
PA N N 14 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 175 ? GLN A 180 ? GLY A 175 GLN A 180 1 ? 6  
HELX_P HELX_P2  AA2 VAL A 188 ? LYS A 194 ? VAL A 188 LYS A 194 1 ? 7  
HELX_P HELX_P3  AA3 GLN A 214 ? ASP A 218 ? GLN A 214 ASP A 218 5 ? 5  
HELX_P HELX_P4  AA4 ARG A 245 ? LEU A 250 ? ARG A 245 LEU A 250 1 ? 6  
HELX_P HELX_P5  AA5 GLY A 366 ? LYS A 370 ? GLY A 366 LYS A 370 5 ? 5  
HELX_P HELX_P6  AA6 ASP A 545 ? PHE A 549 ? ASP A 545 PHE A 549 5 ? 5  
HELX_P HELX_P7  AA7 TYR A 566 ? ALA A 570 ? TYR A 566 ALA A 570 5 ? 5  
HELX_P HELX_P8  AA8 SER B 15  ? ASP B 19  ? SER B 125 ASP B 129 5 ? 5  
HELX_P HELX_P9  AA9 ASP B 21  ? THR B 40  ? ASP B 131 THR B 150 1 ? 20 
HELX_P HELX_P10 AB1 THR B 62  ? ASN B 68  ? THR B 172 ASN B 178 1 ? 7  
HELX_P HELX_P11 AB2 ALA B 93  ? ASN B 102 ? ALA B 203 ASN B 212 1 ? 10 
HELX_P HELX_P12 AB3 GLY B 114 ? CYS B 125 ? GLY B 224 CYS B 235 1 ? 12 
HELX_P HELX_P13 AB4 MET B 151 ? LEU B 155 ? MET B 261 LEU B 265 5 ? 5  
HELX_P HELX_P14 AB5 THR B 184 ? ASN B 195 ? THR B 294 ASN B 305 1 ? 12 
HELX_P HELX_P15 AB6 THR B 204 ? ILE B 218 ? THR B 314 ILE B 328 1 ? 15 
HELX_P HELX_P16 AB7 SER B 230 ? SER B 239 ? SER B 340 SER B 349 1 ? 10 
HELX_P HELX_P17 AB8 MET C 11  ? LEU C 30  ? MET C 9   LEU C 28  1 ? 20 
HELX_P HELX_P18 AB9 PRO C 47  ? ARG C 58  ? PRO C 45  ARG C 56  1 ? 12 
HELX_P HELX_P19 AC1 THR C 110 ? VAL C 117 ? THR C 108 VAL C 115 1 ? 8  
HELX_P HELX_P20 AC2 VAL C 173 ? ARG C 183 ? VAL C 171 ARG C 181 1 ? 11 
HELX_P HELX_P21 AC3 PRO C 237 ? GLN C 242 ? PRO C 235 GLN C 240 1 ? 6  
HELX_P HELX_P22 AC4 ASP C 254 ? PHE C 259 ? ASP C 252 PHE C 257 1 ? 6  
HELX_P HELX_P23 AC5 LEU D 13  ? LEU D 30  ? LEU D 11  LEU D 28  1 ? 18 
HELX_P HELX_P24 AC6 PRO D 47  ? ARG D 58  ? PRO D 45  ARG D 56  1 ? 12 
HELX_P HELX_P25 AC7 GLU D 112 ? VAL D 117 ? GLU D 110 VAL D 115 1 ? 6  
HELX_P HELX_P26 AC8 GLU D 119 ? VAL D 121 ? GLU D 117 VAL D 119 5 ? 3  
HELX_P HELX_P27 AC9 VAL D 173 ? ARG D 183 ? VAL D 171 ARG D 181 1 ? 11 
HELX_P HELX_P28 AD1 ASP D 219 ? MET D 226 ? ASP D 217 MET D 224 5 ? 8  
HELX_P HELX_P29 AD2 GLY E 175 ? GLN E 180 ? GLY E 175 GLN E 180 1 ? 6  
HELX_P HELX_P30 AD3 VAL E 188 ? LYS E 194 ? VAL E 188 LYS E 194 1 ? 7  
HELX_P HELX_P31 AD4 GLN E 214 ? ASP E 218 ? GLN E 214 ASP E 218 5 ? 5  
HELX_P HELX_P32 AD5 ARG E 245 ? LEU E 250 ? ARG E 245 LEU E 250 1 ? 6  
HELX_P HELX_P33 AD6 GLY E 366 ? LYS E 370 ? GLY E 366 LYS E 370 5 ? 5  
HELX_P HELX_P34 AD7 PHE E 428 ? VAL E 430 ? PHE E 428 VAL E 430 5 ? 3  
HELX_P HELX_P35 AD8 ASP E 545 ? PHE E 549 ? ASP E 545 PHE E 549 5 ? 5  
HELX_P HELX_P36 AD9 TYR E 566 ? ALA E 570 ? TYR E 566 ALA E 570 5 ? 5  
HELX_P HELX_P37 AE1 SER F 15  ? ASP F 19  ? SER F 125 ASP F 129 5 ? 5  
HELX_P HELX_P38 AE2 ASP F 21  ? THR F 40  ? ASP F 131 THR F 150 1 ? 20 
HELX_P HELX_P39 AE3 THR F 62  ? ASN F 68  ? THR F 172 ASN F 178 1 ? 7  
HELX_P HELX_P40 AE4 ALA F 93  ? ASN F 102 ? ALA F 203 ASN F 212 1 ? 10 
HELX_P HELX_P41 AE5 GLY F 114 ? CYS F 125 ? GLY F 224 CYS F 235 1 ? 12 
HELX_P HELX_P42 AE6 MET F 151 ? LEU F 155 ? MET F 261 LEU F 265 5 ? 5  
HELX_P HELX_P43 AE7 THR F 184 ? VAL F 193 ? THR F 294 VAL F 303 1 ? 10 
HELX_P HELX_P44 AE8 THR F 204 ? ILE F 218 ? THR F 314 ILE F 328 1 ? 15 
HELX_P HELX_P45 AE9 SER F 230 ? SER F 239 ? SER F 340 SER F 349 1 ? 10 
HELX_P HELX_P46 AF1 LEU G 13  ? LEU G 30  ? LEU G 11  LEU G 28  1 ? 18 
HELX_P HELX_P47 AF2 PRO G 47  ? ARG G 58  ? PRO G 45  ARG G 56  1 ? 12 
HELX_P HELX_P48 AF3 THR G 110 ? VAL G 117 ? THR G 108 VAL G 115 1 ? 8  
HELX_P HELX_P49 AF4 VAL G 173 ? ARG G 183 ? VAL G 171 ARG G 181 1 ? 11 
HELX_P HELX_P50 AF5 PRO G 237 ? GLN G 242 ? PRO G 235 GLN G 240 1 ? 6  
HELX_P HELX_P51 AF6 ASP G 254 ? PHE G 259 ? ASP G 252 PHE G 257 1 ? 6  
HELX_P HELX_P52 AF7 GLU H 12  ? LEU H 30  ? GLU H 10  LEU H 28  1 ? 19 
HELX_P HELX_P53 AF8 PRO H 47  ? ARG H 58  ? PRO H 45  ARG H 56  1 ? 12 
HELX_P HELX_P54 AF9 GLU H 112 ? VAL H 117 ? GLU H 110 VAL H 115 1 ? 6  
HELX_P HELX_P55 AG1 GLU H 119 ? VAL H 121 ? GLU H 117 VAL H 119 5 ? 3  
HELX_P HELX_P56 AG2 VAL H 173 ? ARG H 183 ? VAL H 171 ARG H 181 1 ? 11 
HELX_P HELX_P57 AG3 ASP H 219 ? MET H 226 ? ASP H 217 MET H 224 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A  CYS 59  SG  ? ? ? 1_555 A  CYS 67  SG  ? ? A CYS 59   A CYS 67   1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf2  disulf ?    ? A  CYS 108 SG  ? ? ? 1_555 A  CYS 128 SG  ? ? A CYS 108  A CYS 128  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf3  disulf ?    ? A  CYS 142 SG  ? ? ? 1_555 A  CYS 155 SG  ? ? A CYS 142  A CYS 155  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf4  disulf ?    ? A  CYS 401 SG  ? ? ? 1_555 B  CYS 160 SG  ? ? A CYS 401  B CYS 270  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf5  disulf ?    ? A  CYS 462 SG  ? ? ? 1_555 A  CYS 473 SG  ? ? A CYS 462  A CYS 473  1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf6  disulf ?    ? A  CYS 479 SG  ? ? ? 1_555 A  CYS 536 SG  ? ? A CYS 479  A CYS 536  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf7  disulf ?    ? B  CYS 70  SG  ? ? ? 1_555 B  CYS 77  SG  ? ? B CYS 180  B CYS 187  1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf8  disulf ?    ? B  CYS 125 SG  ? ? ? 1_555 B  CYS 166 SG  ? ? B CYS 235  B CYS 276  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf9  disulf ?    ? C  CYS 196 SG  ? ? ? 1_555 D  CYS 198 SG  ? ? C CYS 194  D CYS 196  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf10 disulf ?    ? C  CYS 198 SG  ? ? ? 1_555 D  CYS 196 SG  ? ? C CYS 196  D CYS 194  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf11 disulf ?    ? C  CYS 258 SG  ? ? ? 1_555 C  CYS 267 SG  ? ? C CYS 256  C CYS 265  1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf12 disulf ?    ? C  CYS 266 SG  ? ? ? 1_555 C  CYS 329 SG  ? ? C CYS 264  C CYS 327  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf13 disulf ?    ? C  CYS 295 SG  ? ? ? 1_555 C  CYS 360 SG  ? ? C CYS 293  C CYS 358  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf14 disulf ?    ? C  CYS 299 SG  ? ? ? 1_555 C  CYS 362 SG  ? ? C CYS 297  C CYS 360  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf15 disulf ?    ? C  CYS 328 SG  ? ? ? 1_555 D  CYS 328 SG  ? ? C CYS 326  D CYS 326  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf16 disulf ?    ? D  CYS 258 SG  ? ? ? 1_555 D  CYS 267 SG  ? ? D CYS 256  D CYS 265  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf17 disulf ?    ? D  CYS 266 SG  ? ? ? 1_555 D  CYS 329 SG  ? ? D CYS 264  D CYS 327  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf18 disulf ?    ? D  CYS 295 SG  ? ? ? 1_555 D  CYS 360 SG  ? ? D CYS 293  D CYS 358  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf19 disulf ?    ? D  CYS 299 SG  ? ? ? 1_555 D  CYS 362 SG  ? ? D CYS 297  D CYS 360  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf20 disulf ?    ? E  CYS 59  SG  ? ? ? 1_555 E  CYS 67  SG  ? ? E CYS 59   E CYS 67   1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf21 disulf ?    ? E  CYS 108 SG  ? ? ? 1_555 E  CYS 128 SG  ? ? E CYS 108  E CYS 128  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf22 disulf ?    ? E  CYS 142 SG  ? ? ? 1_555 E  CYS 155 SG  ? ? E CYS 142  E CYS 155  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf23 disulf ?    ? E  CYS 401 SG  ? ? ? 1_555 F  CYS 160 SG  ? ? E CYS 401  F CYS 270  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf24 disulf ?    ? E  CYS 462 SG  ? ? ? 1_555 E  CYS 473 SG  ? ? E CYS 462  E CYS 473  1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf25 disulf ?    ? E  CYS 479 SG  ? ? ? 1_555 E  CYS 536 SG  ? ? E CYS 479  E CYS 536  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf26 disulf ?    ? F  CYS 70  SG  ? ? ? 1_555 F  CYS 77  SG  ? ? F CYS 180  F CYS 187  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf27 disulf ?    ? F  CYS 125 SG  ? ? ? 1_555 F  CYS 166 SG  ? ? F CYS 235  F CYS 276  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf28 disulf ?    ? G  CYS 196 SG  ? ? ? 1_555 H  CYS 198 SG  ? ? G CYS 194  H CYS 196  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf29 disulf ?    ? G  CYS 198 SG  ? ? ? 1_555 H  CYS 196 SG  ? ? G CYS 196  H CYS 194  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf30 disulf ?    ? G  CYS 258 SG  ? ? ? 1_555 G  CYS 267 SG  ? ? G CYS 256  G CYS 265  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf31 disulf ?    ? G  CYS 266 SG  ? ? ? 1_555 G  CYS 329 SG  ? ? G CYS 264  G CYS 327  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf32 disulf ?    ? G  CYS 295 SG  ? ? ? 1_555 G  CYS 360 SG  ? ? G CYS 293  G CYS 358  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf33 disulf ?    ? G  CYS 299 SG  ? ? ? 1_555 G  CYS 362 SG  ? ? G CYS 297  G CYS 360  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf34 disulf ?    ? G  CYS 328 SG  ? ? ? 1_555 H  CYS 328 SG  ? ? G CYS 326  H CYS 326  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf35 disulf ?    ? H  CYS 266 SG  ? ? ? 1_555 H  CYS 329 SG  ? ? H CYS 264  H CYS 327  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf36 disulf ?    ? H  CYS 295 SG  ? ? ? 1_555 H  CYS 360 SG  ? ? H CYS 293  H CYS 358  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf37 disulf ?    ? H  CYS 299 SG  ? ? ? 1_555 H  CYS 362 SG  ? ? H CYS 297  H CYS 360  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
covale1  covale one  ? A  ASN 44  ND2 ? ? ? 1_555 I  NAG .   C1  ? ? A ASN 44   I NAG 1    1_555 ? ? ? ? ? ? ? 1.443 ? 
N-Glycosylation 
covale2  covale one  ? A  ASN 260 ND2 ? ? ? 1_555 J  NAG .   C1  ? ? A ASN 260  J NAG 1    1_555 ? ? ? ? ? ? ? 1.441 ? 
N-Glycosylation 
covale3  covale one  ? A  ASN 266 ND2 ? ? ? 1_555 K  NAG .   C1  ? ? A ASN 266  K NAG 1    1_555 ? ? ? ? ? ? ? 1.433 ? 
N-Glycosylation 
covale4  covale one  ? A  ASN 459 ND2 ? ? ? 1_555 L  NAG .   C1  ? ? A ASN 459  L NAG 1    1_555 ? ? ? ? ? ? ? 1.441 ? 
N-Glycosylation 
covale5  covale one  ? A  ASN 525 ND2 ? ? ? 1_555 AA NAG .   C1  ? ? A ASN 525  A NAG 2025 1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale6  covale one  ? A  ASN 586 ND2 ? ? ? 1_555 M  NAG .   C1  ? ? A ASN 586  M NAG 1    1_555 ? ? ? ? ? ? ? 1.430 ? 
N-Glycosylation 
covale7  covale one  ? B  ASN 133 ND2 ? ? ? 1_555 EA NAG .   C1  ? ? B ASN 243  B NAG 2004 1_555 ? ? ? ? ? ? ? 1.443 ? 
N-Glycosylation 
covale8  covale one  ? C  ASN 55  ND2 ? ? ? 1_555 N  NAG .   C1  ? ? C ASN 53   N NAG 1    1_555 ? ? ? ? ? ? ? 1.433 ? 
N-Glycosylation 
covale9  covale one  ? D  ASN 55  ND2 ? ? ? 1_555 O  NAG .   C1  ? ? D ASN 53   O NAG 1    1_555 ? ? ? ? ? ? ? 1.430 ? 
N-Glycosylation 
covale10 covale one  ? E  ASN 44  ND2 ? ? ? 1_555 P  NAG .   C1  ? ? E ASN 44   P NAG 1    1_555 ? ? ? ? ? ? ? 1.442 ? 
N-Glycosylation 
covale11 covale one  ? E  ASN 260 ND2 ? ? ? 1_555 Q  NAG .   C1  ? ? E ASN 260  Q NAG 1    1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale12 covale one  ? E  ASN 266 ND2 ? ? ? 1_555 R  NAG .   C1  ? ? E ASN 266  R NAG 1    1_555 ? ? ? ? ? ? ? 1.429 ? 
N-Glycosylation 
covale13 covale one  ? E  ASN 459 ND2 ? ? ? 1_555 S  NAG .   C1  ? ? E ASN 459  S NAG 1    1_555 ? ? ? ? ? ? ? 1.441 ? 
N-Glycosylation 
covale14 covale one  ? E  ASN 525 ND2 ? ? ? 1_555 JA NAG .   C1  ? ? E ASN 525  E NAG 2025 1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale15 covale one  ? E  ASN 586 ND2 ? ? ? 1_555 T  NAG .   C1  ? ? E ASN 586  T NAG 1    1_555 ? ? ? ? ? ? ? 1.428 ? 
N-Glycosylation 
covale16 covale one  ? F  ASN 133 ND2 ? ? ? 1_555 NA NAG .   C1  ? ? F ASN 243  F NAG 2004 1_555 ? ? ? ? ? ? ? 1.442 ? 
N-Glycosylation 
covale17 covale one  ? G  ASN 55  ND2 ? ? ? 1_555 U  NAG .   C1  ? ? G ASN 53   U NAG 1    1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale18 covale one  ? H  ASN 55  ND2 ? ? ? 1_555 V  NAG .   C1  ? ? H ASN 53   V NAG 1    1_555 ? ? ? ? ? ? ? 1.434 ? 
N-Glycosylation 
covale19 covale both ? I  NAG .   O4  ? ? ? 1_555 I  NAG .   C1  ? ? I NAG 1    I NAG 2    1_555 ? ? ? ? ? ? ? 1.435 ? ? 
covale20 covale both ? I  NAG .   O4  ? ? ? 1_555 I  BMA .   C1  ? ? I NAG 2    I BMA 3    1_555 ? ? ? ? ? ? ? 1.444 ? ? 
covale21 covale both ? J  NAG .   O4  ? ? ? 1_555 J  NAG .   C1  ? ? J NAG 1    J NAG 2    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale22 covale both ? J  NAG .   O4  ? ? ? 1_555 J  BMA .   C1  ? ? J NAG 2    J BMA 3    1_555 ? ? ? ? ? ? ? 1.434 ? ? 
covale23 covale both ? J  BMA .   O6  ? ? ? 1_555 J  MAN .   C1  ? ? J BMA 3    J MAN 4    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale24 covale both ? J  BMA .   O3  ? ? ? 1_555 J  MAN .   C1  ? ? J BMA 3    J MAN 6    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale25 covale both ? J  MAN .   O6  ? ? ? 1_555 J  MAN .   C1  ? ? J MAN 4    J MAN 5    1_555 ? ? ? ? ? ? ? 1.449 ? ? 
covale26 covale both ? K  NAG .   O4  ? ? ? 1_555 K  NAG .   C1  ? ? K NAG 1    K NAG 2    1_555 ? ? ? ? ? ? ? 1.433 ? ? 
covale27 covale both ? K  NAG .   O4  ? ? ? 1_555 K  BMA .   C1  ? ? K NAG 2    K BMA 3    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale28 covale both ? K  BMA .   O6  ? ? ? 1_555 K  MAN .   C1  ? ? K BMA 3    K MAN 4    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale29 covale both ? K  BMA .   O3  ? ? ? 1_555 K  MAN .   C1  ? ? K BMA 3    K MAN 7    1_555 ? ? ? ? ? ? ? 1.433 ? ? 
covale30 covale both ? K  MAN .   O3  ? ? ? 1_555 K  MAN .   C1  ? ? K MAN 4    K MAN 5    1_555 ? ? ? ? ? ? ? 1.437 ? ? 
covale31 covale both ? K  MAN .   O6  ? ? ? 1_555 K  MAN .   C1  ? ? K MAN 4    K MAN 6    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale32 covale both ? L  NAG .   O4  ? ? ? 1_555 L  NAG .   C1  ? ? L NAG 1    L NAG 2    1_555 ? ? ? ? ? ? ? 1.438 ? ? 
covale33 covale both ? L  NAG .   O4  ? ? ? 1_555 L  BMA .   C1  ? ? L NAG 2    L BMA 3    1_555 ? ? ? ? ? ? ? 1.433 ? ? 
covale34 covale both ? L  BMA .   O6  ? ? ? 1_555 L  MAN .   C1  ? ? L BMA 3    L MAN 4    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale35 covale both ? M  NAG .   O4  ? ? ? 1_555 M  NAG .   C1  ? ? M NAG 1    M NAG 2    1_555 ? ? ? ? ? ? ? 1.437 ? ? 
covale36 covale both ? N  NAG .   O4  ? ? ? 1_555 N  NAG .   C1  ? ? N NAG 1    N NAG 2    1_555 ? ? ? ? ? ? ? 1.438 ? ? 
covale37 covale both ? N  NAG .   O4  ? ? ? 1_555 N  BMA .   C1  ? ? N NAG 2    N BMA 3    1_555 ? ? ? ? ? ? ? 1.442 ? ? 
covale38 covale both ? N  BMA .   O3  ? ? ? 1_555 N  MAN .   C1  ? ? N BMA 3    N MAN 4    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale39 covale both ? O  NAG .   O4  ? ? ? 1_555 O  NAG .   C1  ? ? O NAG 1    O NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale40 covale both ? O  NAG .   O4  ? ? ? 1_555 O  BMA .   C1  ? ? O NAG 2    O BMA 3    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale41 covale both ? O  BMA .   O3  ? ? ? 1_555 O  MAN .   C1  ? ? O BMA 3    O MAN 4    1_555 ? ? ? ? ? ? ? 1.431 ? ? 
covale42 covale both ? P  NAG .   O4  ? ? ? 1_555 P  NAG .   C1  ? ? P NAG 1    P NAG 2    1_555 ? ? ? ? ? ? ? 1.435 ? ? 
covale43 covale both ? P  NAG .   O4  ? ? ? 1_555 P  BMA .   C1  ? ? P NAG 2    P BMA 3    1_555 ? ? ? ? ? ? ? 1.445 ? ? 
covale44 covale both ? Q  NAG .   O4  ? ? ? 1_555 Q  NAG .   C1  ? ? Q NAG 1    Q NAG 2    1_555 ? ? ? ? ? ? ? 1.435 ? ? 
covale45 covale both ? Q  NAG .   O4  ? ? ? 1_555 Q  BMA .   C1  ? ? Q NAG 2    Q BMA 3    1_555 ? ? ? ? ? ? ? 1.434 ? ? 
covale46 covale both ? Q  BMA .   O6  ? ? ? 1_555 Q  MAN .   C1  ? ? Q BMA 3    Q MAN 4    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale47 covale both ? Q  BMA .   O3  ? ? ? 1_555 Q  MAN .   C1  ? ? Q BMA 3    Q MAN 6    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale48 covale both ? Q  MAN .   O6  ? ? ? 1_555 Q  MAN .   C1  ? ? Q MAN 4    Q MAN 5    1_555 ? ? ? ? ? ? ? 1.444 ? ? 
covale49 covale both ? R  NAG .   O4  ? ? ? 1_555 R  NAG .   C1  ? ? R NAG 1    R NAG 2    1_555 ? ? ? ? ? ? ? 1.430 ? ? 
covale50 covale both ? R  NAG .   O4  ? ? ? 1_555 R  BMA .   C1  ? ? R NAG 2    R BMA 3    1_555 ? ? ? ? ? ? ? 1.433 ? ? 
covale51 covale both ? R  BMA .   O6  ? ? ? 1_555 R  MAN .   C1  ? ? R BMA 3    R MAN 4    1_555 ? ? ? ? ? ? ? 1.449 ? ? 
covale52 covale both ? R  BMA .   O3  ? ? ? 1_555 R  MAN .   C1  ? ? R BMA 3    R MAN 7    1_555 ? ? ? ? ? ? ? 1.435 ? ? 
covale53 covale both ? R  MAN .   O3  ? ? ? 1_555 R  MAN .   C1  ? ? R MAN 4    R MAN 5    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale54 covale both ? R  MAN .   O6  ? ? ? 1_555 R  MAN .   C1  ? ? R MAN 4    R MAN 6    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale55 covale both ? S  NAG .   O4  ? ? ? 1_555 S  NAG .   C1  ? ? S NAG 1    S NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale56 covale both ? S  NAG .   O4  ? ? ? 1_555 S  BMA .   C1  ? ? S NAG 2    S BMA 3    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale57 covale both ? S  BMA .   O6  ? ? ? 1_555 S  MAN .   C1  ? ? S BMA 3    S MAN 4    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale58 covale both ? T  NAG .   O4  ? ? ? 1_555 T  NAG .   C1  ? ? T NAG 1    T NAG 2    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale59 covale both ? U  NAG .   O4  ? ? ? 1_555 U  NAG .   C1  ? ? U NAG 1    U NAG 2    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale60 covale both ? U  NAG .   O4  ? ? ? 1_555 U  BMA .   C1  ? ? U NAG 2    U BMA 3    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale61 covale both ? U  BMA .   O3  ? ? ? 1_555 U  MAN .   C1  ? ? U BMA 3    U MAN 4    1_555 ? ? ? ? ? ? ? 1.458 ? ? 
covale62 covale both ? V  NAG .   O4  ? ? ? 1_555 V  NAG .   C1  ? ? V NAG 1    V NAG 2    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale63 covale both ? V  NAG .   O4  ? ? ? 1_555 V  BMA .   C1  ? ? V NAG 2    V BMA 3    1_555 ? ? ? ? ? ? ? 1.433 ? ? 
covale64 covale both ? V  BMA .   O3  ? ? ? 1_555 V  MAN .   C1  ? ? V BMA 3    V MAN 4    1_555 ? ? ? ? ? ? ? 1.438 ? ? 
covale65 covale both ? V  BMA .   O6  ? ? ? 1_555 V  MAN .   C1  ? ? V BMA 3    V MAN 6    1_555 ? ? ? ? ? ? ? 1.449 ? ? 
covale66 covale both ? V  MAN .   O2  ? ? ? 1_555 V  MAN .   C1  ? ? V MAN 4    V MAN 5    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
metalc1  metalc ?    ? A  ASP 230 OD1 ? ? ? 1_555 Z  CA  .   CA  ? ? A ASP 230  A CA  2004 1_555 ? ? ? ? ? ? ? 2.569 ? ? 
metalc2  metalc ?    ? A  ASN 232 OD1 ? ? ? 1_555 Z  CA  .   CA  ? ? A ASN 232  A CA  2004 1_555 ? ? ? ? ? ? ? 2.287 ? ? 
metalc3  metalc ?    ? A  ASP 234 OD1 ? ? ? 1_555 Z  CA  .   CA  ? ? A ASP 234  A CA  2004 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc4  metalc ?    ? A  ILE 236 O   ? ? ? 1_555 Z  CA  .   CA  ? ? A ILE 236  A CA  2004 1_555 ? ? ? ? ? ? ? 2.180 ? ? 
metalc5  metalc ?    ? A  ASP 238 OD1 ? ? ? 1_555 Z  CA  .   CA  ? ? A ASP 238  A CA  2004 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc6  metalc ?    ? A  ASP 238 OD2 ? ? ? 1_555 Z  CA  .   CA  ? ? A ASP 238  A CA  2004 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc7  metalc ?    ? A  ASP 284 OD1 ? ? ? 1_555 W  CA  .   CA  ? ? A ASP 284  A CA  2001 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc8  metalc ?    ? A  ASN 286 OD1 ? ? ? 1_555 W  CA  .   CA  ? ? A ASN 286  A CA  2001 1_555 ? ? ? ? ? ? ? 2.380 ? ? 
metalc9  metalc ?    ? A  ASP 288 OD1 ? ? ? 1_555 W  CA  .   CA  ? ? A ASP 288  A CA  2001 1_555 ? ? ? ? ? ? ? 2.401 ? ? 
metalc10 metalc ?    ? A  TYR 290 O   ? ? ? 1_555 W  CA  .   CA  ? ? A TYR 290  A CA  2001 1_555 ? ? ? ? ? ? ? 2.244 ? ? 
metalc11 metalc ?    ? A  ASP 292 OD1 ? ? ? 1_555 W  CA  .   CA  ? ? A ASP 292  A CA  2001 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc12 metalc ?    ? A  ASP 292 OD2 ? ? ? 1_555 W  CA  .   CA  ? ? A ASP 292  A CA  2001 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc13 metalc ?    ? A  ASP 349 OD1 ? ? ? 1_555 X  CA  .   CA  ? ? A ASP 349  A CA  2002 1_555 ? ? ? ? ? ? ? 2.589 ? ? 
metalc14 metalc ?    ? A  ASP 351 OD1 ? ? ? 1_555 X  CA  .   CA  ? ? A ASP 351  A CA  2002 1_555 ? ? ? ? ? ? ? 2.477 ? ? 
metalc15 metalc ?    ? A  ASP 353 OD1 ? ? ? 1_555 X  CA  .   CA  ? ? A ASP 353  A CA  2002 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc16 metalc ?    ? A  ASP 353 OD2 ? ? ? 1_555 X  CA  .   CA  ? ? A ASP 353  A CA  2002 1_555 ? ? ? ? ? ? ? 2.456 ? ? 
metalc17 metalc ?    ? A  PHE 355 O   ? ? ? 1_555 X  CA  .   CA  ? ? A PHE 355  A CA  2002 1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc18 metalc ?    ? A  ASP 357 OD1 ? ? ? 1_555 X  CA  .   CA  ? ? A ASP 357  A CA  2002 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc19 metalc ?    ? A  ASP 357 OD2 ? ? ? 1_555 X  CA  .   CA  ? ? A ASP 357  A CA  2002 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc20 metalc ?    ? A  ASP 414 OD1 ? ? ? 1_555 Y  CA  .   CA  ? ? A ASP 414  A CA  2003 1_555 ? ? ? ? ? ? ? 2.631 ? ? 
metalc21 metalc ?    ? A  ASP 416 OD1 ? ? ? 1_555 Y  CA  .   CA  ? ? A ASP 416  A CA  2003 1_555 ? ? ? ? ? ? ? 2.558 ? ? 
metalc22 metalc ?    ? A  ASN 418 OD1 ? ? ? 1_555 Y  CA  .   CA  ? ? A ASN 418  A CA  2003 1_555 ? ? ? ? ? ? ? 2.202 ? ? 
metalc23 metalc ?    ? A  TYR 420 O   ? ? ? 1_555 Y  CA  .   CA  ? ? A TYR 420  A CA  2003 1_555 ? ? ? ? ? ? ? 2.375 ? ? 
metalc24 metalc ?    ? A  ASP 422 OD1 ? ? ? 1_555 Y  CA  .   CA  ? ? A ASP 422  A CA  2003 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc25 metalc ?    ? A  ASP 422 OD2 ? ? ? 1_555 Y  CA  .   CA  ? ? A ASP 422  A CA  2003 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc26 metalc ?    ? B  SER 15  OG  ? ? ? 1_555 CA MN  .   MN  ? ? B SER 125  B MN  2002 1_555 ? ? ? ? ? ? ? 2.166 ? ? 
metalc27 metalc ?    ? B  SER 17  O   ? ? ? 1_555 BA MN  .   MN  ? ? B SER 127  B MN  2001 1_555 ? ? ? ? ? ? ? 2.252 ? ? 
metalc28 metalc ?    ? B  SER 17  OG  ? ? ? 1_555 CA MN  .   MN  ? ? B SER 127  B MN  2002 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc29 metalc ?    ? B  ASP 20  OD1 ? ? ? 1_555 BA MN  .   MN  ? ? B ASP 130  B MN  2001 1_555 ? ? ? ? ? ? ? 2.173 ? ? 
metalc30 metalc ?    ? B  ASP 20  OD2 ? ? ? 1_555 BA MN  .   MN  ? ? B ASP 130  B MN  2001 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc31 metalc ?    ? B  ASP 21  OD1 ? ? ? 1_555 BA MN  .   MN  ? ? B ASP 131  B MN  2001 1_555 ? ? ? ? ? ? ? 2.278 ? ? 
metalc32 metalc ?    ? B  ASP 21  OD2 ? ? ? 1_555 BA MN  .   MN  ? ? B ASP 131  B MN  2001 1_555 ? ? ? ? ? ? ? 2.158 ? ? 
metalc33 metalc ?    ? B  GLU 52  OE2 ? ? ? 1_555 DA MN  .   MN  ? ? B GLU 162  B MN  2003 1_555 ? ? ? ? ? ? ? 2.148 ? ? 
metalc34 metalc ?    ? B  ASN 108 OD1 ? ? ? 1_555 DA MN  .   MN  ? ? B ASN 218  B MN  2003 1_555 ? ? ? ? ? ? ? 2.165 ? ? 
metalc35 metalc ?    ? B  ASP 110 O   ? ? ? 1_555 DA MN  .   MN  ? ? B ASP 220  B MN  2003 1_555 ? ? ? ? ? ? ? 2.143 ? ? 
metalc36 metalc ?    ? B  ASP 110 OD1 ? ? ? 1_555 DA MN  .   MN  ? ? B ASP 220  B MN  2003 1_555 ? ? ? ? ? ? ? 2.186 ? ? 
metalc37 metalc ?    ? B  PRO 112 O   ? ? ? 1_555 DA MN  .   MN  ? ? B PRO 222  B MN  2003 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc38 metalc ?    ? B  GLU 113 OE2 ? ? ? 1_555 CA MN  .   MN  ? ? B GLU 223  B MN  2002 1_555 ? ? ? ? ? ? ? 2.137 ? ? 
metalc39 metalc ?    ? B  GLU 113 OE1 ? ? ? 1_555 DA MN  .   MN  ? ? B GLU 223  B MN  2003 1_555 ? ? ? ? ? ? ? 2.176 ? ? 
metalc40 metalc ?    ? B  ASP 144 OD2 ? ? ? 1_555 BA MN  .   MN  ? ? B ASP 254  B MN  2001 1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc41 metalc ?    ? BA MN  .   MN  ? ? ? 1_555 OA HOH .   O   ? ? B MN  2001 B HOH 2103 1_555 ? ? ? ? ? ? ? 2.238 ? ? 
metalc42 metalc ?    ? CA MN  .   MN  ? ? ? 1_555 OA HOH .   O   ? ? B MN  2002 B HOH 2101 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc43 metalc ?    ? CA MN  .   MN  ? ? ? 1_555 OA HOH .   O   ? ? B MN  2002 B HOH 2102 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc44 metalc ?    ? CA MN  .   MN  ? ? ? 1_555 D  ASP 219 OD1 ? ? B MN  2002 D ASP 217  1_555 ? ? ? ? ? ? ? 2.107 ? ? 
metalc45 metalc ?    ? E  ASN 232 OD1 ? ? ? 1_555 IA CA  .   CA  ? ? E ASN 232  E CA  2004 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc46 metalc ?    ? E  ASP 234 OD1 ? ? ? 1_555 IA CA  .   CA  ? ? E ASP 234  E CA  2004 1_555 ? ? ? ? ? ? ? 2.362 ? ? 
metalc47 metalc ?    ? E  ILE 236 O   ? ? ? 1_555 IA CA  .   CA  ? ? E ILE 236  E CA  2004 1_555 ? ? ? ? ? ? ? 2.387 ? ? 
metalc48 metalc ?    ? E  ASP 238 OD1 ? ? ? 1_555 IA CA  .   CA  ? ? E ASP 238  E CA  2004 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc49 metalc ?    ? E  ASP 238 OD2 ? ? ? 1_555 IA CA  .   CA  ? ? E ASP 238  E CA  2004 1_555 ? ? ? ? ? ? ? 2.446 ? ? 
metalc50 metalc ?    ? E  ASP 284 OD1 ? ? ? 1_555 FA CA  .   CA  ? ? E ASP 284  E CA  2001 1_555 ? ? ? ? ? ? ? 2.367 ? ? 
metalc51 metalc ?    ? E  ASN 286 OD1 ? ? ? 1_555 FA CA  .   CA  ? ? E ASN 286  E CA  2001 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc52 metalc ?    ? E  ASP 288 OD1 ? ? ? 1_555 FA CA  .   CA  ? ? E ASP 288  E CA  2001 1_555 ? ? ? ? ? ? ? 2.384 ? ? 
metalc53 metalc ?    ? E  ASP 288 OD2 ? ? ? 1_555 FA CA  .   CA  ? ? E ASP 288  E CA  2001 1_555 ? ? ? ? ? ? ? 3.171 ? ? 
metalc54 metalc ?    ? E  TYR 290 O   ? ? ? 1_555 FA CA  .   CA  ? ? E TYR 290  E CA  2001 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc55 metalc ?    ? E  ASP 292 OD1 ? ? ? 1_555 FA CA  .   CA  ? ? E ASP 292  E CA  2001 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc56 metalc ?    ? E  ASP 292 OD2 ? ? ? 1_555 FA CA  .   CA  ? ? E ASP 292  E CA  2001 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc57 metalc ?    ? E  ASP 349 OD1 ? ? ? 1_555 GA CA  .   CA  ? ? E ASP 349  E CA  2002 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc58 metalc ?    ? E  ASP 351 OD1 ? ? ? 1_555 GA CA  .   CA  ? ? E ASP 351  E CA  2002 1_555 ? ? ? ? ? ? ? 2.435 ? ? 
metalc59 metalc ?    ? E  ASP 353 OD1 ? ? ? 1_555 GA CA  .   CA  ? ? E ASP 353  E CA  2002 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc60 metalc ?    ? E  ASP 353 OD2 ? ? ? 1_555 GA CA  .   CA  ? ? E ASP 353  E CA  2002 1_555 ? ? ? ? ? ? ? 2.487 ? ? 
metalc61 metalc ?    ? E  PHE 355 O   ? ? ? 1_555 GA CA  .   CA  ? ? E PHE 355  E CA  2002 1_555 ? ? ? ? ? ? ? 2.495 ? ? 
metalc62 metalc ?    ? E  ASP 357 OD1 ? ? ? 1_555 GA CA  .   CA  ? ? E ASP 357  E CA  2002 1_555 ? ? ? ? ? ? ? 2.388 ? ? 
metalc63 metalc ?    ? E  ASP 357 OD2 ? ? ? 1_555 GA CA  .   CA  ? ? E ASP 357  E CA  2002 1_555 ? ? ? ? ? ? ? 2.382 ? ? 
metalc64 metalc ?    ? E  ASP 414 OD1 ? ? ? 1_555 HA CA  .   CA  ? ? E ASP 414  E CA  2003 1_555 ? ? ? ? ? ? ? 2.511 ? ? 
metalc65 metalc ?    ? E  ASP 416 OD1 ? ? ? 1_555 HA CA  .   CA  ? ? E ASP 416  E CA  2003 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc66 metalc ?    ? E  ASN 418 OD1 ? ? ? 1_555 HA CA  .   CA  ? ? E ASN 418  E CA  2003 1_555 ? ? ? ? ? ? ? 2.380 ? ? 
metalc67 metalc ?    ? E  TYR 420 O   ? ? ? 1_555 HA CA  .   CA  ? ? E TYR 420  E CA  2003 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc68 metalc ?    ? E  ASP 422 OD1 ? ? ? 1_555 HA CA  .   CA  ? ? E ASP 422  E CA  2003 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc69 metalc ?    ? E  ASP 422 OD2 ? ? ? 1_555 HA CA  .   CA  ? ? E ASP 422  E CA  2003 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc70 metalc ?    ? F  SER 15  OG  ? ? ? 1_555 LA MN  .   MN  ? ? F SER 125  F MN  2002 1_555 ? ? ? ? ? ? ? 2.182 ? ? 
metalc71 metalc ?    ? F  SER 17  O   ? ? ? 1_555 KA MN  .   MN  ? ? F SER 127  F MN  2001 1_555 ? ? ? ? ? ? ? 2.171 ? ? 
metalc72 metalc ?    ? F  SER 17  OG  ? ? ? 1_555 LA MN  .   MN  ? ? F SER 127  F MN  2002 1_555 ? ? ? ? ? ? ? 2.162 ? ? 
metalc73 metalc ?    ? F  ASP 20  OD1 ? ? ? 1_555 KA MN  .   MN  ? ? F ASP 130  F MN  2001 1_555 ? ? ? ? ? ? ? 2.153 ? ? 
metalc74 metalc ?    ? F  ASP 20  OD2 ? ? ? 1_555 KA MN  .   MN  ? ? F ASP 130  F MN  2001 1_555 ? ? ? ? ? ? ? 2.180 ? ? 
metalc75 metalc ?    ? F  ASP 21  OD2 ? ? ? 1_555 KA MN  .   MN  ? ? F ASP 131  F MN  2001 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc76 metalc ?    ? F  GLU 52  OE2 ? ? ? 1_555 MA MN  .   MN  ? ? F GLU 162  F MN  2003 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc77 metalc ?    ? F  ASN 108 OD1 ? ? ? 1_555 MA MN  .   MN  ? ? F ASN 218  F MN  2003 1_555 ? ? ? ? ? ? ? 2.177 ? ? 
metalc78 metalc ?    ? F  ASP 110 O   ? ? ? 1_555 MA MN  .   MN  ? ? F ASP 220  F MN  2003 1_555 ? ? ? ? ? ? ? 2.169 ? ? 
metalc79 metalc ?    ? F  ASP 110 OD1 ? ? ? 1_555 MA MN  .   MN  ? ? F ASP 220  F MN  2003 1_555 ? ? ? ? ? ? ? 2.151 ? ? 
metalc80 metalc ?    ? F  PRO 112 O   ? ? ? 1_555 MA MN  .   MN  ? ? F PRO 222  F MN  2003 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc81 metalc ?    ? F  GLU 113 OE2 ? ? ? 1_555 LA MN  .   MN  ? ? F GLU 223  F MN  2002 1_555 ? ? ? ? ? ? ? 2.139 ? ? 
metalc82 metalc ?    ? F  GLU 113 OE1 ? ? ? 1_555 MA MN  .   MN  ? ? F GLU 223  F MN  2003 1_555 ? ? ? ? ? ? ? 2.184 ? ? 
metalc83 metalc ?    ? F  ASP 144 OD2 ? ? ? 1_555 KA MN  .   MN  ? ? F ASP 254  F MN  2001 1_555 ? ? ? ? ? ? ? 2.165 ? ? 
metalc84 metalc ?    ? LA MN  .   MN  ? ? ? 1_555 PA HOH .   O   ? ? F MN  2002 F HOH 2101 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc85 metalc ?    ? LA MN  .   MN  ? ? ? 1_555 PA HOH .   O   ? ? F MN  2002 F HOH 2102 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc86 metalc ?    ? LA MN  .   MN  ? ? ? 1_555 H  ASP 219 OD1 ? ? F MN  2002 H ASP 217  1_555 ? ? ? ? ? ? ? 2.171 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  TYR 451 A . ? TYR 451 A PRO 452 A ? PRO 452 A 1 0.41  
2  SER 56  B . ? SER 166 B PRO 57  B ? PRO 167 B 1 4.33  
3  ILE 73  B . ? ILE 183 B PRO 74  B ? PRO 184 B 1 -4.44 
4  VAL 41  C . ? VAL 39  C PRO 42  C ? PRO 40  C 1 -7.65 
5  GLU 286 C . ? GLU 284 C PRO 287 C ? PRO 285 C 1 -3.41 
6  GLU 286 D . ? GLU 284 D PRO 287 D ? PRO 285 D 1 -1.58 
7  TYR 451 E . ? TYR 451 E PRO 452 E ? PRO 452 E 1 -0.12 
8  SER 56  F . ? SER 166 F PRO 57  F ? PRO 167 F 1 4.95  
9  ILE 73  F . ? ILE 183 F PRO 74  F ? PRO 184 F 1 -4.48 
10 VAL 41  G . ? VAL 39  G PRO 42  G ? PRO 40  G 1 -4.23 
11 GLU 286 G . ? GLU 284 G PRO 287 G ? PRO 285 G 1 -3.31 
12 GLU 286 H . ? GLU 284 H PRO 287 H ? PRO 285 H 1 -1.74 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 2 ? 
AB1 ? 4 ? 
AB2 ? 2 ? 
AB3 ? 5 ? 
AB4 ? 4 ? 
AB5 ? 6 ? 
AB6 ? 7 ? 
AB7 ? 4 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 7 ? 
AC2 ? 2 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 4 ? 
AC7 ? 4 ? 
AC8 ? 2 ? 
AC9 ? 2 ? 
AD1 ? 4 ? 
AD2 ? 4 ? 
AD3 ? 4 ? 
AD4 ? 4 ? 
AD5 ? 2 ? 
AD6 ? 4 ? 
AD7 ? 2 ? 
AD8 ? 5 ? 
AD9 ? 4 ? 
AE1 ? 6 ? 
AE2 ? 7 ? 
AE3 ? 4 ? 
AE4 ? 2 ? 
AE5 ? 2 ? 
AE6 ? 7 ? 
AE7 ? 2 ? 
AE8 ? 4 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? parallel      
AB5 4 5 ? parallel      
AB5 5 6 ? parallel      
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB6 5 6 ? anti-parallel 
AB6 6 7 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC1 4 5 ? anti-parallel 
AC1 5 6 ? anti-parallel 
AC1 6 7 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD8 4 5 ? parallel      
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? parallel      
AE1 3 4 ? parallel      
AE1 4 5 ? parallel      
AE1 5 6 ? parallel      
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE2 4 5 ? anti-parallel 
AE2 5 6 ? anti-parallel 
AE2 6 7 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? anti-parallel 
AE6 4 5 ? anti-parallel 
AE6 5 6 ? anti-parallel 
AE6 6 7 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 9   ? SER A 12  ? ALA A 9   SER A 12  
AA1 2 ARG A 432 ? TYR A 436 ? ARG A 432 TYR A 436 
AA1 3 ASP A 422 ? ALA A 427 ? ASP A 422 ALA A 427 
AA1 4 PHE A 405 ? THR A 413 ? PHE A 405 THR A 413 
AA2 1 VAL A 23  ? PHE A 26  ? VAL A 23  PHE A 26  
AA2 2 PHE A 35  ? ALA A 40  ? PHE A 35  ALA A 40  
AA2 3 GLN A 55  ? ASP A 60  ? GLN A 55  ASP A 60  
AA2 4 CYS A 67  ? PRO A 69  ? CYS A 67  PRO A 69  
AA3 1 ASP A 79  ? ALA A 81  ? ASP A 79  ALA A 81  
AA3 2 ASP A 84  ? PRO A 85  ? ASP A 84  PRO A 85  
AA4 1 GLU A 87  ? PHE A 88  ? GLU A 87  PHE A 88  
AA4 2 HIS A 113 ? TRP A 114 ? HIS A 113 TRP A 114 
AA5 1 VAL A 98  ? LYS A 101 ? VAL A 98  LYS A 101 
AA5 2 LYS A 104 ? ALA A 109 ? LYS A 104 ALA A 109 
AA5 3 THR A 127 ? GLN A 131 ? THR A 127 GLN A 131 
AA5 4 THR A 136 ? TYR A 139 ? THR A 136 TYR A 139 
AA6 1 ILE A 161 ? PHE A 163 ? ILE A 161 PHE A 163 
AA6 2 ARG A 168 ? GLY A 173 ? ARG A 168 GLY A 173 
AA6 3 GLN A 182 ? GLN A 187 ? GLN A 182 GLN A 187 
AA6 4 LEU A 208 ? ALA A 209 ? LEU A 208 ALA A 209 
AA7 1 VAL A 226 ? GLY A 229 ? VAL A 226 GLY A 229 
AA7 2 ASP A 238 ? VAL A 243 ? ASP A 238 VAL A 243 
AA7 3 MET A 252 ? TYR A 256 ? MET A 252 TYR A 256 
AA7 4 SER A 263 ? THR A 268 ? SER A 263 THR A 268 
AA8 1 VAL A 280 ? THR A 283 ? VAL A 280 THR A 283 
AA8 2 ASP A 292 ? ALA A 297 ? ASP A 292 ALA A 297 
AA8 3 GLN A 314 ? GLN A 320 ? GLN A 314 GLN A 320 
AA8 4 PHE A 326 ? ASN A 332 ? PHE A 326 ASN A 332 
AA9 1 MET A 301 ? ARG A 303 ? MET A 301 ARG A 303 
AA9 2 LEU A 309 ? GLU A 311 ? LEU A 309 GLU A 311 
AB1 1 ILE A 344 ? GLY A 348 ? ILE A 344 GLY A 348 
AB1 2 ASP A 357 ? ALA A 362 ? ASP A 357 ALA A 362 
AB1 3 ILE A 372 ? PHE A 376 ? ILE A 372 PHE A 376 
AB1 4 GLN A 389 ? GLU A 392 ? GLN A 389 GLU A 392 
AB2 1 GLY A 378 ? ARG A 379 ? GLY A 378 ARG A 379 
AB2 2 GLY A 382 ? LEU A 383 ? GLY A 382 LEU A 383 
AB3 1 ALA A 512 ? PHE A 514 ? ALA A 512 PHE A 514 
AB3 2 GLN A 535 ? LEU A 543 ? GLN A 535 LEU A 543 
AB3 3 CYS A 473 ? GLY A 484 ? CYS A 473 GLY A 484 
AB3 4 VAL A 441 ? TYR A 451 ? VAL A 441 TYR A 451 
AB3 5 ILE A 578 ? LEU A 579 ? ILE A 578 LEU A 579 
AB4 1 SER A 521 ? SER A 529 ? SER A 521 SER A 529 
AB4 2 LYS A 491 ? LEU A 500 ? LYS A 491 LEU A 500 
AB4 3 ILE A 556 ? LEU A 564 ? ILE A 556 LEU A 564 
AB4 4 ILE A 587 ? ALA A 591 ? ILE A 587 ALA A 591 
AB5 1 PHE B 83  ? THR B 90  ? PHE B 193 THR B 200 
AB5 2 PHE B 43  ? PHE B 50  ? PHE B 153 PHE B 160 
AB5 3 VAL B 6   ? ASP B 13  ? VAL B 116 ASP B 123 
AB5 4 LEU B 136 ? VAL B 142 ? LEU B 246 VAL B 252 
AB5 5 VAL B 197 ? VAL B 203 ? VAL B 307 VAL B 313 
AB5 6 THR B 222 ? LEU B 225 ? THR B 332 LEU B 335 
AB6 1 SER C 170 ? ASP C 172 ? SER C 168 ASP C 170 
AB6 2 LEU C 123 ? ARG C 129 ? LEU C 121 ARG C 127 
AB6 3 PHE C 230 ? ALA C 235 ? PHE C 228 ALA C 233 
AB6 4 LYS C 79  ? LEU C 85  ? LYS C 77  LEU C 83  
AB6 5 LYS D 348 ? VAL D 357 ? LYS D 346 VAL D 355 
AB6 6 LEU D 334 ? TYR D 341 ? LEU D 332 TYR D 339 
AB6 7 ILE D 284 ? GLU D 286 ? ILE D 282 GLU D 284 
AB7 1 ILE C 104 ? GLN C 109 ? ILE C 102 GLN C 107 
AB7 2 ILE C 187 ? ALA C 194 ? ILE C 185 ALA C 192 
AB7 3 HIS C 140 ? TYR C 147 ? HIS C 138 TYR C 145 
AB7 4 SER C 151 ? LEU C 159 ? SER C 149 LEU C 157 
AB8 1 CYS C 267 ? ARG C 269 ? CYS C 265 ARG C 267 
AB8 2 PHE C 294 ? LEU C 296 ? PHE C 292 LEU C 294 
AB9 1 TYR C 272 ? ILE C 273 ? TYR C 270 ILE C 271 
AB9 2 TYR C 290 ? HIS C 291 ? TYR C 288 HIS C 289 
AC1 1 ILE C 284 ? GLU C 286 ? ILE C 282 GLU C 284 
AC1 2 LEU C 334 ? VAL C 343 ? LEU C 332 VAL C 341 
AC1 3 LYS C 346 ? VAL C 357 ? LYS C 344 VAL C 355 
AC1 4 LYS D 79  ? LEU D 85  ? LYS D 77  LEU D 83  
AC1 5 PHE D 230 ? ALA D 235 ? PHE D 228 ALA D 233 
AC1 6 LEU D 123 ? ARG D 129 ? LEU D 121 ARG D 127 
AC1 7 PHE D 171 ? ASP D 172 ? PHE D 169 ASP D 170 
AC2 1 CYS C 328 ? PRO C 331 ? CYS C 326 PRO C 329 
AC2 2 CYS C 360 ? SER C 363 ? CYS C 358 SER C 361 
AC3 1 SER D 103 ? PHE D 108 ? SER D 101 PHE D 106 
AC3 2 GLU D 188 ? ALA D 194 ? GLU D 186 ALA D 192 
AC3 3 HIS D 140 ? TYR D 147 ? HIS D 138 TYR D 145 
AC3 4 SER D 151 ? LEU D 159 ? SER D 149 LEU D 157 
AC4 1 CYS D 267 ? ARG D 269 ? CYS D 265 ARG D 267 
AC4 2 PHE D 294 ? LEU D 296 ? PHE D 292 LEU D 294 
AC5 1 CYS D 328 ? PRO D 331 ? CYS D 326 PRO D 329 
AC5 2 CYS D 360 ? SER D 363 ? CYS D 358 SER D 361 
AC6 1 ALA E 9   ? SER E 12  ? ALA E 9   SER E 12  
AC6 2 ARG E 432 ? TYR E 436 ? ARG E 432 TYR E 436 
AC6 3 ASP E 422 ? ALA E 427 ? ASP E 422 ALA E 427 
AC6 4 SER E 408 ? THR E 413 ? SER E 408 THR E 413 
AC7 1 VAL E 23  ? PHE E 26  ? VAL E 23  PHE E 26  
AC7 2 PHE E 35  ? ALA E 40  ? PHE E 35  ALA E 40  
AC7 3 GLN E 55  ? ASP E 60  ? GLN E 55  ASP E 60  
AC7 4 CYS E 67  ? ILE E 70  ? CYS E 67  ILE E 70  
AC8 1 ASP E 79  ? ALA E 81  ? ASP E 79  ALA E 81  
AC8 2 ASP E 84  ? PRO E 85  ? ASP E 84  PRO E 85  
AC9 1 GLU E 87  ? PHE E 88  ? GLU E 87  PHE E 88  
AC9 2 HIS E 113 ? TRP E 114 ? HIS E 113 TRP E 114 
AD1 1 VAL E 98  ? LYS E 101 ? VAL E 98  LYS E 101 
AD1 2 LYS E 104 ? ALA E 109 ? LYS E 104 ALA E 109 
AD1 3 THR E 127 ? GLN E 131 ? THR E 127 GLN E 131 
AD1 4 THR E 136 ? TYR E 139 ? THR E 136 TYR E 139 
AD2 1 ILE E 161 ? PHE E 163 ? ILE E 161 PHE E 163 
AD2 2 ARG E 168 ? GLY E 173 ? ARG E 168 GLY E 173 
AD2 3 GLN E 182 ? GLN E 187 ? GLN E 182 GLN E 187 
AD2 4 LEU E 208 ? ALA E 209 ? LEU E 208 ALA E 209 
AD3 1 VAL E 226 ? GLY E 229 ? VAL E 226 GLY E 229 
AD3 2 ASP E 238 ? VAL E 243 ? ASP E 238 VAL E 243 
AD3 3 MET E 252 ? TYR E 256 ? MET E 252 TYR E 256 
AD3 4 SER E 263 ? THR E 268 ? SER E 263 THR E 268 
AD4 1 VAL E 280 ? THR E 283 ? VAL E 280 THR E 283 
AD4 2 ASP E 292 ? ALA E 297 ? ASP E 292 ALA E 297 
AD4 3 GLN E 314 ? GLN E 320 ? GLN E 314 GLN E 320 
AD4 4 PHE E 326 ? ASN E 332 ? PHE E 326 ASN E 332 
AD5 1 MET E 301 ? ARG E 303 ? MET E 301 ARG E 303 
AD5 2 LEU E 309 ? GLU E 311 ? LEU E 309 GLU E 311 
AD6 1 ILE E 344 ? GLY E 348 ? ILE E 344 GLY E 348 
AD6 2 ASP E 357 ? ALA E 362 ? ASP E 357 ALA E 362 
AD6 3 ILE E 372 ? PHE E 376 ? ILE E 372 PHE E 376 
AD6 4 GLN E 389 ? GLU E 392 ? GLN E 389 GLU E 392 
AD7 1 GLY E 378 ? ARG E 379 ? GLY E 378 ARG E 379 
AD7 2 GLY E 382 ? LEU E 383 ? GLY E 382 LEU E 383 
AD8 1 ALA E 512 ? PHE E 514 ? ALA E 512 PHE E 514 
AD8 2 GLN E 535 ? LEU E 543 ? GLN E 535 LEU E 543 
AD8 3 CYS E 473 ? GLY E 484 ? CYS E 473 GLY E 484 
AD8 4 VAL E 441 ? TYR E 451 ? VAL E 441 TYR E 451 
AD8 5 ILE E 578 ? LEU E 579 ? ILE E 578 LEU E 579 
AD9 1 SER E 521 ? SER E 529 ? SER E 521 SER E 529 
AD9 2 LYS E 491 ? LEU E 500 ? LYS E 491 LEU E 500 
AD9 3 ILE E 556 ? LEU E 564 ? ILE E 556 LEU E 564 
AD9 4 ILE E 587 ? ALA E 591 ? ILE E 587 ALA E 591 
AE1 1 PHE F 83  ? THR F 90  ? PHE F 193 THR F 200 
AE1 2 PHE F 43  ? PHE F 50  ? PHE F 153 PHE F 160 
AE1 3 VAL F 6   ? ASP F 13  ? VAL F 116 ASP F 123 
AE1 4 LEU F 136 ? VAL F 142 ? LEU F 246 VAL F 252 
AE1 5 VAL F 197 ? VAL F 203 ? VAL F 307 VAL F 313 
AE1 6 THR F 222 ? LEU F 225 ? THR F 332 LEU F 335 
AE2 1 SER G 170 ? ASP G 172 ? SER G 168 ASP G 170 
AE2 2 LEU G 123 ? ARG G 129 ? LEU G 121 ARG G 127 
AE2 3 PHE G 230 ? ALA G 235 ? PHE G 228 ALA G 233 
AE2 4 LYS G 79  ? LEU G 85  ? LYS G 77  LEU G 83  
AE2 5 LYS H 348 ? VAL H 357 ? LYS H 346 VAL H 355 
AE2 6 LEU H 334 ? TYR H 341 ? LEU H 332 TYR H 339 
AE2 7 ILE H 284 ? GLU H 286 ? ILE H 282 GLU H 284 
AE3 1 ILE G 104 ? GLN G 109 ? ILE G 102 GLN G 107 
AE3 2 ILE G 187 ? ALA G 194 ? ILE G 185 ALA G 192 
AE3 3 HIS G 140 ? TYR G 147 ? HIS G 138 TYR G 145 
AE3 4 SER G 151 ? LEU G 159 ? SER G 149 LEU G 157 
AE4 1 CYS G 267 ? ARG G 269 ? CYS G 265 ARG G 267 
AE4 2 PHE G 294 ? LEU G 296 ? PHE G 292 LEU G 294 
AE5 1 TYR G 272 ? ILE G 273 ? TYR G 270 ILE G 271 
AE5 2 TYR G 290 ? HIS G 291 ? TYR G 288 HIS G 289 
AE6 1 ILE G 284 ? GLU G 286 ? ILE G 282 GLU G 284 
AE6 2 LEU G 334 ? VAL G 343 ? LEU G 332 VAL G 341 
AE6 3 LYS G 346 ? VAL G 357 ? LYS G 344 VAL G 355 
AE6 4 LYS H 79  ? LEU H 85  ? LYS H 77  LEU H 83  
AE6 5 PHE H 230 ? ALA H 235 ? PHE H 228 ALA H 233 
AE6 6 LEU H 123 ? ARG H 129 ? LEU H 121 ARG H 127 
AE6 7 SER H 170 ? ASP H 172 ? SER H 168 ASP H 170 
AE7 1 CYS G 328 ? PRO G 331 ? CYS G 326 PRO G 329 
AE7 2 CYS G 360 ? SER G 363 ? CYS G 358 SER G 361 
AE8 1 SER H 103 ? PHE H 108 ? SER H 101 PHE H 106 
AE8 2 GLU H 188 ? ALA H 194 ? GLU H 186 ALA H 192 
AE8 3 HIS H 140 ? TYR H 147 ? HIS H 138 TYR H 145 
AE8 4 SER H 151 ? LEU H 159 ? SER H 149 LEU H 157 
AE9 1 CYS H 267 ? ARG H 269 ? CYS H 265 ARG H 267 
AE9 2 PHE H 294 ? LEU H 296 ? PHE H 292 LEU H 294 
AF1 1 CYS H 328 ? PRO H 331 ? CYS H 326 PRO H 329 
AF1 2 CYS H 360 ? SER H 363 ? CYS H 358 SER H 361 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N TYR A 11  ? N TYR A 11  O ALA A 433 ? O ALA A 433 
AA1 2 3 O ARG A 432 ? O ARG A 432 N ALA A 427 ? N ALA A 427 
AA1 3 4 O GLY A 426 ? O GLY A 426 N SER A 408 ? N SER A 408 
AA2 1 2 N ASP A 24  ? N ASP A 24  O LEU A 37  ? O LEU A 37  
AA2 2 3 N LEU A 36  ? N LEU A 36  O CYS A 59  ? O CYS A 59  
AA2 3 4 N LYS A 58  ? N LYS A 58  O GLN A 68  ? O GLN A 68  
AA3 1 2 N TYR A 80  ? N TYR A 80  O ASP A 84  ? O ASP A 84  
AA4 1 2 N PHE A 88  ? N PHE A 88  O HIS A 113 ? O HIS A 113 
AA5 1 2 N ARG A 99  ? N ARG A 99  O LEU A 106 ? O LEU A 106 
AA5 2 3 N ALA A 109 ? N ALA A 109 O THR A 127 ? O THR A 127 
AA5 3 4 N CYS A 128 ? N CYS A 128 O TYR A 139 ? O TYR A 139 
AA6 1 2 N ASP A 162 ? N ASP A 162 O LEU A 170 ? O LEU A 170 
AA6 2 3 N LEU A 171 ? N LEU A 171 O ILE A 184 ? O ILE A 184 
AA6 3 4 N SER A 185 ? N SER A 185 O LEU A 208 ? O LEU A 208 
AA7 1 2 N ALA A 227 ? N ALA A 227 O VAL A 240 ? O VAL A 240 
AA7 2 3 N VAL A 243 ? N VAL A 243 O MET A 252 ? O MET A 252 
AA7 3 4 N ILE A 255 ? N ILE A 255 O LEU A 264 ? O LEU A 264 
AA8 1 2 N ALA A 281 ? N ALA A 281 O PHE A 294 ? O PHE A 294 
AA8 2 3 N ALA A 297 ? N ALA A 297 O GLN A 314 ? O GLN A 314 
AA8 3 4 N VAL A 315 ? N VAL A 315 O LEU A 331 ? O LEU A 331 
AA9 1 2 N ASP A 302 ? N ASP A 302 O GLN A 310 ? O GLN A 310 
AB1 1 2 N GLY A 348 ? N GLY A 348 O ASP A 357 ? O ASP A 357 
AB1 2 3 N ALA A 362 ? N ALA A 362 O ILE A 372 ? O ILE A 372 
AB1 3 4 N VAL A 373 ? N VAL A 373 O LEU A 391 ? O LEU A 391 
AB2 1 2 N ARG A 379 ? N ARG A 379 O GLY A 382 ? O GLY A 382 
AB3 1 2 N LEU A 513 ? N LEU A 513 O TYR A 542 ? O TYR A 542 
AB3 2 3 O LEU A 539 ? O LEU A 539 N VAL A 476 ? N VAL A 476 
AB3 3 4 O ASP A 483 ? O ASP A 483 N THR A 443 ? N THR A 443 
AB3 4 5 N ILE A 442 ? N ILE A 442 O ILE A 578 ? O ILE A 578 
AB4 1 2 O MET A 526 ? O MET A 526 N PHE A 494 ? N PHE A 494 
AB4 2 3 N GLU A 497 ? N GLU A 497 O GLU A 561 ? O GLU A 561 
AB4 3 4 N MET A 560 ? N MET A 560 O ILE A 587 ? O ILE A 587 
AB5 1 2 O LYS B 84  ? O LYS B 194 N SER B 49  ? N SER B 159 
AB5 2 3 O GLY B 48  ? O GLY B 158 N MET B 12  ? N MET B 122 
AB5 3 4 N TYR B 9   ? N TYR B 119 O LEU B 138 ? O LEU B 248 
AB5 4 5 N PHE B 141 ? N PHE B 251 O ALA B 202 ? O ALA B 312 
AB5 5 6 N PHE B 201 ? N PHE B 311 O THR B 222 ? O THR B 332 
AB6 1 2 O PHE C 171 ? O PHE C 169 N LEU C 128 ? N LEU C 126 
AB6 2 3 N ARG C 125 ? N ARG C 123 O MET C 234 ? O MET C 232 
AB6 3 4 O LEU C 233 ? O LEU C 231 N THR C 82  ? N THR C 80  
AB6 4 5 N VAL C 81  ? N VAL C 79  O VAL D 349 ? O VAL D 347 
AB6 5 6 O GLU D 350 ? O GLU D 348 N ILE D 339 ? N ILE D 337 
AB6 6 7 O VAL D 340 ? O VAL D 338 N GLU D 286 ? N GLU D 284 
AB7 1 2 N ILE C 104 ? N ILE C 102 O LEU C 192 ? O LEU C 190 
AB7 2 3 O ARG C 191 ? O ARG C 189 N TYR C 144 ? N TYR C 142 
AB7 3 4 N TYR C 147 ? N TYR C 145 O SER C 151 ? O SER C 149 
AB8 1 2 N ARG C 269 ? N ARG C 267 O PHE C 294 ? O PHE C 292 
AB9 1 2 N ILE C 273 ? N ILE C 271 O TYR C 290 ? O TYR C 288 
AC1 1 2 N GLU C 286 ? N GLU C 284 O VAL C 340 ? O VAL C 338 
AC1 2 3 N ILE C 339 ? N ILE C 337 O GLU C 350 ? O GLU C 348 
AC1 3 4 N VAL C 349 ? N VAL C 347 O VAL D 81  ? O VAL D 79  
AC1 4 5 N THR D 82  ? N THR D 80  O LEU D 233 ? O LEU D 231 
AC1 5 6 O PHE D 230 ? O PHE D 228 N ARG D 129 ? N ARG D 127 
AC1 6 7 N LEU D 128 ? N LEU D 126 O PHE D 171 ? O PHE D 169 
AC2 1 2 N VAL C 330 ? N VAL C 328 O LYS C 361 ? O LYS C 359 
AC3 1 2 N MET D 106 ? N MET D 104 O PHE D 190 ? O PHE D 188 
AC3 2 3 O ARG D 191 ? O ARG D 189 N TYR D 144 ? N TYR D 142 
AC3 3 4 N TYR D 147 ? N TYR D 145 O SER D 151 ? O SER D 149 
AC4 1 2 N ARG D 269 ? N ARG D 267 O PHE D 294 ? O PHE D 292 
AC5 1 2 N VAL D 330 ? N VAL D 328 O LYS D 361 ? O LYS D 359 
AC6 1 2 N TYR E 11  ? N TYR E 11  O ALA E 433 ? O ALA E 433 
AC6 2 3 O ARG E 432 ? O ARG E 432 N ALA E 427 ? N ALA E 427 
AC6 3 4 O GLY E 426 ? O GLY E 426 N SER E 408 ? N SER E 408 
AC7 1 2 N ASP E 24  ? N ASP E 24  O LEU E 37  ? O LEU E 37  
AC7 2 3 N LEU E 36  ? N LEU E 36  O CYS E 59  ? O CYS E 59  
AC7 3 4 N LYS E 58  ? N LYS E 58  O GLN E 68  ? O GLN E 68  
AC8 1 2 N TYR E 80  ? N TYR E 80  O ASP E 84  ? O ASP E 84  
AC9 1 2 N PHE E 88  ? N PHE E 88  O HIS E 113 ? O HIS E 113 
AD1 1 2 N ARG E 99  ? N ARG E 99  O LEU E 106 ? O LEU E 106 
AD1 2 3 N ALA E 109 ? N ALA E 109 O THR E 127 ? O THR E 127 
AD1 3 4 N CYS E 128 ? N CYS E 128 O TYR E 139 ? O TYR E 139 
AD2 1 2 N ASP E 162 ? N ASP E 162 O LEU E 170 ? O LEU E 170 
AD2 2 3 N LEU E 171 ? N LEU E 171 O ILE E 184 ? O ILE E 184 
AD2 3 4 N SER E 185 ? N SER E 185 O LEU E 208 ? O LEU E 208 
AD3 1 2 N GLY E 229 ? N GLY E 229 O ASP E 238 ? O ASP E 238 
AD3 2 3 N VAL E 243 ? N VAL E 243 O MET E 252 ? O MET E 252 
AD3 3 4 N ILE E 255 ? N ILE E 255 O LEU E 264 ? O LEU E 264 
AD4 1 2 N ALA E 281 ? N ALA E 281 O PHE E 294 ? O PHE E 294 
AD4 2 3 N ALA E 297 ? N ALA E 297 O GLN E 314 ? O GLN E 314 
AD4 3 4 N VAL E 315 ? N VAL E 315 O LEU E 331 ? O LEU E 331 
AD5 1 2 N ASP E 302 ? N ASP E 302 O GLN E 310 ? O GLN E 310 
AD6 1 2 N GLY E 348 ? N GLY E 348 O ASP E 357 ? O ASP E 357 
AD6 2 3 N ALA E 362 ? N ALA E 362 O ILE E 372 ? O ILE E 372 
AD6 3 4 N VAL E 373 ? N VAL E 373 O LEU E 391 ? O LEU E 391 
AD7 1 2 N ARG E 379 ? N ARG E 379 O GLY E 382 ? O GLY E 382 
AD8 1 2 N LEU E 513 ? N LEU E 513 O TYR E 542 ? O TYR E 542 
AD8 2 3 O LEU E 539 ? O LEU E 539 N VAL E 476 ? N VAL E 476 
AD8 3 4 O ASP E 483 ? O ASP E 483 N THR E 443 ? N THR E 443 
AD8 4 5 N ILE E 442 ? N ILE E 442 O ILE E 578 ? O ILE E 578 
AD9 1 2 O MET E 526 ? O MET E 526 N PHE E 494 ? N PHE E 494 
AD9 2 3 N GLU E 497 ? N GLU E 497 O GLU E 561 ? O GLU E 561 
AD9 3 4 N ILE E 556 ? N ILE E 556 O ALA E 591 ? O ALA E 591 
AE1 1 2 O LYS F 84  ? O LYS F 194 N SER F 49  ? N SER F 159 
AE1 2 3 O GLY F 48  ? O GLY F 158 N MET F 12  ? N MET F 122 
AE1 3 4 N LEU F 11  ? N LEU F 121 O VAL F 140 ? O VAL F 250 
AE1 4 5 N PHE F 141 ? N PHE F 251 O ILE F 200 ? O ILE F 310 
AE1 5 6 N PHE F 201 ? N PHE F 311 O THR F 222 ? O THR F 332 
AE2 1 2 O PHE G 171 ? O PHE G 169 N LEU G 128 ? N LEU G 126 
AE2 2 3 N ARG G 125 ? N ARG G 123 O MET G 234 ? O MET G 232 
AE2 3 4 O LEU G 233 ? O LEU G 231 N THR G 82  ? N THR G 80  
AE2 4 5 N VAL G 81  ? N VAL G 79  O VAL H 349 ? O VAL H 347 
AE2 5 6 O GLU H 350 ? O GLU H 348 N ILE H 339 ? N ILE H 337 
AE2 6 7 O VAL H 340 ? O VAL H 338 N GLU H 286 ? N GLU H 284 
AE3 1 2 N ILE G 104 ? N ILE G 102 O LEU G 192 ? O LEU G 190 
AE3 2 3 O ARG G 191 ? O ARG G 189 N TYR G 144 ? N TYR G 142 
AE3 3 4 N TYR G 147 ? N TYR G 145 O SER G 151 ? O SER G 149 
AE4 1 2 N ARG G 269 ? N ARG G 267 O PHE G 294 ? O PHE G 292 
AE5 1 2 N ILE G 273 ? N ILE G 271 O TYR G 290 ? O TYR G 288 
AE6 1 2 N GLU G 286 ? N GLU G 284 O VAL G 340 ? O VAL G 338 
AE6 2 3 N ILE G 339 ? N ILE G 337 O GLU G 350 ? O GLU G 348 
AE6 3 4 N VAL G 349 ? N VAL G 347 O VAL H 81  ? O VAL H 79  
AE6 4 5 N THR H 82  ? N THR H 80  O LEU H 233 ? O LEU H 231 
AE6 5 6 O PHE H 230 ? O PHE H 228 N ARG H 129 ? N ARG H 127 
AE6 6 7 N LEU H 128 ? N LEU H 126 O PHE H 171 ? O PHE H 169 
AE7 1 2 N VAL G 330 ? N VAL G 328 O LYS G 361 ? O LYS G 359 
AE8 1 2 N ILE H 104 ? N ILE H 102 O LEU H 192 ? O LEU H 190 
AE8 2 3 O ARG H 191 ? O ARG H 189 N TYR H 144 ? N TYR H 142 
AE8 3 4 N TYR H 147 ? N TYR H 145 O SER H 151 ? O SER H 149 
AE9 1 2 N ARG H 269 ? N ARG H 267 O PHE H 294 ? O PHE H 292 
AF1 1 2 N VAL H 330 ? N VAL H 328 O LYS H 361 ? O LYS H 359 
# 
_atom_sites.entry_id                    5FFO 
_atom_sites.fract_transf_matrix[1][1]   0.012279 
_atom_sites.fract_transf_matrix[1][2]   -0.000033 
_atom_sites.fract_transf_matrix[1][3]   -0.000805 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010936 
_atom_sites.fract_transf_matrix[2][3]   -0.000002 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007648 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . PHE A  1  1   ? 10.681  -12.973 52.010   1.00 193.07 ? 1    PHE A N   1 
ATOM   2     C  CA  . PHE A  1  1   ? 10.743  -12.103 53.178   1.00 196.40 ? 1    PHE A CA  1 
ATOM   3     C  C   . PHE A  1  1   ? 12.059  -11.341 53.217   1.00 200.86 ? 1    PHE A C   1 
ATOM   4     O  O   . PHE A  1  1   ? 12.170  -10.309 53.880   1.00 203.55 ? 1    PHE A O   1 
ATOM   5     C  CB  . PHE A  1  1   ? 10.561  -12.914 54.465   1.00 198.62 ? 1    PHE A CB  1 
ATOM   6     C  CG  . PHE A  1  1   ? 11.634  -13.944 54.694   1.00 213.80 ? 1    PHE A CG  1 
ATOM   7     C  CD1 . PHE A  1  1   ? 11.543  -15.195 54.107   1.00 211.37 ? 1    PHE A CD1 1 
ATOM   8     C  CD2 . PHE A  1  1   ? 12.723  -13.672 55.512   1.00 234.17 ? 1    PHE A CD2 1 
ATOM   9     C  CE1 . PHE A  1  1   ? 12.523  -16.150 54.316   1.00 226.39 ? 1    PHE A CE1 1 
ATOM   10    C  CE2 . PHE A  1  1   ? 13.708  -14.626 55.728   1.00 210.93 ? 1    PHE A CE2 1 
ATOM   11    C  CZ  . PHE A  1  1   ? 13.606  -15.866 55.130   1.00 208.87 ? 1    PHE A CZ  1 
ATOM   12    N  N   . ASN A  1  2   ? 13.051  -11.857 52.493   1.00 213.47 ? 2    ASN A N   1 
ATOM   13    C  CA  . ASN A  1  2   ? 14.417  -11.353 52.541   1.00 219.49 ? 2    ASN A CA  1 
ATOM   14    C  C   . ASN A  1  2   ? 14.743  -10.366 51.425   1.00 216.01 ? 2    ASN A C   1 
ATOM   15    O  O   . ASN A  1  2   ? 15.921  -10.063 51.211   1.00 229.72 ? 2    ASN A O   1 
ATOM   16    C  CB  . ASN A  1  2   ? 15.399  -12.525 52.504   1.00 209.52 ? 2    ASN A CB  1 
ATOM   17    C  CG  . ASN A  1  2   ? 15.156  -13.451 51.327   1.00 205.75 ? 2    ASN A CG  1 
ATOM   18    O  OD1 . ASN A  1  2   ? 14.013  -13.695 50.939   1.00 202.74 ? 2    ASN A OD1 1 
ATOM   19    N  ND2 . ASN A  1  2   ? 16.233  -13.979 50.758   1.00 209.61 ? 2    ASN A ND2 1 
ATOM   20    N  N   . LEU A  1  3   ? 13.742  -9.855  50.711   1.00 215.89 ? 3    LEU A N   1 
ATOM   21    C  CA  . LEU A  1  3   ? 14.005  -8.836  49.701   1.00 215.49 ? 3    LEU A CA  1 
ATOM   22    C  C   . LEU A  1  3   ? 14.290  -7.497  50.367   1.00 214.18 ? 3    LEU A C   1 
ATOM   23    O  O   . LEU A  1  3   ? 13.561  -7.067  51.267   1.00 209.47 ? 3    LEU A O   1 
ATOM   24    C  CB  . LEU A  1  3   ? 12.829  -8.707  48.733   1.00 209.95 ? 3    LEU A CB  1 
ATOM   25    C  CG  . LEU A  1  3   ? 12.728  -9.788  47.658   1.00 198.24 ? 3    LEU A CG  1 
ATOM   26    C  CD1 . LEU A  1  3   ? 11.462  -9.614  46.843   1.00 191.72 ? 3    LEU A CD1 1 
ATOM   27    C  CD2 . LEU A  1  3   ? 13.953  -9.759  46.762   1.00 204.86 ? 3    LEU A CD2 1 
ATOM   28    N  N   . ASP A  1  4   ? 15.360  -6.842  49.927   1.00 213.10 ? 4    ASP A N   1 
ATOM   29    C  CA  . ASP A  1  4   ? 15.782  -5.572  50.507   1.00 220.22 ? 4    ASP A CA  1 
ATOM   30    C  C   . ASP A  1  4   ? 14.908  -4.453  49.948   1.00 209.44 ? 4    ASP A C   1 
ATOM   31    O  O   . ASP A  1  4   ? 15.027  -4.090  48.771   1.00 207.88 ? 4    ASP A O   1 
ATOM   32    C  CB  . ASP A  1  4   ? 17.256  -5.324  50.207   1.00 217.00 ? 4    ASP A CB  1 
ATOM   33    C  CG  . ASP A  1  4   ? 17.755  -4.018  50.781   1.00 221.80 ? 4    ASP A CG  1 
ATOM   34    O  OD1 . ASP A  1  4   ? 17.872  -3.916  52.019   1.00 225.20 ? 4    ASP A OD1 1 
ATOM   35    O  OD2 . ASP A  1  4   ? 18.028  -3.096  49.989   1.00 222.40 ? 4    ASP A OD2 1 
ATOM   36    N  N   . VAL A  1  5   ? 14.040  -3.896  50.800   1.00 209.31 ? 5    VAL A N   1 
ATOM   37    C  CA  . VAL A  1  5   ? 13.201  -2.764  50.430   1.00 207.63 ? 5    VAL A CA  1 
ATOM   38    C  C   . VAL A  1  5   ? 13.765  -1.464  50.967   1.00 212.84 ? 5    VAL A C   1 
ATOM   39    O  O   . VAL A  1  5   ? 13.212  -0.388  50.699   1.00 212.55 ? 5    VAL A O   1 
ATOM   40    C  CB  . VAL A  1  5   ? 11.745  -2.954  50.909   1.00 204.11 ? 5    VAL A CB  1 
ATOM   41    C  CG1 . VAL A  1  5   ? 10.768  -2.232  49.981   1.00 200.49 ? 5    VAL A CG1 1 
ATOM   42    C  CG2 . VAL A  1  5   ? 11.392  -4.427  50.999   1.00 208.31 ? 5    VAL A CG2 1 
ATOM   43    N  N   . ASP A  1  6   ? 14.853  -1.537  51.738   1.00 238.68 ? 6    ASP A N   1 
ATOM   44    C  CA  . ASP A  1  6   ? 15.469  -0.335  52.287   1.00 244.32 ? 6    ASP A CA  1 
ATOM   45    C  C   . ASP A  1  6   ? 16.241  0.431   51.218   1.00 230.92 ? 6    ASP A C   1 
ATOM   46    O  O   . ASP A  1  6   ? 16.125  1.658   51.128   1.00 229.46 ? 6    ASP A O   1 
ATOM   47    C  CB  . ASP A  1  6   ? 16.396  -0.698  53.453   1.00 266.63 ? 6    ASP A CB  1 
ATOM   48    C  CG  . ASP A  1  6   ? 15.656  -1.324  54.626   1.00 265.59 ? 6    ASP A CG  1 
ATOM   49    O  OD1 . ASP A  1  6   ? 14.410  -1.206  54.683   1.00 259.60 ? 6    ASP A OD1 1 
ATOM   50    O  OD2 . ASP A  1  6   ? 16.325  -1.927  55.495   1.00 260.20 ? 6    ASP A OD2 1 
ATOM   51    N  N   . SER A  1  7   ? 17.025  -0.266  50.392   1.00 238.00 ? 7    SER A N   1 
ATOM   52    C  CA  . SER A  1  7   ? 17.865  0.377   49.377   1.00 251.97 ? 7    SER A CA  1 
ATOM   53    C  C   . SER A  1  7   ? 17.773  -0.373  48.051   1.00 236.07 ? 7    SER A C   1 
ATOM   54    O  O   . SER A  1  7   ? 18.697  -1.092  47.653   1.00 227.49 ? 7    SER A O   1 
ATOM   55    C  CB  . SER A  1  7   ? 19.317  0.479   49.856   1.00 264.07 ? 7    SER A CB  1 
ATOM   56    O  OG  . SER A  1  7   ? 19.833  -0.782  50.249   1.00 266.56 ? 7    SER A OG  1 
ATOM   57    N  N   . PRO A  1  8   ? 16.653  -0.238  47.345   1.00 219.15 ? 8    PRO A N   1 
ATOM   58    C  CA  . PRO A  1  8   ? 16.532  -0.835  46.013   1.00 231.12 ? 8    PRO A CA  1 
ATOM   59    C  C   . PRO A  1  8   ? 17.066  0.072   44.914   1.00 253.55 ? 8    PRO A C   1 
ATOM   60    O  O   . PRO A  1  8   ? 17.078  1.299   45.026   1.00 269.28 ? 8    PRO A O   1 
ATOM   61    C  CB  . PRO A  1  8   ? 15.016  -1.030  45.873   1.00 207.13 ? 8    PRO A CB  1 
ATOM   62    C  CG  . PRO A  1  8   ? 14.448  0.112   46.639   1.00 208.78 ? 8    PRO A CG  1 
ATOM   63    C  CD  . PRO A  1  8   ? 15.385  0.370   47.791   1.00 214.57 ? 8    PRO A CD  1 
ATOM   64    N  N   . ALA A  1  9   ? 17.508  -0.562  43.825   1.00 248.54 ? 9    ALA A N   1 
ATOM   65    C  CA  . ALA A  1  9   ? 18.035  0.149   42.662   1.00 233.18 ? 9    ALA A CA  1 
ATOM   66    C  C   . ALA A  1  9   ? 16.894  0.634   41.768   1.00 224.66 ? 9    ALA A C   1 
ATOM   67    O  O   . ALA A  1  9   ? 16.043  -0.159  41.348   1.00 205.14 ? 9    ALA A O   1 
ATOM   68    C  CB  . ALA A  1  9   ? 18.982  -0.757  41.879   1.00 215.57 ? 9    ALA A CB  1 
ATOM   69    N  N   . GLU A  1  10  ? 16.872  1.936   41.474   1.00 228.29 ? 10   GLU A N   1 
ATOM   70    C  CA  . GLU A  1  10  ? 15.827  2.549   40.654   1.00 225.28 ? 10   GLU A CA  1 
ATOM   71    C  C   . GLU A  1  10  ? 16.391  2.877   39.273   1.00 220.88 ? 10   GLU A C   1 
ATOM   72    O  O   . GLU A  1  10  ? 17.233  3.771   39.135   1.00 248.99 ? 10   GLU A O   1 
ATOM   73    C  CB  . GLU A  1  10  ? 15.266  3.799   41.331   1.00 234.08 ? 10   GLU A CB  1 
ATOM   74    C  CG  . GLU A  1  10  ? 14.228  4.548   40.500   1.00 239.54 ? 10   GLU A CG  1 
ATOM   75    C  CD  . GLU A  1  10  ? 13.566  5.685   41.261   1.00 237.40 ? 10   GLU A CD  1 
ATOM   76    O  OE1 . GLU A  1  10  ? 13.708  5.741   42.499   1.00 247.46 ? 10   GLU A OE1 1 
ATOM   77    O  OE2 . GLU A  1  10  ? 12.894  6.520   40.621   1.00 224.85 ? 10   GLU A OE2 1 
ATOM   78    N  N   . TYR A  1  11  ? 15.931  2.148   38.258   1.00 208.72 ? 11   TYR A N   1 
ATOM   79    C  CA  . TYR A  1  11  ? 16.294  2.403   36.869   1.00 209.17 ? 11   TYR A CA  1 
ATOM   80    C  C   . TYR A  1  11  ? 15.133  3.070   36.145   1.00 205.95 ? 11   TYR A C   1 
ATOM   81    O  O   . TYR A  1  11  ? 13.968  2.750   36.395   1.00 209.09 ? 11   TYR A O   1 
ATOM   82    C  CB  . TYR A  1  11  ? 16.686  1.112   36.148   1.00 207.52 ? 11   TYR A CB  1 
ATOM   83    C  CG  . TYR A  1  11  ? 17.920  0.457   36.718   1.00 225.59 ? 11   TYR A CG  1 
ATOM   84    C  CD1 . TYR A  1  11  ? 17.841  -0.384  37.821   1.00 234.20 ? 11   TYR A CD1 1 
ATOM   85    C  CD2 . TYR A  1  11  ? 19.167  0.697   36.163   1.00 228.49 ? 11   TYR A CD2 1 
ATOM   86    C  CE1 . TYR A  1  11  ? 18.970  -0.976  38.345   1.00 231.25 ? 11   TYR A CE1 1 
ATOM   87    C  CE2 . TYR A  1  11  ? 20.299  0.112   36.681   1.00 226.38 ? 11   TYR A CE2 1 
ATOM   88    C  CZ  . TYR A  1  11  ? 20.194  -0.722  37.770   1.00 226.99 ? 11   TYR A CZ  1 
ATOM   89    O  OH  . TYR A  1  11  ? 21.327  -1.302  38.278   1.00 228.54 ? 11   TYR A OH  1 
ATOM   90    N  N   . SER A  1  12  ? 15.455  3.995   35.241   1.00 209.04 ? 12   SER A N   1 
ATOM   91    C  CA  . SER A  1  12  ? 14.431  4.752   34.538   1.00 204.37 ? 12   SER A CA  1 
ATOM   92    C  C   . SER A  1  12  ? 14.749  4.859   33.052   1.00 213.24 ? 12   SER A C   1 
ATOM   93    O  O   . SER A  1  12  ? 15.912  4.844   32.639   1.00 208.40 ? 12   SER A O   1 
ATOM   94    C  CB  . SER A  1  12  ? 14.287  6.158   35.130   1.00 213.08 ? 12   SER A CB  1 
ATOM   95    O  OG  . SER A  1  12  ? 15.503  6.880   35.024   1.00 213.33 ? 12   SER A OG  1 
ATOM   96    N  N   . GLY A  1  13  ? 13.689  4.979   32.253   1.00 203.74 ? 13   GLY A N   1 
ATOM   97    C  CA  . GLY A  1  13  ? 13.799  5.172   30.827   1.00 210.41 ? 13   GLY A CA  1 
ATOM   98    C  C   . GLY A  1  13  ? 12.998  6.382   30.389   1.00 207.38 ? 13   GLY A C   1 
ATOM   99    O  O   . GLY A  1  13  ? 12.450  7.114   31.220   1.00 200.60 ? 13   GLY A O   1 
ATOM   100   N  N   . PRO A  1  14  ? 12.899  6.609   29.078   1.00 213.21 ? 14   PRO A N   1 
ATOM   101   C  CA  . PRO A  1  14  ? 12.142  7.768   28.582   1.00 212.90 ? 14   PRO A CA  1 
ATOM   102   C  C   . PRO A  1  14  ? 10.706  7.767   29.084   1.00 203.46 ? 14   PRO A C   1 
ATOM   103   O  O   . PRO A  1  14  ? 10.058  6.722   29.164   1.00 200.97 ? 14   PRO A O   1 
ATOM   104   C  CB  . PRO A  1  14  ? 12.198  7.602   27.060   1.00 210.58 ? 14   PRO A CB  1 
ATOM   105   C  CG  . PRO A  1  14  ? 13.433  6.782   26.815   1.00 215.52 ? 14   PRO A CG  1 
ATOM   106   C  CD  . PRO A  1  14  ? 13.526  5.846   27.985   1.00 214.81 ? 14   PRO A CD  1 
ATOM   107   N  N   . GLU A  1  15  ? 10.212  8.955   29.429   1.00 198.66 ? 15   GLU A N   1 
ATOM   108   C  CA  . GLU A  1  15  ? 8.849   9.074   29.925   1.00 195.66 ? 15   GLU A CA  1 
ATOM   109   C  C   . GLU A  1  15  ? 7.857   8.815   28.798   1.00 192.22 ? 15   GLU A C   1 
ATOM   110   O  O   . GLU A  1  15  ? 8.128   9.085   27.625   1.00 193.44 ? 15   GLU A O   1 
ATOM   111   C  CB  . GLU A  1  15  ? 8.600   10.454  30.533   1.00 201.02 ? 15   GLU A CB  1 
ATOM   112   C  CG  . GLU A  1  15  ? 8.185   11.514  29.531   1.00 213.71 ? 15   GLU A CG  1 
ATOM   113   C  CD  . GLU A  1  15  ? 7.667   12.766  30.201   1.00 230.43 ? 15   GLU A CD  1 
ATOM   114   O  OE1 . GLU A  1  15  ? 7.850   12.900  31.431   1.00 236.12 ? 15   GLU A OE1 1 
ATOM   115   O  OE2 . GLU A  1  15  ? 7.058   13.603  29.499   1.00 235.65 ? 15   GLU A OE2 1 
ATOM   116   N  N   . GLY A  1  16  ? 6.707   8.253   29.160   1.00 193.95 ? 16   GLY A N   1 
ATOM   117   C  CA  . GLY A  1  16  ? 5.685   7.942   28.184   1.00 193.42 ? 16   GLY A CA  1 
ATOM   118   C  C   . GLY A  1  16  ? 6.009   6.778   27.279   1.00 194.46 ? 16   GLY A C   1 
ATOM   119   O  O   . GLY A  1  16  ? 5.205   6.459   26.395   1.00 184.29 ? 16   GLY A O   1 
ATOM   120   N  N   . SER A  1  17  ? 7.152   6.129   27.472   1.00 187.44 ? 17   SER A N   1 
ATOM   121   C  CA  . SER A  1  17  ? 7.603   5.066   26.591   1.00 181.89 ? 17   SER A CA  1 
ATOM   122   C  C   . SER A  1  17  ? 7.195   3.686   27.074   1.00 177.80 ? 17   SER A C   1 
ATOM   123   O  O   . SER A  1  17  ? 7.530   2.697   26.415   1.00 190.70 ? 17   SER A O   1 
ATOM   124   C  CB  . SER A  1  17  ? 9.128   5.120   26.436   1.00 185.86 ? 17   SER A CB  1 
ATOM   125   O  OG  . SER A  1  17  ? 9.785   4.891   27.671   1.00 187.02 ? 17   SER A OG  1 
ATOM   126   N  N   . TYR A  1  18  ? 6.474   3.598   28.192   1.00 175.94 ? 18   TYR A N   1 
ATOM   127   C  CA  . TYR A  1  18  ? 6.135   2.317   28.808   1.00 172.54 ? 18   TYR A CA  1 
ATOM   128   C  C   . TYR A  1  18  ? 7.398   1.532   29.149   1.00 174.01 ? 18   TYR A C   1 
ATOM   129   O  O   . TYR A  1  18  ? 7.434   0.303   29.049   1.00 171.84 ? 18   TYR A O   1 
ATOM   130   C  CB  . TYR A  1  18  ? 5.208   1.492   27.915   1.00 168.80 ? 18   TYR A CB  1 
ATOM   131   C  CG  . TYR A  1  18  ? 3.801   2.030   27.830   1.00 166.95 ? 18   TYR A CG  1 
ATOM   132   C  CD1 . TYR A  1  18  ? 3.461   3.232   28.434   1.00 168.87 ? 18   TYR A CD1 1 
ATOM   133   C  CD2 . TYR A  1  18  ? 2.814   1.335   27.151   1.00 163.69 ? 18   TYR A CD2 1 
ATOM   134   C  CE1 . TYR A  1  18  ? 2.186   3.730   28.361   1.00 167.66 ? 18   TYR A CE1 1 
ATOM   135   C  CE2 . TYR A  1  18  ? 1.535   1.826   27.072   1.00 165.16 ? 18   TYR A CE2 1 
ATOM   136   C  CZ  . TYR A  1  18  ? 1.222   3.023   27.680   1.00 176.40 ? 18   TYR A CZ  1 
ATOM   137   O  OH  . TYR A  1  18  ? -0.065  3.510   27.600   1.00 184.04 ? 18   TYR A OH  1 
ATOM   138   N  N   . PHE A  1  19  ? 8.444   2.263   29.540   1.00 179.10 ? 19   PHE A N   1 
ATOM   139   C  CA  . PHE A  1  19  ? 9.689   1.667   30.009   1.00 180.31 ? 19   PHE A CA  1 
ATOM   140   C  C   . PHE A  1  19  ? 9.433   0.741   31.189   1.00 178.20 ? 19   PHE A C   1 
ATOM   141   O  O   . PHE A  1  19  ? 9.041   1.190   32.269   1.00 178.39 ? 19   PHE A O   1 
ATOM   142   C  CB  . PHE A  1  19  ? 10.665  2.775   30.398   1.00 185.27 ? 19   PHE A CB  1 
ATOM   143   C  CG  . PHE A  1  19  ? 11.965  2.272   30.933   1.00 188.19 ? 19   PHE A CG  1 
ATOM   144   C  CD1 . PHE A  1  19  ? 12.993  1.920   30.077   1.00 190.47 ? 19   PHE A CD1 1 
ATOM   145   C  CD2 . PHE A  1  19  ? 12.158  2.151   32.296   1.00 189.01 ? 19   PHE A CD2 1 
ATOM   146   C  CE1 . PHE A  1  19  ? 14.185  1.457   30.573   1.00 193.56 ? 19   PHE A CE1 1 
ATOM   147   C  CE2 . PHE A  1  19  ? 13.345  1.687   32.797   1.00 192.01 ? 19   PHE A CE2 1 
ATOM   148   C  CZ  . PHE A  1  19  ? 14.362  1.340   31.937   1.00 195.63 ? 19   PHE A CZ  1 
ATOM   149   N  N   . GLY A  1  20  ? 9.715   -0.543  31.003   1.00 176.70 ? 20   GLY A N   1 
ATOM   150   C  CA  . GLY A  1  20  ? 9.426   -1.551  32.000   1.00 174.62 ? 20   GLY A CA  1 
ATOM   151   C  C   . GLY A  1  20  ? 8.267   -2.452  31.645   1.00 170.08 ? 20   GLY A C   1 
ATOM   152   O  O   . GLY A  1  20  ? 7.841   -3.255  32.485   1.00 168.15 ? 20   GLY A O   1 
ATOM   153   N  N   . PHE A  1  21  ? 7.741   -2.334  30.427   1.00 168.59 ? 21   PHE A N   1 
ATOM   154   C  CA  . PHE A  1  21  ? 6.660   -3.202  29.988   1.00 164.63 ? 21   PHE A CA  1 
ATOM   155   C  C   . PHE A  1  21  ? 7.107   -4.654  29.924   1.00 163.91 ? 21   PHE A C   1 
ATOM   156   O  O   . PHE A  1  21  ? 6.295   -5.564  30.126   1.00 160.93 ? 21   PHE A O   1 
ATOM   157   C  CB  . PHE A  1  21  ? 6.161   -2.729  28.629   1.00 163.98 ? 21   PHE A CB  1 
ATOM   158   C  CG  . PHE A  1  21  ? 4.919   -3.409  28.177   1.00 160.22 ? 21   PHE A CG  1 
ATOM   159   C  CD1 . PHE A  1  21  ? 3.685   -2.903  28.527   1.00 158.27 ? 21   PHE A CD1 1 
ATOM   160   C  CD2 . PHE A  1  21  ? 4.980   -4.555  27.410   1.00 164.74 ? 21   PHE A CD2 1 
ATOM   161   C  CE1 . PHE A  1  21  ? 2.541   -3.521  28.114   1.00 155.16 ? 21   PHE A CE1 1 
ATOM   162   C  CE2 . PHE A  1  21  ? 3.832   -5.181  26.996   1.00 155.86 ? 21   PHE A CE2 1 
ATOM   163   C  CZ  . PHE A  1  21  ? 2.613   -4.663  27.348   1.00 153.91 ? 21   PHE A CZ  1 
ATOM   164   N  N   . ALA A  1  22  ? 8.384   -4.889  29.632   1.00 191.04 ? 22   ALA A N   1 
ATOM   165   C  CA  . ALA A  1  22  ? 8.985   -6.217  29.667   1.00 189.71 ? 22   ALA A CA  1 
ATOM   166   C  C   . ALA A  1  22  ? 10.369  -6.110  30.285   1.00 171.36 ? 22   ALA A C   1 
ATOM   167   O  O   . ALA A  1  22  ? 11.143  -5.216  29.928   1.00 174.52 ? 22   ALA A O   1 
ATOM   168   C  CB  . ALA A  1  22  ? 9.076   -6.833  28.264   1.00 185.21 ? 22   ALA A CB  1 
ATOM   169   N  N   . VAL A  1  23  ? 10.674  -7.015  31.214   1.00 171.61 ? 23   VAL A N   1 
ATOM   170   C  CA  . VAL A  1  23  ? 11.956  -7.026  31.907   1.00 184.41 ? 23   VAL A CA  1 
ATOM   171   C  C   . VAL A  1  23  ? 12.540  -8.434  31.866   1.00 193.02 ? 23   VAL A C   1 
ATOM   172   O  O   . VAL A  1  23  ? 11.810  -9.427  31.767   1.00 206.85 ? 23   VAL A O   1 
ATOM   173   C  CB  . VAL A  1  23  ? 11.816  -6.525  33.362   1.00 176.10 ? 23   VAL A CB  1 
ATOM   174   C  CG1 . VAL A  1  23  ? 11.297  -5.094  33.383   1.00 175.92 ? 23   VAL A CG1 1 
ATOM   175   C  CG2 . VAL A  1  23  ? 10.892  -7.433  34.147   1.00 172.83 ? 23   VAL A CG2 1 
ATOM   176   N  N   . ASP A  1  24  ? 13.866  -8.517  31.943   1.00 180.98 ? 24   ASP A N   1 
ATOM   177   C  CA  . ASP A  1  24  ? 14.573  -9.796  31.965   1.00 182.85 ? 24   ASP A CA  1 
ATOM   178   C  C   . ASP A  1  24  ? 16.009  -9.526  32.416   1.00 201.75 ? 24   ASP A C   1 
ATOM   179   O  O   . ASP A  1  24  ? 16.414  -8.373  32.601   1.00 213.60 ? 24   ASP A O   1 
ATOM   180   C  CB  . ASP A  1  24  ? 14.523  -10.473 30.592   1.00 182.34 ? 24   ASP A CB  1 
ATOM   181   C  CG  . ASP A  1  24  ? 14.703  -11.974 30.672   1.00 182.71 ? 24   ASP A CG  1 
ATOM   182   O  OD1 . ASP A  1  24  ? 13.694  -12.684 30.859   1.00 179.06 ? 24   ASP A OD1 1 
ATOM   183   O  OD2 . ASP A  1  24  ? 15.851  -12.446 30.546   1.00 224.03 ? 24   ASP A OD2 1 
ATOM   184   N  N   . PHE A  1  25  ? 16.784  -10.598 32.572   1.00 200.47 ? 25   PHE A N   1 
ATOM   185   C  CA  . PHE A  1  25  ? 18.193  -10.510 32.930   1.00 196.51 ? 25   PHE A CA  1 
ATOM   186   C  C   . PHE A  1  25  ? 19.081  -10.723 31.707   1.00 199.95 ? 25   PHE A C   1 
ATOM   187   O  O   . PHE A  1  25  ? 18.621  -11.069 30.618   1.00 197.99 ? 25   PHE A O   1 
ATOM   188   C  CB  . PHE A  1  25  ? 18.560  -11.540 34.004   1.00 198.06 ? 25   PHE A CB  1 
ATOM   189   C  CG  . PHE A  1  25  ? 17.917  -11.298 35.334   1.00 196.00 ? 25   PHE A CG  1 
ATOM   190   C  CD1 . PHE A  1  25  ? 16.675  -11.827 35.625   1.00 191.18 ? 25   PHE A CD1 1 
ATOM   191   C  CD2 . PHE A  1  25  ? 18.563  -10.546 36.300   1.00 199.26 ? 25   PHE A CD2 1 
ATOM   192   C  CE1 . PHE A  1  25  ? 16.087  -11.608 36.855   1.00 197.22 ? 25   PHE A CE1 1 
ATOM   193   C  CE2 . PHE A  1  25  ? 17.983  -10.323 37.530   1.00 197.78 ? 25   PHE A CE2 1 
ATOM   194   C  CZ  . PHE A  1  25  ? 16.743  -10.854 37.810   1.00 192.99 ? 25   PHE A CZ  1 
ATOM   195   N  N   . PHE A  1  26  ? 20.381  -10.509 31.906   1.00 205.51 ? 26   PHE A N   1 
ATOM   196   C  CA  . PHE A  1  26  ? 21.376  -10.729 30.865   1.00 209.85 ? 26   PHE A CA  1 
ATOM   197   C  C   . PHE A  1  26  ? 22.635  -11.289 31.506   1.00 215.51 ? 26   PHE A C   1 
ATOM   198   O  O   . PHE A  1  26  ? 23.249  -10.628 32.348   1.00 224.41 ? 26   PHE A O   1 
ATOM   199   C  CB  . PHE A  1  26  ? 21.682  -9.437  30.110   1.00 211.53 ? 26   PHE A CB  1 
ATOM   200   C  CG  . PHE A  1  26  ? 22.533  -9.633  28.893   1.00 215.59 ? 26   PHE A CG  1 
ATOM   201   C  CD1 . PHE A  1  26  ? 22.480  -10.817 28.174   1.00 215.43 ? 26   PHE A CD1 1 
ATOM   202   C  CD2 . PHE A  1  26  ? 23.400  -8.640  28.476   1.00 234.18 ? 26   PHE A CD2 1 
ATOM   203   C  CE1 . PHE A  1  26  ? 23.271  -10.997 27.050   1.00 219.61 ? 26   PHE A CE1 1 
ATOM   204   C  CE2 . PHE A  1  26  ? 24.195  -8.813  27.358   1.00 233.92 ? 26   PHE A CE2 1 
ATOM   205   C  CZ  . PHE A  1  26  ? 24.130  -9.993  26.644   1.00 227.97 ? 26   PHE A CZ  1 
ATOM   206   N  N   . VAL A  1  27  ? 23.009  -12.507 31.123   1.00 231.79 ? 27   VAL A N   1 
ATOM   207   C  CA  . VAL A  1  27  ? 24.228  -13.139 31.624   1.00 244.52 ? 27   VAL A CA  1 
ATOM   208   C  C   . VAL A  1  27  ? 25.052  -13.629 30.435   1.00 245.83 ? 27   VAL A C   1 
ATOM   209   O  O   . VAL A  1  27  ? 24.848  -14.752 29.950   1.00 250.50 ? 27   VAL A O   1 
ATOM   210   C  CB  . VAL A  1  27  ? 23.897  -14.259 32.625   1.00 243.54 ? 27   VAL A CB  1 
ATOM   211   C  CG1 . VAL A  1  27  ? 22.739  -15.129 32.125   1.00 216.75 ? 27   VAL A CG1 1 
ATOM   212   C  CG2 . VAL A  1  27  ? 25.136  -15.099 32.952   1.00 265.30 ? 27   VAL A CG2 1 
ATOM   213   N  N   . PRO A  1  28  ? 25.980  -12.813 29.915   1.00 235.48 ? 28   PRO A N   1 
ATOM   214   C  CA  . PRO A  1  28  ? 26.753  -13.227 28.736   1.00 239.97 ? 28   PRO A CA  1 
ATOM   215   C  C   . PRO A  1  28  ? 27.890  -14.194 29.034   1.00 250.62 ? 28   PRO A C   1 
ATOM   216   O  O   . PRO A  1  28  ? 27.932  -14.845 30.084   1.00 246.50 ? 28   PRO A O   1 
ATOM   217   C  CB  . PRO A  1  28  ? 27.287  -11.896 28.194   1.00 260.48 ? 28   PRO A CB  1 
ATOM   218   C  CG  . PRO A  1  28  ? 27.413  -11.044 29.397   1.00 263.31 ? 28   PRO A CG  1 
ATOM   219   C  CD  . PRO A  1  28  ? 26.260  -11.419 30.293   1.00 236.61 ? 28   PRO A CD  1 
ATOM   220   N  N   . SER A  1  29  ? 28.811  -14.281 28.074   1.00 258.67 ? 29   SER A N   1 
ATOM   221   C  CA  . SER A  1  29  ? 29.862  -15.293 28.072   1.00 261.58 ? 29   SER A CA  1 
ATOM   222   C  C   . SER A  1  29  ? 30.757  -15.213 29.304   1.00 289.26 ? 29   SER A C   1 
ATOM   223   O  O   . SER A  1  29  ? 31.058  -14.127 29.807   1.00 292.65 ? 29   SER A O   1 
ATOM   224   C  CB  . SER A  1  29  ? 30.699  -15.145 26.803   1.00 267.04 ? 29   SER A CB  1 
ATOM   225   O  OG  . SER A  1  29  ? 29.863  -15.175 25.658   1.00 263.08 ? 29   SER A OG  1 
ATOM   226   N  N   . ALA A  1  30  ? 31.176  -16.379 29.781   1.00 306.68 ? 30   ALA A N   1 
ATOM   227   C  CA  . ALA A  1  30  ? 32.128  -16.566 30.883   1.00 313.62 ? 30   ALA A CA  1 
ATOM   228   C  C   . ALA A  1  30  ? 31.646  -15.835 32.142   1.00 323.17 ? 30   ALA A C   1 
ATOM   229   O  O   . ALA A  1  30  ? 30.448  -15.590 32.320   1.00 320.99 ? 30   ALA A O   1 
ATOM   230   C  CB  . ALA A  1  30  ? 33.514  -16.165 30.408   1.00 292.91 ? 30   ALA A CB  1 
ATOM   231   N  N   . SER A  1  31  ? 32.582  -15.485 33.030   1.00 320.79 ? 31   SER A N   1 
ATOM   232   C  CA  . SER A  1  31  ? 32.269  -14.792 34.282   1.00 308.45 ? 31   SER A CA  1 
ATOM   233   C  C   . SER A  1  31  ? 32.424  -13.286 34.074   1.00 307.64 ? 31   SER A C   1 
ATOM   234   O  O   . SER A  1  31  ? 33.401  -12.661 34.493   1.00 306.70 ? 31   SER A O   1 
ATOM   235   C  CB  . SER A  1  31  ? 33.156  -15.302 35.411   1.00 298.52 ? 31   SER A CB  1 
ATOM   236   O  OG  . SER A  1  31  ? 34.532  -15.194 35.081   1.00 296.26 ? 31   SER A OG  1 
ATOM   237   N  N   . SER A  1  32  ? 31.431  -12.700 33.406   1.00 295.17 ? 32   SER A N   1 
ATOM   238   C  CA  . SER A  1  32  ? 31.433  -11.278 33.103   1.00 285.88 ? 32   SER A CA  1 
ATOM   239   C  C   . SER A  1  32  ? 30.481  -10.533 34.041   1.00 255.94 ? 32   SER A C   1 
ATOM   240   O  O   . SER A  1  32  ? 30.014  -11.080 35.048   1.00 253.57 ? 32   SER A O   1 
ATOM   241   C  CB  . SER A  1  32  ? 31.065  -11.071 31.627   1.00 275.32 ? 32   SER A CB  1 
ATOM   242   O  OG  . SER A  1  32  ? 31.951  -11.771 30.773   1.00 283.89 ? 32   SER A OG  1 
ATOM   243   N  N   . ARG A  1  33  ? 30.173  -9.287  33.703   1.00 254.29 ? 33   ARG A N   1 
ATOM   244   C  CA  . ARG A  1  33  ? 29.204  -8.507  34.445   1.00 249.35 ? 33   ARG A CA  1 
ATOM   245   C  C   . ARG A  1  33  ? 27.796  -8.919  34.034   1.00 246.30 ? 33   ARG A C   1 
ATOM   246   O  O   . ARG A  1  33  ? 27.594  -9.650  33.061   1.00 261.11 ? 33   ARG A O   1 
ATOM   247   C  CB  . ARG A  1  33  ? 29.441  -7.013  34.217   1.00 251.17 ? 33   ARG A CB  1 
ATOM   248   C  CG  . ARG A  1  33  ? 30.724  -6.493  34.865   1.00 260.46 ? 33   ARG A CG  1 
ATOM   249   C  CD  . ARG A  1  33  ? 31.104  -5.091  34.397   1.00 261.50 ? 33   ARG A CD  1 
ATOM   250   N  NE  . ARG A  1  33  ? 31.299  -5.011  32.951   1.00 262.29 ? 33   ARG A NE  1 
ATOM   251   C  CZ  . ARG A  1  33  ? 30.470  -4.396  32.115   1.00 266.60 ? 33   ARG A CZ  1 
ATOM   252   N  NH1 . ARG A  1  33  ? 29.384  -3.792  32.578   1.00 270.57 ? 33   ARG A NH1 1 
ATOM   253   N  NH2 . ARG A  1  33  ? 30.736  -4.373  30.815   1.00 262.97 ? 33   ARG A NH2 1 
ATOM   254   N  N   . MET A  1  34  ? 26.814  -8.455  34.802   1.00 248.06 ? 34   MET A N   1 
ATOM   255   C  CA  . MET A  1  34  ? 25.415  -8.779  34.579   1.00 231.22 ? 34   MET A CA  1 
ATOM   256   C  C   . MET A  1  34  ? 24.637  -7.500  34.290   1.00 232.97 ? 34   MET A C   1 
ATOM   257   O  O   . MET A  1  34  ? 25.025  -6.409  34.715   1.00 241.00 ? 34   MET A O   1 
ATOM   258   C  CB  . MET A  1  34  ? 24.823  -9.496  35.798   1.00 240.57 ? 34   MET A CB  1 
ATOM   259   C  CG  . MET A  1  34  ? 25.471  -10.836 36.126   1.00 240.93 ? 34   MET A CG  1 
ATOM   260   S  SD  . MET A  1  34  ? 24.443  -12.253 35.692   1.00 266.01 ? 34   MET A SD  1 
ATOM   261   C  CE  . MET A  1  34  ? 25.425  -13.593 36.362   1.00 258.99 ? 34   MET A CE  1 
ATOM   262   N  N   . PHE A  1  35  ? 23.522  -7.637  33.570   1.00 220.91 ? 35   PHE A N   1 
ATOM   263   C  CA  . PHE A  1  35  ? 22.767  -6.477  33.116   1.00 218.01 ? 35   PHE A CA  1 
ATOM   264   C  C   . PHE A  1  35  ? 21.274  -6.718  33.276   1.00 211.25 ? 35   PHE A C   1 
ATOM   265   O  O   . PHE A  1  35  ? 20.816  -7.854  33.410   1.00 208.62 ? 35   PHE A O   1 
ATOM   266   C  CB  . PHE A  1  35  ? 23.064  -6.143  31.650   1.00 221.35 ? 35   PHE A CB  1 
ATOM   267   C  CG  . PHE A  1  35  ? 24.509  -5.824  31.377   1.00 232.09 ? 35   PHE A CG  1 
ATOM   268   C  CD1 . PHE A  1  35  ? 24.994  -4.536  31.544   1.00 230.70 ? 35   PHE A CD1 1 
ATOM   269   C  CD2 . PHE A  1  35  ? 25.380  -6.811  30.942   1.00 229.90 ? 35   PHE A CD2 1 
ATOM   270   C  CE1 . PHE A  1  35  ? 26.320  -4.240  31.286   1.00 236.34 ? 35   PHE A CE1 1 
ATOM   271   C  CE2 . PHE A  1  35  ? 26.702  -6.520  30.683   1.00 236.67 ? 35   PHE A CE2 1 
ATOM   272   C  CZ  . PHE A  1  35  ? 27.172  -5.234  30.855   1.00 239.85 ? 35   PHE A CZ  1 
ATOM   273   N  N   . LEU A  1  36  ? 20.520  -5.620  33.247   1.00 208.83 ? 36   LEU A N   1 
ATOM   274   C  CA  . LEU A  1  36  ? 19.063  -5.646  33.214   1.00 202.77 ? 36   LEU A CA  1 
ATOM   275   C  C   . LEU A  1  36  ? 18.578  -5.310  31.807   1.00 200.78 ? 36   LEU A C   1 
ATOM   276   O  O   . LEU A  1  36  ? 19.012  -4.317  31.214   1.00 203.35 ? 36   LEU A O   1 
ATOM   277   C  CB  . LEU A  1  36  ? 18.469  -4.657  34.223   1.00 201.70 ? 36   LEU A CB  1 
ATOM   278   C  CG  . LEU A  1  36  ? 18.704  -4.843  35.728   1.00 203.22 ? 36   LEU A CG  1 
ATOM   279   C  CD1 . LEU A  1  36  ? 20.039  -4.259  36.157   1.00 233.40 ? 36   LEU A CD1 1 
ATOM   280   C  CD2 . LEU A  1  36  ? 17.581  -4.191  36.512   1.00 200.07 ? 36   LEU A CD2 1 
ATOM   281   N  N   . LEU A  1  37  ? 17.674  -6.132  31.283   1.00 196.54 ? 37   LEU A N   1 
ATOM   282   C  CA  . LEU A  1  37  ? 17.027  -5.884  30.000   1.00 201.37 ? 37   LEU A CA  1 
ATOM   283   C  C   . LEU A  1  37  ? 15.623  -5.343  30.252   1.00 189.35 ? 37   LEU A C   1 
ATOM   284   O  O   . LEU A  1  37  ? 14.804  -6.013  30.888   1.00 185.87 ? 37   LEU A O   1 
ATOM   285   C  CB  . LEU A  1  37  ? 16.967  -7.164  29.168   1.00 193.02 ? 37   LEU A CB  1 
ATOM   286   C  CG  . LEU A  1  37  ? 18.311  -7.729  28.718   1.00 198.06 ? 37   LEU A CG  1 
ATOM   287   C  CD1 . LEU A  1  37  ? 18.091  -8.974  27.887   1.00 196.84 ? 37   LEU A CD1 1 
ATOM   288   C  CD2 . LEU A  1  37  ? 19.069  -6.685  27.923   1.00 201.94 ? 37   LEU A CD2 1 
ATOM   289   N  N   . VAL A  1  38  ? 15.350  -4.133  29.768   1.00 189.53 ? 38   VAL A N   1 
ATOM   290   C  CA  . VAL A  1  38  ? 14.065  -3.477  29.982   1.00 185.80 ? 38   VAL A CA  1 
ATOM   291   C  C   . VAL A  1  38  ? 13.458  -3.109  28.635   1.00 185.28 ? 38   VAL A C   1 
ATOM   292   O  O   . VAL A  1  38  ? 14.142  -2.550  27.770   1.00 187.29 ? 38   VAL A O   1 
ATOM   293   C  CB  . VAL A  1  38  ? 14.205  -2.230  30.869   1.00 187.92 ? 38   VAL A CB  1 
ATOM   294   C  CG1 . VAL A  1  38  ? 12.834  -1.666  31.173   1.00 201.66 ? 38   VAL A CG1 1 
ATOM   295   C  CG2 . VAL A  1  38  ? 14.952  -2.567  32.150   1.00 190.33 ? 38   VAL A CG2 1 
ATOM   296   N  N   . GLY A  1  39  ? 12.171  -3.410  28.469   1.00 195.66 ? 39   GLY A N   1 
ATOM   297   C  CA  . GLY A  1  39  ? 11.446  -3.046  27.261   1.00 178.05 ? 39   GLY A CA  1 
ATOM   298   C  C   . GLY A  1  39  ? 10.728  -1.711  27.401   1.00 177.62 ? 39   GLY A C   1 
ATOM   299   O  O   . GLY A  1  39  ? 10.162  -1.399  28.448   1.00 176.33 ? 39   GLY A O   1 
ATOM   300   N  N   . ALA A  1  40  ? 10.798  -0.908  26.340   1.00 179.20 ? 40   ALA A N   1 
ATOM   301   C  CA  . ALA A  1  40  ? 10.050  0.345   26.227   1.00 179.03 ? 40   ALA A CA  1 
ATOM   302   C  C   . ALA A  1  40  ? 9.381   0.361   24.858   1.00 177.60 ? 40   ALA A C   1 
ATOM   303   O  O   . ALA A  1  40  ? 9.920   0.930   23.896   1.00 180.46 ? 40   ALA A O   1 
ATOM   304   C  CB  . ALA A  1  40  ? 10.953  1.562   26.428   1.00 183.68 ? 40   ALA A CB  1 
ATOM   305   N  N   . PRO A  1  41  ? 8.200   -0.258  24.733   1.00 173.47 ? 41   PRO A N   1 
ATOM   306   C  CA  . PRO A  1  41  ? 7.611   -0.465  23.398   1.00 172.23 ? 41   PRO A CA  1 
ATOM   307   C  C   . PRO A  1  41  ? 7.088   0.798   22.728   1.00 173.33 ? 41   PRO A C   1 
ATOM   308   O  O   . PRO A  1  41  ? 6.893   0.789   21.507   1.00 173.61 ? 41   PRO A O   1 
ATOM   309   C  CB  . PRO A  1  41  ? 6.482   -1.466  23.668   1.00 167.77 ? 41   PRO A CB  1 
ATOM   310   C  CG  . PRO A  1  41  ? 6.126   -1.239  25.087   1.00 166.65 ? 41   PRO A CG  1 
ATOM   311   C  CD  . PRO A  1  41  ? 7.390   -0.879  25.796   1.00 170.07 ? 41   PRO A CD  1 
ATOM   312   N  N   . LYS A  1  42  ? 6.829   1.874   23.469   1.00 174.23 ? 42   LYS A N   1 
ATOM   313   C  CA  . LYS A  1  42  ? 6.360   3.118   22.876   1.00 175.82 ? 42   LYS A CA  1 
ATOM   314   C  C   . LYS A  1  42  ? 7.467   4.156   22.748   1.00 180.68 ? 42   LYS A C   1 
ATOM   315   O  O   . LYS A  1  42  ? 7.175   5.343   22.565   1.00 182.67 ? 42   LYS A O   1 
ATOM   316   C  CB  . LYS A  1  42  ? 5.190   3.683   23.683   1.00 174.00 ? 42   LYS A CB  1 
ATOM   317   C  CG  . LYS A  1  42  ? 3.855   3.042   23.345   1.00 170.01 ? 42   LYS A CG  1 
ATOM   318   C  CD  . LYS A  1  42  ? 2.688   3.844   23.886   1.00 169.27 ? 42   LYS A CD  1 
ATOM   319   C  CE  . LYS A  1  42  ? 1.380   3.362   23.280   1.00 178.08 ? 42   LYS A CE  1 
ATOM   320   N  NZ  . LYS A  1  42  ? 0.201   4.141   23.753   1.00 191.44 ? 42   LYS A NZ  1 
ATOM   321   N  N   . ALA A  1  43  ? 8.728   3.735   22.839   1.00 207.63 ? 43   ALA A N   1 
ATOM   322   C  CA  . ALA A  1  43  ? 9.854   4.663   22.853   1.00 202.63 ? 43   ALA A CA  1 
ATOM   323   C  C   . ALA A  1  43  ? 10.225  5.128   21.447   1.00 202.61 ? 43   ALA A C   1 
ATOM   324   O  O   . ALA A  1  43  ? 10.419  4.312   20.540   1.00 190.26 ? 43   ALA A O   1 
ATOM   325   C  CB  . ALA A  1  43  ? 11.061  4.008   23.521   1.00 189.65 ? 43   ALA A CB  1 
ATOM   326   N  N   . ASN A  1  44  ? 10.371  6.441   21.286   1.00 194.24 ? 44   ASN A N   1 
ATOM   327   C  CA  . ASN A  1  44  ? 10.883  6.995   20.043   1.00 197.88 ? 44   ASN A CA  1 
ATOM   328   C  C   . ASN A  1  44  ? 12.335  6.586   19.846   1.00 201.40 ? 44   ASN A C   1 
ATOM   329   O  O   . ASN A  1  44  ? 13.132  6.594   20.788   1.00 203.17 ? 44   ASN A O   1 
ATOM   330   C  CB  . ASN A  1  44  ? 10.762  8.520   20.048   1.00 201.27 ? 44   ASN A CB  1 
ATOM   331   C  CG  . ASN A  1  44  ? 9.387   9.002   19.626   1.00 204.54 ? 44   ASN A CG  1 
ATOM   332   O  OD1 . ASN A  1  44  ? 8.839   8.533   18.630   1.00 198.58 ? 44   ASN A OD1 1 
ATOM   333   N  ND2 . ASN A  1  44  ? 8.819   9.943   20.382   1.00 274.51 ? 44   ASN A ND2 1 
ATOM   334   N  N   . THR A  1  45  ? 12.671  6.196   18.622   1.00 218.55 ? 45   THR A N   1 
ATOM   335   C  CA  . THR A  1  45  ? 14.032  5.818   18.266   1.00 216.18 ? 45   THR A CA  1 
ATOM   336   C  C   . THR A  1  45  ? 14.559  6.758   17.186   1.00 212.36 ? 45   THR A C   1 
ATOM   337   O  O   . THR A  1  45  ? 13.873  7.678   16.736   1.00 225.08 ? 45   THR A O   1 
ATOM   338   C  CB  . THR A  1  45  ? 14.094  4.362   17.795   1.00 213.01 ? 45   THR A CB  1 
ATOM   339   O  OG1 . THR A  1  45  ? 13.398  4.228   16.550   1.00 213.65 ? 45   THR A OG1 1 
ATOM   340   C  CG2 . THR A  1  45  ? 13.455  3.442   18.823   1.00 211.11 ? 45   THR A CG2 1 
ATOM   341   N  N   . THR A  1  46  ? 15.795  6.509   16.764   1.00 219.39 ? 46   THR A N   1 
ATOM   342   C  CA  . THR A  1  46  ? 16.437  7.314   15.734   1.00 238.51 ? 46   THR A CA  1 
ATOM   343   C  C   . THR A  1  46  ? 16.167  6.786   14.334   1.00 236.32 ? 46   THR A C   1 
ATOM   344   O  O   . THR A  1  46  ? 16.709  7.326   13.366   1.00 248.53 ? 46   THR A O   1 
ATOM   345   C  CB  . THR A  1  46  ? 17.949  7.379   15.975   1.00 235.89 ? 46   THR A CB  1 
ATOM   346   O  OG1 . THR A  1  46  ? 18.493  6.055   15.947   1.00 226.08 ? 46   THR A OG1 1 
ATOM   347   C  CG2 . THR A  1  46  ? 18.249  8.010   17.324   1.00 227.67 ? 46   THR A CG2 1 
ATOM   348   N  N   . GLN A  1  47  ? 15.351  5.746   14.215   1.00 223.47 ? 47   GLN A N   1 
ATOM   349   C  CA  . GLN A  1  47  ? 15.057  5.147   12.922   1.00 225.37 ? 47   GLN A CA  1 
ATOM   350   C  C   . GLN A  1  47  ? 14.411  6.161   11.980   1.00 231.38 ? 47   GLN A C   1 
ATOM   351   O  O   . GLN A  1  47  ? 13.468  6.859   12.378   1.00 234.05 ? 47   GLN A O   1 
ATOM   352   C  CB  . GLN A  1  47  ? 14.147  3.939   13.110   1.00 221.82 ? 47   GLN A CB  1 
ATOM   353   C  CG  . GLN A  1  47  ? 14.828  2.763   13.786   1.00 223.01 ? 47   GLN A CG  1 
ATOM   354   C  CD  . GLN A  1  47  ? 13.840  1.762   14.344   1.00 215.81 ? 47   GLN A CD  1 
ATOM   355   O  OE1 . GLN A  1  47  ? 12.647  2.044   14.448   1.00 216.61 ? 47   GLN A OE1 1 
ATOM   356   N  NE2 . GLN A  1  47  ? 14.330  0.581   14.699   1.00 212.14 ? 47   GLN A NE2 1 
ATOM   357   N  N   . PRO A  1  48  ? 14.892  6.277   10.741   1.00 221.17 ? 48   PRO A N   1 
ATOM   358   C  CA  . PRO A  1  48  ? 14.379  7.301   9.816    1.00 224.28 ? 48   PRO A CA  1 
ATOM   359   C  C   . PRO A  1  48  ? 12.903  7.103   9.513    1.00 232.68 ? 48   PRO A C   1 
ATOM   360   O  O   . PRO A  1  48  ? 12.486  6.058   9.010    1.00 226.62 ? 48   PRO A O   1 
ATOM   361   C  CB  . PRO A  1  48  ? 15.241  7.108   8.563    1.00 228.31 ? 48   PRO A CB  1 
ATOM   362   C  CG  . PRO A  1  48  ? 16.458  6.378   9.030    1.00 236.95 ? 48   PRO A CG  1 
ATOM   363   C  CD  . PRO A  1  48  ? 15.979  5.488   10.138   1.00 224.64 ? 48   PRO A CD  1 
ATOM   364   N  N   . GLY A  1  49  ? 12.106  8.119   9.837    1.00 238.72 ? 49   GLY A N   1 
ATOM   365   C  CA  . GLY A  1  49  ? 10.695  8.105   9.526    1.00 225.26 ? 49   GLY A CA  1 
ATOM   366   C  C   . GLY A  1  49  ? 9.860   7.217   10.412   1.00 208.32 ? 49   GLY A C   1 
ATOM   367   O  O   . GLY A  1  49  ? 8.642   7.133   10.206   1.00 209.31 ? 49   GLY A O   1 
ATOM   368   N  N   . ILE A  1  50  ? 10.468  6.549   11.384   1.00 208.75 ? 50   ILE A N   1 
ATOM   369   C  CA  . ILE A  1  50  ? 9.774   5.612   12.256   1.00 210.97 ? 50   ILE A CA  1 
ATOM   370   C  C   . ILE A  1  50  ? 9.417   6.335   13.549   1.00 218.24 ? 50   ILE A C   1 
ATOM   371   O  O   . ILE A  1  50  ? 10.302  6.739   14.312   1.00 222.18 ? 50   ILE A O   1 
ATOM   372   C  CB  . ILE A  1  50  ? 10.624  4.365   12.518   1.00 210.29 ? 50   ILE A CB  1 
ATOM   373   C  CG1 . ILE A  1  50  ? 10.979  3.695   11.189   1.00 202.66 ? 50   ILE A CG1 1 
ATOM   374   C  CG2 . ILE A  1  50  ? 9.884   3.408   13.439   1.00 214.05 ? 50   ILE A CG2 1 
ATOM   375   C  CD1 . ILE A  1  50  ? 11.618  2.343   11.339   1.00 202.09 ? 50   ILE A CD1 1 
ATOM   376   N  N   . VAL A  1  51  ? 8.119   6.512   13.791   1.00 204.25 ? 51   VAL A N   1 
ATOM   377   C  CA  . VAL A  1  51  ? 7.628   7.153   15.008   1.00 203.22 ? 51   VAL A CA  1 
ATOM   378   C  C   . VAL A  1  51  ? 7.285   6.078   16.035   1.00 193.14 ? 51   VAL A C   1 
ATOM   379   O  O   . VAL A  1  51  ? 6.478   5.181   15.766   1.00 186.51 ? 51   VAL A O   1 
ATOM   380   C  CB  . VAL A  1  51  ? 6.419   8.058   14.718   1.00 217.25 ? 51   VAL A CB  1 
ATOM   381   C  CG1 . VAL A  1  51  ? 5.466   7.403   13.731   1.00 220.27 ? 51   VAL A CG1 1 
ATOM   382   C  CG2 . VAL A  1  51  ? 5.692   8.414   16.014   1.00 214.96 ? 51   VAL A CG2 1 
ATOM   383   N  N   . GLU A  1  52  ? 7.908   6.168   17.210   1.00 190.54 ? 52   GLU A N   1 
ATOM   384   C  CA  . GLU A  1  52  ? 7.670   5.246   18.322   1.00 186.77 ? 52   GLU A CA  1 
ATOM   385   C  C   . GLU A  1  52  ? 7.877   3.795   17.900   1.00 186.77 ? 52   GLU A C   1 
ATOM   386   O  O   . GLU A  1  52  ? 7.012   2.936   18.090   1.00 180.67 ? 52   GLU A O   1 
ATOM   387   C  CB  . GLU A  1  52  ? 6.280   5.443   18.919   1.00 183.30 ? 52   GLU A CB  1 
ATOM   388   C  CG  . GLU A  1  52  ? 6.118   6.746   19.661   1.00 185.35 ? 52   GLU A CG  1 
ATOM   389   C  CD  . GLU A  1  52  ? 4.808   6.814   20.410   1.00 219.70 ? 52   GLU A CD  1 
ATOM   390   O  OE1 . GLU A  1  52  ? 4.654   7.722   21.253   1.00 222.33 ? 52   GLU A OE1 1 
ATOM   391   O  OE2 . GLU A  1  52  ? 3.935   5.956   20.161   1.00 232.89 ? 52   GLU A OE2 1 
ATOM   392   N  N   . GLY A  1  53  ? 9.041   3.529   17.301   1.00 193.48 ? 53   GLY A N   1 
ATOM   393   C  CA  . GLY A  1  53  ? 9.388   2.164   16.946   1.00 187.92 ? 53   GLY A CA  1 
ATOM   394   C  C   . GLY A  1  53  ? 9.588   1.272   18.155   1.00 189.57 ? 53   GLY A C   1 
ATOM   395   O  O   . GLY A  1  53  ? 9.346   0.063   18.084   1.00 182.01 ? 53   GLY A O   1 
ATOM   396   N  N   . GLY A  1  54  ? 10.019  1.846   19.272   1.00 200.56 ? 54   GLY A N   1 
ATOM   397   C  CA  . GLY A  1  54  ? 10.293  1.087   20.473   1.00 184.02 ? 54   GLY A CA  1 
ATOM   398   C  C   . GLY A  1  54  ? 11.722  0.577   20.516   1.00 187.46 ? 54   GLY A C   1 
ATOM   399   O  O   . GLY A  1  54  ? 12.390  0.414   19.497   1.00 190.25 ? 54   GLY A O   1 
ATOM   400   N  N   . GLN A  1  55  ? 12.197  0.323   21.733   1.00 187.59 ? 55   GLN A N   1 
ATOM   401   C  CA  . GLN A  1  55  ? 13.551  -0.181  21.898   1.00 191.12 ? 55   GLN A CA  1 
ATOM   402   C  C   . GLN A  1  55  ? 13.674  -0.997  23.175   1.00 189.52 ? 55   GLN A C   1 
ATOM   403   O  O   . GLN A  1  55  ? 12.820  -0.946  24.064   1.00 186.27 ? 55   GLN A O   1 
ATOM   404   C  CB  . GLN A  1  55  ? 14.584  0.953   21.916   1.00 204.54 ? 55   GLN A CB  1 
ATOM   405   C  CG  . GLN A  1  55  ? 14.339  2.034   22.961   1.00 196.86 ? 55   GLN A CG  1 
ATOM   406   C  CD  . GLN A  1  55  ? 15.308  3.200   22.824   1.00 211.93 ? 55   GLN A CD  1 
ATOM   407   O  OE1 . GLN A  1  55  ? 16.125  3.236   21.904   1.00 205.62 ? 55   GLN A OE1 1 
ATOM   408   N  NE2 . GLN A  1  55  ? 15.226  4.154   23.745   1.00 213.23 ? 55   GLN A NE2 1 
ATOM   409   N  N   . VAL A  1  56  ? 14.766  -1.754  23.248   1.00 212.67 ? 56   VAL A N   1 
ATOM   410   C  CA  . VAL A  1  56  ? 15.150  -2.506  24.436   1.00 207.77 ? 56   VAL A CA  1 
ATOM   411   C  C   . VAL A  1  56  ? 16.487  -1.959  24.925   1.00 206.50 ? 56   VAL A C   1 
ATOM   412   O  O   . VAL A  1  56  ? 17.456  -1.897  24.159   1.00 201.43 ? 56   VAL A O   1 
ATOM   413   C  CB  . VAL A  1  56  ? 15.234  -4.015  24.141   1.00 206.20 ? 56   VAL A CB  1 
ATOM   414   C  CG1 . VAL A  1  56  ? 15.727  -4.773  25.360   1.00 214.89 ? 56   VAL A CG1 1 
ATOM   415   C  CG2 . VAL A  1  56  ? 13.881  -4.537  23.684   1.00 185.88 ? 56   VAL A CG2 1 
ATOM   416   N  N   . LEU A  1  57  ? 16.537  -1.560  26.194   1.00 197.45 ? 57   LEU A N   1 
ATOM   417   C  CA  . LEU A  1  57  ? 17.706  -0.902  26.759   1.00 202.55 ? 57   LEU A CA  1 
ATOM   418   C  C   . LEU A  1  57  ? 18.500  -1.858  27.637   1.00 204.19 ? 57   LEU A C   1 
ATOM   419   O  O   . LEU A  1  57  ? 17.931  -2.678  28.365   1.00 200.86 ? 57   LEU A O   1 
ATOM   420   C  CB  . LEU A  1  57  ? 17.316  0.330   27.578   1.00 202.67 ? 57   LEU A CB  1 
ATOM   421   C  CG  . LEU A  1  57  ? 16.802  1.546   26.811   1.00 202.86 ? 57   LEU A CG  1 
ATOM   422   C  CD1 . LEU A  1  57  ? 15.293  1.448   26.607   1.00 210.44 ? 57   LEU A CD1 1 
ATOM   423   C  CD2 . LEU A  1  57  ? 17.169  2.823   27.545   1.00 206.34 ? 57   LEU A CD2 1 
ATOM   424   N  N   . LYS A  1  58  ? 19.821  -1.733  27.559   1.00 241.97 ? 58   LYS A N   1 
ATOM   425   C  CA  . LYS A  1  58  ? 20.761  -2.471  28.394   1.00 234.04 ? 58   LYS A CA  1 
ATOM   426   C  C   . LYS A  1  58  ? 21.219  -1.537  29.508   1.00 217.75 ? 58   LYS A C   1 
ATOM   427   O  O   . LYS A  1  58  ? 21.918  -0.552  29.251   1.00 225.68 ? 58   LYS A O   1 
ATOM   428   C  CB  . LYS A  1  58  ? 21.939  -2.969  27.557   1.00 217.36 ? 58   LYS A CB  1 
ATOM   429   C  CG  . LYS A  1  58  ? 22.938  -3.838  28.300   1.00 220.82 ? 58   LYS A CG  1 
ATOM   430   C  CD  . LYS A  1  58  ? 24.225  -3.986  27.490   1.00 229.18 ? 58   LYS A CD  1 
ATOM   431   C  CE  . LYS A  1  58  ? 24.904  -2.635  27.272   1.00 231.45 ? 58   LYS A CE  1 
ATOM   432   N  NZ  . LYS A  1  58  ? 26.202  -2.757  26.556   1.00 237.95 ? 58   LYS A NZ  1 
ATOM   433   N  N   . CYS A  1  59  ? 20.812  -1.833  30.739   1.00 218.03 ? 59   CYS A N   1 
ATOM   434   C  CA  . CYS A  1  59  ? 21.163  -1.019  31.893   1.00 221.10 ? 59   CYS A CA  1 
ATOM   435   C  C   . CYS A  1  59  ? 22.238  -1.713  32.721   1.00 224.93 ? 59   CYS A C   1 
ATOM   436   O  O   . CYS A  1  59  ? 22.225  -2.939  32.876   1.00 223.22 ? 59   CYS A O   1 
ATOM   437   C  CB  . CYS A  1  59  ? 19.925  -0.725  32.758   1.00 225.59 ? 59   CYS A CB  1 
ATOM   438   S  SG  . CYS A  1  59  ? 18.577  0.192   31.932   1.00 234.05 ? 59   CYS A SG  1 
ATOM   439   N  N   . ASP A  1  60  ? 23.170  -0.922  33.240   1.00 225.51 ? 60   ASP A N   1 
ATOM   440   C  CA  . ASP A  1  60  ? 24.305  -1.419  34.005   1.00 235.83 ? 60   ASP A CA  1 
ATOM   441   C  C   . ASP A  1  60  ? 24.009  -1.249  35.489   1.00 231.48 ? 60   ASP A C   1 
ATOM   442   O  O   . ASP A  1  60  ? 23.380  -0.267  35.895   1.00 228.72 ? 60   ASP A O   1 
ATOM   443   C  CB  . ASP A  1  60  ? 25.597  -0.678  33.615   1.00 244.01 ? 60   ASP A CB  1 
ATOM   444   C  CG  . ASP A  1  60  ? 26.803  -1.083  34.462   1.00 242.90 ? 60   ASP A CG  1 
ATOM   445   O  OD1 . ASP A  1  60  ? 27.014  -2.297  34.672   1.00 242.57 ? 60   ASP A OD1 1 
ATOM   446   O  OD2 . ASP A  1  60  ? 27.547  -0.182  34.910   1.00 248.03 ? 60   ASP A OD2 1 
ATOM   447   N  N   . TRP A  1  61  ? 24.368  -2.256  36.279   1.00 255.64 ? 61   TRP A N   1 
ATOM   448   C  CA  . TRP A  1  61  ? 24.270  -2.167  37.732   1.00 248.59 ? 61   TRP A CA  1 
ATOM   449   C  C   . TRP A  1  61  ? 25.554  -1.589  38.349   1.00 262.06 ? 61   TRP A C   1 
ATOM   450   O  O   . TRP A  1  61  ? 26.636  -1.648  37.756   1.00 248.18 ? 61   TRP A O   1 
ATOM   451   C  CB  . TRP A  1  61  ? 23.946  -3.539  38.325   1.00 233.63 ? 61   TRP A CB  1 
ATOM   452   C  CG  . TRP A  1  61  ? 24.216  -3.664  39.789   1.00 236.07 ? 61   TRP A CG  1 
ATOM   453   C  CD1 . TRP A  1  61  ? 25.090  -4.524  40.387   1.00 242.93 ? 61   TRP A CD1 1 
ATOM   454   C  CD2 . TRP A  1  61  ? 23.613  -2.905  40.846   1.00 247.49 ? 61   TRP A CD2 1 
ATOM   455   N  NE1 . TRP A  1  61  ? 25.066  -4.353  41.750   1.00 257.17 ? 61   TRP A NE1 1 
ATOM   456   C  CE2 . TRP A  1  61  ? 24.168  -3.365  42.058   1.00 262.33 ? 61   TRP A CE2 1 
ATOM   457   C  CE3 . TRP A  1  61  ? 22.658  -1.883  40.889   1.00 243.07 ? 61   TRP A CE3 1 
ATOM   458   C  CZ2 . TRP A  1  61  ? 23.798  -2.838  43.297   1.00 267.36 ? 61   TRP A CZ2 1 
ATOM   459   C  CZ3 . TRP A  1  61  ? 22.295  -1.361  42.121   1.00 249.45 ? 61   TRP A CZ3 1 
ATOM   460   C  CH2 . TRP A  1  61  ? 22.862  -1.841  43.306   1.00 256.86 ? 61   TRP A CH2 1 
ATOM   461   N  N   . ARG A  1  65  ? 25.755  3.151   36.854   1.00 251.95 ? 65   ARG A N   1 
ATOM   462   C  CA  . ARG A  1  65  ? 24.476  2.457   36.728   1.00 262.51 ? 65   ARG A CA  1 
ATOM   463   C  C   . ARG A  1  65  ? 23.576  3.089   35.662   1.00 257.37 ? 65   ARG A C   1 
ATOM   464   O  O   . ARG A  1  65  ? 22.368  3.241   35.864   1.00 236.20 ? 65   ARG A O   1 
ATOM   465   C  CB  . ARG A  1  65  ? 23.762  2.417   38.085   1.00 251.43 ? 65   ARG A CB  1 
ATOM   466   C  CG  . ARG A  1  65  ? 24.671  1.996   39.233   1.00 246.97 ? 65   ARG A CG  1 
ATOM   467   C  CD  . ARG A  1  65  ? 23.930  1.954   40.556   1.00 246.55 ? 65   ARG A CD  1 
ATOM   468   N  NE  . ARG A  1  65  ? 23.753  3.286   41.121   1.00 254.70 ? 65   ARG A NE  1 
ATOM   469   C  CZ  . ARG A  1  65  ? 23.113  3.534   42.259   1.00 257.77 ? 65   ARG A CZ  1 
ATOM   470   N  NH1 . ARG A  1  65  ? 22.588  2.535   42.957   1.00 253.21 ? 65   ARG A NH1 1 
ATOM   471   N  NH2 . ARG A  1  65  ? 23.000  4.778   42.702   1.00 257.08 ? 65   ARG A NH2 1 
ATOM   472   N  N   . ARG A  1  66  ? 24.175  3.429   34.522   1.00 253.43 ? 66   ARG A N   1 
ATOM   473   C  CA  . ARG A  1  66  ? 23.482  4.078   33.418   1.00 242.60 ? 66   ARG A CA  1 
ATOM   474   C  C   . ARG A  1  66  ? 22.929  3.045   32.437   1.00 240.28 ? 66   ARG A C   1 
ATOM   475   O  O   . ARG A  1  66  ? 23.437  1.925   32.335   1.00 232.41 ? 66   ARG A O   1 
ATOM   476   C  CB  . ARG A  1  66  ? 24.425  5.037   32.684   1.00 242.86 ? 66   ARG A CB  1 
ATOM   477   C  CG  . ARG A  1  66  ? 25.056  6.099   33.573   1.00 248.41 ? 66   ARG A CG  1 
ATOM   478   C  CD  . ARG A  1  66  ? 26.200  6.803   32.856   1.00 269.86 ? 66   ARG A CD  1 
ATOM   479   N  NE  . ARG A  1  66  ? 27.222  5.869   32.382   1.00 273.06 ? 66   ARG A NE  1 
ATOM   480   C  CZ  . ARG A  1  66  ? 28.311  5.530   33.067   1.00 262.59 ? 66   ARG A CZ  1 
ATOM   481   N  NH1 . ARG A  1  66  ? 28.531  6.043   34.270   1.00 269.86 ? 66   ARG A NH1 1 
ATOM   482   N  NH2 . ARG A  1  66  ? 29.182  4.675   32.549   1.00 265.12 ? 66   ARG A NH2 1 
ATOM   483   N  N   . CYS A  1  67  ? 21.878  3.437   31.712   1.00 240.45 ? 67   CYS A N   1 
ATOM   484   C  CA  . CYS A  1  67  ? 21.252  2.602   30.692   1.00 222.10 ? 67   CYS A CA  1 
ATOM   485   C  C   . CYS A  1  67  ? 21.736  2.984   29.293   1.00 224.70 ? 67   CYS A C   1 
ATOM   486   O  O   . CYS A  1  67  ? 21.950  4.164   28.995   1.00 227.83 ? 67   CYS A O   1 
ATOM   487   C  CB  . CYS A  1  67  ? 19.725  2.705   30.758   1.00 231.30 ? 67   CYS A CB  1 
ATOM   488   S  SG  . CYS A  1  67  ? 18.952  2.155   32.314   1.00 248.84 ? 67   CYS A SG  1 
ATOM   489   N  N   . GLN A  1  68  ? 21.887  1.975   28.430   1.00 224.35 ? 68   GLN A N   1 
ATOM   490   C  CA  . GLN A  1  68  ? 22.370  2.143   27.062   1.00 242.89 ? 68   GLN A CA  1 
ATOM   491   C  C   . GLN A  1  68  ? 21.422  1.439   26.095   1.00 222.00 ? 68   GLN A C   1 
ATOM   492   O  O   . GLN A  1  68  ? 21.089  0.259   26.308   1.00 218.74 ? 68   GLN A O   1 
ATOM   493   C  CB  . GLN A  1  68  ? 23.800  1.579   26.925   1.00 253.63 ? 68   GLN A CB  1 
ATOM   494   C  CG  . GLN A  1  68  ? 24.938  2.583   27.135   1.00 239.32 ? 68   GLN A CG  1 
ATOM   495   C  CD  . GLN A  1  68  ? 24.912  3.724   26.136   1.00 241.46 ? 68   GLN A CD  1 
ATOM   496   O  OE1 . GLN A  1  68  ? 24.445  3.568   25.007   1.00 239.45 ? 68   GLN A OE1 1 
ATOM   497   N  NE2 . GLN A  1  68  ? 25.401  4.885   26.553   1.00 253.69 ? 68   GLN A NE2 1 
ATOM   498   N  N   . PRO A  1  69  ? 20.956  2.113   25.040   1.00 225.24 ? 69   PRO A N   1 
ATOM   499   C  CA  . PRO A  1  69  ? 20.084  1.448   24.059   1.00 242.36 ? 69   PRO A CA  1 
ATOM   500   C  C   . PRO A  1  69  ? 20.798  0.330   23.306   1.00 222.82 ? 69   PRO A C   1 
ATOM   501   O  O   . PRO A  1  69  ? 21.976  0.438   22.966   1.00 228.30 ? 69   PRO A O   1 
ATOM   502   C  CB  . PRO A  1  69  ? 19.677  2.587   23.115   1.00 237.86 ? 69   PRO A CB  1 
ATOM   503   C  CG  . PRO A  1  69  ? 19.892  3.842   23.900   1.00 233.49 ? 69   PRO A CG  1 
ATOM   504   C  CD  . PRO A  1  69  ? 21.084  3.557   24.771   1.00 228.39 ? 69   PRO A CD  1 
ATOM   505   N  N   . ILE A  1  70  ? 20.077  -0.766  23.074   1.00 239.67 ? 70   ILE A N   1 
ATOM   506   C  CA  . ILE A  1  70  ? 20.569  -1.871  22.251   1.00 218.84 ? 70   ILE A CA  1 
ATOM   507   C  C   . ILE A  1  70  ? 20.101  -1.668  20.814   1.00 220.69 ? 70   ILE A C   1 
ATOM   508   O  O   . ILE A  1  70  ? 18.895  -1.594  20.553   1.00 218.32 ? 70   ILE A O   1 
ATOM   509   C  CB  . ILE A  1  70  ? 20.094  -3.229  22.789   1.00 217.80 ? 70   ILE A CB  1 
ATOM   510   C  CG1 . ILE A  1  70  ? 20.515  -3.409  24.244   1.00 212.89 ? 70   ILE A CG1 1 
ATOM   511   C  CG2 . ILE A  1  70  ? 20.673  -4.353  21.949   1.00 217.66 ? 70   ILE A CG2 1 
ATOM   512   C  CD1 . ILE A  1  70  ? 20.056  -4.713  24.852   1.00 221.13 ? 70   ILE A CD1 1 
ATOM   513   N  N   . GLU A  1  71  ? 21.053  -1.561  19.884   1.00 229.45 ? 71   GLU A N   1 
ATOM   514   C  CA  . GLU A  1  71  ? 20.763  -1.361  18.461   1.00 235.84 ? 71   GLU A CA  1 
ATOM   515   C  C   . GLU A  1  71  ? 20.344  -2.680  17.820   1.00 236.60 ? 71   GLU A C   1 
ATOM   516   O  O   . GLU A  1  71  ? 21.177  -3.472  17.371   1.00 243.76 ? 71   GLU A O   1 
ATOM   517   C  CB  . GLU A  1  71  ? 21.967  -0.782  17.733   1.00 259.05 ? 71   GLU A CB  1 
ATOM   518   C  CG  . GLU A  1  71  ? 21.675  -0.417  16.283   1.00 260.21 ? 71   GLU A CG  1 
ATOM   519   C  CD  . GLU A  1  71  ? 22.891  0.117   15.556   1.00 267.40 ? 71   GLU A CD  1 
ATOM   520   O  OE1 . GLU A  1  71  ? 23.983  0.139   16.164   1.00 249.13 ? 71   GLU A OE1 1 
ATOM   521   O  OE2 . GLU A  1  71  ? 22.756  0.501   14.374   1.00 269.99 ? 71   GLU A OE2 1 
ATOM   522   N  N   . PHE A  1  72  ? 19.032  -2.921  17.765   1.00 236.31 ? 72   PHE A N   1 
ATOM   523   C  CA  . PHE A  1  72  ? 18.502  -4.077  17.051   1.00 234.05 ? 72   PHE A CA  1 
ATOM   524   C  C   . PHE A  1  72  ? 18.301  -3.784  15.569   1.00 217.83 ? 72   PHE A C   1 
ATOM   525   O  O   . PHE A  1  72  ? 18.570  -4.644  14.722   1.00 219.66 ? 72   PHE A O   1 
ATOM   526   C  CB  . PHE A  1  72  ? 17.178  -4.526  17.677   1.00 209.77 ? 72   PHE A CB  1 
ATOM   527   C  CG  . PHE A  1  72  ? 17.343  -5.252  18.981   1.00 213.28 ? 72   PHE A CG  1 
ATOM   528   C  CD1 . PHE A  1  72  ? 17.591  -6.616  19.002   1.00 211.62 ? 72   PHE A CD1 1 
ATOM   529   C  CD2 . PHE A  1  72  ? 17.255  -4.573  20.184   1.00 210.51 ? 72   PHE A CD2 1 
ATOM   530   C  CE1 . PHE A  1  72  ? 17.747  -7.288  20.199   1.00 207.39 ? 72   PHE A CE1 1 
ATOM   531   C  CE2 . PHE A  1  72  ? 17.406  -5.241  21.386   1.00 206.00 ? 72   PHE A CE2 1 
ATOM   532   C  CZ  . PHE A  1  72  ? 17.656  -6.600  21.393   1.00 206.13 ? 72   PHE A CZ  1 
ATOM   533   N  N   . ASP A  1  73  ? 17.840  -2.578  15.245   1.00 218.79 ? 73   ASP A N   1 
ATOM   534   C  CA  . ASP A  1  73  ? 17.572  -2.200  13.860   1.00 224.46 ? 73   ASP A CA  1 
ATOM   535   C  C   . ASP A  1  73  ? 17.628  -0.685  13.751   1.00 231.30 ? 73   ASP A C   1 
ATOM   536   O  O   . ASP A  1  73  ? 16.908  0.012   14.474   1.00 233.76 ? 73   ASP A O   1 
ATOM   537   C  CB  . ASP A  1  73  ? 16.208  -2.731  13.411   1.00 225.40 ? 73   ASP A CB  1 
ATOM   538   C  CG  . ASP A  1  73  ? 15.805  -2.221  12.039   1.00 232.08 ? 73   ASP A CG  1 
ATOM   539   O  OD1 . ASP A  1  73  ? 16.676  -2.171  11.144   1.00 235.86 ? 73   ASP A OD1 1 
ATOM   540   O  OD2 . ASP A  1  73  ? 14.618  -1.871  11.854   1.00 239.61 ? 73   ASP A OD2 1 
ATOM   541   N  N   . ALA A  1  74  ? 18.482  -0.175  12.862   1.00 237.42 ? 74   ALA A N   1 
ATOM   542   C  CA  . ALA A  1  74  ? 18.616  1.260   12.637   1.00 245.48 ? 74   ALA A CA  1 
ATOM   543   C  C   . ALA A  1  74  ? 17.900  1.739   11.382   1.00 245.21 ? 74   ALA A C   1 
ATOM   544   O  O   . ALA A  1  74  ? 17.804  2.952   11.165   1.00 247.92 ? 74   ALA A O   1 
ATOM   545   C  CB  . ALA A  1  74  ? 20.099  1.649   12.553   1.00 253.13 ? 74   ALA A CB  1 
ATOM   546   N  N   . THR A  1  75  ? 17.419  0.825   10.547   1.00 239.44 ? 75   THR A N   1 
ATOM   547   C  CA  . THR A  1  75  ? 16.815  1.176   9.272    1.00 235.54 ? 75   THR A CA  1 
ATOM   548   C  C   . THR A  1  75  ? 15.351  1.578   9.441    1.00 227.41 ? 75   THR A C   1 
ATOM   549   O  O   . THR A  1  75  ? 14.702  1.286   10.448   1.00 228.67 ? 75   THR A O   1 
ATOM   550   C  CB  . THR A  1  75  ? 16.925  0.012   8.286    1.00 241.00 ? 75   THR A CB  1 
ATOM   551   O  OG1 . THR A  1  75  ? 16.040  -1.047  8.683    1.00 232.76 ? 75   THR A OG1 1 
ATOM   552   C  CG2 . THR A  1  75  ? 18.353  -0.515  8.249    1.00 260.45 ? 75   THR A CG2 1 
ATOM   553   N  N   . GLY A  1  76  ? 14.838  2.263   8.427    1.00 218.56 ? 76   GLY A N   1 
ATOM   554   C  CA  . GLY A  1  76  ? 13.442  2.643   8.356    1.00 220.78 ? 76   GLY A CA  1 
ATOM   555   C  C   . GLY A  1  76  ? 12.588  1.574   7.709    1.00 222.90 ? 76   GLY A C   1 
ATOM   556   O  O   . GLY A  1  76  ? 12.869  0.376   7.804    1.00 227.32 ? 76   GLY A O   1 
ATOM   557   N  N   . ASN A  1  77  ? 11.518  2.014   7.049    1.00 211.66 ? 77   ASN A N   1 
ATOM   558   C  CA  . ASN A  1  77  ? 10.604  1.107   6.361    1.00 214.81 ? 77   ASN A CA  1 
ATOM   559   C  C   . ASN A  1  77  ? 11.160  0.727   4.992    1.00 223.29 ? 77   ASN A C   1 
ATOM   560   O  O   . ASN A  1  77  ? 11.362  1.595   4.135    1.00 235.56 ? 77   ASN A O   1 
ATOM   561   C  CB  . ASN A  1  77  ? 9.228   1.751   6.211    1.00 221.32 ? 77   ASN A CB  1 
ATOM   562   C  CG  . ASN A  1  77  ? 8.546   1.992   7.543    1.00 218.79 ? 77   ASN A CG  1 
ATOM   563   O  OD1 . ASN A  1  77  ? 9.186   1.972   8.595    1.00 224.32 ? 77   ASN A OD1 1 
ATOM   564   N  ND2 . ASN A  1  77  ? 7.238   2.215   7.505    1.00 210.51 ? 77   ASN A ND2 1 
ATOM   565   N  N   . ARG A  1  78  ? 11.396  -0.566  4.780    1.00 223.62 ? 78   ARG A N   1 
ATOM   566   C  CA  . ARG A  1  78  ? 11.790  -1.039  3.460    1.00 240.12 ? 78   ARG A CA  1 
ATOM   567   C  C   . ARG A  1  78  ? 10.662  -0.827  2.456    1.00 245.45 ? 78   ARG A C   1 
ATOM   568   O  O   . ARG A  1  78  ? 9.477   -0.883  2.795    1.00 238.87 ? 78   ARG A O   1 
ATOM   569   C  CB  . ARG A  1  78  ? 12.181  -2.518  3.510    1.00 243.35 ? 78   ARG A CB  1 
ATOM   570   C  CG  . ARG A  1  78  ? 13.574  -2.779  4.075    1.00 245.34 ? 78   ARG A CG  1 
ATOM   571   C  CD  . ARG A  1  78  ? 13.827  -4.265  4.299    1.00 243.20 ? 78   ARG A CD  1 
ATOM   572   N  NE  . ARG A  1  78  ? 12.915  -4.843  5.282    1.00 242.55 ? 78   ARG A NE  1 
ATOM   573   C  CZ  . ARG A  1  78  ? 13.006  -6.083  5.753    1.00 234.05 ? 78   ARG A CZ  1 
ATOM   574   N  NH1 . ARG A  1  78  ? 13.971  -6.891  5.330    1.00 231.47 ? 78   ARG A NH1 1 
ATOM   575   N  NH2 . ARG A  1  78  ? 12.130  -6.519  6.648    1.00 234.76 ? 78   ARG A NH2 1 
ATOM   576   N  N   . ASP A  1  79  ? 11.046  -0.569  1.208    1.00 239.78 ? 79   ASP A N   1 
ATOM   577   C  CA  . ASP A  1  79  ? 10.103  -0.400  0.109    1.00 245.36 ? 79   ASP A CA  1 
ATOM   578   C  C   . ASP A  1  79  ? 9.964   -1.709  -0.660   1.00 246.98 ? 79   ASP A C   1 
ATOM   579   O  O   . ASP A  1  79  ? 10.968  -2.342  -1.004   1.00 249.19 ? 79   ASP A O   1 
ATOM   580   C  CB  . ASP A  1  79  ? 10.554  0.713   -0.843   1.00 254.74 ? 79   ASP A CB  1 
ATOM   581   C  CG  . ASP A  1  79  ? 10.135  2.099   -0.378   1.00 255.91 ? 79   ASP A CG  1 
ATOM   582   O  OD1 . ASP A  1  79  ? 8.971   2.268   0.044    1.00 258.71 ? 79   ASP A OD1 1 
ATOM   583   O  OD2 . ASP A  1  79  ? 10.965  3.029   -0.458   1.00 253.67 ? 79   ASP A OD2 1 
ATOM   584   N  N   . TYR A  1  80  ? 8.717   -2.117  -0.912   1.00 240.96 ? 80   TYR A N   1 
ATOM   585   C  CA  . TYR A  1  80  ? 8.478   -3.181  -1.880   1.00 245.60 ? 80   TYR A CA  1 
ATOM   586   C  C   . TYR A  1  80  ? 8.717   -2.679  -3.299   1.00 262.37 ? 80   TYR A C   1 
ATOM   587   O  O   . TYR A  1  80  ? 9.340   -3.369  -4.115   1.00 270.77 ? 80   TYR A O   1 
ATOM   588   C  CB  . TYR A  1  80  ? 7.056   -3.724  -1.728   1.00 244.19 ? 80   TYR A CB  1 
ATOM   589   C  CG  . TYR A  1  80  ? 6.637   -4.678  -2.827   1.00 252.05 ? 80   TYR A CG  1 
ATOM   590   C  CD1 . TYR A  1  80  ? 6.899   -6.039  -2.730   1.00 255.76 ? 80   TYR A CD1 1 
ATOM   591   C  CD2 . TYR A  1  80  ? 5.979   -4.216  -3.961   1.00 259.66 ? 80   TYR A CD2 1 
ATOM   592   C  CE1 . TYR A  1  80  ? 6.517   -6.912  -3.732   1.00 260.50 ? 80   TYR A CE1 1 
ATOM   593   C  CE2 . TYR A  1  80  ? 5.598   -5.079  -4.968   1.00 264.99 ? 80   TYR A CE2 1 
ATOM   594   C  CZ  . TYR A  1  80  ? 5.867   -6.426  -4.848   1.00 265.95 ? 80   TYR A CZ  1 
ATOM   595   O  OH  . TYR A  1  80  ? 5.485   -7.288  -5.850   1.00 271.12 ? 80   TYR A OH  1 
ATOM   596   N  N   . ALA A  1  81  ? 8.233   -1.478  -3.604   1.00 260.39 ? 81   ALA A N   1 
ATOM   597   C  CA  . ALA A  1  81  ? 8.484   -0.823  -4.878   1.00 264.49 ? 81   ALA A CA  1 
ATOM   598   C  C   . ALA A  1  81  ? 8.476   0.683   -4.646   1.00 261.91 ? 81   ALA A C   1 
ATOM   599   O  O   . ALA A  1  81  ? 8.283   1.158   -3.522   1.00 266.97 ? 81   ALA A O   1 
ATOM   600   C  CB  . ALA A  1  81  ? 7.453   -1.244  -5.929   1.00 258.74 ? 81   ALA A CB  1 
ATOM   601   N  N   . LYS A  1  82  ? 8.703   1.438   -5.720   1.00 243.16 ? 82   LYS A N   1 
ATOM   602   C  CA  . LYS A  1  82  ? 8.686   2.894   -5.629   1.00 239.50 ? 82   LYS A CA  1 
ATOM   603   C  C   . LYS A  1  82  ? 7.314   3.381   -5.171   1.00 242.64 ? 82   LYS A C   1 
ATOM   604   O  O   . LYS A  1  82  ? 6.286   3.005   -5.744   1.00 244.65 ? 82   LYS A O   1 
ATOM   605   C  CB  . LYS A  1  82  ? 9.050   3.506   -6.981   1.00 246.37 ? 82   LYS A CB  1 
ATOM   606   C  CG  . LYS A  1  82  ? 9.092   5.024   -6.990   1.00 248.89 ? 82   LYS A CG  1 
ATOM   607   C  CD  . LYS A  1  82  ? 9.331   5.561   -8.391   1.00 255.75 ? 82   LYS A CD  1 
ATOM   608   C  CE  . LYS A  1  82  ? 9.288   7.080   -8.415   1.00 258.42 ? 82   LYS A CE  1 
ATOM   609   N  NZ  . LYS A  1  82  ? 9.413   7.619   -9.798   1.00 265.15 ? 82   LYS A NZ  1 
ATOM   610   N  N   . ASP A  1  83  ? 7.303   4.202   -4.116   1.00 248.23 ? 83   ASP A N   1 
ATOM   611   C  CA  . ASP A  1  83  ? 6.086   4.727   -3.488   1.00 246.16 ? 83   ASP A CA  1 
ATOM   612   C  C   . ASP A  1  83  ? 5.187   3.621   -2.938   1.00 248.16 ? 83   ASP A C   1 
ATOM   613   O  O   . ASP A  1  83  ? 3.973   3.812   -2.798   1.00 241.24 ? 83   ASP A O   1 
ATOM   614   C  CB  . ASP A  1  83  ? 5.288   5.620   -4.449   1.00 244.05 ? 83   ASP A CB  1 
ATOM   615   C  CG  . ASP A  1  83  ? 6.094   6.799   -4.963   1.00 242.76 ? 83   ASP A CG  1 
ATOM   616   O  OD1 . ASP A  1  83  ? 6.249   7.790   -4.218   1.00 239.43 ? 83   ASP A OD1 1 
ATOM   617   O  OD2 . ASP A  1  83  ? 6.559   6.743   -6.120   1.00 255.94 ? 83   ASP A OD2 1 
ATOM   618   N  N   . ASP A  1  84  ? 5.764   2.466   -2.615   1.00 260.08 ? 84   ASP A N   1 
ATOM   619   C  CA  . ASP A  1  84  ? 5.014   1.312   -2.118   1.00 250.34 ? 84   ASP A CA  1 
ATOM   620   C  C   . ASP A  1  84  ? 5.762   0.705   -0.942   1.00 244.00 ? 84   ASP A C   1 
ATOM   621   O  O   . ASP A  1  84  ? 6.531   -0.251  -1.098   1.00 245.11 ? 84   ASP A O   1 
ATOM   622   C  CB  . ASP A  1  84  ? 4.800   0.280   -3.228   1.00 252.11 ? 84   ASP A CB  1 
ATOM   623   C  CG  . ASP A  1  84  ? 3.663   -0.672  -2.927   1.00 240.47 ? 84   ASP A CG  1 
ATOM   624   O  OD1 . ASP A  1  84  ? 2.736   -0.290  -2.183   1.00 227.47 ? 84   ASP A OD1 1 
ATOM   625   O  OD2 . ASP A  1  84  ? 3.696   -1.805  -3.447   1.00 243.20 ? 84   ASP A OD2 1 
ATOM   626   N  N   . PRO A  1  85  ? 5.573   1.253   0.260    1.00 234.96 ? 85   PRO A N   1 
ATOM   627   C  CA  . PRO A  1  85  ? 6.317   0.758   1.427    1.00 225.28 ? 85   PRO A CA  1 
ATOM   628   C  C   . PRO A  1  85  ? 5.974   -0.692  1.746    1.00 229.14 ? 85   PRO A C   1 
ATOM   629   O  O   . PRO A  1  85  ? 4.811   -1.097  1.706    1.00 227.69 ? 85   PRO A O   1 
ATOM   630   C  CB  . PRO A  1  85  ? 5.877   1.704   2.553    1.00 213.27 ? 85   PRO A CB  1 
ATOM   631   C  CG  . PRO A  1  85  ? 5.338   2.918   1.849    1.00 218.83 ? 85   PRO A CG  1 
ATOM   632   C  CD  . PRO A  1  85  ? 4.710   2.396   0.597    1.00 227.38 ? 85   PRO A CD  1 
ATOM   633   N  N   . LEU A  1  86  ? 7.008   -1.480  2.065    1.00 233.30 ? 86   LEU A N   1 
ATOM   634   C  CA  . LEU A  1  86  ? 6.810   -2.899  2.350    1.00 222.33 ? 86   LEU A CA  1 
ATOM   635   C  C   . LEU A  1  86  ? 6.359   -3.158  3.780    1.00 221.59 ? 86   LEU A C   1 
ATOM   636   O  O   . LEU A  1  86  ? 5.592   -4.097  4.023    1.00 220.23 ? 86   LEU A O   1 
ATOM   637   C  CB  . LEU A  1  86  ? 8.097   -3.680  2.080    1.00 218.03 ? 86   LEU A CB  1 
ATOM   638   C  CG  . LEU A  1  86  ? 8.053   -5.160  2.467    1.00 212.41 ? 86   LEU A CG  1 
ATOM   639   C  CD1 . LEU A  1  86  ? 7.290   -5.967  1.430    1.00 222.90 ? 86   LEU A CD1 1 
ATOM   640   C  CD2 . LEU A  1  86  ? 9.450   -5.712  2.668    1.00 211.54 ? 86   LEU A CD2 1 
ATOM   641   N  N   . GLU A  1  87  ? 6.823   -2.361  4.738    1.00 228.61 ? 87   GLU A N   1 
ATOM   642   C  CA  . GLU A  1  87  ? 6.541   -2.623  6.141    1.00 206.77 ? 87   GLU A CA  1 
ATOM   643   C  C   . GLU A  1  87  ? 6.245   -1.317  6.862    1.00 204.81 ? 87   GLU A C   1 
ATOM   644   O  O   . GLU A  1  87  ? 6.507   -0.224  6.355    1.00 220.95 ? 87   GLU A O   1 
ATOM   645   C  CB  . GLU A  1  87  ? 7.708   -3.349  6.810    1.00 202.55 ? 87   GLU A CB  1 
ATOM   646   C  CG  . GLU A  1  87  ? 9.037   -2.643  6.623    1.00 216.28 ? 87   GLU A CG  1 
ATOM   647   C  CD  . GLU A  1  87  ? 10.222  -3.521  6.969    1.00 222.56 ? 87   GLU A CD  1 
ATOM   648   O  OE1 . GLU A  1  87  ? 10.007  -4.683  7.376    1.00 221.14 ? 87   GLU A OE1 1 
ATOM   649   O  OE2 . GLU A  1  87  ? 11.370  -3.049  6.829    1.00 227.49 ? 87   GLU A OE2 1 
ATOM   650   N  N   . PHE A  1  88  ? 5.714   -1.446  8.078    1.00 200.31 ? 88   PHE A N   1 
ATOM   651   C  CA  . PHE A  1  88  ? 5.345   -0.294  8.903    1.00 198.38 ? 88   PHE A CA  1 
ATOM   652   C  C   . PHE A  1  88  ? 5.849   -0.561  10.316   1.00 183.71 ? 88   PHE A C   1 
ATOM   653   O  O   . PHE A  1  88  ? 5.192   -1.258  11.097   1.00 179.57 ? 88   PHE A O   1 
ATOM   654   C  CB  . PHE A  1  88  ? 3.840   -0.057  8.894    1.00 203.18 ? 88   PHE A CB  1 
ATOM   655   C  CG  . PHE A  1  88  ? 3.246   0.017   7.521    1.00 196.30 ? 88   PHE A CG  1 
ATOM   656   C  CD1 . PHE A  1  88  ? 2.820   -1.130  6.868    1.00 192.35 ? 88   PHE A CD1 1 
ATOM   657   C  CD2 . PHE A  1  88  ? 3.104   1.237   6.885    1.00 198.50 ? 88   PHE A CD2 1 
ATOM   658   C  CE1 . PHE A  1  88  ? 2.272   -1.060  5.601    1.00 200.13 ? 88   PHE A CE1 1 
ATOM   659   C  CE2 . PHE A  1  88  ? 2.555   1.316   5.620    1.00 205.93 ? 88   PHE A CE2 1 
ATOM   660   C  CZ  . PHE A  1  88  ? 2.138   0.166   4.977    1.00 206.93 ? 88   PHE A CZ  1 
ATOM   661   N  N   . LYS A  1  89  ? 6.999   0.015   10.645   1.00 186.60 ? 89   LYS A N   1 
ATOM   662   C  CA  . LYS A  1  89  ? 7.614   -0.191  11.946   1.00 189.31 ? 89   LYS A CA  1 
ATOM   663   C  C   . LYS A  1  89  ? 7.176   0.852   12.955   1.00 184.78 ? 89   LYS A C   1 
ATOM   664   O  O   . LYS A  1  89  ? 7.525   0.742   14.133   1.00 200.35 ? 89   LYS A O   1 
ATOM   665   C  CB  . LYS A  1  89  ? 9.144   -0.180  11.822   1.00 211.20 ? 89   LYS A CB  1 
ATOM   666   C  CG  . LYS A  1  89  ? 9.727   -1.394  11.106   1.00 215.60 ? 89   LYS A CG  1 
ATOM   667   C  CD  . LYS A  1  89  ? 11.219  -1.234  10.867   1.00 207.23 ? 89   LYS A CD  1 
ATOM   668   C  CE  . LYS A  1  89  ? 11.776  -2.403  10.082   1.00 200.40 ? 89   LYS A CE  1 
ATOM   669   N  NZ  . LYS A  1  89  ? 13.216  -2.204  9.772    1.00 209.94 ? 89   LYS A NZ  1 
ATOM   670   N  N   . SER A  1  90  ? 6.453   1.872   12.515   1.00 185.31 ? 90   SER A N   1 
ATOM   671   C  CA  . SER A  1  90  ? 5.906   2.851   13.437   1.00 183.71 ? 90   SER A CA  1 
ATOM   672   C  C   . SER A  1  90  ? 4.854   2.205   14.328   1.00 178.82 ? 90   SER A C   1 
ATOM   673   O  O   . SER A  1  90  ? 4.004   1.442   13.858   1.00 176.31 ? 90   SER A O   1 
ATOM   674   C  CB  . SER A  1  90  ? 5.298   4.022   12.668   1.00 191.50 ? 90   SER A CB  1 
ATOM   675   O  OG  . SER A  1  90  ? 6.306   4.765   12.008   1.00 198.21 ? 90   SER A OG  1 
ATOM   676   N  N   . HIS A  1  91  ? 4.929   2.504   15.628   1.00 178.66 ? 91   HIS A N   1 
ATOM   677   C  CA  . HIS A  1  91  ? 3.991   1.975   16.623   1.00 175.90 ? 91   HIS A CA  1 
ATOM   678   C  C   . HIS A  1  91  ? 3.967   0.449   16.627   1.00 171.79 ? 91   HIS A C   1 
ATOM   679   O  O   . HIS A  1  91  ? 2.923   -0.168  16.857   1.00 181.61 ? 91   HIS A O   1 
ATOM   680   C  CB  . HIS A  1  91  ? 2.577   2.524   16.408   1.00 194.94 ? 91   HIS A CB  1 
ATOM   681   C  CG  . HIS A  1  91  ? 2.512   4.016   16.283   1.00 208.62 ? 91   HIS A CG  1 
ATOM   682   N  ND1 . HIS A  1  91  ? 2.769   4.867   17.337   1.00 210.60 ? 91   HIS A ND1 1 
ATOM   683   C  CD2 . HIS A  1  91  ? 2.219   4.809   15.225   1.00 208.12 ? 91   HIS A CD2 1 
ATOM   684   C  CE1 . HIS A  1  91  ? 2.633   6.118   16.936   1.00 200.75 ? 91   HIS A CE1 1 
ATOM   685   N  NE2 . HIS A  1  91  ? 2.301   6.111   15.657   1.00 201.63 ? 91   HIS A NE2 1 
ATOM   686   N  N   . GLN A  1  92  ? 5.118   -0.174  16.378   1.00 172.81 ? 92   GLN A N   1 
ATOM   687   C  CA  . GLN A  1  92  ? 5.202   -1.626  16.309   1.00 171.04 ? 92   GLN A CA  1 
ATOM   688   C  C   . GLN A  1  92  ? 5.364   -2.274  17.672   1.00 168.93 ? 92   GLN A C   1 
ATOM   689   O  O   . GLN A  1  92  ? 5.321   -3.507  17.758   1.00 167.28 ? 92   GLN A O   1 
ATOM   690   C  CB  . GLN A  1  92  ? 6.364   -2.053  15.413   1.00 174.51 ? 92   GLN A CB  1 
ATOM   691   C  CG  . GLN A  1  92  ? 7.738   -1.824  16.019   1.00 177.53 ? 92   GLN A CG  1 
ATOM   692   C  CD  . GLN A  1  92  ? 8.854   -2.149  15.047   1.00 196.89 ? 92   GLN A CD  1 
ATOM   693   O  OE1 . GLN A  1  92  ? 8.641   -2.839  14.050   1.00 203.42 ? 92   GLN A OE1 1 
ATOM   694   N  NE2 . GLN A  1  92  ? 10.049  -1.647  15.328   1.00 202.48 ? 92   GLN A NE2 1 
ATOM   695   N  N   . TRP A  1  93  ? 5.583   -1.484  18.721   1.00 169.36 ? 93   TRP A N   1 
ATOM   696   C  CA  . TRP A  1  93  ? 5.684   -2.001  20.083   1.00 167.60 ? 93   TRP A CA  1 
ATOM   697   C  C   . TRP A  1  93  ? 6.846   -2.983  20.227   1.00 169.09 ? 93   TRP A C   1 
ATOM   698   O  O   . TRP A  1  93  ? 6.719   -4.033  20.863   1.00 167.03 ? 93   TRP A O   1 
ATOM   699   C  CB  . TRP A  1  93  ? 4.361   -2.635  20.518   1.00 163.36 ? 93   TRP A CB  1 
ATOM   700   C  CG  . TRP A  1  93  ? 3.363   -1.626  21.018   1.00 162.21 ? 93   TRP A CG  1 
ATOM   701   C  CD1 . TRP A  1  93  ? 2.773   -0.622  20.304   1.00 163.09 ? 93   TRP A CD1 1 
ATOM   702   C  CD2 . TRP A  1  93  ? 2.851   -1.524  22.350   1.00 160.42 ? 93   TRP A CD2 1 
ATOM   703   N  NE1 . TRP A  1  93  ? 1.928   0.096   21.112   1.00 162.04 ? 93   TRP A NE1 1 
ATOM   704   C  CE2 . TRP A  1  93  ? 1.960   -0.439  22.374   1.00 160.40 ? 93   TRP A CE2 1 
ATOM   705   C  CE3 . TRP A  1  93  ? 3.063   -2.249  23.528   1.00 159.14 ? 93   TRP A CE3 1 
ATOM   706   C  CZ2 . TRP A  1  93  ? 1.280   -0.063  23.528   1.00 167.75 ? 93   TRP A CZ2 1 
ATOM   707   C  CZ3 . TRP A  1  93  ? 2.392   -1.872  24.671   1.00 157.88 ? 93   TRP A CZ3 1 
ATOM   708   C  CH2 . TRP A  1  93  ? 1.510   -0.791  24.664   1.00 160.91 ? 93   TRP A CH2 1 
ATOM   709   N  N   . PHE A  1  94  ? 7.986   -2.641  19.620   1.00 206.50 ? 94   PHE A N   1 
ATOM   710   C  CA  . PHE A  1  94  ? 9.197   -3.437  19.773   1.00 175.36 ? 94   PHE A CA  1 
ATOM   711   C  C   . PHE A  1  94  ? 9.735   -3.312  21.193   1.00 175.76 ? 94   PHE A C   1 
ATOM   712   O  O   . PHE A  1  94  ? 10.034  -2.209  21.665   1.00 177.55 ? 94   PHE A O   1 
ATOM   713   C  CB  . PHE A  1  94  ? 10.264  -3.000  18.770   1.00 180.00 ? 94   PHE A CB  1 
ATOM   714   C  CG  . PHE A  1  94  ? 11.577  -3.710  18.942   1.00 183.13 ? 94   PHE A CG  1 
ATOM   715   C  CD1 . PHE A  1  94  ? 11.716  -5.036  18.564   1.00 182.82 ? 94   PHE A CD1 1 
ATOM   716   C  CD2 . PHE A  1  94  ? 12.667  -3.059  19.496   1.00 186.74 ? 94   PHE A CD2 1 
ATOM   717   C  CE1 . PHE A  1  94  ? 12.914  -5.697  18.728   1.00 186.11 ? 94   PHE A CE1 1 
ATOM   718   C  CE2 . PHE A  1  94  ? 13.869  -3.718  19.663   1.00 189.98 ? 94   PHE A CE2 1 
ATOM   719   C  CZ  . PHE A  1  94  ? 13.990  -5.039  19.278   1.00 189.68 ? 94   PHE A CZ  1 
ATOM   720   N  N   . GLY A  1  95  ? 9.922   -4.452  21.846   1.00 174.59 ? 95   GLY A N   1 
ATOM   721   C  CA  . GLY A  1  95  ? 10.255  -4.497  23.251   1.00 174.65 ? 95   GLY A CA  1 
ATOM   722   C  C   . GLY A  1  95  ? 9.087   -4.785  24.164   1.00 195.87 ? 95   GLY A C   1 
ATOM   723   O  O   . GLY A  1  95  ? 9.223   -4.626  25.383   1.00 200.68 ? 95   GLY A O   1 
ATOM   724   N  N   . ALA A  1  96  ? 7.949   -5.221  23.615   1.00 167.06 ? 96   ALA A N   1 
ATOM   725   C  CA  . ALA A  1  96  ? 6.801   -5.565  24.443   1.00 163.28 ? 96   ALA A CA  1 
ATOM   726   C  C   . ALA A  1  96  ? 7.034   -6.851  25.220   1.00 162.40 ? 96   ALA A C   1 
ATOM   727   O  O   . ALA A  1  96  ? 6.440   -7.045  26.286   1.00 175.35 ? 96   ALA A O   1 
ATOM   728   C  CB  . ALA A  1  96  ? 5.550   -5.692  23.575   1.00 188.44 ? 96   ALA A CB  1 
ATOM   729   N  N   . SER A  1  97  ? 7.876   -7.741  24.704   1.00 164.25 ? 97   SER A N   1 
ATOM   730   C  CA  . SER A  1  97  ? 8.278   -8.944  25.420   1.00 167.46 ? 97   SER A CA  1 
ATOM   731   C  C   . SER A  1  97  ? 9.761   -9.178  25.176   1.00 172.52 ? 97   SER A C   1 
ATOM   732   O  O   . SER A  1  97  ? 10.198  -9.253  24.024   1.00 174.74 ? 97   SER A O   1 
ATOM   733   C  CB  . SER A  1  97  ? 7.456   -10.158 24.974   1.00 174.80 ? 97   SER A CB  1 
ATOM   734   O  OG  . SER A  1  97  ? 7.752   -10.506 23.635   1.00 191.75 ? 97   SER A OG  1 
ATOM   735   N  N   . VAL A  1  98  ? 10.532  -9.292  26.256   1.00 170.39 ? 98   VAL A N   1 
ATOM   736   C  CA  . VAL A  1  98  ? 11.972  -9.509  26.181   1.00 174.92 ? 98   VAL A CA  1 
ATOM   737   C  C   . VAL A  1  98  ? 12.311  -10.785 26.937   1.00 184.62 ? 98   VAL A C   1 
ATOM   738   O  O   . VAL A  1  98  ? 11.902  -10.956 28.090   1.00 206.33 ? 98   VAL A O   1 
ATOM   739   C  CB  . VAL A  1  98  ? 12.760  -8.320  26.756   1.00 177.83 ? 98   VAL A CB  1 
ATOM   740   C  CG1 . VAL A  1  98  ? 14.255  -8.499  26.504   1.00 182.99 ? 98   VAL A CG1 1 
ATOM   741   C  CG2 . VAL A  1  98  ? 12.248  -7.004  26.174   1.00 187.02 ? 98   VAL A CG2 1 
ATOM   742   N  N   . ARG A  1  99  ? 13.060  -11.674 26.288   1.00 178.03 ? 99   ARG A N   1 
ATOM   743   C  CA  . ARG A  1  99  ? 13.471  -12.938 26.883   1.00 179.19 ? 99   ARG A CA  1 
ATOM   744   C  C   . ARG A  1  99  ? 14.924  -13.181 26.520   1.00 184.65 ? 99   ARG A C   1 
ATOM   745   O  O   . ARG A  1  99  ? 15.313  -12.997 25.363   1.00 186.74 ? 99   ARG A O   1 
ATOM   746   C  CB  . ARG A  1  99  ? 12.598  -14.103 26.400   1.00 188.83 ? 99   ARG A CB  1 
ATOM   747   C  CG  . ARG A  1  99  ? 11.227  -14.193 27.062   1.00 195.78 ? 99   ARG A CG  1 
ATOM   748   C  CD  . ARG A  1  99  ? 11.316  -14.231 28.584   1.00 205.19 ? 99   ARG A CD  1 
ATOM   749   N  NE  . ARG A  1  99  ? 10.995  -12.936 29.185   1.00 225.31 ? 99   ARG A NE  1 
ATOM   750   C  CZ  . ARG A  1  99  ? 9.775   -12.569 29.577   1.00 200.80 ? 99   ARG A CZ  1 
ATOM   751   N  NH1 . ARG A  1  99  ? 8.746   -13.394 29.430   1.00 188.13 ? 99   ARG A NH1 1 
ATOM   752   N  NH2 . ARG A  1  99  ? 9.579   -11.370 30.113   1.00 188.83 ? 99   ARG A NH2 1 
ATOM   753   N  N   . SER A  1  100 ? 15.719  -13.598 27.502   1.00 190.19 ? 100  SER A N   1 
ATOM   754   C  CA  . SER A  1  100 ? 17.158  -13.749 27.336   1.00 196.89 ? 100  SER A CA  1 
ATOM   755   C  C   . SER A  1  100 ? 17.620  -15.119 27.806   1.00 196.88 ? 100  SER A C   1 
ATOM   756   O  O   . SER A  1  100 ? 17.175  -15.617 28.845   1.00 208.23 ? 100  SER A O   1 
ATOM   757   C  CB  . SER A  1  100 ? 17.914  -12.670 28.107   1.00 195.59 ? 100  SER A CB  1 
ATOM   758   O  OG  . SER A  1  100 ? 19.291  -12.681 27.791   1.00 201.46 ? 100  SER A OG  1 
ATOM   759   N  N   . LYS A  1  101 ? 18.538  -15.712 27.046   1.00 200.05 ? 101  LYS A N   1 
ATOM   760   C  CA  . LYS A  1  101 ? 19.129  -17.002 27.389   1.00 203.18 ? 101  LYS A CA  1 
ATOM   761   C  C   . LYS A  1  101 ? 20.628  -16.907 27.146   1.00 220.02 ? 101  LYS A C   1 
ATOM   762   O  O   . LYS A  1  101 ? 21.073  -16.894 25.995   1.00 233.40 ? 101  LYS A O   1 
ATOM   763   C  CB  . LYS A  1  101 ? 18.509  -18.129 26.567   1.00 201.83 ? 101  LYS A CB  1 
ATOM   764   C  CG  . LYS A  1  101 ? 19.095  -19.498 26.848   1.00 212.41 ? 101  LYS A CG  1 
ATOM   765   C  CD  . LYS A  1  101 ? 18.505  -20.552 25.929   1.00 204.64 ? 101  LYS A CD  1 
ATOM   766   C  CE  . LYS A  1  101 ? 19.047  -21.933 26.260   1.00 219.66 ? 101  LYS A CE  1 
ATOM   767   N  NZ  . LYS A  1  101 ? 20.525  -22.015 26.089   1.00 237.00 ? 101  LYS A NZ  1 
ATOM   768   N  N   . GLN A  1  102 ? 21.401  -16.844 28.229   1.00 212.39 ? 102  GLN A N   1 
ATOM   769   C  CA  . GLN A  1  102 ? 22.861  -16.728 28.185   1.00 219.20 ? 102  GLN A CA  1 
ATOM   770   C  C   . GLN A  1  102 ? 23.222  -15.440 27.458   1.00 220.48 ? 102  GLN A C   1 
ATOM   771   O  O   . GLN A  1  102 ? 22.792  -14.359 27.896   1.00 217.67 ? 102  GLN A O   1 
ATOM   772   C  CB  . GLN A  1  102 ? 23.448  -17.982 27.541   1.00 223.39 ? 102  GLN A CB  1 
ATOM   773   C  CG  . GLN A  1  102 ? 23.064  -19.301 28.139   1.00 222.46 ? 102  GLN A CG  1 
ATOM   774   C  CD  . GLN A  1  102 ? 23.370  -20.427 27.177   1.00 225.79 ? 102  GLN A CD  1 
ATOM   775   O  OE1 . GLN A  1  102 ? 23.962  -20.206 26.120   1.00 229.23 ? 102  GLN A OE1 1 
ATOM   776   N  NE2 . GLN A  1  102 ? 22.989  -21.640 27.541   1.00 227.78 ? 102  GLN A NE2 1 
ATOM   777   N  N   . ASP A  1  103 ? 23.964  -15.502 26.355   1.00 241.92 ? 103  ASP A N   1 
ATOM   778   C  CA  . ASP A  1  103 ? 24.365  -14.347 25.572   1.00 246.52 ? 103  ASP A CA  1 
ATOM   779   C  C   . ASP A  1  103 ? 23.384  -14.050 24.449   1.00 222.58 ? 103  ASP A C   1 
ATOM   780   O  O   . ASP A  1  103 ? 23.707  -13.282 23.538   1.00 224.63 ? 103  ASP A O   1 
ATOM   781   C  CB  . ASP A  1  103 ? 25.784  -14.561 25.021   1.00 236.45 ? 103  ASP A CB  1 
ATOM   782   C  CG  . ASP A  1  103 ? 25.872  -15.718 24.038   1.00 236.46 ? 103  ASP A CG  1 
ATOM   783   O  OD1 . ASP A  1  103 ? 25.101  -16.689 24.189   1.00 247.47 ? 103  ASP A OD1 1 
ATOM   784   O  OD2 . ASP A  1  103 ? 26.732  -15.672 23.130   1.00 241.84 ? 103  ASP A OD2 1 
ATOM   785   N  N   . LYS A  1  104 ? 22.188  -14.623 24.511   1.00 217.08 ? 104  LYS A N   1 
ATOM   786   C  CA  . LYS A  1  104 ? 21.154  -14.420 23.509   1.00 221.59 ? 104  LYS A CA  1 
ATOM   787   C  C   . LYS A  1  104 ? 20.093  -13.490 24.081   1.00 226.89 ? 104  LYS A C   1 
ATOM   788   O  O   . LYS A  1  104 ? 19.623  -13.693 25.206   1.00 233.64 ? 104  LYS A O   1 
ATOM   789   C  CB  . LYS A  1  104 ? 20.528  -15.757 23.111   1.00 218.00 ? 104  LYS A CB  1 
ATOM   790   C  CG  . LYS A  1  104 ? 21.542  -16.816 22.685   1.00 217.16 ? 104  LYS A CG  1 
ATOM   791   C  CD  . LYS A  1  104 ? 20.869  -18.167 22.483   1.00 215.45 ? 104  LYS A CD  1 
ATOM   792   C  CE  . LYS A  1  104 ? 21.863  -19.235 22.068   1.00 221.67 ? 104  LYS A CE  1 
ATOM   793   N  NZ  . LYS A  1  104 ? 22.472  -18.921 20.751   1.00 236.68 ? 104  LYS A NZ  1 
ATOM   794   N  N   . ILE A  1  105 ? 19.702  -12.489 23.300   1.00 213.30 ? 105  ILE A N   1 
ATOM   795   C  CA  . ILE A  1  105 ? 18.646  -11.561 23.679   1.00 201.11 ? 105  ILE A CA  1 
ATOM   796   C  C   . ILE A  1  105 ? 17.613  -11.569 22.567   1.00 197.79 ? 105  ILE A C   1 
ATOM   797   O  O   . ILE A  1  105 ? 17.943  -11.289 21.408   1.00 200.26 ? 105  ILE A O   1 
ATOM   798   C  CB  . ILE A  1  105 ? 19.175  -10.138 23.919   1.00 203.19 ? 105  ILE A CB  1 
ATOM   799   C  CG1 . ILE A  1  105 ? 20.228  -10.138 25.029   1.00 213.85 ? 105  ILE A CG1 1 
ATOM   800   C  CG2 . ILE A  1  105 ? 18.030  -9.200  24.260   1.00 198.36 ? 105  ILE A CG2 1 
ATOM   801   C  CD1 . ILE A  1  105 ? 20.788  -8.770  25.340   1.00 209.79 ? 105  ILE A CD1 1 
ATOM   802   N  N   . LEU A  1  106 ? 16.375  -11.908 22.913   1.00 194.71 ? 106  LEU A N   1 
ATOM   803   C  CA  . LEU A  1  106 ? 15.277  -11.970 21.959   1.00 189.19 ? 106  LEU A CA  1 
ATOM   804   C  C   . LEU A  1  106 ? 14.244  -10.905 22.312   1.00 185.03 ? 106  LEU A C   1 
ATOM   805   O  O   . LEU A  1  106 ? 13.705  -10.900 23.425   1.00 182.16 ? 106  LEU A O   1 
ATOM   806   C  CB  . LEU A  1  106 ? 14.656  -13.367 21.947   1.00 187.09 ? 106  LEU A CB  1 
ATOM   807   C  CG  . LEU A  1  106 ? 13.460  -13.605 21.029   1.00 183.70 ? 106  LEU A CG  1 
ATOM   808   C  CD1 . LEU A  1  106 ? 13.882  -13.477 19.576   1.00 186.88 ? 106  LEU A CD1 1 
ATOM   809   C  CD2 . LEU A  1  106 ? 12.853  -14.974 21.294   1.00 181.72 ? 106  LEU A CD2 1 
ATOM   810   N  N   . ALA A  1  107 ? 13.998  -9.989  21.376   1.00 190.24 ? 107  ALA A N   1 
ATOM   811   C  CA  . ALA A  1  107 ? 12.972  -8.967  21.523   1.00 181.66 ? 107  ALA A CA  1 
ATOM   812   C  C   . ALA A  1  107 ? 12.051  -8.996  20.311   1.00 179.74 ? 107  ALA A C   1 
ATOM   813   O  O   . ALA A  1  107 ? 12.475  -9.329  19.201   1.00 182.31 ? 107  ALA A O   1 
ATOM   814   C  CB  . ALA A  1  107 ? 13.590  -7.574  21.688   1.00 184.24 ? 107  ALA A CB  1 
ATOM   815   N  N   . CYS A  1  108 ? 10.789  -8.623  20.526   1.00 175.55 ? 108  CYS A N   1 
ATOM   816   C  CA  . CYS A  1  108 ? 9.764   -8.753  19.498   1.00 184.74 ? 108  CYS A CA  1 
ATOM   817   C  C   . CYS A  1  108 ? 8.903   -7.499  19.417   1.00 171.55 ? 108  CYS A C   1 
ATOM   818   O  O   . CYS A  1  108 ? 8.805   -6.714  20.363   1.00 177.85 ? 108  CYS A O   1 
ATOM   819   C  CB  . CYS A  1  108 ? 8.864   -9.964  19.747   1.00 189.09 ? 108  CYS A CB  1 
ATOM   820   S  SG  . CYS A  1  108 ? 9.715   -11.541 19.649   1.00 224.81 ? 108  CYS A SG  1 
ATOM   821   N  N   . ALA A  1  109 ? 8.251   -7.343  18.263   1.00 171.09 ? 109  ALA A N   1 
ATOM   822   C  CA  . ALA A  1  109 ? 7.368   -6.214  17.979   1.00 169.72 ? 109  ALA A CA  1 
ATOM   823   C  C   . ALA A  1  109 ? 5.993   -6.764  17.627   1.00 166.17 ? 109  ALA A C   1 
ATOM   824   O  O   . ALA A  1  109 ? 5.705   -7.045  16.453   1.00 166.78 ? 109  ALA A O   1 
ATOM   825   C  CB  . ALA A  1  109 ? 7.922   -5.346  16.853   1.00 175.26 ? 109  ALA A CB  1 
ATOM   826   N  N   . PRO A  1  110 ? 5.124   -6.961  18.619   1.00 162.71 ? 110  PRO A N   1 
ATOM   827   C  CA  . PRO A  1  110 ? 3.809   -7.567  18.346   1.00 175.91 ? 110  PRO A CA  1 
ATOM   828   C  C   . PRO A  1  110 ? 2.905   -6.725  17.459   1.00 186.18 ? 110  PRO A C   1 
ATOM   829   O  O   . PRO A  1  110 ? 2.055   -7.287  16.758   1.00 173.97 ? 110  PRO A O   1 
ATOM   830   C  CB  . PRO A  1  110 ? 3.214   -7.750  19.752   1.00 166.94 ? 110  PRO A CB  1 
ATOM   831   C  CG  . PRO A  1  110 ? 4.414   -7.805  20.658   1.00 177.21 ? 110  PRO A CG  1 
ATOM   832   C  CD  . PRO A  1  110 ? 5.404   -6.852  20.058   1.00 165.53 ? 110  PRO A CD  1 
ATOM   833   N  N   . LEU A  1  111 ? 3.050   -5.399  17.464   1.00 186.94 ? 111  LEU A N   1 
ATOM   834   C  CA  . LEU A  1  111 ? 2.218   -4.530  16.642   1.00 162.48 ? 111  LEU A CA  1 
ATOM   835   C  C   . LEU A  1  111 ? 2.907   -4.124  15.345   1.00 176.03 ? 111  LEU A C   1 
ATOM   836   O  O   . LEU A  1  111 ? 2.524   -3.122  14.728   1.00 182.22 ? 111  LEU A O   1 
ATOM   837   C  CB  . LEU A  1  111 ? 1.790   -3.296  17.432   1.00 160.29 ? 111  LEU A CB  1 
ATOM   838   C  CG  . LEU A  1  111 ? 0.557   -3.568  18.285   1.00 156.75 ? 111  LEU A CG  1 
ATOM   839   C  CD1 . LEU A  1  111 ? 0.201   -2.354  19.109   1.00 169.06 ? 111  LEU A CD1 1 
ATOM   840   C  CD2 . LEU A  1  111 ? -0.610  -3.978  17.402   1.00 158.93 ? 111  LEU A CD2 1 
ATOM   841   N  N   . TYR A  1  112 ? 3.930   -4.869  14.938   1.00 188.58 ? 112  TYR A N   1 
ATOM   842   C  CA  . TYR A  1  112 ? 4.522   -4.698  13.621   1.00 172.96 ? 112  TYR A CA  1 
ATOM   843   C  C   . TYR A  1  112 ? 3.537   -5.138  12.547   1.00 169.07 ? 112  TYR A C   1 
ATOM   844   O  O   . TYR A  1  112 ? 3.037   -6.266  12.569   1.00 167.05 ? 112  TYR A O   1 
ATOM   845   C  CB  . TYR A  1  112 ? 5.819   -5.506  13.535   1.00 172.55 ? 112  TYR A CB  1 
ATOM   846   C  CG  . TYR A  1  112 ? 6.347   -5.761  12.141   1.00 176.12 ? 112  TYR A CG  1 
ATOM   847   C  CD1 . TYR A  1  112 ? 7.176   -4.844  11.508   1.00 193.27 ? 112  TYR A CD1 1 
ATOM   848   C  CD2 . TYR A  1  112 ? 6.045   -6.941  11.472   1.00 175.84 ? 112  TYR A CD2 1 
ATOM   849   C  CE1 . TYR A  1  112 ? 7.671   -5.086  10.239   1.00 201.01 ? 112  TYR A CE1 1 
ATOM   850   C  CE2 . TYR A  1  112 ? 6.532   -7.190  10.207   1.00 183.28 ? 112  TYR A CE2 1 
ATOM   851   C  CZ  . TYR A  1  112 ? 7.345   -6.262  9.595    1.00 191.47 ? 112  TYR A CZ  1 
ATOM   852   O  OH  . TYR A  1  112 ? 7.832   -6.515  8.334    1.00 196.96 ? 112  TYR A OH  1 
ATOM   853   N  N   . HIS A  1  113 ? 3.267   -4.249  11.601   1.00 170.93 ? 113  HIS A N   1 
ATOM   854   C  CA  . HIS A  1  113 ? 2.401   -4.548  10.474   1.00 170.90 ? 113  HIS A CA  1 
ATOM   855   C  C   . HIS A  1  113 ? 3.265   -4.754  9.242    1.00 185.31 ? 113  HIS A C   1 
ATOM   856   O  O   . HIS A  1  113 ? 4.337   -4.158  9.112    1.00 214.52 ? 113  HIS A O   1 
ATOM   857   C  CB  . HIS A  1  113 ? 1.385   -3.429  10.226   1.00 176.28 ? 113  HIS A CB  1 
ATOM   858   C  CG  . HIS A  1  113 ? 0.435   -3.207  11.365   1.00 186.14 ? 113  HIS A CG  1 
ATOM   859   N  ND1 . HIS A  1  113 ? 0.835   -2.670  12.570   1.00 181.50 ? 113  HIS A ND1 1 
ATOM   860   C  CD2 . HIS A  1  113 ? -0.894  -3.445  11.481   1.00 168.01 ? 113  HIS A CD2 1 
ATOM   861   C  CE1 . HIS A  1  113 ? -0.206  -2.592  13.381   1.00 164.14 ? 113  HIS A CE1 1 
ATOM   862   N  NE2 . HIS A  1  113 ? -1.267  -3.057  12.745   1.00 161.72 ? 113  HIS A NE2 1 
ATOM   863   N  N   . TRP A  1  114 ? 2.789   -5.593  8.327    1.00 181.81 ? 114  TRP A N   1 
ATOM   864   C  CA  . TRP A  1  114 ? 3.552   -5.878  7.121    1.00 204.03 ? 114  TRP A CA  1 
ATOM   865   C  C   . TRP A  1  114 ? 2.616   -5.974  5.927    1.00 189.65 ? 114  TRP A C   1 
ATOM   866   O  O   . TRP A  1  114 ? 1.539   -6.576  6.007    1.00 185.38 ? 114  TRP A O   1 
ATOM   867   C  CB  . TRP A  1  114 ? 4.375   -7.167  7.282    1.00 228.13 ? 114  TRP A CB  1 
ATOM   868   C  CG  . TRP A  1  114 ? 4.619   -7.947  6.007    1.00 236.32 ? 114  TRP A CG  1 
ATOM   869   C  CD1 . TRP A  1  114 ? 5.650   -7.778  5.125    1.00 240.48 ? 114  TRP A CD1 1 
ATOM   870   C  CD2 . TRP A  1  114 ? 3.841   -9.044  5.503    1.00 230.52 ? 114  TRP A CD2 1 
ATOM   871   N  NE1 . TRP A  1  114 ? 5.550   -8.684  4.096    1.00 239.34 ? 114  TRP A NE1 1 
ATOM   872   C  CE2 . TRP A  1  114 ? 4.450   -9.474  4.306    1.00 242.13 ? 114  TRP A CE2 1 
ATOM   873   C  CE3 . TRP A  1  114 ? 2.684   -9.697  5.942    1.00 211.29 ? 114  TRP A CE3 1 
ATOM   874   C  CZ2 . TRP A  1  114 ? 3.941   -10.524 3.544    1.00 244.25 ? 114  TRP A CZ2 1 
ATOM   875   C  CZ3 . TRP A  1  114 ? 2.182   -10.740 5.185    1.00 209.11 ? 114  TRP A CZ3 1 
ATOM   876   C  CH2 . TRP A  1  114 ? 2.809   -11.142 4.000    1.00 230.46 ? 114  TRP A CH2 1 
ATOM   877   N  N   . ARG A  1  115 ? 3.032   -5.350  4.827    1.00 184.25 ? 115  ARG A N   1 
ATOM   878   C  CA  . ARG A  1  115 ? 2.215   -5.281  3.626    1.00 189.71 ? 115  ARG A CA  1 
ATOM   879   C  C   . ARG A  1  115 ? 2.393   -6.559  2.825    1.00 199.96 ? 115  ARG A C   1 
ATOM   880   O  O   . ARG A  1  115 ? 3.501   -7.100  2.738    1.00 219.91 ? 115  ARG A O   1 
ATOM   881   C  CB  . ARG A  1  115 ? 2.613   -4.070  2.781    1.00 198.79 ? 115  ARG A CB  1 
ATOM   882   C  CG  . ARG A  1  115 ? 2.018   -4.062  1.387    1.00 211.37 ? 115  ARG A CG  1 
ATOM   883   C  CD  . ARG A  1  115 ? 2.828   -3.151  0.476    1.00 224.40 ? 115  ARG A CD  1 
ATOM   884   N  NE  . ARG A  1  115 ? 2.325   -3.131  -0.893   1.00 238.67 ? 115  ARG A NE  1 
ATOM   885   C  CZ  . ARG A  1  115 ? 2.618   -4.051  -1.806   1.00 257.78 ? 115  ARG A CZ  1 
ATOM   886   N  NH1 . ARG A  1  115 ? 3.411   -5.065  -1.494   1.00 269.22 ? 115  ARG A NH1 1 
ATOM   887   N  NH2 . ARG A  1  115 ? 2.119   -3.963  -3.031   1.00 264.02 ? 115  ARG A NH2 1 
ATOM   888   N  N   . THR A  1  116 ? 1.296   -7.054  2.260    1.00 194.64 ? 116  THR A N   1 
ATOM   889   C  CA  . THR A  1  116 ? 1.345   -8.352  1.612    1.00 202.91 ? 116  THR A CA  1 
ATOM   890   C  C   . THR A  1  116 ? 2.237   -8.258  0.380    1.00 223.62 ? 116  THR A C   1 
ATOM   891   O  O   . THR A  1  116 ? 2.421   -7.184  -0.195   1.00 239.86 ? 116  THR A O   1 
ATOM   892   C  CB  . THR A  1  116 ? -0.072  -8.795  1.212    1.00 202.52 ? 116  THR A CB  1 
ATOM   893   O  OG1 . THR A  1  116 ? -0.914  -8.781  2.374    1.00 199.88 ? 116  THR A OG1 1 
ATOM   894   C  CG2 . THR A  1  116 ? -0.084  -10.199 0.639    1.00 210.97 ? 116  THR A CG2 1 
ATOM   895   N  N   . GLU A  1  117 ? 2.775   -9.395  -0.042   1.00 204.83 ? 117  GLU A N   1 
ATOM   896   C  CA  . GLU A  1  117 ? 3.654   -9.437  -1.199   1.00 201.76 ? 117  GLU A CA  1 
ATOM   897   C  C   . GLU A  1  117 ? 2.873   -9.754  -2.460   1.00 210.15 ? 117  GLU A C   1 
ATOM   898   O  O   . GLU A  1  117 ? 3.447   -9.843  -3.551   1.00 223.31 ? 117  GLU A O   1 
ATOM   899   C  CB  . GLU A  1  117 ? 4.766   -10.466 -0.967   1.00 203.85 ? 117  GLU A CB  1 
ATOM   900   C  CG  . GLU A  1  117 ? 6.008   -10.235 -1.797   1.00 215.55 ? 117  GLU A CG  1 
ATOM   901   C  CD  . GLU A  1  117 ? 7.123   -11.187 -1.437   1.00 213.80 ? 117  GLU A CD  1 
ATOM   902   O  OE1 . GLU A  1  117 ? 6.889   -12.089 -0.604   1.00 208.94 ? 117  GLU A OE1 1 
ATOM   903   O  OE2 . GLU A  1  117 ? 8.243   -11.006 -1.957   1.00 230.77 ? 117  GLU A OE2 1 
ATOM   904   N  N   . MET A  1  118 ? 1.568   -9.931  -2.313   1.00 232.47 ? 118  MET A N   1 
ATOM   905   C  CA  . MET A  1  118 ? 0.617   -10.153 -3.386   1.00 233.79 ? 118  MET A CA  1 
ATOM   906   C  C   . MET A  1  118 ? -0.179  -8.895  -3.700   1.00 231.98 ? 118  MET A C   1 
ATOM   907   O  O   . MET A  1  118 ? -0.474  -8.629  -4.870   1.00 240.54 ? 118  MET A O   1 
ATOM   908   C  CB  . MET A  1  118 ? -0.326  -11.299 -3.004   1.00 241.39 ? 118  MET A CB  1 
ATOM   909   C  CG  . MET A  1  118 ? 0.361   -12.667 -2.974   1.00 248.52 ? 118  MET A CG  1 
ATOM   910   S  SD  . MET A  1  118 ? -0.525  -13.881 -1.967   1.00 256.73 ? 118  MET A SD  1 
ATOM   911   C  CE  . MET A  1  118 ? 0.636   -15.246 -1.941   1.00 244.47 ? 118  MET A CE  1 
ATOM   912   N  N   . LYS A  1  119 ? -0.526  -8.111  -2.678   1.00 232.26 ? 119  LYS A N   1 
ATOM   913   C  CA  . LYS A  1  119 ? -1.262  -6.864  -2.848   1.00 226.72 ? 119  LYS A CA  1 
ATOM   914   C  C   . LYS A  1  119 ? -0.891  -5.911  -1.716   1.00 216.93 ? 119  LYS A C   1 
ATOM   915   O  O   . LYS A  1  119 ? -0.089  -6.237  -0.836   1.00 213.69 ? 119  LYS A O   1 
ATOM   916   C  CB  . LYS A  1  119 ? -2.769  -7.118  -2.896   1.00 227.71 ? 119  LYS A CB  1 
ATOM   917   C  CG  . LYS A  1  119 ? -3.218  -8.310  -2.073   1.00 229.18 ? 119  LYS A CG  1 
ATOM   918   C  CD  . LYS A  1  119 ? -4.657  -8.688  -2.377   1.00 235.63 ? 119  LYS A CD  1 
ATOM   919   C  CE  . LYS A  1  119 ? -4.995  -10.043 -1.772   1.00 235.08 ? 119  LYS A CE  1 
ATOM   920   N  NZ  . LYS A  1  119 ? -4.165  -11.134 -2.359   1.00 240.82 ? 119  LYS A NZ  1 
ATOM   921   N  N   . GLN A  1  120 ? -1.492  -4.720  -1.738   1.00 208.15 ? 120  GLN A N   1 
ATOM   922   C  CA  . GLN A  1  120 ? -1.164  -3.650  -0.790   1.00 200.03 ? 120  GLN A CA  1 
ATOM   923   C  C   . GLN A  1  120 ? -2.054  -3.759  0.445    1.00 196.56 ? 120  GLN A C   1 
ATOM   924   O  O   . GLN A  1  120 ? -3.121  -3.152  0.524    1.00 186.39 ? 120  GLN A O   1 
ATOM   925   C  CB  . GLN A  1  120 ? -1.315  -2.288  -1.451   1.00 203.36 ? 120  GLN A CB  1 
ATOM   926   C  CG  . GLN A  1  120 ? -0.250  -1.962  -2.485   1.00 217.70 ? 120  GLN A CG  1 
ATOM   927   C  CD  . GLN A  1  120 ? -0.552  -0.688  -3.243   1.00 221.41 ? 120  GLN A CD  1 
ATOM   928   O  OE1 . GLN A  1  120 ? -1.366  0.122   -2.806   1.00 218.89 ? 120  GLN A OE1 1 
ATOM   929   N  NE2 . GLN A  1  120 ? 0.115   -0.496  -4.377   1.00 233.66 ? 120  GLN A NE2 1 
ATOM   930   N  N   . GLU A  1  121 ? -1.609  -4.539  1.430    1.00 210.27 ? 121  GLU A N   1 
ATOM   931   C  CA  . GLU A  1  121 ? -2.284  -4.636  2.719    1.00 208.33 ? 121  GLU A CA  1 
ATOM   932   C  C   . GLU A  1  121 ? -1.411  -4.046  3.824    1.00 197.11 ? 121  GLU A C   1 
ATOM   933   O  O   . GLU A  1  121 ? -0.331  -3.501  3.581    1.00 192.30 ? 121  GLU A O   1 
ATOM   934   C  CB  . GLU A  1  121 ? -2.656  -6.085  3.038    1.00 205.98 ? 121  GLU A CB  1 
ATOM   935   C  CG  . GLU A  1  121 ? -3.632  -6.718  2.061    1.00 198.12 ? 121  GLU A CG  1 
ATOM   936   C  CD  . GLU A  1  121 ? -5.014  -6.100  2.159    1.00 187.91 ? 121  GLU A CD  1 
ATOM   937   O  OE1 . GLU A  1  121 ? -5.799  -6.231  1.196    1.00 190.61 ? 121  GLU A OE1 1 
ATOM   938   O  OE2 . GLU A  1  121 ? -5.315  -5.477  3.199    1.00 176.94 ? 121  GLU A OE2 1 
ATOM   939   N  N   . ARG A  1  122 ? -1.908  -4.153  5.066    1.00 200.83 ? 122  ARG A N   1 
ATOM   940   C  CA  . ARG A  1  122 ? -1.195  -3.697  6.262    1.00 194.06 ? 122  ARG A CA  1 
ATOM   941   C  C   . ARG A  1  122 ? -1.575  -4.671  7.379    1.00 194.62 ? 122  ARG A C   1 
ATOM   942   O  O   . ARG A  1  122 ? -2.444  -4.408  8.216    1.00 185.34 ? 122  ARG A O   1 
ATOM   943   C  CB  . ARG A  1  122 ? -1.538  -2.251  6.625    1.00 192.38 ? 122  ARG A CB  1 
ATOM   944   C  CG  . ARG A  1  122 ? -0.658  -1.644  7.715    1.00 192.65 ? 122  ARG A CG  1 
ATOM   945   C  CD  . ARG A  1  122 ? -0.824  -0.126  7.788    1.00 194.31 ? 122  ARG A CD  1 
ATOM   946   N  NE  . ARG A  1  122 ? 0.200   0.507   8.616    1.00 202.12 ? 122  ARG A NE  1 
ATOM   947   C  CZ  . ARG A  1  122 ? 0.081   0.730   9.921    1.00 199.25 ? 122  ARG A CZ  1 
ATOM   948   N  NH1 . ARG A  1  122 ? -1.028  0.376   10.559   1.00 176.46 ? 122  ARG A NH1 1 
ATOM   949   N  NH2 . ARG A  1  122 ? 1.072   1.307   10.589   1.00 204.07 ? 122  ARG A NH2 1 
ATOM   950   N  N   . GLU A  1  123 ? -0.906  -5.819  7.386    1.00 185.01 ? 123  GLU A N   1 
ATOM   951   C  CA  . GLU A  1  123 ? -1.310  -6.916  8.242    1.00 173.99 ? 123  GLU A CA  1 
ATOM   952   C  C   . GLU A  1  123 ? -0.316  -7.112  9.371    1.00 175.47 ? 123  GLU A C   1 
ATOM   953   O  O   . GLU A  1  123 ? 0.886   -7.271  9.117    1.00 185.73 ? 123  GLU A O   1 
ATOM   954   C  CB  . GLU A  1  123 ? -1.437  -8.204  7.428    1.00 181.18 ? 123  GLU A CB  1 
ATOM   955   C  CG  . GLU A  1  123 ? -2.464  -8.103  6.318    1.00 201.71 ? 123  GLU A CG  1 
ATOM   956   C  CD  . GLU A  1  123 ? -2.664  -9.410  5.578    1.00 201.15 ? 123  GLU A CD  1 
ATOM   957   O  OE1 . GLU A  1  123 ? -3.615  -9.489  4.770    1.00 207.42 ? 123  GLU A OE1 1 
ATOM   958   O  OE2 . GLU A  1  123 ? -1.881  -10.357 5.813    1.00 187.02 ? 123  GLU A OE2 1 
ATOM   959   N  N   . PRO A  1  124 ? -0.772  -7.102  10.609   1.00 172.86 ? 124  PRO A N   1 
ATOM   960   C  CA  . PRO A  1  124 ? 0.128   -7.218  11.780   1.00 169.78 ? 124  PRO A CA  1 
ATOM   961   C  C   . PRO A  1  124 ? 0.652   -8.630  12.040   1.00 167.99 ? 124  PRO A C   1 
ATOM   962   O  O   . PRO A  1  124 ? 0.197   -9.358  12.917   1.00 172.97 ? 124  PRO A O   1 
ATOM   963   C  CB  . PRO A  1  124 ? -0.755  -6.719  12.926   1.00 158.71 ? 124  PRO A CB  1 
ATOM   964   C  CG  . PRO A  1  124 ? -2.144  -7.032  12.496   1.00 156.96 ? 124  PRO A CG  1 
ATOM   965   C  CD  . PRO A  1  124 ? -2.172  -6.870  11.003   1.00 161.49 ? 124  PRO A CD  1 
ATOM   966   N  N   . VAL A  1  125 ? 1.656   -9.035  11.254   1.00 165.01 ? 125  VAL A N   1 
ATOM   967   C  CA  . VAL A  1  125 ? 2.222   -10.376 11.394   1.00 165.57 ? 125  VAL A CA  1 
ATOM   968   C  C   . VAL A  1  125 ? 3.247   -10.464 12.516   1.00 166.23 ? 125  VAL A C   1 
ATOM   969   O  O   . VAL A  1  125 ? 3.626   -11.575 12.910   1.00 172.89 ? 125  VAL A O   1 
ATOM   970   C  CB  . VAL A  1  125 ? 2.879   -10.860 10.090   1.00 172.99 ? 125  VAL A CB  1 
ATOM   971   C  CG1 . VAL A  1  125 ? 1.830   -11.052 9.010    1.00 177.07 ? 125  VAL A CG1 1 
ATOM   972   C  CG2 . VAL A  1  125 ? 3.975   -9.901  9.643    1.00 177.36 ? 125  VAL A CG2 1 
ATOM   973   N  N   . GLY A  1  126 ? 3.746   -9.336  13.008   1.00 166.31 ? 126  GLY A N   1 
ATOM   974   C  CA  . GLY A  1  126 ? 4.747   -9.355  14.053   1.00 166.93 ? 126  GLY A CA  1 
ATOM   975   C  C   . GLY A  1  126 ? 6.115   -9.805  13.584   1.00 180.62 ? 126  GLY A C   1 
ATOM   976   O  O   . GLY A  1  126 ? 6.236   -10.653 12.693   1.00 194.36 ? 126  GLY A O   1 
ATOM   977   N  N   . THR A  1  127 ? 7.156   -9.263  14.210   1.00 173.44 ? 127  THR A N   1 
ATOM   978   C  CA  . THR A  1  127 ? 8.525   -9.617  13.878   1.00 177.39 ? 127  THR A CA  1 
ATOM   979   C  C   . THR A  1  127 ? 9.374   -9.545  15.136   1.00 177.88 ? 127  THR A C   1 
ATOM   980   O  O   . THR A  1  127 ? 9.044   -8.832  16.087   1.00 175.63 ? 127  THR A O   1 
ATOM   981   C  CB  . THR A  1  127 ? 9.105   -8.695  12.800   1.00 191.04 ? 127  THR A CB  1 
ATOM   982   O  OG1 . THR A  1  127 ? 10.379  -9.196  12.377   1.00 206.62 ? 127  THR A OG1 1 
ATOM   983   C  CG2 . THR A  1  127 ? 9.271   -7.279  13.336   1.00 181.35 ? 127  THR A CG2 1 
ATOM   984   N  N   . CYS A  1  128 ? 10.456  -10.316 15.142   1.00 185.50 ? 128  CYS A N   1 
ATOM   985   C  CA  . CYS A  1  128 ? 11.397  -10.324 16.249   1.00 182.47 ? 128  CYS A CA  1 
ATOM   986   C  C   . CYS A  1  128 ? 12.813  -10.110 15.734   1.00 188.12 ? 128  CYS A C   1 
ATOM   987   O  O   . CYS A  1  128 ? 13.134  -10.440 14.588   1.00 191.10 ? 128  CYS A O   1 
ATOM   988   C  CB  . CYS A  1  128 ? 11.309  -11.632 17.033   1.00 181.66 ? 128  CYS A CB  1 
ATOM   989   S  SG  . CYS A  1  128 ? 9.641   -11.978 17.666   1.00 213.58 ? 128  CYS A SG  1 
ATOM   990   N  N   . PHE A  1  129 ? 13.648  -9.519  16.583   1.00 189.86 ? 129  PHE A N   1 
ATOM   991   C  CA  . PHE A  1  129 ? 15.077  -9.402  16.336   1.00 197.50 ? 129  PHE A CA  1 
ATOM   992   C  C   . PHE A  1  129 ? 15.847  -10.179 17.398   1.00 196.81 ? 129  PHE A C   1 
ATOM   993   O  O   . PHE A  1  129 ? 15.591  -10.025 18.598   1.00 194.21 ? 129  PHE A O   1 
ATOM   994   C  CB  . PHE A  1  129 ? 15.500  -7.933  16.308   1.00 207.52 ? 129  PHE A CB  1 
ATOM   995   C  CG  . PHE A  1  129 ? 15.011  -7.191  15.092   1.00 210.60 ? 129  PHE A CG  1 
ATOM   996   C  CD1 . PHE A  1  129 ? 15.744  -7.198  13.917   1.00 220.88 ? 129  PHE A CD1 1 
ATOM   997   C  CD2 . PHE A  1  129 ? 13.804  -6.508  15.120   1.00 193.67 ? 129  PHE A CD2 1 
ATOM   998   C  CE1 . PHE A  1  129 ? 15.294  -6.520  12.801   1.00 214.68 ? 129  PHE A CE1 1 
ATOM   999   C  CE2 . PHE A  1  129 ? 13.346  -5.828  14.006   1.00 194.25 ? 129  PHE A CE2 1 
ATOM   1000  C  CZ  . PHE A  1  129 ? 14.092  -5.834  12.845   1.00 198.93 ? 129  PHE A CZ  1 
ATOM   1001  N  N   . LEU A  1  130 ? 16.773  -11.024 16.951   1.00 207.93 ? 130  LEU A N   1 
ATOM   1002  C  CA  . LEU A  1  130 ? 17.601  -11.853 17.820   1.00 203.35 ? 130  LEU A CA  1 
ATOM   1003  C  C   . LEU A  1  130 ? 19.057  -11.416 17.730   1.00 209.56 ? 130  LEU A C   1 
ATOM   1004  O  O   . LEU A  1  130 ? 19.593  -11.255 16.628   1.00 213.52 ? 130  LEU A O   1 
ATOM   1005  C  CB  . LEU A  1  130 ? 17.478  -13.328 17.442   1.00 203.80 ? 130  LEU A CB  1 
ATOM   1006  C  CG  . LEU A  1  130 ? 18.388  -14.293 18.202   1.00 206.94 ? 130  LEU A CG  1 
ATOM   1007  C  CD1 . LEU A  1  130 ? 18.125  -14.232 19.698   1.00 203.76 ? 130  LEU A CD1 1 
ATOM   1008  C  CD2 . LEU A  1  130 ? 18.211  -15.706 17.672   1.00 207.80 ? 130  LEU A CD2 1 
ATOM   1009  N  N   . GLN A  1  131 ? 19.697  -11.233 18.887   1.00 216.35 ? 131  GLN A N   1 
ATOM   1010  C  CA  . GLN A  1  131 ? 21.097  -10.823 18.962   1.00 254.22 ? 131  GLN A CA  1 
ATOM   1011  C  C   . GLN A  1  131 ? 21.893  -11.885 19.714   1.00 249.32 ? 131  GLN A C   1 
ATOM   1012  O  O   . GLN A  1  131 ? 21.770  -12.015 20.937   1.00 243.16 ? 131  GLN A O   1 
ATOM   1013  C  CB  . GLN A  1  131 ? 21.248  -9.459  19.631   1.00 248.19 ? 131  GLN A CB  1 
ATOM   1014  C  CG  . GLN A  1  131 ? 22.679  -8.942  19.621   1.00 239.80 ? 131  GLN A CG  1 
ATOM   1015  C  CD  . GLN A  1  131 ? 22.772  -7.469  19.952   1.00 235.61 ? 131  GLN A CD  1 
ATOM   1016  O  OE1 . GLN A  1  131 ? 21.757  -6.781  20.052   1.00 230.27 ? 131  GLN A OE1 1 
ATOM   1017  N  NE2 . GLN A  1  131 ? 23.994  -6.978  20.137   1.00 235.08 ? 131  GLN A NE2 1 
ATOM   1018  N  N   . ASP A  1  132 ? 22.703  -12.647 18.983   1.00 230.64 ? 132  ASP A N   1 
ATOM   1019  C  CA  . ASP A  1  132 ? 23.584  -13.630 19.601   1.00 234.50 ? 132  ASP A CA  1 
ATOM   1020  C  C   . ASP A  1  132 ? 25.021  -13.125 19.594   1.00 255.31 ? 132  ASP A C   1 
ATOM   1021  O  O   . ASP A  1  132 ? 25.909  -13.757 19.011   1.00 259.11 ? 132  ASP A O   1 
ATOM   1022  C  CB  . ASP A  1  132 ? 23.486  -14.977 18.880   1.00 254.66 ? 132  ASP A CB  1 
ATOM   1023  C  CG  . ASP A  1  132 ? 24.174  -16.096 19.641   1.00 283.60 ? 132  ASP A CG  1 
ATOM   1024  O  OD1 . ASP A  1  132 ? 24.145  -16.068 20.890   1.00 294.57 ? 132  ASP A OD1 1 
ATOM   1025  O  OD2 . ASP A  1  132 ? 24.749  -16.998 18.993   1.00 297.43 ? 132  ASP A OD2 1 
ATOM   1026  N  N   . GLY A  1  133 ? 25.258  -11.980 20.227   1.00 246.75 ? 133  GLY A N   1 
ATOM   1027  C  CA  . GLY A  1  133 ? 26.584  -11.401 20.264   1.00 250.25 ? 133  GLY A CA  1 
ATOM   1028  C  C   . GLY A  1  133 ? 26.698  -10.239 19.304   1.00 252.34 ? 133  GLY A C   1 
ATOM   1029  O  O   . GLY A  1  133 ? 26.293  -9.114  19.616   1.00 258.06 ? 133  GLY A O   1 
ATOM   1030  N  N   . THR A  1  134 ? 27.245  -10.506 18.122   1.00 248.40 ? 134  THR A N   1 
ATOM   1031  C  CA  . THR A  1  134 ? 27.412  -9.494  17.090   1.00 250.71 ? 134  THR A CA  1 
ATOM   1032  C  C   . THR A  1  134 ? 26.295  -9.541  16.058   1.00 246.46 ? 134  THR A C   1 
ATOM   1033  O  O   . THR A  1  134 ? 25.698  -8.510  15.736   1.00 243.87 ? 134  THR A O   1 
ATOM   1034  C  CB  . THR A  1  134 ? 28.763  -9.672  16.389   1.00 259.23 ? 134  THR A CB  1 
ATOM   1035  O  OG1 . THR A  1  134 ? 28.722  -10.850 15.574   1.00 260.98 ? 134  THR A OG1 1 
ATOM   1036  C  CG2 . THR A  1  134 ? 29.875  -9.814  17.411   1.00 266.92 ? 134  THR A CG2 1 
ATOM   1037  N  N   . LYS A  1  135 ? 25.993  -10.729 15.545   1.00 245.96 ? 135  LYS A N   1 
ATOM   1038  C  CA  . LYS A  1  135 ? 24.991  -10.868 14.498   1.00 242.70 ? 135  LYS A CA  1 
ATOM   1039  C  C   . LYS A  1  135 ? 23.604  -10.540 15.031   1.00 234.71 ? 135  LYS A C   1 
ATOM   1040  O  O   . LYS A  1  135 ? 23.212  -11.000 16.107   1.00 231.05 ? 135  LYS A O   1 
ATOM   1041  C  CB  . LYS A  1  135 ? 25.016  -12.284 13.928   1.00 244.41 ? 135  LYS A CB  1 
ATOM   1042  C  CG  . LYS A  1  135 ? 26.365  -12.726 13.377   1.00 252.78 ? 135  LYS A CG  1 
ATOM   1043  C  CD  . LYS A  1  135 ? 26.740  -11.935 12.126   1.00 256.97 ? 135  LYS A CD  1 
ATOM   1044  C  CE  . LYS A  1  135 ? 28.139  -12.289 11.632   1.00 265.88 ? 135  LYS A CE  1 
ATOM   1045  N  NZ  . LYS A  1  135 ? 28.440  -11.695 10.298   1.00 270.27 ? 135  LYS A NZ  1 
ATOM   1046  N  N   . THR A  1  136 ? 22.875  -9.713  14.286   1.00 232.39 ? 136  THR A N   1 
ATOM   1047  C  CA  . THR A  1  136 ? 21.483  -9.394  14.574   1.00 225.29 ? 136  THR A CA  1 
ATOM   1048  C  C   . THR A  1  136 ? 20.639  -9.884  13.406   1.00 223.59 ? 136  THR A C   1 
ATOM   1049  O  O   . THR A  1  136 ? 20.858  -9.466  12.265   1.00 235.62 ? 136  THR A O   1 
ATOM   1050  C  CB  . THR A  1  136 ? 21.296  -7.893  14.786   1.00 224.20 ? 136  THR A CB  1 
ATOM   1051  O  OG1 . THR A  1  136 ? 22.068  -7.467  15.915   1.00 225.97 ? 136  THR A OG1 1 
ATOM   1052  C  CG2 . THR A  1  136 ? 19.835  -7.573  15.019   1.00 217.35 ? 136  THR A CG2 1 
ATOM   1053  N  N   . VAL A  1  137 ? 19.668  -10.755 13.689   1.00 218.82 ? 137  VAL A N   1 
ATOM   1054  C  CA  . VAL A  1  137 ? 18.829  -11.339 12.651   1.00 217.26 ? 137  VAL A CA  1 
ATOM   1055  C  C   . VAL A  1  137 ? 17.377  -10.976 12.921   1.00 210.50 ? 137  VAL A C   1 
ATOM   1056  O  O   . VAL A  1  137 ? 16.995  -10.624 14.038   1.00 206.81 ? 137  VAL A O   1 
ATOM   1057  C  CB  . VAL A  1  137 ? 18.984  -12.873 12.551   1.00 218.65 ? 137  VAL A CB  1 
ATOM   1058  C  CG1 . VAL A  1  137 ? 20.439  -13.254 12.353   1.00 242.53 ? 137  VAL A CG1 1 
ATOM   1059  C  CG2 . VAL A  1  137 ? 18.410  -13.556 13.787   1.00 214.05 ? 137  VAL A CG2 1 
ATOM   1060  N  N   . GLU A  1  138 ? 16.568  -11.054 11.869   1.00 209.37 ? 138  GLU A N   1 
ATOM   1061  C  CA  . GLU A  1  138 ? 15.128  -10.863 11.959   1.00 203.40 ? 138  GLU A CA  1 
ATOM   1062  C  C   . GLU A  1  138 ? 14.424  -12.214 11.996   1.00 200.90 ? 138  GLU A C   1 
ATOM   1063  O  O   . GLU A  1  138 ? 14.894  -13.197 11.415   1.00 204.23 ? 138  GLU A O   1 
ATOM   1064  C  CB  . GLU A  1  138 ? 14.605  -10.040 10.783   1.00 203.77 ? 138  GLU A CB  1 
ATOM   1065  C  CG  . GLU A  1  138 ? 13.192  -9.519  10.972   1.00 198.18 ? 138  GLU A CG  1 
ATOM   1066  C  CD  . GLU A  1  138 ? 12.701  -8.734  9.777    1.00 201.52 ? 138  GLU A CD  1 
ATOM   1067  O  OE1 . GLU A  1  138 ? 13.326  -8.844  8.701    1.00 212.83 ? 138  GLU A OE1 1 
ATOM   1068  O  OE2 . GLU A  1  138 ? 11.681  -8.025  9.905    1.00 199.19 ? 138  GLU A OE2 1 
ATOM   1069  N  N   . TYR A  1  139 ? 13.283  -12.254 12.683   1.00 202.92 ? 139  TYR A N   1 
ATOM   1070  C  CA  . TYR A  1  139 ? 12.504  -13.487 12.828   1.00 207.09 ? 139  TYR A CA  1 
ATOM   1071  C  C   . TYR A  1  139 ? 11.020  -13.143 12.765   1.00 194.59 ? 139  TYR A C   1 
ATOM   1072  O  O   . TYR A  1  139 ? 10.466  -12.577 13.712   1.00 183.78 ? 139  TYR A O   1 
ATOM   1073  C  CB  . TYR A  1  139 ? 12.845  -14.209 14.124   1.00 213.66 ? 139  TYR A CB  1 
ATOM   1074  C  CG  . TYR A  1  139 ? 12.042  -15.473 14.338   1.00 208.00 ? 139  TYR A CG  1 
ATOM   1075  C  CD1 . TYR A  1  139 ? 12.086  -16.512 13.417   1.00 208.79 ? 139  TYR A CD1 1 
ATOM   1076  C  CD2 . TYR A  1  139 ? 11.252  -15.633 15.467   1.00 184.49 ? 139  TYR A CD2 1 
ATOM   1077  C  CE1 . TYR A  1  139 ? 11.356  -17.671 13.611   1.00 195.11 ? 139  TYR A CE1 1 
ATOM   1078  C  CE2 . TYR A  1  139 ? 10.523  -16.789 15.670   1.00 182.43 ? 139  TYR A CE2 1 
ATOM   1079  C  CZ  . TYR A  1  139 ? 10.578  -17.804 14.741   1.00 185.02 ? 139  TYR A CZ  1 
ATOM   1080  O  OH  . TYR A  1  139 ? 9.851   -18.954 14.945   1.00 183.27 ? 139  TYR A OH  1 
ATOM   1081  N  N   . ALA A  1  140 ? 10.384  -13.474 11.643   1.00 201.98 ? 140  ALA A N   1 
ATOM   1082  C  CA  . ALA A  1  140 ? 8.954   -13.241 11.439   1.00 207.80 ? 140  ALA A CA  1 
ATOM   1083  C  C   . ALA A  1  140 ? 8.328   -14.511 10.879   1.00 219.35 ? 140  ALA A C   1 
ATOM   1084  O  O   . ALA A  1  140 ? 8.102   -14.626 9.666    1.00 231.90 ? 140  ALA A O   1 
ATOM   1085  C  CB  . ALA A  1  140 ? 8.715   -12.048 10.515   1.00 205.58 ? 140  ALA A CB  1 
ATOM   1086  N  N   . PRO A  1  141 ? 8.027   -15.490 11.741   1.00 211.18 ? 141  PRO A N   1 
ATOM   1087  C  CA  . PRO A  1  141 ? 7.472   -16.762 11.253   1.00 202.53 ? 141  PRO A CA  1 
ATOM   1088  C  C   . PRO A  1  141 ? 6.044   -16.649 10.766   1.00 194.41 ? 141  PRO A C   1 
ATOM   1089  O  O   . PRO A  1  141 ? 5.554   -17.581 10.113   1.00 198.50 ? 141  PRO A O   1 
ATOM   1090  C  CB  . PRO A  1  141 ? 7.566   -17.678 12.481   1.00 197.81 ? 141  PRO A CB  1 
ATOM   1091  C  CG  . PRO A  1  141 ? 7.461   -16.741 13.631   1.00 201.35 ? 141  PRO A CG  1 
ATOM   1092  C  CD  . PRO A  1  141 ? 8.173   -15.478 13.206   1.00 208.14 ? 141  PRO A CD  1 
ATOM   1093  N  N   . CYS A  1  142 ? 5.358   -15.552 11.084   1.00 174.73 ? 142  CYS A N   1 
ATOM   1094  C  CA  . CYS A  1  142 ? 4.004   -15.303 10.621   1.00 174.13 ? 142  CYS A CA  1 
ATOM   1095  C  C   . CYS A  1  142 ? 3.967   -14.426 9.376    1.00 180.56 ? 142  CYS A C   1 
ATOM   1096  O  O   . CYS A  1  142 ? 2.907   -14.289 8.754    1.00 185.99 ? 142  CYS A O   1 
ATOM   1097  C  CB  . CYS A  1  142 ? 3.187   -14.674 11.754   1.00 190.17 ? 142  CYS A CB  1 
ATOM   1098  S  SG  . CYS A  1  142 ? 2.711   -15.917 12.998   1.00 192.31 ? 142  CYS A SG  1 
ATOM   1099  N  N   . ARG A  1  143 ? 5.093   -13.817 9.014    1.00 187.79 ? 143  ARG A N   1 
ATOM   1100  C  CA  . ARG A  1  143 ? 5.235   -13.090 7.757    1.00 195.32 ? 143  ARG A CA  1 
ATOM   1101  C  C   . ARG A  1  143 ? 5.435   -14.113 6.641    1.00 211.51 ? 143  ARG A C   1 
ATOM   1102  O  O   . ARG A  1  143 ? 6.554   -14.390 6.203    1.00 218.35 ? 143  ARG A O   1 
ATOM   1103  C  CB  . ARG A  1  143 ? 6.408   -12.125 7.841    1.00 196.38 ? 143  ARG A CB  1 
ATOM   1104  C  CG  . ARG A  1  143 ? 6.499   -11.115 6.721    1.00 203.29 ? 143  ARG A CG  1 
ATOM   1105  C  CD  . ARG A  1  143 ? 7.668   -10.176 6.967    1.00 203.80 ? 143  ARG A CD  1 
ATOM   1106  N  NE  . ARG A  1  143 ? 8.945   -10.885 6.905    1.00 214.89 ? 143  ARG A NE  1 
ATOM   1107  C  CZ  . ARG A  1  143 ? 10.082  -10.430 7.422    1.00 231.95 ? 143  ARG A CZ  1 
ATOM   1108  N  NH1 . ARG A  1  143 ? 10.107  -9.260  8.045    1.00 222.59 ? 143  ARG A NH1 1 
ATOM   1109  N  NH2 . ARG A  1  143 ? 11.197  -11.145 7.316    1.00 242.85 ? 143  ARG A NH2 1 
ATOM   1110  N  N   . SER A  1  144 ? 4.327   -14.705 6.191    1.00 215.41 ? 144  SER A N   1 
ATOM   1111  C  CA  . SER A  1  144 ? 4.363   -15.788 5.210    1.00 226.71 ? 144  SER A CA  1 
ATOM   1112  C  C   . SER A  1  144 ? 3.496   -15.443 3.996    1.00 237.50 ? 144  SER A C   1 
ATOM   1113  O  O   . SER A  1  144 ? 3.009   -14.319 3.847    1.00 248.12 ? 144  SER A O   1 
ATOM   1114  C  CB  . SER A  1  144 ? 3.906   -17.103 5.851    1.00 214.62 ? 144  SER A CB  1 
ATOM   1115  O  OG  . SER A  1  144 ? 4.097   -18.211 4.985    1.00 216.14 ? 144  SER A OG  1 
ATOM   1116  N  N   . GLN A  1  145 ? 3.277   -16.447 3.140    1.00 233.55 ? 145  GLN A N   1 
ATOM   1117  C  CA  . GLN A  1  145 ? 2.353   -16.334 2.018    1.00 229.63 ? 145  GLN A CA  1 
ATOM   1118  C  C   . GLN A  1  145 ? 0.936   -16.689 2.434    1.00 216.44 ? 145  GLN A C   1 
ATOM   1119  O  O   . GLN A  1  145 ? -0.000  -16.495 1.650    1.00 214.08 ? 145  GLN A O   1 
ATOM   1120  C  CB  . GLN A  1  145 ? 2.785   -17.251 0.857    1.00 240.98 ? 145  GLN A CB  1 
ATOM   1121  C  CG  . GLN A  1  145 ? 4.241   -17.120 0.383    1.00 247.14 ? 145  GLN A CG  1 
ATOM   1122  C  CD  . GLN A  1  145 ? 4.650   -15.698 0.048    1.00 240.31 ? 145  GLN A CD  1 
ATOM   1123  O  OE1 . GLN A  1  145 ? 5.694   -15.222 0.495    1.00 239.18 ? 145  GLN A OE1 1 
ATOM   1124  N  NE2 . GLN A  1  145 ? 3.847   -15.024 -0.766   1.00 244.16 ? 145  GLN A NE2 1 
ATOM   1125  N  N   . ASP A  1  146 ? 0.773   -17.209 3.650    1.00 212.97 ? 146  ASP A N   1 
ATOM   1126  C  CA  . ASP A  1  146 ? -0.528  -17.468 4.261    1.00 202.54 ? 146  ASP A CA  1 
ATOM   1127  C  C   . ASP A  1  146 ? -1.050  -16.141 4.797    1.00 192.94 ? 146  ASP A C   1 
ATOM   1128  O  O   . ASP A  1  146 ? -0.896  -15.797 5.972    1.00 192.27 ? 146  ASP A O   1 
ATOM   1129  C  CB  . ASP A  1  146 ? -0.406  -18.516 5.358    1.00 194.35 ? 146  ASP A CB  1 
ATOM   1130  C  CG  . ASP A  1  146 ? -1.749  -18.945 5.906    1.00 189.35 ? 146  ASP A CG  1 
ATOM   1131  O  OD1 . ASP A  1  146 ? -2.767  -18.810 5.195    1.00 193.27 ? 146  ASP A OD1 1 
ATOM   1132  O  OD2 . ASP A  1  146 ? -1.785  -19.407 7.064    1.00 191.55 ? 146  ASP A OD2 1 
ATOM   1133  N  N   . ILE A  1  147 ? -1.657  -15.371 3.896    1.00 196.84 ? 147  ILE A N   1 
ATOM   1134  C  CA  . ILE A  1  147 ? -2.028  -13.989 4.181    1.00 200.88 ? 147  ILE A CA  1 
ATOM   1135  C  C   . ILE A  1  147 ? -3.459  -13.896 4.694    1.00 184.84 ? 147  ILE A C   1 
ATOM   1136  O  O   . ILE A  1  147 ? -4.153  -14.910 4.834    1.00 181.94 ? 147  ILE A O   1 
ATOM   1137  C  CB  . ILE A  1  147 ? -1.852  -13.102 2.935    1.00 215.34 ? 147  ILE A CB  1 
ATOM   1138  C  CG1 . ILE A  1  147 ? -2.881  -13.475 1.863    1.00 214.59 ? 147  ILE A CG1 1 
ATOM   1139  C  CG2 . ILE A  1  147 ? -0.437  -13.230 2.399    1.00 219.15 ? 147  ILE A CG2 1 
ATOM   1140  C  CD1 . ILE A  1  147 ? -2.744  -12.683 0.582    1.00 217.61 ? 147  ILE A CD1 1 
ATOM   1141  N  N   . ASP A  1  148 ? -3.890  -12.665 4.982    1.00 195.28 ? 148  ASP A N   1 
ATOM   1142  C  CA  . ASP A  1  148 ? -5.238  -12.338 5.432    1.00 201.06 ? 148  ASP A CA  1 
ATOM   1143  C  C   . ASP A  1  148 ? -5.550  -12.904 6.812    1.00 190.18 ? 148  ASP A C   1 
ATOM   1144  O  O   . ASP A  1  148 ? -4.766  -13.678 7.372    1.00 179.03 ? 148  ASP A O   1 
ATOM   1145  C  CB  . ASP A  1  148 ? -6.278  -12.828 4.420    1.00 212.35 ? 148  ASP A CB  1 
ATOM   1146  C  CG  . ASP A  1  148 ? -7.500  -11.937 4.367    1.00 198.25 ? 148  ASP A CG  1 
ATOM   1147  O  OD1 . ASP A  1  148 ? -7.815  -11.302 5.395    1.00 185.13 ? 148  ASP A OD1 1 
ATOM   1148  O  OD2 . ASP A  1  148 ? -8.142  -11.871 3.299    1.00 199.06 ? 148  ASP A OD2 1 
ATOM   1149  N  N   . ALA A  1  149 ? -6.694  -12.498 7.373    1.00 191.56 ? 149  ALA A N   1 
ATOM   1150  C  CA  . ALA A  1  149 ? -7.075  -12.952 8.705    1.00 179.45 ? 149  ALA A CA  1 
ATOM   1151  C  C   . ALA A  1  149 ? -7.197  -14.469 8.749    1.00 184.89 ? 149  ALA A C   1 
ATOM   1152  O  O   . ALA A  1  149 ? -6.902  -15.092 9.775    1.00 181.31 ? 149  ALA A O   1 
ATOM   1153  C  CB  . ALA A  1  149 ? -8.387  -12.291 9.129    1.00 163.35 ? 149  ALA A CB  1 
ATOM   1154  N  N   . ASP A  1  150 ? -7.648  -15.076 7.646    1.00 194.73 ? 150  ASP A N   1 
ATOM   1155  C  CA  . ASP A  1  150 ? -7.762  -16.529 7.573    1.00 189.42 ? 150  ASP A CA  1 
ATOM   1156  C  C   . ASP A  1  150 ? -6.422  -17.220 7.786    1.00 190.18 ? 150  ASP A C   1 
ATOM   1157  O  O   . ASP A  1  150 ? -6.382  -18.376 8.221    1.00 188.80 ? 150  ASP A O   1 
ATOM   1158  C  CB  . ASP A  1  150 ? -8.353  -16.936 6.227    1.00 193.44 ? 150  ASP A CB  1 
ATOM   1159  C  CG  . ASP A  1  150 ? -9.566  -16.116 5.862    1.00 207.71 ? 150  ASP A CG  1 
ATOM   1160  O  OD1 . ASP A  1  150 ? -10.674 -16.457 6.325    1.00 220.81 ? 150  ASP A OD1 1 
ATOM   1161  O  OD2 . ASP A  1  150 ? -9.408  -15.127 5.116    1.00 196.68 ? 150  ASP A OD2 1 
ATOM   1162  N  N   . GLY A  1  151 ? -5.322  -16.548 7.455    1.00 195.88 ? 151  GLY A N   1 
ATOM   1163  C  CA  . GLY A  1  151 ? -4.010  -17.123 7.655    1.00 194.96 ? 151  GLY A CA  1 
ATOM   1164  C  C   . GLY A  1  151 ? -3.277  -16.517 8.834    1.00 196.27 ? 151  GLY A C   1 
ATOM   1165  O  O   . GLY A  1  151 ? -3.835  -16.393 9.930    1.00 192.16 ? 151  GLY A O   1 
ATOM   1166  N  N   . GLN A  1  152 ? -2.031  -16.105 8.608    1.00 172.48 ? 152  GLN A N   1 
ATOM   1167  C  CA  . GLN A  1  152 ? -1.179  -15.555 9.652    1.00 162.89 ? 152  GLN A CA  1 
ATOM   1168  C  C   . GLN A  1  152 ? -1.020  -14.047 9.507    1.00 163.00 ? 152  GLN A C   1 
ATOM   1169  O  O   . GLN A  1  152 ? -0.095  -13.464 10.079   1.00 163.41 ? 152  GLN A O   1 
ATOM   1170  C  CB  . GLN A  1  152 ? 0.184   -16.247 9.630    1.00 165.94 ? 152  GLN A CB  1 
ATOM   1171  C  CG  . GLN A  1  152 ? 0.131   -17.743 9.913    1.00 166.57 ? 152  GLN A CG  1 
ATOM   1172  C  CD  . GLN A  1  152 ? 1.473   -18.430 9.705    1.00 170.67 ? 152  GLN A CD  1 
ATOM   1173  O  OE1 . GLN A  1  152 ? 2.431   -17.819 9.233    1.00 190.73 ? 152  GLN A OE1 1 
ATOM   1174  N  NE2 . GLN A  1  152 ? 1.543   -19.709 10.050   1.00 170.87 ? 152  GLN A NE2 1 
ATOM   1175  N  N   . GLY A  1  153 ? -1.905  -13.411 8.734    1.00 194.78 ? 153  GLY A N   1 
ATOM   1176  C  CA  . GLY A  1  153 ? -1.806  -11.980 8.510    1.00 195.95 ? 153  GLY A CA  1 
ATOM   1177  C  C   . GLY A  1  153 ? -1.955  -11.164 9.775    1.00 192.11 ? 153  GLY A C   1 
ATOM   1178  O  O   . GLY A  1  153 ? -1.319  -10.117 9.924    1.00 202.94 ? 153  GLY A O   1 
ATOM   1179  N  N   . PHE A  1  154 ? -2.791  -11.625 10.703   1.00 168.02 ? 154  PHE A N   1 
ATOM   1180  C  CA  . PHE A  1  154 ? -3.039  -10.915 11.949   1.00 157.49 ? 154  PHE A CA  1 
ATOM   1181  C  C   . PHE A  1  154 ? -2.518  -11.710 13.141   1.00 164.75 ? 154  PHE A C   1 
ATOM   1182  O  O   . PHE A  1  154 ? -3.024  -11.587 14.259   1.00 150.65 ? 154  PHE A O   1 
ATOM   1183  C  CB  . PHE A  1  154 ? -4.522  -10.589 12.083   1.00 154.00 ? 154  PHE A CB  1 
ATOM   1184  C  CG  . PHE A  1  154 ? -4.987  -9.528  11.118   1.00 168.17 ? 154  PHE A CG  1 
ATOM   1185  C  CD1 . PHE A  1  154 ? -5.115  -9.813  9.768    1.00 177.11 ? 154  PHE A CD1 1 
ATOM   1186  C  CD2 . PHE A  1  154 ? -5.256  -8.239  11.552   1.00 168.14 ? 154  PHE A CD2 1 
ATOM   1187  C  CE1 . PHE A  1  154 ? -5.527  -8.846  8.876    1.00 165.71 ? 154  PHE A CE1 1 
ATOM   1188  C  CE2 . PHE A  1  154 ? -5.665  -7.263  10.657   1.00 155.88 ? 154  PHE A CE2 1 
ATOM   1189  C  CZ  . PHE A  1  154 ? -5.800  -7.571  9.320    1.00 161.95 ? 154  PHE A CZ  1 
ATOM   1190  N  N   . CYS A  1  155 ? -1.484  -12.519 12.878   1.00 192.15 ? 155  CYS A N   1 
ATOM   1191  C  CA  . CYS A  1  155 ? -0.867  -13.395 13.873   1.00 167.79 ? 155  CYS A CA  1 
ATOM   1192  C  C   . CYS A  1  155 ? -0.272  -12.625 15.048   1.00 159.93 ? 155  CYS A C   1 
ATOM   1193  O  O   . CYS A  1  155 ? -0.366  -13.074 16.197   1.00 153.27 ? 155  CYS A O   1 
ATOM   1194  C  CB  . CYS A  1  155 ? 0.207   -14.241 13.187   1.00 160.65 ? 155  CYS A CB  1 
ATOM   1195  S  SG  . CYS A  1  155 ? 1.429   -14.988 14.275   1.00 158.95 ? 155  CYS A SG  1 
ATOM   1196  N  N   . GLN A  1  156 ? 0.378   -11.489 14.782   1.00 159.63 ? 156  GLN A N   1 
ATOM   1197  C  CA  . GLN A  1  156 ? 1.105   -10.737 15.812   1.00 166.22 ? 156  GLN A CA  1 
ATOM   1198  C  C   . GLN A  1  156 ? 2.126   -11.637 16.512   1.00 173.72 ? 156  GLN A C   1 
ATOM   1199  O  O   . GLN A  1  156 ? 2.169   -11.736 17.742   1.00 172.32 ? 156  GLN A O   1 
ATOM   1200  C  CB  . GLN A  1  156 ? 0.149   -10.090 16.819   1.00 154.37 ? 156  GLN A CB  1 
ATOM   1201  C  CG  . GLN A  1  156 ? -0.855  -9.134  16.188   1.00 168.72 ? 156  GLN A CG  1 
ATOM   1202  C  CD  . GLN A  1  156 ? -1.679  -8.372  17.212   1.00 175.15 ? 156  GLN A CD  1 
ATOM   1203  O  OE1 . GLN A  1  156 ? -2.874  -8.632  17.382   1.00 168.28 ? 156  GLN A OE1 1 
ATOM   1204  N  NE2 . GLN A  1  156 ? -1.047  -7.422  17.897   1.00 168.47 ? 156  GLN A NE2 1 
ATOM   1205  N  N   . GLY A  1  157 ? 2.943   -12.305 15.700   1.00 160.58 ? 157  GLY A N   1 
ATOM   1206  C  CA  . GLY A  1  157 ? 3.957   -13.192 16.244   1.00 161.18 ? 157  GLY A CA  1 
ATOM   1207  C  C   . GLY A  1  157 ? 4.931   -12.438 17.131   1.00 186.88 ? 157  GLY A C   1 
ATOM   1208  O  O   . GLY A  1  157 ? 5.332   -11.309 16.833   1.00 195.80 ? 157  GLY A O   1 
ATOM   1209  N  N   . GLY A  1  158 ? 5.310   -13.072 18.236   1.00 197.54 ? 158  GLY A N   1 
ATOM   1210  C  CA  . GLY A  1  158 ? 6.176   -12.453 19.214   1.00 188.22 ? 158  GLY A CA  1 
ATOM   1211  C  C   . GLY A  1  158 ? 5.444   -11.756 20.333   1.00 176.86 ? 158  GLY A C   1 
ATOM   1212  O  O   . GLY A  1  158 ? 6.076   -11.031 21.114   1.00 170.42 ? 158  GLY A O   1 
ATOM   1213  N  N   . PHE A  1  159 ? 4.128   -11.944 20.427   1.00 156.37 ? 159  PHE A N   1 
ATOM   1214  C  CA  . PHE A  1  159 ? 3.370   -11.347 21.518   1.00 153.69 ? 159  PHE A CA  1 
ATOM   1215  C  C   . PHE A  1  159 ? 3.869   -11.854 22.865   1.00 153.63 ? 159  PHE A C   1 
ATOM   1216  O  O   . PHE A  1  159 ? 3.984   -11.083 23.825   1.00 153.41 ? 159  PHE A O   1 
ATOM   1217  C  CB  . PHE A  1  159 ? 1.879   -11.643 21.319   1.00 158.22 ? 159  PHE A CB  1 
ATOM   1218  C  CG  . PHE A  1  159 ? 0.976   -10.872 22.233   1.00 152.61 ? 159  PHE A CG  1 
ATOM   1219  C  CD1 . PHE A  1  159 ? 0.743   -9.526  22.013   1.00 151.82 ? 159  PHE A CD1 1 
ATOM   1220  C  CD2 . PHE A  1  159 ? 0.348   -11.490 23.296   1.00 146.11 ? 159  PHE A CD2 1 
ATOM   1221  C  CE1 . PHE A  1  159 ? -0.086  -8.805  22.847   1.00 146.90 ? 159  PHE A CE1 1 
ATOM   1222  C  CE2 . PHE A  1  159 ? -0.484  -10.774 24.132   1.00 144.39 ? 159  PHE A CE2 1 
ATOM   1223  C  CZ  . PHE A  1  159 ? -0.701  -9.429  23.907   1.00 144.83 ? 159  PHE A CZ  1 
ATOM   1224  N  N   . SER A  1  160 ? 4.225   -13.135 22.937   1.00 154.28 ? 160  SER A N   1 
ATOM   1225  C  CA  . SER A  1  160 ? 4.873   -13.716 24.102   1.00 155.03 ? 160  SER A CA  1 
ATOM   1226  C  C   . SER A  1  160 ? 5.947   -14.678 23.625   1.00 158.21 ? 160  SER A C   1 
ATOM   1227  O  O   . SER A  1  160 ? 5.755   -15.370 22.621   1.00 158.69 ? 160  SER A O   1 
ATOM   1228  C  CB  . SER A  1  160 ? 3.882   -14.469 24.979   1.00 152.17 ? 160  SER A CB  1 
ATOM   1229  O  OG  . SER A  1  160 ? 3.343   -15.558 24.253   1.00 158.67 ? 160  SER A OG  1 
ATOM   1230  N  N   . ILE A  1  161 ? 7.064   -14.740 24.356   1.00 160.71 ? 161  ILE A N   1 
ATOM   1231  C  CA  . ILE A  1  161 ? 8.207   -15.565 23.986   1.00 164.47 ? 161  ILE A CA  1 
ATOM   1232  C  C   . ILE A  1  161 ? 8.802   -16.205 25.235   1.00 165.62 ? 161  ILE A C   1 
ATOM   1233  O  O   . ILE A  1  161 ? 8.511   -15.810 26.366   1.00 163.97 ? 161  ILE A O   1 
ATOM   1234  C  CB  . ILE A  1  161 ? 9.278   -14.748 23.237   1.00 168.00 ? 161  ILE A CB  1 
ATOM   1235  C  CG1 . ILE A  1  161 ? 9.512   -13.418 23.955   1.00 167.90 ? 161  ILE A CG1 1 
ATOM   1236  C  CG2 . ILE A  1  161 ? 8.862   -14.527 21.791   1.00 167.96 ? 161  ILE A CG2 1 
ATOM   1237  C  CD1 . ILE A  1  161 ? 10.591  -12.567 23.330   1.00 171.68 ? 161  ILE A CD1 1 
ATOM   1238  N  N   . ASP A  1  162 ? 9.642   -17.214 25.009   1.00 176.10 ? 162  ASP A N   1 
ATOM   1239  C  CA  . ASP A  1  162 ? 10.376  -17.916 26.060   1.00 179.23 ? 162  ASP A CA  1 
ATOM   1240  C  C   . ASP A  1  162 ? 11.427  -18.799 25.399   1.00 175.49 ? 162  ASP A C   1 
ATOM   1241  O  O   . ASP A  1  162 ? 11.347  -19.097 24.203   1.00 176.37 ? 162  ASP A O   1 
ATOM   1242  C  CB  . ASP A  1  162 ? 9.449   -18.751 26.955   1.00 184.05 ? 162  ASP A CB  1 
ATOM   1243  C  CG  . ASP A  1  162 ? 9.964   -18.878 28.386   1.00 178.35 ? 162  ASP A CG  1 
ATOM   1244  O  OD1 . ASP A  1  162 ? 11.171  -18.643 28.608   1.00 180.99 ? 162  ASP A OD1 1 
ATOM   1245  O  OD2 . ASP A  1  162 ? 9.162   -19.224 29.284   1.00 166.66 ? 162  ASP A OD2 1 
ATOM   1246  N  N   . PHE A  1  163 ? 12.420  -19.203 26.189   1.00 178.74 ? 163  PHE A N   1 
ATOM   1247  C  CA  . PHE A  1  163 ? 13.462  -20.119 25.747   1.00 183.64 ? 163  PHE A CA  1 
ATOM   1248  C  C   . PHE A  1  163 ? 13.350  -21.469 26.448   1.00 184.21 ? 163  PHE A C   1 
ATOM   1249  O  O   . PHE A  1  163 ? 12.981  -21.545 27.625   1.00 182.26 ? 163  PHE A O   1 
ATOM   1250  C  CB  . PHE A  1  163 ? 14.850  -19.524 25.999   1.00 188.11 ? 163  PHE A CB  1 
ATOM   1251  C  CG  . PHE A  1  163 ? 15.255  -18.474 25.004   1.00 189.45 ? 163  PHE A CG  1 
ATOM   1252  C  CD1 . PHE A  1  163 ? 15.721  -18.832 23.751   1.00 192.64 ? 163  PHE A CD1 1 
ATOM   1253  C  CD2 . PHE A  1  163 ? 15.174  -17.129 25.323   1.00 187.90 ? 163  PHE A CD2 1 
ATOM   1254  C  CE1 . PHE A  1  163 ? 16.103  -17.871 22.839   1.00 194.20 ? 163  PHE A CE1 1 
ATOM   1255  C  CE2 . PHE A  1  163 ? 15.552  -16.162 24.413   1.00 189.44 ? 163  PHE A CE2 1 
ATOM   1256  C  CZ  . PHE A  1  163 ? 16.017  -16.533 23.170   1.00 193.52 ? 163  PHE A CZ  1 
ATOM   1257  N  N   . THR A  1  164 ? 13.684  -22.532 25.718   1.00 199.96 ? 164  THR A N   1 
ATOM   1258  C  CA  . THR A  1  164 ? 13.829  -23.865 26.280   1.00 189.25 ? 164  THR A CA  1 
ATOM   1259  C  C   . THR A  1  164 ? 15.280  -24.108 26.681   1.00 199.75 ? 164  THR A C   1 
ATOM   1260  O  O   . THR A  1  164 ? 16.174  -23.303 26.412   1.00 197.58 ? 164  THR A O   1 
ATOM   1261  C  CB  . THR A  1  164 ? 13.398  -24.940 25.281   1.00 190.03 ? 164  THR A CB  1 
ATOM   1262  O  OG1 . THR A  1  164 ? 14.342  -24.996 24.201   1.00 210.83 ? 164  THR A OG1 1 
ATOM   1263  C  CG2 . THR A  1  164 ? 12.022  -24.643 24.728   1.00 184.97 ? 164  THR A CG2 1 
ATOM   1264  N  N   . LYS A  1  165 ? 15.514  -25.254 27.314   1.00 197.31 ? 165  LYS A N   1 
ATOM   1265  C  CA  . LYS A  1  165 ? 16.867  -25.601 27.713   1.00 203.21 ? 165  LYS A CA  1 
ATOM   1266  C  C   . LYS A  1  165 ? 17.662  -26.211 26.567   1.00 220.50 ? 165  LYS A C   1 
ATOM   1267  O  O   . LYS A  1  165 ? 18.880  -26.377 26.693   1.00 255.04 ? 165  LYS A O   1 
ATOM   1268  C  CB  . LYS A  1  165 ? 16.832  -26.563 28.911   1.00 204.09 ? 165  LYS A CB  1 
ATOM   1269  C  CG  . LYS A  1  165 ? 18.195  -26.828 29.559   1.00 225.02 ? 165  LYS A CG  1 
ATOM   1270  C  CD  . LYS A  1  165 ? 18.075  -27.460 30.938   1.00 233.99 ? 165  LYS A CD  1 
ATOM   1271  C  CE  . LYS A  1  165 ? 19.448  -27.856 31.472   1.00 216.99 ? 165  LYS A CE  1 
ATOM   1272  N  NZ  . LYS A  1  165 ? 19.386  -28.564 32.781   1.00 217.83 ? 165  LYS A NZ  1 
ATOM   1273  N  N   . ALA A  1  166 ? 17.018  -26.493 25.434   1.00 208.05 ? 166  ALA A N   1 
ATOM   1274  C  CA  . ALA A  1  166 ? 17.681  -27.105 24.288   1.00 249.06 ? 166  ALA A CA  1 
ATOM   1275  C  C   . ALA A  1  166 ? 17.789  -26.147 23.106   1.00 237.72 ? 166  ALA A C   1 
ATOM   1276  O  O   . ALA A  1  166 ? 17.782  -26.576 21.949   1.00 244.78 ? 166  ALA A O   1 
ATOM   1277  C  CB  . ALA A  1  166 ? 16.953  -28.380 23.866   1.00 240.42 ? 166  ALA A CB  1 
ATOM   1278  N  N   . ASP A  1  167 ? 17.889  -24.848 23.390   1.00 216.79 ? 167  ASP A N   1 
ATOM   1279  C  CA  . ASP A  1  167 ? 18.105  -23.825 22.370   1.00 213.84 ? 167  ASP A CA  1 
ATOM   1280  C  C   . ASP A  1  167 ? 16.998  -23.853 21.318   1.00 207.59 ? 167  ASP A C   1 
ATOM   1281  O  O   . ASP A  1  167 ? 17.249  -23.779 20.114   1.00 210.15 ? 167  ASP A O   1 
ATOM   1282  C  CB  . ASP A  1  167 ? 19.485  -23.958 21.714   1.00 230.51 ? 167  ASP A CB  1 
ATOM   1283  C  CG  . ASP A  1  167 ? 20.625  -23.799 22.699   1.00 222.09 ? 167  ASP A CG  1 
ATOM   1284  O  OD1 . ASP A  1  167 ? 20.424  -24.069 23.899   1.00 249.14 ? 167  ASP A OD1 1 
ATOM   1285  O  OD2 . ASP A  1  167 ? 21.721  -23.377 22.273   1.00 227.14 ? 167  ASP A OD2 1 
ATOM   1286  N  N   . ARG A  1  168 ? 15.760  -23.965 21.784   1.00 207.75 ? 168  ARG A N   1 
ATOM   1287  C  CA  . ARG A  1  168 ? 14.591  -23.768 20.943   1.00 217.19 ? 168  ARG A CA  1 
ATOM   1288  C  C   . ARG A  1  168 ? 13.838  -22.537 21.421   1.00 198.44 ? 168  ARG A C   1 
ATOM   1289  O  O   . ARG A  1  168 ? 13.706  -22.308 22.627   1.00 196.26 ? 168  ARG A O   1 
ATOM   1290  C  CB  . ARG A  1  168 ? 13.665  -24.991 20.956   1.00 202.15 ? 168  ARG A CB  1 
ATOM   1291  C  CG  . ARG A  1  168 ? 14.271  -26.234 20.323   1.00 235.20 ? 168  ARG A CG  1 
ATOM   1292  C  CD  . ARG A  1  168 ? 13.220  -27.296 20.026   1.00 231.89 ? 168  ARG A CD  1 
ATOM   1293  N  NE  . ARG A  1  168 ? 12.356  -26.925 18.907   1.00 203.62 ? 168  ARG A NE  1 
ATOM   1294  C  CZ  . ARG A  1  168 ? 12.320  -27.573 17.747   1.00 207.20 ? 168  ARG A CZ  1 
ATOM   1295  N  NH1 . ARG A  1  168 ? 13.105  -28.623 17.549   1.00 212.22 ? 168  ARG A NH1 1 
ATOM   1296  N  NH2 . ARG A  1  168 ? 11.502  -27.173 16.782   1.00 204.44 ? 168  ARG A NH2 1 
ATOM   1297  N  N   . VAL A  1  169 ? 13.356  -21.746 20.481   1.00 190.31 ? 169  VAL A N   1 
ATOM   1298  C  CA  . VAL A  1  169 ? 12.546  -20.575 20.793   1.00 185.52 ? 169  VAL A CA  1 
ATOM   1299  C  C   . VAL A  1  169 ? 11.075  -20.965 20.771   1.00 180.79 ? 169  VAL A C   1 
ATOM   1300  O  O   . VAL A  1  169 ? 10.622  -21.700 19.885   1.00 181.25 ? 169  VAL A O   1 
ATOM   1301  C  CB  . VAL A  1  169 ? 12.845  -19.437 19.802   1.00 186.64 ? 169  VAL A CB  1 
ATOM   1302  C  CG1 . VAL A  1  169 ? 11.817  -18.330 19.926   1.00 181.79 ? 169  VAL A CG1 1 
ATOM   1303  C  CG2 . VAL A  1  169 ? 14.247  -18.906 20.029   1.00 192.55 ? 169  VAL A CG2 1 
ATOM   1304  N  N   . LEU A  1  170 ? 10.320  -20.469 21.748   1.00 176.57 ? 170  LEU A N   1 
ATOM   1305  C  CA  . LEU A  1  170 ? 8.877   -20.661 21.803   1.00 172.05 ? 170  LEU A CA  1 
ATOM   1306  C  C   . LEU A  1  170 ? 8.189   -19.318 21.590   1.00 168.87 ? 170  LEU A C   1 
ATOM   1307  O  O   . LEU A  1  170 ? 8.347   -18.397 22.401   1.00 167.78 ? 170  LEU A O   1 
ATOM   1308  C  CB  . LEU A  1  170 ? 8.465   -21.280 23.135   1.00 170.08 ? 170  LEU A CB  1 
ATOM   1309  C  CG  . LEU A  1  170 ? 6.965   -21.367 23.370   1.00 165.48 ? 170  LEU A CG  1 
ATOM   1310  C  CD1 . LEU A  1  170 ? 6.310   -22.186 22.274   1.00 165.59 ? 170  LEU A CD1 1 
ATOM   1311  C  CD2 . LEU A  1  170 ? 6.709   -21.984 24.722   1.00 174.23 ? 170  LEU A CD2 1 
ATOM   1312  N  N   . LEU A  1  171 ? 7.415   -19.217 20.515   1.00 167.68 ? 171  LEU A N   1 
ATOM   1313  C  CA  . LEU A  1  171 ? 6.745   -17.984 20.134   1.00 165.24 ? 171  LEU A CA  1 
ATOM   1314  C  C   . LEU A  1  171 ? 5.233   -18.183 20.130   1.00 161.25 ? 171  LEU A C   1 
ATOM   1315  O  O   . LEU A  1  171 ? 4.730   -19.208 19.658   1.00 163.28 ? 171  LEU A O   1 
ATOM   1316  C  CB  . LEU A  1  171 ? 7.230   -17.509 18.756   1.00 168.03 ? 171  LEU A CB  1 
ATOM   1317  C  CG  . LEU A  1  171 ? 6.605   -16.269 18.115   1.00 166.38 ? 171  LEU A CG  1 
ATOM   1318  C  CD1 . LEU A  1  171 ? 7.650   -15.477 17.367   1.00 170.03 ? 171  LEU A CD1 1 
ATOM   1319  C  CD2 . LEU A  1  171 ? 5.490   -16.667 17.163   1.00 164.89 ? 171  LEU A CD2 1 
ATOM   1320  N  N   . GLY A  1  172 ? 4.517   -17.194 20.657   1.00 158.20 ? 172  GLY A N   1 
ATOM   1321  C  CA  . GLY A  1  172 ? 3.065   -17.201 20.690   1.00 154.65 ? 172  GLY A CA  1 
ATOM   1322  C  C   . GLY A  1  172 ? 2.507   -16.185 19.706   1.00 154.00 ? 172  GLY A C   1 
ATOM   1323  O  O   . GLY A  1  172 ? 3.002   -15.059 19.617   1.00 154.85 ? 172  GLY A O   1 
ATOM   1324  N  N   . GLY A  1  173 ? 1.490   -16.614 18.952   1.00 152.85 ? 173  GLY A N   1 
ATOM   1325  C  CA  . GLY A  1  173 ? 0.812   -15.768 17.993   1.00 152.32 ? 173  GLY A CA  1 
ATOM   1326  C  C   . GLY A  1  173 ? -0.699  -15.847 18.120   1.00 149.25 ? 173  GLY A C   1 
ATOM   1327  O  O   . GLY A  1  173 ? -1.348  -16.725 17.543   1.00 160.57 ? 173  GLY A O   1 
ATOM   1328  N  N   . PRO A  1  174 ? -1.286  -14.917 18.882   1.00 147.03 ? 174  PRO A N   1 
ATOM   1329  C  CA  . PRO A  1  174 ? -2.714  -15.033 19.233   1.00 144.30 ? 174  PRO A CA  1 
ATOM   1330  C  C   . PRO A  1  174 ? -3.682  -14.814 18.077   1.00 144.18 ? 174  PRO A C   1 
ATOM   1331  O  O   . PRO A  1  174 ? -4.857  -15.185 18.201   1.00 142.48 ? 174  PRO A O   1 
ATOM   1332  C  CB  . PRO A  1  174 ? -2.895  -13.955 20.312   1.00 142.79 ? 174  PRO A CB  1 
ATOM   1333  C  CG  . PRO A  1  174 ? -1.497  -13.622 20.776   1.00 144.56 ? 174  PRO A CG  1 
ATOM   1334  C  CD  . PRO A  1  174 ? -0.636  -13.797 19.578   1.00 147.28 ? 174  PRO A CD  1 
ATOM   1335  N  N   . GLY A  1  175 ? -3.245  -14.219 16.972   1.00 146.19 ? 175  GLY A N   1 
ATOM   1336  C  CA  . GLY A  1  175 ? -4.148  -13.849 15.895   1.00 146.37 ? 175  GLY A CA  1 
ATOM   1337  C  C   . GLY A  1  175 ? -4.207  -14.794 14.707   1.00 166.61 ? 175  GLY A C   1 
ATOM   1338  O  O   . GLY A  1  175 ? -4.980  -14.564 13.772   1.00 167.96 ? 175  GLY A O   1 
ATOM   1339  N  N   . SER A  1  176 ? -3.346  -15.811 14.692   1.00 178.62 ? 176  SER A N   1 
ATOM   1340  C  CA  . SER A  1  176 ? -3.286  -16.745 13.571   1.00 169.99 ? 176  SER A CA  1 
ATOM   1341  C  C   . SER A  1  176 ? -4.620  -17.460 13.348   1.00 176.13 ? 176  SER A C   1 
ATOM   1342  O  O   . SER A  1  176 ? -5.339  -17.784 14.298   1.00 171.80 ? 176  SER A O   1 
ATOM   1343  C  CB  . SER A  1  176 ? -2.175  -17.770 13.806   1.00 154.08 ? 176  SER A CB  1 
ATOM   1344  O  OG  . SER A  1  176 ? -0.893  -17.184 13.663   1.00 156.31 ? 176  SER A OG  1 
ATOM   1345  N  N   . PHE A  1  177 ? -4.936  -17.716 12.075   1.00 174.20 ? 177  PHE A N   1 
ATOM   1346  C  CA  . PHE A  1  177 ? -6.095  -18.517 11.666   1.00 170.76 ? 177  PHE A CA  1 
ATOM   1347  C  C   . PHE A  1  177 ? -7.396  -17.940 12.227   1.00 164.24 ? 177  PHE A C   1 
ATOM   1348  O  O   . PHE A  1  177 ? -8.150  -18.614 12.930   1.00 162.00 ? 177  PHE A O   1 
ATOM   1349  C  CB  . PHE A  1  177 ? -5.941  -19.985 12.089   1.00 178.37 ? 177  PHE A CB  1 
ATOM   1350  C  CG  . PHE A  1  177 ? -4.600  -20.586 11.767   1.00 191.34 ? 177  PHE A CG  1 
ATOM   1351  C  CD1 . PHE A  1  177 ? -3.994  -20.358 10.545   1.00 205.72 ? 177  PHE A CD1 1 
ATOM   1352  C  CD2 . PHE A  1  177 ? -3.956  -21.402 12.687   1.00 194.55 ? 177  PHE A CD2 1 
ATOM   1353  C  CE1 . PHE A  1  177 ? -2.762  -20.918 10.248   1.00 210.76 ? 177  PHE A CE1 1 
ATOM   1354  C  CE2 . PHE A  1  177 ? -2.726  -21.966 12.396   1.00 201.89 ? 177  PHE A CE2 1 
ATOM   1355  C  CZ  . PHE A  1  177 ? -2.128  -21.723 11.174   1.00 201.75 ? 177  PHE A CZ  1 
ATOM   1356  N  N   . TYR A  1  178 ? -7.658  -16.680 11.879   1.00 160.06 ? 178  TYR A N   1 
ATOM   1357  C  CA  . TYR A  1  178 ? -8.818  -15.949 12.388   1.00 161.77 ? 178  TYR A CA  1 
ATOM   1358  C  C   . TYR A  1  178 ? -8.860  -15.993 13.917   1.00 153.50 ? 178  TYR A C   1 
ATOM   1359  O  O   . TYR A  1  178 ? -9.877  -16.320 14.531   1.00 145.57 ? 178  TYR A O   1 
ATOM   1360  C  CB  . TYR A  1  178 ? -10.118 -16.475 11.775   1.00 162.45 ? 178  TYR A CB  1 
ATOM   1361  C  CG  . TYR A  1  178 ? -10.819 -15.469 10.886   1.00 166.19 ? 178  TYR A CG  1 
ATOM   1362  C  CD1 . TYR A  1  178 ? -11.450 -14.359 11.429   1.00 178.31 ? 178  TYR A CD1 1 
ATOM   1363  C  CD2 . TYR A  1  178 ? -10.853 -15.630 9.507    1.00 167.97 ? 178  TYR A CD2 1 
ATOM   1364  C  CE1 . TYR A  1  178 ? -12.087 -13.435 10.624   1.00 195.69 ? 178  TYR A CE1 1 
ATOM   1365  C  CE2 . TYR A  1  178 ? -11.491 -14.710 8.694    1.00 175.47 ? 178  TYR A CE2 1 
ATOM   1366  C  CZ  . TYR A  1  178 ? -12.106 -13.615 9.256    1.00 190.29 ? 178  TYR A CZ  1 
ATOM   1367  O  OH  . TYR A  1  178 ? -12.742 -12.701 8.444    1.00 195.33 ? 178  TYR A OH  1 
ATOM   1368  N  N   . TRP A  1  179 ? -7.708  -15.696 14.525   1.00 145.05 ? 179  TRP A N   1 
ATOM   1369  C  CA  . TRP A  1  179 ? -7.539  -15.588 15.981   1.00 142.46 ? 179  TRP A CA  1 
ATOM   1370  C  C   . TRP A  1  179 ? -7.796  -16.907 16.700   1.00 141.55 ? 179  TRP A C   1 
ATOM   1371  O  O   . TRP A  1  179 ? -8.119  -16.922 17.891   1.00 139.68 ? 179  TRP A O   1 
ATOM   1372  C  CB  . TRP A  1  179 ? -8.410  -14.485 16.584   1.00 140.71 ? 179  TRP A CB  1 
ATOM   1373  C  CG  . TRP A  1  179 ? -7.985  -13.107 16.199   1.00 141.67 ? 179  TRP A CG  1 
ATOM   1374  C  CD1 . TRP A  1  179 ? -7.073  -12.319 16.837   1.00 141.80 ? 179  TRP A CD1 1 
ATOM   1375  C  CD2 . TRP A  1  179 ? -8.471  -12.346 15.093   1.00 148.46 ? 179  TRP A CD2 1 
ATOM   1376  N  NE1 . TRP A  1  179 ? -6.953  -11.116 16.188   1.00 143.13 ? 179  TRP A NE1 1 
ATOM   1377  C  CE2 . TRP A  1  179 ? -7.805  -11.107 15.115   1.00 147.67 ? 179  TRP A CE2 1 
ATOM   1378  C  CE3 . TRP A  1  179 ? -9.406  -12.593 14.083   1.00 160.32 ? 179  TRP A CE3 1 
ATOM   1379  C  CZ2 . TRP A  1  179 ? -8.043  -10.120 14.165   1.00 151.02 ? 179  TRP A CZ2 1 
ATOM   1380  C  CZ3 . TRP A  1  179 ? -9.639  -11.615 13.144   1.00 145.33 ? 179  TRP A CZ3 1 
ATOM   1381  C  CH2 . TRP A  1  179 ? -8.962  -10.393 13.190   1.00 146.17 ? 179  TRP A CH2 1 
ATOM   1382  N  N   . GLN A  1  180 ? -7.629  -18.030 16.001   1.00 153.83 ? 180  GLN A N   1 
ATOM   1383  C  CA  . GLN A  1  180 ? -7.498  -19.296 16.709   1.00 153.94 ? 180  GLN A CA  1 
ATOM   1384  C  C   . GLN A  1  180 ? -6.224  -19.331 17.540   1.00 155.41 ? 180  GLN A C   1 
ATOM   1385  O  O   . GLN A  1  180 ? -6.179  -20.002 18.578   1.00 172.49 ? 180  GLN A O   1 
ATOM   1386  C  CB  . GLN A  1  180 ? -7.512  -20.470 15.728   1.00 165.68 ? 180  GLN A CB  1 
ATOM   1387  C  CG  . GLN A  1  180 ? -8.854  -20.739 15.080   1.00 164.63 ? 180  GLN A CG  1 
ATOM   1388  C  CD  . GLN A  1  180 ? -8.847  -21.980 14.203   1.00 180.00 ? 180  GLN A CD  1 
ATOM   1389  O  OE1 . GLN A  1  180 ? -7.969  -22.837 14.322   1.00 200.03 ? 180  GLN A OE1 1 
ATOM   1390  N  NE2 . GLN A  1  180 ? -9.831  -22.080 13.314   1.00 174.96 ? 180  GLN A NE2 1 
ATOM   1391  N  N   . GLY A  1  181 ? -5.195  -18.611 17.107   1.00 146.38 ? 181  GLY A N   1 
ATOM   1392  C  CA  . GLY A  1  181 ? -3.894  -18.628 17.737   1.00 153.22 ? 181  GLY A CA  1 
ATOM   1393  C  C   . GLY A  1  181 ? -2.999  -19.738 17.209   1.00 166.15 ? 181  GLY A C   1 
ATOM   1394  O  O   . GLY A  1  181 ? -3.446  -20.709 16.598   1.00 165.41 ? 181  GLY A O   1 
ATOM   1395  N  N   . GLN A  1  182 ? -1.703  -19.587 17.472   1.00 158.92 ? 182  GLN A N   1 
ATOM   1396  C  CA  . GLN A  1  182 ? -0.723  -20.546 16.989   1.00 153.71 ? 182  GLN A CA  1 
ATOM   1397  C  C   . GLN A  1  182 ? 0.533   -20.439 17.837   1.00 154.92 ? 182  GLN A C   1 
ATOM   1398  O  O   . GLN A  1  182 ? 0.907   -19.352 18.282   1.00 154.16 ? 182  GLN A O   1 
ATOM   1399  C  CB  . GLN A  1  182 ? -0.382  -20.310 15.513   1.00 161.00 ? 182  GLN A CB  1 
ATOM   1400  C  CG  . GLN A  1  182 ? 0.464   -21.405 14.879   1.00 171.43 ? 182  GLN A CG  1 
ATOM   1401  C  CD  . GLN A  1  182 ? 0.777   -21.131 13.420   1.00 174.68 ? 182  GLN A CD  1 
ATOM   1402  O  OE1 . GLN A  1  182 ? 0.719   -19.990 12.965   1.00 179.21 ? 182  GLN A OE1 1 
ATOM   1403  N  NE2 . GLN A  1  182 ? 1.081   -22.185 12.672   1.00 180.53 ? 182  GLN A NE2 1 
ATOM   1404  N  N   . LEU A  1  183 ? 1.174   -21.582 18.055   1.00 157.13 ? 183  LEU A N   1 
ATOM   1405  C  CA  . LEU A  1  183 ? 2.485   -21.658 18.681   1.00 159.50 ? 183  LEU A CA  1 
ATOM   1406  C  C   . LEU A  1  183 ? 3.501   -22.109 17.640   1.00 163.82 ? 183  LEU A C   1 
ATOM   1407  O  O   . LEU A  1  183 ? 3.275   -23.103 16.943   1.00 165.58 ? 183  LEU A O   1 
ATOM   1408  C  CB  . LEU A  1  183 ? 2.462   -22.619 19.872   1.00 181.46 ? 183  LEU A CB  1 
ATOM   1409  C  CG  . LEU A  1  183 ? 1.473   -22.298 20.999   1.00 154.86 ? 183  LEU A CG  1 
ATOM   1410  C  CD1 . LEU A  1  183 ? 1.640   -23.276 22.147   1.00 168.95 ? 183  LEU A CD1 1 
ATOM   1411  C  CD2 . LEU A  1  183 ? 1.666   -20.877 21.493   1.00 153.29 ? 183  LEU A CD2 1 
ATOM   1412  N  N   . ILE A  1  184 ? 4.610   -21.380 17.533   1.00 173.65 ? 184  ILE A N   1 
ATOM   1413  C  CA  . ILE A  1  184 ? 5.682   -21.703 16.598   1.00 179.96 ? 184  ILE A CA  1 
ATOM   1414  C  C   . ILE A  1  184 ? 6.976   -21.890 17.382   1.00 173.46 ? 184  ILE A C   1 
ATOM   1415  O  O   . ILE A  1  184 ? 7.313   -21.071 18.245   1.00 172.20 ? 184  ILE A O   1 
ATOM   1416  C  CB  . ILE A  1  184 ? 5.835   -20.616 15.517   1.00 189.10 ? 184  ILE A CB  1 
ATOM   1417  C  CG1 . ILE A  1  184 ? 4.546   -20.499 14.693   1.00 181.18 ? 184  ILE A CG1 1 
ATOM   1418  C  CG2 . ILE A  1  184 ? 7.024   -20.921 14.613   1.00 200.29 ? 184  ILE A CG2 1 
ATOM   1419  C  CD1 . ILE A  1  184 ? 4.640   -19.548 13.511   1.00 176.49 ? 184  ILE A CD1 1 
ATOM   1420  N  N   . SER A  1  185 ? 7.694   -22.971 17.084   1.00 183.89 ? 185  SER A N   1 
ATOM   1421  C  CA  . SER A  1  185 ? 8.966   -23.275 17.725   1.00 187.32 ? 185  SER A CA  1 
ATOM   1422  C  C   . SER A  1  185 ? 10.003  -23.571 16.653   1.00 209.00 ? 185  SER A C   1 
ATOM   1423  O  O   . SER A  1  185 ? 9.785   -24.438 15.801   1.00 214.61 ? 185  SER A O   1 
ATOM   1424  C  CB  . SER A  1  185 ? 8.826   -24.458 18.684   1.00 192.93 ? 185  SER A CB  1 
ATOM   1425  O  OG  . SER A  1  185 ? 10.023  -24.671 19.411   1.00 209.43 ? 185  SER A OG  1 
ATOM   1426  N  N   . ASP A  1  186 ? 11.123  -22.846 16.686   1.00 214.15 ? 186  ASP A N   1 
ATOM   1427  C  CA  . ASP A  1  186 ? 12.222  -23.074 15.757   1.00 216.93 ? 186  ASP A CA  1 
ATOM   1428  C  C   . ASP A  1  186 ? 13.542  -23.214 16.508   1.00 212.56 ? 186  ASP A C   1 
ATOM   1429  O  O   . ASP A  1  186 ? 13.770  -22.563 17.532   1.00 215.96 ? 186  ASP A O   1 
ATOM   1430  C  CB  . ASP A  1  186 ? 12.323  -21.945 14.727   1.00 205.72 ? 186  ASP A CB  1 
ATOM   1431  C  CG  . ASP A  1  186 ? 11.270  -22.056 13.649   1.00 208.67 ? 186  ASP A CG  1 
ATOM   1432  O  OD1 . ASP A  1  186 ? 11.373  -22.985 12.824   1.00 223.79 ? 186  ASP A OD1 1 
ATOM   1433  O  OD2 . ASP A  1  186 ? 10.334  -21.230 13.633   1.00 197.51 ? 186  ASP A OD2 1 
ATOM   1434  N  N   . GLN A  1  187 ? 14.416  -24.065 15.973   1.00 211.45 ? 187  GLN A N   1 
ATOM   1435  C  CA  . GLN A  1  187 ? 15.759  -24.231 16.517   1.00 216.22 ? 187  GLN A CA  1 
ATOM   1436  C  C   . GLN A  1  187 ? 16.621  -23.004 16.228   1.00 218.32 ? 187  GLN A C   1 
ATOM   1437  O  O   . GLN A  1  187 ? 16.644  -22.505 15.098   1.00 220.36 ? 187  GLN A O   1 
ATOM   1438  C  CB  . GLN A  1  187 ? 16.396  -25.485 15.932   1.00 224.80 ? 187  GLN A CB  1 
ATOM   1439  C  CG  . GLN A  1  187 ? 15.683  -26.759 16.335   1.00 225.39 ? 187  GLN A CG  1 
ATOM   1440  C  CD  . GLN A  1  187 ? 16.196  -27.968 15.589   1.00 246.51 ? 187  GLN A CD  1 
ATOM   1441  O  OE1 . GLN A  1  187 ? 16.968  -27.841 14.638   1.00 261.57 ? 187  GLN A OE1 1 
ATOM   1442  N  NE2 . GLN A  1  187 ? 15.777  -29.153 16.021   1.00 233.09 ? 187  GLN A NE2 1 
ATOM   1443  N  N   . VAL A  1  188 ? 17.317  -22.507 17.260   1.00 212.16 ? 188  VAL A N   1 
ATOM   1444  C  CA  . VAL A  1  188 ? 18.121  -21.290 17.118   1.00 217.42 ? 188  VAL A CA  1 
ATOM   1445  C  C   . VAL A  1  188 ? 19.206  -21.462 16.063   1.00 227.72 ? 188  VAL A C   1 
ATOM   1446  O  O   . VAL A  1  188 ? 19.651  -20.481 15.456   1.00 233.16 ? 188  VAL A O   1 
ATOM   1447  C  CB  . VAL A  1  188 ? 18.717  -20.868 18.479   1.00 217.85 ? 188  VAL A CB  1 
ATOM   1448  C  CG1 . VAL A  1  188 ? 17.603  -20.679 19.512   1.00 207.36 ? 188  VAL A CG1 1 
ATOM   1449  C  CG2 . VAL A  1  188 ? 19.769  -21.862 18.954   1.00 219.42 ? 188  VAL A CG2 1 
ATOM   1450  N  N   . ALA A  1  189 ? 19.655  -22.698 15.829   1.00 231.48 ? 189  ALA A N   1 
ATOM   1451  C  CA  . ALA A  1  189 ? 20.647  -22.920 14.786   1.00 238.52 ? 189  ALA A CA  1 
ATOM   1452  C  C   . ALA A  1  189 ? 20.052  -22.667 13.411   1.00 238.10 ? 189  ALA A C   1 
ATOM   1453  O  O   . ALA A  1  189 ? 20.764  -22.233 12.499   1.00 244.59 ? 189  ALA A O   1 
ATOM   1454  C  CB  . ALA A  1  189 ? 21.210  -24.339 14.873   1.00 243.60 ? 189  ALA A CB  1 
ATOM   1455  N  N   . GLU A  1  190 ? 18.758  -22.943 13.248   1.00 235.00 ? 190  GLU A N   1 
ATOM   1456  C  CA  . GLU A  1  190 ? 18.069  -22.703 11.986   1.00 239.88 ? 190  GLU A CA  1 
ATOM   1457  C  C   . GLU A  1  190 ? 17.634  -21.247 11.803   1.00 232.82 ? 190  GLU A C   1 
ATOM   1458  O  O   . GLU A  1  190 ? 17.563  -20.772 10.665   1.00 244.56 ? 190  GLU A O   1 
ATOM   1459  C  CB  . GLU A  1  190 ? 16.865  -23.640 11.888   1.00 239.18 ? 190  GLU A CB  1 
ATOM   1460  C  CG  . GLU A  1  190 ? 16.273  -23.789 10.501   1.00 244.07 ? 190  GLU A CG  1 
ATOM   1461  C  CD  . GLU A  1  190 ? 15.075  -24.720 10.501   1.00 239.53 ? 190  GLU A CD  1 
ATOM   1462  O  OE1 . GLU A  1  190 ? 14.669  -25.187 9.415    1.00 245.85 ? 190  GLU A OE1 1 
ATOM   1463  O  OE2 . GLU A  1  190 ? 14.550  -25.001 11.598   1.00 224.29 ? 190  GLU A OE2 1 
ATOM   1464  N  N   . ILE A  1  191 ? 17.342  -20.528 12.891   1.00 226.28 ? 191  ILE A N   1 
ATOM   1465  C  CA  . ILE A  1  191 ? 16.864  -19.149 12.781   1.00 222.71 ? 191  ILE A CA  1 
ATOM   1466  C  C   . ILE A  1  191 ? 17.939  -18.257 12.170   1.00 233.37 ? 191  ILE A C   1 
ATOM   1467  O  O   . ILE A  1  191 ? 17.669  -17.458 11.265   1.00 239.55 ? 191  ILE A O   1 
ATOM   1468  C  CB  . ILE A  1  191 ? 16.420  -18.630 14.161   1.00 217.49 ? 191  ILE A CB  1 
ATOM   1469  C  CG1 . ILE A  1  191 ? 15.240  -19.451 14.688   1.00 217.48 ? 191  ILE A CG1 1 
ATOM   1470  C  CG2 . ILE A  1  191 ? 16.086  -17.146 14.092   1.00 214.79 ? 191  ILE A CG2 1 
ATOM   1471  C  CD1 . ILE A  1  191 ? 14.776  -19.037 16.067   1.00 218.33 ? 191  ILE A CD1 1 
ATOM   1472  N  N   . VAL A  1  192 ? 19.171  -18.369 12.670   1.00 241.22 ? 192  VAL A N   1 
ATOM   1473  C  CA  . VAL A  1  192 ? 20.253  -17.519 12.186   1.00 246.86 ? 192  VAL A CA  1 
ATOM   1474  C  C   . VAL A  1  192 ? 20.782  -18.017 10.843   1.00 245.48 ? 192  VAL A C   1 
ATOM   1475  O  O   . VAL A  1  192 ? 21.121  -17.219 9.961    1.00 247.93 ? 192  VAL A O   1 
ATOM   1476  C  CB  . VAL A  1  192 ? 21.365  -17.432 13.252   1.00 246.96 ? 192  VAL A CB  1 
ATOM   1477  C  CG1 . VAL A  1  192 ? 21.787  -18.821 13.724   1.00 242.77 ? 192  VAL A CG1 1 
ATOM   1478  C  CG2 . VAL A  1  192 ? 22.560  -16.648 12.725   1.00 257.03 ? 192  VAL A CG2 1 
ATOM   1479  N  N   . SER A  1  193 ? 20.841  -19.337 10.654   1.00 236.99 ? 193  SER A N   1 
ATOM   1480  C  CA  . SER A  1  193 ? 21.428  -19.878 9.433    1.00 243.53 ? 193  SER A CA  1 
ATOM   1481  C  C   . SER A  1  193 ? 20.543  -19.601 8.225    1.00 241.98 ? 193  SER A C   1 
ATOM   1482  O  O   . SER A  1  193 ? 21.044  -19.272 7.144    1.00 246.83 ? 193  SER A O   1 
ATOM   1483  C  CB  . SER A  1  193 ? 21.667  -21.379 9.590    1.00 246.59 ? 193  SER A CB  1 
ATOM   1484  O  OG  . SER A  1  193 ? 20.448  -22.103 9.558    1.00 241.94 ? 193  SER A OG  1 
ATOM   1485  N  N   . LYS A  1  194 ? 19.230  -19.706 8.392    1.00 235.54 ? 194  LYS A N   1 
ATOM   1486  C  CA  . LYS A  1  194 ? 18.299  -19.511 7.293    1.00 233.96 ? 194  LYS A CA  1 
ATOM   1487  C  C   . LYS A  1  194 ? 17.867  -18.063 7.147    1.00 230.61 ? 194  LYS A C   1 
ATOM   1488  O  O   . LYS A  1  194 ? 17.009  -17.767 6.310    1.00 228.82 ? 194  LYS A O   1 
ATOM   1489  C  CB  . LYS A  1  194 ? 17.067  -20.396 7.495    1.00 229.21 ? 194  LYS A CB  1 
ATOM   1490  C  CG  . LYS A  1  194 ? 17.338  -21.883 7.391    1.00 232.96 ? 194  LYS A CG  1 
ATOM   1491  C  CD  . LYS A  1  194 ? 17.983  -22.242 6.073    1.00 240.12 ? 194  LYS A CD  1 
ATOM   1492  C  CE  . LYS A  1  194 ? 18.222  -23.737 5.990    1.00 245.55 ? 194  LYS A CE  1 
ATOM   1493  N  NZ  . LYS A  1  194 ? 19.010  -24.234 7.151    1.00 245.44 ? 194  LYS A NZ  1 
ATOM   1494  N  N   . TYR A  1  195 ? 18.429  -17.160 7.943    1.00 230.00 ? 195  TYR A N   1 
ATOM   1495  C  CA  . TYR A  1  195 ? 18.079  -15.750 7.849    1.00 227.35 ? 195  TYR A CA  1 
ATOM   1496  C  C   . TYR A  1  195 ? 18.624  -15.155 6.557    1.00 251.94 ? 195  TYR A C   1 
ATOM   1497  O  O   . TYR A  1  195 ? 19.781  -15.386 6.194    1.00 252.79 ? 195  TYR A O   1 
ATOM   1498  C  CB  . TYR A  1  195 ? 18.625  -14.988 9.053    1.00 226.12 ? 195  TYR A CB  1 
ATOM   1499  C  CG  . TYR A  1  195 ? 18.487  -13.489 8.930    1.00 224.82 ? 195  TYR A CG  1 
ATOM   1500  C  CD1 . TYR A  1  195 ? 17.239  -12.881 8.932    1.00 219.15 ? 195  TYR A CD1 1 
ATOM   1501  C  CD2 . TYR A  1  195 ? 19.609  -12.682 8.793    1.00 243.89 ? 195  TYR A CD2 1 
ATOM   1502  C  CE1 . TYR A  1  195 ? 17.114  -11.504 8.810    1.00 218.39 ? 195  TYR A CE1 1 
ATOM   1503  C  CE2 . TYR A  1  195 ? 19.494  -11.307 8.673    1.00 243.29 ? 195  TYR A CE2 1 
ATOM   1504  C  CZ  . TYR A  1  195 ? 18.244  -10.725 8.683    1.00 228.67 ? 195  TYR A CZ  1 
ATOM   1505  O  OH  . TYR A  1  195 ? 18.127  -9.358  8.564    1.00 222.86 ? 195  TYR A OH  1 
ATOM   1506  N  N   . ASP A  1  196 ? 17.786  -14.379 5.866    1.00 262.13 ? 196  ASP A N   1 
ATOM   1507  C  CA  . ASP A  1  196 ? 18.164  -13.701 4.630    1.00 263.95 ? 196  ASP A CA  1 
ATOM   1508  C  C   . ASP A  1  196 ? 17.450  -12.359 4.526    1.00 259.01 ? 196  ASP A C   1 
ATOM   1509  O  O   . ASP A  1  196 ? 16.220  -12.322 4.391    1.00 251.73 ? 196  ASP A O   1 
ATOM   1510  C  CB  . ASP A  1  196 ? 17.838  -14.563 3.407    1.00 255.12 ? 196  ASP A CB  1 
ATOM   1511  C  CG  . ASP A  1  196 ? 18.933  -15.560 3.080    1.00 261.50 ? 196  ASP A CG  1 
ATOM   1512  O  OD1 . ASP A  1  196 ? 20.106  -15.296 3.418    1.00 258.55 ? 196  ASP A OD1 1 
ATOM   1513  O  OD2 . ASP A  1  196 ? 18.619  -16.610 2.480    1.00 266.48 ? 196  ASP A OD2 1 
ATOM   1514  N  N   . PRO A  1  197 ? 18.182  -11.239 4.568    1.00 256.16 ? 197  PRO A N   1 
ATOM   1515  C  CA  . PRO A  1  197 ? 17.521  -9.922  4.549    1.00 256.42 ? 197  PRO A CA  1 
ATOM   1516  C  C   . PRO A  1  197 ? 16.759  -9.631  3.266    1.00 264.04 ? 197  PRO A C   1 
ATOM   1517  O  O   . PRO A  1  197 ? 16.000  -8.653  3.228    1.00 257.45 ? 197  PRO A O   1 
ATOM   1518  C  CB  . PRO A  1  197 ? 18.688  -8.941  4.740    1.00 255.53 ? 197  PRO A CB  1 
ATOM   1519  C  CG  . PRO A  1  197 ? 19.883  -9.682  4.240    1.00 255.67 ? 197  PRO A CG  1 
ATOM   1520  C  CD  . PRO A  1  197 ? 19.649  -11.118 4.627    1.00 254.68 ? 197  PRO A CD  1 
ATOM   1521  N  N   . ASN A  1  198 ? 16.929  -10.441 2.223    1.00 274.55 ? 198  ASN A N   1 
ATOM   1522  C  CA  . ASN A  1  198 ? 16.217  -10.270 0.965    1.00 276.62 ? 198  ASN A CA  1 
ATOM   1523  C  C   . ASN A  1  198 ? 15.047  -11.232 0.824    1.00 279.84 ? 198  ASN A C   1 
ATOM   1524  O  O   . ASN A  1  198 ? 14.350  -11.197 -0.196   1.00 282.76 ? 198  ASN A O   1 
ATOM   1525  C  CB  . ASN A  1  198 ? 17.181  -10.449 -0.214   1.00 279.83 ? 198  ASN A CB  1 
ATOM   1526  C  CG  . ASN A  1  198 ? 17.913  -11.779 -0.172   1.00 282.73 ? 198  ASN A CG  1 
ATOM   1527  O  OD1 . ASN A  1  198 ? 18.223  -12.294 0.902    1.00 276.53 ? 198  ASN A OD1 1 
ATOM   1528  N  ND2 . ASN A  1  198 ? 18.202  -12.334 -1.344   1.00 292.10 ? 198  ASN A ND2 1 
ATOM   1529  N  N   . VAL A  1  199 ? 14.815  -12.083 1.820    1.00 276.13 ? 199  VAL A N   1 
ATOM   1530  C  CA  . VAL A  1  199 ? 13.704  -13.027 1.829    1.00 265.51 ? 199  VAL A CA  1 
ATOM   1531  C  C   . VAL A  1  199 ? 12.752  -12.613 2.942    1.00 246.39 ? 199  VAL A C   1 
ATOM   1532  O  O   . VAL A  1  199 ? 13.142  -12.541 4.115    1.00 234.20 ? 199  VAL A O   1 
ATOM   1533  C  CB  . VAL A  1  199 ? 14.187  -14.473 2.018    1.00 266.63 ? 199  VAL A CB  1 
ATOM   1534  C  CG1 . VAL A  1  199 ? 13.006  -15.434 1.980    1.00 266.55 ? 199  VAL A CG1 1 
ATOM   1535  C  CG2 . VAL A  1  199 ? 15.204  -14.833 0.946    1.00 271.18 ? 199  VAL A CG2 1 
ATOM   1536  N  N   . TYR A  1  200 ? 11.505  -12.333 2.573    1.00 241.55 ? 200  TYR A N   1 
ATOM   1537  C  CA  . TYR A  1  200 ? 10.530  -11.840 3.531    1.00 247.26 ? 200  TYR A CA  1 
ATOM   1538  C  C   . TYR A  1  200 ? 9.689   -12.950 4.139    1.00 239.12 ? 200  TYR A C   1 
ATOM   1539  O  O   . TYR A  1  200 ? 9.074   -12.741 5.190    1.00 240.88 ? 200  TYR A O   1 
ATOM   1540  C  CB  . TYR A  1  200 ? 9.602   -10.814 2.867    1.00 257.37 ? 200  TYR A CB  1 
ATOM   1541  C  CG  . TYR A  1  200 ? 10.318  -9.764  2.044    1.00 264.33 ? 200  TYR A CG  1 
ATOM   1542  C  CD1 . TYR A  1  200 ? 11.487  -9.167  2.502    1.00 260.88 ? 200  TYR A CD1 1 
ATOM   1543  C  CD2 . TYR A  1  200 ? 9.820   -9.366  0.810    1.00 270.66 ? 200  TYR A CD2 1 
ATOM   1544  C  CE1 . TYR A  1  200 ? 12.140  -8.208  1.751    1.00 265.64 ? 200  TYR A CE1 1 
ATOM   1545  C  CE2 . TYR A  1  200 ? 10.465  -8.407  0.052    1.00 278.40 ? 200  TYR A CE2 1 
ATOM   1546  C  CZ  . TYR A  1  200 ? 11.623  -7.832  0.527    1.00 278.49 ? 200  TYR A CZ  1 
ATOM   1547  O  OH  . TYR A  1  200 ? 12.266  -6.877  -0.227   1.00 289.08 ? 200  TYR A OH  1 
ATOM   1548  N  N   . SER A  1  201 ? 9.660   -14.126 3.516    1.00 237.23 ? 201  SER A N   1 
ATOM   1549  C  CA  . SER A  1  201 ? 8.907   -15.272 4.020    1.00 236.81 ? 201  SER A CA  1 
ATOM   1550  C  C   . SER A  1  201 ? 9.840   -16.476 4.005    1.00 241.09 ? 201  SER A C   1 
ATOM   1551  O  O   . SER A  1  201 ? 9.934   -17.186 3.001    1.00 238.79 ? 201  SER A O   1 
ATOM   1552  C  CB  . SER A  1  201 ? 7.665   -15.510 3.179    1.00 242.96 ? 201  SER A CB  1 
ATOM   1553  O  OG  . SER A  1  201 ? 6.776   -14.411 3.271    1.00 251.45 ? 201  SER A OG  1 
ATOM   1554  N  N   . ILE A  1  202 ? 10.531  -16.701 5.115    1.00 248.10 ? 202  ILE A N   1 
ATOM   1555  C  CA  . ILE A  1  202 ? 11.480  -17.801 5.221    1.00 250.83 ? 202  ILE A CA  1 
ATOM   1556  C  C   . ILE A  1  202 ? 10.757  -19.010 5.795    1.00 241.01 ? 202  ILE A C   1 
ATOM   1557  O  O   . ILE A  1  202 ? 10.117  -18.924 6.851    1.00 232.81 ? 202  ILE A O   1 
ATOM   1558  C  CB  . ILE A  1  202 ? 12.684  -17.412 6.094    1.00 246.65 ? 202  ILE A CB  1 
ATOM   1559  C  CG1 . ILE A  1  202 ? 13.355  -16.144 5.558    1.00 247.12 ? 202  ILE A CG1 1 
ATOM   1560  C  CG2 . ILE A  1  202 ? 13.686  -18.552 6.153    1.00 245.67 ? 202  ILE A CG2 1 
ATOM   1561  C  CD1 . ILE A  1  202 ? 14.534  -15.680 6.391    1.00 248.69 ? 202  ILE A CD1 1 
ATOM   1562  N  N   . LYS A  1  203 ? 10.850  -20.135 5.096    1.00 241.36 ? 203  LYS A N   1 
ATOM   1563  C  CA  . LYS A  1  203 ? 10.260  -21.389 5.539    1.00 237.78 ? 203  LYS A CA  1 
ATOM   1564  C  C   . LYS A  1  203 ? 11.321  -22.210 6.258    1.00 229.82 ? 203  LYS A C   1 
ATOM   1565  O  O   . LYS A  1  203 ? 12.403  -22.450 5.710    1.00 225.19 ? 203  LYS A O   1 
ATOM   1566  C  CB  . LYS A  1  203 ? 9.686   -22.170 4.355    1.00 248.04 ? 203  LYS A CB  1 
ATOM   1567  C  CG  . LYS A  1  203 ? 8.731   -23.276 4.761    1.00 242.51 ? 203  LYS A CG  1 
ATOM   1568  C  CD  . LYS A  1  203 ? 7.699   -22.749 5.743    1.00 221.82 ? 203  LYS A CD  1 
ATOM   1569  C  CE  . LYS A  1  203 ? 6.808   -23.861 6.259    1.00 219.25 ? 203  LYS A CE  1 
ATOM   1570  N  NZ  . LYS A  1  203 ? 5.848   -23.364 7.282    1.00 211.36 ? 203  LYS A NZ  1 
ATOM   1571  N  N   . TYR A  1  204 ? 11.008  -22.638 7.477    1.00 234.07 ? 204  TYR A N   1 
ATOM   1572  C  CA  . TYR A  1  204 ? 11.911  -23.431 8.303    1.00 239.84 ? 204  TYR A CA  1 
ATOM   1573  C  C   . TYR A  1  204 ? 11.434  -24.879 8.354    1.00 252.39 ? 204  TYR A C   1 
ATOM   1574  O  O   . TYR A  1  204 ? 10.245  -25.136 8.573    1.00 258.86 ? 204  TYR A O   1 
ATOM   1575  C  CB  . TYR A  1  204 ? 12.010  -22.838 9.710    1.00 232.86 ? 204  TYR A CB  1 
ATOM   1576  C  CG  . TYR A  1  204 ? 12.342  -21.356 9.732    1.00 217.14 ? 204  TYR A CG  1 
ATOM   1577  C  CD1 . TYR A  1  204 ? 13.657  -20.928 9.623    1.00 215.31 ? 204  TYR A CD1 1 
ATOM   1578  C  CD2 . TYR A  1  204 ? 11.346  -20.389 9.854    1.00 208.13 ? 204  TYR A CD2 1 
ATOM   1579  C  CE1 . TYR A  1  204 ? 13.979  -19.587 9.642    1.00 214.75 ? 204  TYR A CE1 1 
ATOM   1580  C  CE2 . TYR A  1  204 ? 11.661  -19.036 9.873    1.00 207.31 ? 204  TYR A CE2 1 
ATOM   1581  C  CZ  . TYR A  1  204 ? 12.983  -18.644 9.766    1.00 209.89 ? 204  TYR A CZ  1 
ATOM   1582  O  OH  . TYR A  1  204 ? 13.323  -17.311 9.781    1.00 209.62 ? 204  TYR A OH  1 
ATOM   1583  N  N   . ASN A  1  205 ? 12.363  -25.820 8.136    1.00 258.87 ? 205  ASN A N   1 
ATOM   1584  C  CA  . ASN A  1  205 ? 11.991  -27.231 8.037    1.00 251.55 ? 205  ASN A CA  1 
ATOM   1585  C  C   . ASN A  1  205 ? 11.666  -27.832 9.402    1.00 236.59 ? 205  ASN A C   1 
ATOM   1586  O  O   . ASN A  1  205 ? 10.718  -28.615 9.529    1.00 231.82 ? 205  ASN A O   1 
ATOM   1587  C  CB  . ASN A  1  205 ? 13.105  -28.026 7.355    1.00 258.93 ? 205  ASN A CB  1 
ATOM   1588  C  CG  . ASN A  1  205 ? 13.425  -27.505 5.969    1.00 255.63 ? 205  ASN A CG  1 
ATOM   1589  O  OD1 . ASN A  1  205 ? 14.504  -26.965 5.735    1.00 247.15 ? 205  ASN A OD1 1 
ATOM   1590  N  ND2 . ASN A  1  205 ? 12.482  -27.658 5.041    1.00 258.56 ? 205  ASN A ND2 1 
ATOM   1591  N  N   . ASN A  1  206 ? 12.431  -27.483 10.436   1.00 215.51 ? 206  ASN A N   1 
ATOM   1592  C  CA  . ASN A  1  206 ? 12.209  -28.010 11.774   1.00 212.63 ? 206  ASN A CA  1 
ATOM   1593  C  C   . ASN A  1  206 ? 11.206  -27.184 12.564   1.00 210.83 ? 206  ASN A C   1 
ATOM   1594  O  O   . ASN A  1  206 ? 11.238  -27.199 13.800   1.00 212.91 ? 206  ASN A O   1 
ATOM   1595  C  CB  . ASN A  1  206 ? 13.534  -28.098 12.527   1.00 216.28 ? 206  ASN A CB  1 
ATOM   1596  C  CG  . ASN A  1  206 ? 14.536  -28.981 11.821   1.00 224.02 ? 206  ASN A CG  1 
ATOM   1597  O  OD1 . ASN A  1  206 ? 14.172  -29.996 11.228   1.00 228.52 ? 206  ASN A OD1 1 
ATOM   1598  N  ND2 . ASN A  1  206 ? 15.804  -28.588 11.857   1.00 228.34 ? 206  ASN A ND2 1 
ATOM   1599  N  N   . GLN A  1  207 ? 10.323  -26.469 11.870   1.00 225.83 ? 207  GLN A N   1 
ATOM   1600  C  CA  . GLN A  1  207 ? 9.310   -25.645 12.516   1.00 210.17 ? 207  GLN A CA  1 
ATOM   1601  C  C   . GLN A  1  207 ? 8.209   -26.526 13.091   1.00 198.24 ? 207  GLN A C   1 
ATOM   1602  O  O   . GLN A  1  207 ? 7.699   -27.424 12.416   1.00 209.06 ? 207  GLN A O   1 
ATOM   1603  C  CB  . GLN A  1  207 ? 8.728   -24.651 11.505   1.00 202.23 ? 207  GLN A CB  1 
ATOM   1604  C  CG  . GLN A  1  207 ? 7.777   -23.594 12.063   1.00 196.48 ? 207  GLN A CG  1 
ATOM   1605  C  CD  . GLN A  1  207 ? 7.356   -22.580 11.005   1.00 201.51 ? 207  GLN A CD  1 
ATOM   1606  O  OE1 . GLN A  1  207 ? 8.030   -22.414 9.988    1.00 206.55 ? 207  GLN A OE1 1 
ATOM   1607  N  NE2 . GLN A  1  207 ? 6.240   -21.900 11.241   1.00 196.57 ? 207  GLN A NE2 1 
ATOM   1608  N  N   . LEU A  1  208 ? 7.844   -26.264 14.340   1.00 188.29 ? 208  LEU A N   1 
ATOM   1609  C  CA  . LEU A  1  208 ? 6.721   -26.916 14.992   1.00 188.76 ? 208  LEU A CA  1 
ATOM   1610  C  C   . LEU A  1  208 ? 5.610   -25.888 15.158   1.00 194.76 ? 208  LEU A C   1 
ATOM   1611  O  O   . LEU A  1  208 ? 5.836   -24.821 15.739   1.00 208.31 ? 208  LEU A O   1 
ATOM   1612  C  CB  . LEU A  1  208 ? 7.151   -27.486 16.346   1.00 195.02 ? 208  LEU A CB  1 
ATOM   1613  C  CG  . LEU A  1  208 ? 8.200   -28.600 16.290   1.00 190.43 ? 208  LEU A CG  1 
ATOM   1614  C  CD1 . LEU A  1  208 ? 8.533   -29.085 17.688   1.00 190.14 ? 208  LEU A CD1 1 
ATOM   1615  C  CD2 . LEU A  1  208 ? 7.729   -29.751 15.417   1.00 193.06 ? 208  LEU A CD2 1 
ATOM   1616  N  N   . ALA A  1  209 ? 4.413   -26.207 14.664   1.00 191.92 ? 209  ALA A N   1 
ATOM   1617  C  CA  . ALA A  1  209 ? 3.332   -25.229 14.688   1.00 187.17 ? 209  ALA A CA  1 
ATOM   1618  C  C   . ALA A  1  209 ? 1.980   -25.905 14.866   1.00 176.41 ? 209  ALA A C   1 
ATOM   1619  O  O   . ALA A  1  209 ? 1.745   -26.997 14.338   1.00 181.43 ? 209  ALA A O   1 
ATOM   1620  C  CB  . ALA A  1  209 ? 3.332   -24.393 13.404   1.00 184.95 ? 209  ALA A CB  1 
ATOM   1621  N  N   . THR A  1  210 ? 1.099   -25.247 15.625   1.00 168.80 ? 210  THR A N   1 
ATOM   1622  C  CA  . THR A  1  210 ? -0.287  -25.685 15.784   1.00 168.41 ? 210  THR A CA  1 
ATOM   1623  C  C   . THR A  1  210 ? -1.075  -25.298 14.539   1.00 187.56 ? 210  THR A C   1 
ATOM   1624  O  O   . THR A  1  210 ? -1.343  -24.116 14.302   1.00 193.22 ? 210  THR A O   1 
ATOM   1625  C  CB  . THR A  1  210 ? -0.913  -25.076 17.035   1.00 167.47 ? 210  THR A CB  1 
ATOM   1626  O  OG1 . THR A  1  210 ? -0.720  -23.658 17.026   1.00 161.62 ? 210  THR A OG1 1 
ATOM   1627  C  CG2 . THR A  1  210 ? -0.274  -25.656 18.286   1.00 179.23 ? 210  THR A CG2 1 
ATOM   1628  N  N   . ARG A  1  211 ? -1.432  -26.294 13.737   1.00 194.10 ? 211  ARG A N   1 
ATOM   1629  C  CA  . ARG A  1  211 ? -2.128  -26.068 12.483   1.00 198.80 ? 211  ARG A CA  1 
ATOM   1630  C  C   . ARG A  1  211 ? -3.593  -25.677 12.733   1.00 207.20 ? 211  ARG A C   1 
ATOM   1631  O  O   . ARG A  1  211 ? -4.134  -25.824 13.832   1.00 208.54 ? 211  ARG A O   1 
ATOM   1632  C  CB  . ARG A  1  211 ? -1.990  -27.312 11.604   1.00 207.36 ? 211  ARG A CB  1 
ATOM   1633  C  CG  . ARG A  1  211 ? -0.522  -27.556 11.218   1.00 226.31 ? 211  ARG A CG  1 
ATOM   1634  C  CD  . ARG A  1  211 ? -0.283  -28.842 10.435   1.00 232.80 ? 211  ARG A CD  1 
ATOM   1635  N  NE  . ARG A  1  211 ? 1.117   -28.964 10.028   1.00 212.74 ? 211  ARG A NE  1 
ATOM   1636  C  CZ  . ARG A  1  211 ? 2.075   -29.522 10.763   1.00 198.52 ? 211  ARG A CZ  1 
ATOM   1637  N  NH1 . ARG A  1  211 ? 1.806   -30.024 11.960   1.00 193.05 ? 211  ARG A NH1 1 
ATOM   1638  N  NH2 . ARG A  1  211 ? 3.312   -29.573 10.296   1.00 201.54 ? 211  ARG A NH2 1 
ATOM   1639  N  N   . THR A  1  212 ? -4.235  -25.166 11.683   1.00 208.69 ? 212  THR A N   1 
ATOM   1640  C  CA  . THR A  1  212 ? -5.600  -24.654 11.778   1.00 205.93 ? 212  THR A CA  1 
ATOM   1641  C  C   . THR A  1  212 ? -6.619  -25.758 12.067   1.00 204.56 ? 212  THR A C   1 
ATOM   1642  O  O   . THR A  1  212 ? -6.488  -26.892 11.596   1.00 217.32 ? 212  THR A O   1 
ATOM   1643  C  CB  . THR A  1  212 ? -5.967  -23.920 10.485   1.00 212.91 ? 212  THR A CB  1 
ATOM   1644  O  OG1 . THR A  1  212 ? -7.358  -23.573 10.491   1.00 210.66 ? 212  THR A OG1 1 
ATOM   1645  C  CG2 . THR A  1  212 ? -5.665  -24.783 9.265    1.00 222.88 ? 212  THR A CG2 1 
ATOM   1646  N  N   . ALA A  1  213 ? -7.627  -25.424 12.873   1.00 195.93 ? 213  ALA A N   1 
ATOM   1647  C  CA  . ALA A  1  213 ? -8.695  -26.337 13.270   1.00 203.62 ? 213  ALA A CA  1 
ATOM   1648  C  C   . ALA A  1  213 ? -10.055 -25.821 12.781   1.00 202.42 ? 213  ALA A C   1 
ATOM   1649  O  O   . ALA A  1  213 ? -10.143 -24.923 11.937   1.00 207.62 ? 213  ALA A O   1 
ATOM   1650  C  CB  . ALA A  1  213 ? -8.678  -26.540 14.786   1.00 203.42 ? 213  ALA A CB  1 
ATOM   1651  N  N   . GLN A  1  214 ? -11.124 -26.423 13.306   1.00 189.69 ? 214  GLN A N   1 
ATOM   1652  C  CA  . GLN A  1  214 ? -12.480 -26.068 12.911   1.00 190.47 ? 214  GLN A CA  1 
ATOM   1653  C  C   . GLN A  1  214 ? -12.830 -24.641 13.318   1.00 190.02 ? 214  GLN A C   1 
ATOM   1654  O  O   . GLN A  1  214 ? -12.211 -24.038 14.198   1.00 195.58 ? 214  GLN A O   1 
ATOM   1655  C  CB  . GLN A  1  214 ? -13.502 -27.030 13.511   1.00 187.22 ? 214  GLN A CB  1 
ATOM   1656  C  CG  . GLN A  1  214 ? -13.357 -28.464 13.055   1.00 193.29 ? 214  GLN A CG  1 
ATOM   1657  C  CD  . GLN A  1  214 ? -12.372 -29.237 13.887   1.00 191.52 ? 214  GLN A CD  1 
ATOM   1658  O  OE1 . GLN A  1  214 ? -11.450 -28.668 14.469   1.00 190.85 ? 214  GLN A OE1 1 
ATOM   1659  N  NE2 . GLN A  1  214 ? -12.564 -30.547 13.958   1.00 199.95 ? 214  GLN A NE2 1 
ATOM   1660  N  N   . ALA A  1  215 ? -13.855 -24.105 12.648   1.00 189.24 ? 215  ALA A N   1 
ATOM   1661  C  CA  . ALA A  1  215 ? -14.269 -22.717 12.835   1.00 186.12 ? 215  ALA A CA  1 
ATOM   1662  C  C   . ALA A  1  215 ? -14.783 -22.423 14.241   1.00 185.04 ? 215  ALA A C   1 
ATOM   1663  O  O   . ALA A  1  215 ? -14.820 -21.252 14.634   1.00 183.53 ? 215  ALA A O   1 
ATOM   1664  C  CB  . ALA A  1  215 ? -15.340 -22.357 11.803   1.00 184.40 ? 215  ALA A CB  1 
ATOM   1665  N  N   . ILE A  1  216 ? -15.195 -23.440 15.003   1.00 186.75 ? 216  ILE A N   1 
ATOM   1666  C  CA  . ILE A  1  216 ? -15.697 -23.188 16.352   1.00 174.69 ? 216  ILE A CA  1 
ATOM   1667  C  C   . ILE A  1  216 ? -14.601 -22.663 17.265   1.00 170.36 ? 216  ILE A C   1 
ATOM   1668  O  O   . ILE A  1  216 ? -14.896 -22.006 18.273   1.00 159.63 ? 216  ILE A O   1 
ATOM   1669  C  CB  . ILE A  1  216 ? -16.330 -24.459 16.955   1.00 172.38 ? 216  ILE A CB  1 
ATOM   1670  C  CG1 . ILE A  1  216 ? -17.089 -24.129 18.247   1.00 174.03 ? 216  ILE A CG1 1 
ATOM   1671  C  CG2 . ILE A  1  216 ? -15.268 -25.513 17.205   1.00 178.84 ? 216  ILE A CG2 1 
ATOM   1672  C  CD1 . ILE A  1  216 ? -17.648 -25.343 18.964   1.00 180.82 ? 216  ILE A CD1 1 
ATOM   1673  N  N   . PHE A  1  217 ? -13.340 -22.927 16.938   1.00 185.94 ? 217  PHE A N   1 
ATOM   1674  C  CA  . PHE A  1  217 ? -12.213 -22.518 17.763   1.00 186.37 ? 217  PHE A CA  1 
ATOM   1675  C  C   . PHE A  1  217 ? -11.674 -21.136 17.413   1.00 181.44 ? 217  PHE A C   1 
ATOM   1676  O  O   . PHE A  1  217 ? -10.696 -20.703 18.030   1.00 176.82 ? 217  PHE A O   1 
ATOM   1677  C  CB  . PHE A  1  217 ? -11.090 -23.552 17.658   1.00 172.52 ? 217  PHE A CB  1 
ATOM   1678  C  CG  . PHE A  1  217 ? -11.473 -24.910 18.169   1.00 174.01 ? 217  PHE A CG  1 
ATOM   1679  C  CD1 . PHE A  1  217 ? -11.540 -25.159 19.530   1.00 195.31 ? 217  PHE A CD1 1 
ATOM   1680  C  CD2 . PHE A  1  217 ? -11.772 -25.935 17.288   1.00 178.45 ? 217  PHE A CD2 1 
ATOM   1681  C  CE1 . PHE A  1  217 ? -11.894 -26.410 20.004   1.00 204.02 ? 217  PHE A CE1 1 
ATOM   1682  C  CE2 . PHE A  1  217 ? -12.128 -27.187 17.753   1.00 188.53 ? 217  PHE A CE2 1 
ATOM   1683  C  CZ  . PHE A  1  217 ? -12.189 -27.425 19.113   1.00 202.41 ? 217  PHE A CZ  1 
ATOM   1684  N  N   . ASP A  1  218 ? -12.274 -20.436 16.449   1.00 194.41 ? 218  ASP A N   1 
ATOM   1685  C  CA  . ASP A  1  218 ? -11.875 -19.061 16.184   1.00 185.17 ? 218  ASP A CA  1 
ATOM   1686  C  C   . ASP A  1  218 ? -12.083 -18.202 17.427   1.00 173.07 ? 218  ASP A C   1 
ATOM   1687  O  O   . ASP A  1  218 ? -12.883 -18.521 18.313   1.00 183.08 ? 218  ASP A O   1 
ATOM   1688  C  CB  . ASP A  1  218 ? -12.668 -18.460 15.017   1.00 177.17 ? 218  ASP A CB  1 
ATOM   1689  C  CG  . ASP A  1  218 ? -12.392 -19.145 13.687   1.00 174.05 ? 218  ASP A CG  1 
ATOM   1690  O  OD1 . ASP A  1  218 ? -11.506 -20.022 13.628   1.00 181.93 ? 218  ASP A OD1 1 
ATOM   1691  O  OD2 . ASP A  1  218 ? -13.062 -18.788 12.691   1.00 165.69 ? 218  ASP A OD2 1 
ATOM   1692  N  N   . ASP A  1  219 ? -11.324 -17.107 17.493   1.00 142.09 ? 219  ASP A N   1 
ATOM   1693  C  CA  . ASP A  1  219 ? -11.425 -16.136 18.582   1.00 138.23 ? 219  ASP A CA  1 
ATOM   1694  C  C   . ASP A  1  219 ? -11.115 -16.799 19.927   1.00 135.26 ? 219  ASP A C   1 
ATOM   1695  O  O   . ASP A  1  219 ? -11.864 -16.689 20.898   1.00 133.99 ? 219  ASP A O   1 
ATOM   1696  C  CB  . ASP A  1  219 ? -12.804 -15.467 18.575   1.00 156.46 ? 219  ASP A CB  1 
ATOM   1697  C  CG  . ASP A  1  219 ? -12.907 -14.318 19.551   1.00 188.18 ? 219  ASP A CG  1 
ATOM   1698  O  OD1 . ASP A  1  219 ? -11.959 -13.506 19.617   1.00 151.29 ? 219  ASP A OD1 1 
ATOM   1699  O  OD2 . ASP A  1  219 ? -13.944 -14.223 20.243   1.00 220.18 ? 219  ASP A OD2 1 
ATOM   1700  N  N   . SER A  1  220 ? -9.983  -17.494 19.974   1.00 136.04 ? 220  SER A N   1 
ATOM   1701  C  CA  . SER A  1  220 ? -9.541  -18.198 21.172   1.00 158.89 ? 220  SER A CA  1 
ATOM   1702  C  C   . SER A  1  220 ? -8.286  -17.610 21.791   1.00 165.56 ? 220  SER A C   1 
ATOM   1703  O  O   . SER A  1  220 ? -8.067  -17.787 22.993   1.00 159.33 ? 220  SER A O   1 
ATOM   1704  C  CB  . SER A  1  220 ? -9.293  -19.683 20.866   1.00 168.95 ? 220  SER A CB  1 
ATOM   1705  O  OG  . SER A  1  220 ? -10.511 -20.377 20.650   1.00 176.46 ? 220  SER A OG  1 
ATOM   1706  N  N   . TYR A  1  221 ? -7.445  -16.951 20.995   1.00 150.66 ? 221  TYR A N   1 
ATOM   1707  C  CA  . TYR A  1  221 ? -6.242  -16.289 21.497   1.00 137.57 ? 221  TYR A CA  1 
ATOM   1708  C  C   . TYR A  1  221 ? -5.248  -17.296 22.087   1.00 138.50 ? 221  TYR A C   1 
ATOM   1709  O  O   . TYR A  1  221 ? -4.699  -17.085 23.171   1.00 138.28 ? 221  TYR A O   1 
ATOM   1710  C  CB  . TYR A  1  221 ? -6.593  -15.199 22.522   1.00 136.24 ? 221  TYR A CB  1 
ATOM   1711  C  CG  . TYR A  1  221 ? -7.329  -13.977 21.980   1.00 135.98 ? 221  TYR A CG  1 
ATOM   1712  C  CD1 . TYR A  1  221 ? -7.715  -13.892 20.646   1.00 136.77 ? 221  TYR A CD1 1 
ATOM   1713  C  CD2 . TYR A  1  221 ? -7.630  -12.902 22.812   1.00 135.34 ? 221  TYR A CD2 1 
ATOM   1714  C  CE1 . TYR A  1  221 ? -8.384  -12.769 20.159   1.00 168.50 ? 221  TYR A CE1 1 
ATOM   1715  C  CE2 . TYR A  1  221 ? -8.297  -11.778 22.333   1.00 135.52 ? 221  TYR A CE2 1 
ATOM   1716  C  CZ  . TYR A  1  221 ? -8.672  -11.718 21.007   1.00 136.27 ? 221  TYR A CZ  1 
ATOM   1717  O  OH  . TYR A  1  221 ? -9.330  -10.609 20.528   1.00 136.78 ? 221  TYR A OH  1 
ATOM   1718  N  N   . LEU A  1  222 ? -5.056  -18.428 21.400   1.00 139.83 ? 222  LEU A N   1 
ATOM   1719  C  CA  . LEU A  1  222 ? -3.972  -19.344 21.750   1.00 163.42 ? 222  LEU A CA  1 
ATOM   1720  C  C   . LEU A  1  222 ? -2.619  -18.684 21.504   1.00 161.38 ? 222  LEU A C   1 
ATOM   1721  O  O   . LEU A  1  222 ? -2.351  -18.176 20.412   1.00 155.18 ? 222  LEU A O   1 
ATOM   1722  C  CB  . LEU A  1  222 ? -4.074  -20.643 20.946   1.00 166.25 ? 222  LEU A CB  1 
ATOM   1723  C  CG  . LEU A  1  222 ? -2.818  -21.531 20.965   1.00 145.80 ? 222  LEU A CG  1 
ATOM   1724  C  CD1 . LEU A  1  222 ? -2.519  -22.055 22.369   1.00 145.40 ? 222  LEU A CD1 1 
ATOM   1725  C  CD2 . LEU A  1  222 ? -2.917  -22.680 19.965   1.00 147.93 ? 222  LEU A CD2 1 
ATOM   1726  N  N   . GLY A  1  223 ? -1.749  -18.733 22.507   1.00 160.56 ? 223  GLY A N   1 
ATOM   1727  C  CA  . GLY A  1  223 ? -0.467  -18.063 22.448   1.00 145.97 ? 223  GLY A CA  1 
ATOM   1728  C  C   . GLY A  1  223 ? -0.425  -16.737 23.169   1.00 144.89 ? 223  GLY A C   1 
ATOM   1729  O  O   . GLY A  1  223 ? 0.567   -16.010 23.038   1.00 146.65 ? 223  GLY A O   1 
ATOM   1730  N  N   . TYR A  1  224 ? -1.479  -16.400 23.917   1.00 166.21 ? 224  TYR A N   1 
ATOM   1731  C  CA  . TYR A  1  224 ? -1.532  -15.131 24.635   1.00 170.57 ? 224  TYR A CA  1 
ATOM   1732  C  C   . TYR A  1  224 ? -0.412  -15.034 25.661   1.00 143.01 ? 224  TYR A C   1 
ATOM   1733  O  O   . TYR A  1  224 ? 0.168   -13.962 25.858   1.00 143.95 ? 224  TYR A O   1 
ATOM   1734  C  CB  . TYR A  1  224 ? -2.902  -14.975 25.302   1.00 139.13 ? 224  TYR A CB  1 
ATOM   1735  C  CG  . TYR A  1  224 ? -3.233  -13.572 25.770   1.00 138.53 ? 224  TYR A CG  1 
ATOM   1736  C  CD1 . TYR A  1  224 ? -3.831  -12.659 24.908   1.00 138.30 ? 224  TYR A CD1 1 
ATOM   1737  C  CD2 . TYR A  1  224 ? -2.972  -13.165 27.072   1.00 138.55 ? 224  TYR A CD2 1 
ATOM   1738  C  CE1 . TYR A  1  224 ? -4.144  -11.376 25.320   1.00 138.17 ? 224  TYR A CE1 1 
ATOM   1739  C  CE2 . TYR A  1  224 ? -3.283  -11.881 27.492   1.00 138.43 ? 224  TYR A CE2 1 
ATOM   1740  C  CZ  . TYR A  1  224 ? -3.871  -10.992 26.611   1.00 138.27 ? 224  TYR A CZ  1 
ATOM   1741  O  OH  . TYR A  1  224 ? -4.191  -9.715  27.014   1.00 138.56 ? 224  TYR A OH  1 
ATOM   1742  N  N   . SER A  1  225 ? -0.091  -16.147 26.315   1.00 143.47 ? 225  SER A N   1 
ATOM   1743  C  CA  . SER A  1  225 ? 1.031   -16.231 27.235   1.00 145.29 ? 225  SER A CA  1 
ATOM   1744  C  C   . SER A  1  225 ? 1.668   -17.599 27.070   1.00 147.09 ? 225  SER A C   1 
ATOM   1745  O  O   . SER A  1  225 ? 1.024   -18.549 26.620   1.00 146.41 ? 225  SER A O   1 
ATOM   1746  C  CB  . SER A  1  225 ? 0.609   -16.020 28.693   1.00 144.05 ? 225  SER A CB  1 
ATOM   1747  O  OG  . SER A  1  225 ? -0.276  -17.043 29.114   1.00 142.90 ? 225  SER A OG  1 
ATOM   1748  N  N   . VAL A  1  226 ? 2.949   -17.692 27.427   1.00 149.78 ? 226  VAL A N   1 
ATOM   1749  C  CA  . VAL A  1  226 ? 3.696   -18.929 27.261   1.00 152.25 ? 226  VAL A CA  1 
ATOM   1750  C  C   . VAL A  1  226 ? 4.613   -19.157 28.456   1.00 154.20 ? 226  VAL A C   1 
ATOM   1751  O  O   . VAL A  1  226 ? 4.945   -18.239 29.208   1.00 156.02 ? 226  VAL A O   1 
ATOM   1752  C  CB  . VAL A  1  226 ? 4.508   -18.930 25.946   1.00 154.87 ? 226  VAL A CB  1 
ATOM   1753  C  CG1 . VAL A  1  226 ? 3.576   -18.996 24.739   1.00 153.38 ? 226  VAL A CG1 1 
ATOM   1754  C  CG2 . VAL A  1  226 ? 5.384   -17.695 25.871   1.00 167.89 ? 226  VAL A CG2 1 
ATOM   1755  N  N   . ALA A  1  227 ? 5.006   -20.418 28.625   1.00 156.07 ? 227  ALA A N   1 
ATOM   1756  C  CA  . ALA A  1  227 ? 5.959   -20.842 29.639   1.00 158.66 ? 227  ALA A CA  1 
ATOM   1757  C  C   . ALA A  1  227 ? 6.479   -22.205 29.216   1.00 161.50 ? 227  ALA A C   1 
ATOM   1758  O  O   . ALA A  1  227 ? 5.854   -22.899 28.412   1.00 160.82 ? 227  ALA A O   1 
ATOM   1759  C  CB  . ALA A  1  227 ? 5.330   -20.898 31.033   1.00 156.85 ? 227  ALA A CB  1 
ATOM   1760  N  N   . VAL A  1  228 ? 7.626   -22.591 29.760   1.00 165.05 ? 228  VAL A N   1 
ATOM   1761  C  CA  . VAL A  1  228 ? 8.251   -23.838 29.346   1.00 168.54 ? 228  VAL A CA  1 
ATOM   1762  C  C   . VAL A  1  228 ? 8.564   -24.698 30.562   1.00 170.33 ? 228  VAL A C   1 
ATOM   1763  O  O   . VAL A  1  228 ? 8.779   -24.195 31.670   1.00 170.15 ? 228  VAL A O   1 
ATOM   1764  C  CB  . VAL A  1  228 ? 9.518   -23.574 28.506   1.00 172.48 ? 228  VAL A CB  1 
ATOM   1765  C  CG1 . VAL A  1  228 ? 9.161   -22.810 27.238   1.00 170.98 ? 228  VAL A CG1 1 
ATOM   1766  C  CG2 . VAL A  1  228 ? 10.541  -22.800 29.316   1.00 186.29 ? 228  VAL A CG2 1 
ATOM   1767  N  N   . GLY A  1  229 ? 8.595   -26.012 30.336   1.00 173.92 ? 229  GLY A N   1 
ATOM   1768  C  CA  . GLY A  1  229 ? 8.871   -27.000 31.364   1.00 176.15 ? 229  GLY A CA  1 
ATOM   1769  C  C   . GLY A  1  229 ? 8.586   -28.413 30.887   1.00 177.84 ? 229  GLY A C   1 
ATOM   1770  O  O   . GLY A  1  229 ? 7.777   -28.612 29.975   1.00 175.96 ? 229  GLY A O   1 
ATOM   1771  N  N   . ASP A  1  230 ? 9.246   -29.405 31.488   1.00 199.61 ? 230  ASP A N   1 
ATOM   1772  C  CA  . ASP A  1  230 ? 9.059   -30.803 31.117   1.00 204.24 ? 230  ASP A CA  1 
ATOM   1773  C  C   . ASP A  1  230 ? 7.874   -31.370 31.890   1.00 212.32 ? 230  ASP A C   1 
ATOM   1774  O  O   . ASP A  1  230 ? 7.748   -31.141 33.097   1.00 219.70 ? 230  ASP A O   1 
ATOM   1775  C  CB  . ASP A  1  230 ? 10.318  -31.626 31.405   1.00 194.03 ? 230  ASP A CB  1 
ATOM   1776  C  CG  . ASP A  1  230 ? 10.281  -33.012 30.758   1.00 197.39 ? 230  ASP A CG  1 
ATOM   1777  O  OD1 . ASP A  1  230 ? 9.472   -33.222 29.821   1.00 201.24 ? 230  ASP A OD1 1 
ATOM   1778  O  OD2 . ASP A  1  230 ? 11.050  -33.896 31.200   1.00 202.18 ? 230  ASP A OD2 1 
ATOM   1779  N  N   . PHE A  1  231 ? 7.002   -32.101 31.195   1.00 205.52 ? 231  PHE A N   1 
ATOM   1780  C  CA  . PHE A  1  231 ? 5.785   -32.596 31.830   1.00 184.93 ? 231  PHE A CA  1 
ATOM   1781  C  C   . PHE A  1  231 ? 5.514   -34.060 31.521   1.00 189.42 ? 231  PHE A C   1 
ATOM   1782  O  O   . PHE A  1  231 ? 4.992   -34.790 32.369   1.00 199.05 ? 231  PHE A O   1 
ATOM   1783  C  CB  . PHE A  1  231 ? 4.593   -31.743 31.411   1.00 179.77 ? 231  PHE A CB  1 
ATOM   1784  C  CG  . PHE A  1  231 ? 4.618   -30.362 31.986   1.00 176.86 ? 231  PHE A CG  1 
ATOM   1785  C  CD1 . PHE A  1  231 ? 4.204   -30.133 33.286   1.00 175.25 ? 231  PHE A CD1 1 
ATOM   1786  C  CD2 . PHE A  1  231 ? 5.084   -29.295 31.239   1.00 176.80 ? 231  PHE A CD2 1 
ATOM   1787  C  CE1 . PHE A  1  231 ? 4.235   -28.863 33.822   1.00 173.01 ? 231  PHE A CE1 1 
ATOM   1788  C  CE2 . PHE A  1  231 ? 5.122   -28.020 31.774   1.00 182.26 ? 231  PHE A CE2 1 
ATOM   1789  C  CZ  . PHE A  1  231 ? 4.695   -27.804 33.066   1.00 173.67 ? 231  PHE A CZ  1 
ATOM   1790  N  N   . ASN A  1  232 ? 5.873   -34.505 30.323   1.00 186.77 ? 232  ASN A N   1 
ATOM   1791  C  CA  . ASN A  1  232 ? 5.722   -35.900 29.945   1.00 193.58 ? 232  ASN A CA  1 
ATOM   1792  C  C   . ASN A  1  232 ? 6.908   -36.759 30.368   1.00 190.96 ? 232  ASN A C   1 
ATOM   1793  O  O   . ASN A  1  232 ? 7.015   -37.908 29.926   1.00 194.89 ? 232  ASN A O   1 
ATOM   1794  C  CB  . ASN A  1  232 ? 5.520   -36.001 28.440   1.00 185.63 ? 232  ASN A CB  1 
ATOM   1795  C  CG  . ASN A  1  232 ? 6.572   -35.245 27.674   1.00 187.21 ? 232  ASN A CG  1 
ATOM   1796  O  OD1 . ASN A  1  232 ? 7.261   -34.394 28.229   1.00 186.70 ? 232  ASN A OD1 1 
ATOM   1797  N  ND2 . ASN A  1  232 ? 6.707   -35.550 26.393   1.00 189.45 ? 232  ASN A ND2 1 
ATOM   1798  N  N   . GLY A  1  233 ? 7.789   -36.230 31.215   1.00 191.91 ? 233  GLY A N   1 
ATOM   1799  C  CA  . GLY A  1  233 ? 8.872   -37.001 31.787   1.00 197.48 ? 233  GLY A CA  1 
ATOM   1800  C  C   . GLY A  1  233 ? 9.822   -37.576 30.759   1.00 215.94 ? 233  GLY A C   1 
ATOM   1801  O  O   . GLY A  1  233 ? 10.126  -38.773 30.801   1.00 237.24 ? 233  GLY A O   1 
ATOM   1802  N  N   . ASP A  1  234 ? 10.296  -36.750 29.829   1.00 202.50 ? 234  ASP A N   1 
ATOM   1803  C  CA  . ASP A  1  234 ? 11.231  -37.217 28.810   1.00 207.89 ? 234  ASP A CA  1 
ATOM   1804  C  C   . ASP A  1  234 ? 12.532  -36.431 28.774   1.00 210.97 ? 234  ASP A C   1 
ATOM   1805  O  O   . ASP A  1  234 ? 13.592  -37.016 28.528   1.00 234.03 ? 234  ASP A O   1 
ATOM   1806  C  CB  . ASP A  1  234 ? 10.569  -37.185 27.422   1.00 206.38 ? 234  ASP A CB  1 
ATOM   1807  C  CG  . ASP A  1  234 ? 10.444  -35.785 26.864   1.00 202.23 ? 234  ASP A CG  1 
ATOM   1808  O  OD1 . ASP A  1  234 ? 10.269  -34.845 27.662   1.00 198.33 ? 234  ASP A OD1 1 
ATOM   1809  O  OD2 . ASP A  1  234 ? 10.517  -35.622 25.628   1.00 203.13 ? 234  ASP A OD2 1 
ATOM   1810  N  N   . GLY A  1  235 ? 12.490  -35.124 29.013   1.00 206.37 ? 235  GLY A N   1 
ATOM   1811  C  CA  . GLY A  1  235 ? 13.706  -34.338 29.054   1.00 208.90 ? 235  GLY A CA  1 
ATOM   1812  C  C   . GLY A  1  235 ? 13.655  -33.163 28.106   1.00 206.18 ? 235  GLY A C   1 
ATOM   1813  O  O   . GLY A  1  235 ? 14.506  -32.270 28.156   1.00 207.26 ? 235  GLY A O   1 
ATOM   1814  N  N   . ILE A  1  236 ? 12.663  -33.163 27.224   1.00 202.97 ? 236  ILE A N   1 
ATOM   1815  C  CA  . ILE A  1  236 ? 12.476  -32.086 26.260   1.00 200.32 ? 236  ILE A CA  1 
ATOM   1816  C  C   . ILE A  1  236 ? 11.486  -31.085 26.837   1.00 193.78 ? 236  ILE A C   1 
ATOM   1817  O  O   . ILE A  1  236 ? 10.366  -31.453 27.208   1.00 190.38 ? 236  ILE A O   1 
ATOM   1818  C  CB  . ILE A  1  236 ? 11.989  -32.626 24.909   1.00 201.08 ? 236  ILE A CB  1 
ATOM   1819  C  CG1 . ILE A  1  236 ? 12.977  -33.656 24.360   1.00 208.15 ? 236  ILE A CG1 1 
ATOM   1820  C  CG2 . ILE A  1  236 ? 11.792  -31.484 23.927   1.00 198.53 ? 236  ILE A CG2 1 
ATOM   1821  C  CD1 . ILE A  1  236 ? 14.369  -33.105 24.145   1.00 212.45 ? 236  ILE A CD1 1 
ATOM   1822  N  N   . ASP A  1  237 ? 11.901  -29.822 26.920   1.00 192.41 ? 237  ASP A N   1 
ATOM   1823  C  CA  . ASP A  1  237 ? 11.017  -28.774 27.412   1.00 186.71 ? 237  ASP A CA  1 
ATOM   1824  C  C   . ASP A  1  237 ? 9.757   -28.703 26.557   1.00 182.82 ? 237  ASP A C   1 
ATOM   1825  O  O   . ASP A  1  237 ? 9.833   -28.600 25.329   1.00 183.84 ? 237  ASP A O   1 
ATOM   1826  C  CB  . ASP A  1  237 ? 11.745  -27.429 27.405   1.00 186.70 ? 237  ASP A CB  1 
ATOM   1827  C  CG  . ASP A  1  237 ? 12.596  -27.224 28.638   1.00 188.72 ? 237  ASP A CG  1 
ATOM   1828  O  OD1 . ASP A  1  237 ? 12.826  -28.212 29.364   1.00 191.08 ? 237  ASP A OD1 1 
ATOM   1829  O  OD2 . ASP A  1  237 ? 13.042  -26.081 28.873   1.00 188.25 ? 237  ASP A OD2 1 
ATOM   1830  N  N   . ASP A  1  238 ? 8.597   -28.766 27.213   1.00 182.01 ? 238  ASP A N   1 
ATOM   1831  C  CA  . ASP A  1  238 ? 7.301   -28.755 26.548   1.00 175.44 ? 238  ASP A CA  1 
ATOM   1832  C  C   . ASP A  1  238 ? 6.667   -27.364 26.612   1.00 170.93 ? 238  ASP A C   1 
ATOM   1833  O  O   . ASP A  1  238 ? 7.027   -26.530 27.447   1.00 170.05 ? 238  ASP A O   1 
ATOM   1834  C  CB  . ASP A  1  238 ? 6.365   -29.792 27.180   1.00 174.29 ? 238  ASP A CB  1 
ATOM   1835  C  CG  . ASP A  1  238 ? 6.944   -31.200 27.150   1.00 179.05 ? 238  ASP A CG  1 
ATOM   1836  O  OD1 . ASP A  1  238 ? 7.470   -31.607 26.092   1.00 182.39 ? 238  ASP A OD1 1 
ATOM   1837  O  OD2 . ASP A  1  238 ? 6.858   -31.909 28.178   1.00 184.84 ? 238  ASP A OD2 1 
ATOM   1838  N  N   . PHE A  1  239 ? 5.682   -27.136 25.736   1.00 174.93 ? 239  PHE A N   1 
ATOM   1839  C  CA  . PHE A  1  239 ? 5.109   -25.811 25.504   1.00 171.35 ? 239  PHE A CA  1 
ATOM   1840  C  C   . PHE A  1  239 ? 3.783   -25.655 26.249   1.00 181.99 ? 239  PHE A C   1 
ATOM   1841  O  O   . PHE A  1  239 ? 2.823   -26.390 25.985   1.00 166.04 ? 239  PHE A O   1 
ATOM   1842  C  CB  . PHE A  1  239 ? 4.908   -25.564 24.005   1.00 184.69 ? 239  PHE A CB  1 
ATOM   1843  C  CG  . PHE A  1  239 ? 6.152   -25.782 23.172   1.00 198.80 ? 239  PHE A CG  1 
ATOM   1844  C  CD1 . PHE A  1  239 ? 7.404   -25.415 23.648   1.00 208.70 ? 239  PHE A CD1 1 
ATOM   1845  C  CD2 . PHE A  1  239 ? 6.065   -26.358 21.911   1.00 200.65 ? 239  PHE A CD2 1 
ATOM   1846  C  CE1 . PHE A  1  239 ? 8.545   -25.622 22.879   1.00 221.72 ? 239  PHE A CE1 1 
ATOM   1847  C  CE2 . PHE A  1  239 ? 7.202   -26.565 21.140   1.00 202.02 ? 239  PHE A CE2 1 
ATOM   1848  C  CZ  . PHE A  1  239 ? 8.442   -26.199 21.626   1.00 210.28 ? 239  PHE A CZ  1 
ATOM   1849  N  N   . VAL A  1  240 ? 3.735   -24.693 27.173   1.00 165.04 ? 240  VAL A N   1 
ATOM   1850  C  CA  . VAL A  1  240 ? 2.528   -24.345 27.917   1.00 154.36 ? 240  VAL A CA  1 
ATOM   1851  C  C   . VAL A  1  240 ? 2.057   -22.964 27.485   1.00 151.84 ? 240  VAL A C   1 
ATOM   1852  O  O   . VAL A  1  240 ? 2.856   -22.023 27.410   1.00 152.72 ? 240  VAL A O   1 
ATOM   1853  C  CB  . VAL A  1  240 ? 2.786   -24.375 29.434   1.00 154.47 ? 240  VAL A CB  1 
ATOM   1854  C  CG1 . VAL A  1  240 ? 1.494   -24.127 30.191   1.00 189.70 ? 240  VAL A CG1 1 
ATOM   1855  C  CG2 . VAL A  1  240 ? 3.411   -25.696 29.836   1.00 160.26 ? 240  VAL A CG2 1 
ATOM   1856  N  N   . SER A  1  241 ? 0.752   -22.828 27.244   1.00 163.48 ? 241  SER A N   1 
ATOM   1857  C  CA  . SER A  1  241 ? 0.214   -21.563 26.765   1.00 146.88 ? 241  SER A CA  1 
ATOM   1858  C  C   . SER A  1  241 ? -1.218  -21.368 27.239   1.00 143.79 ? 241  SER A C   1 
ATOM   1859  O  O   . SER A  1  241 ? -2.019  -22.309 27.234   1.00 143.23 ? 241  SER A O   1 
ATOM   1860  C  CB  . SER A  1  241 ? 0.263   -21.481 25.238   1.00 147.75 ? 241  SER A CB  1 
ATOM   1861  O  OG  . SER A  1  241 ? -0.122  -20.193 24.798   1.00 146.20 ? 241  SER A OG  1 
ATOM   1862  N  N   . GLY A  1  242 ? -1.526  -20.137 27.649   1.00 142.17 ? 242  GLY A N   1 
ATOM   1863  C  CA  . GLY A  1  242 ? -2.888  -19.784 28.023   1.00 139.62 ? 242  GLY A CA  1 
ATOM   1864  C  C   . GLY A  1  242 ? -3.756  -19.486 26.806   1.00 138.57 ? 242  GLY A C   1 
ATOM   1865  O  O   . GLY A  1  242 ? -3.330  -18.851 25.840   1.00 139.28 ? 242  GLY A O   1 
ATOM   1866  N  N   . VAL A  1  243 ? -4.993  -19.962 26.866   1.00 137.14 ? 243  VAL A N   1 
ATOM   1867  C  CA  . VAL A  1  243 ? -5.973  -19.730 25.809   1.00 155.17 ? 243  VAL A CA  1 
ATOM   1868  C  C   . VAL A  1  243 ? -7.179  -19.066 26.463   1.00 159.46 ? 243  VAL A C   1 
ATOM   1869  O  O   . VAL A  1  243 ? -8.201  -19.728 26.707   1.00 148.38 ? 243  VAL A O   1 
ATOM   1870  C  CB  . VAL A  1  243 ? -6.346  -21.034 25.091   1.00 143.36 ? 243  VAL A CB  1 
ATOM   1871  C  CG1 . VAL A  1  243 ? -6.953  -20.738 23.727   1.00 137.06 ? 243  VAL A CG1 1 
ATOM   1872  C  CG2 . VAL A  1  243 ? -5.120  -21.915 24.953   1.00 139.37 ? 243  VAL A CG2 1 
ATOM   1873  N  N   . PRO A  1  244 ? -7.089  -17.768 26.776   1.00 145.47 ? 244  PRO A N   1 
ATOM   1874  C  CA  . PRO A  1  244 ? -8.026  -17.166 27.739   1.00 132.64 ? 244  PRO A CA  1 
ATOM   1875  C  C   . PRO A  1  244 ? -9.455  -17.056 27.242   1.00 131.69 ? 244  PRO A C   1 
ATOM   1876  O  O   . PRO A  1  244 ? -10.367 -16.972 28.072   1.00 137.35 ? 244  PRO A O   1 
ATOM   1877  C  CB  . PRO A  1  244 ? -7.420  -15.778 27.993   1.00 132.99 ? 244  PRO A CB  1 
ATOM   1878  C  CG  . PRO A  1  244 ? -6.631  -15.486 26.766   1.00 134.01 ? 244  PRO A CG  1 
ATOM   1879  C  CD  . PRO A  1  244 ? -6.087  -16.802 26.295   1.00 134.84 ? 244  PRO A CD  1 
ATOM   1880  N  N   . ARG A  1  245 ? -9.694  -17.051 25.934   1.00 131.95 ? 245  ARG A N   1 
ATOM   1881  C  CA  . ARG A  1  245 ? -11.053 -16.938 25.428   1.00 131.41 ? 245  ARG A CA  1 
ATOM   1882  C  C   . ARG A  1  245 ? -11.638 -18.282 25.015   1.00 131.61 ? 245  ARG A C   1 
ATOM   1883  O  O   . ARG A  1  245 ? -12.794 -18.335 24.585   1.00 163.26 ? 245  ARG A O   1 
ATOM   1884  C  CB  . ARG A  1  245 ? -11.110 -15.952 24.253   1.00 131.87 ? 245  ARG A CB  1 
ATOM   1885  C  CG  . ARG A  1  245 ? -10.977 -14.487 24.671   1.00 131.84 ? 245  ARG A CG  1 
ATOM   1886  C  CD  . ARG A  1  245 ? -11.346 -13.522 23.540   1.00 132.48 ? 245  ARG A CD  1 
ATOM   1887  N  NE  . ARG A  1  245 ? -12.752 -13.623 23.142   1.00 142.37 ? 245  ARG A NE  1 
ATOM   1888  C  CZ  . ARG A  1  245 ? -13.742 -12.898 23.664   1.00 132.15 ? 245  ARG A CZ  1 
ATOM   1889  N  NH1 . ARG A  1  245 ? -13.481 -12.000 24.598   1.00 132.17 ? 245  ARG A NH1 1 
ATOM   1890  N  NH2 . ARG A  1  245 ? -14.991 -13.061 23.243   1.00 132.35 ? 245  ARG A NH2 1 
ATOM   1891  N  N   . ALA A  1  246 ? -10.874 -19.365 25.138   1.00 132.29 ? 246  ALA A N   1 
ATOM   1892  C  CA  . ALA A  1  246 ? -11.371 -20.693 24.824   1.00 132.89 ? 246  ALA A CA  1 
ATOM   1893  C  C   . ALA A  1  246 ? -12.491 -21.099 25.785   1.00 132.19 ? 246  ALA A C   1 
ATOM   1894  O  O   . ALA A  1  246 ? -12.744 -20.458 26.809   1.00 131.36 ? 246  ALA A O   1 
ATOM   1895  C  CB  . ALA A  1  246 ? -10.236 -21.714 24.877   1.00 134.19 ? 246  ALA A CB  1 
ATOM   1896  N  N   . ALA A  1  247 ? -13.174 -22.186 25.422   1.00 149.07 ? 247  ALA A N   1 
ATOM   1897  C  CA  . ALA A  1  247 ? -14.266 -22.753 26.219   1.00 152.62 ? 247  ALA A CA  1 
ATOM   1898  C  C   . ALA A  1  247 ? -15.355 -21.724 26.507   1.00 133.83 ? 247  ALA A C   1 
ATOM   1899  O  O   . ALA A  1  247 ? -15.869 -21.634 27.624   1.00 131.49 ? 247  ALA A O   1 
ATOM   1900  C  CB  . ALA A  1  247 ? -13.738 -23.351 27.525   1.00 160.75 ? 247  ALA A CB  1 
ATOM   1901  N  N   . ARG A  1  248 ? -15.721 -20.952 25.485   1.00 131.81 ? 248  ARG A N   1 
ATOM   1902  C  CA  . ARG A  1  248 ? -16.802 -19.978 25.596   1.00 131.48 ? 248  ARG A CA  1 
ATOM   1903  C  C   . ARG A  1  248 ? -16.530 -18.984 26.726   1.00 137.80 ? 248  ARG A C   1 
ATOM   1904  O  O   . ARG A  1  248 ? -17.358 -18.781 27.615   1.00 165.93 ? 248  ARG A O   1 
ATOM   1905  C  CB  . ARG A  1  248 ? -18.144 -20.686 25.791   1.00 132.77 ? 248  ARG A CB  1 
ATOM   1906  C  CG  . ARG A  1  248 ? -19.331 -19.934 25.239   1.00 165.05 ? 248  ARG A CG  1 
ATOM   1907  C  CD  . ARG A  1  248 ? -19.147 -19.652 23.756   1.00 178.13 ? 248  ARG A CD  1 
ATOM   1908  N  NE  . ARG A  1  248 ? -20.319 -19.008 23.167   1.00 169.06 ? 248  ARG A NE  1 
ATOM   1909  C  CZ  . ARG A  1  248 ? -21.266 -19.647 22.488   1.00 158.43 ? 248  ARG A CZ  1 
ATOM   1910  N  NH1 . ARG A  1  248 ? -21.179 -20.957 22.303   1.00 168.03 ? 248  ARG A NH1 1 
ATOM   1911  N  NH2 . ARG A  1  248 ? -22.297 -18.976 21.990   1.00 136.37 ? 248  ARG A NH2 1 
ATOM   1912  N  N   . THR A  1  249 ? -15.339 -18.375 26.689   1.00 138.93 ? 249  THR A N   1 
ATOM   1913  C  CA  . THR A  1  249 ? -14.837 -17.373 27.636   1.00 133.73 ? 249  THR A CA  1 
ATOM   1914  C  C   . THR A  1  249 ? -14.570 -17.934 29.025   1.00 129.98 ? 249  THR A C   1 
ATOM   1915  O  O   . THR A  1  249 ? -14.344 -17.157 29.962   1.00 129.97 ? 249  THR A O   1 
ATOM   1916  C  CB  . THR A  1  249 ? -15.775 -16.165 27.762   1.00 152.39 ? 249  THR A CB  1 
ATOM   1917  O  OG1 . THR A  1  249 ? -16.991 -16.558 28.414   1.00 157.50 ? 249  THR A OG1 1 
ATOM   1918  C  CG2 . THR A  1  249 ? -16.093 -15.578 26.390   1.00 130.59 ? 249  THR A CG2 1 
ATOM   1919  N  N   . LEU A  1  250 ? -14.574 -19.257 29.187   1.00 130.23 ? 250  LEU A N   1 
ATOM   1920  C  CA  . LEU A  1  250 ? -14.161 -19.865 30.447   1.00 130.47 ? 250  LEU A CA  1 
ATOM   1921  C  C   . LEU A  1  250 ? -12.661 -19.762 30.659   1.00 130.68 ? 250  LEU A C   1 
ATOM   1922  O  O   . LEU A  1  250 ? -12.195 -19.731 31.803   1.00 130.98 ? 250  LEU A O   1 
ATOM   1923  C  CB  . LEU A  1  250 ? -14.581 -21.331 30.475   1.00 131.07 ? 250  LEU A CB  1 
ATOM   1924  C  CG  . LEU A  1  250 ? -15.183 -21.850 31.776   1.00 150.22 ? 250  LEU A CG  1 
ATOM   1925  C  CD1 . LEU A  1  250 ? -16.161 -20.842 32.359   1.00 131.34 ? 250  LEU A CD1 1 
ATOM   1926  C  CD2 . LEU A  1  250 ? -15.869 -23.186 31.541   1.00 164.03 ? 250  LEU A CD2 1 
ATOM   1927  N  N   . GLY A  1  251 ? -11.900 -19.726 29.574   1.00 130.85 ? 251  GLY A N   1 
ATOM   1928  C  CA  . GLY A  1  251 ? -10.453 -19.692 29.606   1.00 171.80 ? 251  GLY A CA  1 
ATOM   1929  C  C   . GLY A  1  251 ? -9.879  -21.086 29.736   1.00 148.11 ? 251  GLY A C   1 
ATOM   1930  O  O   . GLY A  1  251 ? -10.351 -21.885 30.550   1.00 164.61 ? 251  GLY A O   1 
ATOM   1931  N  N   . MET A  1  252 ? -8.831  -21.380 28.973   1.00 133.50 ? 252  MET A N   1 
ATOM   1932  C  CA  . MET A  1  252 ? -8.202  -22.685 29.022   1.00 134.99 ? 252  MET A CA  1 
ATOM   1933  C  C   . MET A  1  252 ? -6.700  -22.506 28.933   1.00 136.35 ? 252  MET A C   1 
ATOM   1934  O  O   . MET A  1  252 ? -6.195  -21.423 28.637   1.00 136.13 ? 252  MET A O   1 
ATOM   1935  C  CB  . MET A  1  252 ? -8.688  -23.607 27.896   1.00 135.66 ? 252  MET A CB  1 
ATOM   1936  C  CG  . MET A  1  252 ? -10.140 -24.025 28.002   1.00 134.91 ? 252  MET A CG  1 
ATOM   1937  S  SD  . MET A  1  252 ? -10.633 -25.231 26.753   1.00 136.31 ? 252  MET A SD  1 
ATOM   1938  C  CE  . MET A  1  252 ? -9.775  -26.692 27.346   1.00 149.78 ? 252  MET A CE  1 
ATOM   1939  N  N   . VAL A  1  253 ? -5.986  -23.588 29.212   1.00 138.10 ? 253  VAL A N   1 
ATOM   1940  C  CA  . VAL A  1  253 ? -4.544  -23.643 29.028   1.00 145.06 ? 253  VAL A CA  1 
ATOM   1941  C  C   . VAL A  1  253 ? -4.225  -24.945 28.305   1.00 165.41 ? 253  VAL A C   1 
ATOM   1942  O  O   . VAL A  1  253 ? -4.584  -26.027 28.782   1.00 195.18 ? 253  VAL A O   1 
ATOM   1943  C  CB  . VAL A  1  253 ? -3.791  -23.545 30.366   1.00 168.11 ? 253  VAL A CB  1 
ATOM   1944  C  CG1 . VAL A  1  253 ? -2.322  -23.948 30.200   1.00 143.57 ? 253  VAL A CG1 1 
ATOM   1945  C  CG2 . VAL A  1  253 ? -3.919  -22.135 30.939   1.00 141.02 ? 253  VAL A CG2 1 
ATOM   1946  N  N   . TYR A  1  254 ? -3.585  -24.841 27.146   1.00 155.32 ? 254  TYR A N   1 
ATOM   1947  C  CA  . TYR A  1  254 ? -3.207  -26.006 26.363   1.00 151.22 ? 254  TYR A CA  1 
ATOM   1948  C  C   . TYR A  1  254 ? -1.753  -26.351 26.638   1.00 149.14 ? 254  TYR A C   1 
ATOM   1949  O  O   . TYR A  1  254 ? -0.909  -25.461 26.767   1.00 179.35 ? 254  TYR A O   1 
ATOM   1950  C  CB  . TYR A  1  254 ? -3.398  -25.754 24.869   1.00 150.26 ? 254  TYR A CB  1 
ATOM   1951  C  CG  . TYR A  1  254 ? -4.823  -25.491 24.452   1.00 144.35 ? 254  TYR A CG  1 
ATOM   1952  C  CD1 . TYR A  1  254 ? -5.891  -25.821 25.279   1.00 142.76 ? 254  TYR A CD1 1 
ATOM   1953  C  CD2 . TYR A  1  254 ? -5.098  -24.898 23.230   1.00 157.02 ? 254  TYR A CD2 1 
ATOM   1954  C  CE1 . TYR A  1  254 ? -7.197  -25.569 24.892   1.00 187.66 ? 254  TYR A CE1 1 
ATOM   1955  C  CE2 . TYR A  1  254 ? -6.397  -24.638 22.836   1.00 174.72 ? 254  TYR A CE2 1 
ATOM   1956  C  CZ  . TYR A  1  254 ? -7.444  -24.976 23.667   1.00 185.08 ? 254  TYR A CZ  1 
ATOM   1957  O  OH  . TYR A  1  254 ? -8.736  -24.713 23.262   1.00 170.53 ? 254  TYR A OH  1 
ATOM   1958  N  N   . ILE A  1  255 ? -1.461  -27.641 26.733   1.00 158.24 ? 255  ILE A N   1 
ATOM   1959  C  CA  . ILE A  1  255 ? -0.090  -28.118 26.832   1.00 161.70 ? 255  ILE A CA  1 
ATOM   1960  C  C   . ILE A  1  255 ? 0.211   -28.956 25.602   1.00 164.64 ? 255  ILE A C   1 
ATOM   1961  O  O   . ILE A  1  255 ? -0.534  -29.889 25.283   1.00 165.09 ? 255  ILE A O   1 
ATOM   1962  C  CB  . ILE A  1  255 ? 0.148   -28.914 28.125   1.00 162.92 ? 255  ILE A CB  1 
ATOM   1963  C  CG1 . ILE A  1  255 ? 0.008   -27.994 29.340   1.00 164.66 ? 255  ILE A CG1 1 
ATOM   1964  C  CG2 . ILE A  1  255 ? 1.516   -29.561 28.096   1.00 167.14 ? 255  ILE A CG2 1 
ATOM   1965  C  CD1 . ILE A  1  255 ? 0.494   -28.604 30.637   1.00 162.27 ? 255  ILE A CD1 1 
ATOM   1966  N  N   . TYR A  1  256 ? 1.283   -28.605 24.899   1.00 171.31 ? 256  TYR A N   1 
ATOM   1967  C  CA  . TYR A  1  256 ? 1.714   -29.334 23.718   1.00 174.74 ? 256  TYR A CA  1 
ATOM   1968  C  C   . TYR A  1  256 ? 3.101   -29.930 23.929   1.00 179.15 ? 256  TYR A C   1 
ATOM   1969  O  O   . TYR A  1  256 ? 3.942   -29.357 24.626   1.00 190.11 ? 256  TYR A O   1 
ATOM   1970  C  CB  . TYR A  1  256 ? 1.714   -28.435 22.481   1.00 183.72 ? 256  TYR A CB  1 
ATOM   1971  C  CG  . TYR A  1  256 ? 0.340   -27.952 22.075   1.00 185.96 ? 256  TYR A CG  1 
ATOM   1972  C  CD1 . TYR A  1  256 ? -0.450  -28.696 21.206   1.00 185.81 ? 256  TYR A CD1 1 
ATOM   1973  C  CD2 . TYR A  1  256 ? -0.163  -26.746 22.545   1.00 177.26 ? 256  TYR A CD2 1 
ATOM   1974  C  CE1 . TYR A  1  256 ? -1.705  -28.258 20.826   1.00 184.25 ? 256  TYR A CE1 1 
ATOM   1975  C  CE2 . TYR A  1  256 ? -1.415  -26.297 22.167   1.00 164.27 ? 256  TYR A CE2 1 
ATOM   1976  C  CZ  . TYR A  1  256 ? -2.183  -27.057 21.311   1.00 178.31 ? 256  TYR A CZ  1 
ATOM   1977  O  OH  . TYR A  1  256 ? -3.430  -26.610 20.939   1.00 166.12 ? 256  TYR A OH  1 
ATOM   1978  N  N   . ASP A  1  257 ? 3.327   -31.096 23.325   1.00 186.80 ? 257  ASP A N   1 
ATOM   1979  C  CA  . ASP A  1  257 ? 4.646   -31.718 23.344   1.00 213.56 ? 257  ASP A CA  1 
ATOM   1980  C  C   . ASP A  1  257 ? 5.658   -30.875 22.574   1.00 210.34 ? 257  ASP A C   1 
ATOM   1981  O  O   . ASP A  1  257 ? 5.367   -30.360 21.490   1.00 209.72 ? 257  ASP A O   1 
ATOM   1982  C  CB  . ASP A  1  257 ? 4.574   -33.124 22.749   1.00 217.64 ? 257  ASP A CB  1 
ATOM   1983  C  CG  . ASP A  1  257 ? 5.904   -33.847 22.796   1.00 218.96 ? 257  ASP A CG  1 
ATOM   1984  O  OD1 . ASP A  1  257 ? 6.667   -33.642 23.766   1.00 226.93 ? 257  ASP A OD1 1 
ATOM   1985  O  OD2 . ASP A  1  257 ? 6.188   -34.616 21.855   1.00 219.70 ? 257  ASP A OD2 1 
ATOM   1986  N  N   . GLY A  1  258 ? 6.855   -30.738 23.142   1.00 204.92 ? 258  GLY A N   1 
ATOM   1987  C  CA  . GLY A  1  258 ? 7.890   -29.910 22.550   1.00 198.89 ? 258  GLY A CA  1 
ATOM   1988  C  C   . GLY A  1  258 ? 8.732   -30.594 21.493   1.00 204.45 ? 258  GLY A C   1 
ATOM   1989  O  O   . GLY A  1  258 ? 9.826   -30.122 21.166   1.00 207.51 ? 258  GLY A O   1 
ATOM   1990  N  N   . LYS A  1  259 ? 8.238   -31.698 20.945   1.00 198.43 ? 259  LYS A N   1 
ATOM   1991  C  CA  . LYS A  1  259 ? 8.952   -32.436 19.910   1.00 204.13 ? 259  LYS A CA  1 
ATOM   1992  C  C   . LYS A  1  259 ? 8.175   -32.539 18.608   1.00 218.17 ? 259  LYS A C   1 
ATOM   1993  O  O   . LYS A  1  259 ? 8.765   -32.384 17.535   1.00 226.73 ? 259  LYS A O   1 
ATOM   1994  C  CB  . LYS A  1  259 ? 9.308   -33.850 20.407   1.00 210.74 ? 259  LYS A CB  1 
ATOM   1995  C  CG  . LYS A  1  259 ? 10.284  -34.604 19.506   1.00 215.32 ? 259  LYS A CG  1 
ATOM   1996  C  CD  . LYS A  1  259 ? 10.509  -36.035 19.977   1.00 219.63 ? 259  LYS A CD  1 
ATOM   1997  C  CE  . LYS A  1  259 ? 9.268   -36.884 19.777   1.00 225.24 ? 259  LYS A CE  1 
ATOM   1998  N  NZ  . LYS A  1  259 ? 9.500   -38.305 20.153   1.00 235.00 ? 259  LYS A NZ  1 
ATOM   1999  N  N   . ASN A  1  260 ? 6.862   -32.788 18.663   1.00 191.97 ? 260  ASN A N   1 
ATOM   2000  C  CA  . ASN A  1  260 ? 6.071   -32.924 17.446   1.00 192.90 ? 260  ASN A CA  1 
ATOM   2001  C  C   . ASN A  1  260 ? 4.767   -32.141 17.492   1.00 185.96 ? 260  ASN A C   1 
ATOM   2002  O  O   . ASN A  1  260 ? 3.902   -32.353 16.633   1.00 185.55 ? 260  ASN A O   1 
ATOM   2003  C  CB  . ASN A  1  260 ? 5.773   -34.399 17.143   1.00 221.56 ? 260  ASN A CB  1 
ATOM   2004  C  CG  . ASN A  1  260 ? 5.117   -35.129 18.305   1.00 226.27 ? 260  ASN A CG  1 
ATOM   2005  O  OD1 . ASN A  1  260 ? 4.475   -34.521 19.163   1.00 188.62 ? 260  ASN A OD1 1 
ATOM   2006  N  ND2 . ASN A  1  260 ? 5.280   -36.450 18.331   1.00 316.68 ? 260  ASN A ND2 1 
ATOM   2007  N  N   . MET A  1  261 ? 4.597   -31.256 18.473   1.00 181.72 ? 261  MET A N   1 
ATOM   2008  C  CA  . MET A  1  261 ? 3.433   -30.378 18.569   1.00 176.37 ? 261  MET A CA  1 
ATOM   2009  C  C   . MET A  1  261 ? 2.141   -31.202 18.653   1.00 174.76 ? 261  MET A C   1 
ATOM   2010  O  O   . MET A  1  261 ? 1.331   -31.257 17.722   1.00 183.32 ? 261  MET A O   1 
ATOM   2011  C  CB  . MET A  1  261 ? 3.399   -29.397 17.390   1.00 178.12 ? 261  MET A CB  1 
ATOM   2012  C  CG  . MET A  1  261 ? 2.605   -28.143 17.673   1.00 170.98 ? 261  MET A CG  1 
ATOM   2013  S  SD  . MET A  1  261 ? 3.264   -27.276 19.114   1.00 168.86 ? 261  MET A SD  1 
ATOM   2014  C  CE  . MET A  1  261 ? 4.505   -26.224 18.376   1.00 171.36 ? 261  MET A CE  1 
ATOM   2015  N  N   . SER A  1  262 ? 1.981   -31.857 19.805   1.00 180.34 ? 262  SER A N   1 
ATOM   2016  C  CA  . SER A  1  262 ? 0.788   -32.631 20.122   1.00 186.34 ? 262  SER A CA  1 
ATOM   2017  C  C   . SER A  1  262 ? 0.274   -32.233 21.498   1.00 174.92 ? 262  SER A C   1 
ATOM   2018  O  O   . SER A  1  262 ? 1.057   -32.006 22.423   1.00 175.10 ? 262  SER A O   1 
ATOM   2019  C  CB  . SER A  1  262 ? 1.075   -34.138 20.094   1.00 209.01 ? 262  SER A CB  1 
ATOM   2020  O  OG  . SER A  1  262 ? -0.091  -34.888 20.387   1.00 221.93 ? 262  SER A OG  1 
ATOM   2021  N  N   . SER A  1  263 ? -1.050  -32.212 21.645   1.00 178.87 ? 263  SER A N   1 
ATOM   2022  C  CA  . SER A  1  263 ? -1.657  -31.800 22.904   1.00 174.10 ? 263  SER A CA  1 
ATOM   2023  C  C   . SER A  1  263 ? -1.435  -32.857 23.979   1.00 190.09 ? 263  SER A C   1 
ATOM   2024  O  O   . SER A  1  263 ? -1.649  -34.051 23.748   1.00 213.39 ? 263  SER A O   1 
ATOM   2025  C  CB  . SER A  1  263 ? -3.151  -31.548 22.719   1.00 174.19 ? 263  SER A CB  1 
ATOM   2026  O  OG  . SER A  1  263 ? -3.721  -31.005 23.898   1.00 178.50 ? 263  SER A OG  1 
ATOM   2027  N  N   . LEU A  1  264 ? -0.989  -32.418 25.156   1.00 181.82 ? 264  LEU A N   1 
ATOM   2028  C  CA  . LEU A  1  264 ? -0.700  -33.321 26.263   1.00 177.69 ? 264  LEU A CA  1 
ATOM   2029  C  C   . LEU A  1  264 ? -1.738  -33.226 27.374   1.00 174.61 ? 264  LEU A C   1 
ATOM   2030  O  O   . LEU A  1  264 ? -2.349  -34.235 27.737   1.00 175.61 ? 264  LEU A O   1 
ATOM   2031  C  CB  . LEU A  1  264 ? 0.701   -33.040 26.827   1.00 190.81 ? 264  LEU A CB  1 
ATOM   2032  C  CG  . LEU A  1  264 ? 1.915   -33.337 25.946   1.00 192.57 ? 264  LEU A CG  1 
ATOM   2033  C  CD1 . LEU A  1  264 ? 3.196   -33.058 26.714   1.00 185.89 ? 264  LEU A CD1 1 
ATOM   2034  C  CD2 . LEU A  1  264 ? 1.889   -34.772 25.451   1.00 195.11 ? 264  LEU A CD2 1 
ATOM   2035  N  N   . TYR A  1  265 ? -1.968  -32.032 27.913   1.00 174.19 ? 265  TYR A N   1 
ATOM   2036  C  CA  . TYR A  1  265 ? -2.857  -31.850 29.052   1.00 180.25 ? 265  TYR A CA  1 
ATOM   2037  C  C   . TYR A  1  265 ? -3.642  -30.557 28.868   1.00 161.55 ? 265  TYR A C   1 
ATOM   2038  O  O   . TYR A  1  265 ? -3.242  -29.664 28.115   1.00 160.85 ? 265  TYR A O   1 
ATOM   2039  C  CB  . TYR A  1  265 ? -2.080  -31.827 30.380   1.00 198.19 ? 265  TYR A CB  1 
ATOM   2040  C  CG  . TYR A  1  265 ? -1.372  -33.130 30.745   1.00 224.15 ? 265  TYR A CG  1 
ATOM   2041  C  CD1 . TYR A  1  265 ? -2.057  -34.171 31.367   1.00 218.37 ? 265  TYR A CD1 1 
ATOM   2042  C  CD2 . TYR A  1  265 ? -0.018  -33.311 30.478   1.00 210.46 ? 265  TYR A CD2 1 
ATOM   2043  C  CE1 . TYR A  1  265 ? -1.412  -35.358 31.706   1.00 202.35 ? 265  TYR A CE1 1 
ATOM   2044  C  CE2 . TYR A  1  265 ? 0.631   -34.492 30.814   1.00 191.06 ? 265  TYR A CE2 1 
ATOM   2045  C  CZ  . TYR A  1  265 ? -0.071  -35.509 31.426   1.00 178.66 ? 265  TYR A CZ  1 
ATOM   2046  O  OH  . TYR A  1  265 ? 0.567   -36.677 31.760   1.00 183.09 ? 265  TYR A OH  1 
ATOM   2047  N  N   . ASN A  1  266 ? -4.794  -30.481 29.538   1.00 165.01 ? 266  ASN A N   1 
ATOM   2048  C  CA  . ASN A  1  266 ? -5.636  -29.291 29.512   1.00 184.16 ? 266  ASN A CA  1 
ATOM   2049  C  C   . ASN A  1  266 ? -6.012  -28.808 30.907   1.00 182.45 ? 266  ASN A C   1 
ATOM   2050  O  O   . ASN A  1  266 ? -6.249  -29.607 31.820   1.00 195.61 ? 266  ASN A O   1 
ATOM   2051  C  CB  . ASN A  1  266 ? -6.919  -29.533 28.722   1.00 202.51 ? 266  ASN A CB  1 
ATOM   2052  C  CG  . ASN A  1  266 ? -6.724  -29.378 27.235   1.00 208.40 ? 266  ASN A CG  1 
ATOM   2053  O  OD1 . ASN A  1  266 ? -5.798  -28.698 26.783   1.00 182.27 ? 266  ASN A OD1 1 
ATOM   2054  N  ND2 . ASN A  1  266 ? -7.597  -30.001 26.459   1.00 264.21 ? 266  ASN A ND2 1 
ATOM   2055  N  N   . PHE A  1  267 ? -6.077  -27.488 31.051   1.00 148.17 ? 267  PHE A N   1 
ATOM   2056  C  CA  . PHE A  1  267 ? -6.674  -26.832 32.202   1.00 146.56 ? 267  PHE A CA  1 
ATOM   2057  C  C   . PHE A  1  267 ? -7.798  -25.933 31.714   1.00 173.15 ? 267  PHE A C   1 
ATOM   2058  O  O   . PHE A  1  267 ? -7.740  -25.384 30.610   1.00 165.52 ? 267  PHE A O   1 
ATOM   2059  C  CB  . PHE A  1  267 ? -5.661  -26.002 32.981   1.00 146.81 ? 267  PHE A CB  1 
ATOM   2060  C  CG  . PHE A  1  267 ? -4.491  -26.787 33.476   1.00 184.79 ? 267  PHE A CG  1 
ATOM   2061  C  CD1 . PHE A  1  267 ? -4.529  -27.422 34.707   1.00 194.40 ? 267  PHE A CD1 1 
ATOM   2062  C  CD2 . PHE A  1  267 ? -3.343  -26.891 32.706   1.00 191.66 ? 267  PHE A CD2 1 
ATOM   2063  C  CE1 . PHE A  1  267 ? -3.435  -28.148 35.160   1.00 194.62 ? 267  PHE A CE1 1 
ATOM   2064  C  CE2 . PHE A  1  267 ? -2.251  -27.611 33.148   1.00 154.08 ? 267  PHE A CE2 1 
ATOM   2065  C  CZ  . PHE A  1  267 ? -2.294  -28.241 34.376   1.00 177.83 ? 267  PHE A CZ  1 
ATOM   2066  N  N   . THR A  1  268 ? -8.826  -25.789 32.543   1.00 174.32 ? 268  THR A N   1 
ATOM   2067  C  CA  . THR A  1  268 ? -9.989  -24.984 32.205   1.00 141.24 ? 268  THR A CA  1 
ATOM   2068  C  C   . THR A  1  268 ? -10.331 -24.055 33.361   1.00 140.39 ? 268  THR A C   1 
ATOM   2069  O  O   . THR A  1  268 ? -10.338 -24.478 34.523   1.00 141.17 ? 268  THR A O   1 
ATOM   2070  C  CB  . THR A  1  268 ? -11.178 -25.881 31.855   1.00 161.05 ? 268  THR A CB  1 
ATOM   2071  O  OG1 . THR A  1  268 ? -10.762 -26.859 30.894   1.00 143.77 ? 268  THR A OG1 1 
ATOM   2072  C  CG2 . THR A  1  268 ? -12.329 -25.062 31.286   1.00 167.16 ? 268  THR A CG2 1 
ATOM   2073  N  N   . GLY A  1  269 ? -10.587 -22.786 33.037   1.00 134.44 ? 269  GLY A N   1 
ATOM   2074  C  CA  . GLY A  1  269 ? -11.099 -21.858 34.024   1.00 141.73 ? 269  GLY A CA  1 
ATOM   2075  C  C   . GLY A  1  269 ? -12.466 -22.271 34.526   1.00 133.01 ? 269  GLY A C   1 
ATOM   2076  O  O   . GLY A  1  269 ? -13.155 -23.094 33.927   1.00 133.11 ? 269  GLY A O   1 
ATOM   2077  N  N   . GLU A  1  270 ? -12.856 -21.695 35.659   1.00 133.21 ? 270  GLU A N   1 
ATOM   2078  C  CA  . GLU A  1  270 ? -14.100 -22.077 36.311   1.00 155.75 ? 270  GLU A CA  1 
ATOM   2079  C  C   . GLU A  1  270 ? -15.108 -20.938 36.409   1.00 162.38 ? 270  GLU A C   1 
ATOM   2080  O  O   . GLU A  1  270 ? -16.184 -21.123 37.000   1.00 133.98 ? 270  GLU A O   1 
ATOM   2081  C  CB  . GLU A  1  270 ? -13.801 -22.648 37.706   1.00 152.12 ? 270  GLU A CB  1 
ATOM   2082  C  CG  . GLU A  1  270 ? -12.905 -23.886 37.690   1.00 135.94 ? 270  GLU A CG  1 
ATOM   2083  C  CD  . GLU A  1  270 ? -13.643 -25.156 37.269   1.00 142.52 ? 270  GLU A CD  1 
ATOM   2084  O  OE1 . GLU A  1  270 ? -14.836 -25.077 36.903   1.00 142.97 ? 270  GLU A OE1 1 
ATOM   2085  O  OE2 . GLU A  1  270 ? -13.025 -26.240 37.295   1.00 146.79 ? 270  GLU A OE2 1 
ATOM   2086  N  N   . GLN A  1  271 ? -14.800 -19.778 35.832   1.00 170.55 ? 271  GLN A N   1 
ATOM   2087  C  CA  . GLN A  1  271 ? -15.684 -18.623 35.828   1.00 148.68 ? 271  GLN A CA  1 
ATOM   2088  C  C   . GLN A  1  271 ? -15.621 -17.922 34.479   1.00 149.14 ? 271  GLN A C   1 
ATOM   2089  O  O   . GLN A  1  271 ? -14.532 -17.725 33.930   1.00 173.44 ? 271  GLN A O   1 
ATOM   2090  C  CB  . GLN A  1  271 ? -15.290 -17.641 36.918   1.00 133.28 ? 271  GLN A CB  1 
ATOM   2091  C  CG  . GLN A  1  271 ? -16.217 -16.484 37.044   1.00 133.84 ? 271  GLN A CG  1 
ATOM   2092  C  CD  . GLN A  1  271 ? -15.783 -15.561 38.137   1.00 135.02 ? 271  GLN A CD  1 
ATOM   2093  O  OE1 . GLN A  1  271 ? -15.122 -14.555 37.892   1.00 135.03 ? 271  GLN A OE1 1 
ATOM   2094  N  NE2 . GLN A  1  271 ? -16.113 -15.918 39.368   1.00 136.32 ? 271  GLN A NE2 1 
ATOM   2095  N  N   . MET A  1  272 ? -16.787 -17.515 33.970   1.00 140.57 ? 272  MET A N   1 
ATOM   2096  C  CA  . MET A  1  272 ? -16.857 -16.839 32.676   1.00 131.18 ? 272  MET A CA  1 
ATOM   2097  C  C   . MET A  1  272 ? -16.074 -15.532 32.712   1.00 131.21 ? 272  MET A C   1 
ATOM   2098  O  O   . MET A  1  272 ? -16.170 -14.766 33.675   1.00 131.98 ? 272  MET A O   1 
ATOM   2099  C  CB  . MET A  1  272 ? -18.321 -16.571 32.303   1.00 131.76 ? 272  MET A CB  1 
ATOM   2100  C  CG  . MET A  1  272 ? -19.194 -17.819 32.266   1.00 152.44 ? 272  MET A CG  1 
ATOM   2101  S  SD  . MET A  1  272 ? -18.873 -18.810 30.795   1.00 198.23 ? 272  MET A SD  1 
ATOM   2102  C  CE  . MET A  1  272 ? -20.033 -20.164 30.993   1.00 187.45 ? 272  MET A CE  1 
ATOM   2103  N  N   . ALA A  1  273 ? -15.263 -15.303 31.676   1.00 130.69 ? 273  ALA A N   1 
ATOM   2104  C  CA  . ALA A  1  273 ? -14.562 -14.033 31.477   1.00 130.96 ? 273  ALA A CA  1 
ATOM   2105  C  C   . ALA A  1  273 ? -13.686 -13.652 32.669   1.00 142.78 ? 273  ALA A C   1 
ATOM   2106  O  O   . ALA A  1  273 ? -13.543 -12.469 32.998   1.00 134.26 ? 273  ALA A O   1 
ATOM   2107  C  CB  . ALA A  1  273 ? -15.547 -12.909 31.160   1.00 131.63 ? 273  ALA A CB  1 
ATOM   2108  N  N   . ALA A  1  274 ? -13.116 -14.653 33.338   1.00 158.67 ? 274  ALA A N   1 
ATOM   2109  C  CA  . ALA A  1  274 ? -12.129 -14.450 34.387   1.00 132.59 ? 274  ALA A CA  1 
ATOM   2110  C  C   . ALA A  1  274 ? -10.725 -14.303 33.831   1.00 132.29 ? 274  ALA A C   1 
ATOM   2111  O  O   . ALA A  1  274 ? -9.786  -14.056 34.599   1.00 137.45 ? 274  ALA A O   1 
ATOM   2112  C  CB  . ALA A  1  274 ? -12.166 -15.616 35.382   1.00 132.43 ? 274  ALA A CB  1 
ATOM   2113  N  N   . TYR A  1  275 ? -10.566 -14.462 32.521   1.00 131.70 ? 275  TYR A N   1 
ATOM   2114  C  CA  . TYR A  1  275 ? -9.267  -14.409 31.866   1.00 132.12 ? 275  TYR A CA  1 
ATOM   2115  C  C   . TYR A  1  275 ? -8.328  -15.460 32.450   1.00 132.68 ? 275  TYR A C   1 
ATOM   2116  O  O   . TYR A  1  275 ? -7.155  -15.192 32.719   1.00 133.71 ? 275  TYR A O   1 
ATOM   2117  C  CB  . TYR A  1  275 ? -8.654  -13.008 31.926   1.00 133.01 ? 275  TYR A CB  1 
ATOM   2118  C  CG  . TYR A  1  275 ? -8.333  -12.471 30.548   1.00 133.12 ? 275  TYR A CG  1 
ATOM   2119  C  CD1 . TYR A  1  275 ? -9.326  -11.924 29.739   1.00 132.70 ? 275  TYR A CD1 1 
ATOM   2120  C  CD2 . TYR A  1  275 ? -7.045  -12.535 30.042   1.00 133.98 ? 275  TYR A CD2 1 
ATOM   2121  C  CE1 . TYR A  1  275 ? -9.037  -11.443 28.467   1.00 133.07 ? 275  TYR A CE1 1 
ATOM   2122  C  CE2 . TYR A  1  275 ? -6.747  -12.058 28.776   1.00 134.40 ? 275  TYR A CE2 1 
ATOM   2123  C  CZ  . TYR A  1  275 ? -7.743  -11.515 27.994   1.00 133.90 ? 275  TYR A CZ  1 
ATOM   2124  O  OH  . TYR A  1  275 ? -7.432  -11.047 26.740   1.00 134.58 ? 275  TYR A OH  1 
ATOM   2125  N  N   . PHE A  1  276 ? -8.872  -16.652 32.705   1.00 156.10 ? 276  PHE A N   1 
ATOM   2126  C  CA  . PHE A  1  276 ? -8.069  -17.824 33.029   1.00 143.28 ? 276  PHE A CA  1 
ATOM   2127  C  C   . PHE A  1  276 ? -7.065  -18.069 31.913   1.00 133.66 ? 276  PHE A C   1 
ATOM   2128  O  O   . PHE A  1  276 ? -7.442  -18.494 30.817   1.00 133.26 ? 276  PHE A O   1 
ATOM   2129  C  CB  . PHE A  1  276 ? -8.964  -19.049 33.230   1.00 132.75 ? 276  PHE A CB  1 
ATOM   2130  C  CG  . PHE A  1  276 ? -8.220  -20.290 33.641   1.00 141.81 ? 276  PHE A CG  1 
ATOM   2131  C  CD1 . PHE A  1  276 ? -7.957  -20.541 34.977   1.00 168.96 ? 276  PHE A CD1 1 
ATOM   2132  C  CD2 . PHE A  1  276 ? -7.793  -21.210 32.695   1.00 143.37 ? 276  PHE A CD2 1 
ATOM   2133  C  CE1 . PHE A  1  276 ? -7.276  -21.682 35.363   1.00 180.05 ? 276  PHE A CE1 1 
ATOM   2134  C  CE2 . PHE A  1  276 ? -7.107  -22.352 33.076   1.00 153.67 ? 276  PHE A CE2 1 
ATOM   2135  C  CZ  . PHE A  1  276 ? -6.853  -22.588 34.412   1.00 164.50 ? 276  PHE A CZ  1 
ATOM   2136  N  N   . GLY A  1  277 ? -5.784  -17.835 32.185   1.00 134.95 ? 277  GLY A N   1 
ATOM   2137  C  CA  . GLY A  1  277 ? -4.753  -17.993 31.181   1.00 136.01 ? 277  GLY A CA  1 
ATOM   2138  C  C   . GLY A  1  277 ? -4.072  -16.716 30.745   1.00 136.57 ? 277  GLY A C   1 
ATOM   2139  O  O   . GLY A  1  277 ? -3.294  -16.758 29.788   1.00 137.60 ? 277  GLY A O   1 
ATOM   2140  N  N   . PHE A  1  278 ? -4.367  -15.577 31.378   1.00 136.22 ? 278  PHE A N   1 
ATOM   2141  C  CA  . PHE A  1  278 ? -3.693  -14.327 31.032   1.00 137.14 ? 278  PHE A CA  1 
ATOM   2142  C  C   . PHE A  1  278 ? -2.186  -14.431 31.194   1.00 139.24 ? 278  PHE A C   1 
ATOM   2143  O  O   . PHE A  1  278 ? -1.429  -13.914 30.365   1.00 140.39 ? 278  PHE A O   1 
ATOM   2144  C  CB  . PHE A  1  278 ? -4.212  -13.185 31.896   1.00 136.96 ? 278  PHE A CB  1 
ATOM   2145  C  CG  . PHE A  1  278 ? -3.518  -11.874 31.649   1.00 138.28 ? 278  PHE A CG  1 
ATOM   2146  C  CD1 . PHE A  1  278 ? -3.861  -11.095 30.564   1.00 138.04 ? 278  PHE A CD1 1 
ATOM   2147  C  CD2 . PHE A  1  278 ? -2.556  -11.402 32.522   1.00 140.06 ? 278  PHE A CD2 1 
ATOM   2148  C  CE1 . PHE A  1  278 ? -3.243  -9.884  30.333   1.00 139.54 ? 278  PHE A CE1 1 
ATOM   2149  C  CE2 . PHE A  1  278 ? -1.939  -10.189 32.300   1.00 141.58 ? 278  PHE A CE2 1 
ATOM   2150  C  CZ  . PHE A  1  278 ? -2.283  -9.430  31.203   1.00 141.32 ? 278  PHE A CZ  1 
ATOM   2151  N  N   . SER A  1  279 ? -1.731  -15.046 32.284   1.00 153.83 ? 279  SER A N   1 
ATOM   2152  C  CA  . SER A  1  279 ? -0.316  -15.266 32.535   1.00 142.47 ? 279  SER A CA  1 
ATOM   2153  C  C   . SER A  1  279 ? -0.116  -16.694 33.011   1.00 143.06 ? 279  SER A C   1 
ATOM   2154  O  O   . SER A  1  279 ? -0.946  -17.233 33.751   1.00 141.96 ? 279  SER A O   1 
ATOM   2155  C  CB  . SER A  1  279 ? 0.229   -14.294 33.577   1.00 143.83 ? 279  SER A CB  1 
ATOM   2156  O  OG  . SER A  1  279 ? -0.404  -14.505 34.824   1.00 143.27 ? 279  SER A OG  1 
ATOM   2157  N  N   . VAL A  1  280 ? 0.992   -17.300 32.581   1.00 145.15 ? 280  VAL A N   1 
ATOM   2158  C  CA  . VAL A  1  280 ? 1.365   -18.648 32.982   1.00 146.45 ? 280  VAL A CA  1 
ATOM   2159  C  C   . VAL A  1  280 ? 2.852   -18.676 33.311   1.00 149.68 ? 280  VAL A C   1 
ATOM   2160  O  O   . VAL A  1  280 ? 3.629   -17.830 32.865   1.00 150.96 ? 280  VAL A O   1 
ATOM   2161  C  CB  . VAL A  1  280 ? 1.040   -19.695 31.895   1.00 146.16 ? 280  VAL A CB  1 
ATOM   2162  C  CG1 . VAL A  1  280 ? -0.462  -19.902 31.793   1.00 143.41 ? 280  VAL A CG1 1 
ATOM   2163  C  CG2 . VAL A  1  280 ? 1.622   -19.267 30.559   1.00 147.07 ? 280  VAL A CG2 1 
ATOM   2164  N  N   . ALA A  1  281 ? 3.236   -19.664 34.114   1.00 151.28 ? 281  ALA A N   1 
ATOM   2165  C  CA  . ALA A  1  281 ? 4.625   -19.859 34.497   1.00 154.79 ? 281  ALA A CA  1 
ATOM   2166  C  C   . ALA A  1  281 ? 4.829   -21.326 34.830   1.00 156.46 ? 281  ALA A C   1 
ATOM   2167  O  O   . ALA A  1  281 ? 3.889   -22.022 35.215   1.00 154.89 ? 281  ALA A O   1 
ATOM   2168  C  CB  . ALA A  1  281 ? 5.016   -18.981 35.689   1.00 155.73 ? 281  ALA A CB  1 
ATOM   2169  N  N   . ALA A  1  282 ? 6.058   -21.801 34.655   1.00 159.98 ? 282  ALA A N   1 
ATOM   2170  C  CA  . ALA A  1  282 ? 6.383   -23.197 34.928   1.00 162.32 ? 282  ALA A CA  1 
ATOM   2171  C  C   . ALA A  1  282 ? 7.688   -23.283 35.710   1.00 166.34 ? 282  ALA A C   1 
ATOM   2172  O  O   . ALA A  1  282 ? 8.754   -22.929 35.194   1.00 168.94 ? 282  ALA A O   1 
ATOM   2173  C  CB  . ALA A  1  282 ? 6.460   -24.000 33.632   1.00 163.16 ? 282  ALA A CB  1 
ATOM   2174  N  N   . THR A  1  283 ? 7.598   -23.757 36.954   1.00 173.91 ? 283  THR A N   1 
ATOM   2175  C  CA  . THR A  1  283 ? 8.765   -23.997 37.795   1.00 188.97 ? 283  THR A CA  1 
ATOM   2176  C  C   . THR A  1  283 ? 8.398   -25.026 38.859   1.00 190.73 ? 283  THR A C   1 
ATOM   2177  O  O   . THR A  1  283 ? 7.270   -25.034 39.359   1.00 196.22 ? 283  THR A O   1 
ATOM   2178  C  CB  . THR A  1  283 ? 9.266   -22.702 38.451   1.00 180.22 ? 283  THR A CB  1 
ATOM   2179  O  OG1 . THR A  1  283 ? 10.314  -23.002 39.380   1.00 204.37 ? 283  THR A OG1 1 
ATOM   2180  C  CG2 . THR A  1  283 ? 8.138   -22.009 39.195   1.00 168.35 ? 283  THR A CG2 1 
ATOM   2181  N  N   . ASP A  1  284 ? 9.353   -25.895 39.191   1.00 200.04 ? 284  ASP A N   1 
ATOM   2182  C  CA  . ASP A  1  284 ? 9.171   -26.902 40.239   1.00 186.99 ? 284  ASP A CA  1 
ATOM   2183  C  C   . ASP A  1  284 ? 9.153   -26.229 41.608   1.00 187.12 ? 284  ASP A C   1 
ATOM   2184  O  O   . ASP A  1  284 ? 10.165  -25.675 42.045   1.00 221.50 ? 284  ASP A O   1 
ATOM   2185  C  CB  . ASP A  1  284 ? 10.283  -27.943 40.162   1.00 207.95 ? 284  ASP A CB  1 
ATOM   2186  C  CG  . ASP A  1  284 ? 10.173  -28.986 41.253   1.00 212.63 ? 284  ASP A CG  1 
ATOM   2187  O  OD1 . ASP A  1  284 ? 9.031   -29.317 41.636   1.00 205.53 ? 284  ASP A OD1 1 
ATOM   2188  O  OD2 . ASP A  1  284 ? 11.225  -29.472 41.727   1.00 199.19 ? 284  ASP A OD2 1 
ATOM   2189  N  N   . ILE A  1  285 ? 8.009   -26.278 42.292   1.00 175.50 ? 285  ILE A N   1 
ATOM   2190  C  CA  . ILE A  1  285 ? 7.838   -25.547 43.543   1.00 175.41 ? 285  ILE A CA  1 
ATOM   2191  C  C   . ILE A  1  285 ? 7.967   -26.434 44.780   1.00 178.43 ? 285  ILE A C   1 
ATOM   2192  O  O   . ILE A  1  285 ? 8.168   -25.907 45.885   1.00 179.81 ? 285  ILE A O   1 
ATOM   2193  C  CB  . ILE A  1  285 ? 6.482   -24.812 43.561   1.00 170.78 ? 285  ILE A CB  1 
ATOM   2194  C  CG1 . ILE A  1  285 ? 6.557   -23.553 44.428   1.00 170.76 ? 285  ILE A CG1 1 
ATOM   2195  C  CG2 . ILE A  1  285 ? 5.371   -25.740 44.036   1.00 169.53 ? 285  ILE A CG2 1 
ATOM   2196  C  CD1 . ILE A  1  285 ? 7.350   -22.433 43.786   1.00 171.09 ? 285  ILE A CD1 1 
ATOM   2197  N  N   . ASN A  1  286 ? 7.850   -27.753 44.633   1.00 179.77 ? 286  ASN A N   1 
ATOM   2198  C  CA  . ASN A  1  286 ? 7.844   -28.668 45.768   1.00 182.63 ? 286  ASN A CA  1 
ATOM   2199  C  C   . ASN A  1  286 ? 9.014   -29.646 45.734   1.00 187.73 ? 286  ASN A C   1 
ATOM   2200  O  O   . ASN A  1  286 ? 8.951   -30.699 46.375   1.00 190.28 ? 286  ASN A O   1 
ATOM   2201  C  CB  . ASN A  1  286 ? 6.522   -29.431 45.816   1.00 180.18 ? 286  ASN A CB  1 
ATOM   2202  C  CG  . ASN A  1  286 ? 6.212   -30.132 44.508   1.00 178.87 ? 286  ASN A CG  1 
ATOM   2203  O  OD1 . ASN A  1  286 ? 6.649   -29.700 43.440   1.00 178.11 ? 286  ASN A OD1 1 
ATOM   2204  N  ND2 . ASN A  1  286 ? 5.462   -31.224 44.585   1.00 179.25 ? 286  ASN A ND2 1 
ATOM   2205  N  N   . GLY A  1  287 ? 10.080  -29.312 45.010   1.00 189.60 ? 287  GLY A N   1 
ATOM   2206  C  CA  . GLY A  1  287 ? 11.299  -30.099 45.001   1.00 195.04 ? 287  GLY A CA  1 
ATOM   2207  C  C   . GLY A  1  287 ? 11.136  -31.547 44.581   1.00 196.82 ? 287  GLY A C   1 
ATOM   2208  O  O   . GLY A  1  287 ? 11.628  -32.449 45.265   1.00 221.52 ? 287  GLY A O   1 
ATOM   2209  N  N   . ASP A  1  288 ? 10.461  -31.795 43.460   1.00 199.69 ? 288  ASP A N   1 
ATOM   2210  C  CA  . ASP A  1  288 ? 10.320  -33.149 42.936   1.00 201.64 ? 288  ASP A CA  1 
ATOM   2211  C  C   . ASP A  1  288 ? 10.841  -33.281 41.509   1.00 202.50 ? 288  ASP A C   1 
ATOM   2212  O  O   . ASP A  1  288 ? 10.679  -34.344 40.896   1.00 204.03 ? 288  ASP A O   1 
ATOM   2213  C  CB  . ASP A  1  288 ? 8.857   -33.616 43.024   1.00 206.05 ? 288  ASP A CB  1 
ATOM   2214  C  CG  . ASP A  1  288 ? 7.860   -32.595 42.473   1.00 208.19 ? 288  ASP A CG  1 
ATOM   2215  O  OD1 . ASP A  1  288 ? 8.161   -31.382 42.476   1.00 217.77 ? 288  ASP A OD1 1 
ATOM   2216  O  OD2 . ASP A  1  288 ? 6.759   -33.007 42.046   1.00 189.38 ? 288  ASP A OD2 1 
ATOM   2217  N  N   . ASP A  1  289 ? 11.480  -32.239 40.976   1.00 198.65 ? 289  ASP A N   1 
ATOM   2218  C  CA  . ASP A  1  289 ? 12.029  -32.178 39.624   1.00 199.58 ? 289  ASP A CA  1 
ATOM   2219  C  C   . ASP A  1  289 ? 10.952  -32.238 38.549   1.00 204.39 ? 289  ASP A C   1 
ATOM   2220  O  O   . ASP A  1  289 ? 11.274  -32.422 37.364   1.00 196.41 ? 289  ASP A O   1 
ATOM   2221  C  CB  . ASP A  1  289 ? 13.073  -33.273 39.382   1.00 205.81 ? 289  ASP A CB  1 
ATOM   2222  C  CG  . ASP A  1  289 ? 14.236  -33.183 40.344   1.00 210.58 ? 289  ASP A CG  1 
ATOM   2223  O  OD1 . ASP A  1  289 ? 14.132  -33.736 41.459   1.00 219.92 ? 289  ASP A OD1 1 
ATOM   2224  O  OD2 . ASP A  1  289 ? 15.251  -32.548 39.988   1.00 212.88 ? 289  ASP A OD2 1 
ATOM   2225  N  N   . TYR A  1  290 ? 9.681   -32.098 38.925   1.00 210.68 ? 290  TYR A N   1 
ATOM   2226  C  CA  . TYR A  1  290 ? 8.572   -31.957 37.984   1.00 197.84 ? 290  TYR A CA  1 
ATOM   2227  C  C   . TYR A  1  290 ? 8.117   -30.501 37.967   1.00 182.09 ? 290  TYR A C   1 
ATOM   2228  O  O   . TYR A  1  290 ? 7.639   -29.980 38.982   1.00 180.18 ? 290  TYR A O   1 
ATOM   2229  C  CB  . TYR A  1  290 ? 7.419   -32.884 38.354   1.00 188.36 ? 290  TYR A CB  1 
ATOM   2230  C  CG  . TYR A  1  290 ? 7.684   -34.332 38.031   1.00 189.25 ? 290  TYR A CG  1 
ATOM   2231  C  CD1 . TYR A  1  290 ? 8.306   -34.702 36.845   1.00 191.71 ? 290  TYR A CD1 1 
ATOM   2232  C  CD2 . TYR A  1  290 ? 7.319   -35.329 38.919   1.00 191.02 ? 290  TYR A CD2 1 
ATOM   2233  C  CE1 . TYR A  1  290 ? 8.546   -36.025 36.555   1.00 195.87 ? 290  TYR A CE1 1 
ATOM   2234  C  CE2 . TYR A  1  290 ? 7.558   -36.648 38.641   1.00 195.10 ? 290  TYR A CE2 1 
ATOM   2235  C  CZ  . TYR A  1  290 ? 8.169   -36.995 37.461   1.00 197.56 ? 290  TYR A CZ  1 
ATOM   2236  O  OH  . TYR A  1  290 ? 8.405   -38.322 37.192   1.00 206.57 ? 290  TYR A OH  1 
ATOM   2237  N  N   . ALA A  1  291 ? 8.288   -29.844 36.822   1.00 181.78 ? 291  ALA A N   1 
ATOM   2238  C  CA  . ALA A  1  291 ? 7.825   -28.472 36.670   1.00 177.81 ? 291  ALA A CA  1 
ATOM   2239  C  C   . ALA A  1  291 ? 6.328   -28.389 36.937   1.00 173.42 ? 291  ALA A C   1 
ATOM   2240  O  O   . ALA A  1  291 ? 5.563   -29.279 36.554   1.00 173.19 ? 291  ALA A O   1 
ATOM   2241  C  CB  . ALA A  1  291 ? 8.145   -27.955 35.267   1.00 177.47 ? 291  ALA A CB  1 
ATOM   2242  N  N   . ASP A  1  292 ? 5.914   -27.313 37.605   1.00 199.52 ? 292  ASP A N   1 
ATOM   2243  C  CA  . ASP A  1  292 ? 4.534   -27.117 38.026   1.00 185.17 ? 292  ASP A CA  1 
ATOM   2244  C  C   . ASP A  1  292 ? 3.929   -25.911 37.315   1.00 163.85 ? 292  ASP A C   1 
ATOM   2245  O  O   . ASP A  1  292 ? 4.626   -24.940 37.004   1.00 184.00 ? 292  ASP A O   1 
ATOM   2246  C  CB  . ASP A  1  292 ? 4.457   -26.933 39.546   1.00 186.75 ? 292  ASP A CB  1 
ATOM   2247  C  CG  . ASP A  1  292 ? 5.142   -28.067 40.302   1.00 216.84 ? 292  ASP A CG  1 
ATOM   2248  O  OD1 . ASP A  1  292 ? 4.963   -29.239 39.905   1.00 224.37 ? 292  ASP A OD1 1 
ATOM   2249  O  OD2 . ASP A  1  292 ? 5.865   -27.791 41.285   1.00 220.66 ? 292  ASP A OD2 1 
ATOM   2250  N  N   . VAL A  1  293 ? 2.619   -25.972 37.078   1.00 159.39 ? 293  VAL A N   1 
ATOM   2251  C  CA  . VAL A  1  293 ? 1.913   -24.997 36.250   1.00 156.19 ? 293  VAL A CA  1 
ATOM   2252  C  C   . VAL A  1  293 ? 1.210   -23.974 37.132   1.00 167.56 ? 293  VAL A C   1 
ATOM   2253  O  O   . VAL A  1  293 ? 0.423   -24.336 38.016   1.00 163.68 ? 293  VAL A O   1 
ATOM   2254  C  CB  . VAL A  1  293 ? 0.906   -25.694 35.322   1.00 169.38 ? 293  VAL A CB  1 
ATOM   2255  C  CG1 . VAL A  1  293 ? 0.183   -24.672 34.458   1.00 172.63 ? 293  VAL A CG1 1 
ATOM   2256  C  CG2 . VAL A  1  293 ? 1.615   -26.725 34.460   1.00 157.19 ? 293  VAL A CG2 1 
ATOM   2257  N  N   . PHE A  1  294 ? 1.467   -22.696 36.865   1.00 162.43 ? 294  PHE A N   1 
ATOM   2258  C  CA  . PHE A  1  294 ? 0.829   -21.582 37.555   1.00 157.23 ? 294  PHE A CA  1 
ATOM   2259  C  C   . PHE A  1  294 ? 0.026   -20.789 36.536   1.00 146.44 ? 294  PHE A C   1 
ATOM   2260  O  O   . PHE A  1  294 ? 0.596   -20.252 35.581   1.00 163.39 ? 294  PHE A O   1 
ATOM   2261  C  CB  . PHE A  1  294 ? 1.869   -20.688 38.229   1.00 151.10 ? 294  PHE A CB  1 
ATOM   2262  C  CG  . PHE A  1  294 ? 2.659   -21.382 39.297   1.00 154.07 ? 294  PHE A CG  1 
ATOM   2263  C  CD1 . PHE A  1  294 ? 3.791   -22.111 38.970   1.00 167.09 ? 294  PHE A CD1 1 
ATOM   2264  C  CD2 . PHE A  1  294 ? 2.276   -21.304 40.625   1.00 154.40 ? 294  PHE A CD2 1 
ATOM   2265  C  CE1 . PHE A  1  294 ? 4.527   -22.753 39.944   1.00 166.44 ? 294  PHE A CE1 1 
ATOM   2266  C  CE2 . PHE A  1  294 ? 3.008   -21.943 41.608   1.00 172.48 ? 294  PHE A CE2 1 
ATOM   2267  C  CZ  . PHE A  1  294 ? 4.136   -22.670 41.266   1.00 185.93 ? 294  PHE A CZ  1 
ATOM   2268  N  N   . ILE A  1  295 ? -1.290  -20.723 36.728   1.00 144.20 ? 295  ILE A N   1 
ATOM   2269  C  CA  . ILE A  1  295 ? -2.199  -20.068 35.786   1.00 165.32 ? 295  ILE A CA  1 
ATOM   2270  C  C   . ILE A  1  295 ? -2.877  -18.891 36.476   1.00 162.05 ? 295  ILE A C   1 
ATOM   2271  O  O   . ILE A  1  295 ? -3.572  -19.071 37.484   1.00 177.92 ? 295  ILE A O   1 
ATOM   2272  C  CB  . ILE A  1  295 ? -3.246  -21.049 35.242   1.00 178.35 ? 295  ILE A CB  1 
ATOM   2273  C  CG1 . ILE A  1  295 ? -2.549  -22.267 34.634   1.00 190.23 ? 295  ILE A CG1 1 
ATOM   2274  C  CG2 . ILE A  1  295 ? -4.144  -20.356 34.223   1.00 138.47 ? 295  ILE A CG2 1 
ATOM   2275  C  CD1 . ILE A  1  295 ? -3.489  -23.390 34.270   1.00 197.67 ? 295  ILE A CD1 1 
ATOM   2276  N  N   . GLY A  1  296 ? -2.700  -17.695 35.917   1.00 140.35 ? 296  GLY A N   1 
ATOM   2277  C  CA  . GLY A  1  296 ? -3.322  -16.500 36.464   1.00 139.72 ? 296  GLY A CA  1 
ATOM   2278  C  C   . GLY A  1  296 ? -4.653  -16.203 35.792   1.00 137.63 ? 296  GLY A C   1 
ATOM   2279  O  O   . GLY A  1  296 ? -4.797  -16.346 34.582   1.00 136.77 ? 296  GLY A O   1 
ATOM   2280  N  N   . ALA A  1  297 ? -5.636  -15.805 36.607   1.00 154.05 ? 297  ALA A N   1 
ATOM   2281  C  CA  . ALA A  1  297 ? -6.957  -15.376 36.136   1.00 135.66 ? 297  ALA A CA  1 
ATOM   2282  C  C   . ALA A  1  297 ? -7.280  -14.047 36.804   1.00 136.28 ? 297  ALA A C   1 
ATOM   2283  O  O   . ALA A  1  297 ? -8.097  -13.988 37.733   1.00 136.53 ? 297  ALA A O   1 
ATOM   2284  C  CB  . ALA A  1  297 ? -8.027  -16.423 36.440   1.00 134.89 ? 297  ALA A CB  1 
ATOM   2285  N  N   . PRO A  1  298 ? -6.691  -12.950 36.315   1.00 136.85 ? 298  PRO A N   1 
ATOM   2286  C  CA  . PRO A  1  298 ? -6.738  -11.676 37.051   1.00 138.16 ? 298  PRO A CA  1 
ATOM   2287  C  C   . PRO A  1  298 ? -8.123  -11.094 37.168   1.00 137.73 ? 298  PRO A C   1 
ATOM   2288  O  O   . PRO A  1  298 ? -8.349  -10.207 38.005   1.00 139.15 ? 298  PRO A O   1 
ATOM   2289  C  CB  . PRO A  1  298 ? -5.828  -10.757 36.219   1.00 138.88 ? 298  PRO A CB  1 
ATOM   2290  C  CG  . PRO A  1  298 ? -5.043  -11.675 35.331   1.00 139.07 ? 298  PRO A CG  1 
ATOM   2291  C  CD  . PRO A  1  298 ? -5.964  -12.822 35.048   1.00 136.66 ? 298  PRO A CD  1 
ATOM   2292  N  N   . LEU A  1  299 ? -9.068  -11.597 36.389   1.00 148.63 ? 299  LEU A N   1 
ATOM   2293  C  CA  . LEU A  1  299 ? -10.420 -11.076 36.375   1.00 136.01 ? 299  LEU A CA  1 
ATOM   2294  C  C   . LEU A  1  299 ? -11.350 -11.988 37.144   1.00 135.76 ? 299  LEU A C   1 
ATOM   2295  O  O   . LEU A  1  299 ? -12.570 -11.792 37.115   1.00 173.49 ? 299  LEU A O   1 
ATOM   2296  C  CB  . LEU A  1  299 ? -10.910 -10.904 34.937   1.00 134.90 ? 299  LEU A CB  1 
ATOM   2297  C  CG  . LEU A  1  299 ? -9.987  -10.108 34.016   1.00 137.13 ? 299  LEU A CG  1 
ATOM   2298  C  CD1 . LEU A  1  299 ? -10.629 -9.918  32.650   1.00 134.47 ? 299  LEU A CD1 1 
ATOM   2299  C  CD2 . LEU A  1  299 ? -9.614  -8.770  34.638   1.00 137.09 ? 299  LEU A CD2 1 
ATOM   2300  N  N   . PHE A  1  300 ? -10.797 -12.989 37.820   1.00 135.87 ? 300  PHE A N   1 
ATOM   2301  C  CA  . PHE A  1  300 ? -11.609 -13.880 38.624   1.00 136.00 ? 300  PHE A CA  1 
ATOM   2302  C  C   . PHE A  1  300 ? -12.333 -13.094 39.698   1.00 137.57 ? 300  PHE A C   1 
ATOM   2303  O  O   . PHE A  1  300 ? -11.725 -12.309 40.430   1.00 139.07 ? 300  PHE A O   1 
ATOM   2304  C  CB  . PHE A  1  300 ? -10.749 -14.949 39.276   1.00 136.42 ? 300  PHE A CB  1 
ATOM   2305  C  CG  . PHE A  1  300 ? -11.540 -15.970 40.029   1.00 136.73 ? 300  PHE A CG  1 
ATOM   2306  C  CD1 . PHE A  1  300 ? -11.985 -17.115 39.399   1.00 135.69 ? 300  PHE A CD1 1 
ATOM   2307  C  CD2 . PHE A  1  300 ? -11.869 -15.771 41.361   1.00 138.37 ? 300  PHE A CD2 1 
ATOM   2308  C  CE1 . PHE A  1  300 ? -12.717 -18.059 40.088   1.00 136.26 ? 300  PHE A CE1 1 
ATOM   2309  C  CE2 . PHE A  1  300 ? -12.607 -16.706 42.054   1.00 138.94 ? 300  PHE A CE2 1 
ATOM   2310  C  CZ  . PHE A  1  300 ? -13.032 -17.853 41.417   1.00 137.87 ? 300  PHE A CZ  1 
ATOM   2311  N  N   . MET A  1  301 ? -13.628 -13.335 39.812   1.00 137.57 ? 301  MET A N   1 
ATOM   2312  C  CA  . MET A  1  301 ? -14.462 -12.719 40.825   1.00 139.43 ? 301  MET A CA  1 
ATOM   2313  C  C   . MET A  1  301 ? -14.809 -13.770 41.864   1.00 140.21 ? 301  MET A C   1 
ATOM   2314  O  O   . MET A  1  301 ? -15.231 -14.875 41.513   1.00 139.18 ? 301  MET A O   1 
ATOM   2315  C  CB  . MET A  1  301 ? -15.736 -12.152 40.208   1.00 139.48 ? 301  MET A CB  1 
ATOM   2316  C  CG  . MET A  1  301 ? -15.519 -11.293 38.995   1.00 138.66 ? 301  MET A CG  1 
ATOM   2317  S  SD  . MET A  1  301 ? -17.121 -10.742 38.416   1.00 139.30 ? 301  MET A SD  1 
ATOM   2318  C  CE  . MET A  1  301 ? -17.612 -9.676  39.765   1.00 142.44 ? 301  MET A CE  1 
ATOM   2319  N  N   . ASP A  1  302 ? -14.570 -13.465 43.130   1.00 142.25 ? 302  ASP A N   1 
ATOM   2320  C  CA  . ASP A  1  302 ? -15.036 -14.346 44.185   1.00 152.95 ? 302  ASP A CA  1 
ATOM   2321  C  C   . ASP A  1  302 ? -16.176 -13.675 44.941   1.00 167.10 ? 302  ASP A C   1 
ATOM   2322  O  O   . ASP A  1  302 ? -16.461 -12.486 44.773   1.00 172.70 ? 302  ASP A O   1 
ATOM   2323  C  CB  . ASP A  1  302 ? -13.899 -14.746 45.131   1.00 159.59 ? 302  ASP A CB  1 
ATOM   2324  C  CG  . ASP A  1  302 ? -13.576 -13.672 46.143   1.00 160.24 ? 302  ASP A CG  1 
ATOM   2325  O  OD1 . ASP A  1  302 ? -13.640 -12.481 45.785   1.00 172.57 ? 302  ASP A OD1 1 
ATOM   2326  O  OD2 . ASP A  1  302 ? -13.257 -14.018 47.299   1.00 151.05 ? 302  ASP A OD2 1 
ATOM   2327  N  N   . ARG A  1  303 ? -16.812 -14.455 45.805   1.00 177.75 ? 303  ARG A N   1 
ATOM   2328  C  CA  . ARG A  1  303 ? -17.919 -13.974 46.612   1.00 175.55 ? 303  ARG A CA  1 
ATOM   2329  C  C   . ARG A  1  303 ? -17.384 -13.444 47.934   1.00 184.54 ? 303  ARG A C   1 
ATOM   2330  O  O   . ARG A  1  303 ? -16.480 -14.031 48.530   1.00 189.49 ? 303  ARG A O   1 
ATOM   2331  C  CB  . ARG A  1  303 ? -18.925 -15.096 46.853   1.00 185.03 ? 303  ARG A CB  1 
ATOM   2332  C  CG  . ARG A  1  303 ? -20.179 -14.635 47.549   1.00 185.07 ? 303  ARG A CG  1 
ATOM   2333  C  CD  . ARG A  1  303 ? -20.959 -13.664 46.692   1.00 180.32 ? 303  ARG A CD  1 
ATOM   2334  N  NE  . ARG A  1  303 ? -21.715 -14.344 45.648   1.00 189.91 ? 303  ARG A NE  1 
ATOM   2335  C  CZ  . ARG A  1  303 ? -22.595 -13.743 44.853   1.00 214.46 ? 303  ARG A CZ  1 
ATOM   2336  N  NH1 . ARG A  1  303 ? -22.838 -12.447 44.993   1.00 222.76 ? 303  ARG A NH1 1 
ATOM   2337  N  NH2 . ARG A  1  303 ? -23.241 -14.436 43.926   1.00 217.28 ? 303  ARG A NH2 1 
ATOM   2338  N  N   . GLY A  1  304 ? -17.919 -12.306 48.372   1.00 188.74 ? 304  GLY A N   1 
ATOM   2339  C  CA  . GLY A  1  304 ? -17.524 -11.731 49.639   1.00 206.61 ? 304  GLY A CA  1 
ATOM   2340  C  C   . GLY A  1  304 ? -18.312 -12.288 50.814   1.00 210.28 ? 304  GLY A C   1 
ATOM   2341  O  O   . GLY A  1  304 ? -19.227 -13.098 50.671   1.00 200.04 ? 304  GLY A O   1 
ATOM   2342  N  N   . SER A  1  305 ? -17.936 -11.823 52.012   1.00 233.49 ? 305  SER A N   1 
ATOM   2343  C  CA  . SER A  1  305 ? -18.619 -12.264 53.224   1.00 242.81 ? 305  SER A CA  1 
ATOM   2344  C  C   . SER A  1  305 ? -20.039 -11.721 53.281   1.00 263.40 ? 305  SER A C   1 
ATOM   2345  O  O   . SER A  1  305 ? -20.924 -12.349 53.873   1.00 272.67 ? 305  SER A O   1 
ATOM   2346  C  CB  . SER A  1  305 ? -17.836 -11.829 54.466   1.00 241.76 ? 305  SER A CB  1 
ATOM   2347  O  OG  . SER A  1  305 ? -16.508 -12.329 54.459   1.00 242.58 ? 305  SER A OG  1 
ATOM   2348  N  N   . ASP A  1  306 ? -20.272 -10.573 52.654   1.00 273.88 ? 306  ASP A N   1 
ATOM   2349  C  CA  . ASP A  1  306 ? -21.563 -9.904  52.622   1.00 256.45 ? 306  ASP A CA  1 
ATOM   2350  C  C   . ASP A  1  306 ? -22.462 -10.413 51.508   1.00 236.93 ? 306  ASP A C   1 
ATOM   2351  O  O   . ASP A  1  306 ? -23.562 -9.880  51.329   1.00 213.65 ? 306  ASP A O   1 
ATOM   2352  C  CB  . ASP A  1  306 ? -21.361 -8.394  52.465   1.00 250.84 ? 306  ASP A CB  1 
ATOM   2353  C  CG  . ASP A  1  306 ? -20.204 -8.053  51.536   1.00 254.61 ? 306  ASP A CG  1 
ATOM   2354  O  OD1 . ASP A  1  306 ? -19.961 -8.812  50.572   1.00 245.85 ? 306  ASP A OD1 1 
ATOM   2355  O  OD2 . ASP A  1  306 ? -19.531 -7.028  51.773   1.00 261.42 ? 306  ASP A OD2 1 
ATOM   2356  N  N   . GLY A  1  307 ? -22.017 -11.411 50.749   1.00 236.94 ? 307  GLY A N   1 
ATOM   2357  C  CA  . GLY A  1  307 ? -22.787 -11.935 49.648   1.00 222.81 ? 307  GLY A CA  1 
ATOM   2358  C  C   . GLY A  1  307 ? -22.594 -11.203 48.340   1.00 226.09 ? 307  GLY A C   1 
ATOM   2359  O  O   . GLY A  1  307 ? -23.184 -11.608 47.329   1.00 230.35 ? 307  GLY A O   1 
ATOM   2360  N  N   . LYS A  1  308 ? -21.816 -10.126 48.327   1.00 238.79 ? 308  LYS A N   1 
ATOM   2361  C  CA  . LYS A  1  308 ? -21.558 -9.370  47.112   1.00 225.89 ? 308  LYS A CA  1 
ATOM   2362  C  C   . LYS A  1  308 ? -20.315 -9.895  46.395   1.00 205.20 ? 308  LYS A C   1 
ATOM   2363  O  O   . LYS A  1  308 ? -19.311 -10.248 47.025   1.00 177.49 ? 308  LYS A O   1 
ATOM   2364  C  CB  . LYS A  1  308 ? -21.405 -7.880  47.440   1.00 221.87 ? 308  LYS A CB  1 
ATOM   2365  C  CG  . LYS A  1  308 ? -21.508 -6.937  46.245   1.00 213.75 ? 308  LYS A CG  1 
ATOM   2366  C  CD  . LYS A  1  308 ? -21.208 -5.493  46.641   1.00 186.42 ? 308  LYS A CD  1 
ATOM   2367  C  CE  . LYS A  1  308 ? -22.211 -4.969  47.664   1.00 215.99 ? 308  LYS A CE  1 
ATOM   2368  N  NZ  . LYS A  1  308 ? -23.616 -4.980  47.160   1.00 220.20 ? 308  LYS A NZ  1 
ATOM   2369  N  N   . LEU A  1  309 ? -20.401 -9.955  45.067   1.00 195.64 ? 309  LEU A N   1 
ATOM   2370  C  CA  . LEU A  1  309 ? -19.263 -10.347 44.248   1.00 183.15 ? 309  LEU A CA  1 
ATOM   2371  C  C   . LEU A  1  309 ? -18.160 -9.306  44.357   1.00 178.11 ? 309  LEU A C   1 
ATOM   2372  O  O   . LEU A  1  309 ? -18.415 -8.112  44.535   1.00 189.27 ? 309  LEU A O   1 
ATOM   2373  C  CB  . LEU A  1  309 ? -19.689 -10.498 42.790   1.00 187.90 ? 309  LEU A CB  1 
ATOM   2374  C  CG  . LEU A  1  309 ? -20.637 -11.654 42.496   1.00 198.44 ? 309  LEU A CG  1 
ATOM   2375  C  CD1 . LEU A  1  309 ? -21.153 -11.548 41.076   1.00 197.11 ? 309  LEU A CD1 1 
ATOM   2376  C  CD2 . LEU A  1  309 ? -19.909 -12.970 42.714   1.00 158.53 ? 309  LEU A CD2 1 
ATOM   2377  N  N   . GLN A  1  310 ? -16.919 -9.764  44.254   1.00 151.61 ? 310  GLN A N   1 
ATOM   2378  C  CA  . GLN A  1  310 ? -15.790 -8.846  44.208   1.00 152.06 ? 310  GLN A CA  1 
ATOM   2379  C  C   . GLN A  1  310 ? -14.711 -9.414  43.299   1.00 158.70 ? 310  GLN A C   1 
ATOM   2380  O  O   . GLN A  1  310 ? -14.339 -10.585 43.424   1.00 148.05 ? 310  GLN A O   1 
ATOM   2381  C  CB  . GLN A  1  310 ? -15.243 -8.580  45.616   1.00 159.35 ? 310  GLN A CB  1 
ATOM   2382  C  CG  . GLN A  1  310 ? -15.055 -9.834  46.457   1.00 164.39 ? 310  GLN A CG  1 
ATOM   2383  C  CD  . GLN A  1  310 ? -14.327 -9.561  47.756   1.00 168.41 ? 310  GLN A CD  1 
ATOM   2384  O  OE1 . GLN A  1  310 ? -14.338 -8.440  48.252   1.00 192.74 ? 310  GLN A OE1 1 
ATOM   2385  N  NE2 . GLN A  1  310 ? -13.702 -10.591 48.322   1.00 157.20 ? 310  GLN A NE2 1 
ATOM   2386  N  N   . GLU A  1  311 ? -14.240 -8.588  42.366   1.00 145.87 ? 311  GLU A N   1 
ATOM   2387  C  CA  . GLU A  1  311 ? -13.156 -8.962  41.458   1.00 143.79 ? 311  GLU A CA  1 
ATOM   2388  C  C   . GLU A  1  311 ? -11.829 -8.899  42.200   1.00 144.89 ? 311  GLU A C   1 
ATOM   2389  O  O   . GLU A  1  311 ? -11.348 -7.814  42.533   1.00 146.81 ? 311  GLU A O   1 
ATOM   2390  C  CB  . GLU A  1  311 ? -13.113 -8.035  40.250   1.00 143.27 ? 311  GLU A CB  1 
ATOM   2391  C  CG  . GLU A  1  311 ? -11.979 -8.353  39.287   1.00 144.78 ? 311  GLU A CG  1 
ATOM   2392  C  CD  . GLU A  1  311 ? -11.829 -7.304  38.204   1.00 142.38 ? 311  GLU A CD  1 
ATOM   2393  O  OE1 . GLU A  1  311 ? -12.730 -6.451  38.076   1.00 179.57 ? 311  GLU A OE1 1 
ATOM   2394  O  OE2 . GLU A  1  311 ? -10.804 -7.322  37.491   1.00 140.94 ? 311  GLU A OE2 1 
ATOM   2395  N  N   . VAL A  1  312 ? -11.217 -10.056 42.434   1.00 143.97 ? 312  VAL A N   1 
ATOM   2396  C  CA  . VAL A  1  312 ? -9.937  -10.098 43.134   1.00 151.37 ? 312  VAL A CA  1 
ATOM   2397  C  C   . VAL A  1  312 ? -8.856  -10.827 42.358   1.00 143.75 ? 312  VAL A C   1 
ATOM   2398  O  O   . VAL A  1  312 ? -7.662  -10.683 42.686   1.00 144.99 ? 312  VAL A O   1 
ATOM   2399  C  CB  . VAL A  1  312 ? -10.108 -10.727 44.533   1.00 156.18 ? 312  VAL A CB  1 
ATOM   2400  C  CG1 . VAL A  1  312 ? -10.999 -9.860  45.399   1.00 149.19 ? 312  VAL A CG1 1 
ATOM   2401  C  CG2 . VAL A  1  312 ? -10.689 -12.122 44.410   1.00 152.49 ? 312  VAL A CG2 1 
ATOM   2402  N  N   . GLY A  1  313 ? -9.198  -11.608 41.339   1.00 141.49 ? 313  GLY A N   1 
ATOM   2403  C  CA  . GLY A  1  313 ? -8.214  -12.364 40.599   1.00 154.51 ? 313  GLY A CA  1 
ATOM   2404  C  C   . GLY A  1  313 ? -7.875  -13.662 41.301   1.00 143.39 ? 313  GLY A C   1 
ATOM   2405  O  O   . GLY A  1  313 ? -7.951  -13.746 42.531   1.00 142.36 ? 313  GLY A O   1 
ATOM   2406  N  N   . GLN A  1  314 ? -7.485  -14.681 40.539   1.00 139.63 ? 314  GLN A N   1 
ATOM   2407  C  CA  . GLN A  1  314 ? -7.172  -15.984 41.106   1.00 140.17 ? 314  GLN A CA  1 
ATOM   2408  C  C   . GLN A  1  314 ? -6.028  -16.626 40.339   1.00 160.17 ? 314  GLN A C   1 
ATOM   2409  O  O   . GLN A  1  314 ? -5.957  -16.535 39.110   1.00 172.34 ? 314  GLN A O   1 
ATOM   2410  C  CB  . GLN A  1  314 ? -8.380  -16.932 41.082   1.00 139.14 ? 314  GLN A CB  1 
ATOM   2411  C  CG  . GLN A  1  314 ? -8.148  -18.248 41.827   1.00 140.17 ? 314  GLN A CG  1 
ATOM   2412  C  CD  . GLN A  1  314 ? -9.308  -19.222 41.712   1.00 139.39 ? 314  GLN A CD  1 
ATOM   2413  O  OE1 . GLN A  1  314 ? -9.517  -19.835 40.663   1.00 138.14 ? 314  GLN A OE1 1 
ATOM   2414  N  NE2 . GLN A  1  314 ? -10.058 -19.385 42.798   1.00 183.29 ? 314  GLN A NE2 1 
ATOM   2415  N  N   . VAL A  1  315 ? -5.142  -17.282 41.077   1.00 141.86 ? 315  VAL A N   1 
ATOM   2416  C  CA  . VAL A  1  315 ? -4.092  -18.107 40.504   1.00 142.45 ? 315  VAL A CA  1 
ATOM   2417  C  C   . VAL A  1  315 ? -4.303  -19.534 40.983   1.00 143.02 ? 315  VAL A C   1 
ATOM   2418  O  O   . VAL A  1  315 ? -4.465  -19.775 42.185   1.00 144.32 ? 315  VAL A O   1 
ATOM   2419  C  CB  . VAL A  1  315 ? -2.698  -17.587 40.890   1.00 177.09 ? 315  VAL A CB  1 
ATOM   2420  C  CG1 . VAL A  1  315 ? -1.622  -18.538 40.395   1.00 168.85 ? 315  VAL A CG1 1 
ATOM   2421  C  CG2 . VAL A  1  315 ? -2.496  -16.191 40.326   1.00 169.21 ? 315  VAL A CG2 1 
ATOM   2422  N  N   . SER A  1  316 ? -4.324  -20.471 40.045   1.00 143.62 ? 316  SER A N   1 
ATOM   2423  C  CA  . SER A  1  316 ? -4.419  -21.887 40.362   1.00 144.55 ? 316  SER A CA  1 
ATOM   2424  C  C   . SER A  1  316 ? -3.028  -22.510 40.365   1.00 158.26 ? 316  SER A C   1 
ATOM   2425  O  O   . SER A  1  316 ? -2.224  -22.265 39.459   1.00 147.01 ? 316  SER A O   1 
ATOM   2426  C  CB  . SER A  1  316 ? -5.338  -22.601 39.372   1.00 142.95 ? 316  SER A CB  1 
ATOM   2427  O  OG  . SER A  1  316 ? -4.819  -22.535 38.059   1.00 182.83 ? 316  SER A OG  1 
ATOM   2428  N  N   . VAL A  1  317 ? -2.749  -23.309 41.390   1.00 150.05 ? 317  VAL A N   1 
ATOM   2429  C  CA  . VAL A  1  317 ? -1.467  -23.977 41.562   1.00 150.39 ? 317  VAL A CA  1 
ATOM   2430  C  C   . VAL A  1  317 ? -1.675  -25.465 41.316   1.00 151.26 ? 317  VAL A C   1 
ATOM   2431  O  O   . VAL A  1  317 ? -2.374  -26.135 42.085   1.00 151.68 ? 317  VAL A O   1 
ATOM   2432  C  CB  . VAL A  1  317 ? -0.894  -23.722 42.964   1.00 158.67 ? 317  VAL A CB  1 
ATOM   2433  C  CG1 . VAL A  1  317 ? 0.496   -24.312 43.089   1.00 163.75 ? 317  VAL A CG1 1 
ATOM   2434  C  CG2 . VAL A  1  317 ? -0.890  -22.231 43.261   1.00 151.99 ? 317  VAL A CG2 1 
ATOM   2435  N  N   . SER A  1  318 ? -1.050  -25.986 40.260   1.00 169.69 ? 318  SER A N   1 
ATOM   2436  C  CA  . SER A  1  318 ? -1.202  -27.381 39.847   1.00 186.31 ? 318  SER A CA  1 
ATOM   2437  C  C   . SER A  1  318 ? 0.133   -28.106 39.994   1.00 187.50 ? 318  SER A C   1 
ATOM   2438  O  O   . SER A  1  318 ? 1.080   -27.838 39.245   1.00 167.61 ? 318  SER A O   1 
ATOM   2439  C  CB  . SER A  1  318 ? -1.717  -27.466 38.413   1.00 161.15 ? 318  SER A CB  1 
ATOM   2440  O  OG  . SER A  1  318 ? -2.949  -26.783 38.290   1.00 158.12 ? 318  SER A OG  1 
ATOM   2441  N  N   . LEU A  1  319 ? 0.205   -29.024 40.957   1.00 181.57 ? 319  LEU A N   1 
ATOM   2442  C  CA  . LEU A  1  319 ? 1.420   -29.786 41.227   1.00 190.40 ? 319  LEU A CA  1 
ATOM   2443  C  C   . LEU A  1  319 ? 1.481   -31.020 40.326   1.00 196.06 ? 319  LEU A C   1 
ATOM   2444  O  O   . LEU A  1  319 ? 0.592   -31.879 40.378   1.00 178.87 ? 319  LEU A O   1 
ATOM   2445  C  CB  . LEU A  1  319 ? 1.485   -30.186 42.702   1.00 192.57 ? 319  LEU A CB  1 
ATOM   2446  C  CG  . LEU A  1  319 ? 2.134   -29.208 43.694   1.00 187.45 ? 319  LEU A CG  1 
ATOM   2447  C  CD1 . LEU A  1  319 ? 1.514   -27.817 43.634   1.00 183.80 ? 319  LEU A CD1 1 
ATOM   2448  C  CD2 . LEU A  1  319 ? 2.062   -29.756 45.108   1.00 194.40 ? 319  LEU A CD2 1 
ATOM   2449  N  N   . GLN A  1  320 ? 2.526   -31.099 39.499   1.00 197.47 ? 320  GLN A N   1 
ATOM   2450  C  CA  . GLN A  1  320 ? 2.726   -32.236 38.604   1.00 171.58 ? 320  GLN A CA  1 
ATOM   2451  C  C   . GLN A  1  320 ? 3.152   -33.482 39.375   1.00 175.75 ? 320  GLN A C   1 
ATOM   2452  O  O   . GLN A  1  320 ? 3.958   -33.411 40.309   1.00 178.24 ? 320  GLN A O   1 
ATOM   2453  C  CB  . GLN A  1  320 ? 3.781   -31.898 37.551   1.00 172.95 ? 320  GLN A CB  1 
ATOM   2454  C  CG  . GLN A  1  320 ? 4.038   -33.005 36.542   1.00 175.61 ? 320  GLN A CG  1 
ATOM   2455  C  CD  . GLN A  1  320 ? 5.203   -32.699 35.625   1.00 178.70 ? 320  GLN A CD  1 
ATOM   2456  O  OE1 . GLN A  1  320 ? 5.643   -33.554 34.855   1.00 191.59 ? 320  GLN A OE1 1 
ATOM   2457  N  NE2 . GLN A  1  320 ? 5.714   -31.478 35.707   1.00 176.61 ? 320  GLN A NE2 1 
ATOM   2458  N  N   . ARG A  1  321 ? 2.605   -34.631 38.977   1.00 197.83 ? 321  ARG A N   1 
ATOM   2459  C  CA  . ARG A  1  321 ? 2.979   -35.922 39.534   1.00 211.67 ? 321  ARG A CA  1 
ATOM   2460  C  C   . ARG A  1  321 ? 3.434   -36.883 38.440   1.00 192.75 ? 321  ARG A C   1 
ATOM   2461  O  O   . ARG A  1  321 ? 3.023   -36.777 37.279   1.00 190.95 ? 321  ARG A O   1 
ATOM   2462  C  CB  . ARG A  1  321 ? 1.820   -36.538 40.333   1.00 218.51 ? 321  ARG A CB  1 
ATOM   2463  C  CG  . ARG A  1  321 ? 1.235   -35.597 41.379   1.00 212.52 ? 321  ARG A CG  1 
ATOM   2464  C  CD  . ARG A  1  321 ? 2.207   -35.458 42.543   1.00 214.48 ? 321  ARG A CD  1 
ATOM   2465  N  NE  . ARG A  1  321 ? 1.700   -34.626 43.632   1.00 210.42 ? 321  ARG A NE  1 
ATOM   2466  C  CZ  . ARG A  1  321 ? 2.361   -34.399 44.766   1.00 198.20 ? 321  ARG A CZ  1 
ATOM   2467  N  NH1 . ARG A  1  321 ? 3.557   -34.939 44.965   1.00 194.57 ? 321  ARG A NH1 1 
ATOM   2468  N  NH2 . ARG A  1  321 ? 1.832   -33.625 45.703   1.00 187.76 ? 321  ARG A NH2 1 
ATOM   2469  N  N   . ALA A  1  322 ? 4.289   -37.833 38.836   1.00 192.74 ? 322  ALA A N   1 
ATOM   2470  C  CA  . ALA A  1  322 ? 4.806   -38.821 37.896   1.00 211.35 ? 322  ALA A CA  1 
ATOM   2471  C  C   . ALA A  1  322 ? 3.691   -39.697 37.346   1.00 212.22 ? 322  ALA A C   1 
ATOM   2472  O  O   . ALA A  1  322 ? 3.799   -40.209 36.227   1.00 212.11 ? 322  ALA A O   1 
ATOM   2473  C  CB  . ALA A  1  322 ? 5.875   -39.685 38.569   1.00 200.86 ? 322  ALA A CB  1 
ATOM   2474  N  N   . SER A  1  323 ? 2.607   -39.865 38.104   1.00 193.54 ? 323  SER A N   1 
ATOM   2475  C  CA  . SER A  1  323 ? 1.496   -40.680 37.638   1.00 193.14 ? 323  SER A CA  1 
ATOM   2476  C  C   . SER A  1  323 ? 0.696   -39.991 36.555   1.00 188.82 ? 323  SER A C   1 
ATOM   2477  O  O   . SER A  1  323 ? -0.284  -40.568 36.073   1.00 196.76 ? 323  SER A O   1 
ATOM   2478  C  CB  . SER A  1  323 ? 0.579   -41.044 38.806   1.00 192.56 ? 323  SER A CB  1 
ATOM   2479  O  OG  . SER A  1  323 ? 1.284   -41.777 39.787   1.00 197.02 ? 323  SER A OG  1 
ATOM   2480  N  N   . GLY A  1  324 ? 1.082   -38.778 36.171   1.00 198.11 ? 324  GLY A N   1 
ATOM   2481  C  CA  . GLY A  1  324 ? 0.439   -38.051 35.108   1.00 218.92 ? 324  GLY A CA  1 
ATOM   2482  C  C   . GLY A  1  324 ? -0.599  -37.050 35.568   1.00 229.23 ? 324  GLY A C   1 
ATOM   2483  O  O   . GLY A  1  324 ? -0.912  -36.114 34.820   1.00 216.16 ? 324  GLY A O   1 
ATOM   2484  N  N   . ASP A  1  325 ? -1.140  -37.219 36.774   1.00 235.69 ? 325  ASP A N   1 
ATOM   2485  C  CA  . ASP A  1  325 ? -2.193  -36.347 37.275   1.00 220.48 ? 325  ASP A CA  1 
ATOM   2486  C  C   . ASP A  1  325 ? -1.628  -34.986 37.687   1.00 219.78 ? 325  ASP A C   1 
ATOM   2487  O  O   . ASP A  1  325 ? -0.434  -34.703 37.556   1.00 230.61 ? 325  ASP A O   1 
ATOM   2488  C  CB  . ASP A  1  325 ? -2.911  -37.004 38.452   1.00 216.02 ? 325  ASP A CB  1 
ATOM   2489  C  CG  . ASP A  1  325 ? -3.303  -38.440 38.168   1.00 215.90 ? 325  ASP A CG  1 
ATOM   2490  O  OD1 . ASP A  1  325 ? -4.371  -38.649 37.549   1.00 222.53 ? 325  ASP A OD1 1 
ATOM   2491  O  OD2 . ASP A  1  325 ? -2.552  -39.358 38.567   1.00 194.98 ? 325  ASP A OD2 1 
ATOM   2492  N  N   . PHE A  1  326 ? -2.515  -34.135 38.202   1.00 201.65 ? 326  PHE A N   1 
ATOM   2493  C  CA  . PHE A  1  326 ? -2.155  -32.821 38.722   1.00 193.05 ? 326  PHE A CA  1 
ATOM   2494  C  C   . PHE A  1  326 ? -2.922  -32.571 40.011   1.00 198.90 ? 326  PHE A C   1 
ATOM   2495  O  O   . PHE A  1  326 ? -4.129  -32.826 40.074   1.00 210.05 ? 326  PHE A O   1 
ATOM   2496  C  CB  . PHE A  1  326 ? -2.455  -31.710 37.705   1.00 176.44 ? 326  PHE A CB  1 
ATOM   2497  C  CG  . PHE A  1  326 ? -1.473  -31.639 36.561   1.00 178.11 ? 326  PHE A CG  1 
ATOM   2498  C  CD1 . PHE A  1  326 ? -1.638  -32.422 35.428   1.00 180.23 ? 326  PHE A CD1 1 
ATOM   2499  C  CD2 . PHE A  1  326 ? -0.389  -30.774 36.618   1.00 170.42 ? 326  PHE A CD2 1 
ATOM   2500  C  CE1 . PHE A  1  326 ? -0.736  -32.347 34.379   1.00 178.26 ? 326  PHE A CE1 1 
ATOM   2501  C  CE2 . PHE A  1  326 ? 0.514   -30.696 35.573   1.00 171.76 ? 326  PHE A CE2 1 
ATOM   2502  C  CZ  . PHE A  1  326 ? 0.341   -31.483 34.453   1.00 172.67 ? 326  PHE A CZ  1 
ATOM   2503  N  N   . GLN A  1  327 ? -2.232  -32.067 41.030   1.00 190.41 ? 327  GLN A N   1 
ATOM   2504  C  CA  . GLN A  1  327 ? -2.869  -31.633 42.273   1.00 176.75 ? 327  GLN A CA  1 
ATOM   2505  C  C   . GLN A  1  327 ? -3.073  -30.125 42.202   1.00 171.95 ? 327  GLN A C   1 
ATOM   2506  O  O   . GLN A  1  327 ? -2.126  -29.352 42.360   1.00 171.44 ? 327  GLN A O   1 
ATOM   2507  C  CB  . GLN A  1  327 ? -2.030  -32.028 43.480   1.00 181.45 ? 327  GLN A CB  1 
ATOM   2508  C  CG  . GLN A  1  327 ? -1.672  -33.502 43.529   1.00 194.16 ? 327  GLN A CG  1 
ATOM   2509  C  CD  . GLN A  1  327 ? -1.129  -33.912 44.882   1.00 210.46 ? 327  GLN A CD  1 
ATOM   2510  O  OE1 . GLN A  1  327 ? -0.492  -33.116 45.571   1.00 217.07 ? 327  GLN A OE1 1 
ATOM   2511  N  NE2 . GLN A  1  327 ? -1.381  -35.157 45.274   1.00 213.56 ? 327  GLN A NE2 1 
ATOM   2512  N  N   . THR A  1  328 ? -4.315  -29.705 41.982   1.00 170.68 ? 328  THR A N   1 
ATOM   2513  C  CA  . THR A  1  328 ? -4.639  -28.307 41.738   1.00 178.69 ? 328  THR A CA  1 
ATOM   2514  C  C   . THR A  1  328 ? -5.299  -27.683 42.961   1.00 176.06 ? 328  THR A C   1 
ATOM   2515  O  O   . THR A  1  328 ? -6.249  -28.242 43.520   1.00 169.88 ? 328  THR A O   1 
ATOM   2516  C  CB  . THR A  1  328 ? -5.549  -28.163 40.516   1.00 180.95 ? 328  THR A CB  1 
ATOM   2517  O  OG1 . THR A  1  328 ? -4.906  -28.745 39.373   1.00 155.07 ? 328  THR A OG1 1 
ATOM   2518  C  CG2 . THR A  1  328 ? -5.868  -26.693 40.246   1.00 175.51 ? 328  THR A CG2 1 
ATOM   2519  N  N   . THR A  1  329 ? -4.790  -26.524 43.367   1.00 159.05 ? 329  THR A N   1 
ATOM   2520  C  CA  . THR A  1  329 ? -5.406  -25.665 44.365   1.00 149.85 ? 329  THR A CA  1 
ATOM   2521  C  C   . THR A  1  329 ? -5.621  -24.291 43.745   1.00 147.53 ? 329  THR A C   1 
ATOM   2522  O  O   . THR A  1  329 ? -5.241  -24.037 42.601   1.00 149.40 ? 329  THR A O   1 
ATOM   2523  C  CB  . THR A  1  329 ? -4.548  -25.569 45.637   1.00 154.84 ? 329  THR A CB  1 
ATOM   2524  O  OG1 . THR A  1  329 ? -3.216  -25.155 45.302   1.00 153.52 ? 329  THR A OG1 1 
ATOM   2525  C  CG2 . THR A  1  329 ? -4.495  -26.915 46.348   1.00 169.79 ? 329  THR A CG2 1 
ATOM   2526  N  N   . LYS A  1  330 ? -6.272  -23.407 44.485   1.00 147.21 ? 330  LYS A N   1 
ATOM   2527  C  CA  . LYS A  1  330 ? -6.573  -22.086 43.962   1.00 145.38 ? 330  LYS A CA  1 
ATOM   2528  C  C   . LYS A  1  330 ? -6.221  -21.023 44.989   1.00 146.76 ? 330  LYS A C   1 
ATOM   2529  O  O   . LYS A  1  330 ? -6.529  -21.166 46.176   1.00 148.43 ? 330  LYS A O   1 
ATOM   2530  C  CB  . LYS A  1  330 ? -8.039  -21.987 43.559   1.00 143.53 ? 330  LYS A CB  1 
ATOM   2531  C  CG  . LYS A  1  330 ? -8.322  -22.637 42.218   1.00 153.67 ? 330  LYS A CG  1 
ATOM   2532  C  CD  . LYS A  1  330 ? -9.806  -22.749 41.941   1.00 163.27 ? 330  LYS A CD  1 
ATOM   2533  C  CE  . LYS A  1  330 ? -10.055 -23.275 40.536   1.00 171.72 ? 330  LYS A CE  1 
ATOM   2534  N  NZ  . LYS A  1  330 ? -9.279  -24.523 40.270   1.00 177.13 ? 330  LYS A NZ  1 
ATOM   2535  N  N   . LEU A  1  331 ? -5.581  -19.955 44.519   1.00 146.35 ? 331  LEU A N   1 
ATOM   2536  C  CA  . LEU A  1  331 ? -5.117  -18.860 45.366   1.00 147.95 ? 331  LEU A CA  1 
ATOM   2537  C  C   . LEU A  1  331 ? -5.817  -17.581 44.927   1.00 146.51 ? 331  LEU A C   1 
ATOM   2538  O  O   . LEU A  1  331 ? -5.590  -17.095 43.814   1.00 148.38 ? 331  LEU A O   1 
ATOM   2539  C  CB  . LEU A  1  331 ? -3.597  -18.711 45.282   1.00 149.54 ? 331  LEU A CB  1 
ATOM   2540  C  CG  . LEU A  1  331 ? -2.942  -17.750 46.278   1.00 151.95 ? 331  LEU A CG  1 
ATOM   2541  C  CD1 . LEU A  1  331 ? -3.223  -18.195 47.703   1.00 162.38 ? 331  LEU A CD1 1 
ATOM   2542  C  CD2 . LEU A  1  331 ? -1.443  -17.642 46.038   1.00 153.65 ? 331  LEU A CD2 1 
ATOM   2543  N  N   . ASN A  1  332 ? -6.651  -17.032 45.803   1.00 147.28 ? 332  ASN A N   1 
ATOM   2544  C  CA  . ASN A  1  332 ? -7.409  -15.825 45.511   1.00 146.50 ? 332  ASN A CA  1 
ATOM   2545  C  C   . ASN A  1  332 ? -6.617  -14.581 45.894   1.00 148.23 ? 332  ASN A C   1 
ATOM   2546  O  O   . ASN A  1  332 ? -5.811  -14.598 46.828   1.00 150.56 ? 332  ASN A O   1 
ATOM   2547  C  CB  . ASN A  1  332 ? -8.745  -15.838 46.256   1.00 146.99 ? 332  ASN A CB  1 
ATOM   2548  C  CG  . ASN A  1  332 ? -9.744  -16.797 45.643   1.00 159.93 ? 332  ASN A CG  1 
ATOM   2549  O  OD1 . ASN A  1  332 ? -9.386  -17.629 44.809   1.00 165.28 ? 332  ASN A OD1 1 
ATOM   2550  N  ND2 . ASN A  1  332 ? -11.005 -16.688 46.053   1.00 154.00 ? 332  ASN A ND2 1 
ATOM   2551  N  N   . GLY A  1  333 ? -6.847  -13.500 45.153   1.00 147.34 ? 333  GLY A N   1 
ATOM   2552  C  CA  . GLY A  1  333 ? -6.209  -12.233 45.449   1.00 149.18 ? 333  GLY A CA  1 
ATOM   2553  C  C   . GLY A  1  333 ? -6.736  -11.588 46.719   1.00 151.63 ? 333  GLY A C   1 
ATOM   2554  O  O   . GLY A  1  333 ? -7.705  -12.032 47.335   1.00 151.84 ? 333  GLY A O   1 
ATOM   2555  N  N   . PHE A  1  334 ? -6.070  -10.502 47.121   1.00 153.89 ? 334  PHE A N   1 
ATOM   2556  C  CA  . PHE A  1  334 ? -6.375  -9.819  48.373   1.00 168.81 ? 334  PHE A CA  1 
ATOM   2557  C  C   . PHE A  1  334 ? -7.091  -8.494  48.194   1.00 183.18 ? 334  PHE A C   1 
ATOM   2558  O  O   . PHE A  1  334 ? -7.851  -8.096  49.079   1.00 197.11 ? 334  PHE A O   1 
ATOM   2559  C  CB  . PHE A  1  334 ? -5.094  -9.561  49.181   1.00 175.06 ? 334  PHE A CB  1 
ATOM   2560  C  CG  . PHE A  1  334 ? -4.235  -10.776 49.372   1.00 176.63 ? 334  PHE A CG  1 
ATOM   2561  C  CD1 . PHE A  1  334 ? -4.416  -11.605 50.468   1.00 166.23 ? 334  PHE A CD1 1 
ATOM   2562  C  CD2 . PHE A  1  334 ? -3.242  -11.088 48.460   1.00 176.65 ? 334  PHE A CD2 1 
ATOM   2563  C  CE1 . PHE A  1  334 ? -3.622  -12.726 50.648   1.00 163.82 ? 334  PHE A CE1 1 
ATOM   2564  C  CE2 . PHE A  1  334 ? -2.446  -12.208 48.633   1.00 173.53 ? 334  PHE A CE2 1 
ATOM   2565  C  CZ  . PHE A  1  334 ? -2.637  -13.027 49.729   1.00 168.41 ? 334  PHE A CZ  1 
ATOM   2566  N  N   . GLU A  1  335 ? -6.868  -7.795  47.087   1.00 179.69 ? 335  GLU A N   1 
ATOM   2567  C  CA  . GLU A  1  335 ? -7.441  -6.476  46.875   1.00 174.11 ? 335  GLU A CA  1 
ATOM   2568  C  C   . GLU A  1  335 ? -8.401  -6.486  45.691   1.00 168.69 ? 335  GLU A C   1 
ATOM   2569  O  O   . GLU A  1  335 ? -8.123  -7.102  44.655   1.00 159.27 ? 335  GLU A O   1 
ATOM   2570  C  CB  . GLU A  1  335 ? -6.331  -5.437  46.669   1.00 171.89 ? 335  GLU A CB  1 
ATOM   2571  C  CG  . GLU A  1  335 ? -5.675  -4.984  47.974   1.00 167.47 ? 335  GLU A CG  1 
ATOM   2572  C  CD  . GLU A  1  335 ? -4.891  -3.695  47.822   1.00 182.80 ? 335  GLU A CD  1 
ATOM   2573  O  OE1 . GLU A  1  335 ? -3.863  -3.537  48.515   1.00 192.10 ? 335  GLU A OE1 1 
ATOM   2574  O  OE2 . GLU A  1  335 ? -5.301  -2.839  47.008   1.00 190.47 ? 335  GLU A OE2 1 
ATOM   2575  N  N   . VAL A  1  336 ? -9.527  -5.785  45.857   1.00 170.04 ? 336  VAL A N   1 
ATOM   2576  C  CA  . VAL A  1  336 ? -10.539 -5.668  44.808   1.00 165.55 ? 336  VAL A CA  1 
ATOM   2577  C  C   . VAL A  1  336 ? -9.995  -4.851  43.642   1.00 154.12 ? 336  VAL A C   1 
ATOM   2578  O  O   . VAL A  1  336 ? -9.368  -3.801  43.838   1.00 168.87 ? 336  VAL A O   1 
ATOM   2579  C  CB  . VAL A  1  336 ? -11.820 -5.040  45.378   1.00 156.11 ? 336  VAL A CB  1 
ATOM   2580  C  CG1 . VAL A  1  336 ? -12.990 -5.264  44.440   1.00 154.14 ? 336  VAL A CG1 1 
ATOM   2581  C  CG2 . VAL A  1  336 ? -12.123 -5.618  46.755   1.00 157.90 ? 336  VAL A CG2 1 
ATOM   2582  N  N   . PHE A  1  337 ? -10.231 -5.335  42.422   1.00 150.45 ? 337  PHE A N   1 
ATOM   2583  C  CA  . PHE A  1  337 ? -9.831  -4.686  41.174   1.00 149.69 ? 337  PHE A CA  1 
ATOM   2584  C  C   . PHE A  1  337 ? -8.319  -4.582  41.016   1.00 180.89 ? 337  PHE A C   1 
ATOM   2585  O  O   . PHE A  1  337 ? -7.840  -3.903  40.097   1.00 173.03 ? 337  PHE A O   1 
ATOM   2586  C  CB  . PHE A  1  337 ? -10.466 -3.299  41.030   1.00 151.85 ? 337  PHE A CB  1 
ATOM   2587  C  CG  . PHE A  1  337 ? -11.960 -3.333  40.956   1.00 151.67 ? 337  PHE A CG  1 
ATOM   2588  C  CD1 . PHE A  1  337 ? -12.617 -4.466  40.507   1.00 149.03 ? 337  PHE A CD1 1 
ATOM   2589  C  CD2 . PHE A  1  337 ? -12.710 -2.241  41.350   1.00 166.46 ? 337  PHE A CD2 1 
ATOM   2590  C  CE1 . PHE A  1  337 ? -13.999 -4.504  40.443   1.00 158.13 ? 337  PHE A CE1 1 
ATOM   2591  C  CE2 . PHE A  1  337 ? -14.089 -2.273  41.289   1.00 165.13 ? 337  PHE A CE2 1 
ATOM   2592  C  CZ  . PHE A  1  337 ? -14.735 -3.407  40.835   1.00 160.74 ? 337  PHE A CZ  1 
ATOM   2593  N  N   . ALA A  1  338 ? -7.552  -5.240  41.890   1.00 168.21 ? 338  ALA A N   1 
ATOM   2594  C  CA  . ALA A  1  338 ? -6.101  -5.213  41.803   1.00 151.44 ? 338  ALA A CA  1 
ATOM   2595  C  C   . ALA A  1  338 ? -5.584  -6.089  40.683   1.00 148.93 ? 338  ALA A C   1 
ATOM   2596  O  O   . ALA A  1  338 ? -4.431  -5.927  40.270   1.00 181.23 ? 338  ALA A O   1 
ATOM   2597  C  CB  . ALA A  1  338 ? -5.491  -5.670  43.129   1.00 153.24 ? 338  ALA A CB  1 
ATOM   2598  N  N   . ARG A  1  339 ? -6.415  -7.000  40.184   1.00 146.41 ? 339  ARG A N   1 
ATOM   2599  C  CA  . ARG A  1  339 ? -6.024  -7.934  39.138   1.00 144.27 ? 339  ARG A CA  1 
ATOM   2600  C  C   . ARG A  1  339 ? -4.825  -8.764  39.592   1.00 159.60 ? 339  ARG A C   1 
ATOM   2601  O  O   . ARG A  1  339 ? -3.807  -8.873  38.901   1.00 159.17 ? 339  ARG A O   1 
ATOM   2602  C  CB  . ARG A  1  339 ? -5.746  -7.208  37.820   1.00 143.92 ? 339  ARG A CB  1 
ATOM   2603  C  CG  . ARG A  1  339 ? -6.970  -6.523  37.252   1.00 143.32 ? 339  ARG A CG  1 
ATOM   2604  C  CD  . ARG A  1  339 ? -6.739  -6.035  35.837   1.00 142.84 ? 339  ARG A CD  1 
ATOM   2605  N  NE  . ARG A  1  339 ? -7.868  -5.253  35.337   1.00 142.84 ? 339  ARG A NE  1 
ATOM   2606  C  CZ  . ARG A  1  339 ? -7.949  -4.759  34.105   1.00 142.60 ? 339  ARG A CZ  1 
ATOM   2607  N  NH1 . ARG A  1  339 ? -6.970  -4.968  33.237   1.00 142.31 ? 339  ARG A NH1 1 
ATOM   2608  N  NH2 . ARG A  1  339 ? -9.010  -4.060  33.736   1.00 142.96 ? 339  ARG A NH2 1 
ATOM   2609  N  N   . PHE A  1  340 ? -4.950  -9.327  40.794   1.00 169.88 ? 340  PHE A N   1 
ATOM   2610  C  CA  . PHE A  1  340 ? -3.997  -10.311 41.291   1.00 146.39 ? 340  PHE A CA  1 
ATOM   2611  C  C   . PHE A  1  340 ? -3.851  -11.448 40.289   1.00 144.40 ? 340  PHE A C   1 
ATOM   2612  O  O   . PHE A  1  340 ? -4.840  -12.053 39.872   1.00 158.99 ? 340  PHE A O   1 
ATOM   2613  C  CB  . PHE A  1  340 ? -4.488  -10.833 42.645   1.00 147.32 ? 340  PHE A CB  1 
ATOM   2614  C  CG  . PHE A  1  340 ? -3.628  -11.903 43.247   1.00 156.26 ? 340  PHE A CG  1 
ATOM   2615  C  CD1 . PHE A  1  340 ? -2.566  -11.574 44.068   1.00 156.48 ? 340  PHE A CD1 1 
ATOM   2616  C  CD2 . PHE A  1  340 ? -3.907  -13.241 43.022   1.00 152.92 ? 340  PHE A CD2 1 
ATOM   2617  C  CE1 . PHE A  1  340 ? -1.780  -12.559 44.631   1.00 152.34 ? 340  PHE A CE1 1 
ATOM   2618  C  CE2 . PHE A  1  340 ? -3.129  -14.228 43.582   1.00 148.13 ? 340  PHE A CE2 1 
ATOM   2619  C  CZ  . PHE A  1  340 ? -2.062  -13.887 44.388   1.00 150.88 ? 340  PHE A CZ  1 
ATOM   2620  N  N   . GLY A  1  341 ? -2.616  -11.757 39.921   1.00 145.26 ? 341  GLY A N   1 
ATOM   2621  C  CA  . GLY A  1  341 ? -2.370  -12.775 38.925   1.00 143.95 ? 341  GLY A CA  1 
ATOM   2622  C  C   . GLY A  1  341 ? -2.060  -12.256 37.542   1.00 143.34 ? 341  GLY A C   1 
ATOM   2623  O  O   . GLY A  1  341 ? -2.049  -13.047 36.592   1.00 142.23 ? 341  GLY A O   1 
ATOM   2624  N  N   . SER A  1  342 ? -1.869  -10.947 37.387   1.00 144.25 ? 342  SER A N   1 
ATOM   2625  C  CA  . SER A  1  342 ? -1.537  -10.397 36.081   1.00 144.06 ? 342  SER A CA  1 
ATOM   2626  C  C   . SER A  1  342 ? -0.151  -10.823 35.622   1.00 145.58 ? 342  SER A C   1 
ATOM   2627  O  O   . SER A  1  342 ? 0.067   -11.037 34.424   1.00 145.10 ? 342  SER A O   1 
ATOM   2628  C  CB  . SER A  1  342 ? -1.622  -8.879  36.132   1.00 145.20 ? 342  SER A CB  1 
ATOM   2629  O  OG  . SER A  1  342 ? -2.939  -8.476  36.444   1.00 169.12 ? 342  SER A OG  1 
ATOM   2630  N  N   . ALA A  1  343 ? 0.792   -10.956 36.550   1.00 150.63 ? 343  ALA A N   1 
ATOM   2631  C  CA  . ALA A  1  343 ? 2.143   -11.386 36.231   1.00 155.33 ? 343  ALA A CA  1 
ATOM   2632  C  C   . ALA A  1  343 ? 2.608   -12.402 37.262   1.00 150.99 ? 343  ALA A C   1 
ATOM   2633  O  O   . ALA A  1  343 ? 2.363   -12.241 38.462   1.00 151.59 ? 343  ALA A O   1 
ATOM   2634  C  CB  . ALA A  1  343 ? 3.109   -10.198 36.184   1.00 160.16 ? 343  ALA A CB  1 
ATOM   2635  N  N   . ILE A  1  344 ? 3.273   -13.449 36.781   1.00 151.66 ? 344  ILE A N   1 
ATOM   2636  C  CA  . ILE A  1  344 ? 3.769   -14.543 37.607   1.00 153.15 ? 344  ILE A CA  1 
ATOM   2637  C  C   . ILE A  1  344 ? 5.215   -14.797 37.198   1.00 185.88 ? 344  ILE A C   1 
ATOM   2638  O  O   . ILE A  1  344 ? 5.478   -15.194 36.055   1.00 189.76 ? 344  ILE A O   1 
ATOM   2639  C  CB  . ILE A  1  344 ? 2.922   -15.813 37.453   1.00 151.16 ? 344  ILE A CB  1 
ATOM   2640  C  CG1 . ILE A  1  344 ? 1.435   -15.487 37.635   1.00 156.56 ? 344  ILE A CG1 1 
ATOM   2641  C  CG2 . ILE A  1  344 ? 3.361   -16.870 38.451   1.00 152.98 ? 344  ILE A CG2 1 
ATOM   2642  C  CD1 . ILE A  1  344 ? 0.505   -16.651 37.358   1.00 159.47 ? 344  ILE A CD1 1 
ATOM   2643  N  N   . ALA A  1  345 ? 6.150   -14.540 38.110   1.00 191.84 ? 345  ALA A N   1 
ATOM   2644  C  CA  . ALA A  1  345 ? 7.584   -14.689 37.843   1.00 162.64 ? 345  ALA A CA  1 
ATOM   2645  C  C   . ALA A  1  345 ? 8.195   -15.731 38.765   1.00 165.08 ? 345  ALA A C   1 
ATOM   2646  O  O   . ALA A  1  345 ? 8.214   -15.526 39.994   1.00 166.21 ? 345  ALA A O   1 
ATOM   2647  C  CB  . ALA A  1  345 ? 8.310   -13.356 38.017   1.00 164.88 ? 345  ALA A CB  1 
ATOM   2648  N  N   . PRO A  1  346 ? 8.681   -16.857 38.244   1.00 166.24 ? 346  PRO A N   1 
ATOM   2649  C  CA  . PRO A  1  346 ? 9.441   -17.788 39.087   1.00 169.42 ? 346  PRO A CA  1 
ATOM   2650  C  C   . PRO A  1  346 ? 10.695  -17.114 39.617   1.00 173.46 ? 346  PRO A C   1 
ATOM   2651  O  O   . PRO A  1  346 ? 11.423  -16.454 38.873   1.00 174.96 ? 346  PRO A O   1 
ATOM   2652  C  CB  . PRO A  1  346 ? 9.775   -18.942 38.136   1.00 170.25 ? 346  PRO A CB  1 
ATOM   2653  C  CG  . PRO A  1  346 ? 8.796   -18.818 37.013   1.00 170.38 ? 346  PRO A CG  1 
ATOM   2654  C  CD  . PRO A  1  346 ? 8.548   -17.346 36.863   1.00 165.09 ? 346  PRO A CD  1 
ATOM   2655  N  N   . LEU A  1  347 ? 10.937  -17.269 40.916   1.00 175.48 ? 347  LEU A N   1 
ATOM   2656  C  CA  . LEU A  1  347 ? 12.030  -16.577 41.589   1.00 181.01 ? 347  LEU A CA  1 
ATOM   2657  C  C   . LEU A  1  347 ? 13.241  -17.463 41.853   1.00 184.09 ? 347  LEU A C   1 
ATOM   2658  O  O   . LEU A  1  347 ? 14.247  -16.975 42.380   1.00 188.02 ? 347  LEU A O   1 
ATOM   2659  C  CB  . LEU A  1  347 ? 11.534  -15.990 42.914   1.00 181.16 ? 347  LEU A CB  1 
ATOM   2660  C  CG  . LEU A  1  347 ? 10.297  -15.099 42.845   1.00 175.36 ? 347  LEU A CG  1 
ATOM   2661  C  CD1 . LEU A  1  347 ? 9.902   -14.626 44.234   1.00 176.06 ? 347  LEU A CD1 1 
ATOM   2662  C  CD2 . LEU A  1  347 ? 10.556  -13.919 41.928   1.00 175.11 ? 347  LEU A CD2 1 
ATOM   2663  N  N   . GLY A  1  348 ? 13.176  -18.746 41.505   1.00 184.08 ? 348  GLY A N   1 
ATOM   2664  C  CA  . GLY A  1  348 ? 14.208  -19.632 41.988   1.00 188.73 ? 348  GLY A CA  1 
ATOM   2665  C  C   . GLY A  1  348 ? 13.983  -19.888 43.466   1.00 189.74 ? 348  GLY A C   1 
ATOM   2666  O  O   . GLY A  1  348 ? 12.857  -19.852 43.965   1.00 186.40 ? 348  GLY A O   1 
ATOM   2667  N  N   . ASP A  1  349 ? 15.070  -20.143 44.186   1.00 198.51 ? 349  ASP A N   1 
ATOM   2668  C  CA  . ASP A  1  349 ? 15.003  -20.298 45.637   1.00 201.93 ? 349  ASP A CA  1 
ATOM   2669  C  C   . ASP A  1  349 ? 15.434  -18.964 46.234   1.00 205.77 ? 349  ASP A C   1 
ATOM   2670  O  O   . ASP A  1  349 ? 16.598  -18.765 46.584   1.00 206.77 ? 349  ASP A O   1 
ATOM   2671  C  CB  . ASP A  1  349 ? 15.874  -21.448 46.119   1.00 205.28 ? 349  ASP A CB  1 
ATOM   2672  C  CG  . ASP A  1  349 ? 15.465  -21.947 47.490   1.00 211.04 ? 349  ASP A CG  1 
ATOM   2673  O  OD1 . ASP A  1  349 ? 14.708  -21.233 48.192   1.00 215.83 ? 349  ASP A OD1 1 
ATOM   2674  O  OD2 . ASP A  1  349 ? 15.898  -23.056 47.864   1.00 219.78 ? 349  ASP A OD2 1 
ATOM   2675  N  N   . LEU A  1  350 ? 14.469  -18.045 46.343   1.00 201.32 ? 350  LEU A N   1 
ATOM   2676  C  CA  . LEU A  1  350 ? 14.754  -16.681 46.781   1.00 202.63 ? 350  LEU A CA  1 
ATOM   2677  C  C   . LEU A  1  350 ? 15.466  -16.646 48.128   1.00 207.43 ? 350  LEU A C   1 
ATOM   2678  O  O   . LEU A  1  350 ? 16.328  -15.789 48.351   1.00 210.88 ? 350  LEU A O   1 
ATOM   2679  C  CB  . LEU A  1  350 ? 13.454  -15.880 46.853   1.00 198.12 ? 350  LEU A CB  1 
ATOM   2680  C  CG  . LEU A  1  350 ? 13.567  -14.390 47.184   1.00 207.45 ? 350  LEU A CG  1 
ATOM   2681  C  CD1 . LEU A  1  350 ? 14.355  -13.659 46.109   1.00 200.11 ? 350  LEU A CD1 1 
ATOM   2682  C  CD2 . LEU A  1  350 ? 12.196  -13.757 47.378   1.00 212.94 ? 350  LEU A CD2 1 
ATOM   2683  N  N   . ASP A  1  351 ? 15.140  -17.569 49.030   1.00 212.25 ? 351  ASP A N   1 
ATOM   2684  C  CA  . ASP A  1  351 ? 15.712  -17.560 50.369   1.00 216.85 ? 351  ASP A CA  1 
ATOM   2685  C  C   . ASP A  1  351 ? 16.623  -18.755 50.615   1.00 229.96 ? 351  ASP A C   1 
ATOM   2686  O  O   . ASP A  1  351 ? 17.108  -18.932 51.738   1.00 244.44 ? 351  ASP A O   1 
ATOM   2687  C  CB  . ASP A  1  351 ? 14.603  -17.481 51.426   1.00 226.42 ? 351  ASP A CB  1 
ATOM   2688  C  CG  . ASP A  1  351 ? 13.495  -18.498 51.208   1.00 235.53 ? 351  ASP A CG  1 
ATOM   2689  O  OD1 . ASP A  1  351 ? 13.104  -18.724 50.042   1.00 241.21 ? 351  ASP A OD1 1 
ATOM   2690  O  OD2 . ASP A  1  351 ? 12.989  -19.047 52.213   1.00 232.90 ? 351  ASP A OD2 1 
ATOM   2691  N  N   . GLN A  1  352 ? 16.888  -19.557 49.581   1.00 213.26 ? 352  GLN A N   1 
ATOM   2692  C  CA  . GLN A  1  352 ? 17.825  -20.677 49.657   1.00 226.95 ? 352  GLN A CA  1 
ATOM   2693  C  C   . GLN A  1  352 ? 17.470  -21.630 50.797   1.00 231.43 ? 352  GLN A C   1 
ATOM   2694  O  O   . GLN A  1  352 ? 18.299  -21.964 51.646   1.00 230.79 ? 352  GLN A O   1 
ATOM   2695  C  CB  . GLN A  1  352 ? 19.264  -20.174 49.788   1.00 223.58 ? 352  GLN A CB  1 
ATOM   2696  C  CG  . GLN A  1  352 ? 19.805  -19.420 48.571   1.00 226.27 ? 352  GLN A CG  1 
ATOM   2697  C  CD  . GLN A  1  352 ? 19.927  -20.278 47.316   1.00 223.48 ? 352  GLN A CD  1 
ATOM   2698  O  OE1 . GLN A  1  352 ? 18.935  -20.786 46.789   1.00 217.73 ? 352  GLN A OE1 1 
ATOM   2699  N  NE2 . GLN A  1  352 ? 21.154  -20.447 46.838   1.00 227.13 ? 352  GLN A NE2 1 
ATOM   2700  N  N   . ASP A  1  353 ? 16.213  -22.073 50.811   1.00 229.96 ? 353  ASP A N   1 
ATOM   2701  C  CA  . ASP A  1  353 ? 15.740  -23.030 51.801   1.00 223.29 ? 353  ASP A CA  1 
ATOM   2702  C  C   . ASP A  1  353 ? 15.584  -24.438 51.238   1.00 225.89 ? 353  ASP A C   1 
ATOM   2703  O  O   . ASP A  1  353 ? 15.217  -25.354 51.981   1.00 235.13 ? 353  ASP A O   1 
ATOM   2704  C  CB  . ASP A  1  353 ? 14.406  -22.555 52.403   1.00 218.94 ? 353  ASP A CB  1 
ATOM   2705  C  CG  . ASP A  1  353 ? 13.309  -22.330 51.344   1.00 240.62 ? 353  ASP A CG  1 
ATOM   2706  O  OD1 . ASP A  1  353 ? 13.437  -22.825 50.206   1.00 248.99 ? 353  ASP A OD1 1 
ATOM   2707  O  OD2 . ASP A  1  353 ? 12.304  -21.651 51.652   1.00 235.45 ? 353  ASP A OD2 1 
ATOM   2708  N  N   . GLY A  1  354 ? 15.879  -24.639 49.955   1.00 217.18 ? 354  GLY A N   1 
ATOM   2709  C  CA  . GLY A  1  354 ? 15.734  -25.931 49.322   1.00 217.09 ? 354  GLY A CA  1 
ATOM   2710  C  C   . GLY A  1  354 ? 14.468  -26.090 48.511   1.00 211.85 ? 354  GLY A C   1 
ATOM   2711  O  O   . GLY A  1  354 ? 14.261  -27.156 47.917   1.00 211.14 ? 354  GLY A O   1 
ATOM   2712  N  N   . PHE A  1  355 ? 13.606  -25.078 48.484   1.00 200.31 ? 355  PHE A N   1 
ATOM   2713  C  CA  . PHE A  1  355 ? 12.365  -25.120 47.726   1.00 194.82 ? 355  PHE A CA  1 
ATOM   2714  C  C   . PHE A  1  355 ? 12.202  -23.819 46.960   1.00 191.63 ? 355  PHE A C   1 
ATOM   2715  O  O   . PHE A  1  355 ? 12.379  -22.734 47.523   1.00 192.04 ? 355  PHE A O   1 
ATOM   2716  C  CB  . PHE A  1  355 ? 11.163  -25.348 48.636   1.00 192.56 ? 355  PHE A CB  1 
ATOM   2717  C  CG  . PHE A  1  355 ? 11.202  -26.653 49.362   1.00 195.57 ? 355  PHE A CG  1 
ATOM   2718  C  CD1 . PHE A  1  355 ? 10.951  -27.839 48.695   1.00 195.31 ? 355  PHE A CD1 1 
ATOM   2719  C  CD2 . PHE A  1  355 ? 11.483  -26.695 50.714   1.00 198.98 ? 355  PHE A CD2 1 
ATOM   2720  C  CE1 . PHE A  1  355 ? 10.985  -29.042 49.364   1.00 198.42 ? 355  PHE A CE1 1 
ATOM   2721  C  CE2 . PHE A  1  355 ? 11.518  -27.894 51.389   1.00 202.05 ? 355  PHE A CE2 1 
ATOM   2722  C  CZ  . PHE A  1  355 ? 11.269  -29.070 50.714   1.00 201.77 ? 355  PHE A CZ  1 
ATOM   2723  N  N   . ASN A  1  356 ? 11.878  -23.931 45.679   1.00 188.81 ? 356  ASN A N   1 
ATOM   2724  C  CA  . ASN A  1  356 ? 11.687  -22.749 44.851   1.00 195.54 ? 356  ASN A CA  1 
ATOM   2725  C  C   . ASN A  1  356 ? 10.505  -21.915 45.343   1.00 197.84 ? 356  ASN A C   1 
ATOM   2726  O  O   . ASN A  1  356 ? 9.575   -22.418 45.983   1.00 180.47 ? 356  ASN A O   1 
ATOM   2727  C  CB  . ASN A  1  356 ? 11.476  -23.155 43.395   1.00 201.64 ? 356  ASN A CB  1 
ATOM   2728  C  CG  . ASN A  1  356 ? 12.754  -23.627 42.739   1.00 188.57 ? 356  ASN A CG  1 
ATOM   2729  O  OD1 . ASN A  1  356 ? 13.844  -23.184 43.096   1.00 208.93 ? 356  ASN A OD1 1 
ATOM   2730  N  ND2 . ASN A  1  356 ? 12.630  -24.538 41.781   1.00 187.58 ? 356  ASN A ND2 1 
ATOM   2731  N  N   . ASP A  1  357 ? 10.568  -20.618 45.057   1.00 192.31 ? 357  ASP A N   1 
ATOM   2732  C  CA  . ASP A  1  357 ? 9.571   -19.641 45.464   1.00 177.84 ? 357  ASP A CA  1 
ATOM   2733  C  C   . ASP A  1  357 ? 9.070   -18.897 44.231   1.00 174.31 ? 357  ASP A C   1 
ATOM   2734  O  O   . ASP A  1  357 ? 9.639   -19.005 43.140   1.00 174.63 ? 357  ASP A O   1 
ATOM   2735  C  CB  . ASP A  1  357 ? 10.155  -18.673 46.497   1.00 193.70 ? 357  ASP A CB  1 
ATOM   2736  C  CG  . ASP A  1  357 ? 10.898  -19.395 47.607   1.00 196.84 ? 357  ASP A CG  1 
ATOM   2737  O  OD1 . ASP A  1  357 ? 10.355  -20.382 48.151   1.00 190.41 ? 357  ASP A OD1 1 
ATOM   2738  O  OD2 . ASP A  1  357 ? 12.032  -18.988 47.930   1.00 192.29 ? 357  ASP A OD2 1 
ATOM   2739  N  N   . ILE A  1  358 ? 7.994   -18.128 44.403   1.00 176.14 ? 358  ILE A N   1 
ATOM   2740  C  CA  . ILE A  1  358 ? 7.346   -17.475 43.271   1.00 167.80 ? 358  ILE A CA  1 
ATOM   2741  C  C   . ILE A  1  358 ? 6.759   -16.134 43.695   1.00 166.66 ? 358  ILE A C   1 
ATOM   2742  O  O   . ILE A  1  358 ? 6.391   -15.931 44.856   1.00 167.39 ? 358  ILE A O   1 
ATOM   2743  C  CB  . ILE A  1  358 ? 6.267   -18.392 42.654   1.00 164.48 ? 358  ILE A CB  1 
ATOM   2744  C  CG1 . ILE A  1  358 ? 6.007   -17.998 41.199   1.00 162.04 ? 358  ILE A CG1 1 
ATOM   2745  C  CG2 . ILE A  1  358 ? 5.000   -18.365 43.490   1.00 162.41 ? 358  ILE A CG2 1 
ATOM   2746  C  CD1 . ILE A  1  358 ? 5.586   -19.148 40.318   1.00 160.53 ? 358  ILE A CD1 1 
ATOM   2747  N  N   . ALA A  1  359 ? 6.697   -15.208 42.739   1.00 165.26 ? 359  ALA A N   1 
ATOM   2748  C  CA  . ALA A  1  359 ? 6.076   -13.904 42.921   1.00 164.16 ? 359  ALA A CA  1 
ATOM   2749  C  C   . ALA A  1  359 ? 4.835   -13.775 42.043   1.00 160.15 ? 359  ALA A C   1 
ATOM   2750  O  O   . ALA A  1  359 ? 4.818   -14.240 40.898   1.00 158.65 ? 359  ALA A O   1 
ATOM   2751  C  CB  . ALA A  1  359 ? 7.066   -12.778 42.607   1.00 166.55 ? 359  ALA A CB  1 
ATOM   2752  N  N   . ILE A  1  360 ? 3.788   -13.160 42.595   1.00 158.76 ? 360  ILE A N   1 
ATOM   2753  C  CA  . ILE A  1  360 ? 2.550   -12.863 41.877   1.00 164.10 ? 360  ILE A CA  1 
ATOM   2754  C  C   . ILE A  1  360 ? 2.202   -11.398 42.102   1.00 169.24 ? 360  ILE A C   1 
ATOM   2755  O  O   . ILE A  1  360 ? 2.194   -10.928 43.245   1.00 169.70 ? 360  ILE A O   1 
ATOM   2756  C  CB  . ILE A  1  360 ? 1.386   -13.766 42.328   1.00 166.51 ? 360  ILE A CB  1 
ATOM   2757  C  CG1 . ILE A  1  360 ? 1.761   -15.244 42.193   1.00 153.61 ? 360  ILE A CG1 1 
ATOM   2758  C  CG2 . ILE A  1  360 ? 0.134   -13.461 41.525   1.00 150.35 ? 360  ILE A CG2 1 
ATOM   2759  C  CD1 . ILE A  1  360 ? 0.724   -16.193 42.754   1.00 152.33 ? 360  ILE A CD1 1 
ATOM   2760  N  N   . ALA A  1  361 ? 1.914   -10.677 41.021   1.00 154.38 ? 361  ALA A N   1 
ATOM   2761  C  CA  . ALA A  1  361 ? 1.705   -9.238  41.087   1.00 155.22 ? 361  ALA A CA  1 
ATOM   2762  C  C   . ALA A  1  361 ? 0.232   -8.862  40.974   1.00 175.28 ? 361  ALA A C   1 
ATOM   2763  O  O   . ALA A  1  361 ? -0.542  -9.514  40.265   1.00 196.27 ? 361  ALA A O   1 
ATOM   2764  C  CB  . ALA A  1  361 ? 2.497   -8.526  39.993   1.00 156.00 ? 361  ALA A CB  1 
ATOM   2765  N  N   . ALA A  1  362 ? -0.150  -7.801  41.690   1.00 195.23 ? 362  ALA A N   1 
ATOM   2766  C  CA  . ALA A  1  362 ? -1.452  -7.152  41.553   1.00 185.97 ? 362  ALA A CA  1 
ATOM   2767  C  C   . ALA A  1  362 ? -1.191  -5.715  41.112   1.00 184.78 ? 362  ALA A C   1 
ATOM   2768  O  O   . ALA A  1  362 ? -1.180  -4.791  41.943   1.00 176.32 ? 362  ALA A O   1 
ATOM   2769  C  CB  . ALA A  1  362 ? -2.251  -7.213  42.854   1.00 167.72 ? 362  ALA A CB  1 
ATOM   2770  N  N   . PRO A  1  363 ? -1.016  -5.483  39.806   1.00 155.20 ? 363  PRO A N   1 
ATOM   2771  C  CA  . PRO A  1  363 ? -0.468  -4.196  39.342   1.00 165.40 ? 363  PRO A CA  1 
ATOM   2772  C  C   . PRO A  1  363 ? -1.307  -2.993  39.714   1.00 164.19 ? 363  PRO A C   1 
ATOM   2773  O  O   . PRO A  1  363 ? -0.816  -1.861  39.614   1.00 188.55 ? 363  PRO A O   1 
ATOM   2774  C  CB  . PRO A  1  363 ? -0.406  -4.367  37.815   1.00 155.44 ? 363  PRO A CB  1 
ATOM   2775  C  CG  . PRO A  1  363 ? -0.442  -5.844  37.592   1.00 153.12 ? 363  PRO A CG  1 
ATOM   2776  C  CD  . PRO A  1  363 ? -1.309  -6.389  38.685   1.00 152.31 ? 363  PRO A CD  1 
ATOM   2777  N  N   . TYR A  1  364 ? -2.547  -3.192  40.152   1.00 155.66 ? 364  TYR A N   1 
ATOM   2778  C  CA  . TYR A  1  364 ? -3.445  -2.085  40.446   1.00 157.09 ? 364  TYR A CA  1 
ATOM   2779  C  C   . TYR A  1  364 ? -3.919  -2.102  41.896   1.00 170.11 ? 364  TYR A C   1 
ATOM   2780  O  O   . TYR A  1  364 ? -4.918  -1.456  42.227   1.00 181.54 ? 364  TYR A O   1 
ATOM   2781  C  CB  . TYR A  1  364 ? -4.632  -2.117  39.484   1.00 154.67 ? 364  TYR A CB  1 
ATOM   2782  C  CG  . TYR A  1  364 ? -4.219  -2.324  38.042   1.00 163.14 ? 364  TYR A CG  1 
ATOM   2783  C  CD1 . TYR A  1  364 ? -3.523  -1.344  37.348   1.00 156.57 ? 364  TYR A CD1 1 
ATOM   2784  C  CD2 . TYR A  1  364 ? -4.522  -3.507  37.376   1.00 168.30 ? 364  TYR A CD2 1 
ATOM   2785  C  CE1 . TYR A  1  364 ? -3.143  -1.536  36.029   1.00 173.81 ? 364  TYR A CE1 1 
ATOM   2786  C  CE2 . TYR A  1  364 ? -4.145  -3.706  36.057   1.00 159.61 ? 364  TYR A CE2 1 
ATOM   2787  C  CZ  . TYR A  1  364 ? -3.458  -2.717  35.388   1.00 150.39 ? 364  TYR A CZ  1 
ATOM   2788  O  OH  . TYR A  1  364 ? -3.083  -2.910  34.077   1.00 149.49 ? 364  TYR A OH  1 
ATOM   2789  N  N   . GLY A  1  365 ? -3.215  -2.822  42.769   1.00 165.51 ? 365  GLY A N   1 
ATOM   2790  C  CA  . GLY A  1  365 ? -3.538  -2.863  44.178   1.00 167.49 ? 365  GLY A CA  1 
ATOM   2791  C  C   . GLY A  1  365 ? -2.802  -1.795  44.962   1.00 171.68 ? 365  GLY A C   1 
ATOM   2792  O  O   . GLY A  1  365 ? -2.138  -0.915  44.411   1.00 188.21 ? 365  GLY A O   1 
ATOM   2793  N  N   . GLY A  1  366 ? -2.945  -1.869  46.284   1.00 179.05 ? 366  GLY A N   1 
ATOM   2794  C  CA  . GLY A  1  366 ? -2.260  -0.941  47.161   1.00 188.28 ? 366  GLY A CA  1 
ATOM   2795  C  C   . GLY A  1  366 ? -2.909  0.429   47.154   1.00 190.87 ? 366  GLY A C   1 
ATOM   2796  O  O   . GLY A  1  366 ? -3.871  0.701   46.435   1.00 184.78 ? 366  GLY A O   1 
ATOM   2797  N  N   . GLU A  1  367 ? -2.372  1.305   48.001   1.00 182.60 ? 367  GLU A N   1 
ATOM   2798  C  CA  . GLU A  1  367 ? -2.869  2.672   48.077   1.00 192.52 ? 367  GLU A CA  1 
ATOM   2799  C  C   . GLU A  1  367 ? -2.699  3.385   46.741   1.00 185.58 ? 367  GLU A C   1 
ATOM   2800  O  O   . GLU A  1  367 ? -1.674  3.244   46.068   1.00 185.35 ? 367  GLU A O   1 
ATOM   2801  C  CB  . GLU A  1  367 ? -2.134  3.439   49.175   1.00 210.54 ? 367  GLU A CB  1 
ATOM   2802  C  CG  . GLU A  1  367 ? -0.621  3.451   49.021   1.00 213.37 ? 367  GLU A CG  1 
ATOM   2803  C  CD  . GLU A  1  367 ? 0.062   4.284   50.082   1.00 218.90 ? 367  GLU A CD  1 
ATOM   2804  O  OE1 . GLU A  1  367 ? 1.199   4.736   49.844   1.00 211.72 ? 367  GLU A OE1 1 
ATOM   2805  O  OE2 . GLU A  1  367 ? -0.550  4.510   51.147   1.00 236.21 ? 367  GLU A OE2 1 
ATOM   2806  N  N   . ASP A  1  368 ? -3.718  4.153   46.357   1.00 188.26 ? 368  ASP A N   1 
ATOM   2807  C  CA  . ASP A  1  368 ? -3.717  4.938   45.125   1.00 190.83 ? 368  ASP A CA  1 
ATOM   2808  C  C   . ASP A  1  368 ? -3.556  4.067   43.885   1.00 196.90 ? 368  ASP A C   1 
ATOM   2809  O  O   . ASP A  1  368 ? -3.116  4.556   42.838   1.00 204.14 ? 368  ASP A O   1 
ATOM   2810  C  CB  . ASP A  1  368 ? -2.623  6.013   45.154   1.00 195.06 ? 368  ASP A CB  1 
ATOM   2811  C  CG  . ASP A  1  368 ? -2.970  7.223   44.312   1.00 217.01 ? 368  ASP A CG  1 
ATOM   2812  O  OD1 . ASP A  1  368 ? -3.831  7.103   43.416   1.00 239.44 ? 368  ASP A OD1 1 
ATOM   2813  O  OD2 . ASP A  1  368 ? -2.378  8.297   44.546   1.00 219.46 ? 368  ASP A OD2 1 
ATOM   2814  N  N   . LYS A  1  369 ? -3.898  2.782   43.991   1.00 197.83 ? 369  LYS A N   1 
ATOM   2815  C  CA  . LYS A  1  369 ? -3.793  1.829   42.885   1.00 197.09 ? 369  LYS A CA  1 
ATOM   2816  C  C   . LYS A  1  369 ? -2.423  1.911   42.210   1.00 193.82 ? 369  LYS A C   1 
ATOM   2817  O  O   . LYS A  1  369 ? -2.304  2.029   40.987   1.00 169.41 ? 369  LYS A O   1 
ATOM   2818  C  CB  . LYS A  1  369 ? -4.924  2.032   41.877   1.00 194.91 ? 369  LYS A CB  1 
ATOM   2819  C  CG  . LYS A  1  369 ? -6.319  1.967   42.489   1.00 178.34 ? 369  LYS A CG  1 
ATOM   2820  C  CD  . LYS A  1  369 ? -7.326  1.345   41.524   1.00 164.95 ? 369  LYS A CD  1 
ATOM   2821  C  CE  . LYS A  1  369 ? -7.367  2.078   40.189   1.00 164.68 ? 369  LYS A CE  1 
ATOM   2822  N  NZ  . LYS A  1  369 ? -8.286  1.411   39.224   1.00 172.00 ? 369  LYS A NZ  1 
ATOM   2823  N  N   . LYS A  1  370 ? -1.375  1.839   43.030   1.00 186.13 ? 370  LYS A N   1 
ATOM   2824  C  CA  . LYS A  1  370 ? -0.008  1.986   42.545   1.00 177.92 ? 370  LYS A CA  1 
ATOM   2825  C  C   . LYS A  1  370 ? 0.604   0.654   42.151   1.00 173.75 ? 370  LYS A C   1 
ATOM   2826  O  O   . LYS A  1  370 ? 1.278   0.564   41.122   1.00 173.01 ? 370  LYS A O   1 
ATOM   2827  C  CB  . LYS A  1  370 ? 0.863   2.653   43.616   1.00 186.06 ? 370  LYS A CB  1 
ATOM   2828  C  CG  . LYS A  1  370 ? 0.605   4.138   43.808   1.00 205.64 ? 370  LYS A CG  1 
ATOM   2829  C  CD  . LYS A  1  370 ? 1.585   4.748   44.806   1.00 221.75 ? 370  LYS A CD  1 
ATOM   2830  C  CE  . LYS A  1  370 ? 1.091   6.096   45.325   1.00 231.01 ? 370  LYS A CE  1 
ATOM   2831  N  NZ  . LYS A  1  370 ? 2.069   6.743   46.249   1.00 226.14 ? 370  LYS A NZ  1 
ATOM   2832  N  N   . GLY A  1  371 ? 0.359   -0.386  42.938   1.00 176.33 ? 371  GLY A N   1 
ATOM   2833  C  CA  . GLY A  1  371 ? 0.796   -1.729  42.601   1.00 173.79 ? 371  GLY A CA  1 
ATOM   2834  C  C   . GLY A  1  371 ? 1.421   -2.456  43.776   1.00 175.33 ? 371  GLY A C   1 
ATOM   2835  O  O   . GLY A  1  371 ? 2.050   -1.854  44.650   1.00 184.00 ? 371  GLY A O   1 
ATOM   2836  N  N   . ILE A  1  372 ? 1.233   -3.775  43.802   1.00 165.24 ? 372  ILE A N   1 
ATOM   2837  C  CA  . ILE A  1  372 ? 1.748   -4.640  44.860   1.00 166.51 ? 372  ILE A CA  1 
ATOM   2838  C  C   . ILE A  1  372 ? 2.296   -5.909  44.218   1.00 164.54 ? 372  ILE A C   1 
ATOM   2839  O  O   . ILE A  1  372 ? 1.725   -6.422  43.249   1.00 161.32 ? 372  ILE A O   1 
ATOM   2840  C  CB  . ILE A  1  372 ? 0.656   -4.991  45.895   1.00 196.31 ? 372  ILE A CB  1 
ATOM   2841  C  CG1 . ILE A  1  372 ? 0.045   -3.730  46.506   1.00 188.98 ? 372  ILE A CG1 1 
ATOM   2842  C  CG2 . ILE A  1  372 ? 1.225   -5.862  47.006   1.00 202.23 ? 372  ILE A CG2 1 
ATOM   2843  C  CD1 . ILE A  1  372 ? 0.970   -3.006  47.450   1.00 192.43 ? 372  ILE A CD1 1 
ATOM   2844  N  N   . VAL A  1  373 ? 3.406   -6.418  44.753   1.00 166.80 ? 373  VAL A N   1 
ATOM   2845  C  CA  . VAL A  1  373 ? 3.938   -7.721  44.370   1.00 165.68 ? 373  VAL A CA  1 
ATOM   2846  C  C   . VAL A  1  373 ? 4.028   -8.579  45.623   1.00 168.70 ? 373  VAL A C   1 
ATOM   2847  O  O   . VAL A  1  373 ? 4.637   -8.170  46.618   1.00 204.22 ? 373  VAL A O   1 
ATOM   2848  C  CB  . VAL A  1  373 ? 5.314   -7.611  43.687   1.00 167.62 ? 373  VAL A CB  1 
ATOM   2849  C  CG1 . VAL A  1  373 ? 5.867   -8.997  43.404   1.00 176.85 ? 373  VAL A CG1 1 
ATOM   2850  C  CG2 . VAL A  1  373 ? 5.218   -6.805  42.405   1.00 166.42 ? 373  VAL A CG2 1 
ATOM   2851  N  N   . TYR A  1  374 ? 3.444   -9.769  45.564   1.00 164.77 ? 374  TYR A N   1 
ATOM   2852  C  CA  . TYR A  1  374 ? 3.413   -10.684 46.695   1.00 165.95 ? 374  TYR A CA  1 
ATOM   2853  C  C   . TYR A  1  374 ? 4.431   -11.798 46.484   1.00 190.21 ? 374  TYR A C   1 
ATOM   2854  O  O   . TYR A  1  374 ? 4.560   -12.331 45.376   1.00 198.05 ? 374  TYR A O   1 
ATOM   2855  C  CB  . TYR A  1  374 ? 2.013   -11.271 46.889   1.00 163.22 ? 374  TYR A CB  1 
ATOM   2856  C  CG  . TYR A  1  374 ? 0.924   -10.253 47.187   1.00 169.97 ? 374  TYR A CG  1 
ATOM   2857  C  CD1 . TYR A  1  374 ? 0.669   -9.831  48.488   1.00 169.84 ? 374  TYR A CD1 1 
ATOM   2858  C  CD2 . TYR A  1  374 ? 0.122   -9.744  46.168   1.00 181.93 ? 374  TYR A CD2 1 
ATOM   2859  C  CE1 . TYR A  1  374 ? -0.342  -8.909  48.765   1.00 165.26 ? 374  TYR A CE1 1 
ATOM   2860  C  CE2 . TYR A  1  374 ? -0.892  -8.825  46.435   1.00 181.21 ? 374  TYR A CE2 1 
ATOM   2861  C  CZ  . TYR A  1  374 ? -1.119  -8.411  47.733   1.00 169.77 ? 374  TYR A CZ  1 
ATOM   2862  O  OH  . TYR A  1  374 ? -2.123  -7.501  47.989   1.00 163.00 ? 374  TYR A OH  1 
ATOM   2863  N  N   . ILE A  1  375 ? 5.186   -12.108 47.535   1.00 186.33 ? 375  ILE A N   1 
ATOM   2864  C  CA  . ILE A  1  375 ? 6.201   -13.156 47.512   1.00 171.94 ? 375  ILE A CA  1 
ATOM   2865  C  C   . ILE A  1  375 ? 5.664   -14.390 48.226   1.00 171.56 ? 375  ILE A C   1 
ATOM   2866  O  O   . ILE A  1  375 ? 5.248   -14.310 49.388   1.00 184.96 ? 375  ILE A O   1 
ATOM   2867  C  CB  . ILE A  1  375 ? 7.500   -12.667 48.165   1.00 176.56 ? 375  ILE A CB  1 
ATOM   2868  C  CG1 . ILE A  1  375 ? 7.903   -11.318 47.561   1.00 177.19 ? 375  ILE A CG1 1 
ATOM   2869  C  CG2 . ILE A  1  375 ? 8.584   -13.712 48.023   1.00 178.72 ? 375  ILE A CG2 1 
ATOM   2870  C  CD1 . ILE A  1  375 ? 8.029   -11.335 46.055   1.00 174.85 ? 375  ILE A CD1 1 
ATOM   2871  N  N   . PHE A  1  376 ? 5.686   -15.534 47.548   1.00 173.47 ? 376  PHE A N   1 
ATOM   2872  C  CA  . PHE A  1  376 ? 5.209   -16.787 48.119   1.00 173.31 ? 376  PHE A CA  1 
ATOM   2873  C  C   . PHE A  1  376 ? 6.333   -17.810 48.123   1.00 176.10 ? 376  PHE A C   1 
ATOM   2874  O  O   . PHE A  1  376 ? 7.050   -17.959 47.127   1.00 179.41 ? 376  PHE A O   1 
ATOM   2875  C  CB  . PHE A  1  376 ? 4.007   -17.334 47.351   1.00 169.25 ? 376  PHE A CB  1 
ATOM   2876  C  CG  . PHE A  1  376 ? 2.797   -16.449 47.406   1.00 166.81 ? 376  PHE A CG  1 
ATOM   2877  C  CD1 . PHE A  1  376 ? 1.969   -16.446 48.515   1.00 183.54 ? 376  PHE A CD1 1 
ATOM   2878  C  CD2 . PHE A  1  376 ? 2.488   -15.618 46.346   1.00 183.47 ? 376  PHE A CD2 1 
ATOM   2879  C  CE1 . PHE A  1  376 ? 0.849   -15.632 48.559   1.00 178.59 ? 376  PHE A CE1 1 
ATOM   2880  C  CE2 . PHE A  1  376 ? 1.372   -14.801 46.386   1.00 178.61 ? 376  PHE A CE2 1 
ATOM   2881  C  CZ  . PHE A  1  376 ? 0.553   -14.809 47.494   1.00 166.70 ? 376  PHE A CZ  1 
ATOM   2882  N  N   . ASN A  1  377 ? 6.479   -18.512 49.242   1.00 177.53 ? 377  ASN A N   1 
ATOM   2883  C  CA  . ASN A  1  377 ? 7.523   -19.509 49.421   1.00 183.64 ? 377  ASN A CA  1 
ATOM   2884  C  C   . ASN A  1  377 ? 6.974   -20.919 49.216   1.00 196.84 ? 377  ASN A C   1 
ATOM   2885  O  O   . ASN A  1  377 ? 5.804   -21.200 49.495   1.00 203.84 ? 377  ASN A O   1 
ATOM   2886  C  CB  . ASN A  1  377 ? 8.151   -19.381 50.814   1.00 189.80 ? 377  ASN A CB  1 
ATOM   2887  C  CG  . ASN A  1  377 ? 8.880   -18.054 51.011   1.00 193.82 ? 377  ASN A CG  1 
ATOM   2888  O  OD1 . ASN A  1  377 ? 8.284   -17.062 51.431   1.00 197.52 ? 377  ASN A OD1 1 
ATOM   2889  N  ND2 . ASN A  1  377 ? 10.181  -18.044 50.738   1.00 190.50 ? 377  ASN A ND2 1 
ATOM   2890  N  N   . GLY A  1  378 ? 7.830   -21.800 48.675   1.00 179.32 ? 378  GLY A N   1 
ATOM   2891  C  CA  . GLY A  1  378 ? 7.485   -23.196 48.525   1.00 179.17 ? 378  GLY A CA  1 
ATOM   2892  C  C   . GLY A  1  378 ? 7.756   -24.002 49.782   1.00 182.89 ? 378  GLY A C   1 
ATOM   2893  O  O   . GLY A  1  378 ? 8.457   -23.571 50.694   1.00 186.20 ? 378  GLY A O   1 
ATOM   2894  N  N   . ARG A  1  379 ? 7.181   -25.200 49.819   1.00 184.40 ? 379  ARG A N   1 
ATOM   2895  C  CA  . ARG A  1  379 ? 7.413   -26.145 50.905   1.00 186.32 ? 379  ARG A CA  1 
ATOM   2896  C  C   . ARG A  1  379 ? 7.130   -27.545 50.373   1.00 186.31 ? 379  ARG A C   1 
ATOM   2897  O  O   . ARG A  1  379 ? 6.776   -27.726 49.203   1.00 183.48 ? 379  ARG A O   1 
ATOM   2898  C  CB  . ARG A  1  379 ? 6.559   -25.812 52.138   1.00 186.12 ? 379  ARG A CB  1 
ATOM   2899  C  CG  . ARG A  1  379 ? 5.109   -25.467 51.824   1.00 181.43 ? 379  ARG A CG  1 
ATOM   2900  C  CD  . ARG A  1  379 ? 4.342   -24.859 52.999   1.00 181.54 ? 379  ARG A CD  1 
ATOM   2901  N  NE  . ARG A  1  379 ? 2.948   -24.611 52.624   1.00 195.86 ? 379  ARG A NE  1 
ATOM   2902  C  CZ  . ARG A  1  379 ? 2.024   -24.066 53.414   1.00 193.18 ? 379  ARG A CZ  1 
ATOM   2903  N  NH1 . ARG A  1  379 ? 2.329   -23.699 54.652   1.00 187.26 ? 379  ARG A NH1 1 
ATOM   2904  N  NH2 . ARG A  1  379 ? 0.785   -23.892 52.962   1.00 173.28 ? 379  ARG A NH2 1 
ATOM   2905  N  N   . SER A  1  380 ? 7.343   -28.543 51.236   1.00 189.94 ? 380  SER A N   1 
ATOM   2906  C  CA  . SER A  1  380 ? 7.195   -29.934 50.822   1.00 190.91 ? 380  SER A CA  1 
ATOM   2907  C  C   . SER A  1  380 ? 5.811   -30.208 50.249   1.00 186.54 ? 380  SER A C   1 
ATOM   2908  O  O   . SER A  1  380 ? 5.668   -30.976 49.292   1.00 200.53 ? 380  SER A O   1 
ATOM   2909  C  CB  . SER A  1  380 ? 7.477   -30.863 52.003   1.00 195.54 ? 380  SER A CB  1 
ATOM   2910  O  OG  . SER A  1  380 ? 6.525   -30.682 53.037   1.00 194.68 ? 380  SER A OG  1 
ATOM   2911  N  N   . THR A  1  381 ? 4.781   -29.577 50.806   1.00 184.73 ? 381  THR A N   1 
ATOM   2912  C  CA  . THR A  1  381 ? 3.408   -29.796 50.366   1.00 180.95 ? 381  THR A CA  1 
ATOM   2913  C  C   . THR A  1  381 ? 2.999   -28.842 49.256   1.00 176.57 ? 381  THR A C   1 
ATOM   2914  O  O   . THR A  1  381 ? 1.875   -28.935 48.754   1.00 180.82 ? 381  THR A O   1 
ATOM   2915  C  CB  . THR A  1  381 ? 2.452   -29.664 51.557   1.00 199.14 ? 381  THR A CB  1 
ATOM   2916  O  OG1 . THR A  1  381 ? 3.035   -30.302 52.701   1.00 218.02 ? 381  THR A OG1 1 
ATOM   2917  C  CG2 . THR A  1  381 ? 1.110   -30.338 51.265   1.00 178.52 ? 381  THR A CG2 1 
ATOM   2918  N  N   . GLY A  1  382 ? 3.886   -27.943 48.844   1.00 175.81 ? 382  GLY A N   1 
ATOM   2919  C  CA  . GLY A  1  382 ? 3.566   -27.023 47.774   1.00 172.07 ? 382  GLY A CA  1 
ATOM   2920  C  C   . GLY A  1  382 ? 3.849   -25.572 48.092   1.00 171.54 ? 382  GLY A C   1 
ATOM   2921  O  O   . GLY A  1  382 ? 4.804   -25.259 48.804   1.00 174.70 ? 382  GLY A O   1 
ATOM   2922  N  N   . LEU A  1  383 ? 3.044   -24.671 47.539   1.00 173.94 ? 383  LEU A N   1 
ATOM   2923  C  CA  . LEU A  1  383 ? 3.238   -23.241 47.722   1.00 173.42 ? 383  LEU A CA  1 
ATOM   2924  C  C   . LEU A  1  383 ? 2.527   -22.745 48.975   1.00 182.79 ? 383  LEU A C   1 
ATOM   2925  O  O   . LEU A  1  383 ? 1.378   -23.112 49.239   1.00 177.41 ? 383  LEU A O   1 
ATOM   2926  C  CB  . LEU A  1  383 ? 2.728   -22.481 46.500   1.00 193.68 ? 383  LEU A CB  1 
ATOM   2927  C  CG  . LEU A  1  383 ? 3.054   -20.991 46.478   1.00 192.57 ? 383  LEU A CG  1 
ATOM   2928  C  CD1 . LEU A  1  383 ? 4.559   -20.801 46.436   1.00 172.70 ? 383  LEU A CD1 1 
ATOM   2929  C  CD2 . LEU A  1  383 ? 2.389   -20.327 45.285   1.00 185.40 ? 383  LEU A CD2 1 
ATOM   2930  N  N   . ASN A  1  384 ? 3.210   -21.891 49.733   1.00 170.81 ? 384  ASN A N   1 
ATOM   2931  C  CA  . ASN A  1  384 ? 2.611   -21.268 50.909   1.00 171.59 ? 384  ASN A CA  1 
ATOM   2932  C  C   . ASN A  1  384 ? 1.593   -20.218 50.489   1.00 168.31 ? 384  ASN A C   1 
ATOM   2933  O  O   . ASN A  1  384 ? 1.945   -19.226 49.843   1.00 176.06 ? 384  ASN A O   1 
ATOM   2934  C  CB  . ASN A  1  384 ? 3.690   -20.642 51.784   1.00 179.14 ? 384  ASN A CB  1 
ATOM   2935  C  CG  . ASN A  1  384 ? 3.149   -20.134 53.103   1.00 180.17 ? 384  ASN A CG  1 
ATOM   2936  O  OD1 . ASN A  1  384 ? 3.594   -19.103 53.606   1.00 178.97 ? 384  ASN A OD1 1 
ATOM   2937  N  ND2 . ASN A  1  384 ? 2.179   -20.846 53.666   1.00 184.01 ? 384  ASN A ND2 1 
ATOM   2938  N  N   . ALA A  1  385 ? 0.329   -20.437 50.860   1.00 178.47 ? 385  ALA A N   1 
ATOM   2939  C  CA  . ALA A  1  385 ? -0.744  -19.548 50.426   1.00 188.71 ? 385  ALA A CA  1 
ATOM   2940  C  C   . ALA A  1  385 ? -0.611  -18.146 51.008   1.00 186.79 ? 385  ALA A C   1 
ATOM   2941  O  O   . ALA A  1  385 ? -1.124  -17.186 50.421   1.00 184.92 ? 385  ALA A O   1 
ATOM   2942  C  CB  . ALA A  1  385 ? -2.101  -20.140 50.800   1.00 179.21 ? 385  ALA A CB  1 
ATOM   2943  N  N   . VAL A  1  386 ? 0.050   -18.001 52.153   1.00 179.27 ? 386  VAL A N   1 
ATOM   2944  C  CA  . VAL A  1  386 ? 0.210   -16.685 52.773   1.00 179.26 ? 386  VAL A CA  1 
ATOM   2945  C  C   . VAL A  1  386 ? 1.526   -16.055 52.329   1.00 186.24 ? 386  VAL A C   1 
ATOM   2946  O  O   . VAL A  1  386 ? 2.570   -16.725 52.335   1.00 198.29 ? 386  VAL A O   1 
ATOM   2947  C  CB  . VAL A  1  386 ? 0.109   -16.770 54.305   1.00 197.16 ? 386  VAL A CB  1 
ATOM   2948  C  CG1 . VAL A  1  386 ? -1.330  -17.052 54.720   1.00 213.78 ? 386  VAL A CG1 1 
ATOM   2949  C  CG2 . VAL A  1  386 ? 1.034   -17.843 54.856   1.00 191.38 ? 386  VAL A CG2 1 
ATOM   2950  N  N   . PRO A  1  387 ? 1.515   -14.793 51.895   1.00 176.89 ? 387  PRO A N   1 
ATOM   2951  C  CA  . PRO A  1  387 ? 2.760   -14.161 51.445   1.00 189.42 ? 387  PRO A CA  1 
ATOM   2952  C  C   . PRO A  1  387 ? 3.673   -13.823 52.612   1.00 195.44 ? 387  PRO A C   1 
ATOM   2953  O  O   . PRO A  1  387 ? 3.225   -13.395 53.678   1.00 198.80 ? 387  PRO A O   1 
ATOM   2954  C  CB  . PRO A  1  387 ? 2.277   -12.892 50.735   1.00 182.49 ? 387  PRO A CB  1 
ATOM   2955  C  CG  . PRO A  1  387 ? 0.987   -12.567 51.405   1.00 174.92 ? 387  PRO A CG  1 
ATOM   2956  C  CD  . PRO A  1  387 ? 0.356   -13.892 51.751   1.00 173.90 ? 387  PRO A CD  1 
ATOM   2957  N  N   . SER A  1  388 ? 4.974   -13.984 52.386   1.00 204.53 ? 388  SER A N   1 
ATOM   2958  C  CA  . SER A  1  388 ? 5.973   -13.678 53.394   1.00 193.29 ? 388  SER A CA  1 
ATOM   2959  C  C   . SER A  1  388 ? 6.552   -12.283 53.239   1.00 208.51 ? 388  SER A C   1 
ATOM   2960  O  O   . SER A  1  388 ? 7.295   -11.834 54.119   1.00 214.90 ? 388  SER A O   1 
ATOM   2961  C  CB  . SER A  1  388 ? 7.106   -14.709 53.340   1.00 195.46 ? 388  SER A CB  1 
ATOM   2962  O  OG  . SER A  1  388 ? 7.730   -14.702 52.067   1.00 194.06 ? 388  SER A OG  1 
ATOM   2963  N  N   . GLN A  1  389 ? 6.228   -11.590 52.151   1.00 205.58 ? 389  GLN A N   1 
ATOM   2964  C  CA  . GLN A  1  389 ? 6.708   -10.234 51.935   1.00 206.85 ? 389  GLN A CA  1 
ATOM   2965  C  C   . GLN A  1  389 ? 5.774   -9.515  50.972   1.00 208.56 ? 389  GLN A C   1 
ATOM   2966  O  O   . GLN A  1  389 ? 5.255   -10.119 50.028   1.00 193.53 ? 389  GLN A O   1 
ATOM   2967  C  CB  . GLN A  1  389 ? 8.135   -10.224 51.388   1.00 187.73 ? 389  GLN A CB  1 
ATOM   2968  C  CG  . GLN A  1  389 ? 8.781   -8.854  51.419   1.00 190.69 ? 389  GLN A CG  1 
ATOM   2969  C  CD  . GLN A  1  389 ? 10.254  -8.916  51.119   1.00 193.91 ? 389  GLN A CD  1 
ATOM   2970  O  OE1 . GLN A  1  389 ? 10.765  -9.951  50.696   1.00 211.23 ? 389  GLN A OE1 1 
ATOM   2971  N  NE2 . GLN A  1  389 ? 10.949  -7.803  51.325   1.00 197.45 ? 389  GLN A NE2 1 
ATOM   2972  N  N   . ILE A  1  390 ? 5.577   -8.222  51.214   1.00 220.54 ? 390  ILE A N   1 
ATOM   2973  C  CA  . ILE A  1  390 ? 4.707   -7.384  50.397   1.00 218.63 ? 390  ILE A CA  1 
ATOM   2974  C  C   . ILE A  1  390 ? 5.547   -6.266  49.797   1.00 213.45 ? 390  ILE A C   1 
ATOM   2975  O  O   . ILE A  1  390 ? 6.116   -5.445  50.529   1.00 217.23 ? 390  ILE A O   1 
ATOM   2976  C  CB  . ILE A  1  390 ? 3.535   -6.812  51.208   1.00 218.52 ? 390  ILE A CB  1 
ATOM   2977  C  CG1 . ILE A  1  390 ? 2.691   -7.936  51.821   1.00 228.91 ? 390  ILE A CG1 1 
ATOM   2978  C  CG2 . ILE A  1  390 ? 2.677   -5.922  50.327   1.00 208.82 ? 390  ILE A CG2 1 
ATOM   2979  C  CD1 . ILE A  1  390 ? 3.154   -8.384  53.206   1.00 225.50 ? 390  ILE A CD1 1 
ATOM   2980  N  N   . LEU A  1  391 ? 5.625   -6.235  48.470   1.00 209.80 ? 391  LEU A N   1 
ATOM   2981  C  CA  . LEU A  1  391 ? 6.337   -5.185  47.755   1.00 202.82 ? 391  LEU A CA  1 
ATOM   2982  C  C   . LEU A  1  391 ? 5.350   -4.081  47.397   1.00 193.35 ? 391  LEU A C   1 
ATOM   2983  O  O   . LEU A  1  391 ? 4.372   -4.326  46.685   1.00 179.92 ? 391  LEU A O   1 
ATOM   2984  C  CB  . LEU A  1  391 ? 6.998   -5.747  46.498   1.00 183.21 ? 391  LEU A CB  1 
ATOM   2985  C  CG  . LEU A  1  391 ? 8.416   -6.309  46.619   1.00 186.19 ? 391  LEU A CG  1 
ATOM   2986  C  CD1 . LEU A  1  391 ? 8.521   -7.339  47.733   1.00 195.40 ? 391  LEU A CD1 1 
ATOM   2987  C  CD2 . LEU A  1  391 ? 8.830   -6.924  45.299   1.00 184.22 ? 391  LEU A CD2 1 
ATOM   2988  N  N   . GLU A  1  392 ? 5.608   -2.869  47.878   1.00 204.73 ? 392  GLU A N   1 
ATOM   2989  C  CA  . GLU A  1  392 ? 4.698   -1.750  47.684   1.00 203.01 ? 392  GLU A CA  1 
ATOM   2990  C  C   . GLU A  1  392 ? 5.232   -0.802  46.618   1.00 202.72 ? 392  GLU A C   1 
ATOM   2991  O  O   . GLU A  1  392 ? 6.434   -0.521  46.565   1.00 213.48 ? 392  GLU A O   1 
ATOM   2992  C  CB  . GLU A  1  392 ? 4.482   -0.989  48.996   1.00 212.91 ? 392  GLU A CB  1 
ATOM   2993  C  CG  . GLU A  1  392 ? 3.708   -1.765  50.052   1.00 225.63 ? 392  GLU A CG  1 
ATOM   2994  C  CD  . GLU A  1  392 ? 2.260   -1.312  50.165   1.00 244.11 ? 392  GLU A CD  1 
ATOM   2995  O  OE1 . GLU A  1  392 ? 1.846   -0.428  49.384   1.00 243.60 ? 392  GLU A OE1 1 
ATOM   2996  O  OE2 . GLU A  1  392 ? 1.532   -1.848  51.029   1.00 259.16 ? 392  GLU A OE2 1 
ATOM   2997  N  N   . GLY A  1  393 ? 4.326   -0.316  45.770   1.00 194.16 ? 393  GLY A N   1 
ATOM   2998  C  CA  . GLY A  1  393 ? 4.674   0.720   44.807   1.00 194.79 ? 393  GLY A CA  1 
ATOM   2999  C  C   . GLY A  1  393 ? 4.765   2.085   45.474   1.00 213.15 ? 393  GLY A C   1 
ATOM   3000  O  O   . GLY A  1  393 ? 3.991   2.421   46.370   1.00 238.35 ? 393  GLY A O   1 
ATOM   3001  N  N   . GLN A  1  394 ? 5.728   2.880   45.014   1.00 196.20 ? 394  GLN A N   1 
ATOM   3002  C  CA  . GLN A  1  394 ? 6.005   4.187   45.587   1.00 199.19 ? 394  GLN A CA  1 
ATOM   3003  C  C   . GLN A  1  394 ? 5.627   5.339   44.670   1.00 205.69 ? 394  GLN A C   1 
ATOM   3004  O  O   . GLN A  1  394 ? 5.694   6.495   45.099   1.00 218.20 ? 394  GLN A O   1 
ATOM   3005  C  CB  . GLN A  1  394 ? 7.498   4.299   45.939   1.00 198.90 ? 394  GLN A CB  1 
ATOM   3006  C  CG  . GLN A  1  394 ? 8.045   3.168   46.802   1.00 198.12 ? 394  GLN A CG  1 
ATOM   3007  C  CD  . GLN A  1  394 ? 7.472   3.141   48.205   1.00 199.71 ? 394  GLN A CD  1 
ATOM   3008  O  OE1 . GLN A  1  394 ? 6.917   4.128   48.686   1.00 205.30 ? 394  GLN A OE1 1 
ATOM   3009  N  NE2 . GLN A  1  394 ? 7.613   2.003   48.875   1.00 198.79 ? 394  GLN A NE2 1 
ATOM   3010  N  N   . TRP A  1  395 ? 5.256   5.061   43.425   1.00 204.45 ? 395  TRP A N   1 
ATOM   3011  C  CA  . TRP A  1  395 ? 5.122   6.079   42.389   1.00 208.81 ? 395  TRP A CA  1 
ATOM   3012  C  C   . TRP A  1  395 ? 3.651   6.314   42.067   1.00 211.81 ? 395  TRP A C   1 
ATOM   3013  O  O   . TRP A  1  395 ? 2.953   5.396   41.623   1.00 216.63 ? 395  TRP A O   1 
ATOM   3014  C  CB  . TRP A  1  395 ? 5.908   5.667   41.146   1.00 197.66 ? 395  TRP A CB  1 
ATOM   3015  C  CG  . TRP A  1  395 ? 7.338   5.342   41.470   1.00 216.31 ? 395  TRP A CG  1 
ATOM   3016  C  CD1 . TRP A  1  395 ? 8.416   6.175   41.366   1.00 230.94 ? 395  TRP A CD1 1 
ATOM   3017  C  CD2 . TRP A  1  395 ? 7.839   4.104   41.992   1.00 217.81 ? 395  TRP A CD2 1 
ATOM   3018  N  NE1 . TRP A  1  395 ? 9.559   5.526   41.771   1.00 234.16 ? 395  TRP A NE1 1 
ATOM   3019  C  CE2 . TRP A  1  395 ? 9.230   4.255   42.161   1.00 222.38 ? 395  TRP A CE2 1 
ATOM   3020  C  CE3 . TRP A  1  395 ? 7.247   2.881   42.321   1.00 216.07 ? 395  TRP A CE3 1 
ATOM   3021  C  CZ2 . TRP A  1  395 ? 10.036  3.230   42.647   1.00 212.21 ? 395  TRP A CZ2 1 
ATOM   3022  C  CZ3 . TRP A  1  395 ? 8.050   1.866   42.807   1.00 215.03 ? 395  TRP A CZ3 1 
ATOM   3023  C  CH2 . TRP A  1  395 ? 9.427   2.047   42.966   1.00 212.63 ? 395  TRP A CH2 1 
ATOM   3024  N  N   . ALA A  1  396 ? 3.189   7.540   42.305   1.00 217.97 ? 396  ALA A N   1 
ATOM   3025  C  CA  . ALA A  1  396 ? 1.813   7.926   42.031   1.00 223.94 ? 396  ALA A CA  1 
ATOM   3026  C  C   . ALA A  1  396 ? 1.546   8.007   40.527   1.00 231.40 ? 396  ALA A C   1 
ATOM   3027  O  O   . ALA A  1  396 ? 2.461   8.063   39.699   1.00 225.82 ? 396  ALA A O   1 
ATOM   3028  C  CB  . ALA A  1  396 ? 1.488   9.265   42.698   1.00 217.61 ? 396  ALA A CB  1 
ATOM   3029  N  N   . ALA A  1  397 ? 0.259   8.017   40.186   1.00 220.02 ? 397  ALA A N   1 
ATOM   3030  C  CA  . ALA A  1  397 ? -0.191  8.017   38.800   1.00 194.61 ? 397  ALA A CA  1 
ATOM   3031  C  C   . ALA A  1  397 ? -0.320  9.464   38.344   1.00 204.88 ? 397  ALA A C   1 
ATOM   3032  O  O   . ALA A  1  397 ? -1.221  10.185  38.783   1.00 207.81 ? 397  ALA A O   1 
ATOM   3033  C  CB  . ALA A  1  397 ? -1.518  7.274   38.661   1.00 179.38 ? 397  ALA A CB  1 
ATOM   3034  N  N   . ARG A  1  398 ? 0.581   9.883   37.461   1.00 197.74 ? 398  ARG A N   1 
ATOM   3035  C  CA  . ARG A  1  398 ? 0.511   11.189  36.821   1.00 201.98 ? 398  ARG A CA  1 
ATOM   3036  C  C   . ARG A  1  398 ? -0.787  11.392  36.046   1.00 206.65 ? 398  ARG A C   1 
ATOM   3037  O  O   . ARG A  1  398 ? -1.646  12.170  36.470   1.00 220.75 ? 398  ARG A O   1 
ATOM   3038  C  CB  . ARG A  1  398 ? 1.714   11.358  35.895   1.00 205.98 ? 398  ARG A CB  1 
ATOM   3039  C  CG  . ARG A  1  398 ? 2.048   10.087  35.122   1.00 204.43 ? 398  ARG A CG  1 
ATOM   3040  C  CD  . ARG A  1  398 ? 3.282   10.240  34.272   1.00 204.24 ? 398  ARG A CD  1 
ATOM   3041  N  NE  . ARG A  1  398 ? 4.492   10.209  35.080   1.00 211.94 ? 398  ARG A NE  1 
ATOM   3042  C  CZ  . ARG A  1  398 ? 5.719   10.196  34.576   1.00 199.67 ? 398  ARG A CZ  1 
ATOM   3043  N  NH1 . ARG A  1  398 ? 5.895   10.210  33.262   1.00 195.84 ? 398  ARG A NH1 1 
ATOM   3044  N  NH2 . ARG A  1  398 ? 6.769   10.166  35.385   1.00 197.66 ? 398  ARG A NH2 1 
ATOM   3045  N  N   . SER A  1  399 ? -0.941  10.697  34.919   1.00 210.40 ? 399  SER A N   1 
ATOM   3046  C  CA  . SER A  1  399 ? -2.099  10.838  34.047   1.00 213.27 ? 399  SER A CA  1 
ATOM   3047  C  C   . SER A  1  399 ? -2.020  9.787   32.952   1.00 195.18 ? 399  SER A C   1 
ATOM   3048  O  O   . SER A  1  399 ? -0.964  9.624   32.332   1.00 197.16 ? 399  SER A O   1 
ATOM   3049  C  CB  . SER A  1  399 ? -2.145  12.240  33.436   1.00 227.47 ? 399  SER A CB  1 
ATOM   3050  O  OG  . SER A  1  399 ? -0.891  12.567  32.861   1.00 228.59 ? 399  SER A OG  1 
ATOM   3051  N  N   . GLY A  1  400 ? -3.106  9.052   32.724   1.00 193.42 ? 400  GLY A N   1 
ATOM   3052  C  CA  . GLY A  1  400 ? -3.121  8.096   31.638   1.00 184.86 ? 400  GLY A CA  1 
ATOM   3053  C  C   . GLY A  1  400 ? -3.219  6.709   32.225   1.00 181.12 ? 400  GLY A C   1 
ATOM   3054  O  O   . GLY A  1  400 ? -4.193  6.378   32.910   1.00 180.50 ? 400  GLY A O   1 
ATOM   3055  N  N   . CYS A  1  401 ? -2.209  5.878   31.940   1.00 188.02 ? 401  CYS A N   1 
ATOM   3056  C  CA  . CYS A  1  401 ? -2.158  4.554   32.531   1.00 187.15 ? 401  CYS A CA  1 
ATOM   3057  C  C   . CYS A  1  401 ? -1.767  4.654   34.002   1.00 197.78 ? 401  CYS A C   1 
ATOM   3058  O  O   . CYS A  1  401 ? -0.985  5.528   34.388   1.00 202.39 ? 401  CYS A O   1 
ATOM   3059  C  CB  . CYS A  1  401 ? -1.143  3.674   31.813   1.00 163.72 ? 401  CYS A CB  1 
ATOM   3060  S  SG  . CYS A  1  401 ? -1.751  2.696   30.435   1.00 160.06 ? 401  CYS A SG  1 
ATOM   3061  N  N   . PRO A  1  402 ? -2.299  3.768   34.837   1.00 190.39 ? 402  PRO A N   1 
ATOM   3062  C  CA  . PRO A  1  402 ? -1.840  3.678   36.218   1.00 181.47 ? 402  PRO A CA  1 
ATOM   3063  C  C   . PRO A  1  402 ? -0.390  3.236   36.266   1.00 167.05 ? 402  PRO A C   1 
ATOM   3064  O  O   . PRO A  1  402 ? 0.160   2.782   35.249   1.00 165.78 ? 402  PRO A O   1 
ATOM   3065  C  CB  . PRO A  1  402 ? -2.777  2.627   36.837   1.00 163.39 ? 402  PRO A CB  1 
ATOM   3066  C  CG  . PRO A  1  402 ? -3.254  1.830   35.705   1.00 195.65 ? 402  PRO A CG  1 
ATOM   3067  C  CD  . PRO A  1  402 ? -3.356  2.787   34.547   1.00 194.89 ? 402  PRO A CD  1 
ATOM   3068  N  N   . PRO A  1  403 ? 0.277   3.395   37.409   1.00 169.55 ? 403  PRO A N   1 
ATOM   3069  C  CA  . PRO A  1  403 ? 1.700   3.035   37.476   1.00 170.88 ? 403  PRO A CA  1 
ATOM   3070  C  C   . PRO A  1  403 ? 1.982   1.617   37.025   1.00 177.83 ? 403  PRO A C   1 
ATOM   3071  O  O   . PRO A  1  403 ? 3.039   1.365   36.431   1.00 195.82 ? 403  PRO A O   1 
ATOM   3072  C  CB  . PRO A  1  403 ? 2.040   3.243   38.958   1.00 182.02 ? 403  PRO A CB  1 
ATOM   3073  C  CG  . PRO A  1  403 ? 1.009   4.193   39.455   1.00 175.09 ? 403  PRO A CG  1 
ATOM   3074  C  CD  . PRO A  1  403 ? -0.233  3.869   38.706   1.00 171.58 ? 403  PRO A CD  1 
ATOM   3075  N  N   . SER A  1  404 ? 1.069   0.678   37.283   1.00 164.45 ? 404  SER A N   1 
ATOM   3076  C  CA  . SER A  1  404 ? 1.201   -0.700  36.807   1.00 161.45 ? 404  SER A CA  1 
ATOM   3077  C  C   . SER A  1  404 ? 2.467   -1.367  37.344   1.00 162.88 ? 404  SER A C   1 
ATOM   3078  O  O   . SER A  1  404 ? 3.118   -2.148  36.646   1.00 162.06 ? 404  SER A O   1 
ATOM   3079  C  CB  . SER A  1  404 ? 1.179   -0.751  35.278   1.00 159.97 ? 404  SER A CB  1 
ATOM   3080  O  OG  . SER A  1  404 ? 0.053   -0.073  34.743   1.00 159.11 ? 404  SER A OG  1 
ATOM   3081  N  N   . PHE A  1  405 ? 2.830   -1.042  38.586   1.00 165.44 ? 405  PHE A N   1 
ATOM   3082  C  CA  . PHE A  1  405 ? 3.968   -1.678  39.244   1.00 167.19 ? 405  PHE A CA  1 
ATOM   3083  C  C   . PHE A  1  405 ? 3.715   -3.172  39.389   1.00 195.85 ? 405  PHE A C   1 
ATOM   3084  O  O   . PHE A  1  405 ? 2.758   -3.582  40.048   1.00 183.35 ? 405  PHE A O   1 
ATOM   3085  C  CB  . PHE A  1  405 ? 4.206   -1.032  40.612   1.00 170.54 ? 405  PHE A CB  1 
ATOM   3086  C  CG  . PHE A  1  405 ? 5.302   -1.683  41.423   1.00 190.81 ? 405  PHE A CG  1 
ATOM   3087  C  CD1 . PHE A  1  405 ? 6.626   -1.303  41.265   1.00 206.89 ? 405  PHE A CD1 1 
ATOM   3088  C  CD2 . PHE A  1  405 ? 5.002   -2.661  42.360   1.00 184.59 ? 405  PHE A CD2 1 
ATOM   3089  C  CE1 . PHE A  1  405 ? 7.631   -1.897  42.019   1.00 200.00 ? 405  PHE A CE1 1 
ATOM   3090  C  CE2 . PHE A  1  405 ? 6.000   -3.258  43.113   1.00 181.19 ? 405  PHE A CE2 1 
ATOM   3091  C  CZ  . PHE A  1  405 ? 7.314   -2.874  42.943   1.00 177.38 ? 405  PHE A CZ  1 
ATOM   3092  N  N   . GLY A  1  406 ? 4.561   -3.988  38.755   1.00 203.16 ? 406  GLY A N   1 
ATOM   3093  C  CA  . GLY A  1  406 ? 4.410   -5.428  38.797   1.00 188.47 ? 406  GLY A CA  1 
ATOM   3094  C  C   . GLY A  1  406 ? 3.845   -6.050  37.537   1.00 168.55 ? 406  GLY A C   1 
ATOM   3095  O  O   . GLY A  1  406 ? 3.762   -7.282  37.464   1.00 159.67 ? 406  GLY A O   1 
ATOM   3096  N  N   . TYR A  1  407 ? 3.428   -5.238  36.561   1.00 158.04 ? 407  TYR A N   1 
ATOM   3097  C  CA  . TYR A  1  407 ? 2.767   -5.770  35.375   1.00 155.19 ? 407  TYR A CA  1 
ATOM   3098  C  C   . TYR A  1  407 ? 3.615   -6.806  34.647   1.00 155.24 ? 407  TYR A C   1 
ATOM   3099  O  O   . TYR A  1  407 ? 3.067   -7.738  34.048   1.00 157.84 ? 407  TYR A O   1 
ATOM   3100  C  CB  . TYR A  1  407 ? 2.412   -4.639  34.422   1.00 155.31 ? 407  TYR A CB  1 
ATOM   3101  C  CG  . TYR A  1  407 ? 1.668   -5.133  33.209   1.00 162.22 ? 407  TYR A CG  1 
ATOM   3102  C  CD1 . TYR A  1  407 ? 0.297   -5.358  33.258   1.00 153.63 ? 407  TYR A CD1 1 
ATOM   3103  C  CD2 . TYR A  1  407 ? 2.335   -5.390  32.019   1.00 153.04 ? 407  TYR A CD2 1 
ATOM   3104  C  CE1 . TYR A  1  407 ? -0.392  -5.817  32.153   1.00 147.91 ? 407  TYR A CE1 1 
ATOM   3105  C  CE2 . TYR A  1  407 ? 1.652   -5.851  30.908   1.00 163.17 ? 407  TYR A CE2 1 
ATOM   3106  C  CZ  . TYR A  1  407 ? 0.289   -6.060  30.981   1.00 148.33 ? 407  TYR A CZ  1 
ATOM   3107  O  OH  . TYR A  1  407 ? -0.390  -6.515  29.878   1.00 146.52 ? 407  TYR A OH  1 
ATOM   3108  N  N   . SER A  1  408 ? 4.941   -6.666  34.682   1.00 168.01 ? 408  SER A N   1 
ATOM   3109  C  CA  . SER A  1  408 ? 5.861   -7.668  34.155   1.00 159.11 ? 408  SER A CA  1 
ATOM   3110  C  C   . SER A  1  408 ? 7.007   -7.839  35.138   1.00 162.29 ? 408  SER A C   1 
ATOM   3111  O  O   . SER A  1  408 ? 7.430   -6.869  35.773   1.00 164.65 ? 408  SER A O   1 
ATOM   3112  C  CB  . SER A  1  408 ? 6.426   -7.276  32.786   1.00 160.22 ? 408  SER A CB  1 
ATOM   3113  O  OG  . SER A  1  408 ? 7.146   -6.059  32.869   1.00 163.20 ? 408  SER A OG  1 
ATOM   3114  N  N   . MET A  1  409 ? 7.506   -9.067  35.263   1.00 162.70 ? 409  MET A N   1 
ATOM   3115  C  CA  . MET A  1  409 ? 8.636   -9.323  36.146   1.00 166.09 ? 409  MET A CA  1 
ATOM   3116  C  C   . MET A  1  409 ? 9.296   -10.642 35.765   1.00 195.25 ? 409  MET A C   1 
ATOM   3117  O  O   . MET A  1  409 ? 8.697   -11.487 35.094   1.00 192.18 ? 409  MET A O   1 
ATOM   3118  C  CB  . MET A  1  409 ? 8.213   -9.337  37.619   1.00 166.03 ? 409  MET A CB  1 
ATOM   3119  C  CG  . MET A  1  409 ? 6.950   -10.112 37.912   1.00 162.50 ? 409  MET A CG  1 
ATOM   3120  S  SD  . MET A  1  409 ? 6.438   -9.838  39.613   1.00 163.02 ? 409  MET A SD  1 
ATOM   3121  C  CE  . MET A  1  409 ? 5.199   -11.113 39.804   1.00 159.51 ? 409  MET A CE  1 
ATOM   3122  N  N   . LYS A  1  410 ? 10.552  -10.795 36.197   1.00 196.54 ? 410  LYS A N   1 
ATOM   3123  C  CA  . LYS A  1  410 ? 11.339  -11.998 35.952   1.00 183.02 ? 410  LYS A CA  1 
ATOM   3124  C  C   . LYS A  1  410 ? 12.297  -12.229 37.118   1.00 176.44 ? 410  LYS A C   1 
ATOM   3125  O  O   . LYS A  1  410 ? 12.899  -11.282 37.628   1.00 179.05 ? 410  LYS A O   1 
ATOM   3126  C  CB  . LYS A  1  410 ? 12.122  -11.884 34.639   1.00 174.60 ? 410  LYS A CB  1 
ATOM   3127  C  CG  . LYS A  1  410 ? 12.744  -13.183 34.193   1.00 176.31 ? 410  LYS A CG  1 
ATOM   3128  C  CD  . LYS A  1  410 ? 11.682  -14.144 33.682   1.00 172.65 ? 410  LYS A CD  1 
ATOM   3129  C  CE  . LYS A  1  410 ? 12.100  -15.593 33.892   1.00 190.17 ? 410  LYS A CE  1 
ATOM   3130  N  NZ  . LYS A  1  410 ? 13.482  -15.880 33.401   1.00 217.13 ? 410  LYS A NZ  1 
ATOM   3131  N  N   . GLY A  1  411 ? 12.444  -13.489 37.530   1.00 177.02 ? 411  GLY A N   1 
ATOM   3132  C  CA  . GLY A  1  411 ? 13.344  -13.810 38.620   1.00 180.83 ? 411  GLY A CA  1 
ATOM   3133  C  C   . GLY A  1  411 ? 14.287  -14.964 38.339   1.00 183.95 ? 411  GLY A C   1 
ATOM   3134  O  O   . GLY A  1  411 ? 14.548  -15.293 37.177   1.00 184.17 ? 411  GLY A O   1 
ATOM   3135  N  N   . ALA A  1  412 ? 14.794  -15.580 39.412   1.00 186.72 ? 412  ALA A N   1 
ATOM   3136  C  CA  . ALA A  1  412 ? 15.643  -16.774 39.366   1.00 193.64 ? 412  ALA A CA  1 
ATOM   3137  C  C   . ALA A  1  412 ? 17.036  -16.505 38.793   1.00 208.69 ? 412  ALA A C   1 
ATOM   3138  O  O   . ALA A  1  412 ? 17.664  -17.410 38.235   1.00 213.17 ? 412  ALA A O   1 
ATOM   3139  C  CB  . ALA A  1  412 ? 14.968  -17.913 38.592   1.00 189.29 ? 412  ALA A CB  1 
ATOM   3140  N  N   . THR A  1  413 ? 17.532  -15.274 38.916   1.00 196.66 ? 413  THR A N   1 
ATOM   3141  C  CA  . THR A  1  413 ? 18.882  -14.923 38.489   1.00 201.76 ? 413  THR A CA  1 
ATOM   3142  C  C   . THR A  1  413 ? 19.561  -14.110 39.584   1.00 205.30 ? 413  THR A C   1 
ATOM   3143  O  O   . THR A  1  413 ? 19.031  -13.080 40.011   1.00 215.80 ? 413  THR A O   1 
ATOM   3144  C  CB  . THR A  1  413 ? 18.856  -14.145 37.171   1.00 200.67 ? 413  THR A CB  1 
ATOM   3145  O  OG1 . THR A  1  413 ? 18.335  -14.983 36.130   1.00 198.15 ? 413  THR A OG1 1 
ATOM   3146  C  CG2 . THR A  1  413 ? 20.253  -13.687 36.797   1.00 208.26 ? 413  THR A CG2 1 
ATOM   3147  N  N   . ASP A  1  414 ? 20.737  -14.564 40.029   1.00 210.78 ? 414  ASP A N   1 
ATOM   3148  C  CA  . ASP A  1  414 ? 21.492  -13.883 41.086   1.00 214.98 ? 414  ASP A CA  1 
ATOM   3149  C  C   . ASP A  1  414 ? 22.427  -12.876 40.427   1.00 218.52 ? 414  ASP A C   1 
ATOM   3150  O  O   . ASP A  1  414 ? 23.551  -13.197 40.035   1.00 223.38 ? 414  ASP A O   1 
ATOM   3151  C  CB  . ASP A  1  414 ? 22.258  -14.885 41.939   1.00 219.43 ? 414  ASP A CB  1 
ATOM   3152  C  CG  . ASP A  1  414 ? 22.925  -14.239 43.142   1.00 223.70 ? 414  ASP A CG  1 
ATOM   3153  O  OD1 . ASP A  1  414 ? 22.493  -13.141 43.567   1.00 222.19 ? 414  ASP A OD1 1 
ATOM   3154  O  OD2 . ASP A  1  414 ? 23.888  -14.838 43.663   1.00 228.92 ? 414  ASP A OD2 1 
ATOM   3155  N  N   . ILE A  1  415 ? 21.955  -11.631 40.315   1.00 216.40 ? 415  ILE A N   1 
ATOM   3156  C  CA  . ILE A  1  415 ? 22.649  -10.628 39.510   1.00 226.90 ? 415  ILE A CA  1 
ATOM   3157  C  C   . ILE A  1  415 ? 23.865  -10.038 40.219   1.00 225.44 ? 415  ILE A C   1 
ATOM   3158  O  O   . ILE A  1  415 ? 24.742  -9.469  39.556   1.00 229.20 ? 415  ILE A O   1 
ATOM   3159  C  CB  . ILE A  1  415 ? 21.661  -9.519  39.097   1.00 214.64 ? 415  ILE A CB  1 
ATOM   3160  C  CG1 . ILE A  1  415 ? 22.140  -8.787  37.839   1.00 216.12 ? 415  ILE A CG1 1 
ATOM   3161  C  CG2 . ILE A  1  415 ? 21.440  -8.533  40.231   1.00 215.20 ? 415  ILE A CG2 1 
ATOM   3162  C  CD1 . ILE A  1  415 ? 21.180  -7.740  37.332   1.00 212.13 ? 415  ILE A CD1 1 
ATOM   3163  N  N   . ASP A  1  416 ? 23.971  -10.188 41.539   1.00 227.20 ? 416  ASP A N   1 
ATOM   3164  C  CA  . ASP A  1  416 ? 25.069  -9.604  42.297   1.00 233.46 ? 416  ASP A CA  1 
ATOM   3165  C  C   . ASP A  1  416 ? 25.990  -10.652 42.909   1.00 238.31 ? 416  ASP A C   1 
ATOM   3166  O  O   . ASP A  1  416 ? 26.821  -10.306 43.756   1.00 243.58 ? 416  ASP A O   1 
ATOM   3167  C  CB  . ASP A  1  416 ? 24.526  -8.673  43.383   1.00 232.63 ? 416  ASP A CB  1 
ATOM   3168  C  CG  . ASP A  1  416 ? 23.709  -9.404  44.437   1.00 229.85 ? 416  ASP A CG  1 
ATOM   3169  O  OD1 . ASP A  1  416 ? 23.155  -10.488 44.147   1.00 226.46 ? 416  ASP A OD1 1 
ATOM   3170  O  OD2 . ASP A  1  416 ? 23.609  -8.877  45.567   1.00 231.32 ? 416  ASP A OD2 1 
ATOM   3171  N  N   . LYS A  1  417 ? 25.865  -11.917 42.501   1.00 236.99 ? 417  LYS A N   1 
ATOM   3172  C  CA  . LYS A  1  417 ? 26.750  -12.990 42.965   1.00 241.93 ? 417  LYS A CA  1 
ATOM   3173  C  C   . LYS A  1  417 ? 26.776  -13.065 44.488   1.00 243.91 ? 417  LYS A C   1 
ATOM   3174  O  O   . LYS A  1  417 ? 27.799  -13.362 45.108   1.00 250.00 ? 417  LYS A O   1 
ATOM   3175  C  CB  . LYS A  1  417 ? 28.157  -12.822 42.397   1.00 248.58 ? 417  LYS A CB  1 
ATOM   3176  C  CG  . LYS A  1  417 ? 28.200  -12.854 40.879   1.00 249.01 ? 417  LYS A CG  1 
ATOM   3177  C  CD  . LYS A  1  417 ? 27.920  -14.250 40.342   1.00 245.64 ? 417  LYS A CD  1 
ATOM   3178  C  CE  . LYS A  1  417 ? 28.971  -15.240 40.817   1.00 252.01 ? 417  LYS A CE  1 
ATOM   3179  N  NZ  . LYS A  1  417 ? 28.727  -16.612 40.294   1.00 250.95 ? 417  LYS A NZ  1 
ATOM   3180  N  N   . ASN A  1  418 ? 25.625  -12.799 45.090   1.00 248.60 ? 418  ASN A N   1 
ATOM   3181  C  CA  . ASN A  1  418 ? 25.430  -12.779 46.531   1.00 248.40 ? 418  ASN A CA  1 
ATOM   3182  C  C   . ASN A  1  418 ? 24.973  -14.120 47.084   1.00 238.76 ? 418  ASN A C   1 
ATOM   3183  O  O   . ASN A  1  418 ? 24.805  -14.253 48.301   1.00 239.95 ? 418  ASN A O   1 
ATOM   3184  C  CB  . ASN A  1  418 ? 24.393  -11.710 46.865   1.00 249.43 ? 418  ASN A CB  1 
ATOM   3185  C  CG  . ASN A  1  418 ? 22.971  -12.193 46.617   1.00 228.75 ? 418  ASN A CG  1 
ATOM   3186  O  OD1 . ASN A  1  418 ? 22.737  -13.012 45.726   1.00 226.22 ? 418  ASN A OD1 1 
ATOM   3187  N  ND2 . ASN A  1  418 ? 22.009  -11.625 47.335   1.00 225.76 ? 418  ASN A ND2 1 
ATOM   3188  N  N   . GLY A  1  419 ? 24.759  -15.111 46.222   1.00 236.56 ? 419  GLY A N   1 
ATOM   3189  C  CA  . GLY A  1  419 ? 24.303  -16.412 46.647   1.00 235.37 ? 419  GLY A CA  1 
ATOM   3190  C  C   . GLY A  1  419 ? 22.804  -16.561 46.620   1.00 228.33 ? 419  GLY A C   1 
ATOM   3191  O  O   . GLY A  1  419 ? 22.302  -17.660 46.882   1.00 226.88 ? 419  GLY A O   1 
ATOM   3192  N  N   . TYR A  1  420 ? 22.074  -15.486 46.314   1.00 224.54 ? 420  TYR A N   1 
ATOM   3193  C  CA  . TYR A  1  420 ? 20.624  -15.485 46.307   1.00 231.54 ? 420  TYR A CA  1 
ATOM   3194  C  C   . TYR A  1  420 ? 20.085  -14.884 45.016   1.00 221.26 ? 420  TYR A C   1 
ATOM   3195  O  O   . TYR A  1  420 ? 20.561  -13.831 44.567   1.00 232.36 ? 420  TYR A O   1 
ATOM   3196  C  CB  . TYR A  1  420 ? 20.073  -14.689 47.496   1.00 235.65 ? 420  TYR A CB  1 
ATOM   3197  C  CG  . TYR A  1  420 ? 20.480  -15.227 48.844   1.00 242.07 ? 420  TYR A CG  1 
ATOM   3198  C  CD1 . TYR A  1  420 ? 21.717  -14.915 49.397   1.00 232.98 ? 420  TYR A CD1 1 
ATOM   3199  C  CD2 . TYR A  1  420 ? 19.622  -16.042 49.568   1.00 228.51 ? 420  TYR A CD2 1 
ATOM   3200  C  CE1 . TYR A  1  420 ? 22.089  -15.404 50.631   1.00 231.75 ? 420  TYR A CE1 1 
ATOM   3201  C  CE2 . TYR A  1  420 ? 19.984  -16.535 50.802   1.00 223.91 ? 420  TYR A CE2 1 
ATOM   3202  C  CZ  . TYR A  1  420 ? 21.216  -16.211 51.330   1.00 229.42 ? 420  TYR A CZ  1 
ATOM   3203  O  OH  . TYR A  1  420 ? 21.571  -16.707 52.562   1.00 233.64 ? 420  TYR A OH  1 
ATOM   3204  N  N   . PRO A  1  421 ? 19.073  -15.509 44.416   1.00 208.66 ? 421  PRO A N   1 
ATOM   3205  C  CA  . PRO A  1  421 ? 18.483  -14.948 43.195   1.00 220.10 ? 421  PRO A CA  1 
ATOM   3206  C  C   . PRO A  1  421 ? 17.686  -13.686 43.499   1.00 223.50 ? 421  PRO A C   1 
ATOM   3207  O  O   . PRO A  1  421 ? 17.051  -13.566 44.548   1.00 221.46 ? 421  PRO A O   1 
ATOM   3208  C  CB  . PRO A  1  421 ? 17.579  -16.079 42.687   1.00 221.87 ? 421  PRO A CB  1 
ATOM   3209  C  CG  . PRO A  1  421 ? 17.234  -16.856 43.918   1.00 221.25 ? 421  PRO A CG  1 
ATOM   3210  C  CD  . PRO A  1  421 ? 18.464  -16.799 44.786   1.00 206.99 ? 421  PRO A CD  1 
ATOM   3211  N  N   . ASP A  1  422 ? 17.742  -12.729 42.576   1.00 219.62 ? 422  ASP A N   1 
ATOM   3212  C  CA  . ASP A  1  422 ? 17.126  -11.420 42.746   1.00 199.11 ? 422  ASP A CA  1 
ATOM   3213  C  C   . ASP A  1  422 ? 15.947  -11.274 41.784   1.00 193.61 ? 422  ASP A C   1 
ATOM   3214  O  O   . ASP A  1  422 ? 15.627  -12.187 41.016   1.00 191.32 ? 422  ASP A O   1 
ATOM   3215  C  CB  . ASP A  1  422 ? 18.177  -10.323 42.565   1.00 203.39 ? 422  ASP A CB  1 
ATOM   3216  C  CG  . ASP A  1  422 ? 19.427  -10.574 43.408   1.00 209.35 ? 422  ASP A CG  1 
ATOM   3217  O  OD1 . ASP A  1  422 ? 20.296  -11.359 42.973   1.00 212.13 ? 422  ASP A OD1 1 
ATOM   3218  O  OD2 . ASP A  1  422 ? 19.534  -10.001 44.513   1.00 211.55 ? 422  ASP A OD2 1 
ATOM   3219  N  N   . LEU A  1  423 ? 15.295  -10.109 41.831   1.00 198.40 ? 423  LEU A N   1 
ATOM   3220  C  CA  . LEU A  1  423 ? 14.014  -9.909  41.159   1.00 206.42 ? 423  LEU A CA  1 
ATOM   3221  C  C   . LEU A  1  423 ? 13.901  -8.516  40.552   1.00 202.63 ? 423  LEU A C   1 
ATOM   3222  O  O   . LEU A  1  423 ? 14.113  -7.515  41.243   1.00 208.21 ? 423  LEU A O   1 
ATOM   3223  C  CB  . LEU A  1  423 ? 12.864  -10.136 42.146   1.00 183.93 ? 423  LEU A CB  1 
ATOM   3224  C  CG  . LEU A  1  423 ? 11.472  -9.706  41.704   1.00 179.27 ? 423  LEU A CG  1 
ATOM   3225  C  CD1 . LEU A  1  423 ? 11.003  -10.543 40.530   1.00 198.40 ? 423  LEU A CD1 1 
ATOM   3226  C  CD2 . LEU A  1  423 ? 10.510  -9.814  42.869   1.00 179.40 ? 423  LEU A CD2 1 
ATOM   3227  N  N   . ILE A  1  424 ? 13.548  -8.456  39.266   1.00 184.09 ? 424  ILE A N   1 
ATOM   3228  C  CA  . ILE A  1  424 ? 13.264  -7.201  38.572   1.00 183.50 ? 424  ILE A CA  1 
ATOM   3229  C  C   . ILE A  1  424 ? 11.755  -7.038  38.436   1.00 205.64 ? 424  ILE A C   1 
ATOM   3230  O  O   . ILE A  1  424 ? 11.055  -7.980  38.042   1.00 193.56 ? 424  ILE A O   1 
ATOM   3231  C  CB  . ILE A  1  424 ? 13.940  -7.156  37.192   1.00 184.63 ? 424  ILE A CB  1 
ATOM   3232  C  CG1 . ILE A  1  424 ? 15.442  -7.385  37.326   1.00 209.06 ? 424  ILE A CG1 1 
ATOM   3233  C  CG2 . ILE A  1  424 ? 13.694  -5.819  36.517   1.00 184.54 ? 424  ILE A CG2 1 
ATOM   3234  C  CD1 . ILE A  1  424 ? 16.146  -7.558  35.999   1.00 225.25 ? 424  ILE A CD1 1 
ATOM   3235  N  N   . VAL A  1  425 ? 11.254  -5.839  38.741   1.00 216.69 ? 425  VAL A N   1 
ATOM   3236  C  CA  . VAL A  1  425 ? 9.825   -5.535  38.682   1.00 203.89 ? 425  VAL A CA  1 
ATOM   3237  C  C   . VAL A  1  425 ? 9.600   -4.312  37.799   1.00 197.68 ? 425  VAL A C   1 
ATOM   3238  O  O   . VAL A  1  425 ? 10.109  -3.225  38.096   1.00 188.86 ? 425  VAL A O   1 
ATOM   3239  C  CB  . VAL A  1  425 ? 9.238   -5.292  40.079   1.00 204.22 ? 425  VAL A CB  1 
ATOM   3240  C  CG1 . VAL A  1  425 ? 7.771   -4.911  39.964   1.00 196.66 ? 425  VAL A CG1 1 
ATOM   3241  C  CG2 . VAL A  1  425 ? 9.426   -6.520  40.955   1.00 200.71 ? 425  VAL A CG2 1 
ATOM   3242  N  N   . GLY A  1  426 ? 8.820   -4.485  36.733   1.00 197.30 ? 426  GLY A N   1 
ATOM   3243  C  CA  . GLY A  1  426 ? 8.513   -3.395  35.830   1.00 189.58 ? 426  GLY A CA  1 
ATOM   3244  C  C   . GLY A  1  426 ? 7.231   -2.657  36.181   1.00 169.69 ? 426  GLY A C   1 
ATOM   3245  O  O   . GLY A  1  426 ? 6.258   -3.246  36.646   1.00 166.90 ? 426  GLY A O   1 
ATOM   3246  N  N   . ALA A  1  427 ? 7.240   -1.333  35.940   1.00 172.23 ? 427  ALA A N   1 
ATOM   3247  C  CA  . ALA A  1  427 ? 6.070   -0.459  36.125   1.00 170.60 ? 427  ALA A CA  1 
ATOM   3248  C  C   . ALA A  1  427 ? 5.997   0.495   34.928   1.00 171.27 ? 427  ALA A C   1 
ATOM   3249  O  O   . ALA A  1  427 ? 6.416   1.651   35.001   1.00 183.01 ? 427  ALA A O   1 
ATOM   3250  C  CB  . ALA A  1  427 ? 6.146   0.307   37.444   1.00 173.42 ? 427  ALA A CB  1 
ATOM   3251  N  N   . PHE A  1  428 ? 5.414   0.021   33.826   1.00 168.35 ? 428  PHE A N   1 
ATOM   3252  C  CA  . PHE A  1  428 ? 5.493   0.778   32.581   1.00 169.25 ? 428  PHE A CA  1 
ATOM   3253  C  C   . PHE A  1  428 ? 4.700   2.079   32.628   1.00 170.22 ? 428  PHE A C   1 
ATOM   3254  O  O   . PHE A  1  428 ? 5.027   3.012   31.888   1.00 172.52 ? 428  PHE A O   1 
ATOM   3255  C  CB  . PHE A  1  428 ? 5.016   -0.092  31.414   1.00 166.11 ? 428  PHE A CB  1 
ATOM   3256  C  CG  . PHE A  1  428 ? 3.545   -0.394  31.442   1.00 162.58 ? 428  PHE A CG  1 
ATOM   3257  C  CD1 . PHE A  1  428 ? 2.619   0.478   30.880   1.00 162.24 ? 428  PHE A CD1 1 
ATOM   3258  C  CD2 . PHE A  1  428 ? 3.087   -1.550  32.043   1.00 163.89 ? 428  PHE A CD2 1 
ATOM   3259  C  CE1 . PHE A  1  428 ? 1.262   0.199   30.922   1.00 159.37 ? 428  PHE A CE1 1 
ATOM   3260  C  CE2 . PHE A  1  428 ? 1.732   -1.839  32.080   1.00 193.35 ? 428  PHE A CE2 1 
ATOM   3261  C  CZ  . PHE A  1  428 ? 0.815   -0.961  31.520   1.00 156.74 ? 428  PHE A CZ  1 
ATOM   3262  N  N   . GLY A  1  429 ? 3.684   2.169   33.489   1.00 168.91 ? 429  GLY A N   1 
ATOM   3263  C  CA  . GLY A  1  429 ? 2.859   3.365   33.553   1.00 185.14 ? 429  GLY A CA  1 
ATOM   3264  C  C   . GLY A  1  429 ? 3.595   4.599   34.028   1.00 188.80 ? 429  GLY A C   1 
ATOM   3265  O  O   . GLY A  1  429 ? 3.147   5.720   33.760   1.00 196.00 ? 429  GLY A O   1 
ATOM   3266  N  N   . VAL A  1  430 ? 4.709   4.419   34.734   1.00 176.93 ? 430  VAL A N   1 
ATOM   3267  C  CA  . VAL A  1  430 ? 5.555   5.514   35.176   1.00 181.73 ? 430  VAL A CA  1 
ATOM   3268  C  C   . VAL A  1  430 ? 6.958   5.407   34.596   1.00 184.00 ? 430  VAL A C   1 
ATOM   3269  O  O   . VAL A  1  430 ? 7.864   6.109   35.043   1.00 188.23 ? 430  VAL A O   1 
ATOM   3270  C  CB  . VAL A  1  430 ? 5.597   5.604   36.714   1.00 184.83 ? 430  VAL A CB  1 
ATOM   3271  C  CG1 . VAL A  1  430 ? 4.266   6.112   37.259   1.00 182.83 ? 430  VAL A CG1 1 
ATOM   3272  C  CG2 . VAL A  1  430 ? 5.931   4.251   37.318   1.00 183.53 ? 430  VAL A CG2 1 
ATOM   3273  N  N   . ASP A  1  431 ? 7.149   4.529   33.609   1.00 189.53 ? 431  ASP A N   1 
ATOM   3274  C  CA  . ASP A  1  431 ? 8.418   4.341   32.900   1.00 183.73 ? 431  ASP A CA  1 
ATOM   3275  C  C   . ASP A  1  431 ? 9.563   4.065   33.873   1.00 186.61 ? 431  ASP A C   1 
ATOM   3276  O  O   . ASP A  1  431 ? 10.557  4.794   33.926   1.00 197.60 ? 431  ASP A O   1 
ATOM   3277  C  CB  . ASP A  1  431 ? 8.732   5.556   32.024   1.00 191.71 ? 431  ASP A CB  1 
ATOM   3278  C  CG  . ASP A  1  431 ? 7.598   5.905   31.080   1.00 211.24 ? 431  ASP A CG  1 
ATOM   3279  O  OD1 . ASP A  1  431 ? 7.386   5.163   30.098   1.00 221.81 ? 431  ASP A OD1 1 
ATOM   3280  O  OD2 . ASP A  1  431 ? 6.904   6.912   31.330   1.00 229.89 ? 431  ASP A OD2 1 
ATOM   3281  N  N   . ARG A  1  432 ? 9.416   2.984   34.639   1.00 184.36 ? 432  ARG A N   1 
ATOM   3282  C  CA  . ARG A  1  432 ? 10.384  2.678   35.678   1.00 187.09 ? 432  ARG A CA  1 
ATOM   3283  C  C   . ARG A  1  432 ? 10.540  1.171   35.853   1.00 184.74 ? 432  ARG A C   1 
ATOM   3284  O  O   . ARG A  1  432 ? 9.600   0.396   35.651   1.00 180.44 ? 432  ARG A O   1 
ATOM   3285  C  CB  . ARG A  1  432 ? 9.972   3.334   36.999   1.00 188.58 ? 432  ARG A CB  1 
ATOM   3286  C  CG  . ARG A  1  432 ? 11.135  3.857   37.804   1.00 197.10 ? 432  ARG A CG  1 
ATOM   3287  C  CD  . ARG A  1  432 ? 11.643  5.151   37.208   1.00 202.55 ? 432  ARG A CD  1 
ATOM   3288  N  NE  . ARG A  1  432 ? 10.650  6.223   37.177   1.00 202.56 ? 432  ARG A NE  1 
ATOM   3289  C  CZ  . ARG A  1  432 ? 10.625  7.246   38.027   1.00 201.25 ? 432  ARG A CZ  1 
ATOM   3290  N  NH1 . ARG A  1  432 ? 11.537  7.342   38.985   1.00 204.95 ? 432  ARG A NH1 1 
ATOM   3291  N  NH2 . ARG A  1  432 ? 9.687   8.178   37.919   1.00 211.37 ? 432  ARG A NH2 1 
ATOM   3292  N  N   . ALA A  1  433 ? 11.751  0.772   36.243   1.00 205.03 ? 433  ALA A N   1 
ATOM   3293  C  CA  . ALA A  1  433 ? 12.065  -0.594  36.635   1.00 198.97 ? 433  ALA A CA  1 
ATOM   3294  C  C   . ALA A  1  433 ? 12.912  -0.567  37.901   1.00 190.25 ? 433  ALA A C   1 
ATOM   3295  O  O   . ALA A  1  433 ? 13.834  0.247   38.026   1.00 194.69 ? 433  ALA A O   1 
ATOM   3296  C  CB  . ALA A  1  433 ? 12.796  -1.344  35.518   1.00 196.51 ? 433  ALA A CB  1 
ATOM   3297  N  N   . ILE A  1  434 ? 12.597  -1.460  38.837   1.00 188.75 ? 434  ILE A N   1 
ATOM   3298  C  CA  . ILE A  1  434 ? 13.202  -1.465  40.163   1.00 192.10 ? 434  ILE A CA  1 
ATOM   3299  C  C   . ILE A  1  434 ? 13.792  -2.842  40.444   1.00 196.94 ? 434  ILE A C   1 
ATOM   3300  O  O   . ILE A  1  434 ? 13.106  -3.859  40.292   1.00 194.54 ? 434  ILE A O   1 
ATOM   3301  C  CB  . ILE A  1  434 ? 12.179  -1.085  41.249   1.00 190.96 ? 434  ILE A CB  1 
ATOM   3302  C  CG1 . ILE A  1  434 ? 11.484  0.233   40.891   1.00 208.97 ? 434  ILE A CG1 1 
ATOM   3303  C  CG2 . ILE A  1  434 ? 12.856  -0.980  42.601   1.00 195.06 ? 434  ILE A CG2 1 
ATOM   3304  C  CD1 . ILE A  1  434 ? 10.152  0.060   40.162   1.00 201.70 ? 434  ILE A CD1 1 
ATOM   3305  N  N   . LEU A  1  435 ? 15.055  -2.871  40.872   1.00 204.97 ? 435  LEU A N   1 
ATOM   3306  C  CA  . LEU A  1  435 ? 15.744  -4.104  41.244   1.00 201.07 ? 435  LEU A CA  1 
ATOM   3307  C  C   . LEU A  1  435 ? 15.708  -4.284  42.760   1.00 199.67 ? 435  LEU A C   1 
ATOM   3308  O  O   . LEU A  1  435 ? 16.238  -3.448  43.500   1.00 208.54 ? 435  LEU A O   1 
ATOM   3309  C  CB  . LEU A  1  435 ? 17.191  -4.091  40.749   1.00 202.67 ? 435  LEU A CB  1 
ATOM   3310  C  CG  . LEU A  1  435 ? 18.053  -5.296  41.141   1.00 204.99 ? 435  LEU A CG  1 
ATOM   3311  C  CD1 . LEU A  1  435 ? 17.597  -6.557  40.424   1.00 201.22 ? 435  LEU A CD1 1 
ATOM   3312  C  CD2 . LEU A  1  435 ? 19.520  -5.023  40.869   1.00 210.72 ? 435  LEU A CD2 1 
ATOM   3313  N  N   . TYR A  1  436 ? 15.099  -5.377  43.218   1.00 196.89 ? 436  TYR A N   1 
ATOM   3314  C  CA  . TYR A  1  436 ? 15.093  -5.745  44.630   1.00 198.55 ? 436  TYR A CA  1 
ATOM   3315  C  C   . TYR A  1  436 ? 16.114  -6.854  44.856   1.00 201.31 ? 436  TYR A C   1 
ATOM   3316  O  O   . TYR A  1  436 ? 16.045  -7.908  44.213   1.00 199.14 ? 436  TYR A O   1 
ATOM   3317  C  CB  . TYR A  1  436 ? 13.701  -6.194  45.076   1.00 194.13 ? 436  TYR A CB  1 
ATOM   3318  C  CG  . TYR A  1  436 ? 12.669  -5.087  45.096   1.00 192.21 ? 436  TYR A CG  1 
ATOM   3319  C  CD1 . TYR A  1  436 ? 12.559  -4.239  46.189   1.00 194.88 ? 436  TYR A CD1 1 
ATOM   3320  C  CD2 . TYR A  1  436 ? 11.821  -4.877  44.015   1.00 188.18 ? 436  TYR A CD2 1 
ATOM   3321  C  CE1 . TYR A  1  436 ? 11.623  -3.224  46.217   1.00 193.63 ? 436  TYR A CE1 1 
ATOM   3322  C  CE2 . TYR A  1  436 ? 10.881  -3.858  44.031   1.00 191.50 ? 436  TYR A CE2 1 
ATOM   3323  C  CZ  . TYR A  1  436 ? 10.787  -3.035  45.137   1.00 196.04 ? 436  TYR A CZ  1 
ATOM   3324  O  OH  . TYR A  1  436 ? 9.854   -2.020  45.167   1.00 194.45 ? 436  TYR A OH  1 
ATOM   3325  N  N   . ARG A  1  437 ? 17.043  -6.621  45.776   1.00 206.38 ? 437  ARG A N   1 
ATOM   3326  C  CA  . ARG A  1  437 ? 18.116  -7.559  46.068   1.00 210.01 ? 437  ARG A CA  1 
ATOM   3327  C  C   . ARG A  1  437 ? 17.763  -8.403  47.284   1.00 210.05 ? 437  ARG A C   1 
ATOM   3328  O  O   . ARG A  1  437 ? 17.279  -7.882  48.293   1.00 210.52 ? 437  ARG A O   1 
ATOM   3329  C  CB  . ARG A  1  437 ? 19.428  -6.817  46.314   1.00 216.21 ? 437  ARG A CB  1 
ATOM   3330  C  CG  . ARG A  1  437 ? 19.947  -6.066  45.109   1.00 217.06 ? 437  ARG A CG  1 
ATOM   3331  C  CD  . ARG A  1  437 ? 21.287  -5.442  45.424   1.00 223.73 ? 437  ARG A CD  1 
ATOM   3332  N  NE  . ARG A  1  437 ? 21.163  -4.331  46.365   1.00 230.93 ? 437  ARG A NE  1 
ATOM   3333  C  CZ  . ARG A  1  437 ? 22.055  -4.054  47.311   1.00 231.78 ? 437  ARG A CZ  1 
ATOM   3334  N  NH1 . ARG A  1  437 ? 23.125  -4.819  47.448   1.00 235.75 ? 437  ARG A NH1 1 
ATOM   3335  N  NH2 . ARG A  1  437 ? 21.874  -3.024  48.129   1.00 233.90 ? 437  ARG A NH2 1 
ATOM   3336  N  N   . ALA A  1  438 ? 18.014  -9.706  47.188   1.00 209.92 ? 438  ALA A N   1 
ATOM   3337  C  CA  . ALA A  1  438 ? 17.710  -10.611 48.286   1.00 210.20 ? 438  ALA A CA  1 
ATOM   3338  C  C   . ALA A  1  438 ? 18.754  -10.480 49.388   1.00 232.22 ? 438  ALA A C   1 
ATOM   3339  O  O   . ALA A  1  438 ? 19.954  -10.632 49.140   1.00 232.62 ? 438  ALA A O   1 
ATOM   3340  C  CB  . ALA A  1  438 ? 17.652  -12.052 47.783   1.00 208.45 ? 438  ALA A CB  1 
ATOM   3341  N  N   . ARG A  1  439 ? 18.293  -10.221 50.611   1.00 209.31 ? 439  ARG A N   1 
ATOM   3342  C  CA  . ARG A  1  439 ? 19.206  -10.134 51.740   1.00 213.35 ? 439  ARG A CA  1 
ATOM   3343  C  C   . ARG A  1  439 ? 19.527  -11.535 52.254   1.00 216.98 ? 439  ARG A C   1 
ATOM   3344  O  O   . ARG A  1  439 ? 18.655  -12.407 52.259   1.00 212.09 ? 439  ARG A O   1 
ATOM   3345  C  CB  . ARG A  1  439 ? 18.594  -9.298  52.865   1.00 214.98 ? 439  ARG A CB  1 
ATOM   3346  C  CG  . ARG A  1  439 ? 18.313  -7.859  52.474   1.00 216.83 ? 439  ARG A CG  1 
ATOM   3347  C  CD  . ARG A  1  439 ? 17.349  -7.179  53.438   1.00 219.04 ? 439  ARG A CD  1 
ATOM   3348  N  NE  . ARG A  1  439 ? 17.863  -7.107  54.804   1.00 220.78 ? 439  ARG A NE  1 
ATOM   3349  C  CZ  . ARG A  1  439 ? 17.168  -6.636  55.835   1.00 224.53 ? 439  ARG A CZ  1 
ATOM   3350  N  NH1 . ARG A  1  439 ? 15.930  -6.198  55.657   1.00 225.70 ? 439  ARG A NH1 1 
ATOM   3351  N  NH2 . ARG A  1  439 ? 17.708  -6.606  57.046   1.00 230.50 ? 439  ARG A NH2 1 
ATOM   3352  N  N   . PRO A  1  440 ? 20.765  -11.778 52.686   1.00 232.52 ? 440  PRO A N   1 
ATOM   3353  C  CA  . PRO A  1  440 ? 21.106  -13.096 53.233   1.00 234.37 ? 440  PRO A CA  1 
ATOM   3354  C  C   . PRO A  1  440 ? 20.283  -13.398 54.477   1.00 236.18 ? 440  PRO A C   1 
ATOM   3355  O  O   . PRO A  1  440 ? 19.955  -12.510 55.265   1.00 244.49 ? 440  PRO A O   1 
ATOM   3356  C  CB  . PRO A  1  440 ? 22.601  -12.972 53.560   1.00 233.84 ? 440  PRO A CB  1 
ATOM   3357  C  CG  . PRO A  1  440 ? 23.084  -11.833 52.712   1.00 228.15 ? 440  PRO A CG  1 
ATOM   3358  C  CD  . PRO A  1  440 ? 21.932  -10.881 52.628   1.00 227.95 ? 440  PRO A CD  1 
ATOM   3359  N  N   . VAL A  1  441 ? 19.948  -14.673 54.648   1.00 230.55 ? 441  VAL A N   1 
ATOM   3360  C  CA  . VAL A  1  441 ? 19.066  -15.118 55.723   1.00 230.51 ? 441  VAL A CA  1 
ATOM   3361  C  C   . VAL A  1  441 ? 19.910  -15.821 56.777   1.00 240.30 ? 441  VAL A C   1 
ATOM   3362  O  O   . VAL A  1  441 ? 20.581  -16.819 56.488   1.00 245.53 ? 441  VAL A O   1 
ATOM   3363  C  CB  . VAL A  1  441 ? 17.946  -16.029 55.202   1.00 226.24 ? 441  VAL A CB  1 
ATOM   3364  C  CG1 . VAL A  1  441 ? 17.041  -16.460 56.345   1.00 219.97 ? 441  VAL A CG1 1 
ATOM   3365  C  CG2 . VAL A  1  441 ? 17.138  -15.306 54.135   1.00 226.31 ? 441  VAL A CG2 1 
ATOM   3366  N  N   . ILE A  1  442 ? 19.891  -15.283 57.993   1.00 239.35 ? 442  ILE A N   1 
ATOM   3367  C  CA  . ILE A  1  442 ? 20.632  -15.825 59.125   1.00 231.15 ? 442  ILE A CA  1 
ATOM   3368  C  C   . ILE A  1  442 ? 19.673  -16.664 59.960   1.00 227.26 ? 442  ILE A C   1 
ATOM   3369  O  O   . ILE A  1  442 ? 18.630  -16.170 60.406   1.00 234.45 ? 442  ILE A O   1 
ATOM   3370  C  CB  . ILE A  1  442 ? 21.263  -14.706 59.968   1.00 224.01 ? 442  ILE A CB  1 
ATOM   3371  C  CG1 . ILE A  1  442 ? 21.989  -13.696 59.077   1.00 217.08 ? 442  ILE A CG1 1 
ATOM   3372  C  CG2 . ILE A  1  442 ? 22.224  -15.285 60.996   1.00 226.62 ? 442  ILE A CG2 1 
ATOM   3373  C  CD1 . ILE A  1  442 ? 23.160  -14.271 58.339   1.00 214.86 ? 442  ILE A CD1 1 
ATOM   3374  N  N   . THR A  1  443 ? 19.995  -17.941 60.140   1.00 217.54 ? 443  THR A N   1 
ATOM   3375  C  CA  . THR A  1  443 ? 19.268  -18.808 61.059   1.00 218.70 ? 443  THR A CA  1 
ATOM   3376  C  C   . THR A  1  443 ? 20.021  -18.842 62.387   1.00 233.71 ? 443  THR A C   1 
ATOM   3377  O  O   . THR A  1  443 ? 21.199  -19.214 62.429   1.00 245.37 ? 443  THR A O   1 
ATOM   3378  C  CB  . THR A  1  443 ? 19.113  -20.210 60.471   1.00 217.11 ? 443  THR A CB  1 
ATOM   3379  O  OG1 . THR A  1  443 ? 18.250  -20.153 59.327   1.00 214.67 ? 443  THR A OG1 1 
ATOM   3380  C  CG2 . THR A  1  443 ? 18.519  -21.159 61.493   1.00 221.94 ? 443  THR A CG2 1 
ATOM   3381  N  N   . VAL A  1  444 ? 19.346  -18.449 63.464   1.00 239.17 ? 444  VAL A N   1 
ATOM   3382  C  CA  . VAL A  1  444 ? 19.952  -18.348 64.789   1.00 236.44 ? 444  VAL A CA  1 
ATOM   3383  C  C   . VAL A  1  444 ? 19.295  -19.362 65.718   1.00 242.02 ? 444  VAL A C   1 
ATOM   3384  O  O   . VAL A  1  444 ? 18.062  -19.456 65.776   1.00 253.50 ? 444  VAL A O   1 
ATOM   3385  C  CB  . VAL A  1  444 ? 19.835  -16.918 65.345   1.00 235.37 ? 444  VAL A CB  1 
ATOM   3386  C  CG1 . VAL A  1  444 ? 18.414  -16.389 65.182   1.00 244.78 ? 444  VAL A CG1 1 
ATOM   3387  C  CG2 . VAL A  1  444 ? 20.252  -16.875 66.805   1.00 235.84 ? 444  VAL A CG2 1 
ATOM   3388  N  N   . ASN A  1  445 ? 20.119  -20.124 66.438   1.00 239.18 ? 445  ASN A N   1 
ATOM   3389  C  CA  . ASN A  1  445 ? 19.656  -21.049 67.473   1.00 248.71 ? 445  ASN A CA  1 
ATOM   3390  C  C   . ASN A  1  445 ? 20.185  -20.573 68.828   1.00 256.48 ? 445  ASN A C   1 
ATOM   3391  O  O   . ASN A  1  445 ? 21.382  -20.697 69.115   1.00 257.75 ? 445  ASN A O   1 
ATOM   3392  C  CB  . ASN A  1  445 ? 20.098  -22.479 67.166   1.00 249.84 ? 445  ASN A CB  1 
ATOM   3393  C  CG  . ASN A  1  445 ? 19.290  -23.117 66.044   1.00 239.78 ? 445  ASN A CG  1 
ATOM   3394  O  OD1 . ASN A  1  445 ? 19.852  -23.607 65.066   1.00 234.76 ? 445  ASN A OD1 1 
ATOM   3395  N  ND2 . ASN A  1  445 ? 17.966  -23.121 66.187   1.00 238.46 ? 445  ASN A ND2 1 
ATOM   3396  N  N   . ALA A  1  446 ? 19.303  -19.990 69.642   1.00 256.32 ? 446  ALA A N   1 
ATOM   3397  C  CA  . ALA A  1  446 ? 19.662  -19.513 70.969   1.00 255.72 ? 446  ALA A CA  1 
ATOM   3398  C  C   . ALA A  1  446 ? 19.249  -20.512 72.047   1.00 256.33 ? 446  ALA A C   1 
ATOM   3399  O  O   . ALA A  1  446 ? 18.204  -21.162 71.956   1.00 250.96 ? 446  ALA A O   1 
ATOM   3400  C  CB  . ALA A  1  446 ? 19.020  -18.153 71.251   1.00 248.16 ? 446  ALA A CB  1 
ATOM   3401  N  N   . GLY A  1  447 ? 20.081  -20.612 73.078   1.00 271.48 ? 447  GLY A N   1 
ATOM   3402  C  CA  . GLY A  1  447 ? 19.817  -21.502 74.193   1.00 281.60 ? 447  GLY A CA  1 
ATOM   3403  C  C   . GLY A  1  447 ? 19.912  -20.771 75.516   1.00 290.45 ? 447  GLY A C   1 
ATOM   3404  O  O   . GLY A  1  447 ? 20.583  -19.746 75.635   1.00 301.56 ? 447  GLY A O   1 
ATOM   3405  N  N   . LEU A  1  448 ? 19.224  -21.316 76.522   1.00 270.03 ? 448  LEU A N   1 
ATOM   3406  C  CA  . LEU A  1  448 ? 19.235  -20.703 77.852   1.00 256.04 ? 448  LEU A CA  1 
ATOM   3407  C  C   . LEU A  1  448 ? 19.036  -21.781 78.911   1.00 249.33 ? 448  LEU A C   1 
ATOM   3408  O  O   . LEU A  1  448 ? 17.987  -22.433 78.949   1.00 247.63 ? 448  LEU A O   1 
ATOM   3409  C  CB  . LEU A  1  448 ? 18.168  -19.616 77.969   1.00 249.57 ? 448  LEU A CB  1 
ATOM   3410  C  CG  . LEU A  1  448 ? 18.251  -18.782 79.251   1.00 248.24 ? 448  LEU A CG  1 
ATOM   3411  C  CD1 . LEU A  1  448 ? 19.615  -18.122 79.361   1.00 252.90 ? 448  LEU A CD1 1 
ATOM   3412  C  CD2 . LEU A  1  448 ? 17.146  -17.745 79.285   1.00 245.04 ? 448  LEU A CD2 1 
ATOM   3413  N  N   . GLU A  1  449 ? 20.050  -21.980 79.749   1.00 261.14 ? 449  GLU A N   1 
ATOM   3414  C  CA  . GLU A  1  449 ? 19.990  -22.901 80.875   1.00 265.57 ? 449  GLU A CA  1 
ATOM   3415  C  C   . GLU A  1  449 ? 20.091  -22.120 82.178   1.00 270.56 ? 449  GLU A C   1 
ATOM   3416  O  O   . GLU A  1  449 ? 20.923  -21.217 82.306   1.00 272.73 ? 449  GLU A O   1 
ATOM   3417  C  CB  . GLU A  1  449 ? 21.110  -23.943 80.809   1.00 267.09 ? 449  GLU A CB  1 
ATOM   3418  C  CG  . GLU A  1  449 ? 21.093  -24.793 79.556   1.00 271.58 ? 449  GLU A CG  1 
ATOM   3419  C  CD  . GLU A  1  449 ? 22.287  -25.716 79.469   1.00 272.69 ? 449  GLU A CD  1 
ATOM   3420  O  OE1 . GLU A  1  449 ? 22.603  -26.177 78.351   1.00 281.40 ? 449  GLU A OE1 1 
ATOM   3421  O  OE2 . GLU A  1  449 ? 22.913  -25.973 80.519   1.00 260.08 ? 449  GLU A OE2 1 
ATOM   3422  N  N   . VAL A  1  450 ? 19.249  -22.478 83.144   1.00 264.54 ? 450  VAL A N   1 
ATOM   3423  C  CA  . VAL A  1  450 ? 19.260  -21.880 84.475   1.00 260.96 ? 450  VAL A CA  1 
ATOM   3424  C  C   . VAL A  1  450 ? 19.385  -23.010 85.489   1.00 267.23 ? 450  VAL A C   1 
ATOM   3425  O  O   . VAL A  1  450 ? 18.418  -23.744 85.729   1.00 261.51 ? 450  VAL A O   1 
ATOM   3426  C  CB  . VAL A  1  450 ? 18.006  -21.039 84.749   1.00 256.11 ? 450  VAL A CB  1 
ATOM   3427  C  CG1 . VAL A  1  450 ? 18.051  -20.471 86.161   1.00 261.29 ? 450  VAL A CG1 1 
ATOM   3428  C  CG2 . VAL A  1  450 ? 17.882  -19.921 83.725   1.00 252.95 ? 450  VAL A CG2 1 
ATOM   3429  N  N   . TYR A  1  451 ? 20.568  -23.152 86.080   1.00 278.51 ? 451  TYR A N   1 
ATOM   3430  C  CA  . TYR A  1  451 ? 20.809  -24.172 87.098   1.00 282.44 ? 451  TYR A CA  1 
ATOM   3431  C  C   . TYR A  1  451 ? 21.482  -23.546 88.322   1.00 294.61 ? 451  TYR A C   1 
ATOM   3432  O  O   . TYR A  1  451 ? 22.514  -22.889 88.195   1.00 306.79 ? 451  TYR A O   1 
ATOM   3433  C  CB  . TYR A  1  451 ? 21.660  -25.321 86.534   1.00 273.12 ? 451  TYR A CB  1 
ATOM   3434  C  CG  . TYR A  1  451 ? 22.870  -24.893 85.724   1.00 267.21 ? 451  TYR A CG  1 
ATOM   3435  C  CD1 . TYR A  1  451 ? 22.775  -24.680 84.355   1.00 266.99 ? 451  TYR A CD1 1 
ATOM   3436  C  CD2 . TYR A  1  451 ? 24.111  -24.726 86.327   1.00 267.19 ? 451  TYR A CD2 1 
ATOM   3437  C  CE1 . TYR A  1  451 ? 23.876  -24.294 83.614   1.00 268.63 ? 451  TYR A CE1 1 
ATOM   3438  C  CE2 . TYR A  1  451 ? 25.216  -24.341 85.595   1.00 266.47 ? 451  TYR A CE2 1 
ATOM   3439  C  CZ  . TYR A  1  451 ? 25.094  -24.127 84.240   1.00 270.25 ? 451  TYR A CZ  1 
ATOM   3440  O  OH  . TYR A  1  451 ? 26.196  -23.746 83.511   1.00 275.50 ? 451  TYR A OH  1 
ATOM   3441  N  N   . PRO A  1  452 ? 20.905  -23.755 89.519   1.00 278.84 ? 452  PRO A N   1 
ATOM   3442  C  CA  . PRO A  1  452 ? 19.690  -24.535 89.780   1.00 271.53 ? 452  PRO A CA  1 
ATOM   3443  C  C   . PRO A  1  452 ? 18.387  -23.828 89.421   1.00 264.53 ? 452  PRO A C   1 
ATOM   3444  O  O   . PRO A  1  452 ? 18.342  -22.604 89.288   1.00 254.89 ? 452  PRO A O   1 
ATOM   3445  C  CB  . PRO A  1  452 ? 19.751  -24.765 91.290   1.00 261.51 ? 452  PRO A CB  1 
ATOM   3446  C  CG  . PRO A  1  452 ? 20.448  -23.558 91.802   1.00 263.25 ? 452  PRO A CG  1 
ATOM   3447  C  CD  . PRO A  1  452 ? 21.473  -23.200 90.762   1.00 270.58 ? 452  PRO A CD  1 
ATOM   3448  N  N   . SER A  1  453 ? 17.323  -24.627 89.281   1.00 269.66 ? 453  SER A N   1 
ATOM   3449  C  CA  . SER A  1  453 ? 15.987  -24.078 89.091   1.00 254.80 ? 453  SER A CA  1 
ATOM   3450  C  C   . SER A  1  453 ? 15.443  -23.496 90.386   1.00 255.56 ? 453  SER A C   1 
ATOM   3451  O  O   . SER A  1  453 ? 14.692  -22.515 90.360   1.00 245.00 ? 453  SER A O   1 
ATOM   3452  C  CB  . SER A  1  453 ? 15.041  -25.158 88.557   1.00 245.04 ? 453  SER A CB  1 
ATOM   3453  O  OG  . SER A  1  453 ? 14.988  -26.283 89.418   1.00 241.16 ? 453  SER A OG  1 
ATOM   3454  N  N   . ILE A  1  454 ? 15.793  -24.095 91.518   1.00 269.65 ? 454  ILE A N   1 
ATOM   3455  C  CA  . ILE A  1  454 ? 15.248  -23.720 92.816   1.00 269.63 ? 454  ILE A CA  1 
ATOM   3456  C  C   . ILE A  1  454 ? 16.349  -23.001 93.581   1.00 269.35 ? 454  ILE A C   1 
ATOM   3457  O  O   . ILE A  1  454 ? 17.373  -23.600 93.933   1.00 271.57 ? 454  ILE A O   1 
ATOM   3458  C  CB  . ILE A  1  454 ? 14.725  -24.937 93.593   1.00 267.83 ? 454  ILE A CB  1 
ATOM   3459  C  CG1 . ILE A  1  454 ? 15.687  -26.120 93.468   1.00 264.13 ? 454  ILE A CG1 1 
ATOM   3460  C  CG2 . ILE A  1  454 ? 13.354  -25.336 93.086   1.00 261.17 ? 454  ILE A CG2 1 
ATOM   3461  C  CD1 . ILE A  1  454 ? 15.221  -27.364 94.184   1.00 254.01 ? 454  ILE A CD1 1 
ATOM   3462  N  N   . LEU A  1  455 ? 16.152  -21.709 93.822   1.00 274.21 ? 455  LEU A N   1 
ATOM   3463  C  CA  . LEU A  1  455 ? 17.117  -20.908 94.564   1.00 282.55 ? 455  LEU A CA  1 
ATOM   3464  C  C   . LEU A  1  455 ? 16.755  -20.900 96.046   1.00 281.31 ? 455  LEU A C   1 
ATOM   3465  O  O   . LEU A  1  455 ? 15.659  -20.466 96.424   1.00 287.87 ? 455  LEU A O   1 
ATOM   3466  C  CB  . LEU A  1  455 ? 17.178  -19.486 94.006   1.00 281.49 ? 455  LEU A CB  1 
ATOM   3467  C  CG  . LEU A  1  455 ? 17.442  -19.364 92.499   1.00 275.50 ? 455  LEU A CG  1 
ATOM   3468  C  CD1 . LEU A  1  455 ? 17.482  -17.902 92.081   1.00 278.62 ? 455  LEU A CD1 1 
ATOM   3469  C  CD2 . LEU A  1  455 ? 18.726  -20.073 92.098   1.00 272.43 ? 455  LEU A CD2 1 
ATOM   3470  N  N   . ASN A  1  456 ? 17.665  -21.402 96.876   1.00 267.52 ? 456  ASN A N   1 
ATOM   3471  C  CA  . ASN A  1  456 ? 17.468  -21.371 98.314   1.00 254.62 ? 456  ASN A CA  1 
ATOM   3472  C  C   . ASN A  1  456 ? 17.496  -19.926 98.800   1.00 261.26 ? 456  ASN A C   1 
ATOM   3473  O  O   . ASN A  1  456 ? 18.087  -19.045 98.170   1.00 259.32 ? 456  ASN A O   1 
ATOM   3474  C  CB  . ASN A  1  456 ? 18.553  -22.194 99.014   1.00 250.01 ? 456  ASN A CB  1 
ATOM   3475  C  CG  . ASN A  1  456 ? 18.286  -22.384 100.496  1.00 254.43 ? 456  ASN A CG  1 
ATOM   3476  O  OD1 . ASN A  1  456 ? 18.743  -21.602 101.329  1.00 270.01 ? 456  ASN A OD1 1 
ATOM   3477  N  ND2 . ASN A  1  456 ? 17.556  -23.440 100.831  1.00 247.17 ? 456  ASN A ND2 1 
ATOM   3478  N  N   . GLN A  1  457 ? 16.855  -19.684 99.945   1.00 277.22 ? 457  GLN A N   1 
ATOM   3479  C  CA  . GLN A  1  457 ? 16.857  -18.337 100.500  1.00 280.53 ? 457  GLN A CA  1 
ATOM   3480  C  C   . GLN A  1  457 ? 18.205  -17.979 101.112  1.00 279.18 ? 457  GLN A C   1 
ATOM   3481  O  O   . GLN A  1  457 ? 18.485  -16.795 101.332  1.00 281.14 ? 457  GLN A O   1 
ATOM   3482  C  CB  . GLN A  1  457 ? 15.738  -18.192 101.540  1.00 278.76 ? 457  GLN A CB  1 
ATOM   3483  C  CG  . GLN A  1  457 ? 15.579  -16.781 102.083  1.00 271.06 ? 457  GLN A CG  1 
ATOM   3484  C  CD  . GLN A  1  457 ? 15.485  -15.753 100.974  1.00 259.12 ? 457  GLN A CD  1 
ATOM   3485  O  OE1 . GLN A  1  457 ? 14.628  -15.850 100.097  1.00 255.70 ? 457  GLN A OE1 1 
ATOM   3486  N  NE2 . GLN A  1  457 ? 16.389  -14.779 100.987  1.00 258.40 ? 457  GLN A NE2 1 
ATOM   3487  N  N   . ASP A  1  458 ? 19.058  -18.974 101.359  1.00 260.13 ? 458  ASP A N   1 
ATOM   3488  C  CA  . ASP A  1  458 ? 20.379  -18.731 101.943  1.00 244.54 ? 458  ASP A CA  1 
ATOM   3489  C  C   . ASP A  1  458 ? 21.309  -19.856 101.481  1.00 240.19 ? 458  ASP A C   1 
ATOM   3490  O  O   . ASP A  1  458 ? 21.464  -20.870 102.164  1.00 238.87 ? 458  ASP A O   1 
ATOM   3491  C  CB  . ASP A  1  458 ? 20.308  -18.644 103.460  1.00 240.85 ? 458  ASP A CB  1 
ATOM   3492  C  CG  . ASP A  1  458 ? 21.651  -18.334 104.086  1.00 240.22 ? 458  ASP A CG  1 
ATOM   3493  O  OD1 . ASP A  1  458 ? 22.032  -17.145 104.125  1.00 241.49 ? 458  ASP A OD1 1 
ATOM   3494  O  OD2 . ASP A  1  458 ? 22.327  -19.279 104.536  1.00 240.25 ? 458  ASP A OD2 1 
ATOM   3495  N  N   . ASN A  1  459 ? 21.910  -19.668 100.307  1.00 245.82 ? 459  ASN A N   1 
ATOM   3496  C  CA  . ASN A  1  459 ? 22.867  -20.620 99.741   1.00 254.80 ? 459  ASN A CA  1 
ATOM   3497  C  C   . ASN A  1  459 ? 24.087  -19.819 99.298   1.00 260.32 ? 459  ASN A C   1 
ATOM   3498  O  O   . ASN A  1  459 ? 24.196  -19.423 98.136   1.00 263.90 ? 459  ASN A O   1 
ATOM   3499  C  CB  . ASN A  1  459 ? 22.267  -21.409 98.585   1.00 263.66 ? 459  ASN A CB  1 
ATOM   3500  C  CG  . ASN A  1  459 ? 23.287  -22.303 97.910   1.00 283.41 ? 459  ASN A CG  1 
ATOM   3501  O  OD1 . ASN A  1  459 ? 24.265  -22.721 98.532   1.00 259.50 ? 459  ASN A OD1 1 
ATOM   3502  N  ND2 . ASN A  1  459 ? 23.077  -22.587 96.628   1.00 381.85 ? 459  ASN A ND2 1 
ATOM   3503  N  N   . LYS A  1  460 ? 25.020  -19.617 100.220  1.00 265.30 ? 460  LYS A N   1 
ATOM   3504  C  CA  . LYS A  1  460 ? 26.215  -18.826 99.967   1.00 264.99 ? 460  LYS A CA  1 
ATOM   3505  C  C   . LYS A  1  460 ? 27.320  -19.733 99.435   1.00 261.93 ? 460  LYS A C   1 
ATOM   3506  O  O   . LYS A  1  460 ? 27.779  -20.638 100.141  1.00 266.04 ? 460  LYS A O   1 
ATOM   3507  C  CB  . LYS A  1  460 ? 26.641  -18.116 101.251  1.00 273.90 ? 460  LYS A CB  1 
ATOM   3508  C  CG  . LYS A  1  460 ? 25.599  -17.121 101.753  1.00 267.16 ? 460  LYS A CG  1 
ATOM   3509  C  CD  . LYS A  1  460 ? 25.856  -16.677 103.190  1.00 262.00 ? 460  LYS A CD  1 
ATOM   3510  C  CE  . LYS A  1  460 ? 25.752  -17.834 104.180  1.00 253.77 ? 460  LYS A CE  1 
ATOM   3511  N  NZ  . LYS A  1  460 ? 25.865  -17.363 105.593  1.00 250.90 ? 460  LYS A NZ  1 
ATOM   3512  N  N   . THR A  1  461 ? 27.749  -19.494 98.193   1.00 264.14 ? 461  THR A N   1 
ATOM   3513  C  CA  . THR A  1  461 ? 28.728  -20.379 97.569   1.00 263.80 ? 461  THR A CA  1 
ATOM   3514  C  C   . THR A  1  461 ? 29.799  -19.634 96.776   1.00 264.58 ? 461  THR A C   1 
ATOM   3515  O  O   . THR A  1  461 ? 30.994  -19.779 97.059   1.00 267.05 ? 461  THR A O   1 
ATOM   3516  C  CB  . THR A  1  461 ? 28.016  -21.379 96.659   1.00 270.88 ? 461  THR A CB  1 
ATOM   3517  O  OG1 . THR A  1  461 ? 27.034  -22.100 97.412   1.00 270.96 ? 461  THR A OG1 1 
ATOM   3518  C  CG2 . THR A  1  461 ? 29.015  -22.358 96.057   1.00 277.99 ? 461  THR A CG2 1 
ATOM   3519  N  N   . CYS A  1  462 ? 29.390  -18.843 95.782   1.00 271.98 ? 462  CYS A N   1 
ATOM   3520  C  CA  . CYS A  1  462 ? 30.353  -18.075 95.002   1.00 284.11 ? 462  CYS A CA  1 
ATOM   3521  C  C   . CYS A  1  462 ? 31.110  -17.099 95.895   1.00 270.24 ? 462  CYS A C   1 
ATOM   3522  O  O   . CYS A  1  462 ? 30.576  -16.567 96.871   1.00 270.20 ? 462  CYS A O   1 
ATOM   3523  C  CB  . CYS A  1  462 ? 29.658  -17.310 93.876   1.00 301.13 ? 462  CYS A CB  1 
ATOM   3524  S  SG  . CYS A  1  462 ? 28.312  -16.282 94.460   1.00 327.69 ? 462  CYS A SG  1 
ATOM   3525  N  N   . SER A  1  463 ? 32.366  -16.851 95.536   1.00 265.81 ? 463  SER A N   1 
ATOM   3526  C  CA  . SER A  1  463 ? 33.223  -15.999 96.347   1.00 271.16 ? 463  SER A CA  1 
ATOM   3527  C  C   . SER A  1  463 ? 32.754  -14.544 96.334   1.00 270.40 ? 463  SER A C   1 
ATOM   3528  O  O   . SER A  1  463 ? 32.409  -13.986 95.287   1.00 264.94 ? 463  SER A O   1 
ATOM   3529  C  CB  . SER A  1  463 ? 34.667  -16.091 95.855   1.00 272.01 ? 463  SER A CB  1 
ATOM   3530  O  OG  . SER A  1  463 ? 35.552  -15.443 96.750   1.00 284.66 ? 463  SER A OG  1 
ATOM   3531  N  N   . LEU A  1  464 ? 32.739  -13.940 97.524   1.00 265.63 ? 464  LEU A N   1 
ATOM   3532  C  CA  . LEU A  1  464 ? 32.378  -12.551 97.783   1.00 253.36 ? 464  LEU A CA  1 
ATOM   3533  C  C   . LEU A  1  464 ? 32.847  -12.235 99.202   1.00 256.46 ? 464  LEU A C   1 
ATOM   3534  O  O   . LEU A  1  464 ? 32.912  -13.147 100.037  1.00 254.75 ? 464  LEU A O   1 
ATOM   3535  C  CB  . LEU A  1  464 ? 30.869  -12.345 97.620   1.00 236.26 ? 464  LEU A CB  1 
ATOM   3536  C  CG  . LEU A  1  464 ? 30.277  -10.938 97.720   1.00 237.31 ? 464  LEU A CG  1 
ATOM   3537  C  CD1 . LEU A  1  464 ? 30.609  -10.113 96.483   1.00 237.12 ? 464  LEU A CD1 1 
ATOM   3538  C  CD2 . LEU A  1  464 ? 28.778  -11.008 97.931   1.00 236.78 ? 464  LEU A CD2 1 
ATOM   3539  N  N   . PRO A  1  465 ? 33.194  -10.976 99.530   1.00 252.33 ? 465  PRO A N   1 
ATOM   3540  C  CA  . PRO A  1  465 ? 33.578  -10.733 100.927  1.00 243.25 ? 465  PRO A CA  1 
ATOM   3541  C  C   . PRO A  1  465 ? 32.419  -10.893 101.909  1.00 243.85 ? 465  PRO A C   1 
ATOM   3542  O  O   . PRO A  1  465 ? 31.891  -9.895  102.398  1.00 245.06 ? 465  PRO A O   1 
ATOM   3543  C  CB  . PRO A  1  465 ? 34.082  -9.283  100.909  1.00 245.92 ? 465  PRO A CB  1 
ATOM   3544  C  CG  . PRO A  1  465 ? 33.511  -8.682  99.670   1.00 246.54 ? 465  PRO A CG  1 
ATOM   3545  C  CD  . PRO A  1  465 ? 33.457  -9.805  98.678   1.00 249.49 ? 465  PRO A CD  1 
ATOM   3546  N  N   . LYS A  1  470 ? 30.007  -13.873 100.538  1.00 269.87 ? 470  LYS A N   1 
ATOM   3547  C  CA  . LYS A  1  470 ? 29.202  -14.960 99.991   1.00 263.26 ? 470  LYS A CA  1 
ATOM   3548  C  C   . LYS A  1  470 ? 27.715  -14.682 100.185  1.00 259.51 ? 470  LYS A C   1 
ATOM   3549  O  O   . LYS A  1  470 ? 27.260  -14.428 101.300  1.00 261.83 ? 470  LYS A O   1 
ATOM   3550  C  CB  . LYS A  1  470 ? 29.569  -16.304 100.639  1.00 262.91 ? 470  LYS A CB  1 
ATOM   3551  C  CG  . LYS A  1  470 ? 30.823  -17.004 100.103  1.00 261.61 ? 470  LYS A CG  1 
ATOM   3552  C  CD  . LYS A  1  470 ? 32.083  -16.171 100.241  1.00 261.46 ? 470  LYS A CD  1 
ATOM   3553  C  CE  . LYS A  1  470 ? 32.512  -16.074 101.692  1.00 254.61 ? 470  LYS A CE  1 
ATOM   3554  N  NZ  . LYS A  1  470 ? 33.751  -15.267 101.864  1.00 248.87 ? 470  LYS A NZ  1 
ATOM   3555  N  N   . VAL A  1  471 ? 26.958  -14.716 99.087   1.00 254.15 ? 471  VAL A N   1 
ATOM   3556  C  CA  . VAL A  1  471 ? 25.512  -14.537 99.118   1.00 253.74 ? 471  VAL A CA  1 
ATOM   3557  C  C   . VAL A  1  471 ? 24.874  -15.564 98.190   1.00 262.50 ? 471  VAL A C   1 
ATOM   3558  O  O   . VAL A  1  471 ? 25.534  -16.160 97.337   1.00 269.57 ? 471  VAL A O   1 
ATOM   3559  C  CB  . VAL A  1  471 ? 25.087  -13.109 98.715   1.00 255.85 ? 471  VAL A CB  1 
ATOM   3560  C  CG1 . VAL A  1  471 ? 25.556  -12.095 99.755   1.00 253.75 ? 471  VAL A CG1 1 
ATOM   3561  C  CG2 . VAL A  1  471 ? 25.640  -12.770 97.343   1.00 268.25 ? 471  VAL A CG2 1 
ATOM   3562  N  N   . SER A  1  472 ? 23.571  -15.780 98.381   1.00 262.35 ? 472  SER A N   1 
ATOM   3563  C  CA  . SER A  1  472 ? 22.800  -16.713 97.561   1.00 255.68 ? 472  SER A CA  1 
ATOM   3564  C  C   . SER A  1  472 ? 22.910  -16.430 96.063   1.00 254.60 ? 472  SER A C   1 
ATOM   3565  O  O   . SER A  1  472 ? 22.255  -15.516 95.552   1.00 248.89 ? 472  SER A O   1 
ATOM   3566  C  CB  . SER A  1  472 ? 21.332  -16.681 97.985   1.00 249.58 ? 472  SER A CB  1 
ATOM   3567  O  OG  . SER A  1  472 ? 20.572  -17.619 97.247   1.00 247.38 ? 472  SER A OG  1 
ATOM   3568  N  N   . CYS A  1  473 ? 23.718  -17.220 95.349   1.00 270.21 ? 473  CYS A N   1 
ATOM   3569  C  CA  . CYS A  1  473 ? 24.013  -16.986 93.940   1.00 278.59 ? 473  CYS A CA  1 
ATOM   3570  C  C   . CYS A  1  473 ? 23.811  -18.247 93.106   1.00 273.70 ? 473  CYS A C   1 
ATOM   3571  O  O   . CYS A  1  473 ? 23.743  -19.363 93.628   1.00 265.65 ? 473  CYS A O   1 
ATOM   3572  C  CB  . CYS A  1  473 ? 25.438  -16.464 93.747   1.00 288.65 ? 473  CYS A CB  1 
ATOM   3573  S  SG  . CYS A  1  473 ? 26.709  -17.518 94.428   1.00 318.14 ? 473  CYS A SG  1 
ATOM   3574  N  N   . PHE A  1  474 ? 23.744  -18.044 91.787   1.00 283.83 ? 474  PHE A N   1 
ATOM   3575  C  CA  . PHE A  1  474 ? 23.496  -19.107 90.820   1.00 290.31 ? 474  PHE A CA  1 
ATOM   3576  C  C   . PHE A  1  474 ? 24.198  -18.774 89.507   1.00 297.13 ? 474  PHE A C   1 
ATOM   3577  O  O   . PHE A  1  474 ? 24.588  -17.629 89.262   1.00 298.11 ? 474  PHE A O   1 
ATOM   3578  C  CB  . PHE A  1  474 ? 21.988  -19.306 90.603   1.00 287.21 ? 474  PHE A CB  1 
ATOM   3579  C  CG  . PHE A  1  474 ? 21.279  -18.061 90.149   1.00 282.03 ? 474  PHE A CG  1 
ATOM   3580  C  CD1 . PHE A  1  474 ? 20.843  -17.124 91.073   1.00 280.50 ? 474  PHE A CD1 1 
ATOM   3581  C  CD2 . PHE A  1  474 ? 21.038  -17.830 88.807   1.00 279.70 ? 474  PHE A CD2 1 
ATOM   3582  C  CE1 . PHE A  1  474 ? 20.193  -15.975 90.665   1.00 279.45 ? 474  PHE A CE1 1 
ATOM   3583  C  CE2 . PHE A  1  474 ? 20.384  -16.685 88.392   1.00 275.54 ? 474  PHE A CE2 1 
ATOM   3584  C  CZ  . PHE A  1  474 ? 19.961  -15.756 89.322   1.00 279.39 ? 474  PHE A CZ  1 
ATOM   3585  N  N   . ASN A  1  475 ? 24.370  -19.797 88.668   1.00 302.40 ? 475  ASN A N   1 
ATOM   3586  C  CA  . ASN A  1  475 ? 25.074  -19.680 87.394   1.00 299.66 ? 475  ASN A CA  1 
ATOM   3587  C  C   . ASN A  1  475 ? 24.092  -19.493 86.244   1.00 298.09 ? 475  ASN A C   1 
ATOM   3588  O  O   . ASN A  1  475 ? 23.110  -20.234 86.133   1.00 304.86 ? 475  ASN A O   1 
ATOM   3589  C  CB  . ASN A  1  475 ? 25.936  -20.918 87.139   1.00 300.45 ? 475  ASN A CB  1 
ATOM   3590  C  CG  . ASN A  1  475 ? 26.998  -21.113 88.199   1.00 307.50 ? 475  ASN A CG  1 
ATOM   3591  O  OD1 . ASN A  1  475 ? 26.763  -21.772 89.210   1.00 312.78 ? 475  ASN A OD1 1 
ATOM   3592  N  ND2 . ASN A  1  475 ? 28.177  -20.542 87.971   1.00 307.52 ? 475  ASN A ND2 1 
ATOM   3593  N  N   . VAL A  1  476 ? 24.365  -18.511 85.387   1.00 297.71 ? 476  VAL A N   1 
ATOM   3594  C  CA  . VAL A  1  476 ? 23.575  -18.256 84.184   1.00 295.10 ? 476  VAL A CA  1 
ATOM   3595  C  C   . VAL A  1  476 ? 24.436  -18.605 82.975   1.00 296.91 ? 476  VAL A C   1 
ATOM   3596  O  O   . VAL A  1  476 ? 25.411  -17.906 82.675   1.00 295.75 ? 476  VAL A O   1 
ATOM   3597  C  CB  . VAL A  1  476 ? 23.088  -16.805 84.120   1.00 296.51 ? 476  VAL A CB  1 
ATOM   3598  C  CG1 . VAL A  1  476 ? 22.265  -16.586 82.861   1.00 298.52 ? 476  VAL A CG1 1 
ATOM   3599  C  CG2 . VAL A  1  476 ? 22.278  -16.464 85.361   1.00 295.76 ? 476  VAL A CG2 1 
ATOM   3600  N  N   . ARG A  1  477 ? 24.096  -19.692 82.284   1.00 302.91 ? 477  ARG A N   1 
ATOM   3601  C  CA  . ARG A  1  477 ? 24.827  -20.129 81.098   1.00 301.38 ? 477  ARG A CA  1 
ATOM   3602  C  C   . ARG A  1  477 ? 23.938  -19.975 79.868   1.00 296.59 ? 477  ARG A C   1 
ATOM   3603  O  O   . ARG A  1  477 ? 22.879  -20.606 79.782   1.00 294.18 ? 477  ARG A O   1 
ATOM   3604  C  CB  . ARG A  1  477 ? 25.301  -21.575 81.251   1.00 300.53 ? 477  ARG A CB  1 
ATOM   3605  C  CG  . ARG A  1  477 ? 26.166  -22.077 80.097   1.00 299.50 ? 477  ARG A CG  1 
ATOM   3606  C  CD  . ARG A  1  477 ? 26.776  -23.441 80.399   1.00 300.97 ? 477  ARG A CD  1 
ATOM   3607  N  NE  . ARG A  1  477 ? 27.630  -23.924 79.317   1.00 306.05 ? 477  ARG A NE  1 
ATOM   3608  C  CZ  . ARG A  1  477 ? 27.215  -24.724 78.339   1.00 308.16 ? 477  ARG A CZ  1 
ATOM   3609  N  NH1 . ARG A  1  477 ? 25.954  -25.135 78.308   1.00 309.04 ? 477  ARG A NH1 1 
ATOM   3610  N  NH2 . ARG A  1  477 ? 28.060  -25.117 77.394   1.00 306.77 ? 477  ARG A NH2 1 
ATOM   3611  N  N   . PHE A  1  478 ? 24.371  -19.140 78.923   1.00 302.55 ? 478  PHE A N   1 
ATOM   3612  C  CA  . PHE A  1  478 ? 23.654  -18.893 77.677   1.00 303.42 ? 478  PHE A CA  1 
ATOM   3613  C  C   . PHE A  1  478 ? 24.560  -19.226 76.498   1.00 303.55 ? 478  PHE A C   1 
ATOM   3614  O  O   . PHE A  1  478 ? 25.717  -18.793 76.461   1.00 309.56 ? 478  PHE A O   1 
ATOM   3615  C  CB  . PHE A  1  478 ? 23.189  -17.433 77.592   1.00 307.59 ? 478  PHE A CB  1 
ATOM   3616  C  CG  . PHE A  1  478 ? 24.313  -16.432 77.649   1.00 312.77 ? 478  PHE A CG  1 
ATOM   3617  C  CD1 . PHE A  1  478 ? 24.845  -16.034 78.865   1.00 312.12 ? 478  PHE A CD1 1 
ATOM   3618  C  CD2 . PHE A  1  478 ? 24.838  -15.893 76.484   1.00 316.33 ? 478  PHE A CD2 1 
ATOM   3619  C  CE1 . PHE A  1  478 ? 25.882  -15.120 78.919   1.00 314.85 ? 478  PHE A CE1 1 
ATOM   3620  C  CE2 . PHE A  1  478 ? 25.874  -14.981 76.531   1.00 320.39 ? 478  PHE A CE2 1 
ATOM   3621  C  CZ  . PHE A  1  478 ? 26.396  -14.593 77.750   1.00 318.97 ? 478  PHE A CZ  1 
ATOM   3622  N  N   . CYS A  1  479 ? 24.039  -19.989 75.539   1.00 293.53 ? 479  CYS A N   1 
ATOM   3623  C  CA  . CYS A  1  479 ? 24.790  -20.386 74.357   1.00 292.29 ? 479  CYS A CA  1 
ATOM   3624  C  C   . CYS A  1  479 ? 24.199  -19.726 73.117   1.00 280.72 ? 479  CYS A C   1 
ATOM   3625  O  O   . CYS A  1  479 ? 22.999  -19.445 73.058   1.00 267.84 ? 479  CYS A O   1 
ATOM   3626  C  CB  . CYS A  1  479 ? 24.787  -21.904 74.174   1.00 290.39 ? 479  CYS A CB  1 
ATOM   3627  S  SG  . CYS A  1  479 ? 25.541  -22.877 75.511   1.00 300.46 ? 479  CYS A SG  1 
ATOM   3628  N  N   . LEU A  1  480 ? 25.048  -19.499 72.115   1.00 282.71 ? 480  LEU A N   1 
ATOM   3629  C  CA  . LEU A  1  480 ? 24.655  -18.770 70.917   1.00 268.56 ? 480  LEU A CA  1 
ATOM   3630  C  C   . LEU A  1  480 ? 25.325  -19.368 69.689   1.00 258.76 ? 480  LEU A C   1 
ATOM   3631  O  O   . LEU A  1  480 ? 26.543  -19.574 69.679   1.00 265.00 ? 480  LEU A O   1 
ATOM   3632  C  CB  . LEU A  1  480 ? 25.017  -17.286 71.039   1.00 278.33 ? 480  LEU A CB  1 
ATOM   3633  C  CG  . LEU A  1  480 ? 24.225  -16.334 70.145   1.00 268.33 ? 480  LEU A CG  1 
ATOM   3634  C  CD1 . LEU A  1  480 ? 22.740  -16.554 70.346   1.00 259.25 ? 480  LEU A CD1 1 
ATOM   3635  C  CD2 . LEU A  1  480 ? 24.603  -14.887 70.418   1.00 275.92 ? 480  LEU A CD2 1 
ATOM   3636  N  N   . LYS A  1  481 ? 24.529  -19.651 68.660   1.00 253.28 ? 481  LYS A N   1 
ATOM   3637  C  CA  . LYS A  1  481 ? 25.028  -20.224 67.418   1.00 272.24 ? 481  LYS A CA  1 
ATOM   3638  C  C   . LYS A  1  481 ? 24.235  -19.658 66.247   1.00 282.66 ? 481  LYS A C   1 
ATOM   3639  O  O   . LYS A  1  481 ? 23.010  -19.527 66.328   1.00 278.87 ? 481  LYS A O   1 
ATOM   3640  C  CB  . LYS A  1  481 ? 24.932  -21.754 67.434   1.00 279.74 ? 481  LYS A CB  1 
ATOM   3641  C  CG  . LYS A  1  481 ? 25.548  -22.435 66.223   1.00 291.44 ? 481  LYS A CG  1 
ATOM   3642  C  CD  . LYS A  1  481 ? 25.518  -23.943 66.383   1.00 295.17 ? 481  LYS A CD  1 
ATOM   3643  C  CE  . LYS A  1  481 ? 24.097  -24.479 66.249   1.00 288.92 ? 481  LYS A CE  1 
ATOM   3644  N  NZ  . LYS A  1  481 ? 23.505  -24.211 64.902   1.00 274.60 ? 481  LYS A NZ  1 
ATOM   3645  N  N   . ALA A  1  482 ? 24.938  -19.312 65.167   1.00 275.52 ? 482  ALA A N   1 
ATOM   3646  C  CA  . ALA A  1  482 ? 24.318  -18.715 63.992   1.00 252.04 ? 482  ALA A CA  1 
ATOM   3647  C  C   . ALA A  1  482 ? 24.947  -19.285 62.727   1.00 241.63 ? 482  ALA A C   1 
ATOM   3648  O  O   . ALA A  1  482 ? 26.058  -19.821 62.745   1.00 248.06 ? 482  ALA A O   1 
ATOM   3649  C  CB  . ALA A  1  482 ? 24.440  -17.185 64.000   1.00 249.65 ? 482  ALA A CB  1 
ATOM   3650  N  N   . ASP A  1  483 ? 24.207  -19.180 61.624   1.00 231.01 ? 483  ASP A N   1 
ATOM   3651  C  CA  . ASP A  1  483 ? 24.697  -19.635 60.330   1.00 234.27 ? 483  ASP A CA  1 
ATOM   3652  C  C   . ASP A  1  483 ? 23.856  -19.019 59.220   1.00 238.16 ? 483  ASP A C   1 
ATOM   3653  O  O   . ASP A  1  483 ? 22.748  -18.526 59.450   1.00 245.39 ? 483  ASP A O   1 
ATOM   3654  C  CB  . ASP A  1  483 ? 24.684  -21.164 60.230   1.00 233.84 ? 483  ASP A CB  1 
ATOM   3655  C  CG  . ASP A  1  483 ? 25.556  -21.679 59.101   1.00 228.79 ? 483  ASP A CG  1 
ATOM   3656  O  OD1 . ASP A  1  483 ? 26.619  -21.074 58.843   1.00 220.93 ? 483  ASP A OD1 1 
ATOM   3657  O  OD2 . ASP A  1  483 ? 25.176  -22.688 58.471   1.00 234.82 ? 483  ASP A OD2 1 
ATOM   3658  N  N   . GLY A  1  484 ? 24.409  -19.057 58.008   1.00 238.37 ? 484  GLY A N   1 
ATOM   3659  C  CA  . GLY A  1  484 ? 23.730  -18.557 56.831   1.00 229.17 ? 484  GLY A CA  1 
ATOM   3660  C  C   . GLY A  1  484 ? 24.093  -19.423 55.645   1.00 222.30 ? 484  GLY A C   1 
ATOM   3661  O  O   . GLY A  1  484 ? 24.979  -20.277 55.723   1.00 235.56 ? 484  GLY A O   1 
ATOM   3662  N  N   . LYS A  1  485 ? 23.389  -19.202 54.534   1.00 208.10 ? 485  LYS A N   1 
ATOM   3663  C  CA  . LYS A  1  485 ? 23.563  -20.036 53.338   1.00 209.22 ? 485  LYS A CA  1 
ATOM   3664  C  C   . LYS A  1  485 ? 23.586  -19.118 52.115   1.00 225.87 ? 485  LYS A C   1 
ATOM   3665  O  O   . LYS A  1  485 ? 22.545  -18.811 51.528   1.00 222.04 ? 485  LYS A O   1 
ATOM   3666  C  CB  . LYS A  1  485 ? 22.476  -21.096 53.234   1.00 203.87 ? 485  LYS A CB  1 
ATOM   3667  C  CG  . LYS A  1  485 ? 22.802  -22.209 52.242   1.00 206.37 ? 485  LYS A CG  1 
ATOM   3668  C  CD  . LYS A  1  485 ? 21.846  -23.386 52.390   1.00 200.82 ? 485  LYS A CD  1 
ATOM   3669  C  CE  . LYS A  1  485 ? 22.243  -24.543 51.481   1.00 204.52 ? 485  LYS A CE  1 
ATOM   3670  N  NZ  . LYS A  1  485 ? 21.332  -25.715 51.618   1.00 203.41 ? 485  LYS A NZ  1 
ATOM   3671  N  N   . GLY A  1  486 ? 24.787  -18.711 51.727   1.00 242.73 ? 486  GLY A N   1 
ATOM   3672  C  CA  . GLY A  1  486 ? 25.024  -17.787 50.625   1.00 245.93 ? 486  GLY A CA  1 
ATOM   3673  C  C   . GLY A  1  486 ? 26.428  -17.209 50.733   1.00 241.56 ? 486  GLY A C   1 
ATOM   3674  O  O   . GLY A  1  486 ? 27.330  -17.842 51.283   1.00 238.91 ? 486  GLY A O   1 
ATOM   3675  N  N   . VAL A  1  487 ? 26.597  -16.000 50.204   1.00 236.85 ? 487  VAL A N   1 
ATOM   3676  C  CA  . VAL A  1  487 ? 27.867  -15.279 50.302   1.00 235.38 ? 487  VAL A CA  1 
ATOM   3677  C  C   . VAL A  1  487 ? 27.720  -14.253 51.421   1.00 231.22 ? 487  VAL A C   1 
ATOM   3678  O  O   . VAL A  1  487 ? 27.104  -13.200 51.242   1.00 228.49 ? 487  VAL A O   1 
ATOM   3679  C  CB  . VAL A  1  487 ? 28.264  -14.625 48.977   1.00 230.05 ? 487  VAL A CB  1 
ATOM   3680  C  CG1 . VAL A  1  487 ? 29.515  -13.774 49.157   1.00 241.16 ? 487  VAL A CG1 1 
ATOM   3681  C  CG2 . VAL A  1  487 ? 28.501  -15.684 47.909   1.00 224.30 ? 487  VAL A CG2 1 
ATOM   3682  N  N   . LEU A  1  488 ? 28.285  -14.563 52.583   1.00 249.38 ? 488  LEU A N   1 
ATOM   3683  C  CA  . LEU A  1  488 ? 28.287  -13.682 53.740   1.00 260.44 ? 488  LEU A CA  1 
ATOM   3684  C  C   . LEU A  1  488 ? 29.610  -13.853 54.471   1.00 259.57 ? 488  LEU A C   1 
ATOM   3685  O  O   . LEU A  1  488 ? 30.258  -14.900 54.354   1.00 251.70 ? 488  LEU A O   1 
ATOM   3686  C  CB  . LEU A  1  488 ? 27.099  -13.971 54.676   1.00 262.06 ? 488  LEU A CB  1 
ATOM   3687  C  CG  . LEU A  1  488 ? 26.835  -15.358 55.271   1.00 264.42 ? 488  LEU A CG  1 
ATOM   3688  C  CD1 . LEU A  1  488 ? 26.027  -15.223 56.550   1.00 264.23 ? 488  LEU A CD1 1 
ATOM   3689  C  CD2 . LEU A  1  488 ? 26.097  -16.260 54.295   1.00 245.37 ? 488  LEU A CD2 1 
ATOM   3690  N  N   . PRO A  1  489 ? 30.048  -12.839 55.219   1.00 257.92 ? 489  PRO A N   1 
ATOM   3691  C  CA  . PRO A  1  489 ? 31.293  -12.971 55.991   1.00 250.14 ? 489  PRO A CA  1 
ATOM   3692  C  C   . PRO A  1  489 ? 31.172  -14.034 57.071   1.00 249.86 ? 489  PRO A C   1 
ATOM   3693  O  O   . PRO A  1  489 ? 30.082  -14.490 57.423   1.00 249.57 ? 489  PRO A O   1 
ATOM   3694  C  CB  . PRO A  1  489 ? 31.493  -11.579 56.598   1.00 247.46 ? 489  PRO A CB  1 
ATOM   3695  C  CG  . PRO A  1  489 ? 30.138  -10.967 56.599   1.00 250.43 ? 489  PRO A CG  1 
ATOM   3696  C  CD  . PRO A  1  489 ? 29.445  -11.506 55.383   1.00 259.75 ? 489  PRO A CD  1 
ATOM   3697  N  N   . ARG A  1  490 ? 32.328  -14.431 57.610   1.00 244.12 ? 490  ARG A N   1 
ATOM   3698  C  CA  . ARG A  1  490 ? 32.334  -15.428 58.678   1.00 241.86 ? 490  ARG A CA  1 
ATOM   3699  C  C   . ARG A  1  490 ? 32.016  -14.800 60.030   1.00 239.31 ? 490  ARG A C   1 
ATOM   3700  O  O   . ARG A  1  490 ? 31.228  -15.349 60.809   1.00 242.42 ? 490  ARG A O   1 
ATOM   3701  C  CB  . ARG A  1  490 ? 33.691  -16.144 58.734   1.00 247.60 ? 490  ARG A CB  1 
ATOM   3702  C  CG  . ARG A  1  490 ? 33.830  -17.307 57.755   1.00 257.53 ? 490  ARG A CG  1 
ATOM   3703  C  CD  . ARG A  1  490 ? 32.847  -18.432 58.065   1.00 253.18 ? 490  ARG A CD  1 
ATOM   3704  N  NE  . ARG A  1  490 ? 32.864  -19.471 57.037   1.00 257.19 ? 490  ARG A NE  1 
ATOM   3705  C  CZ  . ARG A  1  490 ? 32.003  -20.483 56.978   1.00 256.84 ? 490  ARG A CZ  1 
ATOM   3706  N  NH1 . ARG A  1  490 ? 31.046  -20.600 57.890   1.00 256.22 ? 490  ARG A NH1 1 
ATOM   3707  N  NH2 . ARG A  1  490 ? 32.096  -21.377 56.003   1.00 262.27 ? 490  ARG A NH2 1 
ATOM   3708  N  N   . LYS A  1  491 ? 32.608  -13.644 60.317   1.00 235.29 ? 491  LYS A N   1 
ATOM   3709  C  CA  . LYS A  1  491 ? 32.498  -13.025 61.635   1.00 240.76 ? 491  LYS A CA  1 
ATOM   3710  C  C   . LYS A  1  491 ? 31.237  -12.169 61.701   1.00 242.02 ? 491  LYS A C   1 
ATOM   3711  O  O   . LYS A  1  491 ? 31.166  -11.102 61.081   1.00 242.39 ? 491  LYS A O   1 
ATOM   3712  C  CB  . LYS A  1  491 ? 33.748  -12.206 61.928   1.00 245.42 ? 491  LYS A CB  1 
ATOM   3713  C  CG  . LYS A  1  491 ? 35.035  -13.013 61.825   1.00 248.43 ? 491  LYS A CG  1 
ATOM   3714  C  CD  . LYS A  1  491 ? 35.003  -14.199 62.765   1.00 246.13 ? 491  LYS A CD  1 
ATOM   3715  C  CE  . LYS A  1  491 ? 36.232  -15.069 62.599   1.00 260.24 ? 491  LYS A CE  1 
ATOM   3716  N  NZ  . LYS A  1  491 ? 36.202  -16.228 63.531   1.00 262.70 ? 491  LYS A NZ  1 
ATOM   3717  N  N   . LEU A  1  492 ? 30.236  -12.645 62.441   1.00 240.35 ? 492  LEU A N   1 
ATOM   3718  C  CA  . LEU A  1  492 ? 29.005  -11.904 62.697   1.00 242.21 ? 492  LEU A CA  1 
ATOM   3719  C  C   . LEU A  1  492 ? 29.027  -11.360 64.124   1.00 243.46 ? 492  LEU A C   1 
ATOM   3720  O  O   . LEU A  1  492 ? 29.083  -12.134 65.087   1.00 248.18 ? 492  LEU A O   1 
ATOM   3721  C  CB  . LEU A  1  492 ? 27.783  -12.798 62.479   1.00 239.55 ? 492  LEU A CB  1 
ATOM   3722  C  CG  . LEU A  1  492 ? 27.646  -13.513 61.129   1.00 237.99 ? 492  LEU A CG  1 
ATOM   3723  C  CD1 . LEU A  1  492 ? 26.501  -14.520 61.177   1.00 242.54 ? 492  LEU A CD1 1 
ATOM   3724  C  CD2 . LEU A  1  492 ? 27.445  -12.519 59.992   1.00 234.48 ? 492  LEU A CD2 1 
ATOM   3725  N  N   . ASN A  1  493 ? 28.984  -10.033 64.257   1.00 242.68 ? 493  ASN A N   1 
ATOM   3726  C  CA  . ASN A  1  493 ? 29.022  -9.368  65.558   1.00 254.92 ? 493  ASN A CA  1 
ATOM   3727  C  C   . ASN A  1  493 ? 27.616  -9.246  66.139   1.00 248.41 ? 493  ASN A C   1 
ATOM   3728  O  O   . ASN A  1  493 ? 26.757  -8.570  65.563   1.00 246.55 ? 493  ASN A O   1 
ATOM   3729  C  CB  . ASN A  1  493 ? 29.663  -7.986  65.438   1.00 263.46 ? 493  ASN A CB  1 
ATOM   3730  C  CG  . ASN A  1  493 ? 31.171  -8.048  65.313   1.00 266.81 ? 493  ASN A CG  1 
ATOM   3731  O  OD1 . ASN A  1  493 ? 31.732  -9.069  64.914   1.00 278.21 ? 493  ASN A OD1 1 
ATOM   3732  N  ND2 . ASN A  1  493 ? 31.838  -6.953  65.661   1.00 250.58 ? 493  ASN A ND2 1 
ATOM   3733  N  N   . PHE A  1  494 ? 27.398  -9.861  67.299   1.00 249.90 ? 494  PHE A N   1 
ATOM   3734  C  CA  . PHE A  1  494 ? 26.114  -9.838  67.988   1.00 247.58 ? 494  PHE A CA  1 
ATOM   3735  C  C   . PHE A  1  494 ? 26.164  -8.916  69.198   1.00 259.70 ? 494  PHE A C   1 
ATOM   3736  O  O   . PHE A  1  494 ? 27.193  -8.814  69.875   1.00 274.42 ? 494  PHE A O   1 
ATOM   3737  C  CB  . PHE A  1  494 ? 25.710  -11.242 68.433   1.00 246.01 ? 494  PHE A CB  1 
ATOM   3738  C  CG  . PHE A  1  494 ? 25.196  -12.097 67.325   1.00 243.82 ? 494  PHE A CG  1 
ATOM   3739  C  CD1 . PHE A  1  494 ? 26.072  -12.720 66.458   1.00 249.36 ? 494  PHE A CD1 1 
ATOM   3740  C  CD2 . PHE A  1  494 ? 23.837  -12.285 67.154   1.00 243.82 ? 494  PHE A CD2 1 
ATOM   3741  C  CE1 . PHE A  1  494 ? 25.605  -13.504 65.432   1.00 252.63 ? 494  PHE A CE1 1 
ATOM   3742  C  CE2 . PHE A  1  494 ? 23.363  -13.073 66.132   1.00 246.90 ? 494  PHE A CE2 1 
ATOM   3743  C  CZ  . PHE A  1  494 ? 24.249  -13.685 65.270   1.00 248.73 ? 494  PHE A CZ  1 
ATOM   3744  N  N   . GLN A  1  495 ? 25.041  -8.255  69.470   1.00 264.47 ? 495  GLN A N   1 
ATOM   3745  C  CA  . GLN A  1  495 ? 24.849  -7.463  70.681   1.00 278.76 ? 495  GLN A CA  1 
ATOM   3746  C  C   . GLN A  1  495 ? 23.803  -8.166  71.537   1.00 274.52 ? 495  GLN A C   1 
ATOM   3747  O  O   . GLN A  1  495 ? 22.634  -8.251  71.148   1.00 275.76 ? 495  GLN A O   1 
ATOM   3748  C  CB  . GLN A  1  495 ? 24.409  -6.039  70.351   1.00 284.57 ? 495  GLN A CB  1 
ATOM   3749  C  CG  . GLN A  1  495 ? 25.399  -5.234  69.527   1.00 296.37 ? 495  GLN A CG  1 
ATOM   3750  C  CD  . GLN A  1  495 ? 24.979  -3.783  69.382   1.00 298.58 ? 495  GLN A CD  1 
ATOM   3751  O  OE1 . GLN A  1  495 ? 25.620  -3.006  68.675   1.00 312.50 ? 495  GLN A OE1 1 
ATOM   3752  N  NE2 . GLN A  1  495 ? 23.897  -3.412  70.058   1.00 288.87 ? 495  GLN A NE2 1 
ATOM   3753  N  N   . VAL A  1  496 ? 24.220  -8.682  72.691   1.00 266.61 ? 496  VAL A N   1 
ATOM   3754  C  CA  . VAL A  1  496 ? 23.353  -9.477  73.556   1.00 256.09 ? 496  VAL A CA  1 
ATOM   3755  C  C   . VAL A  1  496 ? 23.075  -8.695  74.835   1.00 257.64 ? 496  VAL A C   1 
ATOM   3756  O  O   . VAL A  1  496 ? 24.004  -8.184  75.474   1.00 261.55 ? 496  VAL A O   1 
ATOM   3757  C  CB  . VAL A  1  496 ? 23.980  -10.846 73.864   1.00 250.23 ? 496  VAL A CB  1 
ATOM   3758  C  CG1 . VAL A  1  496 ? 23.050  -11.670 74.728   1.00 248.69 ? 496  VAL A CG1 1 
ATOM   3759  C  CG2 . VAL A  1  496 ? 24.303  -11.582 72.571   1.00 253.41 ? 496  VAL A CG2 1 
ATOM   3760  N  N   . GLU A  1  497 ? 21.796  -8.602  75.205   1.00 253.30 ? 497  GLU A N   1 
ATOM   3761  C  CA  . GLU A  1  497 ? 21.361  -7.975  76.446   1.00 250.13 ? 497  GLU A CA  1 
ATOM   3762  C  C   . GLU A  1  497 ? 20.624  -8.995  77.301   1.00 248.34 ? 497  GLU A C   1 
ATOM   3763  O  O   . GLU A  1  497 ? 19.813  -9.776  76.794   1.00 251.40 ? 497  GLU A O   1 
ATOM   3764  C  CB  . GLU A  1  497 ? 20.449  -6.763  76.187   1.00 250.35 ? 497  GLU A CB  1 
ATOM   3765  C  CG  . GLU A  1  497 ? 20.862  -5.891  75.011   1.00 256.46 ? 497  GLU A CG  1 
ATOM   3766  C  CD  . GLU A  1  497 ? 22.175  -5.165  75.244   1.00 251.94 ? 497  GLU A CD  1 
ATOM   3767  O  OE1 . GLU A  1  497 ? 22.944  -5.003  74.274   1.00 254.09 ? 497  GLU A OE1 1 
ATOM   3768  O  OE2 . GLU A  1  497 ? 22.445  -4.766  76.396   1.00 249.52 ? 497  GLU A OE2 1 
ATOM   3769  N  N   . LEU A  1  498 ? 20.901  -8.984  78.601   1.00 253.59 ? 498  LEU A N   1 
ATOM   3770  C  CA  . LEU A  1  498 ? 20.227  -9.854  79.555   1.00 257.02 ? 498  LEU A CA  1 
ATOM   3771  C  C   . LEU A  1  498 ? 19.585  -9.001  80.639   1.00 267.82 ? 498  LEU A C   1 
ATOM   3772  O  O   . LEU A  1  498 ? 20.212  -8.068  81.152   1.00 271.22 ? 498  LEU A O   1 
ATOM   3773  C  CB  . LEU A  1  498 ? 21.204  -10.865 80.169   1.00 255.40 ? 498  LEU A CB  1 
ATOM   3774  C  CG  . LEU A  1  498 ? 21.336  -12.241 79.507   1.00 250.57 ? 498  LEU A CG  1 
ATOM   3775  C  CD1 . LEU A  1  498 ? 21.814  -12.130 78.071   1.00 248.99 ? 498  LEU A CD1 1 
ATOM   3776  C  CD2 . LEU A  1  498 ? 22.289  -13.109 80.307   1.00 253.11 ? 498  LEU A CD2 1 
ATOM   3777  N  N   . LEU A  1  499 ? 18.333  -9.313  80.979   1.00 279.86 ? 499  LEU A N   1 
ATOM   3778  C  CA  . LEU A  1  499 ? 17.606  -8.612  82.034   1.00 282.98 ? 499  LEU A CA  1 
ATOM   3779  C  C   . LEU A  1  499 ? 17.053  -9.621  83.028   1.00 272.73 ? 499  LEU A C   1 
ATOM   3780  O  O   . LEU A  1  499 ? 16.259  -10.493 82.658   1.00 272.02 ? 499  LEU A O   1 
ATOM   3781  C  CB  . LEU A  1  499 ? 16.473  -7.757  81.459   1.00 293.73 ? 499  LEU A CB  1 
ATOM   3782  C  CG  . LEU A  1  499 ? 16.828  -6.770  80.344   1.00 300.51 ? 499  LEU A CG  1 
ATOM   3783  C  CD1 . LEU A  1  499 ? 15.568  -6.313  79.612   1.00 300.18 ? 499  LEU A CD1 1 
ATOM   3784  C  CD2 . LEU A  1  499 ? 17.581  -5.587  80.917   1.00 300.66 ? 499  LEU A CD2 1 
ATOM   3785  N  N   . LEU A  1  500 ? 17.464  -9.494  84.285   1.00 265.37 ? 500  LEU A N   1 
ATOM   3786  C  CA  . LEU A  1  500 ? 16.970  -10.347 85.355   1.00 267.23 ? 500  LEU A CA  1 
ATOM   3787  C  C   . LEU A  1  500 ? 15.697  -9.762  85.952   1.00 273.53 ? 500  LEU A C   1 
ATOM   3788  O  O   . LEU A  1  500 ? 15.578  -8.543  86.111   1.00 280.61 ? 500  LEU A O   1 
ATOM   3789  C  CB  . LEU A  1  500 ? 18.029  -10.504 86.447   1.00 267.07 ? 500  LEU A CB  1 
ATOM   3790  C  CG  . LEU A  1  500 ? 19.351  -11.169 86.062   1.00 273.54 ? 500  LEU A CG  1 
ATOM   3791  C  CD1 . LEU A  1  500 ? 20.385  -10.972 87.155   1.00 277.83 ? 500  LEU A CD1 1 
ATOM   3792  C  CD2 . LEU A  1  500 ? 19.147  -12.649 85.786   1.00 280.53 ? 500  LEU A CD2 1 
ATOM   3793  N  N   . ASP A  1  501 ? 14.749  -10.637 86.282   1.00 267.61 ? 501  ASP A N   1 
ATOM   3794  C  CA  . ASP A  1  501 ? 13.518  -10.238 86.960   1.00 261.54 ? 501  ASP A CA  1 
ATOM   3795  C  C   . ASP A  1  501 ? 12.799  -9.124  86.204   1.00 259.70 ? 501  ASP A C   1 
ATOM   3796  O  O   . ASP A  1  501 ? 12.455  -8.079  86.762   1.00 257.21 ? 501  ASP A O   1 
ATOM   3797  C  CB  . ASP A  1  501 ? 13.808  -9.816  88.399   1.00 266.41 ? 501  ASP A CB  1 
ATOM   3798  C  CG  . ASP A  1  501 ? 12.557  -9.727  89.239   1.00 270.62 ? 501  ASP A CG  1 
ATOM   3799  O  OD1 . ASP A  1  501 ? 11.602  -10.480 88.957   1.00 259.05 ? 501  ASP A OD1 1 
ATOM   3800  O  OD2 . ASP A  1  501 ? 12.529  -8.898  90.172   1.00 287.37 ? 501  ASP A OD2 1 
ATOM   3801  N  N   . LYS A  1  502 ? 12.583  -9.347  84.906   1.00 254.91 ? 502  LYS A N   1 
ATOM   3802  C  CA  . LYS A  1  502 ? 11.949  -8.316  84.090   1.00 256.18 ? 502  LYS A CA  1 
ATOM   3803  C  C   . LYS A  1  502 ? 10.507  -8.063  84.512   1.00 258.91 ? 502  LYS A C   1 
ATOM   3804  O  O   . LYS A  1  502 ? 10.045  -6.916  84.488   1.00 259.86 ? 502  LYS A O   1 
ATOM   3805  C  CB  . LYS A  1  502 ? 11.988  -8.687  82.612   1.00 252.92 ? 502  LYS A CB  1 
ATOM   3806  C  CG  . LYS A  1  502 ? 11.371  -7.587  81.781   1.00 254.24 ? 502  LYS A CG  1 
ATOM   3807  C  CD  . LYS A  1  502 ? 11.210  -7.925  80.329   1.00 247.14 ? 502  LYS A CD  1 
ATOM   3808  C  CE  . LYS A  1  502 ? 10.605  -6.730  79.626   1.00 248.44 ? 502  LYS A CE  1 
ATOM   3809  N  NZ  . LYS A  1  502 ? 11.511  -5.553  79.673   1.00 249.86 ? 502  LYS A NZ  1 
ATOM   3810  N  N   . LEU A  1  503 ? 9.776   -9.121  84.874   1.00 262.50 ? 503  LEU A N   1 
ATOM   3811  C  CA  . LEU A  1  503 ? 8.357   -9.044  85.216   1.00 265.61 ? 503  LEU A CA  1 
ATOM   3812  C  C   . LEU A  1  503 ? 8.028   -7.850  86.106   1.00 274.12 ? 503  LEU A C   1 
ATOM   3813  O  O   . LEU A  1  503 ? 6.924   -7.300  86.033   1.00 276.14 ? 503  LEU A O   1 
ATOM   3814  C  CB  . LEU A  1  503 ? 7.906   -10.340 85.895   1.00 267.72 ? 503  LEU A CB  1 
ATOM   3815  C  CG  . LEU A  1  503 ? 7.267   -11.419 85.014   1.00 264.71 ? 503  LEU A CG  1 
ATOM   3816  C  CD1 . LEU A  1  503 ? 8.014   -11.585 83.694   1.00 262.30 ? 503  LEU A CD1 1 
ATOM   3817  C  CD2 . LEU A  1  503 ? 7.182   -12.743 85.760   1.00 263.46 ? 503  LEU A CD2 1 
ATOM   3818  N  N   . LYS A  1  504 ? 8.979   -7.441  86.946   1.00 279.39 ? 504  LYS A N   1 
ATOM   3819  C  CA  . LYS A  1  504 ? 8.848   -6.224  87.744   1.00 281.10 ? 504  LYS A CA  1 
ATOM   3820  C  C   . LYS A  1  504 ? 9.075   -5.009  86.848   1.00 282.44 ? 504  LYS A C   1 
ATOM   3821  O  O   . LYS A  1  504 ? 10.193  -4.777  86.375   1.00 279.24 ? 504  LYS A O   1 
ATOM   3822  C  CB  . LYS A  1  504 ? 9.833   -6.241  88.908   1.00 276.65 ? 504  LYS A CB  1 
ATOM   3823  C  CG  . LYS A  1  504 ? 9.520   -7.271  89.987   1.00 273.66 ? 504  LYS A CG  1 
ATOM   3824  C  CD  . LYS A  1  504 ? 8.215   -6.953  90.702   1.00 269.46 ? 504  LYS A CD  1 
ATOM   3825  C  CE  . LYS A  1  504 ? 7.993   -7.884  91.883   1.00 265.99 ? 504  LYS A CE  1 
ATOM   3826  N  NZ  . LYS A  1  504 ? 6.743   -7.553  92.618   1.00 266.24 ? 504  LYS A NZ  1 
ATOM   3827  N  N   . GLN A  1  505 ? 8.011   -4.245  86.602   1.00 288.64 ? 505  GLN A N   1 
ATOM   3828  C  CA  . GLN A  1  505 ? 8.102   -3.039  85.791   1.00 288.03 ? 505  GLN A CA  1 
ATOM   3829  C  C   . GLN A  1  505 ? 9.007   -2.004  86.461   1.00 294.57 ? 505  GLN A C   1 
ATOM   3830  O  O   . GLN A  1  505 ? 9.284   -2.063  87.662   1.00 308.96 ? 505  GLN A O   1 
ATOM   3831  C  CB  . GLN A  1  505 ? 6.709   -2.450  85.555   1.00 282.00 ? 505  GLN A CB  1 
ATOM   3832  C  CG  . GLN A  1  505 ? 5.756   -3.362  84.777   1.00 274.76 ? 505  GLN A CG  1 
ATOM   3833  C  CD  . GLN A  1  505 ? 6.093   -3.469  83.297   1.00 264.39 ? 505  GLN A CD  1 
ATOM   3834  O  OE1 . GLN A  1  505 ? 6.939   -2.739  82.782   1.00 266.63 ? 505  GLN A OE1 1 
ATOM   3835  N  NE2 . GLN A  1  505 ? 5.420   -4.382  82.606   1.00 258.07 ? 505  GLN A NE2 1 
ATOM   3836  N  N   . LYS A  1  506 ? 9.470   -1.042  85.659   1.00 271.64 ? 506  LYS A N   1 
ATOM   3837  C  CA  . LYS A  1  506 ? 10.348  0.017   86.145   1.00 258.98 ? 506  LYS A CA  1 
ATOM   3838  C  C   . LYS A  1  506 ? 9.691   0.831   87.254   1.00 268.32 ? 506  LYS A C   1 
ATOM   3839  O  O   . LYS A  1  506 ? 8.830   1.678   86.991   1.00 277.18 ? 506  LYS A O   1 
ATOM   3840  C  CB  . LYS A  1  506 ? 10.766  0.931   84.993   1.00 247.55 ? 506  LYS A CB  1 
ATOM   3841  C  CG  . LYS A  1  506 ? 11.853  1.911   85.371   1.00 249.01 ? 506  LYS A CG  1 
ATOM   3842  C  CD  . LYS A  1  506 ? 13.043  1.183   85.977   1.00 248.37 ? 506  LYS A CD  1 
ATOM   3843  C  CE  . LYS A  1  506 ? 14.149  2.154   86.351   1.00 251.31 ? 506  LYS A CE  1 
ATOM   3844  N  NZ  . LYS A  1  506 ? 14.663  2.883   85.161   1.00 254.01 ? 506  LYS A NZ  1 
ATOM   3845  N  N   . GLY A  1  507 ? 10.093  0.573   88.496   1.00 256.78 ? 507  GLY A N   1 
ATOM   3846  C  CA  . GLY A  1  507 ? 9.573   1.284   89.648   1.00 250.08 ? 507  GLY A CA  1 
ATOM   3847  C  C   . GLY A  1  507 ? 9.273   0.334   90.788   1.00 243.11 ? 507  GLY A C   1 
ATOM   3848  O  O   . GLY A  1  507 ? 9.129   0.746   91.943   1.00 242.12 ? 507  GLY A O   1 
ATOM   3849  N  N   . ALA A  1  508 ? 9.171   -0.952  90.460   1.00 248.21 ? 508  ALA A N   1 
ATOM   3850  C  CA  . ALA A  1  508 ? 8.855   -1.984  91.438   1.00 246.62 ? 508  ALA A CA  1 
ATOM   3851  C  C   . ALA A  1  508 ? 10.058  -2.303  92.313   1.00 249.40 ? 508  ALA A C   1 
ATOM   3852  O  O   . ALA A  1  508 ? 10.978  -1.488  92.443   1.00 246.98 ? 508  ALA A O   1 
ATOM   3853  C  CB  . ALA A  1  508 ? 8.361   -3.252  90.742   1.00 243.13 ? 508  ALA A CB  1 
ATOM   3854  N  N   . ILE A  1  509 ? 10.051  -3.484  92.924   1.00 263.18 ? 509  ILE A N   1 
ATOM   3855  C  CA  . ILE A  1  509 ? 11.140  -3.950  93.774   1.00 271.14 ? 509  ILE A CA  1 
ATOM   3856  C  C   . ILE A  1  509 ? 11.836  -5.103  93.055   1.00 267.14 ? 509  ILE A C   1 
ATOM   3857  O  O   . ILE A  1  509 ? 11.239  -6.163  92.823   1.00 259.88 ? 509  ILE A O   1 
ATOM   3858  C  CB  . ILE A  1  509 ? 10.636  -4.363  95.162   1.00 266.61 ? 509  ILE A CB  1 
ATOM   3859  C  CG1 . ILE A  1  509 ? 11.729  -5.111  95.928   1.00 258.78 ? 509  ILE A CG1 1 
ATOM   3860  C  CG2 . ILE A  1  509 ? 9.342   -5.169  95.062   1.00 267.20 ? 509  ILE A CG2 1 
ATOM   3861  C  CD1 . ILE A  1  509 ? 12.917  -4.255  96.290   1.00 255.20 ? 509  ILE A CD1 1 
ATOM   3862  N  N   . ARG A  1  510 ? 13.092  -4.884  92.673   1.00 275.99 ? 510  ARG A N   1 
ATOM   3863  C  CA  . ARG A  1  510 ? 13.872  -5.856  91.921   1.00 276.90 ? 510  ARG A CA  1 
ATOM   3864  C  C   . ARG A  1  510 ? 14.578  -6.791  92.896   1.00 282.61 ? 510  ARG A C   1 
ATOM   3865  O  O   . ARG A  1  510 ? 14.808  -6.445  94.056   1.00 292.19 ? 510  ARG A O   1 
ATOM   3866  C  CB  . ARG A  1  510 ? 14.888  -5.148  91.015   1.00 275.10 ? 510  ARG A CB  1 
ATOM   3867  C  CG  . ARG A  1  510 ? 15.431  -5.993  89.864   1.00 269.18 ? 510  ARG A CG  1 
ATOM   3868  C  CD  . ARG A  1  510 ? 14.392  -6.159  88.761   1.00 265.51 ? 510  ARG A CD  1 
ATOM   3869  N  NE  . ARG A  1  510 ? 14.004  -4.875  88.183   1.00 267.00 ? 510  ARG A NE  1 
ATOM   3870  C  CZ  . ARG A  1  510 ? 13.316  -4.737  87.054   1.00 264.07 ? 510  ARG A CZ  1 
ATOM   3871  N  NH1 . ARG A  1  510 ? 12.933  -5.807  86.371   1.00 259.23 ? 510  ARG A NH1 1 
ATOM   3872  N  NH2 . ARG A  1  510 ? 13.012  -3.527  86.603   1.00 267.73 ? 510  ARG A NH2 1 
ATOM   3873  N  N   . ARG A  1  511 ? 14.920  -7.994  92.418   1.00 280.99 ? 511  ARG A N   1 
ATOM   3874  C  CA  . ARG A  1  511 ? 15.489  -9.013  93.292   1.00 275.66 ? 511  ARG A CA  1 
ATOM   3875  C  C   . ARG A  1  511 ? 16.737  -9.711  92.761   1.00 275.43 ? 511  ARG A C   1 
ATOM   3876  O  O   . ARG A  1  511 ? 17.284  -10.568 93.467   1.00 269.17 ? 511  ARG A O   1 
ATOM   3877  C  CB  . ARG A  1  511 ? 14.429  -10.079 93.615   1.00 269.60 ? 511  ARG A CB  1 
ATOM   3878  C  CG  . ARG A  1  511 ? 13.207  -9.523  94.326   1.00 271.24 ? 511  ARG A CG  1 
ATOM   3879  C  CD  . ARG A  1  511 ? 12.000  -10.413 94.131   1.00 269.40 ? 511  ARG A CD  1 
ATOM   3880  N  NE  . ARG A  1  511 ? 11.652  -10.545 92.723   1.00 276.74 ? 511  ARG A NE  1 
ATOM   3881  C  CZ  . ARG A  1  511 ? 10.656  -11.296 92.272   1.00 289.29 ? 511  ARG A CZ  1 
ATOM   3882  N  NH1 . ARG A  1  511 ? 9.909   -11.987 93.123   1.00 288.03 ? 511  ARG A NH1 1 
ATOM   3883  N  NH2 . ARG A  1  511 ? 10.408  -11.360 90.970   1.00 294.29 ? 511  ARG A NH2 1 
ATOM   3884  N  N   . ALA A  1  512 ? 17.202  -9.393  91.556   1.00 285.55 ? 512  ALA A N   1 
ATOM   3885  C  CA  . ALA A  1  512 ? 18.387  -10.035 91.007   1.00 283.64 ? 512  ALA A CA  1 
ATOM   3886  C  C   . ALA A  1  512 ? 19.306  -9.000  90.373   1.00 297.71 ? 512  ALA A C   1 
ATOM   3887  O  O   . ALA A  1  512 ? 18.857  -7.949  89.905   1.00 310.57 ? 512  ALA A O   1 
ATOM   3888  C  CB  . ALA A  1  512 ? 18.015  -11.107 89.976   1.00 271.58 ? 512  ALA A CB  1 
ATOM   3889  N  N   . LEU A  1  513 ? 20.598  -9.326  90.344   1.00 290.08 ? 513  LEU A N   1 
ATOM   3890  C  CA  . LEU A  1  513 ? 21.626  -8.493  89.734   1.00 289.77 ? 513  LEU A CA  1 
ATOM   3891  C  C   . LEU A  1  513 ? 22.935  -9.271  89.742   1.00 285.95 ? 513  LEU A C   1 
ATOM   3892  O  O   . LEU A  1  513 ? 23.212  -10.010 90.690   1.00 280.02 ? 513  LEU A O   1 
ATOM   3893  C  CB  . LEU A  1  513 ? 21.786  -7.146  90.463   1.00 283.67 ? 513  LEU A CB  1 
ATOM   3894  C  CG  . LEU A  1  513 ? 22.310  -7.070  91.898   1.00 270.45 ? 513  LEU A CG  1 
ATOM   3895  C  CD1 . LEU A  1  513 ? 23.807  -6.815  91.908   1.00 271.04 ? 513  LEU A CD1 1 
ATOM   3896  C  CD2 . LEU A  1  513 ? 21.585  -5.980  92.662   1.00 270.03 ? 513  LEU A CD2 1 
ATOM   3897  N  N   . PHE A  1  514 ? 23.712  -9.122  88.669   1.00 283.16 ? 514  PHE A N   1 
ATOM   3898  C  CA  . PHE A  1  514 ? 24.907  -9.929  88.466   1.00 280.37 ? 514  PHE A CA  1 
ATOM   3899  C  C   . PHE A  1  514 ? 25.916  -9.730  89.597   1.00 285.74 ? 514  PHE A C   1 
ATOM   3900  O  O   . PHE A  1  514 ? 25.894  -8.736  90.328   1.00 286.29 ? 514  PHE A O   1 
ATOM   3901  C  CB  . PHE A  1  514 ? 25.551  -9.607  87.116   1.00 270.03 ? 514  PHE A CB  1 
ATOM   3902  C  CG  . PHE A  1  514 ? 24.747  -10.074 85.929   1.00 264.68 ? 514  PHE A CG  1 
ATOM   3903  C  CD1 . PHE A  1  514 ? 23.548  -9.466  85.591   1.00 263.15 ? 514  PHE A CD1 1 
ATOM   3904  C  CD2 . PHE A  1  514 ? 25.189  -11.138 85.161   1.00 260.89 ? 514  PHE A CD2 1 
ATOM   3905  C  CE1 . PHE A  1  514 ? 22.812  -9.906  84.503   1.00 255.28 ? 514  PHE A CE1 1 
ATOM   3906  C  CE2 . PHE A  1  514 ? 24.460  -11.581 84.074   1.00 255.52 ? 514  PHE A CE2 1 
ATOM   3907  C  CZ  . PHE A  1  514 ? 23.269  -10.965 83.745   1.00 252.37 ? 514  PHE A CZ  1 
ATOM   3908  N  N   . LEU A  1  515 ? 26.823  -10.703 89.721   1.00 284.09 ? 515  LEU A N   1 
ATOM   3909  C  CA  . LEU A  1  515 ? 27.728  -10.748 90.867   1.00 275.59 ? 515  LEU A CA  1 
ATOM   3910  C  C   . LEU A  1  515 ? 28.768  -9.636  90.800   1.00 268.44 ? 515  LEU A C   1 
ATOM   3911  O  O   . LEU A  1  515 ? 28.964  -8.898  91.772   1.00 272.52 ? 515  LEU A O   1 
ATOM   3912  C  CB  . LEU A  1  515 ? 28.404  -12.118 90.940   1.00 275.55 ? 515  LEU A CB  1 
ATOM   3913  C  CG  . LEU A  1  515 ? 29.312  -12.393 92.141   1.00 277.45 ? 515  LEU A CG  1 
ATOM   3914  C  CD1 . LEU A  1  515 ? 28.525  -12.332 93.441   1.00 275.19 ? 515  LEU A CD1 1 
ATOM   3915  C  CD2 . LEU A  1  515 ? 29.998  -13.742 91.995   1.00 281.43 ? 515  LEU A CD2 1 
ATOM   3916  N  N   . TYR A  1  516 ? 29.444  -9.496  89.660   1.00 265.52 ? 516  TYR A N   1 
ATOM   3917  C  CA  . TYR A  1  516 ? 30.487  -8.490  89.511   1.00 269.83 ? 516  TYR A CA  1 
ATOM   3918  C  C   . TYR A  1  516 ? 29.995  -7.224  88.827   1.00 274.72 ? 516  TYR A C   1 
ATOM   3919  O  O   . TYR A  1  516 ? 30.490  -6.134  89.136   1.00 279.53 ? 516  TYR A O   1 
ATOM   3920  C  CB  . TYR A  1  516 ? 31.674  -9.064  88.724   1.00 272.98 ? 516  TYR A CB  1 
ATOM   3921  C  CG  . TYR A  1  516 ? 33.010  -8.411  89.033   1.00 273.72 ? 516  TYR A CG  1 
ATOM   3922  C  CD1 . TYR A  1  516 ? 33.126  -7.436  90.020   1.00 269.65 ? 516  TYR A CD1 1 
ATOM   3923  C  CD2 . TYR A  1  516 ? 34.155  -8.769  88.333   1.00 275.03 ? 516  TYR A CD2 1 
ATOM   3924  C  CE1 . TYR A  1  516 ? 34.346  -6.840  90.299   1.00 270.18 ? 516  TYR A CE1 1 
ATOM   3925  C  CE2 . TYR A  1  516 ? 35.375  -8.178  88.605   1.00 273.07 ? 516  TYR A CE2 1 
ATOM   3926  C  CZ  . TYR A  1  516 ? 35.466  -7.215  89.589   1.00 267.41 ? 516  TYR A CZ  1 
ATOM   3927  O  OH  . TYR A  1  516 ? 36.681  -6.626  89.861   1.00 261.69 ? 516  TYR A OH  1 
ATOM   3928  N  N   . SER A  1  517 ? 29.033  -7.340  87.908   1.00 273.76 ? 517  SER A N   1 
ATOM   3929  C  CA  . SER A  1  517 ? 28.505  -6.166  87.224   1.00 276.07 ? 517  SER A CA  1 
ATOM   3930  C  C   . SER A  1  517 ? 27.729  -5.251  88.163   1.00 282.99 ? 517  SER A C   1 
ATOM   3931  O  O   . SER A  1  517 ? 27.588  -4.059  87.864   1.00 289.42 ? 517  SER A O   1 
ATOM   3932  C  CB  . SER A  1  517 ? 27.616  -6.590  86.051   1.00 266.38 ? 517  SER A CB  1 
ATOM   3933  O  OG  . SER A  1  517 ? 27.119  -5.462  85.349   1.00 264.48 ? 517  SER A OG  1 
ATOM   3934  N  N   . ARG A  1  518 ? 27.224  -5.780  89.280   1.00 274.47 ? 518  ARG A N   1 
ATOM   3935  C  CA  . ARG A  1  518 ? 26.444  -5.010  90.253   1.00 268.93 ? 518  ARG A CA  1 
ATOM   3936  C  C   . ARG A  1  518 ? 25.278  -4.285  89.587   1.00 267.87 ? 518  ARG A C   1 
ATOM   3937  O  O   . ARG A  1  518 ? 24.916  -3.168  89.962   1.00 264.14 ? 518  ARG A O   1 
ATOM   3938  C  CB  . ARG A  1  518 ? 27.325  -4.016  91.011   1.00 278.85 ? 518  ARG A CB  1 
ATOM   3939  C  CG  . ARG A  1  518 ? 28.699  -4.539  91.386   1.00 284.18 ? 518  ARG A CG  1 
ATOM   3940  C  CD  . ARG A  1  518 ? 28.600  -5.771  92.260   1.00 277.76 ? 518  ARG A CD  1 
ATOM   3941  N  NE  . ARG A  1  518 ? 29.818  -5.982  93.035   1.00 275.99 ? 518  ARG A NE  1 
ATOM   3942  C  CZ  . ARG A  1  518 ? 30.033  -5.441  94.228   1.00 271.64 ? 518  ARG A CZ  1 
ATOM   3943  N  NH1 . ARG A  1  518 ? 29.108  -4.660  94.766   1.00 271.53 ? 518  ARG A NH1 1 
ATOM   3944  N  NH2 . ARG A  1  518 ? 31.164  -5.678  94.878   1.00 267.33 ? 518  ARG A NH2 1 
ATOM   3945  N  N   . SER A  1  519 ? 24.673  -4.932  88.597   1.00 279.36 ? 519  SER A N   1 
ATOM   3946  C  CA  . SER A  1  519 ? 23.651  -4.280  87.792   1.00 281.03 ? 519  SER A CA  1 
ATOM   3947  C  C   . SER A  1  519 ? 22.716  -5.333  87.213   1.00 277.57 ? 519  SER A C   1 
ATOM   3948  O  O   . SER A  1  519 ? 23.179  -6.301  86.594   1.00 269.89 ? 519  SER A O   1 
ATOM   3949  C  CB  . SER A  1  519 ? 24.301  -3.445  86.684   1.00 279.34 ? 519  SER A CB  1 
ATOM   3950  O  OG  . SER A  1  519 ? 23.330  -2.780  85.895   1.00 269.46 ? 519  SER A OG  1 
ATOM   3951  N  N   . PRO A  1  520 ? 21.390  -5.183  87.413   1.00 285.77 ? 520  PRO A N   1 
ATOM   3952  C  CA  . PRO A  1  520 ? 20.431  -6.210  86.977   1.00 281.74 ? 520  PRO A CA  1 
ATOM   3953  C  C   . PRO A  1  520 ? 20.552  -6.594  85.510   1.00 274.45 ? 520  PRO A C   1 
ATOM   3954  O  O   . PRO A  1  520 ? 20.001  -7.615  85.086   1.00 268.96 ? 520  PRO A O   1 
ATOM   3955  C  CB  . PRO A  1  520 ? 19.073  -5.554  87.264   1.00 277.83 ? 520  PRO A CB  1 
ATOM   3956  C  CG  . PRO A  1  520 ? 19.339  -4.631  88.407   1.00 277.79 ? 520  PRO A CG  1 
ATOM   3957  C  CD  . PRO A  1  520 ? 20.753  -4.133  88.227   1.00 283.48 ? 520  PRO A CD  1 
ATOM   3958  N  N   . SER A  1  521 ? 21.256  -5.782  84.727   1.00 269.56 ? 521  SER A N   1 
ATOM   3959  C  CA  . SER A  1  521 ? 21.445  -6.035  83.309   1.00 267.82 ? 521  SER A CA  1 
ATOM   3960  C  C   . SER A  1  521 ? 22.934  -6.096  82.996   1.00 272.88 ? 521  SER A C   1 
ATOM   3961  O  O   . SER A  1  521 ? 23.747  -5.412  83.625   1.00 272.21 ? 521  SER A O   1 
ATOM   3962  C  CB  . SER A  1  521 ? 20.774  -4.953  82.445   1.00 266.80 ? 521  SER A CB  1 
ATOM   3963  O  OG  . SER A  1  521 ? 21.178  -3.648  82.825   1.00 269.08 ? 521  SER A OG  1 
ATOM   3964  N  N   . HIS A  1  522 ? 23.285  -6.934  82.023   1.00 274.25 ? 522  HIS A N   1 
ATOM   3965  C  CA  . HIS A  1  522 ? 24.667  -7.087  81.590   1.00 276.60 ? 522  HIS A CA  1 
ATOM   3966  C  C   . HIS A  1  522 ? 24.705  -7.036  80.073   1.00 268.40 ? 522  HIS A C   1 
ATOM   3967  O  O   . HIS A  1  522 ? 24.017  -7.812  79.403   1.00 253.77 ? 522  HIS A O   1 
ATOM   3968  C  CB  . HIS A  1  522 ? 25.280  -8.404  82.094   1.00 270.74 ? 522  HIS A CB  1 
ATOM   3969  C  CG  . HIS A  1  522 ? 26.686  -8.637  81.627   1.00 268.11 ? 522  HIS A CG  1 
ATOM   3970  N  ND1 . HIS A  1  522 ? 26.988  -9.383  80.507   1.00 260.62 ? 522  HIS A ND1 1 
ATOM   3971  C  CD2 . HIS A  1  522 ? 27.872  -8.215  82.127   1.00 271.11 ? 522  HIS A CD2 1 
ATOM   3972  C  CE1 . HIS A  1  522 ? 28.298  -9.415  80.341   1.00 262.57 ? 522  HIS A CE1 1 
ATOM   3973  N  NE2 . HIS A  1  522 ? 28.858  -8.713  81.310   1.00 270.64 ? 522  HIS A NE2 1 
ATOM   3974  N  N   . SER A  1  523 ? 25.504  -6.123  79.538   1.00 268.82 ? 523  SER A N   1 
ATOM   3975  C  CA  . SER A  1  523 ? 25.686  -5.993  78.104   1.00 255.17 ? 523  SER A CA  1 
ATOM   3976  C  C   . SER A  1  523 ? 27.004  -6.641  77.708   1.00 261.56 ? 523  SER A C   1 
ATOM   3977  O  O   . SER A  1  523 ? 27.986  -6.593  78.453   1.00 267.41 ? 523  SER A O   1 
ATOM   3978  C  CB  . SER A  1  523 ? 25.675  -4.522  77.684   1.00 253.15 ? 523  SER A CB  1 
ATOM   3979  O  OG  . SER A  1  523 ? 25.796  -4.390  76.281   1.00 254.55 ? 523  SER A OG  1 
ATOM   3980  N  N   . LYS A  1  524 ? 27.017  -7.248  76.524   1.00 261.26 ? 524  LYS A N   1 
ATOM   3981  C  CA  . LYS A  1  524 ? 28.214  -7.907  76.025   1.00 262.89 ? 524  LYS A CA  1 
ATOM   3982  C  C   . LYS A  1  524 ? 28.181  -7.904  74.508   1.00 261.14 ? 524  LYS A C   1 
ATOM   3983  O  O   . LYS A  1  524 ? 27.194  -8.326  73.896   1.00 244.72 ? 524  LYS A O   1 
ATOM   3984  C  CB  . LYS A  1  524 ? 28.335  -9.342  76.550   1.00 251.00 ? 524  LYS A CB  1 
ATOM   3985  C  CG  . LYS A  1  524 ? 29.551  -10.092 76.013   1.00 246.16 ? 524  LYS A CG  1 
ATOM   3986  C  CD  . LYS A  1  524 ? 30.858  -9.417  76.418   1.00 240.39 ? 524  LYS A CD  1 
ATOM   3987  C  CE  . LYS A  1  524 ? 32.048  -9.996  75.664   1.00 237.35 ? 524  LYS A CE  1 
ATOM   3988  N  NZ  . LYS A  1  524 ? 32.280  -11.432 75.966   1.00 235.85 ? 524  LYS A NZ  1 
ATOM   3989  N  N   . ASN A  1  525 ? 29.264  -7.419  73.914   1.00 271.04 ? 525  ASN A N   1 
ATOM   3990  C  CA  . ASN A  1  525 ? 29.431  -7.404  72.470   1.00 260.50 ? 525  ASN A CA  1 
ATOM   3991  C  C   . ASN A  1  525 ? 30.069  -8.727  72.070   1.00 261.41 ? 525  ASN A C   1 
ATOM   3992  O  O   . ASN A  1  525 ? 31.131  -9.091  72.588   1.00 270.25 ? 525  ASN A O   1 
ATOM   3993  C  CB  . ASN A  1  525 ? 30.296  -6.203  72.081   1.00 270.52 ? 525  ASN A CB  1 
ATOM   3994  C  CG  . ASN A  1  525 ? 29.578  -4.893  72.337   1.00 296.78 ? 525  ASN A CG  1 
ATOM   3995  O  OD1 . ASN A  1  525 ? 28.355  -4.821  72.201   1.00 262.29 ? 525  ASN A OD1 1 
ATOM   3996  N  ND2 . ASN A  1  525 ? 30.309  -3.867  72.749   1.00 410.05 ? 525  ASN A ND2 1 
ATOM   3997  N  N   . MET A  1  526 ? 29.447  -9.427  71.122   1.00 252.08 ? 526  MET A N   1 
ATOM   3998  C  CA  . MET A  1  526 ? 29.807  -10.814 70.837   1.00 251.92 ? 526  MET A CA  1 
ATOM   3999  C  C   . MET A  1  526 ? 30.077  -11.014 69.355   1.00 246.39 ? 526  MET A C   1 
ATOM   4000  O  O   . MET A  1  526 ? 29.155  -10.968 68.536   1.00 249.20 ? 526  MET A O   1 
ATOM   4001  C  CB  . MET A  1  526 ? 28.710  -11.770 71.311   1.00 253.33 ? 526  MET A CB  1 
ATOM   4002  C  CG  . MET A  1  526 ? 29.249  -13.109 71.787   1.00 261.18 ? 526  MET A CG  1 
ATOM   4003  S  SD  . MET A  1  526 ? 27.997  -14.352 72.157   1.00 265.24 ? 526  MET A SD  1 
ATOM   4004  C  CE  . MET A  1  526 ? 29.028  -15.806 72.359   1.00 260.62 ? 526  MET A CE  1 
ATOM   4005  N  N   . THR A  1  527 ? 31.344  -11.227 69.017   1.00 252.73 ? 527  THR A N   1 
ATOM   4006  C  CA  . THR A  1  527 ? 31.727  -11.716 67.702   1.00 253.34 ? 527  THR A CA  1 
ATOM   4007  C  C   . THR A  1  527 ? 31.694  -13.239 67.718   1.00 256.55 ? 527  THR A C   1 
ATOM   4008  O  O   . THR A  1  527 ? 32.458  -13.876 68.452   1.00 265.74 ? 527  THR A O   1 
ATOM   4009  C  CB  . THR A  1  527 ? 33.115  -11.211 67.316   1.00 259.30 ? 527  THR A CB  1 
ATOM   4010  O  OG1 . THR A  1  527 ? 33.071  -9.790  67.139   1.00 262.77 ? 527  THR A OG1 1 
ATOM   4011  C  CG2 . THR A  1  527 ? 33.588  -11.882 66.038   1.00 251.53 ? 527  THR A CG2 1 
ATOM   4012  N  N   . ILE A  1  528 ? 30.803  -13.821 66.922   1.00 246.10 ? 528  ILE A N   1 
ATOM   4013  C  CA  . ILE A  1  528 ? 30.754  -15.265 66.757   1.00 242.92 ? 528  ILE A CA  1 
ATOM   4014  C  C   . ILE A  1  528 ? 30.930  -15.571 65.280   1.00 248.09 ? 528  ILE A C   1 
ATOM   4015  O  O   . ILE A  1  528 ? 30.579  -14.768 64.408   1.00 246.23 ? 528  ILE A O   1 
ATOM   4016  C  CB  . ILE A  1  528 ? 29.449  -15.891 67.298   1.00 227.53 ? 528  ILE A CB  1 
ATOM   4017  C  CG1 . ILE A  1  528 ? 28.288  -15.662 66.333   1.00 226.88 ? 528  ILE A CG1 1 
ATOM   4018  C  CG2 . ILE A  1  528 ? 29.108  -15.320 68.658   1.00 230.35 ? 528  ILE A CG2 1 
ATOM   4019  C  CD1 . ILE A  1  528 ? 27.019  -16.346 66.765   1.00 228.05 ? 528  ILE A CD1 1 
ATOM   4020  N  N   . SER A  1  529 ? 31.466  -16.754 65.000   1.00 255.30 ? 529  SER A N   1 
ATOM   4021  C  CA  . SER A  1  529 ? 31.700  -17.203 63.636   1.00 254.16 ? 529  SER A CA  1 
ATOM   4022  C  C   . SER A  1  529 ? 30.647  -18.228 63.258   1.00 231.66 ? 529  SER A C   1 
ATOM   4023  O  O   . SER A  1  529 ? 30.365  -19.157 64.025   1.00 227.03 ? 529  SER A O   1 
ATOM   4024  C  CB  . SER A  1  529 ? 33.097  -17.808 63.476   1.00 265.00 ? 529  SER A CB  1 
ATOM   4025  O  OG  . SER A  1  529 ? 33.217  -19.003 64.225   1.00 262.65 ? 529  SER A OG  1 
ATOM   4026  N  N   . ARG A  1  530 ? 30.060  -18.046 62.088   1.00 229.31 ? 530  ARG A N   1 
ATOM   4027  C  CA  . ARG A  1  530 ? 29.067  -18.984 61.609   1.00 230.15 ? 530  ARG A CA  1 
ATOM   4028  C  C   . ARG A  1  530 ? 29.739  -20.264 61.127   1.00 228.51 ? 530  ARG A C   1 
ATOM   4029  O  O   . ARG A  1  530 ? 30.887  -20.257 60.673   1.00 226.70 ? 530  ARG A O   1 
ATOM   4030  C  CB  . ARG A  1  530 ? 28.238  -18.337 60.494   1.00 241.14 ? 530  ARG A CB  1 
ATOM   4031  C  CG  . ARG A  1  530 ? 28.776  -18.548 59.090   1.00 241.37 ? 530  ARG A CG  1 
ATOM   4032  C  CD  . ARG A  1  530 ? 27.947  -17.784 58.066   1.00 224.84 ? 530  ARG A CD  1 
ATOM   4033  N  NE  . ARG A  1  530 ? 28.298  -18.159 56.699   1.00 221.81 ? 530  ARG A NE  1 
ATOM   4034  C  CZ  . ARG A  1  530 ? 29.366  -17.699 56.053   1.00 231.12 ? 530  ARG A CZ  1 
ATOM   4035  N  NH1 . ARG A  1  530 ? 30.202  -16.871 56.659   1.00 243.54 ? 530  ARG A NH1 1 
ATOM   4036  N  NH2 . ARG A  1  530 ? 29.616  -18.091 54.811   1.00 227.69 ? 530  ARG A NH2 1 
ATOM   4037  N  N   . GLY A  1  531 ? 29.019  -21.376 61.267   1.00 233.44 ? 531  GLY A N   1 
ATOM   4038  C  CA  . GLY A  1  531 ? 29.455  -22.652 60.732   1.00 237.75 ? 531  GLY A CA  1 
ATOM   4039  C  C   . GLY A  1  531 ? 30.414  -23.463 61.579   1.00 235.66 ? 531  GLY A C   1 
ATOM   4040  O  O   . GLY A  1  531 ? 30.423  -24.697 61.500   1.00 230.76 ? 531  GLY A O   1 
ATOM   4041  N  N   . GLY A  1  532 ? 31.223  -22.793 62.395   1.00 248.21 ? 532  GLY A N   1 
ATOM   4042  C  CA  . GLY A  1  532 ? 32.259  -23.482 63.141   1.00 254.82 ? 532  GLY A CA  1 
ATOM   4043  C  C   . GLY A  1  532 ? 31.750  -24.319 64.295   1.00 254.40 ? 532  GLY A C   1 
ATOM   4044  O  O   . GLY A  1  532 ? 31.591  -25.534 64.162   1.00 255.93 ? 532  GLY A O   1 
ATOM   4045  N  N   . LEU A  1  533 ? 31.457  -23.671 65.419   1.00 253.29 ? 533  LEU A N   1 
ATOM   4046  C  CA  . LEU A  1  533 ? 30.965  -24.337 66.616   1.00 249.03 ? 533  LEU A CA  1 
ATOM   4047  C  C   . LEU A  1  533 ? 30.120  -23.332 67.381   1.00 249.82 ? 533  LEU A C   1 
ATOM   4048  O  O   . LEU A  1  533 ? 30.135  -22.134 67.092   1.00 259.19 ? 533  LEU A O   1 
ATOM   4049  C  CB  . LEU A  1  533 ? 32.102  -24.865 67.514   1.00 232.64 ? 533  LEU A CB  1 
ATOM   4050  C  CG  . LEU A  1  533 ? 33.216  -25.810 67.042   1.00 221.21 ? 533  LEU A CG  1 
ATOM   4051  C  CD1 . LEU A  1  533 ? 34.291  -25.940 68.115   1.00 224.45 ? 533  LEU A CD1 1 
ATOM   4052  C  CD2 . LEU A  1  533 ? 32.663  -27.179 66.690   1.00 222.30 ? 533  LEU A CD2 1 
ATOM   4053  N  N   . MET A  1  534 ? 29.357  -23.827 68.346   1.00 238.53 ? 534  MET A N   1 
ATOM   4054  C  CA  . MET A  1  534 ? 28.543  -22.944 69.167   1.00 236.71 ? 534  MET A CA  1 
ATOM   4055  C  C   . MET A  1  534 ? 29.406  -22.313 70.252   1.00 244.49 ? 534  MET A C   1 
ATOM   4056  O  O   . MET A  1  534 ? 30.068  -23.020 71.016   1.00 247.06 ? 534  MET A O   1 
ATOM   4057  C  CB  . MET A  1  534 ? 27.380  -23.717 69.787   1.00 237.54 ? 534  MET A CB  1 
ATOM   4058  C  CG  . MET A  1  534 ? 26.416  -22.860 70.586   1.00 242.85 ? 534  MET A CG  1 
ATOM   4059  S  SD  . MET A  1  534 ? 25.184  -23.868 71.428   1.00 246.32 ? 534  MET A SD  1 
ATOM   4060  C  CE  . MET A  1  534 ? 24.496  -24.787 70.056   1.00 245.06 ? 534  MET A CE  1 
ATOM   4061  N  N   . GLN A  1  535 ? 29.401  -20.983 70.322   1.00 244.05 ? 535  GLN A N   1 
ATOM   4062  C  CA  . GLN A  1  535 ? 30.131  -20.269 71.365   1.00 243.91 ? 535  GLN A CA  1 
ATOM   4063  C  C   . GLN A  1  535 ? 29.190  -19.961 72.522   1.00 248.06 ? 535  GLN A C   1 
ATOM   4064  O  O   . GLN A  1  535 ? 28.148  -19.327 72.331   1.00 244.99 ? 535  GLN A O   1 
ATOM   4065  C  CB  . GLN A  1  535 ? 30.754  -18.982 70.829   1.00 239.56 ? 535  GLN A CB  1 
ATOM   4066  C  CG  . GLN A  1  535 ? 32.102  -19.174 70.160   1.00 236.57 ? 535  GLN A CG  1 
ATOM   4067  C  CD  . GLN A  1  535 ? 32.619  -17.899 69.534   1.00 236.41 ? 535  GLN A CD  1 
ATOM   4068  O  OE1 . GLN A  1  535 ? 31.845  -17.008 69.192   1.00 241.31 ? 535  GLN A OE1 1 
ATOM   4069  N  NE2 . GLN A  1  535 ? 33.932  -17.803 69.381   1.00 234.60 ? 535  GLN A NE2 1 
ATOM   4070  N  N   . CYS A  1  536 ? 29.565  -20.402 73.718   1.00 263.32 ? 536  CYS A N   1 
ATOM   4071  C  CA  . CYS A  1  536 ? 28.757  -20.246 74.916   1.00 267.87 ? 536  CYS A CA  1 
ATOM   4072  C  C   . CYS A  1  536 ? 29.559  -19.488 75.971   1.00 266.96 ? 536  CYS A C   1 
ATOM   4073  O  O   . CYS A  1  536 ? 30.789  -19.427 75.909   1.00 269.46 ? 536  CYS A O   1 
ATOM   4074  C  CB  . CYS A  1  536 ? 28.310  -21.622 75.432   1.00 283.08 ? 536  CYS A CB  1 
ATOM   4075  S  SG  . CYS A  1  536 ? 26.848  -21.646 76.475   1.00 305.18 ? 536  CYS A SG  1 
ATOM   4076  N  N   . GLU A  1  537 ? 28.856  -18.906 76.947   1.00 267.56 ? 537  GLU A N   1 
ATOM   4077  C  CA  . GLU A  1  537 ? 29.520  -18.136 77.996   1.00 274.76 ? 537  GLU A CA  1 
ATOM   4078  C  C   . GLU A  1  537 ? 28.726  -18.193 79.296   1.00 278.02 ? 537  GLU A C   1 
ATOM   4079  O  O   . GLU A  1  537 ? 27.504  -18.012 79.291   1.00 278.35 ? 537  GLU A O   1 
ATOM   4080  C  CB  . GLU A  1  537 ? 29.708  -16.679 77.556   1.00 272.37 ? 537  GLU A CB  1 
ATOM   4081  C  CG  . GLU A  1  537 ? 30.061  -15.725 78.681   1.00 286.40 ? 537  GLU A CG  1 
ATOM   4082  C  CD  . GLU A  1  537 ? 30.370  -14.328 78.181   1.00 294.20 ? 537  GLU A CD  1 
ATOM   4083  O  OE1 . GLU A  1  537 ? 30.955  -14.202 77.084   1.00 296.82 ? 537  GLU A OE1 1 
ATOM   4084  O  OE2 . GLU A  1  537 ? 30.034  -13.356 78.889   1.00 296.47 ? 537  GLU A OE2 1 
ATOM   4085  N  N   . GLU A  1  538 ? 29.424  -18.441 80.404   1.00 274.53 ? 538  GLU A N   1 
ATOM   4086  C  CA  . GLU A  1  538 ? 28.825  -18.527 81.728   1.00 272.89 ? 538  GLU A CA  1 
ATOM   4087  C  C   . GLU A  1  538 ? 29.128  -17.276 82.556   1.00 280.50 ? 538  GLU A C   1 
ATOM   4088  O  O   . GLU A  1  538 ? 30.137  -16.597 82.348   1.00 280.28 ? 538  GLU A O   1 
ATOM   4089  C  CB  . GLU A  1  538 ? 29.328  -19.781 82.449   1.00 273.10 ? 538  GLU A CB  1 
ATOM   4090  C  CG  . GLU A  1  538 ? 28.543  -20.165 83.691   1.00 278.07 ? 538  GLU A CG  1 
ATOM   4091  C  CD  . GLU A  1  538 ? 29.217  -21.271 84.481   1.00 287.25 ? 538  GLU A CD  1 
ATOM   4092  O  OE1 . GLU A  1  538 ? 30.268  -21.768 84.028   1.00 293.65 ? 538  GLU A OE1 1 
ATOM   4093  O  OE2 . GLU A  1  538 ? 28.697  -21.642 85.554   1.00 288.56 ? 538  GLU A OE2 1 
ATOM   4094  N  N   . LEU A  1  539 ? 28.234  -16.975 83.501   1.00 284.97 ? 539  LEU A N   1 
ATOM   4095  C  CA  . LEU A  1  539 ? 28.377  -15.819 84.380   1.00 289.92 ? 539  LEU A CA  1 
ATOM   4096  C  C   . LEU A  1  539 ? 27.502  -16.047 85.608   1.00 282.67 ? 539  LEU A C   1 
ATOM   4097  O  O   . LEU A  1  539 ? 26.525  -16.798 85.550   1.00 286.23 ? 539  LEU A O   1 
ATOM   4098  C  CB  . LEU A  1  539 ? 28.000  -14.521 83.657   1.00 286.55 ? 539  LEU A CB  1 
ATOM   4099  C  CG  . LEU A  1  539 ? 28.609  -13.210 84.163   1.00 287.53 ? 539  LEU A CG  1 
ATOM   4100  C  CD1 . LEU A  1  539 ? 30.135  -13.248 84.102   1.00 285.45 ? 539  LEU A CD1 1 
ATOM   4101  C  CD2 . LEU A  1  539 ? 28.078  -12.041 83.349   1.00 286.47 ? 539  LEU A CD2 1 
ATOM   4102  N  N   . ILE A  1  540 ? 27.853  -15.398 86.720   1.00 251.72 ? 540  ILE A N   1 
ATOM   4103  C  CA  . ILE A  1  540 ? 27.192  -15.631 88.004   1.00 239.64 ? 540  ILE A CA  1 
ATOM   4104  C  C   . ILE A  1  540 ? 26.316  -14.440 88.378   1.00 241.70 ? 540  ILE A C   1 
ATOM   4105  O  O   . ILE A  1  540 ? 26.772  -13.291 88.358   1.00 241.66 ? 540  ILE A O   1 
ATOM   4106  C  CB  . ILE A  1  540 ? 28.209  -15.923 89.118   1.00 240.30 ? 540  ILE A CB  1 
ATOM   4107  C  CG1 . ILE A  1  540 ? 28.975  -17.211 88.816   1.00 239.35 ? 540  ILE A CG1 1 
ATOM   4108  C  CG2 . ILE A  1  540 ? 27.522  -16.015 90.464   1.00 241.72 ? 540  ILE A CG2 1 
ATOM   4109  C  CD1 . ILE A  1  540 ? 29.952  -17.602 89.901   1.00 239.93 ? 540  ILE A CD1 1 
ATOM   4110  N  N   . ALA A  1  541 ? 25.054  -14.723 88.707   1.00 265.10 ? 541  ALA A N   1 
ATOM   4111  C  CA  . ALA A  1  541 ? 24.117  -13.755 89.261   1.00 266.29 ? 541  ALA A CA  1 
ATOM   4112  C  C   . ALA A  1  541 ? 23.600  -14.265 90.602   1.00 262.95 ? 541  ALA A C   1 
ATOM   4113  O  O   . ALA A  1  541 ? 23.584  -15.472 90.855   1.00 264.30 ? 541  ALA A O   1 
ATOM   4114  C  CB  . ALA A  1  541 ? 22.951  -13.478 88.305   1.00 269.61 ? 541  ALA A CB  1 
ATOM   4115  N  N   . TYR A  1  542 ? 23.195  -13.342 91.476   1.00 265.10 ? 542  TYR A N   1 
ATOM   4116  C  CA  . TYR A  1  542 ? 22.719  -13.713 92.801   1.00 272.62 ? 542  TYR A CA  1 
ATOM   4117  C  C   . TYR A  1  542 ? 21.386  -13.056 93.140   1.00 267.15 ? 542  TYR A C   1 
ATOM   4118  O  O   . TYR A  1  542 ? 20.975  -12.065 92.529   1.00 264.58 ? 542  TYR A O   1 
ATOM   4119  C  CB  . TYR A  1  542 ? 23.744  -13.345 93.876   1.00 283.32 ? 542  TYR A CB  1 
ATOM   4120  C  CG  . TYR A  1  542 ? 23.873  -11.867 94.139   1.00 289.59 ? 542  TYR A CG  1 
ATOM   4121  C  CD1 . TYR A  1  542 ? 24.684  -11.066 93.348   1.00 294.59 ? 542  TYR A CD1 1 
ATOM   4122  C  CD2 . TYR A  1  542 ? 23.189  -11.273 95.191   1.00 289.75 ? 542  TYR A CD2 1 
ATOM   4123  C  CE1 . TYR A  1  542 ? 24.809  -9.713  93.597   1.00 294.65 ? 542  TYR A CE1 1 
ATOM   4124  C  CE2 . TYR A  1  542 ? 23.304  -9.922  95.447   1.00 293.59 ? 542  TYR A CE2 1 
ATOM   4125  C  CZ  . TYR A  1  542 ? 24.117  -9.146  94.646   1.00 293.25 ? 542  TYR A CZ  1 
ATOM   4126  O  OH  . TYR A  1  542 ? 24.242  -7.798  94.892   1.00 292.68 ? 542  TYR A OH  1 
ATOM   4127  N  N   . LEU A  1  543 ? 20.712  -13.649 94.127   1.00 271.81 ? 543  LEU A N   1 
ATOM   4128  C  CA  . LEU A  1  543 ? 19.474  -13.135 94.693   1.00 273.71 ? 543  LEU A CA  1 
ATOM   4129  C  C   . LEU A  1  543 ? 19.763  -12.193 95.863   1.00 281.72 ? 543  LEU A C   1 
ATOM   4130  O  O   . LEU A  1  543 ? 20.756  -12.345 96.578   1.00 285.25 ? 543  LEU A O   1 
ATOM   4131  C  CB  . LEU A  1  543 ? 18.586  -14.294 95.157   1.00 273.31 ? 543  LEU A CB  1 
ATOM   4132  C  CG  . LEU A  1  543 ? 17.273  -13.983 95.882   1.00 276.18 ? 543  LEU A CG  1 
ATOM   4133  C  CD1 . LEU A  1  543 ? 16.283  -13.269 94.961   1.00 277.99 ? 543  LEU A CD1 1 
ATOM   4134  C  CD2 . LEU A  1  543 ? 16.655  -15.249 96.460   1.00 279.33 ? 543  LEU A CD2 1 
ATOM   4135  N  N   . ARG A  1  544 ? 18.857  -11.237 96.072   1.00 284.68 ? 544  ARG A N   1 
ATOM   4136  C  CA  . ARG A  1  544 ? 18.913  -10.347 97.225   1.00 292.91 ? 544  ARG A CA  1 
ATOM   4137  C  C   . ARG A  1  544 ? 18.506  -11.053 98.524   1.00 290.21 ? 544  ARG A C   1 
ATOM   4138  O  O   . ARG A  1  544 ? 17.821  -12.079 98.529   1.00 285.58 ? 544  ARG A O   1 
ATOM   4139  C  CB  . ARG A  1  544 ? 18.026  -9.120  97.012   1.00 293.91 ? 544  ARG A CB  1 
ATOM   4140  C  CG  . ARG A  1  544 ? 18.562  -8.097  96.011   1.00 288.34 ? 544  ARG A CG  1 
ATOM   4141  C  CD  . ARG A  1  544 ? 17.842  -6.764  96.203   1.00 283.14 ? 544  ARG A CD  1 
ATOM   4142  N  NE  . ARG A  1  544 ? 18.410  -5.668  95.422   1.00 284.24 ? 544  ARG A NE  1 
ATOM   4143  C  CZ  . ARG A  1  544 ? 18.276  -5.527  94.108   1.00 291.84 ? 544  ARG A CZ  1 
ATOM   4144  N  NH1 . ARG A  1  544 ? 17.606  -6.427  93.401   1.00 295.61 ? 544  ARG A NH1 1 
ATOM   4145  N  NH2 . ARG A  1  544 ? 18.824  -4.486  93.497   1.00 293.34 ? 544  ARG A NH2 1 
ATOM   4146  N  N   . ASP A  1  545 ? 18.956  -10.472 99.639   1.00 292.06 ? 545  ASP A N   1 
ATOM   4147  C  CA  . ASP A  1  545 ? 18.654  -10.946 100.986  1.00 285.02 ? 545  ASP A CA  1 
ATOM   4148  C  C   . ASP A  1  545 ? 17.146  -11.014 101.247  1.00 296.87 ? 545  ASP A C   1 
ATOM   4149  O  O   . ASP A  1  545 ? 16.337  -10.344 100.598  1.00 301.47 ? 545  ASP A O   1 
ATOM   4150  C  CB  . ASP A  1  545 ? 19.329  -10.040 102.013  1.00 281.22 ? 545  ASP A CB  1 
ATOM   4151  C  CG  . ASP A  1  545 ? 19.141  -10.524 103.432  1.00 290.26 ? 545  ASP A CG  1 
ATOM   4152  O  OD1 . ASP A  1  545 ? 19.936  -11.373 103.882  1.00 293.80 ? 545  ASP A OD1 1 
ATOM   4153  O  OD2 . ASP A  1  545 ? 18.190  -10.060 104.095  1.00 296.95 ? 545  ASP A OD2 1 
ATOM   4154  N  N   . GLU A  1  546 ? 16.781  -11.859 102.218  1.00 312.05 ? 546  GLU A N   1 
ATOM   4155  C  CA  . GLU A  1  546 ? 15.378  -12.038 102.591  1.00 315.91 ? 546  GLU A CA  1 
ATOM   4156  C  C   . GLU A  1  546 ? 14.759  -10.748 103.121  1.00 312.11 ? 546  GLU A C   1 
ATOM   4157  O  O   . GLU A  1  546 ? 13.623  -10.409 102.768  1.00 307.10 ? 546  GLU A O   1 
ATOM   4158  C  CB  . GLU A  1  546 ? 15.255  -13.148 103.639  1.00 314.19 ? 546  GLU A CB  1 
ATOM   4159  C  CG  . GLU A  1  546 ? 13.822  -13.460 104.063  1.00 309.66 ? 546  GLU A CG  1 
ATOM   4160  C  CD  . GLU A  1  546 ? 13.746  -14.581 105.081  1.00 303.68 ? 546  GLU A CD  1 
ATOM   4161  O  OE1 . GLU A  1  546 ? 14.815  -15.094 105.468  1.00 298.47 ? 546  GLU A OE1 1 
ATOM   4162  O  OE2 . GLU A  1  546 ? 12.626  -14.942 105.507  1.00 302.23 ? 546  GLU A OE2 1 
ATOM   4163  N  N   . SER A  1  547 ? 15.492  -10.008 103.959  1.00 312.02 ? 547  SER A N   1 
ATOM   4164  C  CA  . SER A  1  547 ? 14.941  -8.827  104.617  1.00 309.82 ? 547  SER A CA  1 
ATOM   4165  C  C   . SER A  1  547 ? 14.806  -7.630  103.683  1.00 319.58 ? 547  SER A C   1 
ATOM   4166  O  O   . SER A  1  547 ? 14.195  -6.627  104.073  1.00 325.20 ? 547  SER A O   1 
ATOM   4167  C  CB  . SER A  1  547 ? 15.804  -8.444  105.830  1.00 288.07 ? 547  SER A CB  1 
ATOM   4168  O  OG  . SER A  1  547 ? 15.771  -9.441  106.838  1.00 278.29 ? 547  SER A OG  1 
ATOM   4169  N  N   . GLU A  1  548 ? 15.356  -7.710  102.473  1.00 307.00 ? 548  GLU A N   1 
ATOM   4170  C  CA  . GLU A  1  548 ? 15.336  -6.610  101.518  1.00 294.69 ? 548  GLU A CA  1 
ATOM   4171  C  C   . GLU A  1  548 ? 14.068  -6.569  100.675  1.00 280.92 ? 548  GLU A C   1 
ATOM   4172  O  O   . GLU A  1  548 ? 13.815  -5.553  100.015  1.00 280.64 ? 548  GLU A O   1 
ATOM   4173  C  CB  . GLU A  1  548 ? 16.568  -6.693  100.607  1.00 287.03 ? 548  GLU A CB  1 
ATOM   4174  C  CG  . GLU A  1  548 ? 17.888  -6.559  101.360  1.00 281.42 ? 548  GLU A CG  1 
ATOM   4175  C  CD  . GLU A  1  548 ? 19.091  -6.449  100.441  1.00 274.05 ? 548  GLU A CD  1 
ATOM   4176  O  OE1 . GLU A  1  548 ? 20.194  -6.142  100.939  1.00 275.56 ? 548  GLU A OE1 1 
ATOM   4177  O  OE2 . GLU A  1  548 ? 18.935  -6.664  99.223   1.00 273.36 ? 548  GLU A OE2 1 
ATOM   4178  N  N   . PHE A  1  549 ? 13.277  -7.639  100.670  1.00 276.47 ? 549  PHE A N   1 
ATOM   4179  C  CA  . PHE A  1  549 ? 12.024  -7.661  99.919   1.00 283.95 ? 549  PHE A CA  1 
ATOM   4180  C  C   . PHE A  1  549 ? 11.135  -8.757  100.487  1.00 292.19 ? 549  PHE A C   1 
ATOM   4181  O  O   . PHE A  1  549 ? 11.570  -9.907  100.607  1.00 291.67 ? 549  PHE A O   1 
ATOM   4182  C  CB  . PHE A  1  549 ? 12.281  -7.871  98.422   1.00 279.40 ? 549  PHE A CB  1 
ATOM   4183  C  CG  . PHE A  1  549 ? 12.908  -9.194  98.090   1.00 284.35 ? 549  PHE A CG  1 
ATOM   4184  C  CD1 . PHE A  1  549 ? 14.278  -9.363  98.183   1.00 294.67 ? 549  PHE A CD1 1 
ATOM   4185  C  CD2 . PHE A  1  549 ? 12.132  -10.267 97.682   1.00 286.24 ? 549  PHE A CD2 1 
ATOM   4186  C  CE1 . PHE A  1  549 ? 14.865  -10.575 97.882   1.00 303.78 ? 549  PHE A CE1 1 
ATOM   4187  C  CE2 . PHE A  1  549 ? 12.715  -11.488 97.381   1.00 296.71 ? 549  PHE A CE2 1 
ATOM   4188  C  CZ  . PHE A  1  549 ? 14.086  -11.639 97.480   1.00 305.54 ? 549  PHE A CZ  1 
ATOM   4189  N  N   . ARG A  1  550 ? 9.910   -8.395  100.877  1.00 294.60 ? 550  ARG A N   1 
ATOM   4190  C  CA  . ARG A  1  550 ? 8.946   -9.372  101.372  1.00 290.40 ? 550  ARG A CA  1 
ATOM   4191  C  C   . ARG A  1  550 ? 8.275   -10.146 100.247  1.00 289.47 ? 550  ARG A C   1 
ATOM   4192  O  O   . ARG A  1  550 ? 7.572   -11.127 100.519  1.00 290.82 ? 550  ARG A O   1 
ATOM   4193  C  CB  . ARG A  1  550 ? 7.883   -8.682  102.237  1.00 282.26 ? 550  ARG A CB  1 
ATOM   4194  C  CG  . ARG A  1  550 ? 7.294   -7.414  101.632  1.00 277.18 ? 550  ARG A CG  1 
ATOM   4195  C  CD  . ARG A  1  550 ? 6.258   -6.788  102.560  1.00 271.80 ? 550  ARG A CD  1 
ATOM   4196  N  NE  . ARG A  1  550 ? 5.521   -5.697  101.926  1.00 267.06 ? 550  ARG A NE  1 
ATOM   4197  C  CZ  . ARG A  1  550 ? 5.815   -4.408  102.067  1.00 268.08 ? 550  ARG A CZ  1 
ATOM   4198  N  NH1 . ARG A  1  550 ? 6.836   -4.032  102.826  1.00 268.26 ? 550  ARG A NH1 1 
ATOM   4199  N  NH2 . ARG A  1  550 ? 5.081   -3.490  101.451  1.00 269.32 ? 550  ARG A NH2 1 
ATOM   4200  N  N   . ASP A  1  551 ? 8.475   -9.726  99.001   1.00 287.81 ? 551  ASP A N   1 
ATOM   4201  C  CA  . ASP A  1  551 ? 7.823   -10.317 97.835   1.00 282.70 ? 551  ASP A CA  1 
ATOM   4202  C  C   . ASP A  1  551 ? 8.615   -11.545 97.398   1.00 285.36 ? 551  ASP A C   1 
ATOM   4203  O  O   . ASP A  1  551 ? 9.531   -11.463 96.578   1.00 288.65 ? 551  ASP A O   1 
ATOM   4204  C  CB  . ASP A  1  551 ? 7.722   -9.286  96.717   1.00 279.40 ? 551  ASP A CB  1 
ATOM   4205  C  CG  . ASP A  1  551 ? 6.731   -9.682  95.639   1.00 286.53 ? 551  ASP A CG  1 
ATOM   4206  O  OD1 . ASP A  1  551 ? 6.411   -10.883 95.512   1.00 285.80 ? 551  ASP A OD1 1 
ATOM   4207  O  OD2 . ASP A  1  551 ? 6.275   -8.779  94.906   1.00 294.50 ? 551  ASP A OD2 1 
ATOM   4208  N  N   . LYS A  1  552 ? 8.248   -12.709 97.940   1.00 290.42 ? 552  LYS A N   1 
ATOM   4209  C  CA  . LYS A  1  552 ? 8.878   -13.975 97.579   1.00 291.73 ? 552  LYS A CA  1 
ATOM   4210  C  C   . LYS A  1  552 ? 7.951   -14.857 96.752   1.00 293.90 ? 552  LYS A C   1 
ATOM   4211  O  O   . LYS A  1  552 ? 8.204   -16.058 96.608   1.00 300.69 ? 552  LYS A O   1 
ATOM   4212  C  CB  . LYS A  1  552 ? 9.341   -14.734 98.824   1.00 289.50 ? 552  LYS A CB  1 
ATOM   4213  C  CG  . LYS A  1  552 ? 10.561  -14.159 99.522   1.00 283.95 ? 552  LYS A CG  1 
ATOM   4214  C  CD  . LYS A  1  552 ? 10.160  -13.245 100.657  1.00 279.82 ? 552  LYS A CD  1 
ATOM   4215  C  CE  . LYS A  1  552 ? 11.337  -12.953 101.561  1.00 280.27 ? 552  LYS A CE  1 
ATOM   4216  N  NZ  . LYS A  1  552 ? 10.961  -12.055 102.685  1.00 291.19 ? 552  LYS A NZ  1 
ATOM   4217  N  N   . LEU A  1  553 ? 6.886   -14.280 96.199   1.00 284.84 ? 553  LEU A N   1 
ATOM   4218  C  CA  . LEU A  1  553 ? 5.901   -15.027 95.431   1.00 279.49 ? 553  LEU A CA  1 
ATOM   4219  C  C   . LEU A  1  553 ? 5.990   -14.779 93.934   1.00 277.20 ? 553  LEU A C   1 
ATOM   4220  O  O   . LEU A  1  553 ? 5.569   -15.634 93.153   1.00 276.01 ? 553  LEU A O   1 
ATOM   4221  C  CB  . LEU A  1  553 ? 4.479   -14.689 95.905   1.00 276.30 ? 553  LEU A CB  1 
ATOM   4222  C  CG  . LEU A  1  553 ? 4.106   -14.872 97.382   1.00 268.17 ? 553  LEU A CG  1 
ATOM   4223  C  CD1 . LEU A  1  553 ? 4.726   -16.141 97.955   1.00 271.85 ? 553  LEU A CD1 1 
ATOM   4224  C  CD2 . LEU A  1  553 ? 4.470   -13.651 98.217   1.00 264.48 ? 553  LEU A CD2 1 
ATOM   4225  N  N   . THR A  1  554 ? 6.514   -13.631 93.519   1.00 271.39 ? 554  THR A N   1 
ATOM   4226  C  CA  . THR A  1  554 ? 6.609   -13.250 92.115   1.00 268.16 ? 554  THR A CA  1 
ATOM   4227  C  C   . THR A  1  554 ? 7.756   -14.002 91.446   1.00 277.87 ? 554  THR A C   1 
ATOM   4228  O  O   . THR A  1  554 ? 8.924   -13.677 91.696   1.00 297.63 ? 554  THR A O   1 
ATOM   4229  C  CB  . THR A  1  554 ? 6.811   -11.739 91.984   1.00 265.07 ? 554  THR A CB  1 
ATOM   4230  O  OG1 . THR A  1  554 ? 5.728   -11.051 92.621   1.00 265.19 ? 554  THR A OG1 1 
ATOM   4231  C  CG2 . THR A  1  554 ? 6.866   -11.336 90.522   1.00 262.71 ? 554  THR A CG2 1 
ATOM   4232  N  N   . PRO A  1  555 ? 7.477   -15.044 90.656   1.00 261.43 ? 555  PRO A N   1 
ATOM   4233  C  CA  . PRO A  1  555 ? 8.562   -15.809 90.021   1.00 256.57 ? 555  PRO A CA  1 
ATOM   4234  C  C   . PRO A  1  555 ? 9.534   -14.921 89.251   1.00 251.79 ? 555  PRO A C   1 
ATOM   4235  O  O   . PRO A  1  555 ? 9.133   -13.996 88.543   1.00 252.55 ? 555  PRO A O   1 
ATOM   4236  C  CB  . PRO A  1  555 ? 7.816   -16.773 89.092   1.00 253.04 ? 555  PRO A CB  1 
ATOM   4237  C  CG  . PRO A  1  555 ? 6.516   -16.108 88.825   1.00 253.02 ? 555  PRO A CG  1 
ATOM   4238  C  CD  . PRO A  1  555 ? 6.159   -15.402 90.100   1.00 253.22 ? 555  PRO A CD  1 
ATOM   4239  N  N   . ILE A  1  556 ? 10.825  -15.228 89.379   1.00 250.50 ? 556  ILE A N   1 
ATOM   4240  C  CA  . ILE A  1  556 ? 11.891  -14.407 88.807   1.00 251.03 ? 556  ILE A CA  1 
ATOM   4241  C  C   . ILE A  1  556 ? 12.191  -14.949 87.415   1.00 256.66 ? 556  ILE A C   1 
ATOM   4242  O  O   . ILE A  1  556 ? 12.808  -16.005 87.261   1.00 261.83 ? 556  ILE A O   1 
ATOM   4243  C  CB  . ILE A  1  556 ? 13.142  -14.398 89.686   1.00 252.73 ? 556  ILE A CB  1 
ATOM   4244  C  CG1 . ILE A  1  556 ? 12.797  -13.910 91.094   1.00 263.64 ? 556  ILE A CG1 1 
ATOM   4245  C  CG2 . ILE A  1  556 ? 14.227  -13.537 89.049   1.00 252.77 ? 556  ILE A CG2 1 
ATOM   4246  C  CD1 . ILE A  1  556 ? 13.990  -13.819 92.025   1.00 272.85 ? 556  ILE A CD1 1 
ATOM   4247  N  N   . THR A  1  557 ? 11.734  -14.229 86.397   1.00 258.42 ? 557  THR A N   1 
ATOM   4248  C  CA  . THR A  1  557 ? 11.949  -14.616 85.011   1.00 253.67 ? 557  THR A CA  1 
ATOM   4249  C  C   . THR A  1  557 ? 13.271  -14.030 84.530   1.00 249.46 ? 557  THR A C   1 
ATOM   4250  O  O   . THR A  1  557 ? 13.470  -12.810 84.582   1.00 243.80 ? 557  THR A O   1 
ATOM   4251  C  CB  . THR A  1  557 ? 10.791  -14.141 84.134   1.00 250.24 ? 557  THR A CB  1 
ATOM   4252  O  OG1 . THR A  1  557 ? 9.588   -14.818 84.520   1.00 252.10 ? 557  THR A OG1 1 
ATOM   4253  C  CG2 . THR A  1  557 ? 11.079  -14.426 82.673   1.00 251.75 ? 557  THR A CG2 1 
ATOM   4254  N  N   . ILE A  1  558 ? 14.169  -14.897 84.071   1.00 260.46 ? 558  ILE A N   1 
ATOM   4255  C  CA  . ILE A  1  558 ? 15.422  -14.474 83.453   1.00 259.66 ? 558  ILE A CA  1 
ATOM   4256  C  C   . ILE A  1  558 ? 15.156  -14.255 81.971   1.00 268.74 ? 558  ILE A C   1 
ATOM   4257  O  O   . ILE A  1  558 ? 14.792  -15.192 81.251   1.00 271.61 ? 558  ILE A O   1 
ATOM   4258  C  CB  . ILE A  1  558 ? 16.538  -15.512 83.659   1.00 250.16 ? 558  ILE A CB  1 
ATOM   4259  C  CG1 . ILE A  1  558 ? 16.932  -15.641 85.137   1.00 249.68 ? 558  ILE A CG1 1 
ATOM   4260  C  CG2 . ILE A  1  558 ? 17.750  -15.166 82.807   1.00 245.84 ? 558  ILE A CG2 1 
ATOM   4261  C  CD1 . ILE A  1  558 ? 16.090  -16.621 85.929   1.00 248.35 ? 558  ILE A CD1 1 
ATOM   4262  N  N   . PHE A  1  559 ? 15.354  -13.026 81.507   1.00 271.41 ? 559  PHE A N   1 
ATOM   4263  C  CA  . PHE A  1  559 ? 15.080  -12.665 80.124   1.00 270.73 ? 559  PHE A CA  1 
ATOM   4264  C  C   . PHE A  1  559 ? 16.395  -12.490 79.379   1.00 264.44 ? 559  PHE A C   1 
ATOM   4265  O  O   . PHE A  1  559 ? 17.297  -11.792 79.856   1.00 279.28 ? 559  PHE A O   1 
ATOM   4266  C  CB  . PHE A  1  559 ? 14.241  -11.386 80.045   1.00 270.99 ? 559  PHE A CB  1 
ATOM   4267  C  CG  . PHE A  1  559 ? 13.989  -10.915 78.641   1.00 264.12 ? 559  PHE A CG  1 
ATOM   4268  C  CD1 . PHE A  1  559 ? 13.046  -11.548 77.847   1.00 259.49 ? 559  PHE A CD1 1 
ATOM   4269  C  CD2 . PHE A  1  559 ? 14.699  -9.851  78.112   1.00 262.63 ? 559  PHE A CD2 1 
ATOM   4270  C  CE1 . PHE A  1  559 ? 12.813  -11.126 76.556   1.00 258.57 ? 559  PHE A CE1 1 
ATOM   4271  C  CE2 . PHE A  1  559 ? 14.470  -9.425  76.821   1.00 263.31 ? 559  PHE A CE2 1 
ATOM   4272  C  CZ  . PHE A  1  559 ? 13.531  -10.068 76.041   1.00 264.71 ? 559  PHE A CZ  1 
ATOM   4273  N  N   . MET A  1  560 ? 16.504  -13.129 78.219   1.00 250.87 ? 560  MET A N   1 
ATOM   4274  C  CA  . MET A  1  560 ? 17.681  -13.028 77.369   1.00 254.41 ? 560  MET A CA  1 
ATOM   4275  C  C   . MET A  1  560 ? 17.273  -12.484 76.010   1.00 264.86 ? 560  MET A C   1 
ATOM   4276  O  O   . MET A  1  560 ? 16.403  -13.056 75.346   1.00 273.93 ? 560  MET A O   1 
ATOM   4277  C  CB  . MET A  1  560 ? 18.360  -14.384 77.200   1.00 253.68 ? 560  MET A CB  1 
ATOM   4278  C  CG  . MET A  1  560 ? 19.444  -14.375 76.148   1.00 255.79 ? 560  MET A CG  1 
ATOM   4279  S  SD  . MET A  1  560 ? 20.129  -16.012 75.877   1.00 262.52 ? 560  MET A SD  1 
ATOM   4280  C  CE  . MET A  1  560 ? 21.092  -15.731 74.392   1.00 260.48 ? 560  MET A CE  1 
ATOM   4281  N  N   . GLU A  1  561 ? 17.917  -11.398 75.592   1.00 264.55 ? 561  GLU A N   1 
ATOM   4282  C  CA  . GLU A  1  561 ? 17.644  -10.743 74.321   1.00 262.39 ? 561  GLU A CA  1 
ATOM   4283  C  C   . GLU A  1  561 ? 18.924  -10.691 73.496   1.00 264.14 ? 561  GLU A C   1 
ATOM   4284  O  O   . GLU A  1  561 ? 20.015  -10.495 74.041   1.00 277.96 ? 561  GLU A O   1 
ATOM   4285  C  CB  . GLU A  1  561 ? 17.096  -9.327  74.549   1.00 259.29 ? 561  GLU A CB  1 
ATOM   4286  C  CG  . GLU A  1  561 ? 16.815  -8.529  73.286   1.00 257.83 ? 561  GLU A CG  1 
ATOM   4287  C  CD  . GLU A  1  561 ? 16.406  -7.098  73.588   1.00 261.71 ? 561  GLU A CD  1 
ATOM   4288  O  OE1 . GLU A  1  561 ? 16.536  -6.676  74.759   1.00 259.32 ? 561  GLU A OE1 1 
ATOM   4289  O  OE2 . GLU A  1  561 ? 15.955  -6.397  72.658   1.00 266.44 ? 561  GLU A OE2 1 
ATOM   4290  N  N   . TYR A  1  562 ? 18.797  -10.881 72.183   1.00 255.41 ? 562  TYR A N   1 
ATOM   4291  C  CA  . TYR A  1  562 ? 19.955  -10.862 71.302   1.00 257.39 ? 562  TYR A CA  1 
ATOM   4292  C  C   . TYR A  1  562 ? 19.615  -10.164 69.992   1.00 258.03 ? 562  TYR A C   1 
ATOM   4293  O  O   . TYR A  1  562 ? 18.484  -10.236 69.504   1.00 257.36 ? 562  TYR A O   1 
ATOM   4294  C  CB  . TYR A  1  562 ? 20.484  -12.283 71.041   1.00 255.05 ? 562  TYR A CB  1 
ATOM   4295  C  CG  . TYR A  1  562 ? 19.464  -13.251 70.484   1.00 257.93 ? 562  TYR A CG  1 
ATOM   4296  C  CD1 . TYR A  1  562 ? 19.278  -13.389 69.114   1.00 264.09 ? 562  TYR A CD1 1 
ATOM   4297  C  CD2 . TYR A  1  562 ? 18.692  -14.035 71.332   1.00 259.60 ? 562  TYR A CD2 1 
ATOM   4298  C  CE1 . TYR A  1  562 ? 18.348  -14.280 68.605   1.00 266.17 ? 562  TYR A CE1 1 
ATOM   4299  C  CE2 . TYR A  1  562 ? 17.760  -14.924 70.833   1.00 262.12 ? 562  TYR A CE2 1 
ATOM   4300  C  CZ  . TYR A  1  562 ? 17.594  -15.045 69.470   1.00 264.25 ? 562  TYR A CZ  1 
ATOM   4301  O  OH  . TYR A  1  562 ? 16.666  -15.932 68.972   1.00 260.95 ? 562  TYR A OH  1 
ATOM   4302  N  N   . ARG A  1  563 ? 20.621  -9.496  69.424   1.00 275.52 ? 563  ARG A N   1 
ATOM   4303  C  CA  . ARG A  1  563 ? 20.477  -8.754  68.178   1.00 280.08 ? 563  ARG A CA  1 
ATOM   4304  C  C   . ARG A  1  563 ? 21.781  -8.836  67.395   1.00 280.07 ? 563  ARG A C   1 
ATOM   4305  O  O   . ARG A  1  563 ? 22.793  -9.354  67.878   1.00 281.08 ? 563  ARG A O   1 
ATOM   4306  C  CB  . ARG A  1  563 ? 20.095  -7.283  68.410   1.00 291.07 ? 563  ARG A CB  1 
ATOM   4307  C  CG  . ARG A  1  563 ? 18.796  -7.046  69.178   1.00 298.57 ? 563  ARG A CG  1 
ATOM   4308  C  CD  . ARG A  1  563 ? 18.492  -5.554  69.298   1.00 312.44 ? 563  ARG A CD  1 
ATOM   4309  N  NE  . ARG A  1  563 ? 17.119  -5.283  69.726   1.00 313.98 ? 563  ARG A NE  1 
ATOM   4310  C  CZ  . ARG A  1  563 ? 16.627  -4.064  69.936   1.00 312.50 ? 563  ARG A CZ  1 
ATOM   4311  N  NH1 . ARG A  1  563 ? 17.399  -2.998  69.765   1.00 322.32 ? 563  ARG A NH1 1 
ATOM   4312  N  NH2 . ARG A  1  563 ? 15.367  -3.909  70.323   1.00 299.43 ? 563  ARG A NH2 1 
ATOM   4313  N  N   . LEU A  1  564 ? 21.736  -8.323  66.166   1.00 274.90 ? 564  LEU A N   1 
ATOM   4314  C  CA  . LEU A  1  564 ? 22.859  -8.295  65.242   1.00 273.89 ? 564  LEU A CA  1 
ATOM   4315  C  C   . LEU A  1  564 ? 23.263  -6.846  64.972   1.00 288.31 ? 564  LEU A C   1 
ATOM   4316  O  O   . LEU A  1  564 ? 22.468  -5.916  65.131   1.00 288.63 ? 564  LEU A O   1 
ATOM   4317  C  CB  . LEU A  1  564 ? 22.509  -9.022  63.934   1.00 257.10 ? 564  LEU A CB  1 
ATOM   4318  C  CG  . LEU A  1  564 ? 23.588  -9.158  62.856   1.00 255.52 ? 564  LEU A CG  1 
ATOM   4319  C  CD1 . LEU A  1  564 ? 24.827  -9.807  63.452   1.00 262.22 ? 564  LEU A CD1 1 
ATOM   4320  C  CD2 . LEU A  1  564 ? 23.095  -9.960  61.664   1.00 262.79 ? 564  LEU A CD2 1 
ATOM   4321  N  N   . ASP A  1  565 ? 24.519  -6.666  64.551   1.00 298.58 ? 565  ASP A N   1 
ATOM   4322  C  CA  . ASP A  1  565 ? 25.029  -5.356  64.147   1.00 292.88 ? 565  ASP A CA  1 
ATOM   4323  C  C   . ASP A  1  565 ? 24.587  -4.927  62.745   1.00 281.18 ? 565  ASP A C   1 
ATOM   4324  O  O   . ASP A  1  565 ? 24.501  -3.724  62.476   1.00 275.71 ? 565  ASP A O   1 
ATOM   4325  C  CB  . ASP A  1  565 ? 26.555  -5.380  64.203   1.00 292.79 ? 565  ASP A CB  1 
ATOM   4326  C  CG  . ASP A  1  565 ? 27.169  -3.992  64.236   1.00 294.59 ? 565  ASP A CG  1 
ATOM   4327  O  OD1 . ASP A  1  565 ? 27.388  -3.447  65.341   1.00 295.66 ? 565  ASP A OD1 1 
ATOM   4328  O  OD2 . ASP A  1  565 ? 27.440  -3.446  63.150   1.00 298.64 ? 565  ASP A OD2 1 
ATOM   4329  N  N   . TYR A  1  566 ? 24.304  -5.874  61.846   1.00 265.81 ? 566  TYR A N   1 
ATOM   4330  C  CA  . TYR A  1  566 ? 24.018  -5.611  60.430   1.00 262.44 ? 566  TYR A CA  1 
ATOM   4331  C  C   . TYR A  1  566 ? 25.081  -4.781  59.708   1.00 264.00 ? 566  TYR A C   1 
ATOM   4332  O  O   . TYR A  1  566 ? 25.492  -5.145  58.602   1.00 269.64 ? 566  TYR A O   1 
ATOM   4333  C  CB  . TYR A  1  566 ? 22.673  -4.895  60.240   1.00 263.51 ? 566  TYR A CB  1 
ATOM   4334  C  CG  . TYR A  1  566 ? 21.426  -5.615  60.707   1.00 270.44 ? 566  TYR A CG  1 
ATOM   4335  C  CD1 . TYR A  1  566 ? 21.388  -6.999  60.814   1.00 271.85 ? 566  TYR A CD1 1 
ATOM   4336  C  CD2 . TYR A  1  566 ? 20.263  -4.906  60.990   1.00 268.47 ? 566  TYR A CD2 1 
ATOM   4337  C  CE1 . TYR A  1  566 ? 20.235  -7.655  61.223   1.00 262.28 ? 566  TYR A CE1 1 
ATOM   4338  C  CE2 . TYR A  1  566 ? 19.108  -5.551  61.398   1.00 256.94 ? 566  TYR A CE2 1 
ATOM   4339  C  CZ  . TYR A  1  566 ? 19.099  -6.926  61.513   1.00 250.58 ? 566  TYR A CZ  1 
ATOM   4340  O  OH  . TYR A  1  566 ? 17.956  -7.576  61.917   1.00 244.14 ? 566  TYR A OH  1 
ATOM   4341  N  N   . ARG A  1  567 ? 25.517  -3.662  60.298   1.00 261.74 ? 567  ARG A N   1 
ATOM   4342  C  CA  . ARG A  1  567 ? 26.474  -2.790  59.619   1.00 258.71 ? 567  ARG A CA  1 
ATOM   4343  C  C   . ARG A  1  567 ? 27.791  -3.504  59.335   1.00 250.59 ? 567  ARG A C   1 
ATOM   4344  O  O   . ARG A  1  567 ? 28.358  -3.366  58.245   1.00 249.05 ? 567  ARG A O   1 
ATOM   4345  C  CB  . ARG A  1  567 ? 26.710  -1.519  60.433   1.00 268.87 ? 567  ARG A CB  1 
ATOM   4346  C  CG  . ARG A  1  567 ? 25.450  -0.706  60.677   1.00 275.28 ? 567  ARG A CG  1 
ATOM   4347  C  CD  . ARG A  1  567 ? 25.790  0.690   61.169   1.00 283.44 ? 567  ARG A CD  1 
ATOM   4348  N  NE  . ARG A  1  567 ? 24.601  1.454   61.533   1.00 283.17 ? 567  ARG A NE  1 
ATOM   4349  C  CZ  . ARG A  1  567 ? 24.609  2.749   61.832   1.00 276.22 ? 567  ARG A CZ  1 
ATOM   4350  N  NH1 . ARG A  1  567 ? 25.748  3.430   61.807   1.00 265.05 ? 567  ARG A NH1 1 
ATOM   4351  N  NH2 . ARG A  1  567 ? 23.479  3.364   62.155   1.00 275.12 ? 567  ARG A NH2 1 
ATOM   4352  N  N   . THR A  1  568 ? 28.299  -4.265  60.304   1.00 256.53 ? 568  THR A N   1 
ATOM   4353  C  CA  . THR A  1  568 ? 29.531  -5.022  60.119   1.00 259.72 ? 568  THR A CA  1 
ATOM   4354  C  C   . THR A  1  568 ? 29.304  -6.362  59.437   1.00 258.43 ? 568  THR A C   1 
ATOM   4355  O  O   . THR A  1  568 ? 30.276  -7.077  59.174   1.00 259.88 ? 568  THR A O   1 
ATOM   4356  C  CB  . THR A  1  568 ? 30.228  -5.253  61.461   1.00 265.02 ? 568  THR A CB  1 
ATOM   4357  O  OG1 . THR A  1  568 ? 31.570  -5.696  61.231   1.00 281.54 ? 568  THR A OG1 1 
ATOM   4358  C  CG2 . THR A  1  568 ? 29.493  -6.314  62.260   1.00 255.25 ? 568  THR A CG2 1 
ATOM   4359  N  N   . ALA A  1  569 ? 28.055  -6.727  59.162   1.00 259.18 ? 569  ALA A N   1 
ATOM   4360  C  CA  . ALA A  1  569 ? 27.737  -7.941  58.423   1.00 266.89 ? 569  ALA A CA  1 
ATOM   4361  C  C   . ALA A  1  569 ? 27.211  -7.636  57.025   1.00 277.38 ? 569  ALA A C   1 
ATOM   4362  O  O   . ALA A  1  569 ? 26.760  -8.551  56.327   1.00 277.41 ? 569  ALA A O   1 
ATOM   4363  C  CB  . ALA A  1  569 ? 26.727  -8.788  59.201   1.00 263.14 ? 569  ALA A CB  1 
ATOM   4364  N  N   . ALA A  1  570 ? 27.254  -6.373  56.604   1.00 284.27 ? 570  ALA A N   1 
ATOM   4365  C  CA  . ALA A  1  570 ? 26.807  -5.979  55.279   1.00 275.63 ? 570  ALA A CA  1 
ATOM   4366  C  C   . ALA A  1  570 ? 27.848  -6.371  54.235   1.00 269.55 ? 570  ALA A C   1 
ATOM   4367  O  O   . ALA A  1  570 ? 28.977  -6.754  54.552   1.00 273.64 ? 570  ALA A O   1 
ATOM   4368  C  CB  . ALA A  1  570 ? 26.534  -4.475  55.224   1.00 276.68 ? 570  ALA A CB  1 
ATOM   4369  N  N   . ASP A  1  571 ? 27.456  -6.282  52.970   1.00 258.08 ? 571  ASP A N   1 
ATOM   4370  C  CA  . ASP A  1  571 ? 28.335  -6.659  51.879   1.00 262.52 ? 571  ASP A CA  1 
ATOM   4371  C  C   . ASP A  1  571 ? 28.956  -5.412  51.244   1.00 257.83 ? 571  ASP A C   1 
ATOM   4372  O  O   . ASP A  1  571 ? 28.680  -4.275  51.639   1.00 257.56 ? 571  ASP A O   1 
ATOM   4373  C  CB  . ASP A  1  571 ? 27.561  -7.489  50.857   1.00 261.77 ? 571  ASP A CB  1 
ATOM   4374  C  CG  . ASP A  1  571 ? 28.458  -8.389  50.041   1.00 268.33 ? 571  ASP A CG  1 
ATOM   4375  O  OD1 . ASP A  1  571 ? 29.494  -8.836  50.576   1.00 257.75 ? 571  ASP A OD1 1 
ATOM   4376  O  OD2 . ASP A  1  571 ? 28.119  -8.655  48.868   1.00 267.90 ? 571  ASP A OD2 1 
ATOM   4377  N  N   . THR A  1  572 ? 29.817  -5.637  50.243   1.00 252.59 ? 572  THR A N   1 
ATOM   4378  C  CA  . THR A  1  572 ? 30.426  -4.527  49.514   1.00 253.13 ? 572  THR A CA  1 
ATOM   4379  C  C   . THR A  1  572 ? 29.370  -3.672  48.830   1.00 256.64 ? 572  THR A C   1 
ATOM   4380  O  O   . THR A  1  572 ? 29.593  -2.479  48.592   1.00 261.12 ? 572  THR A O   1 
ATOM   4381  C  CB  . THR A  1  572 ? 31.435  -5.054  48.485   1.00 254.97 ? 572  THR A CB  1 
ATOM   4382  O  OG1 . THR A  1  572 ? 31.985  -3.959  47.740   1.00 249.92 ? 572  THR A OG1 1 
ATOM   4383  C  CG2 . THR A  1  572 ? 30.771  -6.033  47.524   1.00 254.11 ? 572  THR A CG2 1 
ATOM   4384  N  N   . THR A  1  573 ? 28.224  -4.262  48.505   1.00 242.21 ? 573  THR A N   1 
ATOM   4385  C  CA  . THR A  1  573 ? 27.112  -3.554  47.894   1.00 228.89 ? 573  THR A CA  1 
ATOM   4386  C  C   . THR A  1  573 ? 26.153  -2.955  48.917   1.00 240.92 ? 573  THR A C   1 
ATOM   4387  O  O   . THR A  1  573 ? 25.130  -2.388  48.522   1.00 264.44 ? 573  THR A O   1 
ATOM   4388  C  CB  . THR A  1  573 ? 26.344  -4.494  46.959   1.00 220.51 ? 573  THR A CB  1 
ATOM   4389  O  OG1 . THR A  1  573 ? 25.759  -5.554  47.725   1.00 219.22 ? 573  THR A OG1 1 
ATOM   4390  C  CG2 . THR A  1  573 ? 27.269  -5.086  45.911   1.00 217.60 ? 573  THR A CG2 1 
ATOM   4391  N  N   . GLY A  1  574 ? 26.451  -3.058  50.212   1.00 230.24 ? 574  GLY A N   1 
ATOM   4392  C  CA  . GLY A  1  574 ? 25.579  -2.484  51.219   1.00 225.64 ? 574  GLY A CA  1 
ATOM   4393  C  C   . GLY A  1  574 ? 24.348  -3.296  51.541   1.00 222.13 ? 574  GLY A C   1 
ATOM   4394  O  O   . GLY A  1  574 ? 23.381  -2.753  52.087   1.00 224.13 ? 574  GLY A O   1 
ATOM   4395  N  N   . LEU A  1  575 ? 24.344  -4.579  51.201   1.00 217.73 ? 575  LEU A N   1 
ATOM   4396  C  CA  . LEU A  1  575 ? 23.195  -5.448  51.418   1.00 216.43 ? 575  LEU A CA  1 
ATOM   4397  C  C   . LEU A  1  575 ? 23.272  -6.037  52.820   1.00 226.38 ? 575  LEU A C   1 
ATOM   4398  O  O   . LEU A  1  575 ? 24.130  -6.881  53.100   1.00 235.24 ? 575  LEU A O   1 
ATOM   4399  C  CB  . LEU A  1  575 ? 23.158  -6.545  50.362   1.00 214.80 ? 575  LEU A CB  1 
ATOM   4400  C  CG  . LEU A  1  575 ? 21.786  -7.156  50.127   1.00 212.81 ? 575  LEU A CG  1 
ATOM   4401  C  CD1 . LEU A  1  575 ? 20.800  -6.048  49.831   1.00 232.44 ? 575  LEU A CD1 1 
ATOM   4402  C  CD2 . LEU A  1  575 ? 21.871  -8.123  48.962   1.00 210.62 ? 575  LEU A CD2 1 
ATOM   4403  N  N   . GLN A  1  576 ? 22.375  -5.594  53.700   1.00 227.60 ? 576  GLN A N   1 
ATOM   4404  C  CA  . GLN A  1  576 ? 22.392  -6.068  55.082   1.00 228.54 ? 576  GLN A CA  1 
ATOM   4405  C  C   . GLN A  1  576 ? 21.592  -7.358  55.212   1.00 226.51 ? 576  GLN A C   1 
ATOM   4406  O  O   . GLN A  1  576 ? 20.482  -7.446  54.676   1.00 224.83 ? 576  GLN A O   1 
ATOM   4407  C  CB  . GLN A  1  576 ? 21.826  -5.021  56.027   1.00 230.41 ? 576  GLN A CB  1 
ATOM   4408  C  CG  . GLN A  1  576 ? 22.333  -3.615  55.785   1.00 242.81 ? 576  GLN A CG  1 
ATOM   4409  C  CD  . GLN A  1  576 ? 21.681  -2.606  56.707   1.00 252.50 ? 576  GLN A CD  1 
ATOM   4410  O  OE1 . GLN A  1  576 ? 20.756  -2.934  57.451   1.00 247.91 ? 576  GLN A OE1 1 
ATOM   4411  N  NE2 . GLN A  1  576 ? 22.170  -1.374  56.673   1.00 267.25 ? 576  GLN A NE2 1 
ATOM   4412  N  N   . PRO A  1  577 ? 22.123  -8.374  55.906   1.00 238.79 ? 577  PRO A N   1 
ATOM   4413  C  CA  . PRO A  1  577 ? 21.387  -9.636  56.073   1.00 238.73 ? 577  PRO A CA  1 
ATOM   4414  C  C   . PRO A  1  577 ? 20.107  -9.479  56.881   1.00 245.27 ? 577  PRO A C   1 
ATOM   4415  O  O   . PRO A  1  577 ? 19.779  -8.380  57.340   1.00 254.94 ? 577  PRO A O   1 
ATOM   4416  C  CB  . PRO A  1  577 ? 22.398  -10.537 56.799   1.00 234.38 ? 577  PRO A CB  1 
ATOM   4417  C  CG  . PRO A  1  577 ? 23.735  -9.925  56.518   1.00 244.80 ? 577  PRO A CG  1 
ATOM   4418  C  CD  . PRO A  1  577 ? 23.475  -8.447  56.481   1.00 249.81 ? 577  PRO A CD  1 
ATOM   4419  N  N   . ILE A  1  578 ? 19.375  -10.579 57.064   1.00 238.75 ? 578  ILE A N   1 
ATOM   4420  C  CA  . ILE A  1  578 ? 18.116  -10.555 57.798   1.00 234.56 ? 578  ILE A CA  1 
ATOM   4421  C  C   . ILE A  1  578 ? 17.874  -11.929 58.411   1.00 234.29 ? 578  ILE A C   1 
ATOM   4422  O  O   . ILE A  1  578 ? 18.265  -12.956 57.850   1.00 235.42 ? 578  ILE A O   1 
ATOM   4423  C  CB  . ILE A  1  578 ? 16.939  -10.125 56.892   1.00 222.06 ? 578  ILE A CB  1 
ATOM   4424  C  CG1 . ILE A  1  578 ? 15.686  -9.856  57.729   1.00 223.19 ? 578  ILE A CG1 1 
ATOM   4425  C  CG2 . ILE A  1  578 ? 16.670  -11.177 55.820   1.00 213.80 ? 578  ILE A CG2 1 
ATOM   4426  C  CD1 . ILE A  1  578 ? 15.876  -8.785  58.793   1.00 220.50 ? 578  ILE A CD1 1 
ATOM   4427  N  N   . LEU A  1  579 ? 17.234  -11.937 59.580   1.00 230.07 ? 579  LEU A N   1 
ATOM   4428  C  CA  . LEU A  1  579 ? 16.930  -13.166 60.303   1.00 222.11 ? 579  LEU A CA  1 
ATOM   4429  C  C   . LEU A  1  579 ? 15.757  -13.916 59.679   1.00 213.93 ? 579  LEU A C   1 
ATOM   4430  O  O   . LEU A  1  579 ? 14.863  -13.322 59.062   1.00 210.62 ? 579  LEU A O   1 
ATOM   4431  C  CB  . LEU A  1  579 ? 16.616  -12.861 61.769   1.00 218.50 ? 579  LEU A CB  1 
ATOM   4432  C  CG  . LEU A  1  579 ? 17.747  -12.293 62.634   1.00 219.20 ? 579  LEU A CG  1 
ATOM   4433  C  CD1 . LEU A  1  579 ? 17.222  -11.906 64.008   1.00 219.81 ? 579  LEU A CD1 1 
ATOM   4434  C  CD2 . LEU A  1  579 ? 18.880  -13.293 62.766   1.00 222.10 ? 579  LEU A CD2 1 
ATOM   4435  N  N   . ASN A  1  580 ? 15.792  -15.243 59.811   1.00 211.63 ? 580  ASN A N   1 
ATOM   4436  C  CA  . ASN A  1  580 ? 14.655  -16.047 59.391   1.00 210.34 ? 580  ASN A CA  1 
ATOM   4437  C  C   . ASN A  1  580 ? 13.443  -15.641 60.218   1.00 214.36 ? 580  ASN A C   1 
ATOM   4438  O  O   . ASN A  1  580 ? 13.555  -15.303 61.398   1.00 219.01 ? 580  ASN A O   1 
ATOM   4439  C  CB  . ASN A  1  580 ? 14.958  -17.541 59.544   1.00 210.32 ? 580  ASN A CB  1 
ATOM   4440  C  CG  . ASN A  1  580 ? 13.854  -18.424 58.975   1.00 208.20 ? 580  ASN A CG  1 
ATOM   4441  O  OD1 . ASN A  1  580 ? 13.032  -18.968 59.710   1.00 211.29 ? 580  ASN A OD1 1 
ATOM   4442  N  ND2 . ASN A  1  580 ? 13.825  -18.549 57.653   1.00 205.72 ? 580  ASN A ND2 1 
ATOM   4443  N  N   . GLN A  1  581 ? 12.272  -15.716 59.598   1.00 209.82 ? 581  GLN A N   1 
ATOM   4444  C  CA  . GLN A  1  581 ? 11.125  -14.964 60.093   1.00 210.62 ? 581  GLN A CA  1 
ATOM   4445  C  C   . GLN A  1  581 ? 10.406  -15.631 61.264   1.00 200.62 ? 581  GLN A C   1 
ATOM   4446  O  O   . GLN A  1  581 ? 9.938   -14.939 62.174   1.00 201.85 ? 581  GLN A O   1 
ATOM   4447  C  CB  . GLN A  1  581 ? 10.174  -14.717 58.929   1.00 221.82 ? 581  GLN A CB  1 
ATOM   4448  C  CG  . GLN A  1  581 ? 9.803   -15.961 58.115   1.00 216.16 ? 581  GLN A CG  1 
ATOM   4449  C  CD  . GLN A  1  581 ? 8.349   -15.974 57.674   1.00 205.73 ? 581  GLN A CD  1 
ATOM   4450  O  OE1 . GLN A  1  581 ? 7.522   -15.226 58.193   1.00 217.41 ? 581  GLN A OE1 1 
ATOM   4451  N  NE2 . GLN A  1  581 ? 8.048   -16.780 56.659   1.00 194.25 ? 581  GLN A NE2 1 
ATOM   4452  N  N   . PHE A  1  582 ? 10.263  -16.954 61.266   1.00 213.31 ? 582  PHE A N   1 
ATOM   4453  C  CA  . PHE A  1  582 ? 9.555   -17.561 62.390   1.00 219.86 ? 582  PHE A CA  1 
ATOM   4454  C  C   . PHE A  1  582 ? 10.446  -17.803 63.607   1.00 237.66 ? 582  PHE A C   1 
ATOM   4455  O  O   . PHE A  1  582 ? 9.919   -18.141 64.672   1.00 246.51 ? 582  PHE A O   1 
ATOM   4456  C  CB  . PHE A  1  582 ? 8.814   -18.826 61.956   1.00 219.95 ? 582  PHE A CB  1 
ATOM   4457  C  CG  . PHE A  1  582 ? 7.322   -18.621 61.871   1.00 226.51 ? 582  PHE A CG  1 
ATOM   4458  C  CD1 . PHE A  1  582 ? 6.792   -17.762 60.922   1.00 229.05 ? 582  PHE A CD1 1 
ATOM   4459  C  CD2 . PHE A  1  582 ? 6.456   -19.226 62.773   1.00 226.66 ? 582  PHE A CD2 1 
ATOM   4460  C  CE1 . PHE A  1  582 ? 5.425   -17.531 60.842   1.00 226.71 ? 582  PHE A CE1 1 
ATOM   4461  C  CE2 . PHE A  1  582 ? 5.081   -19.000 62.699   1.00 222.22 ? 582  PHE A CE2 1 
ATOM   4462  C  CZ  . PHE A  1  582 ? 4.568   -18.152 61.731   1.00 220.34 ? 582  PHE A CZ  1 
ATOM   4463  N  N   . THR A  1  583 ? 11.782  -17.683 63.483   1.00 235.17 ? 583  THR A N   1 
ATOM   4464  C  CA  . THR A  1  583 ? 12.652  -17.959 64.627   1.00 238.61 ? 583  THR A CA  1 
ATOM   4465  C  C   . THR A  1  583 ? 13.651  -16.847 64.961   1.00 229.05 ? 583  THR A C   1 
ATOM   4466  O  O   . THR A  1  583 ? 14.820  -17.147 65.241   1.00 231.30 ? 583  THR A O   1 
ATOM   4467  C  CB  . THR A  1  583 ? 13.453  -19.242 64.374   1.00 243.55 ? 583  THR A CB  1 
ATOM   4468  O  OG1 . THR A  1  583 ? 14.427  -19.011 63.340   1.00 246.98 ? 583  THR A OG1 1 
ATOM   4469  C  CG2 . THR A  1  583 ? 12.536  -20.382 63.950   1.00 240.23 ? 583  THR A CG2 1 
ATOM   4470  N  N   . PRO A  1  584 ? 13.264  -15.550 64.951   1.00 217.36 ? 584  PRO A N   1 
ATOM   4471  C  CA  . PRO A  1  584 ? 14.235  -14.515 65.338   1.00 225.29 ? 584  PRO A CA  1 
ATOM   4472  C  C   . PRO A  1  584 ? 14.255  -14.183 66.827   1.00 233.51 ? 584  PRO A C   1 
ATOM   4473  O  O   . PRO A  1  584 ? 15.265  -13.697 67.342   1.00 244.23 ? 584  PRO A O   1 
ATOM   4474  C  CB  . PRO A  1  584 ? 13.779  -13.306 64.519   1.00 223.19 ? 584  PRO A CB  1 
ATOM   4475  C  CG  . PRO A  1  584 ? 12.307  -13.445 64.538   1.00 217.97 ? 584  PRO A CG  1 
ATOM   4476  C  CD  . PRO A  1  584 ? 12.048  -14.926 64.388   1.00 212.53 ? 584  PRO A CD  1 
ATOM   4477  N  N   . ALA A  1  585 ? 13.143  -14.418 67.521   1.00 211.79 ? 585  ALA A N   1 
ATOM   4478  C  CA  . ALA A  1  585 ? 12.908  -13.855 68.844   1.00 213.93 ? 585  ALA A CA  1 
ATOM   4479  C  C   . ALA A  1  585 ? 13.926  -14.284 69.909   1.00 234.75 ? 585  ALA A C   1 
ATOM   4480  O  O   . ALA A  1  585 ? 14.575  -15.335 69.841   1.00 241.94 ? 585  ALA A O   1 
ATOM   4481  C  CB  . ALA A  1  585 ? 11.512  -14.231 69.323   1.00 211.59 ? 585  ALA A CB  1 
ATOM   4482  N  N   . ASN A  1  586 ? 14.031  -13.418 70.916   1.00 236.35 ? 586  ASN A N   1 
ATOM   4483  C  CA  . ASN A  1  586 ? 14.615  -13.647 72.231   1.00 228.31 ? 586  ASN A CA  1 
ATOM   4484  C  C   . ASN A  1  586 ? 13.935  -14.835 72.926   1.00 232.20 ? 586  ASN A C   1 
ATOM   4485  O  O   . ASN A  1  586 ? 12.890  -15.327 72.494   1.00 245.79 ? 586  ASN A O   1 
ATOM   4486  C  CB  . ASN A  1  586 ? 14.457  -12.365 73.048   1.00 223.43 ? 586  ASN A CB  1 
ATOM   4487  C  CG  . ASN A  1  586 ? 13.061  -11.833 72.942   1.00 243.82 ? 586  ASN A CG  1 
ATOM   4488  O  OD1 . ASN A  1  586 ? 12.112  -12.615 72.954   1.00 227.13 ? 586  ASN A OD1 1 
ATOM   4489  N  ND2 . ASN A  1  586 ? 12.899  -10.528 72.798   1.00 323.50 ? 586  ASN A ND2 1 
ATOM   4490  N  N   . ILE A  1  587 ? 14.537  -15.294 74.030   1.00 230.59 ? 587  ILE A N   1 
ATOM   4491  C  CA  . ILE A  1  587 ? 13.977  -16.394 74.808   1.00 232.62 ? 587  ILE A CA  1 
ATOM   4492  C  C   . ILE A  1  587 ? 14.062  -16.101 76.303   1.00 237.52 ? 587  ILE A C   1 
ATOM   4493  O  O   . ILE A  1  587 ? 14.897  -15.319 76.765   1.00 243.38 ? 587  ILE A O   1 
ATOM   4494  C  CB  . ILE A  1  587 ? 14.660  -17.745 74.499   1.00 239.61 ? 587  ILE A CB  1 
ATOM   4495  C  CG1 . ILE A  1  587 ? 16.181  -17.599 74.505   1.00 233.21 ? 587  ILE A CG1 1 
ATOM   4496  C  CG2 . ILE A  1  587 ? 14.172  -18.294 73.165   1.00 251.38 ? 587  ILE A CG2 1 
ATOM   4497  C  CD1 . ILE A  1  587 ? 16.907  -18.902 74.247   1.00 233.16 ? 587  ILE A CD1 1 
ATOM   4498  N  N   . SER A  1  588 ? 13.173  -16.751 77.061   1.00 239.01 ? 588  SER A N   1 
ATOM   4499  C  CA  . SER A  1  588 ? 13.054  -16.546 78.498   1.00 235.98 ? 588  SER A CA  1 
ATOM   4500  C  C   . SER A  1  588 ? 12.901  -17.875 79.236   1.00 230.43 ? 588  SER A C   1 
ATOM   4501  O  O   . SER A  1  588 ? 12.338  -18.842 78.711   1.00 231.98 ? 588  SER A O   1 
ATOM   4502  C  CB  . SER A  1  588 ? 11.868  -15.633 78.824   1.00 239.65 ? 588  SER A CB  1 
ATOM   4503  O  OG  . SER A  1  588 ? 10.648  -16.210 78.391   1.00 243.76 ? 588  SER A OG  1 
ATOM   4504  N  N   . ARG A  1  589 ? 13.419  -17.909 80.469   1.00 226.19 ? 589  ARG A N   1 
ATOM   4505  C  CA  . ARG A  1  589 ? 13.249  -19.026 81.396   1.00 228.15 ? 589  ARG A CA  1 
ATOM   4506  C  C   . ARG A  1  589 ? 13.037  -18.440 82.790   1.00 248.29 ? 589  ARG A C   1 
ATOM   4507  O  O   . ARG A  1  589 ? 12.963  -17.219 82.953   1.00 264.01 ? 589  ARG A O   1 
ATOM   4508  C  CB  . ARG A  1  589 ? 14.435  -19.995 81.333   1.00 228.59 ? 589  ARG A CB  1 
ATOM   4509  C  CG  . ARG A  1  589 ? 14.093  -21.410 81.788   1.00 229.57 ? 589  ARG A CG  1 
ATOM   4510  C  CD  . ARG A  1  589 ? 15.317  -22.297 81.881   1.00 231.56 ? 589  ARG A CD  1 
ATOM   4511  N  NE  . ARG A  1  589 ? 15.006  -23.580 82.505   1.00 231.24 ? 589  ARG A NE  1 
ATOM   4512  C  CZ  . ARG A  1  589 ? 15.899  -24.537 82.738   1.00 231.84 ? 589  ARG A CZ  1 
ATOM   4513  N  NH1 . ARG A  1  589 ? 17.168  -24.369 82.392   1.00 239.90 ? 589  ARG A NH1 1 
ATOM   4514  N  NH2 . ARG A  1  589 ? 15.519  -25.668 83.314   1.00 231.71 ? 589  ARG A NH2 1 
ATOM   4515  N  N   . GLN A  1  590 ? 12.928  -19.295 83.810   1.00 247.73 ? 590  GLN A N   1 
ATOM   4516  C  CA  . GLN A  1  590 ? 12.585  -18.794 85.139   1.00 247.58 ? 590  GLN A CA  1 
ATOM   4517  C  C   . GLN A  1  590 ? 13.029  -19.766 86.230   1.00 250.87 ? 590  GLN A C   1 
ATOM   4518  O  O   . GLN A  1  590 ? 13.087  -20.979 86.017   1.00 261.31 ? 590  GLN A O   1 
ATOM   4519  C  CB  . GLN A  1  590 ? 11.076  -18.537 85.246   1.00 239.76 ? 590  GLN A CB  1 
ATOM   4520  C  CG  . GLN A  1  590 ? 10.221  -19.768 84.966   1.00 234.10 ? 590  GLN A CG  1 
ATOM   4521  C  CD  . GLN A  1  590 ? 8.739   -19.457 84.942   1.00 228.88 ? 590  GLN A CD  1 
ATOM   4522  O  OE1 . GLN A  1  590 ? 8.339   -18.293 84.969   1.00 228.56 ? 590  GLN A OE1 1 
ATOM   4523  N  NE2 . GLN A  1  590 ? 7.914   -20.498 84.869   1.00 228.17 ? 590  GLN A NE2 1 
ATOM   4524  N  N   . ALA A  1  591 ? 13.329  -19.212 87.407   1.00 241.74 ? 591  ALA A N   1 
ATOM   4525  C  CA  . ALA A  1  591 ? 13.674  -19.978 88.598   1.00 235.92 ? 591  ALA A CA  1 
ATOM   4526  C  C   . ALA A  1  591 ? 12.728  -19.582 89.725   1.00 230.66 ? 591  ALA A C   1 
ATOM   4527  O  O   . ALA A  1  591 ? 12.163  -18.486 89.712   1.00 228.67 ? 591  ALA A O   1 
ATOM   4528  C  CB  . ALA A  1  591 ? 15.139  -19.751 89.010   1.00 235.90 ? 591  ALA A CB  1 
ATOM   4529  N  N   . HIS A  1  592 ? 12.551  -20.472 90.705   1.00 227.95 ? 592  HIS A N   1 
ATOM   4530  C  CA  . HIS A  1  592 ? 11.504  -20.294 91.706   1.00 228.79 ? 592  HIS A CA  1 
ATOM   4531  C  C   . HIS A  1  592 ? 12.015  -20.524 93.124   1.00 241.95 ? 592  HIS A C   1 
ATOM   4532  O  O   . HIS A  1  592 ? 12.956  -21.291 93.350   1.00 246.46 ? 592  HIS A O   1 
ATOM   4533  C  CB  . HIS A  1  592 ? 10.330  -21.235 91.432   1.00 224.92 ? 592  HIS A CB  1 
ATOM   4534  C  CG  . HIS A  1  592 ? 9.737   -21.069 90.069   1.00 225.32 ? 592  HIS A CG  1 
ATOM   4535  N  ND1 . HIS A  1  592 ? 8.794   -20.107 89.782   1.00 228.87 ? 592  HIS A ND1 1 
ATOM   4536  C  CD2 . HIS A  1  592 ? 9.961   -21.734 88.911   1.00 228.28 ? 592  HIS A CD2 1 
ATOM   4537  C  CE1 . HIS A  1  592 ? 8.457   -20.190 88.508   1.00 235.36 ? 592  HIS A CE1 1 
ATOM   4538  N  NE2 . HIS A  1  592 ? 9.151   -21.169 87.957   1.00 235.62 ? 592  HIS A NE2 1 
ATOM   4539  N  N   . ILE A  1  593 ? 11.361  -19.854 94.077   1.00 242.52 ? 593  ILE A N   1 
ATOM   4540  C  CA  . ILE A  1  593 ? 11.624  -19.992 95.508   1.00 228.49 ? 593  ILE A CA  1 
ATOM   4541  C  C   . ILE A  1  593 ? 10.440  -20.721 96.124   1.00 222.82 ? 593  ILE A C   1 
ATOM   4542  O  O   . ILE A  1  593 ? 9.306   -20.221 96.095   1.00 225.63 ? 593  ILE A O   1 
ATOM   4543  C  CB  . ILE A  1  593 ? 11.837  -18.630 96.192   1.00 220.05 ? 593  ILE A CB  1 
ATOM   4544  C  CG1 . ILE A  1  593 ? 12.793  -17.749 95.388   1.00 221.41 ? 593  ILE A CG1 1 
ATOM   4545  C  CG2 . ILE A  1  593 ? 12.342  -18.819 97.618   1.00 220.94 ? 593  ILE A CG2 1 
ATOM   4546  C  CD1 . ILE A  1  593 ? 12.088  -16.728 94.516   1.00 221.24 ? 593  ILE A CD1 1 
ATOM   4547  N  N   . LEU A  1  594 ? 10.700  -21.896 96.681   1.00 210.92 ? 594  LEU A N   1 
ATOM   4548  C  CA  . LEU A  1  594 ? 9.642   -22.723 97.236   1.00 222.44 ? 594  LEU A CA  1 
ATOM   4549  C  C   . LEU A  1  594 ? 9.781   -22.840 98.749   1.00 279.50 ? 594  LEU A C   1 
ATOM   4550  O  O   . LEU A  1  594 ? 10.660  -22.249 99.392   1.00 207.32 ? 594  LEU A O   1 
ATOM   4551  C  CB  . LEU A  1  594 ? 9.627   -24.116 96.600   1.00 222.18 ? 594  LEU A CB  1 
ATOM   4552  C  CG  . LEU A  1  594 ? 9.066   -24.309 95.181   1.00 201.73 ? 594  LEU A CG  1 
ATOM   4553  C  CD1 . LEU A  1  594 ? 10.147  -24.114 94.124   1.00 200.22 ? 594  LEU A CD1 1 
ATOM   4554  C  CD2 . LEU A  1  594 ? 8.406   -25.680 95.028   1.00 202.14 ? 594  LEU A CD2 1 
ATOM   4555  N  N   . LEU A  1  595 ? 8.892   -23.650 99.301   1.00 186.46 ? 595  LEU A N   1 
ATOM   4556  C  CA  . LEU A  1  595 ? 8.583   -23.659 100.721  1.00 222.03 ? 595  LEU A CA  1 
ATOM   4557  C  C   . LEU A  1  595 ? 7.539   -24.745 100.940  1.00 211.34 ? 595  LEU A C   1 
ATOM   4558  O  O   . LEU A  1  595 ? 6.755   -25.048 100.033  1.00 179.45 ? 595  LEU A O   1 
ATOM   4559  C  CB  . LEU A  1  595 ? 8.093   -22.261 101.209  1.00 224.55 ? 595  LEU A CB  1 
ATOM   4560  C  CG  . LEU A  1  595 ? 6.715   -21.556 101.160  1.00 218.70 ? 595  LEU A CG  1 
ATOM   4561  C  CD1 . LEU A  1  595 ? 6.803   -20.155 101.893  1.00 216.88 ? 595  LEU A CD1 1 
ATOM   4562  C  CD2 . LEU A  1  595 ? 6.114   -21.461 99.747   1.00 200.59 ? 595  LEU A CD2 1 
ATOM   4563  N  N   . ASP A  1  596 ? 7.564   -25.342 102.136  1.00 175.48 ? 596  ASP A N   1 
ATOM   4564  C  CA  . ASP A  1  596 ? 6.569   -26.328 102.630  1.00 151.81 ? 596  ASP A CA  1 
ATOM   4565  C  C   . ASP A  1  596 ? 6.495   -27.637 101.822  1.00 158.38 ? 596  ASP A C   1 
ATOM   4566  O  O   . ASP A  1  596 ? 5.551   -28.437 101.935  1.00 163.74 ? 596  ASP A O   1 
ATOM   4567  C  CB  . ASP A  1  596 ? 5.168   -25.708 102.693  1.00 191.42 ? 596  ASP A CB  1 
ATOM   4568  C  CG  . ASP A  1  596 ? 5.116   -24.345 103.497  1.00 169.24 ? 596  ASP A CG  1 
ATOM   4569  O  OD1 . ASP A  1  596 ? 6.153   -23.575 103.545  1.00 167.84 ? 596  ASP A OD1 1 
ATOM   4570  O  OD2 . ASP A  1  596 ? 4.002   -24.056 104.083  1.00 159.33 ? 596  ASP A OD2 1 
ATOM   4571  N  N   . ASP B  2  3   ? -48.611 2.916   38.685   1.00 282.12 ? 113  ASP B N   1 
ATOM   4572  C  CA  . ASP B  2  3   ? -48.070 4.025   37.910   1.00 279.20 ? 113  ASP B CA  1 
ATOM   4573  C  C   . ASP B  2  3   ? -46.688 4.419   38.416   1.00 265.79 ? 113  ASP B C   1 
ATOM   4574  O  O   . ASP B  2  3   ? -46.533 4.815   39.572   1.00 265.39 ? 113  ASP B O   1 
ATOM   4575  C  CB  . ASP B  2  3   ? -49.011 5.225   37.966   1.00 292.61 ? 113  ASP B CB  1 
ATOM   4576  C  CG  . ASP B  2  3   ? -48.572 6.344   37.053   1.00 291.42 ? 113  ASP B CG  1 
ATOM   4577  O  OD1 . ASP B  2  3   ? -47.871 6.063   36.058   1.00 283.52 ? 113  ASP B OD1 1 
ATOM   4578  O  OD2 . ASP B  2  3   ? -48.922 7.507   37.336   1.00 298.77 ? 113  ASP B OD2 1 
ATOM   4579  N  N   . TYR B  2  4   ? -45.682 4.322   37.541   1.00 270.75 ? 114  TYR B N   1 
ATOM   4580  C  CA  . TYR B  2  4   ? -44.316 4.576   37.974   1.00 258.03 ? 114  TYR B CA  1 
ATOM   4581  C  C   . TYR B  2  4   ? -43.436 4.919   36.785   1.00 253.14 ? 114  TYR B C   1 
ATOM   4582  O  O   . TYR B  2  4   ? -43.568 4.284   35.729   1.00 250.71 ? 114  TYR B O   1 
ATOM   4583  C  CB  . TYR B  2  4   ? -43.755 3.363   38.722   1.00 249.31 ? 114  TYR B CB  1 
ATOM   4584  C  CG  . TYR B  2  4   ? -42.413 3.607   39.362   1.00 252.21 ? 114  TYR B CG  1 
ATOM   4585  C  CD1 . TYR B  2  4   ? -42.314 4.283   40.569   1.00 256.74 ? 114  TYR B CD1 1 
ATOM   4586  C  CD2 . TYR B  2  4   ? -41.245 3.144   38.770   1.00 238.19 ? 114  TYR B CD2 1 
ATOM   4587  C  CE1 . TYR B  2  4   ? -41.087 4.506   41.162   1.00 260.09 ? 114  TYR B CE1 1 
ATOM   4588  C  CE2 . TYR B  2  4   ? -40.012 3.361   39.356   1.00 218.05 ? 114  TYR B CE2 1 
ATOM   4589  C  CZ  . TYR B  2  4   ? -39.939 4.042   40.553   1.00 244.47 ? 114  TYR B CZ  1 
ATOM   4590  O  OH  . TYR B  2  4   ? -38.715 4.263   41.144   1.00 221.99 ? 114  TYR B OH  1 
ATOM   4591  N  N   . PRO B  2  5   ? -42.571 5.928   36.904   1.00 258.53 ? 115  PRO B N   1 
ATOM   4592  C  CA  . PRO B  2  5   ? -41.694 6.317   35.788   1.00 260.07 ? 115  PRO B CA  1 
ATOM   4593  C  C   . PRO B  2  5   ? -40.729 5.214   35.370   1.00 224.45 ? 115  PRO B C   1 
ATOM   4594  O  O   . PRO B  2  5   ? -40.222 4.456   36.198   1.00 217.39 ? 115  PRO B O   1 
ATOM   4595  C  CB  . PRO B  2  5   ? -40.940 7.531   36.344   1.00 256.89 ? 115  PRO B CB  1 
ATOM   4596  C  CG  . PRO B  2  5   ? -41.841 8.073   37.421   1.00 264.98 ? 115  PRO B CG  1 
ATOM   4597  C  CD  . PRO B  2  5   ? -42.483 6.863   38.037   1.00 260.47 ? 115  PRO B CD  1 
ATOM   4598  N  N   . VAL B  2  6   ? -40.459 5.148   34.065   1.00 211.03 ? 116  VAL B N   1 
ATOM   4599  C  CA  . VAL B  2  6   ? -39.593 4.125   33.485   1.00 200.98 ? 116  VAL B CA  1 
ATOM   4600  C  C   . VAL B  2  6   ? -38.741 4.741   32.382   1.00 207.83 ? 116  VAL B C   1 
ATOM   4601  O  O   . VAL B  2  6   ? -39.250 5.491   31.542   1.00 209.47 ? 116  VAL B O   1 
ATOM   4602  C  CB  . VAL B  2  6   ? -40.409 2.942   32.934   1.00 204.98 ? 116  VAL B CB  1 
ATOM   4603  C  CG1 . VAL B  2  6   ? -39.570 2.115   31.985   1.00 196.47 ? 116  VAL B CG1 1 
ATOM   4604  C  CG2 . VAL B  2  6   ? -40.895 2.073   34.078   1.00 205.93 ? 116  VAL B CG2 1 
ATOM   4605  N  N   . ASP B  2  7   ? -37.442 4.432   32.392   1.00 185.54 ? 117  ASP B N   1 
ATOM   4606  C  CA  . ASP B  2  7   ? -36.509 4.813   31.339   1.00 180.78 ? 117  ASP B CA  1 
ATOM   4607  C  C   . ASP B  2  7   ? -35.987 3.569   30.632   1.00 173.80 ? 117  ASP B C   1 
ATOM   4608  O  O   . ASP B  2  7   ? -35.717 2.550   31.275   1.00 167.93 ? 117  ASP B O   1 
ATOM   4609  C  CB  . ASP B  2  7   ? -35.324 5.601   31.895   1.00 211.47 ? 117  ASP B CB  1 
ATOM   4610  C  CG  . ASP B  2  7   ? -35.739 6.884   32.561   1.00 202.45 ? 117  ASP B CG  1 
ATOM   4611  O  OD1 . ASP B  2  7   ? -36.836 7.398   32.248   1.00 194.74 ? 117  ASP B OD1 1 
ATOM   4612  O  OD2 . ASP B  2  7   ? -34.958 7.375   33.399   1.00 176.19 ? 117  ASP B OD2 1 
ATOM   4613  N  N   . LEU B  2  8   ? -35.853 3.648   29.309   1.00 174.94 ? 118  LEU B N   1 
ATOM   4614  C  CA  . LEU B  2  8   ? -35.367 2.524   28.507   1.00 169.21 ? 118  LEU B CA  1 
ATOM   4615  C  C   . LEU B  2  8   ? -34.364 3.038   27.479   1.00 169.19 ? 118  LEU B C   1 
ATOM   4616  O  O   . LEU B  2  8   ? -34.726 3.830   26.606   1.00 198.43 ? 118  LEU B O   1 
ATOM   4617  C  CB  . LEU B  2  8   ? -36.531 1.793   27.833   1.00 201.70 ? 118  LEU B CB  1 
ATOM   4618  C  CG  . LEU B  2  8   ? -36.280 0.460   27.113   1.00 192.46 ? 118  LEU B CG  1 
ATOM   4619  C  CD1 . LEU B  2  8   ? -35.906 0.666   25.654   1.00 190.91 ? 118  LEU B CD1 1 
ATOM   4620  C  CD2 . LEU B  2  8   ? -35.197 -0.332  27.820   1.00 162.45 ? 118  LEU B CD2 1 
ATOM   4621  N  N   . TYR B  2  9   ? -33.104 2.614   27.592   1.00 176.67 ? 119  TYR B N   1 
ATOM   4622  C  CA  . TYR B  2  9   ? -32.070 2.960   26.619   1.00 160.65 ? 119  TYR B CA  1 
ATOM   4623  C  C   . TYR B  2  9   ? -31.889 1.807   25.640   1.00 148.53 ? 119  TYR B C   1 
ATOM   4624  O  O   . TYR B  2  9   ? -31.784 0.647   26.050   1.00 173.70 ? 119  TYR B O   1 
ATOM   4625  C  CB  . TYR B  2  9   ? -30.738 3.281   27.300   1.00 142.63 ? 119  TYR B CB  1 
ATOM   4626  C  CG  . TYR B  2  9   ? -29.770 4.051   26.422   1.00 141.16 ? 119  TYR B CG  1 
ATOM   4627  C  CD1 . TYR B  2  9   ? -29.778 5.442   26.396   1.00 158.64 ? 119  TYR B CD1 1 
ATOM   4628  C  CD2 . TYR B  2  9   ? -28.855 3.393   25.614   1.00 145.96 ? 119  TYR B CD2 1 
ATOM   4629  C  CE1 . TYR B  2  9   ? -28.892 6.155   25.595   1.00 147.91 ? 119  TYR B CE1 1 
ATOM   4630  C  CE2 . TYR B  2  9   ? -27.963 4.099   24.809   1.00 134.75 ? 119  TYR B CE2 1 
ATOM   4631  C  CZ  . TYR B  2  9   ? -27.989 5.477   24.804   1.00 139.93 ? 119  TYR B CZ  1 
ATOM   4632  O  OH  . TYR B  2  9   ? -27.113 6.181   24.008   1.00 140.03 ? 119  TYR B OH  1 
ATOM   4633  N  N   . TYR B  2  10  ? -31.840 2.129   24.353   1.00 152.09 ? 120  TYR B N   1 
ATOM   4634  C  CA  . TYR B  2  10  ? -31.777 1.126   23.295   1.00 151.24 ? 120  TYR B CA  1 
ATOM   4635  C  C   . TYR B  2  10  ? -30.363 1.097   22.725   1.00 143.76 ? 120  TYR B C   1 
ATOM   4636  O  O   . TYR B  2  10  ? -29.965 2.001   21.985   1.00 146.16 ? 120  TYR B O   1 
ATOM   4637  C  CB  . TYR B  2  10  ? -32.814 1.420   22.220   1.00 161.80 ? 120  TYR B CB  1 
ATOM   4638  C  CG  . TYR B  2  10  ? -33.134 0.235   21.345   1.00 162.98 ? 120  TYR B CG  1 
ATOM   4639  C  CD1 . TYR B  2  10  ? -33.909 -0.810  21.821   1.00 164.21 ? 120  TYR B CD1 1 
ATOM   4640  C  CD2 . TYR B  2  10  ? -32.670 0.166   20.041   1.00 163.52 ? 120  TYR B CD2 1 
ATOM   4641  C  CE1 . TYR B  2  10  ? -34.205 -1.898  21.026   1.00 184.67 ? 120  TYR B CE1 1 
ATOM   4642  C  CE2 . TYR B  2  10  ? -32.962 -0.914  19.239   1.00 165.06 ? 120  TYR B CE2 1 
ATOM   4643  C  CZ  . TYR B  2  10  ? -33.730 -1.946  19.735   1.00 185.88 ? 120  TYR B CZ  1 
ATOM   4644  O  OH  . TYR B  2  10  ? -34.028 -3.030  18.938   1.00 200.19 ? 120  TYR B OH  1 
ATOM   4645  N  N   . LEU B  2  11  ? -29.607 0.055   23.078   1.00 135.28 ? 121  LEU B N   1 
ATOM   4646  C  CA  . LEU B  2  11  ? -28.215 -0.111  22.653   1.00 127.94 ? 121  LEU B CA  1 
ATOM   4647  C  C   . LEU B  2  11  ? -28.144 -1.103  21.492   1.00 127.90 ? 121  LEU B C   1 
ATOM   4648  O  O   . LEU B  2  11  ? -28.230 -2.318  21.692   1.00 124.66 ? 121  LEU B O   1 
ATOM   4649  C  CB  . LEU B  2  11  ? -27.365 -0.571  23.828   1.00 119.13 ? 121  LEU B CB  1 
ATOM   4650  C  CG  . LEU B  2  11  ? -25.867 -0.406  23.623   1.00 117.87 ? 121  LEU B CG  1 
ATOM   4651  C  CD1 . LEU B  2  11  ? -25.571 1.056   23.320   1.00 116.09 ? 121  LEU B CD1 1 
ATOM   4652  C  CD2 . LEU B  2  11  ? -25.127 -0.877  24.863   1.00 148.82 ? 121  LEU B CD2 1 
ATOM   4653  N  N   . MET B  2  12  ? -27.948 -0.588  20.279   1.00 157.62 ? 122  MET B N   1 
ATOM   4654  C  CA  . MET B  2  12  ? -27.943 -1.407  19.073   1.00 139.88 ? 122  MET B CA  1 
ATOM   4655  C  C   . MET B  2  12  ? -26.525 -1.668  18.574   1.00 126.50 ? 122  MET B C   1 
ATOM   4656  O  O   . MET B  2  12  ? -25.691 -0.758  18.525   1.00 125.03 ? 122  MET B O   1 
ATOM   4657  C  CB  . MET B  2  12  ? -28.749 -0.735  17.961   1.00 150.66 ? 122  MET B CB  1 
ATOM   4658  C  CG  . MET B  2  12  ? -29.068 -1.650  16.798   1.00 146.65 ? 122  MET B CG  1 
ATOM   4659  S  SD  . MET B  2  12  ? -29.212 -0.751  15.242   1.00 196.43 ? 122  MET B SD  1 
ATOM   4660  C  CE  . MET B  2  12  ? -30.606 0.328   15.550   1.00 197.89 ? 122  MET B CE  1 
ATOM   4661  N  N   . ASP B  2  13  ? -26.283 -2.905  18.148   1.00 123.40 ? 123  ASP B N   1 
ATOM   4662  C  CA  . ASP B  2  13  ? -25.025 -3.302  17.526   1.00 118.24 ? 123  ASP B CA  1 
ATOM   4663  C  C   . ASP B  2  13  ? -25.092 -3.033  16.033   1.00 124.53 ? 123  ASP B C   1 
ATOM   4664  O  O   . ASP B  2  13  ? -25.897 -3.642  15.324   1.00 168.37 ? 123  ASP B O   1 
ATOM   4665  C  CB  . ASP B  2  13  ? -24.750 -4.784  17.759   1.00 112.60 ? 123  ASP B CB  1 
ATOM   4666  C  CG  . ASP B  2  13  ? -23.566 -5.291  16.966   1.00 108.68 ? 123  ASP B CG  1 
ATOM   4667  O  OD1 . ASP B  2  13  ? -22.634 -4.510  16.694   1.00 107.38 ? 123  ASP B OD1 1 
ATOM   4668  O  OD2 . ASP B  2  13  ? -23.597 -6.476  16.577   1.00 107.65 ? 123  ASP B OD2 1 
ATOM   4669  N  N   . LEU B  2  14  ? -24.242 -2.142  15.550   1.00 124.73 ? 124  LEU B N   1 
ATOM   4670  C  CA  . LEU B  2  14  ? -24.232 -1.832  14.136   1.00 131.08 ? 124  LEU B CA  1 
ATOM   4671  C  C   . LEU B  2  14  ? -23.171 -2.611  13.381   1.00 129.08 ? 124  LEU B C   1 
ATOM   4672  O  O   . LEU B  2  14  ? -22.900 -2.295  12.221   1.00 149.03 ? 124  LEU B O   1 
ATOM   4673  C  CB  . LEU B  2  14  ? -24.027 -0.333  13.934   1.00 135.48 ? 124  LEU B CB  1 
ATOM   4674  C  CG  . LEU B  2  14  ? -25.267 0.513   14.199   1.00 142.85 ? 124  LEU B CG  1 
ATOM   4675  C  CD1 . LEU B  2  14  ? -24.996 1.970   13.900   1.00 154.64 ? 124  LEU B CD1 1 
ATOM   4676  C  CD2 . LEU B  2  14  ? -26.391 0.006   13.328   1.00 150.44 ? 124  LEU B CD2 1 
ATOM   4677  N  N   . SER B  2  15  ? -22.596 -3.646  13.987   1.00 122.03 ? 125  SER B N   1 
ATOM   4678  C  CA  . SER B  2  15  ? -21.491 -4.348  13.351   1.00 121.57 ? 125  SER B CA  1 
ATOM   4679  C  C   . SER B  2  15  ? -21.958 -5.072  12.086   1.00 129.91 ? 125  SER B C   1 
ATOM   4680  O  O   . SER B  2  15  ? -23.143 -5.095  11.736   1.00 135.87 ? 125  SER B O   1 
ATOM   4681  C  CB  . SER B  2  15  ? -20.837 -5.315  14.336   1.00 112.90 ? 125  SER B CB  1 
ATOM   4682  O  OG  . SER B  2  15  ? -21.727 -6.347  14.721   1.00 112.32 ? 125  SER B OG  1 
ATOM   4683  N  N   . ALA B  2  16  ? -20.997 -5.704  11.409   1.00 130.70 ? 126  ALA B N   1 
ATOM   4684  C  CA  . ALA B  2  16  ? -21.264 -6.255  10.088   1.00 139.38 ? 126  ALA B CA  1 
ATOM   4685  C  C   . ALA B  2  16  ? -22.202 -7.448  10.159   1.00 140.76 ? 126  ALA B C   1 
ATOM   4686  O  O   . ALA B  2  16  ? -22.972 -7.686  9.224    1.00 149.11 ? 126  ALA B O   1 
ATOM   4687  C  CB  . ALA B  2  16  ? -19.952 -6.640  9.404    1.00 139.92 ? 126  ALA B CB  1 
ATOM   4688  N  N   . SER B  2  17  ? -22.184 -8.187  11.257   1.00 133.28 ? 127  SER B N   1 
ATOM   4689  C  CA  . SER B  2  17  ? -23.006 -9.381  11.355   1.00 134.65 ? 127  SER B CA  1 
ATOM   4690  C  C   . SER B  2  17  ? -24.466 -9.052  11.595   1.00 138.15 ? 127  SER B C   1 
ATOM   4691  O  O   . SER B  2  17  ? -25.275 -9.965  11.817   1.00 139.31 ? 127  SER B O   1 
ATOM   4692  C  CB  . SER B  2  17  ? -22.477 -10.301 12.464   1.00 136.22 ? 127  SER B CB  1 
ATOM   4693  O  OG  . SER B  2  17  ? -22.294 -9.606  13.691   1.00 118.41 ? 127  SER B OG  1 
ATOM   4694  N  N   . MET B  2  18  ? -24.826 -7.774  11.516   1.00 140.72 ? 128  MET B N   1 
ATOM   4695  C  CA  . MET B  2  18  ? -26.160 -7.320  11.867   1.00 144.01 ? 128  MET B CA  1 
ATOM   4696  C  C   . MET B  2  18  ? -27.000 -6.935  10.655   1.00 155.56 ? 128  MET B C   1 
ATOM   4697  O  O   . MET B  2  18  ? -28.133 -6.468  10.825   1.00 160.00 ? 128  MET B O   1 
ATOM   4698  C  CB  . MET B  2  18  ? -26.050 -6.139  12.830   1.00 138.73 ? 128  MET B CB  1 
ATOM   4699  C  CG  . MET B  2  18  ? -25.533 -6.505  14.205   1.00 128.09 ? 128  MET B CG  1 
ATOM   4700  S  SD  . MET B  2  18  ? -26.705 -7.473  15.160   1.00 126.54 ? 128  MET B SD  1 
ATOM   4701  C  CE  . MET B  2  18  ? -28.087 -6.335  15.210   1.00 135.87 ? 128  MET B CE  1 
ATOM   4702  N  N   . ASP B  2  19  ? -26.494 -7.146  9.435    1.00 161.20 ? 129  ASP B N   1 
ATOM   4703  C  CA  . ASP B  2  19  ? -27.289 -6.829  8.253    1.00 172.89 ? 129  ASP B CA  1 
ATOM   4704  C  C   . ASP B  2  19  ? -28.461 -7.787  8.115    1.00 178.53 ? 129  ASP B C   1 
ATOM   4705  O  O   . ASP B  2  19  ? -29.528 -7.403  7.621    1.00 208.98 ? 129  ASP B O   1 
ATOM   4706  C  CB  . ASP B  2  19  ? -26.418 -6.862  6.995    1.00 192.24 ? 129  ASP B CB  1 
ATOM   4707  C  CG  . ASP B  2  19  ? -27.213 -6.586  5.724    1.00 215.98 ? 129  ASP B CG  1 
ATOM   4708  O  OD1 . ASP B  2  19  ? -27.477 -5.401  5.423    1.00 195.55 ? 129  ASP B OD1 1 
ATOM   4709  O  OD2 . ASP B  2  19  ? -27.579 -7.557  5.025    1.00 218.97 ? 129  ASP B OD2 1 
ATOM   4710  N  N   . ASP B  2  20  ? -28.286 -9.028  8.561    1.00 173.41 ? 130  ASP B N   1 
ATOM   4711  C  CA  . ASP B  2  20  ? -29.355 -10.013 8.556    1.00 183.59 ? 130  ASP B CA  1 
ATOM   4712  C  C   . ASP B  2  20  ? -30.322 -9.805  9.705    1.00 174.99 ? 130  ASP B C   1 
ATOM   4713  O  O   . ASP B  2  20  ? -31.395 -10.417 9.724    1.00 180.14 ? 130  ASP B O   1 
ATOM   4714  C  CB  . ASP B  2  20  ? -28.767 -11.427 8.627    1.00 193.80 ? 130  ASP B CB  1 
ATOM   4715  C  CG  . ASP B  2  20  ? -27.765 -11.591 9.763    1.00 161.72 ? 130  ASP B CG  1 
ATOM   4716  O  OD1 . ASP B  2  20  ? -27.025 -10.629 10.055   1.00 157.02 ? 130  ASP B OD1 1 
ATOM   4717  O  OD2 . ASP B  2  20  ? -27.711 -12.678 10.372   1.00 157.40 ? 130  ASP B OD2 1 
ATOM   4718  N  N   . ASP B  2  21  ? -29.966 -8.963  10.660   1.00 167.61 ? 131  ASP B N   1 
ATOM   4719  C  CA  . ASP B  2  21  ? -30.769 -8.758  11.844   1.00 164.52 ? 131  ASP B CA  1 
ATOM   4720  C  C   . ASP B  2  21  ? -31.253 -7.322  11.917   1.00 168.00 ? 131  ASP B C   1 
ATOM   4721  O  O   . ASP B  2  21  ? -31.904 -6.945  12.898   1.00 167.83 ? 131  ASP B O   1 
ATOM   4722  C  CB  . ASP B  2  21  ? -29.948 -9.089  13.092   1.00 152.48 ? 131  ASP B CB  1 
ATOM   4723  C  CG  . ASP B  2  21  ? -28.891 -10.162 12.836   1.00 157.55 ? 131  ASP B CG  1 
ATOM   4724  O  OD1 . ASP B  2  21  ? -29.157 -11.201 12.193   1.00 152.91 ? 131  ASP B OD1 1 
ATOM   4725  O  OD2 . ASP B  2  21  ? -27.744 -9.934  13.262   1.00 168.02 ? 131  ASP B OD2 1 
ATOM   4726  N  N   . LEU B  2  22  ? -30.905 -6.503  10.922   1.00 173.24 ? 132  LEU B N   1 
ATOM   4727  C  CA  . LEU B  2  22  ? -31.234 -5.081  10.942   1.00 181.13 ? 132  LEU B CA  1 
ATOM   4728  C  C   . LEU B  2  22  ? -32.741 -4.852  10.973   1.00 193.61 ? 132  LEU B C   1 
ATOM   4729  O  O   . LEU B  2  22  ? -33.252 -4.117  11.827   1.00 203.08 ? 132  LEU B O   1 
ATOM   4730  C  CB  . LEU B  2  22  ? -30.616 -4.402  9.720    1.00 199.66 ? 132  LEU B CB  1 
ATOM   4731  C  CG  . LEU B  2  22  ? -30.891 -2.911  9.521    1.00 209.78 ? 132  LEU B CG  1 
ATOM   4732  C  CD1 . LEU B  2  22  ? -30.330 -2.108  10.682   1.00 184.71 ? 132  LEU B CD1 1 
ATOM   4733  C  CD2 . LEU B  2  22  ? -30.323 -2.431  8.190    1.00 207.30 ? 132  LEU B CD2 1 
ATOM   4734  N  N   . ASN B  2  23  ? -33.474 -5.488  10.053   1.00 195.07 ? 133  ASN B N   1 
ATOM   4735  C  CA  . ASN B  2  23  ? -34.909 -5.253  9.945    1.00 206.02 ? 133  ASN B CA  1 
ATOM   4736  C  C   . ASN B  2  23  ? -35.652 -5.698  11.193   1.00 204.98 ? 133  ASN B C   1 
ATOM   4737  O  O   . ASN B  2  23  ? -36.771 -5.234  11.437   1.00 213.66 ? 133  ASN B O   1 
ATOM   4738  C  CB  . ASN B  2  23  ? -35.474 -5.975  8.722    1.00 216.06 ? 133  ASN B CB  1 
ATOM   4739  C  CG  . ASN B  2  23  ? -35.237 -7.466  8.772    1.00 216.68 ? 133  ASN B CG  1 
ATOM   4740  O  OD1 . ASN B  2  23  ? -34.231 -7.926  9.312    1.00 210.08 ? 133  ASN B OD1 1 
ATOM   4741  N  ND2 . ASN B  2  23  ? -36.169 -8.233  8.220    1.00 221.34 ? 133  ASN B ND2 1 
ATOM   4742  N  N   . THR B  2  24  ? -35.050 -6.580  11.991   1.00 195.41 ? 134  THR B N   1 
ATOM   4743  C  CA  . THR B  2  24  ? -35.673 -7.002  13.237   1.00 193.82 ? 134  THR B CA  1 
ATOM   4744  C  C   . THR B  2  24  ? -35.553 -5.922  14.297   1.00 190.48 ? 134  THR B C   1 
ATOM   4745  O  O   . THR B  2  24  ? -36.428 -5.795  15.160   1.00 194.18 ? 134  THR B O   1 
ATOM   4746  C  CB  . THR B  2  24  ? -35.018 -8.287  13.750   1.00 184.61 ? 134  THR B CB  1 
ATOM   4747  O  OG1 . THR B  2  24  ? -35.033 -9.295  12.730   1.00 187.51 ? 134  THR B OG1 1 
ATOM   4748  C  CG2 . THR B  2  24  ? -35.757 -8.795  14.953   1.00 184.90 ? 134  THR B CG2 1 
ATOM   4749  N  N   . ILE B  2  25  ? -34.493 -5.123  14.223   1.00 190.09 ? 135  ILE B N   1 
ATOM   4750  C  CA  . ILE B  2  25  ? -34.261 -4.091  15.222   1.00 180.80 ? 135  ILE B CA  1 
ATOM   4751  C  C   . ILE B  2  25  ? -35.158 -2.889  14.973   1.00 191.19 ? 135  ILE B C   1 
ATOM   4752  O  O   . ILE B  2  25  ? -35.689 -2.290  15.915   1.00 199.37 ? 135  ILE B O   1 
ATOM   4753  C  CB  . ILE B  2  25  ? -32.772 -3.713  15.227   1.00 171.02 ? 135  ILE B CB  1 
ATOM   4754  C  CG1 . ILE B  2  25  ? -31.932 -4.944  15.566   1.00 161.29 ? 135  ILE B CG1 1 
ATOM   4755  C  CG2 . ILE B  2  25  ? -32.510 -2.609  16.213   1.00 172.56 ? 135  ILE B CG2 1 
ATOM   4756  C  CD1 . ILE B  2  25  ? -32.523 -5.779  16.672   1.00 159.60 ? 135  ILE B CD1 1 
ATOM   4757  N  N   . LYS B  2  26  ? -35.356 -2.529  13.705   1.00 198.73 ? 136  LYS B N   1 
ATOM   4758  C  CA  . LYS B  2  26  ? -36.259 -1.431  13.385   1.00 213.77 ? 136  LYS B CA  1 
ATOM   4759  C  C   . LYS B  2  26  ? -37.702 -1.808  13.692   1.00 229.37 ? 136  LYS B C   1 
ATOM   4760  O  O   . LYS B  2  26  ? -38.490 -0.954  14.115   1.00 240.49 ? 136  LYS B O   1 
ATOM   4761  C  CB  . LYS B  2  26  ? -36.093 -1.038  11.915   1.00 224.23 ? 136  LYS B CB  1 
ATOM   4762  C  CG  . LYS B  2  26  ? -34.672 -0.608  11.548   1.00 208.23 ? 136  LYS B CG  1 
ATOM   4763  C  CD  . LYS B  2  26  ? -34.561 -0.162  10.097   1.00 216.52 ? 136  LYS B CD  1 
ATOM   4764  C  CE  . LYS B  2  26  ? -33.120 0.156   9.730    1.00 208.07 ? 136  LYS B CE  1 
ATOM   4765  N  NZ  . LYS B  2  26  ? -32.977 0.554   8.306    1.00 215.72 ? 136  LYS B NZ  1 
ATOM   4766  N  N   . GLU B  2  27  ? -38.059 -3.080  13.496   1.00 227.75 ? 137  GLU B N   1 
ATOM   4767  C  CA  . GLU B  2  27  ? -39.374 -3.564  13.889   1.00 235.82 ? 137  GLU B CA  1 
ATOM   4768  C  C   . GLU B  2  27  ? -39.482 -3.751  15.391   1.00 222.79 ? 137  GLU B C   1 
ATOM   4769  O  O   . GLU B  2  27  ? -40.595 -3.882  15.910   1.00 230.40 ? 137  GLU B O   1 
ATOM   4770  C  CB  . GLU B  2  27  ? -39.691 -4.885  13.182   1.00 232.70 ? 137  GLU B CB  1 
ATOM   4771  C  CG  . GLU B  2  27  ? -40.271 -4.730  11.788   1.00 242.93 ? 137  GLU B CG  1 
ATOM   4772  C  CD  . GLU B  2  27  ? -40.913 -6.009  11.286   1.00 253.05 ? 137  GLU B CD  1 
ATOM   4773  O  OE1 . GLU B  2  27  ? -41.181 -6.100  10.069   1.00 262.03 ? 137  GLU B OE1 1 
ATOM   4774  O  OE2 . GLU B  2  27  ? -41.141 -6.926  12.106   1.00 245.52 ? 137  GLU B OE2 1 
ATOM   4775  N  N   . LEU B  2  28  ? -38.351 -3.779  16.091   1.00 210.36 ? 138  LEU B N   1 
ATOM   4776  C  CA  . LEU B  2  28  ? -38.347 -3.792  17.545   1.00 205.02 ? 138  LEU B CA  1 
ATOM   4777  C  C   . LEU B  2  28  ? -38.406 -2.385  18.119   1.00 206.60 ? 138  LEU B C   1 
ATOM   4778  O  O   . LEU B  2  28  ? -39.026 -2.170  19.163   1.00 208.85 ? 138  LEU B O   1 
ATOM   4779  C  CB  . LEU B  2  28  ? -37.108 -4.522  18.062   1.00 191.55 ? 138  LEU B CB  1 
ATOM   4780  C  CG  . LEU B  2  28  ? -36.946 -4.538  19.579   1.00 185.30 ? 138  LEU B CG  1 
ATOM   4781  C  CD1 . LEU B  2  28  ? -38.213 -5.039  20.246   1.00 192.72 ? 138  LEU B CD1 1 
ATOM   4782  C  CD2 . LEU B  2  28  ? -35.777 -5.412  19.955   1.00 173.30 ? 138  LEU B CD2 1 
ATOM   4783  N  N   . GLY B  2  29  ? -37.767 -1.423  17.460   1.00 205.93 ? 139  GLY B N   1 
ATOM   4784  C  CA  . GLY B  2  29  ? -37.826 -0.045  17.893   1.00 208.47 ? 139  GLY B CA  1 
ATOM   4785  C  C   . GLY B  2  29  ? -39.224 0.536   17.837   1.00 221.94 ? 139  GLY B C   1 
ATOM   4786  O  O   . GLY B  2  29  ? -39.738 1.026   18.847   1.00 224.21 ? 139  GLY B O   1 
ATOM   4787  N  N   . SER B  2  30  ? -39.850 0.490   16.657   1.00 231.53 ? 140  SER B N   1 
ATOM   4788  C  CA  . SER B  2  30  ? -41.182 1.067   16.504   1.00 245.56 ? 140  SER B CA  1 
ATOM   4789  C  C   . SER B  2  30  ? -42.203 0.334   17.362   1.00 249.68 ? 140  SER B C   1 
ATOM   4790  O  O   . SER B  2  30  ? -43.103 0.955   17.939   1.00 257.78 ? 140  SER B O   1 
ATOM   4791  C  CB  . SER B  2  30  ? -41.602 1.033   15.035   1.00 255.10 ? 140  SER B CB  1 
ATOM   4792  O  OG  . SER B  2  30  ? -41.775 -0.301  14.588   1.00 254.84 ? 140  SER B OG  1 
ATOM   4793  N  N   . ARG B  2  31  ? -42.068 -0.990  17.471   1.00 244.62 ? 141  ARG B N   1 
ATOM   4794  C  CA  . ARG B  2  31  ? -43.003 -1.764  18.280   1.00 248.77 ? 141  ARG B CA  1 
ATOM   4795  C  C   . ARG B  2  31  ? -42.824 -1.453  19.759   1.00 242.86 ? 141  ARG B C   1 
ATOM   4796  O  O   . ARG B  2  31  ? -43.804 -1.384  20.511   1.00 250.12 ? 141  ARG B O   1 
ATOM   4797  C  CB  . ARG B  2  31  ? -42.808 -3.255  18.008   1.00 244.63 ? 141  ARG B CB  1 
ATOM   4798  C  CG  . ARG B  2  31  ? -43.901 -4.152  18.557   1.00 251.66 ? 141  ARG B CG  1 
ATOM   4799  C  CD  . ARG B  2  31  ? -43.709 -5.584  18.084   1.00 248.89 ? 141  ARG B CD  1 
ATOM   4800  N  NE  . ARG B  2  31  ? -44.811 -6.450  18.496   1.00 257.26 ? 141  ARG B NE  1 
ATOM   4801  C  CZ  . ARG B  2  31  ? -44.924 -7.728  18.151   1.00 257.89 ? 141  ARG B CZ  1 
ATOM   4802  N  NH1 . ARG B  2  31  ? -44.004 -8.292  17.382   1.00 250.50 ? 141  ARG B NH1 1 
ATOM   4803  N  NH2 . ARG B  2  31  ? -45.959 -8.442  18.569   1.00 266.49 ? 141  ARG B NH2 1 
ATOM   4804  N  N   . LEU B  2  32  ? -41.577 -1.259  20.189   1.00 230.28 ? 142  LEU B N   1 
ATOM   4805  C  CA  . LEU B  2  32  ? -41.311 -0.847  21.562   1.00 224.73 ? 142  LEU B CA  1 
ATOM   4806  C  C   . LEU B  2  32  ? -41.710 0.606   21.784   1.00 231.39 ? 142  LEU B C   1 
ATOM   4807  O  O   . LEU B  2  32  ? -42.040 0.994   22.911   1.00 232.32 ? 142  LEU B O   1 
ATOM   4808  C  CB  . LEU B  2  32  ? -39.828 -1.074  21.883   1.00 215.16 ? 142  LEU B CB  1 
ATOM   4809  C  CG  . LEU B  2  32  ? -39.160 -0.648  23.194   1.00 212.86 ? 142  LEU B CG  1 
ATOM   4810  C  CD1 . LEU B  2  32  ? -38.140 -1.693  23.649   1.00 189.71 ? 142  LEU B CD1 1 
ATOM   4811  C  CD2 . LEU B  2  32  ? -38.484 0.703   23.025   1.00 209.38 ? 142  LEU B CD2 1 
ATOM   4812  N  N   . SER B  2  33  ? -41.713 1.414   20.724   1.00 236.78 ? 143  SER B N   1 
ATOM   4813  C  CA  . SER B  2  33  ? -42.103 2.813   20.830   1.00 244.11 ? 143  SER B CA  1 
ATOM   4814  C  C   . SER B  2  33  ? -43.617 2.958   20.763   1.00 259.02 ? 143  SER B C   1 
ATOM   4815  O  O   . SER B  2  33  ? -44.133 4.011   20.371   1.00 268.52 ? 143  SER B O   1 
ATOM   4816  C  CB  . SER B  2  33  ? -41.441 3.640   19.726   1.00 244.21 ? 143  SER B CB  1 
ATOM   4817  O  OG  . SER B  2  33  ? -41.830 4.998   19.809   1.00 251.99 ? 143  SER B OG  1 
ATOM   4818  N  N   . LYS B  2  34  ? -44.336 1.905   21.145   1.00 261.75 ? 144  LYS B N   1 
ATOM   4819  C  CA  . LYS B  2  34  ? -45.791 1.916   21.143   1.00 276.38 ? 144  LYS B CA  1 
ATOM   4820  C  C   . LYS B  2  34  ? -46.319 1.306   22.435   1.00 276.38 ? 144  LYS B C   1 
ATOM   4821  O  O   . LYS B  2  34  ? -47.136 1.917   23.130   1.00 284.63 ? 144  LYS B O   1 
ATOM   4822  C  CB  . LYS B  2  34  ? -46.327 1.153   19.928   1.00 283.68 ? 144  LYS B CB  1 
ATOM   4823  C  CG  . LYS B  2  34  ? -47.809 0.787   20.001   1.00 298.20 ? 144  LYS B CG  1 
ATOM   4824  C  CD  . LYS B  2  34  ? -48.713 2.018   20.036   1.00 311.20 ? 144  LYS B CD  1 
ATOM   4825  C  CE  . LYS B  2  34  ? -50.182 1.629   20.197   1.00 326.10 ? 144  LYS B CE  1 
ATOM   4826  N  NZ  . LYS B  2  34  ? -51.079 2.817   20.292   1.00 339.36 ? 144  LYS B NZ  1 
ATOM   4827  N  N   . GLU B  2  35  ? -45.829 0.116   22.784   1.00 267.36 ? 145  GLU B N   1 
ATOM   4828  C  CA  . GLU B  2  35  ? -46.340 -0.588  23.952   1.00 267.94 ? 145  GLU B CA  1 
ATOM   4829  C  C   . GLU B  2  35  ? -45.874 0.038   25.260   1.00 261.44 ? 145  GLU B C   1 
ATOM   4830  O  O   . GLU B  2  35  ? -46.413 -0.303  26.319   1.00 263.92 ? 145  GLU B O   1 
ATOM   4831  C  CB  . GLU B  2  35  ? -45.921 -2.061  23.889   1.00 260.60 ? 145  GLU B CB  1 
ATOM   4832  C  CG  . GLU B  2  35  ? -46.245 -2.768  22.567   1.00 265.99 ? 145  GLU B CG  1 
ATOM   4833  C  CD  . GLU B  2  35  ? -47.735 -2.951  22.322   1.00 282.19 ? 145  GLU B CD  1 
ATOM   4834  O  OE1 . GLU B  2  35  ? -48.506 -2.988  23.303   1.00 287.97 ? 145  GLU B OE1 1 
ATOM   4835  O  OE2 . GLU B  2  35  ? -48.132 -3.066  21.142   1.00 289.68 ? 145  GLU B OE2 1 
ATOM   4836  N  N   . MET B  2  36  ? -44.891 0.939   25.213   1.00 253.80 ? 146  MET B N   1 
ATOM   4837  C  CA  . MET B  2  36  ? -44.388 1.563   26.431   1.00 247.77 ? 146  MET B CA  1 
ATOM   4838  C  C   . MET B  2  36  ? -45.391 2.537   27.023   1.00 259.12 ? 146  MET B C   1 
ATOM   4839  O  O   . MET B  2  36  ? -45.482 2.667   28.249   1.00 258.05 ? 146  MET B O   1 
ATOM   4840  C  CB  . MET B  2  36  ? -43.081 2.296   26.141   1.00 237.78 ? 146  MET B CB  1 
ATOM   4841  C  CG  . MET B  2  36  ? -41.859 1.406   26.088   1.00 224.12 ? 146  MET B CG  1 
ATOM   4842  S  SD  . MET B  2  36  ? -41.583 0.499   27.621   1.00 216.23 ? 146  MET B SD  1 
ATOM   4843  C  CE  . MET B  2  36  ? -41.343 1.826   28.801   1.00 215.45 ? 146  MET B CE  1 
ATOM   4844  N  N   . SER B  2  37  ? -46.152 3.222   26.174   1.00 270.56 ? 147  SER B N   1 
ATOM   4845  C  CA  . SER B  2  37  ? -47.116 4.198   26.654   1.00 282.36 ? 147  SER B CA  1 
ATOM   4846  C  C   . SER B  2  37  ? -48.326 3.549   27.306   1.00 291.99 ? 147  SER B C   1 
ATOM   4847  O  O   . SER B  2  37  ? -49.150 4.262   27.889   1.00 301.87 ? 147  SER B O   1 
ATOM   4848  C  CB  . SER B  2  37  ? -47.557 5.097   25.496   1.00 292.38 ? 147  SER B CB  1 
ATOM   4849  O  OG  . SER B  2  37  ? -48.514 6.052   25.918   1.00 304.71 ? 147  SER B OG  1 
ATOM   4850  N  N   . LYS B  2  38  ? -48.453 2.224   27.227   1.00 289.91 ? 148  LYS B N   1 
ATOM   4851  C  CA  . LYS B  2  38  ? -49.606 1.530   27.784   1.00 299.81 ? 148  LYS B CA  1 
ATOM   4852  C  C   . LYS B  2  38  ? -49.550 1.461   29.305   1.00 296.34 ? 148  LYS B C   1 
ATOM   4853  O  O   . LYS B  2  38  ? -50.375 2.072   29.992   1.00 306.06 ? 148  LYS B O   1 
ATOM   4854  C  CB  . LYS B  2  38  ? -49.711 0.117   27.201   1.00 298.82 ? 148  LYS B CB  1 
ATOM   4855  C  CG  . LYS B  2  38  ? -50.054 0.067   25.716   1.00 305.71 ? 148  LYS B CG  1 
ATOM   4856  C  CD  . LYS B  2  38  ? -51.432 0.660   25.435   1.00 323.62 ? 148  LYS B CD  1 
ATOM   4857  C  CE  . LYS B  2  38  ? -51.781 0.597   23.952   1.00 331.21 ? 148  LYS B CE  1 
ATOM   4858  N  NZ  . LYS B  2  38  ? -51.820 -0.798  23.430   1.00 329.96 ? 148  LYS B NZ  1 
ATOM   4859  N  N   . LEU B  2  39  ? -48.574 0.733   29.842   1.00 283.02 ? 149  LEU B N   1 
ATOM   4860  C  CA  . LEU B  2  39  ? -48.522 0.470   31.274   1.00 279.91 ? 149  LEU B CA  1 
ATOM   4861  C  C   . LEU B  2  39  ? -47.982 1.640   32.088   1.00 275.81 ? 149  LEU B C   1 
ATOM   4862  O  O   . LEU B  2  39  ? -47.966 1.554   33.321   1.00 274.19 ? 149  LEU B O   1 
ATOM   4863  C  CB  . LEU B  2  39  ? -47.679 -0.778  31.545   1.00 267.84 ? 149  LEU B CB  1 
ATOM   4864  C  CG  . LEU B  2  39  ? -48.444 -2.006  32.039   1.00 273.27 ? 149  LEU B CG  1 
ATOM   4865  C  CD1 . LEU B  2  39  ? -47.490 -3.167  32.243   1.00 260.79 ? 149  LEU B CD1 1 
ATOM   4866  C  CD2 . LEU B  2  39  ? -49.183 -1.683  33.328   1.00 280.80 ? 149  LEU B CD2 1 
ATOM   4867  N  N   . THR B  2  40  ? -47.549 2.724   31.448   1.00 274.67 ? 150  THR B N   1 
ATOM   4868  C  CA  . THR B  2  40  ? -47.052 3.882   32.175   1.00 271.73 ? 150  THR B CA  1 
ATOM   4869  C  C   . THR B  2  40  ? -47.219 5.125   31.317   1.00 278.16 ? 150  THR B C   1 
ATOM   4870  O  O   . THR B  2  40  ? -47.194 5.059   30.085   1.00 279.47 ? 150  THR B O   1 
ATOM   4871  C  CB  . THR B  2  40  ? -45.578 3.727   32.569   1.00 255.79 ? 150  THR B CB  1 
ATOM   4872  O  OG1 . THR B  2  40  ? -45.149 4.892   33.285   1.00 254.20 ? 150  THR B OG1 1 
ATOM   4873  C  CG2 . THR B  2  40  ? -44.709 3.553   31.331   1.00 248.12 ? 150  THR B CG2 1 
ATOM   4874  N  N   . SER B  2  41  ? -47.373 6.264   31.988   1.00 282.48 ? 151  SER B N   1 
ATOM   4875  C  CA  . SER B  2  41  ? -47.472 7.549   31.314   1.00 288.68 ? 151  SER B CA  1 
ATOM   4876  C  C   . SER B  2  41  ? -46.167 8.323   31.338   1.00 278.01 ? 151  SER B C   1 
ATOM   4877  O  O   . SER B  2  41  ? -45.922 9.137   30.441   1.00 279.89 ? 151  SER B O   1 
ATOM   4878  C  CB  . SER B  2  41  ? -48.574 8.399   31.956   1.00 302.45 ? 151  SER B CB  1 
ATOM   4879  O  OG  . SER B  2  41  ? -48.400 8.463   33.360   1.00 299.16 ? 151  SER B OG  1 
ATOM   4880  N  N   . ASN B  2  42  ? -45.332 8.093   32.347   1.00 267.56 ? 152  ASN B N   1 
ATOM   4881  C  CA  . ASN B  2  42  ? -44.032 8.749   32.448   1.00 257.28 ? 152  ASN B CA  1 
ATOM   4882  C  C   . ASN B  2  42  ? -42.990 7.864   31.765   1.00 254.64 ? 152  ASN B C   1 
ATOM   4883  O  O   . ASN B  2  42  ? -42.262 7.093   32.397   1.00 247.69 ? 152  ASN B O   1 
ATOM   4884  C  CB  . ASN B  2  42  ? -43.687 9.025   33.904   1.00 253.53 ? 152  ASN B CB  1 
ATOM   4885  C  CG  . ASN B  2  42  ? -42.712 10.165  34.054   1.00 248.80 ? 152  ASN B CG  1 
ATOM   4886  O  OD1 . ASN B  2  42  ? -42.375 10.838  33.081   1.00 249.47 ? 152  ASN B OD1 1 
ATOM   4887  N  ND2 . ASN B  2  42  ? -42.254 10.396  35.275   1.00 245.09 ? 152  ASN B ND2 1 
ATOM   4888  N  N   . PHE B  2  43  ? -42.922 7.982   30.440   1.00 272.88 ? 153  PHE B N   1 
ATOM   4889  C  CA  . PHE B  2  43  ? -42.074 7.133   29.610   1.00 257.66 ? 153  PHE B CA  1 
ATOM   4890  C  C   . PHE B  2  43  ? -41.103 7.973   28.789   1.00 251.92 ? 153  PHE B C   1 
ATOM   4891  O  O   . PHE B  2  43  ? -41.524 8.829   28.003   1.00 271.83 ? 153  PHE B O   1 
ATOM   4892  C  CB  . PHE B  2  43  ? -42.920 6.252   28.691   1.00 248.00 ? 153  PHE B CB  1 
ATOM   4893  C  CG  . PHE B  2  43  ? -42.212 5.840   27.433   1.00 258.98 ? 153  PHE B CG  1 
ATOM   4894  C  CD1 . PHE B  2  43  ? -41.144 4.955   27.481   1.00 262.36 ? 153  PHE B CD1 1 
ATOM   4895  C  CD2 . PHE B  2  43  ? -42.616 6.332   26.201   1.00 251.01 ? 153  PHE B CD2 1 
ATOM   4896  C  CE1 . PHE B  2  43  ? -40.485 4.573   26.327   1.00 263.06 ? 153  PHE B CE1 1 
ATOM   4897  C  CE2 . PHE B  2  43  ? -41.963 5.950   25.040   1.00 270.87 ? 153  PHE B CE2 1 
ATOM   4898  C  CZ  . PHE B  2  43  ? -40.898 5.067   25.105   1.00 273.51 ? 153  PHE B CZ  1 
ATOM   4899  N  N   . ARG B  2  44  ? -39.807 7.721   28.972   1.00 220.80 ? 154  ARG B N   1 
ATOM   4900  C  CA  . ARG B  2  44  ? -38.750 8.337   28.181   1.00 215.88 ? 154  ARG B CA  1 
ATOM   4901  C  C   . ARG B  2  44  ? -37.778 7.259   27.731   1.00 204.86 ? 154  ARG B C   1 
ATOM   4902  O  O   . ARG B  2  44  ? -37.385 6.407   28.534   1.00 197.17 ? 154  ARG B O   1 
ATOM   4903  C  CB  . ARG B  2  44  ? -38.016 9.413   28.980   1.00 212.85 ? 154  ARG B CB  1 
ATOM   4904  C  CG  . ARG B  2  44  ? -38.899 10.570  29.378   1.00 224.01 ? 154  ARG B CG  1 
ATOM   4905  C  CD  . ARG B  2  44  ? -38.097 11.681  30.010   1.00 221.41 ? 154  ARG B CD  1 
ATOM   4906  N  NE  . ARG B  2  44  ? -38.967 12.721  30.546   1.00 232.13 ? 154  ARG B NE  1 
ATOM   4907  C  CZ  . ARG B  2  44  ? -38.542 13.736  31.288   1.00 232.36 ? 154  ARG B CZ  1 
ATOM   4908  N  NH1 . ARG B  2  44  ? -37.253 13.848  31.584   1.00 231.21 ? 154  ARG B NH1 1 
ATOM   4909  N  NH2 . ARG B  2  44  ? -39.405 14.637  31.736   1.00 242.95 ? 154  ARG B NH2 1 
ATOM   4910  N  N   . LEU B  2  45  ? -37.414 7.275   26.447   1.00 204.71 ? 155  LEU B N   1 
ATOM   4911  C  CA  . LEU B  2  45  ? -36.510 6.279   25.883   1.00 196.69 ? 155  LEU B CA  1 
ATOM   4912  C  C   . LEU B  2  45  ? -35.391 6.946   25.082   1.00 191.35 ? 155  LEU B C   1 
ATOM   4913  O  O   . LEU B  2  45  ? -35.575 8.022   24.507   1.00 208.30 ? 155  LEU B O   1 
ATOM   4914  C  CB  . LEU B  2  45  ? -37.278 5.279   25.003   1.00 199.67 ? 155  LEU B CB  1 
ATOM   4915  C  CG  . LEU B  2  45  ? -37.567 5.625   23.541   1.00 206.82 ? 155  LEU B CG  1 
ATOM   4916  C  CD1 . LEU B  2  45  ? -38.202 4.427   22.860   1.00 209.58 ? 155  LEU B CD1 1 
ATOM   4917  C  CD2 . LEU B  2  45  ? -38.448 6.864   23.392   1.00 218.82 ? 155  LEU B CD2 1 
ATOM   4918  N  N   . GLY B  2  46  ? -34.224 6.290   25.047   1.00 180.66 ? 156  GLY B N   1 
ATOM   4919  C  CA  . GLY B  2  46  ? -33.066 6.800   24.322   1.00 176.49 ? 156  GLY B CA  1 
ATOM   4920  C  C   . GLY B  2  46  ? -32.450 5.823   23.336   1.00 171.25 ? 156  GLY B C   1 
ATOM   4921  O  O   . GLY B  2  46  ? -33.030 4.766   23.075   1.00 171.91 ? 156  GLY B O   1 
ATOM   4922  N  N   . PHE B  2  47  ? -31.276 6.145   22.783   1.00 166.51 ? 157  PHE B N   1 
ATOM   4923  C  CA  . PHE B  2  47  ? -30.662 5.275   21.783   1.00 162.26 ? 157  PHE B CA  1 
ATOM   4924  C  C   . PHE B  2  47  ? -29.158 5.522   21.689   1.00 156.00 ? 157  PHE B C   1 
ATOM   4925  O  O   . PHE B  2  47  ? -28.682 6.650   21.848   1.00 155.99 ? 157  PHE B O   1 
ATOM   4926  C  CB  . PHE B  2  47  ? -31.302 5.457   20.401   1.00 171.06 ? 157  PHE B CB  1 
ATOM   4927  C  CG  . PHE B  2  47  ? -30.639 4.649   19.321   1.00 167.45 ? 157  PHE B CG  1 
ATOM   4928  C  CD1 . PHE B  2  47  ? -30.879 3.292   19.210   1.00 164.45 ? 157  PHE B CD1 1 
ATOM   4929  C  CD2 . PHE B  2  47  ? -29.776 5.246   18.418   1.00 167.63 ? 157  PHE B CD2 1 
ATOM   4930  C  CE1 . PHE B  2  47  ? -30.270 2.543   18.220   1.00 161.52 ? 157  PHE B CE1 1 
ATOM   4931  C  CE2 . PHE B  2  47  ? -29.166 4.504   17.424   1.00 164.83 ? 157  PHE B CE2 1 
ATOM   4932  C  CZ  . PHE B  2  47  ? -29.412 3.151   17.325   1.00 161.69 ? 157  PHE B CZ  1 
ATOM   4933  N  N   . GLY B  2  48  ? -28.431 4.437   21.427   1.00 172.64 ? 158  GLY B N   1 
ATOM   4934  C  CA  . GLY B  2  48  ? -26.990 4.481   21.242   1.00 140.41 ? 158  GLY B CA  1 
ATOM   4935  C  C   . GLY B  2  48  ? -26.537 3.317   20.388   1.00 136.46 ? 158  GLY B C   1 
ATOM   4936  O  O   . GLY B  2  48  ? -27.161 2.251   20.377   1.00 136.01 ? 158  GLY B O   1 
ATOM   4937  N  N   . SER B  2  49  ? -25.447 3.526   19.658   1.00 134.19 ? 159  SER B N   1 
ATOM   4938  C  CA  . SER B  2  49  ? -24.923 2.531   18.734   1.00 131.21 ? 159  SER B CA  1 
ATOM   4939  C  C   . SER B  2  49  ? -23.434 2.306   18.971   1.00 123.08 ? 159  SER B C   1 
ATOM   4940  O  O   . SER B  2  49  ? -22.728 3.184   19.472   1.00 121.69 ? 159  SER B O   1 
ATOM   4941  C  CB  . SER B  2  49  ? -25.179 2.956   17.293   1.00 138.90 ? 159  SER B CB  1 
ATOM   4942  O  OG  . SER B  2  49  ? -24.670 4.256   17.066   1.00 153.86 ? 159  SER B OG  1 
ATOM   4943  N  N   . PHE B  2  50  ? -22.968 1.108   18.620   1.00 118.22 ? 160  PHE B N   1 
ATOM   4944  C  CA  . PHE B  2  50  ? -21.567 0.739   18.786   1.00 110.94 ? 160  PHE B CA  1 
ATOM   4945  C  C   . PHE B  2  50  ? -21.160 -0.193  17.656   1.00 110.20 ? 160  PHE B C   1 
ATOM   4946  O  O   . PHE B  2  50  ? -22.006 -0.726  16.933   1.00 114.28 ? 160  PHE B O   1 
ATOM   4947  C  CB  . PHE B  2  50  ? -21.304 0.080   20.151   1.00 114.18 ? 160  PHE B CB  1 
ATOM   4948  C  CG  . PHE B  2  50  ? -21.986 -1.258  20.335   1.00 143.77 ? 160  PHE B CG  1 
ATOM   4949  C  CD1 . PHE B  2  50  ? -23.297 -1.325  20.780   1.00 123.24 ? 160  PHE B CD1 1 
ATOM   4950  C  CD2 . PHE B  2  50  ? -21.311 -2.447  20.091   1.00 127.88 ? 160  PHE B CD2 1 
ATOM   4951  C  CE1 . PHE B  2  50  ? -23.932 -2.549  20.961   1.00 104.45 ? 160  PHE B CE1 1 
ATOM   4952  C  CE2 . PHE B  2  50  ? -21.945 -3.675  20.269   1.00 95.20  ? 160  PHE B CE2 1 
ATOM   4953  C  CZ  . PHE B  2  50  ? -23.253 -3.722  20.708   1.00 99.25  ? 160  PHE B CZ  1 
ATOM   4954  N  N   . VAL B  2  51  ? -19.845 -0.324  17.462   1.00 105.84 ? 161  VAL B N   1 
ATOM   4955  C  CA  . VAL B  2  51  ? -19.292 -1.298  16.522   1.00 104.31 ? 161  VAL B CA  1 
ATOM   4956  C  C   . VAL B  2  51  ? -18.096 -2.023  17.140   1.00 96.32  ? 161  VAL B C   1 
ATOM   4957  O  O   . VAL B  2  51  ? -18.216 -3.175  17.570   1.00 91.96  ? 161  VAL B O   1 
ATOM   4958  C  CB  . VAL B  2  51  ? -18.897 -0.638  15.188   1.00 110.06 ? 161  VAL B CB  1 
ATOM   4959  C  CG1 . VAL B  2  51  ? -18.408 -1.687  14.216   1.00 111.94 ? 161  VAL B CG1 1 
ATOM   4960  C  CG2 . VAL B  2  51  ? -20.068 0.091   14.587   1.00 118.58 ? 161  VAL B CG2 1 
ATOM   4961  N  N   . GLU B  2  52  ? -16.953 -1.338  17.226   1.00 103.67 ? 162  GLU B N   1 
ATOM   4962  C  CA  . GLU B  2  52  ? -15.664 -1.917  17.606   1.00 88.77  ? 162  GLU B CA  1 
ATOM   4963  C  C   . GLU B  2  52  ? -14.662 -0.783  17.804   1.00 107.72 ? 162  GLU B C   1 
ATOM   4964  O  O   . GLU B  2  52  ? -14.832 0.310   17.254   1.00 150.07 ? 162  GLU B O   1 
ATOM   4965  C  CB  . GLU B  2  52  ? -15.166 -2.890  16.522   1.00 91.73  ? 162  GLU B CB  1 
ATOM   4966  C  CG  . GLU B  2  52  ? -13.915 -3.707  16.847   1.00 122.17 ? 162  GLU B CG  1 
ATOM   4967  C  CD  . GLU B  2  52  ? -14.133 -4.780  17.897   1.00 117.00 ? 162  GLU B CD  1 
ATOM   4968  O  OE1 . GLU B  2  52  ? -13.305 -4.876  18.821   1.00 76.96  ? 162  GLU B OE1 1 
ATOM   4969  O  OE2 . GLU B  2  52  ? -15.118 -5.538  17.790   1.00 111.38 ? 162  GLU B OE2 1 
ATOM   4970  N  N   . LYS B  2  53  ? -13.587 -1.066  18.550   1.00 118.60 ? 163  LYS B N   1 
ATOM   4971  C  CA  . LYS B  2  53  ? -12.531 -0.064  18.756   1.00 124.51 ? 163  LYS B CA  1 
ATOM   4972  C  C   . LYS B  2  53  ? -11.783 0.167   17.453   1.00 93.33  ? 163  LYS B C   1 
ATOM   4973  O  O   . LYS B  2  53  ? -11.283 -0.795  16.854   1.00 137.06 ? 163  LYS B O   1 
ATOM   4974  C  CB  . LYS B  2  53  ? -11.551 -0.478  19.843   1.00 106.43 ? 163  LYS B CB  1 
ATOM   4975  C  CG  . LYS B  2  53  ? -12.119 -0.475  21.246   1.00 102.59 ? 163  LYS B CG  1 
ATOM   4976  C  CD  . LYS B  2  53  ? -11.007 -0.727  22.264   1.00 130.53 ? 163  LYS B CD  1 
ATOM   4977  C  CE  . LYS B  2  53  ? -11.490 -0.686  23.720   1.00 68.64  ? 163  LYS B CE  1 
ATOM   4978  N  NZ  . LYS B  2  53  ? -12.030 0.622   24.168   1.00 72.52  ? 163  LYS B NZ  1 
ATOM   4979  N  N   . PRO B  2  54  ? -11.695 1.400   16.972   1.00 122.93 ? 164  PRO B N   1 
ATOM   4980  C  CA  . PRO B  2  54  ? -11.111 1.637   15.645   1.00 140.29 ? 164  PRO B CA  1 
ATOM   4981  C  C   . PRO B  2  54  ? -9.592  1.511   15.576   1.00 159.71 ? 164  PRO B C   1 
ATOM   4982  O  O   . PRO B  2  54  ? -8.923  2.443   15.119   1.00 105.97 ? 164  PRO B O   1 
ATOM   4983  C  CB  . PRO B  2  54  ? -11.563 3.069   15.332   1.00 163.00 ? 164  PRO B CB  1 
ATOM   4984  C  CG  . PRO B  2  54  ? -11.693 3.716   16.675   1.00 168.29 ? 164  PRO B CG  1 
ATOM   4985  C  CD  . PRO B  2  54  ? -12.166 2.641   17.613   1.00 98.85  ? 164  PRO B CD  1 
ATOM   4986  N  N   . VAL B  2  55  ? -9.024  0.389   16.022   1.00 190.84 ? 165  VAL B N   1 
ATOM   4987  C  CA  . VAL B  2  55  ? -7.581  0.184   15.979   1.00 127.97 ? 165  VAL B CA  1 
ATOM   4988  C  C   . VAL B  2  55  ? -7.289  -1.255  15.572   1.00 119.78 ? 165  VAL B C   1 
ATOM   4989  O  O   . VAL B  2  55  ? -8.065  -2.173  15.857   1.00 110.14 ? 165  VAL B O   1 
ATOM   4990  C  CB  . VAL B  2  55  ? -6.930  0.539   17.332   1.00 107.58 ? 165  VAL B CB  1 
ATOM   4991  C  CG1 . VAL B  2  55  ? -7.520  -0.316  18.438   1.00 87.86  ? 165  VAL B CG1 1 
ATOM   4992  C  CG2 . VAL B  2  55  ? -5.414  0.412   17.264   1.00 98.74  ? 165  VAL B CG2 1 
ATOM   4993  N  N   . SER B  2  56  ? -6.173  -1.437  14.874   1.00 124.58 ? 166  SER B N   1 
ATOM   4994  C  CA  . SER B  2  56  ? -5.666  -2.764  14.541   1.00 159.83 ? 166  SER B CA  1 
ATOM   4995  C  C   . SER B  2  56  ? -5.414  -3.539  15.852   1.00 127.22 ? 166  SER B C   1 
ATOM   4996  O  O   . SER B  2  56  ? -5.053  -2.948  16.868   1.00 90.70  ? 166  SER B O   1 
ATOM   4997  C  CB  . SER B  2  56  ? -4.389  -2.637  13.691   1.00 106.86 ? 166  SER B CB  1 
ATOM   4998  O  OG  . SER B  2  56  ? -4.136  -3.787  12.892   1.00 109.92 ? 166  SER B OG  1 
ATOM   4999  N  N   . PRO B  2  57  ? -5.619  -4.865  15.842   1.00 112.12 ? 167  PRO B N   1 
ATOM   5000  C  CA  . PRO B  2  57  ? -5.979  -5.731  14.713   1.00 165.05 ? 167  PRO B CA  1 
ATOM   5001  C  C   . PRO B  2  57  ? -7.482  -5.904  14.482   1.00 123.81 ? 167  PRO B C   1 
ATOM   5002  O  O   . PRO B  2  57  ? -7.890  -6.690  13.628   1.00 136.63 ? 167  PRO B O   1 
ATOM   5003  C  CB  . PRO B  2  57  ? -5.345  -7.062  15.104   1.00 142.39 ? 167  PRO B CB  1 
ATOM   5004  C  CG  . PRO B  2  57  ? -5.467  -7.081  16.592   1.00 108.02 ? 167  PRO B CG  1 
ATOM   5005  C  CD  . PRO B  2  57  ? -5.333  -5.651  17.056   1.00 90.33  ? 167  PRO B CD  1 
ATOM   5006  N  N   . PHE B  2  58  ? -8.302  -5.192  15.249   1.00 98.22  ? 168  PHE B N   1 
ATOM   5007  C  CA  . PHE B  2  58  ? -9.741  -5.378  15.127   1.00 98.44  ? 168  PHE B CA  1 
ATOM   5008  C  C   . PHE B  2  58  ? -10.277 -4.855  13.806   1.00 122.35 ? 168  PHE B C   1 
ATOM   5009  O  O   . PHE B  2  58  ? -11.293 -5.362  13.317   1.00 116.75 ? 168  PHE B O   1 
ATOM   5010  C  CB  . PHE B  2  58  ? -10.433 -4.705  16.298   1.00 120.58 ? 168  PHE B CB  1 
ATOM   5011  C  CG  . PHE B  2  58  ? -9.925  -5.180  17.613   1.00 172.05 ? 168  PHE B CG  1 
ATOM   5012  C  CD1 . PHE B  2  58  ? -9.623  -6.521  17.799   1.00 163.57 ? 168  PHE B CD1 1 
ATOM   5013  C  CD2 . PHE B  2  58  ? -9.694  -4.294  18.646   1.00 169.97 ? 168  PHE B CD2 1 
ATOM   5014  C  CE1 . PHE B  2  58  ? -9.129  -6.970  19.000   1.00 116.64 ? 168  PHE B CE1 1 
ATOM   5015  C  CE2 . PHE B  2  58  ? -9.200  -4.739  19.848   1.00 77.31  ? 168  PHE B CE2 1 
ATOM   5016  C  CZ  . PHE B  2  58  ? -8.918  -6.080  20.023   1.00 76.25  ? 168  PHE B CZ  1 
ATOM   5017  N  N   . VAL B  2  59  ? -9.623  -3.843  13.226   1.00 134.18 ? 169  VAL B N   1 
ATOM   5018  C  CA  . VAL B  2  59  ? -9.973  -3.290  11.922   1.00 149.48 ? 169  VAL B CA  1 
ATOM   5019  C  C   . VAL B  2  59  ? -8.714  -3.229  11.067   1.00 161.83 ? 169  VAL B C   1 
ATOM   5020  O  O   . VAL B  2  59  ? -7.617  -2.985  11.583   1.00 116.24 ? 169  VAL B O   1 
ATOM   5021  C  CB  . VAL B  2  59  ? -10.605 -1.886  12.036   1.00 155.58 ? 169  VAL B CB  1 
ATOM   5022  C  CG1 . VAL B  2  59  ? -11.250 -1.483  10.708   1.00 171.94 ? 169  VAL B CG1 1 
ATOM   5023  C  CG2 . VAL B  2  59  ? -11.613 -1.826  13.180   1.00 109.13 ? 169  VAL B CG2 1 
ATOM   5024  N  N   . LYS B  2  60  ? -8.868  -3.481  9.768    1.00 176.77 ? 170  LYS B N   1 
ATOM   5025  C  CA  . LYS B  2  60  ? -7.744  -3.339  8.852    1.00 163.42 ? 170  LYS B CA  1 
ATOM   5026  C  C   . LYS B  2  60  ? -7.330  -1.876  8.734    1.00 163.15 ? 170  LYS B C   1 
ATOM   5027  O  O   . LYS B  2  60  ? -8.173  -0.973  8.722    1.00 140.18 ? 170  LYS B O   1 
ATOM   5028  C  CB  . LYS B  2  60  ? -8.086  -3.909  7.477    1.00 144.09 ? 170  LYS B CB  1 
ATOM   5029  C  CG  . LYS B  2  60  ? -7.869  -5.406  7.383    1.00 143.27 ? 170  LYS B CG  1 
ATOM   5030  C  CD  . LYS B  2  60  ? -7.948  -5.896  5.956    1.00 152.19 ? 170  LYS B CD  1 
ATOM   5031  C  CE  . LYS B  2  60  ? -7.593  -7.369  5.859    1.00 151.88 ? 170  LYS B CE  1 
ATOM   5032  N  NZ  . LYS B  2  60  ? -8.470  -8.221  6.707    1.00 146.11 ? 170  LYS B NZ  1 
ATOM   5033  N  N   . THR B  2  61  ? -6.014  -1.654  8.636    1.00 188.35 ? 171  THR B N   1 
ATOM   5034  C  CA  . THR B  2  61  ? -5.410  -0.327  8.631    1.00 195.02 ? 171  THR B CA  1 
ATOM   5035  C  C   . THR B  2  61  ? -5.000  0.128   7.230    1.00 163.73 ? 171  THR B C   1 
ATOM   5036  O  O   . THR B  2  61  ? -4.061  0.919   7.081    1.00 159.36 ? 171  THR B O   1 
ATOM   5037  C  CB  . THR B  2  61  ? -4.203  -0.289  9.575    1.00 184.10 ? 171  THR B CB  1 
ATOM   5038  O  OG1 . THR B  2  61  ? -3.420  -1.482  9.419    1.00 165.74 ? 171  THR B OG1 1 
ATOM   5039  C  CG2 . THR B  2  61  ? -4.647  -0.165  11.024   1.00 157.13 ? 171  THR B CG2 1 
ATOM   5040  N  N   . THR B  2  62  ? -5.680  -0.345  6.210    1.00 153.40 ? 172  THR B N   1 
ATOM   5041  C  CA  . THR B  2  62  ? -5.426  0.151   4.864    1.00 173.41 ? 172  THR B CA  1 
ATOM   5042  C  C   . THR B  2  62  ? -6.285  1.386   4.592    1.00 198.45 ? 172  THR B C   1 
ATOM   5043  O  O   . THR B  2  62  ? -7.444  1.434   5.013    1.00 208.81 ? 172  THR B O   1 
ATOM   5044  C  CB  . THR B  2  62  ? -5.726  -0.927  3.828    1.00 189.26 ? 172  THR B CB  1 
ATOM   5045  O  OG1 . THR B  2  62  ? -7.087  -1.360  3.961    1.00 173.54 ? 172  THR B OG1 1 
ATOM   5046  C  CG2 . THR B  2  62  ? -4.800  -2.124  4.029    1.00 178.69 ? 172  THR B CG2 1 
ATOM   5047  N  N   . PRO B  2  63  ? -5.731  2.397   3.914    1.00 175.49 ? 173  PRO B N   1 
ATOM   5048  C  CA  . PRO B  2  63  ? -6.454  3.674   3.753    1.00 179.91 ? 173  PRO B CA  1 
ATOM   5049  C  C   . PRO B  2  63  ? -7.866  3.546   3.200    1.00 183.52 ? 173  PRO B C   1 
ATOM   5050  O  O   . PRO B  2  63  ? -8.716  4.391   3.510    1.00 183.89 ? 173  PRO B O   1 
ATOM   5051  C  CB  . PRO B  2  63  ? -5.548  4.467   2.799    1.00 216.11 ? 173  PRO B CB  1 
ATOM   5052  C  CG  . PRO B  2  63  ? -4.643  3.448   2.172    1.00 211.67 ? 173  PRO B CG  1 
ATOM   5053  C  CD  . PRO B  2  63  ? -4.439  2.402   3.212    1.00 181.28 ? 173  PRO B CD  1 
ATOM   5054  N  N   . GLU B  2  64  ? -8.151  2.523   2.392    1.00 186.82 ? 174  GLU B N   1 
ATOM   5055  C  CA  . GLU B  2  64  ? -9.494  2.370   1.841    1.00 191.20 ? 174  GLU B CA  1 
ATOM   5056  C  C   . GLU B  2  64  ? -10.443 1.718   2.841    1.00 182.62 ? 174  GLU B C   1 
ATOM   5057  O  O   . GLU B  2  64  ? -11.616 2.099   2.928    1.00 184.01 ? 174  GLU B O   1 
ATOM   5058  C  CB  . GLU B  2  64  ? -9.443  1.561   0.544    1.00 199.22 ? 174  GLU B CB  1 
ATOM   5059  C  CG  . GLU B  2  64  ? -10.809 1.265   -0.062   1.00 211.08 ? 174  GLU B CG  1 
ATOM   5060  C  CD  . GLU B  2  64  ? -10.722 0.445   -1.334   1.00 215.99 ? 174  GLU B CD  1 
ATOM   5061  O  OE1 . GLU B  2  64  ? -9.603  0.274   -1.860   1.00 215.68 ? 174  GLU B OE1 1 
ATOM   5062  O  OE2 . GLU B  2  64  ? -11.775 -0.039  -1.801   1.00 216.67 ? 174  GLU B OE2 1 
ATOM   5063  N  N   . GLU B  2  65  ? -9.955  0.739   3.603    1.00 217.89 ? 175  GLU B N   1 
ATOM   5064  C  CA  . GLU B  2  65  ? -10.773 -0.009  4.552    1.00 185.55 ? 175  GLU B CA  1 
ATOM   5065  C  C   . GLU B  2  65  ? -10.928 0.708   5.888    1.00 161.11 ? 175  GLU B C   1 
ATOM   5066  O  O   . GLU B  2  65  ? -11.531 0.155   6.818    1.00 153.41 ? 175  GLU B O   1 
ATOM   5067  C  CB  . GLU B  2  65  ? -10.174 -1.403  4.764    1.00 163.82 ? 175  GLU B CB  1 
ATOM   5068  C  CG  . GLU B  2  65  ? -11.162 -2.454  5.263    1.00 211.88 ? 175  GLU B CG  1 
ATOM   5069  C  CD  . GLU B  2  65  ? -10.641 -3.862  5.085    1.00 211.86 ? 175  GLU B CD  1 
ATOM   5070  O  OE1 . GLU B  2  65  ? -9.923  -4.095  4.088    1.00 200.06 ? 175  GLU B OE1 1 
ATOM   5071  O  OE2 . GLU B  2  65  ? -10.939 -4.725  5.942    1.00 203.85 ? 175  GLU B OE2 1 
ATOM   5072  N  N   . ILE B  2  66  ? -10.384 1.911   6.013    1.00 160.00 ? 176  ILE B N   1 
ATOM   5073  C  CA  . ILE B  2  66  ? -10.641 2.745   7.177    1.00 154.19 ? 176  ILE B CA  1 
ATOM   5074  C  C   . ILE B  2  66  ? -11.917 3.550   6.987    1.00 162.46 ? 176  ILE B C   1 
ATOM   5075  O  O   . ILE B  2  66  ? -12.802 3.547   7.845    1.00 186.12 ? 176  ILE B O   1 
ATOM   5076  C  CB  . ILE B  2  66  ? -9.428  3.663   7.448    1.00 154.20 ? 176  ILE B CB  1 
ATOM   5077  C  CG1 . ILE B  2  66  ? -8.170  2.836   7.726    1.00 149.91 ? 176  ILE B CG1 1 
ATOM   5078  C  CG2 . ILE B  2  66  ? -9.726  4.601   8.607    1.00 149.33 ? 176  ILE B CG2 1 
ATOM   5079  C  CD1 . ILE B  2  66  ? -6.912  3.661   7.903    1.00 151.72 ? 176  ILE B CD1 1 
ATOM   5080  N  N   . ALA B  2  67  ? -12.034 4.227   5.841    1.00 168.78 ? 177  ALA B N   1 
ATOM   5081  C  CA  . ALA B  2  67  ? -13.233 4.981   5.505    1.00 174.94 ? 177  ALA B CA  1 
ATOM   5082  C  C   . ALA B  2  67  ? -14.356 4.092   4.998    1.00 177.70 ? 177  ALA B C   1 
ATOM   5083  O  O   . ALA B  2  67  ? -15.517 4.515   5.003    1.00 181.02 ? 177  ALA B O   1 
ATOM   5084  C  CB  . ALA B  2  67  ? -12.903 6.044   4.459    1.00 185.58 ? 177  ALA B CB  1 
ATOM   5085  N  N   . ASN B  2  68  ? -14.036 2.879   4.552    1.00 177.10 ? 178  ASN B N   1 
ATOM   5086  C  CA  . ASN B  2  68  ? -15.034 1.926   4.073    1.00 179.94 ? 178  ASN B CA  1 
ATOM   5087  C  C   . ASN B  2  68  ? -14.622 0.528   4.504    1.00 172.78 ? 178  ASN B C   1 
ATOM   5088  O  O   . ASN B  2  68  ? -13.989 -0.213  3.739    1.00 175.85 ? 178  ASN B O   1 
ATOM   5089  C  CB  . ASN B  2  68  ? -15.193 1.991   2.556    1.00 191.95 ? 178  ASN B CB  1 
ATOM   5090  C  CG  . ASN B  2  68  ? -16.247 1.030   2.048    1.00 195.71 ? 178  ASN B CG  1 
ATOM   5091  O  OD1 . ASN B  2  68  ? -17.265 0.806   2.701    1.00 192.42 ? 178  ASN B OD1 1 
ATOM   5092  N  ND2 . ASN B  2  68  ? -15.992 0.432   0.891    1.00 202.92 ? 178  ASN B ND2 1 
ATOM   5093  N  N   . PRO B  2  69  ? -14.980 0.123   5.729    1.00 163.65 ? 179  PRO B N   1 
ATOM   5094  C  CA  . PRO B  2  69  ? -14.592 -1.214  6.209    1.00 168.40 ? 179  PRO B CA  1 
ATOM   5095  C  C   . PRO B  2  69  ? -15.322 -2.353  5.517    1.00 174.81 ? 179  PRO B C   1 
ATOM   5096  O  O   . PRO B  2  69  ? -14.978 -3.520  5.765    1.00 157.26 ? 179  PRO B O   1 
ATOM   5097  C  CB  . PRO B  2  69  ? -14.921 -1.160  7.709    1.00 156.65 ? 179  PRO B CB  1 
ATOM   5098  C  CG  . PRO B  2  69  ? -15.966 -0.122  7.832    1.00 150.23 ? 179  PRO B CG  1 
ATOM   5099  C  CD  . PRO B  2  69  ? -15.659 0.908   6.774    1.00 159.13 ? 179  PRO B CD  1 
ATOM   5100  N  N   . CYS B  2  70  ? -16.322 -2.063  4.677    1.00 169.76 ? 180  CYS B N   1 
ATOM   5101  C  CA  . CYS B  2  70  ? -16.982 -3.079  3.871    1.00 175.47 ? 180  CYS B CA  1 
ATOM   5102  C  C   . CYS B  2  70  ? -16.353 -3.206  2.503    1.00 184.22 ? 180  CYS B C   1 
ATOM   5103  O  O   . CYS B  2  70  ? -17.008 -3.683  1.568    1.00 192.11 ? 180  CYS B O   1 
ATOM   5104  C  CB  . CYS B  2  70  ? -18.472 -2.778  3.720    1.00 180.59 ? 180  CYS B CB  1 
ATOM   5105  S  SG  . CYS B  2  70  ? -19.361 -2.757  5.255    1.00 222.32 ? 180  CYS B SG  1 
ATOM   5106  N  N   . SER B  2  71  ? -15.096 -2.798  2.363    1.00 183.46 ? 181  SER B N   1 
ATOM   5107  C  CA  . SER B  2  71  ? -14.406 -2.945  1.102    1.00 191.72 ? 181  SER B CA  1 
ATOM   5108  C  C   . SER B  2  71  ? -14.142 -4.426  0.853    1.00 191.07 ? 181  SER B C   1 
ATOM   5109  O  O   . SER B  2  71  ? -14.404 -5.281  1.705    1.00 183.89 ? 181  SER B O   1 
ATOM   5110  C  CB  . SER B  2  71  ? -13.110 -2.131  1.111    1.00 190.95 ? 181  SER B CB  1 
ATOM   5111  O  OG  . SER B  2  71  ? -12.428 -2.253  -0.119   1.00 199.49 ? 181  SER B OG  1 
ATOM   5112  N  N   . SER B  2  72  ? -13.652 -4.733  -0.350   1.00 224.03 ? 182  SER B N   1 
ATOM   5113  C  CA  . SER B  2  72  ? -13.312 -6.075  -0.840   1.00 233.76 ? 182  SER B CA  1 
ATOM   5114  C  C   . SER B  2  72  ? -14.526 -6.991  -0.985   1.00 228.67 ? 182  SER B C   1 
ATOM   5115  O  O   . SER B  2  72  ? -14.364 -8.150  -1.401   1.00 224.40 ? 182  SER B O   1 
ATOM   5116  C  CB  . SER B  2  72  ? -12.270 -6.780  0.039    1.00 210.65 ? 182  SER B CB  1 
ATOM   5117  O  OG  . SER B  2  72  ? -12.090 -8.126  -0.378   1.00 211.94 ? 182  SER B OG  1 
ATOM   5118  N  N   . ILE B  2  73  ? -15.732 -6.518  -0.690   1.00 213.50 ? 183  ILE B N   1 
ATOM   5119  C  CA  . ILE B  2  73  ? -16.935 -7.332  -0.828   1.00 206.47 ? 183  ILE B CA  1 
ATOM   5120  C  C   . ILE B  2  73  ? -17.531 -7.190  -2.231   1.00 219.40 ? 183  ILE B C   1 
ATOM   5121  O  O   . ILE B  2  73  ? -17.757 -8.195  -2.906   1.00 224.59 ? 183  ILE B O   1 
ATOM   5122  C  CB  . ILE B  2  73  ? -17.978 -6.979  0.263    1.00 203.80 ? 183  ILE B CB  1 
ATOM   5123  C  CG1 . ILE B  2  73  ? -17.357 -7.093  1.657    1.00 209.71 ? 183  ILE B CG1 1 
ATOM   5124  C  CG2 . ILE B  2  73  ? -19.217 -7.868  0.133    1.00 204.54 ? 183  ILE B CG2 1 
ATOM   5125  C  CD1 . ILE B  2  73  ? -18.273 -6.648  2.779    1.00 211.17 ? 183  ILE B CD1 1 
ATOM   5126  N  N   . PRO B  2  74  ? -17.788 -5.947  -2.689   1.00 225.25 ? 184  PRO B N   1 
ATOM   5127  C  CA  . PRO B  2  74  ? -17.698 -4.605  -2.095   1.00 221.88 ? 184  PRO B CA  1 
ATOM   5128  C  C   . PRO B  2  74  ? -19.034 -4.097  -1.543   1.00 221.55 ? 184  PRO B C   1 
ATOM   5129  O  O   . PRO B  2  74  ? -20.083 -4.588  -1.958   1.00 227.25 ? 184  PRO B O   1 
ATOM   5130  C  CB  . PRO B  2  74  ? -17.237 -3.750  -3.268   1.00 231.98 ? 184  PRO B CB  1 
ATOM   5131  C  CG  . PRO B  2  74  ? -17.910 -4.383  -4.442   1.00 242.77 ? 184  PRO B CG  1 
ATOM   5132  C  CD  . PRO B  2  74  ? -18.033 -5.865  -4.141   1.00 238.32 ? 184  PRO B CD  1 
ATOM   5133  N  N   . TYR B  2  75  ? -18.990 -3.135  -0.621   1.00 215.39 ? 185  TYR B N   1 
ATOM   5134  C  CA  . TYR B  2  75  ? -20.199 -2.515  -0.088   1.00 215.62 ? 185  TYR B CA  1 
ATOM   5135  C  C   . TYR B  2  75  ? -19.813 -1.223  0.620    1.00 211.22 ? 185  TYR B C   1 
ATOM   5136  O  O   . TYR B  2  75  ? -18.695 -1.085  1.122    1.00 204.34 ? 185  TYR B O   1 
ATOM   5137  C  CB  . TYR B  2  75  ? -20.950 -3.449  0.870    1.00 208.58 ? 185  TYR B CB  1 
ATOM   5138  C  CG  . TYR B  2  75  ? -22.292 -2.916  1.342    1.00 210.14 ? 185  TYR B CG  1 
ATOM   5139  C  CD1 . TYR B  2  75  ? -23.370 -2.815  0.468    1.00 221.19 ? 185  TYR B CD1 1 
ATOM   5140  C  CD2 . TYR B  2  75  ? -22.486 -2.529  2.662    1.00 201.63 ? 185  TYR B CD2 1 
ATOM   5141  C  CE1 . TYR B  2  75  ? -24.601 -2.332  0.894    1.00 223.38 ? 185  TYR B CE1 1 
ATOM   5142  C  CE2 . TYR B  2  75  ? -23.715 -2.047  3.097    1.00 204.64 ? 185  TYR B CE2 1 
ATOM   5143  C  CZ  . TYR B  2  75  ? -24.767 -1.951  2.209    1.00 214.29 ? 185  TYR B CZ  1 
ATOM   5144  O  OH  . TYR B  2  75  ? -25.985 -1.472  2.641    1.00 216.94 ? 185  TYR B OH  1 
ATOM   5145  N  N   . PHE B  2  76  ? -20.748 -0.278  0.645    1.00 215.89 ? 186  PHE B N   1 
ATOM   5146  C  CA  . PHE B  2  76  ? -20.554 1.010   1.297    1.00 213.03 ? 186  PHE B CA  1 
ATOM   5147  C  C   . PHE B  2  76  ? -21.159 0.968   2.693    1.00 203.81 ? 186  PHE B C   1 
ATOM   5148  O  O   . PHE B  2  76  ? -22.364 0.734   2.844    1.00 206.14 ? 186  PHE B O   1 
ATOM   5149  C  CB  . PHE B  2  76  ? -21.183 2.140   0.483    1.00 224.57 ? 186  PHE B CB  1 
ATOM   5150  C  CG  . PHE B  2  76  ? -21.003 3.495   1.101    1.00 222.75 ? 186  PHE B CG  1 
ATOM   5151  C  CD1 . PHE B  2  76  ? -19.819 4.192   0.934    1.00 222.45 ? 186  PHE B CD1 1 
ATOM   5152  C  CD2 . PHE B  2  76  ? -22.016 4.072   1.852    1.00 221.87 ? 186  PHE B CD2 1 
ATOM   5153  C  CE1 . PHE B  2  76  ? -19.645 5.437   1.505    1.00 221.25 ? 186  PHE B CE1 1 
ATOM   5154  C  CE2 . PHE B  2  76  ? -21.849 5.319   2.426    1.00 220.65 ? 186  PHE B CE2 1 
ATOM   5155  C  CZ  . PHE B  2  76  ? -20.661 6.002   2.251    1.00 220.33 ? 186  PHE B CZ  1 
ATOM   5156  N  N   . CYS B  2  77  ? -20.331 1.196   3.709    1.00 193.89 ? 187  CYS B N   1 
ATOM   5157  C  CA  . CYS B  2  77  ? -20.816 1.235   5.077    1.00 186.79 ? 187  CYS B CA  1 
ATOM   5158  C  C   . CYS B  2  77  ? -20.038 2.266   5.887    1.00 179.39 ? 187  CYS B C   1 
ATOM   5159  O  O   . CYS B  2  77  ? -18.983 2.756   5.474    1.00 180.70 ? 187  CYS B O   1 
ATOM   5160  C  CB  . CYS B  2  77  ? -20.734 -0.148  5.723    1.00 182.60 ? 187  CYS B CB  1 
ATOM   5161  S  SG  . CYS B  2  77  ? -19.089 -0.841  5.844    1.00 174.89 ? 187  CYS B SG  1 
ATOM   5162  N  N   . LEU B  2  78  ? -20.590 2.586   7.057    1.00 177.25 ? 188  LEU B N   1 
ATOM   5163  C  CA  . LEU B  2  78  ? -20.001 3.551   7.975    1.00 170.16 ? 188  LEU B CA  1 
ATOM   5164  C  C   . LEU B  2  78  ? -18.650 3.057   8.503    1.00 186.61 ? 188  LEU B C   1 
ATOM   5165  O  O   . LEU B  2  78  ? -18.418 1.848   8.609    1.00 197.39 ? 188  LEU B O   1 
ATOM   5166  C  CB  . LEU B  2  78  ? -20.952 3.797   9.147    1.00 178.53 ? 188  LEU B CB  1 
ATOM   5167  C  CG  . LEU B  2  78  ? -22.412 4.143   8.838    1.00 195.28 ? 188  LEU B CG  1 
ATOM   5168  C  CD1 . LEU B  2  78  ? -23.192 4.406   10.124   1.00 178.12 ? 188  LEU B CD1 1 
ATOM   5169  C  CD2 . LEU B  2  78  ? -22.519 5.327   7.886    1.00 203.18 ? 188  LEU B CD2 1 
ATOM   5170  N  N   . PRO B  2  79  ? -17.741 3.971   8.845    1.00 164.75 ? 189  PRO B N   1 
ATOM   5171  C  CA  . PRO B  2  79  ? -16.458 3.568   9.440    1.00 154.31 ? 189  PRO B CA  1 
ATOM   5172  C  C   . PRO B  2  79  ? -16.656 2.920   10.805   1.00 138.70 ? 189  PRO B C   1 
ATOM   5173  O  O   . PRO B  2  79  ? -17.734 2.964   11.397   1.00 137.36 ? 189  PRO B O   1 
ATOM   5174  C  CB  . PRO B  2  79  ? -15.692 4.890   9.557    1.00 158.40 ? 189  PRO B CB  1 
ATOM   5175  C  CG  . PRO B  2  79  ? -16.759 5.939   9.605    1.00 155.67 ? 189  PRO B CG  1 
ATOM   5176  C  CD  . PRO B  2  79  ? -17.850 5.434   8.710    1.00 162.57 ? 189  PRO B CD  1 
ATOM   5177  N  N   . THR B  2  80  ? -15.588 2.290   11.304   1.00 131.92 ? 190  THR B N   1 
ATOM   5178  C  CA  . THR B  2  80  ? -15.639 1.617   12.601   1.00 166.22 ? 190  THR B CA  1 
ATOM   5179  C  C   . THR B  2  80  ? -15.501 2.626   13.734   1.00 152.51 ? 190  THR B C   1 
ATOM   5180  O  O   . THR B  2  80  ? -14.581 3.451   13.737   1.00 172.34 ? 190  THR B O   1 
ATOM   5181  C  CB  . THR B  2  80  ? -14.546 0.555   12.726   1.00 131.56 ? 190  THR B CB  1 
ATOM   5182  O  OG1 . THR B  2  80  ? -14.630 -0.361  11.628   1.00 162.82 ? 190  THR B OG1 1 
ATOM   5183  C  CG2 . THR B  2  80  ? -14.689 -0.205  14.042   1.00 108.73 ? 190  THR B CG2 1 
ATOM   5184  N  N   . PHE B  2  81  ? -16.426 2.573   14.686   1.00 116.54 ? 191  PHE B N   1 
ATOM   5185  C  CA  . PHE B  2  81  ? -16.387 3.456   15.838   1.00 115.40 ? 191  PHE B CA  1 
ATOM   5186  C  C   . PHE B  2  81  ? -16.697 2.652   17.085   1.00 108.45 ? 191  PHE B C   1 
ATOM   5187  O  O   . PHE B  2  81  ? -17.414 1.651   17.030   1.00 106.77 ? 191  PHE B O   1 
ATOM   5188  C  CB  . PHE B  2  81  ? -17.386 4.608   15.715   1.00 122.96 ? 191  PHE B CB  1 
ATOM   5189  C  CG  . PHE B  2  81  ? -18.802 4.157   15.558   1.00 125.62 ? 191  PHE B CG  1 
ATOM   5190  C  CD1 . PHE B  2  81  ? -19.312 3.859   14.311   1.00 130.96 ? 191  PHE B CD1 1 
ATOM   5191  C  CD2 . PHE B  2  81  ? -19.621 4.023   16.662   1.00 123.42 ? 191  PHE B CD2 1 
ATOM   5192  C  CE1 . PHE B  2  81  ? -20.614 3.446   14.163   1.00 134.22 ? 191  PHE B CE1 1 
ATOM   5193  C  CE2 . PHE B  2  81  ? -20.923 3.608   16.523   1.00 126.67 ? 191  PHE B CE2 1 
ATOM   5194  C  CZ  . PHE B  2  81  ? -21.422 3.317   15.270   1.00 132.15 ? 191  PHE B CZ  1 
ATOM   5195  N  N   . GLY B  2  82  ? -16.143 3.097   18.209   1.00 122.02 ? 192  GLY B N   1 
ATOM   5196  C  CA  . GLY B  2  82  ? -16.369 2.437   19.479   1.00 98.88  ? 192  GLY B CA  1 
ATOM   5197  C  C   . GLY B  2  82  ? -17.807 2.511   19.954   1.00 101.28 ? 192  GLY B C   1 
ATOM   5198  O  O   . GLY B  2  82  ? -18.486 1.484   20.051   1.00 100.74 ? 192  GLY B O   1 
ATOM   5199  N  N   . PHE B  2  83  ? -18.291 3.717   20.251   1.00 106.22 ? 193  PHE B N   1 
ATOM   5200  C  CA  . PHE B  2  83  ? -19.660 3.889   20.723   1.00 109.52 ? 193  PHE B CA  1 
ATOM   5201  C  C   . PHE B  2  83  ? -20.089 5.332   20.517   1.00 117.19 ? 193  PHE B C   1 
ATOM   5202  O  O   . PHE B  2  83  ? -19.346 6.262   20.851   1.00 117.73 ? 193  PHE B O   1 
ATOM   5203  C  CB  . PHE B  2  83  ? -19.807 3.499   22.198   1.00 104.35 ? 193  PHE B CB  1 
ATOM   5204  C  CG  . PHE B  2  83  ? -21.006 4.110   22.865   1.00 108.87 ? 193  PHE B CG  1 
ATOM   5205  C  CD1 . PHE B  2  83  ? -22.290 3.700   22.533   1.00 112.92 ? 193  PHE B CD1 1 
ATOM   5206  C  CD2 . PHE B  2  83  ? -20.848 5.101   23.819   1.00 120.38 ? 193  PHE B CD2 1 
ATOM   5207  C  CE1 . PHE B  2  83  ? -23.395 4.262   23.143   1.00 117.80 ? 193  PHE B CE1 1 
ATOM   5208  C  CE2 . PHE B  2  83  ? -21.948 5.670   24.432   1.00 146.92 ? 193  PHE B CE2 1 
ATOM   5209  C  CZ  . PHE B  2  83  ? -23.226 5.248   24.094   1.00 128.68 ? 193  PHE B CZ  1 
ATOM   5210  N  N   . LYS B  2  84  ? -21.281 5.510   19.956   1.00 123.68 ? 194  LYS B N   1 
ATOM   5211  C  CA  . LYS B  2  84  ? -21.862 6.823   19.717   1.00 132.03 ? 194  LYS B CA  1 
ATOM   5212  C  C   . LYS B  2  84  ? -23.184 6.930   20.464   1.00 135.19 ? 194  LYS B C   1 
ATOM   5213  O  O   . LYS B  2  84  ? -24.103 6.139   20.225   1.00 136.45 ? 194  LYS B O   1 
ATOM   5214  C  CB  . LYS B  2  84  ? -22.071 7.053   18.219   1.00 157.38 ? 194  LYS B CB  1 
ATOM   5215  C  CG  . LYS B  2  84  ? -20.778 7.198   17.427   1.00 137.70 ? 194  LYS B CG  1 
ATOM   5216  C  CD  . LYS B  2  84  ? -21.062 7.478   15.960   1.00 145.47 ? 194  LYS B CD  1 
ATOM   5217  C  CE  . LYS B  2  84  ? -19.773 7.667   15.174   1.00 145.21 ? 194  LYS B CE  1 
ATOM   5218  N  NZ  . LYS B  2  84  ? -20.030 7.976   13.736   1.00 180.95 ? 194  LYS B NZ  1 
ATOM   5219  N  N   . HIS B  2  85  ? -23.286 7.916   21.350   1.00 137.17 ? 195  HIS B N   1 
ATOM   5220  C  CA  . HIS B  2  85  ? -24.543 8.231   22.021   1.00 143.29 ? 195  HIS B CA  1 
ATOM   5221  C  C   . HIS B  2  85  ? -25.346 9.155   21.112   1.00 174.34 ? 195  HIS B C   1 
ATOM   5222  O  O   . HIS B  2  85  ? -25.004 10.331  20.943   1.00 156.74 ? 195  HIS B O   1 
ATOM   5223  C  CB  . HIS B  2  85  ? -24.300 8.873   23.383   1.00 158.24 ? 195  HIS B CB  1 
ATOM   5224  C  CG  . HIS B  2  85  ? -25.551 9.351   24.056   1.00 156.18 ? 195  HIS B CG  1 
ATOM   5225  N  ND1 . HIS B  2  85  ? -26.619 8.521   24.323   1.00 146.49 ? 195  HIS B ND1 1 
ATOM   5226  C  CD2 . HIS B  2  85  ? -25.910 10.579  24.498   1.00 178.73 ? 195  HIS B CD2 1 
ATOM   5227  C  CE1 . HIS B  2  85  ? -27.577 9.215   24.911   1.00 152.86 ? 195  HIS B CE1 1 
ATOM   5228  N  NE2 . HIS B  2  85  ? -27.172 10.466  25.029   1.00 156.22 ? 195  HIS B NE2 1 
ATOM   5229  N  N   . ILE B  2  86  ? -26.406 8.619   20.516   1.00 176.99 ? 196  ILE B N   1 
ATOM   5230  C  CA  . ILE B  2  86  ? -27.163 9.366   19.522   1.00 167.01 ? 196  ILE B CA  1 
ATOM   5231  C  C   . ILE B  2  86  ? -28.328 10.097  20.174   1.00 174.24 ? 196  ILE B C   1 
ATOM   5232  O  O   . ILE B  2  86  ? -28.424 11.326  20.087   1.00 184.91 ? 196  ILE B O   1 
ATOM   5233  C  CB  . ILE B  2  86  ? -27.639 8.438   18.392   1.00 173.12 ? 196  ILE B CB  1 
ATOM   5234  C  CG1 . ILE B  2  86  ? -26.432 7.734   17.761   1.00 162.23 ? 196  ILE B CG1 1 
ATOM   5235  C  CG2 . ILE B  2  86  ? -28.412 9.226   17.350   1.00 192.53 ? 196  ILE B CG2 1 
ATOM   5236  C  CD1 . ILE B  2  86  ? -26.760 6.870   16.561   1.00 164.62 ? 196  ILE B CD1 1 
ATOM   5237  N  N   . LEU B  2  87  ? -29.206 9.359   20.843   1.00 173.48 ? 197  LEU B N   1 
ATOM   5238  C  CA  . LEU B  2  87  ? -30.442 9.933   21.381   1.00 181.48 ? 197  LEU B CA  1 
ATOM   5239  C  C   . LEU B  2  87  ? -30.488 9.889   22.903   1.00 177.07 ? 197  LEU B C   1 
ATOM   5240  O  O   . LEU B  2  87  ? -30.561 8.791   23.486   1.00 171.06 ? 197  LEU B O   1 
ATOM   5241  C  CB  . LEU B  2  87  ? -31.655 9.212   20.798   1.00 187.41 ? 197  LEU B CB  1 
ATOM   5242  C  CG  . LEU B  2  87  ? -33.002 9.735   21.295   1.00 196.79 ? 197  LEU B CG  1 
ATOM   5243  C  CD1 . LEU B  2  87  ? -33.187 11.188  20.902   1.00 205.91 ? 197  LEU B CD1 1 
ATOM   5244  C  CD2 . LEU B  2  87  ? -34.129 8.886   20.748   1.00 202.39 ? 197  LEU B CD2 1 
ATOM   5245  N  N   . PRO B  2  88  ? -30.418 11.033  23.587   1.00 192.73 ? 198  PRO B N   1 
ATOM   5246  C  CA  . PRO B  2  88  ? -30.723 11.055  25.021   1.00 178.23 ? 198  PRO B CA  1 
ATOM   5247  C  C   . PRO B  2  88  ? -32.181 10.707  25.263   1.00 184.92 ? 198  PRO B C   1 
ATOM   5248  O  O   . PRO B  2  88  ? -33.063 11.091  24.492   1.00 194.25 ? 198  PRO B O   1 
ATOM   5249  C  CB  . PRO B  2  88  ? -30.421 12.501  25.432   1.00 182.38 ? 198  PRO B CB  1 
ATOM   5250  C  CG  . PRO B  2  88  ? -29.503 13.015  24.381   1.00 193.88 ? 198  PRO B CG  1 
ATOM   5251  C  CD  . PRO B  2  88  ? -29.943 12.342  23.109   1.00 209.03 ? 198  PRO B CD  1 
ATOM   5252  N  N   . LEU B  2  89  ? -32.429 9.979   26.348   1.00 180.73 ? 199  LEU B N   1 
ATOM   5253  C  CA  . LEU B  2  89  ? -33.769 9.470   26.605   1.00 198.65 ? 199  LEU B CA  1 
ATOM   5254  C  C   . LEU B  2  89  ? -34.751 10.611  26.847   1.00 200.34 ? 199  LEU B C   1 
ATOM   5255  O  O   . LEU B  2  89  ? -34.541 11.458  27.720   1.00 198.44 ? 199  LEU B O   1 
ATOM   5256  C  CB  . LEU B  2  89  ? -33.752 8.498   27.787   1.00 180.16 ? 199  LEU B CB  1 
ATOM   5257  C  CG  . LEU B  2  89  ? -33.274 8.938   29.170   1.00 176.28 ? 199  LEU B CG  1 
ATOM   5258  C  CD1 . LEU B  2  89  ? -34.458 9.312   30.038   1.00 187.32 ? 199  LEU B CD1 1 
ATOM   5259  C  CD2 . LEU B  2  89  ? -32.481 7.820   29.820   1.00 165.57 ? 199  LEU B CD2 1 
ATOM   5260  N  N   . THR B  2  90  ? -35.829 10.628  26.062   1.00 210.00 ? 200  THR B N   1 
ATOM   5261  C  CA  . THR B  2  90  ? -36.838 11.675  26.138   1.00 229.77 ? 200  THR B CA  1 
ATOM   5262  C  C   . THR B  2  90  ? -38.206 11.069  25.864   1.00 232.49 ? 200  THR B C   1 
ATOM   5263  O  O   . THR B  2  90  ? -38.329 9.936   25.390   1.00 225.06 ? 200  THR B O   1 
ATOM   5264  C  CB  . THR B  2  90  ? -36.579 12.808  25.131   1.00 238.68 ? 200  THR B CB  1 
ATOM   5265  O  OG1 . THR B  2  90  ? -36.473 12.264  23.809   1.00 236.48 ? 200  THR B OG1 1 
ATOM   5266  C  CG2 . THR B  2  90  ? -35.310 13.582  25.470   1.00 234.50 ? 200  THR B CG2 1 
ATOM   5267  N  N   . ASN B  2  91  ? -39.246 11.851  26.163   1.00 239.00 ? 201  ASN B N   1 
ATOM   5268  C  CA  . ASN B  2  91  ? -40.602 11.383  25.908   1.00 248.83 ? 201  ASN B CA  1 
ATOM   5269  C  C   . ASN B  2  91  ? -40.921 11.390  24.418   1.00 255.36 ? 201  ASN B C   1 
ATOM   5270  O  O   . ASN B  2  91  ? -41.726 10.571  23.960   1.00 260.44 ? 201  ASN B O   1 
ATOM   5271  C  CB  . ASN B  2  91  ? -41.616 12.211  26.702   1.00 259.46 ? 201  ASN B CB  1 
ATOM   5272  C  CG  . ASN B  2  91  ? -41.500 13.694  26.440   1.00 265.96 ? 201  ASN B CG  1 
ATOM   5273  O  OD1 . ASN B  2  91  ? -41.384 14.131  25.298   1.00 281.99 ? 201  ASN B OD1 1 
ATOM   5274  N  ND2 . ASN B  2  91  ? -41.537 14.483  27.506   1.00 267.68 ? 201  ASN B ND2 1 
ATOM   5275  N  N   . ASP B  2  92  ? -40.318 12.305  23.654   1.00 256.46 ? 202  ASP B N   1 
ATOM   5276  C  CA  . ASP B  2  92  ? -40.548 12.371  22.214   1.00 262.96 ? 202  ASP B CA  1 
ATOM   5277  C  C   . ASP B  2  92  ? -40.247 11.014  21.588   1.00 256.13 ? 202  ASP B C   1 
ATOM   5278  O  O   . ASP B  2  92  ? -39.080 10.650  21.414   1.00 245.33 ? 202  ASP B O   1 
ATOM   5279  C  CB  . ASP B  2  92  ? -39.686 13.460  21.561   1.00 263.01 ? 202  ASP B CB  1 
ATOM   5280  C  CG  . ASP B  2  92  ? -40.159 14.870  21.889   1.00 274.43 ? 202  ASP B CG  1 
ATOM   5281  O  OD1 . ASP B  2  92  ? -40.229 15.216  23.085   1.00 279.61 ? 202  ASP B OD1 1 
ATOM   5282  O  OD2 . ASP B  2  92  ? -40.453 15.638  20.947   1.00 282.55 ? 202  ASP B OD2 1 
ATOM   5283  N  N   . ALA B  2  93  ? -41.294 10.260  21.244   1.00 262.95 ? 203  ALA B N   1 
ATOM   5284  C  CA  . ALA B  2  93  ? -41.136 8.873   20.830   1.00 257.05 ? 203  ALA B CA  1 
ATOM   5285  C  C   . ALA B  2  93  ? -41.033 8.683   19.324   1.00 260.44 ? 203  ALA B C   1 
ATOM   5286  O  O   . ALA B  2  93  ? -40.446 7.687   18.887   1.00 252.85 ? 203  ALA B O   1 
ATOM   5287  C  CB  . ALA B  2  93  ? -42.307 8.033   21.361   1.00 262.47 ? 203  ALA B CB  1 
ATOM   5288  N  N   . GLU B  2  94  ? -41.560 9.603   18.517   1.00 271.86 ? 204  GLU B N   1 
ATOM   5289  C  CA  . GLU B  2  94  ? -41.376 9.471   17.079   1.00 275.12 ? 204  GLU B CA  1 
ATOM   5290  C  C   . GLU B  2  94  ? -40.013 9.954   16.633   1.00 267.16 ? 204  GLU B C   1 
ATOM   5291  O  O   . GLU B  2  94  ? -39.580 9.613   15.528   1.00 266.55 ? 204  GLU B O   1 
ATOM   5292  C  CB  . GLU B  2  94  ? -42.469 10.204  16.305   1.00 291.26 ? 204  GLU B CB  1 
ATOM   5293  C  CG  . GLU B  2  94  ? -43.820 9.547   16.422   1.00 300.56 ? 204  GLU B CG  1 
ATOM   5294  C  CD  . GLU B  2  94  ? -44.716 9.889   15.259   1.00 315.53 ? 204  GLU B CD  1 
ATOM   5295  O  OE1 . GLU B  2  94  ? -44.364 10.814  14.494   1.00 319.54 ? 204  GLU B OE1 1 
ATOM   5296  O  OE2 . GLU B  2  94  ? -45.774 9.242   15.118   1.00 323.89 ? 204  GLU B OE2 1 
ATOM   5297  N  N   . ARG B  2  95  ? -39.326 10.724  17.473   1.00 261.55 ? 205  ARG B N   1 
ATOM   5298  C  CA  . ARG B  2  95  ? -37.936 11.039  17.189   1.00 252.87 ? 205  ARG B CA  1 
ATOM   5299  C  C   . ARG B  2  95  ? -37.072 9.806   17.374   1.00 239.79 ? 205  ARG B C   1 
ATOM   5300  O  O   . ARG B  2  95  ? -36.056 9.648   16.688   1.00 234.08 ? 205  ARG B O   1 
ATOM   5301  C  CB  . ARG B  2  95  ? -37.463 12.175  18.097   1.00 251.06 ? 205  ARG B CB  1 
ATOM   5302  C  CG  . ARG B  2  95  ? -36.083 12.709  17.778   1.00 244.48 ? 205  ARG B CG  1 
ATOM   5303  C  CD  . ARG B  2  95  ? -36.012 13.202  16.349   1.00 252.13 ? 205  ARG B CD  1 
ATOM   5304  N  NE  . ARG B  2  95  ? -34.680 13.693  16.020   1.00 249.23 ? 205  ARG B NE  1 
ATOM   5305  C  CZ  . ARG B  2  95  ? -34.282 14.945  16.214   1.00 249.63 ? 205  ARG B CZ  1 
ATOM   5306  N  NH1 . ARG B  2  95  ? -35.115 15.837  16.735   1.00 258.16 ? 205  ARG B NH1 1 
ATOM   5307  N  NH2 . ARG B  2  95  ? -33.050 15.305  15.886   1.00 244.79 ? 205  ARG B NH2 1 
ATOM   5308  N  N   . PHE B  2  96  ? -37.466 8.924   18.295   1.00 235.54 ? 206  PHE B N   1 
ATOM   5309  C  CA  . PHE B  2  96  ? -36.758 7.663   18.474   1.00 224.14 ? 206  PHE B CA  1 
ATOM   5310  C  C   . PHE B  2  96  ? -36.850 6.803   17.223   1.00 226.03 ? 206  PHE B C   1 
ATOM   5311  O  O   . PHE B  2  96  ? -35.843 6.267   16.749   1.00 218.10 ? 206  PHE B O   1 
ATOM   5312  C  CB  . PHE B  2  96  ? -37.323 6.916   19.684   1.00 221.33 ? 206  PHE B CB  1 
ATOM   5313  C  CG  . PHE B  2  96  ? -36.835 5.495   19.808   1.00 218.03 ? 206  PHE B CG  1 
ATOM   5314  C  CD1 . PHE B  2  96  ? -35.592 5.218   20.358   1.00 203.70 ? 206  PHE B CD1 1 
ATOM   5315  C  CD2 . PHE B  2  96  ? -37.626 4.436   19.388   1.00 235.60 ? 206  PHE B CD2 1 
ATOM   5316  C  CE1 . PHE B  2  96  ? -35.143 3.910   20.478   1.00 191.27 ? 206  PHE B CE1 1 
ATOM   5317  C  CE2 . PHE B  2  96  ? -37.181 3.124   19.508   1.00 235.26 ? 206  PHE B CE2 1 
ATOM   5318  C  CZ  . PHE B  2  96  ? -35.939 2.863   20.053   1.00 195.56 ? 206  PHE B CZ  1 
ATOM   5319  N  N   . ASN B  2  97  ? -38.055 6.669   16.667   1.00 237.16 ? 207  ASN B N   1 
ATOM   5320  C  CA  . ASN B  2  97  ? -38.240 5.812   15.501   1.00 240.02 ? 207  ASN B CA  1 
ATOM   5321  C  C   . ASN B  2  97  ? -37.457 6.329   14.301   1.00 240.78 ? 207  ASN B C   1 
ATOM   5322  O  O   . ASN B  2  97  ? -36.834 5.545   13.575   1.00 236.02 ? 207  ASN B O   1 
ATOM   5323  C  CB  . ASN B  2  97  ? -39.726 5.700   15.174   1.00 253.34 ? 207  ASN B CB  1 
ATOM   5324  C  CG  . ASN B  2  97  ? -40.499 4.982   16.257   1.00 253.01 ? 207  ASN B CG  1 
ATOM   5325  O  OD1 . ASN B  2  97  ? -39.942 4.182   17.008   1.00 242.46 ? 207  ASN B OD1 1 
ATOM   5326  N  ND2 . ASN B  2  97  ? -41.791 5.272   16.352   1.00 265.21 ? 207  ASN B ND2 1 
ATOM   5327  N  N   . GLU B  2  98  ? -37.464 7.647   14.086   1.00 247.09 ? 208  GLU B N   1 
ATOM   5328  C  CA  . GLU B  2  98  ? -36.784 8.235   12.936   1.00 249.45 ? 208  GLU B CA  1 
ATOM   5329  C  C   . GLU B  2  98  ? -35.282 7.985   12.957   1.00 237.01 ? 208  GLU B C   1 
ATOM   5330  O  O   . GLU B  2  98  ? -34.625 8.116   11.919   1.00 237.68 ? 208  GLU B O   1 
ATOM   5331  C  CB  . GLU B  2  98  ? -37.065 9.738   12.884   1.00 258.51 ? 208  GLU B CB  1 
ATOM   5332  C  CG  . GLU B  2  98  ? -38.515 10.091  12.588   1.00 273.01 ? 208  GLU B CG  1 
ATOM   5333  C  CD  . GLU B  2  98  ? -38.851 11.524  12.956   1.00 280.75 ? 208  GLU B CD  1 
ATOM   5334  O  OE1 . GLU B  2  98  ? -37.916 12.306  13.230   1.00 275.78 ? 208  GLU B OE1 1 
ATOM   5335  O  OE2 . GLU B  2  98  ? -40.052 11.867  12.989   1.00 292.24 ? 208  GLU B OE2 1 
ATOM   5336  N  N   . ILE B  2  99  ? -34.723 7.638   14.115   1.00 231.75 ? 209  ILE B N   1 
ATOM   5337  C  CA  . ILE B  2  99  ? -33.296 7.354   14.197   1.00 214.83 ? 209  ILE B CA  1 
ATOM   5338  C  C   . ILE B  2  99  ? -33.016 5.912   13.809   1.00 208.71 ? 209  ILE B C   1 
ATOM   5339  O  O   . ILE B  2  99  ? -32.064 5.631   13.074   1.00 204.53 ? 209  ILE B O   1 
ATOM   5340  C  CB  . ILE B  2  99  ? -32.781 7.672   15.609   1.00 206.78 ? 209  ILE B CB  1 
ATOM   5341  C  CG1 . ILE B  2  99  ? -32.951 9.163   15.909   1.00 213.21 ? 209  ILE B CG1 1 
ATOM   5342  C  CG2 . ILE B  2  99  ? -31.329 7.242   15.755   1.00 195.05 ? 209  ILE B CG2 1 
ATOM   5343  C  CD1 . ILE B  2  99  ? -32.634 9.540   17.332   1.00 207.23 ? 209  ILE B CD1 1 
ATOM   5344  N  N   . VAL B  2  100 ? -33.843 4.981   14.284   1.00 208.83 ? 210  VAL B N   1 
ATOM   5345  C  CA  . VAL B  2  100 ? -33.630 3.569   13.993   1.00 207.55 ? 210  VAL B CA  1 
ATOM   5346  C  C   . VAL B  2  100 ? -33.805 3.280   12.508   1.00 210.14 ? 210  VAL B C   1 
ATOM   5347  O  O   . VAL B  2  100 ? -33.144 2.389   11.961   1.00 204.94 ? 210  VAL B O   1 
ATOM   5348  C  CB  . VAL B  2  100 ? -34.574 2.713   14.855   1.00 214.01 ? 210  VAL B CB  1 
ATOM   5349  C  CG1 . VAL B  2  100 ? -34.197 1.246   14.758   1.00 206.35 ? 210  VAL B CG1 1 
ATOM   5350  C  CG2 . VAL B  2  100 ? -34.538 3.180   16.301   1.00 211.97 ? 210  VAL B CG2 1 
ATOM   5351  N  N   . LYS B  2  101 ? -34.681 4.022   11.830   1.00 222.09 ? 211  LYS B N   1 
ATOM   5352  C  CA  . LYS B  2  101 ? -34.937 3.772   10.415   1.00 229.84 ? 211  LYS B CA  1 
ATOM   5353  C  C   . LYS B  2  101 ? -33.705 4.070   9.566    1.00 226.35 ? 211  LYS B C   1 
ATOM   5354  O  O   . LYS B  2  101 ? -33.381 3.313   8.643    1.00 226.04 ? 211  LYS B O   1 
ATOM   5355  C  CB  . LYS B  2  101 ? -36.123 4.615   9.952    1.00 244.17 ? 211  LYS B CB  1 
ATOM   5356  C  CG  . LYS B  2  101 ? -37.413 4.362   10.725   1.00 249.46 ? 211  LYS B CG  1 
ATOM   5357  C  CD  . LYS B  2  101 ? -38.352 5.558   10.603   1.00 262.18 ? 211  LYS B CD  1 
ATOM   5358  C  CE  . LYS B  2  101 ? -39.589 5.417   11.479   1.00 267.71 ? 211  LYS B CE  1 
ATOM   5359  N  NZ  . LYS B  2  101 ? -40.463 6.624   11.391   1.00 280.36 ? 211  LYS B NZ  1 
ATOM   5360  N  N   . ASN B  2  102 ? -33.008 5.165   9.862    1.00 224.25 ? 212  ASN B N   1 
ATOM   5361  C  CA  . ASN B  2  102 ? -31.889 5.617   9.045    1.00 222.82 ? 212  ASN B CA  1 
ATOM   5362  C  C   . ASN B  2  102 ? -30.586 4.904   9.370    1.00 210.04 ? 212  ASN B C   1 
ATOM   5363  O  O   . ASN B  2  102 ? -29.562 5.220   8.755    1.00 208.33 ? 212  ASN B O   1 
ATOM   5364  C  CB  . ASN B  2  102 ? -31.689 7.124   9.215    1.00 226.98 ? 212  ASN B CB  1 
ATOM   5365  C  CG  . ASN B  2  102 ? -32.962 7.904   9.011    1.00 239.82 ? 212  ASN B CG  1 
ATOM   5366  O  OD1 . ASN B  2  102 ? -34.054 7.337   9.019    1.00 244.79 ? 212  ASN B OD1 1 
ATOM   5367  N  ND2 . ASN B  2  102 ? -32.836 9.213   8.836    1.00 245.87 ? 212  ASN B ND2 1 
ATOM   5368  N  N   . GLN B  2  103 ? -30.594 3.969   10.317   1.00 201.71 ? 213  GLN B N   1 
ATOM   5369  C  CA  . GLN B  2  103 ? -29.364 3.308   10.732   1.00 189.82 ? 213  GLN B CA  1 
ATOM   5370  C  C   . GLN B  2  103 ? -28.811 2.416   9.628    1.00 188.77 ? 213  GLN B C   1 
ATOM   5371  O  O   . GLN B  2  103 ? -29.514 1.551   9.096    1.00 193.22 ? 213  GLN B O   1 
ATOM   5372  C  CB  . GLN B  2  103 ? -29.609 2.491   11.996   1.00 182.37 ? 213  GLN B CB  1 
ATOM   5373  C  CG  . GLN B  2  103 ? -29.833 3.333   13.240   1.00 181.16 ? 213  GLN B CG  1 
ATOM   5374  C  CD  . GLN B  2  103 ? -28.628 4.184   13.598   1.00 175.81 ? 213  GLN B CD  1 
ATOM   5375  O  OE1 . GLN B  2  103 ? -27.492 3.864   13.242   1.00 169.93 ? 213  GLN B OE1 1 
ATOM   5376  N  NE2 . GLN B  2  103 ? -28.871 5.274   14.316   1.00 178.34 ? 213  GLN B NE2 1 
ATOM   5377  N  N   . LYS B  2  104 ? -27.548 2.636   9.285    1.00 185.07 ? 214  LYS B N   1 
ATOM   5378  C  CA  . LYS B  2  104 ? -26.830 1.824   8.317    1.00 186.24 ? 214  LYS B CA  1 
ATOM   5379  C  C   . LYS B  2  104 ? -25.845 0.905   9.033    1.00 174.62 ? 214  LYS B C   1 
ATOM   5380  O  O   . LYS B  2  104 ? -25.531 1.085   10.213   1.00 165.73 ? 214  LYS B O   1 
ATOM   5381  C  CB  . LYS B  2  104 ? -26.089 2.702   7.303    1.00 192.50 ? 214  LYS B CB  1 
ATOM   5382  C  CG  . LYS B  2  104 ? -26.983 3.617   6.476    1.00 205.18 ? 214  LYS B CG  1 
ATOM   5383  C  CD  . LYS B  2  104 ? -26.175 4.365   5.420    1.00 211.63 ? 214  LYS B CD  1 
ATOM   5384  C  CE  . LYS B  2  104 ? -27.017 5.401   4.681    1.00 224.44 ? 214  LYS B CE  1 
ATOM   5385  N  NZ  . LYS B  2  104 ? -27.524 6.489   5.568    1.00 223.89 ? 214  LYS B NZ  1 
ATOM   5386  N  N   . ILE B  2  105 ? -25.362 -0.092  8.294    1.00 175.40 ? 215  ILE B N   1 
ATOM   5387  C  CA  . ILE B  2  105 ? -24.436 -1.088  8.824    1.00 165.93 ? 215  ILE B CA  1 
ATOM   5388  C  C   . ILE B  2  105 ? -23.021 -0.528  8.805    1.00 161.95 ? 215  ILE B C   1 
ATOM   5389  O  O   . ILE B  2  105 ? -22.675 0.312   7.970    1.00 168.31 ? 215  ILE B O   1 
ATOM   5390  C  CB  . ILE B  2  105 ? -24.525 -2.399  8.016    1.00 170.74 ? 215  ILE B CB  1 
ATOM   5391  C  CG1 . ILE B  2  105 ? -25.978 -2.700  7.634    1.00 192.96 ? 215  ILE B CG1 1 
ATOM   5392  C  CG2 . ILE B  2  105 ? -23.933 -3.560  8.805    1.00 159.84 ? 215  ILE B CG2 1 
ATOM   5393  C  CD1 . ILE B  2  105 ? -26.349 -2.296  6.206    1.00 189.92 ? 215  ILE B CD1 1 
ATOM   5394  N  N   . SER B  2  106 ? -22.206 -0.967  9.762    1.00 151.80 ? 216  SER B N   1 
ATOM   5395  C  CA  . SER B  2  106 ? -20.772 -0.733  9.779    1.00 147.63 ? 216  SER B CA  1 
ATOM   5396  C  C   . SER B  2  106 ? -20.055 -2.062  9.558    1.00 144.67 ? 216  SER B C   1 
ATOM   5397  O  O   . SER B  2  106 ? -20.654 -3.030  9.068    1.00 148.13 ? 216  SER B O   1 
ATOM   5398  C  CB  . SER B  2  106 ? -20.360 -0.075  11.092   1.00 139.10 ? 216  SER B CB  1 
ATOM   5399  O  OG  . SER B  2  106 ? -21.035 1.146   11.291   1.00 142.45 ? 216  SER B OG  1 
ATOM   5400  N  N   . ALA B  2  107 ? -18.787 -2.121  9.946    1.00 138.70 ? 217  ALA B N   1 
ATOM   5401  C  CA  . ALA B  2  107 ? -18.035 -3.352  9.775    1.00 136.28 ? 217  ALA B CA  1 
ATOM   5402  C  C   . ALA B  2  107 ? -16.793 -3.323  10.650   1.00 129.59 ? 217  ALA B C   1 
ATOM   5403  O  O   . ALA B  2  107 ? -16.406 -2.290  11.201   1.00 136.69 ? 217  ALA B O   1 
ATOM   5404  C  CB  . ALA B  2  107 ? -17.649 -3.574  8.313    1.00 144.82 ? 217  ALA B CB  1 
ATOM   5405  N  N   . ASN B  2  108 ? -16.190 -4.496  10.782   1.00 124.86 ? 218  ASN B N   1 
ATOM   5406  C  CA  . ASN B  2  108 ? -14.899 -4.704  11.419   1.00 118.70 ? 218  ASN B CA  1 
ATOM   5407  C  C   . ASN B  2  108 ? -14.419 -6.079  10.955   1.00 138.74 ? 218  ASN B C   1 
ATOM   5408  O  O   . ASN B  2  108 ? -14.882 -6.580  9.924    1.00 130.76 ? 218  ASN B O   1 
ATOM   5409  C  CB  . ASN B  2  108 ? -15.009 -4.548  12.948   1.00 114.71 ? 218  ASN B CB  1 
ATOM   5410  C  CG  . ASN B  2  108 ? -15.865 -5.623  13.589   1.00 108.93 ? 218  ASN B CG  1 
ATOM   5411  O  OD1 . ASN B  2  108 ? -15.345 -6.547  14.202   1.00 101.89 ? 218  ASN B OD1 1 
ATOM   5412  N  ND2 . ASN B  2  108 ? -17.182 -5.490  13.479   1.00 128.85 ? 218  ASN B ND2 1 
ATOM   5413  N  N   . ILE B  2  109 ? -13.503 -6.698  11.703   1.00 148.97 ? 219  ILE B N   1 
ATOM   5414  C  CA  . ILE B  2  109 ? -12.930 -7.985  11.319   1.00 115.26 ? 219  ILE B CA  1 
ATOM   5415  C  C   . ILE B  2  109 ? -13.367 -9.103  12.259   1.00 110.11 ? 219  ILE B C   1 
ATOM   5416  O  O   . ILE B  2  109 ? -13.903 -10.121 11.816   1.00 113.23 ? 219  ILE B O   1 
ATOM   5417  C  CB  . ILE B  2  109 ? -11.386 -7.917  11.236   1.00 114.66 ? 219  ILE B CB  1 
ATOM   5418  C  CG1 . ILE B  2  109 ? -10.921 -6.692  10.462   1.00 179.34 ? 219  ILE B CG1 1 
ATOM   5419  C  CG2 . ILE B  2  109 ? -10.848 -9.171  10.565   1.00 118.17 ? 219  ILE B CG2 1 
ATOM   5420  C  CD1 . ILE B  2  109 ? -9.412  -6.576  10.414   1.00 119.18 ? 219  ILE B CD1 1 
ATOM   5421  N  N   . ASP B  2  110 ? -13.185 -8.913  13.564   1.00 135.27 ? 220  ASP B N   1 
ATOM   5422  C  CA  . ASP B  2  110 ? -13.268 -10.003 14.530   1.00 118.42 ? 220  ASP B CA  1 
ATOM   5423  C  C   . ASP B  2  110 ? -14.680 -10.073 15.099   1.00 96.04  ? 220  ASP B C   1 
ATOM   5424  O  O   . ASP B  2  110 ? -15.251 -9.047  15.489   1.00 94.42  ? 220  ASP B O   1 
ATOM   5425  C  CB  . ASP B  2  110 ? -12.222 -9.838  15.641   1.00 91.47  ? 220  ASP B CB  1 
ATOM   5426  C  CG  . ASP B  2  110 ? -12.551 -8.726  16.627   1.00 86.48  ? 220  ASP B CG  1 
ATOM   5427  O  OD1 . ASP B  2  110 ? -13.305 -7.785  16.313   1.00 105.22 ? 220  ASP B OD1 1 
ATOM   5428  O  OD2 . ASP B  2  110 ? -12.000 -8.777  17.729   1.00 81.07  ? 220  ASP B OD2 1 
ATOM   5429  N  N   . THR B  2  111 ? -15.259 -11.279 15.069   1.00 97.32  ? 221  THR B N   1 
ATOM   5430  C  CA  . THR B  2  111 ? -16.674 -11.488 15.386   1.00 97.49  ? 221  THR B CA  1 
ATOM   5431  C  C   . THR B  2  111 ? -17.127 -10.860 16.703   1.00 91.11  ? 221  THR B C   1 
ATOM   5432  O  O   . THR B  2  111 ? -18.211 -10.254 16.720   1.00 92.53  ? 221  THR B O   1 
ATOM   5433  C  CB  . THR B  2  111 ? -16.976 -12.991 15.339   1.00 118.70 ? 221  THR B CB  1 
ATOM   5434  O  OG1 . THR B  2  111 ? -16.451 -13.540 14.127   1.00 165.21 ? 221  THR B OG1 1 
ATOM   5435  C  CG2 . THR B  2  111 ? -18.473 -13.218 15.345   1.00 101.38 ? 221  THR B CG2 1 
ATOM   5436  N  N   . PRO B  2  112 ? -16.402 -10.983 17.825   1.00 166.69 ? 222  PRO B N   1 
ATOM   5437  C  CA  . PRO B  2  112 ? -16.826 -10.285 19.046   1.00 79.38  ? 222  PRO B CA  1 
ATOM   5438  C  C   . PRO B  2  112 ? -16.606 -8.787  18.937   1.00 79.16  ? 222  PRO B C   1 
ATOM   5439  O  O   . PRO B  2  112 ? -15.661 -8.313  18.299   1.00 81.05  ? 222  PRO B O   1 
ATOM   5440  C  CB  . PRO B  2  112 ? -15.931 -10.890 20.125   1.00 73.90  ? 222  PRO B CB  1 
ATOM   5441  C  CG  . PRO B  2  112 ? -14.725 -11.318 19.394   1.00 76.42  ? 222  PRO B CG  1 
ATOM   5442  C  CD  . PRO B  2  112 ? -15.205 -11.809 18.079   1.00 83.04  ? 222  PRO B CD  1 
ATOM   5443  N  N   . GLU B  2  113 ? -17.445 -8.042  19.641   1.00 76.53  ? 223  GLU B N   1 
ATOM   5444  C  CA  . GLU B  2  113 ? -17.509 -6.604  19.446   1.00 87.95  ? 223  GLU B CA  1 
ATOM   5445  C  C   . GLU B  2  113 ? -17.245 -5.866  20.756   1.00 72.95  ? 223  GLU B C   1 
ATOM   5446  O  O   . GLU B  2  113 ? -17.006 -6.458  21.806   1.00 159.29 ? 223  GLU B O   1 
ATOM   5447  C  CB  . GLU B  2  113 ? -18.868 -6.216  18.841   1.00 83.21  ? 223  GLU B CB  1 
ATOM   5448  C  CG  . GLU B  2  113 ? -19.360 -7.075  17.637   1.00 90.04  ? 223  GLU B CG  1 
ATOM   5449  C  CD  . GLU B  2  113 ? -18.512 -6.960  16.353   1.00 127.09 ? 223  GLU B CD  1 
ATOM   5450  O  OE1 . GLU B  2  113 ? -17.422 -6.349  16.377   1.00 117.92 ? 223  GLU B OE1 1 
ATOM   5451  O  OE2 . GLU B  2  113 ? -18.951 -7.481  15.301   1.00 110.08 ? 223  GLU B OE2 1 
ATOM   5452  N  N   . GLY B  2  114 ? -17.277 -4.546  20.674   1.00 115.41 ? 224  GLY B N   1 
ATOM   5453  C  CA  . GLY B  2  114 ? -17.059 -3.712  21.833   1.00 74.74  ? 224  GLY B CA  1 
ATOM   5454  C  C   . GLY B  2  114 ? -18.388 -3.417  22.496   1.00 125.68 ? 224  GLY B C   1 
ATOM   5455  O  O   . GLY B  2  114 ? -18.766 -2.247  22.657   1.00 81.40  ? 224  GLY B O   1 
ATOM   5456  N  N   . GLY B  2  115 ? -19.138 -4.482  22.810   1.00 76.52  ? 225  GLY B N   1 
ATOM   5457  C  CA  . GLY B  2  115 ? -20.436 -4.299  23.435   1.00 79.88  ? 225  GLY B CA  1 
ATOM   5458  C  C   . GLY B  2  115 ? -20.352 -3.698  24.824   1.00 78.00  ? 225  GLY B C   1 
ATOM   5459  O  O   . GLY B  2  115 ? -21.166 -2.845  25.191   1.00 82.26  ? 225  GLY B O   1 
ATOM   5460  N  N   . PHE B  2  116 ? -19.359 -4.112  25.607   1.00 72.13  ? 226  PHE B N   1 
ATOM   5461  C  CA  . PHE B  2  116 ? -19.284 -3.655  26.989   1.00 70.52  ? 226  PHE B CA  1 
ATOM   5462  C  C   . PHE B  2  116 ? -18.935 -2.177  27.094   1.00 72.96  ? 226  PHE B C   1 
ATOM   5463  O  O   . PHE B  2  116 ? -19.401 -1.507  28.023   1.00 74.73  ? 226  PHE B O   1 
ATOM   5464  C  CB  . PHE B  2  116 ? -18.284 -4.505  27.759   1.00 64.29  ? 226  PHE B CB  1 
ATOM   5465  C  CG  . PHE B  2  116 ? -18.713 -5.933  27.927   1.00 62.33  ? 226  PHE B CG  1 
ATOM   5466  C  CD1 . PHE B  2  116 ? -20.019 -6.300  27.677   1.00 101.11 ? 226  PHE B CD1 1 
ATOM   5467  C  CD2 . PHE B  2  116 ? -17.822 -6.904  28.370   1.00 92.16  ? 226  PHE B CD2 1 
ATOM   5468  C  CE1 . PHE B  2  116 ? -20.427 -7.607  27.829   1.00 94.20  ? 226  PHE B CE1 1 
ATOM   5469  C  CE2 . PHE B  2  116 ? -18.227 -8.222  28.536   1.00 55.97  ? 226  PHE B CE2 1 
ATOM   5470  C  CZ  . PHE B  2  116 ? -19.525 -8.571  28.266   1.00 77.16  ? 226  PHE B CZ  1 
ATOM   5471  N  N   . ASP B  2  117 ? -18.142 -1.654  26.146   1.00 73.71  ? 227  ASP B N   1 
ATOM   5472  C  CA  . ASP B  2  117 ? -17.800 -0.229  26.120   1.00 76.94  ? 227  ASP B CA  1 
ATOM   5473  C  C   . ASP B  2  117 ? -19.045 0.647   26.060   1.00 83.32  ? 227  ASP B C   1 
ATOM   5474  O  O   . ASP B  2  117 ? -19.089 1.725   26.665   1.00 85.80  ? 227  ASP B O   1 
ATOM   5475  C  CB  . ASP B  2  117 ? -16.893 0.080   24.924   1.00 134.94 ? 227  ASP B CB  1 
ATOM   5476  C  CG  . ASP B  2  117 ? -15.416 -0.102  25.236   1.00 141.52 ? 227  ASP B CG  1 
ATOM   5477  O  OD1 . ASP B  2  117 ? -15.088 -0.887  26.148   1.00 100.09 ? 227  ASP B OD1 1 
ATOM   5478  O  OD2 . ASP B  2  117 ? -14.587 0.574   24.579   1.00 108.38 ? 227  ASP B OD2 1 
ATOM   5479  N  N   . ALA B  2  118 ? -20.016 0.249   25.237   1.00 86.79  ? 228  ALA B N   1 
ATOM   5480  C  CA  . ALA B  2  118 ? -21.283 0.968   25.131   1.00 115.31 ? 228  ALA B CA  1 
ATOM   5481  C  C   . ALA B  2  118 ? -22.130 0.808   26.392   1.00 100.08 ? 228  ALA B C   1 
ATOM   5482  O  O   . ALA B  2  118 ? -22.818 1.747   26.812   1.00 104.03 ? 228  ALA B O   1 
ATOM   5483  C  CB  . ALA B  2  118 ? -22.044 0.478   23.901   1.00 131.12 ? 228  ALA B CB  1 
ATOM   5484  N  N   . ILE B  2  119 ? -22.125 -0.384  26.984   1.00 94.05  ? 229  ILE B N   1 
ATOM   5485  C  CA  . ILE B  2  119 ? -22.864 -0.595  28.220   1.00 89.43  ? 229  ILE B CA  1 
ATOM   5486  C  C   . ILE B  2  119 ? -22.294 0.293   29.321   1.00 88.10  ? 229  ILE B C   1 
ATOM   5487  O  O   . ILE B  2  119 ? -23.037 0.969   30.043   1.00 99.15  ? 229  ILE B O   1 
ATOM   5488  C  CB  . ILE B  2  119 ? -22.811 -2.088  28.595   1.00 84.70  ? 229  ILE B CB  1 
ATOM   5489  C  CG1 . ILE B  2  119 ? -23.395 -2.942  27.478   1.00 86.76  ? 229  ILE B CG1 1 
ATOM   5490  C  CG2 . ILE B  2  119 ? -23.543 -2.371  29.881   1.00 85.37  ? 229  ILE B CG2 1 
ATOM   5491  C  CD1 . ILE B  2  119 ? -23.341 -4.407  27.803   1.00 83.98  ? 229  ILE B CD1 1 
ATOM   5492  N  N   . MET B  2  120 ? -20.960 0.365   29.408   1.00 83.27  ? 230  MET B N   1 
ATOM   5493  C  CA  . MET B  2  120 ? -20.289 1.138   30.455   1.00 82.56  ? 230  MET B CA  1 
ATOM   5494  C  C   . MET B  2  120 ? -20.528 2.641   30.301   1.00 87.84  ? 230  MET B C   1 
ATOM   5495  O  O   . MET B  2  120 ? -20.727 3.351   31.295   1.00 90.97  ? 230  MET B O   1 
ATOM   5496  C  CB  . MET B  2  120 ? -18.791 0.821   30.437   1.00 106.58 ? 230  MET B CB  1 
ATOM   5497  C  CG  . MET B  2  120 ? -17.933 1.624   31.406   1.00 106.23 ? 230  MET B CG  1 
ATOM   5498  S  SD  . MET B  2  120 ? -18.304 1.387   33.146   1.00 81.26  ? 230  MET B SD  1 
ATOM   5499  C  CE  . MET B  2  120 ? -17.650 -0.249  33.422   1.00 75.29  ? 230  MET B CE  1 
ATOM   5500  N  N   . GLN B  2  121 ? -20.445 3.162   29.076   1.00 90.98  ? 231  GLN B N   1 
ATOM   5501  C  CA  . GLN B  2  121 ? -20.633 4.597   28.899   1.00 97.02  ? 231  GLN B CA  1 
ATOM   5502  C  C   . GLN B  2  121 ? -22.079 5.001   29.114   1.00 103.27 ? 231  GLN B C   1 
ATOM   5503  O  O   . GLN B  2  121 ? -22.347 6.054   29.703   1.00 107.43 ? 231  GLN B O   1 
ATOM   5504  C  CB  . GLN B  2  121 ? -20.140 5.043   27.525   1.00 123.79 ? 231  GLN B CB  1 
ATOM   5505  C  CG  . GLN B  2  121 ? -18.642 4.927   27.385   1.00 115.19 ? 231  GLN B CG  1 
ATOM   5506  C  CD  . GLN B  2  121 ? -17.934 5.687   28.491   1.00 93.92  ? 231  GLN B CD  1 
ATOM   5507  O  OE1 . GLN B  2  121 ? -18.240 6.853   28.757   1.00 99.05  ? 231  GLN B OE1 1 
ATOM   5508  N  NE2 . GLN B  2  121 ? -16.989 5.023   29.151   1.00 110.69 ? 231  GLN B NE2 1 
ATOM   5509  N  N   . ALA B  2  122 ? -23.022 4.161   28.677   1.00 126.68 ? 232  ALA B N   1 
ATOM   5510  C  CA  . ALA B  2  122 ? -24.436 4.477   28.849   1.00 111.23 ? 232  ALA B CA  1 
ATOM   5511  C  C   . ALA B  2  122 ? -24.843 4.360   30.303   1.00 110.52 ? 232  ALA B C   1 
ATOM   5512  O  O   . ALA B  2  122 ? -25.755 5.060   30.748   1.00 116.61 ? 232  ALA B O   1 
ATOM   5513  C  CB  . ALA B  2  122 ? -25.294 3.555   27.985   1.00 113.23 ? 232  ALA B CB  1 
ATOM   5514  N  N   . ALA B  2  123 ? -24.135 3.529   31.063   1.00 107.80 ? 233  ALA B N   1 
ATOM   5515  C  CA  . ALA B  2  123 ? -24.443 3.333   32.471   1.00 108.02 ? 233  ALA B CA  1 
ATOM   5516  C  C   . ALA B  2  123 ? -23.954 4.501   33.316   1.00 110.38 ? 233  ALA B C   1 
ATOM   5517  O  O   . ALA B  2  123 ? -24.734 5.113   34.054   1.00 115.64 ? 233  ALA B O   1 
ATOM   5518  C  CB  . ALA B  2  123 ? -23.805 2.031   32.963   1.00 103.00 ? 233  ALA B CB  1 
ATOM   5519  N  N   . VAL B  2  124 ? -22.668 4.840   33.202   1.00 126.16 ? 234  VAL B N   1 
ATOM   5520  C  CA  . VAL B  2  124 ? -22.073 5.825   34.099   1.00 127.59 ? 234  VAL B CA  1 
ATOM   5521  C  C   . VAL B  2  124 ? -22.576 7.228   33.788   1.00 110.47 ? 234  VAL B C   1 
ATOM   5522  O  O   . VAL B  2  124 ? -22.844 8.021   34.700   1.00 114.79 ? 234  VAL B O   1 
ATOM   5523  C  CB  . VAL B  2  124 ? -20.543 5.741   34.023   1.00 100.86 ? 234  VAL B CB  1 
ATOM   5524  C  CG1 . VAL B  2  124 ? -19.922 6.670   35.054   1.00 167.73 ? 234  VAL B CG1 1 
ATOM   5525  C  CG2 . VAL B  2  124 ? -20.092 4.315   34.232   1.00 95.58  ? 234  VAL B CG2 1 
ATOM   5526  N  N   . CYS B  2  125 ? -22.683 7.570   32.503   1.00 111.40 ? 235  CYS B N   1 
ATOM   5527  C  CA  . CYS B  2  125 ? -23.130 8.904   32.114   1.00 124.36 ? 235  CYS B CA  1 
ATOM   5528  C  C   . CYS B  2  125 ? -24.581 9.137   32.510   1.00 125.55 ? 235  CYS B C   1 
ATOM   5529  O  O   . CYS B  2  125 ? -25.492 8.934   31.701   1.00 129.53 ? 235  CYS B O   1 
ATOM   5530  C  CB  . CYS B  2  125 ? -22.962 9.123   30.604   1.00 137.52 ? 235  CYS B CB  1 
ATOM   5531  S  SG  . CYS B  2  125 ? -21.260 9.039   29.970   1.00 115.65 ? 235  CYS B SG  1 
ATOM   5532  N  N   . LYS B  2  126 ? -24.805 9.593   33.741   1.00 128.70 ? 236  LYS B N   1 
ATOM   5533  C  CA  . LYS B  2  126 ? -26.155 9.916   34.178   1.00 156.49 ? 236  LYS B CA  1 
ATOM   5534  C  C   . LYS B  2  126 ? -26.618 11.255  33.640   1.00 143.00 ? 236  LYS B C   1 
ATOM   5535  O  O   . LYS B  2  126 ? -27.788 11.609  33.814   1.00 150.16 ? 236  LYS B O   1 
ATOM   5536  C  CB  . LYS B  2  126 ? -26.230 9.942   35.708   1.00 165.10 ? 236  LYS B CB  1 
ATOM   5537  C  CG  . LYS B  2  126 ? -26.101 8.594   36.394   1.00 129.05 ? 236  LYS B CG  1 
ATOM   5538  C  CD  . LYS B  2  126 ? -26.120 8.760   37.911   1.00 131.79 ? 236  LYS B CD  1 
ATOM   5539  C  CE  . LYS B  2  126 ? -26.080 7.416   38.625   1.00 129.00 ? 236  LYS B CE  1 
ATOM   5540  N  NZ  . LYS B  2  126 ? -26.041 7.550   40.113   1.00 131.60 ? 236  LYS B NZ  1 
ATOM   5541  N  N   . GLU B  2  127 ? -25.730 12.000  32.991   1.00 143.03 ? 237  GLU B N   1 
ATOM   5542  C  CA  . GLU B  2  127 ? -26.030 13.338  32.509   1.00 179.20 ? 237  GLU B CA  1 
ATOM   5543  C  C   . GLU B  2  127 ? -26.236 13.356  31.001   1.00 187.43 ? 237  GLU B C   1 
ATOM   5544  O  O   . GLU B  2  127 ? -27.305 13.754  30.526   1.00 211.94 ? 237  GLU B O   1 
ATOM   5545  C  CB  . GLU B  2  127 ? -24.901 14.299  32.912   1.00 201.47 ? 237  GLU B CB  1 
ATOM   5546  C  CG  . GLU B  2  127 ? -24.579 14.307  34.404   1.00 190.39 ? 237  GLU B CG  1 
ATOM   5547  C  CD  . GLU B  2  127 ? -23.292 15.049  34.725   1.00 196.52 ? 237  GLU B CD  1 
ATOM   5548  O  OE1 . GLU B  2  127 ? -22.972 15.196  35.925   1.00 202.69 ? 237  GLU B OE1 1 
ATOM   5549  O  OE2 . GLU B  2  127 ? -22.607 15.498  33.781   1.00 182.83 ? 237  GLU B OE2 1 
ATOM   5550  N  N   . LYS B  2  128 ? -25.232 12.927  30.230   1.00 171.11 ? 238  LYS B N   1 
ATOM   5551  C  CA  . LYS B  2  128 ? -25.343 12.946  28.778   1.00 151.99 ? 238  LYS B CA  1 
ATOM   5552  C  C   . LYS B  2  128 ? -26.336 11.912  28.281   1.00 161.11 ? 238  LYS B C   1 
ATOM   5553  O  O   . LYS B  2  128 ? -26.808 12.015  27.146   1.00 181.41 ? 238  LYS B O   1 
ATOM   5554  C  CB  . LYS B  2  128 ? -23.972 12.725  28.144   1.00 146.30 ? 238  LYS B CB  1 
ATOM   5555  C  CG  . LYS B  2  128 ? -22.896 13.627  28.730   1.00 157.54 ? 238  LYS B CG  1 
ATOM   5556  C  CD  . LYS B  2  128 ? -21.622 13.610  27.907   1.00 169.17 ? 238  LYS B CD  1 
ATOM   5557  C  CE  . LYS B  2  128 ? -21.812 14.327  26.586   1.00 154.83 ? 238  LYS B CE  1 
ATOM   5558  N  NZ  . LYS B  2  128 ? -20.527 14.439  25.851   1.00 147.98 ? 238  LYS B NZ  1 
ATOM   5559  N  N   . ILE B  2  129 ? -26.652 10.915  29.100   1.00 147.43 ? 239  ILE B N   1 
ATOM   5560  C  CA  . ILE B  2  129 ? -27.752 10.007  28.800   1.00 149.23 ? 239  ILE B CA  1 
ATOM   5561  C  C   . ILE B  2  129 ? -29.026 10.470  29.481   1.00 156.85 ? 239  ILE B C   1 
ATOM   5562  O  O   . ILE B  2  129 ? -30.104 10.438  28.884   1.00 174.19 ? 239  ILE B O   1 
ATOM   5563  C  CB  . ILE B  2  129 ? -27.390 8.565   29.195   1.00 140.48 ? 239  ILE B CB  1 
ATOM   5564  C  CG1 . ILE B  2  129 ? -26.641 7.872   28.057   1.00 135.83 ? 239  ILE B CG1 1 
ATOM   5565  C  CG2 . ILE B  2  129 ? -28.633 7.793   29.593   1.00 143.13 ? 239  ILE B CG2 1 
ATOM   5566  C  CD1 . ILE B  2  129 ? -25.245 8.378   27.859   1.00 131.82 ? 239  ILE B CD1 1 
ATOM   5567  N  N   . GLY B  2  130 ? -28.917 10.919  30.727   1.00 156.39 ? 240  GLY B N   1 
ATOM   5568  C  CA  . GLY B  2  130 ? -30.051 11.497  31.417   1.00 165.50 ? 240  GLY B CA  1 
ATOM   5569  C  C   . GLY B  2  130 ? -30.896 10.468  32.133   1.00 163.70 ? 240  GLY B C   1 
ATOM   5570  O  O   . GLY B  2  130 ? -32.066 10.273  31.798   1.00 170.33 ? 240  GLY B O   1 
ATOM   5571  N  N   . TRP B  2  131 ? -30.313 9.797   33.119   1.00 156.35 ? 241  TRP B N   1 
ATOM   5572  C  CA  . TRP B  2  131 ? -31.063 8.834   33.905   1.00 156.05 ? 241  TRP B CA  1 
ATOM   5573  C  C   . TRP B  2  131 ? -31.908 9.537   34.954   1.00 176.87 ? 241  TRP B C   1 
ATOM   5574  O  O   . TRP B  2  131 ? -31.437 10.442  35.650   1.00 163.79 ? 241  TRP B O   1 
ATOM   5575  C  CB  . TRP B  2  131 ? -30.128 7.836   34.577   1.00 151.48 ? 241  TRP B CB  1 
ATOM   5576  C  CG  . TRP B  2  131 ? -29.428 6.952   33.611   1.00 154.11 ? 241  TRP B CG  1 
ATOM   5577  C  CD1 . TRP B  2  131 ? -28.127 7.024   33.227   1.00 133.04 ? 241  TRP B CD1 1 
ATOM   5578  C  CD2 . TRP B  2  131 ? -30.011 5.868   32.875   1.00 182.93 ? 241  TRP B CD2 1 
ATOM   5579  N  NE1 . TRP B  2  131 ? -27.853 6.039   32.311   1.00 128.77 ? 241  TRP B NE1 1 
ATOM   5580  C  CE2 . TRP B  2  131 ? -28.993 5.315   32.076   1.00 132.50 ? 241  TRP B CE2 1 
ATOM   5581  C  CE3 . TRP B  2  131 ? -31.296 5.307   32.820   1.00 145.16 ? 241  TRP B CE3 1 
ATOM   5582  C  CZ2 . TRP B  2  131 ? -29.214 4.226   31.231   1.00 130.90 ? 241  TRP B CZ2 1 
ATOM   5583  C  CZ3 . TRP B  2  131 ? -31.514 4.231   31.981   1.00 143.70 ? 241  TRP B CZ3 1 
ATOM   5584  C  CH2 . TRP B  2  131 ? -30.475 3.701   31.196   1.00 136.51 ? 241  TRP B CH2 1 
ATOM   5585  N  N   . ARG B  2  132 ? -33.159 9.096   35.074   1.00 196.12 ? 242  ARG B N   1 
ATOM   5586  C  CA  . ARG B  2  132 ? -34.072 9.666   36.049   1.00 177.14 ? 242  ARG B CA  1 
ATOM   5587  C  C   . ARG B  2  132 ? -33.591 9.358   37.463   1.00 172.21 ? 242  ARG B C   1 
ATOM   5588  O  O   . ARG B  2  132 ? -32.832 8.417   37.704   1.00 163.54 ? 242  ARG B O   1 
ATOM   5589  C  CB  . ARG B  2  132 ? -35.475 9.108   35.847   1.00 184.74 ? 242  ARG B CB  1 
ATOM   5590  C  CG  . ARG B  2  132 ? -36.347 9.907   34.903   1.00 196.20 ? 242  ARG B CG  1 
ATOM   5591  C  CD  . ARG B  2  132 ? -37.694 9.223   34.746   1.00 214.01 ? 242  ARG B CD  1 
ATOM   5592  N  NE  . ARG B  2  132 ? -38.564 9.930   33.818   1.00 213.41 ? 242  ARG B NE  1 
ATOM   5593  C  CZ  . ARG B  2  132 ? -39.521 9.344   33.108   1.00 218.88 ? 242  ARG B CZ  1 
ATOM   5594  N  NH1 . ARG B  2  132 ? -39.730 8.039   33.218   1.00 215.52 ? 242  ARG B NH1 1 
ATOM   5595  N  NH2 . ARG B  2  132 ? -40.263 10.063  32.280   1.00 228.87 ? 242  ARG B NH2 1 
ATOM   5596  N  N   . ASN B  2  133 ? -34.085 10.149  38.412   1.00 185.44 ? 243  ASN B N   1 
ATOM   5597  C  CA  . ASN B  2  133 ? -33.682 9.991   39.806   1.00 182.96 ? 243  ASN B CA  1 
ATOM   5598  C  C   . ASN B  2  133 ? -34.227 8.693   40.390   1.00 177.53 ? 243  ASN B C   1 
ATOM   5599  O  O   . ASN B  2  133 ? -33.467 7.826   40.834   1.00 171.96 ? 243  ASN B O   1 
ATOM   5600  C  CB  . ASN B  2  133 ? -34.135 11.217  40.600   1.00 187.07 ? 243  ASN B CB  1 
ATOM   5601  C  CG  . ASN B  2  133 ? -33.145 12.361  40.485   1.00 190.83 ? 243  ASN B CG  1 
ATOM   5602  O  OD1 . ASN B  2  133 ? -32.039 12.175  39.979   1.00 177.69 ? 243  ASN B OD1 1 
ATOM   5603  N  ND2 . ASN B  2  133 ? -33.537 13.551  40.917   1.00 214.77 ? 243  ASN B ND2 1 
ATOM   5604  N  N   . ASP B  2  134 ? -35.546 8.538   40.401   1.00 195.63 ? 244  ASP B N   1 
ATOM   5605  C  CA  . ASP B  2  134 ? -36.190 7.345   40.943   1.00 210.01 ? 244  ASP B CA  1 
ATOM   5606  C  C   . ASP B  2  134 ? -37.009 6.714   39.823   1.00 195.59 ? 244  ASP B C   1 
ATOM   5607  O  O   . ASP B  2  134 ? -38.185 7.035   39.635   1.00 205.63 ? 244  ASP B O   1 
ATOM   5608  C  CB  . ASP B  2  134 ? -37.039 7.687   42.157   1.00 218.38 ? 244  ASP B CB  1 
ATOM   5609  C  CG  . ASP B  2  134 ? -36.270 8.483   43.193   1.00 247.92 ? 244  ASP B CG  1 
ATOM   5610  O  OD1 . ASP B  2  134 ? -36.255 9.729   43.098   1.00 272.99 ? 244  ASP B OD1 1 
ATOM   5611  O  OD2 . ASP B  2  134 ? -35.666 7.862   44.094   1.00 242.71 ? 244  ASP B OD2 1 
ATOM   5612  N  N   . SER B  2  135 ? -36.372 5.833   39.057   1.00 200.99 ? 245  SER B N   1 
ATOM   5613  C  CA  . SER B  2  135 ? -37.053 5.133   37.980   1.00 195.78 ? 245  SER B CA  1 
ATOM   5614  C  C   . SER B  2  135 ? -36.342 3.814   37.721   1.00 198.16 ? 245  SER B C   1 
ATOM   5615  O  O   . SER B  2  135 ? -35.311 3.504   38.323   1.00 183.96 ? 245  SER B O   1 
ATOM   5616  C  CB  . SER B  2  135 ? -37.108 5.967   36.700   1.00 189.28 ? 245  SER B CB  1 
ATOM   5617  O  OG  . SER B  2  135 ? -35.830 6.046   36.099   1.00 180.19 ? 245  SER B OG  1 
ATOM   5618  N  N   . LEU B  2  136 ? -36.921 3.034   36.816   1.00 198.82 ? 246  LEU B N   1 
ATOM   5619  C  CA  . LEU B  2  136 ? -36.365 1.749   36.401   1.00 168.98 ? 246  LEU B CA  1 
ATOM   5620  C  C   . LEU B  2  136 ? -35.435 2.001   35.220   1.00 161.50 ? 246  LEU B C   1 
ATOM   5621  O  O   . LEU B  2  136 ? -35.888 2.216   34.094   1.00 165.67 ? 246  LEU B O   1 
ATOM   5622  C  CB  . LEU B  2  136 ? -37.484 0.781   36.041   1.00 178.91 ? 246  LEU B CB  1 
ATOM   5623  C  CG  . LEU B  2  136 ? -38.506 0.518   37.149   1.00 183.99 ? 246  LEU B CG  1 
ATOM   5624  C  CD1 . LEU B  2  136 ? -39.524 -0.520  36.702   1.00 191.96 ? 246  LEU B CD1 1 
ATOM   5625  C  CD2 . LEU B  2  136 ? -37.809 0.081   38.429   1.00 195.69 ? 246  LEU B CD2 1 
ATOM   5626  N  N   . HIS B  2  137 ? -34.129 2.008   35.481   1.00 159.71 ? 247  HIS B N   1 
ATOM   5627  C  CA  . HIS B  2  137 ? -33.117 2.248   34.449   1.00 178.74 ? 247  HIS B CA  1 
ATOM   5628  C  C   . HIS B  2  137 ? -32.875 0.956   33.674   1.00 174.47 ? 247  HIS B C   1 
ATOM   5629  O  O   . HIS B  2  137 ? -32.042 0.128   34.045   1.00 163.89 ? 247  HIS B O   1 
ATOM   5630  C  CB  . HIS B  2  137 ? -31.833 2.760   35.081   1.00 140.18 ? 247  HIS B CB  1 
ATOM   5631  C  CG  . HIS B  2  137 ? -32.039 3.919   36.000   1.00 144.76 ? 247  HIS B CG  1 
ATOM   5632  N  ND1 . HIS B  2  137 ? -31.254 4.137   37.112   1.00 164.95 ? 247  HIS B ND1 1 
ATOM   5633  C  CD2 . HIS B  2  137 ? -32.939 4.929   35.971   1.00 152.27 ? 247  HIS B CD2 1 
ATOM   5634  C  CE1 . HIS B  2  137 ? -31.665 5.229   37.732   1.00 185.76 ? 247  HIS B CE1 1 
ATOM   5635  N  NE2 . HIS B  2  137 ? -32.687 5.728   37.060   1.00 188.18 ? 247  HIS B NE2 1 
ATOM   5636  N  N   . LEU B  2  138 ? -33.585 0.797   32.559   1.00 180.32 ? 248  LEU B N   1 
ATOM   5637  C  CA  . LEU B  2  138 ? -33.517 -0.412  31.744   1.00 152.92 ? 248  LEU B CA  1 
ATOM   5638  C  C   . LEU B  2  138 ? -32.691 -0.158  30.489   1.00 142.62 ? 248  LEU B C   1 
ATOM   5639  O  O   . LEU B  2  138 ? -32.911 0.834   29.787   1.00 158.76 ? 248  LEU B O   1 
ATOM   5640  C  CB  . LEU B  2  138 ? -34.921 -0.877  31.359   1.00 167.80 ? 248  LEU B CB  1 
ATOM   5641  C  CG  . LEU B  2  138 ? -35.978 -0.959  32.461   1.00 180.04 ? 248  LEU B CG  1 
ATOM   5642  C  CD1 . LEU B  2  138 ? -37.284 -1.466  31.881   1.00 171.56 ? 248  LEU B CD1 1 
ATOM   5643  C  CD2 . LEU B  2  138 ? -35.511 -1.853  33.598   1.00 170.27 ? 248  LEU B CD2 1 
ATOM   5644  N  N   . LEU B  2  139 ? -31.761 -1.071  30.197   1.00 132.20 ? 249  LEU B N   1 
ATOM   5645  C  CA  . LEU B  2  139 ? -30.821 -0.928  29.080   1.00 141.07 ? 249  LEU B CA  1 
ATOM   5646  C  C   . LEU B  2  139 ? -30.883 -2.174  28.200   1.00 126.83 ? 249  LEU B C   1 
ATOM   5647  O  O   . LEU B  2  139 ? -30.318 -3.214  28.548   1.00 120.50 ? 249  LEU B O   1 
ATOM   5648  C  CB  . LEU B  2  139 ? -29.407 -0.679  29.595   1.00 119.52 ? 249  LEU B CB  1 
ATOM   5649  C  CG  . LEU B  2  139 ? -28.472 0.236   28.806   1.00 117.77 ? 249  LEU B CG  1 
ATOM   5650  C  CD1 . LEU B  2  139 ? -27.298 0.580   29.691   1.00 126.67 ? 249  LEU B CD1 1 
ATOM   5651  C  CD2 . LEU B  2  139 ? -28.008 -0.431  27.527   1.00 115.45 ? 249  LEU B CD2 1 
ATOM   5652  N  N   . VAL B  2  140 ? -31.589 -2.074  27.077   1.00 133.43 ? 250  VAL B N   1 
ATOM   5653  C  CA  . VAL B  2  140 ? -31.699 -3.180  26.131   1.00 133.43 ? 250  VAL B CA  1 
ATOM   5654  C  C   . VAL B  2  140 ? -30.420 -3.278  25.308   1.00 126.72 ? 250  VAL B C   1 
ATOM   5655  O  O   . VAL B  2  140 ? -30.058 -2.338  24.592   1.00 128.17 ? 250  VAL B O   1 
ATOM   5656  C  CB  . VAL B  2  140 ? -32.927 -3.006  25.227   1.00 143.83 ? 250  VAL B CB  1 
ATOM   5657  C  CG1 . VAL B  2  140 ? -32.842 -3.927  24.022   1.00 143.96 ? 250  VAL B CG1 1 
ATOM   5658  C  CG2 . VAL B  2  140 ? -34.191 -3.287  26.020   1.00 150.52 ? 250  VAL B CG2 1 
ATOM   5659  N  N   . PHE B  2  141 ? -29.754 -4.431  25.385   1.00 120.07 ? 251  PHE B N   1 
ATOM   5660  C  CA  . PHE B  2  141 ? -28.510 -4.694  24.667   1.00 157.97 ? 251  PHE B CA  1 
ATOM   5661  C  C   . PHE B  2  141 ? -28.766 -5.708  23.559   1.00 115.68 ? 251  PHE B C   1 
ATOM   5662  O  O   . PHE B  2  141 ? -29.170 -6.842  23.834   1.00 115.46 ? 251  PHE B O   1 
ATOM   5663  C  CB  . PHE B  2  141 ? -27.429 -5.213  25.617   1.00 155.07 ? 251  PHE B CB  1 
ATOM   5664  C  CG  . PHE B  2  141 ? -26.141 -5.552  24.931   1.00 122.55 ? 251  PHE B CG  1 
ATOM   5665  C  CD1 . PHE B  2  141 ? -25.247 -4.555  24.574   1.00 96.98  ? 251  PHE B CD1 1 
ATOM   5666  C  CD2 . PHE B  2  141 ? -25.831 -6.868  24.624   1.00 112.99 ? 251  PHE B CD2 1 
ATOM   5667  C  CE1 . PHE B  2  141 ? -24.064 -4.862  23.930   1.00 92.17  ? 251  PHE B CE1 1 
ATOM   5668  C  CE2 . PHE B  2  141 ? -24.652 -7.182  23.980   1.00 111.47 ? 251  PHE B CE2 1 
ATOM   5669  C  CZ  . PHE B  2  141 ? -23.766 -6.176  23.630   1.00 88.86  ? 251  PHE B CZ  1 
ATOM   5670  N  N   . VAL B  2  142 ? -28.481 -5.316  22.317   1.00 117.77 ? 252  VAL B N   1 
ATOM   5671  C  CA  . VAL B  2  142 ? -28.739 -6.138  21.137   1.00 120.80 ? 252  VAL B CA  1 
ATOM   5672  C  C   . VAL B  2  142 ? -27.440 -6.294  20.357   1.00 115.30 ? 252  VAL B C   1 
ATOM   5673  O  O   . VAL B  2  142 ? -26.827 -5.292  19.967   1.00 115.08 ? 252  VAL B O   1 
ATOM   5674  C  CB  . VAL B  2  142 ? -29.823 -5.532  20.229   1.00 130.99 ? 252  VAL B CB  1 
ATOM   5675  C  CG1 . VAL B  2  142 ? -29.922 -6.334  18.955   1.00 133.93 ? 252  VAL B CG1 1 
ATOM   5676  C  CG2 . VAL B  2  142 ? -31.167 -5.477  20.935   1.00 137.56 ? 252  VAL B CG2 1 
ATOM   5677  N  N   . SER B  2  143 ? -27.025 -7.542  20.129   1.00 111.48 ? 253  SER B N   1 
ATOM   5678  C  CA  . SER B  2  143 ? -25.902 -7.869  19.255   1.00 107.54 ? 253  SER B CA  1 
ATOM   5679  C  C   . SER B  2  143 ? -25.999 -9.344  18.898   1.00 106.85 ? 253  SER B C   1 
ATOM   5680  O  O   . SER B  2  143 ? -26.412 -10.161 19.722   1.00 107.47 ? 253  SER B O   1 
ATOM   5681  C  CB  . SER B  2  143 ? -24.545 -7.577  19.910   1.00 99.40  ? 253  SER B CB  1 
ATOM   5682  O  OG  . SER B  2  143 ? -24.297 -8.452  20.997   1.00 141.49 ? 253  SER B OG  1 
ATOM   5683  N  N   . ASP B  2  144 ? -25.592 -9.689  17.674   1.00 108.08 ? 254  ASP B N   1 
ATOM   5684  C  CA  . ASP B  2  144 ? -25.693 -11.069 17.210   1.00 128.02 ? 254  ASP B CA  1 
ATOM   5685  C  C   . ASP B  2  144 ? -24.359 -11.801 17.294   1.00 140.37 ? 254  ASP B C   1 
ATOM   5686  O  O   . ASP B  2  144 ? -24.126 -12.763 16.551   1.00 164.33 ? 254  ASP B O   1 
ATOM   5687  C  CB  . ASP B  2  144 ? -26.245 -11.127 15.786   1.00 119.69 ? 254  ASP B CB  1 
ATOM   5688  C  CG  . ASP B  2  144 ? -25.257 -10.637 14.752   1.00 121.75 ? 254  ASP B CG  1 
ATOM   5689  O  OD1 . ASP B  2  144 ? -24.376 -9.819  15.107   1.00 116.81 ? 254  ASP B OD1 1 
ATOM   5690  O  OD2 . ASP B  2  144 ? -25.372 -11.076 13.581   1.00 128.82 ? 254  ASP B OD2 1 
ATOM   5691  N  N   . ALA B  2  145 ? -23.480 -11.367 18.193   1.00 97.53  ? 255  ALA B N   1 
ATOM   5692  C  CA  . ALA B  2  145 ? -22.185 -12.000 18.370   1.00 93.16  ? 255  ALA B CA  1 
ATOM   5693  C  C   . ALA B  2  145 ? -21.703 -11.769 19.801   1.00 86.95  ? 255  ALA B C   1 
ATOM   5694  O  O   . ALA B  2  145 ? -22.367 -11.116 20.613   1.00 82.76  ? 255  ALA B O   1 
ATOM   5695  C  CB  . ALA B  2  145 ? -21.176 -11.460 17.352   1.00 95.56  ? 255  ALA B CB  1 
ATOM   5696  N  N   . ASP B  2  146 ? -20.514 -12.294 20.091   1.00 81.43  ? 256  ASP B N   1 
ATOM   5697  C  CA  . ASP B  2  146 ? -19.888 -12.123 21.388   1.00 74.22  ? 256  ASP B CA  1 
ATOM   5698  C  C   . ASP B  2  146 ? -19.452 -10.668 21.553   1.00 71.85  ? 256  ASP B C   1 
ATOM   5699  O  O   . ASP B  2  146 ? -19.610 -9.833  20.659   1.00 129.74 ? 256  ASP B O   1 
ATOM   5700  C  CB  . ASP B  2  146 ? -18.701 -13.078 21.513   1.00 72.54  ? 256  ASP B CB  1 
ATOM   5701  C  CG  . ASP B  2  146 ? -18.303 -13.356 22.959   1.00 180.72 ? 256  ASP B CG  1 
ATOM   5702  O  OD1 . ASP B  2  146 ? -18.499 -12.482 23.835   1.00 142.01 ? 256  ASP B OD1 1 
ATOM   5703  O  OD2 . ASP B  2  146 ? -17.772 -14.457 23.213   1.00 152.43 ? 256  ASP B OD2 1 
ATOM   5704  N  N   . SER B  2  147 ? -18.897 -10.348 22.714   1.00 128.91 ? 257  SER B N   1 
ATOM   5705  C  CA  . SER B  2  147 ? -18.376 -9.010  22.927   1.00 64.98  ? 257  SER B CA  1 
ATOM   5706  C  C   . SER B  2  147 ? -17.086 -9.093  23.738   1.00 65.61  ? 257  SER B C   1 
ATOM   5707  O  O   . SER B  2  147 ? -16.873 -10.019 24.532   1.00 56.24  ? 257  SER B O   1 
ATOM   5708  C  CB  . SER B  2  147 ? -19.414 -8.057  23.562   1.00 68.51  ? 257  SER B CB  1 
ATOM   5709  O  OG  . SER B  2  147 ? -19.964 -8.564  24.759   1.00 67.13  ? 257  SER B OG  1 
ATOM   5710  N  N   . HIS B  2  148 ? -16.195 -8.151  23.434   1.00 112.34 ? 258  HIS B N   1 
ATOM   5711  C  CA  . HIS B  2  148 ? -14.898 -8.049  24.078   1.00 55.65  ? 258  HIS B CA  1 
ATOM   5712  C  C   . HIS B  2  148 ? -15.020 -7.484  25.476   1.00 53.61  ? 258  HIS B C   1 
ATOM   5713  O  O   . HIS B  2  148 ? -15.808 -6.571  25.733   1.00 56.69  ? 258  HIS B O   1 
ATOM   5714  C  CB  . HIS B  2  148 ? -13.975 -7.147  23.263   1.00 102.65 ? 258  HIS B CB  1 
ATOM   5715  C  CG  . HIS B  2  148 ? -13.443 -7.783  22.025   1.00 62.86  ? 258  HIS B CG  1 
ATOM   5716  N  ND1 . HIS B  2  148 ? -12.435 -8.718  22.048   1.00 63.00  ? 258  HIS B ND1 1 
ATOM   5717  C  CD2 . HIS B  2  148 ? -13.788 -7.633  20.729   1.00 68.20  ? 258  HIS B CD2 1 
ATOM   5718  C  CE1 . HIS B  2  148 ? -12.169 -9.109  20.818   1.00 67.93  ? 258  HIS B CE1 1 
ATOM   5719  N  NE2 . HIS B  2  148 ? -12.982 -8.470  19.997   1.00 124.88 ? 258  HIS B NE2 1 
ATOM   5720  N  N   . PHE B  2  149 ? -14.202 -8.014  26.373   1.00 49.44  ? 259  PHE B N   1 
ATOM   5721  C  CA  . PHE B  2  149 ? -14.079 -7.463  27.711   1.00 127.73 ? 259  PHE B CA  1 
ATOM   5722  C  C   . PHE B  2  149 ? -12.636 -7.025  27.952   1.00 144.33 ? 259  PHE B C   1 
ATOM   5723  O  O   . PHE B  2  149 ? -11.871 -6.806  26.997   1.00 48.15  ? 259  PHE B O   1 
ATOM   5724  C  CB  . PHE B  2  149 ? -14.558 -8.490  28.753   1.00 46.02  ? 259  PHE B CB  1 
ATOM   5725  C  CG  . PHE B  2  149 ? -14.049 -9.896  28.512   1.00 71.43  ? 259  PHE B CG  1 
ATOM   5726  C  CD1 . PHE B  2  149 ? -14.726 -10.774 27.668   1.00 46.68  ? 259  PHE B CD1 1 
ATOM   5727  C  CD2 . PHE B  2  149 ? -12.916 -10.353 29.166   1.00 119.93 ? 259  PHE B CD2 1 
ATOM   5728  C  CE1 . PHE B  2  149 ? -14.254 -12.064 27.453   1.00 48.75  ? 259  PHE B CE1 1 
ATOM   5729  C  CE2 . PHE B  2  149 ? -12.451 -11.637 28.960   1.00 174.32 ? 259  PHE B CE2 1 
ATOM   5730  C  CZ  . PHE B  2  149 ? -13.119 -12.495 28.099   1.00 148.41 ? 259  PHE B CZ  1 
ATOM   5731  N  N   . GLY B  2  150 ? -12.278 -6.851  29.222   1.00 166.79 ? 260  GLY B N   1 
ATOM   5732  C  CA  . GLY B  2  150 ? -10.978 -6.365  29.623   1.00 46.70  ? 260  GLY B CA  1 
ATOM   5733  C  C   . GLY B  2  150 ? -9.835  -7.153  29.026   1.00 46.98  ? 260  GLY B C   1 
ATOM   5734  O  O   . GLY B  2  150 ? -9.978  -8.340  28.711   1.00 46.72  ? 260  GLY B O   1 
ATOM   5735  N  N   . MET B  2  151 ? -8.698  -6.481  28.842   1.00 51.05  ? 261  MET B N   1 
ATOM   5736  C  CA  . MET B  2  151 ? -7.400  -7.039  28.475   1.00 52.81  ? 261  MET B CA  1 
ATOM   5737  C  C   . MET B  2  151 ? -7.408  -7.630  27.083   1.00 117.05 ? 261  MET B C   1 
ATOM   5738  O  O   . MET B  2  151 ? -6.347  -8.044  26.582   1.00 143.57 ? 261  MET B O   1 
ATOM   5739  C  CB  . MET B  2  151 ? -6.918  -8.083  29.487   1.00 58.58  ? 261  MET B CB  1 
ATOM   5740  C  CG  . MET B  2  151 ? -6.549  -7.469  30.826   1.00 51.82  ? 261  MET B CG  1 
ATOM   5741  S  SD  . MET B  2  151 ? -6.653  -8.716  32.093   1.00 50.51  ? 261  MET B SD  1 
ATOM   5742  C  CE  . MET B  2  151 ? -5.443  -8.108  33.260   1.00 172.58 ? 261  MET B CE  1 
ATOM   5743  N  N   . ASP B  2  152 ? -8.564  -7.651  26.421   1.00 113.21 ? 262  ASP B N   1 
ATOM   5744  C  CA  . ASP B  2  152 ? -8.629  -8.058  25.031   1.00 55.59  ? 262  ASP B CA  1 
ATOM   5745  C  C   . ASP B  2  152 ? -8.017  -6.997  24.140   1.00 58.58  ? 262  ASP B C   1 
ATOM   5746  O  O   . ASP B  2  152 ? -7.557  -7.309  23.039   1.00 62.28  ? 262  ASP B O   1 
ATOM   5747  C  CB  . ASP B  2  152 ? -10.089 -8.295  24.618   1.00 55.35  ? 262  ASP B CB  1 
ATOM   5748  C  CG  . ASP B  2  152 ? -10.642 -9.627  25.086   1.00 54.30  ? 262  ASP B CG  1 
ATOM   5749  O  OD1 . ASP B  2  152 ? -9.879  -10.604 25.201   1.00 55.33  ? 262  ASP B OD1 1 
ATOM   5750  O  OD2 . ASP B  2  152 ? -11.865 -9.693  25.297   1.00 53.01  ? 262  ASP B OD2 1 
ATOM   5751  N  N   . SER B  2  153 ? -7.959  -5.763  24.627   1.00 62.56  ? 263  SER B N   1 
ATOM   5752  C  CA  . SER B  2  153 ? -7.373  -4.647  23.909   1.00 160.23 ? 263  SER B CA  1 
ATOM   5753  C  C   . SER B  2  153 ? -5.853  -4.646  23.982   1.00 220.89 ? 263  SER B C   1 
ATOM   5754  O  O   . SER B  2  153 ? -5.207  -3.870  23.259   1.00 71.97  ? 263  SER B O   1 
ATOM   5755  C  CB  . SER B  2  153 ? -7.956  -3.353  24.484   1.00 65.49  ? 263  SER B CB  1 
ATOM   5756  O  OG  . SER B  2  153 ? -7.804  -3.335  25.895   1.00 63.23  ? 263  SER B OG  1 
ATOM   5757  N  N   . LYS B  2  154 ? -5.275  -5.560  24.769   1.00 205.44 ? 264  LYS B N   1 
ATOM   5758  C  CA  . LYS B  2  154 ? -3.825  -5.654  24.879   1.00 166.73 ? 264  LYS B CA  1 
ATOM   5759  C  C   . LYS B  2  154 ? -3.189  -5.939  23.527   1.00 69.14  ? 264  LYS B C   1 
ATOM   5760  O  O   . LYS B  2  154 ? -2.068  -5.494  23.263   1.00 72.60  ? 264  LYS B O   1 
ATOM   5761  C  CB  . LYS B  2  154 ? -3.450  -6.743  25.884   1.00 112.78 ? 264  LYS B CB  1 
ATOM   5762  C  CG  . LYS B  2  154 ? -1.954  -6.922  26.101   1.00 120.58 ? 264  LYS B CG  1 
ATOM   5763  C  CD  . LYS B  2  154 ? -1.702  -7.929  27.213   1.00 97.49  ? 264  LYS B CD  1 
ATOM   5764  C  CE  . LYS B  2  154 ? -0.244  -8.351  27.292   1.00 67.61  ? 264  LYS B CE  1 
ATOM   5765  N  NZ  . LYS B  2  154 ? 0.623   -7.171  27.457   1.00 70.13  ? 264  LYS B NZ  1 
ATOM   5766  N  N   . LEU B  2  155 ? -3.888  -6.694  22.675   1.00 69.03  ? 265  LEU B N   1 
ATOM   5767  C  CA  . LEU B  2  155 ? -3.411  -6.953  21.324   1.00 113.45 ? 265  LEU B CA  1 
ATOM   5768  C  C   . LEU B  2  155 ? -3.336  -5.669  20.514   1.00 169.46 ? 265  LEU B C   1 
ATOM   5769  O  O   . LEU B  2  155 ? -2.432  -5.494  19.688   1.00 155.01 ? 265  LEU B O   1 
ATOM   5770  C  CB  . LEU B  2  155 ? -4.330  -7.954  20.638   1.00 108.73 ? 265  LEU B CB  1 
ATOM   5771  C  CG  . LEU B  2  155 ? -4.590  -9.208  21.457   1.00 102.11 ? 265  LEU B CG  1 
ATOM   5772  C  CD1 . LEU B  2  155 ? -5.589  -10.040 20.706   1.00 135.95 ? 265  LEU B CD1 1 
ATOM   5773  C  CD2 . LEU B  2  155 ? -3.305  -9.973  21.692   1.00 117.43 ? 265  LEU B CD2 1 
ATOM   5774  N  N   . ALA B  2  156 ? -4.284  -4.763  20.729   1.00 130.10 ? 266  ALA B N   1 
ATOM   5775  C  CA  . ALA B  2  156 ? -4.285  -3.503  20.006   1.00 137.44 ? 266  ALA B CA  1 
ATOM   5776  C  C   . ALA B  2  156 ? -3.244  -2.532  20.532   1.00 111.78 ? 266  ALA B C   1 
ATOM   5777  O  O   . ALA B  2  156 ? -2.947  -1.540  19.857   1.00 85.24  ? 266  ALA B O   1 
ATOM   5778  C  CB  . ALA B  2  156 ? -5.668  -2.861  20.087   1.00 118.04 ? 266  ALA B CB  1 
ATOM   5779  N  N   . GLY B  2  157 ? -2.689  -2.804  21.705   1.00 130.38 ? 267  GLY B N   1 
ATOM   5780  C  CA  . GLY B  2  157 ? -1.757  -1.923  22.353   1.00 132.29 ? 267  GLY B CA  1 
ATOM   5781  C  C   . GLY B  2  157 ? -2.377  -1.004  23.370   1.00 78.57  ? 267  GLY B C   1 
ATOM   5782  O  O   . GLY B  2  157 ? -1.777  0.029   23.697   1.00 82.33  ? 267  GLY B O   1 
ATOM   5783  N  N   . ILE B  2  158 ? -3.530  -1.373  23.923   1.00 95.33  ? 268  ILE B N   1 
ATOM   5784  C  CA  . ILE B  2  158 ? -4.238  -0.570  24.915   1.00 103.23 ? 268  ILE B CA  1 
ATOM   5785  C  C   . ILE B  2  158 ? -4.136  -1.322  26.231   1.00 69.15  ? 268  ILE B C   1 
ATOM   5786  O  O   . ILE B  2  158 ? -4.672  -2.428  26.376   1.00 65.05  ? 268  ILE B O   1 
ATOM   5787  C  CB  . ILE B  2  158 ? -5.697  -0.318  24.526   1.00 92.78  ? 268  ILE B CB  1 
ATOM   5788  C  CG1 . ILE B  2  158 ? -5.794  0.085   23.044   1.00 97.98  ? 268  ILE B CG1 1 
ATOM   5789  C  CG2 . ILE B  2  158 ? -6.264  0.774   25.422   1.00 72.43  ? 268  ILE B CG2 1 
ATOM   5790  C  CD1 . ILE B  2  158 ? -7.215  0.206   22.522   1.00 73.82  ? 268  ILE B CD1 1 
ATOM   5791  N  N   . VAL B  2  159 ? -3.421  -0.730  27.183   1.00 71.48  ? 269  VAL B N   1 
ATOM   5792  C  CA  . VAL B  2  159 ? -3.135  -1.351  28.467   1.00 159.55 ? 269  VAL B CA  1 
ATOM   5793  C  C   . VAL B  2  159 ? -3.624  -0.514  29.641   1.00 165.55 ? 269  VAL B C   1 
ATOM   5794  O  O   . VAL B  2  159 ? -3.508  -0.952  30.791   1.00 69.10  ? 269  VAL B O   1 
ATOM   5795  C  CB  . VAL B  2  159 ? -1.621  -1.627  28.605   1.00 106.10 ? 269  VAL B CB  1 
ATOM   5796  C  CG1 . VAL B  2  159 ? -1.173  -2.748  27.661   1.00 70.93  ? 269  VAL B CG1 1 
ATOM   5797  C  CG2 . VAL B  2  159 ? -0.850  -0.370  28.283   1.00 78.02  ? 269  VAL B CG2 1 
ATOM   5798  N  N   . CYS B  2  160 ? -4.236  0.643   29.381   1.00 160.66 ? 270  CYS B N   1 
ATOM   5799  C  CA  . CYS B  2  160 ? -4.798  1.480   30.434   1.00 75.41  ? 270  CYS B CA  1 
ATOM   5800  C  C   . CYS B  2  160 ? -6.204  0.987   30.718   1.00 71.65  ? 270  CYS B C   1 
ATOM   5801  O  O   . CYS B  2  160 ? -7.019  0.931   29.787   1.00 70.33  ? 270  CYS B O   1 
ATOM   5802  C  CB  . CYS B  2  160 ? -4.832  2.948   30.024   1.00 146.09 ? 270  CYS B CB  1 
ATOM   5803  S  SG  . CYS B  2  160 ? -3.246  3.792   29.600   1.00 238.57 ? 270  CYS B SG  1 
ATOM   5804  N  N   . PRO B  2  161 ? -6.505  0.553   31.952   1.00 148.69 ? 271  PRO B N   1 
ATOM   5805  C  CA  . PRO B  2  161 ? -7.821  -0.036  32.265   1.00 80.43  ? 271  PRO B CA  1 
ATOM   5806  C  C   . PRO B  2  161 ? -8.982  0.937   32.116   1.00 69.88  ? 271  PRO B C   1 
ATOM   5807  O  O   . PRO B  2  161 ? -8.828  2.155   32.100   1.00 74.42  ? 271  PRO B O   1 
ATOM   5808  C  CB  . PRO B  2  161 ? -7.673  -0.468  33.727   1.00 66.58  ? 271  PRO B CB  1 
ATOM   5809  C  CG  . PRO B  2  161 ? -6.190  -0.564  33.967   1.00 67.53  ? 271  PRO B CG  1 
ATOM   5810  C  CD  . PRO B  2  161 ? -5.592  0.510   33.109   1.00 103.55 ? 271  PRO B CD  1 
ATOM   5811  N  N   . ASN B  2  162 ? -10.177 0.389   32.054   1.00 67.67  ? 272  ASN B N   1 
ATOM   5812  C  CA  . ASN B  2  162 ? -11.337 1.261   31.957   1.00 128.10 ? 272  ASN B CA  1 
ATOM   5813  C  C   . ASN B  2  162 ? -11.689 1.817   33.336   1.00 159.43 ? 272  ASN B C   1 
ATOM   5814  O  O   . ASN B  2  162 ? -11.954 1.047   34.265   1.00 160.80 ? 272  ASN B O   1 
ATOM   5815  C  CB  . ASN B  2  162 ? -12.546 0.531   31.399   1.00 68.41  ? 272  ASN B CB  1 
ATOM   5816  C  CG  . ASN B  2  162 ? -13.616 1.494   30.991   1.00 72.18  ? 272  ASN B CG  1 
ATOM   5817  O  OD1 . ASN B  2  162 ? -14.348 2.003   31.831   1.00 75.35  ? 272  ASN B OD1 1 
ATOM   5818  N  ND2 . ASN B  2  162 ? -13.739 1.731   29.695   1.00 72.13  ? 272  ASN B ND2 1 
ATOM   5819  N  N   . ASP B  2  163 ? -11.703 3.146   33.476   1.00 169.51 ? 273  ASP B N   1 
ATOM   5820  C  CA  . ASP B  2  163 ? -12.064 3.734   34.761   1.00 130.54 ? 273  ASP B CA  1 
ATOM   5821  C  C   . ASP B  2  163 ? -13.561 3.672   35.038   1.00 112.38 ? 273  ASP B C   1 
ATOM   5822  O  O   . ASP B  2  163 ? -13.977 3.882   36.184   1.00 105.12 ? 273  ASP B O   1 
ATOM   5823  C  CB  . ASP B  2  163 ? -11.596 5.193   34.854   1.00 88.94  ? 273  ASP B CB  1 
ATOM   5824  C  CG  . ASP B  2  163 ? -12.012 6.019   33.657   1.00 93.60  ? 273  ASP B CG  1 
ATOM   5825  O  OD1 . ASP B  2  163 ? -12.772 5.504   32.816   1.00 88.76  ? 273  ASP B OD1 1 
ATOM   5826  O  OD2 . ASP B  2  163 ? -11.602 7.194   33.570   1.00 132.20 ? 273  ASP B OD2 1 
ATOM   5827  N  N   . GLY B  2  164 ? -14.380 3.382   34.036   1.00 82.31  ? 274  GLY B N   1 
ATOM   5828  C  CA  . GLY B  2  164 ? -15.795 3.364   34.292   1.00 112.30 ? 274  GLY B CA  1 
ATOM   5829  C  C   . GLY B  2  164 ? -16.317 4.748   34.590   1.00 124.68 ? 274  GLY B C   1 
ATOM   5830  O  O   . GLY B  2  164 ? -16.965 4.975   35.615   1.00 167.76 ? 274  GLY B O   1 
ATOM   5831  N  N   . LEU B  2  165 ? -16.000 5.693   33.719   1.00 95.11  ? 275  LEU B N   1 
ATOM   5832  C  CA  . LEU B  2  165 ? -16.442 7.063   33.874   1.00 100.80 ? 275  LEU B CA  1 
ATOM   5833  C  C   . LEU B  2  165 ? -17.097 7.515   32.577   1.00 107.39 ? 275  LEU B C   1 
ATOM   5834  O  O   . LEU B  2  165 ? -17.163 6.771   31.594   1.00 114.95 ? 275  LEU B O   1 
ATOM   5835  C  CB  . LEU B  2  165 ? -15.275 7.975   34.268   1.00 103.35 ? 275  LEU B CB  1 
ATOM   5836  C  CG  . LEU B  2  165 ? -14.657 7.658   35.629   1.00 102.96 ? 275  LEU B CG  1 
ATOM   5837  C  CD1 . LEU B  2  165 ? -13.476 8.572   35.924   1.00 106.04 ? 275  LEU B CD1 1 
ATOM   5838  C  CD2 . LEU B  2  165 ? -15.721 7.764   36.716   1.00 135.41 ? 275  LEU B CD2 1 
ATOM   5839  N  N   . CYS B  2  166 ? -17.608 8.742   32.585   1.00 130.20 ? 276  CYS B N   1 
ATOM   5840  C  CA  . CYS B  2  166 ? -18.284 9.293   31.417   1.00 148.46 ? 276  CYS B CA  1 
ATOM   5841  C  C   . CYS B  2  166 ? -17.242 9.885   30.474   1.00 129.80 ? 276  CYS B C   1 
ATOM   5842  O  O   . CYS B  2  166 ? -16.641 10.923  30.773   1.00 122.91 ? 276  CYS B O   1 
ATOM   5843  C  CB  . CYS B  2  166 ? -19.306 10.343  31.837   1.00 155.51 ? 276  CYS B CB  1 
ATOM   5844  S  SG  . CYS B  2  166 ? -20.439 10.814  30.513   1.00 192.32 ? 276  CYS B SG  1 
ATOM   5845  N  N   . HIS B  2  167 ? -17.035 9.235   29.327   1.00 105.70 ? 277  HIS B N   1 
ATOM   5846  C  CA  . HIS B  2  167 ? -16.057 9.706   28.353   1.00 123.42 ? 277  HIS B CA  1 
ATOM   5847  C  C   . HIS B  2  167 ? -16.713 9.963   27.003   1.00 120.14 ? 277  HIS B C   1 
ATOM   5848  O  O   . HIS B  2  167 ? -16.326 9.362   25.995   1.00 124.85 ? 277  HIS B O   1 
ATOM   5849  C  CB  . HIS B  2  167 ? -14.915 8.695   28.199   1.00 130.64 ? 277  HIS B CB  1 
ATOM   5850  C  CG  . HIS B  2  167 ? -14.050 8.564   29.415   1.00 142.75 ? 277  HIS B CG  1 
ATOM   5851  N  ND1 . HIS B  2  167 ? -13.242 9.586   29.870   1.00 136.49 ? 277  HIS B ND1 1 
ATOM   5852  C  CD2 . HIS B  2  167 ? -13.866 7.531   30.271   1.00 126.78 ? 277  HIS B CD2 1 
ATOM   5853  C  CE1 . HIS B  2  167 ? -12.598 9.187   30.952   1.00 127.65 ? 277  HIS B CE1 1 
ATOM   5854  N  NE2 . HIS B  2  167 ? -12.960 7.945   31.218   1.00 165.96 ? 277  HIS B NE2 1 
ATOM   5855  N  N   . LEU B  2  168 ? -17.698 10.857  26.970   1.00 119.10 ? 278  LEU B N   1 
ATOM   5856  C  CA  . LEU B  2  168 ? -18.378 11.234  25.739   1.00 125.24 ? 278  LEU B CA  1 
ATOM   5857  C  C   . LEU B  2  168 ? -17.982 12.658  25.379   1.00 164.18 ? 278  LEU B C   1 
ATOM   5858  O  O   . LEU B  2  168 ? -18.183 13.582  26.174   1.00 191.07 ? 278  LEU B O   1 
ATOM   5859  C  CB  . LEU B  2  168 ? -19.893 11.107  25.883   1.00 128.48 ? 278  LEU B CB  1 
ATOM   5860  C  CG  . LEU B  2  168 ? -20.412 9.697   26.185   1.00 136.21 ? 278  LEU B CG  1 
ATOM   5861  C  CD1 . LEU B  2  168 ? -21.922 9.713   26.370   1.00 144.36 ? 278  LEU B CD1 1 
ATOM   5862  C  CD2 . LEU B  2  168 ? -20.009 8.707   25.097   1.00 119.24 ? 278  LEU B CD2 1 
ATOM   5863  N  N   . ASP B  2  169 ? -17.403 12.824  24.189   1.00 134.79 ? 279  ASP B N   1 
ATOM   5864  C  CA  . ASP B  2  169 ? -16.921 14.121  23.729   1.00 142.01 ? 279  ASP B CA  1 
ATOM   5865  C  C   . ASP B  2  169 ? -18.056 15.010  23.235   1.00 150.93 ? 279  ASP B C   1 
ATOM   5866  O  O   . ASP B  2  169 ? -19.234 14.723  23.473   1.00 151.66 ? 279  ASP B O   1 
ATOM   5867  C  CB  . ASP B  2  169 ? -15.879 13.936  22.618   1.00 189.42 ? 279  ASP B CB  1 
ATOM   5868  C  CG  . ASP B  2  169 ? -16.338 12.977  21.520   1.00 176.38 ? 279  ASP B CG  1 
ATOM   5869  O  OD1 . ASP B  2  169 ? -17.554 12.721  21.403   1.00 142.34 ? 279  ASP B OD1 1 
ATOM   5870  O  OD2 . ASP B  2  169 ? -15.473 12.471  20.773   1.00 186.92 ? 279  ASP B OD2 1 
ATOM   5871  N  N   . SER B  2  170 ? -17.708 16.083  22.521   1.00 158.39 ? 280  SER B N   1 
ATOM   5872  C  CA  . SER B  2  170 ? -18.723 16.978  21.985   1.00 167.80 ? 280  SER B CA  1 
ATOM   5873  C  C   . SER B  2  170 ? -19.543 16.311  20.893   1.00 188.66 ? 280  SER B C   1 
ATOM   5874  O  O   . SER B  2  170 ? -20.655 16.762  20.603   1.00 211.64 ? 280  SER B O   1 
ATOM   5875  C  CB  . SER B  2  170 ? -18.065 18.249  21.451   1.00 175.73 ? 280  SER B CB  1 
ATOM   5876  O  OG  . SER B  2  170 ? -17.064 17.923  20.505   1.00 174.53 ? 280  SER B OG  1 
ATOM   5877  N  N   . LYS B  2  171 ? -19.027 15.244  20.292   1.00 189.84 ? 281  LYS B N   1 
ATOM   5878  C  CA  . LYS B  2  171 ? -19.765 14.488  19.293   1.00 165.71 ? 281  LYS B CA  1 
ATOM   5879  C  C   . LYS B  2  171 ? -20.651 13.420  19.918   1.00 160.32 ? 281  LYS B C   1 
ATOM   5880  O  O   . LYS B  2  171 ? -21.289 12.656  19.183   1.00 161.08 ? 281  LYS B O   1 
ATOM   5881  C  CB  . LYS B  2  171 ? -18.786 13.844  18.298   1.00 170.09 ? 281  LYS B CB  1 
ATOM   5882  C  CG  . LYS B  2  171 ? -17.967 14.848  17.480   1.00 184.94 ? 281  LYS B CG  1 
ATOM   5883  C  CD  . LYS B  2  171 ? -16.989 14.169  16.524   1.00 173.55 ? 281  LYS B CD  1 
ATOM   5884  C  CE  . LYS B  2  171 ? -16.192 15.199  15.726   1.00 189.62 ? 281  LYS B CE  1 
ATOM   5885  N  NZ  . LYS B  2  171 ? -15.214 14.572  14.791   1.00 185.15 ? 281  LYS B NZ  1 
ATOM   5886  N  N   . ASN B  2  172 ? -20.720 13.372  21.250   1.00 155.04 ? 282  ASN B N   1 
ATOM   5887  C  CA  . ASN B  2  172 ? -21.464 12.344  21.980   1.00 149.82 ? 282  ASN B CA  1 
ATOM   5888  C  C   . ASN B  2  172 ? -20.975 10.941  21.625   1.00 142.10 ? 282  ASN B C   1 
ATOM   5889  O  O   . ASN B  2  172 ? -21.759 9.997   21.541   1.00 140.42 ? 282  ASN B O   1 
ATOM   5890  C  CB  . ASN B  2  172 ? -22.971 12.469  21.749   1.00 156.58 ? 282  ASN B CB  1 
ATOM   5891  C  CG  . ASN B  2  172 ? -23.605 13.545  22.606   1.00 191.44 ? 282  ASN B CG  1 
ATOM   5892  O  OD1 . ASN B  2  172 ? -23.203 13.758  23.749   1.00 185.99 ? 282  ASN B OD1 1 
ATOM   5893  N  ND2 . ASN B  2  172 ? -24.614 14.219  22.064   1.00 216.37 ? 282  ASN B ND2 1 
ATOM   5894  N  N   . GLU B  2  173 ? -19.670 10.806  21.410   1.00 147.56 ? 283  GLU B N   1 
ATOM   5895  C  CA  . GLU B  2  173 ? -19.036 9.538   21.082   1.00 140.53 ? 283  GLU B CA  1 
ATOM   5896  C  C   . GLU B  2  173 ? -18.099 9.121   22.209   1.00 139.57 ? 283  GLU B C   1 
ATOM   5897  O  O   . GLU B  2  173 ? -17.719 9.928   23.058   1.00 151.51 ? 283  GLU B O   1 
ATOM   5898  C  CB  . GLU B  2  173 ? -18.247 9.641   19.769   1.00 133.41 ? 283  GLU B CB  1 
ATOM   5899  C  CG  . GLU B  2  173 ? -19.037 10.249  18.617   1.00 171.58 ? 283  GLU B CG  1 
ATOM   5900  C  CD  . GLU B  2  173 ? -18.221 10.385  17.341   1.00 184.87 ? 283  GLU B CD  1 
ATOM   5901  O  OE1 . GLU B  2  173 ? -17.175 9.711   17.229   1.00 183.59 ? 283  GLU B OE1 1 
ATOM   5902  O  OE2 . GLU B  2  173 ? -18.627 11.164  16.448   1.00 185.23 ? 283  GLU B OE2 1 
ATOM   5903  N  N   . TYR B  2  174 ? -17.735 7.840   22.216   1.00 121.60 ? 284  TYR B N   1 
ATOM   5904  C  CA  . TYR B  2  174 ? -16.730 7.357   23.155   1.00 109.21 ? 284  TYR B CA  1 
ATOM   5905  C  C   . TYR B  2  174 ? -15.351 7.854   22.738   1.00 113.38 ? 284  TYR B C   1 
ATOM   5906  O  O   . TYR B  2  174 ? -14.696 7.228   21.900   1.00 107.99 ? 284  TYR B O   1 
ATOM   5907  C  CB  . TYR B  2  174 ? -16.740 5.836   23.217   1.00 115.43 ? 284  TYR B CB  1 
ATOM   5908  C  CG  . TYR B  2  174 ? -15.981 5.254   24.379   1.00 95.66  ? 284  TYR B CG  1 
ATOM   5909  C  CD1 . TYR B  2  174 ? -15.401 6.069   25.342   1.00 95.73  ? 284  TYR B CD1 1 
ATOM   5910  C  CD2 . TYR B  2  174 ? -15.817 3.883   24.494   1.00 89.65  ? 284  TYR B CD2 1 
ATOM   5911  C  CE1 . TYR B  2  174 ? -14.702 5.529   26.394   1.00 90.08  ? 284  TYR B CE1 1 
ATOM   5912  C  CE2 . TYR B  2  174 ? -15.123 3.338   25.539   1.00 83.97  ? 284  TYR B CE2 1 
ATOM   5913  C  CZ  . TYR B  2  174 ? -14.566 4.160   26.484   1.00 84.22  ? 284  TYR B CZ  1 
ATOM   5914  O  OH  . TYR B  2  174 ? -13.872 3.592   27.520   1.00 79.08  ? 284  TYR B OH  1 
ATOM   5915  N  N   . SER B  2  175 ? -14.905 8.980   23.307   1.00 144.76 ? 285  SER B N   1 
ATOM   5916  C  CA  . SER B  2  175 ? -13.623 9.560   22.912   1.00 131.38 ? 285  SER B CA  1 
ATOM   5917  C  C   . SER B  2  175 ? -12.441 8.748   23.425   1.00 137.02 ? 285  SER B C   1 
ATOM   5918  O  O   . SER B  2  175 ? -11.393 8.699   22.766   1.00 108.39 ? 285  SER B O   1 
ATOM   5919  C  CB  . SER B  2  175 ? -13.522 11.000  23.412   1.00 151.40 ? 285  SER B CB  1 
ATOM   5920  O  OG  . SER B  2  175 ? -13.579 11.045  24.827   1.00 117.16 ? 285  SER B OG  1 
ATOM   5921  N  N   . MET B  2  176 ? -12.579 8.120   24.588   1.00 108.35 ? 286  MET B N   1 
ATOM   5922  C  CA  . MET B  2  176 ? -11.502 7.326   25.186   1.00 96.24  ? 286  MET B CA  1 
ATOM   5923  C  C   . MET B  2  176 ? -11.668 5.843   24.876   1.00 90.55  ? 286  MET B C   1 
ATOM   5924  O  O   . MET B  2  176 ? -11.421 4.988   25.723   1.00 103.84 ? 286  MET B O   1 
ATOM   5925  C  CB  . MET B  2  176 ? -11.456 7.567   26.690   1.00 94.22  ? 286  MET B CB  1 
ATOM   5926  C  CG  . MET B  2  176 ? -11.412 9.028   27.085   1.00 100.24 ? 286  MET B CG  1 
ATOM   5927  S  SD  . MET B  2  176 ? -9.879  9.843   26.606   1.00 265.47 ? 286  MET B SD  1 
ATOM   5928  C  CE  . MET B  2  176 ? -8.738  9.109   27.770   1.00 186.01 ? 286  MET B CE  1 
ATOM   5929  N  N   . SER B  2  177 ? -12.008 5.518   23.628   1.00 92.37  ? 287  SER B N   1 
ATOM   5930  C  CA  . SER B  2  177 ? -12.198 4.136   23.204   1.00 87.92  ? 287  SER B CA  1 
ATOM   5931  C  C   . SER B  2  177 ? -10.889 3.476   22.820   1.00 85.02  ? 287  SER B C   1 
ATOM   5932  O  O   . SER B  2  177 ? -10.659 2.311   23.150   1.00 139.69 ? 287  SER B O   1 
ATOM   5933  C  CB  . SER B  2  177 ? -13.154 4.076   22.010   1.00 91.92  ? 287  SER B CB  1 
ATOM   5934  O  OG  . SER B  2  177 ? -13.373 2.736   21.597   1.00 151.15 ? 287  SER B OG  1 
ATOM   5935  N  N   . THR B  2  178 ? -10.022 4.217   22.142   1.00 108.40 ? 288  THR B N   1 
ATOM   5936  C  CA  . THR B  2  178 ? -8.690  3.773   21.768   1.00 87.87  ? 288  THR B CA  1 
ATOM   5937  C  C   . THR B  2  178 ? -7.686  4.063   22.866   1.00 87.18  ? 288  THR B C   1 
ATOM   5938  O  O   . THR B  2  178 ? -6.483  3.862   22.665   1.00 86.84  ? 288  THR B O   1 
ATOM   5939  C  CB  . THR B  2  178 ? -8.253  4.457   20.472   1.00 107.67 ? 288  THR B CB  1 
ATOM   5940  O  OG1 . THR B  2  178 ? -8.013  5.846   20.727   1.00 133.38 ? 288  THR B OG1 1 
ATOM   5941  C  CG2 . THR B  2  178 ? -9.334  4.325   19.407   1.00 134.10 ? 288  THR B CG2 1 
ATOM   5942  N  N   . VAL B  2  179 ? -8.165  4.571   24.002   1.00 98.01  ? 289  VAL B N   1 
ATOM   5943  C  CA  . VAL B  2  179 ? -7.321  4.920   25.126   1.00 86.75  ? 289  VAL B CA  1 
ATOM   5944  C  C   . VAL B  2  179 ? -7.515  3.983   26.307   1.00 81.91  ? 289  VAL B C   1 
ATOM   5945  O  O   . VAL B  2  179 ? -6.562  3.752   27.060   1.00 81.98  ? 289  VAL B O   1 
ATOM   5946  C  CB  . VAL B  2  179 ? -7.575  6.379   25.552   1.00 92.33  ? 289  VAL B CB  1 
ATOM   5947  C  CG1 . VAL B  2  179 ? -6.433  6.878   26.437   1.00 134.82 ? 289  VAL B CG1 1 
ATOM   5948  C  CG2 . VAL B  2  179 ? -7.769  7.265   24.326   1.00 96.97  ? 289  VAL B CG2 1 
ATOM   5949  N  N   . LEU B  2  180 ? -8.716  3.457   26.503   1.00 78.39  ? 290  LEU B N   1 
ATOM   5950  C  CA  . LEU B  2  180 ? -9.016  2.621   27.650   1.00 76.69  ? 290  LEU B CA  1 
ATOM   5951  C  C   . LEU B  2  180 ? -9.323  1.196   27.222   1.00 76.01  ? 290  LEU B C   1 
ATOM   5952  O  O   . LEU B  2  180 ? -9.867  0.951   26.140   1.00 92.68  ? 290  LEU B O   1 
ATOM   5953  C  CB  . LEU B  2  180 ? -10.202 3.173   28.444   1.00 76.18  ? 290  LEU B CB  1 
ATOM   5954  C  CG  . LEU B  2  180 ? -10.123 4.639   28.843   1.00 82.09  ? 290  LEU B CG  1 
ATOM   5955  C  CD1 . LEU B  2  180 ? -11.359 5.036   29.612   1.00 83.62  ? 290  LEU B CD1 1 
ATOM   5956  C  CD2 . LEU B  2  180 ? -8.879  4.885   29.668   1.00 109.77 ? 290  LEU B CD2 1 
ATOM   5957  N  N   . GLU B  2  181 ? -8.998  0.258   28.105   1.00 78.56  ? 291  GLU B N   1 
ATOM   5958  C  CA  . GLU B  2  181 ? -9.345  -1.125  27.857   1.00 90.62  ? 291  GLU B CA  1 
ATOM   5959  C  C   . GLU B  2  181 ? -10.863 -1.296  27.897   1.00 78.07  ? 291  GLU B C   1 
ATOM   5960  O  O   . GLU B  2  181 ? -11.616 -0.434  28.366   1.00 62.93  ? 291  GLU B O   1 
ATOM   5961  C  CB  . GLU B  2  181 ? -8.699  -2.046  28.894   1.00 58.73  ? 291  GLU B CB  1 
ATOM   5962  C  CG  . GLU B  2  181 ? -7.179  -2.100  28.923   1.00 119.54 ? 291  GLU B CG  1 
ATOM   5963  C  CD  . GLU B  2  181 ? -6.678  -3.006  30.037   1.00 89.70  ? 291  GLU B CD  1 
ATOM   5964  O  OE1 . GLU B  2  181 ? -7.520  -3.437  30.847   1.00 55.87  ? 291  GLU B OE1 1 
ATOM   5965  O  OE2 . GLU B  2  181 ? -5.456  -3.274  30.120   1.00 58.97  ? 291  GLU B OE2 1 
ATOM   5966  N  N   . TYR B  2  182 ? -11.309 -2.436  27.402   1.00 74.03  ? 292  TYR B N   1 
ATOM   5967  C  CA  . TYR B  2  182 ? -12.685 -2.813  27.614   1.00 102.68 ? 292  TYR B CA  1 
ATOM   5968  C  C   . TYR B  2  182 ? -12.925 -3.082  29.101   1.00 129.97 ? 292  TYR B C   1 
ATOM   5969  O  O   . TYR B  2  182 ? -11.991 -3.439  29.836   1.00 54.13  ? 292  TYR B O   1 
ATOM   5970  C  CB  . TYR B  2  182 ? -13.033 -4.057  26.827   1.00 55.10  ? 292  TYR B CB  1 
ATOM   5971  C  CG  . TYR B  2  182 ? -12.822 -4.027  25.351   1.00 63.42  ? 292  TYR B CG  1 
ATOM   5972  C  CD1 . TYR B  2  182 ? -11.672 -4.557  24.778   1.00 55.69  ? 292  TYR B CD1 1 
ATOM   5973  C  CD2 . TYR B  2  182 ? -13.813 -3.545  24.520   1.00 136.12 ? 292  TYR B CD2 1 
ATOM   5974  C  CE1 . TYR B  2  182 ? -11.505 -4.566  23.408   1.00 58.74  ? 292  TYR B CE1 1 
ATOM   5975  C  CE2 . TYR B  2  182 ? -13.659 -3.547  23.165   1.00 161.46 ? 292  TYR B CE2 1 
ATOM   5976  C  CZ  . TYR B  2  182 ? -12.509 -4.052  22.608   1.00 118.20 ? 292  TYR B CZ  1 
ATOM   5977  O  OH  . TYR B  2  182 ? -12.399 -4.029  21.241   1.00 66.68  ? 292  TYR B OH  1 
ATOM   5978  N  N   . PRO B  2  183 ? -14.155 -2.865  29.577   1.00 174.45 ? 293  PRO B N   1 
ATOM   5979  C  CA  . PRO B  2  183 ? -14.488 -3.201  30.963   1.00 94.53  ? 293  PRO B CA  1 
ATOM   5980  C  C   . PRO B  2  183 ? -14.729 -4.688  31.148   1.00 54.36  ? 293  PRO B C   1 
ATOM   5981  O  O   . PRO B  2  183 ? -15.125 -5.405  30.227   1.00 52.16  ? 293  PRO B O   1 
ATOM   5982  C  CB  . PRO B  2  183 ? -15.767 -2.399  31.217   1.00 62.80  ? 293  PRO B CB  1 
ATOM   5983  C  CG  . PRO B  2  183 ? -16.381 -2.297  29.912   1.00 62.98  ? 293  PRO B CG  1 
ATOM   5984  C  CD  . PRO B  2  183 ? -15.296 -2.220  28.900   1.00 60.86  ? 293  PRO B CD  1 
ATOM   5985  N  N   . THR B  2  184 ? -14.438 -5.151  32.360   1.00 61.80  ? 294  THR B N   1 
ATOM   5986  C  CA  . THR B  2  184 ? -14.650 -6.533  32.750   1.00 86.96  ? 294  THR B CA  1 
ATOM   5987  C  C   . THR B  2  184 ? -16.050 -6.679  33.331   1.00 79.48  ? 294  THR B C   1 
ATOM   5988  O  O   . THR B  2  184 ? -16.756 -5.697  33.560   1.00 154.93 ? 294  THR B O   1 
ATOM   5989  C  CB  . THR B  2  184 ? -13.602 -6.978  33.773   1.00 120.68 ? 294  THR B CB  1 
ATOM   5990  O  OG1 . THR B  2  184 ? -13.917 -6.395  35.038   1.00 52.78  ? 294  THR B OG1 1 
ATOM   5991  C  CG2 . THR B  2  184 ? -12.176 -6.512  33.358   1.00 48.49  ? 294  THR B CG2 1 
ATOM   5992  N  N   . ILE B  2  185 ? -16.464 -7.928  33.550   1.00 62.50  ? 295  ILE B N   1 
ATOM   5993  C  CA  . ILE B  2  185 ? -17.745 -8.184  34.211   1.00 56.21  ? 295  ILE B CA  1 
ATOM   5994  C  C   . ILE B  2  185 ? -17.735 -7.630  35.641   1.00 86.15  ? 295  ILE B C   1 
ATOM   5995  O  O   . ILE B  2  185 ? -18.768 -7.179  36.156   1.00 64.19  ? 295  ILE B O   1 
ATOM   5996  C  CB  . ILE B  2  185 ? -18.069 -9.688  34.154   1.00 122.13 ? 295  ILE B CB  1 
ATOM   5997  C  CG1 . ILE B  2  185 ? -18.236 -10.115 32.688   1.00 56.09  ? 295  ILE B CG1 1 
ATOM   5998  C  CG2 . ILE B  2  185 ? -19.330 -10.015 34.960   1.00 178.11 ? 295  ILE B CG2 1 
ATOM   5999  C  CD1 . ILE B  2  185 ? -18.737 -11.521 32.500   1.00 50.82  ? 295  ILE B CD1 1 
ATOM   6000  N  N   . GLY B  2  186 ? -16.578 -7.681  36.314   1.00 102.88 ? 296  GLY B N   1 
ATOM   6001  C  CA  . GLY B  2  186 ? -16.449 -7.035  37.613   1.00 59.95  ? 296  GLY B CA  1 
ATOM   6002  C  C   . GLY B  2  186 ? -16.633 -5.527  37.555   1.00 108.60 ? 296  GLY B C   1 
ATOM   6003  O  O   . GLY B  2  186 ? -17.333 -4.948  38.390   1.00 145.18 ? 296  GLY B O   1 
ATOM   6004  N  N   . GLN B  2  187 ? -16.002 -4.866  36.570   1.00 62.83  ? 297  GLN B N   1 
ATOM   6005  C  CA  . GLN B  2  187 ? -16.148 -3.417  36.423   1.00 80.86  ? 297  GLN B CA  1 
ATOM   6006  C  C   . GLN B  2  187 ? -17.587 -3.049  36.079   1.00 85.16  ? 297  GLN B C   1 
ATOM   6007  O  O   . GLN B  2  187 ? -18.146 -2.096  36.634   1.00 129.30 ? 297  GLN B O   1 
ATOM   6008  C  CB  . GLN B  2  187 ? -15.199 -2.880  35.337   1.00 113.81 ? 297  GLN B CB  1 
ATOM   6009  C  CG  . GLN B  2  187 ? -13.683 -3.077  35.568   1.00 136.96 ? 297  GLN B CG  1 
ATOM   6010  C  CD  . GLN B  2  187 ? -12.793 -2.411  34.492   1.00 62.04  ? 297  GLN B CD  1 
ATOM   6011  O  OE1 . GLN B  2  187 ? -13.094 -1.330  33.983   1.00 65.18  ? 297  GLN B OE1 1 
ATOM   6012  N  NE2 . GLN B  2  187 ? -11.715 -3.093  34.124   1.00 104.38 ? 297  GLN B NE2 1 
ATOM   6013  N  N   . LEU B  2  188 ? -18.193 -3.798  35.158   1.00 69.08  ? 298  LEU B N   1 
ATOM   6014  C  CA  . LEU B  2  188 ? -19.579 -3.575  34.770   1.00 73.13  ? 298  LEU B CA  1 
ATOM   6015  C  C   . LEU B  2  188 ? -20.519 -3.801  35.947   1.00 77.16  ? 298  LEU B C   1 
ATOM   6016  O  O   . LEU B  2  188 ? -21.456 -3.022  36.161   1.00 145.76 ? 298  LEU B O   1 
ATOM   6017  C  CB  . LEU B  2  188 ? -19.919 -4.499  33.600   1.00 70.52  ? 298  LEU B CB  1 
ATOM   6018  C  CG  . LEU B  2  188 ? -19.307 -4.137  32.247   1.00 67.87  ? 298  LEU B CG  1 
ATOM   6019  C  CD1 . LEU B  2  188 ? -19.476 -5.253  31.259   1.00 64.68  ? 298  LEU B CD1 1 
ATOM   6020  C  CD2 . LEU B  2  188 ? -19.918 -2.862  31.686   1.00 72.23  ? 298  LEU B CD2 1 
ATOM   6021  N  N   . ILE B  2  189 ? -20.285 -4.862  36.725   1.00 75.03  ? 299  ILE B N   1 
ATOM   6022  C  CA  . ILE B  2  189 ? -21.114 -5.109  37.900   1.00 103.24 ? 299  ILE B CA  1 
ATOM   6023  C  C   . ILE B  2  189 ? -20.964 -3.978  38.906   1.00 85.92  ? 299  ILE B C   1 
ATOM   6024  O  O   . ILE B  2  189 ? -21.931 -3.601  39.580   1.00 110.04 ? 299  ILE B O   1 
ATOM   6025  C  CB  . ILE B  2  189 ? -20.770 -6.478  38.518   1.00 150.43 ? 299  ILE B CB  1 
ATOM   6026  C  CG1 . ILE B  2  189 ? -21.276 -7.611  37.622   1.00 127.02 ? 299  ILE B CG1 1 
ATOM   6027  C  CG2 . ILE B  2  189 ? -21.360 -6.613  39.915   1.00 181.26 ? 299  ILE B CG2 1 
ATOM   6028  C  CD1 . ILE B  2  189 ? -20.915 -8.986  38.127   1.00 70.97  ? 299  ILE B CD1 1 
ATOM   6029  N  N   . ASP B  2  190 ? -19.768 -3.399  39.008   1.00 103.91 ? 300  ASP B N   1 
ATOM   6030  C  CA  . ASP B  2  190 ? -19.541 -2.334  39.977   1.00 129.07 ? 300  ASP B CA  1 
ATOM   6031  C  C   . ASP B  2  190 ? -20.164 -1.007  39.563   1.00 147.18 ? 300  ASP B C   1 
ATOM   6032  O  O   . ASP B  2  190 ? -20.357 -0.140  40.420   1.00 154.66 ? 300  ASP B O   1 
ATOM   6033  C  CB  . ASP B  2  190 ? -18.041 -2.139  40.201   1.00 81.06  ? 300  ASP B CB  1 
ATOM   6034  C  CG  . ASP B  2  190 ? -17.743 -1.175  41.327   1.00 157.27 ? 300  ASP B CG  1 
ATOM   6035  O  OD1 . ASP B  2  190 ? -18.467 -1.196  42.346   1.00 188.00 ? 300  ASP B OD1 1 
ATOM   6036  O  OD2 . ASP B  2  190 ? -16.811 -0.364  41.166   1.00 84.56  ? 300  ASP B OD2 1 
ATOM   6037  N  N   . LYS B  2  191 ? -20.511 -0.829  38.289   1.00 153.17 ? 301  LYS B N   1 
ATOM   6038  C  CA  . LYS B  2  191 ? -21.067 0.430   37.815   1.00 123.77 ? 301  LYS B CA  1 
ATOM   6039  C  C   . LYS B  2  191 ? -22.527 0.326   37.417   1.00 101.41 ? 301  LYS B C   1 
ATOM   6040  O  O   . LYS B  2  191 ? -23.188 1.361   37.276   1.00 102.51 ? 301  LYS B O   1 
ATOM   6041  C  CB  . LYS B  2  191 ? -20.263 0.959   36.618   1.00 121.32 ? 301  LYS B CB  1 
ATOM   6042  C  CG  . LYS B  2  191 ? -18.923 1.603   36.973   1.00 90.01  ? 301  LYS B CG  1 
ATOM   6043  C  CD  . LYS B  2  191 ? -19.076 2.846   37.843   1.00 95.58  ? 301  LYS B CD  1 
ATOM   6044  C  CE  . LYS B  2  191 ? -17.712 3.342   38.296   1.00 94.40  ? 301  LYS B CE  1 
ATOM   6045  N  NZ  . LYS B  2  191 ? -17.798 4.575   39.116   1.00 99.65  ? 301  LYS B NZ  1 
ATOM   6046  N  N   . LEU B  2  192 ? -23.048 -0.886  37.253   1.00 101.67 ? 302  LEU B N   1 
ATOM   6047  C  CA  . LEU B  2  192 ? -24.454 -1.099  36.952   1.00 102.03 ? 302  LEU B CA  1 
ATOM   6048  C  C   . LEU B  2  192 ? -25.308 -1.095  38.209   1.00 141.30 ? 302  LEU B C   1 
ATOM   6049  O  O   . LEU B  2  192 ? -26.543 -1.122  38.121   1.00 148.73 ? 302  LEU B O   1 
ATOM   6050  C  CB  . LEU B  2  192 ? -24.621 -2.425  36.199   1.00 98.83  ? 302  LEU B CB  1 
ATOM   6051  C  CG  . LEU B  2  192 ? -24.200 -2.452  34.728   1.00 99.17  ? 302  LEU B CG  1 
ATOM   6052  C  CD1 . LEU B  2  192 ? -24.442 -3.827  34.148   1.00 108.74 ? 302  LEU B CD1 1 
ATOM   6053  C  CD2 . LEU B  2  192 ? -24.960 -1.407  33.933   1.00 117.42 ? 302  LEU B CD2 1 
ATOM   6054  N  N   . VAL B  2  193 ? -24.670 -1.060  39.372   1.00 106.31 ? 303  VAL B N   1 
ATOM   6055  C  CA  . VAL B  2  193 ? -25.358 -0.962  40.640   1.00 109.10 ? 303  VAL B CA  1 
ATOM   6056  C  C   . VAL B  2  193 ? -25.224 0.435   41.228   1.00 135.64 ? 303  VAL B C   1 
ATOM   6057  O  O   . VAL B  2  193 ? -26.178 0.962   41.802   1.00 159.91 ? 303  VAL B O   1 
ATOM   6058  C  CB  . VAL B  2  193 ? -24.836 -2.032  41.623   1.00 119.43 ? 303  VAL B CB  1 
ATOM   6059  C  CG1 . VAL B  2  193 ? -25.613 -1.979  42.941   1.00 161.50 ? 303  VAL B CG1 1 
ATOM   6060  C  CG2 . VAL B  2  193 ? -24.916 -3.411  40.996   1.00 102.82 ? 303  VAL B CG2 1 
ATOM   6061  N  N   . GLN B  2  194 ? -24.049 1.057   41.067   1.00 120.98 ? 304  GLN B N   1 
ATOM   6062  C  CA  . GLN B  2  194 ? -23.889 2.451   41.466   1.00 141.16 ? 304  GLN B CA  1 
ATOM   6063  C  C   . GLN B  2  194 ? -24.881 3.338   40.739   1.00 160.76 ? 304  GLN B C   1 
ATOM   6064  O  O   . GLN B  2  194 ? -25.260 4.399   41.248   1.00 155.89 ? 304  GLN B O   1 
ATOM   6065  C  CB  . GLN B  2  194 ? -22.471 2.929   41.177   1.00 120.30 ? 304  GLN B CB  1 
ATOM   6066  C  CG  . GLN B  2  194 ? -21.407 2.356   42.074   1.00 146.65 ? 304  GLN B CG  1 
ATOM   6067  C  CD  . GLN B  2  194 ? -20.037 2.881   41.699   1.00 148.82 ? 304  GLN B CD  1 
ATOM   6068  O  OE1 . GLN B  2  194 ? -19.922 3.807   40.895   1.00 118.15 ? 304  GLN B OE1 1 
ATOM   6069  N  NE2 . GLN B  2  194 ? -18.991 2.287   42.265   1.00 142.47 ? 304  GLN B NE2 1 
ATOM   6070  N  N   . ASN B  2  195 ? -25.285 2.936   39.537   1.00 158.96 ? 305  ASN B N   1 
ATOM   6071  C  CA  . ASN B  2  195 ? -26.317 3.630   38.792   1.00 151.09 ? 305  ASN B CA  1 
ATOM   6072  C  C   . ASN B  2  195 ? -27.636 2.883   38.796   1.00 124.47 ? 305  ASN B C   1 
ATOM   6073  O  O   . ASN B  2  195 ? -28.648 3.444   38.357   1.00 129.70 ? 305  ASN B O   1 
ATOM   6074  C  CB  . ASN B  2  195 ? -25.854 3.852   37.348   1.00 134.63 ? 305  ASN B CB  1 
ATOM   6075  C  CG  . ASN B  2  195 ? -24.409 4.284   37.276   1.00 145.08 ? 305  ASN B CG  1 
ATOM   6076  O  OD1 . ASN B  2  195 ? -23.953 5.092   38.086   1.00 151.63 ? 305  ASN B OD1 1 
ATOM   6077  N  ND2 . ASN B  2  195 ? -23.671 3.732   36.324   1.00 151.14 ? 305  ASN B ND2 1 
ATOM   6078  N  N   . ASN B  2  196 ? -27.652 1.654   39.318   1.00 122.70 ? 306  ASN B N   1 
ATOM   6079  C  CA  . ASN B  2  196 ? -28.839 0.814   39.360   1.00 126.77 ? 306  ASN B CA  1 
ATOM   6080  C  C   . ASN B  2  196 ? -29.410 0.643   37.960   1.00 127.13 ? 306  ASN B C   1 
ATOM   6081  O  O   . ASN B  2  196 ? -30.393 1.300   37.602   1.00 133.01 ? 306  ASN B O   1 
ATOM   6082  C  CB  . ASN B  2  196 ? -29.890 1.405   40.303   1.00 162.91 ? 306  ASN B CB  1 
ATOM   6083  C  CG  . ASN B  2  196 ? -31.077 0.478   40.504   1.00 146.83 ? 306  ASN B CG  1 
ATOM   6084  O  OD1 . ASN B  2  196 ? -30.942 -0.742  40.438   1.00 152.94 ? 306  ASN B OD1 1 
ATOM   6085  N  ND2 . ASN B  2  196 ? -32.251 1.057   40.735   1.00 149.57 ? 306  ASN B ND2 1 
ATOM   6086  N  N   . VAL B  2  197 ? -28.793 -0.222  37.157   1.00 121.13 ? 307  VAL B N   1 
ATOM   6087  C  CA  . VAL B  2  197 ? -29.184 -0.445  35.769   1.00 120.78 ? 307  VAL B CA  1 
ATOM   6088  C  C   . VAL B  2  197 ? -29.487 -1.928  35.601   1.00 119.58 ? 307  VAL B C   1 
ATOM   6089  O  O   . VAL B  2  197 ? -28.693 -2.775  36.028   1.00 114.49 ? 307  VAL B O   1 
ATOM   6090  C  CB  . VAL B  2  197 ? -28.082 0.023   34.796   1.00 146.05 ? 307  VAL B CB  1 
ATOM   6091  C  CG1 . VAL B  2  197 ? -28.496 -0.158  33.351   1.00 144.00 ? 307  VAL B CG1 1 
ATOM   6092  C  CG2 . VAL B  2  197 ? -27.730 1.483   35.045   1.00 128.93 ? 307  VAL B CG2 1 
ATOM   6093  N  N   . LEU B  2  198 ? -30.662 -2.238  35.040   1.00 159.42 ? 308  LEU B N   1 
ATOM   6094  C  CA  . LEU B  2  198 ? -31.061 -3.610  34.717   1.00 124.89 ? 308  LEU B CA  1 
ATOM   6095  C  C   . LEU B  2  198 ? -30.746 -3.893  33.253   1.00 129.57 ? 308  LEU B C   1 
ATOM   6096  O  O   . LEU B  2  198 ? -31.360 -3.310  32.354   1.00 124.62 ? 308  LEU B O   1 
ATOM   6097  C  CB  . LEU B  2  198 ? -32.541 -3.836  35.004   1.00 134.07 ? 308  LEU B CB  1 
ATOM   6098  C  CG  . LEU B  2  198 ? -32.991 -3.747  36.460   1.00 164.83 ? 308  LEU B CG  1 
ATOM   6099  C  CD1 . LEU B  2  198 ? -34.472 -4.069  36.540   1.00 173.69 ? 308  LEU B CD1 1 
ATOM   6100  C  CD2 . LEU B  2  198 ? -32.179 -4.686  37.340   1.00 163.20 ? 308  LEU B CD2 1 
ATOM   6101  N  N   . LEU B  2  199 ? -29.806 -4.806  33.017   1.00 154.18 ? 309  LEU B N   1 
ATOM   6102  C  CA  . LEU B  2  199 ? -29.272 -5.060  31.681   1.00 143.79 ? 309  LEU B CA  1 
ATOM   6103  C  C   . LEU B  2  199 ? -30.002 -6.239  31.044   1.00 111.65 ? 309  LEU B C   1 
ATOM   6104  O  O   . LEU B  2  199 ? -29.937 -7.368  31.539   1.00 110.38 ? 309  LEU B O   1 
ATOM   6105  C  CB  . LEU B  2  199 ? -27.765 -5.308  31.735   1.00 100.70 ? 309  LEU B CB  1 
ATOM   6106  C  CG  . LEU B  2  199 ? -27.073 -5.388  30.375   1.00 95.77  ? 309  LEU B CG  1 
ATOM   6107  C  CD1 . LEU B  2  199 ? -27.260 -4.106  29.584   1.00 99.73  ? 309  LEU B CD1 1 
ATOM   6108  C  CD2 . LEU B  2  199 ? -25.636 -5.692  30.569   1.00 88.20  ? 309  LEU B CD2 1 
ATOM   6109  N  N   . ILE B  2  200 ? -30.716 -5.968  29.964   1.00 115.99 ? 310  ILE B N   1 
ATOM   6110  C  CA  . ILE B  2  200 ? -31.410 -6.994  29.201   1.00 140.38 ? 310  ILE B CA  1 
ATOM   6111  C  C   . ILE B  2  200 ? -30.523 -7.386  28.029   1.00 115.18 ? 310  ILE B C   1 
ATOM   6112  O  O   . ILE B  2  200 ? -30.177 -6.542  27.194   1.00 115.58 ? 310  ILE B O   1 
ATOM   6113  C  CB  . ILE B  2  200 ? -32.781 -6.499  28.713   1.00 130.37 ? 310  ILE B CB  1 
ATOM   6114  C  CG1 . ILE B  2  200 ? -33.689 -6.192  29.901   1.00 135.65 ? 310  ILE B CG1 1 
ATOM   6115  C  CG2 . ILE B  2  200 ? -33.425 -7.529  27.806   1.00 134.76 ? 310  ILE B CG2 1 
ATOM   6116  C  CD1 . ILE B  2  200 ? -35.002 -5.601  29.501   1.00 146.61 ? 310  ILE B CD1 1 
ATOM   6117  N  N   . PHE B  2  201 ? -30.144 -8.658  27.974   1.00 111.22 ? 311  PHE B N   1 
ATOM   6118  C  CA  . PHE B  2  201 ? -29.420 -9.211  26.837   1.00 107.87 ? 311  PHE B CA  1 
ATOM   6119  C  C   . PHE B  2  201 ? -30.428 -9.697  25.800   1.00 134.14 ? 311  PHE B C   1 
ATOM   6120  O  O   . PHE B  2  201 ? -31.272 -10.547 26.104   1.00 132.54 ? 311  PHE B O   1 
ATOM   6121  C  CB  . PHE B  2  201 ? -28.520 -10.362 27.281   1.00 100.59 ? 311  PHE B CB  1 
ATOM   6122  C  CG  . PHE B  2  201 ? -27.308 -9.922  28.047   1.00 133.46 ? 311  PHE B CG  1 
ATOM   6123  C  CD1 . PHE B  2  201 ? -26.596 -8.799  27.655   1.00 115.92 ? 311  PHE B CD1 1 
ATOM   6124  C  CD2 . PHE B  2  201 ? -26.888 -10.621 29.166   1.00 122.82 ? 311  PHE B CD2 1 
ATOM   6125  C  CE1 . PHE B  2  201 ? -25.498 -8.393  28.353   1.00 84.99  ? 311  PHE B CE1 1 
ATOM   6126  C  CE2 . PHE B  2  201 ? -25.785 -10.211 29.871   1.00 82.56  ? 311  PHE B CE2 1 
ATOM   6127  C  CZ  . PHE B  2  201 ? -25.094 -9.097  29.463   1.00 80.72  ? 311  PHE B CZ  1 
ATOM   6128  N  N   . ALA B  2  202 ? -30.350 -9.158  24.584   1.00 130.93 ? 312  ALA B N   1 
ATOM   6129  C  CA  . ALA B  2  202 ? -31.233 -9.545  23.481   1.00 125.45 ? 312  ALA B CA  1 
ATOM   6130  C  C   . ALA B  2  202 ? -30.370 -9.973  22.295   1.00 122.14 ? 312  ALA B C   1 
ATOM   6131  O  O   . ALA B  2  202 ? -30.103 -9.179  21.390   1.00 123.68 ? 312  ALA B O   1 
ATOM   6132  C  CB  . ALA B  2  202 ? -32.164 -8.397  23.109   1.00 133.94 ? 312  ALA B CB  1 
ATOM   6133  N  N   . VAL B  2  203 ? -29.995 -11.254 22.267   1.00 134.02 ? 313  VAL B N   1 
ATOM   6134  C  CA  . VAL B  2  203 ? -29.055 -11.763 21.273   1.00 152.33 ? 313  VAL B CA  1 
ATOM   6135  C  C   . VAL B  2  203 ? -29.725 -12.819 20.404   1.00 125.68 ? 313  VAL B C   1 
ATOM   6136  O  O   . VAL B  2  203 ? -30.947 -12.997 20.450   1.00 128.03 ? 313  VAL B O   1 
ATOM   6137  C  CB  . VAL B  2  203 ? -27.784 -12.329 21.942   1.00 136.44 ? 313  VAL B CB  1 
ATOM   6138  C  CG1 . VAL B  2  203 ? -27.047 -11.245 22.718   1.00 100.06 ? 313  VAL B CG1 1 
ATOM   6139  C  CG2 . VAL B  2  203 ? -28.135 -13.478 22.861   1.00 113.63 ? 313  VAL B CG2 1 
ATOM   6140  N  N   . THR B  2  204 ? -28.929 -13.494 19.580   1.00 149.59 ? 314  THR B N   1 
ATOM   6141  C  CA  . THR B  2  204 ? -29.375 -14.581 18.722   1.00 159.71 ? 314  THR B CA  1 
ATOM   6142  C  C   . THR B  2  204 ? -29.280 -15.924 19.447   1.00 143.55 ? 314  THR B C   1 
ATOM   6143  O  O   . THR B  2  204 ? -28.687 -16.038 20.520   1.00 130.25 ? 314  THR B O   1 
ATOM   6144  C  CB  . THR B  2  204 ? -28.543 -14.600 17.444   1.00 157.53 ? 314  THR B CB  1 
ATOM   6145  O  OG1 . THR B  2  204 ? -27.148 -14.601 17.784   1.00 138.03 ? 314  THR B OG1 1 
ATOM   6146  C  CG2 . THR B  2  204 ? -28.857 -13.378 16.603   1.00 126.81 ? 314  THR B CG2 1 
ATOM   6147  N  N   . GLN B  2  205 ? -29.880 -16.953 18.839   1.00 124.32 ? 315  GLN B N   1 
ATOM   6148  C  CA  . GLN B  2  205 ? -29.928 -18.266 19.476   1.00 123.00 ? 315  GLN B CA  1 
ATOM   6149  C  C   . GLN B  2  205 ? -28.540 -18.755 19.868   1.00 132.09 ? 315  GLN B C   1 
ATOM   6150  O  O   . GLN B  2  205 ? -28.305 -19.127 21.022   1.00 157.77 ? 315  GLN B O   1 
ATOM   6151  C  CB  . GLN B  2  205 ? -30.594 -19.283 18.557   1.00 143.56 ? 315  GLN B CB  1 
ATOM   6152  C  CG  . GLN B  2  205 ? -32.036 -18.979 18.247   1.00 173.52 ? 315  GLN B CG  1 
ATOM   6153  C  CD  . GLN B  2  205 ? -32.751 -20.175 17.667   1.00 168.20 ? 315  GLN B CD  1 
ATOM   6154  O  OE1 . GLN B  2  205 ? -32.319 -21.317 17.842   1.00 159.81 ? 315  GLN B OE1 1 
ATOM   6155  N  NE2 . GLN B  2  205 ? -33.849 -19.923 16.968   1.00 196.45 ? 315  GLN B NE2 1 
ATOM   6156  N  N   . GLU B  2  206 ? -27.597 -18.740 18.922   1.00 143.18 ? 316  GLU B N   1 
ATOM   6157  C  CA  . GLU B  2  206 ? -26.268 -19.280 19.189   1.00 135.56 ? 316  GLU B CA  1 
ATOM   6158  C  C   . GLU B  2  206 ? -25.514 -18.474 20.229   1.00 110.30 ? 316  GLU B C   1 
ATOM   6159  O  O   . GLU B  2  206 ? -24.489 -18.948 20.728   1.00 112.16 ? 316  GLU B O   1 
ATOM   6160  C  CB  . GLU B  2  206 ? -25.435 -19.340 17.910   1.00 140.25 ? 316  GLU B CB  1 
ATOM   6161  C  CG  . GLU B  2  206 ? -25.133 -17.983 17.316   1.00 136.36 ? 316  GLU B CG  1 
ATOM   6162  C  CD  . GLU B  2  206 ? -26.283 -17.450 16.493   1.00 166.16 ? 316  GLU B CD  1 
ATOM   6163  O  OE1 . GLU B  2  206 ? -27.306 -18.157 16.370   1.00 163.68 ? 316  GLU B OE1 1 
ATOM   6164  O  OE2 . GLU B  2  206 ? -26.170 -16.322 15.974   1.00 197.81 ? 316  GLU B OE2 1 
ATOM   6165  N  N   . GLN B  2  207 ? -25.995 -17.282 20.566   1.00 98.66  ? 317  GLN B N   1 
ATOM   6166  C  CA  . GLN B  2  207 ? -25.330 -16.426 21.530   1.00 137.85 ? 317  GLN B CA  1 
ATOM   6167  C  C   . GLN B  2  207 ? -26.030 -16.419 22.883   1.00 138.65 ? 317  GLN B C   1 
ATOM   6168  O  O   . GLN B  2  207 ? -25.531 -15.798 23.826   1.00 86.93  ? 317  GLN B O   1 
ATOM   6169  C  CB  . GLN B  2  207 ? -25.230 -15.003 20.966   1.00 92.31  ? 317  GLN B CB  1 
ATOM   6170  C  CG  . GLN B  2  207 ? -23.861 -14.410 21.150   1.00 86.52  ? 317  GLN B CG  1 
ATOM   6171  C  CD  . GLN B  2  207 ? -22.816 -15.145 20.350   1.00 113.24 ? 317  GLN B CD  1 
ATOM   6172  O  OE1 . GLN B  2  207 ? -23.126 -15.761 19.329   1.00 149.72 ? 317  GLN B OE1 1 
ATOM   6173  N  NE2 . GLN B  2  207 ? -21.575 -15.123 20.829   1.00 82.52  ? 317  GLN B NE2 1 
ATOM   6174  N  N   . VAL B  2  208 ? -27.121 -17.166 23.035   1.00 148.99 ? 318  VAL B N   1 
ATOM   6175  C  CA  . VAL B  2  208 ? -27.845 -17.151 24.300   1.00 98.80  ? 318  VAL B CA  1 
ATOM   6176  C  C   . VAL B  2  208 ? -27.088 -17.943 25.354   1.00 92.70  ? 318  VAL B C   1 
ATOM   6177  O  O   . VAL B  2  208 ? -26.872 -17.463 26.472   1.00 89.62  ? 318  VAL B O   1 
ATOM   6178  C  CB  . VAL B  2  208 ? -29.273 -17.690 24.112   1.00 107.92 ? 318  VAL B CB  1 
ATOM   6179  C  CG1 . VAL B  2  208 ? -29.953 -17.812 25.456   1.00 109.87 ? 318  VAL B CG1 1 
ATOM   6180  C  CG2 . VAL B  2  208 ? -30.069 -16.778 23.201   1.00 114.68 ? 318  VAL B CG2 1 
ATOM   6181  N  N   . HIS B  2  209 ? -26.644 -19.155 25.004   1.00 142.62 ? 319  HIS B N   1 
ATOM   6182  C  CA  . HIS B  2  209 ? -25.968 -20.006 25.978   1.00 143.84 ? 319  HIS B CA  1 
ATOM   6183  C  C   . HIS B  2  209 ? -24.771 -19.291 26.575   1.00 123.66 ? 319  HIS B C   1 
ATOM   6184  O  O   . HIS B  2  209 ? -24.379 -19.579 27.711   1.00 75.55  ? 319  HIS B O   1 
ATOM   6185  C  CB  . HIS B  2  209 ? -25.547 -21.325 25.318   1.00 160.72 ? 319  HIS B CB  1 
ATOM   6186  C  CG  . HIS B  2  209 ? -25.074 -22.379 26.278   1.00 152.51 ? 319  HIS B CG  1 
ATOM   6187  N  ND1 . HIS B  2  209 ? -23.778 -22.442 26.746   1.00 170.89 ? 319  HIS B ND1 1 
ATOM   6188  C  CD2 . HIS B  2  209 ? -25.722 -23.433 26.830   1.00 110.76 ? 319  HIS B CD2 1 
ATOM   6189  C  CE1 . HIS B  2  209 ? -23.653 -23.479 27.555   1.00 115.32 ? 319  HIS B CE1 1 
ATOM   6190  N  NE2 . HIS B  2  209 ? -24.818 -24.097 27.623   1.00 96.92  ? 319  HIS B NE2 1 
ATOM   6191  N  N   . LEU B  2  210 ? -24.201 -18.337 25.835   1.00 96.23  ? 320  LEU B N   1 
ATOM   6192  C  CA  . LEU B  2  210 ? -23.108 -17.517 26.351   1.00 116.86 ? 320  LEU B CA  1 
ATOM   6193  C  C   . LEU B  2  210 ? -23.614 -16.447 27.317   1.00 111.83 ? 320  LEU B C   1 
ATOM   6194  O  O   . LEU B  2  210 ? -23.221 -16.410 28.486   1.00 68.36  ? 320  LEU B O   1 
ATOM   6195  C  CB  . LEU B  2  210 ? -22.359 -16.865 25.181   1.00 139.90 ? 320  LEU B CB  1 
ATOM   6196  C  CG  . LEU B  2  210 ? -20.994 -16.172 25.305   1.00 120.77 ? 320  LEU B CG  1 
ATOM   6197  C  CD1 . LEU B  2  210 ? -20.423 -15.965 23.920   1.00 116.19 ? 320  LEU B CD1 1 
ATOM   6198  C  CD2 . LEU B  2  210 ? -21.090 -14.828 25.978   1.00 119.71 ? 320  LEU B CD2 1 
ATOM   6199  N  N   . TYR B  2  211 ? -24.480 -15.557 26.836   1.00 76.52  ? 321  TYR B N   1 
ATOM   6200  C  CA  . TYR B  2  211 ? -24.858 -14.395 27.625   1.00 77.61  ? 321  TYR B CA  1 
ATOM   6201  C  C   . TYR B  2  211 ? -25.709 -14.748 28.831   1.00 80.37  ? 321  TYR B C   1 
ATOM   6202  O  O   . TYR B  2  211 ? -25.765 -13.956 29.773   1.00 79.93  ? 321  TYR B O   1 
ATOM   6203  C  CB  . TYR B  2  211 ? -25.595 -13.400 26.739   1.00 83.04  ? 321  TYR B CB  1 
ATOM   6204  C  CG  . TYR B  2  211 ? -24.685 -12.579 25.859   1.00 80.40  ? 321  TYR B CG  1 
ATOM   6205  C  CD1 . TYR B  2  211 ? -23.980 -13.175 24.823   1.00 78.43  ? 321  TYR B CD1 1 
ATOM   6206  C  CD2 . TYR B  2  211 ? -24.561 -11.208 26.029   1.00 130.27 ? 321  TYR B CD2 1 
ATOM   6207  C  CE1 . TYR B  2  211 ? -23.150 -12.439 24.003   1.00 76.73  ? 321  TYR B CE1 1 
ATOM   6208  C  CE2 . TYR B  2  211 ? -23.736 -10.456 25.204   1.00 146.57 ? 321  TYR B CE2 1 
ATOM   6209  C  CZ  . TYR B  2  211 ? -23.033 -11.079 24.191   1.00 134.62 ? 321  TYR B CZ  1 
ATOM   6210  O  OH  . TYR B  2  211 ? -22.214 -10.343 23.360   1.00 109.16 ? 321  TYR B OH  1 
ATOM   6211  N  N   . GLU B  2  212 ? -26.370 -15.911 28.830   1.00 128.80 ? 322  GLU B N   1 
ATOM   6212  C  CA  . GLU B  2  212 ? -27.168 -16.303 29.988   1.00 100.08 ? 322  GLU B CA  1 
ATOM   6213  C  C   . GLU B  2  212 ? -26.282 -16.596 31.176   1.00 82.00  ? 322  GLU B C   1 
ATOM   6214  O  O   . GLU B  2  212 ? -26.707 -16.435 32.324   1.00 85.16  ? 322  GLU B O   1 
ATOM   6215  C  CB  . GLU B  2  212 ? -28.020 -17.531 29.682   1.00 92.41  ? 322  GLU B CB  1 
ATOM   6216  C  CG  . GLU B  2  212 ? -28.942 -17.895 30.832   1.00 109.49 ? 322  GLU B CG  1 
ATOM   6217  C  CD  . GLU B  2  212 ? -29.770 -19.124 30.552   1.00 138.59 ? 322  GLU B CD  1 
ATOM   6218  O  OE1 . GLU B  2  212 ? -29.647 -19.680 29.442   1.00 183.64 ? 322  GLU B OE1 1 
ATOM   6219  O  OE2 . GLU B  2  212 ? -30.549 -19.529 31.441   1.00 147.22 ? 322  GLU B OE2 1 
ATOM   6220  N  N   . ASN B  2  213 ? -25.074 -17.088 30.916   1.00 75.18  ? 323  ASN B N   1 
ATOM   6221  C  CA  . ASN B  2  213 ? -24.112 -17.270 31.988   1.00 112.44 ? 323  ASN B CA  1 
ATOM   6222  C  C   . ASN B  2  213 ? -23.531 -15.934 32.433   1.00 138.39 ? 323  ASN B C   1 
ATOM   6223  O  O   . ASN B  2  213 ? -23.102 -15.802 33.583   1.00 118.75 ? 323  ASN B O   1 
ATOM   6224  C  CB  . ASN B  2  213 ? -23.022 -18.240 31.537   1.00 142.82 ? 323  ASN B CB  1 
ATOM   6225  C  CG  . ASN B  2  213 ? -23.567 -19.640 31.260   1.00 137.89 ? 323  ASN B CG  1 
ATOM   6226  O  OD1 . ASN B  2  213 ? -23.297 -20.229 30.213   1.00 109.59 ? 323  ASN B OD1 1 
ATOM   6227  N  ND2 . ASN B  2  213 ? -24.337 -20.174 32.202   1.00 146.95 ? 323  ASN B ND2 1 
ATOM   6228  N  N   . TYR B  2  214 ? -23.527 -14.932 31.548   1.00 135.69 ? 324  TYR B N   1 
ATOM   6229  C  CA  . TYR B  2  214 ? -23.161 -13.584 31.972   1.00 67.00  ? 324  TYR B CA  1 
ATOM   6230  C  C   . TYR B  2  214 ? -24.230 -12.989 32.871   1.00 101.49 ? 324  TYR B C   1 
ATOM   6231  O  O   . TYR B  2  214 ? -23.919 -12.375 33.898   1.00 158.14 ? 324  TYR B O   1 
ATOM   6232  C  CB  . TYR B  2  214 ? -22.963 -12.674 30.767   1.00 66.29  ? 324  TYR B CB  1 
ATOM   6233  C  CG  . TYR B  2  214 ? -21.690 -12.889 29.993   1.00 61.43  ? 324  TYR B CG  1 
ATOM   6234  C  CD1 . TYR B  2  214 ? -20.744 -13.823 30.409   1.00 113.42 ? 324  TYR B CD1 1 
ATOM   6235  C  CD2 . TYR B  2  214 ? -21.436 -12.153 28.836   1.00 62.13  ? 324  TYR B CD2 1 
ATOM   6236  C  CE1 . TYR B  2  214 ? -19.577 -14.016 29.690   1.00 163.09 ? 324  TYR B CE1 1 
ATOM   6237  C  CE2 . TYR B  2  214 ? -20.287 -12.340 28.115   1.00 58.44  ? 324  TYR B CE2 1 
ATOM   6238  C  CZ  . TYR B  2  214 ? -19.353 -13.271 28.543   1.00 130.47 ? 324  TYR B CZ  1 
ATOM   6239  O  OH  . TYR B  2  214 ? -18.194 -13.462 27.819   1.00 77.91  ? 324  TYR B OH  1 
ATOM   6240  N  N   . ALA B  2  215 ? -25.497 -13.168 32.501   1.00 80.05  ? 325  ALA B N   1 
ATOM   6241  C  CA  . ALA B  2  215 ? -26.593 -12.656 33.309   1.00 108.75 ? 325  ALA B CA  1 
ATOM   6242  C  C   . ALA B  2  215 ? -26.631 -13.311 34.677   1.00 114.42 ? 325  ALA B C   1 
ATOM   6243  O  O   . ALA B  2  215 ? -27.193 -12.737 35.615   1.00 145.75 ? 325  ALA B O   1 
ATOM   6244  C  CB  . ALA B  2  215 ? -27.924 -12.869 32.581   1.00 116.79 ? 325  ALA B CB  1 
ATOM   6245  N  N   . LYS B  2  216 ? -26.064 -14.510 34.804   1.00 133.65 ? 326  LYS B N   1 
ATOM   6246  C  CA  . LYS B  2  216 ? -25.986 -15.137 36.113   1.00 153.49 ? 326  LYS B CA  1 
ATOM   6247  C  C   . LYS B  2  216 ? -24.985 -14.401 36.989   1.00 142.36 ? 326  LYS B C   1 
ATOM   6248  O  O   . LYS B  2  216 ? -25.185 -14.281 38.203   1.00 199.33 ? 326  LYS B O   1 
ATOM   6249  C  CB  . LYS B  2  216 ? -25.614 -16.615 35.974   1.00 141.97 ? 326  LYS B CB  1 
ATOM   6250  C  CG  . LYS B  2  216 ? -26.675 -17.470 35.279   1.00 87.18  ? 326  LYS B CG  1 
ATOM   6251  C  CD  . LYS B  2  216 ? -26.242 -18.929 35.221   1.00 84.30  ? 326  LYS B CD  1 
ATOM   6252  C  CE  . LYS B  2  216 ? -27.265 -19.793 34.504   1.00 90.12  ? 326  LYS B CE  1 
ATOM   6253  N  NZ  . LYS B  2  216 ? -26.886 -21.237 34.494   1.00 88.13  ? 326  LYS B NZ  1 
ATOM   6254  N  N   . LEU B  2  217 ? -23.897 -13.909 36.392   1.00 77.53  ? 327  LEU B N   1 
ATOM   6255  C  CA  . LEU B  2  217 ? -22.940 -13.119 37.158   1.00 98.43  ? 327  LEU B CA  1 
ATOM   6256  C  C   . LEU B  2  217 ? -23.494 -11.737 37.458   1.00 148.99 ? 327  LEU B C   1 
ATOM   6257  O  O   . LEU B  2  217 ? -23.501 -11.293 38.612   1.00 169.71 ? 327  LEU B O   1 
ATOM   6258  C  CB  . LEU B  2  217 ? -21.608 -13.006 36.419   1.00 67.55  ? 327  LEU B CB  1 
ATOM   6259  C  CG  . LEU B  2  217 ? -20.925 -14.318 36.033   1.00 62.29  ? 327  LEU B CG  1 
ATOM   6260  C  CD1 . LEU B  2  217 ? -19.573 -14.053 35.379   1.00 55.95  ? 327  LEU B CD1 1 
ATOM   6261  C  CD2 . LEU B  2  217 ? -20.785 -15.237 37.233   1.00 135.02 ? 327  LEU B CD2 1 
ATOM   6262  N  N   . ILE B  2  218 ? -23.937 -11.032 36.426   1.00 117.50 ? 328  ILE B N   1 
ATOM   6263  C  CA  . ILE B  2  218 ? -24.452 -9.675  36.569   1.00 91.03  ? 328  ILE B CA  1 
ATOM   6264  C  C   . ILE B  2  218 ? -25.775 -9.688  37.326   1.00 103.39 ? 328  ILE B C   1 
ATOM   6265  O  O   . ILE B  2  218 ? -26.760 -10.256 36.834   1.00 149.81 ? 328  ILE B O   1 
ATOM   6266  C  CB  . ILE B  2  218 ? -24.596 -9.016  35.193   1.00 102.04 ? 328  ILE B CB  1 
ATOM   6267  C  CG1 . ILE B  2  218 ? -23.310 -9.232  34.405   1.00 82.14  ? 328  ILE B CG1 1 
ATOM   6268  C  CG2 . ILE B  2  218 ? -24.880 -7.534  35.330   1.00 149.70 ? 328  ILE B CG2 1 
ATOM   6269  C  CD1 . ILE B  2  218 ? -23.339 -8.632  33.033   1.00 80.59  ? 328  ILE B CD1 1 
ATOM   6270  N  N   . PRO B  2  219 ? -25.852 -9.076  38.510   1.00 125.93 ? 329  PRO B N   1 
ATOM   6271  C  CA  . PRO B  2  219 ? -27.113 -9.101  39.265   1.00 136.05 ? 329  PRO B CA  1 
ATOM   6272  C  C   . PRO B  2  219 ? -28.199 -8.297  38.566   1.00 139.91 ? 329  PRO B C   1 
ATOM   6273  O  O   . PRO B  2  219 ? -27.971 -7.177  38.105   1.00 131.26 ? 329  PRO B O   1 
ATOM   6274  C  CB  . PRO B  2  219 ? -26.731 -8.486  40.618   1.00 162.51 ? 329  PRO B CB  1 
ATOM   6275  C  CG  . PRO B  2  219 ? -25.532 -7.648  40.330   1.00 130.91 ? 329  PRO B CG  1 
ATOM   6276  C  CD  . PRO B  2  219 ? -24.782 -8.374  39.244   1.00 90.60  ? 329  PRO B CD  1 
ATOM   6277  N  N   . GLY B  2  220 ? -29.386 -8.882  38.495   1.00 113.51 ? 330  GLY B N   1 
ATOM   6278  C  CA  . GLY B  2  220 ? -30.520 -8.211  37.902   1.00 145.33 ? 330  GLY B CA  1 
ATOM   6279  C  C   . GLY B  2  220 ? -30.563 -8.317  36.395   1.00 130.43 ? 330  GLY B C   1 
ATOM   6280  O  O   . GLY B  2  220 ? -31.640 -8.220  35.800   1.00 181.01 ? 330  GLY B O   1 
ATOM   6281  N  N   . ALA B  2  221 ? -29.407 -8.513  35.766   1.00 110.26 ? 331  ALA B N   1 
ATOM   6282  C  CA  . ALA B  2  221 ? -29.361 -8.620  34.314   1.00 108.17 ? 331  ALA B CA  1 
ATOM   6283  C  C   . ALA B  2  221 ? -29.949 -9.948  33.845   1.00 136.76 ? 331  ALA B C   1 
ATOM   6284  O  O   . ALA B  2  221 ? -29.558 -11.020 34.318   1.00 107.20 ? 331  ALA B O   1 
ATOM   6285  C  CB  . ALA B  2  221 ? -27.930 -8.468  33.810   1.00 107.44 ? 331  ALA B CB  1 
ATOM   6286  N  N   . THR B  2  222 ? -30.863 -9.867  32.884   1.00 169.64 ? 332  THR B N   1 
ATOM   6287  C  CA  . THR B  2  222 ? -31.576 -10.990 32.290   1.00 118.50 ? 332  THR B CA  1 
ATOM   6288  C  C   . THR B  2  222 ? -31.191 -11.111 30.820   1.00 141.90 ? 332  THR B C   1 
ATOM   6289  O  O   . THR B  2  222 ? -30.387 -10.332 30.300   1.00 155.33 ? 332  THR B O   1 
ATOM   6290  C  CB  . THR B  2  222 ? -33.084 -10.803 32.437   1.00 129.13 ? 332  THR B CB  1 
ATOM   6291  O  OG1 . THR B  2  222 ? -33.507 -9.750  31.564   1.00 132.10 ? 332  THR B OG1 1 
ATOM   6292  C  CG2 . THR B  2  222 ? -33.426 -10.428 33.871   1.00 132.93 ? 332  THR B CG2 1 
ATOM   6293  N  N   . VAL B  2  223 ? -31.740 -12.129 30.160   1.00 140.14 ? 333  VAL B N   1 
ATOM   6294  C  CA  . VAL B  2  223 ? -31.445 -12.417 28.763   1.00 134.56 ? 333  VAL B CA  1 
ATOM   6295  C  C   . VAL B  2  223 ? -32.746 -12.427 27.962   1.00 125.34 ? 333  VAL B C   1 
ATOM   6296  O  O   . VAL B  2  223 ? -33.841 -12.440 28.517   1.00 132.63 ? 333  VAL B O   1 
ATOM   6297  C  CB  . VAL B  2  223 ? -30.675 -13.739 28.595   1.00 113.07 ? 333  VAL B CB  1 
ATOM   6298  C  CG1 . VAL B  2  223 ? -29.221 -13.529 28.959   1.00 100.45 ? 333  VAL B CG1 1 
ATOM   6299  C  CG2 . VAL B  2  223 ? -31.280 -14.815 29.486   1.00 113.97 ? 333  VAL B CG2 1 
ATOM   6300  N  N   . GLY B  2  224 ? -32.603 -12.386 26.637   1.00 128.63 ? 334  GLY B N   1 
ATOM   6301  C  CA  . GLY B  2  224 ? -33.744 -12.413 25.738   1.00 138.32 ? 334  GLY B CA  1 
ATOM   6302  C  C   . GLY B  2  224 ? -33.356 -12.942 24.376   1.00 137.82 ? 334  GLY B C   1 
ATOM   6303  O  O   . GLY B  2  224 ? -32.185 -12.904 23.987   1.00 166.04 ? 334  GLY B O   1 
ATOM   6304  N  N   . LEU B  2  225 ? -34.352 -13.446 23.649   1.00 144.19 ? 335  LEU B N   1 
ATOM   6305  C  CA  . LEU B  2  225 ? -34.146 -14.010 22.321   1.00 145.44 ? 335  LEU B CA  1 
ATOM   6306  C  C   . LEU B  2  225 ? -34.711 -13.097 21.239   1.00 156.87 ? 335  LEU B C   1 
ATOM   6307  O  O   . LEU B  2  225 ? -35.799 -12.530 21.393   1.00 200.64 ? 335  LEU B O   1 
ATOM   6308  C  CB  . LEU B  2  225 ? -34.797 -15.386 22.196   1.00 150.44 ? 335  LEU B CB  1 
ATOM   6309  C  CG  . LEU B  2  225 ? -34.481 -16.069 20.862   1.00 182.40 ? 335  LEU B CG  1 
ATOM   6310  C  CD1 . LEU B  2  225 ? -32.969 -16.282 20.690   1.00 140.45 ? 335  LEU B CD1 1 
ATOM   6311  C  CD2 . LEU B  2  225 ? -35.275 -17.362 20.668   1.00 192.65 ? 335  LEU B CD2 1 
ATOM   6312  N  N   . LEU B  2  226 ? -34.002 -13.025 20.113   1.00 151.02 ? 336  LEU B N   1 
ATOM   6313  C  CA  . LEU B  2  226 ? -34.394 -12.209 18.970   1.00 169.34 ? 336  LEU B CA  1 
ATOM   6314  C  C   . LEU B  2  226 ? -35.113 -13.062 17.931   1.00 165.96 ? 336  LEU B C   1 
ATOM   6315  O  O   . LEU B  2  226 ? -34.589 -14.092 17.495   1.00 162.82 ? 336  LEU B O   1 
ATOM   6316  C  CB  . LEU B  2  226 ? -33.168 -11.550 18.332   1.00 151.19 ? 336  LEU B CB  1 
ATOM   6317  C  CG  . LEU B  2  226 ? -33.120 -10.022 18.307   1.00 152.44 ? 336  LEU B CG  1 
ATOM   6318  C  CD1 . LEU B  2  226 ? -34.512 -9.457  18.148   1.00 193.26 ? 336  LEU B CD1 1 
ATOM   6319  C  CD2 . LEU B  2  226 ? -32.482 -9.482  19.554   1.00 144.74 ? 336  LEU B CD2 1 
ATOM   6320  N  N   . GLN B  2  227 ? -36.307 -12.631 17.535   1.00 176.39 ? 337  GLN B N   1 
ATOM   6321  C  CA  . GLN B  2  227 ? -37.046 -13.296 16.476   1.00 185.65 ? 337  GLN B CA  1 
ATOM   6322  C  C   . GLN B  2  227 ? -37.612 -12.231 15.554   1.00 194.29 ? 337  GLN B C   1 
ATOM   6323  O  O   . GLN B  2  227 ? -37.535 -11.035 15.843   1.00 193.54 ? 337  GLN B O   1 
ATOM   6324  C  CB  . GLN B  2  227 ? -38.165 -14.177 17.031   1.00 206.17 ? 337  GLN B CB  1 
ATOM   6325  C  CG  . GLN B  2  227 ? -37.668 -15.380 17.803   1.00 195.13 ? 337  GLN B CG  1 
ATOM   6326  C  CD  . GLN B  2  227 ? -38.796 -16.302 18.207   1.00 216.85 ? 337  GLN B CD  1 
ATOM   6327  O  OE1 . GLN B  2  227 ? -39.973 -15.981 18.010   1.00 229.57 ? 337  GLN B OE1 1 
ATOM   6328  N  NE2 . GLN B  2  227 ? -38.452 -17.436 18.810   1.00 196.74 ? 337  GLN B NE2 1 
ATOM   6329  N  N   . LYS B  2  228 ? -38.186 -12.674 14.430   1.00 203.10 ? 338  LYS B N   1 
ATOM   6330  C  CA  . LYS B  2  228 ? -38.837 -11.735 13.520   1.00 215.95 ? 338  LYS B CA  1 
ATOM   6331  C  C   . LYS B  2  228 ? -39.961 -10.984 14.219   1.00 220.87 ? 338  LYS B C   1 
ATOM   6332  O  O   . LYS B  2  228 ? -40.107 -9.767  14.050   1.00 225.24 ? 338  LYS B O   1 
ATOM   6333  C  CB  . LYS B  2  228 ? -39.365 -12.465 12.286   1.00 222.26 ? 338  LYS B CB  1 
ATOM   6334  C  CG  . LYS B  2  228 ? -38.281 -13.036 11.394   1.00 216.17 ? 338  LYS B CG  1 
ATOM   6335  C  CD  . LYS B  2  228 ? -38.884 -13.697 10.172   1.00 226.55 ? 338  LYS B CD  1 
ATOM   6336  C  CE  . LYS B  2  228 ? -37.809 -14.255 9.261    1.00 222.90 ? 338  LYS B CE  1 
ATOM   6337  N  NZ  . LYS B  2  228 ? -38.406 -14.904 8.062    1.00 238.67 ? 338  LYS B NZ  1 
ATOM   6338  N  N   . ASP B  2  229 ? -40.775 -11.695 14.997   1.00 224.77 ? 339  ASP B N   1 
ATOM   6339  C  CA  . ASP B  2  229 ? -41.753 -11.062 15.880   1.00 231.16 ? 339  ASP B CA  1 
ATOM   6340  C  C   . ASP B  2  229 ? -41.036 -10.735 17.180   1.00 220.07 ? 339  ASP B C   1 
ATOM   6341  O  O   . ASP B  2  229 ? -41.012 -11.525 18.123   1.00 216.12 ? 339  ASP B O   1 
ATOM   6342  C  CB  . ASP B  2  229 ? -42.958 -11.964 16.100   1.00 241.44 ? 339  ASP B CB  1 
ATOM   6343  C  CG  . ASP B  2  229 ? -43.824 -12.076 14.868   1.00 254.61 ? 339  ASP B CG  1 
ATOM   6344  O  OD1 . ASP B  2  229 ? -43.918 -11.082 14.116   1.00 259.15 ? 339  ASP B OD1 1 
ATOM   6345  O  OD2 . ASP B  2  229 ? -44.404 -13.156 14.645   1.00 270.46 ? 339  ASP B OD2 1 
ATOM   6346  N  N   . SER B  2  230 ? -40.444 -9.543  17.227   1.00 215.55 ? 340  SER B N   1 
ATOM   6347  C  CA  . SER B  2  230 ? -39.628 -9.138  18.364   1.00 214.54 ? 340  SER B CA  1 
ATOM   6348  C  C   . SER B  2  230 ? -40.478 -8.781  19.579   1.00 228.08 ? 340  SER B C   1 
ATOM   6349  O  O   . SER B  2  230 ? -39.975 -8.178  20.533   1.00 231.57 ? 340  SER B O   1 
ATOM   6350  C  CB  . SER B  2  230 ? -38.729 -7.960  17.964   1.00 209.92 ? 340  SER B CB  1 
ATOM   6351  O  OG  . SER B  2  230 ? -39.480 -6.891  17.403   1.00 229.13 ? 340  SER B OG  1 
ATOM   6352  N  N   . GLY B  2  231 ? -41.756 -9.169  19.577   1.00 220.51 ? 341  GLY B N   1 
ATOM   6353  C  CA  . GLY B  2  231 ? -42.577 -8.988  20.762   1.00 225.05 ? 341  GLY B CA  1 
ATOM   6354  C  C   . GLY B  2  231 ? -42.150 -9.853  21.922   1.00 217.02 ? 341  GLY B C   1 
ATOM   6355  O  O   . GLY B  2  231 ? -42.613 -9.626  23.049   1.00 218.83 ? 341  GLY B O   1 
ATOM   6356  N  N   . ASN B  2  232 ? -41.273 -10.828 21.647   1.00 208.72 ? 342  ASN B N   1 
ATOM   6357  C  CA  . ASN B  2  232 ? -40.698 -11.690 22.673   1.00 200.29 ? 342  ASN B CA  1 
ATOM   6358  C  C   . ASN B  2  232 ? -39.957 -10.861 23.722   1.00 191.62 ? 342  ASN B C   1 
ATOM   6359  O  O   . ASN B  2  232 ? -40.168 -11.032 24.926   1.00 190.84 ? 342  ASN B O   1 
ATOM   6360  C  CB  . ASN B  2  232 ? -39.739 -12.718 22.012   1.00 192.73 ? 342  ASN B CB  1 
ATOM   6361  C  CG  . ASN B  2  232 ? -40.501 -13.907 21.230   1.00 205.16 ? 342  ASN B CG  1 
ATOM   6362  O  OD1 . ASN B  2  232 ? -41.728 -14.195 21.442   1.00 235.35 ? 342  ASN B OD1 1 
ATOM   6363  N  ND2 . ASN B  2  232 ? -39.734 -14.597 20.336   1.00 198.40 ? 342  ASN B ND2 1 
ATOM   6364  N  N   . ILE B  2  233 ? -39.138 -9.903  23.278   1.00 186.11 ? 343  ILE B N   1 
ATOM   6365  C  CA  . ILE B  2  233 ? -38.400 -9.044  24.204   1.00 189.70 ? 343  ILE B CA  1 
ATOM   6366  C  C   . ILE B  2  233 ? -39.340 -8.093  24.936   1.00 190.22 ? 343  ILE B C   1 
ATOM   6367  O  O   . ILE B  2  233 ? -39.075 -7.689  26.077   1.00 200.34 ? 343  ILE B O   1 
ATOM   6368  C  CB  . ILE B  2  233 ? -37.311 -8.289  23.427   1.00 172.45 ? 343  ILE B CB  1 
ATOM   6369  C  CG1 . ILE B  2  233 ? -36.618 -9.268  22.481   1.00 192.86 ? 343  ILE B CG1 1 
ATOM   6370  C  CG2 . ILE B  2  233 ? -36.302 -7.687  24.387   1.00 162.43 ? 343  ILE B CG2 1 
ATOM   6371  C  CD1 . ILE B  2  233 ? -35.539 -8.664  21.633   1.00 190.28 ? 343  ILE B CD1 1 
ATOM   6372  N  N   . LEU B  2  234 ? -40.447 -7.722  24.301   1.00 197.62 ? 344  LEU B N   1 
ATOM   6373  C  CA  . LEU B  2  234 ? -41.416 -6.881  24.978   1.00 206.03 ? 344  LEU B CA  1 
ATOM   6374  C  C   . LEU B  2  234 ? -42.030 -7.612  26.158   1.00 208.52 ? 344  LEU B C   1 
ATOM   6375  O  O   . LEU B  2  234 ? -42.306 -6.995  27.190   1.00 209.96 ? 344  LEU B O   1 
ATOM   6376  C  CB  . LEU B  2  234 ? -42.490 -6.449  23.984   1.00 218.89 ? 344  LEU B CB  1 
ATOM   6377  C  CG  . LEU B  2  234 ? -41.957 -5.668  22.781   1.00 217.90 ? 344  LEU B CG  1 
ATOM   6378  C  CD1 . LEU B  2  234 ? -43.093 -5.145  21.925   1.00 231.80 ? 344  LEU B CD1 1 
ATOM   6379  C  CD2 . LEU B  2  234 ? -41.050 -4.534  23.223   1.00 210.26 ? 344  LEU B CD2 1 
ATOM   6380  N  N   . GLN B  2  235 ? -42.215 -8.930  26.034   1.00 209.19 ? 345  GLN B N   1 
ATOM   6381  C  CA  . GLN B  2  235 ? -42.762 -9.713  27.138   1.00 228.14 ? 345  GLN B CA  1 
ATOM   6382  C  C   . GLN B  2  235 ? -41.840 -9.690  28.351   1.00 227.90 ? 345  GLN B C   1 
ATOM   6383  O  O   . GLN B  2  235 ? -42.310 -9.794  29.490   1.00 261.78 ? 345  GLN B O   1 
ATOM   6384  C  CB  . GLN B  2  235 ? -43.015 -11.157 26.691   1.00 222.11 ? 345  GLN B CB  1 
ATOM   6385  C  CG  . GLN B  2  235 ? -44.222 -11.352 25.779   1.00 227.79 ? 345  GLN B CG  1 
ATOM   6386  C  CD  . GLN B  2  235 ? -44.506 -12.822 25.488   1.00 230.82 ? 345  GLN B CD  1 
ATOM   6387  O  OE1 . GLN B  2  235 ? -43.879 -13.714 26.062   1.00 223.31 ? 345  GLN B OE1 1 
ATOM   6388  N  NE2 . GLN B  2  235 ? -45.449 -13.077 24.587   1.00 244.90 ? 345  GLN B NE2 1 
ATOM   6389  N  N   . LEU B  2  236 ? -40.531 -9.559  28.129   1.00 199.12 ? 346  LEU B N   1 
ATOM   6390  C  CA  . LEU B  2  236 ? -39.597 -9.400  29.240   1.00 211.53 ? 346  LEU B CA  1 
ATOM   6391  C  C   . LEU B  2  236 ? -39.910 -8.139  30.034   1.00 200.14 ? 346  LEU B C   1 
ATOM   6392  O  O   . LEU B  2  236 ? -40.055 -8.176  31.262   1.00 194.15 ? 346  LEU B O   1 
ATOM   6393  C  CB  . LEU B  2  236 ? -38.165 -9.352  28.709   1.00 185.74 ? 346  LEU B CB  1 
ATOM   6394  C  CG  . LEU B  2  236 ? -37.566 -10.661 28.204   1.00 172.53 ? 346  LEU B CG  1 
ATOM   6395  C  CD1 . LEU B  2  236 ? -36.305 -10.377 27.435   1.00 163.64 ? 346  LEU B CD1 1 
ATOM   6396  C  CD2 . LEU B  2  236 ? -37.258 -11.567 29.374   1.00 169.26 ? 346  LEU B CD2 1 
ATOM   6397  N  N   . ILE B  2  237 ? -40.005 -7.006  29.341   1.00 185.61 ? 347  ILE B N   1 
ATOM   6398  C  CA  . ILE B  2  237 ? -40.139 -5.721  30.013   1.00 187.59 ? 347  ILE B CA  1 
ATOM   6399  C  C   . ILE B  2  237 ? -41.480 -5.622  30.736   1.00 198.94 ? 347  ILE B C   1 
ATOM   6400  O  O   . ILE B  2  237 ? -41.555 -5.106  31.857   1.00 199.45 ? 347  ILE B O   1 
ATOM   6401  C  CB  . ILE B  2  237 ? -39.940 -4.591  28.990   1.00 188.91 ? 347  ILE B CB  1 
ATOM   6402  C  CG1 . ILE B  2  237 ? -38.757 -4.929  28.076   1.00 179.57 ? 347  ILE B CG1 1 
ATOM   6403  C  CG2 . ILE B  2  237 ? -39.676 -3.285  29.701   1.00 187.87 ? 347  ILE B CG2 1 
ATOM   6404  C  CD1 . ILE B  2  237 ? -38.481 -3.898  27.000   1.00 180.85 ? 347  ILE B CD1 1 
ATOM   6405  N  N   . ILE B  2  238 ? -42.557 -6.112  30.108   1.00 210.44 ? 348  ILE B N   1 
ATOM   6406  C  CA  . ILE B  2  238 ? -43.886 -6.065  30.722   1.00 225.09 ? 348  ILE B CA  1 
ATOM   6407  C  C   . ILE B  2  238 ? -43.929 -6.912  31.989   1.00 225.13 ? 348  ILE B C   1 
ATOM   6408  O  O   . ILE B  2  238 ? -44.541 -6.527  32.994   1.00 227.41 ? 348  ILE B O   1 
ATOM   6409  C  CB  . ILE B  2  238 ? -44.958 -6.515  29.714   1.00 232.70 ? 348  ILE B CB  1 
ATOM   6410  C  CG1 . ILE B  2  238 ? -44.930 -5.621  28.475   1.00 235.29 ? 348  ILE B CG1 1 
ATOM   6411  C  CG2 . ILE B  2  238 ? -46.336 -6.490  30.358   1.00 246.15 ? 348  ILE B CG2 1 
ATOM   6412  C  CD1 . ILE B  2  238 ? -45.962 -5.985  27.434   1.00 247.14 ? 348  ILE B CD1 1 
ATOM   6413  N  N   . SER B  2  239 ? -43.302 -8.085  31.957   1.00 252.63 ? 349  SER B N   1 
ATOM   6414  C  CA  . SER B  2  239 ? -43.188 -8.919  33.144   1.00 241.31 ? 349  SER B CA  1 
ATOM   6415  C  C   . SER B  2  239 ? -42.024 -8.496  34.033   1.00 210.11 ? 349  SER B C   1 
ATOM   6416  O  O   . SER B  2  239 ? -41.710 -9.193  35.004   1.00 201.48 ? 349  SER B O   1 
ATOM   6417  C  CB  . SER B  2  239 ? -43.041 -10.390 32.744   1.00 241.61 ? 349  SER B CB  1 
ATOM   6418  O  OG  . SER B  2  239 ? -41.945 -10.573 31.862   1.00 226.40 ? 349  SER B OG  1 
ATOM   6419  N  N   . ALA B  2  240 ? -41.377 -7.374  33.714   1.00 197.87 ? 350  ALA B N   1 
ATOM   6420  C  CA  . ALA B  2  240 ? -40.395 -6.754  34.587   1.00 190.18 ? 350  ALA B CA  1 
ATOM   6421  C  C   . ALA B  2  240 ? -40.951 -5.520  35.279   1.00 196.30 ? 350  ALA B C   1 
ATOM   6422  O  O   . ALA B  2  240 ? -40.304 -4.985  36.186   1.00 192.01 ? 350  ALA B O   1 
ATOM   6423  C  CB  . ALA B  2  240 ? -39.130 -6.384  33.797   1.00 178.98 ? 350  ALA B CB  1 
ATOM   6424  N  N   . TYR B  2  241 ? -42.143 -5.083  34.894   1.00 210.10 ? 351  TYR B N   1 
ATOM   6425  C  CA  . TYR B  2  241 ? -42.851 -4.001  35.555   1.00 233.32 ? 351  TYR B CA  1 
ATOM   6426  C  C   . TYR B  2  241 ? -43.633 -4.503  36.762   1.00 237.24 ? 351  TYR B C   1 
ATOM   6427  O  O   . TYR B  2  241 ? -44.449 -3.762  37.320   1.00 231.40 ? 351  TYR B O   1 
ATOM   6428  C  CB  . TYR B  2  241 ? -43.786 -3.315  34.551   1.00 248.53 ? 351  TYR B CB  1 
ATOM   6429  C  CG  . TYR B  2  241 ? -44.264 -1.926  34.929   1.00 253.57 ? 351  TYR B CG  1 
ATOM   6430  C  CD1 . TYR B  2  241 ? -43.397 -0.838  34.889   1.00 222.27 ? 351  TYR B CD1 1 
ATOM   6431  C  CD2 . TYR B  2  241 ? -45.591 -1.696  35.279   1.00 241.86 ? 351  TYR B CD2 1 
ATOM   6432  C  CE1 . TYR B  2  241 ? -43.833 0.431   35.215   1.00 229.79 ? 351  TYR B CE1 1 
ATOM   6433  C  CE2 . TYR B  2  241 ? -46.034 -0.427  35.607   1.00 248.16 ? 351  TYR B CE2 1 
ATOM   6434  C  CZ  . TYR B  2  241 ? -45.149 0.631   35.572   1.00 253.17 ? 351  TYR B CZ  1 
ATOM   6435  O  OH  . TYR B  2  241 ? -45.576 1.899   35.894   1.00 254.80 ? 351  TYR B OH  1 
ATOM   6436  N  N   . GLU B  2  242 ? -43.411 -5.759  37.158   1.00 220.40 ? 352  GLU B N   1 
ATOM   6437  C  CA  . GLU B  2  242 ? -44.080 -6.317  38.328   1.00 227.95 ? 352  GLU B CA  1 
ATOM   6438  C  C   . GLU B  2  242 ? -43.695 -5.571  39.598   1.00 226.38 ? 352  GLU B C   1 
ATOM   6439  O  O   . GLU B  2  242 ? -44.532 -5.368  40.485   1.00 242.63 ? 352  GLU B O   1 
ATOM   6440  C  CB  . GLU B  2  242 ? -43.730 -7.797  38.456   1.00 224.40 ? 352  GLU B CB  1 
ATOM   6441  C  CG  . GLU B  2  242 ? -44.128 -8.628  37.253   1.00 246.60 ? 352  GLU B CG  1 
ATOM   6442  C  CD  . GLU B  2  242 ? -43.567 -10.034 37.313   1.00 258.19 ? 352  GLU B CD  1 
ATOM   6443  O  OE1 . GLU B  2  242 ? -42.738 -10.304 38.211   1.00 253.29 ? 352  GLU B OE1 1 
ATOM   6444  O  OE2 . GLU B  2  242 ? -43.950 -10.866 36.464   1.00 268.36 ? 352  GLU B OE2 1 
ATOM   6445  N  N   . GLU B  2  243 ? -42.428 -5.164  39.702   1.00 243.75 ? 353  GLU B N   1 
ATOM   6446  C  CA  . GLU B  2  243 ? -41.901 -4.443  40.857   1.00 245.53 ? 353  GLU B CA  1 
ATOM   6447  C  C   . GLU B  2  243 ? -42.123 -5.224  42.149   1.00 253.88 ? 353  GLU B C   1 
ATOM   6448  O  O   . GLU B  2  243 ? -41.548 -6.303  42.331   1.00 258.31 ? 353  GLU B O   1 
ATOM   6449  C  CB  . GLU B  2  243 ? -42.526 -3.048  40.948   1.00 238.78 ? 353  GLU B CB  1 
ATOM   6450  C  CG  . GLU B  2  243 ? -42.388 -2.222  39.673   1.00 231.54 ? 353  GLU B CG  1 
ATOM   6451  C  CD  . GLU B  2  243 ? -42.817 -0.778  39.855   1.00 237.81 ? 353  GLU B CD  1 
ATOM   6452  O  OE1 . GLU B  2  243 ? -43.772 -0.349  39.175   1.00 250.22 ? 353  GLU B OE1 1 
ATOM   6453  O  OE2 . GLU B  2  243 ? -42.213 -0.078  40.694   1.00 245.09 ? 353  GLU B OE2 1 
ATOM   6454  N  N   . LEU B  2  244 ? -42.948 -4.685  43.046   1.00 249.74 ? 354  LEU B N   1 
ATOM   6455  C  CA  . LEU B  2  244 ? -43.244 -5.303  44.343   1.00 243.32 ? 354  LEU B CA  1 
ATOM   6456  C  C   . LEU B  2  244 ? -41.981 -5.578  45.155   1.00 241.79 ? 354  LEU B C   1 
ATOM   6457  O  O   . LEU B  2  244 ? -41.994 -6.390  46.082   1.00 229.36 ? 354  LEU B O   1 
ATOM   6458  C  CB  . LEU B  2  244 ? -44.032 -6.604  44.157   1.00 241.26 ? 354  LEU B CB  1 
ATOM   6459  C  CG  . LEU B  2  244 ? -45.434 -6.481  43.558   1.00 253.59 ? 354  LEU B CG  1 
ATOM   6460  C  CD1 . LEU B  2  244 ? -46.105 -7.844  43.446   1.00 259.86 ? 354  LEU B CD1 1 
ATOM   6461  C  CD2 . LEU B  2  244 ? -46.273 -5.532  44.393   1.00 264.50 ? 354  LEU B CD2 1 
ATOM   6462  N  N   . ASP C  3  10  ? -61.596 14.308  -51.805  1.00 265.53 ? 8    ASP C N   1 
ATOM   6463  C  CA  . ASP C  3  10  ? -60.771 14.664  -50.658  1.00 261.69 ? 8    ASP C CA  1 
ATOM   6464  C  C   . ASP C  3  10  ? -59.868 13.505  -50.261  1.00 260.91 ? 8    ASP C C   1 
ATOM   6465  O  O   . ASP C  3  10  ? -58.813 13.704  -49.664  1.00 250.76 ? 8    ASP C O   1 
ATOM   6466  C  CB  . ASP C  3  10  ? -61.645 15.085  -49.476  1.00 252.59 ? 8    ASP C CB  1 
ATOM   6467  C  CG  . ASP C  3  10  ? -62.301 16.434  -49.693  1.00 257.03 ? 8    ASP C CG  1 
ATOM   6468  O  OD1 . ASP C  3  10  ? -61.667 17.303  -50.329  1.00 266.89 ? 8    ASP C OD1 1 
ATOM   6469  O  OD2 . ASP C  3  10  ? -63.448 16.627  -49.236  1.00 254.13 ? 8    ASP C OD2 1 
ATOM   6470  N  N   . MET C  3  11  ? -60.288 12.291  -50.600  1.00 277.66 ? 9    MET C N   1 
ATOM   6471  C  CA  . MET C  3  11  ? -59.486 11.109  -50.322  1.00 277.87 ? 9    MET C CA  1 
ATOM   6472  C  C   . MET C  3  11  ? -58.493 10.805  -51.434  1.00 276.44 ? 9    MET C C   1 
ATOM   6473  O  O   . MET C  3  11  ? -57.498 10.110  -51.194  1.00 263.98 ? 9    MET C O   1 
ATOM   6474  C  CB  . MET C  3  11  ? -60.403 9.903   -50.088  1.00 284.96 ? 9    MET C CB  1 
ATOM   6475  C  CG  . MET C  3  11  ? -59.697 8.662   -49.573  1.00 281.69 ? 9    MET C CG  1 
ATOM   6476  S  SD  . MET C  3  11  ? -58.904 8.899   -47.969  1.00 275.52 ? 9    MET C SD  1 
ATOM   6477  C  CE  . MET C  3  11  ? -60.330 9.140   -46.916  1.00 273.01 ? 9    MET C CE  1 
ATOM   6478  N  N   . GLU C  3  12  ? -58.736 11.312  -52.641  1.00 293.93 ? 10   GLU C N   1 
ATOM   6479  C  CA  . GLU C  3  12  ? -57.781 11.185  -53.732  1.00 295.58 ? 10   GLU C CA  1 
ATOM   6480  C  C   . GLU C  3  12  ? -56.783 12.332  -53.768  1.00 298.58 ? 10   GLU C C   1 
ATOM   6481  O  O   . GLU C  3  12  ? -55.738 12.208  -54.418  1.00 298.77 ? 10   GLU C O   1 
ATOM   6482  C  CB  . GLU C  3  12  ? -58.515 11.101  -55.077  1.00 301.13 ? 10   GLU C CB  1 
ATOM   6483  C  CG  . GLU C  3  12  ? -59.301 9.814   -55.286  1.00 300.79 ? 10   GLU C CG  1 
ATOM   6484  C  CD  . GLU C  3  12  ? -58.426 8.638   -55.694  1.00 301.28 ? 10   GLU C CD  1 
ATOM   6485  O  OE1 . GLU C  3  12  ? -57.280 8.863   -56.135  1.00 306.90 ? 10   GLU C OE1 1 
ATOM   6486  O  OE2 . GLU C  3  12  ? -58.891 7.484   -55.574  1.00 299.52 ? 10   GLU C OE2 1 
ATOM   6487  N  N   . LEU C  3  13  ? -57.083 13.443  -53.092  1.00 289.01 ? 11   LEU C N   1 
ATOM   6488  C  CA  . LEU C  3  13  ? -56.136 14.545  -53.011  1.00 271.12 ? 11   LEU C CA  1 
ATOM   6489  C  C   . LEU C  3  13  ? -55.057 14.277  -51.974  1.00 254.23 ? 11   LEU C C   1 
ATOM   6490  O  O   . LEU C  3  13  ? -53.945 14.805  -52.090  1.00 248.64 ? 11   LEU C O   1 
ATOM   6491  C  CB  . LEU C  3  13  ? -56.869 15.845  -52.683  1.00 264.81 ? 11   LEU C CB  1 
ATOM   6492  C  CG  . LEU C  3  13  ? -58.023 16.227  -53.611  1.00 258.32 ? 11   LEU C CG  1 
ATOM   6493  C  CD1 . LEU C  3  13  ? -58.670 17.520  -53.145  1.00 253.40 ? 11   LEU C CD1 1 
ATOM   6494  C  CD2 . LEU C  3  13  ? -57.530 16.351  -55.043  1.00 264.86 ? 11   LEU C CD2 1 
ATOM   6495  N  N   . VAL C  3  14  ? -55.369 13.463  -50.962  1.00 258.60 ? 12   VAL C N   1 
ATOM   6496  C  CA  . VAL C  3  14  ? -54.380 13.121  -49.948  1.00 259.41 ? 12   VAL C CA  1 
ATOM   6497  C  C   . VAL C  3  14  ? -53.281 12.257  -50.550  1.00 269.81 ? 12   VAL C C   1 
ATOM   6498  O  O   . VAL C  3  14  ? -52.097 12.418  -50.230  1.00 270.57 ? 12   VAL C O   1 
ATOM   6499  C  CB  . VAL C  3  14  ? -55.062 12.421  -48.760  1.00 256.97 ? 12   VAL C CB  1 
ATOM   6500  C  CG1 . VAL C  3  14  ? -54.027 12.006  -47.733  1.00 255.39 ? 12   VAL C CG1 1 
ATOM   6501  C  CG2 . VAL C  3  14  ? -56.099 13.329  -48.128  1.00 254.87 ? 12   VAL C CG2 1 
ATOM   6502  N  N   . LYS C  3  15  ? -53.651 11.340  -51.447  1.00 276.96 ? 13   LYS C N   1 
ATOM   6503  C  CA  . LYS C  3  15  ? -52.691 10.375  -51.971  1.00 281.06 ? 13   LYS C CA  1 
ATOM   6504  C  C   . LYS C  3  15  ? -51.721 11.008  -52.964  1.00 279.23 ? 13   LYS C C   1 
ATOM   6505  O  O   . LYS C  3  15  ? -50.579 10.550  -53.084  1.00 272.13 ? 13   LYS C O   1 
ATOM   6506  C  CB  . LYS C  3  15  ? -53.441 9.211   -52.619  1.00 285.77 ? 13   LYS C CB  1 
ATOM   6507  C  CG  . LYS C  3  15  ? -54.466 8.558   -51.702  1.00 284.14 ? 13   LYS C CG  1 
ATOM   6508  C  CD  . LYS C  3  15  ? -55.251 7.468   -52.411  1.00 278.74 ? 13   LYS C CD  1 
ATOM   6509  C  CE  . LYS C  3  15  ? -56.214 6.784   -51.453  1.00 270.82 ? 13   LYS C CE  1 
ATOM   6510  N  NZ  . LYS C  3  15  ? -56.979 5.695   -52.115  1.00 272.30 ? 13   LYS C NZ  1 
ATOM   6511  N  N   . ARG C  3  16  ? -52.142 12.060  -53.676  1.00 281.51 ? 14   ARG C N   1 
ATOM   6512  C  CA  . ARG C  3  16  ? -51.303 12.644  -54.721  1.00 275.94 ? 14   ARG C CA  1 
ATOM   6513  C  C   . ARG C  3  16  ? -50.126 13.441  -54.165  1.00 272.67 ? 14   ARG C C   1 
ATOM   6514  O  O   . ARG C  3  16  ? -49.136 13.633  -54.879  1.00 269.34 ? 14   ARG C O   1 
ATOM   6515  C  CB  . ARG C  3  16  ? -52.144 13.541  -55.633  1.00 272.12 ? 14   ARG C CB  1 
ATOM   6516  C  CG  . ARG C  3  16  ? -53.163 12.802  -56.491  1.00 268.27 ? 14   ARG C CG  1 
ATOM   6517  C  CD  . ARG C  3  16  ? -52.483 11.829  -57.439  1.00 263.49 ? 14   ARG C CD  1 
ATOM   6518  N  NE  . ARG C  3  16  ? -51.460 12.486  -58.245  1.00 262.33 ? 14   ARG C NE  1 
ATOM   6519  C  CZ  . ARG C  3  16  ? -50.710 11.867  -59.150  1.00 262.98 ? 14   ARG C CZ  1 
ATOM   6520  N  NH1 . ARG C  3  16  ? -50.867 10.569  -59.370  1.00 264.85 ? 14   ARG C NH1 1 
ATOM   6521  N  NH2 . ARG C  3  16  ? -49.802 12.546  -59.836  1.00 262.63 ? 14   ARG C NH2 1 
ATOM   6522  N  N   . LYS C  3  17  ? -50.207 13.913  -52.917  1.00 274.21 ? 15   LYS C N   1 
ATOM   6523  C  CA  . LYS C  3  17  ? -49.121 14.711  -52.354  1.00 269.15 ? 15   LYS C CA  1 
ATOM   6524  C  C   . LYS C  3  17  ? -47.926 13.848  -51.958  1.00 260.56 ? 15   LYS C C   1 
ATOM   6525  O  O   . LYS C  3  17  ? -46.776 14.271  -52.118  1.00 260.46 ? 15   LYS C O   1 
ATOM   6526  C  CB  . LYS C  3  17  ? -49.623 15.509  -51.152  1.00 270.08 ? 15   LYS C CB  1 
ATOM   6527  C  CG  . LYS C  3  17  ? -48.528 16.272  -50.418  1.00 263.33 ? 15   LYS C CG  1 
ATOM   6528  C  CD  . LYS C  3  17  ? -49.103 17.266  -49.427  1.00 262.36 ? 15   LYS C CD  1 
ATOM   6529  C  CE  . LYS C  3  17  ? -49.816 18.397  -50.145  1.00 266.06 ? 15   LYS C CE  1 
ATOM   6530  N  NZ  . LYS C  3  17  ? -50.296 19.441  -49.199  1.00 259.94 ? 15   LYS C NZ  1 
ATOM   6531  N  N   . ARG C  3  18  ? -48.176 12.639  -51.442  1.00 254.93 ? 16   ARG C N   1 
ATOM   6532  C  CA  . ARG C  3  18  ? -47.082 11.752  -51.051  1.00 254.90 ? 16   ARG C CA  1 
ATOM   6533  C  C   . ARG C  3  18  ? -46.267 11.291  -52.251  1.00 260.74 ? 16   ARG C C   1 
ATOM   6534  O  O   . ARG C  3  18  ? -45.052 11.093  -52.133  1.00 263.70 ? 16   ARG C O   1 
ATOM   6535  C  CB  . ARG C  3  18  ? -47.627 10.536  -50.303  1.00 254.55 ? 16   ARG C CB  1 
ATOM   6536  C  CG  . ARG C  3  18  ? -46.548 9.563   -49.833  1.00 252.41 ? 16   ARG C CG  1 
ATOM   6537  C  CD  . ARG C  3  18  ? -47.144 8.313   -49.204  1.00 254.72 ? 16   ARG C CD  1 
ATOM   6538  N  NE  . ARG C  3  18  ? -46.147 7.540   -48.466  1.00 250.04 ? 16   ARG C NE  1 
ATOM   6539  C  CZ  . ARG C  3  18  ? -45.354 6.625   -49.014  1.00 251.70 ? 16   ARG C CZ  1 
ATOM   6540  N  NH1 . ARG C  3  18  ? -45.436 6.367   -50.311  1.00 266.78 ? 16   ARG C NH1 1 
ATOM   6541  N  NH2 . ARG C  3  18  ? -44.477 5.970   -48.266  1.00 248.56 ? 16   ARG C NH2 1 
ATOM   6542  N  N   . ILE C  3  19  ? -46.911 11.112  -53.407  1.00 262.37 ? 17   ILE C N   1 
ATOM   6543  C  CA  . ILE C  3  19  ? -46.211 10.598  -54.581  1.00 263.07 ? 17   ILE C CA  1 
ATOM   6544  C  C   . ILE C  3  19  ? -45.095 11.547  -54.999  1.00 264.47 ? 17   ILE C C   1 
ATOM   6545  O  O   . ILE C  3  19  ? -43.982 11.115  -55.325  1.00 258.90 ? 17   ILE C O   1 
ATOM   6546  C  CB  . ILE C  3  19  ? -47.208 10.349  -55.728  1.00 276.03 ? 17   ILE C CB  1 
ATOM   6547  C  CG1 . ILE C  3  19  ? -48.259 9.321   -55.299  1.00 279.21 ? 17   ILE C CG1 1 
ATOM   6548  C  CG2 . ILE C  3  19  ? -46.480 9.881   -56.980  1.00 286.12 ? 17   ILE C CG2 1 
ATOM   6549  C  CD1 . ILE C  3  19  ? -49.289 9.003   -56.368  1.00 286.90 ? 17   ILE C CD1 1 
ATOM   6550  N  N   . GLU C  3  20  ? -45.368 12.856  -54.992  1.00 280.48 ? 18   GLU C N   1 
ATOM   6551  C  CA  . GLU C  3  20  ? -44.341 13.827  -55.354  1.00 285.35 ? 18   GLU C CA  1 
ATOM   6552  C  C   . GLU C  3  20  ? -43.237 13.914  -54.310  1.00 288.81 ? 18   GLU C C   1 
ATOM   6553  O  O   . GLU C  3  20  ? -42.138 14.386  -54.626  1.00 288.61 ? 18   GLU C O   1 
ATOM   6554  C  CB  . GLU C  3  20  ? -44.965 15.207  -55.578  1.00 283.79 ? 18   GLU C CB  1 
ATOM   6555  C  CG  . GLU C  3  20  ? -45.766 15.323  -56.869  1.00 280.03 ? 18   GLU C CG  1 
ATOM   6556  C  CD  . GLU C  3  20  ? -44.909 15.142  -58.111  1.00 276.67 ? 18   GLU C CD  1 
ATOM   6557  O  OE1 . GLU C  3  20  ? -43.718 15.520  -58.080  1.00 266.06 ? 18   GLU C OE1 1 
ATOM   6558  O  OE2 . GLU C  3  20  ? -45.426 14.616  -59.120  1.00 283.07 ? 18   GLU C OE2 1 
ATOM   6559  N  N   . ALA C  3  21  ? -43.503 13.478  -53.076  1.00 286.26 ? 19   ALA C N   1 
ATOM   6560  C  CA  . ALA C  3  21  ? -42.437 13.354  -52.090  1.00 276.72 ? 19   ALA C CA  1 
ATOM   6561  C  C   . ALA C  3  21  ? -41.632 12.079  -52.299  1.00 279.60 ? 19   ALA C C   1 
ATOM   6562  O  O   . ALA C  3  21  ? -40.444 12.039  -51.961  1.00 279.95 ? 19   ALA C O   1 
ATOM   6563  C  CB  . ALA C  3  21  ? -43.016 13.389  -50.673  1.00 265.91 ? 19   ALA C CB  1 
ATOM   6564  N  N   . ILE C  3  22  ? -42.258 11.037  -52.851  1.00 277.50 ? 20   ILE C N   1 
ATOM   6565  C  CA  . ILE C  3  22  ? -41.526 9.826   -53.208  1.00 270.16 ? 20   ILE C CA  1 
ATOM   6566  C  C   . ILE C  3  22  ? -40.607 10.091  -54.394  1.00 266.65 ? 20   ILE C C   1 
ATOM   6567  O  O   . ILE C  3  22  ? -39.472 9.598   -54.443  1.00 259.58 ? 20   ILE C O   1 
ATOM   6568  C  CB  . ILE C  3  22  ? -42.510 8.678   -53.496  1.00 266.41 ? 20   ILE C CB  1 
ATOM   6569  C  CG1 . ILE C  3  22  ? -43.243 8.259   -52.219  1.00 267.68 ? 20   ILE C CG1 1 
ATOM   6570  C  CG2 . ILE C  3  22  ? -41.786 7.494   -54.111  1.00 264.17 ? 20   ILE C CG2 1 
ATOM   6571  C  CD1 . ILE C  3  22  ? -42.347 7.622   -51.174  1.00 262.19 ? 20   ILE C CD1 1 
ATOM   6572  N  N   . ARG C  3  23  ? -41.083 10.875  -55.367  1.00 268.31 ? 21   ARG C N   1 
ATOM   6573  C  CA  . ARG C  3  23  ? -40.263 11.232  -56.520  1.00 267.96 ? 21   ARG C CA  1 
ATOM   6574  C  C   . ARG C  3  23  ? -38.989 11.945  -56.086  1.00 270.14 ? 21   ARG C C   1 
ATOM   6575  O  O   . ARG C  3  23  ? -37.887 11.597  -56.525  1.00 273.25 ? 21   ARG C O   1 
ATOM   6576  C  CB  . ARG C  3  23  ? -41.070 12.108  -57.479  1.00 266.97 ? 21   ARG C CB  1 
ATOM   6577  C  CG  . ARG C  3  23  ? -40.247 12.739  -58.589  1.00 266.82 ? 21   ARG C CG  1 
ATOM   6578  C  CD  . ARG C  3  23  ? -41.088 13.701  -59.410  1.00 267.23 ? 21   ARG C CD  1 
ATOM   6579  N  NE  . ARG C  3  23  ? -42.152 13.012  -60.133  1.00 266.03 ? 21   ARG C NE  1 
ATOM   6580  C  CZ  . ARG C  3  23  ? -42.035 12.552  -61.375  1.00 269.88 ? 21   ARG C CZ  1 
ATOM   6581  N  NH1 . ARG C  3  23  ? -40.898 12.708  -62.040  1.00 275.78 ? 21   ARG C NH1 1 
ATOM   6582  N  NH2 . ARG C  3  23  ? -43.056 11.935  -61.956  1.00 266.32 ? 21   ARG C NH2 1 
ATOM   6583  N  N   . GLY C  3  24  ? -39.121 12.951  -55.217  1.00 260.25 ? 22   GLY C N   1 
ATOM   6584  C  CA  . GLY C  3  24  ? -37.953 13.636  -54.692  1.00 253.91 ? 22   GLY C CA  1 
ATOM   6585  C  C   . GLY C  3  24  ? -37.123 12.797  -53.745  1.00 248.82 ? 22   GLY C C   1 
ATOM   6586  O  O   . GLY C  3  24  ? -35.951 13.116  -53.519  1.00 247.72 ? 22   GLY C O   1 
ATOM   6587  N  N   . GLN C  3  25  ? -37.701 11.730  -53.189  1.00 253.04 ? 23   GLN C N   1 
ATOM   6588  C  CA  . GLN C  3  25  ? -36.958 10.851  -52.292  1.00 260.40 ? 23   GLN C CA  1 
ATOM   6589  C  C   . GLN C  3  25  ? -36.095 9.866   -53.072  1.00 255.88 ? 23   GLN C C   1 
ATOM   6590  O  O   . GLN C  3  25  ? -34.891 9.749   -52.820  1.00 252.29 ? 23   GLN C O   1 
ATOM   6591  C  CB  . GLN C  3  25  ? -37.924 10.098  -51.371  1.00 266.69 ? 23   GLN C CB  1 
ATOM   6592  C  CG  . GLN C  3  25  ? -37.242 9.229   -50.319  1.00 264.72 ? 23   GLN C CG  1 
ATOM   6593  C  CD  . GLN C  3  25  ? -38.214 8.316   -49.589  1.00 260.32 ? 23   GLN C CD  1 
ATOM   6594  O  OE1 . GLN C  3  25  ? -39.288 7.998   -50.099  1.00 250.60 ? 23   GLN C OE1 1 
ATOM   6595  N  NE2 . GLN C  3  25  ? -37.838 7.891   -48.387  1.00 260.73 ? 23   GLN C NE2 1 
ATOM   6596  N  N   . ILE C  3  26  ? -36.700 9.151   -54.026  1.00 241.79 ? 24   ILE C N   1 
ATOM   6597  C  CA  . ILE C  3  26  ? -35.972 8.141   -54.793  1.00 239.25 ? 24   ILE C CA  1 
ATOM   6598  C  C   . ILE C  3  26  ? -34.795 8.774   -55.524  1.00 244.82 ? 24   ILE C C   1 
ATOM   6599  O  O   . ILE C  3  26  ? -33.684 8.231   -55.538  1.00 241.78 ? 24   ILE C O   1 
ATOM   6600  C  CB  . ILE C  3  26  ? -36.924 7.429   -55.770  1.00 241.39 ? 24   ILE C CB  1 
ATOM   6601  C  CG1 . ILE C  3  26  ? -38.054 6.734   -55.010  1.00 239.35 ? 24   ILE C CG1 1 
ATOM   6602  C  CG2 . ILE C  3  26  ? -36.161 6.432   -56.623  1.00 249.07 ? 24   ILE C CG2 1 
ATOM   6603  C  CD1 . ILE C  3  26  ? -39.040 6.023   -55.911  1.00 243.20 ? 24   ILE C CD1 1 
ATOM   6604  N  N   . LEU C  3  27  ? -35.025 9.935   -56.146  1.00 265.69 ? 25   LEU C N   1 
ATOM   6605  C  CA  . LEU C  3  27  ? -33.953 10.623  -56.857  1.00 273.86 ? 25   LEU C CA  1 
ATOM   6606  C  C   . LEU C  3  27  ? -32.848 11.070  -55.908  1.00 267.58 ? 25   LEU C C   1 
ATOM   6607  O  O   . LEU C  3  27  ? -31.673 11.096  -56.292  1.00 270.32 ? 25   LEU C O   1 
ATOM   6608  C  CB  . LEU C  3  27  ? -34.519 11.820  -57.623  1.00 281.01 ? 25   LEU C CB  1 
ATOM   6609  C  CG  . LEU C  3  27  ? -35.530 11.510  -58.732  1.00 277.75 ? 25   LEU C CG  1 
ATOM   6610  C  CD1 . LEU C  3  27  ? -36.017 12.795  -59.387  1.00 276.00 ? 25   LEU C CD1 1 
ATOM   6611  C  CD2 . LEU C  3  27  ? -34.936 10.564  -59.767  1.00 276.31 ? 25   LEU C CD2 1 
ATOM   6612  N  N   . SER C  3  28  ? -33.201 11.424  -54.670  1.00 258.26 ? 26   SER C N   1 
ATOM   6613  C  CA  . SER C  3  28  ? -32.191 11.774  -53.679  1.00 255.37 ? 26   SER C CA  1 
ATOM   6614  C  C   . SER C  3  28  ? -31.513 10.540  -53.102  1.00 257.66 ? 26   SER C C   1 
ATOM   6615  O  O   . SER C  3  28  ? -30.329 10.597  -52.749  1.00 261.09 ? 26   SER C O   1 
ATOM   6616  C  CB  . SER C  3  28  ? -32.820 12.594  -52.551  1.00 256.10 ? 26   SER C CB  1 
ATOM   6617  O  OG  . SER C  3  28  ? -33.788 11.830  -51.850  1.00 256.64 ? 26   SER C OG  1 
ATOM   6618  N  N   . LYS C  3  29  ? -32.239 9.427   -52.991  1.00 252.01 ? 27   LYS C N   1 
ATOM   6619  C  CA  . LYS C  3  29  ? -31.632 8.207   -52.473  1.00 252.19 ? 27   LYS C CA  1 
ATOM   6620  C  C   . LYS C  3  29  ? -30.708 7.574   -53.506  1.00 256.91 ? 27   LYS C C   1 
ATOM   6621  O  O   . LYS C  3  29  ? -29.678 6.991   -53.149  1.00 260.65 ? 27   LYS C O   1 
ATOM   6622  C  CB  . LYS C  3  29  ? -32.722 7.226   -52.040  1.00 253.94 ? 27   LYS C CB  1 
ATOM   6623  C  CG  . LYS C  3  29  ? -33.583 7.730   -50.888  1.00 247.31 ? 27   LYS C CG  1 
ATOM   6624  C  CD  . LYS C  3  29  ? -34.716 6.766   -50.577  1.00 250.63 ? 27   LYS C CD  1 
ATOM   6625  C  CE  . LYS C  3  29  ? -34.201 5.495   -49.926  1.00 255.76 ? 27   LYS C CE  1 
ATOM   6626  N  NZ  . LYS C  3  29  ? -33.702 5.747   -48.546  1.00 245.74 ? 27   LYS C NZ  1 
ATOM   6627  N  N   . LEU C  3  30  ? -31.053 7.685   -54.789  1.00 244.05 ? 28   LEU C N   1 
ATOM   6628  C  CA  . LEU C  3  30  ? -30.225 7.182   -55.878  1.00 237.55 ? 28   LEU C CA  1 
ATOM   6629  C  C   . LEU C  3  30  ? -29.213 8.206   -56.374  1.00 241.91 ? 28   LEU C C   1 
ATOM   6630  O  O   . LEU C  3  30  ? -28.416 7.886   -57.264  1.00 241.91 ? 28   LEU C O   1 
ATOM   6631  C  CB  . LEU C  3  30  ? -31.110 6.735   -57.044  1.00 240.40 ? 28   LEU C CB  1 
ATOM   6632  C  CG  . LEU C  3  30  ? -32.077 5.590   -56.755  1.00 240.43 ? 28   LEU C CG  1 
ATOM   6633  C  CD1 . LEU C  3  30  ? -32.929 5.305   -57.977  1.00 246.52 ? 28   LEU C CD1 1 
ATOM   6634  C  CD2 . LEU C  3  30  ? -31.313 4.348   -56.329  1.00 247.13 ? 28   LEU C CD2 1 
ATOM   6635  N  N   . ARG C  3  31  ? -29.225 9.418   -55.816  1.00 258.57 ? 29   ARG C N   1 
ATOM   6636  C  CA  . ARG C  3  31  ? -28.368 10.513  -56.269  1.00 260.04 ? 29   ARG C CA  1 
ATOM   6637  C  C   . ARG C  3  31  ? -28.526 10.748  -57.768  1.00 265.69 ? 29   ARG C C   1 
ATOM   6638  O  O   . ARG C  3  31  ? -27.550 10.936  -58.498  1.00 265.03 ? 29   ARG C O   1 
ATOM   6639  C  CB  . ARG C  3  31  ? -26.904 10.265  -55.903  1.00 249.84 ? 29   ARG C CB  1 
ATOM   6640  C  CG  . ARG C  3  31  ? -26.628 10.265  -54.409  1.00 244.79 ? 29   ARG C CG  1 
ATOM   6641  C  CD  . ARG C  3  31  ? -25.154 10.499  -54.133  1.00 250.76 ? 29   ARG C CD  1 
ATOM   6642  N  NE  . ARG C  3  31  ? -24.752 9.996   -52.823  1.00 261.21 ? 29   ARG C NE  1 
ATOM   6643  C  CZ  . ARG C  3  31  ? -24.686 10.738  -51.723  1.00 260.65 ? 29   ARG C CZ  1 
ATOM   6644  N  NH1 . ARG C  3  31  ? -24.997 12.025  -51.770  1.00 257.29 ? 29   ARG C NH1 1 
ATOM   6645  N  NH2 . ARG C  3  31  ? -24.306 10.191  -50.575  1.00 258.29 ? 29   ARG C NH2 1 
ATOM   6646  N  N   . LEU C  3  32  ? -29.772 10.729  -58.233  1.00 265.96 ? 30   LEU C N   1 
ATOM   6647  C  CA  . LEU C  3  32  ? -30.105 10.981  -59.627  1.00 264.40 ? 30   LEU C CA  1 
ATOM   6648  C  C   . LEU C  3  32  ? -30.898 12.273  -59.743  1.00 266.88 ? 30   LEU C C   1 
ATOM   6649  O  O   . LEU C  3  32  ? -31.727 12.586  -58.882  1.00 270.84 ? 30   LEU C O   1 
ATOM   6650  C  CB  . LEU C  3  32  ? -30.916 9.827   -60.225  1.00 268.97 ? 30   LEU C CB  1 
ATOM   6651  C  CG  . LEU C  3  32  ? -30.196 8.503   -60.469  1.00 275.10 ? 30   LEU C CG  1 
ATOM   6652  C  CD1 . LEU C  3  32  ? -31.147 7.493   -61.094  1.00 275.64 ? 30   LEU C CD1 1 
ATOM   6653  C  CD2 . LEU C  3  32  ? -28.981 8.715   -61.355  1.00 282.02 ? 30   LEU C CD2 1 
ATOM   6654  N  N   . ALA C  3  33  ? -30.637 13.025  -60.807  1.00 265.40 ? 31   ALA C N   1 
ATOM   6655  C  CA  . ALA C  3  33  ? -31.462 14.184  -61.113  1.00 269.72 ? 31   ALA C CA  1 
ATOM   6656  C  C   . ALA C  3  33  ? -32.596 13.838  -62.064  1.00 267.53 ? 31   ALA C C   1 
ATOM   6657  O  O   . ALA C  3  33  ? -33.673 14.439  -61.984  1.00 271.74 ? 31   ALA C O   1 
ATOM   6658  C  CB  . ALA C  3  33  ? -30.604 15.306  -61.710  1.00 277.54 ? 31   ALA C CB  1 
ATOM   6659  N  N   . SER C  3  34  ? -32.388 12.866  -62.946  1.00 270.32 ? 32   SER C N   1 
ATOM   6660  C  CA  . SER C  3  34  ? -33.395 12.483  -63.919  1.00 279.85 ? 32   SER C CA  1 
ATOM   6661  C  C   . SER C  3  34  ? -33.187 11.020  -64.276  1.00 282.92 ? 32   SER C C   1 
ATOM   6662  O  O   . SER C  3  34  ? -32.053 10.533  -64.231  1.00 284.36 ? 32   SER C O   1 
ATOM   6663  C  CB  . SER C  3  34  ? -33.313 13.356  -65.179  1.00 290.38 ? 32   SER C CB  1 
ATOM   6664  O  OG  . SER C  3  34  ? -34.231 12.915  -66.162  1.00 299.86 ? 32   SER C OG  1 
ATOM   6665  N  N   . PRO C  3  35  ? -34.258 10.293  -64.615  1.00 277.30 ? 33   PRO C N   1 
ATOM   6666  C  CA  . PRO C  3  35  ? -34.095 8.892   -65.011  1.00 271.42 ? 33   PRO C CA  1 
ATOM   6667  C  C   . PRO C  3  35  ? -33.336 8.762   -66.325  1.00 273.30 ? 33   PRO C C   1 
ATOM   6668  O  O   . PRO C  3  35  ? -33.447 9.624   -67.212  1.00 273.03 ? 33   PRO C O   1 
ATOM   6669  C  CB  . PRO C  3  35  ? -35.544 8.389   -65.148  1.00 267.57 ? 33   PRO C CB  1 
ATOM   6670  C  CG  . PRO C  3  35  ? -36.411 9.591   -65.119  1.00 268.67 ? 33   PRO C CG  1 
ATOM   6671  C  CD  . PRO C  3  35  ? -35.666 10.654  -64.388  1.00 270.39 ? 33   PRO C CD  1 
ATOM   6672  N  N   . PRO C  3  36  ? -32.570 7.685   -66.490  1.00 270.03 ? 34   PRO C N   1 
ATOM   6673  C  CA  . PRO C  3  36  ? -31.692 7.534   -67.658  1.00 272.56 ? 34   PRO C CA  1 
ATOM   6674  C  C   . PRO C  3  36  ? -32.437 7.011   -68.883  1.00 268.17 ? 34   PRO C C   1 
ATOM   6675  O  O   . PRO C  3  36  ? -33.624 6.695   -68.843  1.00 261.02 ? 34   PRO C O   1 
ATOM   6676  C  CB  . PRO C  3  36  ? -30.653 6.520   -67.175  1.00 277.39 ? 34   PRO C CB  1 
ATOM   6677  C  CG  . PRO C  3  36  ? -31.389 5.700   -66.151  1.00 271.66 ? 34   PRO C CG  1 
ATOM   6678  C  CD  . PRO C  3  36  ? -32.347 6.637   -65.478  1.00 267.44 ? 34   PRO C CD  1 
ATOM   6679  N  N   . SER C  3  37  ? -31.689 6.906   -69.989  1.00 267.59 ? 35   SER C N   1 
ATOM   6680  C  CA  . SER C  3  37  ? -32.253 6.505   -71.280  1.00 274.49 ? 35   SER C CA  1 
ATOM   6681  C  C   . SER C  3  37  ? -31.095 6.043   -72.167  1.00 277.44 ? 35   SER C C   1 
ATOM   6682  O  O   . SER C  3  37  ? -30.407 6.873   -72.768  1.00 279.49 ? 35   SER C O   1 
ATOM   6683  C  CB  . SER C  3  37  ? -33.015 7.654   -71.918  1.00 273.69 ? 35   SER C CB  1 
ATOM   6684  O  OG  . SER C  3  37  ? -32.141 8.721   -72.249  1.00 270.78 ? 35   SER C OG  1 
ATOM   6685  N  N   . GLN C  3  38  ? -30.896 4.729   -72.250  1.00 275.10 ? 36   GLN C N   1 
ATOM   6686  C  CA  . GLN C  3  38  ? -29.783 4.198   -73.029  1.00 271.84 ? 36   GLN C CA  1 
ATOM   6687  C  C   . GLN C  3  38  ? -30.200 3.063   -73.954  1.00 262.31 ? 36   GLN C C   1 
ATOM   6688  O  O   . GLN C  3  38  ? -31.395 2.793   -74.124  1.00 258.84 ? 36   GLN C O   1 
ATOM   6689  C  CB  . GLN C  3  38  ? -28.668 3.712   -72.101  1.00 271.00 ? 36   GLN C CB  1 
ATOM   6690  C  CG  . GLN C  3  38  ? -27.911 4.816   -71.393  1.00 270.07 ? 36   GLN C CG  1 
ATOM   6691  C  CD  . GLN C  3  38  ? -27.172 5.730   -72.351  1.00 277.03 ? 36   GLN C CD  1 
ATOM   6692  O  OE1 . GLN C  3  38  ? -26.958 5.394   -73.518  1.00 279.63 ? 36   GLN C OE1 1 
ATOM   6693  N  NE2 . GLN C  3  38  ? -26.775 6.896   -71.859  1.00 277.74 ? 36   GLN C NE2 1 
ATOM   6694  N  N   . GLY C  3  39  ? -29.208 2.409   -74.564  1.00 243.38 ? 37   GLY C N   1 
ATOM   6695  C  CA  . GLY C  3  39  ? -29.484 1.226   -75.362  1.00 241.69 ? 37   GLY C CA  1 
ATOM   6696  C  C   . GLY C  3  39  ? -30.076 0.114   -74.518  1.00 234.91 ? 37   GLY C C   1 
ATOM   6697  O  O   . GLY C  3  39  ? -29.779 -0.007  -73.324  1.00 233.68 ? 37   GLY C O   1 
ATOM   6698  N  N   . GLU C  3  40  ? -30.920 -0.708  -75.153  1.00 238.73 ? 38   GLU C N   1 
ATOM   6699  C  CA  . GLU C  3  40  ? -31.891 -1.547  -74.448  1.00 236.26 ? 38   GLU C CA  1 
ATOM   6700  C  C   . GLU C  3  40  ? -31.651 -3.024  -74.728  1.00 239.64 ? 38   GLU C C   1 
ATOM   6701  O  O   . GLU C  3  40  ? -31.582 -3.449  -75.889  1.00 238.71 ? 38   GLU C O   1 
ATOM   6702  C  CB  . GLU C  3  40  ? -33.346 -1.187  -74.831  1.00 220.14 ? 38   GLU C CB  1 
ATOM   6703  C  CG  . GLU C  3  40  ? -34.444 -1.722  -73.774  1.00 218.80 ? 38   GLU C CG  1 
ATOM   6704  C  CD  . GLU C  3  40  ? -36.017 -1.544  -74.186  1.00 221.27 ? 38   GLU C CD  1 
ATOM   6705  O  OE1 . GLU C  3  40  ? -36.388 -0.696  -75.098  1.00 223.47 ? 38   GLU C OE1 1 
ATOM   6706  O  OE2 . GLU C  3  40  ? -36.884 -2.275  -73.563  1.00 221.36 ? 38   GLU C OE2 1 
ATOM   6707  N  N   . VAL C  3  41  ? -31.519 -3.790  -73.656  1.00 271.41 ? 39   VAL C N   1 
ATOM   6708  C  CA  . VAL C  3  41  ? -31.416 -5.239  -73.695  1.00 275.12 ? 39   VAL C CA  1 
ATOM   6709  C  C   . VAL C  3  41  ? -32.144 -5.713  -72.443  1.00 280.91 ? 39   VAL C C   1 
ATOM   6710  O  O   . VAL C  3  41  ? -32.043 -5.060  -71.404  1.00 269.19 ? 39   VAL C O   1 
ATOM   6711  C  CB  . VAL C  3  41  ? -29.947 -5.711  -73.721  1.00 271.10 ? 39   VAL C CB  1 
ATOM   6712  C  CG1 . VAL C  3  41  ? -29.862 -7.216  -73.588  1.00 278.99 ? 39   VAL C CG1 1 
ATOM   6713  C  CG2 . VAL C  3  41  ? -29.241 -5.249  -74.994  1.00 267.35 ? 39   VAL C CG2 1 
ATOM   6714  N  N   . PRO C  3  42  ? -32.909 -6.816  -72.521  1.00 308.03 ? 40   PRO C N   1 
ATOM   6715  C  CA  . PRO C  3  42  ? -33.337 -7.649  -73.648  1.00 319.30 ? 40   PRO C CA  1 
ATOM   6716  C  C   . PRO C  3  42  ? -34.837 -7.532  -73.944  1.00 329.09 ? 40   PRO C C   1 
ATOM   6717  O  O   . PRO C  3  42  ? -35.612 -7.209  -73.040  1.00 331.34 ? 40   PRO C O   1 
ATOM   6718  C  CB  . PRO C  3  42  ? -32.991 -9.063  -73.165  1.00 309.92 ? 40   PRO C CB  1 
ATOM   6719  C  CG  . PRO C  3  42  ? -33.046 -8.974  -71.631  1.00 300.22 ? 40   PRO C CG  1 
ATOM   6720  C  CD  . PRO C  3  42  ? -33.156 -7.510  -71.246  1.00 301.15 ? 40   PRO C CD  1 
ATOM   6721  N  N   . PRO C  3  43  ? -35.247 -7.791  -75.191  1.00 340.13 ? 41   PRO C N   1 
ATOM   6722  C  CA  . PRO C  3  43  ? -36.685 -7.769  -75.503  1.00 335.60 ? 41   PRO C CA  1 
ATOM   6723  C  C   . PRO C  3  43  ? -37.460 -8.885  -74.828  1.00 329.14 ? 41   PRO C C   1 
ATOM   6724  O  O   . PRO C  3  43  ? -38.694 -8.808  -74.757  1.00 337.62 ? 41   PRO C O   1 
ATOM   6725  C  CB  . PRO C  3  43  ? -36.717 -7.907  -77.031  1.00 339.89 ? 41   PRO C CB  1 
ATOM   6726  C  CG  . PRO C  3  43  ? -35.454 -8.624  -77.363  1.00 343.10 ? 41   PRO C CG  1 
ATOM   6727  C  CD  . PRO C  3  43  ? -34.431 -8.142  -76.367  1.00 339.64 ? 41   PRO C CD  1 
ATOM   6728  N  N   . GLY C  3  44  ? -36.779 -9.920  -74.339  1.00 350.97 ? 42   GLY C N   1 
ATOM   6729  C  CA  . GLY C  3  44  ? -37.400 -10.952 -73.546  1.00 332.84 ? 42   GLY C CA  1 
ATOM   6730  C  C   . GLY C  3  44  ? -37.075 -10.783 -72.074  1.00 307.04 ? 42   GLY C C   1 
ATOM   6731  O  O   . GLY C  3  44  ? -36.709 -9.693  -71.619  1.00 293.89 ? 42   GLY C O   1 
ATOM   6732  N  N   . PRO C  3  45  ? -37.194 -11.862 -71.300  1.00 287.12 ? 43   PRO C N   1 
ATOM   6733  C  CA  . PRO C  3  45  ? -36.956 -11.762 -69.852  1.00 277.37 ? 43   PRO C CA  1 
ATOM   6734  C  C   . PRO C  3  45  ? -35.481 -11.541 -69.546  1.00 287.11 ? 43   PRO C C   1 
ATOM   6735  O  O   . PRO C  3  45  ? -34.605 -12.204 -70.108  1.00 289.87 ? 43   PRO C O   1 
ATOM   6736  C  CB  . PRO C  3  45  ? -37.455 -13.109 -69.314  1.00 276.93 ? 43   PRO C CB  1 
ATOM   6737  C  CG  . PRO C  3  45  ? -37.351 -14.037 -70.473  1.00 291.64 ? 43   PRO C CG  1 
ATOM   6738  C  CD  . PRO C  3  45  ? -37.617 -13.214 -71.703  1.00 297.90 ? 43   PRO C CD  1 
ATOM   6739  N  N   . LEU C  3  46  ? -35.220 -10.598 -68.639  1.00 277.70 ? 44   LEU C N   1 
ATOM   6740  C  CA  . LEU C  3  46  ? -33.901 -10.139 -68.217  1.00 269.62 ? 44   LEU C CA  1 
ATOM   6741  C  C   . LEU C  3  46  ? -32.978 -11.294 -67.844  1.00 269.34 ? 44   LEU C C   1 
ATOM   6742  O  O   . LEU C  3  46  ? -33.458 -12.361 -67.438  1.00 259.72 ? 44   LEU C O   1 
ATOM   6743  C  CB  . LEU C  3  46  ? -34.055 -9.188  -67.032  1.00 249.11 ? 44   LEU C CB  1 
ATOM   6744  C  CG  . LEU C  3  46  ? -35.316 -8.335  -67.111  1.00 250.59 ? 44   LEU C CG  1 
ATOM   6745  C  CD1 . LEU C  3  46  ? -36.346 -8.790  -66.089  1.00 248.57 ? 44   LEU C CD1 1 
ATOM   6746  C  CD2 . LEU C  3  46  ? -34.946 -6.892  -66.911  1.00 251.50 ? 44   LEU C CD2 1 
ATOM   6747  N  N   . PRO C  3  47  ? -31.657 -11.118 -67.953  1.00 283.91 ? 45   PRO C N   1 
ATOM   6748  C  CA  . PRO C  3  47  ? -30.739 -12.225 -67.654  1.00 285.25 ? 45   PRO C CA  1 
ATOM   6749  C  C   . PRO C  3  47  ? -30.867 -12.680 -66.209  1.00 263.66 ? 45   PRO C C   1 
ATOM   6750  O  O   . PRO C  3  47  ? -31.007 -11.868 -65.293  1.00 255.69 ? 45   PRO C O   1 
ATOM   6751  C  CB  . PRO C  3  47  ? -29.355 -11.627 -67.936  1.00 287.29 ? 45   PRO C CB  1 
ATOM   6752  C  CG  . PRO C  3  47  ? -29.544 -10.155 -67.803  1.00 275.97 ? 45   PRO C CG  1 
ATOM   6753  C  CD  . PRO C  3  47  ? -30.928 -9.890  -68.319  1.00 283.78 ? 45   PRO C CD  1 
ATOM   6754  N  N   . GLU C  3  48  ? -30.816 -13.999 -66.016  1.00 261.73 ? 46   GLU C N   1 
ATOM   6755  C  CA  . GLU C  3  48  ? -31.044 -14.606 -64.711  1.00 251.39 ? 46   GLU C CA  1 
ATOM   6756  C  C   . GLU C  3  48  ? -29.843 -14.504 -63.783  1.00 234.83 ? 46   GLU C C   1 
ATOM   6757  O  O   . GLU C  3  48  ? -29.905 -15.023 -62.662  1.00 227.98 ? 46   GLU C O   1 
ATOM   6758  C  CB  . GLU C  3  48  ? -31.442 -16.075 -64.876  1.00 248.50 ? 46   GLU C CB  1 
ATOM   6759  C  CG  . GLU C  3  48  ? -32.778 -16.271 -65.570  1.00 248.79 ? 46   GLU C CG  1 
ATOM   6760  C  CD  . GLU C  3  48  ? -33.291 -17.690 -65.461  1.00 249.74 ? 46   GLU C CD  1 
ATOM   6761  O  OE1 . GLU C  3  48  ? -32.491 -18.590 -65.133  1.00 243.59 ? 46   GLU C OE1 1 
ATOM   6762  O  OE2 . GLU C  3  48  ? -34.499 -17.902 -65.697  1.00 260.38 ? 46   GLU C OE2 1 
ATOM   6763  N  N   . ALA C  3  49  ? -28.754 -13.865 -64.214  1.00 239.34 ? 47   ALA C N   1 
ATOM   6764  C  CA  . ALA C  3  49  ? -27.662 -13.591 -63.288  1.00 241.82 ? 47   ALA C CA  1 
ATOM   6765  C  C   . ALA C  3  49  ? -28.059 -12.515 -62.287  1.00 243.35 ? 47   ALA C C   1 
ATOM   6766  O  O   . ALA C  3  49  ? -27.733 -12.614 -61.098  1.00 223.18 ? 47   ALA C O   1 
ATOM   6767  C  CB  . ALA C  3  49  ? -26.410 -13.174 -64.058  1.00 243.39 ? 47   ALA C CB  1 
ATOM   6768  N  N   . VAL C  3  50  ? -28.761 -11.479 -62.753  1.00 261.76 ? 48   VAL C N   1 
ATOM   6769  C  CA  . VAL C  3  50  ? -29.264 -10.449 -61.852  1.00 239.44 ? 48   VAL C CA  1 
ATOM   6770  C  C   . VAL C  3  50  ? -30.616 -10.829 -61.268  1.00 234.61 ? 48   VAL C C   1 
ATOM   6771  O  O   . VAL C  3  50  ? -31.007 -10.283 -60.229  1.00 240.29 ? 48   VAL C O   1 
ATOM   6772  C  CB  . VAL C  3  50  ? -29.360 -9.088  -62.561  1.00 240.22 ? 48   VAL C CB  1 
ATOM   6773  C  CG1 . VAL C  3  50  ? -28.012 -8.703  -63.148  1.00 248.63 ? 48   VAL C CG1 1 
ATOM   6774  C  CG2 . VAL C  3  50  ? -30.439 -9.115  -63.639  1.00 246.57 ? 48   VAL C CG2 1 
ATOM   6775  N  N   . LEU C  3  51  ? -31.346 -11.747 -61.912  1.00 228.99 ? 49   LEU C N   1 
ATOM   6776  C  CA  . LEU C  3  51  ? -32.580 -12.245 -61.319  1.00 225.16 ? 49   LEU C CA  1 
ATOM   6777  C  C   . LEU C  3  51  ? -32.293 -13.156 -60.134  1.00 242.41 ? 49   LEU C C   1 
ATOM   6778  O  O   . LEU C  3  51  ? -33.135 -13.285 -59.237  1.00 244.91 ? 49   LEU C O   1 
ATOM   6779  C  CB  . LEU C  3  51  ? -33.418 -12.979 -62.368  1.00 221.51 ? 49   LEU C CB  1 
ATOM   6780  C  CG  . LEU C  3  51  ? -34.040 -12.114 -63.468  1.00 233.22 ? 49   LEU C CG  1 
ATOM   6781  C  CD1 . LEU C  3  51  ? -34.887 -12.959 -64.411  1.00 249.86 ? 49   LEU C CD1 1 
ATOM   6782  C  CD2 . LEU C  3  51  ? -34.864 -10.981 -62.876  1.00 225.84 ? 49   LEU C CD2 1 
ATOM   6783  N  N   . ALA C  3  52  ? -31.118 -13.792 -60.114  1.00 249.38 ? 50   ALA C N   1 
ATOM   6784  C  CA  . ALA C  3  52  ? -30.721 -14.570 -58.947  1.00 236.81 ? 50   ALA C CA  1 
ATOM   6785  C  C   . ALA C  3  52  ? -30.408 -13.662 -57.768  1.00 217.04 ? 50   ALA C C   1 
ATOM   6786  O  O   . ALA C  3  52  ? -30.706 -14.004 -56.618  1.00 209.22 ? 50   ALA C O   1 
ATOM   6787  C  CB  . ALA C  3  52  ? -29.512 -15.448 -59.284  1.00 244.07 ? 50   ALA C CB  1 
ATOM   6788  N  N   . LEU C  3  53  ? -29.799 -12.504 -58.036  1.00 220.66 ? 51   LEU C N   1 
ATOM   6789  C  CA  . LEU C  3  53  ? -29.610 -11.504 -56.993  1.00 218.57 ? 51   LEU C CA  1 
ATOM   6790  C  C   . LEU C  3  53  ? -30.947 -10.966 -56.508  1.00 218.19 ? 51   LEU C C   1 
ATOM   6791  O  O   . LEU C  3  53  ? -31.181 -10.854 -55.299  1.00 227.06 ? 51   LEU C O   1 
ATOM   6792  C  CB  . LEU C  3  53  ? -28.737 -10.359 -57.510  1.00 227.91 ? 51   LEU C CB  1 
ATOM   6793  C  CG  . LEU C  3  53  ? -27.219 -10.478 -57.374  1.00 234.44 ? 51   LEU C CG  1 
ATOM   6794  C  CD1 . LEU C  3  53  ? -26.660 -11.555 -58.294  1.00 246.62 ? 51   LEU C CD1 1 
ATOM   6795  C  CD2 . LEU C  3  53  ? -26.564 -9.134  -57.652  1.00 230.85 ? 51   LEU C CD2 1 
ATOM   6796  N  N   . TYR C  3  54  ? -31.838 -10.624 -57.440  1.00 210.33 ? 52   TYR C N   1 
ATOM   6797  C  CA  . TYR C  3  54  ? -33.116 -10.038 -57.056  1.00 211.79 ? 52   TYR C CA  1 
ATOM   6798  C  C   . TYR C  3  54  ? -33.992 -11.048 -56.328  1.00 214.80 ? 52   TYR C C   1 
ATOM   6799  O  O   . TYR C  3  54  ? -34.740 -10.682 -55.414  1.00 227.24 ? 52   TYR C O   1 
ATOM   6800  C  CB  . TYR C  3  54  ? -33.831 -9.498  -58.291  1.00 223.20 ? 52   TYR C CB  1 
ATOM   6801  C  CG  . TYR C  3  54  ? -35.155 -8.840  -57.988  1.00 229.69 ? 52   TYR C CG  1 
ATOM   6802  C  CD1 . TYR C  3  54  ? -35.211 -7.588  -57.389  1.00 222.34 ? 52   TYR C CD1 1 
ATOM   6803  C  CD2 . TYR C  3  54  ? -36.351 -9.467  -58.309  1.00 246.13 ? 52   TYR C CD2 1 
ATOM   6804  C  CE1 . TYR C  3  54  ? -36.423 -6.983  -57.115  1.00 229.82 ? 52   TYR C CE1 1 
ATOM   6805  C  CE2 . TYR C  3  54  ? -37.564 -8.872  -58.041  1.00 249.66 ? 52   TYR C CE2 1 
ATOM   6806  C  CZ  . TYR C  3  54  ? -37.596 -7.631  -57.443  1.00 242.88 ? 52   TYR C CZ  1 
ATOM   6807  O  OH  . TYR C  3  54  ? -38.811 -7.042  -57.175  1.00 244.36 ? 52   TYR C OH  1 
ATOM   6808  N  N   . ASN C  3  55  ? -33.913 -12.324 -56.715  1.00 215.38 ? 53   ASN C N   1 
ATOM   6809  C  CA  . ASN C  3  55  ? -34.663 -13.362 -56.017  1.00 226.46 ? 53   ASN C CA  1 
ATOM   6810  C  C   . ASN C  3  55  ? -34.047 -13.706 -54.666  1.00 238.05 ? 53   ASN C C   1 
ATOM   6811  O  O   . ASN C  3  55  ? -34.740 -14.268 -53.809  1.00 236.14 ? 53   ASN C O   1 
ATOM   6812  C  CB  . ASN C  3  55  ? -34.764 -14.609 -56.897  1.00 233.21 ? 53   ASN C CB  1 
ATOM   6813  C  CG  . ASN C  3  55  ? -35.827 -14.475 -57.976  1.00 252.24 ? 53   ASN C CG  1 
ATOM   6814  O  OD1 . ASN C  3  55  ? -36.398 -13.402 -58.171  1.00 241.30 ? 53   ASN C OD1 1 
ATOM   6815  N  ND2 . ASN C  3  55  ? -36.097 -15.561 -58.684  1.00 329.34 ? 53   ASN C ND2 1 
ATOM   6816  N  N   . SER C  3  56  ? -32.770 -13.378 -54.455  1.00 249.02 ? 54   SER C N   1 
ATOM   6817  C  CA  . SER C  3  56  ? -32.123 -13.578 -53.164  1.00 235.89 ? 54   SER C CA  1 
ATOM   6818  C  C   . SER C  3  56  ? -32.297 -12.395 -52.224  1.00 223.98 ? 54   SER C C   1 
ATOM   6819  O  O   . SER C  3  56  ? -32.121 -12.557 -51.012  1.00 223.95 ? 54   SER C O   1 
ATOM   6820  C  CB  . SER C  3  56  ? -30.627 -13.847 -53.355  1.00 228.59 ? 54   SER C CB  1 
ATOM   6821  O  OG  . SER C  3  56  ? -30.406 -14.958 -54.207  1.00 233.63 ? 54   SER C OG  1 
ATOM   6822  N  N   . THR C  3  57  ? -32.634 -11.214 -52.749  1.00 211.78 ? 55   THR C N   1 
ATOM   6823  C  CA  . THR C  3  57  ? -32.825 -10.048 -51.896  1.00 206.85 ? 55   THR C CA  1 
ATOM   6824  C  C   . THR C  3  57  ? -34.245 -9.963  -51.350  1.00 214.54 ? 55   THR C C   1 
ATOM   6825  O  O   . THR C  3  57  ? -34.439 -9.521  -50.211  1.00 229.93 ? 55   THR C O   1 
ATOM   6826  C  CB  . THR C  3  57  ? -32.486 -8.772  -52.663  1.00 209.60 ? 55   THR C CB  1 
ATOM   6827  O  OG1 . THR C  3  57  ? -31.259 -8.957  -53.376  1.00 223.21 ? 55   THR C OG1 1 
ATOM   6828  C  CG2 . THR C  3  57  ? -32.321 -7.610  -51.697  1.00 210.89 ? 55   THR C CG2 1 
ATOM   6829  N  N   . ARG C  3  58  ? -35.244 -10.372 -52.136  1.00 210.52 ? 56   ARG C N   1 
ATOM   6830  C  CA  . ARG C  3  58  ? -36.609 -10.453 -51.631  1.00 212.16 ? 56   ARG C CA  1 
ATOM   6831  C  C   . ARG C  3  58  ? -36.810 -11.629 -50.688  1.00 211.98 ? 56   ARG C C   1 
ATOM   6832  O  O   . ARG C  3  58  ? -37.848 -11.700 -50.021  1.00 211.17 ? 56   ARG C O   1 
ATOM   6833  C  CB  . ARG C  3  58  ? -37.601 -10.563 -52.793  1.00 218.11 ? 56   ARG C CB  1 
ATOM   6834  C  CG  . ARG C  3  58  ? -37.538 -9.414  -53.786  1.00 215.73 ? 56   ARG C CG  1 
ATOM   6835  C  CD  . ARG C  3  58  ? -38.766 -9.375  -54.687  1.00 216.89 ? 56   ARG C CD  1 
ATOM   6836  N  NE  . ARG C  3  58  ? -38.823 -10.506 -55.608  1.00 216.65 ? 56   ARG C NE  1 
ATOM   6837  C  CZ  . ARG C  3  58  ? -39.571 -11.587 -55.419  1.00 224.40 ? 56   ARG C CZ  1 
ATOM   6838  N  NH1 . ARG C  3  58  ? -40.331 -11.690 -54.338  1.00 217.36 ? 56   ARG C NH1 1 
ATOM   6839  N  NH2 . ARG C  3  58  ? -39.560 -12.565 -56.314  1.00 242.00 ? 56   ARG C NH2 1 
ATOM   6840  N  N   . ASP C  3  59  ? -35.844 -12.546 -50.617  1.00 231.17 ? 57   ASP C N   1 
ATOM   6841  C  CA  . ASP C  3  59  ? -35.991 -13.800 -49.880  1.00 238.19 ? 57   ASP C CA  1 
ATOM   6842  C  C   . ASP C  3  59  ? -35.615 -13.564 -48.420  1.00 224.38 ? 57   ASP C C   1 
ATOM   6843  O  O   . ASP C  3  59  ? -34.486 -13.798 -47.982  1.00 228.59 ? 57   ASP C O   1 
ATOM   6844  C  CB  . ASP C  3  59  ? -35.132 -14.885 -50.521  1.00 246.62 ? 57   ASP C CB  1 
ATOM   6845  C  CG  . ASP C  3  59  ? -35.350 -16.261 -49.904  1.00 246.57 ? 57   ASP C CG  1 
ATOM   6846  O  OD1 . ASP C  3  59  ? -36.021 -16.363 -48.853  1.00 249.12 ? 57   ASP C OD1 1 
ATOM   6847  O  OD2 . ASP C  3  59  ? -34.835 -17.248 -50.473  1.00 241.93 ? 57   ASP C OD2 1 
ATOM   6848  N  N   . ARG C  3  60  ? -36.595 -13.108 -47.645  1.00 214.05 ? 58   ARG C N   1 
ATOM   6849  C  CA  . ARG C  3  60  ? -36.430 -12.963 -46.204  1.00 222.43 ? 58   ARG C CA  1 
ATOM   6850  C  C   . ARG C  3  60  ? -37.050 -14.187 -45.537  1.00 216.67 ? 58   ARG C C   1 
ATOM   6851  O  O   . ARG C  3  60  ? -38.240 -14.471 -45.716  1.00 214.53 ? 58   ARG C O   1 
ATOM   6852  C  CB  . ARG C  3  60  ? -37.033 -11.649 -45.697  1.00 243.96 ? 58   ARG C CB  1 
ATOM   6853  C  CG  . ARG C  3  60  ? -38.554 -11.492 -45.804  1.00 256.48 ? 58   ARG C CG  1 
ATOM   6854  C  CD  . ARG C  3  60  ? -39.235 -11.707 -44.448  1.00 245.63 ? 58   ARG C CD  1 
ATOM   6855  N  NE  . ARG C  3  60  ? -40.625 -12.141 -44.579  1.00 230.43 ? 58   ARG C NE  1 
ATOM   6856  C  CZ  . ARG C  3  60  ? -41.355 -12.620 -43.576  1.00 219.41 ? 58   ARG C CZ  1 
ATOM   6857  N  NH1 . ARG C  3  60  ? -40.830 -12.727 -42.362  1.00 216.79 ? 58   ARG C NH1 1 
ATOM   6858  N  NH2 . ARG C  3  60  ? -42.609 -12.995 -43.785  1.00 222.43 ? 58   ARG C NH2 1 
ATOM   6859  N  N   . VAL C  3  61  ? -36.221 -14.950 -44.826  1.00 216.76 ? 59   VAL C N   1 
ATOM   6860  C  CA  . VAL C  3  61  ? -36.701 -16.015 -43.953  1.00 227.24 ? 59   VAL C CA  1 
ATOM   6861  C  C   . VAL C  3  61  ? -35.942 -15.903 -42.636  1.00 237.40 ? 59   VAL C C   1 
ATOM   6862  O  O   . VAL C  3  61  ? -36.438 -15.304 -41.673  1.00 248.05 ? 59   VAL C O   1 
ATOM   6863  C  CB  . VAL C  3  61  ? -36.536 -17.412 -44.585  1.00 226.02 ? 59   VAL C CB  1 
ATOM   6864  C  CG1 . VAL C  3  61  ? -37.250 -18.448 -43.747  1.00 230.95 ? 59   VAL C CG1 1 
ATOM   6865  C  CG2 . VAL C  3  61  ? -37.064 -17.443 -46.015  1.00 219.95 ? 59   VAL C CG2 1 
ATOM   6866  N  N   . ALA C  3  62  ? -34.736 -16.470 -42.591  1.00 239.54 ? 60   ALA C N   1 
ATOM   6867  C  CA  . ALA C  3  62  ? -33.819 -16.345 -41.449  1.00 233.67 ? 60   ALA C CA  1 
ATOM   6868  C  C   . ALA C  3  62  ? -34.390 -16.885 -40.137  1.00 230.64 ? 60   ALA C C   1 
ATOM   6869  O  O   . ALA C  3  62  ? -35.521 -17.370 -40.078  1.00 233.12 ? 60   ALA C O   1 
ATOM   6870  C  CB  . ALA C  3  62  ? -33.397 -14.888 -41.271  1.00 226.05 ? 60   ALA C CB  1 
ATOM   6871  N  N   . ALA C  3  74  ? -29.608 8.765   -40.263  1.00 219.26 ? 72   ALA C N   1 
ATOM   6872  C  CA  . ALA C  3  74  ? -28.447 7.950   -40.597  1.00 215.17 ? 72   ALA C CA  1 
ATOM   6873  C  C   . ALA C  3  74  ? -28.292 7.802   -42.110  1.00 221.76 ? 72   ALA C C   1 
ATOM   6874  O  O   . ALA C  3  74  ? -28.385 8.783   -42.849  1.00 226.09 ? 72   ALA C O   1 
ATOM   6875  C  CB  . ALA C  3  74  ? -28.551 6.584   -39.937  1.00 206.24 ? 72   ALA C CB  1 
ATOM   6876  N  N   . ASP C  3  75  ? -28.062 6.570   -42.564  1.00 230.73 ? 73   ASP C N   1 
ATOM   6877  C  CA  . ASP C  3  75  ? -27.786 6.287   -43.973  1.00 229.56 ? 73   ASP C CA  1 
ATOM   6878  C  C   . ASP C  3  75  ? -29.100 6.076   -44.709  1.00 228.81 ? 73   ASP C C   1 
ATOM   6879  O  O   . ASP C  3  75  ? -29.661 4.978   -44.703  1.00 223.57 ? 73   ASP C O   1 
ATOM   6880  C  CB  . ASP C  3  75  ? -26.883 5.069   -44.111  1.00 236.46 ? 73   ASP C CB  1 
ATOM   6881  C  CG  . ASP C  3  75  ? -25.519 5.293   -43.510  1.00 249.84 ? 73   ASP C CG  1 
ATOM   6882  O  OD1 . ASP C  3  75  ? -25.354 5.039   -42.298  1.00 257.22 ? 73   ASP C OD1 1 
ATOM   6883  O  OD2 . ASP C  3  75  ? -24.613 5.729   -44.250  1.00 249.74 ? 73   ASP C OD2 1 
ATOM   6884  N  N   . TYR C  3  76  ? -29.584 7.130   -45.359  1.00 237.28 ? 74   TYR C N   1 
ATOM   6885  C  CA  . TYR C  3  76  ? -30.804 7.056   -46.146  1.00 243.94 ? 74   TYR C CA  1 
ATOM   6886  C  C   . TYR C  3  76  ? -30.548 6.771   -47.617  1.00 237.63 ? 74   TYR C C   1 
ATOM   6887  O  O   . TYR C  3  76  ? -31.497 6.456   -48.342  1.00 237.19 ? 74   TYR C O   1 
ATOM   6888  C  CB  . TYR C  3  76  ? -31.598 8.361   -46.017  1.00 264.54 ? 74   TYR C CB  1 
ATOM   6889  C  CG  . TYR C  3  76  ? -32.343 8.493   -44.709  1.00 277.41 ? 74   TYR C CG  1 
ATOM   6890  C  CD1 . TYR C  3  76  ? -33.573 7.872   -44.526  1.00 269.79 ? 74   TYR C CD1 1 
ATOM   6891  C  CD2 . TYR C  3  76  ? -31.821 9.239   -43.660  1.00 277.29 ? 74   TYR C CD2 1 
ATOM   6892  C  CE1 . TYR C  3  76  ? -34.261 7.987   -43.334  1.00 257.30 ? 74   TYR C CE1 1 
ATOM   6893  C  CE2 . TYR C  3  76  ? -32.503 9.361   -42.463  1.00 267.13 ? 74   TYR C CE2 1 
ATOM   6894  C  CZ  . TYR C  3  76  ? -33.722 8.733   -42.306  1.00 257.82 ? 74   TYR C CZ  1 
ATOM   6895  O  OH  . TYR C  3  76  ? -34.403 8.851   -41.118  1.00 257.23 ? 74   TYR C OH  1 
ATOM   6896  N  N   . TYR C  3  77  ? -29.303 6.864   -48.075  1.00 232.56 ? 75   TYR C N   1 
ATOM   6897  C  CA  . TYR C  3  77  ? -29.010 6.670   -49.486  1.00 239.24 ? 75   TYR C CA  1 
ATOM   6898  C  C   . TYR C  3  77  ? -29.087 5.185   -49.850  1.00 245.60 ? 75   TYR C C   1 
ATOM   6899  O  O   . TYR C  3  77  ? -29.300 4.311   -49.003  1.00 248.01 ? 75   TYR C O   1 
ATOM   6900  C  CB  . TYR C  3  77  ? -27.641 7.253   -49.827  1.00 244.46 ? 75   TYR C CB  1 
ATOM   6901  C  CG  . TYR C  3  77  ? -27.553 8.760   -49.681  1.00 253.33 ? 75   TYR C CG  1 
ATOM   6902  C  CD1 . TYR C  3  77  ? -27.908 9.603   -50.727  1.00 254.32 ? 75   TYR C CD1 1 
ATOM   6903  C  CD2 . TYR C  3  77  ? -27.107 9.338   -48.498  1.00 259.10 ? 75   TYR C CD2 1 
ATOM   6904  C  CE1 . TYR C  3  77  ? -27.826 10.980  -50.596  1.00 255.07 ? 75   TYR C CE1 1 
ATOM   6905  C  CE2 . TYR C  3  77  ? -27.020 10.712  -48.359  1.00 259.63 ? 75   TYR C CE2 1 
ATOM   6906  C  CZ  . TYR C  3  77  ? -27.380 11.527  -49.411  1.00 253.81 ? 75   TYR C CZ  1 
ATOM   6907  O  OH  . TYR C  3  77  ? -27.295 12.894  -49.273  1.00 251.39 ? 75   TYR C OH  1 
ATOM   6908  N  N   . ALA C  3  78  ? -28.908 4.899   -51.139  1.00 244.22 ? 76   ALA C N   1 
ATOM   6909  C  CA  . ALA C  3  78  ? -29.055 3.556   -51.681  1.00 236.38 ? 76   ALA C CA  1 
ATOM   6910  C  C   . ALA C  3  78  ? -27.757 2.763   -51.564  1.00 230.75 ? 76   ALA C C   1 
ATOM   6911  O  O   . ALA C  3  78  ? -26.661 3.320   -51.465  1.00 238.58 ? 76   ALA C O   1 
ATOM   6912  C  CB  . ALA C  3  78  ? -29.491 3.610   -53.145  1.00 234.44 ? 76   ALA C CB  1 
ATOM   6913  N  N   . LYS C  3  79  ? -27.897 1.440   -51.587  1.00 218.81 ? 77   LYS C N   1 
ATOM   6914  C  CA  . LYS C  3  79  ? -26.766 0.528   -51.486  1.00 215.09 ? 77   LYS C CA  1 
ATOM   6915  C  C   . LYS C  3  79  ? -26.805 -0.438  -52.660  1.00 226.86 ? 77   LYS C C   1 
ATOM   6916  O  O   . LYS C  3  79  ? -27.832 -1.080  -52.900  1.00 232.94 ? 77   LYS C O   1 
ATOM   6917  C  CB  . LYS C  3  79  ? -26.795 -0.245  -50.163  1.00 211.61 ? 77   LYS C CB  1 
ATOM   6918  C  CG  . LYS C  3  79  ? -27.071 0.619   -48.942  1.00 213.09 ? 77   LYS C CG  1 
ATOM   6919  C  CD  . LYS C  3  79  ? -25.965 1.635   -48.708  1.00 220.28 ? 77   LYS C CD  1 
ATOM   6920  C  CE  . LYS C  3  79  ? -26.241 2.464   -47.461  1.00 218.27 ? 77   LYS C CE  1 
ATOM   6921  N  NZ  . LYS C  3  79  ? -25.193 3.491   -47.205  1.00 222.98 ? 77   LYS C NZ  1 
ATOM   6922  N  N   . GLU C  3  80  ? -25.692 -0.539  -53.388  1.00 233.11 ? 78   GLU C N   1 
ATOM   6923  C  CA  . GLU C  3  80  ? -25.606 -1.436  -54.536  1.00 232.07 ? 78   GLU C CA  1 
ATOM   6924  C  C   . GLU C  3  80  ? -25.321 -2.854  -54.052  1.00 235.13 ? 78   GLU C C   1 
ATOM   6925  O  O   . GLU C  3  80  ? -24.301 -3.104  -53.401  1.00 236.95 ? 78   GLU C O   1 
ATOM   6926  C  CB  . GLU C  3  80  ? -24.525 -0.964  -55.508  1.00 226.53 ? 78   GLU C CB  1 
ATOM   6927  C  CG  . GLU C  3  80  ? -24.367 -1.844  -56.745  1.00 221.61 ? 78   GLU C CG  1 
ATOM   6928  C  CD  . GLU C  3  80  ? -23.382 -1.274  -57.752  1.00 222.14 ? 78   GLU C CD  1 
ATOM   6929  O  OE1 . GLU C  3  80  ? -23.012 -0.089  -57.626  1.00 225.66 ? 78   GLU C OE1 1 
ATOM   6930  O  OE2 . GLU C  3  80  ? -22.977 -2.014  -58.672  1.00 220.34 ? 78   GLU C OE2 1 
ATOM   6931  N  N   . VAL C  3  81  ? -26.219 -3.782  -54.377  1.00 232.86 ? 79   VAL C N   1 
ATOM   6932  C  CA  . VAL C  3  81  ? -26.175 -5.144  -53.853  1.00 229.59 ? 79   VAL C CA  1 
ATOM   6933  C  C   . VAL C  3  81  ? -25.513 -6.051  -54.882  1.00 240.04 ? 79   VAL C C   1 
ATOM   6934  O  O   . VAL C  3  81  ? -25.946 -6.117  -56.039  1.00 248.67 ? 79   VAL C O   1 
ATOM   6935  C  CB  . VAL C  3  81  ? -27.582 -5.649  -53.496  1.00 230.69 ? 79   VAL C CB  1 
ATOM   6936  C  CG1 . VAL C  3  81  ? -27.527 -7.093  -53.035  1.00 230.52 ? 79   VAL C CG1 1 
ATOM   6937  C  CG2 . VAL C  3  81  ? -28.201 -4.770  -52.422  1.00 224.24 ? 79   VAL C CG2 1 
ATOM   6938  N  N   . THR C  3  82  ? -24.469 -6.760  -54.454  1.00 239.27 ? 80   THR C N   1 
ATOM   6939  C  CA  . THR C  3  82  ? -23.777 -7.741  -55.277  1.00 237.66 ? 80   THR C CA  1 
ATOM   6940  C  C   . THR C  3  82  ? -23.482 -8.969  -54.425  1.00 225.16 ? 80   THR C C   1 
ATOM   6941  O  O   . THR C  3  82  ? -23.444 -8.898  -53.195  1.00 219.05 ? 80   THR C O   1 
ATOM   6942  C  CB  . THR C  3  82  ? -22.475 -7.179  -55.867  1.00 242.52 ? 80   THR C CB  1 
ATOM   6943  O  OG1 . THR C  3  82  ? -21.683 -6.595  -54.823  1.00 228.43 ? 80   THR C OG1 1 
ATOM   6944  C  CG2 . THR C  3  82  ? -22.774 -6.124  -56.929  1.00 248.81 ? 80   THR C CG2 1 
ATOM   6945  N  N   . ARG C  3  83  ? -23.271 -10.104 -55.089  1.00 223.91 ? 81   ARG C N   1 
ATOM   6946  C  CA  . ARG C  3  83  ? -23.044 -11.364 -54.395  1.00 215.20 ? 81   ARG C CA  1 
ATOM   6947  C  C   . ARG C  3  83  ? -21.840 -12.087 -54.988  1.00 216.87 ? 81   ARG C C   1 
ATOM   6948  O  O   . ARG C  3  83  ? -21.394 -11.792 -56.101  1.00 232.61 ? 81   ARG C O   1 
ATOM   6949  C  CB  . ARG C  3  83  ? -24.276 -12.275 -54.463  1.00 213.50 ? 81   ARG C CB  1 
ATOM   6950  C  CG  . ARG C  3  83  ? -24.408 -13.022 -55.777  1.00 228.58 ? 81   ARG C CG  1 
ATOM   6951  C  CD  . ARG C  3  83  ? -25.484 -14.090 -55.715  1.00 229.60 ? 81   ARG C CD  1 
ATOM   6952  N  NE  . ARG C  3  83  ? -25.499 -14.902 -56.928  1.00 230.15 ? 81   ARG C NE  1 
ATOM   6953  C  CZ  . ARG C  3  83  ? -26.302 -15.941 -57.124  1.00 230.30 ? 81   ARG C CZ  1 
ATOM   6954  N  NH1 . ARG C  3  83  ? -27.165 -16.304 -56.184  1.00 219.65 ? 81   ARG C NH1 1 
ATOM   6955  N  NH2 . ARG C  3  83  ? -26.241 -16.617 -58.263  1.00 241.90 ? 81   ARG C NH2 1 
ATOM   6956  N  N   . VAL C  3  84  ? -21.323 -13.052 -54.226  1.00 209.70 ? 82   VAL C N   1 
ATOM   6957  C  CA  . VAL C  3  84  ? -20.199 -13.887 -54.645  1.00 217.62 ? 82   VAL C CA  1 
ATOM   6958  C  C   . VAL C  3  84  ? -20.409 -15.299 -54.110  1.00 220.65 ? 82   VAL C C   1 
ATOM   6959  O  O   . VAL C  3  84  ? -20.641 -15.486 -52.911  1.00 210.39 ? 82   VAL C O   1 
ATOM   6960  C  CB  . VAL C  3  84  ? -18.846 -13.324 -54.161  1.00 217.55 ? 82   VAL C CB  1 
ATOM   6961  C  CG1 . VAL C  3  84  ? -18.356 -12.227 -55.095  1.00 229.80 ? 82   VAL C CG1 1 
ATOM   6962  C  CG2 . VAL C  3  84  ? -18.962 -12.800 -52.738  1.00 211.82 ? 82   VAL C CG2 1 
ATOM   6963  N  N   . LEU C  3  85  ? -20.316 -16.291 -54.995  1.00 247.82 ? 83   LEU C N   1 
ATOM   6964  C  CA  . LEU C  3  85  ? -20.470 -17.688 -54.614  1.00 244.46 ? 83   LEU C CA  1 
ATOM   6965  C  C   . LEU C  3  85  ? -19.181 -18.218 -53.983  1.00 241.86 ? 83   LEU C C   1 
ATOM   6966  O  O   . LEU C  3  85  ? -18.126 -17.579 -54.020  1.00 251.32 ? 83   LEU C O   1 
ATOM   6967  C  CB  . LEU C  3  85  ? -20.853 -18.537 -55.825  1.00 243.50 ? 83   LEU C CB  1 
ATOM   6968  C  CG  . LEU C  3  85  ? -22.153 -18.170 -56.544  1.00 236.35 ? 83   LEU C CG  1 
ATOM   6969  C  CD1 . LEU C  3  85  ? -22.279 -18.945 -57.848  1.00 251.38 ? 83   LEU C CD1 1 
ATOM   6970  C  CD2 . LEU C  3  85  ? -23.357 -18.424 -55.647  1.00 221.19 ? 83   LEU C CD2 1 
ATOM   6971  N  N   . MET C  3  86  ? -19.271 -19.415 -53.404  1.00 222.91 ? 84   MET C N   1 
ATOM   6972  C  CA  . MET C  3  86  ? -18.139 -20.007 -52.712  1.00 217.05 ? 84   MET C CA  1 
ATOM   6973  C  C   . MET C  3  86  ? -17.323 -20.880 -53.660  1.00 221.78 ? 84   MET C C   1 
ATOM   6974  O  O   . MET C  3  86  ? -17.559 -20.930 -54.869  1.00 229.57 ? 84   MET C O   1 
ATOM   6975  C  CB  . MET C  3  86  ? -18.605 -20.813 -51.501  1.00 217.95 ? 84   MET C CB  1 
ATOM   6976  C  CG  . MET C  3  86  ? -19.366 -22.086 -51.839  1.00 222.29 ? 84   MET C CG  1 
ATOM   6977  S  SD  . MET C  3  86  ? -19.596 -23.138 -50.390  1.00 221.45 ? 84   MET C SD  1 
ATOM   6978  C  CE  . MET C  3  86  ? -20.373 -24.584 -51.111  1.00 234.64 ? 84   MET C CE  1 
ATOM   6979  N  N   . VAL C  3  87  ? -16.343 -21.583 -53.097  1.00 229.18 ? 85   VAL C N   1 
ATOM   6980  C  CA  . VAL C  3  87  ? -15.457 -22.455 -53.855  1.00 248.20 ? 85   VAL C CA  1 
ATOM   6981  C  C   . VAL C  3  87  ? -15.948 -23.890 -53.728  1.00 252.01 ? 85   VAL C C   1 
ATOM   6982  O  O   . VAL C  3  87  ? -16.529 -24.292 -52.714  1.00 268.59 ? 85   VAL C O   1 
ATOM   6983  C  CB  . VAL C  3  87  ? -13.996 -22.311 -53.377  1.00 248.23 ? 85   VAL C CB  1 
ATOM   6984  C  CG1 . VAL C  3  87  ? -13.059 -23.149 -54.236  1.00 250.16 ? 85   VAL C CG1 1 
ATOM   6985  C  CG2 . VAL C  3  87  ? -13.576 -20.851 -53.408  1.00 242.93 ? 85   VAL C CG2 1 
ATOM   6986  N  N   . GLU C  3  88  ? -15.714 -24.670 -54.779  1.00 235.02 ? 86   GLU C N   1 
ATOM   6987  C  CA  . GLU C  3  88  ? -16.125 -26.062 -54.810  1.00 234.82 ? 86   GLU C CA  1 
ATOM   6988  C  C   . GLU C  3  88  ? -15.314 -26.881 -53.815  1.00 238.17 ? 86   GLU C C   1 
ATOM   6989  O  O   . GLU C  3  88  ? -14.396 -26.390 -53.156  1.00 233.03 ? 86   GLU C O   1 
ATOM   6990  C  CB  . GLU C  3  88  ? -15.977 -26.610 -56.225  1.00 244.40 ? 86   GLU C CB  1 
ATOM   6991  C  CG  . GLU C  3  88  ? -16.585 -25.705 -57.277  1.00 243.50 ? 86   GLU C CG  1 
ATOM   6992  C  CD  . GLU C  3  88  ? -16.214 -26.098 -58.687  1.00 256.31 ? 86   GLU C CD  1 
ATOM   6993  O  OE1 . GLU C  3  88  ? -15.554 -27.142 -58.864  1.00 256.09 ? 86   GLU C OE1 1 
ATOM   6994  O  OE2 . GLU C  3  88  ? -16.583 -25.355 -59.620  1.00 265.45 ? 86   GLU C OE2 1 
ATOM   6995  N  N   . THR C  3  89  ? -15.662 -28.162 -53.713  1.00 248.79 ? 87   THR C N   1 
ATOM   6996  C  CA  . THR C  3  89  ? -14.832 -29.096 -52.964  1.00 245.47 ? 87   THR C CA  1 
ATOM   6997  C  C   . THR C  3  89  ? -13.489 -29.337 -53.638  1.00 238.68 ? 87   THR C C   1 
ATOM   6998  O  O   . THR C  3  89  ? -12.660 -30.075 -53.094  1.00 232.60 ? 87   THR C O   1 
ATOM   6999  C  CB  . THR C  3  89  ? -15.576 -30.416 -52.772  1.00 241.96 ? 87   THR C CB  1 
ATOM   7000  O  OG1 . THR C  3  89  ? -16.061 -30.883 -54.040  1.00 235.52 ? 87   THR C OG1 1 
ATOM   7001  C  CG2 . THR C  3  89  ? -16.747 -30.221 -51.816  1.00 231.58 ? 87   THR C CG2 1 
ATOM   7002  N  N   . HIS C  3  90  ? -13.266 -28.735 -54.800  1.00 233.01 ? 88   HIS C N   1 
ATOM   7003  C  CA  . HIS C  3  90  ? -11.980 -28.755 -55.480  1.00 233.75 ? 88   HIS C CA  1 
ATOM   7004  C  C   . HIS C  3  90  ? -11.157 -27.558 -55.003  1.00 234.33 ? 88   HIS C C   1 
ATOM   7005  O  O   . HIS C  3  90  ? -11.442 -26.979 -53.953  1.00 234.46 ? 88   HIS C O   1 
ATOM   7006  C  CB  . HIS C  3  90  ? -12.195 -28.750 -56.995  1.00 234.06 ? 88   HIS C CB  1 
ATOM   7007  C  CG  . HIS C  3  90  ? -13.186 -29.765 -57.467  1.00 247.11 ? 88   HIS C CG  1 
ATOM   7008  N  ND1 . HIS C  3  90  ? -14.534 -29.672 -57.194  1.00 230.97 ? 88   HIS C ND1 1 
ATOM   7009  C  CD2 . HIS C  3  90  ? -13.026 -30.894 -58.196  1.00 272.29 ? 88   HIS C CD2 1 
ATOM   7010  C  CE1 . HIS C  3  90  ? -15.161 -30.702 -57.733  1.00 256.75 ? 88   HIS C CE1 1 
ATOM   7011  N  NE2 . HIS C  3  90  ? -14.269 -31.458 -58.347  1.00 275.11 ? 88   HIS C NE2 1 
ATOM   7012  N  N   . ASN C  3  91  ? -10.132 -27.178 -55.763  1.00 246.90 ? 89   ASN C N   1 
ATOM   7013  C  CA  . ASN C  3  91  ? -9.361  -25.956 -55.518  1.00 246.86 ? 89   ASN C CA  1 
ATOM   7014  C  C   . ASN C  3  91  ? -8.814  -25.902 -54.091  1.00 238.96 ? 89   ASN C C   1 
ATOM   7015  O  O   . ASN C  3  91  ? -8.952  -24.901 -53.383  1.00 228.62 ? 89   ASN C O   1 
ATOM   7016  C  CB  . ASN C  3  91  ? -10.195 -24.714 -55.834  1.00 231.88 ? 89   ASN C CB  1 
ATOM   7017  C  CG  . ASN C  3  91  ? -10.417 -24.530 -57.324  1.00 247.35 ? 89   ASN C CG  1 
ATOM   7018  O  OD1 . ASN C  3  91  ? -9.630  -25.007 -58.144  1.00 269.66 ? 89   ASN C OD1 1 
ATOM   7019  N  ND2 . ASN C  3  91  ? -11.489 -23.832 -57.683  1.00 234.48 ? 89   ASN C ND2 1 
ATOM   7020  N  N   . GLU C  3  92  ? -8.189  -27.004 -53.674  1.00 243.41 ? 90   GLU C N   1 
ATOM   7021  C  CA  . GLU C  3  92  ? -7.428  -27.126 -52.434  1.00 237.35 ? 90   GLU C CA  1 
ATOM   7022  C  C   . GLU C  3  92  ? -8.292  -27.083 -51.182  1.00 232.32 ? 90   GLU C C   1 
ATOM   7023  O  O   . GLU C  3  92  ? -7.752  -26.968 -50.072  1.00 233.93 ? 90   GLU C O   1 
ATOM   7024  C  CB  . GLU C  3  92  ? -6.337  -26.055 -52.341  1.00 237.86 ? 90   GLU C CB  1 
ATOM   7025  C  CG  . GLU C  3  92  ? -5.342  -26.104 -53.488  1.00 246.66 ? 90   GLU C CG  1 
ATOM   7026  C  CD  . GLU C  3  92  ? -4.408  -24.916 -53.498  1.00 247.33 ? 90   GLU C CD  1 
ATOM   7027  O  OE1 . GLU C  3  92  ? -4.652  -23.972 -52.720  1.00 251.98 ? 90   GLU C OE1 1 
ATOM   7028  O  OE2 . GLU C  3  92  ? -3.431  -24.927 -54.279  1.00 241.47 ? 90   GLU C OE2 1 
ATOM   7029  N  N   . ILE C  3  93  ? -9.620  -27.170 -51.317  1.00 232.56 ? 91   ILE C N   1 
ATOM   7030  C  CA  . ILE C  3  93  ? -10.488 -27.294 -50.146  1.00 233.72 ? 91   ILE C CA  1 
ATOM   7031  C  C   . ILE C  3  93  ? -10.450 -28.697 -49.564  1.00 241.81 ? 91   ILE C C   1 
ATOM   7032  O  O   . ILE C  3  93  ? -11.053 -28.945 -48.510  1.00 239.79 ? 91   ILE C O   1 
ATOM   7033  C  CB  . ILE C  3  93  ? -11.919 -26.864 -50.533  1.00 236.01 ? 91   ILE C CB  1 
ATOM   7034  C  CG1 . ILE C  3  93  ? -11.885 -25.555 -51.324  1.00 230.82 ? 91   ILE C CG1 1 
ATOM   7035  C  CG2 . ILE C  3  93  ? -12.789 -26.656 -49.305  1.00 232.21 ? 91   ILE C CG2 1 
ATOM   7036  C  CD1 . ILE C  3  93  ? -11.204 -24.414 -50.600  1.00 225.17 ? 91   ILE C CD1 1 
ATOM   7037  N  N   . TYR C  3  94  ? -9.728  -29.618 -50.203  1.00 254.94 ? 92   TYR C N   1 
ATOM   7038  C  CA  . TYR C  3  94  ? -9.690  -31.011 -49.789  1.00 261.58 ? 92   TYR C CA  1 
ATOM   7039  C  C   . TYR C  3  94  ? -8.414  -31.404 -49.055  1.00 271.58 ? 92   TYR C C   1 
ATOM   7040  O  O   . TYR C  3  94  ? -8.377  -32.484 -48.454  1.00 269.94 ? 92   TYR C O   1 
ATOM   7041  C  CB  . TYR C  3  94  ? -9.884  -31.931 -51.010  1.00 255.70 ? 92   TYR C CB  1 
ATOM   7042  C  CG  . TYR C  3  94  ? -9.044  -31.582 -52.225  1.00 244.16 ? 92   TYR C CG  1 
ATOM   7043  C  CD1 . TYR C  3  94  ? -9.436  -30.578 -53.104  1.00 242.80 ? 92   TYR C CD1 1 
ATOM   7044  C  CD2 . TYR C  3  94  ? -7.875  -32.278 -52.511  1.00 240.20 ? 92   TYR C CD2 1 
ATOM   7045  C  CE1 . TYR C  3  94  ? -8.678  -30.264 -54.216  1.00 252.88 ? 92   TYR C CE1 1 
ATOM   7046  C  CE2 . TYR C  3  94  ? -7.110  -31.971 -53.622  1.00 240.72 ? 92   TYR C CE2 1 
ATOM   7047  C  CZ  . TYR C  3  94  ? -7.517  -30.963 -54.472  1.00 244.00 ? 92   TYR C CZ  1 
ATOM   7048  O  OH  . TYR C  3  94  ? -6.764  -30.652 -55.581  1.00 234.28 ? 92   TYR C OH  1 
ATOM   7049  N  N   . ASP C  3  95  ? -7.376  -30.565 -49.071  1.00 275.30 ? 93   ASP C N   1 
ATOM   7050  C  CA  . ASP C  3  95  ? -6.119  -30.906 -48.416  1.00 274.41 ? 93   ASP C CA  1 
ATOM   7051  C  C   . ASP C  3  95  ? -6.145  -30.678 -46.911  1.00 263.63 ? 93   ASP C C   1 
ATOM   7052  O  O   . ASP C  3  95  ? -5.221  -31.124 -46.219  1.00 259.77 ? 93   ASP C O   1 
ATOM   7053  C  CB  . ASP C  3  95  ? -4.966  -30.098 -49.024  1.00 266.76 ? 93   ASP C CB  1 
ATOM   7054  C  CG  . ASP C  3  95  ? -4.767  -30.374 -50.505  1.00 265.00 ? 93   ASP C CG  1 
ATOM   7055  O  OD1 . ASP C  3  95  ? -5.423  -31.292 -51.039  1.00 264.39 ? 93   ASP C OD1 1 
ATOM   7056  O  OD2 . ASP C  3  95  ? -3.942  -29.679 -51.135  1.00 266.25 ? 93   ASP C OD2 1 
ATOM   7057  N  N   . LYS C  3  96  ? -7.167  -30.014 -46.388  1.00 263.49 ? 94   LYS C N   1 
ATOM   7058  C  CA  . LYS C  3  96  ? -7.158  -29.574 -44.999  1.00 267.41 ? 94   LYS C CA  1 
ATOM   7059  C  C   . LYS C  3  96  ? -8.289  -30.150 -44.159  1.00 280.41 ? 94   LYS C C   1 
ATOM   7060  O  O   . LYS C  3  96  ? -8.074  -30.456 -42.982  1.00 279.93 ? 94   LYS C O   1 
ATOM   7061  C  CB  . LYS C  3  96  ? -7.211  -28.042 -44.942  1.00 261.74 ? 94   LYS C CB  1 
ATOM   7062  C  CG  . LYS C  3  96  ? -6.027  -27.349 -45.591  1.00 259.02 ? 94   LYS C CG  1 
ATOM   7063  C  CD  . LYS C  3  96  ? -4.782  -27.500 -44.745  1.00 256.97 ? 94   LYS C CD  1 
ATOM   7064  C  CE  . LYS C  3  96  ? -3.749  -26.461 -45.124  1.00 253.56 ? 94   LYS C CE  1 
ATOM   7065  N  NZ  . LYS C  3  96  ? -3.463  -26.475 -46.583  1.00 254.55 ? 94   LYS C NZ  1 
ATOM   7066  N  N   . PHE C  3  97  ? -9.489  -30.311 -44.717  1.00 290.78 ? 95   PHE C N   1 
ATOM   7067  C  CA  . PHE C  3  97  ? -10.640 -30.633 -43.882  1.00 293.74 ? 95   PHE C CA  1 
ATOM   7068  C  C   . PHE C  3  97  ? -11.331 -31.922 -44.320  1.00 302.50 ? 95   PHE C C   1 
ATOM   7069  O  O   . PHE C  3  97  ? -10.791 -33.004 -44.117  1.00 319.33 ? 95   PHE C O   1 
ATOM   7070  C  CB  . PHE C  3  97  ? -11.627 -29.471 -43.898  1.00 294.95 ? 95   PHE C CB  1 
ATOM   7071  C  CG  . PHE C  3  97  ? -10.969 -28.127 -43.828  1.00 302.76 ? 95   PHE C CG  1 
ATOM   7072  C  CD1 . PHE C  3  97  ? -10.614 -27.582 -42.604  1.00 291.84 ? 95   PHE C CD1 1 
ATOM   7073  C  CD2 . PHE C  3  97  ? -10.682 -27.422 -44.985  1.00 307.21 ? 95   PHE C CD2 1 
ATOM   7074  C  CE1 . PHE C  3  97  ? -9.997  -26.354 -42.533  1.00 283.28 ? 95   PHE C CE1 1 
ATOM   7075  C  CE2 . PHE C  3  97  ? -10.061 -26.190 -44.919  1.00 301.13 ? 95   PHE C CE2 1 
ATOM   7076  C  CZ  . PHE C  3  97  ? -9.718  -25.655 -43.688  1.00 288.73 ? 95   PHE C CZ  1 
ATOM   7077  N  N   . LYS C  3  98  ? -12.540 -31.781 -44.870  1.00 300.29 ? 96   LYS C N   1 
ATOM   7078  C  CA  . LYS C  3  98  ? -13.292 -32.834 -45.557  1.00 309.59 ? 96   LYS C CA  1 
ATOM   7079  C  C   . LYS C  3  98  ? -14.070 -33.767 -44.629  1.00 313.03 ? 96   LYS C C   1 
ATOM   7080  O  O   . LYS C  3  98  ? -15.277 -33.941 -44.816  1.00 310.53 ? 96   LYS C O   1 
ATOM   7081  C  CB  . LYS C  3  98  ? -12.368 -33.655 -46.463  1.00 314.75 ? 96   LYS C CB  1 
ATOM   7082  C  CG  . LYS C  3  98  ? -13.040 -34.881 -47.075  1.00 314.25 ? 96   LYS C CG  1 
ATOM   7083  C  CD  . LYS C  3  98  ? -12.035 -35.808 -47.753  1.00 313.46 ? 96   LYS C CD  1 
ATOM   7084  C  CE  . LYS C  3  98  ? -12.686 -37.131 -48.154  1.00 318.11 ? 96   LYS C CE  1 
ATOM   7085  N  NZ  . LYS C  3  98  ? -11.736 -38.092 -48.792  1.00 328.01 ? 96   LYS C NZ  1 
ATOM   7086  N  N   . GLN C  3  99  ? -13.418 -34.371 -43.632  1.00 317.42 ? 97   GLN C N   1 
ATOM   7087  C  CA  . GLN C  3  99  ? -13.972 -35.556 -42.977  1.00 320.11 ? 97   GLN C CA  1 
ATOM   7088  C  C   . GLN C  3  99  ? -14.510 -35.312 -41.570  1.00 318.62 ? 97   GLN C C   1 
ATOM   7089  O  O   . GLN C  3  99  ? -14.822 -36.282 -40.868  1.00 322.59 ? 97   GLN C O   1 
ATOM   7090  C  CB  . GLN C  3  99  ? -12.933 -36.679 -42.914  1.00 319.48 ? 97   GLN C CB  1 
ATOM   7091  C  CG  . GLN C  3  99  ? -11.942 -36.708 -44.063  1.00 323.75 ? 97   GLN C CG  1 
ATOM   7092  C  CD  . GLN C  3  99  ? -10.628 -36.037 -43.708  1.00 320.47 ? 97   GLN C CD  1 
ATOM   7093  O  OE1 . GLN C  3  99  ? -10.488 -35.453 -42.632  1.00 327.70 ? 97   GLN C OE1 1 
ATOM   7094  N  NE2 . GLN C  3  99  ? -9.657  -36.120 -44.611  1.00 313.52 ? 97   GLN C NE2 1 
ATOM   7095  N  N   . SER C  3  100 ? -14.621 -34.064 -41.124  1.00 300.08 ? 98   SER C N   1 
ATOM   7096  C  CA  . SER C  3  100 ? -15.295 -33.815 -39.851  1.00 289.74 ? 98   SER C CA  1 
ATOM   7097  C  C   . SER C  3  100 ? -16.785 -33.825 -40.154  1.00 293.46 ? 98   SER C C   1 
ATOM   7098  O  O   . SER C  3  100 ? -17.382 -32.806 -40.504  1.00 289.09 ? 98   SER C O   1 
ATOM   7099  C  CB  . SER C  3  100 ? -14.837 -32.509 -39.216  1.00 280.80 ? 98   SER C CB  1 
ATOM   7100  O  OG  . SER C  3  100 ? -15.158 -31.404 -40.033  1.00 277.56 ? 98   SER C OG  1 
ATOM   7101  N  N   . THR C  3  101 ? -17.387 -35.015 -40.035  1.00 300.27 ? 99   THR C N   1 
ATOM   7102  C  CA  . THR C  3  101 ? -18.770 -35.211 -40.451  1.00 297.77 ? 99   THR C CA  1 
ATOM   7103  C  C   . THR C  3  101 ? -19.735 -34.317 -39.691  1.00 291.33 ? 99   THR C C   1 
ATOM   7104  O  O   . THR C  3  101 ? -20.877 -34.150 -40.130  1.00 289.34 ? 99   THR C O   1 
ATOM   7105  C  CB  . THR C  3  101 ? -19.181 -36.675 -40.270  1.00 295.49 ? 99   THR C CB  1 
ATOM   7106  O  OG1 . THR C  3  101 ? -19.207 -36.998 -38.874  1.00 290.94 ? 99   THR C OG1 1 
ATOM   7107  C  CG2 . THR C  3  101 ? -18.205 -37.596 -40.987  1.00 294.88 ? 99   THR C CG2 1 
ATOM   7108  N  N   . HIS C  3  102 ? -19.306 -33.735 -38.569  1.00 285.46 ? 100  HIS C N   1 
ATOM   7109  C  CA  . HIS C  3  102 ? -20.143 -32.860 -37.758  1.00 284.19 ? 100  HIS C CA  1 
ATOM   7110  C  C   . HIS C  3  102 ? -19.844 -31.383 -37.992  1.00 275.46 ? 100  HIS C C   1 
ATOM   7111  O  O   . HIS C  3  102 ? -20.051 -30.558 -37.094  1.00 269.35 ? 100  HIS C O   1 
ATOM   7112  C  CB  . HIS C  3  102 ? -19.981 -33.204 -36.279  1.00 288.83 ? 100  HIS C CB  1 
ATOM   7113  C  CG  . HIS C  3  102 ? -20.303 -34.627 -35.951  1.00 298.98 ? 100  HIS C CG  1 
ATOM   7114  N  ND1 . HIS C  3  102 ? -21.557 -35.032 -35.549  1.00 300.42 ? 100  HIS C ND1 1 
ATOM   7115  C  CD2 . HIS C  3  102 ? -19.536 -35.742 -35.969  1.00 302.17 ? 100  HIS C CD2 1 
ATOM   7116  C  CE1 . HIS C  3  102 ? -21.548 -36.335 -35.330  1.00 304.75 ? 100  HIS C CE1 1 
ATOM   7117  N  NE2 . HIS C  3  102 ? -20.333 -36.790 -35.576  1.00 306.74 ? 100  HIS C NE2 1 
ATOM   7118  N  N   . SER C  3  103 ? -19.362 -31.027 -39.180  1.00 283.95 ? 101  SER C N   1 
ATOM   7119  C  CA  . SER C  3  103 ? -19.025 -29.640 -39.470  1.00 278.55 ? 101  SER C CA  1 
ATOM   7120  C  C   . SER C  3  103 ? -19.045 -29.422 -40.977  1.00 281.18 ? 101  SER C C   1 
ATOM   7121  O  O   . SER C  3  103 ? -18.996 -30.372 -41.762  1.00 288.12 ? 101  SER C O   1 
ATOM   7122  C  CB  . SER C  3  103 ? -17.658 -29.264 -38.886  1.00 276.43 ? 101  SER C CB  1 
ATOM   7123  O  OG  . SER C  3  103 ? -17.612 -29.504 -37.489  1.00 273.75 ? 101  SER C OG  1 
ATOM   7124  N  N   . ILE C  3  104 ? -19.119 -28.150 -41.368  1.00 270.54 ? 102  ILE C N   1 
ATOM   7125  C  CA  . ILE C  3  104 ? -19.109 -27.749 -42.772  1.00 267.60 ? 102  ILE C CA  1 
ATOM   7126  C  C   . ILE C  3  104 ? -18.195 -26.540 -42.922  1.00 263.88 ? 102  ILE C C   1 
ATOM   7127  O  O   . ILE C  3  104 ? -18.311 -25.571 -42.164  1.00 254.59 ? 102  ILE C O   1 
ATOM   7128  C  CB  . ILE C  3  104 ? -20.525 -27.432 -43.291  1.00 259.88 ? 102  ILE C CB  1 
ATOM   7129  C  CG1 . ILE C  3  104 ? -21.270 -28.730 -43.621  1.00 266.12 ? 102  ILE C CG1 1 
ATOM   7130  C  CG2 . ILE C  3  104 ? -20.463 -26.513 -44.501  1.00 259.02 ? 102  ILE C CG2 1 
ATOM   7131  C  CD1 . ILE C  3  104 ? -22.656 -28.531 -44.197  1.00 265.45 ? 102  ILE C CD1 1 
ATOM   7132  N  N   . TYR C  3  105 ? -17.292 -26.591 -43.899  1.00 274.10 ? 103  TYR C N   1 
ATOM   7133  C  CA  . TYR C  3  105 ? -16.306 -25.541 -44.115  1.00 272.96 ? 103  TYR C CA  1 
ATOM   7134  C  C   . TYR C  3  105 ? -16.573 -24.825 -45.432  1.00 272.66 ? 103  TYR C C   1 
ATOM   7135  O  O   . TYR C  3  105 ? -16.860 -25.463 -46.449  1.00 281.45 ? 103  TYR C O   1 
ATOM   7136  C  CB  . TYR C  3  105 ? -14.889 -26.115 -44.115  1.00 277.70 ? 103  TYR C CB  1 
ATOM   7137  C  CG  . TYR C  3  105 ? -14.609 -27.011 -42.936  1.00 278.27 ? 103  TYR C CG  1 
ATOM   7138  C  CD1 . TYR C  3  105 ? -14.173 -26.484 -41.728  1.00 272.23 ? 103  TYR C CD1 1 
ATOM   7139  C  CD2 . TYR C  3  105 ? -14.788 -28.384 -43.027  1.00 281.44 ? 103  TYR C CD2 1 
ATOM   7140  C  CE1 . TYR C  3  105 ? -13.919 -27.302 -40.645  1.00 275.36 ? 103  TYR C CE1 1 
ATOM   7141  C  CE2 . TYR C  3  105 ? -14.535 -29.207 -41.954  1.00 280.93 ? 103  TYR C CE2 1 
ATOM   7142  C  CZ  . TYR C  3  105 ? -14.101 -28.663 -40.763  1.00 281.82 ? 103  TYR C CZ  1 
ATOM   7143  O  OH  . TYR C  3  105 ? -13.850 -29.485 -39.688  1.00 288.28 ? 103  TYR C OH  1 
ATOM   7144  N  N   . MET C  3  106 ? -16.461 -23.496 -45.410  1.00 266.62 ? 104  MET C N   1 
ATOM   7145  C  CA  . MET C  3  106 ? -16.730 -22.660 -46.571  1.00 261.77 ? 104  MET C CA  1 
ATOM   7146  C  C   . MET C  3  106 ? -15.576 -21.691 -46.786  1.00 255.27 ? 104  MET C C   1 
ATOM   7147  O  O   . MET C  3  106 ? -15.056 -21.115 -45.827  1.00 248.89 ? 104  MET C O   1 
ATOM   7148  C  CB  . MET C  3  106 ? -18.042 -21.892 -46.394  1.00 259.24 ? 104  MET C CB  1 
ATOM   7149  C  CG  . MET C  3  106 ? -19.228 -22.788 -46.079  1.00 263.54 ? 104  MET C CG  1 
ATOM   7150  S  SD  . MET C  3  106 ? -20.669 -21.870 -45.518  1.00 274.74 ? 104  MET C SD  1 
ATOM   7151  C  CE  . MET C  3  106 ? -20.037 -21.132 -44.012  1.00 271.25 ? 104  MET C CE  1 
ATOM   7152  N  N   . PHE C  3  107 ? -15.182 -21.507 -48.047  1.00 269.47 ? 105  PHE C N   1 
ATOM   7153  C  CA  . PHE C  3  107 ? -14.017 -20.701 -48.388  1.00 278.89 ? 105  PHE C CA  1 
ATOM   7154  C  C   . PHE C  3  107 ? -14.330 -19.769 -49.552  1.00 283.55 ? 105  PHE C C   1 
ATOM   7155  O  O   . PHE C  3  107 ? -15.163 -20.076 -50.411  1.00 286.72 ? 105  PHE C O   1 
ATOM   7156  C  CB  . PHE C  3  107 ? -12.807 -21.594 -48.733  1.00 287.80 ? 105  PHE C CB  1 
ATOM   7157  C  CG  . PHE C  3  107 ? -12.028 -22.055 -47.528  1.00 281.76 ? 105  PHE C CG  1 
ATOM   7158  C  CD1 . PHE C  3  107 ? -12.519 -23.055 -46.703  1.00 271.96 ? 105  PHE C CD1 1 
ATOM   7159  C  CD2 . PHE C  3  107 ? -10.798 -21.489 -47.228  1.00 283.87 ? 105  PHE C CD2 1 
ATOM   7160  C  CE1 . PHE C  3  107 ? -11.803 -23.473 -45.599  1.00 269.13 ? 105  PHE C CE1 1 
ATOM   7161  C  CE2 . PHE C  3  107 ? -10.076 -21.906 -46.127  1.00 284.53 ? 105  PHE C CE2 1 
ATOM   7162  C  CZ  . PHE C  3  107 ? -10.579 -22.896 -45.312  1.00 278.30 ? 105  PHE C CZ  1 
ATOM   7163  N  N   . PHE C  3  108 ? -13.647 -18.621 -49.573  1.00 282.91 ? 106  PHE C N   1 
ATOM   7164  C  CA  . PHE C  3  108 ? -13.839 -17.610 -50.606  1.00 275.27 ? 106  PHE C CA  1 
ATOM   7165  C  C   . PHE C  3  108 ? -12.491 -17.043 -51.038  1.00 271.42 ? 106  PHE C C   1 
ATOM   7166  O  O   . PHE C  3  108 ? -11.466 -17.242 -50.379  1.00 272.94 ? 106  PHE C O   1 
ATOM   7167  C  CB  . PHE C  3  108 ? -14.748 -16.473 -50.122  1.00 261.90 ? 106  PHE C CB  1 
ATOM   7168  C  CG  . PHE C  3  108 ? -16.130 -16.916 -49.736  1.00 261.09 ? 106  PHE C CG  1 
ATOM   7169  C  CD1 . PHE C  3  108 ? -17.155 -16.927 -50.670  1.00 267.13 ? 106  PHE C CD1 1 
ATOM   7170  C  CD2 . PHE C  3  108 ? -16.410 -17.308 -48.436  1.00 258.92 ? 106  PHE C CD2 1 
ATOM   7171  C  CE1 . PHE C  3  108 ? -18.430 -17.326 -50.318  1.00 270.60 ? 106  PHE C CE1 1 
ATOM   7172  C  CE2 . PHE C  3  108 ? -17.682 -17.708 -48.076  1.00 265.36 ? 106  PHE C CE2 1 
ATOM   7173  C  CZ  . PHE C  3  108 ? -18.695 -17.717 -49.019  1.00 272.68 ? 106  PHE C CZ  1 
ATOM   7174  N  N   . GLN C  3  109 ? -12.505 -16.320 -52.155  1.00 255.49 ? 107  GLN C N   1 
ATOM   7175  C  CA  . GLN C  3  109 ? -11.312 -15.698 -52.715  1.00 245.59 ? 107  GLN C CA  1 
ATOM   7176  C  C   . GLN C  3  109 ? -11.382 -14.187 -52.531  1.00 252.03 ? 107  GLN C C   1 
ATOM   7177  O  O   . GLN C  3  109 ? -12.400 -13.565 -52.854  1.00 256.68 ? 107  GLN C O   1 
ATOM   7178  C  CB  . GLN C  3  109 ? -11.159 -16.042 -54.199  1.00 241.99 ? 107  GLN C CB  1 
ATOM   7179  C  CG  . GLN C  3  109 ? -10.890 -17.516 -54.475  1.00 246.33 ? 107  GLN C CG  1 
ATOM   7180  C  CD  . GLN C  3  109 ? -10.721 -17.817 -55.956  1.00 259.73 ? 107  GLN C CD  1 
ATOM   7181  O  OE1 . GLN C  3  109 ? -10.957 -16.962 -56.810  1.00 268.01 ? 107  GLN C OE1 1 
ATOM   7182  N  NE2 . GLN C  3  109 ? -10.308 -19.041 -56.265  1.00 263.24 ? 107  GLN C NE2 1 
ATOM   7183  N  N   . THR C  3  110 ? -10.298 -13.601 -52.021  1.00 254.49 ? 108  THR C N   1 
ATOM   7184  C  CA  . THR C  3  110 ? -10.253 -12.158 -51.814  1.00 255.24 ? 108  THR C CA  1 
ATOM   7185  C  C   . THR C  3  110 ? -10.054 -11.392 -53.113  1.00 259.68 ? 108  THR C C   1 
ATOM   7186  O  O   . THR C  3  110 ? -10.394 -10.205 -53.176  1.00 247.77 ? 108  THR C O   1 
ATOM   7187  C  CB  . THR C  3  110 ? -9.134  -11.794 -50.834  1.00 255.66 ? 108  THR C CB  1 
ATOM   7188  O  OG1 . THR C  3  110 ? -9.097  -12.755 -49.771  1.00 260.32 ? 108  THR C OG1 1 
ATOM   7189  C  CG2 . THR C  3  110 ? -9.356  -10.405 -50.242  1.00 249.14 ? 108  THR C CG2 1 
ATOM   7190  N  N   . SER C  3  111 ? -9.516  -12.044 -54.148  1.00 286.07 ? 109  SER C N   1 
ATOM   7191  C  CA  . SER C  3  111 ? -9.296  -11.372 -55.423  1.00 291.02 ? 109  SER C CA  1 
ATOM   7192  C  C   . SER C  3  111 ? -10.602 -10.921 -56.067  1.00 278.62 ? 109  SER C C   1 
ATOM   7193  O  O   . SER C  3  111 ? -10.590 -10.001 -56.893  1.00 282.10 ? 109  SER C O   1 
ATOM   7194  C  CB  . SER C  3  111 ? -8.521  -12.290 -56.378  1.00 288.27 ? 109  SER C CB  1 
ATOM   7195  O  OG  . SER C  3  111 ? -7.262  -12.667 -55.839  1.00 276.93 ? 109  SER C OG  1 
ATOM   7196  N  N   . GLU C  3  112 ? -11.727 -11.541 -55.707  1.00 253.67 ? 110  GLU C N   1 
ATOM   7197  C  CA  . GLU C  3  112 ? -13.028 -11.128 -56.210  1.00 249.32 ? 110  GLU C CA  1 
ATOM   7198  C  C   . GLU C  3  112 ? -13.811 -10.292 -55.210  1.00 249.82 ? 110  GLU C C   1 
ATOM   7199  O  O   . GLU C  3  112 ? -14.746 -9.588  -55.609  1.00 251.03 ? 110  GLU C O   1 
ATOM   7200  C  CB  . GLU C  3  112 ? -13.856 -12.361 -56.597  1.00 247.29 ? 110  GLU C CB  1 
ATOM   7201  C  CG  . GLU C  3  112 ? -13.119 -13.327 -57.507  1.00 254.47 ? 110  GLU C CG  1 
ATOM   7202  C  CD  . GLU C  3  112 ? -13.949 -14.541 -57.866  1.00 258.31 ? 110  GLU C CD  1 
ATOM   7203  O  OE1 . GLU C  3  112 ? -15.135 -14.584 -57.476  1.00 241.16 ? 110  GLU C OE1 1 
ATOM   7204  O  OE2 . GLU C  3  112 ? -13.414 -15.451 -58.538  1.00 273.93 ? 110  GLU C OE2 1 
ATOM   7205  N  N   . LEU C  3  113 ? -13.451 -10.354 -53.928  1.00 242.22 ? 111  LEU C N   1 
ATOM   7206  C  CA  . LEU C  3  113 ? -14.150 -9.565  -52.921  1.00 242.35 ? 111  LEU C CA  1 
ATOM   7207  C  C   . LEU C  3  113 ? -13.804 -8.091  -53.045  1.00 247.18 ? 111  LEU C C   1 
ATOM   7208  O  O   . LEU C  3  113 ? -14.692 -7.232  -53.043  1.00 249.34 ? 111  LEU C O   1 
ATOM   7209  C  CB  . LEU C  3  113 ? -13.800 -10.074 -51.527  1.00 241.91 ? 111  LEU C CB  1 
ATOM   7210  C  CG  . LEU C  3  113 ? -14.510 -11.364 -51.144  1.00 244.72 ? 111  LEU C CG  1 
ATOM   7211  C  CD1 . LEU C  3  113 ? -14.074 -11.790 -49.760  1.00 254.30 ? 111  LEU C CD1 1 
ATOM   7212  C  CD2 . LEU C  3  113 ? -16.014 -11.161 -51.209  1.00 240.12 ? 111  LEU C CD2 1 
ATOM   7213  N  N   . ARG C  3  114 ? -12.514 -7.779  -53.144  1.00 249.41 ? 112  ARG C N   1 
ATOM   7214  C  CA  . ARG C  3  114 ? -12.066 -6.404  -53.281  1.00 254.95 ? 112  ARG C CA  1 
ATOM   7215  C  C   . ARG C  3  114 ? -12.288 -5.851  -54.685  1.00 259.76 ? 112  ARG C C   1 
ATOM   7216  O  O   . ARG C  3  114 ? -11.776 -4.771  -55.001  1.00 274.36 ? 112  ARG C O   1 
ATOM   7217  C  CB  . ARG C  3  114 ? -10.591 -6.293  -52.882  1.00 263.10 ? 112  ARG C CB  1 
ATOM   7218  C  CG  . ARG C  3  114 ? -10.337 -6.551  -51.399  1.00 254.13 ? 112  ARG C CG  1 
ATOM   7219  C  CD  . ARG C  3  114 ? -8.900  -6.229  -50.998  1.00 258.98 ? 112  ARG C CD  1 
ATOM   7220  N  NE  . ARG C  3  114 ? -7.945  -7.231  -51.466  1.00 264.23 ? 112  ARG C NE  1 
ATOM   7221  C  CZ  . ARG C  3  114 ? -6.630  -7.160  -51.278  1.00 260.73 ? 112  ARG C CZ  1 
ATOM   7222  N  NH1 . ARG C  3  114 ? -6.101  -6.131  -50.629  1.00 259.02 ? 112  ARG C NH1 1 
ATOM   7223  N  NH2 . ARG C  3  114 ? -5.840  -8.120  -51.739  1.00 255.62 ? 112  ARG C NH2 1 
ATOM   7224  N  N   . GLU C  3  115 ? -13.037 -6.560  -55.529  1.00 249.36 ? 113  GLU C N   1 
ATOM   7225  C  CA  . GLU C  3  115 ? -13.457 -6.042  -56.824  1.00 251.91 ? 113  GLU C CA  1 
ATOM   7226  C  C   . GLU C  3  115 ? -14.901 -5.562  -56.809  1.00 249.71 ? 113  GLU C C   1 
ATOM   7227  O  O   . GLU C  3  115 ? -15.226 -4.567  -57.464  1.00 259.51 ? 113  GLU C O   1 
ATOM   7228  C  CB  . GLU C  3  115 ? -13.280 -7.115  -57.909  1.00 255.15 ? 113  GLU C CB  1 
ATOM   7229  C  CG  . GLU C  3  115 ? -13.237 -6.574  -59.336  1.00 271.09 ? 113  GLU C CG  1 
ATOM   7230  C  CD  . GLU C  3  115 ? -13.043 -7.673  -60.368  1.00 276.42 ? 113  GLU C CD  1 
ATOM   7231  O  OE1 . GLU C  3  115 ? -13.018 -8.858  -59.973  1.00 282.29 ? 113  GLU C OE1 1 
ATOM   7232  O  OE2 . GLU C  3  115 ? -12.917 -7.355  -61.572  1.00 270.14 ? 113  GLU C OE2 1 
ATOM   7233  N  N   . ALA C  3  116 ? -15.774 -6.247  -56.066  1.00 223.28 ? 114  ALA C N   1 
ATOM   7234  C  CA  . ALA C  3  116 ? -17.142 -5.770  -55.914  1.00 218.48 ? 114  ALA C CA  1 
ATOM   7235  C  C   . ALA C  3  116 ? -17.199 -4.569  -54.981  1.00 221.56 ? 114  ALA C C   1 
ATOM   7236  O  O   . ALA C  3  116 ? -17.976 -3.635  -55.206  1.00 224.35 ? 114  ALA C O   1 
ATOM   7237  C  CB  . ALA C  3  116 ? -18.035 -6.899  -55.398  1.00 214.85 ? 114  ALA C CB  1 
ATOM   7238  N  N   . VAL C  3  117 ? -16.381 -4.575  -53.934  1.00 231.89 ? 115  VAL C N   1 
ATOM   7239  C  CA  . VAL C  3  117 ? -16.298 -3.456  -52.999  1.00 245.51 ? 115  VAL C CA  1 
ATOM   7240  C  C   . VAL C  3  117 ? -14.839 -3.021  -52.890  1.00 258.27 ? 115  VAL C C   1 
ATOM   7241  O  O   . VAL C  3  117 ? -14.070 -3.627  -52.129  1.00 267.82 ? 115  VAL C O   1 
ATOM   7242  C  CB  . VAL C  3  117 ? -16.878 -3.833  -51.627  1.00 241.36 ? 115  VAL C CB  1 
ATOM   7243  C  CG1 . VAL C  3  117 ? -16.911 -2.622  -50.709  1.00 241.37 ? 115  VAL C CG1 1 
ATOM   7244  C  CG2 . VAL C  3  117 ? -18.271 -4.433  -51.777  1.00 235.47 ? 115  VAL C CG2 1 
ATOM   7245  N  N   . PRO C  3  118 ? -14.411 -1.988  -53.633  1.00 260.70 ? 116  PRO C N   1 
ATOM   7246  C  CA  . PRO C  3  118 ? -13.000 -1.572  -53.593  1.00 257.16 ? 116  PRO C CA  1 
ATOM   7247  C  C   . PRO C  3  118 ? -12.543 -1.088  -52.226  1.00 258.73 ? 116  PRO C C   1 
ATOM   7248  O  O   . PRO C  3  118 ? -11.559 -1.592  -51.676  1.00 248.30 ? 116  PRO C O   1 
ATOM   7249  C  CB  . PRO C  3  118 ? -12.940 -0.439  -54.627  1.00 259.99 ? 116  PRO C CB  1 
ATOM   7250  C  CG  . PRO C  3  118 ? -14.106 -0.682  -55.528  1.00 264.39 ? 116  PRO C CG  1 
ATOM   7251  C  CD  . PRO C  3  118 ? -15.179 -1.240  -54.643  1.00 258.95 ? 116  PRO C CD  1 
ATOM   7252  N  N   . GLU C  3  119 ? -13.245 -0.110  -51.668  1.00 283.00 ? 117  GLU C N   1 
ATOM   7253  C  CA  . GLU C  3  119 ? -12.826 0.456   -50.391  1.00 294.04 ? 117  GLU C CA  1 
ATOM   7254  C  C   . GLU C  3  119 ? -13.625 -0.160  -49.252  1.00 289.88 ? 117  GLU C C   1 
ATOM   7255  O  O   . GLU C  3  119 ? -14.856 -0.274  -49.358  1.00 287.83 ? 117  GLU C O   1 
ATOM   7256  C  CB  . GLU C  3  119 ? -13.011 1.970   -50.400  1.00 304.60 ? 117  GLU C CB  1 
ATOM   7257  C  CG  . GLU C  3  119 ? -12.416 2.678   -49.200  1.00 304.23 ? 117  GLU C CG  1 
ATOM   7258  C  CD  . GLU C  3  119 ? -12.439 4.186   -49.342  1.00 308.43 ? 117  GLU C CD  1 
ATOM   7259  O  OE1 . GLU C  3  119 ? -12.899 4.686   -50.393  1.00 313.87 ? 117  GLU C OE1 1 
ATOM   7260  O  OE2 . GLU C  3  119 ? -11.994 4.871   -48.398  1.00 308.25 ? 117  GLU C OE2 1 
ATOM   7261  N  N   . PRO C  3  120 ? -12.970 -0.569  -48.159  1.00 285.16 ? 118  PRO C N   1 
ATOM   7262  C  CA  . PRO C  3  120 ? -13.705 -1.191  -47.040  1.00 287.74 ? 118  PRO C CA  1 
ATOM   7263  C  C   . PRO C  3  120 ? -14.730 -0.279  -46.384  1.00 282.36 ? 118  PRO C C   1 
ATOM   7264  O  O   . PRO C  3  120 ? -15.636 -0.778  -45.701  1.00 272.63 ? 118  PRO C O   1 
ATOM   7265  C  CB  . PRO C  3  120 ? -12.587 -1.570  -46.057  1.00 283.97 ? 118  PRO C CB  1 
ATOM   7266  C  CG  . PRO C  3  120 ? -11.351 -1.664  -46.901  1.00 279.88 ? 118  PRO C CG  1 
ATOM   7267  C  CD  . PRO C  3  120 ? -11.512 -0.604  -47.951  1.00 278.97 ? 118  PRO C CD  1 
ATOM   7268  N  N   . VAL C  3  121 ? -14.612 1.040   -46.557  1.00 280.33 ? 119  VAL C N   1 
ATOM   7269  C  CA  . VAL C  3  121 ? -15.573 1.956   -45.952  1.00 269.23 ? 119  VAL C CA  1 
ATOM   7270  C  C   . VAL C  3  121 ? -16.899 1.911   -46.699  1.00 255.45 ? 119  VAL C C   1 
ATOM   7271  O  O   . VAL C  3  121 ? -17.964 2.111   -46.101  1.00 254.40 ? 119  VAL C O   1 
ATOM   7272  C  CB  . VAL C  3  121 ? -14.990 3.382   -45.909  1.00 283.43 ? 119  VAL C CB  1 
ATOM   7273  C  CG1 . VAL C  3  121 ? -15.803 4.260   -44.967  1.00 291.02 ? 119  VAL C CG1 1 
ATOM   7274  C  CG2 . VAL C  3  121 ? -13.523 3.353   -45.489  1.00 283.42 ? 119  VAL C CG2 1 
ATOM   7275  N  N   . LEU C  3  122 ? -16.862 1.645   -48.007  1.00 242.24 ? 120  LEU C N   1 
ATOM   7276  C  CA  . LEU C  3  122 ? -18.085 1.545   -48.794  1.00 240.45 ? 120  LEU C CA  1 
ATOM   7277  C  C   . LEU C  3  122 ? -18.980 0.410   -48.324  1.00 234.37 ? 120  LEU C C   1 
ATOM   7278  O  O   . LEU C  3  122 ? -20.197 0.473   -48.526  1.00 233.02 ? 120  LEU C O   1 
ATOM   7279  C  CB  . LEU C  3  122 ? -17.744 1.351   -50.272  1.00 247.06 ? 120  LEU C CB  1 
ATOM   7280  C  CG  . LEU C  3  122 ? -16.808 2.378   -50.908  1.00 261.05 ? 120  LEU C CG  1 
ATOM   7281  C  CD1 . LEU C  3  122 ? -16.476 1.993   -52.345  1.00 270.32 ? 120  LEU C CD1 1 
ATOM   7282  C  CD2 . LEU C  3  122 ? -17.412 3.776   -50.849  1.00 260.16 ? 120  LEU C CD2 1 
ATOM   7283  N  N   . LEU C  3  123 ? -18.410 -0.620  -47.704  1.00 224.33 ? 121  LEU C N   1 
ATOM   7284  C  CA  . LEU C  3  123 ? -19.200 -1.757  -47.254  1.00 218.62 ? 121  LEU C CA  1 
ATOM   7285  C  C   . LEU C  3  123 ? -20.152 -1.320  -46.149  1.00 226.87 ? 121  LEU C C   1 
ATOM   7286  O  O   . LEU C  3  123 ? -19.733 -0.723  -45.152  1.00 234.33 ? 121  LEU C O   1 
ATOM   7287  C  CB  . LEU C  3  123 ? -18.281 -2.878  -46.765  1.00 215.46 ? 121  LEU C CB  1 
ATOM   7288  C  CG  . LEU C  3  123 ? -18.796 -4.322  -46.781  1.00 209.74 ? 121  LEU C CG  1 
ATOM   7289  C  CD1 . LEU C  3  123 ? -19.695 -4.614  -45.594  1.00 205.33 ? 121  LEU C CD1 1 
ATOM   7290  C  CD2 . LEU C  3  123 ? -19.526 -4.612  -48.080  1.00 211.22 ? 121  LEU C CD2 1 
ATOM   7291  N  N   . SER C  3  124 ? -21.440 -1.615  -46.329  1.00 229.84 ? 122  SER C N   1 
ATOM   7292  C  CA  . SER C  3  124 ? -22.463 -1.269  -45.352  1.00 231.87 ? 122  SER C CA  1 
ATOM   7293  C  C   . SER C  3  124 ? -23.023 -2.500  -44.651  1.00 231.23 ? 122  SER C C   1 
ATOM   7294  O  O   . SER C  3  124 ? -22.994 -2.578  -43.419  1.00 233.93 ? 122  SER C O   1 
ATOM   7295  C  CB  . SER C  3  124 ? -23.593 -0.477  -46.027  1.00 232.95 ? 122  SER C CB  1 
ATOM   7296  O  OG  . SER C  3  124 ? -24.240 -1.251  -47.022  1.00 234.39 ? 122  SER C OG  1 
ATOM   7297  N  N   . ARG C  3  125 ? -23.534 -3.473  -45.402  1.00 229.71 ? 123  ARG C N   1 
ATOM   7298  C  CA  . ARG C  3  125 ? -24.088 -4.690  -44.821  1.00 216.92 ? 123  ARG C CA  1 
ATOM   7299  C  C   . ARG C  3  125 ? -23.608 -5.886  -45.632  1.00 223.01 ? 123  ARG C C   1 
ATOM   7300  O  O   . ARG C  3  125 ? -23.716 -5.888  -46.862  1.00 225.79 ? 123  ARG C O   1 
ATOM   7301  C  CB  . ARG C  3  125 ? -25.622 -4.634  -44.787  1.00 199.58 ? 123  ARG C CB  1 
ATOM   7302  C  CG  . ARG C  3  125 ? -26.289 -5.832  -44.128  1.00 192.83 ? 123  ARG C CG  1 
ATOM   7303  C  CD  . ARG C  3  125 ? -27.802 -5.667  -44.068  1.00 193.61 ? 123  ARG C CD  1 
ATOM   7304  N  NE  . ARG C  3  125 ? -28.453 -6.822  -43.453  1.00 197.50 ? 123  ARG C NE  1 
ATOM   7305  C  CZ  . ARG C  3  125 ? -28.796 -6.895  -42.170  1.00 189.77 ? 123  ARG C CZ  1 
ATOM   7306  N  NH1 . ARG C  3  125 ? -28.556 -5.875  -41.360  1.00 190.13 ? 123  ARG C NH1 1 
ATOM   7307  N  NH2 . ARG C  3  125 ? -29.383 -7.986  -41.696  1.00 188.88 ? 123  ARG C NH2 1 
ATOM   7308  N  N   . ALA C  3  126 ? -23.067 -6.892  -44.943  1.00 217.52 ? 124  ALA C N   1 
ATOM   7309  C  CA  . ALA C  3  126 ? -22.545 -8.104  -45.577  1.00 209.07 ? 124  ALA C CA  1 
ATOM   7310  C  C   . ALA C  3  126 ? -23.039 -9.311  -44.784  1.00 217.21 ? 124  ALA C C   1 
ATOM   7311  O  O   . ALA C  3  126 ? -22.426 -9.694  -43.783  1.00 227.02 ? 124  ALA C O   1 
ATOM   7312  C  CB  . ALA C  3  126 ? -21.021 -8.076  -45.648  1.00 204.04 ? 124  ALA C CB  1 
ATOM   7313  N  N   . GLU C  3  127 ? -24.138 -9.914  -45.235  1.00 219.71 ? 125  GLU C N   1 
ATOM   7314  C  CA  . GLU C  3  127 ? -24.761 -11.041 -44.551  1.00 210.12 ? 125  GLU C CA  1 
ATOM   7315  C  C   . GLU C  3  127 ? -24.546 -12.322 -45.348  1.00 205.51 ? 125  GLU C C   1 
ATOM   7316  O  O   . GLU C  3  127 ? -24.797 -12.357 -46.558  1.00 198.67 ? 125  GLU C O   1 
ATOM   7317  C  CB  . GLU C  3  127 ? -26.255 -10.787 -44.333  1.00 199.91 ? 125  GLU C CB  1 
ATOM   7318  C  CG  . GLU C  3  127 ? -26.986 -10.245 -45.548  1.00 197.23 ? 125  GLU C CG  1 
ATOM   7319  C  CD  . GLU C  3  127 ? -28.428 -9.913  -45.244  1.00 197.71 ? 125  GLU C CD  1 
ATOM   7320  O  OE1 . GLU C  3  127 ? -28.921 -10.354 -44.186  1.00 196.72 ? 125  GLU C OE1 1 
ATOM   7321  O  OE2 . GLU C  3  127 ? -29.066 -9.210  -46.055  1.00 202.20 ? 125  GLU C OE2 1 
ATOM   7322  N  N   . LEU C  3  128 ? -24.083 -13.370 -44.666  1.00 217.75 ? 126  LEU C N   1 
ATOM   7323  C  CA  . LEU C  3  128 ? -23.795 -14.659 -45.290  1.00 222.66 ? 126  LEU C CA  1 
ATOM   7324  C  C   . LEU C  3  128 ? -25.053 -15.522 -45.279  1.00 235.75 ? 126  LEU C C   1 
ATOM   7325  O  O   . LEU C  3  128 ? -25.577 -15.845 -44.208  1.00 253.97 ? 126  LEU C O   1 
ATOM   7326  C  CB  . LEU C  3  128 ? -22.654 -15.363 -44.555  1.00 214.31 ? 126  LEU C CB  1 
ATOM   7327  C  CG  . LEU C  3  128 ? -22.267 -16.778 -45.001  1.00 208.49 ? 126  LEU C CG  1 
ATOM   7328  C  CD1 . LEU C  3  128 ? -21.782 -16.788 -46.446  1.00 225.77 ? 126  LEU C CD1 1 
ATOM   7329  C  CD2 . LEU C  3  128 ? -21.212 -17.369 -44.075  1.00 204.15 ? 126  LEU C CD2 1 
ATOM   7330  N  N   . ARG C  3  129 ? -25.526 -15.910 -46.462  1.00 226.77 ? 127  ARG C N   1 
ATOM   7331  C  CA  . ARG C  3  129 ? -26.767 -16.662 -46.606  1.00 212.73 ? 127  ARG C CA  1 
ATOM   7332  C  C   . ARG C  3  129 ? -26.481 -18.078 -47.098  1.00 216.41 ? 127  ARG C C   1 
ATOM   7333  O  O   . ARG C  3  129 ? -25.645 -18.281 -47.982  1.00 216.80 ? 127  ARG C O   1 
ATOM   7334  C  CB  . ARG C  3  129 ? -27.721 -15.948 -47.570  1.00 209.90 ? 127  ARG C CB  1 
ATOM   7335  C  CG  . ARG C  3  129 ? -28.091 -14.534 -47.138  1.00 208.30 ? 127  ARG C CG  1 
ATOM   7336  C  CD  . ARG C  3  129 ? -29.327 -14.030 -47.868  1.00 209.83 ? 127  ARG C CD  1 
ATOM   7337  N  NE  . ARG C  3  129 ? -29.756 -12.723 -47.376  1.00 219.24 ? 127  ARG C NE  1 
ATOM   7338  C  CZ  . ARG C  3  129 ? -30.881 -12.116 -47.743  1.00 232.13 ? 127  ARG C CZ  1 
ATOM   7339  N  NH1 . ARG C  3  129 ? -31.699 -12.699 -48.608  1.00 237.30 ? 127  ARG C NH1 1 
ATOM   7340  N  NH2 . ARG C  3  129 ? -31.192 -10.926 -47.243  1.00 234.23 ? 127  ARG C NH2 1 
ATOM   7341  N  N   . LEU C  3  130 ? -27.181 -19.061 -46.523  1.00 213.29 ? 128  LEU C N   1 
ATOM   7342  C  CA  . LEU C  3  130 ? -26.950 -20.459 -46.873  1.00 217.09 ? 128  LEU C CA  1 
ATOM   7343  C  C   . LEU C  3  130 ? -28.218 -21.117 -47.410  1.00 219.28 ? 128  LEU C C   1 
ATOM   7344  O  O   . LEU C  3  130 ? -29.147 -20.428 -47.850  1.00 220.77 ? 128  LEU C O   1 
ATOM   7345  C  CB  . LEU C  3  130 ? -26.424 -21.233 -45.662  1.00 216.10 ? 128  LEU C CB  1 
ATOM   7346  C  CG  . LEU C  3  130 ? -25.343 -20.568 -44.806  1.00 212.42 ? 128  LEU C CG  1 
ATOM   7347  C  CD1 . LEU C  3  130 ? -24.907 -21.498 -43.689  1.00 216.26 ? 128  LEU C CD1 1 
ATOM   7348  C  CD2 . LEU C  3  130 ? -24.147 -20.154 -45.647  1.00 211.91 ? 128  LEU C CD2 1 
ATOM   7349  N  N   . LEU C  3  131 ? -28.271 -22.447 -47.393  1.00 220.37 ? 129  LEU C N   1 
ATOM   7350  C  CA  . LEU C  3  131 ? -29.449 -23.160 -47.877  1.00 219.77 ? 129  LEU C CA  1 
ATOM   7351  C  C   . LEU C  3  131 ? -29.634 -24.444 -47.078  1.00 223.04 ? 129  LEU C C   1 
ATOM   7352  O  O   . LEU C  3  131 ? -28.780 -25.335 -47.116  1.00 225.44 ? 129  LEU C O   1 
ATOM   7353  C  CB  . LEU C  3  131 ? -29.319 -23.454 -49.372  1.00 223.94 ? 129  LEU C CB  1 
ATOM   7354  C  CG  . LEU C  3  131 ? -30.551 -23.975 -50.117  1.00 232.23 ? 129  LEU C CG  1 
ATOM   7355  C  CD1 . LEU C  3  131 ? -30.579 -25.499 -50.151  1.00 246.03 ? 129  LEU C CD1 1 
ATOM   7356  C  CD2 . LEU C  3  131 ? -31.837 -23.428 -49.505  1.00 228.76 ? 129  LEU C CD2 1 
ATOM   7357  N  N   . ARG C  3  132 ? -30.763 -24.541 -46.380  1.00 230.84 ? 130  ARG C N   1 
ATOM   7358  C  CA  . ARG C  3  132 ? -31.079 -25.686 -45.538  1.00 234.16 ? 130  ARG C CA  1 
ATOM   7359  C  C   . ARG C  3  132 ? -31.843 -26.745 -46.326  1.00 242.72 ? 130  ARG C C   1 
ATOM   7360  O  O   . ARG C  3  132 ? -32.660 -26.432 -47.197  1.00 259.87 ? 130  ARG C O   1 
ATOM   7361  C  CB  . ARG C  3  132 ? -31.900 -25.234 -44.326  1.00 239.11 ? 130  ARG C CB  1 
ATOM   7362  C  CG  . ARG C  3  132 ? -32.726 -26.313 -43.630  1.00 246.35 ? 130  ARG C CG  1 
ATOM   7363  C  CD  . ARG C  3  132 ? -33.768 -25.675 -42.714  1.00 246.44 ? 130  ARG C CD  1 
ATOM   7364  N  NE  . ARG C  3  132 ? -34.669 -26.644 -42.096  1.00 261.78 ? 130  ARG C NE  1 
ATOM   7365  C  CZ  . ARG C  3  132 ? -34.663 -26.953 -40.803  1.00 264.41 ? 130  ARG C CZ  1 
ATOM   7366  N  NH1 . ARG C  3  132 ? -35.522 -27.848 -40.329  1.00 266.94 ? 130  ARG C NH1 1 
ATOM   7367  N  NH2 . ARG C  3  132 ? -33.799 -26.369 -39.984  1.00 258.93 ? 130  ARG C NH2 1 
ATOM   7368  N  N   . LEU C  3  133 ? -31.564 -28.009 -46.015  1.00 246.18 ? 131  LEU C N   1 
ATOM   7369  C  CA  . LEU C  3  133 ? -32.278 -29.128 -46.619  1.00 271.80 ? 131  LEU C CA  1 
ATOM   7370  C  C   . LEU C  3  133 ? -33.090 -29.914 -45.603  1.00 282.50 ? 131  LEU C C   1 
ATOM   7371  O  O   . LEU C  3  133 ? -34.288 -30.144 -45.816  1.00 285.64 ? 131  LEU C O   1 
ATOM   7372  C  CB  . LEU C  3  133 ? -31.293 -30.071 -47.335  1.00 275.43 ? 131  LEU C CB  1 
ATOM   7373  C  CG  . LEU C  3  133 ? -30.677 -29.652 -48.673  1.00 271.57 ? 131  LEU C CG  1 
ATOM   7374  C  CD1 . LEU C  3  133 ? -29.616 -28.580 -48.492  1.00 262.22 ? 131  LEU C CD1 1 
ATOM   7375  C  CD2 . LEU C  3  133 ? -30.095 -30.864 -49.386  1.00 269.92 ? 131  LEU C CD2 1 
ATOM   7376  N  N   . LYS C  3  134 ? -32.467 -30.327 -44.498  1.00 288.02 ? 132  LYS C N   1 
ATOM   7377  C  CA  . LYS C  3  134 ? -33.132 -31.164 -43.506  1.00 289.94 ? 132  LYS C CA  1 
ATOM   7378  C  C   . LYS C  3  134 ? -34.329 -30.438 -42.905  1.00 284.56 ? 132  LYS C C   1 
ATOM   7379  O  O   . LYS C  3  134 ? -34.243 -29.265 -42.537  1.00 281.09 ? 132  LYS C O   1 
ATOM   7380  C  CB  . LYS C  3  134 ? -32.145 -31.543 -42.398  1.00 274.57 ? 132  LYS C CB  1 
ATOM   7381  C  CG  . LYS C  3  134 ? -32.339 -32.925 -41.792  1.00 277.94 ? 132  LYS C CG  1 
ATOM   7382  C  CD  . LYS C  3  134 ? -31.131 -33.302 -40.942  1.00 267.52 ? 132  LYS C CD  1 
ATOM   7383  C  CE  . LYS C  3  134 ? -31.193 -34.746 -40.472  1.00 280.65 ? 132  LYS C CE  1 
ATOM   7384  N  NZ  . LYS C  3  134 ? -29.966 -35.132 -39.716  1.00 274.91 ? 132  LYS C NZ  1 
ATOM   7385  N  N   . LEU C  3  135 ? -35.453 -31.145 -42.801  1.00 272.61 ? 133  LEU C N   1 
ATOM   7386  C  CA  . LEU C  3  135 ? -36.682 -30.555 -42.295  1.00 251.76 ? 133  LEU C CA  1 
ATOM   7387  C  C   . LEU C  3  135 ? -37.167 -31.166 -40.990  1.00 246.78 ? 133  LEU C C   1 
ATOM   7388  O  O   . LEU C  3  135 ? -38.099 -30.624 -40.385  1.00 242.49 ? 133  LEU C O   1 
ATOM   7389  C  CB  . LEU C  3  135 ? -37.795 -30.666 -43.351  1.00 250.43 ? 133  LEU C CB  1 
ATOM   7390  C  CG  . LEU C  3  135 ? -38.239 -32.044 -43.842  1.00 258.04 ? 133  LEU C CG  1 
ATOM   7391  C  CD1 . LEU C  3  135 ? -39.462 -32.530 -43.079  1.00 261.25 ? 133  LEU C CD1 1 
ATOM   7392  C  CD2 . LEU C  3  135 ? -38.526 -31.985 -45.329  1.00 260.88 ? 133  LEU C CD2 1 
ATOM   7393  N  N   . LYS C  3  136 ? -36.562 -32.259 -40.536  1.00 241.40 ? 134  LYS C N   1 
ATOM   7394  C  CA  . LYS C  3  136 ? -36.993 -32.985 -39.351  1.00 234.37 ? 134  LYS C CA  1 
ATOM   7395  C  C   . LYS C  3  136 ? -36.053 -32.683 -38.189  1.00 229.02 ? 134  LYS C C   1 
ATOM   7396  O  O   . LYS C  3  136 ? -34.856 -32.459 -38.396  1.00 228.49 ? 134  LYS C O   1 
ATOM   7397  C  CB  . LYS C  3  136 ? -37.031 -34.489 -39.638  1.00 227.71 ? 134  LYS C CB  1 
ATOM   7398  C  CG  . LYS C  3  136 ? -37.776 -34.827 -40.918  1.00 226.21 ? 134  LYS C CG  1 
ATOM   7399  C  CD  . LYS C  3  136 ? -37.499 -36.230 -41.413  1.00 228.98 ? 134  LYS C CD  1 
ATOM   7400  C  CE  . LYS C  3  136 ? -38.209 -36.459 -42.738  1.00 234.09 ? 134  LYS C CE  1 
ATOM   7401  N  NZ  . LYS C  3  136 ? -37.988 -37.823 -43.279  1.00 240.70 ? 134  LYS C NZ  1 
ATOM   7402  N  N   . VAL C  3  137 ? -36.602 -32.684 -36.967  1.00 219.87 ? 135  VAL C N   1 
ATOM   7403  C  CA  . VAL C  3  137 ? -35.853 -32.445 -35.732  1.00 219.83 ? 135  VAL C CA  1 
ATOM   7404  C  C   . VAL C  3  137 ? -35.313 -31.014 -35.712  1.00 216.95 ? 135  VAL C C   1 
ATOM   7405  O  O   . VAL C  3  137 ? -35.499 -30.251 -36.666  1.00 213.54 ? 135  VAL C O   1 
ATOM   7406  C  CB  . VAL C  3  137 ? -34.717 -33.480 -35.549  1.00 228.87 ? 135  VAL C CB  1 
ATOM   7407  C  CG1 . VAL C  3  137 ? -34.225 -33.548 -34.100  1.00 227.30 ? 135  VAL C CG1 1 
ATOM   7408  C  CG2 . VAL C  3  137 ? -35.163 -34.864 -36.001  1.00 249.80 ? 135  VAL C CG2 1 
ATOM   7409  N  N   . GLU C  3  138 ? -34.658 -30.640 -34.612  1.00 228.90 ? 136  GLU C N   1 
ATOM   7410  C  CA  . GLU C  3  138 ? -34.055 -29.331 -34.414  1.00 232.19 ? 136  GLU C CA  1 
ATOM   7411  C  C   . GLU C  3  138 ? -32.630 -29.522 -33.914  1.00 242.78 ? 136  GLU C C   1 
ATOM   7412  O  O   . GLU C  3  138 ? -32.368 -30.413 -33.101  1.00 253.11 ? 136  GLU C O   1 
ATOM   7413  C  CB  . GLU C  3  138 ? -34.878 -28.508 -33.414  1.00 228.36 ? 136  GLU C CB  1 
ATOM   7414  C  CG  . GLU C  3  138 ? -34.113 -27.446 -32.650  1.00 223.97 ? 136  GLU C CG  1 
ATOM   7415  C  CD  . GLU C  3  138 ? -35.043 -26.499 -31.918  1.00 226.78 ? 136  GLU C CD  1 
ATOM   7416  O  OE1 . GLU C  3  138 ? -35.927 -26.991 -31.185  1.00 226.73 ? 136  GLU C OE1 1 
ATOM   7417  O  OE2 . GLU C  3  138 ? -34.903 -25.269 -32.085  1.00 230.33 ? 136  GLU C OE2 1 
ATOM   7418  N  N   . GLN C  3  139 ? -31.708 -28.698 -34.410  1.00 240.59 ? 137  GLN C N   1 
ATOM   7419  C  CA  . GLN C  3  139 ? -30.301 -28.826 -34.058  1.00 235.12 ? 137  GLN C CA  1 
ATOM   7420  C  C   . GLN C  3  139 ? -29.714 -27.446 -33.782  1.00 227.02 ? 137  GLN C C   1 
ATOM   7421  O  O   . GLN C  3  139 ? -30.286 -26.417 -34.149  1.00 222.45 ? 137  GLN C O   1 
ATOM   7422  C  CB  . GLN C  3  139 ? -29.511 -29.557 -35.161  1.00 245.58 ? 137  GLN C CB  1 
ATOM   7423  C  CG  . GLN C  3  139 ? -29.698 -31.085 -35.157  1.00 258.66 ? 137  GLN C CG  1 
ATOM   7424  C  CD  . GLN C  3  139 ? -29.162 -31.770 -36.412  1.00 261.62 ? 137  GLN C CD  1 
ATOM   7425  O  OE1 . GLN C  3  139 ? -29.095 -31.166 -37.483  1.00 266.28 ? 137  GLN C OE1 1 
ATOM   7426  N  NE2 . GLN C  3  139 ? -28.783 -33.039 -36.280  1.00 252.18 ? 137  GLN C NE2 1 
ATOM   7427  N  N   . HIS C  3  140 ? -28.552 -27.443 -33.126  1.00 229.56 ? 138  HIS C N   1 
ATOM   7428  C  CA  . HIS C  3  140 ? -27.909 -26.237 -32.616  1.00 234.89 ? 138  HIS C CA  1 
ATOM   7429  C  C   . HIS C  3  140 ? -26.611 -25.990 -33.371  1.00 233.11 ? 138  HIS C C   1 
ATOM   7430  O  O   . HIS C  3  140 ? -25.787 -26.900 -33.506  1.00 240.89 ? 138  HIS C O   1 
ATOM   7431  C  CB  . HIS C  3  140 ? -27.628 -26.371 -31.119  1.00 241.08 ? 138  HIS C CB  1 
ATOM   7432  C  CG  . HIS C  3  140 ? -27.266 -25.084 -30.449  1.00 237.72 ? 138  HIS C CG  1 
ATOM   7433  N  ND1 . HIS C  3  140 ? -28.178 -24.072 -30.244  1.00 237.35 ? 138  HIS C ND1 1 
ATOM   7434  C  CD2 . HIS C  3  140 ? -26.096 -24.650 -29.923  1.00 229.73 ? 138  HIS C CD2 1 
ATOM   7435  C  CE1 . HIS C  3  140 ? -27.585 -23.067 -29.626  1.00 229.29 ? 138  HIS C CE1 1 
ATOM   7436  N  NE2 . HIS C  3  140 ? -26.321 -23.392 -29.419  1.00 224.32 ? 138  HIS C NE2 1 
ATOM   7437  N  N   . VAL C  3  141 ? -26.411 -24.753 -33.823  1.00 225.16 ? 139  VAL C N   1 
ATOM   7438  C  CA  . VAL C  3  141 ? -25.333 -24.414 -34.744  1.00 224.16 ? 139  VAL C CA  1 
ATOM   7439  C  C   . VAL C  3  141 ? -24.483 -23.299 -34.144  1.00 220.98 ? 139  VAL C C   1 
ATOM   7440  O  O   . VAL C  3  141 ? -25.018 -22.313 -33.624  1.00 216.39 ? 139  VAL C O   1 
ATOM   7441  C  CB  . VAL C  3  141 ? -25.891 -23.999 -36.117  1.00 226.99 ? 139  VAL C CB  1 
ATOM   7442  C  CG1 . VAL C  3  141 ? -24.772 -23.560 -37.037  1.00 236.70 ? 139  VAL C CG1 1 
ATOM   7443  C  CG2 . VAL C  3  141 ? -26.671 -25.146 -36.732  1.00 235.34 ? 139  VAL C CG2 1 
ATOM   7444  N  N   . GLU C  3  142 ? -23.160 -23.450 -34.238  1.00 228.55 ? 140  GLU C N   1 
ATOM   7445  C  CA  . GLU C  3  142 ? -22.200 -22.421 -33.856  1.00 237.50 ? 140  GLU C CA  1 
ATOM   7446  C  C   . GLU C  3  142 ? -21.358 -22.034 -35.069  1.00 231.78 ? 140  GLU C C   1 
ATOM   7447  O  O   . GLU C  3  142 ? -21.023 -22.884 -35.901  1.00 233.03 ? 140  GLU C O   1 
ATOM   7448  C  CB  . GLU C  3  142 ? -21.285 -22.901 -32.715  1.00 242.89 ? 140  GLU C CB  1 
ATOM   7449  C  CG  . GLU C  3  142 ? -22.014 -23.364 -31.456  1.00 239.66 ? 140  GLU C CG  1 
ATOM   7450  C  CD  . GLU C  3  142 ? -21.066 -23.921 -30.404  1.00 240.51 ? 140  GLU C CD  1 
ATOM   7451  O  OE1 . GLU C  3  142 ? -19.834 -23.850 -30.610  1.00 248.15 ? 140  GLU C OE1 1 
ATOM   7452  O  OE2 . GLU C  3  142 ? -21.552 -24.433 -29.372  1.00 234.88 ? 140  GLU C OE2 1 
ATOM   7453  N  N   . LEU C  3  143 ? -21.012 -20.751 -35.165  1.00 217.30 ? 141  LEU C N   1 
ATOM   7454  C  CA  . LEU C  3  143 ? -20.291 -20.208 -36.308  1.00 198.66 ? 141  LEU C CA  1 
ATOM   7455  C  C   . LEU C  3  143 ? -18.916 -19.711 -35.881  1.00 198.59 ? 141  LEU C C   1 
ATOM   7456  O  O   . LEU C  3  143 ? -18.763 -19.131 -34.802  1.00 209.56 ? 141  LEU C O   1 
ATOM   7457  C  CB  . LEU C  3  143 ? -21.079 -19.066 -36.951  1.00 191.80 ? 141  LEU C CB  1 
ATOM   7458  C  CG  . LEU C  3  143 ? -20.508 -18.511 -38.252  1.00 189.15 ? 141  LEU C CG  1 
ATOM   7459  C  CD1 . LEU C  3  143 ? -20.462 -19.606 -39.302  1.00 206.28 ? 141  LEU C CD1 1 
ATOM   7460  C  CD2 . LEU C  3  143 ? -21.341 -17.339 -38.728  1.00 184.68 ? 141  LEU C CD2 1 
ATOM   7461  N  N   . TYR C  3  144 ? -17.918 -19.930 -36.732  1.00 201.83 ? 142  TYR C N   1 
ATOM   7462  C  CA  . TYR C  3  144 ? -16.544 -19.570 -36.416  1.00 202.24 ? 142  TYR C CA  1 
ATOM   7463  C  C   . TYR C  3  144 ? -15.929 -18.804 -37.580  1.00 203.62 ? 142  TYR C C   1 
ATOM   7464  O  O   . TYR C  3  144 ? -16.491 -18.732 -38.675  1.00 205.56 ? 142  TYR C O   1 
ATOM   7465  C  CB  . TYR C  3  144 ? -15.705 -20.811 -36.091  1.00 211.47 ? 142  TYR C CB  1 
ATOM   7466  C  CG  . TYR C  3  144 ? -16.095 -21.494 -34.799  1.00 219.10 ? 142  TYR C CG  1 
ATOM   7467  C  CD1 . TYR C  3  144 ? -15.512 -21.124 -33.596  1.00 221.10 ? 142  TYR C CD1 1 
ATOM   7468  C  CD2 . TYR C  3  144 ? -17.041 -22.512 -34.783  1.00 224.57 ? 142  TYR C CD2 1 
ATOM   7469  C  CE1 . TYR C  3  144 ? -15.860 -21.742 -32.413  1.00 223.20 ? 142  TYR C CE1 1 
ATOM   7470  C  CE2 . TYR C  3  144 ? -17.395 -23.137 -33.602  1.00 224.53 ? 142  TYR C CE2 1 
ATOM   7471  C  CZ  . TYR C  3  144 ? -16.800 -22.747 -32.422  1.00 221.98 ? 142  TYR C CZ  1 
ATOM   7472  O  OH  . TYR C  3  144 ? -17.143 -23.362 -31.242  1.00 224.24 ? 142  TYR C OH  1 
ATOM   7473  N  N   . GLN C  3  145 ? -14.757 -18.228 -37.331  1.00 218.67 ? 143  GLN C N   1 
ATOM   7474  C  CA  . GLN C  3  145 ? -14.017 -17.473 -38.330  1.00 225.12 ? 143  GLN C CA  1 
ATOM   7475  C  C   . GLN C  3  145 ? -12.622 -18.067 -38.489  1.00 233.51 ? 143  GLN C C   1 
ATOM   7476  O  O   . GLN C  3  145 ? -12.079 -18.664 -37.555  1.00 240.86 ? 143  GLN C O   1 
ATOM   7477  C  CB  . GLN C  3  145 ? -13.931 -15.994 -37.936  1.00 226.48 ? 143  GLN C CB  1 
ATOM   7478  C  CG  . GLN C  3  145 ? -13.346 -15.086 -38.995  1.00 232.45 ? 143  GLN C CG  1 
ATOM   7479  C  CD  . GLN C  3  145 ? -13.129 -13.677 -38.486  1.00 237.86 ? 143  GLN C CD  1 
ATOM   7480  O  OE1 . GLN C  3  145 ? -13.668 -13.291 -37.448  1.00 243.33 ? 143  GLN C OE1 1 
ATOM   7481  N  NE2 . GLN C  3  145 ? -12.330 -12.901 -39.209  1.00 228.25 ? 143  GLN C NE2 1 
ATOM   7482  N  N   . LYS C  3  146 ? -12.043 -17.905 -39.681  1.00 226.14 ? 144  LYS C N   1 
ATOM   7483  C  CA  . LYS C  3  146 ? -10.738 -18.485 -39.990  1.00 227.49 ? 144  LYS C CA  1 
ATOM   7484  C  C   . LYS C  3  146 ? -9.619  -17.591 -39.466  1.00 237.58 ? 144  LYS C C   1 
ATOM   7485  O  O   . LYS C  3  146 ? -9.499  -16.429 -39.873  1.00 243.69 ? 144  LYS C O   1 
ATOM   7486  C  CB  . LYS C  3  146 ? -10.587 -18.691 -41.496  1.00 228.26 ? 144  LYS C CB  1 
ATOM   7487  C  CG  . LYS C  3  146 ? -9.260  -19.313 -41.920  1.00 231.23 ? 144  LYS C CG  1 
ATOM   7488  C  CD  . LYS C  3  146 ? -9.156  -19.394 -43.437  1.00 230.11 ? 144  LYS C CD  1 
ATOM   7489  C  CE  . LYS C  3  146 ? -7.834  -20.002 -43.875  1.00 231.93 ? 144  LYS C CE  1 
ATOM   7490  N  NZ  . LYS C  3  146 ? -7.623  -19.952 -45.348  1.00 230.80 ? 144  LYS C NZ  1 
ATOM   7491  N  N   . TYR C  3  147 ? -8.789  -18.140 -38.581  1.00 240.77 ? 145  TYR C N   1 
ATOM   7492  C  CA  . TYR C  3  147 ? -7.638  -17.435 -38.030  1.00 241.28 ? 145  TYR C CA  1 
ATOM   7493  C  C   . TYR C  3  147 ? -6.409  -18.323 -38.143  1.00 249.99 ? 145  TYR C C   1 
ATOM   7494  O  O   . TYR C  3  147 ? -6.474  -19.516 -37.830  1.00 251.80 ? 145  TYR C O   1 
ATOM   7495  C  CB  . TYR C  3  147 ? -7.877  -17.040 -36.569  1.00 228.86 ? 145  TYR C CB  1 
ATOM   7496  C  CG  . TYR C  3  147 ? -8.707  -15.791 -36.414  1.00 224.16 ? 145  TYR C CG  1 
ATOM   7497  C  CD1 . TYR C  3  147 ? -8.108  -14.540 -36.370  1.00 224.68 ? 145  TYR C CD1 1 
ATOM   7498  C  CD2 . TYR C  3  147 ? -10.090 -15.859 -36.324  1.00 223.85 ? 145  TYR C CD2 1 
ATOM   7499  C  CE1 . TYR C  3  147 ? -8.862  -13.392 -36.234  1.00 224.53 ? 145  TYR C CE1 1 
ATOM   7500  C  CE2 . TYR C  3  147 ? -10.853 -14.716 -36.186  1.00 229.05 ? 145  TYR C CE2 1 
ATOM   7501  C  CZ  . TYR C  3  147 ? -10.234 -13.484 -36.143  1.00 230.89 ? 145  TYR C CZ  1 
ATOM   7502  O  OH  . TYR C  3  147 ? -10.985 -12.339 -36.007  1.00 239.23 ? 145  TYR C OH  1 
ATOM   7503  N  N   . SER C  3  148 ? -5.295  -17.745 -38.599  1.00 252.10 ? 146  SER C N   1 
ATOM   7504  C  CA  . SER C  3  148 ? -4.024  -18.454 -38.754  1.00 253.99 ? 146  SER C CA  1 
ATOM   7505  C  C   . SER C  3  148 ? -4.148  -19.684 -39.648  1.00 264.96 ? 146  SER C C   1 
ATOM   7506  O  O   . SER C  3  148 ? -3.298  -20.581 -39.596  1.00 269.84 ? 146  SER C O   1 
ATOM   7507  C  CB  . SER C  3  148 ? -3.441  -18.852 -37.391  1.00 248.57 ? 146  SER C CB  1 
ATOM   7508  O  OG  . SER C  3  148 ? -2.176  -19.477 -37.532  1.00 244.26 ? 146  SER C OG  1 
ATOM   7509  N  N   . GLN C  3  149 ? -5.206  -19.746 -40.458  1.00 271.20 ? 147  GLN C N   1 
ATOM   7510  C  CA  . GLN C  3  149 ? -5.502  -20.848 -41.370  1.00 268.31 ? 147  GLN C CA  1 
ATOM   7511  C  C   . GLN C  3  149 ? -5.641  -22.193 -40.660  1.00 268.04 ? 147  GLN C C   1 
ATOM   7512  O  O   . GLN C  3  149 ? -5.664  -23.239 -41.324  1.00 266.98 ? 147  GLN C O   1 
ATOM   7513  C  CB  . GLN C  3  149 ? -4.452  -20.944 -42.487  1.00 264.21 ? 147  GLN C CB  1 
ATOM   7514  C  CG  . GLN C  3  149 ? -4.313  -19.670 -43.317  1.00 261.93 ? 147  GLN C CG  1 
ATOM   7515  C  CD  . GLN C  3  149 ? -3.309  -19.808 -44.447  1.00 274.48 ? 147  GLN C CD  1 
ATOM   7516  O  OE1 . GLN C  3  149 ? -2.931  -20.916 -44.827  1.00 281.12 ? 147  GLN C OE1 1 
ATOM   7517  N  NE2 . GLN C  3  149 ? -2.869  -18.677 -44.987  1.00 278.22 ? 147  GLN C NE2 1 
ATOM   7518  N  N   . ASN C  3  150 ? -5.750  -22.198 -39.329  1.00 262.06 ? 148  ASN C N   1 
ATOM   7519  C  CA  . ASN C  3  150 ? -5.871  -23.429 -38.557  1.00 257.25 ? 148  ASN C CA  1 
ATOM   7520  C  C   . ASN C  3  150 ? -6.791  -23.221 -37.359  1.00 243.42 ? 148  ASN C C   1 
ATOM   7521  O  O   . ASN C  3  150 ? -7.614  -24.086 -37.039  1.00 244.41 ? 148  ASN C O   1 
ATOM   7522  C  CB  . ASN C  3  150 ? -4.492  -23.909 -38.091  1.00 260.01 ? 148  ASN C CB  1 
ATOM   7523  C  CG  . ASN C  3  150 ? -4.565  -25.153 -37.218  1.00 257.96 ? 148  ASN C CG  1 
ATOM   7524  O  OD1 . ASN C  3  150 ? -5.473  -25.974 -37.357  1.00 262.60 ? 148  ASN C OD1 1 
ATOM   7525  N  ND2 . ASN C  3  150 ? -3.604  -25.297 -36.312  1.00 252.17 ? 148  ASN C ND2 1 
ATOM   7526  N  N   . SER C  3  151 ? -6.658  -22.079 -36.695  1.00 241.65 ? 149  SER C N   1 
ATOM   7527  C  CA  . SER C  3  151 ? -7.461  -21.768 -35.523  1.00 240.93 ? 149  SER C CA  1 
ATOM   7528  C  C   . SER C  3  151 ? -8.778  -21.122 -35.930  1.00 234.59 ? 149  SER C C   1 
ATOM   7529  O  O   . SER C  3  151 ? -8.863  -20.403 -36.929  1.00 232.89 ? 149  SER C O   1 
ATOM   7530  C  CB  . SER C  3  151 ? -6.702  -20.840 -34.573  1.00 246.05 ? 149  SER C CB  1 
ATOM   7531  O  OG  . SER C  3  151 ? -7.530  -20.423 -33.501  1.00 244.62 ? 149  SER C OG  1 
ATOM   7532  N  N   . TRP C  3  152 ? -9.814  -21.388 -35.142  1.00 228.46 ? 150  TRP C N   1 
ATOM   7533  C  CA  . TRP C  3  152 ? -11.143 -20.850 -35.386  1.00 225.27 ? 150  TRP C CA  1 
ATOM   7534  C  C   . TRP C  3  152 ? -11.603 -20.094 -34.152  1.00 217.88 ? 150  TRP C C   1 
ATOM   7535  O  O   . TRP C  3  152 ? -11.485 -20.596 -33.029  1.00 218.89 ? 150  TRP C O   1 
ATOM   7536  C  CB  . TRP C  3  152 ? -12.127 -21.964 -35.740  1.00 234.00 ? 150  TRP C CB  1 
ATOM   7537  C  CG  . TRP C  3  152 ? -11.624 -22.831 -36.847  1.00 242.60 ? 150  TRP C CG  1 
ATOM   7538  C  CD1 . TRP C  3  152 ? -10.944 -24.007 -36.721  1.00 244.31 ? 150  TRP C CD1 1 
ATOM   7539  C  CD2 . TRP C  3  152 ? -11.739 -22.581 -38.253  1.00 247.03 ? 150  TRP C CD2 1 
ATOM   7540  N  NE1 . TRP C  3  152 ? -10.636 -24.510 -37.961  1.00 249.91 ? 150  TRP C NE1 1 
ATOM   7541  C  CE2 . TRP C  3  152 ? -11.113 -23.654 -38.919  1.00 257.77 ? 150  TRP C CE2 1 
ATOM   7542  C  CE3 . TRP C  3  152 ? -12.313 -21.557 -39.013  1.00 243.03 ? 150  TRP C CE3 1 
ATOM   7543  C  CZ2 . TRP C  3  152 ? -11.047 -23.733 -40.310  1.00 266.08 ? 150  TRP C CZ2 1 
ATOM   7544  C  CZ3 . TRP C  3  152 ? -12.248 -21.638 -40.392  1.00 252.43 ? 150  TRP C CZ3 1 
ATOM   7545  C  CH2 . TRP C  3  152 ? -11.618 -22.717 -41.027  1.00 264.68 ? 150  TRP C CH2 1 
ATOM   7546  N  N   . ARG C  3  153 ? -12.112 -18.887 -34.359  1.00 204.07 ? 151  ARG C N   1 
ATOM   7547  C  CA  . ARG C  3  153 ? -12.600 -18.060 -33.270  1.00 203.03 ? 151  ARG C CA  1 
ATOM   7548  C  C   . ARG C  3  153 ? -14.107 -17.890 -33.387  1.00 205.23 ? 151  ARG C C   1 
ATOM   7549  O  O   . ARG C  3  153 ? -14.647 -17.748 -34.490  1.00 197.86 ? 151  ARG C O   1 
ATOM   7550  C  CB  . ARG C  3  153 ? -11.900 -16.701 -33.248  1.00 208.82 ? 151  ARG C CB  1 
ATOM   7551  C  CG  . ARG C  3  153 ? -10.401 -16.807 -33.002  1.00 216.11 ? 151  ARG C CG  1 
ATOM   7552  C  CD  . ARG C  3  153 ? -10.080 -17.746 -31.844  1.00 206.60 ? 151  ARG C CD  1 
ATOM   7553  N  NE  . ARG C  3  153 ? -10.402 -17.158 -30.549  1.00 198.86 ? 151  ARG C NE  1 
ATOM   7554  C  CZ  . ARG C  3  153 ? -10.136 -17.734 -29.381  1.00 198.48 ? 151  ARG C CZ  1 
ATOM   7555  N  NH1 . ARG C  3  153 ? -9.541  -18.918 -29.347  1.00 200.02 ? 151  ARG C NH1 1 
ATOM   7556  N  NH2 . ARG C  3  153 ? -10.465 -17.124 -28.250  1.00 196.83 ? 151  ARG C NH2 1 
ATOM   7557  N  N   . TYR C  3  154 ? -14.769 -17.918 -32.234  1.00 222.04 ? 152  TYR C N   1 
ATOM   7558  C  CA  . TYR C  3  154 ? -16.221 -17.894 -32.166  1.00 213.21 ? 152  TYR C CA  1 
ATOM   7559  C  C   . TYR C  3  154 ? -16.776 -16.615 -32.781  1.00 201.37 ? 152  TYR C C   1 
ATOM   7560  O  O   . TYR C  3  154 ? -16.134 -15.561 -32.774  1.00 198.98 ? 152  TYR C O   1 
ATOM   7561  C  CB  . TYR C  3  154 ? -16.660 -18.015 -30.708  1.00 217.74 ? 152  TYR C CB  1 
ATOM   7562  C  CG  . TYR C  3  154 ? -18.136 -18.233 -30.507  1.00 217.44 ? 152  TYR C CG  1 
ATOM   7563  C  CD1 . TYR C  3  154 ? -18.675 -19.510 -30.546  1.00 222.69 ? 152  TYR C CD1 1 
ATOM   7564  C  CD2 . TYR C  3  154 ? -18.988 -17.166 -30.258  1.00 208.65 ? 152  TYR C CD2 1 
ATOM   7565  C  CE1 . TYR C  3  154 ? -20.021 -19.718 -30.354  1.00 221.54 ? 152  TYR C CE1 1 
ATOM   7566  C  CE2 . TYR C  3  154 ? -20.336 -17.365 -30.063  1.00 203.91 ? 152  TYR C CE2 1 
ATOM   7567  C  CZ  . TYR C  3  154 ? -20.846 -18.645 -30.113  1.00 213.05 ? 152  TYR C CZ  1 
ATOM   7568  O  OH  . TYR C  3  154 ? -22.186 -18.859 -29.920  1.00 220.49 ? 152  TYR C OH  1 
ATOM   7569  N  N   . LEU C  3  155 ? -17.987 -16.721 -33.324  1.00 189.46 ? 153  LEU C N   1 
ATOM   7570  C  CA  . LEU C  3  155 ? -18.659 -15.579 -33.927  1.00 184.41 ? 153  LEU C CA  1 
ATOM   7571  C  C   . LEU C  3  155 ? -20.053 -15.415 -33.347  1.00 182.76 ? 153  LEU C C   1 
ATOM   7572  O  O   . LEU C  3  155 ? -20.237 -14.706 -32.353  1.00 180.40 ? 153  LEU C O   1 
ATOM   7573  C  CB  . LEU C  3  155 ? -18.737 -15.734 -35.445  1.00 184.36 ? 153  LEU C CB  1 
ATOM   7574  C  CG  . LEU C  3  155 ? -17.395 -15.688 -36.169  1.00 198.62 ? 153  LEU C CG  1 
ATOM   7575  C  CD1 . LEU C  3  155 ? -17.608 -15.771 -37.667  1.00 207.51 ? 153  LEU C CD1 1 
ATOM   7576  C  CD2 . LEU C  3  155 ? -16.643 -14.421 -35.798  1.00 199.50 ? 153  LEU C CD2 1 
ATOM   7577  N  N   . SER C  3  156 ? -21.039 -16.069 -33.955  1.00 186.03 ? 154  SER C N   1 
ATOM   7578  C  CA  . SER C  3  156 ? -22.426 -15.952 -33.536  1.00 185.08 ? 154  SER C CA  1 
ATOM   7579  C  C   . SER C  3  156 ? -23.037 -17.342 -33.386  1.00 192.84 ? 154  SER C C   1 
ATOM   7580  O  O   . SER C  3  156 ? -22.381 -18.366 -33.599  1.00 195.66 ? 154  SER C O   1 
ATOM   7581  C  CB  . SER C  3  156 ? -23.232 -15.104 -34.526  1.00 181.40 ? 154  SER C CB  1 
ATOM   7582  O  OG  . SER C  3  156 ? -23.280 -15.710 -35.802  1.00 182.69 ? 154  SER C OG  1 
ATOM   7583  N  N   . ASN C  3  157 ? -24.316 -17.369 -33.015  1.00 199.54 ? 155  ASN C N   1 
ATOM   7584  C  CA  . ASN C  3  157 ? -25.028 -18.603 -32.721  1.00 205.85 ? 155  ASN C CA  1 
ATOM   7585  C  C   . ASN C  3  157 ? -26.484 -18.446 -33.138  1.00 208.72 ? 155  ASN C C   1 
ATOM   7586  O  O   . ASN C  3  157 ? -27.025 -17.336 -33.141  1.00 205.90 ? 155  ASN C O   1 
ATOM   7587  C  CB  . ASN C  3  157 ? -24.927 -18.947 -31.228  1.00 222.92 ? 155  ASN C CB  1 
ATOM   7588  C  CG  . ASN C  3  157 ? -25.554 -20.279 -30.886  1.00 237.27 ? 155  ASN C CG  1 
ATOM   7589  O  OD1 . ASN C  3  157 ? -26.723 -20.346 -30.506  1.00 253.84 ? 155  ASN C OD1 1 
ATOM   7590  N  ND2 . ASN C  3  157 ? -24.776 -21.350 -31.007  1.00 233.94 ? 155  ASN C ND2 1 
ATOM   7591  N  N   . ARG C  3  158 ? -27.116 -19.564 -33.496  1.00 215.70 ? 156  ARG C N   1 
ATOM   7592  C  CA  . ARG C  3  158 ? -28.515 -19.525 -33.906  1.00 217.29 ? 156  ARG C CA  1 
ATOM   7593  C  C   . ARG C  3  158 ? -29.122 -20.917 -33.821  1.00 222.39 ? 156  ARG C C   1 
ATOM   7594  O  O   . ARG C  3  158 ? -28.555 -21.878 -34.350  1.00 220.24 ? 156  ARG C O   1 
ATOM   7595  C  CB  . ARG C  3  158 ? -28.652 -18.979 -35.325  1.00 209.43 ? 156  ARG C CB  1 
ATOM   7596  C  CG  . ARG C  3  158 ? -30.081 -18.759 -35.759  1.00 208.84 ? 156  ARG C CG  1 
ATOM   7597  C  CD  . ARG C  3  158 ? -30.109 -17.828 -36.939  1.00 207.81 ? 156  ARG C CD  1 
ATOM   7598  N  NE  . ARG C  3  158 ? -29.310 -16.637 -36.674  1.00 207.37 ? 156  ARG C NE  1 
ATOM   7599  C  CZ  . ARG C  3  158 ? -29.084 -15.681 -37.566  1.00 213.83 ? 156  ARG C CZ  1 
ATOM   7600  N  NH1 . ARG C  3  158 ? -29.600 -15.782 -38.783  1.00 214.94 ? 156  ARG C NH1 1 
ATOM   7601  N  NH2 . ARG C  3  158 ? -28.344 -14.627 -37.244  1.00 213.11 ? 156  ARG C NH2 1 
ATOM   7602  N  N   . LEU C  3  159 ? -30.272 -21.015 -33.163  1.00 217.03 ? 157  LEU C N   1 
ATOM   7603  C  CA  . LEU C  3  159 ? -31.034 -22.252 -33.117  1.00 214.52 ? 157  LEU C CA  1 
ATOM   7604  C  C   . LEU C  3  159 ? -31.932 -22.338 -34.346  1.00 214.90 ? 157  LEU C C   1 
ATOM   7605  O  O   . LEU C  3  159 ? -32.368 -21.321 -34.891  1.00 212.12 ? 157  LEU C O   1 
ATOM   7606  C  CB  . LEU C  3  159 ? -31.871 -22.332 -31.836  1.00 214.76 ? 157  LEU C CB  1 
ATOM   7607  C  CG  . LEU C  3  159 ? -31.161 -22.440 -30.478  1.00 216.31 ? 157  LEU C CG  1 
ATOM   7608  C  CD1 . LEU C  3  159 ? -30.650 -21.093 -29.977  1.00 214.07 ? 157  LEU C CD1 1 
ATOM   7609  C  CD2 . LEU C  3  159 ? -32.084 -23.074 -29.447  1.00 224.07 ? 157  LEU C CD2 1 
ATOM   7610  N  N   . LEU C  3  160 ? -32.202 -23.566 -34.783  1.00 220.24 ? 158  LEU C N   1 
ATOM   7611  C  CA  . LEU C  3  160 ? -32.938 -23.819 -36.015  1.00 217.94 ? 158  LEU C CA  1 
ATOM   7612  C  C   . LEU C  3  160 ? -34.235 -24.565 -35.719  1.00 232.35 ? 158  LEU C C   1 
ATOM   7613  O  O   . LEU C  3  160 ? -34.297 -25.388 -34.804  1.00 236.63 ? 158  LEU C O   1 
ATOM   7614  C  CB  . LEU C  3  160 ? -32.085 -24.626 -37.004  1.00 210.88 ? 158  LEU C CB  1 
ATOM   7615  C  CG  . LEU C  3  160 ? -30.980 -23.912 -37.789  1.00 207.74 ? 158  LEU C CG  1 
ATOM   7616  C  CD1 . LEU C  3  160 ? -29.844 -23.432 -36.897  1.00 209.02 ? 158  LEU C CD1 1 
ATOM   7617  C  CD2 . LEU C  3  160 ? -30.453 -24.832 -38.878  1.00 210.72 ? 158  LEU C CD2 1 
ATOM   7618  N  N   . ALA C  3  161 ? -35.277 -24.284 -36.516  1.00 242.92 ? 159  ALA C N   1 
ATOM   7619  C  CA  . ALA C  3  161 ? -36.595 -24.855 -36.267  1.00 241.99 ? 159  ALA C CA  1 
ATOM   7620  C  C   . ALA C  3  161 ? -36.992 -25.847 -37.360  1.00 249.17 ? 159  ALA C C   1 
ATOM   7621  O  O   . ALA C  3  161 ? -36.663 -25.655 -38.535  1.00 258.42 ? 159  ALA C O   1 
ATOM   7622  C  CB  . ALA C  3  161 ? -37.658 -23.753 -36.179  1.00 237.70 ? 159  ALA C CB  1 
ATOM   7623  N  N   . PRO C  3  162 ? -37.716 -26.921 -37.001  1.00 236.95 ? 160  PRO C N   1 
ATOM   7624  C  CA  . PRO C  3  162 ? -38.110 -27.923 -38.004  1.00 242.82 ? 160  PRO C CA  1 
ATOM   7625  C  C   . PRO C  3  162 ? -39.137 -27.407 -39.000  1.00 250.15 ? 160  PRO C C   1 
ATOM   7626  O  O   . PRO C  3  162 ? -40.343 -27.632 -38.840  1.00 255.54 ? 160  PRO C O   1 
ATOM   7627  C  CB  . PRO C  3  162 ? -38.679 -29.066 -37.151  1.00 244.88 ? 160  PRO C CB  1 
ATOM   7628  C  CG  . PRO C  3  162 ? -39.130 -28.407 -35.891  1.00 238.44 ? 160  PRO C CG  1 
ATOM   7629  C  CD  . PRO C  3  162 ? -38.150 -27.294 -35.643  1.00 231.73 ? 160  PRO C CD  1 
ATOM   7630  N  N   . SER C  3  163 ? -38.665 -26.714 -40.036  1.00 255.28 ? 161  SER C N   1 
ATOM   7631  C  CA  . SER C  3  163 ? -39.523 -26.229 -41.109  1.00 254.34 ? 161  SER C CA  1 
ATOM   7632  C  C   . SER C  3  163 ? -39.725 -27.331 -42.140  1.00 262.63 ? 161  SER C C   1 
ATOM   7633  O  O   . SER C  3  163 ? -38.754 -27.931 -42.611  1.00 257.76 ? 161  SER C O   1 
ATOM   7634  C  CB  . SER C  3  163 ? -38.913 -24.993 -41.770  1.00 245.57 ? 161  SER C CB  1 
ATOM   7635  O  OG  . SER C  3  163 ? -39.689 -24.560 -42.872  1.00 244.76 ? 161  SER C OG  1 
ATOM   7636  N  N   . ASP C  3  164 ? -40.986 -27.582 -42.499  1.00 271.32 ? 162  ASP C N   1 
ATOM   7637  C  CA  . ASP C  3  164 ? -41.305 -28.668 -43.420  1.00 275.98 ? 162  ASP C CA  1 
ATOM   7638  C  C   . ASP C  3  164 ? -40.755 -28.435 -44.823  1.00 269.14 ? 162  ASP C C   1 
ATOM   7639  O  O   . ASP C  3  164 ? -40.607 -29.398 -45.584  1.00 269.74 ? 162  ASP C O   1 
ATOM   7640  C  CB  . ASP C  3  164 ? -42.821 -28.869 -43.487  1.00 286.38 ? 162  ASP C CB  1 
ATOM   7641  C  CG  . ASP C  3  164 ? -43.438 -29.121 -42.125  1.00 286.46 ? 162  ASP C CG  1 
ATOM   7642  O  OD1 . ASP C  3  164 ? -43.230 -30.224 -41.575  1.00 301.59 ? 162  ASP C OD1 1 
ATOM   7643  O  OD2 . ASP C  3  164 ? -44.141 -28.223 -41.610  1.00 268.50 ? 162  ASP C OD2 1 
ATOM   7644  N  N   . SER C  3  165 ? -40.456 -27.196 -45.180  1.00 268.43 ? 163  SER C N   1 
ATOM   7645  C  CA  . SER C  3  165 ? -39.958 -26.839 -46.496  1.00 275.69 ? 163  SER C CA  1 
ATOM   7646  C  C   . SER C  3  165 ? -38.496 -26.417 -46.417  1.00 255.17 ? 163  SER C C   1 
ATOM   7647  O  O   . SER C  3  165 ? -37.993 -26.092 -45.336  1.00 245.05 ? 163  SER C O   1 
ATOM   7648  C  CB  . SER C  3  165 ? -40.800 -25.700 -47.094  1.00 285.63 ? 163  SER C CB  1 
ATOM   7649  O  OG  . SER C  3  165 ? -40.729 -24.531 -46.296  1.00 277.40 ? 163  SER C OG  1 
ATOM   7650  N  N   . PRO C  3  166 ? -37.773 -26.434 -47.538  1.00 265.26 ? 164  PRO C N   1 
ATOM   7651  C  CA  . PRO C  3  166 ? -36.401 -25.909 -47.530  1.00 251.05 ? 164  PRO C CA  1 
ATOM   7652  C  C   . PRO C  3  166 ? -36.386 -24.451 -47.100  1.00 243.66 ? 164  PRO C C   1 
ATOM   7653  O  O   . PRO C  3  166 ? -37.108 -23.614 -47.647  1.00 240.69 ? 164  PRO C O   1 
ATOM   7654  C  CB  . PRO C  3  166 ? -35.943 -26.080 -48.985  1.00 265.11 ? 164  PRO C CB  1 
ATOM   7655  C  CG  . PRO C  3  166 ? -37.206 -26.244 -49.778  1.00 279.53 ? 164  PRO C CG  1 
ATOM   7656  C  CD  . PRO C  3  166 ? -38.139 -26.971 -48.859  1.00 284.15 ? 164  PRO C CD  1 
ATOM   7657  N  N   . GLU C  3  167 ? -35.560 -24.155 -46.105  1.00 247.62 ? 165  GLU C N   1 
ATOM   7658  C  CA  . GLU C  3  167 ? -35.527 -22.844 -45.480  1.00 249.33 ? 165  GLU C CA  1 
ATOM   7659  C  C   . GLU C  3  167 ? -34.214 -22.142 -45.810  1.00 248.78 ? 165  GLU C C   1 
ATOM   7660  O  O   . GLU C  3  167 ? -33.183 -22.784 -46.027  1.00 251.12 ? 165  GLU C O   1 
ATOM   7661  C  CB  . GLU C  3  167 ? -35.705 -22.969 -43.964  1.00 250.06 ? 165  GLU C CB  1 
ATOM   7662  C  CG  . GLU C  3  167 ? -36.213 -21.720 -43.279  1.00 246.38 ? 165  GLU C CG  1 
ATOM   7663  C  CD  . GLU C  3  167 ? -36.565 -21.958 -41.824  1.00 254.79 ? 165  GLU C CD  1 
ATOM   7664  O  OE1 . GLU C  3  167 ? -36.472 -23.118 -41.373  1.00 258.65 ? 165  GLU C OE1 1 
ATOM   7665  O  OE2 . GLU C  3  167 ? -36.934 -20.986 -41.131  1.00 254.18 ? 165  GLU C OE2 1 
ATOM   7666  N  N   . TRP C  3  168 ? -34.262 -20.814 -45.856  1.00 241.67 ? 166  TRP C N   1 
ATOM   7667  C  CA  . TRP C  3  168 ? -33.112 -19.996 -46.224  1.00 247.09 ? 166  TRP C CA  1 
ATOM   7668  C  C   . TRP C  3  168 ? -32.762 -19.101 -45.041  1.00 240.88 ? 166  TRP C C   1 
ATOM   7669  O  O   . TRP C  3  168 ? -33.590 -18.296 -44.604  1.00 238.16 ? 166  TRP C O   1 
ATOM   7670  C  CB  . TRP C  3  168 ? -33.422 -19.171 -47.478  1.00 246.58 ? 166  TRP C CB  1 
ATOM   7671  C  CG  . TRP C  3  168 ? -32.224 -18.829 -48.334  1.00 237.39 ? 166  TRP C CG  1 
ATOM   7672  C  CD1 . TRP C  3  168 ? -31.204 -17.982 -48.014  1.00 244.30 ? 166  TRP C CD1 1 
ATOM   7673  C  CD2 . TRP C  3  168 ? -31.946 -19.306 -49.659  1.00 220.61 ? 166  TRP C CD2 1 
ATOM   7674  N  NE1 . TRP C  3  168 ? -30.302 -17.911 -49.048  1.00 227.11 ? 166  TRP C NE1 1 
ATOM   7675  C  CE2 . TRP C  3  168 ? -30.734 -18.713 -50.070  1.00 217.74 ? 166  TRP C CE2 1 
ATOM   7676  C  CE3 . TRP C  3  168 ? -32.599 -20.177 -50.533  1.00 225.64 ? 166  TRP C CE3 1 
ATOM   7677  C  CZ2 . TRP C  3  168 ? -30.163 -18.966 -51.312  1.00 218.85 ? 166  TRP C CZ2 1 
ATOM   7678  C  CZ3 . TRP C  3  168 ? -32.030 -20.427 -51.767  1.00 238.54 ? 166  TRP C CZ3 1 
ATOM   7679  C  CH2 . TRP C  3  168 ? -30.824 -19.823 -52.145  1.00 237.78 ? 166  TRP C CH2 1 
ATOM   7680  N  N   . LEU C  3  169 ? -31.545 -19.243 -44.518  1.00 235.07 ? 167  LEU C N   1 
ATOM   7681  C  CA  . LEU C  3  169 ? -31.098 -18.471 -43.364  1.00 234.23 ? 167  LEU C CA  1 
ATOM   7682  C  C   . LEU C  3  169 ? -30.008 -17.485 -43.773  1.00 236.50 ? 167  LEU C C   1 
ATOM   7683  O  O   . LEU C  3  169 ? -29.582 -17.434 -44.930  1.00 250.02 ? 167  LEU C O   1 
ATOM   7684  C  CB  . LEU C  3  169 ? -30.610 -19.395 -42.248  1.00 243.57 ? 167  LEU C CB  1 
ATOM   7685  C  CG  . LEU C  3  169 ? -31.639 -19.733 -41.166  1.00 260.87 ? 167  LEU C CG  1 
ATOM   7686  C  CD1 . LEU C  3  169 ? -32.746 -20.615 -41.726  1.00 269.35 ? 167  LEU C CD1 1 
ATOM   7687  C  CD2 . LEU C  3  169 ? -30.970 -20.387 -39.964  1.00 264.07 ? 167  LEU C CD2 1 
ATOM   7688  N  N   . SER C  3  170 ? -29.552 -16.694 -42.801  1.00 224.93 ? 168  SER C N   1 
ATOM   7689  C  CA  . SER C  3  170 ? -28.561 -15.659 -43.064  1.00 224.66 ? 168  SER C CA  1 
ATOM   7690  C  C   . SER C  3  170 ? -27.859 -15.289 -41.766  1.00 210.37 ? 168  SER C C   1 
ATOM   7691  O  O   . SER C  3  170 ? -28.491 -15.236 -40.709  1.00 211.90 ? 168  SER C O   1 
ATOM   7692  C  CB  . SER C  3  170 ? -29.208 -14.417 -43.687  1.00 234.93 ? 168  SER C CB  1 
ATOM   7693  O  OG  . SER C  3  170 ? -30.171 -13.858 -42.812  1.00 238.92 ? 168  SER C OG  1 
ATOM   7694  N  N   . PHE C  3  171 ? -26.556 -15.024 -41.857  1.00 203.61 ? 169  PHE C N   1 
ATOM   7695  C  CA  . PHE C  3  171 ? -25.750 -14.634 -40.704  1.00 202.75 ? 169  PHE C CA  1 
ATOM   7696  C  C   . PHE C  3  171 ? -25.008 -13.345 -41.020  1.00 201.30 ? 169  PHE C C   1 
ATOM   7697  O  O   . PHE C  3  171 ? -24.260 -13.279 -42.001  1.00 213.11 ? 169  PHE C O   1 
ATOM   7698  C  CB  . PHE C  3  171 ? -24.768 -15.741 -40.317  1.00 205.06 ? 169  PHE C CB  1 
ATOM   7699  C  CG  . PHE C  3  171 ? -25.402 -16.875 -39.564  1.00 215.19 ? 169  PHE C CG  1 
ATOM   7700  C  CD1 . PHE C  3  171 ? -25.522 -16.826 -38.185  1.00 233.35 ? 169  PHE C CD1 1 
ATOM   7701  C  CD2 . PHE C  3  171 ? -25.879 -17.989 -40.235  1.00 219.75 ? 169  PHE C CD2 1 
ATOM   7702  C  CE1 . PHE C  3  171 ? -26.103 -17.868 -37.488  1.00 237.61 ? 169  PHE C CE1 1 
ATOM   7703  C  CE2 . PHE C  3  171 ? -26.462 -19.035 -39.543  1.00 229.22 ? 169  PHE C CE2 1 
ATOM   7704  C  CZ  . PHE C  3  171 ? -26.574 -18.974 -38.168  1.00 234.75 ? 169  PHE C CZ  1 
ATOM   7705  N  N   . ASP C  3  172 ? -25.202 -12.333 -40.179  1.00 197.57 ? 170  ASP C N   1 
ATOM   7706  C  CA  . ASP C  3  172 ? -24.620 -11.009 -40.392  1.00 196.88 ? 170  ASP C CA  1 
ATOM   7707  C  C   . ASP C  3  172 ? -23.140 -11.030 -40.017  1.00 196.86 ? 170  ASP C C   1 
ATOM   7708  O  O   . ASP C  3  172 ? -22.781 -10.951 -38.840  1.00 196.30 ? 170  ASP C O   1 
ATOM   7709  C  CB  . ASP C  3  172 ? -25.381 -9.976  -39.570  1.00 222.49 ? 170  ASP C CB  1 
ATOM   7710  C  CG  . ASP C  3  172 ? -25.115 -8.553  -40.025  1.00 239.34 ? 170  ASP C CG  1 
ATOM   7711  O  OD1 . ASP C  3  172 ? -24.005 -8.278  -40.530  1.00 243.97 ? 170  ASP C OD1 1 
ATOM   7712  O  OD2 . ASP C  3  172 ? -26.023 -7.707  -39.874  1.00 245.97 ? 170  ASP C OD2 1 
ATOM   7713  N  N   . VAL C  3  173 ? -22.269 -11.110 -41.024  1.00 199.83 ? 171  VAL C N   1 
ATOM   7714  C  CA  . VAL C  3  173 ? -20.825 -11.130 -40.806  1.00 211.51 ? 171  VAL C CA  1 
ATOM   7715  C  C   . VAL C  3  173 ? -20.200 -9.857  -41.360  1.00 216.20 ? 171  VAL C C   1 
ATOM   7716  O  O   . VAL C  3  173 ? -19.089 -9.883  -41.902  1.00 216.77 ? 171  VAL C O   1 
ATOM   7717  C  CB  . VAL C  3  173 ? -20.180 -12.371 -41.448  1.00 226.81 ? 171  VAL C CB  1 
ATOM   7718  C  CG1 . VAL C  3  173 ? -20.561 -13.625 -40.685  1.00 239.08 ? 171  VAL C CG1 1 
ATOM   7719  C  CG2 . VAL C  3  173 ? -20.597 -12.486 -42.906  1.00 221.35 ? 171  VAL C CG2 1 
ATOM   7720  N  N   . THR C  3  174 ? -20.909 -8.735  -41.225  1.00 209.80 ? 172  THR C N   1 
ATOM   7721  C  CA  . THR C  3  174 ? -20.429 -7.476  -41.786  1.00 207.54 ? 172  THR C CA  1 
ATOM   7722  C  C   . THR C  3  174 ? -19.098 -7.068  -41.168  1.00 205.25 ? 172  THR C C   1 
ATOM   7723  O  O   . THR C  3  174 ? -18.155 -6.702  -41.880  1.00 209.45 ? 172  THR C O   1 
ATOM   7724  C  CB  . THR C  3  174 ? -21.476 -6.386  -41.580  1.00 214.95 ? 172  THR C CB  1 
ATOM   7725  O  OG1 . THR C  3  174 ? -22.664 -6.722  -42.307  1.00 220.52 ? 172  THR C OG1 1 
ATOM   7726  C  CG2 . THR C  3  174 ? -20.948 -5.044  -42.062  1.00 221.61 ? 172  THR C CG2 1 
ATOM   7727  N  N   . GLY C  3  175 ? -19.004 -7.130  -39.837  1.00 215.40 ? 173  GLY C N   1 
ATOM   7728  C  CA  . GLY C  3  175 ? -17.766 -6.765  -39.169  1.00 218.38 ? 173  GLY C CA  1 
ATOM   7729  C  C   . GLY C  3  175 ? -16.594 -7.633  -39.576  1.00 219.71 ? 173  GLY C C   1 
ATOM   7730  O  O   . GLY C  3  175 ? -15.440 -7.204  -39.488  1.00 224.11 ? 173  GLY C O   1 
ATOM   7731  N  N   . VAL C  3  176 ? -16.867 -8.856  -40.031  1.00 223.01 ? 174  VAL C N   1 
ATOM   7732  C  CA  . VAL C  3  176 ? -15.801 -9.738  -40.492  1.00 232.21 ? 174  VAL C CA  1 
ATOM   7733  C  C   . VAL C  3  176 ? -15.366 -9.360  -41.901  1.00 236.16 ? 174  VAL C C   1 
ATOM   7734  O  O   . VAL C  3  176 ? -14.168 -9.268  -42.194  1.00 242.53 ? 174  VAL C O   1 
ATOM   7735  C  CB  . VAL C  3  176 ? -16.253 -11.207 -40.417  1.00 231.18 ? 174  VAL C CB  1 
ATOM   7736  C  CG1 . VAL C  3  176 ? -15.180 -12.117 -40.990  1.00 240.65 ? 174  VAL C CG1 1 
ATOM   7737  C  CG2 . VAL C  3  176 ? -16.571 -11.592 -38.984  1.00 222.70 ? 174  VAL C CG2 1 
ATOM   7738  N  N   . VAL C  3  177 ? -16.335 -9.134  -42.790  1.00 229.81 ? 175  VAL C N   1 
ATOM   7739  C  CA  . VAL C  3  177 ? -16.017 -8.825  -44.182  1.00 233.30 ? 175  VAL C CA  1 
ATOM   7740  C  C   . VAL C  3  177 ? -15.269 -7.502  -44.279  1.00 240.43 ? 175  VAL C C   1 
ATOM   7741  O  O   . VAL C  3  177 ? -14.355 -7.347  -45.100  1.00 242.85 ? 175  VAL C O   1 
ATOM   7742  C  CB  . VAL C  3  177 ? -17.303 -8.817  -45.030  1.00 228.60 ? 175  VAL C CB  1 
ATOM   7743  C  CG1 . VAL C  3  177 ? -16.982 -8.498  -46.479  1.00 233.16 ? 175  VAL C CG1 1 
ATOM   7744  C  CG2 . VAL C  3  177 ? -18.017 -10.154 -44.924  1.00 220.77 ? 175  VAL C CG2 1 
ATOM   7745  N  N   . ARG C  3  178 ? -15.638 -6.531  -43.438  1.00 247.41 ? 176  ARG C N   1 
ATOM   7746  C  CA  . ARG C  3  178 ? -15.009 -5.214  -43.497  1.00 253.48 ? 176  ARG C CA  1 
ATOM   7747  C  C   . ARG C  3  178 ? -13.513 -5.299  -43.226  1.00 257.39 ? 176  ARG C C   1 
ATOM   7748  O  O   . ARG C  3  178 ? -12.715 -4.627  -43.891  1.00 261.36 ? 176  ARG C O   1 
ATOM   7749  C  CB  . ARG C  3  178 ? -15.678 -4.269  -42.500  1.00 250.57 ? 176  ARG C CB  1 
ATOM   7750  C  CG  . ARG C  3  178 ? -14.962 -2.936  -42.334  1.00 254.59 ? 176  ARG C CG  1 
ATOM   7751  C  CD  . ARG C  3  178 ? -15.746 -1.984  -41.444  1.00 257.61 ? 176  ARG C CD  1 
ATOM   7752  N  NE  . ARG C  3  178 ? -16.945 -1.481  -42.108  1.00 259.59 ? 176  ARG C NE  1 
ATOM   7753  C  CZ  . ARG C  3  178 ? -18.172 -1.947  -41.898  1.00 262.94 ? 176  ARG C CZ  1 
ATOM   7754  N  NH1 . ARG C  3  178 ? -18.375 -2.931  -41.031  1.00 265.09 ? 176  ARG C NH1 1 
ATOM   7755  N  NH2 . ARG C  3  178 ? -19.200 -1.424  -42.553  1.00 262.47 ? 176  ARG C NH2 1 
ATOM   7756  N  N   . GLN C  3  179 ? -13.110 -6.123  -42.255  1.00 261.16 ? 177  GLN C N   1 
ATOM   7757  C  CA  . GLN C  3  179 ? -11.691 -6.255  -41.943  1.00 263.34 ? 177  GLN C CA  1 
ATOM   7758  C  C   . GLN C  3  179 ? -10.952 -7.051  -43.010  1.00 263.85 ? 177  GLN C C   1 
ATOM   7759  O  O   . GLN C  3  179 ? -9.740  -6.881  -43.178  1.00 272.39 ? 177  GLN C O   1 
ATOM   7760  C  CB  . GLN C  3  179 ? -11.510 -6.912  -40.574  1.00 255.83 ? 177  GLN C CB  1 
ATOM   7761  C  CG  . GLN C  3  179 ? -12.163 -6.157  -39.425  1.00 254.90 ? 177  GLN C CG  1 
ATOM   7762  C  CD  . GLN C  3  179 ? -12.057 -6.899  -38.104  1.00 261.99 ? 177  GLN C CD  1 
ATOM   7763  O  OE1 . GLN C  3  179 ? -11.449 -7.967  -38.026  1.00 267.94 ? 177  GLN C OE1 1 
ATOM   7764  N  NE2 . GLN C  3  179 ? -12.652 -6.335  -37.058  1.00 258.95 ? 177  GLN C NE2 1 
ATOM   7765  N  N   . TRP C  3  180 ? -11.656 -7.917  -43.740  1.00 245.32 ? 178  TRP C N   1 
ATOM   7766  C  CA  . TRP C  3  180 ? -11.008 -8.737  -44.753  1.00 246.20 ? 178  TRP C CA  1 
ATOM   7767  C  C   . TRP C  3  180 ? -10.666 -7.961  -46.014  1.00 250.65 ? 178  TRP C C   1 
ATOM   7768  O  O   . TRP C  3  180 ? -9.750  -8.361  -46.742  1.00 257.60 ? 178  TRP C O   1 
ATOM   7769  C  CB  . TRP C  3  180 ? -11.896 -9.927  -45.113  1.00 240.26 ? 178  TRP C CB  1 
ATOM   7770  C  CG  . TRP C  3  180 ? -11.892 -10.993 -44.074  1.00 238.03 ? 178  TRP C CG  1 
ATOM   7771  C  CD1 . TRP C  3  180 ? -11.237 -10.971 -42.876  1.00 248.04 ? 178  TRP C CD1 1 
ATOM   7772  C  CD2 . TRP C  3  180 ? -12.569 -12.251 -44.138  1.00 231.94 ? 178  TRP C CD2 1 
ATOM   7773  N  NE1 . TRP C  3  180 ? -11.469 -12.138 -42.189  1.00 249.00 ? 178  TRP C NE1 1 
ATOM   7774  C  CE2 . TRP C  3  180 ? -12.283 -12.941 -42.943  1.00 244.63 ? 178  TRP C CE2 1 
ATOM   7775  C  CE3 . TRP C  3  180 ? -13.391 -12.862 -45.089  1.00 229.85 ? 178  TRP C CE3 1 
ATOM   7776  C  CZ2 . TRP C  3  180 ? -12.791 -14.211 -42.676  1.00 243.49 ? 178  TRP C CZ2 1 
ATOM   7777  C  CZ3 . TRP C  3  180 ? -13.893 -14.121 -44.822  1.00 228.60 ? 178  TRP C CZ3 1 
ATOM   7778  C  CH2 . TRP C  3  180 ? -13.592 -14.781 -43.626  1.00 234.41 ? 178  TRP C CH2 1 
ATOM   7779  N  N   . LEU C  3  181 ? -11.380 -6.871  -46.294  1.00 246.04 ? 179  LEU C N   1 
ATOM   7780  C  CA  . LEU C  3  181 ? -11.079 -6.065  -47.469  1.00 253.85 ? 179  LEU C CA  1 
ATOM   7781  C  C   . LEU C  3  181 ? -9.899  -5.133  -47.243  1.00 265.79 ? 179  LEU C C   1 
ATOM   7782  O  O   . LEU C  3  181 ? -9.318  -4.639  -48.218  1.00 272.83 ? 179  LEU C O   1 
ATOM   7783  C  CB  . LEU C  3  181 ? -12.314 -5.264  -47.888  1.00 247.80 ? 179  LEU C CB  1 
ATOM   7784  C  CG  . LEU C  3  181 ? -13.271 -5.903  -48.902  1.00 245.22 ? 179  LEU C CG  1 
ATOM   7785  C  CD1 . LEU C  3  181 ? -13.686 -7.307  -48.489  1.00 245.52 ? 179  LEU C CD1 1 
ATOM   7786  C  CD2 . LEU C  3  181 ? -14.497 -5.023  -49.088  1.00 240.63 ? 179  LEU C CD2 1 
ATOM   7787  N  N   . SER C  3  182 ? -9.530  -4.883  -45.984  1.00 271.47 ? 180  SER C N   1 
ATOM   7788  C  CA  . SER C  3  182 ? -8.337  -4.104  -45.684  1.00 271.75 ? 180  SER C CA  1 
ATOM   7789  C  C   . SER C  3  182 ? -7.066  -4.938  -45.757  1.00 281.21 ? 180  SER C C   1 
ATOM   7790  O  O   . SER C  3  182 ? -5.985  -4.379  -45.971  1.00 293.67 ? 180  SER C O   1 
ATOM   7791  C  CB  . SER C  3  182 ? -8.456  -3.467  -44.297  1.00 259.79 ? 180  SER C CB  1 
ATOM   7792  O  OG  . SER C  3  182 ? -8.504  -4.454  -43.279  1.00 257.53 ? 180  SER C OG  1 
ATOM   7793  N  N   . ARG C  3  183 ? -7.170  -6.253  -45.603  1.00 277.06 ? 181  ARG C N   1 
ATOM   7794  C  CA  . ARG C  3  183 ? -6.007  -7.125  -45.620  1.00 269.90 ? 181  ARG C CA  1 
ATOM   7795  C  C   . ARG C  3  183 ? -5.713  -7.603  -47.036  1.00 276.74 ? 181  ARG C C   1 
ATOM   7796  O  O   . ARG C  3  183 ? -6.614  -7.756  -47.866  1.00 280.00 ? 181  ARG C O   1 
ATOM   7797  C  CB  . ARG C  3  183 ? -6.220  -8.330  -44.702  1.00 255.14 ? 181  ARG C CB  1 
ATOM   7798  C  CG  . ARG C  3  183 ? -6.704  -7.952  -43.315  1.00 254.86 ? 181  ARG C CG  1 
ATOM   7799  C  CD  . ARG C  3  183 ? -7.056  -9.169  -42.480  1.00 267.98 ? 181  ARG C CD  1 
ATOM   7800  N  NE  . ARG C  3  183 ? -7.800  -8.793  -41.279  1.00 268.76 ? 181  ARG C NE  1 
ATOM   7801  C  CZ  . ARG C  3  183 ? -7.236  -8.426  -40.133  1.00 265.58 ? 181  ARG C CZ  1 
ATOM   7802  N  NH1 . ARG C  3  183 ? -5.915  -8.385  -40.024  1.00 267.27 ? 181  ARG C NH1 1 
ATOM   7803  N  NH2 . ARG C  3  183 ? -7.993  -8.099  -39.095  1.00 256.17 ? 181  ARG C NH2 1 
ATOM   7804  N  N   . GLY C  3  184 ? -4.436  -7.835  -47.307  1.00 276.77 ? 182  GLY C N   1 
ATOM   7805  C  CA  . GLY C  3  184 ? -4.029  -8.401  -48.572  1.00 284.34 ? 182  GLY C CA  1 
ATOM   7806  C  C   . GLY C  3  184 ? -4.099  -9.910  -48.635  1.00 291.17 ? 182  GLY C C   1 
ATOM   7807  O  O   . GLY C  3  184 ? -3.619  -10.500 -49.609  1.00 295.53 ? 182  GLY C O   1 
ATOM   7808  N  N   . GLY C  3  185 ? -4.674  -10.555 -47.621  1.00 289.17 ? 183  GLY C N   1 
ATOM   7809  C  CA  . GLY C  3  185 ? -4.794  -11.999 -47.613  1.00 284.70 ? 183  GLY C CA  1 
ATOM   7810  C  C   . GLY C  3  185 ? -5.746  -12.495 -48.680  1.00 275.57 ? 183  GLY C C   1 
ATOM   7811  O  O   . GLY C  3  185 ? -6.962  -12.330 -48.553  1.00 266.89 ? 183  GLY C O   1 
ATOM   7812  N  N   . GLU C  3  186 ? -5.208  -13.103 -49.737  1.00 268.18 ? 184  GLU C N   1 
ATOM   7813  C  CA  . GLU C  3  186 ? -6.010  -13.536 -50.874  1.00 258.04 ? 184  GLU C CA  1 
ATOM   7814  C  C   . GLU C  3  186 ? -6.752  -14.847 -50.625  1.00 254.53 ? 184  GLU C C   1 
ATOM   7815  O  O   . GLU C  3  186 ? -7.346  -15.388 -51.565  1.00 251.79 ? 184  GLU C O   1 
ATOM   7816  C  CB  . GLU C  3  186 ? -5.130  -13.667 -52.126  1.00 264.45 ? 184  GLU C CB  1 
ATOM   7817  C  CG  . GLU C  3  186 ? -4.527  -12.350 -52.617  1.00 261.33 ? 184  GLU C CG  1 
ATOM   7818  C  CD  . GLU C  3  186 ? -3.965  -12.439 -54.032  1.00 264.86 ? 184  GLU C CD  1 
ATOM   7819  O  OE1 . GLU C  3  186 ? -4.189  -13.467 -54.705  1.00 266.11 ? 184  GLU C OE1 1 
ATOM   7820  O  OE2 . GLU C  3  186 ? -3.302  -11.475 -54.473  1.00 259.95 ? 184  GLU C OE2 1 
ATOM   7821  N  N   . ILE C  3  187 ? -6.741  -15.369 -49.397  1.00 248.87 ? 185  ILE C N   1 
ATOM   7822  C  CA  . ILE C  3  187 ? -7.466  -16.593 -49.063  1.00 243.68 ? 185  ILE C CA  1 
ATOM   7823  C  C   . ILE C  3  187 ? -8.031  -16.457 -47.653  1.00 238.50 ? 185  ILE C C   1 
ATOM   7824  O  O   . ILE C  3  187 ? -7.281  -16.218 -46.699  1.00 239.06 ? 185  ILE C O   1 
ATOM   7825  C  CB  . ILE C  3  187 ? -6.582  -17.849 -49.176  1.00 242.30 ? 185  ILE C CB  1 
ATOM   7826  C  CG1 . ILE C  3  187 ? -7.330  -19.080 -48.657  1.00 237.79 ? 185  ILE C CG1 1 
ATOM   7827  C  CG2 . ILE C  3  187 ? -5.256  -17.660 -48.444  1.00 239.29 ? 185  ILE C CG2 1 
ATOM   7828  C  CD1 . ILE C  3  187 ? -8.575  -19.417 -49.448  1.00 236.01 ? 185  ILE C CD1 1 
ATOM   7829  N  N   . GLU C  3  188 ? -9.349  -16.595 -47.523  1.00 246.72 ? 186  GLU C N   1 
ATOM   7830  C  CA  . GLU C  3  188 ? -10.039 -16.547 -46.234  1.00 257.65 ? 186  GLU C CA  1 
ATOM   7831  C  C   . GLU C  3  188 ? -11.149 -17.596 -46.253  1.00 261.49 ? 186  GLU C C   1 
ATOM   7832  O  O   . GLU C  3  188 ? -11.269 -18.378 -47.201  1.00 271.35 ? 186  GLU C O   1 
ATOM   7833  C  CB  . GLU C  3  188 ? -10.583 -15.139 -45.952  1.00 260.56 ? 186  GLU C CB  1 
ATOM   7834  C  CG  . GLU C  3  188 ? -9.523  -14.053 -45.831  1.00 266.54 ? 186  GLU C CG  1 
ATOM   7835  C  CD  . GLU C  3  188 ? -8.707  -14.157 -44.554  1.00 272.32 ? 186  GLU C CD  1 
ATOM   7836  O  OE1 . GLU C  3  188 ? -9.068  -14.962 -43.668  1.00 280.70 ? 186  GLU C OE1 1 
ATOM   7837  O  OE2 . GLU C  3  188 ? -7.701  -13.426 -44.437  1.00 268.36 ? 186  GLU C OE2 1 
ATOM   7838  N  N   . GLY C  3  189 ? -11.972 -17.617 -45.210  1.00 255.75 ? 187  GLY C N   1 
ATOM   7839  C  CA  . GLY C  3  189 ? -13.064 -18.571 -45.160  1.00 254.86 ? 187  GLY C CA  1 
ATOM   7840  C  C   . GLY C  3  189 ? -13.760 -18.570 -43.814  1.00 254.21 ? 187  GLY C C   1 
ATOM   7841  O  O   . GLY C  3  189 ? -13.381 -17.851 -42.884  1.00 249.23 ? 187  GLY C O   1 
ATOM   7842  N  N   . PHE C  3  190 ? -14.799 -19.405 -43.730  1.00 249.00 ? 188  PHE C N   1 
ATOM   7843  C  CA  . PHE C  3  190 ? -15.597 -19.577 -42.524  1.00 229.65 ? 188  PHE C CA  1 
ATOM   7844  C  C   . PHE C  3  190 ? -15.687 -21.057 -42.170  1.00 228.85 ? 188  PHE C C   1 
ATOM   7845  O  O   . PHE C  3  190 ? -15.250 -21.933 -42.920  1.00 237.48 ? 188  PHE C O   1 
ATOM   7846  C  CB  . PHE C  3  190 ? -17.010 -18.999 -42.690  1.00 220.42 ? 188  PHE C CB  1 
ATOM   7847  C  CG  . PHE C  3  190 ? -17.045 -17.514 -42.909  1.00 216.84 ? 188  PHE C CG  1 
ATOM   7848  C  CD1 . PHE C  3  190 ? -17.116 -16.641 -41.837  1.00 211.72 ? 188  PHE C CD1 1 
ATOM   7849  C  CD2 . PHE C  3  190 ? -17.029 -16.991 -44.190  1.00 226.29 ? 188  PHE C CD2 1 
ATOM   7850  C  CE1 . PHE C  3  190 ? -17.160 -15.274 -42.038  1.00 209.19 ? 188  PHE C CE1 1 
ATOM   7851  C  CE2 . PHE C  3  190 ? -17.072 -15.626 -44.398  1.00 224.13 ? 188  PHE C CE2 1 
ATOM   7852  C  CZ  . PHE C  3  190 ? -17.137 -14.766 -43.321  1.00 215.33 ? 188  PHE C CZ  1 
ATOM   7853  N  N   . ARG C  3  191 ? -16.278 -21.332 -41.010  1.00 204.00 ? 189  ARG C N   1 
ATOM   7854  C  CA  . ARG C  3  191 ? -16.483 -22.697 -40.543  1.00 209.93 ? 189  ARG C CA  1 
ATOM   7855  C  C   . ARG C  3  191 ? -17.821 -22.773 -39.834  1.00 208.97 ? 189  ARG C C   1 
ATOM   7856  O  O   . ARG C  3  191 ? -18.152 -21.896 -39.031  1.00 212.75 ? 189  ARG C O   1 
ATOM   7857  C  CB  . ARG C  3  191 ? -15.369 -23.142 -39.591  1.00 224.24 ? 189  ARG C CB  1 
ATOM   7858  C  CG  . ARG C  3  191 ? -15.675 -24.431 -38.835  1.00 236.68 ? 189  ARG C CG  1 
ATOM   7859  C  CD  . ARG C  3  191 ? -14.808 -24.568 -37.585  1.00 244.30 ? 189  ARG C CD  1 
ATOM   7860  N  NE  . ARG C  3  191 ? -15.162 -25.745 -36.792  1.00 239.15 ? 189  ARG C NE  1 
ATOM   7861  C  CZ  . ARG C  3  191 ? -14.610 -26.056 -35.622  1.00 237.74 ? 189  ARG C CZ  1 
ATOM   7862  N  NH1 . ARG C  3  191 ? -13.675 -25.277 -35.096  1.00 233.07 ? 189  ARG C NH1 1 
ATOM   7863  N  NH2 . ARG C  3  191 ? -14.996 -27.148 -34.976  1.00 245.86 ? 189  ARG C NH2 1 
ATOM   7864  N  N   . LEU C  3  192 ? -18.583 -23.821 -40.119  1.00 221.69 ? 190  LEU C N   1 
ATOM   7865  C  CA  . LEU C  3  192 ? -19.873 -24.029 -39.472  1.00 222.59 ? 190  LEU C CA  1 
ATOM   7866  C  C   . LEU C  3  192 ? -19.872 -25.419 -38.845  1.00 242.36 ? 190  LEU C C   1 
ATOM   7867  O  O   . LEU C  3  192 ? -20.092 -26.419 -39.535  1.00 254.71 ? 190  LEU C O   1 
ATOM   7868  C  CB  . LEU C  3  192 ? -21.013 -23.861 -40.465  1.00 219.67 ? 190  LEU C CB  1 
ATOM   7869  C  CG  . LEU C  3  192 ? -22.407 -23.757 -39.852  1.00 217.16 ? 190  LEU C CG  1 
ATOM   7870  C  CD1 . LEU C  3  192 ? -23.236 -22.744 -40.617  1.00 218.67 ? 190  LEU C CD1 1 
ATOM   7871  C  CD2 . LEU C  3  192 ? -23.094 -25.110 -39.845  1.00 222.15 ? 190  LEU C CD2 1 
ATOM   7872  N  N   . SER C  3  193 ? -19.621 -25.481 -37.544  1.00 244.35 ? 191  SER C N   1 
ATOM   7873  C  CA  . SER C  3  193 ? -19.683 -26.729 -36.807  1.00 248.30 ? 191  SER C CA  1 
ATOM   7874  C  C   . SER C  3  193 ? -20.992 -26.781 -36.018  1.00 239.98 ? 191  SER C C   1 
ATOM   7875  O  O   . SER C  3  193 ? -21.954 -26.072 -36.334  1.00 230.67 ? 191  SER C O   1 
ATOM   7876  C  CB  . SER C  3  193 ? -18.447 -26.862 -35.912  1.00 256.94 ? 191  SER C CB  1 
ATOM   7877  O  OG  . SER C  3  193 ? -18.359 -25.784 -35.000  1.00 261.12 ? 191  SER C OG  1 
ATOM   7878  N  N   . ALA C  3  194 ? -21.038 -27.614 -34.988  1.00 243.94 ? 192  ALA C N   1 
ATOM   7879  C  CA  . ALA C  3  194 ? -22.236 -27.787 -34.183  1.00 245.84 ? 192  ALA C CA  1 
ATOM   7880  C  C   . ALA C  3  194 ? -21.947 -27.427 -32.728  1.00 250.93 ? 192  ALA C C   1 
ATOM   7881  O  O   . ALA C  3  194 ? -20.905 -26.858 -32.396  1.00 265.71 ? 192  ALA C O   1 
ATOM   7882  C  CB  . ALA C  3  194 ? -22.756 -29.217 -34.310  1.00 247.55 ? 192  ALA C CB  1 
ATOM   7883  N  N   . HIS C  3  195 ? -22.891 -27.767 -31.857  1.00 234.11 ? 193  HIS C N   1 
ATOM   7884  C  CA  . HIS C  3  195 ? -22.744 -27.464 -30.443  1.00 233.02 ? 193  HIS C CA  1 
ATOM   7885  C  C   . HIS C  3  195 ? -21.716 -28.389 -29.806  1.00 238.27 ? 193  HIS C C   1 
ATOM   7886  O  O   . HIS C  3  195 ? -21.630 -29.574 -30.142  1.00 244.27 ? 193  HIS C O   1 
ATOM   7887  C  CB  . HIS C  3  195 ? -24.088 -27.605 -29.735  1.00 238.09 ? 193  HIS C CB  1 
ATOM   7888  C  CG  . HIS C  3  195 ? -24.048 -27.238 -28.286  1.00 242.07 ? 193  HIS C CG  1 
ATOM   7889  N  ND1 . HIS C  3  195 ? -23.577 -26.022 -27.841  1.00 238.15 ? 193  HIS C ND1 1 
ATOM   7890  C  CD2 . HIS C  3  195 ? -24.421 -27.926 -27.181  1.00 247.39 ? 193  HIS C CD2 1 
ATOM   7891  C  CE1 . HIS C  3  195 ? -23.663 -25.975 -26.524  1.00 242.56 ? 193  HIS C CE1 1 
ATOM   7892  N  NE2 . HIS C  3  195 ? -24.172 -27.118 -26.098  1.00 248.05 ? 193  HIS C NE2 1 
ATOM   7893  N  N   . CYS C  3  196 ? -20.926 -27.839 -28.888  1.00 238.73 ? 194  CYS C N   1 
ATOM   7894  C  CA  . CYS C  3  196 ? -19.985 -28.613 -28.088  1.00 241.01 ? 194  CYS C CA  1 
ATOM   7895  C  C   . CYS C  3  196 ? -20.445 -28.567 -26.640  1.00 237.12 ? 194  CYS C C   1 
ATOM   7896  O  O   . CYS C  3  196 ? -20.479 -27.493 -26.031  1.00 223.88 ? 194  CYS C O   1 
ATOM   7897  C  CB  . CYS C  3  196 ? -18.558 -28.074 -28.204  1.00 246.71 ? 194  CYS C CB  1 
ATOM   7898  S  SG  . CYS C  3  196 ? -17.928 -27.722 -29.857  1.00 246.95 ? 194  CYS C SG  1 
ATOM   7899  N  N   . SER C  3  197 ? -20.798 -29.724 -26.094  1.00 246.79 ? 195  SER C N   1 
ATOM   7900  C  CA  . SER C  3  197 ? -21.285 -29.817 -24.722  1.00 239.87 ? 195  SER C CA  1 
ATOM   7901  C  C   . SER C  3  197 ? -20.119 -30.157 -23.799  1.00 238.97 ? 195  SER C C   1 
ATOM   7902  O  O   . SER C  3  197 ? -19.609 -31.282 -23.818  1.00 240.38 ? 195  SER C O   1 
ATOM   7903  C  CB  . SER C  3  197 ? -22.387 -30.865 -24.619  1.00 250.27 ? 195  SER C CB  1 
ATOM   7904  O  OG  . SER C  3  197 ? -21.899 -32.148 -24.975  1.00 258.73 ? 195  SER C OG  1 
ATOM   7905  N  N   . CYS C  3  198 ? -19.703 -29.189 -22.986  1.00 254.38 ? 196  CYS C N   1 
ATOM   7906  C  CA  . CYS C  3  198 ? -18.638 -29.415 -22.013  1.00 261.53 ? 196  CYS C CA  1 
ATOM   7907  C  C   . CYS C  3  198 ? -18.967 -28.746 -20.683  1.00 250.97 ? 196  CYS C C   1 
ATOM   7908  O  O   . CYS C  3  198 ? -20.082 -28.268 -20.479  1.00 244.46 ? 196  CYS C O   1 
ATOM   7909  C  CB  . CYS C  3  198 ? -17.298 -28.895 -22.539  1.00 267.80 ? 196  CYS C CB  1 
ATOM   7910  S  SG  . CYS C  3  198 ? -17.112 -27.096 -22.473  1.00 273.54 ? 196  CYS C SG  1 
ATOM   7911  N  N   . ILE C  3  209 ? -20.211 -35.121 -30.334  1.00 285.62 ? 207  ILE C N   1 
ATOM   7912  C  CA  . ILE C  3  209 ? -20.302 -34.146 -31.411  1.00 279.81 ? 207  ILE C CA  1 
ATOM   7913  C  C   . ILE C  3  209 ? -21.675 -34.253 -32.061  1.00 285.41 ? 207  ILE C C   1 
ATOM   7914  O  O   . ILE C  3  209 ? -22.054 -35.316 -32.562  1.00 284.92 ? 207  ILE C O   1 
ATOM   7915  C  CB  . ILE C  3  209 ? -19.177 -34.337 -32.440  1.00 279.72 ? 207  ILE C CB  1 
ATOM   7916  C  CG1 . ILE C  3  209 ? -18.364 -35.589 -32.101  1.00 283.01 ? 207  ILE C CG1 1 
ATOM   7917  C  CG2 . ILE C  3  209 ? -18.276 -33.108 -32.479  1.00 274.42 ? 207  ILE C CG2 1 
ATOM   7918  C  CD1 . ILE C  3  209 ? -17.498 -36.084 -33.235  1.00 285.78 ? 207  ILE C CD1 1 
ATOM   7919  N  N   . ASN C  3  210 ? -22.416 -33.148 -32.044  1.00 292.99 ? 208  ASN C N   1 
ATOM   7920  C  CA  . ASN C  3  210 ? -23.798 -33.105 -32.489  1.00 298.35 ? 208  ASN C CA  1 
ATOM   7921  C  C   . ASN C  3  210 ? -23.917 -32.442 -33.866  1.00 297.36 ? 208  ASN C C   1 
ATOM   7922  O  O   . ASN C  3  210 ? -22.955 -32.408 -34.639  1.00 297.62 ? 208  ASN C O   1 
ATOM   7923  C  CB  . ASN C  3  210 ? -24.628 -32.372 -31.428  1.00 288.98 ? 208  ASN C CB  1 
ATOM   7924  C  CG  . ASN C  3  210 ? -24.387 -32.909 -30.044  1.00 276.74 ? 208  ASN C CG  1 
ATOM   7925  O  OD1 . ASN C  3  210 ? -23.545 -32.397 -29.308  1.00 268.22 ? 208  ASN C OD1 1 
ATOM   7926  N  ND2 . ASN C  3  210 ? -25.122 -33.950 -29.677  1.00 281.15 ? 208  ASN C ND2 1 
ATOM   7927  N  N   . GLY C  3  211 ? -25.109 -31.927 -34.166  1.00 296.14 ? 209  GLY C N   1 
ATOM   7928  C  CA  . GLY C  3  211 ? -25.422 -31.118 -35.356  1.00 286.61 ? 209  GLY C CA  1 
ATOM   7929  C  C   . GLY C  3  211 ? -25.494 -31.752 -36.726  1.00 282.13 ? 209  GLY C C   1 
ATOM   7930  O  O   . GLY C  3  211 ? -26.361 -31.403 -37.531  1.00 277.21 ? 209  GLY C O   1 
ATOM   7931  N  N   . PHE C  3  212 ? -24.590 -32.675 -37.026  1.00 288.48 ? 210  PHE C N   1 
ATOM   7932  C  CA  . PHE C  3  212 ? -24.563 -33.327 -38.326  1.00 299.20 ? 210  PHE C CA  1 
ATOM   7933  C  C   . PHE C  3  212 ? -24.455 -34.824 -38.096  1.00 301.11 ? 210  PHE C C   1 
ATOM   7934  O  O   . PHE C  3  212 ? -23.570 -35.279 -37.364  1.00 299.54 ? 210  PHE C O   1 
ATOM   7935  C  CB  . PHE C  3  212 ? -23.392 -32.834 -39.187  1.00 303.73 ? 210  PHE C CB  1 
ATOM   7936  C  CG  . PHE C  3  212 ? -23.355 -31.340 -39.397  1.00 298.34 ? 210  PHE C CG  1 
ATOM   7937  C  CD1 . PHE C  3  212 ? -23.014 -30.485 -38.359  1.00 289.65 ? 210  PHE C CD1 1 
ATOM   7938  C  CD2 . PHE C  3  212 ? -23.613 -30.794 -40.645  1.00 299.06 ? 210  PHE C CD2 1 
ATOM   7939  C  CE1 . PHE C  3  212 ? -22.967 -29.122 -38.548  1.00 287.40 ? 210  PHE C CE1 1 
ATOM   7940  C  CE2 . PHE C  3  212 ? -23.558 -29.425 -40.842  1.00 293.36 ? 210  PHE C CE2 1 
ATOM   7941  C  CZ  . PHE C  3  212 ? -23.239 -28.590 -39.790  1.00 290.23 ? 210  PHE C CZ  1 
ATOM   7942  N  N   . THR C  3  213 ? -25.357 -35.587 -38.712  1.00 310.58 ? 211  THR C N   1 
ATOM   7943  C  CA  . THR C  3  213 ? -25.418 -37.025 -38.504  1.00 310.43 ? 211  THR C CA  1 
ATOM   7944  C  C   . THR C  3  213 ? -25.017 -37.832 -39.730  1.00 314.24 ? 211  THR C C   1 
ATOM   7945  O  O   . THR C  3  213 ? -24.866 -39.053 -39.623  1.00 313.97 ? 211  THR C O   1 
ATOM   7946  C  CB  . THR C  3  213 ? -26.832 -37.436 -38.064  1.00 306.02 ? 211  THR C CB  1 
ATOM   7947  O  OG1 . THR C  3  213 ? -27.755 -37.211 -39.138  1.00 301.59 ? 211  THR C OG1 1 
ATOM   7948  C  CG2 . THR C  3  213 ? -27.261 -36.619 -36.859  1.00 292.81 ? 211  THR C CG2 1 
ATOM   7949  N  N   . THR C  3  214 ? -24.839 -37.191 -40.881  1.00 327.45 ? 212  THR C N   1 
ATOM   7950  C  CA  . THR C  3  214 ? -24.414 -37.858 -42.101  1.00 334.91 ? 212  THR C CA  1 
ATOM   7951  C  C   . THR C  3  214 ? -22.981 -37.463 -42.442  1.00 338.13 ? 212  THR C C   1 
ATOM   7952  O  O   . THR C  3  214 ? -22.537 -36.350 -42.140  1.00 328.02 ? 212  THR C O   1 
ATOM   7953  C  CB  . THR C  3  214 ? -25.342 -37.504 -43.269  1.00 330.08 ? 212  THR C CB  1 
ATOM   7954  O  OG1 . THR C  3  214 ? -26.702 -37.503 -42.819  1.00 333.27 ? 212  THR C OG1 1 
ATOM   7955  C  CG2 . THR C  3  214 ? -25.198 -38.518 -44.401  1.00 325.69 ? 212  THR C CG2 1 
ATOM   7956  N  N   . GLY C  3  215 ? -22.263 -38.388 -43.085  1.00 343.16 ? 213  GLY C N   1 
ATOM   7957  C  CA  . GLY C  3  215 ? -20.897 -38.179 -43.515  1.00 332.20 ? 213  GLY C CA  1 
ATOM   7958  C  C   . GLY C  3  215 ? -20.701 -37.692 -44.934  1.00 329.17 ? 213  GLY C C   1 
ATOM   7959  O  O   . GLY C  3  215 ? -19.556 -37.463 -45.337  1.00 323.82 ? 213  GLY C O   1 
ATOM   7960  N  N   . ARG C  3  216 ? -21.776 -37.525 -45.712  1.00 326.59 ? 214  ARG C N   1 
ATOM   7961  C  CA  . ARG C  3  216 ? -21.634 -36.994 -47.063  1.00 322.45 ? 214  ARG C CA  1 
ATOM   7962  C  C   . ARG C  3  216 ? -21.405 -35.491 -47.066  1.00 320.87 ? 214  ARG C C   1 
ATOM   7963  O  O   . ARG C  3  216 ? -20.935 -34.951 -48.075  1.00 323.31 ? 214  ARG C O   1 
ATOM   7964  C  CB  . ARG C  3  216 ? -22.874 -37.319 -47.899  1.00 313.00 ? 214  ARG C CB  1 
ATOM   7965  C  CG  . ARG C  3  216 ? -23.262 -38.783 -47.899  1.00 307.24 ? 214  ARG C CG  1 
ATOM   7966  C  CD  . ARG C  3  216 ? -24.494 -39.018 -48.751  1.00 301.65 ? 214  ARG C CD  1 
ATOM   7967  N  NE  . ARG C  3  216 ? -24.751 -40.437 -48.957  1.00 299.06 ? 214  ARG C NE  1 
ATOM   7968  C  CZ  . ARG C  3  216 ? -25.697 -40.911 -49.760  1.00 305.64 ? 214  ARG C CZ  1 
ATOM   7969  N  NH1 . ARG C  3  216 ? -26.475 -40.075 -50.435  1.00 300.11 ? 214  ARG C NH1 1 
ATOM   7970  N  NH2 . ARG C  3  216 ? -25.863 -42.219 -49.891  1.00 323.08 ? 214  ARG C NH2 1 
ATOM   7971  N  N   . ARG C  3  217 ? -21.754 -34.810 -45.969  1.00 319.38 ? 215  ARG C N   1 
ATOM   7972  C  CA  . ARG C  3  217 ? -21.649 -33.362 -45.804  1.00 309.14 ? 215  ARG C CA  1 
ATOM   7973  C  C   . ARG C  3  217 ? -22.611 -32.617 -46.726  1.00 304.17 ? 215  ARG C C   1 
ATOM   7974  O  O   . ARG C  3  217 ? -22.856 -31.421 -46.537  1.00 299.55 ? 215  ARG C O   1 
ATOM   7975  C  CB  . ARG C  3  217 ? -20.210 -32.884 -46.034  1.00 307.45 ? 215  ARG C CB  1 
ATOM   7976  C  CG  . ARG C  3  217 ? -19.862 -31.595 -45.307  1.00 291.20 ? 215  ARG C CG  1 
ATOM   7977  C  CD  . ARG C  3  217 ? -18.875 -30.749 -46.099  1.00 286.83 ? 215  ARG C CD  1 
ATOM   7978  N  NE  . ARG C  3  217 ? -17.666 -31.485 -46.458  1.00 290.09 ? 215  ARG C NE  1 
ATOM   7979  C  CZ  . ARG C  3  217 ? -16.664 -30.972 -47.167  1.00 290.60 ? 215  ARG C CZ  1 
ATOM   7980  N  NH1 . ARG C  3  217 ? -16.723 -29.718 -47.592  1.00 280.17 ? 215  ARG C NH1 1 
ATOM   7981  N  NH2 . ARG C  3  217 ? -15.604 -31.712 -47.453  1.00 300.61 ? 215  ARG C NH2 1 
ATOM   7982  N  N   . GLY C  3  218 ? -23.175 -33.313 -47.712  1.00 291.72 ? 216  GLY C N   1 
ATOM   7983  C  CA  . GLY C  3  218 ? -24.106 -32.744 -48.660  1.00 280.82 ? 216  GLY C CA  1 
ATOM   7984  C  C   . GLY C  3  218 ? -25.560 -32.934 -48.319  1.00 276.82 ? 216  GLY C C   1 
ATOM   7985  O  O   . GLY C  3  218 ? -26.435 -32.497 -49.076  1.00 265.06 ? 216  GLY C O   1 
ATOM   7986  N  N   . ASP C  3  219 ? -25.849 -33.581 -47.190  1.00 286.74 ? 217  ASP C N   1 
ATOM   7987  C  CA  . ASP C  3  219 ? -27.224 -33.816 -46.777  1.00 285.94 ? 217  ASP C CA  1 
ATOM   7988  C  C   . ASP C  3  219 ? -27.817 -32.629 -46.026  1.00 279.36 ? 217  ASP C C   1 
ATOM   7989  O  O   . ASP C  3  219 ? -28.976 -32.272 -46.265  1.00 276.33 ? 217  ASP C O   1 
ATOM   7990  C  CB  . ASP C  3  219 ? -27.305 -35.085 -45.922  1.00 281.74 ? 217  ASP C CB  1 
ATOM   7991  C  CG  . ASP C  3  219 ? -26.966 -36.344 -46.712  1.00 280.30 ? 217  ASP C CG  1 
ATOM   7992  O  OD1 . ASP C  3  219 ? -26.105 -36.277 -47.615  1.00 277.32 ? 217  ASP C OD1 1 
ATOM   7993  O  OD2 . ASP C  3  219 ? -27.562 -37.407 -46.427  1.00 280.27 ? 217  ASP C OD2 1 
ATOM   7994  N  N   . LEU C  3  220 ? -27.054 -31.992 -45.132  1.00 268.79 ? 218  LEU C N   1 
ATOM   7995  C  CA  . LEU C  3  220 ? -27.622 -30.880 -44.377  1.00 262.85 ? 218  LEU C CA  1 
ATOM   7996  C  C   . LEU C  3  220 ? -27.562 -29.573 -45.158  1.00 252.79 ? 218  LEU C C   1 
ATOM   7997  O  O   . LEU C  3  220 ? -28.413 -28.693 -44.957  1.00 242.08 ? 218  LEU C O   1 
ATOM   7998  C  CB  . LEU C  3  220 ? -26.914 -30.721 -43.023  1.00 258.67 ? 218  LEU C CB  1 
ATOM   7999  C  CG  . LEU C  3  220 ? -27.608 -29.753 -42.054  1.00 252.72 ? 218  LEU C CG  1 
ATOM   8000  C  CD1 . LEU C  3  220 ? -29.037 -30.184 -41.847  1.00 251.28 ? 218  LEU C CD1 1 
ATOM   8001  C  CD2 . LEU C  3  220 ? -26.909 -29.648 -40.710  1.00 255.28 ? 218  LEU C CD2 1 
ATOM   8002  N  N   . ALA C  3  221 ? -26.579 -29.429 -46.047  1.00 262.24 ? 219  ALA C N   1 
ATOM   8003  C  CA  . ALA C  3  221 ? -26.428 -28.225 -46.844  1.00 259.55 ? 219  ALA C CA  1 
ATOM   8004  C  C   . ALA C  3  221 ? -26.083 -28.613 -48.268  1.00 262.04 ? 219  ALA C C   1 
ATOM   8005  O  O   . ALA C  3  221 ? -25.525 -29.682 -48.529  1.00 268.04 ? 219  ALA C O   1 
ATOM   8006  C  CB  . ALA C  3  221 ? -25.338 -27.296 -46.300  1.00 253.22 ? 219  ALA C CB  1 
ATOM   8007  N  N   . THR C  3  222 ? -26.398 -27.719 -49.191  1.00 252.98 ? 220  THR C N   1 
ATOM   8008  C  CA  . THR C  3  222 ? -26.069 -27.983 -50.584  1.00 258.24 ? 220  THR C CA  1 
ATOM   8009  C  C   . THR C  3  222 ? -24.558 -27.949 -50.793  1.00 267.70 ? 220  THR C C   1 
ATOM   8010  O  O   . THR C  3  222 ? -23.859 -27.040 -50.336  1.00 262.05 ? 220  THR C O   1 
ATOM   8011  C  CB  . THR C  3  222 ? -26.767 -26.996 -51.499  1.00 249.30 ? 220  THR C CB  1 
ATOM   8012  O  OG1 . THR C  3  222 ? -26.415 -27.279 -52.860  1.00 251.84 ? 220  THR C OG1 1 
ATOM   8013  C  CG2 . THR C  3  222 ? -26.386 -25.559 -51.145  1.00 238.99 ? 220  THR C CG2 1 
ATOM   8014  N  N   . ILE C  3  223 ? -24.057 -28.937 -51.529  1.00 290.86 ? 221  ILE C N   1 
ATOM   8015  C  CA  . ILE C  3  223 ? -22.625 -29.084 -51.784  1.00 292.27 ? 221  ILE C CA  1 
ATOM   8016  C  C   . ILE C  3  223 ? -22.446 -29.421 -53.260  1.00 297.89 ? 221  ILE C C   1 
ATOM   8017  O  O   . ILE C  3  223 ? -23.251 -30.165 -53.833  1.00 304.78 ? 221  ILE C O   1 
ATOM   8018  C  CB  . ILE C  3  223 ? -22.002 -30.173 -50.880  1.00 297.80 ? 221  ILE C CB  1 
ATOM   8019  C  CG1 . ILE C  3  223 ? -22.283 -29.899 -49.394  1.00 288.31 ? 221  ILE C CG1 1 
ATOM   8020  C  CG2 . ILE C  3  223 ? -20.499 -30.253 -51.113  1.00 294.48 ? 221  ILE C CG2 1 
ATOM   8021  C  CD1 . ILE C  3  223 ? -21.486 -28.730 -48.829  1.00 276.44 ? 221  ILE C CD1 1 
ATOM   8022  N  N   . HIS C  3  224 ? -21.366 -28.901 -53.861  1.00 307.30 ? 222  HIS C N   1 
ATOM   8023  C  CA  . HIS C  3  224 ? -21.068 -29.050 -55.293  1.00 325.43 ? 222  HIS C CA  1 
ATOM   8024  C  C   . HIS C  3  224 ? -22.329 -28.949 -56.152  1.00 324.24 ? 222  HIS C C   1 
ATOM   8025  O  O   . HIS C  3  224 ? -22.493 -29.680 -57.135  1.00 330.21 ? 222  HIS C O   1 
ATOM   8026  C  CB  . HIS C  3  224 ? -20.315 -30.360 -55.587  1.00 330.93 ? 222  HIS C CB  1 
ATOM   8027  C  CG  . HIS C  3  224 ? -21.143 -31.600 -55.421  1.00 328.72 ? 222  HIS C CG  1 
ATOM   8028  N  ND1 . HIS C  3  224 ? -21.439 -32.140 -54.187  1.00 316.23 ? 222  HIS C ND1 1 
ATOM   8029  C  CD2 . HIS C  3  224 ? -21.695 -32.434 -56.337  1.00 331.85 ? 222  HIS C CD2 1 
ATOM   8030  C  CE1 . HIS C  3  224 ? -22.160 -33.237 -54.348  1.00 317.79 ? 222  HIS C CE1 1 
ATOM   8031  N  NE2 . HIS C  3  224 ? -22.329 -33.438 -55.643  1.00 331.01 ? 222  HIS C NE2 1 
ATOM   8032  N  N   . GLY C  3  225 ? -23.223 -28.030 -55.789  1.00 287.48 ? 223  GLY C N   1 
ATOM   8033  C  CA  . GLY C  3  225 ? -24.444 -27.821 -56.537  1.00 272.36 ? 223  GLY C CA  1 
ATOM   8034  C  C   . GLY C  3  225 ? -24.733 -26.337 -56.656  1.00 252.40 ? 223  GLY C C   1 
ATOM   8035  O  O   . GLY C  3  225 ? -24.243 -25.515 -55.871  1.00 242.85 ? 223  GLY C O   1 
ATOM   8036  N  N   . MET C  3  226 ? -25.546 -26.005 -57.658  1.00 248.67 ? 224  MET C N   1 
ATOM   8037  C  CA  . MET C  3  226 ? -25.885 -24.613 -57.915  1.00 235.73 ? 224  MET C CA  1 
ATOM   8038  C  C   . MET C  3  226 ? -26.688 -24.050 -56.750  1.00 227.60 ? 224  MET C C   1 
ATOM   8039  O  O   . MET C  3  226 ? -27.305 -24.791 -55.980  1.00 219.09 ? 224  MET C O   1 
ATOM   8040  C  CB  . MET C  3  226 ? -26.670 -24.485 -59.221  1.00 239.53 ? 224  MET C CB  1 
ATOM   8041  C  CG  . MET C  3  226 ? -27.974 -25.254 -59.248  1.00 237.66 ? 224  MET C CG  1 
ATOM   8042  S  SD  . MET C  3  226 ? -28.548 -25.474 -60.937  1.00 234.79 ? 224  MET C SD  1 
ATOM   8043  C  CE  . MET C  3  226 ? -28.499 -23.779 -61.512  1.00 232.66 ? 224  MET C CE  1 
ATOM   8044  N  N   . ASN C  3  227 ? -26.657 -22.721 -56.618  1.00 244.91 ? 225  ASN C N   1 
ATOM   8045  C  CA  . ASN C  3  227 ? -27.256 -22.001 -55.495  1.00 248.85 ? 225  ASN C CA  1 
ATOM   8046  C  C   . ASN C  3  227 ? -26.540 -22.265 -54.181  1.00 239.37 ? 225  ASN C C   1 
ATOM   8047  O  O   . ASN C  3  227 ? -27.082 -21.984 -53.108  1.00 222.52 ? 225  ASN C O   1 
ATOM   8048  C  CB  . ASN C  3  227 ? -28.750 -22.334 -55.337  1.00 252.12 ? 225  ASN C CB  1 
ATOM   8049  C  CG  . ASN C  3  227 ? -29.544 -22.014 -56.578  1.00 252.59 ? 225  ASN C CG  1 
ATOM   8050  O  OD1 . ASN C  3  227 ? -28.983 -21.827 -57.655  1.00 251.12 ? 225  ASN C OD1 1 
ATOM   8051  N  ND2 . ASN C  3  227 ? -30.864 -21.949 -56.437  1.00 252.82 ? 225  ASN C ND2 1 
ATOM   8052  N  N   . ARG C  3  228 ? -25.328 -22.810 -54.249  1.00 238.15 ? 226  ARG C N   1 
ATOM   8053  C  CA  . ARG C  3  228 ? -24.566 -23.088 -53.050  1.00 222.02 ? 226  ARG C CA  1 
ATOM   8054  C  C   . ARG C  3  228 ? -24.283 -21.800 -52.281  1.00 219.63 ? 226  ARG C C   1 
ATOM   8055  O  O   . ARG C  3  228 ? -24.249 -20.715 -52.866  1.00 213.15 ? 226  ARG C O   1 
ATOM   8056  C  CB  . ARG C  3  228 ? -23.254 -23.766 -53.408  1.00 217.85 ? 226  ARG C CB  1 
ATOM   8057  C  CG  . ARG C  3  228 ? -22.380 -22.944 -54.299  1.00 213.62 ? 226  ARG C CG  1 
ATOM   8058  C  CD  . ARG C  3  228 ? -21.196 -23.762 -54.619  1.00 216.57 ? 226  ARG C CD  1 
ATOM   8059  N  NE  . ARG C  3  228 ? -20.120 -22.997 -55.214  1.00 219.37 ? 226  ARG C NE  1 
ATOM   8060  C  CZ  . ARG C  3  228 ? -18.955 -23.543 -55.511  1.00 227.53 ? 226  ARG C CZ  1 
ATOM   8061  N  NH1 . ARG C  3  228 ? -18.781 -24.825 -55.253  1.00 224.94 ? 226  ARG C NH1 1 
ATOM   8062  N  NH2 . ARG C  3  228 ? -17.989 -22.822 -56.059  1.00 239.20 ? 226  ARG C NH2 1 
ATOM   8063  N  N   . PRO C  3  229 ? -24.070 -21.908 -50.945  1.00 234.10 ? 227  PRO C N   1 
ATOM   8064  C  CA  . PRO C  3  229 ? -23.922 -20.720 -50.089  1.00 235.10 ? 227  PRO C CA  1 
ATOM   8065  C  C   . PRO C  3  229 ? -23.133 -19.569 -50.699  1.00 239.31 ? 227  PRO C C   1 
ATOM   8066  O  O   . PRO C  3  229 ? -22.036 -19.760 -51.237  1.00 242.34 ? 227  PRO C O   1 
ATOM   8067  C  CB  . PRO C  3  229 ? -23.211 -21.289 -48.858  1.00 235.86 ? 227  PRO C CB  1 
ATOM   8068  C  CG  . PRO C  3  229 ? -23.768 -22.680 -48.745  1.00 242.53 ? 227  PRO C CG  1 
ATOM   8069  C  CD  . PRO C  3  229 ? -24.010 -23.159 -50.161  1.00 242.51 ? 227  PRO C CD  1 
ATOM   8070  N  N   . PHE C  3  230 ? -23.702 -18.369 -50.629  1.00 236.96 ? 228  PHE C N   1 
ATOM   8071  C  CA  . PHE C  3  230 ? -23.110 -17.175 -51.209  1.00 235.76 ? 228  PHE C CA  1 
ATOM   8072  C  C   . PHE C  3  230 ? -23.145 -16.044 -50.188  1.00 218.77 ? 228  PHE C C   1 
ATOM   8073  O  O   . PHE C  3  230 ? -23.982 -16.022 -49.284  1.00 215.65 ? 228  PHE C O   1 
ATOM   8074  C  CB  . PHE C  3  230 ? -23.844 -16.750 -52.491  1.00 248.23 ? 228  PHE C CB  1 
ATOM   8075  C  CG  . PHE C  3  230 ? -25.233 -16.218 -52.254  1.00 244.12 ? 228  PHE C CG  1 
ATOM   8076  C  CD1 . PHE C  3  230 ? -26.304 -17.079 -52.069  1.00 240.02 ? 228  PHE C CD1 1 
ATOM   8077  C  CD2 . PHE C  3  230 ? -25.469 -14.852 -52.230  1.00 239.86 ? 228  PHE C CD2 1 
ATOM   8078  C  CE1 . PHE C  3  230 ? -27.580 -16.588 -51.856  1.00 230.26 ? 228  PHE C CE1 1 
ATOM   8079  C  CE2 . PHE C  3  230 ? -26.741 -14.356 -52.018  1.00 233.76 ? 228  PHE C CE2 1 
ATOM   8080  C  CZ  . PHE C  3  230 ? -27.797 -15.225 -51.831  1.00 229.42 ? 228  PHE C CZ  1 
ATOM   8081  N  N   . LEU C  3  231 ? -22.225 -15.094 -50.348  1.00 204.22 ? 229  LEU C N   1 
ATOM   8082  C  CA  . LEU C  3  231 ? -22.095 -13.954 -49.442  1.00 204.28 ? 229  LEU C CA  1 
ATOM   8083  C  C   . LEU C  3  231 ? -22.756 -12.736 -50.082  1.00 204.90 ? 229  LEU C C   1 
ATOM   8084  O  O   . LEU C  3  231 ? -22.209 -12.137 -51.010  1.00 215.50 ? 229  LEU C O   1 
ATOM   8085  C  CB  . LEU C  3  231 ? -20.629 -13.683 -49.126  1.00 206.36 ? 229  LEU C CB  1 
ATOM   8086  C  CG  . LEU C  3  231 ? -20.330 -12.522 -48.175  1.00 216.15 ? 229  LEU C CG  1 
ATOM   8087  C  CD1 . LEU C  3  231 ? -21.009 -12.742 -46.837  1.00 228.26 ? 229  LEU C CD1 1 
ATOM   8088  C  CD2 . LEU C  3  231 ? -18.834 -12.351 -47.985  1.00 215.28 ? 229  LEU C CD2 1 
ATOM   8089  N  N   . LEU C  3  232 ? -23.928 -12.359 -49.572  1.00 205.28 ? 230  LEU C N   1 
ATOM   8090  C  CA  . LEU C  3  232 ? -24.647 -11.201 -50.091  1.00 212.96 ? 230  LEU C CA  1 
ATOM   8091  C  C   . LEU C  3  232 ? -24.036 -9.918  -49.536  1.00 215.85 ? 230  LEU C C   1 
ATOM   8092  O  O   . LEU C  3  232 ? -23.882 -9.765  -48.320  1.00 218.83 ? 230  LEU C O   1 
ATOM   8093  C  CB  . LEU C  3  232 ? -26.130 -11.287 -49.731  1.00 216.37 ? 230  LEU C CB  1 
ATOM   8094  C  CG  . LEU C  3  232 ? -27.083 -10.300 -50.414  1.00 220.51 ? 230  LEU C CG  1 
ATOM   8095  C  CD1 . LEU C  3  232 ? -27.127 -10.536 -51.918  1.00 229.65 ? 230  LEU C CD1 1 
ATOM   8096  C  CD2 . LEU C  3  232 ? -28.477 -10.399 -49.814  1.00 213.89 ? 230  LEU C CD2 1 
ATOM   8097  N  N   . LEU C  3  233 ? -23.685 -8.997  -50.431  1.00 216.65 ? 231  LEU C N   1 
ATOM   8098  C  CA  . LEU C  3  233 ? -23.027 -7.751  -50.066  1.00 216.88 ? 231  LEU C CA  1 
ATOM   8099  C  C   . LEU C  3  233 ? -23.917 -6.568  -50.427  1.00 229.26 ? 231  LEU C C   1 
ATOM   8100  O  O   . LEU C  3  233 ? -24.611 -6.589  -51.448  1.00 241.32 ? 231  LEU C O   1 
ATOM   8101  C  CB  . LEU C  3  233 ? -21.672 -7.620  -50.773  1.00 216.04 ? 231  LEU C CB  1 
ATOM   8102  C  CG  . LEU C  3  233 ? -20.671 -8.765  -50.588  1.00 219.36 ? 231  LEU C CG  1 
ATOM   8103  C  CD1 . LEU C  3  233 ? -19.442 -8.564  -51.469  1.00 229.37 ? 231  LEU C CD1 1 
ATOM   8104  C  CD2 . LEU C  3  233 ? -20.270 -8.888  -49.130  1.00 219.45 ? 231  LEU C CD2 1 
ATOM   8105  N  N   . MET C  3  234 ? -23.899 -5.537  -49.584  1.00 218.60 ? 232  MET C N   1 
ATOM   8106  C  CA  . MET C  3  234 ? -24.655 -4.305  -49.817  1.00 214.33 ? 232  MET C CA  1 
ATOM   8107  C  C   . MET C  3  234 ? -23.726 -3.137  -49.501  1.00 220.99 ? 232  MET C C   1 
ATOM   8108  O  O   . MET C  3  234 ? -23.485 -2.830  -48.330  1.00 215.39 ? 232  MET C O   1 
ATOM   8109  C  CB  . MET C  3  234 ? -25.919 -4.260  -48.967  1.00 210.40 ? 232  MET C CB  1 
ATOM   8110  C  CG  . MET C  3  234 ? -26.837 -5.457  -49.156  1.00 214.75 ? 232  MET C CG  1 
ATOM   8111  S  SD  . MET C  3  234 ? -28.231 -5.449  -48.015  1.00 222.94 ? 232  MET C SD  1 
ATOM   8112  C  CE  . MET C  3  234 ? -29.069 -6.963  -48.478  1.00 219.00 ? 232  MET C CE  1 
ATOM   8113  N  N   . ALA C  3  235 ? -23.202 -2.492  -50.540  1.00 240.34 ? 233  ALA C N   1 
ATOM   8114  C  CA  . ALA C  3  235 ? -22.202 -1.448  -50.383  1.00 249.26 ? 233  ALA C CA  1 
ATOM   8115  C  C   . ALA C  3  235 ? -22.635 -0.192  -51.128  1.00 249.70 ? 233  ALA C C   1 
ATOM   8116  O  O   . ALA C  3  235 ? -23.591 -0.197  -51.907  1.00 240.88 ? 233  ALA C O   1 
ATOM   8117  C  CB  . ALA C  3  235 ? -20.827 -1.916  -50.882  1.00 253.69 ? 233  ALA C CB  1 
ATOM   8118  N  N   . THR C  3  236 ? -21.903 0.905   -50.879  1.00 261.73 ? 234  THR C N   1 
ATOM   8119  C  CA  . THR C  3  236 ? -22.167 2.204   -51.491  1.00 262.22 ? 234  THR C CA  1 
ATOM   8120  C  C   . THR C  3  236 ? -21.196 2.456   -52.633  1.00 269.53 ? 234  THR C C   1 
ATOM   8121  O  O   . THR C  3  236 ? -19.976 2.361   -52.429  1.00 273.24 ? 234  THR C O   1 
ATOM   8122  C  CB  . THR C  3  236 ? -22.046 3.318   -50.455  1.00 258.18 ? 234  THR C CB  1 
ATOM   8123  O  OG1 . THR C  3  236 ? -23.053 3.155   -49.450  1.00 263.08 ? 234  THR C OG1 1 
ATOM   8124  C  CG2 . THR C  3  236 ? -22.214 4.678   -51.107  1.00 249.42 ? 234  THR C CG2 1 
ATOM   8125  N  N   . PRO C  3  237 ? -21.688 2.778   -53.831  1.00 273.79 ? 235  PRO C N   1 
ATOM   8126  C  CA  . PRO C  3  237 ? -20.790 3.017   -54.969  1.00 277.39 ? 235  PRO C CA  1 
ATOM   8127  C  C   . PRO C  3  237 ? -19.853 4.193   -54.728  1.00 275.28 ? 235  PRO C C   1 
ATOM   8128  O  O   . PRO C  3  237 ? -20.119 5.081   -53.914  1.00 278.89 ? 235  PRO C O   1 
ATOM   8129  C  CB  . PRO C  3  237 ? -21.755 3.311   -56.126  1.00 274.35 ? 235  PRO C CB  1 
ATOM   8130  C  CG  . PRO C  3  237 ? -23.034 2.654   -55.726  1.00 267.32 ? 235  PRO C CG  1 
ATOM   8131  C  CD  . PRO C  3  237 ? -23.105 2.793   -54.232  1.00 261.24 ? 235  PRO C CD  1 
ATOM   8132  N  N   . LEU C  3  238 ? -18.733 4.190   -55.459  1.00 255.38 ? 236  LEU C N   1 
ATOM   8133  C  CA  . LEU C  3  238 ? -17.795 5.303   -55.366  1.00 254.52 ? 236  LEU C CA  1 
ATOM   8134  C  C   . LEU C  3  238 ? -18.390 6.576   -55.943  1.00 265.67 ? 236  LEU C C   1 
ATOM   8135  O  O   . LEU C  3  238 ? -17.955 7.678   -55.591  1.00 271.89 ? 236  LEU C O   1 
ATOM   8136  C  CB  . LEU C  3  238 ? -16.488 4.970   -56.090  1.00 255.20 ? 236  LEU C CB  1 
ATOM   8137  C  CG  . LEU C  3  238 ? -15.657 3.775   -55.613  1.00 248.18 ? 236  LEU C CG  1 
ATOM   8138  C  CD1 . LEU C  3  238 ? -16.144 2.463   -56.225  1.00 247.96 ? 236  LEU C CD1 1 
ATOM   8139  C  CD2 . LEU C  3  238 ? -14.190 4.011   -55.928  1.00 249.21 ? 236  LEU C CD2 1 
ATOM   8140  N  N   . GLU C  3  239 ? -19.374 6.440   -56.836  1.00 271.89 ? 237  GLU C N   1 
ATOM   8141  C  CA  . GLU C  3  239 ? -20.059 7.604   -57.382  1.00 276.81 ? 237  GLU C CA  1 
ATOM   8142  C  C   . GLU C  3  239 ? -20.798 8.377   -56.297  1.00 283.64 ? 237  GLU C C   1 
ATOM   8143  O  O   . GLU C  3  239 ? -20.975 9.596   -56.413  1.00 286.69 ? 237  GLU C O   1 
ATOM   8144  C  CB  . GLU C  3  239 ? -21.031 7.157   -58.476  1.00 269.83 ? 237  GLU C CB  1 
ATOM   8145  C  CG  . GLU C  3  239 ? -20.401 6.274   -59.543  1.00 264.63 ? 237  GLU C CG  1 
ATOM   8146  C  CD  . GLU C  3  239 ? -21.375 5.250   -60.095  1.00 257.73 ? 237  GLU C CD  1 
ATOM   8147  O  OE1 . GLU C  3  239 ? -22.495 5.146   -59.552  1.00 247.97 ? 237  GLU C OE1 1 
ATOM   8148  O  OE2 . GLU C  3  239 ? -21.021 4.548   -61.066  1.00 264.70 ? 237  GLU C OE2 1 
ATOM   8149  N  N   . ARG C  3  240 ? -21.225 7.690   -55.236  1.00 281.15 ? 238  ARG C N   1 
ATOM   8150  C  CA  . ARG C  3  240 ? -21.971 8.330   -54.158  1.00 269.73 ? 238  ARG C CA  1 
ATOM   8151  C  C   . ARG C  3  240 ? -21.035 9.007   -53.161  1.00 264.07 ? 238  ARG C C   1 
ATOM   8152  O  O   . ARG C  3  240 ? -21.156 10.208  -52.899  1.00 266.64 ? 238  ARG C O   1 
ATOM   8153  C  CB  . ARG C  3  240 ? -22.849 7.296   -53.447  1.00 261.29 ? 238  ARG C CB  1 
ATOM   8154  C  CG  . ARG C  3  240 ? -23.640 6.388   -54.374  1.00 255.19 ? 238  ARG C CG  1 
ATOM   8155  C  CD  . ARG C  3  240 ? -24.732 7.141   -55.108  1.00 254.23 ? 238  ARG C CD  1 
ATOM   8156  N  NE  . ARG C  3  240 ? -25.533 6.249   -55.938  1.00 254.13 ? 238  ARG C NE  1 
ATOM   8157  C  CZ  . ARG C  3  240 ? -25.324 6.050   -57.234  1.00 261.32 ? 238  ARG C CZ  1 
ATOM   8158  N  NH1 . ARG C  3  240 ? -24.341 6.687   -57.854  1.00 260.16 ? 238  ARG C NH1 1 
ATOM   8159  N  NH2 . ARG C  3  240 ? -26.100 5.216   -57.910  1.00 270.33 ? 238  ARG C NH2 1 
ATOM   8160  N  N   . ALA C  3  241 ? -20.093 8.244   -52.596  1.00 252.11 ? 239  ALA C N   1 
ATOM   8161  C  CA  . ALA C  3  241 ? -19.217 8.779   -51.556  1.00 254.15 ? 239  ALA C CA  1 
ATOM   8162  C  C   . ALA C  3  241 ? -18.385 9.945   -52.076  1.00 265.37 ? 239  ALA C C   1 
ATOM   8163  O  O   . ALA C  3  241 ? -18.265 10.981  -51.411  1.00 271.05 ? 239  ALA C O   1 
ATOM   8164  C  CB  . ALA C  3  241 ? -18.315 7.670   -51.015  1.00 251.64 ? 239  ALA C CB  1 
ATOM   8165  N  N   . GLN C  3  242 ? -17.805 9.797   -53.263  1.00 272.30 ? 240  GLN C N   1 
ATOM   8166  C  CA  . GLN C  3  242 ? -17.009 10.862  -53.868  1.00 273.08 ? 240  GLN C CA  1 
ATOM   8167  C  C   . GLN C  3  242 ? -17.893 12.002  -54.366  1.00 266.36 ? 240  GLN C C   1 
ATOM   8168  O  O   . GLN C  3  242 ? -17.622 13.174  -54.102  1.00 264.91 ? 240  GLN C O   1 
ATOM   8169  C  CB  . GLN C  3  242 ? -16.167 10.311  -55.019  1.00 271.65 ? 240  GLN C CB  1 
ATOM   8170  C  CG  . GLN C  3  242 ? -15.214 9.203   -54.610  1.00 264.06 ? 240  GLN C CG  1 
ATOM   8171  C  CD  . GLN C  3  242 ? -14.418 8.664   -55.779  1.00 265.10 ? 240  GLN C CD  1 
ATOM   8172  O  OE1 . GLN C  3  242 ? -14.527 9.160   -56.901  1.00 271.68 ? 240  GLN C OE1 1 
ATOM   8173  N  NE2 . GLN C  3  242 ? -13.610 7.642   -55.522  1.00 260.25 ? 240  GLN C NE2 1 
ATOM   8174  N  N   . ALA C  3  252 ? -28.389 10.789  -37.620  1.00 268.23 ? 250  ALA C N   1 
ATOM   8175  C  CA  . ALA C  3  252 ? -29.262 11.118  -36.498  1.00 270.72 ? 250  ALA C CA  1 
ATOM   8176  C  C   . ALA C  3  252 ? -28.498 11.096  -35.173  1.00 265.03 ? 250  ALA C C   1 
ATOM   8177  O  O   . ALA C  3  252 ? -28.465 10.076  -34.484  1.00 266.46 ? 250  ALA C O   1 
ATOM   8178  C  CB  . ALA C  3  252 ? -30.446 10.159  -36.449  1.00 270.62 ? 250  ALA C CB  1 
ATOM   8179  N  N   . LEU C  3  253 ? -27.871 12.220  -34.832  1.00 245.83 ? 251  LEU C N   1 
ATOM   8180  C  CA  . LEU C  3  253 ? -27.108 12.328  -33.598  1.00 232.21 ? 251  LEU C CA  1 
ATOM   8181  C  C   . LEU C  3  253 ? -28.035 12.606  -32.414  1.00 238.18 ? 251  LEU C C   1 
ATOM   8182  O  O   . LEU C  3  253 ? -29.133 13.154  -32.560  1.00 216.62 ? 251  LEU C O   1 
ATOM   8183  C  CB  . LEU C  3  253 ? -26.048 13.423  -33.721  1.00 221.58 ? 251  LEU C CB  1 
ATOM   8184  C  CG  . LEU C  3  253 ? -25.073 13.247  -34.888  1.00 225.52 ? 251  LEU C CG  1 
ATOM   8185  C  CD1 . LEU C  3  253 ? -24.070 14.387  -34.940  1.00 230.12 ? 251  LEU C CD1 1 
ATOM   8186  C  CD2 . LEU C  3  253 ? -24.363 11.904  -34.788  1.00 225.08 ? 251  LEU C CD2 1 
ATOM   8187  N  N   . ASP C  3  254 ? -27.572 12.218  -31.222  1.00 272.86 ? 252  ASP C N   1 
ATOM   8188  C  CA  . ASP C  3  254 ? -28.383 12.295  -30.010  1.00 267.72 ? 252  ASP C CA  1 
ATOM   8189  C  C   . ASP C  3  254 ? -28.002 13.476  -29.122  1.00 247.43 ? 252  ASP C C   1 
ATOM   8190  O  O   . ASP C  3  254 ? -27.790 14.592  -29.607  1.00 232.13 ? 252  ASP C O   1 
ATOM   8191  C  CB  . ASP C  3  254 ? -28.281 10.987  -29.212  1.00 276.43 ? 252  ASP C CB  1 
ATOM   8192  C  CG  . ASP C  3  254 ? -26.842 10.515  -29.014  1.00 270.08 ? 252  ASP C CG  1 
ATOM   8193  O  OD1 . ASP C  3  254 ? -25.902 11.297  -29.272  1.00 282.44 ? 252  ASP C OD1 1 
ATOM   8194  O  OD2 . ASP C  3  254 ? -26.652 9.357   -28.581  1.00 248.38 ? 252  ASP C OD2 1 
ATOM   8195  N  N   . THR C  3  255 ? -27.946 13.238  -27.809  1.00 242.16 ? 253  THR C N   1 
ATOM   8196  C  CA  . THR C  3  255 ? -27.632 14.294  -26.855  1.00 236.73 ? 253  THR C CA  1 
ATOM   8197  C  C   . THR C  3  255 ? -26.181 14.751  -26.948  1.00 250.99 ? 253  THR C C   1 
ATOM   8198  O  O   . THR C  3  255 ? -25.872 15.872  -26.530  1.00 256.47 ? 253  THR C O   1 
ATOM   8199  C  CB  . THR C  3  255 ? -27.932 13.816  -25.435  1.00 236.16 ? 253  THR C CB  1 
ATOM   8200  O  OG1 . THR C  3  255 ? -27.070 12.719  -25.111  1.00 255.87 ? 253  THR C OG1 1 
ATOM   8201  C  CG2 . THR C  3  255 ? -29.377 13.353  -25.329  1.00 222.01 ? 253  THR C CG2 1 
ATOM   8202  N  N   . ASN C  3  256 ? -25.290 13.917  -27.492  1.00 254.69 ? 254  ASN C N   1 
ATOM   8203  C  CA  . ASN C  3  256 ? -23.872 14.253  -27.583  1.00 254.89 ? 254  ASN C CA  1 
ATOM   8204  C  C   . ASN C  3  256 ? -23.586 15.327  -28.621  1.00 260.83 ? 254  ASN C C   1 
ATOM   8205  O  O   . ASN C  3  256 ? -22.443 15.785  -28.721  1.00 262.40 ? 254  ASN C O   1 
ATOM   8206  C  CB  . ASN C  3  256 ? -23.061 12.998  -27.909  1.00 252.24 ? 254  ASN C CB  1 
ATOM   8207  C  CG  . ASN C  3  256 ? -23.216 11.916  -26.861  1.00 258.28 ? 254  ASN C CG  1 
ATOM   8208  O  OD1 . ASN C  3  256 ? -23.393 12.204  -25.677  1.00 256.70 ? 254  ASN C OD1 1 
ATOM   8209  N  ND2 . ASN C  3  256 ? -23.160 10.662  -27.292  1.00 265.89 ? 254  ASN C ND2 1 
ATOM   8210  N  N   . TYR C  3  257 ? -24.590 15.729  -29.392  1.00 264.21 ? 255  TYR C N   1 
ATOM   8211  C  CA  . TYR C  3  257 ? -24.450 16.754  -30.414  1.00 262.23 ? 255  TYR C CA  1 
ATOM   8212  C  C   . TYR C  3  257 ? -25.539 17.793  -30.203  1.00 245.54 ? 255  TYR C C   1 
ATOM   8213  O  O   . TYR C  3  257 ? -25.358 18.975  -30.512  1.00 248.41 ? 255  TYR C O   1 
ATOM   8214  C  CB  . TYR C  3  257 ? -24.548 16.139  -31.809  1.00 274.49 ? 255  TYR C CB  1 
ATOM   8215  C  CG  . TYR C  3  257 ? -24.805 17.136  -32.916  1.00 273.66 ? 255  TYR C CG  1 
ATOM   8216  C  CD1 . TYR C  3  257 ? -23.775 17.902  -33.446  1.00 277.21 ? 255  TYR C CD1 1 
ATOM   8217  C  CD2 . TYR C  3  257 ? -26.086 17.317  -33.422  1.00 268.89 ? 255  TYR C CD2 1 
ATOM   8218  C  CE1 . TYR C  3  257 ? -24.013 18.814  -34.458  1.00 282.23 ? 255  TYR C CE1 1 
ATOM   8219  C  CE2 . TYR C  3  257 ? -26.334 18.228  -34.428  1.00 271.20 ? 255  TYR C CE2 1 
ATOM   8220  C  CZ  . TYR C  3  257 ? -25.295 18.973  -34.944  1.00 281.56 ? 255  TYR C CZ  1 
ATOM   8221  O  OH  . TYR C  3  257 ? -25.539 19.881  -35.948  1.00 294.09 ? 255  TYR C OH  1 
ATOM   8222  N  N   . CYS C  3  258 ? -26.678 17.348  -29.675  1.00 235.49 ? 256  CYS C N   1 
ATOM   8223  C  CA  . CYS C  3  258 ? -27.830 18.219  -29.516  1.00 241.30 ? 256  CYS C CA  1 
ATOM   8224  C  C   . CYS C  3  258 ? -27.733 19.121  -28.298  1.00 247.84 ? 256  CYS C C   1 
ATOM   8225  O  O   . CYS C  3  258 ? -28.481 20.100  -28.210  1.00 240.84 ? 256  CYS C O   1 
ATOM   8226  C  CB  . CYS C  3  258 ? -29.109 17.383  -29.426  1.00 242.79 ? 256  CYS C CB  1 
ATOM   8227  S  SG  . CYS C  3  258 ? -29.999 17.444  -30.965  1.00 248.68 ? 256  CYS C SG  1 
ATOM   8228  N  N   . PHE C  3  259 ? -26.838 18.817  -27.363  1.00 263.51 ? 257  PHE C N   1 
ATOM   8229  C  CA  . PHE C  3  259 ? -26.655 19.639  -26.177  1.00 271.69 ? 257  PHE C CA  1 
ATOM   8230  C  C   . PHE C  3  259 ? -25.431 20.536  -26.271  1.00 279.99 ? 257  PHE C C   1 
ATOM   8231  O  O   . PHE C  3  259 ? -25.362 21.544  -25.558  1.00 282.29 ? 257  PHE C O   1 
ATOM   8232  C  CB  . PHE C  3  259 ? -26.547 18.750  -24.930  1.00 267.90 ? 257  PHE C CB  1 
ATOM   8233  C  CG  . PHE C  3  259 ? -27.860 18.161  -24.481  1.00 259.35 ? 257  PHE C CG  1 
ATOM   8234  C  CD1 . PHE C  3  259 ? -28.611 17.365  -25.333  1.00 253.43 ? 257  PHE C CD1 1 
ATOM   8235  C  CD2 . PHE C  3  259 ? -28.326 18.381  -23.196  1.00 254.13 ? 257  PHE C CD2 1 
ATOM   8236  C  CE1 . PHE C  3  259 ? -29.812 16.820  -24.918  1.00 249.48 ? 257  PHE C CE1 1 
ATOM   8237  C  CE2 . PHE C  3  259 ? -29.520 17.831  -22.775  1.00 247.47 ? 257  PHE C CE2 1 
ATOM   8238  C  CZ  . PHE C  3  259 ? -30.265 17.052  -23.637  1.00 245.75 ? 257  PHE C CZ  1 
ATOM   8239  N  N   . SER C  3  260 ? -24.467 20.184  -27.120  1.00 281.71 ? 258  SER C N   1 
ATOM   8240  C  CA  . SER C  3  260 ? -23.257 20.967  -27.315  1.00 277.24 ? 258  SER C CA  1 
ATOM   8241  C  C   . SER C  3  260 ? -23.380 21.981  -28.444  1.00 282.00 ? 258  SER C C   1 
ATOM   8242  O  O   . SER C  3  260 ? -22.506 22.847  -28.574  1.00 279.84 ? 258  SER C O   1 
ATOM   8243  C  CB  . SER C  3  260 ? -22.063 20.042  -27.585  1.00 271.64 ? 258  SER C CB  1 
ATOM   8244  O  OG  . SER C  3  260 ? -22.283 19.236  -28.730  1.00 267.29 ? 258  SER C OG  1 
ATOM   8245  N  N   . SER C  3  261 ? -24.431 21.901  -29.257  1.00 283.14 ? 259  SER C N   1 
ATOM   8246  C  CA  . SER C  3  261 ? -24.619 22.808  -30.377  1.00 279.35 ? 259  SER C CA  1 
ATOM   8247  C  C   . SER C  3  261 ? -26.040 23.357  -30.375  1.00 267.77 ? 259  SER C C   1 
ATOM   8248  O  O   . SER C  3  261 ? -26.957 22.783  -29.780  1.00 258.40 ? 259  SER C O   1 
ATOM   8249  C  CB  . SER C  3  261 ? -24.327 22.116  -31.714  1.00 277.89 ? 259  SER C CB  1 
ATOM   8250  O  OG  . SER C  3  261 ? -25.191 21.010  -31.911  1.00 271.66 ? 259  SER C OG  1 
ATOM   8251  N  N   . THR C  3  262 ? -26.210 24.490  -31.058  1.00 268.20 ? 260  THR C N   1 
ATOM   8252  C  CA  . THR C  3  262 ? -27.504 25.162  -31.188  1.00 267.16 ? 260  THR C CA  1 
ATOM   8253  C  C   . THR C  3  262 ? -28.075 24.848  -32.566  1.00 257.06 ? 260  THR C C   1 
ATOM   8254  O  O   . THR C  3  262 ? -27.749 25.514  -33.552  1.00 263.27 ? 260  THR C O   1 
ATOM   8255  C  CB  . THR C  3  262 ? -27.354 26.665  -30.984  1.00 274.09 ? 260  THR C CB  1 
ATOM   8256  O  OG1 . THR C  3  262 ? -26.756 26.922  -29.708  1.00 277.12 ? 260  THR C OG1 1 
ATOM   8257  C  CG2 . THR C  3  262 ? -28.712 27.353  -31.058  1.00 267.48 ? 260  THR C CG2 1 
ATOM   8258  N  N   . GLU C  3  263 ? -28.935 23.837  -32.636  1.00 243.21 ? 261  GLU C N   1 
ATOM   8259  C  CA  . GLU C  3  263 ? -29.524 23.422  -33.900  1.00 238.29 ? 261  GLU C CA  1 
ATOM   8260  C  C   . GLU C  3  263 ? -30.787 24.225  -34.185  1.00 233.79 ? 261  GLU C C   1 
ATOM   8261  O  O   . GLU C  3  263 ? -31.560 24.538  -33.276  1.00 228.51 ? 261  GLU C O   1 
ATOM   8262  C  CB  . GLU C  3  263 ? -29.843 21.925  -33.877  1.00 240.67 ? 261  GLU C CB  1 
ATOM   8263  C  CG  . GLU C  3  263 ? -30.240 21.332  -35.223  1.00 240.57 ? 261  GLU C CG  1 
ATOM   8264  C  CD  . GLU C  3  263 ? -29.083 21.259  -36.202  1.00 231.03 ? 261  GLU C CD  1 
ATOM   8265  O  OE1 . GLU C  3  263 ? -27.928 21.126  -35.748  1.00 227.63 ? 261  GLU C OE1 1 
ATOM   8266  O  OE2 . GLU C  3  263 ? -29.329 21.337  -37.424  1.00 232.28 ? 261  GLU C OE2 1 
ATOM   8267  N  N   . LYS C  3  264 ? -30.977 24.573  -35.454  1.00 249.82 ? 262  LYS C N   1 
ATOM   8268  C  CA  . LYS C  3  264 ? -32.230 25.149  -35.918  1.00 248.35 ? 262  LYS C CA  1 
ATOM   8269  C  C   . LYS C  3  264 ? -33.197 24.084  -36.421  1.00 244.19 ? 262  LYS C C   1 
ATOM   8270  O  O   . LYS C  3  264 ? -34.386 24.373  -36.595  1.00 236.15 ? 262  LYS C O   1 
ATOM   8271  C  CB  . LYS C  3  264 ? -31.949 26.186  -37.019  1.00 255.23 ? 262  LYS C CB  1 
ATOM   8272  C  CG  . LYS C  3  264 ? -33.154 26.997  -37.472  1.00 256.43 ? 262  LYS C CG  1 
ATOM   8273  C  CD  . LYS C  3  264 ? -33.895 27.596  -36.287  1.00 257.80 ? 262  LYS C CD  1 
ATOM   8274  C  CE  . LYS C  3  264 ? -35.133 28.359  -36.738  1.00 258.25 ? 262  LYS C CE  1 
ATOM   8275  N  NZ  . LYS C  3  264 ? -35.931 28.878  -35.590  1.00 249.19 ? 262  LYS C NZ  1 
ATOM   8276  N  N   . ASN C  3  265 ? -32.717 22.860  -36.634  1.00 241.43 ? 263  ASN C N   1 
ATOM   8277  C  CA  . ASN C  3  265 ? -33.503 21.739  -37.119  1.00 233.10 ? 263  ASN C CA  1 
ATOM   8278  C  C   . ASN C  3  265 ? -33.983 20.854  -35.968  1.00 230.07 ? 263  ASN C C   1 
ATOM   8279  O  O   . ASN C  3  265 ? -33.916 21.217  -34.790  1.00 223.18 ? 263  ASN C O   1 
ATOM   8280  C  CB  . ASN C  3  265 ? -32.681 20.927  -38.119  1.00 242.39 ? 263  ASN C CB  1 
ATOM   8281  C  CG  . ASN C  3  265 ? -32.560 21.610  -39.457  1.00 252.38 ? 263  ASN C CG  1 
ATOM   8282  O  OD1 . ASN C  3  265 ? -33.552 22.075  -40.019  1.00 254.10 ? 263  ASN C OD1 1 
ATOM   8283  N  ND2 . ASN C  3  265 ? -31.343 21.677  -39.979  1.00 258.58 ? 263  ASN C ND2 1 
ATOM   8284  N  N   . CYS C  3  266 ? -34.458 19.659  -36.323  1.00 236.13 ? 264  CYS C N   1 
ATOM   8285  C  CA  . CYS C  3  266 ? -35.000 18.695  -35.375  1.00 235.52 ? 264  CYS C CA  1 
ATOM   8286  C  C   . CYS C  3  266 ? -33.935 18.193  -34.410  1.00 221.96 ? 264  CYS C C   1 
ATOM   8287  O  O   . CYS C  3  266 ? -33.243 17.207  -34.687  1.00 229.80 ? 264  CYS C O   1 
ATOM   8288  C  CB  . CYS C  3  266 ? -35.622 17.516  -36.117  1.00 245.86 ? 264  CYS C CB  1 
ATOM   8289  S  SG  . CYS C  3  266 ? -36.195 16.192  -35.041  1.00 249.36 ? 264  CYS C SG  1 
ATOM   8290  N  N   . CYS C  3  267 ? -33.788 18.881  -33.287  1.00 212.59 ? 265  CYS C N   1 
ATOM   8291  C  CA  . CYS C  3  267 ? -32.828 18.533  -32.254  1.00 213.00 ? 265  CYS C CA  1 
ATOM   8292  C  C   . CYS C  3  267 ? -33.570 18.232  -30.955  1.00 214.66 ? 265  CYS C C   1 
ATOM   8293  O  O   . CYS C  3  267 ? -34.630 18.806  -30.687  1.00 216.40 ? 265  CYS C O   1 
ATOM   8294  C  CB  . CYS C  3  267 ? -31.840 19.683  -32.063  1.00 241.02 ? 265  CYS C CB  1 
ATOM   8295  S  SG  . CYS C  3  267 ? -30.448 19.417  -30.968  1.00 286.51 ? 265  CYS C SG  1 
ATOM   8296  N  N   . VAL C  3  268 ? -33.015 17.335  -30.142  1.00 228.13 ? 266  VAL C N   1 
ATOM   8297  C  CA  . VAL C  3  268 ? -33.624 17.011  -28.853  1.00 228.86 ? 266  VAL C CA  1 
ATOM   8298  C  C   . VAL C  3  268 ? -33.242 18.086  -27.842  1.00 219.59 ? 266  VAL C C   1 
ATOM   8299  O  O   . VAL C  3  268 ? -32.058 18.322  -27.585  1.00 233.21 ? 266  VAL C O   1 
ATOM   8300  C  CB  . VAL C  3  268 ? -33.214 15.613  -28.364  1.00 227.27 ? 266  VAL C CB  1 
ATOM   8301  C  CG1 . VAL C  3  268 ? -31.738 15.354  -28.580  1.00 232.26 ? 266  VAL C CG1 1 
ATOM   8302  C  CG2 . VAL C  3  268 ? -33.585 15.439  -26.892  1.00 220.01 ? 266  VAL C CG2 1 
ATOM   8303  N  N   . ARG C  3  269 ? -34.246 18.747  -27.276  1.00 192.85 ? 267  ARG C N   1 
ATOM   8304  C  CA  . ARG C  3  269 ? -34.008 19.832  -26.340  1.00 199.39 ? 267  ARG C CA  1 
ATOM   8305  C  C   . ARG C  3  269 ? -34.022 19.308  -24.912  1.00 198.41 ? 267  ARG C C   1 
ATOM   8306  O  O   . ARG C  3  269 ? -34.703 18.330  -24.594  1.00 188.70 ? 267  ARG C O   1 
ATOM   8307  C  CB  . ARG C  3  269 ? -35.060 20.927  -26.502  1.00 201.48 ? 267  ARG C CB  1 
ATOM   8308  C  CG  . ARG C  3  269 ? -35.219 21.427  -27.925  1.00 204.13 ? 267  ARG C CG  1 
ATOM   8309  C  CD  . ARG C  3  269 ? -33.909 21.942  -28.485  1.00 211.72 ? 267  ARG C CD  1 
ATOM   8310  N  NE  . ARG C  3  269 ? -34.004 22.197  -29.920  1.00 221.07 ? 267  ARG C NE  1 
ATOM   8311  C  CZ  . ARG C  3  269 ? -32.987 22.591  -30.679  1.00 235.59 ? 267  ARG C CZ  1 
ATOM   8312  N  NH1 . ARG C  3  269 ? -31.789 22.774  -30.139  1.00 252.78 ? 267  ARG C NH1 1 
ATOM   8313  N  NH2 . ARG C  3  269 ? -33.162 22.798  -31.978  1.00 229.21 ? 267  ARG C NH2 1 
ATOM   8314  N  N   . GLN C  3  270 ? -33.257 19.974  -24.052  1.00 212.74 ? 268  GLN C N   1 
ATOM   8315  C  CA  . GLN C  3  270 ? -33.139 19.574  -22.657  1.00 218.06 ? 268  GLN C CA  1 
ATOM   8316  C  C   . GLN C  3  270 ? -34.369 19.999  -21.862  1.00 208.49 ? 268  GLN C C   1 
ATOM   8317  O  O   . GLN C  3  270 ? -34.897 21.101  -22.044  1.00 203.56 ? 268  GLN C O   1 
ATOM   8318  C  CB  . GLN C  3  270 ? -31.879 20.181  -22.043  1.00 229.98 ? 268  GLN C CB  1 
ATOM   8319  C  CG  . GLN C  3  270 ? -31.605 19.758  -20.615  1.00 234.97 ? 268  GLN C CG  1 
ATOM   8320  C  CD  . GLN C  3  270 ? -30.399 20.459  -20.033  1.00 247.73 ? 268  GLN C CD  1 
ATOM   8321  O  OE1 . GLN C  3  270 ? -29.732 21.239  -20.714  1.00 244.29 ? 268  GLN C OE1 1 
ATOM   8322  N  NE2 . GLN C  3  270 ? -30.116 20.192  -18.764  1.00 260.51 ? 268  GLN C NE2 1 
ATOM   8323  N  N   . LEU C  3  271 ? -34.827 19.111  -20.977  1.00 210.06 ? 269  LEU C N   1 
ATOM   8324  C  CA  . LEU C  3  271 ? -35.978 19.406  -20.122  1.00 210.42 ? 269  LEU C CA  1 
ATOM   8325  C  C   . LEU C  3  271 ? -35.908 18.525  -18.880  1.00 223.52 ? 269  LEU C C   1 
ATOM   8326  O  O   . LEU C  3  271 ? -36.080 17.306  -18.974  1.00 244.33 ? 269  LEU C O   1 
ATOM   8327  C  CB  . LEU C  3  271 ? -37.285 19.189  -20.872  1.00 198.05 ? 269  LEU C CB  1 
ATOM   8328  C  CG  . LEU C  3  271 ? -38.546 19.403  -20.030  1.00 194.11 ? 269  LEU C CG  1 
ATOM   8329  C  CD1 . LEU C  3  271 ? -38.589 20.821  -19.491  1.00 202.85 ? 269  LEU C CD1 1 
ATOM   8330  C  CD2 . LEU C  3  271 ? -39.789 19.092  -20.839  1.00 199.12 ? 269  LEU C CD2 1 
ATOM   8331  N  N   . TYR C  3  272 ? -35.658 19.141  -17.730  1.00 211.61 ? 270  TYR C N   1 
ATOM   8332  C  CA  . TYR C  3  272 ? -35.660 18.451  -16.447  1.00 205.95 ? 270  TYR C CA  1 
ATOM   8333  C  C   . TYR C  3  272 ? -37.028 18.627  -15.802  1.00 202.13 ? 270  TYR C C   1 
ATOM   8334  O  O   . TYR C  3  272 ? -37.467 19.758  -15.570  1.00 213.99 ? 270  TYR C O   1 
ATOM   8335  C  CB  . TYR C  3  272 ? -34.561 18.998  -15.538  1.00 221.67 ? 270  TYR C CB  1 
ATOM   8336  C  CG  . TYR C  3  272 ? -34.588 18.449  -14.135  1.00 230.36 ? 270  TYR C CG  1 
ATOM   8337  C  CD1 . TYR C  3  272 ? -34.090 17.185  -13.852  1.00 231.68 ? 270  TYR C CD1 1 
ATOM   8338  C  CD2 . TYR C  3  272 ? -35.109 19.199  -13.089  1.00 243.71 ? 270  TYR C CD2 1 
ATOM   8339  C  CE1 . TYR C  3  272 ? -34.109 16.684  -12.568  1.00 241.73 ? 270  TYR C CE1 1 
ATOM   8340  C  CE2 . TYR C  3  272 ? -35.134 18.707  -11.803  1.00 256.14 ? 270  TYR C CE2 1 
ATOM   8341  C  CZ  . TYR C  3  272 ? -34.633 17.449  -11.547  1.00 259.17 ? 270  TYR C CZ  1 
ATOM   8342  O  OH  . TYR C  3  272 ? -34.655 16.955  -10.264  1.00 277.95 ? 270  TYR C OH  1 
ATOM   8343  N  N   . ILE C  3  273 ? -37.694 17.515  -15.508  1.00 205.97 ? 271  ILE C N   1 
ATOM   8344  C  CA  . ILE C  3  273 ? -39.055 17.526  -14.986  1.00 214.45 ? 271  ILE C CA  1 
ATOM   8345  C  C   . ILE C  3  273 ? -39.004 17.190  -13.502  1.00 230.27 ? 271  ILE C C   1 
ATOM   8346  O  O   . ILE C  3  273 ? -38.584 16.091  -13.123  1.00 243.16 ? 271  ILE C O   1 
ATOM   8347  C  CB  . ILE C  3  273 ? -39.956 16.544  -15.746  1.00 204.14 ? 271  ILE C CB  1 
ATOM   8348  C  CG1 . ILE C  3  273 ? -40.069 16.962  -17.213  1.00 186.05 ? 271  ILE C CG1 1 
ATOM   8349  C  CG2 . ILE C  3  273 ? -41.331 16.467  -15.099  1.00 222.11 ? 271  ILE C CG2 1 
ATOM   8350  C  CD1 . ILE C  3  273 ? -41.023 16.108  -18.016  1.00 179.42 ? 271  ILE C CD1 1 
ATOM   8351  N  N   . ASP C  3  274 ? -39.432 18.134  -12.667  1.00 226.56 ? 272  ASP C N   1 
ATOM   8352  C  CA  . ASP C  3  274 ? -39.524 17.934  -11.228  1.00 222.74 ? 272  ASP C CA  1 
ATOM   8353  C  C   . ASP C  3  274 ? -40.955 17.577  -10.849  1.00 215.80 ? 272  ASP C C   1 
ATOM   8354  O  O   . ASP C  3  274 ? -41.911 18.100  -11.427  1.00 211.51 ? 272  ASP C O   1 
ATOM   8355  C  CB  . ASP C  3  274 ? -39.078 19.188  -10.470  1.00 234.36 ? 272  ASP C CB  1 
ATOM   8356  C  CG  . ASP C  3  274 ? -38.802 18.921  -8.996   1.00 246.95 ? 272  ASP C CG  1 
ATOM   8357  O  OD1 . ASP C  3  274 ? -39.496 18.079  -8.387   1.00 243.87 ? 272  ASP C OD1 1 
ATOM   8358  O  OD2 . ASP C  3  274 ? -37.890 19.566  -8.438   1.00 259.87 ? 272  ASP C OD2 1 
ATOM   8359  N  N   . PHE C  3  275 ? -41.093 16.682  -9.870   1.00 217.52 ? 273  PHE C N   1 
ATOM   8360  C  CA  . PHE C  3  275 ? -42.417 16.278  -9.418   1.00 216.60 ? 273  PHE C CA  1 
ATOM   8361  C  C   . PHE C  3  275 ? -43.016 17.315  -8.480   1.00 222.20 ? 273  PHE C C   1 
ATOM   8362  O  O   . PHE C  3  275 ? -44.215 17.605  -8.552   1.00 218.78 ? 273  PHE C O   1 
ATOM   8363  C  CB  . PHE C  3  275 ? -42.348 14.920  -8.723   1.00 210.34 ? 273  PHE C CB  1 
ATOM   8364  C  CG  . PHE C  3  275 ? -41.902 13.807  -9.618   1.00 197.63 ? 273  PHE C CG  1 
ATOM   8365  C  CD1 . PHE C  3  275 ? -42.815 13.098  -10.377  1.00 184.65 ? 273  PHE C CD1 1 
ATOM   8366  C  CD2 . PHE C  3  275 ? -40.564 13.474  -9.704   1.00 198.95 ? 273  PHE C CD2 1 
ATOM   8367  C  CE1 . PHE C  3  275 ? -42.398 12.072  -11.204  1.00 170.88 ? 273  PHE C CE1 1 
ATOM   8368  C  CE2 . PHE C  3  275 ? -40.143 12.453  -10.527  1.00 185.88 ? 273  PHE C CE2 1 
ATOM   8369  C  CZ  . PHE C  3  275 ? -41.061 11.751  -11.277  1.00 170.81 ? 273  PHE C CZ  1 
ATOM   8370  N  N   . ARG C  3  276 ? -42.197 17.876  -7.592   1.00 227.21 ? 274  ARG C N   1 
ATOM   8371  C  CA  . ARG C  3  276 ? -42.685 18.875  -6.652   1.00 234.34 ? 274  ARG C CA  1 
ATOM   8372  C  C   . ARG C  3  276 ? -42.842 20.242  -7.299   1.00 236.10 ? 274  ARG C C   1 
ATOM   8373  O  O   . ARG C  3  276 ? -43.726 21.010  -6.906   1.00 238.09 ? 274  ARG C O   1 
ATOM   8374  C  CB  . ARG C  3  276 ? -41.736 18.971  -5.455   1.00 247.99 ? 274  ARG C CB  1 
ATOM   8375  C  CG  . ARG C  3  276 ? -41.743 17.749  -4.551   1.00 253.83 ? 274  ARG C CG  1 
ATOM   8376  C  CD  . ARG C  3  276 ? -42.942 17.749  -3.609   1.00 270.65 ? 274  ARG C CD  1 
ATOM   8377  N  NE  . ARG C  3  276 ? -42.816 18.728  -2.529   1.00 283.37 ? 274  ARG C NE  1 
ATOM   8378  C  CZ  . ARG C  3  276 ? -43.403 19.923  -2.518   1.00 284.39 ? 274  ARG C CZ  1 
ATOM   8379  N  NH1 . ARG C  3  276 ? -44.169 20.300  -3.534   1.00 285.44 ? 274  ARG C NH1 1 
ATOM   8380  N  NH2 . ARG C  3  276 ? -43.228 20.741  -1.487   1.00 277.52 ? 274  ARG C NH2 1 
ATOM   8381  N  N   . LYS C  3  277 ? -42.017 20.555  -8.296   1.00 233.47 ? 275  LYS C N   1 
ATOM   8382  C  CA  . LYS C  3  277 ? -41.970 21.888  -8.884   1.00 239.70 ? 275  LYS C CA  1 
ATOM   8383  C  C   . LYS C  3  277 ? -42.824 22.025  -10.135  1.00 240.71 ? 275  LYS C C   1 
ATOM   8384  O  O   . LYS C  3  277 ? -43.529 23.027  -10.291  1.00 240.78 ? 275  LYS C O   1 
ATOM   8385  C  CB  . LYS C  3  277 ? -40.520 22.257  -9.214   1.00 248.26 ? 275  LYS C CB  1 
ATOM   8386  C  CG  . LYS C  3  277 ? -40.356 23.641  -9.802   1.00 257.02 ? 275  LYS C CG  1 
ATOM   8387  C  CD  . LYS C  3  277 ? -40.725 24.708  -8.790   1.00 271.04 ? 275  LYS C CD  1 
ATOM   8388  C  CE  . LYS C  3  277 ? -40.501 26.095  -9.363   1.00 282.65 ? 275  LYS C CE  1 
ATOM   8389  N  NZ  . LYS C  3  277 ? -41.303 26.316  -10.600  1.00 277.51 ? 275  LYS C NZ  1 
ATOM   8390  N  N   . ASP C  3  278 ? -42.780 21.045  -11.033  1.00 235.93 ? 276  ASP C N   1 
ATOM   8391  C  CA  . ASP C  3  278 ? -43.460 21.132  -12.315  1.00 234.59 ? 276  ASP C CA  1 
ATOM   8392  C  C   . ASP C  3  278 ? -44.718 20.275  -12.383  1.00 231.43 ? 276  ASP C C   1 
ATOM   8393  O  O   . ASP C  3  278 ? -45.414 20.297  -13.404  1.00 222.40 ? 276  ASP C O   1 
ATOM   8394  C  CB  . ASP C  3  278 ? -42.494 20.741  -13.440  1.00 223.63 ? 276  ASP C CB  1 
ATOM   8395  C  CG  . ASP C  3  278 ? -41.234 21.593  -13.443  1.00 225.77 ? 276  ASP C CG  1 
ATOM   8396  O  OD1 . ASP C  3  278 ? -41.307 22.778  -13.048  1.00 232.56 ? 276  ASP C OD1 1 
ATOM   8397  O  OD2 . ASP C  3  278 ? -40.167 21.077  -13.835  1.00 224.78 ? 276  ASP C OD2 1 
ATOM   8398  N  N   . LEU C  3  279 ? -45.019 19.512  -11.332  1.00 227.72 ? 277  LEU C N   1 
ATOM   8399  C  CA  . LEU C  3  279 ? -46.201 18.659  -11.312  1.00 217.76 ? 277  LEU C CA  1 
ATOM   8400  C  C   . LEU C  3  279 ? -46.934 18.774  -9.981   1.00 210.43 ? 277  LEU C C   1 
ATOM   8401  O  O   . LEU C  3  279 ? -48.159 18.617  -9.922   1.00 205.64 ? 277  LEU C O   1 
ATOM   8402  C  CB  . LEU C  3  279 ? -45.815 17.205  -11.586  1.00 211.37 ? 277  LEU C CB  1 
ATOM   8403  C  CG  . LEU C  3  279 ? -45.415 16.859  -13.025  1.00 195.42 ? 277  LEU C CG  1 
ATOM   8404  C  CD1 . LEU C  3  279 ? -44.999 15.399  -13.141  1.00 188.03 ? 277  LEU C CD1 1 
ATOM   8405  C  CD2 . LEU C  3  279 ? -46.548 17.168  -13.991  1.00 188.03 ? 277  LEU C CD2 1 
ATOM   8406  N  N   . GLY C  3  280 ? -46.195 19.033  -8.908   1.00 205.54 ? 278  GLY C N   1 
ATOM   8407  C  CA  . GLY C  3  280 ? -46.805 19.089  -7.594   1.00 212.41 ? 278  GLY C CA  1 
ATOM   8408  C  C   . GLY C  3  280 ? -47.172 17.717  -7.080   1.00 219.79 ? 278  GLY C C   1 
ATOM   8409  O  O   . GLY C  3  280 ? -48.265 17.538  -6.528   1.00 235.35 ? 278  GLY C O   1 
ATOM   8410  N  N   . TRP C  3  281 ? -46.292 16.736  -7.266   1.00 217.23 ? 279  TRP C N   1 
ATOM   8411  C  CA  . TRP C  3  281 ? -46.530 15.360  -6.841   1.00 212.98 ? 279  TRP C CA  1 
ATOM   8412  C  C   . TRP C  3  281 ? -45.515 14.983  -5.770   1.00 222.05 ? 279  TRP C C   1 
ATOM   8413  O  O   . TRP C  3  281 ? -44.329 14.799  -6.069   1.00 224.74 ? 279  TRP C O   1 
ATOM   8414  C  CB  . TRP C  3  281 ? -46.441 14.398  -8.020   1.00 201.15 ? 279  TRP C CB  1 
ATOM   8415  C  CG  . TRP C  3  281 ? -47.546 14.532  -9.002   1.00 193.99 ? 279  TRP C CG  1 
ATOM   8416  C  CD1 . TRP C  3  281 ? -48.587 15.416  -8.960   1.00 193.74 ? 279  TRP C CD1 1 
ATOM   8417  C  CD2 . TRP C  3  281 ? -47.724 13.755  -10.187  1.00 190.84 ? 279  TRP C CD2 1 
ATOM   8418  N  NE1 . TRP C  3  281 ? -49.403 15.233  -10.051  1.00 201.73 ? 279  TRP C NE1 1 
ATOM   8419  C  CE2 . TRP C  3  281 ? -48.894 14.219  -10.819  1.00 209.59 ? 279  TRP C CE2 1 
ATOM   8420  C  CE3 . TRP C  3  281 ? -47.005 12.709  -10.776  1.00 170.28 ? 279  TRP C CE3 1 
ATOM   8421  C  CZ2 . TRP C  3  281 ? -49.361 13.672  -12.012  1.00 211.33 ? 279  TRP C CZ2 1 
ATOM   8422  C  CZ3 . TRP C  3  281 ? -47.469 12.167  -11.959  1.00 162.53 ? 279  TRP C CZ3 1 
ATOM   8423  C  CH2 . TRP C  3  281 ? -48.636 12.649  -12.565  1.00 187.33 ? 279  TRP C CH2 1 
ATOM   8424  N  N   . LYS C  3  282 ? -45.980 14.855  -4.530   1.00 248.82 ? 280  LYS C N   1 
ATOM   8425  C  CA  . LYS C  3  282 ? -45.142 14.429  -3.417   1.00 253.66 ? 280  LYS C CA  1 
ATOM   8426  C  C   . LYS C  3  282 ? -45.380 12.968  -3.057   1.00 256.20 ? 280  LYS C C   1 
ATOM   8427  O  O   . LYS C  3  282 ? -44.893 12.499  -2.023   1.00 257.14 ? 280  LYS C O   1 
ATOM   8428  C  CB  . LYS C  3  282 ? -45.380 15.333  -2.200   1.00 257.43 ? 280  LYS C CB  1 
ATOM   8429  C  CG  . LYS C  3  282 ? -44.227 15.368  -1.193   1.00 255.76 ? 280  LYS C CG  1 
ATOM   8430  C  CD  . LYS C  3  282 ? -44.418 16.467  -0.156   1.00 254.67 ? 280  LYS C CD  1 
ATOM   8431  C  CE  . LYS C  3  282 ? -45.686 16.263  0.657    1.00 249.43 ? 280  LYS C CE  1 
ATOM   8432  N  NZ  . LYS C  3  282 ? -45.849 17.328  1.687    1.00 255.63 ? 280  LYS C NZ  1 
ATOM   8433  N  N   . TRP C  3  283 ? -46.118 12.241  -3.891   1.00 244.57 ? 281  TRP C N   1 
ATOM   8434  C  CA  . TRP C  3  283 ? -46.419 10.837  -3.659   1.00 238.46 ? 281  TRP C CA  1 
ATOM   8435  C  C   . TRP C  3  283 ? -45.427 9.897   -4.331   1.00 234.57 ? 281  TRP C C   1 
ATOM   8436  O  O   . TRP C  3  283 ? -45.547 8.677   -4.174   1.00 239.69 ? 281  TRP C O   1 
ATOM   8437  C  CB  . TRP C  3  283 ? -47.838 10.526  -4.143   1.00 232.63 ? 281  TRP C CB  1 
ATOM   8438  C  CG  . TRP C  3  283 ? -48.021 10.747  -5.610   1.00 222.20 ? 281  TRP C CG  1 
ATOM   8439  C  CD1 . TRP C  3  283 ? -48.266 11.934  -6.235   1.00 222.16 ? 281  TRP C CD1 1 
ATOM   8440  C  CD2 . TRP C  3  283 ? -47.985 9.751   -6.638   1.00 204.80 ? 281  TRP C CD2 1 
ATOM   8441  N  NE1 . TRP C  3  283 ? -48.378 11.739  -7.591   1.00 217.02 ? 281  TRP C NE1 1 
ATOM   8442  C  CE2 . TRP C  3  283 ? -48.210 10.407  -7.864   1.00 205.02 ? 281  TRP C CE2 1 
ATOM   8443  C  CE3 . TRP C  3  283 ? -47.782 8.367   -6.640   1.00 198.13 ? 281  TRP C CE3 1 
ATOM   8444  C  CZ2 . TRP C  3  283 ? -48.237 9.728   -9.080   1.00 192.74 ? 281  TRP C CZ2 1 
ATOM   8445  C  CZ3 . TRP C  3  283 ? -47.810 7.695   -7.847   1.00 198.31 ? 281  TRP C CZ3 1 
ATOM   8446  C  CH2 . TRP C  3  283 ? -48.037 8.376   -9.051   1.00 191.09 ? 281  TRP C CH2 1 
ATOM   8447  N  N   . ILE C  3  284 ? -44.450 10.427  -5.063   1.00 210.41 ? 282  ILE C N   1 
ATOM   8448  C  CA  . ILE C  3  284 ? -43.410 9.628   -5.702   1.00 195.35 ? 282  ILE C CA  1 
ATOM   8449  C  C   . ILE C  3  284 ? -42.113 9.903   -4.963   1.00 200.69 ? 282  ILE C C   1 
ATOM   8450  O  O   . ILE C  3  284 ? -41.569 11.013  -5.033   1.00 206.66 ? 282  ILE C O   1 
ATOM   8451  C  CB  . ILE C  3  284 ? -43.267 9.947   -7.193   1.00 183.92 ? 282  ILE C CB  1 
ATOM   8452  C  CG1 . ILE C  3  284 ? -44.560 9.612   -7.928   1.00 182.34 ? 282  ILE C CG1 1 
ATOM   8453  C  CG2 . ILE C  3  284 ? -42.093 9.183   -7.784   1.00 173.46 ? 282  ILE C CG2 1 
ATOM   8454  C  CD1 . ILE C  3  284 ? -44.486 9.872   -9.412   1.00 198.21 ? 282  ILE C CD1 1 
ATOM   8455  N  N   . HIS C  3  285 ? -41.604 8.887   -4.267   1.00 205.34 ? 283  HIS C N   1 
ATOM   8456  C  CA  . HIS C  3  285 ? -40.407 9.083   -3.460   1.00 220.44 ? 283  HIS C CA  1 
ATOM   8457  C  C   . HIS C  3  285 ? -39.173 9.191   -4.342   1.00 211.99 ? 283  HIS C C   1 
ATOM   8458  O  O   . HIS C  3  285 ? -38.416 10.164  -4.252   1.00 223.09 ? 283  HIS C O   1 
ATOM   8459  C  CB  . HIS C  3  285 ? -40.258 7.943   -2.454   1.00 239.58 ? 283  HIS C CB  1 
ATOM   8460  C  CG  . HIS C  3  285 ? -41.339 7.908   -1.419   1.00 245.60 ? 283  HIS C CG  1 
ATOM   8461  N  ND1 . HIS C  3  285 ? -42.675 7.823   -1.744   1.00 238.77 ? 283  HIS C ND1 1 
ATOM   8462  C  CD2 . HIS C  3  285 ? -41.281 7.952   -0.067   1.00 251.56 ? 283  HIS C CD2 1 
ATOM   8463  C  CE1 . HIS C  3  285 ? -43.395 7.816   -0.636   1.00 244.52 ? 283  HIS C CE1 1 
ATOM   8464  N  NE2 . HIS C  3  285 ? -42.573 7.892   0.396    1.00 255.84 ? 283  HIS C NE2 1 
ATOM   8465  N  N   . GLU C  3  286 ? -38.963 8.211   -5.211   1.00 204.07 ? 284  GLU C N   1 
ATOM   8466  C  CA  . GLU C  3  286 ? -37.810 8.228   -6.098   1.00 204.29 ? 284  GLU C CA  1 
ATOM   8467  C  C   . GLU C  3  286 ? -38.178 7.891   -7.529   1.00 198.22 ? 284  GLU C C   1 
ATOM   8468  O  O   . GLU C  3  286 ? -38.931 6.950   -7.778   1.00 207.21 ? 284  GLU C O   1 
ATOM   8469  C  CB  . GLU C  3  286 ? -36.728 7.267   -5.607   1.00 214.67 ? 284  GLU C CB  1 
ATOM   8470  C  CG  . GLU C  3  286 ? -36.130 7.654   -4.270   1.00 223.52 ? 284  GLU C CG  1 
ATOM   8471  C  CD  . GLU C  3  286 ? -35.353 8.956   -4.339   1.00 215.21 ? 284  GLU C CD  1 
ATOM   8472  O  OE1 . GLU C  3  286 ? -34.897 9.323   -5.446   1.00 203.86 ? 284  GLU C OE1 1 
ATOM   8473  O  OE2 . GLU C  3  286 ? -35.208 9.614   -3.286   1.00 221.60 ? 284  GLU C OE2 1 
ATOM   8474  N  N   . PRO C  3  287 ? -37.656 8.683   -8.475   1.00 193.32 ? 285  PRO C N   1 
ATOM   8475  C  CA  . PRO C  3  287 ? -36.837 9.858   -8.159   1.00 195.47 ? 285  PRO C CA  1 
ATOM   8476  C  C   . PRO C  3  287 ? -37.697 11.087  -7.892   1.00 210.74 ? 285  PRO C C   1 
ATOM   8477  O  O   . PRO C  3  287 ? -38.924 11.003  -7.956   1.00 224.42 ? 285  PRO C O   1 
ATOM   8478  C  CB  . PRO C  3  287 ? -35.996 10.042  -9.417   1.00 195.79 ? 285  PRO C CB  1 
ATOM   8479  C  CG  . PRO C  3  287 ? -36.890 9.559   -10.510  1.00 200.70 ? 285  PRO C CG  1 
ATOM   8480  C  CD  . PRO C  3  287 ? -37.703 8.424   -9.925   1.00 203.13 ? 285  PRO C CD  1 
ATOM   8481  N  N   . LYS C  3  288 ? -37.057 12.212  -7.579   1.00 211.60 ? 286  LYS C N   1 
ATOM   8482  C  CA  . LYS C  3  288 ? -37.751 13.476  -7.371   1.00 221.57 ? 286  LYS C CA  1 
ATOM   8483  C  C   . LYS C  3  288 ? -37.475 14.451  -8.511   1.00 238.71 ? 286  LYS C C   1 
ATOM   8484  O  O   . LYS C  3  288 ? -37.480 15.669  -8.314   1.00 247.06 ? 286  LYS C O   1 
ATOM   8485  C  CB  . LYS C  3  288 ? -37.363 14.091  -6.028   1.00 229.97 ? 286  LYS C CB  1 
ATOM   8486  C  CG  . LYS C  3  288 ? -37.722 13.225  -4.831   1.00 235.46 ? 286  LYS C CG  1 
ATOM   8487  C  CD  . LYS C  3  288 ? -37.123 13.755  -3.538   1.00 235.63 ? 286  LYS C CD  1 
ATOM   8488  C  CE  . LYS C  3  288 ? -37.401 12.805  -2.383   1.00 228.05 ? 286  LYS C CE  1 
ATOM   8489  N  NZ  . LYS C  3  288 ? -36.775 13.267  -1.114   1.00 233.95 ? 286  LYS C NZ  1 
ATOM   8490  N  N   . GLY C  3  289 ? -37.238 13.918  -9.707   1.00 240.24 ? 287  GLY C N   1 
ATOM   8491  C  CA  . GLY C  3  289 ? -36.922 14.714  -10.874  1.00 234.92 ? 287  GLY C CA  1 
ATOM   8492  C  C   . GLY C  3  289 ? -36.045 13.944  -11.839  1.00 225.65 ? 287  GLY C C   1 
ATOM   8493  O  O   . GLY C  3  289 ? -35.189 13.169  -11.404  1.00 229.20 ? 287  GLY C O   1 
ATOM   8494  N  N   . TYR C  3  290 ? -36.246 14.129  -13.143  1.00 228.53 ? 288  TYR C N   1 
ATOM   8495  C  CA  . TYR C  3  290 ? -35.467 13.396  -14.133  1.00 220.53 ? 288  TYR C CA  1 
ATOM   8496  C  C   . TYR C  3  290 ? -35.467 14.169  -15.448  1.00 218.36 ? 288  TYR C C   1 
ATOM   8497  O  O   . TYR C  3  290 ? -36.212 15.137  -15.626  1.00 215.19 ? 288  TYR C O   1 
ATOM   8498  C  CB  . TYR C  3  290 ? -36.016 11.980  -14.321  1.00 215.09 ? 288  TYR C CB  1 
ATOM   8499  C  CG  . TYR C  3  290 ? -37.287 11.926  -15.134  1.00 202.47 ? 288  TYR C CG  1 
ATOM   8500  C  CD1 . TYR C  3  290 ? -38.472 12.463  -14.644  1.00 198.79 ? 288  TYR C CD1 1 
ATOM   8501  C  CD2 . TYR C  3  290 ? -37.308 11.322  -16.383  1.00 190.00 ? 288  TYR C CD2 1 
ATOM   8502  C  CE1 . TYR C  3  290 ? -39.636 12.417  -15.382  1.00 184.48 ? 288  TYR C CE1 1 
ATOM   8503  C  CE2 . TYR C  3  290 ? -38.468 11.265  -17.125  1.00 190.93 ? 288  TYR C CE2 1 
ATOM   8504  C  CZ  . TYR C  3  290 ? -39.629 11.815  -16.620  1.00 195.10 ? 288  TYR C CZ  1 
ATOM   8505  O  OH  . TYR C  3  290 ? -40.788 11.765  -17.354  1.00 220.19 ? 288  TYR C OH  1 
ATOM   8506  N  N   . HIS C  3  291 ? -34.618 13.719  -16.376  1.00 204.42 ? 289  HIS C N   1 
ATOM   8507  C  CA  . HIS C  3  291 ? -34.451 14.357  -17.685  1.00 204.03 ? 289  HIS C CA  1 
ATOM   8508  C  C   . HIS C  3  291 ? -35.264 13.597  -18.732  1.00 207.39 ? 289  HIS C C   1 
ATOM   8509  O  O   . HIS C  3  291 ? -34.780 12.651  -19.352  1.00 208.70 ? 289  HIS C O   1 
ATOM   8510  C  CB  . HIS C  3  291 ? -32.977 14.418  -18.073  1.00 208.88 ? 289  HIS C CB  1 
ATOM   8511  C  CG  . HIS C  3  291 ? -32.173 15.376  -17.250  1.00 233.26 ? 289  HIS C CG  1 
ATOM   8512  N  ND1 . HIS C  3  291 ? -31.945 15.193  -15.902  1.00 251.41 ? 289  HIS C ND1 1 
ATOM   8513  C  CD2 . HIS C  3  291 ? -31.537 16.524  -17.585  1.00 241.64 ? 289  HIS C CD2 1 
ATOM   8514  C  CE1 . HIS C  3  291 ? -31.206 16.187  -15.442  1.00 255.12 ? 289  HIS C CE1 1 
ATOM   8515  N  NE2 . HIS C  3  291 ? -30.944 17.008  -16.443  1.00 254.77 ? 289  HIS C NE2 1 
ATOM   8516  N  N   . ALA C  3  292 ? -36.516 14.021  -18.932  1.00 206.54 ? 290  ALA C N   1 
ATOM   8517  C  CA  . ALA C  3  292 ? -37.346 13.415  -19.969  1.00 188.44 ? 290  ALA C CA  1 
ATOM   8518  C  C   . ALA C  3  292 ? -37.038 13.997  -21.343  1.00 188.58 ? 290  ALA C C   1 
ATOM   8519  O  O   . ALA C  3  292 ? -37.037 13.268  -22.341  1.00 200.10 ? 290  ALA C O   1 
ATOM   8520  C  CB  . ALA C  3  292 ? -38.826 13.596  -19.638  1.00 192.61 ? 290  ALA C CB  1 
ATOM   8521  N  N   . ASN C  3  293 ? -36.802 15.309  -21.413  1.00 193.20 ? 291  ASN C N   1 
ATOM   8522  C  CA  . ASN C  3  293 ? -36.503 16.014  -22.658  1.00 205.13 ? 291  ASN C CA  1 
ATOM   8523  C  C   . ASN C  3  293 ? -37.655 15.929  -23.652  1.00 196.31 ? 291  ASN C C   1 
ATOM   8524  O  O   . ASN C  3  293 ? -38.722 15.388  -23.338  1.00 182.85 ? 291  ASN C O   1 
ATOM   8525  C  CB  . ASN C  3  293 ? -35.216 15.480  -23.299  1.00 208.77 ? 291  ASN C CB  1 
ATOM   8526  C  CG  . ASN C  3  293 ? -34.000 15.678  -22.417  1.00 210.65 ? 291  ASN C CG  1 
ATOM   8527  O  OD1 . ASN C  3  293 ? -34.049 16.406  -21.426  1.00 214.08 ? 291  ASN C OD1 1 
ATOM   8528  N  ND2 . ASN C  3  293 ? -32.896 15.037  -22.779  1.00 211.61 ? 291  ASN C ND2 1 
ATOM   8529  N  N   . PHE C  3  294 ? -37.448 16.475  -24.850  1.00 195.15 ? 292  PHE C N   1 
ATOM   8530  C  CA  . PHE C  3  294 ? -38.456 16.459  -25.902  1.00 194.26 ? 292  PHE C CA  1 
ATOM   8531  C  C   . PHE C  3  294 ? -37.780 16.783  -27.229  1.00 193.10 ? 292  PHE C C   1 
ATOM   8532  O  O   . PHE C  3  294 ? -36.640 17.255  -27.269  1.00 190.06 ? 292  PHE C O   1 
ATOM   8533  C  CB  . PHE C  3  294 ? -39.583 17.450  -25.607  1.00 185.06 ? 292  PHE C CB  1 
ATOM   8534  C  CG  . PHE C  3  294 ? -39.117 18.869  -25.498  1.00 188.44 ? 292  PHE C CG  1 
ATOM   8535  C  CD1 . PHE C  3  294 ? -38.603 19.350  -24.305  1.00 194.11 ? 292  PHE C CD1 1 
ATOM   8536  C  CD2 . PHE C  3  294 ? -39.194 19.725  -26.584  1.00 198.40 ? 292  PHE C CD2 1 
ATOM   8537  C  CE1 . PHE C  3  294 ? -38.172 20.655  -24.195  1.00 207.60 ? 292  PHE C CE1 1 
ATOM   8538  C  CE2 . PHE C  3  294 ? -38.766 21.035  -26.482  1.00 212.96 ? 292  PHE C CE2 1 
ATOM   8539  C  CZ  . PHE C  3  294 ? -38.255 21.501  -25.283  1.00 217.60 ? 292  PHE C CZ  1 
ATOM   8540  N  N   . CYS C  3  295 ? -38.517 16.559  -28.319  1.00 187.31 ? 293  CYS C N   1 
ATOM   8541  C  CA  . CYS C  3  295 ? -38.044 16.836  -29.673  1.00 191.38 ? 293  CYS C CA  1 
ATOM   8542  C  C   . CYS C  3  295 ? -38.765 18.061  -30.212  1.00 211.10 ? 293  CYS C C   1 
ATOM   8543  O  O   . CYS C  3  295 ? -39.999 18.087  -30.260  1.00 225.73 ? 293  CYS C O   1 
ATOM   8544  C  CB  . CYS C  3  295 ? -38.278 15.653  -30.611  1.00 195.24 ? 293  CYS C CB  1 
ATOM   8545  S  SG  . CYS C  3  295 ? -37.545 14.094  -30.107  1.00 230.23 ? 293  CYS C SG  1 
ATOM   8546  N  N   . LEU C  3  296 ? -37.998 19.074  -30.602  1.00 228.14 ? 294  LEU C N   1 
ATOM   8547  C  CA  . LEU C  3  296 ? -38.538 20.288  -31.196  1.00 231.60 ? 294  LEU C CA  1 
ATOM   8548  C  C   . LEU C  3  296 ? -37.674 20.672  -32.388  1.00 227.53 ? 294  LEU C C   1 
ATOM   8549  O  O   . LEU C  3  296 ? -36.447 20.753  -32.267  1.00 226.60 ? 294  LEU C O   1 
ATOM   8550  C  CB  . LEU C  3  296 ? -38.589 21.422  -30.164  1.00 227.89 ? 294  LEU C CB  1 
ATOM   8551  C  CG  . LEU C  3  296 ? -39.592 22.563  -30.357  1.00 227.16 ? 294  LEU C CG  1 
ATOM   8552  C  CD1 . LEU C  3  296 ? -39.087 23.591  -31.361  1.00 239.50 ? 294  LEU C CD1 1 
ATOM   8553  C  CD2 . LEU C  3  296 ? -40.949 22.015  -30.779  1.00 221.91 ? 294  LEU C CD2 1 
ATOM   8554  N  N   . GLY C  3  297 ? -38.308 20.902  -33.535  1.00 219.42 ? 295  GLY C N   1 
ATOM   8555  C  CA  . GLY C  3  297 ? -37.582 21.289  -34.719  1.00 220.35 ? 295  GLY C CA  1 
ATOM   8556  C  C   . GLY C  3  297 ? -38.278 20.927  -36.014  1.00 227.18 ? 295  GLY C C   1 
ATOM   8557  O  O   . GLY C  3  297 ? -39.116 20.021  -36.069  1.00 233.34 ? 295  GLY C O   1 
ATOM   8558  N  N   . PRO C  3  298 ? -37.952 21.649  -37.082  1.00 236.95 ? 296  PRO C N   1 
ATOM   8559  C  CA  . PRO C  3  298 ? -38.527 21.359  -38.396  1.00 242.88 ? 296  PRO C CA  1 
ATOM   8560  C  C   . PRO C  3  298 ? -37.753 20.275  -39.132  1.00 235.10 ? 296  PRO C C   1 
ATOM   8561  O  O   . PRO C  3  298 ? -36.579 20.010  -38.861  1.00 235.13 ? 296  PRO C O   1 
ATOM   8562  C  CB  . PRO C  3  298 ? -38.401 22.705  -39.125  1.00 251.79 ? 296  PRO C CB  1 
ATOM   8563  C  CG  . PRO C  3  298 ? -37.173 23.317  -38.533  1.00 245.84 ? 296  PRO C CG  1 
ATOM   8564  C  CD  . PRO C  3  298 ? -37.135 22.874  -37.089  1.00 235.03 ? 296  PRO C CD  1 
ATOM   8565  N  N   . CYS C  3  299 ? -38.438 19.655  -40.094  1.00 238.68 ? 297  CYS C N   1 
ATOM   8566  C  CA  . CYS C  3  299 ? -37.845 18.596  -40.912  1.00 250.30 ? 297  CYS C CA  1 
ATOM   8567  C  C   . CYS C  3  299 ? -38.231 18.817  -42.370  1.00 270.04 ? 297  CYS C C   1 
ATOM   8568  O  O   . CYS C  3  299 ? -39.257 18.306  -42.840  1.00 277.57 ? 297  CYS C O   1 
ATOM   8569  C  CB  . CYS C  3  299 ? -38.291 17.209  -40.443  1.00 246.98 ? 297  CYS C CB  1 
ATOM   8570  S  SG  . CYS C  3  299 ? -37.922 16.820  -38.713  1.00 229.74 ? 297  CYS C SG  1 
ATOM   8571  N  N   . PRO C  3  300 ? -37.424 19.592  -43.128  1.00 291.28 ? 298  PRO C N   1 
ATOM   8572  C  CA  . PRO C  3  300 ? -37.738 19.821  -44.546  1.00 293.55 ? 298  PRO C CA  1 
ATOM   8573  C  C   . PRO C  3  300 ? -37.050 18.843  -45.486  1.00 292.55 ? 298  PRO C C   1 
ATOM   8574  O  O   . PRO C  3  300 ? -36.255 18.000  -45.050  1.00 293.22 ? 298  PRO C O   1 
ATOM   8575  C  CB  . PRO C  3  300 ? -37.260 21.263  -44.775  1.00 292.01 ? 298  PRO C CB  1 
ATOM   8576  C  CG  . PRO C  3  300 ? -36.204 21.513  -43.703  1.00 290.74 ? 298  PRO C CG  1 
ATOM   8577  C  CD  . PRO C  3  300 ? -36.228 20.351  -42.721  1.00 288.42 ? 298  PRO C CD  1 
ATOM   8578  N  N   . TYR C  3  301 ? -37.353 18.931  -46.779  1.00 290.51 ? 299  TYR C N   1 
ATOM   8579  C  CA  . TYR C  3  301 ? -36.760 18.029  -47.769  1.00 296.46 ? 299  TYR C CA  1 
ATOM   8580  C  C   . TYR C  3  301 ? -35.307 18.407  -48.061  1.00 300.64 ? 299  TYR C C   1 
ATOM   8581  O  O   . TYR C  3  301 ? -34.837 18.304  -49.196  1.00 305.94 ? 299  TYR C O   1 
ATOM   8582  C  CB  . TYR C  3  301 ? -37.579 18.028  -49.064  1.00 301.51 ? 299  TYR C CB  1 
ATOM   8583  C  CG  . TYR C  3  301 ? -39.062 17.846  -48.836  1.00 298.88 ? 299  TYR C CG  1 
ATOM   8584  C  CD1 . TYR C  3  301 ? -39.594 16.588  -48.583  1.00 293.82 ? 299  TYR C CD1 1 
ATOM   8585  C  CD2 . TYR C  3  301 ? -39.928 18.929  -48.869  1.00 303.33 ? 299  TYR C CD2 1 
ATOM   8586  C  CE1 . TYR C  3  301 ? -40.946 16.415  -48.364  1.00 298.42 ? 299  TYR C CE1 1 
ATOM   8587  C  CE2 . TYR C  3  301 ? -41.283 18.768  -48.653  1.00 311.08 ? 299  TYR C CE2 1 
ATOM   8588  C  CZ  . TYR C  3  301 ? -41.787 17.507  -48.400  1.00 308.09 ? 299  TYR C CZ  1 
ATOM   8589  O  OH  . TYR C  3  301 ? -43.135 17.330  -48.183  1.00 319.62 ? 299  TYR C OH  1 
ATOM   8590  N  N   . PRO C  3  321 ? -38.865 11.039  -45.719  1.00 242.12 ? 319  PRO C N   1 
ATOM   8591  C  CA  . PRO C  3  321 ? -39.696 12.030  -46.393  1.00 247.41 ? 319  PRO C CA  1 
ATOM   8592  C  C   . PRO C  3  321 ? -40.894 11.368  -47.065  1.00 248.93 ? 319  PRO C C   1 
ATOM   8593  O  O   . PRO C  3  321 ? -40.926 11.208  -48.285  1.00 250.61 ? 319  PRO C O   1 
ATOM   8594  C  CB  . PRO C  3  321 ? -38.876 12.807  -47.412  1.00 254.97 ? 319  PRO C CB  1 
ATOM   8595  N  N   . GLY C  3  322 ? -41.877 10.987  -46.262  1.00 259.12 ? 320  GLY C N   1 
ATOM   8596  C  CA  . GLY C  3  322 ? -43.061 10.346  -46.797  1.00 264.06 ? 320  GLY C CA  1 
ATOM   8597  C  C   . GLY C  3  322 ? -43.994 9.933   -45.681  1.00 266.42 ? 320  GLY C C   1 
ATOM   8598  O  O   . GLY C  3  322 ? -43.864 10.381  -44.538  1.00 260.25 ? 320  GLY C O   1 
ATOM   8599  N  N   . ALA C  3  323 ? -44.951 9.071   -46.042  1.00 271.67 ? 321  ALA C N   1 
ATOM   8600  C  CA  . ALA C  3  323 ? -45.929 8.503   -45.116  1.00 278.30 ? 321  ALA C CA  1 
ATOM   8601  C  C   . ALA C  3  323 ? -46.880 9.553   -44.549  1.00 280.00 ? 321  ALA C C   1 
ATOM   8602  O  O   . ALA C  3  323 ? -48.088 9.500   -44.806  1.00 290.14 ? 321  ALA C O   1 
ATOM   8603  C  CB  . ALA C  3  323 ? -45.229 7.768   -43.972  1.00 269.91 ? 321  ALA C CB  1 
ATOM   8604  N  N   . SER C  3  324 ? -46.360 10.494  -43.767  1.00 273.92 ? 322  SER C N   1 
ATOM   8605  C  CA  . SER C  3  324 ? -47.175 11.556  -43.195  1.00 272.10 ? 322  SER C CA  1 
ATOM   8606  C  C   . SER C  3  324 ? -47.232 12.762  -44.129  1.00 277.31 ? 322  SER C C   1 
ATOM   8607  O  O   . SER C  3  324 ? -46.314 13.009  -44.916  1.00 281.88 ? 322  SER C O   1 
ATOM   8608  C  CB  . SER C  3  324 ? -46.621 11.983  -41.835  1.00 251.49 ? 322  SER C CB  1 
ATOM   8609  O  OG  . SER C  3  324 ? -45.341 12.575  -41.980  1.00 246.03 ? 322  SER C OG  1 
ATOM   8610  N  N   . ALA C  3  325 ? -48.328 13.521  -44.029  1.00 265.73 ? 323  ALA C N   1 
ATOM   8611  C  CA  . ALA C  3  325 ? -48.482 14.727  -44.837  1.00 260.74 ? 323  ALA C CA  1 
ATOM   8612  C  C   . ALA C  3  325 ? -47.450 15.795  -44.496  1.00 257.02 ? 323  ALA C C   1 
ATOM   8613  O  O   . ALA C  3  325 ? -47.146 16.642  -45.343  1.00 259.12 ? 323  ALA C O   1 
ATOM   8614  C  CB  . ALA C  3  325 ? -49.889 15.298  -44.663  1.00 259.93 ? 323  ALA C CB  1 
ATOM   8615  N  N   . ALA C  3  326 ? -46.910 15.773  -43.284  1.00 262.67 ? 324  ALA C N   1 
ATOM   8616  C  CA  . ALA C  3  326 ? -45.927 16.746  -42.829  1.00 267.31 ? 324  ALA C CA  1 
ATOM   8617  C  C   . ALA C  3  326 ? -44.895 16.045  -41.953  1.00 258.45 ? 324  ALA C C   1 
ATOM   8618  O  O   . ALA C  3  326 ? -45.212 15.662  -40.818  1.00 250.49 ? 324  ALA C O   1 
ATOM   8619  C  CB  . ALA C  3  326 ? -46.604 17.886  -42.067  1.00 268.16 ? 324  ALA C CB  1 
ATOM   8620  N  N   . PRO C  3  327 ? -43.671 15.835  -42.441  1.00 251.24 ? 325  PRO C N   1 
ATOM   8621  C  CA  . PRO C  3  327 ? -42.656 15.138  -41.631  1.00 241.31 ? 325  PRO C CA  1 
ATOM   8622  C  C   . PRO C  3  327 ? -42.371 15.885  -40.336  1.00 236.90 ? 325  PRO C C   1 
ATOM   8623  O  O   . PRO C  3  327 ? -42.027 17.069  -40.338  1.00 233.96 ? 325  PRO C O   1 
ATOM   8624  C  CB  . PRO C  3  327 ? -41.432 15.099  -42.554  1.00 243.94 ? 325  PRO C CB  1 
ATOM   8625  C  CG  . PRO C  3  327 ? -41.986 15.257  -43.935  1.00 257.45 ? 325  PRO C CG  1 
ATOM   8626  C  CD  . PRO C  3  327 ? -43.164 16.177  -43.782  1.00 263.07 ? 325  PRO C CD  1 
ATOM   8627  N  N   . CYS C  3  328 ? -42.516 15.172  -39.222  1.00 228.63 ? 326  CYS C N   1 
ATOM   8628  C  CA  . CYS C  3  328 ? -42.395 15.729  -37.883  1.00 216.88 ? 326  CYS C CA  1 
ATOM   8629  C  C   . CYS C  3  328 ? -41.094 15.307  -37.215  1.00 213.64 ? 326  CYS C C   1 
ATOM   8630  O  O   . CYS C  3  328 ? -40.446 14.328  -37.603  1.00 216.87 ? 326  CYS C O   1 
ATOM   8631  C  CB  . CYS C  3  328 ? -43.571 15.299  -36.997  1.00 221.55 ? 326  CYS C CB  1 
ATOM   8632  S  SG  . CYS C  3  328 ? -45.193 15.952  -37.459  1.00 250.91 ? 326  CYS C SG  1 
ATOM   8633  N  N   . CYS C  3  329 ? -40.717 16.093  -36.207  1.00 218.03 ? 327  CYS C N   1 
ATOM   8634  C  CA  . CYS C  3  329 ? -39.557 15.858  -35.348  1.00 226.55 ? 327  CYS C CA  1 
ATOM   8635  C  C   . CYS C  3  329 ? -39.964 14.912  -34.221  1.00 222.64 ? 327  CYS C C   1 
ATOM   8636  O  O   . CYS C  3  329 ? -40.370 15.335  -33.136  1.00 223.39 ? 327  CYS C O   1 
ATOM   8637  C  CB  . CYS C  3  329 ? -39.039 17.181  -34.802  1.00 227.39 ? 327  CYS C CB  1 
ATOM   8638  S  SG  . CYS C  3  329 ? -37.533 17.104  -33.818  1.00 241.08 ? 327  CYS C SG  1 
ATOM   8639  N  N   . VAL C  3  330 ? -39.853 13.612  -34.475  1.00 227.17 ? 328  VAL C N   1 
ATOM   8640  C  CA  . VAL C  3  330 ? -40.276 12.606  -33.502  1.00 216.20 ? 328  VAL C CA  1 
ATOM   8641  C  C   . VAL C  3  330 ? -39.058 11.939  -32.873  1.00 195.68 ? 328  VAL C C   1 
ATOM   8642  O  O   . VAL C  3  330 ? -37.996 11.857  -33.506  1.00 200.97 ? 328  VAL C O   1 
ATOM   8643  C  CB  . VAL C  3  330 ? -41.206 11.568  -34.150  1.00 223.68 ? 328  VAL C CB  1 
ATOM   8644  C  CG1 . VAL C  3  330 ? -42.496 12.231  -34.605  1.00 232.56 ? 328  VAL C CG1 1 
ATOM   8645  C  CG2 . VAL C  3  330 ? -40.515 10.891  -35.321  1.00 231.11 ? 328  VAL C CG2 1 
ATOM   8646  N  N   . PRO C  3  331 ? -39.158 11.477  -31.629  1.00 190.44 ? 329  PRO C N   1 
ATOM   8647  C  CA  . PRO C  3  331 ? -38.027 10.781  -31.006  1.00 189.18 ? 329  PRO C CA  1 
ATOM   8648  C  C   . PRO C  3  331 ? -37.786 9.420   -31.634  1.00 195.89 ? 329  PRO C C   1 
ATOM   8649  O  O   . PRO C  3  331 ? -38.724 8.701   -31.984  1.00 196.73 ? 329  PRO C O   1 
ATOM   8650  C  CB  . PRO C  3  331 ? -38.459 10.647  -29.542  1.00 204.07 ? 329  PRO C CB  1 
ATOM   8651  C  CG  . PRO C  3  331 ? -39.950 10.695  -29.591  1.00 206.91 ? 329  PRO C CG  1 
ATOM   8652  C  CD  . PRO C  3  331 ? -40.282 11.651  -30.694  1.00 191.92 ? 329  PRO C CD  1 
ATOM   8653  N  N   . GLN C  3  332 ? -36.508 9.075   -31.776  1.00 197.78 ? 330  GLN C N   1 
ATOM   8654  C  CA  . GLN C  3  332 ? -36.097 7.781   -32.308  1.00 207.47 ? 330  GLN C CA  1 
ATOM   8655  C  C   . GLN C  3  332 ? -35.743 6.783   -31.216  1.00 198.64 ? 330  GLN C C   1 
ATOM   8656  O  O   . GLN C  3  332 ? -36.145 5.618   -31.294  1.00 212.33 ? 330  GLN C O   1 
ATOM   8657  C  CB  . GLN C  3  332 ? -34.903 7.952   -33.255  1.00 209.51 ? 330  GLN C CB  1 
ATOM   8658  C  CG  . GLN C  3  332 ? -34.436 6.659   -33.912  1.00 206.00 ? 330  GLN C CG  1 
ATOM   8659  C  CD  . GLN C  3  332 ? -33.334 6.884   -34.932  1.00 220.42 ? 330  GLN C CD  1 
ATOM   8660  O  OE1 . GLN C  3  332 ? -32.811 7.992   -35.064  1.00 225.13 ? 330  GLN C OE1 1 
ATOM   8661  N  NE2 . GLN C  3  332 ? -32.980 5.834   -35.664  1.00 226.37 ? 330  GLN C NE2 1 
ATOM   8662  N  N   . ALA C  3  333 ? -35.004 7.211   -30.198  1.00 191.37 ? 331  ALA C N   1 
ATOM   8663  C  CA  . ALA C  3  333 ? -34.616 6.353   -29.087  1.00 188.17 ? 331  ALA C CA  1 
ATOM   8664  C  C   . ALA C  3  333 ? -35.147 6.929   -27.781  1.00 193.88 ? 331  ALA C C   1 
ATOM   8665  O  O   . ALA C  3  333 ? -34.968 8.120   -27.503  1.00 200.15 ? 331  ALA C O   1 
ATOM   8666  C  CB  . ALA C  3  333 ? -33.094 6.193   -29.026  1.00 206.26 ? 331  ALA C CB  1 
ATOM   8667  N  N   . LEU C  3  334 ? -35.814 6.086   -26.992  1.00 188.03 ? 332  LEU C N   1 
ATOM   8668  C  CA  . LEU C  3  334 ? -36.341 6.471   -25.690  1.00 172.67 ? 332  LEU C CA  1 
ATOM   8669  C  C   . LEU C  3  334 ? -35.873 5.488   -24.625  1.00 170.35 ? 332  LEU C C   1 
ATOM   8670  O  O   . LEU C  3  334 ? -35.580 4.324   -24.908  1.00 171.45 ? 332  LEU C O   1 
ATOM   8671  C  CB  . LEU C  3  334 ? -37.871 6.538   -25.690  1.00 175.29 ? 332  LEU C CB  1 
ATOM   8672  C  CG  . LEU C  3  334 ? -38.514 7.688   -26.463  1.00 173.31 ? 332  LEU C CG  1 
ATOM   8673  C  CD1 . LEU C  3  334 ? -38.615 7.348   -27.944  1.00 191.75 ? 332  LEU C CD1 1 
ATOM   8674  C  CD2 . LEU C  3  334 ? -39.880 8.002   -25.881  1.00 167.35 ? 332  LEU C CD2 1 
ATOM   8675  N  N   . GLU C  3  335 ? -35.830 5.965   -23.380  1.00 180.87 ? 333  GLU C N   1 
ATOM   8676  C  CA  . GLU C  3  335 ? -35.316 5.168   -22.278  1.00 174.53 ? 333  GLU C CA  1 
ATOM   8677  C  C   . GLU C  3  335 ? -36.319 5.083   -21.132  1.00 170.50 ? 333  GLU C C   1 
ATOM   8678  O  O   . GLU C  3  335 ? -36.999 6.070   -20.820  1.00 168.90 ? 333  GLU C O   1 
ATOM   8679  C  CB  . GLU C  3  335 ? -33.979 5.741   -21.771  1.00 182.57 ? 333  GLU C CB  1 
ATOM   8680  C  CG  . GLU C  3  335 ? -32.858 5.739   -22.821  1.00 195.67 ? 333  GLU C CG  1 
ATOM   8681  C  CD  . GLU C  3  335 ? -31.531 6.272   -22.288  1.00 211.09 ? 333  GLU C CD  1 
ATOM   8682  O  OE1 . GLU C  3  335 ? -31.429 6.518   -21.068  1.00 220.14 ? 333  GLU C OE1 1 
ATOM   8683  O  OE2 . GLU C  3  335 ? -30.583 6.432   -23.088  1.00 227.49 ? 333  GLU C OE2 1 
ATOM   8684  N  N   . PRO C  3  336 ? -36.448 3.910   -20.507  1.00 161.44 ? 334  PRO C N   1 
ATOM   8685  C  CA  . PRO C  3  336 ? -37.402 3.747   -19.405  1.00 159.41 ? 334  PRO C CA  1 
ATOM   8686  C  C   . PRO C  3  336 ? -36.927 4.418   -18.126  1.00 159.25 ? 334  PRO C C   1 
ATOM   8687  O  O   . PRO C  3  336 ? -35.754 4.755   -17.957  1.00 161.35 ? 334  PRO C O   1 
ATOM   8688  C  CB  . PRO C  3  336 ? -37.478 2.228   -19.227  1.00 161.18 ? 334  PRO C CB  1 
ATOM   8689  C  CG  . PRO C  3  336 ? -36.167 1.747   -19.677  1.00 164.69 ? 334  PRO C CG  1 
ATOM   8690  C  CD  . PRO C  3  336 ? -35.762 2.647   -20.821  1.00 164.72 ? 334  PRO C CD  1 
ATOM   8691  N  N   . LEU C  3  337 ? -37.871 4.575   -17.199  1.00 169.90 ? 335  LEU C N   1 
ATOM   8692  C  CA  . LEU C  3  337 ? -37.630 5.253   -15.927  1.00 173.16 ? 335  LEU C CA  1 
ATOM   8693  C  C   . LEU C  3  337 ? -38.185 4.429   -14.771  1.00 170.88 ? 335  LEU C C   1 
ATOM   8694  O  O   . LEU C  3  337 ? -39.408 4.166   -14.731  1.00 155.51 ? 335  LEU C O   1 
ATOM   8695  C  CB  . LEU C  3  337 ? -38.256 6.652   -15.945  1.00 167.79 ? 335  LEU C CB  1 
ATOM   8696  C  CG  . LEU C  3  337 ? -38.240 7.414   -14.621  1.00 162.18 ? 335  LEU C CG  1 
ATOM   8697  C  CD1 . LEU C  3  337 ? -36.812 7.728   -14.216  1.00 197.24 ? 335  LEU C CD1 1 
ATOM   8698  C  CD2 . LEU C  3  337 ? -39.056 8.683   -14.725  1.00 156.67 ? 335  LEU C CD2 1 
ATOM   8699  N  N   . PRO C  3  338 ? -37.346 3.987   -13.828  1.00 184.35 ? 336  PRO C N   1 
ATOM   8700  C  CA  . PRO C  3  338 ? -37.860 3.323   -12.625  1.00 181.81 ? 336  PRO C CA  1 
ATOM   8701  C  C   . PRO C  3  338 ? -38.359 4.328   -11.595  1.00 167.04 ? 336  PRO C C   1 
ATOM   8702  O  O   . PRO C  3  338 ? -37.716 5.346   -11.323  1.00 160.52 ? 336  PRO C O   1 
ATOM   8703  C  CB  . PRO C  3  338 ? -36.638 2.553   -12.103  1.00 174.28 ? 336  PRO C CB  1 
ATOM   8704  C  CG  . PRO C  3  338 ? -35.472 3.354   -12.564  1.00 166.21 ? 336  PRO C CG  1 
ATOM   8705  C  CD  . PRO C  3  338 ? -35.872 3.940   -13.901  1.00 168.29 ? 336  PRO C CD  1 
ATOM   8706  N  N   . ILE C  3  339 ? -39.516 4.024   -11.002  1.00 157.82 ? 337  ILE C N   1 
ATOM   8707  C  CA  . ILE C  3  339 ? -40.137 4.891   -10.010  1.00 157.38 ? 337  ILE C CA  1 
ATOM   8708  C  C   . ILE C  3  339 ? -40.416 4.087   -8.750   1.00 171.89 ? 337  ILE C C   1 
ATOM   8709  O  O   . ILE C  3  339 ? -40.461 2.855   -8.765   1.00 173.01 ? 337  ILE C O   1 
ATOM   8710  C  CB  . ILE C  3  339 ? -41.442 5.534   -10.519  1.00 154.68 ? 337  ILE C CB  1 
ATOM   8711  C  CG1 . ILE C  3  339 ? -42.498 4.460   -10.788  1.00 153.42 ? 337  ILE C CG1 1 
ATOM   8712  C  CG2 . ILE C  3  339 ? -41.173 6.344   -11.765  1.00 154.82 ? 337  ILE C CG2 1 
ATOM   8713  C  CD1 . ILE C  3  339 ? -43.827 5.015   -11.230  1.00 151.79 ? 337  ILE C CD1 1 
ATOM   8714  N  N   . VAL C  3  340 ? -40.591 4.810   -7.646   1.00 168.75 ? 338  VAL C N   1 
ATOM   8715  C  CA  . VAL C  3  340 ? -40.923 4.214   -6.359   1.00 161.37 ? 338  VAL C CA  1 
ATOM   8716  C  C   . VAL C  3  340 ? -42.073 5.002   -5.755   1.00 163.42 ? 338  VAL C C   1 
ATOM   8717  O  O   . VAL C  3  340 ? -41.944 6.208   -5.516   1.00 167.85 ? 338  VAL C O   1 
ATOM   8718  C  CB  . VAL C  3  340 ? -39.727 4.183   -5.400   1.00 165.60 ? 338  VAL C CB  1 
ATOM   8719  C  CG1 . VAL C  3  340 ? -40.182 3.691   -4.044   1.00 167.52 ? 338  VAL C CG1 1 
ATOM   8720  C  CG2 . VAL C  3  340 ? -38.633 3.284   -5.952   1.00 173.45 ? 338  VAL C CG2 1 
ATOM   8721  N  N   . TYR C  3  341 ? -43.202 4.331   -5.542   1.00 172.03 ? 339  TYR C N   1 
ATOM   8722  C  CA  . TYR C  3  341 ? -44.357 4.942   -4.906   1.00 186.34 ? 339  TYR C CA  1 
ATOM   8723  C  C   . TYR C  3  341 ? -45.027 3.925   -3.994   1.00 203.38 ? 339  TYR C C   1 
ATOM   8724  O  O   . TYR C  3  341 ? -44.807 2.717   -4.107   1.00 211.28 ? 339  TYR C O   1 
ATOM   8725  C  CB  . TYR C  3  341 ? -45.357 5.467   -5.938   1.00 176.30 ? 339  TYR C CB  1 
ATOM   8726  C  CG  . TYR C  3  341 ? -46.061 4.385   -6.717   1.00 164.68 ? 339  TYR C CG  1 
ATOM   8727  C  CD1 . TYR C  3  341 ? -45.467 3.802   -7.824   1.00 159.18 ? 339  TYR C CD1 1 
ATOM   8728  C  CD2 . TYR C  3  341 ? -47.324 3.951   -6.343   1.00 170.96 ? 339  TYR C CD2 1 
ATOM   8729  C  CE1 . TYR C  3  341 ? -46.114 2.817   -8.538   1.00 155.96 ? 339  TYR C CE1 1 
ATOM   8730  C  CE2 . TYR C  3  341 ? -47.975 2.970   -7.047   1.00 172.10 ? 339  TYR C CE2 1 
ATOM   8731  C  CZ  . TYR C  3  341 ? -47.369 2.405   -8.143   1.00 160.10 ? 339  TYR C CZ  1 
ATOM   8732  O  OH  . TYR C  3  341 ? -48.026 1.423   -8.847   1.00 165.43 ? 339  TYR C OH  1 
ATOM   8733  N  N   . TYR C  3  342 ? -45.863 4.426   -3.093   1.00 211.31 ? 340  TYR C N   1 
ATOM   8734  C  CA  . TYR C  3  342 ? -46.578 3.587   -2.145   1.00 208.70 ? 340  TYR C CA  1 
ATOM   8735  C  C   . TYR C  3  342 ? -48.034 3.414   -2.564   1.00 204.38 ? 340  TYR C C   1 
ATOM   8736  O  O   . TYR C  3  342 ? -48.602 4.230   -3.295   1.00 188.30 ? 340  TYR C O   1 
ATOM   8737  C  CB  . TYR C  3  342 ? -46.509 4.182   -0.739   1.00 209.28 ? 340  TYR C CB  1 
ATOM   8738  C  CG  . TYR C  3  342 ? -45.210 3.921   -0.014   1.00 208.60 ? 340  TYR C CG  1 
ATOM   8739  C  CD1 . TYR C  3  342 ? -44.040 4.561   -0.398   1.00 205.20 ? 340  TYR C CD1 1 
ATOM   8740  C  CD2 . TYR C  3  342 ? -45.159 3.057   1.071    1.00 213.00 ? 340  TYR C CD2 1 
ATOM   8741  C  CE1 . TYR C  3  342 ? -42.851 4.337   0.268    1.00 209.84 ? 340  TYR C CE1 1 
ATOM   8742  C  CE2 . TYR C  3  342 ? -43.974 2.829   1.748    1.00 221.96 ? 340  TYR C CE2 1 
ATOM   8743  C  CZ  . TYR C  3  342 ? -42.822 3.471   1.339    1.00 215.36 ? 340  TYR C CZ  1 
ATOM   8744  O  OH  . TYR C  3  342 ? -41.633 3.251   1.999    1.00 206.68 ? 340  TYR C OH  1 
ATOM   8745  N  N   . VAL C  3  343 ? -48.636 2.331   -2.076   1.00 230.45 ? 341  VAL C N   1 
ATOM   8746  C  CA  . VAL C  3  343 ? -50.045 2.020   -2.307   1.00 236.65 ? 341  VAL C CA  1 
ATOM   8747  C  C   . VAL C  3  343 ? -50.655 1.731   -0.940   1.00 243.74 ? 341  VAL C C   1 
ATOM   8748  O  O   . VAL C  3  343 ? -50.546 0.611   -0.430   1.00 240.27 ? 341  VAL C O   1 
ATOM   8749  C  CB  . VAL C  3  343 ? -50.230 0.830   -3.256   1.00 223.51 ? 341  VAL C CB  1 
ATOM   8750  C  CG1 . VAL C  3  343 ? -51.708 0.541   -3.474   1.00 238.18 ? 341  VAL C CG1 1 
ATOM   8751  C  CG2 . VAL C  3  343 ? -49.527 1.083   -4.579   1.00 190.52 ? 341  VAL C CG2 1 
ATOM   8752  N  N   . GLY C  3  344 ? -51.301 2.732   -0.344   1.00 252.72 ? 342  GLY C N   1 
ATOM   8753  C  CA  . GLY C  3  344 ? -51.795 2.585   1.010    1.00 256.95 ? 342  GLY C CA  1 
ATOM   8754  C  C   . GLY C  3  344 ? -50.653 2.381   1.983    1.00 252.80 ? 342  GLY C C   1 
ATOM   8755  O  O   . GLY C  3  344 ? -50.051 3.347   2.461    1.00 247.56 ? 342  GLY C O   1 
ATOM   8756  N  N   . ARG C  3  345 ? -50.352 1.118   2.287    1.00 248.39 ? 343  ARG C N   1 
ATOM   8757  C  CA  . ARG C  3  345 ? -49.217 0.759   3.124    1.00 246.82 ? 343  ARG C CA  1 
ATOM   8758  C  C   . ARG C  3  345 ? -48.168 -0.049  2.371    1.00 248.52 ? 343  ARG C C   1 
ATOM   8759  O  O   . ARG C  3  345 ? -47.140 -0.401  2.961    1.00 248.49 ? 343  ARG C O   1 
ATOM   8760  C  CB  . ARG C  3  345 ? -49.679 -0.030  4.360    1.00 250.54 ? 343  ARG C CB  1 
ATOM   8761  C  CG  . ARG C  3  345 ? -50.901 0.543   5.065    1.00 251.32 ? 343  ARG C CG  1 
ATOM   8762  C  CD  . ARG C  3  345 ? -51.252 -0.257  6.316    1.00 249.55 ? 343  ARG C CD  1 
ATOM   8763  N  NE  . ARG C  3  345 ? -52.567 0.101   6.845    1.00 251.28 ? 343  ARG C NE  1 
ATOM   8764  C  CZ  . ARG C  3  345 ? -53.693 -0.549  6.562    1.00 249.42 ? 343  ARG C CZ  1 
ATOM   8765  N  NH1 . ARG C  3  345 ? -53.674 -1.601  5.754    1.00 241.98 ? 343  ARG C NH1 1 
ATOM   8766  N  NH2 . ARG C  3  345 ? -54.843 -0.148  7.090    1.00 250.57 ? 343  ARG C NH2 1 
ATOM   8767  N  N   . LYS C  3  346 ? -48.397 -0.354  1.091    1.00 237.68 ? 344  LYS C N   1 
ATOM   8768  C  CA  . LYS C  3  346 ? -47.517 -1.220  0.307    1.00 239.03 ? 344  LYS C CA  1 
ATOM   8769  C  C   . LYS C  3  346 ? -46.676 -0.417  -0.679   1.00 226.77 ? 344  LYS C C   1 
ATOM   8770  O  O   . LYS C  3  346 ? -47.231 0.173   -1.619   1.00 222.53 ? 344  LYS C O   1 
ATOM   8771  C  CB  . LYS C  3  346 ? -48.342 -2.276  -0.436   1.00 234.65 ? 344  LYS C CB  1 
ATOM   8772  C  CG  . LYS C  3  346 ? -49.356 -3.003  0.442    1.00 235.95 ? 344  LYS C CG  1 
ATOM   8773  C  CD  . LYS C  3  346 ? -50.091 -4.102  -0.314   1.00 226.24 ? 344  LYS C CD  1 
ATOM   8774  C  CE  . LYS C  3  346 ? -51.155 -4.756  0.562    1.00 227.09 ? 344  LYS C CE  1 
ATOM   8775  N  NZ  . LYS C  3  346 ? -50.555 -5.541  1.682    1.00 235.18 ? 344  LYS C NZ  1 
ATOM   8776  N  N   . PRO C  3  347 ? -45.350 -0.360  -0.507   1.00 223.84 ? 345  PRO C N   1 
ATOM   8777  C  CA  . PRO C  3  347 ? -44.487 0.323   -1.487   1.00 209.52 ? 345  PRO C CA  1 
ATOM   8778  C  C   . PRO C  3  347 ? -44.225 -0.557  -2.705   1.00 202.19 ? 345  PRO C C   1 
ATOM   8779  O  O   . PRO C  3  347 ? -43.859 -1.728  -2.573   1.00 200.89 ? 345  PRO C O   1 
ATOM   8780  C  CB  . PRO C  3  347 ? -43.196 0.582   -0.704   1.00 211.86 ? 345  PRO C CB  1 
ATOM   8781  C  CG  . PRO C  3  347 ? -43.146 -0.516  0.295    1.00 217.30 ? 345  PRO C CG  1 
ATOM   8782  C  CD  . PRO C  3  347 ? -44.580 -0.864  0.646    1.00 230.25 ? 345  PRO C CD  1 
ATOM   8783  N  N   . LYS C  3  348 ? -44.421 0.009   -3.895   1.00 194.56 ? 346  LYS C N   1 
ATOM   8784  C  CA  . LYS C  3  348 ? -44.233 -0.707  -5.153   1.00 196.02 ? 346  LYS C CA  1 
ATOM   8785  C  C   . LYS C  3  348 ? -43.155 -0.019  -5.981   1.00 188.23 ? 346  LYS C C   1 
ATOM   8786  O  O   . LYS C  3  348 ? -43.290 1.161   -6.321   1.00 191.53 ? 346  LYS C O   1 
ATOM   8787  C  CB  . LYS C  3  348 ? -45.550 -0.777  -5.931   1.00 192.21 ? 346  LYS C CB  1 
ATOM   8788  C  CG  . LYS C  3  348 ? -46.647 -1.537  -5.198   1.00 194.50 ? 346  LYS C CG  1 
ATOM   8789  C  CD  . LYS C  3  348 ? -47.901 -1.682  -6.043   1.00 191.08 ? 346  LYS C CD  1 
ATOM   8790  C  CE  . LYS C  3  348 ? -48.975 -2.467  -5.300   1.00 197.43 ? 346  LYS C CE  1 
ATOM   8791  N  NZ  . LYS C  3  348 ? -48.497 -3.833  -4.943   1.00 216.86 ? 346  LYS C NZ  1 
ATOM   8792  N  N   . VAL C  3  349 ? -42.088 -0.749  -6.301   1.00 171.07 ? 347  VAL C N   1 
ATOM   8793  C  CA  . VAL C  3  349 ? -41.035 -0.243  -7.177   1.00 162.78 ? 347  VAL C CA  1 
ATOM   8794  C  C   . VAL C  3  349 ? -41.369 -0.662  -8.601   1.00 160.99 ? 347  VAL C C   1 
ATOM   8795  O  O   . VAL C  3  349 ? -41.228 -1.833  -8.956   1.00 162.49 ? 347  VAL C O   1 
ATOM   8796  C  CB  . VAL C  3  349 ? -39.654 -0.756  -6.764   1.00 166.94 ? 347  VAL C CB  1 
ATOM   8797  C  CG1 . VAL C  3  349 ? -38.588 -0.144  -7.657   1.00 167.54 ? 347  VAL C CG1 1 
ATOM   8798  C  CG2 . VAL C  3  349 ? -39.391 -0.425  -5.317   1.00 169.55 ? 347  VAL C CG2 1 
ATOM   8799  N  N   . GLU C  3  350 ? -41.792 0.296   -9.423   1.00 158.41 ? 348  GLU C N   1 
ATOM   8800  C  CA  . GLU C  3  350 ? -42.205 0.018   -10.789  1.00 160.21 ? 348  GLU C CA  1 
ATOM   8801  C  C   . GLU C  3  350 ? -41.369 0.820   -11.779  1.00 167.20 ? 348  GLU C C   1 
ATOM   8802  O  O   . GLU C  3  350 ? -40.756 1.833   -11.430  1.00 168.50 ? 348  GLU C O   1 
ATOM   8803  C  CB  . GLU C  3  350 ? -43.694 0.321   -10.989  1.00 154.96 ? 348  GLU C CB  1 
ATOM   8804  C  CG  . GLU C  3  350 ? -44.599 -0.465  -10.053  1.00 157.75 ? 348  GLU C CG  1 
ATOM   8805  C  CD  . GLU C  3  350 ? -46.057 -0.410  -10.456  1.00 173.71 ? 348  GLU C CD  1 
ATOM   8806  O  OE1 . GLU C  3  350 ? -46.874 -1.113  -9.825   1.00 190.65 ? 348  GLU C OE1 1 
ATOM   8807  O  OE2 . GLU C  3  350 ? -46.382 0.324   -11.411  1.00 167.43 ? 348  GLU C OE2 1 
ATOM   8808  N  N   . GLN C  3  351 ? -41.367 0.361   -13.033  1.00 161.29 ? 349  GLN C N   1 
ATOM   8809  C  CA  . GLN C  3  351 ? -40.572 0.974   -14.092  1.00 157.06 ? 349  GLN C CA  1 
ATOM   8810  C  C   . GLN C  3  351 ? -41.460 1.283   -15.286  1.00 162.94 ? 349  GLN C C   1 
ATOM   8811  O  O   . GLN C  3  351 ? -42.029 0.369   -15.894  1.00 159.40 ? 349  GLN C O   1 
ATOM   8812  C  CB  . GLN C  3  351 ? -39.418 0.068   -14.519  1.00 160.13 ? 349  GLN C CB  1 
ATOM   8813  C  CG  . GLN C  3  351 ? -38.522 0.691   -15.566  1.00 160.75 ? 349  GLN C CG  1 
ATOM   8814  C  CD  . GLN C  3  351 ? -37.414 -0.243  -16.010  1.00 174.53 ? 349  GLN C CD  1 
ATOM   8815  O  OE1 . GLN C  3  351 ? -37.485 -1.453  -15.800  1.00 182.23 ? 349  GLN C OE1 1 
ATOM   8816  N  NE2 . GLN C  3  351 ? -36.377 0.318   -16.619  1.00 179.03 ? 349  GLN C NE2 1 
ATOM   8817  N  N   . LEU C  3  352 ? -41.539 2.564   -15.638  1.00 183.26 ? 350  LEU C N   1 
ATOM   8818  C  CA  . LEU C  3  352 ? -42.310 3.003   -16.790  1.00 159.97 ? 350  LEU C CA  1 
ATOM   8819  C  C   . LEU C  3  352 ? -41.500 2.807   -18.061  1.00 166.06 ? 350  LEU C C   1 
ATOM   8820  O  O   . LEU C  3  352 ? -40.276 2.953   -18.061  1.00 182.58 ? 350  LEU C O   1 
ATOM   8821  C  CB  . LEU C  3  352 ? -42.697 4.474   -16.648  1.00 154.76 ? 350  LEU C CB  1 
ATOM   8822  C  CG  . LEU C  3  352 ? -43.538 4.845   -15.432  1.00 176.28 ? 350  LEU C CG  1 
ATOM   8823  C  CD1 . LEU C  3  352 ? -43.826 6.335   -15.432  1.00 194.11 ? 350  LEU C CD1 1 
ATOM   8824  C  CD2 . LEU C  3  352 ? -44.828 4.046   -15.411  1.00 186.96 ? 350  LEU C CD2 1 
ATOM   8825  N  N   . SER C  3  353 ? -42.188 2.465   -19.144  1.00 175.49 ? 351  SER C N   1 
ATOM   8826  C  CA  . SER C  3  353 ? -41.537 2.199   -20.420  1.00 187.69 ? 351  SER C CA  1 
ATOM   8827  C  C   . SER C  3  353 ? -41.533 3.440   -21.310  1.00 190.91 ? 351  SER C C   1 
ATOM   8828  O  O   . SER C  3  353 ? -42.568 4.093   -21.483  1.00 207.06 ? 351  SER C O   1 
ATOM   8829  C  CB  . SER C  3  353 ? -42.231 1.031   -21.125  1.00 204.57 ? 351  SER C CB  1 
ATOM   8830  O  OG  . SER C  3  353 ? -43.620 1.274   -21.278  1.00 211.84 ? 351  SER C OG  1 
ATOM   8831  N  N   . ASN C  3  354 ? -40.360 3.756   -21.869  1.00 180.84 ? 352  ASN C N   1 
ATOM   8832  C  CA  . ASN C  3  354 ? -40.170 4.876   -22.788  1.00 193.85 ? 352  ASN C CA  1 
ATOM   8833  C  C   . ASN C  3  354 ? -40.580 6.214   -22.181  1.00 181.06 ? 352  ASN C C   1 
ATOM   8834  O  O   . ASN C  3  354 ? -41.716 6.666   -22.362  1.00 186.01 ? 352  ASN C O   1 
ATOM   8835  C  CB  . ASN C  3  354 ? -40.937 4.635   -24.095  1.00 206.02 ? 352  ASN C CB  1 
ATOM   8836  C  CG  . ASN C  3  354 ? -40.400 3.444   -24.882  1.00 192.97 ? 352  ASN C CG  1 
ATOM   8837  O  OD1 . ASN C  3  354 ? -39.486 3.587   -25.693  1.00 188.40 ? 352  ASN C OD1 1 
ATOM   8838  N  ND2 . ASN C  3  354 ? -40.973 2.268   -24.650  1.00 185.61 ? 352  ASN C ND2 1 
ATOM   8839  N  N   . MET C  3  355 ? -39.649 6.871   -21.487  1.00 159.20 ? 353  MET C N   1 
ATOM   8840  C  CA  . MET C  3  355 ? -39.917 8.168   -20.875  1.00 168.57 ? 353  MET C CA  1 
ATOM   8841  C  C   . MET C  3  355 ? -38.833 9.166   -21.261  1.00 169.80 ? 353  MET C C   1 
ATOM   8842  O  O   . MET C  3  355 ? -39.133 10.295  -21.665  1.00 174.06 ? 353  MET C O   1 
ATOM   8843  C  CB  . MET C  3  355 ? -40.004 8.056   -19.346  1.00 165.07 ? 353  MET C CB  1 
ATOM   8844  C  CG  . MET C  3  355 ? -41.157 7.217   -18.795  1.00 155.69 ? 353  MET C CG  1 
ATOM   8845  S  SD  . MET C  3  355 ? -42.790 7.856   -19.189  1.00 159.83 ? 353  MET C SD  1 
ATOM   8846  C  CE  . MET C  3  355 ? -42.734 9.463   -18.404  1.00 154.51 ? 353  MET C CE  1 
ATOM   8847  N  N   . ILE C  3  356 ? -37.572 8.762   -21.132  1.00 160.98 ? 354  ILE C N   1 
ATOM   8848  C  CA  . ILE C  3  356 ? -36.444 9.643   -21.422  1.00 164.23 ? 354  ILE C CA  1 
ATOM   8849  C  C   . ILE C  3  356 ? -36.190 9.654   -22.922  1.00 167.94 ? 354  ILE C C   1 
ATOM   8850  O  O   . ILE C  3  356 ? -35.869 8.620   -23.515  1.00 177.57 ? 354  ILE C O   1 
ATOM   8851  C  CB  . ILE C  3  356 ? -35.185 9.210   -20.657  1.00 178.60 ? 354  ILE C CB  1 
ATOM   8852  C  CG1 . ILE C  3  356 ? -35.355 9.434   -19.152  1.00 180.12 ? 354  ILE C CG1 1 
ATOM   8853  C  CG2 . ILE C  3  356 ? -33.967 9.959   -21.175  1.00 181.00 ? 354  ILE C CG2 1 
ATOM   8854  C  CD1 . ILE C  3  356 ? -35.931 8.249   -18.409  1.00 183.92 ? 354  ILE C CD1 1 
ATOM   8855  N  N   . VAL C  3  357 ? -36.319 10.826  -23.533  1.00 169.24 ? 355  VAL C N   1 
ATOM   8856  C  CA  . VAL C  3  357 ? -36.082 10.976  -24.964  1.00 169.96 ? 355  VAL C CA  1 
ATOM   8857  C  C   . VAL C  3  357 ? -34.594 11.187  -25.202  1.00 181.75 ? 355  VAL C C   1 
ATOM   8858  O  O   . VAL C  3  357 ? -34.016 12.180  -24.746  1.00 189.03 ? 355  VAL C O   1 
ATOM   8859  C  CB  . VAL C  3  357 ? -36.900 12.135  -25.540  1.00 170.79 ? 355  VAL C CB  1 
ATOM   8860  C  CG1 . VAL C  3  357 ? -36.477 12.401  -26.968  1.00 174.44 ? 355  VAL C CG1 1 
ATOM   8861  C  CG2 . VAL C  3  357 ? -38.382 11.807  -25.469  1.00 169.13 ? 355  VAL C CG2 1 
ATOM   8862  N  N   . ARG C  3  358 ? -33.972 10.248  -25.913  1.00 187.03 ? 356  ARG C N   1 
ATOM   8863  C  CA  . ARG C  3  358 ? -32.537 10.329  -26.216  1.00 197.18 ? 356  ARG C CA  1 
ATOM   8864  C  C   . ARG C  3  358 ? -32.316 10.991  -27.574  1.00 196.36 ? 356  ARG C C   1 
ATOM   8865  O  O   . ARG C  3  358 ? -31.797 12.108  -27.654  1.00 200.17 ? 356  ARG C O   1 
ATOM   8866  C  CB  . ARG C  3  358 ? -31.911 8.934   -26.158  1.00 222.07 ? 356  ARG C CB  1 
ATOM   8867  C  CG  . ARG C  3  358 ? -30.402 8.921   -26.327  1.00 236.43 ? 356  ARG C CG  1 
ATOM   8868  C  CD  . ARG C  3  358 ? -29.705 9.635   -25.173  1.00 227.11 ? 356  ARG C CD  1 
ATOM   8869  N  NE  . ARG C  3  358 ? -29.838 8.916   -23.907  1.00 224.61 ? 356  ARG C NE  1 
ATOM   8870  C  CZ  . ARG C  3  358 ? -29.258 9.292   -22.770  1.00 230.11 ? 356  ARG C CZ  1 
ATOM   8871  N  NH1 . ARG C  3  358 ? -28.501 10.380  -22.738  1.00 236.66 ? 356  ARG C NH1 1 
ATOM   8872  N  NH2 . ARG C  3  358 ? -29.429 8.580   -21.665  1.00 226.39 ? 356  ARG C NH2 1 
ATOM   8873  N  N   . SER C  3  359 ? -32.698 10.306  -28.648  1.00 191.11 ? 357  SER C N   1 
ATOM   8874  C  CA  . SER C  3  359 ? -32.515 10.789  -30.009  1.00 197.84 ? 357  SER C CA  1 
ATOM   8875  C  C   . SER C  3  359 ? -33.842 11.245  -30.595  1.00 198.36 ? 357  SER C C   1 
ATOM   8876  O  O   . SER C  3  359 ? -34.917 10.972  -30.057  1.00 192.85 ? 357  SER C O   1 
ATOM   8877  C  CB  . SER C  3  359 ? -31.908 9.703   -30.906  1.00 202.73 ? 357  SER C CB  1 
ATOM   8878  O  OG  . SER C  3  359 ? -30.692 9.217   -30.377  1.00 210.55 ? 357  SER C OG  1 
ATOM   8879  N  N   . CYS C  3  360 ? -33.747 11.933  -31.730  1.00 206.71 ? 358  CYS C N   1 
ATOM   8880  C  CA  . CYS C  3  360 ? -34.914 12.385  -32.471  1.00 215.76 ? 358  CYS C CA  1 
ATOM   8881  C  C   . CYS C  3  360 ? -34.660 12.185  -33.955  1.00 205.99 ? 358  CYS C C   1 
ATOM   8882  O  O   . CYS C  3  360 ? -33.548 12.412  -34.439  1.00 198.90 ? 358  CYS C O   1 
ATOM   8883  C  CB  . CYS C  3  360 ? -35.234 13.862  -32.202  1.00 226.06 ? 358  CYS C CB  1 
ATOM   8884  S  SG  . CYS C  3  360 ? -35.545 14.251  -30.461  1.00 256.79 ? 358  CYS C SG  1 
ATOM   8885  N  N   . LYS C  3  361 ? -35.692 11.740  -34.663  1.00 202.82 ? 359  LYS C N   1 
ATOM   8886  C  CA  . LYS C  3  361 ? -35.655 11.501  -36.098  1.00 202.70 ? 359  LYS C CA  1 
ATOM   8887  C  C   . LYS C  3  361 ? -36.770 12.293  -36.774  1.00 210.82 ? 359  LYS C C   1 
ATOM   8888  O  O   . LYS C  3  361 ? -37.590 12.943  -36.121  1.00 216.09 ? 359  LYS C O   1 
ATOM   8889  C  CB  . LYS C  3  361 ? -35.786 10.006  -36.416  1.00 205.43 ? 359  LYS C CB  1 
ATOM   8890  C  CG  . LYS C  3  361 ? -37.099 9.380   -35.952  1.00 205.40 ? 359  LYS C CG  1 
ATOM   8891  C  CD  . LYS C  3  361 ? -37.221 7.911   -36.358  1.00 205.01 ? 359  LYS C CD  1 
ATOM   8892  C  CE  . LYS C  3  361 ? -38.523 7.298   -35.841  1.00 200.37 ? 359  LYS C CE  1 
ATOM   8893  N  NZ  . LYS C  3  361 ? -38.695 5.860   -36.201  1.00 204.13 ? 359  LYS C NZ  1 
ATOM   8894  N  N   . CYS C  3  362 ? -36.790 12.241  -38.104  1.00 226.21 ? 360  CYS C N   1 
ATOM   8895  C  CA  . CYS C  3  362 ? -37.834 12.871  -38.905  1.00 230.57 ? 360  CYS C CA  1 
ATOM   8896  C  C   . CYS C  3  362 ? -38.461 11.827  -39.814  1.00 242.14 ? 360  CYS C C   1 
ATOM   8897  O  O   . CYS C  3  362 ? -37.788 11.281  -40.695  1.00 258.10 ? 360  CYS C O   1 
ATOM   8898  C  CB  . CYS C  3  362 ? -37.277 14.030  -39.729  1.00 234.35 ? 360  CYS C CB  1 
ATOM   8899  S  SG  . CYS C  3  362 ? -36.536 15.329  -38.740  1.00 240.96 ? 360  CYS C SG  1 
ATOM   8900  N  N   . SER C  3  363 ? -39.743 11.555  -39.609  1.00 242.61 ? 361  SER C N   1 
ATOM   8901  C  CA  . SER C  3  363 ? -40.438 10.580  -40.442  1.00 249.59 ? 361  SER C CA  1 
ATOM   8902  C  C   . SER C  3  363 ? -41.886 10.992  -40.654  1.00 269.40 ? 361  SER C C   1 
ATOM   8903  O  O   . SER C  3  363 ? -42.355 11.971  -40.072  1.00 278.13 ? 361  SER C O   1 
ATOM   8904  C  CB  . SER C  3  363 ? -40.368 9.183   -39.820  1.00 243.99 ? 361  SER C CB  1 
ATOM   8905  O  OG  . SER C  3  363 ? -40.890 9.184   -38.504  1.00 244.27 ? 361  SER C OG  1 
ATOM   8906  O  OXT . SER C  3  363 ? -42.615 10.359  -41.420  1.00 272.83 ? 361  SER C OXT 1 
ATOM   8907  N  N   . ILE D  3  9   ? -43.250 31.768  -34.079  1.00 214.79 ? 7    ILE D N   1 
ATOM   8908  C  CA  . ILE D  3  9   ? -42.568 32.349  -32.929  1.00 217.34 ? 7    ILE D CA  1 
ATOM   8909  C  C   . ILE D  3  9   ? -42.176 31.189  -32.002  1.00 217.14 ? 7    ILE D C   1 
ATOM   8910  O  O   . ILE D  3  9   ? -41.047 31.129  -31.510  1.00 217.25 ? 7    ILE D O   1 
ATOM   8911  C  CB  . ILE D  3  9   ? -43.420 33.413  -32.213  1.00 216.35 ? 7    ILE D CB  1 
ATOM   8912  C  CG1 . ILE D  3  9   ? -43.620 34.662  -33.084  1.00 222.67 ? 7    ILE D CG1 1 
ATOM   8913  C  CG2 . ILE D  3  9   ? -42.710 33.858  -30.979  1.00 221.10 ? 7    ILE D CG2 1 
ATOM   8914  C  CD1 . ILE D  3  9   ? -44.712 34.559  -34.128  1.00 226.91 ? 7    ILE D CD1 1 
ATOM   8915  N  N   . ASP D  3  10  ? -43.148 30.289  -31.793  1.00 221.84 ? 8    ASP D N   1 
ATOM   8916  C  CA  . ASP D  3  10  ? -43.044 29.018  -31.071  1.00 220.15 ? 8    ASP D CA  1 
ATOM   8917  C  C   . ASP D  3  10  ? -43.139 29.111  -29.566  1.00 216.99 ? 8    ASP D C   1 
ATOM   8918  O  O   . ASP D  3  10  ? -43.943 28.395  -28.968  1.00 215.92 ? 8    ASP D O   1 
ATOM   8919  C  CB  . ASP D  3  10  ? -41.749 28.312  -31.408  1.00 212.29 ? 8    ASP D CB  1 
ATOM   8920  C  CG  . ASP D  3  10  ? -41.714 27.868  -32.825  1.00 226.18 ? 8    ASP D CG  1 
ATOM   8921  O  OD1 . ASP D  3  10  ? -42.806 27.748  -33.426  1.00 238.84 ? 8    ASP D OD1 1 
ATOM   8922  O  OD2 . ASP D  3  10  ? -40.602 27.641  -33.339  1.00 229.18 ? 8    ASP D OD2 1 
ATOM   8923  N  N   . MET D  3  11  ? -42.234 29.852  -28.940  1.00 201.82 ? 9    MET D N   1 
ATOM   8924  C  CA  . MET D  3  11  ? -42.346 30.143  -27.511  1.00 200.66 ? 9    MET D CA  1 
ATOM   8925  C  C   . MET D  3  11  ? -41.761 29.030  -26.624  1.00 201.30 ? 9    MET D C   1 
ATOM   8926  O  O   . MET D  3  11  ? -41.365 27.996  -27.160  1.00 192.65 ? 9    MET D O   1 
ATOM   8927  C  CB  . MET D  3  11  ? -43.821 30.472  -27.267  1.00 207.32 ? 9    MET D CB  1 
ATOM   8928  C  CG  . MET D  3  11  ? -44.369 30.105  -26.069  1.00 214.49 ? 9    MET D CG  1 
ATOM   8929  S  SD  . MET D  3  11  ? -43.674 30.973  -24.679  1.00 206.45 ? 9    MET D SD  1 
ATOM   8930  C  CE  . MET D  3  11  ? -44.460 32.471  -25.057  1.00 227.63 ? 9    MET D CE  1 
ATOM   8931  N  N   . GLU D  3  12  ? -41.646 29.217  -25.289  1.00 209.84 ? 10   GLU D N   1 
ATOM   8932  C  CA  . GLU D  3  12  ? -41.096 28.194  -24.374  1.00 205.97 ? 10   GLU D CA  1 
ATOM   8933  C  C   . GLU D  3  12  ? -42.156 27.362  -23.674  1.00 197.64 ? 10   GLU D C   1 
ATOM   8934  O  O   . GLU D  3  12  ? -41.818 26.494  -22.856  1.00 189.36 ? 10   GLU D O   1 
ATOM   8935  C  CB  . GLU D  3  12  ? -40.185 28.825  -23.302  1.00 219.95 ? 10   GLU D CB  1 
ATOM   8936  C  CG  . GLU D  3  12  ? -39.163 27.924  -22.590  1.00 218.73 ? 10   GLU D CG  1 
ATOM   8937  C  CD  . GLU D  3  12  ? -38.544 28.614  -21.390  1.00 236.60 ? 10   GLU D CD  1 
ATOM   8938  O  OE1 . GLU D  3  12  ? -39.278 28.845  -20.406  1.00 251.86 ? 10   GLU D OE1 1 
ATOM   8939  O  OE2 . GLU D  3  12  ? -37.342 28.950  -21.441  1.00 235.71 ? 10   GLU D OE2 1 
ATOM   8940  N  N   . LEU D  3  13  ? -43.428 27.634  -23.941  1.00 198.75 ? 11   LEU D N   1 
ATOM   8941  C  CA  . LEU D  3  13  ? -44.490 26.834  -23.357  1.00 191.50 ? 11   LEU D CA  1 
ATOM   8942  C  C   . LEU D  3  13  ? -44.507 25.422  -23.903  1.00 181.93 ? 11   LEU D C   1 
ATOM   8943  O  O   . LEU D  3  13  ? -45.231 24.581  -23.361  1.00 178.84 ? 11   LEU D O   1 
ATOM   8944  C  CB  . LEU D  3  13  ? -45.861 27.489  -23.584  1.00 207.21 ? 11   LEU D CB  1 
ATOM   8945  C  CG  . LEU D  3  13  ? -46.514 27.628  -24.974  1.00 202.48 ? 11   LEU D CG  1 
ATOM   8946  C  CD1 . LEU D  3  13  ? -47.166 26.341  -25.524  1.00 189.72 ? 11   LEU D CD1 1 
ATOM   8947  C  CD2 . LEU D  3  13  ? -47.538 28.753  -24.967  1.00 215.10 ? 11   LEU D CD2 1 
ATOM   8948  N  N   . VAL D  3  14  ? -43.769 25.163  -24.982  1.00 190.16 ? 12   VAL D N   1 
ATOM   8949  C  CA  . VAL D  3  14  ? -43.667 23.810  -25.515  1.00 199.90 ? 12   VAL D CA  1 
ATOM   8950  C  C   . VAL D  3  14  ? -43.198 22.852  -24.428  1.00 198.22 ? 12   VAL D C   1 
ATOM   8951  O  O   . VAL D  3  14  ? -43.627 21.691  -24.371  1.00 188.89 ? 12   VAL D O   1 
ATOM   8952  C  CB  . VAL D  3  14  ? -42.731 23.801  -26.740  1.00 201.04 ? 12   VAL D CB  1 
ATOM   8953  C  CG1 . VAL D  3  14  ? -42.612 22.400  -27.337  1.00 188.19 ? 12   VAL D CG1 1 
ATOM   8954  C  CG2 . VAL D  3  14  ? -43.214 24.809  -27.789  1.00 212.82 ? 12   VAL D CG2 1 
ATOM   8955  N  N   . LYS D  3  15  ? -42.325 23.329  -23.537  1.00 199.85 ? 13   LYS D N   1 
ATOM   8956  C  CA  . LYS D  3  15  ? -41.869 22.500  -22.427  1.00 183.82 ? 13   LYS D CA  1 
ATOM   8957  C  C   . LYS D  3  15  ? -43.022 22.174  -21.491  1.00 174.29 ? 13   LYS D C   1 
ATOM   8958  O  O   . LYS D  3  15  ? -43.110 21.057  -20.970  1.00 168.95 ? 13   LYS D O   1 
ATOM   8959  C  CB  . LYS D  3  15  ? -40.746 23.212  -21.670  1.00 191.76 ? 13   LYS D CB  1 
ATOM   8960  C  CG  . LYS D  3  15  ? -39.555 23.611  -22.536  1.00 206.12 ? 13   LYS D CG  1 
ATOM   8961  C  CD  . LYS D  3  15  ? -38.493 24.347  -21.734  1.00 211.10 ? 13   LYS D CD  1 
ATOM   8962  C  CE  . LYS D  3  15  ? -37.305 24.718  -22.604  1.00 210.93 ? 13   LYS D CE  1 
ATOM   8963  N  NZ  . LYS D  3  15  ? -36.252 25.425  -21.828  1.00 216.12 ? 13   LYS D NZ  1 
ATOM   8964  N  N   . ARG D  3  16  ? -43.938 23.129  -21.299  1.00 182.67 ? 14   ARG D N   1 
ATOM   8965  C  CA  . ARG D  3  16  ? -45.100 22.897  -20.450  1.00 184.56 ? 14   ARG D CA  1 
ATOM   8966  C  C   . ARG D  3  16  ? -46.124 21.995  -21.119  1.00 183.31 ? 14   ARG D C   1 
ATOM   8967  O  O   . ARG D  3  16  ? -46.903 21.336  -20.420  1.00 173.57 ? 14   ARG D O   1 
ATOM   8968  C  CB  . ARG D  3  16  ? -45.741 24.233  -20.065  1.00 190.50 ? 14   ARG D CB  1 
ATOM   8969  C  CG  . ARG D  3  16  ? -44.934 25.034  -19.056  1.00 198.64 ? 14   ARG D CG  1 
ATOM   8970  C  CD  . ARG D  3  16  ? -44.755 24.242  -17.776  1.00 200.37 ? 14   ARG D CD  1 
ATOM   8971  N  NE  . ARG D  3  16  ? -46.030 23.731  -17.285  1.00 195.31 ? 14   ARG D NE  1 
ATOM   8972  C  CZ  . ARG D  3  16  ? -46.171 23.016  -16.173  1.00 195.93 ? 14   ARG D CZ  1 
ATOM   8973  N  NH1 . ARG D  3  16  ? -45.115 22.726  -15.427  1.00 207.89 ? 14   ARG D NH1 1 
ATOM   8974  N  NH2 . ARG D  3  16  ? -47.373 22.595  -15.806  1.00 191.09 ? 14   ARG D NH2 1 
ATOM   8975  N  N   . LYS D  3  17  ? -46.135 21.947  -22.453  1.00 177.55 ? 15   LYS D N   1 
ATOM   8976  C  CA  . LYS D  3  17  ? -47.003 21.008  -23.150  1.00 172.28 ? 15   LYS D CA  1 
ATOM   8977  C  C   . LYS D  3  17  ? -46.517 19.585  -22.939  1.00 168.14 ? 15   LYS D C   1 
ATOM   8978  O  O   . LYS D  3  17  ? -47.324 18.651  -22.896  1.00 167.61 ? 15   LYS D O   1 
ATOM   8979  C  CB  . LYS D  3  17  ? -47.054 21.343  -24.645  1.00 175.12 ? 15   LYS D CB  1 
ATOM   8980  C  CG  . LYS D  3  17  ? -47.982 22.501  -25.029  1.00 181.65 ? 15   LYS D CG  1 
ATOM   8981  C  CD  . LYS D  3  17  ? -47.967 22.732  -26.542  1.00 182.56 ? 15   LYS D CD  1 
ATOM   8982  C  CE  . LYS D  3  17  ? -48.955 23.805  -26.972  1.00 188.59 ? 15   LYS D CE  1 
ATOM   8983  N  NZ  . LYS D  3  17  ? -48.849 24.128  -28.423  1.00 191.66 ? 15   LYS D NZ  1 
ATOM   8984  N  N   . ARG D  3  18  ? -45.198 19.413  -22.824  1.00 177.10 ? 16   ARG D N   1 
ATOM   8985  C  CA  . ARG D  3  18  ? -44.618 18.113  -22.506  1.00 171.68 ? 16   ARG D CA  1 
ATOM   8986  C  C   . ARG D  3  18  ? -44.919 17.708  -21.066  1.00 171.84 ? 16   ARG D C   1 
ATOM   8987  O  O   . ARG D  3  18  ? -45.242 16.545  -20.799  1.00 166.73 ? 16   ARG D O   1 
ATOM   8988  C  CB  . ARG D  3  18  ? -43.109 18.152  -22.756  1.00 170.33 ? 16   ARG D CB  1 
ATOM   8989  C  CG  . ARG D  3  18  ? -42.320 16.946  -22.254  1.00 177.77 ? 16   ARG D CG  1 
ATOM   8990  C  CD  . ARG D  3  18  ? -42.376 15.772  -23.220  1.00 185.70 ? 16   ARG D CD  1 
ATOM   8991  N  NE  . ARG D  3  18  ? -41.726 14.582  -22.674  1.00 184.88 ? 16   ARG D NE  1 
ATOM   8992  C  CZ  . ARG D  3  18  ? -41.572 13.439  -23.337  1.00 186.51 ? 16   ARG D CZ  1 
ATOM   8993  N  NH1 . ARG D  3  18  ? -42.017 13.322  -24.582  1.00 199.47 ? 16   ARG D NH1 1 
ATOM   8994  N  NH2 . ARG D  3  18  ? -40.968 12.413  -22.756  1.00 171.70 ? 16   ARG D NH2 1 
ATOM   8995  N  N   . ILE D  3  19  ? -44.816 18.654  -20.126  1.00 175.75 ? 17   ILE D N   1 
ATOM   8996  C  CA  . ILE D  3  19  ? -45.042 18.346  -18.713  1.00 175.27 ? 17   ILE D CA  1 
ATOM   8997  C  C   . ILE D  3  19  ? -46.480 17.906  -18.481  1.00 176.09 ? 17   ILE D C   1 
ATOM   8998  O  O   . ILE D  3  19  ? -46.740 16.941  -17.752  1.00 166.50 ? 17   ILE D O   1 
ATOM   8999  C  CB  . ILE D  3  19  ? -44.678 19.557  -17.834  1.00 184.81 ? 17   ILE D CB  1 
ATOM   9000  C  CG1 . ILE D  3  19  ? -43.189 19.885  -17.958  1.00 194.15 ? 17   ILE D CG1 1 
ATOM   9001  C  CG2 . ILE D  3  19  ? -45.048 19.298  -16.388  1.00 186.12 ? 17   ILE D CG2 1 
ATOM   9002  C  CD1 . ILE D  3  19  ? -42.746 21.037  -17.081  1.00 200.50 ? 17   ILE D CD1 1 
ATOM   9003  N  N   . GLU D  3  20  ? -47.438 18.614  -19.081  1.00 181.50 ? 18   GLU D N   1 
ATOM   9004  C  CA  . GLU D  3  20  ? -48.835 18.233  -18.930  1.00 166.64 ? 18   GLU D CA  1 
ATOM   9005  C  C   . GLU D  3  20  ? -49.173 16.978  -19.719  1.00 165.21 ? 18   GLU D C   1 
ATOM   9006  O  O   . GLU D  3  20  ? -50.189 16.335  -19.431  1.00 165.88 ? 18   GLU D O   1 
ATOM   9007  C  CB  . GLU D  3  20  ? -49.737 19.391  -19.352  1.00 171.22 ? 18   GLU D CB  1 
ATOM   9008  C  CG  . GLU D  3  20  ? -49.726 20.547  -18.365  1.00 176.43 ? 18   GLU D CG  1 
ATOM   9009  C  CD  . GLU D  3  20  ? -50.205 20.137  -16.986  1.00 178.00 ? 18   GLU D CD  1 
ATOM   9010  O  OE1 . GLU D  3  20  ? -51.102 19.271  -16.899  1.00 186.49 ? 18   GLU D OE1 1 
ATOM   9011  O  OE2 . GLU D  3  20  ? -49.683 20.681  -15.991  1.00 174.78 ? 18   GLU D OE2 1 
ATOM   9012  N  N   . ALA D  3  21  ? -48.350 16.625  -20.710  1.00 187.07 ? 19   ALA D N   1 
ATOM   9013  C  CA  . ALA D  3  21  ? -48.497 15.348  -21.397  1.00 193.47 ? 19   ALA D CA  1 
ATOM   9014  C  C   . ALA D  3  21  ? -47.817 14.231  -20.622  1.00 188.97 ? 19   ALA D C   1 
ATOM   9015  O  O   . ALA D  3  21  ? -48.224 13.068  -20.726  1.00 189.47 ? 19   ALA D O   1 
ATOM   9016  C  CB  . ALA D  3  21  ? -47.933 15.434  -22.817  1.00 198.87 ? 19   ALA D CB  1 
ATOM   9017  N  N   . ILE D  3  22  ? -46.768 14.562  -19.865  1.00 184.09 ? 20   ILE D N   1 
ATOM   9018  C  CA  . ILE D  3  22  ? -46.168 13.592  -18.958  1.00 178.04 ? 20   ILE D CA  1 
ATOM   9019  C  C   . ILE D  3  22  ? -47.120 13.301  -17.805  1.00 167.62 ? 20   ILE D C   1 
ATOM   9020  O  O   . ILE D  3  22  ? -47.262 12.151  -17.370  1.00 167.92 ? 20   ILE D O   1 
ATOM   9021  C  CB  . ILE D  3  22  ? -44.806 14.103  -18.451  1.00 174.88 ? 20   ILE D CB  1 
ATOM   9022  C  CG1 . ILE D  3  22  ? -43.768 14.109  -19.572  1.00 163.05 ? 20   ILE D CG1 1 
ATOM   9023  C  CG2 . ILE D  3  22  ? -44.297 13.234  -17.317  1.00 187.57 ? 20   ILE D CG2 1 
ATOM   9024  C  CD1 . ILE D  3  22  ? -43.417 12.743  -20.063  1.00 159.98 ? 20   ILE D CD1 1 
ATOM   9025  N  N   . ARG D  3  23  ? -47.787 14.340  -17.296  1.00 159.97 ? 21   ARG D N   1 
ATOM   9026  C  CA  . ARG D  3  23  ? -48.725 14.175  -16.190  1.00 161.22 ? 21   ARG D CA  1 
ATOM   9027  C  C   . ARG D  3  23  ? -49.799 13.144  -16.517  1.00 159.59 ? 21   ARG D C   1 
ATOM   9028  O  O   . ARG D  3  23  ? -50.012 12.192  -15.760  1.00 158.67 ? 21   ARG D O   1 
ATOM   9029  C  CB  . ARG D  3  23  ? -49.353 15.527  -15.853  1.00 166.26 ? 21   ARG D CB  1 
ATOM   9030  C  CG  . ARG D  3  23  ? -50.493 15.460  -14.864  1.00 170.79 ? 21   ARG D CG  1 
ATOM   9031  C  CD  . ARG D  3  23  ? -51.145 16.817  -14.702  1.00 177.26 ? 21   ARG D CD  1 
ATOM   9032  N  NE  . ARG D  3  23  ? -50.236 17.799  -14.119  1.00 183.04 ? 21   ARG D NE  1 
ATOM   9033  C  CZ  . ARG D  3  23  ? -50.154 18.061  -12.818  1.00 190.55 ? 21   ARG D CZ  1 
ATOM   9034  N  NH1 . ARG D  3  23  ? -50.925 17.411  -11.957  1.00 190.79 ? 21   ARG D NH1 1 
ATOM   9035  N  NH2 . ARG D  3  23  ? -49.300 18.972  -12.377  1.00 198.72 ? 21   ARG D NH2 1 
ATOM   9036  N  N   . GLY D  3  24  ? -50.463 13.293  -17.664  1.00 165.83 ? 22   GLY D N   1 
ATOM   9037  C  CA  . GLY D  3  24  ? -51.476 12.323  -18.035  1.00 179.60 ? 22   GLY D CA  1 
ATOM   9038  C  C   . GLY D  3  24  ? -50.914 10.981  -18.450  1.00 187.53 ? 22   GLY D C   1 
ATOM   9039  O  O   . GLY D  3  24  ? -51.640 9.981   -18.423  1.00 196.20 ? 22   GLY D O   1 
ATOM   9040  N  N   . GLN D  3  25  ? -49.628 10.936  -18.809  1.00 190.20 ? 23   GLN D N   1 
ATOM   9041  C  CA  . GLN D  3  25  ? -48.995 9.696   -19.247  1.00 185.08 ? 23   GLN D CA  1 
ATOM   9042  C  C   . GLN D  3  25  ? -48.689 8.785   -18.065  1.00 164.36 ? 23   GLN D C   1 
ATOM   9043  O  O   . GLN D  3  25  ? -49.053 7.604   -18.073  1.00 160.57 ? 23   GLN D O   1 
ATOM   9044  C  CB  . GLN D  3  25  ? -47.711 10.004  -20.020  1.00 191.59 ? 23   GLN D CB  1 
ATOM   9045  C  CG  . GLN D  3  25  ? -47.053 8.792   -20.663  1.00 193.62 ? 23   GLN D CG  1 
ATOM   9046  C  CD  . GLN D  3  25  ? -45.662 9.104   -21.186  1.00 196.95 ? 23   GLN D CD  1 
ATOM   9047  O  OE1 . GLN D  3  25  ? -45.025 10.057  -20.742  1.00 202.70 ? 23   GLN D OE1 1 
ATOM   9048  N  NE2 . GLN D  3  25  ? -45.187 8.305   -22.136  1.00 197.02 ? 23   GLN D NE2 1 
ATOM   9049  N  N   . ILE D  3  26  ? -47.991 9.311   -17.056  1.00 160.96 ? 24   ILE D N   1 
ATOM   9050  C  CA  . ILE D  3  26  ? -47.644 8.507   -15.888  1.00 160.44 ? 24   ILE D CA  1 
ATOM   9051  C  C   . ILE D  3  26  ? -48.899 7.916   -15.260  1.00 172.84 ? 24   ILE D C   1 
ATOM   9052  O  O   . ILE D  3  26  ? -48.934 6.732   -14.905  1.00 192.56 ? 24   ILE D O   1 
ATOM   9053  C  CB  . ILE D  3  26  ? -46.854 9.352   -14.874  1.00 161.89 ? 24   ILE D CB  1 
ATOM   9054  C  CG1 . ILE D  3  26  ? -45.607 9.940   -15.529  1.00 161.71 ? 24   ILE D CG1 1 
ATOM   9055  C  CG2 . ILE D  3  26  ? -46.463 8.504   -13.670  1.00 162.47 ? 24   ILE D CG2 1 
ATOM   9056  C  CD1 . ILE D  3  26  ? -44.789 10.809  -14.596  1.00 165.16 ? 24   ILE D CD1 1 
ATOM   9057  N  N   . LEU D  3  27  ? -49.954 8.727   -15.128  1.00 166.95 ? 25   LEU D N   1 
ATOM   9058  C  CA  . LEU D  3  27  ? -51.190 8.248   -14.518  1.00 174.28 ? 25   LEU D CA  1 
ATOM   9059  C  C   . LEU D  3  27  ? -51.853 7.161   -15.352  1.00 183.90 ? 25   LEU D C   1 
ATOM   9060  O  O   . LEU D  3  27  ? -52.504 6.269   -14.797  1.00 200.79 ? 25   LEU D O   1 
ATOM   9061  C  CB  . LEU D  3  27  ? -52.154 9.411   -14.305  1.00 185.44 ? 25   LEU D CB  1 
ATOM   9062  C  CG  . LEU D  3  27  ? -51.654 10.466  -13.323  1.00 181.33 ? 25   LEU D CG  1 
ATOM   9063  C  CD1 . LEU D  3  27  ? -52.688 11.565  -13.151  1.00 196.00 ? 25   LEU D CD1 1 
ATOM   9064  C  CD2 . LEU D  3  27  ? -51.321 9.812   -11.997  1.00 171.87 ? 25   LEU D CD2 1 
ATOM   9065  N  N   . SER D  3  28  ? -51.717 7.220   -16.676  1.00 176.19 ? 26   SER D N   1 
ATOM   9066  C  CA  . SER D  3  28  ? -52.328 6.203   -17.521  1.00 178.51 ? 26   SER D CA  1 
ATOM   9067  C  C   . SER D  3  28  ? -51.525 4.906   -17.529  1.00 167.34 ? 26   SER D C   1 
ATOM   9068  O  O   . SER D  3  28  ? -52.111 3.818   -17.598  1.00 172.07 ? 26   SER D O   1 
ATOM   9069  C  CB  . SER D  3  28  ? -52.495 6.737   -18.943  1.00 202.41 ? 26   SER D CB  1 
ATOM   9070  O  OG  . SER D  3  28  ? -51.237 7.018   -19.533  1.00 205.10 ? 26   SER D OG  1 
ATOM   9071  N  N   . LYS D  3  29  ? -50.196 4.991   -17.442  1.00 171.34 ? 27   LYS D N   1 
ATOM   9072  C  CA  . LYS D  3  29  ? -49.396 3.774   -17.422  1.00 171.10 ? 27   LYS D CA  1 
ATOM   9073  C  C   . LYS D  3  29  ? -49.577 3.020   -16.116  1.00 171.42 ? 27   LYS D C   1 
ATOM   9074  O  O   . LYS D  3  29  ? -49.513 1.786   -16.097  1.00 183.58 ? 27   LYS D O   1 
ATOM   9075  C  CB  . LYS D  3  29  ? -47.923 4.110   -17.639  1.00 177.16 ? 27   LYS D CB  1 
ATOM   9076  C  CG  . LYS D  3  29  ? -47.617 4.635   -19.021  1.00 180.54 ? 27   LYS D CG  1 
ATOM   9077  C  CD  . LYS D  3  29  ? -46.145 4.940   -19.168  1.00 175.08 ? 27   LYS D CD  1 
ATOM   9078  C  CE  . LYS D  3  29  ? -45.815 5.286   -20.600  1.00 183.92 ? 27   LYS D CE  1 
ATOM   9079  N  NZ  . LYS D  3  29  ? -44.363 5.500   -20.803  1.00 193.85 ? 27   LYS D NZ  1 
ATOM   9080  N  N   . LEU D  3  30  ? -49.829 3.735   -15.029  1.00 171.59 ? 28   LEU D N   1 
ATOM   9081  C  CA  . LEU D  3  30  ? -50.120 3.120   -13.747  1.00 179.72 ? 28   LEU D CA  1 
ATOM   9082  C  C   . LEU D  3  30  ? -51.588 2.753   -13.619  1.00 183.78 ? 28   LEU D C   1 
ATOM   9083  O  O   . LEU D  3  30  ? -51.994 2.224   -12.577  1.00 178.87 ? 28   LEU D O   1 
ATOM   9084  C  CB  . LEU D  3  30  ? -49.719 4.067   -12.608  1.00 188.09 ? 28   LEU D CB  1 
ATOM   9085  C  CG  . LEU D  3  30  ? -48.249 4.487   -12.531  1.00 188.78 ? 28   LEU D CG  1 
ATOM   9086  C  CD1 . LEU D  3  30  ? -48.025 5.523   -11.439  1.00 191.95 ? 28   LEU D CD1 1 
ATOM   9087  C  CD2 . LEU D  3  30  ? -47.358 3.288   -12.307  1.00 190.44 ? 28   LEU D CD2 1 
ATOM   9088  N  N   . ARG D  3  31  ? -52.383 3.031   -14.657  1.00 185.59 ? 29   ARG D N   1 
ATOM   9089  C  CA  . ARG D  3  31  ? -53.827 2.794   -14.661  1.00 195.58 ? 29   ARG D CA  1 
ATOM   9090  C  C   . ARG D  3  31  ? -54.505 3.508   -13.492  1.00 200.29 ? 29   ARG D C   1 
ATOM   9091  O  O   . ARG D  3  31  ? -55.383 2.959   -12.821  1.00 199.74 ? 29   ARG D O   1 
ATOM   9092  C  CB  . ARG D  3  31  ? -54.141 1.296   -14.656  1.00 187.96 ? 29   ARG D CB  1 
ATOM   9093  C  CG  . ARG D  3  31  ? -55.514 0.941   -15.205  1.00 186.22 ? 29   ARG D CG  1 
ATOM   9094  C  CD  . ARG D  3  31  ? -55.803 -0.531  -14.992  1.00 191.30 ? 29   ARG D CD  1 
ATOM   9095  N  NE  . ARG D  3  31  ? -54.919 -1.374  -15.785  1.00 187.37 ? 29   ARG D NE  1 
ATOM   9096  C  CZ  . ARG D  3  31  ? -55.269 -1.945  -16.930  1.00 189.10 ? 29   ARG D CZ  1 
ATOM   9097  N  NH1 . ARG D  3  31  ? -56.493 -1.771  -17.408  1.00 196.46 ? 29   ARG D NH1 1 
ATOM   9098  N  NH2 . ARG D  3  31  ? -54.400 -2.697  -17.588  1.00 190.66 ? 29   ARG D NH2 1 
ATOM   9099  N  N   . LEU D  3  32  ? -54.092 4.746   -13.243  1.00 199.28 ? 30   LEU D N   1 
ATOM   9100  C  CA  . LEU D  3  32  ? -54.610 5.548   -12.147  1.00 183.28 ? 30   LEU D CA  1 
ATOM   9101  C  C   . LEU D  3  32  ? -55.304 6.787   -12.694  1.00 200.14 ? 30   LEU D C   1 
ATOM   9102  O  O   . LEU D  3  32  ? -54.909 7.335   -13.728  1.00 210.58 ? 30   LEU D O   1 
ATOM   9103  C  CB  . LEU D  3  32  ? -53.485 5.963   -11.197  1.00 187.83 ? 30   LEU D CB  1 
ATOM   9104  C  CG  . LEU D  3  32  ? -52.862 4.842   -10.362  1.00 206.49 ? 30   LEU D CG  1 
ATOM   9105  C  CD1 . LEU D  3  32  ? -51.748 5.379   -9.474   1.00 193.67 ? 30   LEU D CD1 1 
ATOM   9106  C  CD2 . LEU D  3  32  ? -53.922 4.137   -9.530   1.00 224.97 ? 30   LEU D CD2 1 
ATOM   9107  N  N   . ALA D  3  33  ? -56.358 7.218   -12.002  1.00 214.13 ? 31   ALA D N   1 
ATOM   9108  C  CA  . ALA D  3  33  ? -57.049 8.457   -12.338  1.00 215.91 ? 31   ALA D CA  1 
ATOM   9109  C  C   . ALA D  3  33  ? -56.576 9.643   -11.515  1.00 199.57 ? 31   ALA D C   1 
ATOM   9110  O  O   . ALA D  3  33  ? -56.553 10.770  -12.022  1.00 197.18 ? 31   ALA D O   1 
ATOM   9111  C  CB  . ALA D  3  33  ? -58.563 8.290   -12.158  1.00 221.00 ? 31   ALA D CB  1 
ATOM   9112  N  N   . SER D  3  34  ? -56.191 9.414   -10.263  1.00 195.37 ? 32   SER D N   1 
ATOM   9113  C  CA  . SER D  3  34  ? -55.722 10.463  -9.374   1.00 205.37 ? 32   SER D CA  1 
ATOM   9114  C  C   . SER D  3  34  ? -54.633 9.885   -8.485   1.00 201.86 ? 32   SER D C   1 
ATOM   9115  O  O   . SER D  3  34  ? -54.631 8.676   -8.220   1.00 195.09 ? 32   SER D O   1 
ATOM   9116  C  CB  . SER D  3  34  ? -56.869 11.030  -8.523   1.00 238.20 ? 32   SER D CB  1 
ATOM   9117  O  OG  . SER D  3  34  ? -57.461 10.024  -7.720   1.00 256.17 ? 32   SER D OG  1 
ATOM   9118  N  N   . PRO D  3  35  ? -53.694 10.708  -8.025   1.00 206.04 ? 33   PRO D N   1 
ATOM   9119  C  CA  . PRO D  3  35  ? -52.618 10.216  -7.145   1.00 214.30 ? 33   PRO D CA  1 
ATOM   9120  C  C   . PRO D  3  35  ? -53.174 9.595   -5.875   1.00 229.92 ? 33   PRO D C   1 
ATOM   9121  O  O   . PRO D  3  35  ? -54.180 10.073  -5.330   1.00 234.80 ? 33   PRO D O   1 
ATOM   9122  C  CB  . PRO D  3  35  ? -51.813 11.487  -6.836   1.00 206.36 ? 33   PRO D CB  1 
ATOM   9123  C  CG  . PRO D  3  35  ? -52.062 12.376  -8.009   1.00 201.06 ? 33   PRO D CG  1 
ATOM   9124  C  CD  . PRO D  3  35  ? -53.483 12.111  -8.423   1.00 204.07 ? 33   PRO D CD  1 
ATOM   9125  N  N   . PRO D  3  36  ? -52.553 8.522   -5.383   1.00 236.25 ? 34   PRO D N   1 
ATOM   9126  C  CA  . PRO D  3  36  ? -53.064 7.842   -4.186   1.00 232.06 ? 34   PRO D CA  1 
ATOM   9127  C  C   . PRO D  3  36  ? -52.838 8.666   -2.926   1.00 215.99 ? 34   PRO D C   1 
ATOM   9128  O  O   . PRO D  3  36  ? -52.197 9.719   -2.931   1.00 215.80 ? 34   PRO D O   1 
ATOM   9129  C  CB  . PRO D  3  36  ? -52.262 6.538   -4.148   1.00 230.58 ? 34   PRO D CB  1 
ATOM   9130  C  CG  . PRO D  3  36  ? -50.981 6.876   -4.832   1.00 230.23 ? 34   PRO D CG  1 
ATOM   9131  C  CD  . PRO D  3  36  ? -51.327 7.887   -5.899   1.00 232.07 ? 34   PRO D CD  1 
ATOM   9132  N  N   . SER D  3  37  ? -53.372 8.153   -1.822   1.00 208.20 ? 35   SER D N   1 
ATOM   9133  C  CA  . SER D  3  37  ? -53.286 8.841   -0.545   1.00 210.94 ? 35   SER D CA  1 
ATOM   9134  C  C   . SER D  3  37  ? -51.970 8.514   0.142    1.00 211.22 ? 35   SER D C   1 
ATOM   9135  O  O   . SER D  3  37  ? -51.527 7.363   0.161    1.00 209.38 ? 35   SER D O   1 
ATOM   9136  C  CB  . SER D  3  37  ? -54.453 8.456   0.366    1.00 217.21 ? 35   SER D CB  1 
ATOM   9137  O  OG  . SER D  3  37  ? -54.373 7.090   0.735    1.00 214.71 ? 35   SER D OG  1 
ATOM   9138  N  N   . GLN D  3  38  ? -51.367 9.540   0.731    1.00 231.00 ? 36   GLN D N   1 
ATOM   9139  C  CA  . GLN D  3  38  ? -50.066 9.428   1.375    1.00 247.11 ? 36   GLN D CA  1 
ATOM   9140  C  C   . GLN D  3  38  ? -50.172 9.725   2.871    1.00 250.50 ? 36   GLN D C   1 
ATOM   9141  O  O   . GLN D  3  38  ? -49.157 9.919   3.546    1.00 244.38 ? 36   GLN D O   1 
ATOM   9142  C  CB  . GLN D  3  38  ? -49.071 10.361  0.674    1.00 259.80 ? 36   GLN D CB  1 
ATOM   9143  C  CG  . GLN D  3  38  ? -47.589 10.081  0.911    1.00 264.90 ? 36   GLN D CG  1 
ATOM   9144  C  CD  . GLN D  3  38  ? -46.695 11.125  0.257    1.00 266.33 ? 36   GLN D CD  1 
ATOM   9145  O  OE1 . GLN D  3  38  ? -47.183 12.083  -0.343   1.00 268.65 ? 36   GLN D OE1 1 
ATOM   9146  N  NE2 . GLN D  3  38  ? -45.383 10.940  0.364    1.00 265.46 ? 36   GLN D NE2 1 
ATOM   9147  N  N   . GLY D  3  39  ? -51.392 9.743   3.402    1.00 241.77 ? 37   GLY D N   1 
ATOM   9148  C  CA  . GLY D  3  39  ? -51.623 9.921   4.817    1.00 243.59 ? 37   GLY D CA  1 
ATOM   9149  C  C   . GLY D  3  39  ? -51.766 8.563   5.458    1.00 243.84 ? 37   GLY D C   1 
ATOM   9150  O  O   . GLY D  3  39  ? -51.864 8.441   6.685    1.00 240.14 ? 37   GLY D O   1 
ATOM   9151  N  N   . GLU D  3  40  ? -51.797 7.533   4.615    1.00 249.09 ? 38   GLU D N   1 
ATOM   9152  C  CA  . GLU D  3  40  ? -51.771 6.138   5.030    1.00 241.28 ? 38   GLU D CA  1 
ATOM   9153  C  C   . GLU D  3  40  ? -50.376 5.551   4.801    1.00 240.53 ? 38   GLU D C   1 
ATOM   9154  O  O   . GLU D  3  40  ? -50.164 4.347   4.987    1.00 235.73 ? 38   GLU D O   1 
ATOM   9155  C  CB  . GLU D  3  40  ? -52.890 5.345   4.296    1.00 222.13 ? 38   GLU D CB  1 
ATOM   9156  C  CG  . GLU D  3  40  ? -54.431 5.824   4.634    1.00 206.38 ? 38   GLU D CG  1 
ATOM   9157  C  CD  . GLU D  3  40  ? -55.670 5.308   3.691    1.00 197.68 ? 38   GLU D CD  1 
ATOM   9158  O  OE1 . GLU D  3  40  ? -55.591 5.207   2.378    1.00 189.20 ? 38   GLU D OE1 1 
ATOM   9159  O  OE2 . GLU D  3  40  ? -56.758 5.070   4.342    1.00 201.16 ? 38   GLU D OE2 1 
ATOM   9160  N  N   . VAL D  3  41  ? -49.403 6.406   4.494    1.00 240.41 ? 39   VAL D N   1 
ATOM   9161  C  CA  . VAL D  3  41  ? -48.017 6.033   4.212    1.00 236.01 ? 39   VAL D CA  1 
ATOM   9162  C  C   . VAL D  3  41  ? -47.192 6.672   5.324    1.00 247.06 ? 39   VAL D C   1 
ATOM   9163  O  O   . VAL D  3  41  ? -47.458 7.826   5.691    1.00 247.19 ? 39   VAL D O   1 
ATOM   9164  C  CB  . VAL D  3  41  ? -47.574 6.525   2.821    1.00 235.00 ? 39   VAL D CB  1 
ATOM   9165  C  CG1 . VAL D  3  41  ? -46.121 6.155   2.513    1.00 248.86 ? 39   VAL D CG1 1 
ATOM   9166  C  CG2 . VAL D  3  41  ? -48.509 6.013   1.743    1.00 226.66 ? 39   VAL D CG2 1 
ATOM   9167  N  N   . PRO D  3  42  ? -46.194 5.998   5.888    1.00 262.74 ? 40   PRO D N   1 
ATOM   9168  C  CA  . PRO D  3  42  ? -45.434 6.617   6.973    1.00 280.63 ? 40   PRO D CA  1 
ATOM   9169  C  C   . PRO D  3  42  ? -44.266 7.413   6.423    1.00 282.90 ? 40   PRO D C   1 
ATOM   9170  O  O   . PRO D  3  42  ? -43.433 6.878   5.674    1.00 262.24 ? 40   PRO D O   1 
ATOM   9171  C  CB  . PRO D  3  42  ? -44.954 5.418   7.804    1.00 276.73 ? 40   PRO D CB  1 
ATOM   9172  C  CG  . PRO D  3  42  ? -45.009 4.225   6.865    1.00 259.68 ? 40   PRO D CG  1 
ATOM   9173  C  CD  . PRO D  3  42  ? -45.736 4.623   5.608    1.00 252.53 ? 40   PRO D CD  1 
ATOM   9174  N  N   . PRO D  3  43  ? -44.170 8.699   6.774    1.00 289.41 ? 41   PRO D N   1 
ATOM   9175  C  CA  . PRO D  3  43  ? -43.050 9.516   6.288    1.00 286.12 ? 41   PRO D CA  1 
ATOM   9176  C  C   . PRO D  3  43  ? -41.771 9.197   7.049    1.00 294.83 ? 41   PRO D C   1 
ATOM   9177  O  O   . PRO D  3  43  ? -41.758 9.170   8.282    1.00 291.69 ? 41   PRO D O   1 
ATOM   9178  C  CB  . PRO D  3  43  ? -43.515 10.955  6.556    1.00 283.44 ? 41   PRO D CB  1 
ATOM   9179  C  CG  . PRO D  3  43  ? -44.450 10.829  7.707    1.00 277.39 ? 41   PRO D CG  1 
ATOM   9180  C  CD  . PRO D  3  43  ? -45.145 9.496   7.542    1.00 276.89 ? 41   PRO D CD  1 
ATOM   9181  N  N   . GLY D  3  44  ? -40.695 8.956   6.305    1.00 247.32 ? 42   GLY D N   1 
ATOM   9182  C  CA  . GLY D  3  44  ? -39.395 8.778   6.904    1.00 255.87 ? 42   GLY D CA  1 
ATOM   9183  C  C   . GLY D  3  44  ? -38.707 7.474   6.550    1.00 240.29 ? 42   GLY D C   1 
ATOM   9184  O  O   . GLY D  3  44  ? -37.663 7.465   5.893    1.00 231.28 ? 42   GLY D O   1 
ATOM   9185  N  N   . PRO D  3  45  ? -39.287 6.343   6.961    1.00 233.29 ? 43   PRO D N   1 
ATOM   9186  C  CA  . PRO D  3  45  ? -38.618 5.049   6.752    1.00 235.12 ? 43   PRO D CA  1 
ATOM   9187  C  C   . PRO D  3  45  ? -38.578 4.683   5.277    1.00 245.45 ? 43   PRO D C   1 
ATOM   9188  O  O   . PRO D  3  45  ? -39.613 4.597   4.614    1.00 254.04 ? 43   PRO D O   1 
ATOM   9189  C  CB  . PRO D  3  45  ? -39.480 4.067   7.551    1.00 232.76 ? 43   PRO D CB  1 
ATOM   9190  C  CG  . PRO D  3  45  ? -40.814 4.717   7.638    1.00 225.58 ? 43   PRO D CG  1 
ATOM   9191  C  CD  . PRO D  3  45  ? -40.560 6.189   7.688    1.00 231.03 ? 43   PRO D CD  1 
ATOM   9192  N  N   . LEU D  3  46  ? -37.369 4.475   4.765    1.00 247.39 ? 44   LEU D N   1 
ATOM   9193  C  CA  . LEU D  3  46  ? -37.166 3.995   3.398    1.00 237.71 ? 44   LEU D CA  1 
ATOM   9194  C  C   . LEU D  3  46  ? -36.159 2.855   3.427    1.00 230.63 ? 44   LEU D C   1 
ATOM   9195  O  O   . LEU D  3  46  ? -34.951 3.096   3.596    1.00 244.56 ? 44   LEU D O   1 
ATOM   9196  C  CB  . LEU D  3  46  ? -36.708 5.101   2.458    1.00 234.53 ? 44   LEU D CB  1 
ATOM   9197  C  CG  . LEU D  3  46  ? -37.771 6.178   2.244    1.00 221.25 ? 44   LEU D CG  1 
ATOM   9198  C  CD1 . LEU D  3  46  ? -37.143 7.494   1.777    1.00 212.61 ? 44   LEU D CD1 1 
ATOM   9199  C  CD2 . LEU D  3  46  ? -38.887 5.691   1.311    1.00 198.11 ? 44   LEU D CD2 1 
ATOM   9200  N  N   . PRO D  3  47  ? -36.620 1.611   3.295    1.00 207.95 ? 45   PRO D N   1 
ATOM   9201  C  CA  . PRO D  3  47  ? -35.721 0.460   3.448    1.00 212.75 ? 45   PRO D CA  1 
ATOM   9202  C  C   . PRO D  3  47  ? -34.632 0.439   2.387    1.00 216.99 ? 45   PRO D C   1 
ATOM   9203  O  O   . PRO D  3  47  ? -34.849 0.828   1.237    1.00 229.79 ? 45   PRO D O   1 
ATOM   9204  C  CB  . PRO D  3  47  ? -36.661 -0.743  3.294    1.00 203.71 ? 45   PRO D CB  1 
ATOM   9205  C  CG  . PRO D  3  47  ? -37.800 -0.215  2.471    1.00 185.85 ? 45   PRO D CG  1 
ATOM   9206  C  CD  . PRO D  3  47  ? -37.984 1.206   2.915    1.00 179.91 ? 45   PRO D CD  1 
ATOM   9207  N  N   . GLU D  3  48  ? -33.442 -0.013  2.787    1.00 204.23 ? 46   GLU D N   1 
ATOM   9208  C  CA  . GLU D  3  48  ? -32.366 -0.195  1.825    1.00 195.10 ? 46   GLU D CA  1 
ATOM   9209  C  C   . GLU D  3  48  ? -32.577 -1.428  0.962    1.00 186.62 ? 46   GLU D C   1 
ATOM   9210  O  O   . GLU D  3  48  ? -31.759 -1.693  0.074    1.00 188.58 ? 46   GLU D O   1 
ATOM   9211  C  CB  . GLU D  3  48  ? -31.007 -0.282  2.541    1.00 186.11 ? 46   GLU D CB  1 
ATOM   9212  C  CG  . GLU D  3  48  ? -30.537 1.011   3.196    1.00 182.85 ? 46   GLU D CG  1 
ATOM   9213  C  CD  . GLU D  3  48  ? -29.079 0.949   3.601    1.00 182.50 ? 46   GLU D CD  1 
ATOM   9214  O  OE1 . GLU D  3  48  ? -28.515 -0.165  3.630    1.00 175.96 ? 46   GLU D OE1 1 
ATOM   9215  O  OE2 . GLU D  3  48  ? -28.496 2.017   3.882    1.00 190.23 ? 46   GLU D OE2 1 
ATOM   9216  N  N   . ALA D  3  49  ? -33.656 -2.181  1.202    1.00 176.07 ? 47   ALA D N   1 
ATOM   9217  C  CA  . ALA D  3  49  ? -34.004 -3.313  0.352    1.00 182.09 ? 47   ALA D CA  1 
ATOM   9218  C  C   . ALA D  3  49  ? -34.639 -2.838  -0.949   1.00 179.12 ? 47   ALA D C   1 
ATOM   9219  O  O   . ALA D  3  49  ? -34.416 -3.435  -2.009   1.00 185.38 ? 47   ALA D O   1 
ATOM   9220  C  CB  . ALA D  3  49  ? -34.938 -4.274  1.091    1.00 171.26 ? 47   ALA D CB  1 
ATOM   9221  N  N   . VAL D  3  50  ? -35.445 -1.775  -0.883   1.00 170.01 ? 48   VAL D N   1 
ATOM   9222  C  CA  . VAL D  3  50  ? -36.006 -1.203  -2.099   1.00 170.59 ? 48   VAL D CA  1 
ATOM   9223  C  C   . VAL D  3  50  ? -35.017 -0.259  -2.763   1.00 174.33 ? 48   VAL D C   1 
ATOM   9224  O  O   . VAL D  3  50  ? -35.160 0.045   -3.953   1.00 180.93 ? 48   VAL D O   1 
ATOM   9225  C  CB  . VAL D  3  50  ? -37.327 -0.475  -1.808   1.00 165.23 ? 48   VAL D CB  1 
ATOM   9226  C  CG1 . VAL D  3  50  ? -38.299 -1.407  -1.098   1.00 162.43 ? 48   VAL D CG1 1 
ATOM   9227  C  CG2 . VAL D  3  50  ? -37.082 0.772   -0.990   1.00 169.83 ? 48   VAL D CG2 1 
ATOM   9228  N  N   . LEU D  3  51  ? -34.015 0.213   -2.018   1.00 172.53 ? 49   LEU D N   1 
ATOM   9229  C  CA  . LEU D  3  51  ? -32.958 1.005   -2.628   1.00 172.42 ? 49   LEU D CA  1 
ATOM   9230  C  C   . LEU D  3  51  ? -32.024 0.129   -3.449   1.00 183.24 ? 49   LEU D C   1 
ATOM   9231  O  O   . LEU D  3  51  ? -31.439 0.601   -4.428   1.00 201.89 ? 49   LEU D O   1 
ATOM   9232  C  CB  . LEU D  3  51  ? -32.181 1.764   -1.551   1.00 174.23 ? 49   LEU D CB  1 
ATOM   9233  C  CG  . LEU D  3  51  ? -32.908 2.925   -0.862   1.00 183.72 ? 49   LEU D CG  1 
ATOM   9234  C  CD1 . LEU D  3  51  ? -31.974 3.653   0.095    1.00 208.41 ? 49   LEU D CD1 1 
ATOM   9235  C  CD2 . LEU D  3  51  ? -33.488 3.894   -1.877   1.00 181.98 ? 49   LEU D CD2 1 
ATOM   9236  N  N   . ALA D  3  52  ? -31.874 -1.143  -3.071   1.00 178.26 ? 50   ALA D N   1 
ATOM   9237  C  CA  . ALA D  3  52  ? -31.093 -2.067  -3.887   1.00 169.21 ? 50   ALA D CA  1 
ATOM   9238  C  C   . ALA D  3  52  ? -31.831 -2.448  -5.163   1.00 166.62 ? 50   ALA D C   1 
ATOM   9239  O  O   . ALA D  3  52  ? -31.194 -2.711  -6.189   1.00 168.00 ? 50   ALA D O   1 
ATOM   9240  C  CB  . ALA D  3  52  ? -30.736 -3.316  -3.080   1.00 167.83 ? 50   ALA D CB  1 
ATOM   9241  N  N   . LEU D  3  53  ? -33.166 -2.495  -5.115   1.00 154.56 ? 51   LEU D N   1 
ATOM   9242  C  CA  . LEU D  3  53  ? -33.953 -2.716  -6.325   1.00 154.96 ? 51   LEU D CA  1 
ATOM   9243  C  C   . LEU D  3  53  ? -33.806 -1.546  -7.285   1.00 156.74 ? 51   LEU D C   1 
ATOM   9244  O  O   . LEU D  3  53  ? -33.574 -1.734  -8.485   1.00 168.83 ? 51   LEU D O   1 
ATOM   9245  C  CB  . LEU D  3  53  ? -35.425 -2.920  -5.965   1.00 154.25 ? 51   LEU D CB  1 
ATOM   9246  C  CG  . LEU D  3  53  ? -35.940 -4.348  -5.823   1.00 153.75 ? 51   LEU D CG  1 
ATOM   9247  C  CD1 . LEU D  3  53  ? -37.321 -4.340  -5.192   1.00 166.15 ? 51   LEU D CD1 1 
ATOM   9248  C  CD2 . LEU D  3  53  ? -35.984 -5.003  -7.189   1.00 153.56 ? 51   LEU D CD2 1 
ATOM   9249  N  N   . TYR D  3  54  ? -33.950 -0.326  -6.769   1.00 155.40 ? 52   TYR D N   1 
ATOM   9250  C  CA  . TYR D  3  54  ? -33.854 0.860   -7.605   1.00 166.90 ? 52   TYR D CA  1 
ATOM   9251  C  C   . TYR D  3  54  ? -32.442 1.041   -8.155   1.00 189.67 ? 52   TYR D C   1 
ATOM   9252  O  O   . TYR D  3  54  ? -32.272 1.536   -9.275   1.00 209.35 ? 52   TYR D O   1 
ATOM   9253  C  CB  . TYR D  3  54  ? -34.299 2.077   -6.792   1.00 164.07 ? 52   TYR D CB  1 
ATOM   9254  C  CG  . TYR D  3  54  ? -34.420 3.370   -7.564   1.00 169.08 ? 52   TYR D CG  1 
ATOM   9255  C  CD1 . TYR D  3  54  ? -35.481 3.587   -8.436   1.00 166.25 ? 52   TYR D CD1 1 
ATOM   9256  C  CD2 . TYR D  3  54  ? -33.482 4.382   -7.409   1.00 176.30 ? 52   TYR D CD2 1 
ATOM   9257  C  CE1 . TYR D  3  54  ? -35.597 4.772   -9.136   1.00 172.58 ? 52   TYR D CE1 1 
ATOM   9258  C  CE2 . TYR D  3  54  ? -33.592 5.569   -8.105   1.00 181.73 ? 52   TYR D CE2 1 
ATOM   9259  C  CZ  . TYR D  3  54  ? -34.651 5.758   -8.967   1.00 181.84 ? 52   TYR D CZ  1 
ATOM   9260  O  OH  . TYR D  3  54  ? -34.768 6.939   -9.665   1.00 191.16 ? 52   TYR D OH  1 
ATOM   9261  N  N   . ASN D  3  55  ? -31.421 0.630   -7.394   1.00 190.00 ? 53   ASN D N   1 
ATOM   9262  C  CA  . ASN D  3  55  ? -30.039 0.765   -7.854   1.00 191.82 ? 53   ASN D CA  1 
ATOM   9263  C  C   . ASN D  3  55  ? -29.680 -0.269  -8.909   1.00 182.39 ? 53   ASN D C   1 
ATOM   9264  O  O   . ASN D  3  55  ? -28.806 -0.017  -9.745   1.00 170.21 ? 53   ASN D O   1 
ATOM   9265  C  CB  . ASN D  3  55  ? -29.078 0.629   -6.677   1.00 210.31 ? 53   ASN D CB  1 
ATOM   9266  C  CG  . ASN D  3  55  ? -29.073 1.840   -5.780   1.00 220.38 ? 53   ASN D CG  1 
ATOM   9267  O  OD1 . ASN D  3  55  ? -29.817 2.800   -6.000   1.00 194.67 ? 53   ASN D OD1 1 
ATOM   9268  N  ND2 . ASN D  3  55  ? -28.251 1.795   -4.744   1.00 278.20 ? 53   ASN D ND2 1 
ATOM   9269  N  N   . SER D  3  56  ? -30.350 -1.417  -8.911   1.00 181.28 ? 54   SER D N   1 
ATOM   9270  C  CA  . SER D  3  56  ? -30.030 -2.462  -9.870   1.00 172.81 ? 54   SER D CA  1 
ATOM   9271  C  C   . SER D  3  56  ? -30.713 -2.256  -11.212  1.00 186.61 ? 54   SER D C   1 
ATOM   9272  O  O   . SER D  3  56  ? -30.245 -2.801  -12.217  1.00 197.90 ? 54   SER D O   1 
ATOM   9273  C  CB  . SER D  3  56  ? -30.403 -3.830  -9.292   1.00 171.00 ? 54   SER D CB  1 
ATOM   9274  O  OG  . SER D  3  56  ? -31.767 -3.855  -8.914   1.00 192.32 ? 54   SER D OG  1 
ATOM   9275  N  N   . THR D  3  57  ? -31.783 -1.461  -11.261  1.00 182.71 ? 55   THR D N   1 
ATOM   9276  C  CA  . THR D  3  57  ? -32.446 -1.211  -12.534  1.00 181.71 ? 55   THR D CA  1 
ATOM   9277  C  C   . THR D  3  57  ? -31.708 -0.149  -13.333  1.00 183.78 ? 55   THR D C   1 
ATOM   9278  O  O   . THR D  3  57  ? -31.642 -0.225  -14.565  1.00 203.14 ? 55   THR D O   1 
ATOM   9279  C  CB  . THR D  3  57  ? -33.894 -0.776  -12.295  1.00 166.33 ? 55   THR D CB  1 
ATOM   9280  O  OG1 . THR D  3  57  ? -33.913 0.341   -11.395  1.00 166.05 ? 55   THR D OG1 1 
ATOM   9281  C  CG2 . THR D  3  57  ? -34.711 -1.915  -11.703  1.00 157.01 ? 55   THR D CG2 1 
ATOM   9282  N  N   . ARG D  3  58  ? -31.156 0.845   -12.643  1.00 158.54 ? 56   ARG D N   1 
ATOM   9283  C  CA  . ARG D  3  58  ? -30.343 1.889   -13.247  1.00 167.46 ? 56   ARG D CA  1 
ATOM   9284  C  C   . ARG D  3  58  ? -28.910 1.447   -13.509  1.00 168.49 ? 56   ARG D C   1 
ATOM   9285  O  O   . ARG D  3  58  ? -28.170 2.162   -14.194  1.00 177.40 ? 56   ARG D O   1 
ATOM   9286  C  CB  . ARG D  3  58  ? -30.366 3.129   -12.351  1.00 170.93 ? 56   ARG D CB  1 
ATOM   9287  C  CG  . ARG D  3  58  ? -31.762 3.715   -12.201  1.00 170.80 ? 56   ARG D CG  1 
ATOM   9288  C  CD  . ARG D  3  58  ? -31.724 5.153   -11.743  1.00 178.80 ? 56   ARG D CD  1 
ATOM   9289  N  NE  . ARG D  3  58  ? -31.131 5.264   -10.418  1.00 183.02 ? 56   ARG D NE  1 
ATOM   9290  C  CZ  . ARG D  3  58  ? -29.907 5.729   -10.190  1.00 190.17 ? 56   ARG D CZ  1 
ATOM   9291  N  NH1 . ARG D  3  58  ? -29.150 6.128   -11.203  1.00 193.60 ? 56   ARG D NH1 1 
ATOM   9292  N  NH2 . ARG D  3  58  ? -29.442 5.791   -8.951   1.00 199.83 ? 56   ARG D NH2 1 
ATOM   9293  N  N   . ASP D  3  59  ? -28.505 0.291   -12.987  1.00 179.83 ? 57   ASP D N   1 
ATOM   9294  C  CA  . ASP D  3  59  ? -27.109 -0.126  -13.033  1.00 185.01 ? 57   ASP D CA  1 
ATOM   9295  C  C   . ASP D  3  59  ? -26.683 -0.666  -14.398  1.00 186.40 ? 57   ASP D C   1 
ATOM   9296  O  O   . ASP D  3  59  ? -25.526 -0.478  -14.797  1.00 184.25 ? 57   ASP D O   1 
ATOM   9297  C  CB  . ASP D  3  59  ? -26.892 -1.186  -11.952  1.00 199.70 ? 57   ASP D CB  1 
ATOM   9298  C  CG  . ASP D  3  59  ? -25.433 -1.399  -11.613  1.00 227.59 ? 57   ASP D CG  1 
ATOM   9299  O  OD1 . ASP D  3  59  ? -24.550 -0.956  -12.375  1.00 249.65 ? 57   ASP D OD1 1 
ATOM   9300  O  OD2 . ASP D  3  59  ? -25.170 -2.015  -10.559  1.00 227.25 ? 57   ASP D OD2 1 
ATOM   9301  N  N   . ARG D  3  60  ? -27.583 -1.323  -15.131  1.00 201.63 ? 58   ARG D N   1 
ATOM   9302  C  CA  . ARG D  3  60  ? -27.203 -2.085  -16.319  1.00 210.98 ? 58   ARG D CA  1 
ATOM   9303  C  C   . ARG D  3  60  ? -26.593 -1.234  -17.431  1.00 223.22 ? 58   ARG D C   1 
ATOM   9304  O  O   . ARG D  3  60  ? -27.310 -0.694  -18.282  1.00 232.61 ? 58   ARG D O   1 
ATOM   9305  C  CB  . ARG D  3  60  ? -28.417 -2.849  -16.859  1.00 229.19 ? 58   ARG D CB  1 
ATOM   9306  C  CG  . ARG D  3  60  ? -29.694 -2.021  -16.984  1.00 231.27 ? 58   ARG D CG  1 
ATOM   9307  C  CD  . ARG D  3  60  ? -30.728 -2.723  -17.854  1.00 222.01 ? 58   ARG D CD  1 
ATOM   9308  N  NE  . ARG D  3  60  ? -31.946 -1.929  -17.995  1.00 211.07 ? 58   ARG D NE  1 
ATOM   9309  C  CZ  . ARG D  3  60  ? -33.105 -2.404  -18.439  1.00 200.64 ? 58   ARG D CZ  1 
ATOM   9310  N  NH1 . ARG D  3  60  ? -33.216 -3.680  -18.783  1.00 202.51 ? 58   ARG D NH1 1 
ATOM   9311  N  NH2 . ARG D  3  60  ? -34.158 -1.603  -18.531  1.00 187.97 ? 58   ARG D NH2 1 
ATOM   9312  N  N   . VAL D  3  61  ? -25.266 -1.110  -17.441  1.00 218.27 ? 59   VAL D N   1 
ATOM   9313  C  CA  . VAL D  3  61  ? -24.584 -0.602  -18.625  1.00 237.16 ? 59   VAL D CA  1 
ATOM   9314  C  C   . VAL D  3  61  ? -24.150 -1.751  -19.531  1.00 236.55 ? 59   VAL D C   1 
ATOM   9315  O  O   . VAL D  3  61  ? -23.906 -1.534  -20.728  1.00 244.50 ? 59   VAL D O   1 
ATOM   9316  C  CB  . VAL D  3  61  ? -23.381 0.283   -18.239  1.00 240.64 ? 59   VAL D CB  1 
ATOM   9317  C  CG1 . VAL D  3  61  ? -22.820 1.018   -19.460  1.00 243.54 ? 59   VAL D CG1 1 
ATOM   9318  C  CG2 . VAL D  3  61  ? -23.780 1.283   -17.167  1.00 229.93 ? 59   VAL D CG2 1 
ATOM   9319  N  N   . ALA D  3  62  ? -24.083 -2.971  -19.005  1.00 210.20 ? 60   ALA D N   1 
ATOM   9320  C  CA  . ALA D  3  62  ? -23.678 -4.137  -19.772  1.00 202.65 ? 60   ALA D CA  1 
ATOM   9321  C  C   . ALA D  3  62  ? -24.805 -5.158  -19.816  1.00 196.42 ? 60   ALA D C   1 
ATOM   9322  O  O   . ALA D  3  62  ? -25.628 -5.242  -18.899  1.00 192.05 ? 60   ALA D O   1 
ATOM   9323  C  CB  . ALA D  3  62  ? -22.423 -4.779  -19.184  1.00 202.07 ? 60   ALA D CB  1 
ATOM   9324  N  N   . GLY D  3  63  ? -24.832 -5.927  -20.902  1.00 184.59 ? 61   GLY D N   1 
ATOM   9325  C  CA  . GLY D  3  63  ? -25.849 -6.939  -21.097  1.00 182.05 ? 61   GLY D CA  1 
ATOM   9326  C  C   . GLY D  3  63  ? -26.725 -6.689  -22.306  1.00 192.17 ? 61   GLY D C   1 
ATOM   9327  O  O   . GLY D  3  63  ? -26.937 -5.539  -22.703  1.00 202.91 ? 61   GLY D O   1 
ATOM   9328  N  N   . GLU D  3  64  ? -27.242 -7.760  -22.897  1.00 188.42 ? 62   GLU D N   1 
ATOM   9329  C  CA  . GLU D  3  64  ? -28.126 -7.650  -24.047  1.00 185.97 ? 62   GLU D CA  1 
ATOM   9330  C  C   . GLU D  3  64  ? -29.331 -8.568  -23.889  1.00 181.16 ? 62   GLU D C   1 
ATOM   9331  O  O   . GLU D  3  64  ? -29.236 -9.625  -23.265  1.00 180.44 ? 62   GLU D O   1 
ATOM   9332  C  CB  . GLU D  3  64  ? -27.376 -7.981  -25.336  1.00 205.07 ? 62   GLU D CB  1 
ATOM   9333  C  CG  . GLU D  3  64  ? -26.295 -6.979  -25.704  1.00 222.81 ? 62   GLU D CG  1 
ATOM   9334  C  CD  . GLU D  3  64  ? -25.555 -7.366  -26.971  1.00 237.91 ? 62   GLU D CD  1 
ATOM   9335  O  OE1 . GLU D  3  64  ? -25.736 -8.510  -27.437  1.00 241.37 ? 62   GLU D OE1 1 
ATOM   9336  O  OE2 . GLU D  3  64  ? -24.796 -6.527  -27.501  1.00 240.07 ? 62   GLU D OE2 1 
ATOM   9337  N  N   . PRO D  3  72  ? -47.523 -4.243  -29.175  1.00 214.35 ? 70   PRO D N   1 
ATOM   9338  C  CA  . PRO D  3  72  ? -47.715 -4.796  -27.830  1.00 214.18 ? 70   PRO D CA  1 
ATOM   9339  C  C   . PRO D  3  72  ? -48.534 -3.874  -26.927  1.00 232.59 ? 70   PRO D C   1 
ATOM   9340  O  O   . PRO D  3  72  ? -48.016 -2.879  -26.414  1.00 224.60 ? 70   PRO D O   1 
ATOM   9341  C  CB  . PRO D  3  72  ? -46.284 -4.949  -27.309  1.00 198.07 ? 70   PRO D CB  1 
ATOM   9342  C  CG  . PRO D  3  72  ? -45.461 -5.121  -28.534  1.00 197.54 ? 70   PRO D CG  1 
ATOM   9343  C  CD  . PRO D  3  72  ? -46.107 -4.257  -29.580  1.00 208.82 ? 70   PRO D CD  1 
ATOM   9344  N  N   . GLU D  3  73  ? -49.812 -4.224  -26.744  1.00 249.65 ? 71   GLU D N   1 
ATOM   9345  C  CA  . GLU D  3  73  ? -50.723 -3.397  -25.956  1.00 246.67 ? 71   GLU D CA  1 
ATOM   9346  C  C   . GLU D  3  73  ? -50.371 -3.408  -24.474  1.00 234.93 ? 71   GLU D C   1 
ATOM   9347  O  O   . GLU D  3  73  ? -50.558 -2.398  -23.786  1.00 234.69 ? 71   GLU D O   1 
ATOM   9348  C  CB  . GLU D  3  73  ? -52.168 -3.869  -26.153  1.00 246.27 ? 71   GLU D CB  1 
ATOM   9349  C  CG  . GLU D  3  73  ? -52.366 -5.379  -25.989  1.00 235.35 ? 71   GLU D CG  1 
ATOM   9350  C  CD  . GLU D  3  73  ? -53.815 -5.773  -25.741  1.00 220.69 ? 71   GLU D CD  1 
ATOM   9351  O  OE1 . GLU D  3  73  ? -54.673 -4.871  -25.639  1.00 220.06 ? 71   GLU D OE1 1 
ATOM   9352  O  OE2 . GLU D  3  73  ? -54.093 -6.988  -25.641  1.00 216.75 ? 71   GLU D OE2 1 
ATOM   9353  N  N   . ALA D  3  74  ? -49.874 -4.536  -23.962  1.00 227.61 ? 72   ALA D N   1 
ATOM   9354  C  CA  . ALA D  3  74  ? -49.543 -4.669  -22.549  1.00 225.37 ? 72   ALA D CA  1 
ATOM   9355  C  C   . ALA D  3  74  ? -48.170 -4.112  -22.209  1.00 230.96 ? 72   ALA D C   1 
ATOM   9356  O  O   . ALA D  3  74  ? -47.859 -3.953  -21.023  1.00 230.52 ? 72   ALA D O   1 
ATOM   9357  C  CB  . ALA D  3  74  ? -49.625 -6.138  -22.123  1.00 216.10 ? 72   ALA D CB  1 
ATOM   9358  N  N   . ASP D  3  75  ? -47.354 -3.804  -23.213  1.00 235.40 ? 73   ASP D N   1 
ATOM   9359  C  CA  . ASP D  3  75  ? -45.990 -3.348  -23.001  1.00 237.05 ? 73   ASP D CA  1 
ATOM   9360  C  C   . ASP D  3  75  ? -45.901 -1.848  -22.754  1.00 228.08 ? 73   ASP D C   1 
ATOM   9361  O  O   . ASP D  3  75  ? -44.824 -1.353  -22.401  1.00 219.16 ? 73   ASP D O   1 
ATOM   9362  C  CB  . ASP D  3  75  ? -45.129 -3.733  -24.209  1.00 247.57 ? 73   ASP D CB  1 
ATOM   9363  C  CG  . ASP D  3  75  ? -43.652 -3.581  -23.943  1.00 251.45 ? 73   ASP D CG  1 
ATOM   9364  O  OD1 . ASP D  3  75  ? -43.238 -3.772  -22.779  1.00 247.27 ? 73   ASP D OD1 1 
ATOM   9365  O  OD2 . ASP D  3  75  ? -42.906 -3.276  -24.898  1.00 253.29 ? 73   ASP D OD2 1 
ATOM   9366  N  N   . TYR D  3  76  ? -47.005 -1.122  -22.897  1.00 231.41 ? 74   TYR D N   1 
ATOM   9367  C  CA  . TYR D  3  76  ? -47.009 0.313   -22.666  1.00 228.12 ? 74   TYR D CA  1 
ATOM   9368  C  C   . TYR D  3  76  ? -47.292 0.657   -21.214  1.00 205.63 ? 74   TYR D C   1 
ATOM   9369  O  O   . TYR D  3  76  ? -46.883 1.727   -20.750  1.00 204.72 ? 74   TYR D O   1 
ATOM   9370  C  CB  . TYR D  3  76  ? -48.046 0.983   -23.581  1.00 232.34 ? 74   TYR D CB  1 
ATOM   9371  C  CG  . TYR D  3  76  ? -48.530 2.352   -23.138  1.00 224.85 ? 74   TYR D CG  1 
ATOM   9372  C  CD1 . TYR D  3  76  ? -47.798 3.499   -23.424  1.00 215.22 ? 74   TYR D CD1 1 
ATOM   9373  C  CD2 . TYR D  3  76  ? -49.734 2.498   -22.454  1.00 219.89 ? 74   TYR D CD2 1 
ATOM   9374  C  CE1 . TYR D  3  76  ? -48.245 4.748   -23.032  1.00 208.12 ? 74   TYR D CE1 1 
ATOM   9375  C  CE2 . TYR D  3  76  ? -50.187 3.743   -22.057  1.00 215.54 ? 74   TYR D CE2 1 
ATOM   9376  C  CZ  . TYR D  3  76  ? -49.438 4.863   -22.348  1.00 206.49 ? 74   TYR D CZ  1 
ATOM   9377  O  OH  . TYR D  3  76  ? -49.885 6.103   -21.957  1.00 196.85 ? 74   TYR D OH  1 
ATOM   9378  N  N   . TYR D  3  77  ? -47.959 -0.230  -20.483  1.00 184.54 ? 75   TYR D N   1 
ATOM   9379  C  CA  . TYR D  3  77  ? -48.268 0.007   -19.085  1.00 185.77 ? 75   TYR D CA  1 
ATOM   9380  C  C   . TYR D  3  77  ? -47.037 -0.259  -18.216  1.00 175.28 ? 75   TYR D C   1 
ATOM   9381  O  O   . TYR D  3  77  ? -45.978 -0.680  -18.691  1.00 173.61 ? 75   TYR D O   1 
ATOM   9382  C  CB  . TYR D  3  77  ? -49.459 -0.848  -18.659  1.00 204.48 ? 75   TYR D CB  1 
ATOM   9383  C  CG  . TYR D  3  77  ? -50.773 -0.439  -19.300  1.00 208.77 ? 75   TYR D CG  1 
ATOM   9384  C  CD1 . TYR D  3  77  ? -51.595 0.519   -18.711  1.00 206.09 ? 75   TYR D CD1 1 
ATOM   9385  C  CD2 . TYR D  3  77  ? -51.185 -1.005  -20.500  1.00 206.38 ? 75   TYR D CD2 1 
ATOM   9386  C  CE1 . TYR D  3  77  ? -52.796 0.890   -19.299  1.00 214.36 ? 75   TYR D CE1 1 
ATOM   9387  C  CE2 . TYR D  3  77  ? -52.380 -0.639  -21.095  1.00 210.60 ? 75   TYR D CE2 1 
ATOM   9388  C  CZ  . TYR D  3  77  ? -53.181 0.308   -20.494  1.00 216.65 ? 75   TYR D CZ  1 
ATOM   9389  O  OH  . TYR D  3  77  ? -54.368 0.667   -21.094  1.00 212.74 ? 75   TYR D OH  1 
ATOM   9390  N  N   . ALA D  3  78  ? -47.181 0.008   -16.920  1.00 166.22 ? 76   ALA D N   1 
ATOM   9391  C  CA  . ALA D  3  78  ? -46.080 -0.115  -15.978  1.00 172.74 ? 76   ALA D CA  1 
ATOM   9392  C  C   . ALA D  3  78  ? -45.889 -1.560  -15.532  1.00 178.74 ? 76   ALA D C   1 
ATOM   9393  O  O   . ALA D  3  78  ? -46.828 -2.361  -15.517  1.00 183.13 ? 76   ALA D O   1 
ATOM   9394  C  CB  . ALA D  3  78  ? -46.323 0.770   -14.758  1.00 175.92 ? 76   ALA D CB  1 
ATOM   9395  N  N   . LYS D  3  79  ? -44.658 -1.874  -15.127  1.00 168.87 ? 77   LYS D N   1 
ATOM   9396  C  CA  . LYS D  3  79  ? -44.287 -3.208  -14.673  1.00 155.43 ? 77   LYS D CA  1 
ATOM   9397  C  C   . LYS D  3  79  ? -43.678 -3.109  -13.285  1.00 151.59 ? 77   LYS D C   1 
ATOM   9398  O  O   . LYS D  3  79  ? -42.726 -2.352  -13.076  1.00 148.84 ? 77   LYS D O   1 
ATOM   9399  C  CB  . LYS D  3  79  ? -43.293 -3.867  -15.634  1.00 153.00 ? 77   LYS D CB  1 
ATOM   9400  C  CG  . LYS D  3  79  ? -43.698 -3.782  -17.096  1.00 159.13 ? 77   LYS D CG  1 
ATOM   9401  C  CD  . LYS D  3  79  ? -44.984 -4.552  -17.354  1.00 168.06 ? 77   LYS D CD  1 
ATOM   9402  C  CE  . LYS D  3  79  ? -45.393 -4.495  -18.818  1.00 164.04 ? 77   LYS D CE  1 
ATOM   9403  N  NZ  . LYS D  3  79  ? -46.671 -5.224  -19.064  1.00 163.03 ? 77   LYS D NZ  1 
ATOM   9404  N  N   . GLU D  3  80  ? -44.215 -3.887  -12.347  1.00 166.61 ? 78   GLU D N   1 
ATOM   9405  C  CA  . GLU D  3  80  ? -43.726 -3.884  -10.975  1.00 171.23 ? 78   GLU D CA  1 
ATOM   9406  C  C   . GLU D  3  80  ? -42.421 -4.667  -10.900  1.00 163.57 ? 78   GLU D C   1 
ATOM   9407  O  O   . GLU D  3  80  ? -42.398 -5.880  -11.139  1.00 163.61 ? 78   GLU D O   1 
ATOM   9408  C  CB  . GLU D  3  80  ? -44.771 -4.472  -10.027  1.00 171.24 ? 78   GLU D CB  1 
ATOM   9409  C  CG  . GLU D  3  80  ? -44.326 -4.507  -8.573   1.00 172.01 ? 78   GLU D CG  1 
ATOM   9410  C  CD  . GLU D  3  80  ? -45.415 -4.996  -7.642   1.00 174.08 ? 78   GLU D CD  1 
ATOM   9411  O  OE1 . GLU D  3  80  ? -46.585 -5.049  -8.077   1.00 171.75 ? 78   GLU D OE1 1 
ATOM   9412  O  OE2 . GLU D  3  80  ? -45.101 -5.329  -6.479   1.00 178.98 ? 78   GLU D OE2 1 
ATOM   9413  N  N   . VAL D  3  81  ? -41.340 -3.974  -10.565  1.00 165.74 ? 79   VAL D N   1 
ATOM   9414  C  CA  . VAL D  3  81  ? -40.008 -4.566  -10.541  1.00 164.13 ? 79   VAL D CA  1 
ATOM   9415  C  C   . VAL D  3  81  ? -39.725 -5.106  -9.146   1.00 176.20 ? 79   VAL D C   1 
ATOM   9416  O  O   . VAL D  3  81  ? -39.751 -4.361  -8.160   1.00 186.00 ? 79   VAL D O   1 
ATOM   9417  C  CB  . VAL D  3  81  ? -38.944 -3.543  -10.958  1.00 172.87 ? 79   VAL D CB  1 
ATOM   9418  C  CG1 . VAL D  3  81  ? -37.559 -4.158  -10.866  1.00 178.08 ? 79   VAL D CG1 1 
ATOM   9419  C  CG2 . VAL D  3  81  ? -39.220 -3.045  -12.363  1.00 184.60 ? 79   VAL D CG2 1 
ATOM   9420  N  N   . THR D  3  82  ? -39.451 -6.404  -9.067   1.00 172.93 ? 80   THR D N   1 
ATOM   9421  C  CA  . THR D  3  82  ? -39.039 -7.057  -7.836   1.00 171.21 ? 80   THR D CA  1 
ATOM   9422  C  C   . THR D  3  82  ? -37.859 -7.969  -8.140   1.00 169.84 ? 80   THR D C   1 
ATOM   9423  O  O   . THR D  3  82  ? -37.672 -8.404  -9.277   1.00 176.41 ? 80   THR D O   1 
ATOM   9424  C  CB  . THR D  3  82  ? -40.195 -7.850  -7.207   1.00 167.05 ? 80   THR D CB  1 
ATOM   9425  O  OG1 . THR D  3  82  ? -40.800 -8.688  -8.200   1.00 164.52 ? 80   THR D OG1 1 
ATOM   9426  C  CG2 . THR D  3  82  ? -41.245 -6.906  -6.631   1.00 177.31 ? 80   THR D CG2 1 
ATOM   9427  N  N   . ARG D  3  83  ? -37.045 -8.237  -7.125   1.00 163.43 ? 81   ARG D N   1 
ATOM   9428  C  CA  . ARG D  3  83  ? -35.885 -9.096  -7.291   1.00 162.84 ? 81   ARG D CA  1 
ATOM   9429  C  C   . ARG D  3  83  ? -35.880 -10.167 -6.211   1.00 172.98 ? 81   ARG D C   1 
ATOM   9430  O  O   . ARG D  3  83  ? -36.558 -10.048 -5.187   1.00 180.64 ? 81   ARG D O   1 
ATOM   9431  C  CB  . ARG D  3  83  ? -34.582 -8.290  -7.246   1.00 158.33 ? 81   ARG D CB  1 
ATOM   9432  C  CG  . ARG D  3  83  ? -34.121 -7.945  -5.842   1.00 157.75 ? 81   ARG D CG  1 
ATOM   9433  C  CD  . ARG D  3  83  ? -32.743 -7.298  -5.846   1.00 162.76 ? 81   ARG D CD  1 
ATOM   9434  N  NE  . ARG D  3  83  ? -32.192 -7.179  -4.498   1.00 167.07 ? 81   ARG D NE  1 
ATOM   9435  C  CZ  . ARG D  3  83  ? -30.987 -6.689  -4.224   1.00 168.59 ? 81   ARG D CZ  1 
ATOM   9436  N  NH1 . ARG D  3  83  ? -30.203 -6.264  -5.206   1.00 164.03 ? 81   ARG D NH1 1 
ATOM   9437  N  NH2 . ARG D  3  83  ? -30.566 -6.622  -2.970   1.00 173.60 ? 81   ARG D NH2 1 
ATOM   9438  N  N   . VAL D  3  84  ? -35.111 -11.227 -6.458   1.00 173.89 ? 82   VAL D N   1 
ATOM   9439  C  CA  . VAL D  3  84  ? -34.939 -12.324 -5.508   1.00 171.45 ? 82   VAL D CA  1 
ATOM   9440  C  C   . VAL D  3  84  ? -33.484 -12.770 -5.546   1.00 171.09 ? 82   VAL D C   1 
ATOM   9441  O  O   . VAL D  3  84  ? -32.938 -13.044 -6.620   1.00 169.27 ? 82   VAL D O   1 
ATOM   9442  C  CB  . VAL D  3  84  ? -35.874 -13.516 -5.800   1.00 173.67 ? 82   VAL D CB  1 
ATOM   9443  C  CG1 . VAL D  3  84  ? -37.260 -13.268 -5.224   1.00 168.69 ? 82   VAL D CG1 1 
ATOM   9444  C  CG2 . VAL D  3  84  ? -35.960 -13.768 -7.287   1.00 183.18 ? 82   VAL D CG2 1 
ATOM   9445  N  N   . LEU D  3  85  ? -32.853 -12.824 -4.377   1.00 167.69 ? 83   LEU D N   1 
ATOM   9446  C  CA  . LEU D  3  85  ? -31.484 -13.297 -4.269   1.00 163.02 ? 83   LEU D CA  1 
ATOM   9447  C  C   . LEU D  3  85  ? -31.447 -14.817 -4.400   1.00 165.28 ? 83   LEU D C   1 
ATOM   9448  O  O   . LEU D  3  85  ? -32.478 -15.496 -4.375   1.00 167.05 ? 83   LEU D O   1 
ATOM   9449  C  CB  . LEU D  3  85  ? -30.871 -12.854 -2.944   1.00 158.76 ? 83   LEU D CB  1 
ATOM   9450  C  CG  . LEU D  3  85  ? -30.797 -11.340 -2.749   1.00 154.62 ? 83   LEU D CG  1 
ATOM   9451  C  CD1 . LEU D  3  85  ? -30.333 -11.014 -1.344   1.00 170.05 ? 83   LEU D CD1 1 
ATOM   9452  C  CD2 . LEU D  3  85  ? -29.883 -10.699 -3.776   1.00 152.84 ? 83   LEU D CD2 1 
ATOM   9453  N  N   . MET D  3  86  ? -30.240 -15.358 -4.539   1.00 172.76 ? 84   MET D N   1 
ATOM   9454  C  CA  . MET D  3  86  ? -30.091 -16.788 -4.746   1.00 177.95 ? 84   MET D CA  1 
ATOM   9455  C  C   . MET D  3  86  ? -29.893 -17.513 -3.418   1.00 181.52 ? 84   MET D C   1 
ATOM   9456  O  O   . MET D  3  86  ? -29.831 -16.913 -2.342   1.00 175.65 ? 84   MET D O   1 
ATOM   9457  C  CB  . MET D  3  86  ? -28.935 -17.089 -5.700   1.00 187.79 ? 84   MET D CB  1 
ATOM   9458  C  CG  . MET D  3  86  ? -27.549 -16.765 -5.170   1.00 186.84 ? 84   MET D CG  1 
ATOM   9459  S  SD  . MET D  3  86  ? -26.254 -17.529 -6.174   1.00 184.19 ? 84   MET D SD  1 
ATOM   9460  C  CE  . MET D  3  86  ? -24.797 -17.041 -5.257   1.00 187.42 ? 84   MET D CE  1 
ATOM   9461  N  N   . VAL D  3  87  ? -29.816 -18.833 -3.504   1.00 197.55 ? 85   VAL D N   1 
ATOM   9462  C  CA  . VAL D  3  87  ? -29.545 -19.687 -2.358   1.00 197.99 ? 85   VAL D CA  1 
ATOM   9463  C  C   . VAL D  3  87  ? -28.040 -19.818 -2.196   1.00 203.82 ? 85   VAL D C   1 
ATOM   9464  O  O   . VAL D  3  87  ? -27.305 -20.000 -3.173   1.00 206.99 ? 85   VAL D O   1 
ATOM   9465  C  CB  . VAL D  3  87  ? -30.212 -21.062 -2.535   1.00 201.15 ? 85   VAL D CB  1 
ATOM   9466  C  CG1 . VAL D  3  87  ? -30.043 -21.897 -1.280   1.00 213.00 ? 85   VAL D CG1 1 
ATOM   9467  C  CG2 . VAL D  3  87  ? -31.682 -20.885 -2.877   1.00 198.89 ? 85   VAL D CG2 1 
ATOM   9468  N  N   . GLU D  3  88  ? -27.579 -19.732 -0.956   1.00 213.26 ? 86   GLU D N   1 
ATOM   9469  C  CA  . GLU D  3  88  ? -26.157 -19.815 -0.676   1.00 223.51 ? 86   GLU D CA  1 
ATOM   9470  C  C   . GLU D  3  88  ? -25.643 -21.239 -0.887   1.00 236.55 ? 86   GLU D C   1 
ATOM   9471  O  O   . GLU D  3  88  ? -26.403 -22.191 -1.084   1.00 244.63 ? 86   GLU D O   1 
ATOM   9472  C  CB  . GLU D  3  88  ? -25.883 -19.352 0.747    1.00 235.02 ? 86   GLU D CB  1 
ATOM   9473  C  CG  . GLU D  3  88  ? -26.627 -18.088 1.107    1.00 233.07 ? 86   GLU D CG  1 
ATOM   9474  C  CD  . GLU D  3  88  ? -26.746 -17.899 2.601    1.00 245.18 ? 86   GLU D CD  1 
ATOM   9475  O  OE1 . GLU D  3  88  ? -26.179 -18.719 3.352    1.00 245.38 ? 86   GLU D OE1 1 
ATOM   9476  O  OE2 . GLU D  3  88  ? -27.427 -16.942 3.024    1.00 250.79 ? 86   GLU D OE2 1 
ATOM   9477  N  N   . THR D  3  89  ? -24.321 -21.378 -0.832   1.00 232.74 ? 87   THR D N   1 
ATOM   9478  C  CA  . THR D  3  89  ? -23.665 -22.676 -0.915   1.00 229.54 ? 87   THR D CA  1 
ATOM   9479  C  C   . THR D  3  89  ? -23.663 -23.424 0.407    1.00 230.58 ? 87   THR D C   1 
ATOM   9480  O  O   . THR D  3  89  ? -23.050 -24.493 0.497    1.00 232.50 ? 87   THR D O   1 
ATOM   9481  C  CB  . THR D  3  89  ? -22.223 -22.507 -1.398   1.00 229.31 ? 87   THR D CB  1 
ATOM   9482  O  OG1 . THR D  3  89  ? -21.618 -21.397 -0.721   1.00 225.52 ? 87   THR D OG1 1 
ATOM   9483  C  CG2 . THR D  3  89  ? -22.180 -22.288 -2.899   1.00 230.94 ? 87   THR D CG2 1 
ATOM   9484  N  N   . HIS D  3  90  ? -24.332 -22.896 1.423    1.00 245.01 ? 88   HIS D N   1 
ATOM   9485  C  CA  . HIS D  3  90  ? -24.342 -23.479 2.756    1.00 264.35 ? 88   HIS D CA  1 
ATOM   9486  C  C   . HIS D  3  90  ? -25.411 -24.545 2.947    1.00 265.72 ? 88   HIS D C   1 
ATOM   9487  O  O   . HIS D  3  90  ? -25.493 -25.123 4.036    1.00 273.78 ? 88   HIS D O   1 
ATOM   9488  C  CB  . HIS D  3  90  ? -24.510 -22.380 3.811    1.00 265.21 ? 88   HIS D CB  1 
ATOM   9489  C  CG  . HIS D  3  90  ? -23.512 -21.272 3.687    1.00 264.19 ? 88   HIS D CG  1 
ATOM   9490  N  ND1 . HIS D  3  90  ? -23.534 -20.363 2.651    1.00 251.44 ? 88   HIS D ND1 1 
ATOM   9491  C  CD2 . HIS D  3  90  ? -22.465 -20.923 4.472    1.00 270.11 ? 88   HIS D CD2 1 
ATOM   9492  C  CE1 . HIS D  3  90  ? -22.542 -19.504 2.800    1.00 253.04 ? 88   HIS D CE1 1 
ATOM   9493  N  NE2 . HIS D  3  90  ? -21.879 -19.821 3.897    1.00 267.94 ? 88   HIS D NE2 1 
ATOM   9494  N  N   . ASN D  3  91  ? -26.219 -24.839 1.927    1.00 252.37 ? 89   ASN D N   1 
ATOM   9495  C  CA  . ASN D  3  91  ? -27.294 -25.806 2.117    1.00 253.85 ? 89   ASN D CA  1 
ATOM   9496  C  C   . ASN D  3  91  ? -27.411 -26.856 1.015    1.00 237.75 ? 89   ASN D C   1 
ATOM   9497  O  O   . ASN D  3  91  ? -27.415 -28.058 1.305    1.00 233.61 ? 89   ASN D O   1 
ATOM   9498  C  CB  . ASN D  3  91  ? -28.629 -25.067 2.242    1.00 252.48 ? 89   ASN D CB  1 
ATOM   9499  C  CG  . ASN D  3  91  ? -28.756 -24.309 3.549    1.00 256.15 ? 89   ASN D CG  1 
ATOM   9500  O  OD1 . ASN D  3  91  ? -28.198 -24.710 4.571    1.00 272.86 ? 89   ASN D OD1 1 
ATOM   9501  N  ND2 . ASN D  3  91  ? -29.495 -23.206 3.522    1.00 240.19 ? 89   ASN D ND2 1 
ATOM   9502  N  N   . GLU D  3  92  ? -27.499 -26.433 -0.246   1.00 223.89 ? 90   GLU D N   1 
ATOM   9503  C  CA  . GLU D  3  92  ? -27.708 -27.375 -1.334   1.00 227.31 ? 90   GLU D CA  1 
ATOM   9504  C  C   . GLU D  3  92  ? -26.656 -27.350 -2.426   1.00 230.44 ? 90   GLU D C   1 
ATOM   9505  O  O   . GLU D  3  92  ? -26.559 -28.326 -3.177   1.00 234.07 ? 90   GLU D O   1 
ATOM   9506  C  CB  . GLU D  3  92  ? -29.073 -27.124 -1.991   1.00 230.75 ? 90   GLU D CB  1 
ATOM   9507  C  CG  . GLU D  3  92  ? -30.236 -27.273 -1.050   1.00 246.87 ? 90   GLU D CG  1 
ATOM   9508  C  CD  . GLU D  3  92  ? -31.536 -26.885 -1.702   1.00 252.55 ? 90   GLU D CD  1 
ATOM   9509  O  OE1 . GLU D  3  92  ? -31.494 -26.390 -2.847   1.00 246.92 ? 90   GLU D OE1 1 
ATOM   9510  O  OE2 . GLU D  3  92  ? -32.598 -27.075 -1.072   1.00 258.41 ? 90   GLU D OE2 1 
ATOM   9511  N  N   . ILE D  3  93  ? -25.861 -26.284 -2.540   1.00 243.83 ? 91   ILE D N   1 
ATOM   9512  C  CA  . ILE D  3  93  ? -24.964 -26.164 -3.688   1.00 255.15 ? 91   ILE D CA  1 
ATOM   9513  C  C   . ILE D  3  93  ? -23.683 -26.960 -3.507   1.00 254.52 ? 91   ILE D C   1 
ATOM   9514  O  O   . ILE D  3  93  ? -22.916 -27.117 -4.465   1.00 256.79 ? 91   ILE D O   1 
ATOM   9515  C  CB  . ILE D  3  93  ? -24.676 -24.675 -3.960   1.00 249.26 ? 91   ILE D CB  1 
ATOM   9516  C  CG1 . ILE D  3  93  ? -25.977 -23.868 -3.931   1.00 237.83 ? 91   ILE D CG1 1 
ATOM   9517  C  CG2 . ILE D  3  93  ? -24.022 -24.477 -5.321   1.00 238.35 ? 91   ILE D CG2 1 
ATOM   9518  C  CD1 . ILE D  3  93  ? -25.843 -22.476 -4.483   1.00 221.16 ? 91   ILE D CD1 1 
ATOM   9519  N  N   . TYR D  3  94  ? -23.457 -27.530 -2.324   1.00 261.59 ? 92   TYR D N   1 
ATOM   9520  C  CA  . TYR D  3  94  ? -22.266 -28.327 -2.084   1.00 275.10 ? 92   TYR D CA  1 
ATOM   9521  C  C   . TYR D  3  94  ? -22.564 -29.817 -2.007   1.00 283.19 ? 92   TYR D C   1 
ATOM   9522  O  O   . TYR D  3  94  ? -21.624 -30.620 -1.980   1.00 293.55 ? 92   TYR D O   1 
ATOM   9523  C  CB  . TYR D  3  94  ? -21.562 -27.873 -0.790   1.00 283.92 ? 92   TYR D CB  1 
ATOM   9524  C  CG  . TYR D  3  94  ? -22.278 -28.245 0.495    1.00 290.75 ? 92   TYR D CG  1 
ATOM   9525  C  CD1 . TYR D  3  94  ? -23.342 -27.490 0.966    1.00 284.36 ? 92   TYR D CD1 1 
ATOM   9526  C  CD2 . TYR D  3  94  ? -21.858 -29.333 1.258    1.00 294.07 ? 92   TYR D CD2 1 
ATOM   9527  C  CE1 . TYR D  3  94  ? -23.992 -27.822 2.142    1.00 286.53 ? 92   TYR D CE1 1 
ATOM   9528  C  CE2 . TYR D  3  94  ? -22.500 -29.672 2.438    1.00 292.62 ? 92   TYR D CE2 1 
ATOM   9529  C  CZ  . TYR D  3  94  ? -23.566 -28.912 2.874    1.00 291.10 ? 92   TYR D CZ  1 
ATOM   9530  O  OH  . TYR D  3  94  ? -24.208 -29.244 4.046    1.00 294.24 ? 92   TYR D OH  1 
ATOM   9531  N  N   . ASP D  3  95  ? -23.841 -30.204 -1.977   1.00 288.01 ? 93   ASP D N   1 
ATOM   9532  C  CA  . ASP D  3  95  ? -24.215 -31.593 -1.745   1.00 303.66 ? 93   ASP D CA  1 
ATOM   9533  C  C   . ASP D  3  95  ? -23.965 -32.489 -2.955   1.00 301.73 ? 93   ASP D C   1 
ATOM   9534  O  O   . ASP D  3  95  ? -23.878 -33.711 -2.791   1.00 310.90 ? 93   ASP D O   1 
ATOM   9535  C  CB  . ASP D  3  95  ? -25.691 -31.658 -1.331   1.00 299.16 ? 93   ASP D CB  1 
ATOM   9536  C  CG  . ASP D  3  95  ? -26.090 -33.011 -0.756   1.00 295.25 ? 93   ASP D CG  1 
ATOM   9537  O  OD1 . ASP D  3  95  ? -25.199 -33.797 -0.366   1.00 297.20 ? 93   ASP D OD1 1 
ATOM   9538  O  OD2 . ASP D  3  95  ? -27.310 -33.280 -0.681   1.00 282.59 ? 93   ASP D OD2 1 
ATOM   9539  N  N   . LYS D  3  96  ? -23.829 -31.928 -4.156   1.00 286.16 ? 94   LYS D N   1 
ATOM   9540  C  CA  . LYS D  3  96  ? -23.669 -32.744 -5.356   1.00 295.43 ? 94   LYS D CA  1 
ATOM   9541  C  C   . LYS D  3  96  ? -22.388 -32.467 -6.125   1.00 296.58 ? 94   LYS D C   1 
ATOM   9542  O  O   . LYS D  3  96  ? -21.710 -33.410 -6.547   1.00 310.42 ? 94   LYS D O   1 
ATOM   9543  C  CB  . LYS D  3  96  ? -24.872 -32.537 -6.295   1.00 293.64 ? 94   LYS D CB  1 
ATOM   9544  C  CG  . LYS D  3  96  ? -24.796 -33.338 -7.589   1.00 299.26 ? 94   LYS D CG  1 
ATOM   9545  C  CD  . LYS D  3  96  ? -26.021 -33.118 -8.470   1.00 290.37 ? 94   LYS D CD  1 
ATOM   9546  C  CE  . LYS D  3  96  ? -25.839 -33.750 -9.846   1.00 284.49 ? 94   LYS D CE  1 
ATOM   9547  N  NZ  . LYS D  3  96  ? -25.527 -35.204 -9.750   1.00 292.58 ? 94   LYS D NZ  1 
ATOM   9548  N  N   . PHE D  3  97  ? -22.038 -31.214 -6.318   1.00 276.40 ? 95   PHE D N   1 
ATOM   9549  C  CA  . PHE D  3  97  ? -20.926 -30.858 -7.191   1.00 273.90 ? 95   PHE D CA  1 
ATOM   9550  C  C   . PHE D  3  97  ? -19.949 -29.882 -6.559   1.00 271.29 ? 95   PHE D C   1 
ATOM   9551  O  O   . PHE D  3  97  ? -18.747 -29.979 -6.826   1.00 274.39 ? 95   PHE D O   1 
ATOM   9552  C  CB  . PHE D  3  97  ? -21.468 -30.268 -8.499   1.00 269.79 ? 95   PHE D CB  1 
ATOM   9553  C  CG  . PHE D  3  97  ? -22.828 -29.646 -8.360   1.00 266.27 ? 95   PHE D CG  1 
ATOM   9554  C  CD1 . PHE D  3  97  ? -22.998 -28.464 -7.659   1.00 258.63 ? 95   PHE D CD1 1 
ATOM   9555  C  CD2 . PHE D  3  97  ? -23.936 -30.238 -8.944   1.00 262.67 ? 95   PHE D CD2 1 
ATOM   9556  C  CE1 . PHE D  3  97  ? -24.249 -27.892 -7.531   1.00 251.71 ? 95   PHE D CE1 1 
ATOM   9557  C  CE2 . PHE D  3  97  ? -25.189 -29.668 -8.821   1.00 249.07 ? 95   PHE D CE2 1 
ATOM   9558  C  CZ  . PHE D  3  97  ? -25.345 -28.495 -8.114   1.00 246.76 ? 95   PHE D CZ  1 
ATOM   9559  N  N   . LYS D  3  98  ? -20.440 -28.932 -5.759   1.00 259.84 ? 96   LYS D N   1 
ATOM   9560  C  CA  . LYS D  3  98  ? -19.639 -27.842 -5.212   1.00 254.85 ? 96   LYS D CA  1 
ATOM   9561  C  C   . LYS D  3  98  ? -19.168 -26.951 -6.352   1.00 249.58 ? 96   LYS D C   1 
ATOM   9562  O  O   . LYS D  3  98  ? -19.880 -26.783 -7.347   1.00 238.08 ? 96   LYS D O   1 
ATOM   9563  C  CB  . LYS D  3  98  ? -18.455 -28.359 -4.385   1.00 251.82 ? 96   LYS D CB  1 
ATOM   9564  C  CG  . LYS D  3  98  ? -18.861 -29.121 -3.136   1.00 244.08 ? 96   LYS D CG  1 
ATOM   9565  C  CD  . LYS D  3  98  ? -17.696 -29.294 -2.176   1.00 237.84 ? 96   LYS D CD  1 
ATOM   9566  C  CE  . LYS D  3  98  ? -16.683 -30.298 -2.704   1.00 238.45 ? 96   LYS D CE  1 
ATOM   9567  N  NZ  . LYS D  3  98  ? -17.220 -31.689 -2.744   1.00 240.41 ? 96   LYS D NZ  1 
ATOM   9568  N  N   . GLN D  3  99  ? -17.982 -26.369 -6.214   1.00 253.17 ? 97   GLN D N   1 
ATOM   9569  C  CA  . GLN D  3  99  ? -17.440 -25.441 -7.195   1.00 249.07 ? 97   GLN D CA  1 
ATOM   9570  C  C   . GLN D  3  99  ? -16.159 -26.018 -7.777   1.00 258.85 ? 97   GLN D C   1 
ATOM   9571  O  O   . GLN D  3  99  ? -15.349 -26.607 -7.055   1.00 264.69 ? 97   GLN D O   1 
ATOM   9572  C  CB  . GLN D  3  99  ? -17.183 -24.063 -6.562   1.00 244.09 ? 97   GLN D CB  1 
ATOM   9573  C  CG  . GLN D  3  99  ? -16.672 -22.991 -7.519   1.00 234.63 ? 97   GLN D CG  1 
ATOM   9574  C  CD  . GLN D  3  99  ? -15.159 -22.912 -7.560   1.00 238.90 ? 97   GLN D CD  1 
ATOM   9575  O  OE1 . GLN D  3  99  ? -14.550 -22.968 -8.627   1.00 246.51 ? 97   GLN D OE1 1 
ATOM   9576  N  NE2 . GLN D  3  99  ? -14.543 -22.785 -6.389   1.00 236.00 ? 97   GLN D NE2 1 
ATOM   9577  N  N   . SER D  3  100 ? -15.984 -25.854 -9.087   1.00 261.79 ? 98   SER D N   1 
ATOM   9578  C  CA  . SER D  3  100 ? -14.787 -26.339 -9.756   1.00 261.38 ? 98   SER D CA  1 
ATOM   9579  C  C   . SER D  3  100 ? -14.452 -25.424 -10.926  1.00 256.22 ? 98   SER D C   1 
ATOM   9580  O  O   . SER D  3  100 ? -15.259 -24.593 -11.351  1.00 250.81 ? 98   SER D O   1 
ATOM   9581  C  CB  . SER D  3  100 ? -14.961 -27.785 -10.237  1.00 257.68 ? 98   SER D CB  1 
ATOM   9582  O  OG  . SER D  3  100 ? -15.162 -28.665 -9.144   1.00 257.61 ? 98   SER D OG  1 
ATOM   9583  N  N   . THR D  3  101 ? -13.232 -25.588 -11.444  1.00 257.90 ? 99   THR D N   1 
ATOM   9584  C  CA  . THR D  3  101 ? -12.756 -24.785 -12.564  1.00 254.28 ? 99   THR D CA  1 
ATOM   9585  C  C   . THR D  3  101 ? -13.546 -25.041 -13.838  1.00 253.02 ? 99   THR D C   1 
ATOM   9586  O  O   . THR D  3  101 ? -13.365 -24.313 -14.821  1.00 258.04 ? 99   THR D O   1 
ATOM   9587  C  CB  . THR D  3  101 ? -11.273 -25.070 -12.812  1.00 267.27 ? 99   THR D CB  1 
ATOM   9588  O  OG1 . THR D  3  101 ? -11.112 -26.427 -13.248  1.00 281.08 ? 99   THR D OG1 1 
ATOM   9589  C  CG2 . THR D  3  101 ? -10.473 -24.865 -11.532  1.00 268.62 ? 99   THR D CG2 1 
ATOM   9590  N  N   . HIS D  3  102 ? -14.415 -26.048 -13.838  1.00 253.35 ? 100  HIS D N   1 
ATOM   9591  C  CA  . HIS D  3  102 ? -15.159 -26.440 -15.024  1.00 261.39 ? 100  HIS D CA  1 
ATOM   9592  C  C   . HIS D  3  102 ? -16.518 -25.759 -15.106  1.00 266.64 ? 100  HIS D C   1 
ATOM   9593  O  O   . HIS D  3  102 ? -17.003 -25.498 -16.214  1.00 266.04 ? 100  HIS D O   1 
ATOM   9594  C  CB  . HIS D  3  102 ? -15.329 -27.965 -15.036  1.00 261.53 ? 100  HIS D CB  1 
ATOM   9595  C  CG  . HIS D  3  102 ? -15.908 -28.510 -16.306  1.00 263.01 ? 100  HIS D CG  1 
ATOM   9596  N  ND1 . HIS D  3  102 ? -16.374 -29.802 -16.409  1.00 262.03 ? 100  HIS D ND1 1 
ATOM   9597  C  CD2 . HIS D  3  102 ? -16.083 -27.948 -17.526  1.00 261.72 ? 100  HIS D CD2 1 
ATOM   9598  C  CE1 . HIS D  3  102 ? -16.822 -30.010 -17.634  1.00 260.72 ? 100  HIS D CE1 1 
ATOM   9599  N  NE2 . HIS D  3  102 ? -16.657 -28.900 -18.332  1.00 260.44 ? 100  HIS D NE2 1 
ATOM   9600  N  N   . SER D  3  103 ? -17.133 -25.440 -13.967  1.00 268.99 ? 101  SER D N   1 
ATOM   9601  C  CA  . SER D  3  103 ? -18.460 -24.837 -13.971  1.00 260.08 ? 101  SER D CA  1 
ATOM   9602  C  C   . SER D  3  103 ? -18.689 -24.068 -12.675  1.00 253.67 ? 101  SER D C   1 
ATOM   9603  O  O   . SER D  3  103 ? -17.965 -24.234 -11.690  1.00 250.20 ? 101  SER D O   1 
ATOM   9604  C  CB  . SER D  3  103 ? -19.548 -25.898 -14.168  1.00 266.36 ? 101  SER D CB  1 
ATOM   9605  O  OG  . SER D  3  103 ? -19.401 -26.961 -13.242  1.00 277.11 ? 101  SER D OG  1 
ATOM   9606  N  N   . ILE D  3  104 ? -19.713 -23.216 -12.698  1.00 257.74 ? 102  ILE D N   1 
ATOM   9607  C  CA  . ILE D  3  104 ? -20.152 -22.446 -11.539  1.00 253.28 ? 102  ILE D CA  1 
ATOM   9608  C  C   . ILE D  3  104 ? -21.672 -22.547 -11.449  1.00 245.15 ? 102  ILE D C   1 
ATOM   9609  O  O   . ILE D  3  104 ? -22.370 -22.295 -12.437  1.00 249.40 ? 102  ILE D O   1 
ATOM   9610  C  CB  . ILE D  3  104 ? -19.701 -20.976 -11.638  1.00 243.60 ? 102  ILE D CB  1 
ATOM   9611  C  CG1 . ILE D  3  104 ? -18.217 -20.853 -11.277  1.00 256.45 ? 102  ILE D CG1 1 
ATOM   9612  C  CG2 . ILE D  3  104 ? -20.563 -20.090 -10.754  1.00 229.86 ? 102  ILE D CG2 1 
ATOM   9613  C  CD1 . ILE D  3  104 ? -17.673 -19.445 -11.353  1.00 258.59 ? 102  ILE D CD1 1 
ATOM   9614  N  N   . TYR D  3  105 ? -22.184 -22.900 -10.270  1.00 231.52 ? 103  TYR D N   1 
ATOM   9615  C  CA  . TYR D  3  105 ? -23.605 -23.168 -10.084  1.00 229.37 ? 103  TYR D CA  1 
ATOM   9616  C  C   . TYR D  3  105 ? -24.266 -22.119 -9.197   1.00 239.29 ? 103  TYR D C   1 
ATOM   9617  O  O   . TYR D  3  105 ? -23.722 -21.731 -8.158   1.00 246.11 ? 103  TYR D O   1 
ATOM   9618  C  CB  . TYR D  3  105 ? -23.819 -24.561 -9.486   1.00 234.13 ? 103  TYR D CB  1 
ATOM   9619  C  CG  . TYR D  3  105 ? -23.170 -25.670 -10.284  1.00 242.36 ? 103  TYR D CG  1 
ATOM   9620  C  CD1 . TYR D  3  105 ? -23.827 -26.251 -11.363  1.00 242.08 ? 103  TYR D CD1 1 
ATOM   9621  C  CD2 . TYR D  3  105 ? -21.897 -26.130 -9.966   1.00 257.79 ? 103  TYR D CD2 1 
ATOM   9622  C  CE1 . TYR D  3  105 ? -23.238 -27.265 -12.097  1.00 255.04 ? 103  TYR D CE1 1 
ATOM   9623  C  CE2 . TYR D  3  105 ? -21.299 -27.143 -10.695  1.00 272.11 ? 103  TYR D CE2 1 
ATOM   9624  C  CZ  . TYR D  3  105 ? -21.974 -27.707 -11.758  1.00 270.76 ? 103  TYR D CZ  1 
ATOM   9625  O  OH  . TYR D  3  105 ? -21.376 -28.715 -12.482  1.00 279.87 ? 103  TYR D OH  1 
ATOM   9626  N  N   . MET D  3  106 ? -25.449 -21.666 -9.620   1.00 248.95 ? 104  MET D N   1 
ATOM   9627  C  CA  . MET D  3  106 ? -26.271 -20.717 -8.880   1.00 234.94 ? 104  MET D CA  1 
ATOM   9628  C  C   . MET D  3  106 ? -27.666 -21.300 -8.712   1.00 227.03 ? 104  MET D C   1 
ATOM   9629  O  O   . MET D  3  106 ? -28.247 -21.815 -9.671   1.00 228.94 ? 104  MET D O   1 
ATOM   9630  C  CB  . MET D  3  106 ? -26.351 -19.380 -9.613   1.00 227.53 ? 104  MET D CB  1 
ATOM   9631  C  CG  . MET D  3  106 ? -24.999 -18.800 -9.970   1.00 235.65 ? 104  MET D CG  1 
ATOM   9632  S  SD  . MET D  3  106 ? -25.145 -17.476 -11.176  1.00 238.27 ? 104  MET D SD  1 
ATOM   9633  C  CE  . MET D  3  106 ? -25.746 -18.390 -12.595  1.00 246.49 ? 104  MET D CE  1 
ATOM   9634  N  N   . PHE D  3  107 ? -28.218 -21.188 -7.504   1.00 213.66 ? 105  PHE D N   1 
ATOM   9635  C  CA  . PHE D  3  107 ? -29.493 -21.816 -7.183   1.00 216.32 ? 105  PHE D CA  1 
ATOM   9636  C  C   . PHE D  3  107 ? -30.468 -20.811 -6.589   1.00 211.41 ? 105  PHE D C   1 
ATOM   9637  O  O   . PHE D  3  107 ? -30.082 -19.901 -5.850   1.00 218.65 ? 105  PHE D O   1 
ATOM   9638  C  CB  . PHE D  3  107 ? -29.315 -22.983 -6.204   1.00 224.13 ? 105  PHE D CB  1 
ATOM   9639  C  CG  . PHE D  3  107 ? -28.944 -24.274 -6.867   1.00 234.95 ? 105  PHE D CG  1 
ATOM   9640  C  CD1 . PHE D  3  107 ? -27.650 -24.498 -7.304   1.00 246.70 ? 105  PHE D CD1 1 
ATOM   9641  C  CD2 . PHE D  3  107 ? -29.892 -25.265 -7.053   1.00 230.89 ? 105  PHE D CD2 1 
ATOM   9642  C  CE1 . PHE D  3  107 ? -27.309 -25.690 -7.918   1.00 254.49 ? 105  PHE D CE1 1 
ATOM   9643  C  CE2 . PHE D  3  107 ? -29.558 -26.458 -7.664   1.00 243.66 ? 105  PHE D CE2 1 
ATOM   9644  C  CZ  . PHE D  3  107 ? -28.265 -26.672 -8.097   1.00 253.94 ? 105  PHE D CZ  1 
ATOM   9645  N  N   . PHE D  3  108 ? -31.748 -21.008 -6.903   1.00 197.83 ? 106  PHE D N   1 
ATOM   9646  C  CA  . PHE D  3  108 ? -32.835 -20.168 -6.425   1.00 188.84 ? 106  PHE D CA  1 
ATOM   9647  C  C   . PHE D  3  108 ? -33.966 -21.055 -5.921   1.00 194.25 ? 106  PHE D C   1 
ATOM   9648  O  O   . PHE D  3  108 ? -33.996 -22.265 -6.170   1.00 208.81 ? 106  PHE D O   1 
ATOM   9649  C  CB  . PHE D  3  108 ? -33.353 -19.238 -7.529   1.00 191.45 ? 106  PHE D CB  1 
ATOM   9650  C  CG  . PHE D  3  108 ? -32.344 -18.237 -8.003   1.00 199.07 ? 106  PHE D CG  1 
ATOM   9651  C  CD1 . PHE D  3  108 ? -31.390 -18.588 -8.943   1.00 204.71 ? 106  PHE D CD1 1 
ATOM   9652  C  CD2 . PHE D  3  108 ? -32.363 -16.937 -7.526   1.00 202.71 ? 106  PHE D CD2 1 
ATOM   9653  C  CE1 . PHE D  3  108 ? -30.463 -17.668 -9.388   1.00 208.67 ? 106  PHE D CE1 1 
ATOM   9654  C  CE2 . PHE D  3  108 ? -31.441 -16.009 -7.969   1.00 209.60 ? 106  PHE D CE2 1 
ATOM   9655  C  CZ  . PHE D  3  108 ? -30.488 -16.375 -8.900   1.00 215.76 ? 106  PHE D CZ  1 
ATOM   9656  N  N   . GLN D  3  109 ? -34.915 -20.441 -5.224   1.00 188.28 ? 107  GLN D N   1 
ATOM   9657  C  CA  . GLN D  3  109 ? -36.085 -21.150 -4.737   1.00 188.07 ? 107  GLN D CA  1 
ATOM   9658  C  C   . GLN D  3  109 ? -37.237 -20.988 -5.730   1.00 188.62 ? 107  GLN D C   1 
ATOM   9659  O  O   . GLN D  3  109 ? -37.026 -20.687 -6.907   1.00 194.73 ? 107  GLN D O   1 
ATOM   9660  C  CB  . GLN D  3  109 ? -36.485 -20.633 -3.348   1.00 199.18 ? 107  GLN D CB  1 
ATOM   9661  C  CG  . GLN D  3  109 ? -35.480 -20.867 -2.244   1.00 205.15 ? 107  GLN D CG  1 
ATOM   9662  C  CD  . GLN D  3  109 ? -35.970 -20.347 -0.898   1.00 197.09 ? 107  GLN D CD  1 
ATOM   9663  O  OE1 . GLN D  3  109 ? -36.979 -19.643 -0.814   1.00 187.45 ? 107  GLN D OE1 1 
ATOM   9664  N  NE2 . GLN D  3  109 ? -35.263 -20.710 0.164    1.00 201.87 ? 107  GLN D NE2 1 
ATOM   9665  N  N   . THR D  3  110 ? -38.461 -21.218 -5.258   1.00 183.76 ? 108  THR D N   1 
ATOM   9666  C  CA  . THR D  3  110 ? -39.690 -20.992 -6.018   1.00 184.46 ? 108  THR D CA  1 
ATOM   9667  C  C   . THR D  3  110 ? -40.819 -20.477 -5.150   1.00 181.74 ? 108  THR D C   1 
ATOM   9668  O  O   . THR D  3  110 ? -41.768 -19.887 -5.679   1.00 181.83 ? 108  THR D O   1 
ATOM   9669  C  CB  . THR D  3  110 ? -40.158 -22.274 -6.718   1.00 188.48 ? 108  THR D CB  1 
ATOM   9670  O  OG1 . THR D  3  110 ? -39.028 -22.964 -7.271   1.00 191.71 ? 108  THR D OG1 1 
ATOM   9671  C  CG2 . THR D  3  110 ? -41.142 -21.945 -7.838   1.00 190.19 ? 108  THR D CG2 1 
ATOM   9672  N  N   . SER D  3  111 ? -40.749 -20.679 -3.836   1.00 193.81 ? 109  SER D N   1 
ATOM   9673  C  CA  . SER D  3  111 ? -41.745 -20.159 -2.917   1.00 207.47 ? 109  SER D CA  1 
ATOM   9674  C  C   . SER D  3  111 ? -41.727 -18.640 -2.853   1.00 213.67 ? 109  SER D C   1 
ATOM   9675  O  O   . SER D  3  111 ? -42.739 -18.041 -2.473   1.00 229.40 ? 109  SER D O   1 
ATOM   9676  C  CB  . SER D  3  111 ? -41.499 -20.738 -1.522   1.00 208.91 ? 109  SER D CB  1 
ATOM   9677  O  OG  . SER D  3  111 ? -41.492 -22.156 -1.537   1.00 223.19 ? 109  SER D OG  1 
ATOM   9678  N  N   . GLU D  3  112 ? -40.595 -18.013 -3.190   1.00 215.81 ? 110  GLU D N   1 
ATOM   9679  C  CA  . GLU D  3  112 ? -40.482 -16.565 -3.310   1.00 197.79 ? 110  GLU D CA  1 
ATOM   9680  C  C   . GLU D  3  112 ? -40.561 -16.098 -4.756   1.00 205.18 ? 110  GLU D C   1 
ATOM   9681  O  O   . GLU D  3  112 ? -40.880 -14.927 -5.006   1.00 207.26 ? 110  GLU D O   1 
ATOM   9682  C  CB  . GLU D  3  112 ? -39.176 -16.082 -2.662   1.00 203.73 ? 110  GLU D CB  1 
ATOM   9683  C  CG  . GLU D  3  112 ? -39.069 -16.361 -1.106   1.00 179.53 ? 110  GLU D CG  1 
ATOM   9684  C  CD  . GLU D  3  112 ? -37.685 -15.906 -0.470   1.00 175.04 ? 110  GLU D CD  1 
ATOM   9685  O  OE1 . GLU D  3  112 ? -36.738 -15.520 -1.250   1.00 182.51 ? 110  GLU D OE1 1 
ATOM   9686  O  OE2 . GLU D  3  112 ? -37.556 -15.928 0.802    1.00 174.82 ? 110  GLU D OE2 1 
ATOM   9687  N  N   . LEU D  3  113 ? -40.293 -16.987 -5.707   1.00 184.50 ? 111  LEU D N   1 
ATOM   9688  C  CA  . LEU D  3  113 ? -40.464 -16.637 -7.111   1.00 181.45 ? 111  LEU D CA  1 
ATOM   9689  C  C   . LEU D  3  113 ? -41.943 -16.565 -7.466   1.00 177.99 ? 111  LEU D C   1 
ATOM   9690  O  O   . LEU D  3  113 ? -42.404 -15.602 -8.091   1.00 178.88 ? 111  LEU D O   1 
ATOM   9691  C  CB  . LEU D  3  113 ? -39.730 -17.656 -7.987   1.00 186.88 ? 111  LEU D CB  1 
ATOM   9692  C  CG  . LEU D  3  113 ? -38.217 -17.458 -8.173   1.00 183.12 ? 111  LEU D CG  1 
ATOM   9693  C  CD1 . LEU D  3  113 ? -37.962 -16.230 -9.013   1.00 189.82 ? 111  LEU D CD1 1 
ATOM   9694  C  CD2 . LEU D  3  113 ? -37.450 -17.363 -6.846   1.00 177.47 ? 111  LEU D CD2 1 
ATOM   9695  N  N   . ARG D  3  114 ? -42.708 -17.568 -7.043   1.00 200.34 ? 112  ARG D N   1 
ATOM   9696  C  CA  . ARG D  3  114 ? -44.156 -17.557 -7.171   1.00 202.97 ? 112  ARG D CA  1 
ATOM   9697  C  C   . ARG D  3  114 ? -44.792 -16.678 -6.103   1.00 204.39 ? 112  ARG D C   1 
ATOM   9698  O  O   . ARG D  3  114 ? -46.030 -16.614 -6.038   1.00 207.74 ? 112  ARG D O   1 
ATOM   9699  C  CB  . ARG D  3  114 ? -44.692 -19.005 -7.067   1.00 211.10 ? 112  ARG D CB  1 
ATOM   9700  C  CG  . ARG D  3  114 ? -46.131 -19.379 -7.734   1.00 218.67 ? 112  ARG D CG  1 
ATOM   9701  C  CD  . ARG D  3  114 ? -46.767 -20.827 -7.282   1.00 223.46 ? 112  ARG D CD  1 
ATOM   9702  N  NE  . ARG D  3  114 ? -46.477 -21.303 -5.886   1.00 229.94 ? 112  ARG D NE  1 
ATOM   9703  C  CZ  . ARG D  3  114 ? -47.235 -21.130 -4.776   1.00 210.73 ? 112  ARG D CZ  1 
ATOM   9704  N  NH1 . ARG D  3  114 ? -48.418 -20.463 -4.805   1.00 197.03 ? 112  ARG D NH1 1 
ATOM   9705  N  NH2 . ARG D  3  114 ? -46.789 -21.648 -3.614   1.00 208.35 ? 112  ARG D NH2 1 
ATOM   9706  N  N   . GLU D  3  115 ? -44.002 -15.968 -5.292   1.00 196.55 ? 113  GLU D N   1 
ATOM   9707  C  CA  . GLU D  3  115 ? -44.524 -14.981 -4.353   1.00 198.02 ? 113  GLU D CA  1 
ATOM   9708  C  C   . GLU D  3  115 ? -44.367 -13.565 -4.889   1.00 191.71 ? 113  GLU D C   1 
ATOM   9709  O  O   . GLU D  3  115 ? -45.290 -12.757 -4.760   1.00 196.23 ? 113  GLU D O   1 
ATOM   9710  C  CB  . GLU D  3  115 ? -43.830 -15.129 -2.987   1.00 197.74 ? 113  GLU D CB  1 
ATOM   9711  C  CG  . GLU D  3  115 ? -44.571 -14.518 -1.819   1.00 195.99 ? 113  GLU D CG  1 
ATOM   9712  C  CD  . GLU D  3  115 ? -44.412 -13.025 -1.787   1.00 199.03 ? 113  GLU D CD  1 
ATOM   9713  O  OE1 . GLU D  3  115 ? -43.311 -12.559 -2.148   1.00 182.01 ? 113  GLU D OE1 1 
ATOM   9714  O  OE2 . GLU D  3  115 ? -45.366 -12.322 -1.390   1.00 217.66 ? 113  GLU D OE2 1 
ATOM   9715  N  N   . ALA D  3  116 ? -43.249 -13.272 -5.558   1.00 185.17 ? 114  ALA D N   1 
ATOM   9716  C  CA  . ALA D  3  116 ? -43.105 -11.979 -6.219   1.00 191.41 ? 114  ALA D CA  1 
ATOM   9717  C  C   . ALA D  3  116 ? -43.979 -11.895 -7.467   1.00 203.04 ? 114  ALA D C   1 
ATOM   9718  O  O   . ALA D  3  116 ? -44.567 -10.844 -7.756   1.00 214.29 ? 114  ALA D O   1 
ATOM   9719  C  CB  . ALA D  3  116 ? -41.637 -11.731 -6.571   1.00 181.42 ? 114  ALA D CB  1 
ATOM   9720  N  N   . VAL D  3  117 ? -44.085 -12.993 -8.210   1.00 192.94 ? 115  VAL D N   1 
ATOM   9721  C  CA  . VAL D  3  117 ? -44.975 -13.084 -9.365   1.00 186.21 ? 115  VAL D CA  1 
ATOM   9722  C  C   . VAL D  3  117 ? -45.887 -14.288 -9.164   1.00 191.21 ? 115  VAL D C   1 
ATOM   9723  O  O   . VAL D  3  117 ? -45.514 -15.413 -9.532   1.00 198.60 ? 115  VAL D O   1 
ATOM   9724  C  CB  . VAL D  3  117 ? -44.189 -13.193 -10.678  1.00 186.97 ? 115  VAL D CB  1 
ATOM   9725  C  CG1 . VAL D  3  117 ? -45.135 -13.150 -11.867  1.00 193.50 ? 115  VAL D CG1 1 
ATOM   9726  C  CG2 . VAL D  3  117 ? -43.157 -12.081 -10.777  1.00 186.97 ? 115  VAL D CG2 1 
ATOM   9727  N  N   . PRO D  3  118 ? -47.072 -14.106 -8.570   1.00 197.42 ? 116  PRO D N   1 
ATOM   9728  C  CA  . PRO D  3  118 ? -47.957 -15.245 -8.296   1.00 204.61 ? 116  PRO D CA  1 
ATOM   9729  C  C   . PRO D  3  118 ? -48.334 -16.032 -9.539   1.00 210.07 ? 116  PRO D C   1 
ATOM   9730  O  O   . PRO D  3  118 ? -48.135 -17.248 -9.593   1.00 229.34 ? 116  PRO D O   1 
ATOM   9731  C  CB  . PRO D  3  118 ? -49.189 -14.584 -7.663   1.00 204.86 ? 116  PRO D CB  1 
ATOM   9732  C  CG  . PRO D  3  118 ? -48.676 -13.306 -7.087   1.00 200.59 ? 116  PRO D CG  1 
ATOM   9733  C  CD  . PRO D  3  118 ? -47.625 -12.842 -8.056   1.00 195.10 ? 116  PRO D CD  1 
ATOM   9734  N  N   . GLU D  3  119 ? -48.891 -15.354 -10.537  1.00 203.54 ? 117  GLU D N   1 
ATOM   9735  C  CA  . GLU D  3  119 ? -49.333 -16.066 -11.729  1.00 216.77 ? 117  GLU D CA  1 
ATOM   9736  C  C   . GLU D  3  119 ? -48.266 -15.996 -12.815  1.00 214.25 ? 117  GLU D C   1 
ATOM   9737  O  O   . GLU D  3  119 ? -47.711 -14.912 -13.061  1.00 215.15 ? 117  GLU D O   1 
ATOM   9738  C  CB  . GLU D  3  119 ? -50.648 -15.481 -12.239  1.00 221.10 ? 117  GLU D CB  1 
ATOM   9739  C  CG  . GLU D  3  119 ? -51.336 -16.335 -13.290  1.00 233.71 ? 117  GLU D CG  1 
ATOM   9740  C  CD  . GLU D  3  119 ? -52.754 -15.888 -13.570  1.00 241.48 ? 117  GLU D CD  1 
ATOM   9741  O  OE1 . GLU D  3  119 ? -53.200 -14.899 -12.950  1.00 240.65 ? 117  GLU D OE1 1 
ATOM   9742  O  OE2 . GLU D  3  119 ? -53.422 -16.524 -14.412  1.00 248.24 ? 117  GLU D OE2 1 
ATOM   9743  N  N   . PRO D  3  120 ? -47.925 -17.123 -13.451  1.00 199.43 ? 118  PRO D N   1 
ATOM   9744  C  CA  . PRO D  3  120 ? -46.846 -17.113 -14.455  1.00 194.35 ? 118  PRO D CA  1 
ATOM   9745  C  C   . PRO D  3  120 ? -47.088 -16.169 -15.616  1.00 194.42 ? 118  PRO D C   1 
ATOM   9746  O  O   . PRO D  3  120 ? -46.126 -15.785 -16.294  1.00 193.02 ? 118  PRO D O   1 
ATOM   9747  C  CB  . PRO D  3  120 ? -46.804 -18.570 -14.938  1.00 201.70 ? 118  PRO D CB  1 
ATOM   9748  C  CG  . PRO D  3  120 ? -47.422 -19.356 -13.840  1.00 205.49 ? 118  PRO D CG  1 
ATOM   9749  C  CD  . PRO D  3  120 ? -48.480 -18.473 -13.254  1.00 202.86 ? 118  PRO D CD  1 
ATOM   9750  N  N   . VAL D  3  121 ? -48.337 -15.780 -15.872  1.00 189.35 ? 119  VAL D N   1 
ATOM   9751  C  CA  . VAL D  3  121 ? -48.619 -14.933 -17.025  1.00 186.96 ? 119  VAL D CA  1 
ATOM   9752  C  C   . VAL D  3  121 ? -48.196 -13.496 -16.764  1.00 182.70 ? 119  VAL D C   1 
ATOM   9753  O  O   . VAL D  3  121 ? -47.880 -12.757 -17.706  1.00 177.41 ? 119  VAL D O   1 
ATOM   9754  C  CB  . VAL D  3  121 ? -50.113 -15.019 -17.384  1.00 191.62 ? 119  VAL D CB  1 
ATOM   9755  C  CG1 . VAL D  3  121 ? -50.360 -14.440 -18.766  1.00 197.71 ? 119  VAL D CG1 1 
ATOM   9756  C  CG2 . VAL D  3  121 ? -50.610 -16.459 -17.298  1.00 198.96 ? 119  VAL D CG2 1 
ATOM   9757  N  N   . LEU D  3  122 ? -48.152 -13.083 -15.495  1.00 189.05 ? 120  LEU D N   1 
ATOM   9758  C  CA  . LEU D  3  122 ? -47.818 -11.708 -15.151  1.00 186.22 ? 120  LEU D CA  1 
ATOM   9759  C  C   . LEU D  3  122 ? -46.381 -11.371 -15.506  1.00 177.42 ? 120  LEU D C   1 
ATOM   9760  O  O   . LEU D  3  122 ? -46.066 -10.198 -15.732  1.00 171.70 ? 120  LEU D O   1 
ATOM   9761  C  CB  . LEU D  3  122 ? -48.050 -11.478 -13.654  1.00 195.66 ? 120  LEU D CB  1 
ATOM   9762  C  CG  . LEU D  3  122 ? -49.446 -11.779 -13.099  1.00 202.19 ? 120  LEU D CG  1 
ATOM   9763  C  CD1 . LEU D  3  122 ? -49.487 -11.622 -11.587  1.00 193.99 ? 120  LEU D CD1 1 
ATOM   9764  C  CD2 . LEU D  3  122 ? -50.486 -10.883 -13.751  1.00 208.84 ? 120  LEU D CD2 1 
ATOM   9765  N  N   . LEU D  3  123 ? -45.518 -12.379 -15.574  1.00 189.96 ? 121  LEU D N   1 
ATOM   9766  C  CA  . LEU D  3  123 ? -44.103 -12.162 -15.831  1.00 193.62 ? 121  LEU D CA  1 
ATOM   9767  C  C   . LEU D  3  123 ? -43.903 -11.586 -17.226  1.00 205.99 ? 121  LEU D C   1 
ATOM   9768  O  O   . LEU D  3  123 ? -44.414 -12.125 -18.213  1.00 216.81 ? 121  LEU D O   1 
ATOM   9769  C  CB  . LEU D  3  123 ? -43.345 -13.480 -15.679  1.00 197.34 ? 121  LEU D CB  1 
ATOM   9770  C  CG  . LEU D  3  123 ? -41.853 -13.430 -15.353  1.00 193.25 ? 121  LEU D CG  1 
ATOM   9771  C  CD1 . LEU D  3  123 ? -41.014 -13.203 -16.598  1.00 194.49 ? 121  LEU D CD1 1 
ATOM   9772  C  CD2 . LEU D  3  123 ? -41.590 -12.349 -14.318  1.00 189.62 ? 121  LEU D CD2 1 
ATOM   9773  N  N   . SER D  3  124 ? -43.173 -10.476 -17.303  1.00 199.30 ? 122  SER D N   1 
ATOM   9774  C  CA  . SER D  3  124 ? -42.876 -9.828  -18.571  1.00 193.04 ? 122  SER D CA  1 
ATOM   9775  C  C   . SER D  3  124 ? -41.414 -10.004 -18.966  1.00 199.79 ? 122  SER D C   1 
ATOM   9776  O  O   . SER D  3  124 ? -41.125 -10.556 -20.032  1.00 193.65 ? 122  SER D O   1 
ATOM   9777  C  CB  . SER D  3  124 ? -43.252 -8.341  -18.494  1.00 182.13 ? 122  SER D CB  1 
ATOM   9778  O  OG  . SER D  3  124 ? -43.007 -7.680  -19.721  1.00 179.30 ? 122  SER D OG  1 
ATOM   9779  N  N   . ARG D  3  125 ? -40.477 -9.544  -18.134  1.00 220.09 ? 123  ARG D N   1 
ATOM   9780  C  CA  . ARG D  3  125 ? -39.049 -9.703  -18.391  1.00 224.88 ? 123  ARG D CA  1 
ATOM   9781  C  C   . ARG D  3  125 ? -38.334 -10.119 -17.113  1.00 226.35 ? 123  ARG D C   1 
ATOM   9782  O  O   . ARG D  3  125 ? -38.514 -9.493  -16.063  1.00 233.01 ? 123  ARG D O   1 
ATOM   9783  C  CB  . ARG D  3  125 ? -38.428 -8.411  -18.938  1.00 223.84 ? 123  ARG D CB  1 
ATOM   9784  C  CG  . ARG D  3  125 ? -36.931 -8.515  -19.218  1.00 215.46 ? 123  ARG D CG  1 
ATOM   9785  C  CD  . ARG D  3  125 ? -36.404 -7.275  -19.936  1.00 216.92 ? 123  ARG D CD  1 
ATOM   9786  N  NE  . ARG D  3  125 ? -34.990 -7.394  -20.286  1.00 220.95 ? 123  ARG D NE  1 
ATOM   9787  C  CZ  . ARG D  3  125 ? -34.332 -6.530  -21.056  1.00 217.54 ? 123  ARG D CZ  1 
ATOM   9788  N  NH1 . ARG D  3  125 ? -34.959 -5.477  -21.568  1.00 215.06 ? 123  ARG D NH1 1 
ATOM   9789  N  NH2 . ARG D  3  125 ? -33.046 -6.722  -21.319  1.00 210.46 ? 123  ARG D NH2 1 
ATOM   9790  N  N   . ALA D  3  126 ? -37.518 -11.169 -17.207  1.00 216.06 ? 124  ALA D N   1 
ATOM   9791  C  CA  . ALA D  3  126 ? -36.785 -11.707 -16.061  1.00 216.44 ? 124  ALA D CA  1 
ATOM   9792  C  C   . ALA D  3  126 ? -35.324 -11.900 -16.457  1.00 200.71 ? 124  ALA D C   1 
ATOM   9793  O  O   . ALA D  3  126 ? -34.983 -12.875 -17.132  1.00 192.25 ? 124  ALA D O   1 
ATOM   9794  C  CB  . ALA D  3  126 ? -37.405 -13.014 -15.582  1.00 230.83 ? 124  ALA D CB  1 
ATOM   9795  N  N   . GLU D  3  127 ? -34.469 -10.965 -16.056  1.00 196.87 ? 125  GLU D N   1 
ATOM   9796  C  CA  . GLU D  3  127 ? -33.047 -11.015 -16.367  1.00 196.31 ? 125  GLU D CA  1 
ATOM   9797  C  C   . GLU D  3  127 ? -32.248 -11.370 -15.118  1.00 187.89 ? 125  GLU D C   1 
ATOM   9798  O  O   . GLU D  3  127 ? -32.442 -10.770 -14.056  1.00 191.96 ? 125  GLU D O   1 
ATOM   9799  C  CB  . GLU D  3  127 ? -32.575 -9.687  -16.965  1.00 199.72 ? 125  GLU D CB  1 
ATOM   9800  C  CG  . GLU D  3  127 ? -33.101 -8.453  -16.251  1.00 197.56 ? 125  GLU D CG  1 
ATOM   9801  C  CD  . GLU D  3  127 ? -32.754 -7.166  -16.977  1.00 198.48 ? 125  GLU D CD  1 
ATOM   9802  O  OE1 . GLU D  3  127 ? -31.900 -7.208  -17.887  1.00 194.13 ? 125  GLU D OE1 1 
ATOM   9803  O  OE2 . GLU D  3  127 ? -33.340 -6.114  -16.643  1.00 202.13 ? 125  GLU D OE2 1 
ATOM   9804  N  N   . LEU D  3  128 ? -31.366 -12.356 -15.251  1.00 181.00 ? 126  LEU D N   1 
ATOM   9805  C  CA  . LEU D  3  128 ? -30.485 -12.786 -14.172  1.00 182.28 ? 126  LEU D CA  1 
ATOM   9806  C  C   . LEU D  3  128 ? -29.209 -11.953 -14.207  1.00 178.42 ? 126  LEU D C   1 
ATOM   9807  O  O   . LEU D  3  128 ? -28.497 -11.947 -15.216  1.00 181.59 ? 126  LEU D O   1 
ATOM   9808  C  CB  . LEU D  3  128 ? -30.162 -14.271 -14.309  1.00 190.84 ? 126  LEU D CB  1 
ATOM   9809  C  CG  . LEU D  3  128 ? -29.150 -14.834 -13.311  1.00 204.74 ? 126  LEU D CG  1 
ATOM   9810  C  CD1 . LEU D  3  128 ? -29.669 -14.698 -11.889  1.00 213.56 ? 126  LEU D CD1 1 
ATOM   9811  C  CD2 . LEU D  3  128 ? -28.834 -16.284 -13.641  1.00 206.90 ? 126  LEU D CD2 1 
ATOM   9812  N  N   . ARG D  3  129 ? -28.922 -11.248 -13.117  1.00 181.69 ? 127  ARG D N   1 
ATOM   9813  C  CA  . ARG D  3  129 ? -27.793 -10.331 -13.060  1.00 183.63 ? 127  ARG D CA  1 
ATOM   9814  C  C   . ARG D  3  129 ? -26.710 -10.837 -12.115  1.00 202.90 ? 127  ARG D C   1 
ATOM   9815  O  O   . ARG D  3  129 ? -27.007 -11.373 -11.042  1.00 221.23 ? 127  ARG D O   1 
ATOM   9816  C  CB  . ARG D  3  129 ? -28.247 -8.940  -12.630  1.00 182.24 ? 127  ARG D CB  1 
ATOM   9817  C  CG  . ARG D  3  129 ? -29.348 -8.384  -13.496  1.00 173.73 ? 127  ARG D CG  1 
ATOM   9818  C  CD  . ARG D  3  129 ? -29.403 -6.884  -13.391  1.00 171.76 ? 127  ARG D CD  1 
ATOM   9819  N  NE  . ARG D  3  129 ? -30.377 -6.326  -14.315  1.00 173.30 ? 127  ARG D NE  1 
ATOM   9820  C  CZ  . ARG D  3  129 ? -30.525 -5.028  -14.543  1.00 176.73 ? 127  ARG D CZ  1 
ATOM   9821  N  NH1 . ARG D  3  129 ? -29.744 -4.153  -13.926  1.00 174.43 ? 127  ARG D NH1 1 
ATOM   9822  N  NH2 . ARG D  3  129 ? -31.446 -4.608  -15.397  1.00 188.28 ? 127  ARG D NH2 1 
ATOM   9823  N  N   . LEU D  3  130 ? -25.451 -10.662 -12.526  1.00 206.42 ? 128  LEU D N   1 
ATOM   9824  C  CA  . LEU D  3  130 ? -24.307 -11.107 -11.737  1.00 208.05 ? 128  LEU D CA  1 
ATOM   9825  C  C   . LEU D  3  130 ? -23.387 -9.943  -11.375  1.00 205.94 ? 128  LEU D C   1 
ATOM   9826  O  O   . LEU D  3  130 ? -23.774 -8.775  -11.484  1.00 200.53 ? 128  LEU D O   1 
ATOM   9827  C  CB  . LEU D  3  130 ? -23.517 -12.172 -12.501  1.00 206.24 ? 128  LEU D CB  1 
ATOM   9828  C  CG  . LEU D  3  130 ? -24.291 -13.309 -13.175  1.00 200.47 ? 128  LEU D CG  1 
ATOM   9829  C  CD1 . LEU D  3  130 ? -23.331 -14.351 -13.717  1.00 207.36 ? 128  LEU D CD1 1 
ATOM   9830  C  CD2 . LEU D  3  130 ? -25.277 -13.952 -12.221  1.00 201.38 ? 128  LEU D CD2 1 
ATOM   9831  N  N   . LEU D  3  131 ? -22.165 -10.256 -10.945  1.00 208.36 ? 129  LEU D N   1 
ATOM   9832  C  CA  . LEU D  3  131 ? -21.160 -9.250  -10.616  1.00 201.79 ? 129  LEU D CA  1 
ATOM   9833  C  C   . LEU D  3  131 ? -19.796 -9.740  -11.076  1.00 209.47 ? 129  LEU D C   1 
ATOM   9834  O  O   . LEU D  3  131 ? -19.282 -10.734 -10.553  1.00 217.29 ? 129  LEU D O   1 
ATOM   9835  C  CB  . LEU D  3  131 ? -21.140 -8.954  -9.115   1.00 198.15 ? 129  LEU D CB  1 
ATOM   9836  C  CG  . LEU D  3  131 ? -20.159 -7.860  -8.691   1.00 207.17 ? 129  LEU D CG  1 
ATOM   9837  C  CD1 . LEU D  3  131 ? -20.220 -6.669  -9.635   1.00 188.96 ? 129  LEU D CD1 1 
ATOM   9838  C  CD2 . LEU D  3  131 ? -20.432 -7.429  -7.260   1.00 228.15 ? 129  LEU D CD2 1 
ATOM   9839  N  N   . ARG D  3  132 ? -19.202 -9.028  -12.027  1.00 210.22 ? 130  ARG D N   1 
ATOM   9840  C  CA  . ARG D  3  132 ? -17.902 -9.387  -12.572  1.00 206.36 ? 130  ARG D CA  1 
ATOM   9841  C  C   . ARG D  3  132 ? -16.774 -8.814  -11.728  1.00 207.45 ? 130  ARG D C   1 
ATOM   9842  O  O   . ARG D  3  132 ? -16.940 -7.844  -10.986  1.00 212.77 ? 130  ARG D O   1 
ATOM   9843  C  CB  . ARG D  3  132 ? -17.748 -8.886  -14.010  1.00 210.19 ? 130  ARG D CB  1 
ATOM   9844  C  CG  . ARG D  3  132 ? -18.502 -9.683  -15.052  1.00 228.76 ? 130  ARG D CG  1 
ATOM   9845  C  CD  . ARG D  3  132 ? -18.115 -9.221  -16.459  1.00 247.53 ? 130  ARG D CD  1 
ATOM   9846  N  NE  . ARG D  3  132 ? -18.857 -9.924  -17.507  1.00 267.37 ? 130  ARG D NE  1 
ATOM   9847  C  CZ  . ARG D  3  132 ? -18.729 -9.690  -18.813  1.00 270.62 ? 130  ARG D CZ  1 
ATOM   9848  N  NH1 . ARG D  3  132 ? -17.881 -8.766  -19.247  1.00 271.51 ? 130  ARG D NH1 1 
ATOM   9849  N  NH2 . ARG D  3  132 ? -19.448 -10.384 -19.689  1.00 266.77 ? 130  ARG D NH2 1 
ATOM   9850  N  N   . LEU D  3  133 ? -15.622 -9.456  -11.830  1.00 200.02 ? 131  LEU D N   1 
ATOM   9851  C  CA  . LEU D  3  133 ? -14.367 -8.932  -11.325  1.00 202.96 ? 131  LEU D CA  1 
ATOM   9852  C  C   . LEU D  3  133 ? -13.459 -8.666  -12.514  1.00 210.88 ? 131  LEU D C   1 
ATOM   9853  O  O   . LEU D  3  133 ? -13.781 -9.020  -13.650  1.00 216.08 ? 131  LEU D O   1 
ATOM   9854  C  CB  . LEU D  3  133 ? -13.722 -9.910  -10.341  1.00 205.51 ? 131  LEU D CB  1 
ATOM   9855  C  CG  . LEU D  3  133 ? -14.469 -10.012 -9.013   1.00 204.74 ? 131  LEU D CG  1 
ATOM   9856  C  CD1 . LEU D  3  133 ? -13.768 -10.972 -8.070   1.00 226.59 ? 131  LEU D CD1 1 
ATOM   9857  C  CD2 . LEU D  3  133 ? -14.635 -8.641  -8.370   1.00 197.77 ? 131  LEU D CD2 1 
ATOM   9858  N  N   . LYS D  3  134 ? -12.322 -8.028  -12.255  1.00 216.56 ? 132  LYS D N   1 
ATOM   9859  C  CA  . LYS D  3  134 ? -11.404 -7.727  -13.346  1.00 233.45 ? 132  LYS D CA  1 
ATOM   9860  C  C   . LYS D  3  134 ? -10.957 -9.027  -14.007  1.00 240.08 ? 132  LYS D C   1 
ATOM   9861  O  O   . LYS D  3  134 ? -10.554 -9.977  -13.329  1.00 263.19 ? 132  LYS D O   1 
ATOM   9862  C  CB  . LYS D  3  134 ? -10.199 -6.927  -12.837  1.00 244.78 ? 132  LYS D CB  1 
ATOM   9863  C  CG  . LYS D  3  134 ? -9.350  -7.605  -11.758  1.00 240.93 ? 132  LYS D CG  1 
ATOM   9864  C  CD  . LYS D  3  134 ? -8.125  -6.754  -11.424  1.00 231.55 ? 132  LYS D CD  1 
ATOM   9865  C  CE  . LYS D  3  134 ? -7.242  -7.403  -10.368  1.00 223.75 ? 132  LYS D CE  1 
ATOM   9866  N  NZ  . LYS D  3  134 ? -6.027  -6.584  -10.085  1.00 221.50 ? 132  LYS D NZ  1 
ATOM   9867  N  N   . LEU D  3  135 ? -11.073 -9.090  -15.339  1.00 212.31 ? 133  LEU D N   1 
ATOM   9868  C  CA  . LEU D  3  135 ? -10.753 -10.309 -16.068  1.00 214.87 ? 133  LEU D CA  1 
ATOM   9869  C  C   . LEU D  3  135 ? -9.701  -10.119 -17.154  1.00 225.53 ? 133  LEU D C   1 
ATOM   9870  O  O   . LEU D  3  135 ? -9.232  -11.116 -17.717  1.00 235.25 ? 133  LEU D O   1 
ATOM   9871  C  CB  . LEU D  3  135 ? -12.025 -10.908 -16.689  1.00 213.80 ? 133  LEU D CB  1 
ATOM   9872  C  CG  . LEU D  3  135 ? -11.922 -12.403 -16.986  1.00 223.30 ? 133  LEU D CG  1 
ATOM   9873  C  CD1 . LEU D  3  135 ? -11.423 -13.122 -15.751  1.00 227.60 ? 133  LEU D CD1 1 
ATOM   9874  C  CD2 . LEU D  3  135 ? -13.251 -12.968 -17.412  1.00 225.82 ? 133  LEU D CD2 1 
ATOM   9875  N  N   . LYS D  3  136 ? -9.315  -8.887  -17.456  1.00 232.40 ? 134  LYS D N   1 
ATOM   9876  C  CA  . LYS D  3  136 ? -8.312  -8.574  -18.493  1.00 244.24 ? 134  LYS D CA  1 
ATOM   9877  C  C   . LYS D  3  136 ? -8.792  -9.149  -19.832  1.00 259.46 ? 134  LYS D C   1 
ATOM   9878  O  O   . LYS D  3  136 ? -10.002 -9.147  -20.110  1.00 264.81 ? 134  LYS D O   1 
ATOM   9879  C  CB  . LYS D  3  136 ? -6.935  -9.047  -18.065  1.00 243.39 ? 134  LYS D CB  1 
ATOM   9880  C  CG  . LYS D  3  136 ? -6.367  -8.381  -16.825  1.00 245.52 ? 134  LYS D CG  1 
ATOM   9881  C  CD  . LYS D  3  136 ? -5.001  -8.966  -16.484  1.00 251.73 ? 134  LYS D CD  1 
ATOM   9882  C  CE  . LYS D  3  136 ? -4.385  -8.317  -15.253  1.00 242.15 ? 134  LYS D CE  1 
ATOM   9883  N  NZ  . LYS D  3  136 ? -3.047  -8.910  -14.976  1.00 238.33 ? 134  LYS D NZ  1 
ATOM   9884  N  N   . VAL D  3  137 ? -7.888  -9.719  -20.628  1.00 267.57 ? 135  VAL D N   1 
ATOM   9885  C  CA  . VAL D  3  137 ? -8.037  -9.834  -22.079  1.00 276.65 ? 135  VAL D CA  1 
ATOM   9886  C  C   . VAL D  3  137 ? -9.345  -10.478 -22.535  1.00 275.02 ? 135  VAL D C   1 
ATOM   9887  O  O   . VAL D  3  137 ? -10.262 -9.779  -22.984  1.00 274.20 ? 135  VAL D O   1 
ATOM   9888  C  CB  . VAL D  3  137 ? -6.837  -10.586 -22.678  1.00 272.63 ? 135  VAL D CB  1 
ATOM   9889  C  CG1 . VAL D  3  137 ? -6.743  -10.315 -24.174  1.00 267.14 ? 135  VAL D CG1 1 
ATOM   9890  C  CG2 . VAL D  3  137 ? -5.555  -10.167 -21.980  1.00 269.49 ? 135  VAL D CG2 1 
ATOM   9891  N  N   . GLU D  3  138 ? -9.450  -11.804 -22.440  1.00 266.37 ? 136  GLU D N   1 
ATOM   9892  C  CA  . GLU D  3  138 ? -10.549 -12.487 -23.109  1.00 253.14 ? 136  GLU D CA  1 
ATOM   9893  C  C   . GLU D  3  138 ? -11.036 -13.681 -22.305  1.00 244.09 ? 136  GLU D C   1 
ATOM   9894  O  O   . GLU D  3  138 ? -10.247 -14.382 -21.666  1.00 253.23 ? 136  GLU D O   1 
ATOM   9895  C  CB  . GLU D  3  138 ? -10.129 -12.965 -24.507  1.00 255.48 ? 136  GLU D CB  1 
ATOM   9896  C  CG  . GLU D  3  138 ? -9.994  -11.873 -25.551  1.00 249.26 ? 136  GLU D CG  1 
ATOM   9897  C  CD  . GLU D  3  138 ? -9.385  -12.389 -26.839  1.00 255.72 ? 136  GLU D CD  1 
ATOM   9898  O  OE1 . GLU D  3  138 ? -9.001  -13.575 -26.889  1.00 259.78 ? 136  GLU D OE1 1 
ATOM   9899  O  OE2 . GLU D  3  138 ? -9.291  -11.606 -27.805  1.00 260.04 ? 136  GLU D OE2 1 
ATOM   9900  N  N   . GLN D  3  139 ? -12.353 -13.876 -22.318  1.00 230.73 ? 137  GLN D N   1 
ATOM   9901  C  CA  . GLN D  3  139 ? -12.967 -15.128 -21.905  1.00 232.77 ? 137  GLN D CA  1 
ATOM   9902  C  C   . GLN D  3  139 ? -14.307 -15.256 -22.621  1.00 236.81 ? 137  GLN D C   1 
ATOM   9903  O  O   . GLN D  3  139 ? -14.900 -14.262 -23.044  1.00 247.52 ? 137  GLN D O   1 
ATOM   9904  C  CB  . GLN D  3  139 ? -13.129 -15.211 -20.384  1.00 227.36 ? 137  GLN D CB  1 
ATOM   9905  C  CG  . GLN D  3  139 ? -13.253 -16.634 -19.854  1.00 232.59 ? 137  GLN D CG  1 
ATOM   9906  C  CD  . GLN D  3  139 ? -12.020 -17.482 -20.110  1.00 245.60 ? 137  GLN D CD  1 
ATOM   9907  O  OE1 . GLN D  3  139 ? -10.915 -16.964 -20.279  1.00 251.25 ? 137  GLN D OE1 1 
ATOM   9908  N  NE2 . GLN D  3  139 ? -12.205 -18.797 -20.130  1.00 246.58 ? 137  GLN D NE2 1 
ATOM   9909  N  N   . HIS D  3  140 ? -14.780 -16.495 -22.759  1.00 223.74 ? 138  HIS D N   1 
ATOM   9910  C  CA  . HIS D  3  140 ? -16.060 -16.786 -23.397  1.00 214.62 ? 138  HIS D CA  1 
ATOM   9911  C  C   . HIS D  3  140 ? -16.913 -17.638 -22.467  1.00 214.10 ? 138  HIS D C   1 
ATOM   9912  O  O   . HIS D  3  140 ? -16.421 -18.613 -21.891  1.00 217.31 ? 138  HIS D O   1 
ATOM   9913  C  CB  . HIS D  3  140 ? -15.856 -17.500 -24.734  1.00 226.69 ? 138  HIS D CB  1 
ATOM   9914  C  CG  . HIS D  3  140 ? -17.103 -17.620 -25.553  1.00 229.79 ? 138  HIS D CG  1 
ATOM   9915  N  ND1 . HIS D  3  140 ? -17.184 -18.425 -26.669  1.00 233.01 ? 138  HIS D ND1 1 
ATOM   9916  C  CD2 . HIS D  3  140 ? -18.316 -17.030 -25.426  1.00 226.63 ? 138  HIS D CD2 1 
ATOM   9917  C  CE1 . HIS D  3  140 ? -18.396 -18.335 -27.187  1.00 230.36 ? 138  HIS D CE1 1 
ATOM   9918  N  NE2 . HIS D  3  140 ? -19.101 -17.493 -26.454  1.00 221.05 ? 138  HIS D NE2 1 
ATOM   9919  N  N   . VAL D  3  141 ? -18.189 -17.275 -22.325  1.00 222.12 ? 139  VAL D N   1 
ATOM   9920  C  CA  . VAL D  3  141 ? -19.085 -17.889 -21.348  1.00 225.84 ? 139  VAL D CA  1 
ATOM   9921  C  C   . VAL D  3  141 ? -20.320 -18.440 -22.054  1.00 234.71 ? 139  VAL D C   1 
ATOM   9922  O  O   . VAL D  3  141 ? -20.917 -17.760 -22.898  1.00 233.12 ? 139  VAL D O   1 
ATOM   9923  C  CB  . VAL D  3  141 ? -19.490 -16.884 -20.257  1.00 210.58 ? 139  VAL D CB  1 
ATOM   9924  C  CG1 . VAL D  3  141 ? -20.455 -17.527 -19.278  1.00 210.53 ? 139  VAL D CG1 1 
ATOM   9925  C  CG2 . VAL D  3  141 ? -18.260 -16.367 -19.536  1.00 206.63 ? 139  VAL D CG2 1 
ATOM   9926  N  N   . GLU D  3  142 ? -20.694 -19.675 -21.711  1.00 243.98 ? 140  GLU D N   1 
ATOM   9927  C  CA  . GLU D  3  142 ? -21.943 -20.292 -22.139  1.00 239.19 ? 140  GLU D CA  1 
A